2HKQB

Crystal structure of the c-terminal domain of human eb1 in complex with the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hkqB00
2HL3A 2CP2A 2HQHA 2HKNA 2CP5A 1WHKA 2E4HA 2E3IA 3RDVA 1IXDA 2COZA 2CP0A 2CP6A 1TOVA 1WHGA 2COWA 1LPLA 1TXQA 2MPXC 3E2UA 1WHLA 2QK0A 4B6MA 2COYA 2Z0WA 3TQ7P 2E3HA 2M02A 1WHJA 1WHMA 2CP7A 1WHHA 2CP3A 2HKQB 2HL5C
chains in the Genus database with same CATH superfamily
1K0SA 1Y96B 3PNWC 3REAB 5CKDA 3OYLA 1RUWA 3CBMA 1M2VB 1PCXA 1TSFA 2YWWA 4E7ZA 4BE0A 4ME7A 1H8KA 3CCRT 1AWWA 4E2FB 4AFZC 3HRSA 5FU7B 4AFUC 4M77B 1KG1A 2QG9B 2QTXA 3CCJA 2YT6A 1M1KU 3H8ZA 1HD3A 5KH6A 1BIAA 3EG2A 5A0LA 3G6EQ 2GFAA 2MWPA 2Y4XA 1TWBA 9ATCB 5HCKA 4HT8A 3EH2A 1K1ZA 5EC7A 4J9HA 3LW5E 3EG9B 2QASA 3QXEB 1WX6A 2E10A 4X9DA 3RBBB 5GAOr 4F7UB 3C94A 3KXTA 2E1HA 4NL3A 5IHKA 3CMET 4HCZA 3CCRQ 1ZLMA 3QSUA 5D6YA 2LCCA 2DEQA 4MZMA 1NE8A 3OYNA 1H92A 5KYXB 7AT1B 1ZUKA 3URGA 2OJ2A 1NYGA 2MCNA 4N4HA 4II1A 3CC2A 2LMJA 1OU9A 4DBHA 2LQKA 2X4YA 1WQ7A 2HD0A 2VUBA 2LT1A 2BZ8A 4PFOA 3RUXA 3SWNA 2LZ6B 1LNXA 2EIFA 2O88A 1M3BA 4LDUA 2EAYA 2R58A 1OOTA 3GNFB 2HNIA 1FMWA 1NEGA 2YUNA 3M55A 2EJ9A 1VQ6T 3RIRA 2LCSA 2EKOA 1VQOQ 2HL5C 3VJPA 1Z9QA 4PJLA 1EFNA 2NUPA 4ZGDB 2ZAEA 4OMQA 1I0CA 3LYIA 1M1GA 3OYGA 3HKSA 2BE7D 2FZCB 1Q82U 4PJOD 1VQKA 3CCVA 3RERA 1NM7A 1ZHIA 2AKKA 1X6BA 3H0HA 4HA8A 1T3LA 2RN8A 4CC3A 5CKEA 4B9WA 1VQNT 1KQ1A 1QLYA 1UEBA 2V26A 1JO8A 2A36A 4MZTA 5GMKm 3Q1JA 1BYMA 2MI6A 2J6FA 1LVKA 3CPWP 1XTDA 1GBRA 5CVIA 2HBWA 3LWIA 2P4RA 1KQSS 4QQGA 3A98A 2DRKA 3QUIA 2JJ9A 1NBEB 2KNBB 4ZN1A 1N8RU 2JUFA 3M4GA 2YRDA 3WVDB 2F5KA 2CS7A 3VS7A 1KFZA 4JZ4A 4J8OA 2K2VA 1VQNQ 2ZPHB 3MKDA 5CIUA 5GANh 4PJJA 5KCOA 3RMQA 1EIFA 3OA6A 1U8RA 1VYVA 5GAMj 1RACB 2EQIA 2XMFA 4HVUA 4LXCA 4ZGEB 1YJNA 1Y0MA 3HHTB 2EQJA 1V29B 1K8AR 2VVKA 1ZSZB 1H3HA 1X6OA 2M9UA 1M8VA 1KQSP 1KIKA 3JSCA 4VUBA 2QQBA 2RHUA 2JS2A 5FWBA 2EWNA 2K5FA 1LPLA 1PD0A 4RMOA 3SB2A 3H0IA 1G3WA 1SSHA 2JXBA 2LJ1A 1VQ7T 4JPBW 2BUDA 2JMCA 3EG3A 2ROLA 2QDLA 3E9GA 3CQTA 4QT7A 1R0BG 3EAEA 2ENMA 2EGCA 2K57A 2DZCA 2XHCA 2OX7A 2RJCA 3HPWA 1PNJA 3G71T 4PJOE 2EPDA 1JJ2P 1YWOA 1U5SA 2ABLA 4M78B 2NYSA 3MEUA 3G6EA 2RPNA 4FCYA 2QQSA 2E3HA 3ER0A 4PFZA 2PVGB 1U1TA 2VGMA 1K73U 2RI3A 2FRYA 3GF5A 5GJVB 1VQ4T 1AT1B 1LJOA 3UWNA 4MDWA 2DZ9A 1HK9A 2V8JA 4C5GA 4EMHA 1BCOA 4M75D 1RI9A 1H3ZA 3QHSA 4PJMA 3BFMA 4RCCA 4O6JA 3E9FA 1UGSB 2DKGA 4XU1A 5GANj 2L5QA 4C5HA 2K3YA 2KRNA 1IXDA 5DLQE 2VV5A 4BY6B 4C8QG 1I5LA 3V7SA 1YBYA 2L3PA 4E7KA 3JCMe 2X4JA 2OTJQ 2E5QA 3EHRA 3HFOA 3CMAT 3VUZA 4DOVA 4N0AC 3OS1A 2GTOA 1BI2A 2ESWA 1BI3A 2OAUA 2F2WA 1JQQA 1RAGB 2MIOA 1VQOA 2AZSA 2O01E 2FVUA 1MMAA 4J7FA 1K0XA 1W2BA 5I22A 1ZBJA 4JRIA 5KYUB 3OYHA 3UA7A 4BI8B 4JZ3A 1SEMA 5LJ3h 1N6AA 4IUTA 3H6ZA 3VS6A 2LP5A 5CK9A 3OMCA 1WNLA 1BKBA 1NPRA 3DKMA 4XTUA 1G83A 3CCUT 5GMKi 2QA4T 2V8IA 3HTRA 2V8KA 4C8QC 2KT8A 2L2PA 2DL4A 1KD1C 2EGAA 2EYYA 1X69A 2HQEA 4JRPA 1IGQA 2RO0A 3NTKA 3SD4A 2HCKA 3CCJT 2HEQA 1TH7A 2DF6A 2ED1A 1VQNA 3PVLA 3FRNA 2GFUA 3J7AF 1OQKA 1S72Q 1HJDA 4M75E 5LJ3d 4HVVA 2DTOA 4EPCA 3CCUQ 5LJ3g 1PD1A 3EGDA 2QA4Q 3VYGA 3JCMP 1C1AA 2K5IA 3E1SA 2RK2A 3V8LA 3AHUA 3A5ZB 1T0HA 4A4KA 5LJ5h 1D1AA 3CC2T 5J3BA 3SEMA 1M1KR 3CCJQ 4ZGJB 1M4ZA 1JU5C 1OX9A 4OB1B 4C8QE 4KH0B 2PVOB 2RHIA 3A8LB 2DVJA 2E70A 2RHZA 5KE3A 1AWJA 1MV0B 1BI0A 4PKCC 4OF1A 3META 5I2MA 2K79A 5A0GA 1Q81C 1PRLC 2DEUA 3A1PA 3NHNA 2ZPIB 1SHGA 4JJNK 1KSWA 2KVQG 4HKEA 4FT2A 1S1NA 4BDYA 2LVMA 3CC2Q 3U23A 3CBOA 4N0AA 1G2BA 2JTEA 4JS5A 2YUOA 3M0SA 1PHTA 1QVGP 3CCVT 3N5BB 3VS2A 4M7DB 1AZGB 4QQDA 1NLOC 3QWYA 1UFFA 5HKCA 3SFMA 1V1CA 4RTVA 4NS5A 1D09B 1TS9A 3PMTA 4OMNA 2KRSA 2VKNA 3M57A 3VKIA 2GF7A 1D3BA 1IRXA 1ZBXA 3VU3C 3M0QA 2KT1A 4C92E 1NJIC 2EYZA 1QVFP 2RQWA 2DETA 2OTJA 2E5KA 2YRCA 2J06A 4M77G 3L2QA 1YHQQ 3OB9A 2KSSA 2F2VA 2JNGA 3VRYA 1D0ZA 2GCXA 4C8QA 4C8QF 2X3XD 5LJ5j 1Q81R 3JB9J 2FHDA 4KUDK 3BY7A 4Z89A 4KGZB 1WHHA 3CPWA 2DYBA 3X24B 1YJNT 3L1AA 1W2BP 3M56A 4M7AE 2DILA 4F7UG 2DO3A 3M59A 2D0QB 1G3TA 1XOVA 1TOVA 2CUDA 5GMKh 1KK7A 1EZZB 1WXUA 3CXCP 3JV3A 4HT9A 2Z0WA 2XI9A 1Q7YC 1MMDA 4QQ6A 3VS1A 1X2KA 3OYMA 2MK5A 3SHWA 2EW3A 2KMTA 3CCMT 1CKAA 4AFSC 1TUCA 2QQRA 2KRMA 1B7TA 1MNEA 4LE9A 5GAOl 4A54A 3GLXA 4A63B 1ABQA 2I0NA 2YLBA 5GAN4 5FU7C 3NGPA 3TSZA 3JCMQ 1Y71A 4M77C 4AT1B 4QVCA 2D8HA 4OMFB 2G6FX 1QKXA 5D7UA 1YCYA 3KBGA 3G6ET 4FYYB 2FZGB 5GAN5 1SF9A 1ZA1B 4C5IA 3QPHA 2YHTA 4C92A 1WGSA 5L8RE 4C92F 1S72A 1E7OA 2PNIA 2VASA 5CAIA 2HSEB 3FJPA 3AT1B 4YTLA 2AK5A 3CCUA 4B9XA 3CCMQ 2GBQA 2BZYA 2QA4A 3MJXA 4ZTFA 1ACMB 4BB7A 2VB6A 1YITQ 3QO3A 1D0YA 3OYEA 2LNHB 4IURA 2HDAA 3MCAB 4BD3A 2OTLT 3EG1A 2J6OA 2RQTA 3CCSQ 1UHCA 1JJ2A 2FG0A 4DBFA 4R55A 3JCMf 3I56Q 1K9MC 3RKXA 4CC2A 3EGUA 4M7AA 2CP6A 2XU8A 4XU3A 4M7AF 2LJ0A 1NEBA 1XNIA 3OQ5A 1Q7YR 4ZNXA 1UJYA 1BK2A 4A4GA 2VWFA 1WHMA 2FRWA 1K73R 1X43A 2E6ZA 4PFPA 3CCET 4Q5WA 2HQHA 1KC8U 2DIQA 1XJWB 2H3JA 2RQUA 1YFNA 1GL5A 2CUBA 2C0OA 5GMKj 1VQOT 2M16A 5FROA 1UUEA 2L8DA 6AT1B 2OTLQ 2K9GA 1N5ZA 1PWTA 4KGXB 4XU2A 1SHFA 3HP9A 4J5YA 1CSKA 5KYYB 2EQMA 3T9NA 5KYWA 5CCAA 1VYUA 2CT4A 2D6FA 1AWOA 2COZA 2PU9B 5A0DA 3CCEQ 2YRVA 4IIMA 3NFCA 3CPWS 2CH4A 4EIKA 2AT1B 4JJBA 2KI7A 1WZOA 2DJZA 2ZPGB 1X75C 1YJ9T 1O75A 2J05A 4CI0C 1K8AC 1K9MR 4PLIA 2EJGA 1UECA 5LJ3e 1AHJB 1OU8A 1OYXA 4F16A 4J7IA 1ZSGA 1YJWT 2CP0A 1Q95G 5FW9A 4OB3B 1Y96A 4IUPA 1YHQA 2XDDA 2AHJB 1M2VA 1K9AA 2BIVA 2M02A 4M78G 1Q86C 2F2XA 2RH2A 3D7SB 3M0TA 3KFVA 4XTZA 3L2RA 2HMAA 2ECZA 4M77A 4M77F 4DOWA 2E4HA 2OAWA 1UHFA 1VQ5T 1YJ9Q 1ZSZC 2JTMA 2DRMA 1CKBA 1YJWQ 4HCKA 1NLPC 2LDMA 2RD1A 4AMCA 8AT1B 4ZTJA 3NPFA 1FMKA 2RQVA 2DJQA 3THKA 1MMNA 5LL6S 2K5LA 5A2QE 3H9NA 3ASKA 2CREA 5GAMf 5FWCA 1X2QA 3J81E 1UG1A 3A8MB 4AG1C 3A8OB 5KYXA 4O5VA 3MHXA 2DERA 5LJ5e 2AZVA 3G7ZA 2LT4A 1JJ2S 4PNOA 3G4SA 4JRQA 4CRIA 3DB3A 1VQ5Q 4CC7A 2NUTA 5GAN3 3QJ6A 2YLCA 4M78C 1JRIA 2QQ9A 2P0QA 2V1QA 4EMKB 4C0DB 5ECAA 1PG5B 3RR6A 1JB0E 1VQLQ 3OS0A 2D0NA 1WI7A 4GBQA 4KUIA 2H8HA 3CCMA 1Q86R 4E7JA 5IT9E 1NJIU 1W4SA 2V1RA 2K6DA 1YITA 4M4ZA 4WF2A 4RUGA 2F1LA 1Y57A 2X9HA 2E3IA 1F1BB 3CCSA 4PJOB 3I56A 1N9RA 3RNJA 3LLRA 2HSPA 4XAXB 4BE1A 3CD6Q 1WPYA 2NUZA 4BDZA 2LX7A 3VRZA 1WJRA 1WJQA 1VIFA 3LGFA 4J9CA 3ME9A 2O9SA 1VYTA 4BY6C 3DLMA 4XTXA 4Z88A 2OTJT 2QQAA 2BZXA 2L3SA 2YSQA 5FU6C 3CCQQ 2M51A 5IN1A 1QVGA 2B86A 1I5OB 2DIGA 2RQRA 1YNZA 2HBPA 3DB4A 5CKHA 1N27A 3CEYA 1IGUA 1WHLA 2O31A 1WXBA 1MV3A 1HXDA 1WHJA 3I9QA 2OTLA 2CGHA 2HZYA 5GANf 2RI2A 3I35A 2QXFA 1G3SA 2IPOB 1M90U 2ZGWA 2SEMA 1RL2A 2PTKA 2FEIA 3QBYA 1WJSA 1VQ8T 2CZ1B 3NTHA 3TSWA 2P0KA 1QVFA 1NPPA 4JJCA 1W70A 1XQHA 1B34A 3OS2A 3CCEA 1WQWA 5FRNA 1QP2A 1V76A 4J6WA 3EGDB 1T0JA 2QEXQ 2HL3A 1VUBA 4E7IA 1AEYA 1ZSZA 4C8QD 2EYWA 2KE9A 5EG2A 4DEYA 4OGCA 5I11A 2IVWA 3ULRB 5FLXE 5GMKe 5GAN6 2M1HA 4RCBA 1ZQ1A 2XDBA 1E6GA 1IZ6A 1LOJA 4D6WA 3GIBA 3O5ZA 1I8FA 3M0PA 1WA7A 1SKUB 4DA4A 1VQ8Q 2KYBA 4BI4A 2DYIA 4ORZA 2ATCB 4R56A 1M1KC 1GFCA 3M0RA 4ZN3A 2AIRB 3C0CA 2E41A 3CXCA 4NL2A 3OYJA 3RKYA 1S72T 2CDTA 1UGVA 1YWPA 3VYHB 1YJ9A 4M78A 3NTIA 2CP7A 2KYMA 3EGXA 4M78F 2XG8D 1G5VA 4M7DG 3L2UA 4E7SA 5IXFA 1GFDA 4LUDA 2EVRA 2E64A 1YJWA 4RG2A 3FJ5A 3OS5A 2KGTA 1Y07A 2ED0A 2P4TA 1UDLA 3EFRA 2VC8A 3I5SA 4C92D 1RAFB 4LDYA 2QYZA 1W1FA 4JJDA 4M75B 2ZPFB 4J83A 2JT4A 3SDZA 2G3RA 1VQ5A 1GXIE 3L2ZA 1NYFA 1PKSA 1RABB 5CQXA 2YUPA 3OYFA 1X27A 2CKKA 2PVDB 3VS4A 1C6VX 3F70A 5I2SA 4F14A 1VQLA 2ZPBB 2Y4YA 3PGGA 4LD9K 1ZUYA 1QVGS 4PK4A 4IKFA 4M7AD 3UF4A 1ABOA 3S6WA 3EFOA 3E19A 4M7DC 3V8KA 1DJ7B 1X01A 3OSSC 5GAOm 1QQJA 4KBMB 1VQPQ 2QGFB 1KC8R 1U1SA 2O4XA 3EFSA 2XICA 2KROA 2CZ0B 3HRUA 2RHXA 3CD6A 1VOMA 4MMKA 1WLPB 4RG8A 5LJ3j 5J26A 2KXDA 5KYUA 2DTIA 2FPEA 4OB0B 1QVFS 1PM3A 1ZX6A 1M2OA 1GBQA 1WHGA 1B3QA 4P5NA 3CCQA 3P8DA 1G3YA 1N8RC 4J9FA 2E65A 1YHQT 4E7LA 3O8VA 4LNPA 3FLGA 4XTVA 4R0KA 3UA6A 1I1JA 4JLIA 3DLLA 4RTXA 1M27C 2DNUA 1W2BS 3WXMB 5AT1B 1I4K1 4XK8E 3VS0A 3A8GB 4QVDA 3JCMW 4C92B 3UT1A 1ARKA 2FYKA 4ELZC 3CXCS 1OV3A 2GTJA 1Q82R 2Y90A 4X9CA 1UTIA 2QEXA 1YCSB 2MMPA 1M9SA 5LJ5f 3JCMV 2R5MA 4QKUA 2DLPA 3INZA 1JBMA 1OEBA 2CYZB 3JCMc 1VQMQ 4C0GA 1EX4A 4M77D 1KHIA 4KT0E 4D8KA 3M0UA 1FMVA 4FYXB 1BI1A 5GAOq 1YIJT 3G4ST 1MMGA 2QGGA 4M7AB 1IHVA 1VQ8A 3EG0A 3VS3A 2FPDA 3PE0A 2JTFA 2DXTA 2DFUA 2RF0A 2GNCA 1RAAB 4KRTA 1KHCA 2F69A 4C5EA 2BTTA 3PFSA 1AD5A 3LH5A 1N8RR 2JVVA 1BIBA 2QK0A 4BE2A 5HK0A 3HFNA 2HKQB 4GLMA 1FX7A 5IAYA 1K73C 1R8OB 2L3RA 3JB9G 4XU0A 1YITT 3BDLA 1GCPA 4DBRA 3CC4Q 2MPXC 4OP0A 1YIJQ 4OB2B 4LDWA 3CCST 3G4SQ 1VA7A 2COYA 4EDUA 3I56T 2YXYA 1RLPC 4DEXA 4GY5A 4L59A 1T3SA 5CKFA 8ATCB 4M7DA 3I55T 1OZ2A 4M7DF 3PIPA 4BI3A 3V7CA 3MP8A 3SWNB 1YI2T 1AOJA 5KE2A 3JCMd 2HQXA 1BBZA 1RAHB 2L0AA 3JCMg 5GAN8 3A8HB 2RMOA 4BACA 2FL7A 2NUPB 3PMIA 1RLQC 1U06A 4Y91A 1M30A 4HXJA 2DD5A 3LH0A 3L42A 3MP1A 3ZFJA 1UGQB 2A0FB 2K2MA 3QYHB 3I55Q 3OBWA 1AZEA 3E2UA 1I81A 2IG0A 3OYKA 5GAN2 2DAQA 1D1CA 1SSFA 2DL3A 3V8JA 1YI2Q 2GQVA 1MNDA 2FZKB 4M77E 1FWZA 1VQPA 2CSQA 3UDCA 1MHNA 1IREB 4F04B 4LDXA 1JXMA 4Y92A 2KR3A 3M53A 3TEEA 2RB6A 4J9IA 3H41A 3R6OA 5HY6A 3HL8A 5HK3A 3OYCA 2DVEA 1IO6A 1FYNA 2LX9A 3QDFA 1WFWA 2KK4A 1M90R 2QTVA 3CC7T 1B07A 4KH1B 3RESA 1KD1U 3GNGA 4F7UE 3GBQA 1N9SA 4KULA 1QWFA 3X20B 1LCKA 1OX8A 3MEVA 2C06A 4E6RA 2DMOA 3OYIA 3QYGB 2WACA 2DBKA 1UJ0A 2KQWA 3L2WA 1QKWA 2DXBA 3JCMX 1A0NB 1PSEA 1VIEA 3TQ7P 5GAMh 2NUTB 2RJEA 1WDXA 1G8XA 1BB9A 4J9EA 2KBTA 1M8MA 2JS0A 5IH2A 1JXOA 2MYSA 4OMPA 3S3OA 3REBB 3QDRB 4RTWA 4TVRA 2AKLA 1OULA 2OI3A 1UGPB 3OYYA 2R57A 2CT3A 3CC7Q 1MUZA 3CMEQ 3I5RA 2H3EB 2KEAA 4JRKA 4PJOG 4L6V5 1QCNA 3CCLA 4J6YA 2M0OA 4V2SA 1X6GA 1VQMA 2ZCFB 2J6KA 3P8BB 2EKHA 5GJWB 1J3TA 2XIDA 2K3BA 1OPKA 4L5GA 4M78D 5GAMd 3QZ9B 1OZ3A 4UC4A 2B8AA 3UPUA 1R0CB 4IUUA 2DXUA 1YN8A 2D1XA 5GAMg 4CC4B 1Q81U 3BDUA 4EMKC 2CP3A 4RTTA 1JEGA 1TTHB 4C0DC 1IB8A 3EG9A 1VQLT 2XD0A 3JCMb 4E7HA 2JZ2A 3MEAA 1VQ6Q 4F7UA 1MGQA 4F7UF 1OPLA 2DL5A 1VQ9A 4JUVA 2P0PA 3MO8A 1QW1A 2LQNA 2L3QA 2LC4A 5D6WA 2DL7A 4XTWA 2CZ6B 3CC4A 1U3OA 3PTAA 1YIJA 1RAIB 4PJOC 3JB9F 2JN0A 3CD6T 2K7AA 1RADB 5KYYA 4DQ2A 1B34B 2RM4A 1WIEA 4J9DA 1QCOA 3OY9A 3PVQA 1HYOA 4ELYC 3CCQT 1PRMC 1I07A 3S3MA 2DX1A 4X1VA 3M54A 2E6NA 2HKNA 4A4HA 3TU4K 2D8JA 4D8DA 5I21A 2LQ8A 4HCCA 1SRLA 5CR2A 2A08A 3JRZA 1M1FA 3TREA 4FIBA 5M9OA 2ZPEB 1AVZC 3I55A 5DM7R 1KQ2A 4AG2C 1QVPA 4KGVB 1YI2A 3QIIA 5GANd 4FW1A 2M0YA 2A7YA 4N4GA 3LGLA 5GANg 3FB9A 3QJYA 2QEXT 4IUQA 3EGXB 5IHIA 4EMGA 1M5Q1 3FIFA 4M78E 2VYTA 1SPKA 4N4IA 3M9QA 2EQKA 2RHYA 1Q7YU 2MOXA 2EQUA 2F5TX 1OI1A 4J9GA 5KYNA 4M75G 3FEOA 3VUBA 1VQ7Q 2LQWA 3OMGA 4K11A 1GCQC 3CCRA 3ZEHA 2FO0A 2COWA 4A4FA 2HAXA 1QP3A 1M3CA 2JM9A 3CBPA 3EHQA 1ZA2B 2O2OA 2DA9A 2K4YA 5AYFA 2RK1A 5GMKl 3RMSA 3G71Q 2WSFE 2CP5A 2K3XA 3WVEB 3ZL7C 2JM8A 2DK3A 2EJFA 5GAOp 1TG0A 4EMKA 4A53A 3J80E 5FU6B 1C0MA 3CC7A 3G1JA 2KAFA 1VQ4Q 3CMEA 4ESRA 4Z02A 3EFOB 3C4SA 2LRQA 2SRCA 3OSVA 3M4YA 4JS4A 1K9MU 4M75C 3JB9I 2O4XB 4AFQC 2WSCE 4FL6A 5L23A 3JAME 4PJOA 2X51A 4PJOF 1PC0A 3KUFA 2O9VA 3RDVA 4FW2A 1KC8C 3M5AA 4MMLA 3HSBA 2EGEA 2X4XA 4FYWB 1QWEA 3OYAA 3PT9A 3FDRA 2W10A 2FPFA 3C95A 5C0MA 2VGNA 2X35A 3CMAQ 2XDPA 2YDLA 2NWMA 1PKTA 1VQ6A 4LUEA 4M7DD 2QI2A 4XTYA 4QW2A 4FYVB 4C92G 3NMZC 2RNAA 3R6NA 2CSIA 4FT4A 1D3BB 2PQWA 2QAZA 1VQPT 3OYDA 3LX7A 3OW2A 1M3AA 4RTUA 4OGEA 2LCLA 2CH4W 4PLLA 3P8HA 1YP5A 1UGRB 3FC3A 4QVZA 1NG2A 3MEWA 1AWXA 4JDSA 4MZPA 5CQYA 5CO7A 4PL6A 5GAN7 5CKBA 2PZ1A 2A3LA 1TU0B 2J7IA 1K8AU 3H0FA 4HCBA 4C8QB 1WXTA 1Q82C 4M7AG 4DBQA 2RI5A 2MF2A 2A28A 1R77A 2PUKB 2DXCA 4RKUE 2DD4A 2ZZDA 1TUDA 4RTYA 5LJ3f 1K4US 1SRMA 1WYXA 2IIMA 3RKWA 5J39A 1KJWA 1GCQA 1Q86U 4PJNA 2JW4A 3QZ5B 5DY9A 3TCJA 4FM4B 3IQLA 2LNVA 2VXEA 4OVAA 3OYBA 4C92C 2W0ZA 4IUVA 5D6XA 4Y28E 2DL8A 2GQIA 5GAMe 2QDYB 2A37A 1KD1R 1UB4A 4LN2A 4Z8AA 1E6HA 4RTZA 4HVWA 3CCLT 1BU1A 1FXXA 4OMLA 2XK0A 2ROTA 2WSEE 2JOYA 4C0ZA 1VQMT 2JMAA 5LJ5d 5FRMA 4FSXA 2MAMA 1VQ7A 4J6XA 1VQKT 3GP8A 5LJ5g 4OMMA 3ZBDA 4M7AC 4M7DE 2FB7A 2RA2A 2EYXA 1NZ9A 4FU6A 3UATA 2X3WD 4LDVA 4M75A 4FSSA 4M75F 4ATOA 3PIOA 3M58A 3MPUB 1QMCA 3G71A 3V7RA 4JLGA 2R5AA 2YUQA 1IHWA 4C0FA 1W6XA 1QCFA 4J9BA 1O9SA 2XKOC 4WCIA 3CCLQ 2P84A 1SG5A 3BE3A 2LJ3A 4MDXA 1VQ9T 4XQ3A 1RAEB 2GGRA 3GOXA 4GLKA 4WTOB 2DTHA 3CC4T 1PSFA 1VQ4A 3GPLA 1VQKQ 4OMOA 3TVTA 3CCVQ 3VS5A 3BW1A 2KDSA 3JCMJ 3C12A 3QWXX 2CZ7B 5GAOn 3QG1A 2LTOA 3JB9H 4IIOA 3JCMh 1D0XA 2PUOB 2L89A 2BKDN 3VV0A 3SWNC 4A4EA 3L2VA 2BE9B 2EBPA 4X34A 2CP2A 3X26B 4E47A 3LWHA 4BUGA 3QKJA 3OW2S 1Y7XA 1UE9A 3OBYA 2KY9A 1TUGB 1P92A 1VQ9Q 3MP6A 1HSQA 1D1BA 5GANe 2RJDA 2KXCA 1RI0A 3HRTA 5KCHA 1K76A 1ZUUA 3CMAA 1TXQA 2DBMA 2EYQA 5IHNA 2C0TA 2C0IA 2X4WA 5C6SA 3JB9D 2RJFA 5KYWB 2NLUA 5DLOA 2E12A 1BCMA 1M90C 3EH1A 2DM1A 1WHKA 3CPFA 3S3NA 4F17A 2EFIA 4NOYA 1YJNQ 2I2LA 2VXFA 1H641 2DPPB 3X28B 1Z9ZA 1GRIA 2DE0X 1NJIR 5IXBA 4B6MA 1KQSA 2MWOA 3X25B 3OW2P 4ANJA 4LD6A 2D9TA
chains in the Genus database with same CATH topology
2HL3A 2CP2A 2HQHA 2HKNA 2CP5A 1WHKA 2E4HA 2E3IA 3RDVA 1IXDA 2COZA 2CP0A 2CP6A 1TOVA 1WHGA 2COWA 1LPLA 1TXQA 2MPXC 3E2UA 1WHLA 2QK0A 4B6MA 2COYA 2Z0WA 3TQ7P 2E3HA 2M02A 1WHJA 1WHMA 2CP7A 1WHHA 2CP3A 2HKQB 2HL5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL3 A;  2CP2 A;  2HQH A;  2HKN A;  2CP5 A;  1WHK A;  2E4H A;  2E3I A;  3RDV A;  1IXD A;  2COZ A;  2CP0 A;  2CP6 A;  1TOV A;  1WHG A;  2COW A;  1LPL A;  1TXQ A;  2MPX C;  3E2U A;  1WHL A;  2QK0 A;  4B6M A;  2COY A;  2Z0W A;  3TQ7 P;  2E3H A;  2M02 A;  1WHJ A;  1WHM A;  2CP7 A;  1WHH A;  2CP3 A;  2HKQ B;  2HL5 C; 
#chains in the Genus database with same CATH topology
 1K0S A;  1Y96 B;  3PNW C;  3REA B;  5CKD A;  3OYL A;  1RUW A;  3CBM A;  1M2V B;  1PCX A;  1TSF A;  2YWW A;  4E7Z A;  4BE0 A;  4ME7 A;  1H8K A;  3CCR T;  1AWW A;  4E2F B;  4AFZ C;  3HRS A;  5FU7 B;  4AFU C;  4M77 B;  1KG1 A;  2QG9 B;  2QTX A;  3CCJ A;  2YT6 A;  1M1K U;  3H8Z A;  1HD3 A;  5KH6 A;  1BIA A;  3EG2 A;  5A0L A;  3G6E Q;  2GFA A;  2MWP A;  2Y4X A;  1TWB A;  9ATC B;  5HCK A;  4HT8 A;  3EH2 A;  1K1Z A;  5EC7 A;  4J9H A;  3LW5 E;  3EG9 B;  2QAS A;  3QXE B;  1WX6 A;  2E10 A;  4X9D A;  3RBB B;  5GAO r;  4F7U B;  3C94 A;  3KXT A;  2E1H A;  4NL3 A;  5IHK A;  3CME T;  4HCZ A;  3CCR Q;  1ZLM A;  3QSU A;  5D6Y A;  2LCC A;  2DEQ A;  4MZM A;  1NE8 A;  3OYN A;  1H92 A;  5KYX B;  7AT1 B;  1ZUK A;  3URG A;  2OJ2 A;  1NYG A;  2MCN A;  4N4H A;  4II1 A;  3CC2 A;  2LMJ A;  1OU9 A;  4DBH A;  2LQK A;  2X4Y A;  1WQ7 A;  2HD0 A;  2VUB A;  2LT1 A;  2BZ8 A;  4PFO A;  3RUX A;  3SWN A;  2LZ6 B;  1LNX A;  2EIF A;  2O88 A;  1M3B A;  4LDU A;  2EAY A;  2R58 A;  1OOT A;  3GNF B;  2HNI A;  1FMW A;  1NEG A;  2YUN A;  3M55 A;  2EJ9 A;  1VQ6 T;  3RIR A;  2LCS A;  2EKO A;  1VQO Q;  2HL5 C;  3VJP A;  1Z9Q A;  4PJL A;  1EFN A;  2NUP A;  4ZGD B;  2ZAE A;  4OMQ A;  1I0C A;  3LYI A;  1M1G A;  3OYG A;  3HKS A;  2BE7 D;  2FZC B;  1Q82 U;  4PJO D;  1VQK A;  3CCV A;  3RER A;  1NM7 A;  1ZHI A;  2AKK A;  1X6B A;  3H0H A;  4HA8 A;  1T3L A;  2RN8 A;  4CC3 A;  5CKE A;  4B9W A;  1VQN T;  1KQ1 A;  1QLY A;  1UEB A;  2V26 A;  1JO8 A;  2A36 A;  4MZT A;  5GMK m;  3Q1J A;  1BYM A;  2MI6 A;  2J6F A;  1LVK A;  3CPW P;  1XTD A;  1GBR A;  5CVI A;  2HBW A;  3LWI A;  2P4R A;  1KQS S;  4QQG A;  3A98 A;  2DRK A;  3QUI A;  2JJ9 A;  1NBE B;  2KNB B;  4ZN1 A;  1N8R U;  2JUF A;  3M4G A;  2YRD A;  3WVD B;  2F5K A;  2CS7 A;  3VS7 A;  1KFZ A;  4JZ4 A;  4J8O A;  2K2V A;  1VQN Q;  2ZPH B;  3MKD A;  5CIU A;  5GAN h;  4PJJ A;  5KCO A;  3RMQ A;  1EIF A;  3OA6 A;  1U8R A;  1VYV A;  5GAM j;  1RAC B;  2EQI A;  2XMF A;  4HVU A;  4LXC A;  4ZGE B;  1YJN A;  1Y0M A;  3HHT B;  2EQJ A;  1V29 B;  1K8A R;  2VVK A;  1ZSZ B;  1H3H A;  1X6O A;  2M9U A;  1M8V A;  1KQS P;  1KIK A;  3JSC A;  4VUB A;  2QQB A;  2RHU A;  2JS2 A;  5FWB A;  2EWN A;  2K5F A;  1LPL A;  1PD0 A;  4RMO A;  3SB2 A;  3H0I A;  1G3W A;  1SSH A;  2JXB A;  2LJ1 A;  1VQ7 T;  4JPB W;  2BUD A;  2JMC A;  3EG3 A;  2ROL A;  2QDL A;  3E9G A;  3CQT A;  4QT7 A;  1R0B G;  3EAE A;  2ENM A;  2EGC A;  2K57 A;  2DZC A;  2XHC A;  2OX7 A;  2RJC A;  3HPW A;  1PNJ A;  3G71 T;  4PJO E;  2EPD A;  1JJ2 P;  1YWO A;  1U5S A;  2ABL A;  4M78 B;  2NYS A;  3MEU A;  3G6E A;  2RPN A;  4FCY A;  2QQS A;  2E3H A;  3ER0 A;  4PFZ A;  2PVG B;  1U1T A;  2VGM A;  1K73 U;  2RI3 A;  2FRY A;  3GF5 A;  5GJV B;  1VQ4 T;  1AT1 B;  1LJO A;  3UWN A;  4MDW A;  2DZ9 A;  1HK9 A;  2V8J A;  4C5G A;  4EMH A;  1BCO A;  4M75 D;  1RI9 A;  1H3Z A;  3QHS A;  4PJM A;  3BFM A;  4RCC A;  4O6J A;  3E9F A;  1UGS B;  2DKG A;  4XU1 A;  5GAN j;  2L5Q A;  4C5H A;  2K3Y A;  2KRN A;  1IXD A;  5DLQ E;  2VV5 A;  4BY6 B;  4C8Q G;  1I5L A;  3V7S A;  1YBY A;  2L3P A;  4E7K A;  3JCM e;  2X4J A;  2OTJ Q;  2E5Q A;  3EHR A;  3HFO A;  3CMA T;  3VUZ A;  4DOV A;  4N0A C;  3OS1 A;  2GTO A;  1BI2 A;  2ESW A;  1BI3 A;  2OAU A;  2F2W A;  1JQQ A;  1RAG B;  2MIO A;  1VQO A;  2AZS A;  2O01 E;  2FVU A;  1MMA A;  4J7F A;  1K0X A;  1W2B A;  5I22 A;  1ZBJ A;  4JRI A;  5KYU B;  3OYH A;  3UA7 A;  4BI8 B;  4JZ3 A;  1SEM A;  5LJ3 h;  1N6A A;  4IUT A;  3H6Z A;  3VS6 A;  2LP5 A;  5CK9 A;  3OMC A;  1WNL A;  1BKB A;  1NPR A;  3DKM A;  4XTU A;  1G83 A;  3CCU T;  5GMK i;  2QA4 T;  2V8I A;  3HTR A;  2V8K A;  4C8Q C;  2KT8 A;  2L2P A;  2DL4 A;  1KD1 C;  2EGA A;  2EYY A;  1X69 A;  2HQE A;  4JRP A;  1IGQ A;  2RO0 A;  3NTK A;  3SD4 A;  2HCK A;  3CCJ T;  2HEQ A;  1TH7 A;  2DF6 A;  2ED1 A;  1VQN A;  3PVL A;  3FRN A;  2GFU A;  3J7A F;  1OQK A;  1S72 Q;  1HJD A;  4M75 E;  5LJ3 d;  4HVV A;  2DTO A;  4EPC A;  3CCU Q;  5LJ3 g;  1PD1 A;  3EGD A;  2QA4 Q;  3VYG A;  3JCM P;  1C1A A;  2K5I A;  3E1S A;  2RK2 A;  3V8L A;  3AHU A;  3A5Z B;  1T0H A;  4A4K A;  5LJ5 h;  1D1A A;  3CC2 T;  5J3B A;  3SEM A;  1M1K R;  3CCJ Q;  4ZGJ B;  1M4Z A;  1JU5 C;  1OX9 A;  4OB1 B;  4C8Q E;  4KH0 B;  2PVO B;  2RHI A;  3A8L B;  2DVJ A;  2E70 A;  2RHZ A;  5KE3 A;  1AWJ A;  1MV0 B;  1BI0 A;  4PKC C;  4OF1 A;  3MET A;  5I2M A;  2K79 A;  5A0G A;  1Q81 C;  1PRL C;  2DEU A;  3A1P A;  3NHN A;  2ZPI B;  1SHG A;  4JJN K;  1KSW A;  2KVQ G;  4HKE A;  4FT2 A;  1S1N A;  4BDY A;  2LVM A;  3CC2 Q;  3U23 A;  3CBO A;  4N0A A;  1G2B A;  2JTE A;  4JS5 A;  2YUO A;  3M0S A;  1PHT A;  1QVG P;  3CCV T;  3N5B B;  3VS2 A;  4M7D B;  1AZG B;  4QQD A;  1NLO C;  3QWY A;  1UFF A;  5HKC A;  3SFM A;  1V1C A;  4RTV A;  4NS5 A;  1D09 B;  1TS9 A;  3PMT A;  4OMN A;  2KRS A;  2VKN A;  3M57 A;  3VKI A;  2GF7 A;  1D3B A;  1IRX A;  1ZBX A;  3VU3 C;  3M0Q A;  2KT1 A;  4C92 E;  1NJI C;  2EYZ A;  1QVF P;  2RQW A;  2DET A;  2OTJ A;  2E5K A;  2YRC A;  2J06 A;  4M77 G;  3L2Q A;  1YHQ Q;  3OB9 A;  2KSS A;  2F2V A;  2JNG A;  3VRY A;  1D0Z A;  2GCX A;  4C8Q A;  4C8Q F;  2X3X D;  5LJ5 j;  1Q81 R;  3JB9 J;  2FHD A;  4KUD K;  3BY7 A;  4Z89 A;  4KGZ B;  1WHH A;  3CPW A;  2DYB A;  3X24 B;  1YJN T;  3L1A A;  1W2B P;  3M56 A;  4M7A E;  2DIL A;  4F7U G;  2DO3 A;  3M59 A;  2D0Q B;  1G3T A;  1XOV A;  1TOV A;  2CUD A;  5GMK h;  1KK7 A;  1EZZ B;  1WXU A;  3CXC P;  3JV3 A;  4HT9 A;  2Z0W A;  2XI9 A;  1Q7Y C;  1MMD A;  4QQ6 A;  3VS1 A;  1X2K A;  3OYM A;  2MK5 A;  3SHW A;  2EW3 A;  2KMT A;  3CCM T;  1CKA A;  4AFS C;  1TUC A;  2QQR A;  2KRM A;  1B7T A;  1MNE A;  4LE9 A;  5GAO l;  4A54 A;  3GLX A;  4A63 B;  1ABQ A;  2I0N A;  2YLB A;  5GAN 4;  5FU7 C;  3NGP A;  3TSZ A;  3JCM Q;  1Y71 A;  4M77 C;  4AT1 B;  4QVC A;  2D8H A;  4OMF B;  2G6F X;  1QKX A;  5D7U A;  1YCY A;  3KBG A;  3G6E T;  4FYY B;  2FZG B;  5GAN 5;  1SF9 A;  1ZA1 B;  4C5I A;  3QPH A;  2YHT A;  4C92 A;  1WGS A;  5L8R E;  4C92 F;  1S72 A;  1E7O A;  2PNI A;  2VAS A;  5CAI A;  2HSE B;  3FJP A;  3AT1 B;  4YTL A;  2AK5 A;  3CCU A;  4B9X A;  3CCM Q;  2GBQ A;  2BZY A;  2QA4 A;  3MJX A;  4ZTF A;  1ACM B;  4BB7 A;  2VB6 A;  1YIT Q;  3QO3 A;  1D0Y A;  3OYE A;  2LNH B;  4IUR A;  2HDA A;  3MCA B;  4BD3 A;  2OTL T;  3EG1 A;  2J6O A;  2RQT A;  3CCS Q;  1UHC A;  1JJ2 A;  2FG0 A;  4DBF A;  4R55 A;  3JCM f;  3I56 Q;  1K9M C;  3RKX A;  4CC2 A;  3EGU A;  4M7A A;  2CP6 A;  2XU8 A;  4XU3 A;  4M7A F;  2LJ0 A;  1NEB A;  1XNI A;  3OQ5 A;  1Q7Y R;  4ZNX A;  1UJY A;  1BK2 A;  4A4G A;  2VWF A;  1WHM A;  2FRW A;  1K73 R;  1X43 A;  2E6Z A;  4PFP A;  3CCE T;  4Q5W A;  2HQH A;  1KC8 U;  2DIQ A;  1XJW B;  2H3J A;  2RQU A;  1YFN A;  1GL5 A;  2CUB A;  2C0O A;  5GMK j;  1VQO T;  2M16 A;  5FRO A;  1UUE A;  2L8D A;  6AT1 B;  2OTL Q;  2K9G A;  1N5Z A;  1PWT A;  4KGX B;  4XU2 A;  1SHF A;  3HP9 A;  4J5Y A;  1CSK A;  5KYY B;  2EQM A;  3T9N A;  5KYW A;  5CCA A;  1VYU A;  2CT4 A;  2D6F A;  1AWO A;  2COZ A;  2PU9 B;  5A0D A;  3CCE Q;  2YRV A;  4IIM A;  3NFC A;  3CPW S;  2CH4 A;  4EIK A;  2AT1 B;  4JJB A;  2KI7 A;  1WZO A;  2DJZ A;  2ZPG B;  1X75 C;  1YJ9 T;  1O75 A;  2J05 A;  4CI0 C;  1K8A C;  1K9M R;  4PLI A;  2EJG A;  1UEC A;  5LJ3 e;  1AHJ B;  1OU8 A;  1OYX A;  4F16 A;  4J7I A;  1ZSG A;  1YJW T;  2CP0 A;  1Q95 G;  5FW9 A;  4OB3 B;  1Y96 A;  4IUP A;  1YHQ A;  2XDD A;  2AHJ B;  1M2V A;  1K9A A;  2BIV A;  2M02 A;  4M78 G;  1Q86 C;  2F2X A;  2RH2 A;  3D7S B;  3M0T A;  3KFV A;  4XTZ A;  3L2R A;  2HMA A;  2ECZ A;  4M77 A;  4M77 F;  4DOW A;  2E4H A;  2OAW A;  1UHF A;  1VQ5 T;  1YJ9 Q;  1ZSZ C;  2JTM A;  2DRM A;  1CKB A;  1YJW Q;  4HCK A;  1NLP C;  2LDM A;  2RD1 A;  4AMC A;  8AT1 B;  4ZTJ A;  3NPF A;  1FMK A;  2RQV A;  2DJQ A;  3THK A;  1MMN A;  5LL6 S;  2K5L A;  5A2Q E;  3H9N A;  3ASK A;  2CRE A;  5GAM f;  5FWC A;  1X2Q A;  3J81 E;  1UG1 A;  3A8M B;  4AG1 C;  3A8O B;  5KYX A;  4O5V A;  3MHX A;  2DER A;  5LJ5 e;  2AZV A;  3G7Z A;  2LT4 A;  1JJ2 S;  4PNO A;  3G4S A;  4JRQ A;  4CRI A;  3DB3 A;  1VQ5 Q;  4CC7 A;  2NUT A;  5GAN 3;  3QJ6 A;  2YLC A;  4M78 C;  1JRI A;  2QQ9 A;  2P0Q A;  2V1Q A;  4EMK B;  4C0D B;  5ECA A;  1PG5 B;  3RR6 A;  1JB0 E;  1VQL Q;  3OS0 A;  2D0N A;  1WI7 A;  4GBQ A;  4KUI A;  2H8H A;  3CCM A;  1Q86 R;  4E7J A;  5IT9 E;  1NJI U;  1W4S A;  2V1R A;  2K6D A;  1YIT A;  4M4Z A;  4WF2 A;  4RUG A;  2F1L A;  1Y57 A;  2X9H A;  2E3I A;  1F1B B;  3CCS A;  4PJO B;  3I56 A;  1N9R A;  3RNJ A;  3LLR A;  2HSP A;  4XAX B;  4BE1 A;  3CD6 Q;  1WPY A;  2NUZ A;  4BDZ A;  2LX7 A;  3VRZ A;  1WJR A;  1WJQ A;  1VIF A;  3LGF A;  4J9C A;  3ME9 A;  2O9S A;  1VYT A;  4BY6 C;  3DLM A;  4XTX A;  4Z88 A;  2OTJ T;  2QQA A;  2BZX A;  2L3S A;  2YSQ A;  5FU6 C;  3CCQ Q;  2M51 A;  5IN1 A;  1QVG A;  2B86 A;  1I5O B;  2DIG A;  2RQR A;  1YNZ A;  2HBP A;  3DB4 A;  5CKH A;  1N27 A;  3CEY A;  1IGU A;  1WHL A;  2O31 A;  1WXB A;  1MV3 A;  1HXD A;  1WHJ A;  3I9Q A;  2OTL A;  2CGH A;  2HZY A;  5GAN f;  2RI2 A;  3I35 A;  2QXF A;  1G3S A;  2IPO B;  1M90 U;  2ZGW A;  2SEM A;  1RL2 A;  2PTK A;  2FEI A;  3QBY A;  1WJS A;  1VQ8 T;  2CZ1 B;  3NTH A;  3TSW A;  2P0K A;  1QVF A;  1NPP A;  4JJC A;  1W70 A;  1XQH A;  1B34 A;  3OS2 A;  3CCE A;  1WQW A;  5FRN A;  1QP2 A;  1V76 A;  4J6W A;  3EGD B;  1T0J A;  2QEX Q;  2HL3 A;  1VUB A;  4E7I A;  1AEY A;  1ZSZ A;  4C8Q D;  2EYW A;  2KE9 A;  5EG2 A;  4DEY A;  4OGC A;  5I11 A;  2IVW A;  3ULR B;  5FLX E;  5GMK e;  5GAN 6;  2M1H A;  4RCB A;  1ZQ1 A;  2XDB A;  1E6G A;  1IZ6 A;  1LOJ A;  4D6W A;  3GIB A;  3O5Z A;  1I8F A;  3M0P A;  1WA7 A;  1SKU B;  4DA4 A;  1VQ8 Q;  2KYB A;  4BI4 A;  2DYI A;  4ORZ A;  2ATC B;  4R56 A;  1M1K C;  1GFC A;  3M0R A;  4ZN3 A;  2AIR B;  3C0C A;  2E41 A;  3CXC A;  4NL2 A;  3OYJ A;  3RKY A;  1S72 T;  2CDT A;  1UGV A;  1YWP A;  3VYH B;  1YJ9 A;  4M78 A;  3NTI A;  2CP7 A;  2KYM A;  3EGX A;  4M78 F;  2XG8 D;  1G5V A;  4M7D G;  3L2U A;  4E7S A;  5IXF A;  1GFD A;  4LUD A;  2EVR A;  2E64 A;  1YJW A;  4RG2 A;  3FJ5 A;  3OS5 A;  2KGT A;  1Y07 A;  2ED0 A;  2P4T A;  1UDL A;  3EFR A;  2VC8 A;  3I5S A;  4C92 D;  1RAF B;  4LDY A;  2QYZ A;  1W1F A;  4JJD A;  4M75 B;  2ZPF B;  4J83 A;  2JT4 A;  3SDZ A;  2G3R A;  1VQ5 A;  1GXI E;  3L2Z A;  1NYF A;  1PKS A;  1RAB B;  5CQX A;  2YUP A;  3OYF A;  1X27 A;  2CKK A;  2PVD B;  3VS4 A;  1C6V X;  3F70 A;  5I2S A;  4F14 A;  1VQL A;  2ZPB B;  2Y4Y A;  3PGG A;  4LD9 K;  1ZUY A;  1QVG S;  4PK4 A;  4IKF A;  4M7A D;  3UF4 A;  1ABO A;  3S6W A;  3EFO A;  3E19 A;  4M7D C;  3V8K A;  1DJ7 B;  1X01 A;  3OSS C;  5GAO m;  1QQJ A;  4KBM B;  1VQP Q;  2QGF B;  1KC8 R;  1U1S A;  2O4X A;  3EFS A;  2XIC A;  2KRO A;  2CZ0 B;  3HRU A;  2RHX A;  3CD6 A;  1VOM A;  4MMK A;  1WLP B;  4RG8 A;  5LJ3 j;  5J26 A;  2KXD A;  5KYU A;  2DTI A;  2FPE A;  4OB0 B;  1QVF S;  1PM3 A;  1ZX6 A;  1M2O A;  1GBQ A;  1WHG A;  1B3Q A;  4P5N A;  3CCQ A;  3P8D A;  1G3Y A;  1N8R C;  4J9F A;  2E65 A;  1YHQ T;  4E7L A;  3O8V A;  4LNP A;  3FLG A;  4XTV A;  4R0K A;  3UA6 A;  1I1J A;  4JLI A;  3DLL A;  4RTX A;  1M27 C;  2DNU A;  1W2B S;  3WXM B;  5AT1 B;  1I4K 1;  4XK8 E;  3VS0 A;  3A8G B;  4QVD A;  3JCM W;  4C92 B;  3UT1 A;  1ARK A;  2FYK A;  4ELZ C;  3CXC S;  1OV3 A;  2GTJ A;  1Q82 R;  2Y90 A;  4X9C A;  1UTI A;  2QEX A;  1YCS B;  2MMP A;  1M9S A;  5LJ5 f;  3JCM V;  2R5M A;  4QKU A;  2DLP A;  3INZ A;  1JBM A;  1OEB A;  2CYZ B;  3JCM c;  1VQM Q;  4C0G A;  1EX4 A;  4M77 D;  1KHI A;  4KT0 E;  4D8K A;  3M0U A;  1FMV A;  4FYX B;  1BI1 A;  5GAO q;  1YIJ T;  3G4S T;  1MMG A;  2QGG A;  4M7A B;  1IHV A;  1VQ8 A;  3EG0 A;  3VS3 A;  2FPD A;  3PE0 A;  2JTF A;  2DXT A;  2DFU A;  2RF0 A;  2GNC A;  1RAA B;  4KRT A;  1KHC A;  2F69 A;  4C5E A;  2BTT A;  3PFS A;  1AD5 A;  3LH5 A;  1N8R R;  2JVV A;  1BIB A;  2QK0 A;  4BE2 A;  5HK0 A;  3HFN A;  2HKQ B;  4GLM A;  1FX7 A;  5IAY A;  1K73 C;  1R8O B;  2L3R A;  3JB9 G;  4XU0 A;  1YIT T;  3BDL A;  1GCP A;  4DBR A;  3CC4 Q;  2MPX C;  4OP0 A;  1YIJ Q;  4OB2 B;  4LDW A;  3CCS T;  3G4S Q;  1VA7 A;  2COY A;  4EDU A;  3I56 T;  2YXY A;  1RLP C;  4DEX A;  4GY5 A;  4L59 A;  1T3S A;  5CKF A;  8ATC B;  4M7D A;  3I55 T;  1OZ2 A;  4M7D F;  3PIP A;  4BI3 A;  3V7C A;  3MP8 A;  3SWN B;  1YI2 T;  1AOJ A;  5KE2 A;  3JCM d;  2HQX A;  1BBZ A;  1RAH B;  2L0A A;  3JCM g;  5GAN 8;  3A8H B;  2RMO A;  4BAC A;  2FL7 A;  2NUP B;  3PMI A;  1RLQ C;  1U06 A;  4Y91 A;  1M30 A;  4HXJ A;  2DD5 A;  3LH0 A;  3L42 A;  3MP1 A;  3ZFJ A;  1UGQ B;  2A0F B;  2K2M A;  3QYH B;  3I55 Q;  3OBW A;  1AZE A;  3E2U A;  1I81 A;  2IG0 A;  3OYK A;  5GAN 2;  2DAQ A;  1D1C A;  1SSF A;  2DL3 A;  3V8J A;  1YI2 Q;  2GQV A;  1MND A;  2FZK B;  4M77 E;  1FWZ A;  1VQP A;  2CSQ A;  3UDC A;  1MHN A;  1IRE B;  4F04 B;  4LDX A;  1JXM A;  4Y92 A;  2KR3 A;  3M53 A;  3TEE A;  2RB6 A;  4J9I A;  3H41 A;  3R6O A;  5HY6 A;  3HL8 A;  5HK3 A;  3OYC A;  2DVE A;  1IO6 A;  1FYN A;  2LX9 A;  3QDF A;  1WFW A;  2KK4 A;  1M90 R;  2QTV A;  3CC7 T;  1B07 A;  4KH1 B;  3RES A;  1KD1 U;  3GNG A;  4F7U E;  3GBQ A;  1N9S A;  4KUL A;  1QWF A;  3X20 B;  1LCK A;  1OX8 A;  3MEV A;  2C06 A;  4E6R A;  2DMO A;  3OYI A;  3QYG B;  2WAC A;  2DBK A;  1UJ0 A;  2KQW A;  3L2W A;  1QKW A;  2DXB A;  3JCM X;  1A0N B;  1PSE A;  1VIE A;  3TQ7 P;  5GAM h;  2NUT B;  2RJE A;  1WDX A;  1G8X A;  1BB9 A;  4J9E A;  2KBT A;  1M8M A;  2JS0 A;  5IH2 A;  1JXO A;  2MYS A;  4OMP A;  3S3O A;  3REB B;  3QDR B;  4RTW A;  4TVR A;  2AKL A;  1OUL A;  2OI3 A;  1UGP B;  3OYY A;  2R57 A;  2CT3 A;  3CC7 Q;  1MUZ A;  3CME Q;  3I5R A;  2H3E B;  2KEA A;  4JRK A;  4PJO G;  4L6V 5;  1QCN A;  3CCL A;  4J6Y A;  2M0O A;  4V2S A;  1X6G A;  1VQM A;  2ZCF B;  2J6K A;  3P8B B;  2EKH A;  5GJW B;  1J3T A;  2XID A;  2K3B A;  1OPK A;  4L5G A;  4M78 D;  5GAM d;  3QZ9 B;  1OZ3 A;  4UC4 A;  2B8A A;  3UPU A;  1R0C B;  4IUU A;  2DXU A;  1YN8 A;  2D1X A;  5GAM g;  4CC4 B;  1Q81 U;  3BDU A;  4EMK C;  2CP3 A;  4RTT A;  1JEG A;  1TTH B;  4C0D C;  1IB8 A;  3EG9 A;  1VQL T;  2XD0 A;  3JCM b;  4E7H A;  2JZ2 A;  3MEA A;  1VQ6 Q;  4F7U A;  1MGQ A;  4F7U F;  1OPL A;  2DL5 A;  1VQ9 A;  4JUV A;  2P0P A;  3MO8 A;  1QW1 A;  2LQN A;  2L3Q A;  2LC4 A;  5D6W A;  2DL7 A;  4XTW A;  2CZ6 B;  3CC4 A;  1U3O A;  3PTA A;  1YIJ A;  1RAI B;  4PJO C;  3JB9 F;  2JN0 A;  3CD6 T;  2K7A A;  1RAD B;  5KYY A;  4DQ2 A;  1B34 B;  2RM4 A;  1WIE A;  4J9D A;  1QCO A;  3OY9 A;  3PVQ A;  1HYO A;  4ELY C;  3CCQ T;  1PRM C;  1I07 A;  3S3M A;  2DX1 A;  4X1V A;  3M54 A;  2E6N A;  2HKN A;  4A4H A;  3TU4 K;  2D8J A;  4D8D A;  5I21 A;  2LQ8 A;  4HCC A;  1SRL A;  5CR2 A;  2A08 A;  3JRZ A;  1M1F A;  3TRE A;  4FIB A;  5M9O A;  2ZPE B;  1AVZ C;  3I55 A;  5DM7 R;  1KQ2 A;  4AG2 C;  1QVP A;  4KGV B;  1YI2 A;  3QII A;  5GAN d;  4FW1 A;  2M0Y A;  2A7Y A;  4N4G A;  3LGL A;  5GAN g;  3FB9 A;  3QJY A;  2QEX T;  4IUQ A;  3EGX B;  5IHI A;  4EMG A;  1M5Q 1;  3FIF A;  4M78 E;  2VYT A;  1SPK A;  4N4I A;  3M9Q A;  2EQK A;  2RHY A;  1Q7Y U;  2MOX A;  2EQU A;  2F5T X;  1OI1 A;  4J9G A;  5KYN A;  4M75 G;  3FEO A;  3VUB A;  1VQ7 Q;  2LQW A;  3OMG A;  4K11 A;  1GCQ C;  3CCR A;  3ZEH A;  2FO0 A;  2COW A;  4A4F A;  2HAX A;  1QP3 A;  1M3C A;  2JM9 A;  3CBP A;  3EHQ A;  1ZA2 B;  2O2O A;  2DA9 A;  2K4Y A;  5AYF A;  2RK1 A;  5GMK l;  3RMS A;  3G71 Q;  2WSF E;  2CP5 A;  2K3X A;  3WVE B;  3ZL7 C;  2JM8 A;  2DK3 A;  2EJF A;  5GAO p;  1TG0 A;  4EMK A;  4A53 A;  3J80 E;  5FU6 B;  1C0M A;  3CC7 A;  3G1J A;  2KAF A;  1VQ4 Q;  3CME A;  4ESR A;  4Z02 A;  3EFO B;  3C4S A;  2LRQ A;  2SRC A;  3OSV A;  3M4Y A;  4JS4 A;  1K9M U;  4M75 C;  3JB9 I;  2O4X B;  4AFQ C;  2WSC E;  4FL6 A;  5L23 A;  3JAM E;  4PJO A;  2X51 A;  4PJO F;  1PC0 A;  3KUF A;  2O9V A;  3RDV A;  4FW2 A;  1KC8 C;  3M5A A;  4MML A;  3HSB A;  2EGE A;  2X4X A;  4FYW B;  1QWE A;  3OYA A;  3PT9 A;  3FDR A;  2W10 A;  2FPF A;  3C95 A;  5C0M A;  2VGN A;  2X35 A;  3CMA Q;  2XDP A;  2YDL A;  2NWM A;  1PKT A;  1VQ6 A;  4LUE A;  4M7D D;  2QI2 A;  4XTY A;  4QW2 A;  4FYV B;  4C92 G;  3NMZ C;  2RNA A;  3R6N A;  2CSI A;  4FT4 A;  1D3B B;  2PQW A;  2QAZ A;  1VQP T;  3OYD A;  3LX7 A;  3OW2 A;  1M3A A;  4RTU A;  4OGE A;  2LCL A;  2CH4 W;  4PLL A;  3P8H A;  1YP5 A;  1UGR B;  3FC3 A;  4QVZ A;  1NG2 A;  3MEW A;  1AWX A;  4JDS A;  4MZP A;  5CQY A;  5CO7 A;  4PL6 A;  5GAN 7;  5CKB A;  2PZ1 A;  2A3L A;  1TU0 B;  2J7I A;  1K8A U;  3H0F A;  4HCB A;  4C8Q B;  1WXT A;  1Q82 C;  4M7A G;  4DBQ A;  2RI5 A;  2MF2 A;  2A28 A;  1R77 A;  2PUK B;  2DXC A;  4RKU E;  2DD4 A;  2ZZD A;  1TUD A;  4RTY A;  5LJ3 f;  1K4U S;  1SRM A;  1WYX A;  2IIM A;  3RKW A;  5J39 A;  1KJW A;  1GCQ A;  1Q86 U;  4PJN A;  2JW4 A;  3QZ5 B;  5DY9 A;  3TCJ A;  4FM4 B;  3IQL A;  2LNV A;  2VXE A;  4OVA A;  3OYB A;  4C92 C;  2W0Z A;  4IUV A;  5D6X A;  4Y28 E;  2DL8 A;  2GQI A;  5GAM e;  2QDY B;  2A37 A;  1KD1 R;  1UB4 A;  4LN2 A;  4Z8A A;  1E6H A;  4RTZ A;  4HVW A;  3CCL T;  1BU1 A;  1FXX A;  4OML A;  2XK0 A;  2ROT A;  2WSE E;  2JOY A;  4C0Z A;  1VQM T;  2JMA A;  5LJ5 d;  5FRM A;  4FSX A;  2MAM A;  1VQ7 A;  4J6X A;  1VQK T;  3GP8 A;  5LJ5 g;  4OMM A;  3ZBD A;  4M7A C;  4M7D E;  2FB7 A;  2RA2 A;  2EYX A;  1NZ9 A;  4FU6 A;  3UAT A;  2X3W D;  4LDV A;  4M75 A;  4FSS A;  4M75 F;  4ATO A;  3PIO A;  3M58 A;  3MPU B;  1QMC A;  3G71 A;  3V7R A;  4JLG A;  2R5A A;  2YUQ A;  1IHW A;  4C0F A;  1W6X A;  1QCF A;  4J9B A;  1O9S A;  2XKO C;  4WCI A;  3CCL Q;  2P84 A;  1SG5 A;  3BE3 A;  2LJ3 A;  4MDX A;  1VQ9 T;  4XQ3 A;  1RAE B;  2GGR A;  3GOX A;  4GLK A;  4WTO B;  2DTH A;  3CC4 T;  1PSF A;  1VQ4 A;  3GPL A;  1VQK Q;  4OMO A;  3TVT A;  3CCV Q;  3VS5 A;  3BW1 A;  2KDS A;  3JCM J;  3C12 A;  3QWX X;  2CZ7 B;  5GAO n;  3QG1 A;  2LTO A;  3JB9 H;  4IIO A;  3JCM h;  1D0X A;  2PUO B;  2L89 A;  2BKD N;  3VV0 A;  3SWN C;  4A4E A;  3L2V A;  2BE9 B;  2EBP A;  4X34 A;  2CP2 A;  3X26 B;  4E47 A;  3LWH A;  4BUG A;  3QKJ A;  3OW2 S;  1Y7X A;  1UE9 A;  3OBY A;  2KY9 A;  1TUG B;  1P92 A;  1VQ9 Q;  3MP6 A;  1HSQ A;  1D1B A;  5GAN e;  2RJD A;  2KXC A;  1RI0 A;  3HRT A;  5KCH A;  1K76 A;  1ZUU A;  3CMA A;  1TXQ A;  2DBM A;  2EYQ A;  5IHN A;  2C0T A;  2C0I A;  2X4W A;  5C6S A;  3JB9 D;  2RJF A;  5KYW B;  2NLU A;  5DLO A;  2E12 A;  1BCM A;  1M90 C;  3EH1 A;  2DM1 A;  1WHK A;  3CPF A;  3S3N A;  4F17 A;  2EFI A;  4NOY A;  1YJN Q;  2I2L A;  2VXF A;  1H64 1;  2DPP B;  3X28 B;  1Z9Z A;  1GRI A;  2DE0 X;  1NJI R;  5IXB A;  4B6M A;  1KQS A;  2MWO A;  3X25 B;  3OW2 P;  4ANJ A;  4LD6 A;  2D9T A; 
#chains in the Genus database with same CATH homology
 2HL3 A;  2CP2 A;  2HQH A;  2HKN A;  2CP5 A;  1WHK A;  2E4H A;  2E3I A;  3RDV A;  1IXD A;  2COZ A;  2CP0 A;  2CP6 A;  1TOV A;  1WHG A;  2COW A;  1LPL A;  1TXQ A;  2MPX C;  3E2U A;  1WHL A;  2QK0 A;  4B6M A;  2COY A;  2Z0W A;  3TQ7 P;  2E3H A;  2M02 A;  1WHJ A;  1WHM A;  2CP7 A;  1WHH A;  2CP3 A;  2HKQ B;  2HL5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...