2HKQB

Crystal structure of the c-terminal domain of human eb1 in complex with the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hkqB00
2CP2A 2E3HA 2HKQB 2MPXC 2HKNA 2E3IA 2HQHA 1WHKA 2CP7A 3TQ7P 4B6MA 1IXDA 1TOVA 1TXQA 1WHGA 1WHMA 3E2UA 2QK0A 2COYA 2HL5C 2HL3A 2CP0A 1WHJA 1WHLA 2Z0WA 1WHHA 2E4HA 2COZA 2CP3A 2M02A 1LPLA 3RDVA 2CP5A 2CP6A 2COWA
chains in the Genus database with same CATH superfamily
2D0NA 1WJSA 2W10A 2E5QA 2P4RA 1TG0A 3NHNA 3ZBDA 2F2WA 4JRQA 2A3LA 1UE9A 2CT3A 2DJZA 1N9SA 2LX9A 3CQTA 1BI2A 1Y57A 2LNHB 1O9SA 1S72A 1B34A 2AHJB 2L3PA 4HXJA 4KBMB 2JTEA 1IHWA 4ZTJA 2ZPBB 2DL7A 2PUKB 1JXOA 4R55A 3M0TA 2AKLA 2AIRB 1VQLT 1RUWA 1D3BA 5KCHA 3S6WA 4HKEA 2KBTA 1IHVA 4FSXA 3UWNA 2KSSA 5CKHA 2RI2A 2J6OA 2R58A 1WX6A 3M0SA 1D1AA 3HL8A 4EPCA 1K73C 4ATOA 3J80E 1YJWQ 1H8KA 4HVVA 2KRNA 5CIUA 4C8QF 4YTLA 5FWBA 4M75E 1OEBA 1VQ7A 1KSWA 1KHCA 1WXBA 2JM8A 3MHXA 5I22A 2AK5A 3FC3A 4JJNK 2EQIA 4M7AC 3JCMe 2WSFE 2ECZA 3RKWA 2EYYA 4PLIA 1E6HA 1JJ2S 1M3CA 2J06A 2V26A 3I35A 4CC2A 2M16A 1TOVA 1CSKA 2HL3A 1I5OB 2JTMA 3BDUA 1YHQT 1K8AR 4OMPA 1D0XA 5ECAA 3EGXB 4PK4A 4GBQA 3TSZA 1Z9QA 1QW1A 2EWNA 2CGHA 2QXFA 3EGDA 4F7UA 5HK0A 4HT9A 4DBRA 2RHYA 1M90R 4RG8A 2HAXA 3JCMQ 4EDUA 1V76A 2LX7A 2EVRA 2DM1A 2E12A 1ZX6A 4DOVA 5LJ5g 4PJOC 2V1QA 1G5VA 2EKHA 2O4XB 2FZCB 2K3YA 5GAN3 3A8HB 1M2VA 2SEMA 4Z02A 1KD1R 2DTOA 1VQNA 2OTLA 4BY6B 2EW3A 2DVEA 1M3AA 1VQPT 1Q7YR 4C92B 3LLRA 1VQ8T 3OYKA 2FL7A 1JJ2P 2WSCE 1WDXA 1JO8A 4O5VA 1AZEA 4C0FA 4KUDK 5CKDA 2I2LA 4M77E 1WZOA 1B7TA 2X4YA 3QJ6A 1UGPB 4PJOA 2BZYA 1NEGA 2LDMA 3GNGA 2BZXA 3MEVA 4LUEA 4GLKA 2MAMA 5M9OA 3A8OB 4C5HA 1H3ZA 2KDSA 3QJYA 3A1PA 1HYOA 1X27A 1GCQC 6AT1B 2I0NA 3QWXX 2QTXA 3SEMA 2DL3A 3C4SA 2K2VA 2MOXA 4AFSC 1K9AA 1OZ2A 4OB2B 5GMKi 3OBYA 5C0MA 1YHQQ 1ZUUA 1ZSZB 4FYVB 2XMFA 2Z0WA 1K9MR 2YT6A 1Q86C 4M7DC 1YN8A 3CXCP 2KY9A 2E6NA 4IIMA 1VQ5A 2CREA 1BI1A 3FRNA 1NG2A 2COWA 3GP8A 4M75D 2DYBA 2H3JA 2LCCA 4OMMA 1NYGA 3G6EA 3QYHB 2GCXA 1MGQA 1YITQ 3JRZA 4AMCA 3LWHA 5GAMe 4RTTA 2PTKA 2BE7D 4JZ3A 2QEXA 4BB7A 2YWWA 4B9XA 3UPUA 1G3TA 2JW4A 4J5YA 1VQ6A 1VQPQ 2L0AA 2J6KA 4XU3A 3OW2P 1LOJA 1VQ8Q 3RUXA 2O2OA 2RQUA 3EHQA 1G3WA 3V8JA 2CH4A 1MNDA 1RAGB 4QW2A 2EQMA 3VS4A 1QCOA 1HXDA 1OU9A 4HVWA 1QVFP 4J6WA 2QA4A 3QDRB 2E65A 5IN1A 2EAYA 1Q95G 5FLXE 1TWBA 2YHTA 4L6V5 3M4GA 1T3LA 1C6VX 2YDLA 4MMKA 5I21A 2AZSA 4OB3B 5CQXA 2CZ7B 2CSQA 3S3NA 1W70A 1N8RR 3E9GA 3EGXA 3I5SA 1ZQ1A 4BY6C 2PVDB 5GANd 2L3QA 4C92C 4M77D 3GPLA 3N5BB 4A4FA 3OYEA 1N5ZA 2X35A 1BIBA 3CCJT 3R6NA 1WXTA 2BTTA 5GAMg 4DOWA 2M1HA 1QQJA 4BE1A 2RQRA 2RJEA 2HKQB 2MYSA 1VQ4A 2O4XA 1AWWA 1NPRA 4N4HA 4F04B 1WHKA 2FRYA 1M90U 3H41A 2XDBA 1PSFA 1V1CA 1ZUYA 5GANh 4J9HA 4M77G 2L5QA 1BCOA 4DEXA 5GANf 3VS1A 4OVAA 4A53A 3SB2A 1Y07A 4NL2A 2RHZA 3CMET 4CC7A 4RTXA 4C92A 1EFNA 3VS7A 1YJ9T 3M9QA 1RAEB 2JZ2A 1K73U 4XTWA 2EJFA 3JSCA 4XTVA 2M0YA 4BUGA 1M27C 1ZA1B 4DBFA 2Y4YA 4EMGA 4DA4A 4ZN3A 1YBYA 2LT1A 3CCRT 1ZSZC 1FMVA 2KAFA 3PVLA 2EFIA 3M0RA 1IB8A 3RBBB 1YP5A 1YJNA 3RERA 2HZYA 2K2MA 4OMLA 3OYLA 5EC7A 4Y28E 1O75A 1CKAA 2K3XA 3CPFA 2FVUA 3I56Q 2EYXA 1I1JA 3QUIA 1UGRB 4KGXB 1GBQA 2YRDA 3KBGA 3JCMb 4EIKA 1VQKA 4NOYA 1M2OA 3MCAB 2RK2A 4M78B 2PVGB 3G71Q 3VV0A 1SG5A 1YIJA 1M1KR 1ZSZA 2YLBA 2HEQA 1QCNA 3EHRA 1C1AA 3ZL7C 4OB1B 2XU8A 3LW5E 1WJRA 3LWIA 1U5SA 4CC4B 2KYBA 2VVKA 2GNCA 4ELYC 2V1RA 3M56A 3UT1A 4QVZA 2JMAA 3RR6A 3OYBA 2DL8A 3X24B 3CCJQ 3PT9A 3LX7A 3JCMV 2XIDA 1NYFA 3VUBA 1NJIC 3TU4K 2KQWA 2ZAEA 1SKUB 5KYYB 1WA7A 2XK0A 2DD5A 2F5KA 2JVVA 4JJCA 3OYDA 1QKWA 4F17A 2QK0A 5GMKe 4QVCA 2RNAA 1AT1B 1W4SA 3PMTA 4F16A 5FU7B 3CMEQ 2CZ1B 4MDWA 2OI3A 4BDZA 3HFNA 1YJ9Q 2HDAA 1KG1A 2E3HA 2YRCA 4FU6A 3MEUA 4N4GA 5LJ3e 3CCRQ 2YRVA 3ULRB 1NM7A 2GGRA 2D0QB 2JUFA 1PD1A 2VWFA 1U1TA 4IUQA 2HSPA 1UJ0A 2X4XA 2K5IA 3WVDB 4FW1A 4F14A 4M7AB 5KCOA 4RTZA 3SFMA 5IXFA 2GTJA 3GBQA 3NTKA 1MV0B 3EG2A 1ZUKA 2E3IA 1FMWA 4XQ3A 4OMQA 1YI2T 1FXXA 5D6XA 2CH4W 1Q86U 4E7IA 3OYMA 4RTVA 2M0OA 1VIEA 4KH0B 4LDXA 3JB9H 4LNPA 1FWZA 1NPPA 4FIBA 3M54A 3I5RA 2FHDA 2V8IA 1VUBA 2DXUA 2HSEB 2FPEA 3FJ5A 3OS1A 1PKSA 4ZTFA 4IURA 4FT4A 1M9SA 3CBPA 4Q5WA 4M75F 1TS9A 3SDZA 2ZPHB 3OYGA 3NGPA 1U1SA 2EBPA 3P8DA 1M1GA 2X51A 2FZKB 4JZ4A 1GL5A 3BFMA 2XKOC 4HVUA 4QQGA 3KFVA 2QQAA 3G4ST 2DXCA 4BE2A 4PFPA 1BYMA 3UDCA 4A63B 2RHIA 4F7UE 3MJXA 1I5LA 1R0CB 2F69A 1EX4A 3VYHB 5LJ3g 1M5Q1 2PQWA 3HRSA 4M7AE 4J9CA 1YITA 4M78C 2Y90A 4P5NA 3CCQT 3CC4T 4OP0A 4ZN1A 3JCMd 2NWMA 1RACB 1C0MA 4AT1B 2DMOA 3M55A 3CCSA 2HL5C 1VQPA 2DX1A 3NTIA 1HJDA 4UC4A 1X2KA 1TTHB 5IXBA 2M02A 1K8AC 2KXDA 2CYZB 3HP9A 4ZGJB 1X43A 1RLPC 2WSEE 5I2MA 1FYNA 8AT1B 2KVQG 5FRMA 4M78A 1OU8A 4Z88A 4OF1A 2WACA 4D6WA 4RKUE 3JCMh 4E7SA 1OPLA 4D8DA 1YI2Q 2JT4A 4TVRA 5D6WA 1OULA 4DBQA 3CMAA 1M90C 4PJOE 1IGQA 5LJ5e 3VS5A 4ZGEB 3C95A 4M7DB 3FDRA 1AVZC 5FU7C 5GMKl 3RESA 1ZBJA 3DKMA 2KXCA 3M53A 3WVEB 2JOYA 2L3SA 4X1VA 4M77F 2CZ0B 4IUPA 3CPWA 1X69A 2QGFB 1PRLC 3JCMc 3P8HA 4V2SA 5KYYA 2KMTA 3FJPA 3FB9A 4MMLA 3TSWA 5IT9E 1VQOA 2QAZA 2MIOA 4KGZB 2CUDA 5GANj 4A4HA 3RDVA 2VXEA 4AFUC 2FO0A 4HCKA 1VYVA 2F2VA 3ZEHA 3REAB 1VIFA 1PM3A 3G4SQ 1X2QA 3EG9B 3CCUT 3F70A 3CCLQ 4PJLA 3DLMA 3VKIA 5CO7A 3H0HA 3NMZC 1T0JA 3URGA 2CUBA 3PIPA 1NLPC 5A2QE 1TH7A 3QKJA 4X34A 3CCMT 3PTAA 4GY5A 4JJDA 2RH2A 2EGCA 1OI1A 3Q1JA 2KGTA 3CCQQ 2ROLA 3CC4Q 2XDPA 2GFAA 2ZPGB 3VRZA 2DVJA 1VQ9A 1SEMA 2QGGA 1HD3A 3EG3A 1BIAA 4PFZA 4C8QB 4M7AA 3OMCA 4ZNXA 2A08A 4M7DE 4DBHA 1Q82R 1TU0B 2KT8A 4D8KA 1QWEA 3L2RA 4RG2A 2DIGA 3CD6A 3EG0A 3VJPA 1RAIB 1K9MC 4BI4A 3OBWA 2P0PA 5GMKj 4XK8E 2NUZA 4A54A 4ANJA 2LCSA 1UDLA 1WFWA 3JB9I 4FW2A 1BB9A 4IUUA 3I56A 1WHGA 1QLYA 1VQLQ 1WLPB 3P8BB 1NJIU 3GIBA 3QZ9B 1XOVA 1M8VA 4DEYA 3HHTB 3G71A 1WGSA 2JS0A 3QXEB 3HKSA 4CRIA 4XU0A 4K11A 5FWCA 1TSFA 3PNWC 3CCVT 4BI3A 2EGAA 1S72T 3CCJA 2RF0A 5I11A 2VASA 2RB6A 3C94A 2LJ1A 4N4IA 1QP2A 3CCUQ 4PJOD 1BCMA 3RMSA 2LT4A 3VS6A 1Q81R 2A37A 5L23A 1K0XA 2ED1A 3JV3A 2K5FA 1RADB 2CT4A 2DZCA 2KNBB 3CCMQ 2X9HA 4C5GA 3RKYA 1X01A 4LDVA 5CVIA 5GAOn 1SHFA 1B3QA 1Y96B 4PJOG 1PD0A 4E2FB 3KXTA 4C92E 1N8RC 3ER0A 5CKBA 1KIKA 1GCQA 2K4YA 1VQ7T 5CK9A 4ZGDB 1IO6A 1UTIA 5KYUB 1OPKA 3X26B 1NBEB 2CP3A 2DA9A 4PFOA 2RJDA 4E7HA 2DF6A 3RIRA 4C0ZA 5GAOl 4HA8A 3JB9D 3THKA 4M7DA 4M75G 9ATCB 4LD9K 1GXIE 1VQMT 2BE9B 4FYWB 1WQ7A 4FCYA 3CEYA 2ROTA 2YUOA 2A28A 2RN8A 1HK9A 1QWFA 4LD6A 5GAOq 3GF5A 3EFOB 3JB9G 1SRMA 1GFDA 1JQQA 2CZ6B 4J9BA 2HQHA 2CP7A 4R56A 4C8QC 3A5ZB 3NFCA 3CCVQ 1VOMA 4JLIA 4FT2A 3EG9A 1S72Q 3I55A 2EQJA 4QT7A 1UUEA 3C0CA 3QG1A 1UB4A 3CC2A 2RJFA 2GF7A 2OTLT 1WI7A 2EKOA 4FSSA 2LQKA 1PHTA 3OA6A 2FB7A 2ZGWA 3EFSA 2K7AA 5IH2A 1KQ2A 2R5AA 2YSQA 3RKXA 1K8AU 2IIMA 4C8QA 1IZ6A 3JB9J 2QDYB 2B86A 3PVQA 2P0KA 4J9FA 1SSHA 2VUBA 2P84A 2FG0A 3HRUA 1M1KC 2RPNA 1BU1A 3NTHA 4WCIA 1VQ7Q 2X3WD 2MCNA 3M4YA 4CI0C 4OB0B 2RQTA 5GAN5 1ZBXA 1MUZA 3QBYA 1LJOA 1SSFA 3INZA 3MP8A 5GJVB 2O88A 1V29B 5GJWB 4LUDA 2GQIA 3HRTA 3L2ZA 3X25B 4E7LA 5EG2A 3L1AA 3OYAA 3PIOA 1W2BS 1KC8R 3HSBA 1VQMQ 3CPWS 1KD1U 4J6YA 4ELZC 1RAAB 1K4US 3QDFA 4C0GA 1AEYA 3VYGA 4QQ6A 1Q7YU 4AFZC 1WHJA 2PVOB 4Y92A 4QKUA 1QCFA 5DY9A 1VQ5T 2NUPB 3M0UA 2OTJT 4C92D 1OV3A 3UA6A 3M58A 3VS3A 2BUDA 4KRTA 1BBZA 3G6ET 1FX7A 1YJWA 2DLPA 1UGSB 2DXTA 1ACMB 5LJ3d 2DRMA 1UG1A 3E9FA 2QEXT 2DTHA 4KT0E 5GMKh 4HCCA 4Z8AA 2L8DA 4J9DA 4C92G 3BE3A 2ENMA 2O01E 2OTLQ 2DXBA 2DNUA 2E5KA 4E7ZA 1UJYA 4RUGA 1M30A 3E2UA 3TVTA 3CCLA 4HCBA 2RI3A 1Y96A 2VKNA 4RTWA 1K9MU 3CPWP 2C0IA 5LJ3h 1HSQA 5IAYA 1SPKA 1MV3A 2J05A 4FYYB 1I4K1 2HD0A 5KYUA 2KI7A 3OSSC 1Y71A 1NLOC 4FL6A 4Z89A 2VB6A 1W6XA 2G6FX 4XTYA 3CXCA 1ZLMA 2ZZDA 5AT1B 5D6YA 2QASA 3TQ7P 1WIEA 4Y91A 1JB0E 5HCKA 5I2SA 5KH6A 4JRPA 1GCPA 2C06A 1I81A 2YLCA 2L2PA 1JXMA 2C0TA 4LN2A 5LL6S 3M59A 4HT8A 4A4GA 4NS5A 1WNLA 2DERA 2LC4A 1K0SA 2FEIA 4C0DB 1UECA 3MO8A 5HY6A 3EFOA 2DFUA 5GAN2 1KFZA 5IHIA 1QKXA 4M78E 2DYIA 1VQLA 4O6JA 1VQ5Q 5GAOr 3AHUA 3BDLA 1GFCA 2OTJQ 1PWTA 2DILA 4JPBW 2EYZA 1VQ4T 1XQHA 2ATCB 2VGMA 3G6EQ 5GANg 1D0YA 5GAMj 1PNJA 2JTFA 2K5LA 2LCLA 4E47A 2E1HA 1QVFA 1D1BA 1DJ7B 3LH0A 1X6GA 2QEXQ 4AG2C 1BI3A 4PJOF 5KYXB 3VUZA 3PFSA 2RHXA 3EH1A 2O9SA 2P0QA 1M3BA 1U8RA 1M4ZA 2CSIA 4MZTA 1N8RU 3UF4A 3CCUA 1KK7A 1BKBA 2LVMA 3QWYA 1ARKA 1YJNT 3GLXA 1YHQA 2HBPA 5CKFA 1PSEA 3CCET 4KH1B 2JMCA 5LJ5d 2J7IA 2EPDA 3HFOA 2EGEA 1MHNA 2DPPB 3QO3A 1NEBA 3L2QA 2ESWA 2B8AA 2DK3A 1VQKT 1QVPA 2VGNA 1M8MA 2X4WA 3JB9F 2QQRA 3O5ZA 4J7IA 4A4EA 1YIJT 2ZPEB 5LJ5h 4EMHA 1MMDA 3EGUA 1OQKA 2HCKA 1D09B 1H641 4OMOA 1UHCA 2GFUA 2W0ZA 2NUPA 2LP5A 3DLLA 1UGVA 1X6OA 1UEBA 1E7OA 1OOTA 3A98A 2EJ9A 2FZGB 4IKFA 3L42A 4M75B 3BY7A 1ZA2B 4AG1C 2FPDA 1M1FA 1VQ8A 1U3OA 4LXCA 2O9VA 2JJ9A 3EG1A 5GAOm 5HK3A 1VQ4Q 1YWOA 3TREA 1N9RA 1XTDA 2JXBA 3E1SA 4RCBA 3JCMf 2RQWA 2E64A 1GRIA 1TUGB 3QSUA 3IQLA 1D1CA 3J7AF 3SWNB 4J6XA 3CCVA 2COZA 1SRLA 1Q82C 1FMKA 1N27A 3FLGA 2QYZA 2RO0A 2OX7A 1M1KU 2RM4A 3X20B 1LVKA 1Y0MA 5GAN7 2QQ9A 1W2BA 4PKCC 4M78D 1AWJA 2KR3A 4C0DC 2Y4XA 3VRYA 1KD1C 3DB4A 3SD4A 3CC7T 1YJNQ 2LRQA 2EYQA 2M51A 2GQVA 3CCEQ 3A8MB 4R0KA 1Q7YC 2CKKA 2AKKA 2DO3A 1B07A 1D0ZA 2ED0A 1IREB 2C0OA 4J9EA 1WQWA 3TCJA 2DE0X 4M78G 5AYFA 1YCYA 3REBB 1VQKQ 1TUCA 2E70A 4DQ2A 2LQNA 4IUVA 4WTOB 3A8GB 1YIJQ 5KYWB 2H8HA 2XDDA 2RJCA 2FPFA 2LQ8A 4M77B 2DL5A 2DD4A 1XNIA 5J3BA 1G8XA 1VQMA 2BIVA 4PJMA 2AZVA 2YXYA 3JCMW 1VYTA 1E6GA 4CC3A 1Q81C 2ZCFB 1JU5C 2DBMA 4C92F 3S3OA 5FROA 1SF9A 3VS0A 1JRIA 4II1A 1QMCA 1EZZB 1LPLA 2F2XA 4OGCA 1OYXA 5CQYA 1KQSA 5FU6C 2K9GA 2EYWA 4B9WA 5KYXA 1MMAA 4EMKB 3V7CA 2D1XA 3AT1B 4B6MA 3PGGA 2AT1B 4JUVA 4M7AD 1RAFB 2H3EB 3HPWA 3H6ZA 5CCAA 2D8HA 3OYHA 1JBMA 1QVGA 1YITT 2A7YA 4LDUA 2JS2A 2HQXA 4QQDA 3T9NA 5GAMd 2CDTA 1K73R 1AZGB 3OS5A 5LJ3j 1A0NB 4F7UG 3CXCS 1YCSB 3H0FA 3CCST 3FEOA 2PZ1A 4JJBA 3CC7Q 3OB9A 1T0HA 4M7AG 5GAN6 3E19A 5J39A 1SHGA 7AT1B 5D7UA 4M75C 2E4HA 2QI2A 2GTOA 2A36A 3H0IA 3DB3A 2K3BA 3GNFB 2LZ6B 1T3SA 3JCMg 5GAMh 1PKTA 3ZFJA 4C8QE 5GAMf 4JDSA 4J8OA 2XHCA 4L59A 1YFNA 4M4ZA 3OYYA 4ESRA 4BE0A 3CMAT 1GBRA 4FM4B 3SWNC 2QDLA 1X6BA 1XJWB 3OW2S 3CMEA 1Y7XA 2P4TA 1UGQB 4OGEA 4M75A 1YJ9A 1IGUA 1JEGA 2DETA 2VXFA 3QHSA 2OJ2A 2HKNA 5FW9A 3MP1A 2JM9A 5J26A 2RI5A 4PNOA 4PLLA 8ATCB 4XU1A 1QP3A 1VQOT 1QVFS 2VC8A 2QQSA 2OAUA 3ASKA 2LJ3A 3L2VA 3CCRA 1R8OB 1I8FA 2M9UA 4J9IA 3QIIA 2OTJA 3SWNA 2KRSA 2MK5A 3JCMP 2MF2A 5A0DA 1CKBA 1WXUA 2R57A 1EIFA 2E10A 5CAIA 1F1BB 4E7KA 1PCXA 3M0QA 2YUNA 4QVDA 1AHJB 1VQ9T 2QG9B 4XU2A 4M77C 1VYUA 2DJQA 1P92A 4M7DD 3KUFA 3MEWA 3CCSQ 4GLMA 2BKDN 5KE3A 3OYJA 3LYIA 2VYTA 1KC8C 4C5IA 2NUTB 4RTYA 3CD6T 3V8LA 5KE2A 4RMOA 1YNZA 3OYFA 4PJNA 3SHWA 2MI6A 1VQNT 2IVWA 2KT1A 4BI8B 2DZ9A 4M7DG 5KYWA 4PL6A 3I56T 5LJ5j 1G3SA 4X9DA 4EMKC 3CMAQ 1ZHIA 3H8ZA 2LMJA 1LCKA 1NE8A 3RMQA 1WHMA 1Q86R 4M77A 4VUBA 2HMAA 2L89A 4MZPA 1AWXA 4LDWA 2F5TX 3OY9A 2LNVA 2HQEA 5A0GA 1R0BG 3G71T 1RAHB 2KE9A 3HTRA 2HNIA 2K6DA 2SRCA 2LJ0A 4E6RA 1RI0A 5DLOA 3GOXA 1I07A 3ME9A 2XICA 1I0CA 1W1FA 4JLGA 3WXMB 1VQOQ 2VV5A 2CP0A 1AD5A 4XTZA 4KULA 1Q82U 4EMKA 4JS5A 1N6AA 1H92A 1X75C 1G3YA 4C8QD 1BI0A 4LDYA 1H3HA 1IRXA 2ZPFB 2MPXC 5GAN4 3OYCA 1PG5B 4ME7A 3J81E 1KQ1A 1OZ3A 1YI2A 3OMGA 2BZ8A 2EQUA 3M0PA 4L5GA 1KJWA 2KK4A 4C8QG 1VA7A 4M78F 2PU9B 2DBKA 1VQ9Q 5C6SA 4JRIA 2GBQA 3QPHA 2FRWA 1JJ2A 2D6FA 3OS0A 2X4JA 1IXDA 3NPFA 1TXQA 1YWPA 2A0FB 2EIFA 3CD6Q 2EQKA 5DLQE 1WHLA 3G7ZA 5GMKm 1J3TA 3MP6A 3CBOA 3CCEA 4J7FA 5IHNA 3JCMX 3OSVA 4XAXB 5GAOp 1VQNQ 4KUIA 2LTOA 3OQ5A 5GANe 5KYNA 2O31A 4RCCA 1VQ6T 1K1ZA 2DRKA 2L3RA 1G2BA 1Q81U 3I9QA 3G4SA 1B34B 4JRKA 4LE9A 1RL2A 2DTIA 4OMNA 1OX8A 2X3XD 1W2BP 2DEUA 1UHFA 3META 2KYMA 3UA7A 3L2UA 2RHUA 5LJ3f 2XD0A 3EH2A 3V7SA 1KQSS 1TUDA 2FYKA 3CCQA 2QA4T 3CC4A 1D3BB 4MZMA 3L2WA 2D9TA 1RI9A 3RNJA 4BDYA 5GAN8 3I55T 4HCZA 1ABQA 1QVGS 3VU3C 4F7UF 3CC2T 1MMGA 5CKEA 2RD1A 1ABOA 2DL4A 4J83A 5HKCA 4M7AF 2DAQA 4C5EA 1ZSGA 4KGVB 4BACA 1G83A 2KRMA 4A4KA 4AFQC 3TEEA 2RA2A 2XI9A 5DM7R 2IPOB 1UFFA 1Z9ZA 4N0AC 3S3MA 3FIFA 2EJGA 3LH5A 2DEQA 1AWOA 2NUTA 3OW2A 1NZ9A 4RTUA 4BD3A 2D8JA 3OS2A 3QYGB 2QQBA 2K57A 3UATA 2K79A 2ZPIB 3LGFA 1PRMC 2DIQA 3O8VA 4E7JA 3V7RA 2JNGA 3VS2A 4MDXA 3OYIA 3MEAA 1BK2A 2PUOB 5L8RE 1R77A 3CC7A 1MNEA 1KQSP 4WF2A 1RLQC 3EGDB 4F7UB 3M57A 3U23A 3JAME 2XG8D 3M5AA 2E6ZA 2LQWA 2MWPA 4N0AA 2PNIA 1KHIA 2OAWA 2CP2A 1VQ6Q 1QVGP 2ABLA 1RABB 3EFRA 4XTXA 3PE0A 3OYNA 1NJIR 2KEAA 1M2VB 1MMNA 2IG0A 3CBMA 2MMPA 1S1NA 3CCMA 4NL3A 5A0LA 1AOJA 4IIOA 2CP5A 3A8LB 3LGLA 2QA4Q 5FU6B 5CR2A 4PJJA 2NYSA 2JN0A 2F1LA 2QTVA 2CS7A 3G1JA 2RMOA 3JCMJ 1YJWT 2J6FA 3MKDA 1LNXA 3I55Q 3QZ5B 1OX9A 4J9GA 1WHHA 4PJOB 3X28B 2YUQA 3CC2Q 4JS4A 1WJQA 2NLUA 2DKGA 1K76A 3MPUB 2R5MA 4X9CA 3H9NA 1PC0A 2CP6A 2RQVA 5LJ5f 2YUPA 3R6OA 4IUTA 2RK1A 1KC8U 3CCLT 2V8KA 2COYA 5IHKA 4FYXB 1U06A 4OMFB 5FRNA 3V8KA 3C12A 2V8JA 1WPYA 2KROA 3PMIA 4M7DF 2E41A 2HBWA 3EAEA 3D7SB 4XTUA 3BW1A 4ORZA 1WYXA 2G3RA 2MWOA
chains in the Genus database with same CATH topology
2CP2A 2E3HA 2HKQB 2MPXC 2HKNA 2E3IA 2HQHA 1WHKA 2CP7A 3TQ7P 4B6MA 1IXDA 1TOVA 1TXQA 1WHGA 1WHMA 3E2UA 2QK0A 2COYA 2HL5C 2HL3A 2CP0A 1WHJA 1WHLA 2Z0WA 1WHHA 2E4HA 2COZA 2CP3A 2M02A 1LPLA 3RDVA 2CP5A 2CP6A 2COWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP2 A;  2E3H A;  2HKQ B;  2MPX C;  2HKN A;  2E3I A;  2HQH A;  1WHK A;  2CP7 A;  3TQ7 P;  4B6M A;  1IXD A;  1TOV A;  1TXQ A;  1WHG A;  1WHM A;  3E2U A;  2QK0 A;  2COY A;  2HL5 C;  2HL3 A;  2CP0 A;  1WHJ A;  1WHL A;  2Z0W A;  1WHH A;  2E4H A;  2COZ A;  2CP3 A;  2M02 A;  1LPL A;  3RDV A;  2CP5 A;  2CP6 A;  2COW A; 
#chains in the Genus database with same CATH topology
 2D0N A;  1WJS A;  2W10 A;  2E5Q A;  2P4R A;  1TG0 A;  3NHN A;  3ZBD A;  2F2W A;  4JRQ A;  2A3L A;  1UE9 A;  2CT3 A;  2DJZ A;  1N9S A;  2LX9 A;  3CQT A;  1BI2 A;  1Y57 A;  2LNH B;  1O9S A;  1S72 A;  1B34 A;  2AHJ B;  2L3P A;  4HXJ A;  4KBM B;  2JTE A;  1IHW A;  4ZTJ A;  2ZPB B;  2DL7 A;  2PUK B;  1JXO A;  4R55 A;  3M0T A;  2AKL A;  2AIR B;  1VQL T;  1RUW A;  1D3B A;  5KCH A;  3S6W A;  4HKE A;  2KBT A;  1IHV A;  4FSX A;  3UWN A;  2KSS A;  5CKH A;  2RI2 A;  2J6O A;  2R58 A;  1WX6 A;  3M0S A;  1D1A A;  3HL8 A;  4EPC A;  1K73 C;  4ATO A;  3J80 E;  1YJW Q;  1H8K A;  4HVV A;  2KRN A;  5CIU A;  4C8Q F;  4YTL A;  5FWB A;  4M75 E;  1OEB A;  1VQ7 A;  1KSW A;  1KHC A;  1WXB A;  2JM8 A;  3MHX A;  5I22 A;  2AK5 A;  3FC3 A;  4JJN K;  2EQI A;  4M7A C;  3JCM e;  2WSF E;  2ECZ A;  3RKW A;  2EYY A;  4PLI A;  1E6H A;  1JJ2 S;  1M3C A;  2J06 A;  2V26 A;  3I35 A;  4CC2 A;  2M16 A;  1TOV A;  1CSK A;  2HL3 A;  1I5O B;  2JTM A;  3BDU A;  1YHQ T;  1K8A R;  4OMP A;  1D0X A;  5ECA A;  3EGX B;  4PK4 A;  4GBQ A;  3TSZ A;  1Z9Q A;  1QW1 A;  2EWN A;  2CGH A;  2QXF A;  3EGD A;  4F7U A;  5HK0 A;  4HT9 A;  4DBR A;  2RHY A;  1M90 R;  4RG8 A;  2HAX A;  3JCM Q;  4EDU A;  1V76 A;  2LX7 A;  2EVR A;  2DM1 A;  2E12 A;  1ZX6 A;  4DOV A;  5LJ5 g;  4PJO C;  2V1Q A;  1G5V A;  2EKH A;  2O4X B;  2FZC B;  2K3Y A;  5GAN 3;  3A8H B;  1M2V A;  2SEM A;  4Z02 A;  1KD1 R;  2DTO A;  1VQN A;  2OTL A;  4BY6 B;  2EW3 A;  2DVE A;  1M3A A;  1VQP T;  1Q7Y R;  4C92 B;  3LLR A;  1VQ8 T;  3OYK A;  2FL7 A;  1JJ2 P;  2WSC E;  1WDX A;  1JO8 A;  4O5V A;  1AZE A;  4C0F A;  4KUD K;  5CKD A;  2I2L A;  4M77 E;  1WZO A;  1B7T A;  2X4Y A;  3QJ6 A;  1UGP B;  4PJO A;  2BZY A;  1NEG A;  2LDM A;  3GNG A;  2BZX A;  3MEV A;  4LUE A;  4GLK A;  2MAM A;  5M9O A;  3A8O B;  4C5H A;  1H3Z A;  2KDS A;  3QJY A;  3A1P A;  1HYO A;  1X27 A;  1GCQ C;  6AT1 B;  2I0N A;  3QWX X;  2QTX A;  3SEM A;  2DL3 A;  3C4S A;  2K2V A;  2MOX A;  4AFS C;  1K9A A;  1OZ2 A;  4OB2 B;  5GMK i;  3OBY A;  5C0M A;  1YHQ Q;  1ZUU A;  1ZSZ B;  4FYV B;  2XMF A;  2Z0W A;  1K9M R;  2YT6 A;  1Q86 C;  4M7D C;  1YN8 A;  3CXC P;  2KY9 A;  2E6N A;  4IIM A;  1VQ5 A;  2CRE A;  1BI1 A;  3FRN A;  1NG2 A;  2COW A;  3GP8 A;  4M75 D;  2DYB A;  2H3J A;  2LCC A;  4OMM A;  1NYG A;  3G6E A;  3QYH B;  2GCX A;  1MGQ A;  1YIT Q;  3JRZ A;  4AMC A;  3LWH A;  5GAM e;  4RTT A;  2PTK A;  2BE7 D;  4JZ3 A;  2QEX A;  4BB7 A;  2YWW A;  4B9X A;  3UPU A;  1G3T A;  2JW4 A;  4J5Y A;  1VQ6 A;  1VQP Q;  2L0A A;  2J6K A;  4XU3 A;  3OW2 P;  1LOJ A;  1VQ8 Q;  3RUX A;  2O2O A;  2RQU A;  3EHQ A;  1G3W A;  3V8J A;  2CH4 A;  1MND A;  1RAG B;  4QW2 A;  2EQM A;  3VS4 A;  1QCO A;  1HXD A;  1OU9 A;  4HVW A;  1QVF P;  4J6W A;  2QA4 A;  3QDR B;  2E65 A;  5IN1 A;  2EAY A;  1Q95 G;  5FLX E;  1TWB A;  2YHT A;  4L6V 5;  3M4G A;  1T3L A;  1C6V X;  2YDL A;  4MMK A;  5I21 A;  2AZS A;  4OB3 B;  5CQX A;  2CZ7 B;  2CSQ A;  3S3N A;  1W70 A;  1N8R R;  3E9G A;  3EGX A;  3I5S A;  1ZQ1 A;  4BY6 C;  2PVD B;  5GAN d;  2L3Q A;  4C92 C;  4M77 D;  3GPL A;  3N5B B;  4A4F A;  3OYE A;  1N5Z A;  2X35 A;  1BIB A;  3CCJ T;  3R6N A;  1WXT A;  2BTT A;  5GAM g;  4DOW A;  2M1H A;  1QQJ A;  4BE1 A;  2RQR A;  2RJE A;  2HKQ B;  2MYS A;  1VQ4 A;  2O4X A;  1AWW A;  1NPR A;  4N4H A;  4F04 B;  1WHK A;  2FRY A;  1M90 U;  3H41 A;  2XDB A;  1PSF A;  1V1C A;  1ZUY A;  5GAN h;  4J9H A;  4M77 G;  2L5Q A;  1BCO A;  4DEX A;  5GAN f;  3VS1 A;  4OVA A;  4A53 A;  3SB2 A;  1Y07 A;  4NL2 A;  2RHZ A;  3CME T;  4CC7 A;  4RTX A;  4C92 A;  1EFN A;  3VS7 A;  1YJ9 T;  3M9Q A;  1RAE B;  2JZ2 A;  1K73 U;  4XTW A;  2EJF A;  3JSC A;  4XTV A;  2M0Y A;  4BUG A;  1M27 C;  1ZA1 B;  4DBF A;  2Y4Y A;  4EMG A;  4DA4 A;  4ZN3 A;  1YBY A;  2LT1 A;  3CCR T;  1ZSZ C;  1FMV A;  2KAF A;  3PVL A;  2EFI A;  3M0R A;  1IB8 A;  3RBB B;  1YP5 A;  1YJN A;  3RER A;  2HZY A;  2K2M A;  4OML A;  3OYL A;  5EC7 A;  4Y28 E;  1O75 A;  1CKA A;  2K3X A;  3CPF A;  2FVU A;  3I56 Q;  2EYX A;  1I1J A;  3QUI A;  1UGR B;  4KGX B;  1GBQ A;  2YRD A;  3KBG A;  3JCM b;  4EIK A;  1VQK A;  4NOY A;  1M2O A;  3MCA B;  2RK2 A;  4M78 B;  2PVG B;  3G71 Q;  3VV0 A;  1SG5 A;  1YIJ A;  1M1K R;  1ZSZ A;  2YLB A;  2HEQ A;  1QCN A;  3EHR A;  1C1A A;  3ZL7 C;  4OB1 B;  2XU8 A;  3LW5 E;  1WJR A;  3LWI A;  1U5S A;  4CC4 B;  2KYB A;  2VVK A;  2GNC A;  4ELY C;  2V1R A;  3M56 A;  3UT1 A;  4QVZ A;  2JMA A;  3RR6 A;  3OYB A;  2DL8 A;  3X24 B;  3CCJ Q;  3PT9 A;  3LX7 A;  3JCM V;  2XID A;  1NYF A;  3VUB A;  1NJI C;  3TU4 K;  2KQW A;  2ZAE A;  1SKU B;  5KYY B;  1WA7 A;  2XK0 A;  2DD5 A;  2F5K A;  2JVV A;  4JJC A;  3OYD A;  1QKW A;  4F17 A;  2QK0 A;  5GMK e;  4QVC A;  2RNA A;  1AT1 B;  1W4S A;  3PMT A;  4F16 A;  5FU7 B;  3CME Q;  2CZ1 B;  4MDW A;  2OI3 A;  4BDZ A;  3HFN A;  1YJ9 Q;  2HDA A;  1KG1 A;  2E3H A;  2YRC A;  4FU6 A;  3MEU A;  4N4G A;  5LJ3 e;  3CCR Q;  2YRV A;  3ULR B;  1NM7 A;  2GGR A;  2D0Q B;  2JUF A;  1PD1 A;  2VWF A;  1U1T A;  4IUQ A;  2HSP A;  1UJ0 A;  2X4X A;  2K5I A;  3WVD B;  4FW1 A;  4F14 A;  4M7A B;  5KCO A;  4RTZ A;  3SFM A;  5IXF A;  2GTJ A;  3GBQ A;  3NTK A;  1MV0 B;  3EG2 A;  1ZUK A;  2E3I A;  1FMW A;  4XQ3 A;  4OMQ A;  1YI2 T;  1FXX A;  5D6X A;  2CH4 W;  1Q86 U;  4E7I A;  3OYM A;  4RTV A;  2M0O A;  1VIE A;  4KH0 B;  4LDX A;  3JB9 H;  4LNP A;  1FWZ A;  1NPP A;  4FIB A;  3M54 A;  3I5R A;  2FHD A;  2V8I A;  1VUB A;  2DXU A;  2HSE B;  2FPE A;  3FJ5 A;  3OS1 A;  1PKS A;  4ZTF A;  4IUR A;  4FT4 A;  1M9S A;  3CBP A;  4Q5W A;  4M75 F;  1TS9 A;  3SDZ A;  2ZPH B;  3OYG A;  3NGP A;  1U1S A;  2EBP A;  3P8D A;  1M1G A;  2X51 A;  2FZK B;  4JZ4 A;  1GL5 A;  3BFM A;  2XKO C;  4HVU A;  4QQG A;  3KFV A;  2QQA A;  3G4S T;  2DXC A;  4BE2 A;  4PFP A;  1BYM A;  3UDC A;  4A63 B;  2RHI A;  4F7U E;  3MJX A;  1I5L A;  1R0C B;  2F69 A;  1EX4 A;  3VYH B;  5LJ3 g;  1M5Q 1;  2PQW A;  3HRS A;  4M7A E;  4J9C A;  1YIT A;  4M78 C;  2Y90 A;  4P5N A;  3CCQ T;  3CC4 T;  4OP0 A;  4ZN1 A;  3JCM d;  2NWM A;  1RAC B;  1C0M A;  4AT1 B;  2DMO A;  3M55 A;  3CCS A;  2HL5 C;  1VQP A;  2DX1 A;  3NTI A;  1HJD A;  4UC4 A;  1X2K A;  1TTH B;  5IXB A;  2M02 A;  1K8A C;  2KXD A;  2CYZ B;  3HP9 A;  4ZGJ B;  1X43 A;  1RLP C;  2WSE E;  5I2M A;  1FYN A;  8AT1 B;  2KVQ G;  5FRM A;  4M78 A;  1OU8 A;  4Z88 A;  4OF1 A;  2WAC A;  4D6W A;  4RKU E;  3JCM h;  4E7S A;  1OPL A;  4D8D A;  1YI2 Q;  2JT4 A;  4TVR A;  5D6W A;  1OUL A;  4DBQ A;  3CMA A;  1M90 C;  4PJO E;  1IGQ A;  5LJ5 e;  3VS5 A;  4ZGE B;  3C95 A;  4M7D B;  3FDR A;  1AVZ C;  5FU7 C;  5GMK l;  3RES A;  1ZBJ A;  3DKM A;  2KXC A;  3M53 A;  3WVE B;  2JOY A;  2L3S A;  4X1V A;  4M77 F;  2CZ0 B;  4IUP A;  3CPW A;  1X69 A;  2QGF B;  1PRL C;  3JCM c;  3P8H A;  4V2S A;  5KYY A;  2KMT A;  3FJP A;  3FB9 A;  4MML A;  3TSW A;  5IT9 E;  1VQO A;  2QAZ A;  2MIO A;  4KGZ B;  2CUD A;  5GAN j;  4A4H A;  3RDV A;  2VXE A;  4AFU C;  2FO0 A;  4HCK A;  1VYV A;  2F2V A;  3ZEH A;  3REA B;  1VIF A;  1PM3 A;  3G4S Q;  1X2Q A;  3EG9 B;  3CCU T;  3F70 A;  3CCL Q;  4PJL A;  3DLM A;  3VKI A;  5CO7 A;  3H0H A;  3NMZ C;  1T0J A;  3URG A;  2CUB A;  3PIP A;  1NLP C;  5A2Q E;  1TH7 A;  3QKJ A;  4X34 A;  3CCM T;  3PTA A;  4GY5 A;  4JJD A;  2RH2 A;  2EGC A;  1OI1 A;  3Q1J A;  2KGT A;  3CCQ Q;  2ROL A;  3CC4 Q;  2XDP A;  2GFA A;  2ZPG B;  3VRZ A;  2DVJ A;  1VQ9 A;  1SEM A;  2QGG A;  1HD3 A;  3EG3 A;  1BIA A;  4PFZ A;  4C8Q B;  4M7A A;  3OMC A;  4ZNX A;  2A08 A;  4M7D E;  4DBH A;  1Q82 R;  1TU0 B;  2KT8 A;  4D8K A;  1QWE A;  3L2R A;  4RG2 A;  2DIG A;  3CD6 A;  3EG0 A;  3VJP A;  1RAI B;  1K9M C;  4BI4 A;  3OBW A;  2P0P A;  5GMK j;  4XK8 E;  2NUZ A;  4A54 A;  4ANJ A;  2LCS A;  1UDL A;  1WFW A;  3JB9 I;  4FW2 A;  1BB9 A;  4IUU A;  3I56 A;  1WHG A;  1QLY A;  1VQL Q;  1WLP B;  3P8B B;  1NJI U;  3GIB A;  3QZ9 B;  1XOV A;  1M8V A;  4DEY A;  3HHT B;  3G71 A;  1WGS A;  2JS0 A;  3QXE B;  3HKS A;  4CRI A;  4XU0 A;  4K11 A;  5FWC A;  1TSF A;  3PNW C;  3CCV T;  4BI3 A;  2EGA A;  1S72 T;  3CCJ A;  2RF0 A;  5I11 A;  2VAS A;  2RB6 A;  3C94 A;  2LJ1 A;  4N4I A;  1QP2 A;  3CCU Q;  4PJO D;  1BCM A;  3RMS A;  2LT4 A;  3VS6 A;  1Q81 R;  2A37 A;  5L23 A;  1K0X A;  2ED1 A;  3JV3 A;  2K5F A;  1RAD B;  2CT4 A;  2DZC A;  2KNB B;  3CCM Q;  2X9H A;  4C5G A;  3RKY A;  1X01 A;  4LDV A;  5CVI A;  5GAO n;  1SHF A;  1B3Q A;  1Y96 B;  4PJO G;  1PD0 A;  4E2F B;  3KXT A;  4C92 E;  1N8R C;  3ER0 A;  5CKB A;  1KIK A;  1GCQ A;  2K4Y A;  1VQ7 T;  5CK9 A;  4ZGD B;  1IO6 A;  1UTI A;  5KYU B;  1OPK A;  3X26 B;  1NBE B;  2CP3 A;  2DA9 A;  4PFO A;  2RJD A;  4E7H A;  2DF6 A;  3RIR A;  4C0Z A;  5GAO l;  4HA8 A;  3JB9 D;  3THK A;  4M7D A;  4M75 G;  9ATC B;  4LD9 K;  1GXI E;  1VQM T;  2BE9 B;  4FYW B;  1WQ7 A;  4FCY A;  3CEY A;  2ROT A;  2YUO A;  2A28 A;  2RN8 A;  1HK9 A;  1QWF A;  4LD6 A;  5GAO q;  3GF5 A;  3EFO B;  3JB9 G;  1SRM A;  1GFD A;  1JQQ A;  2CZ6 B;  4J9B A;  2HQH A;  2CP7 A;  4R56 A;  4C8Q C;  3A5Z B;  3NFC A;  3CCV Q;  1VOM A;  4JLI A;  4FT2 A;  3EG9 A;  1S72 Q;  3I55 A;  2EQJ A;  4QT7 A;  1UUE A;  3C0C A;  3QG1 A;  1UB4 A;  3CC2 A;  2RJF A;  2GF7 A;  2OTL T;  1WI7 A;  2EKO A;  4FSS A;  2LQK A;  1PHT A;  3OA6 A;  2FB7 A;  2ZGW A;  3EFS A;  2K7A A;  5IH2 A;  1KQ2 A;  2R5A A;  2YSQ A;  3RKX A;  1K8A U;  2IIM A;  4C8Q A;  1IZ6 A;  3JB9 J;  2QDY B;  2B86 A;  3PVQ A;  2P0K A;  4J9F A;  1SSH A;  2VUB A;  2P84 A;  2FG0 A;  3HRU A;  1M1K C;  2RPN A;  1BU1 A;  3NTH A;  4WCI A;  1VQ7 Q;  2X3W D;  2MCN A;  3M4Y A;  4CI0 C;  4OB0 B;  2RQT A;  5GAN 5;  1ZBX A;  1MUZ A;  3QBY A;  1LJO A;  1SSF A;  3INZ A;  3MP8 A;  5GJV B;  2O88 A;  1V29 B;  5GJW B;  4LUD A;  2GQI A;  3HRT A;  3L2Z A;  3X25 B;  4E7L A;  5EG2 A;  3L1A A;  3OYA A;  3PIO A;  1W2B S;  1KC8 R;  3HSB A;  1VQM Q;  3CPW S;  1KD1 U;  4J6Y A;  4ELZ C;  1RAA B;  1K4U S;  3QDF A;  4C0G A;  1AEY A;  3VYG A;  4QQ6 A;  1Q7Y U;  4AFZ C;  1WHJ A;  2PVO B;  4Y92 A;  4QKU A;  1QCF A;  5DY9 A;  1VQ5 T;  2NUP B;  3M0U A;  2OTJ T;  4C92 D;  1OV3 A;  3UA6 A;  3M58 A;  3VS3 A;  2BUD A;  4KRT A;  1BBZ A;  3G6E T;  1FX7 A;  1YJW A;  2DLP A;  1UGS B;  2DXT A;  1ACM B;  5LJ3 d;  2DRM A;  1UG1 A;  3E9F A;  2QEX T;  2DTH A;  4KT0 E;  5GMK h;  4HCC A;  4Z8A A;  2L8D A;  4J9D A;  4C92 G;  3BE3 A;  2ENM A;  2O01 E;  2OTL Q;  2DXB A;  2DNU A;  2E5K A;  4E7Z A;  1UJY A;  4RUG A;  1M30 A;  3E2U A;  3TVT A;  3CCL A;  4HCB A;  2RI3 A;  1Y96 A;  2VKN A;  4RTW A;  1K9M U;  3CPW P;  2C0I A;  5LJ3 h;  1HSQ A;  5IAY A;  1SPK A;  1MV3 A;  2J05 A;  4FYY B;  1I4K 1;  2HD0 A;  5KYU A;  2KI7 A;  3OSS C;  1Y71 A;  1NLO C;  4FL6 A;  4Z89 A;  2VB6 A;  1W6X A;  2G6F X;  4XTY A;  3CXC A;  1ZLM A;  2ZZD A;  5AT1 B;  5D6Y A;  2QAS A;  3TQ7 P;  1WIE A;  4Y91 A;  1JB0 E;  5HCK A;  5I2S A;  5KH6 A;  4JRP A;  1GCP A;  2C06 A;  1I81 A;  2YLC A;  2L2P A;  1JXM A;  2C0T A;  4LN2 A;  5LL6 S;  3M59 A;  4HT8 A;  4A4G A;  4NS5 A;  1WNL A;  2DER A;  2LC4 A;  1K0S A;  2FEI A;  4C0D B;  1UEC A;  3MO8 A;  5HY6 A;  3EFO A;  2DFU A;  5GAN 2;  1KFZ A;  5IHI A;  1QKX A;  4M78 E;  2DYI A;  1VQL A;  4O6J A;  1VQ5 Q;  5GAO r;  3AHU A;  3BDL A;  1GFC A;  2OTJ Q;  1PWT A;  2DIL A;  4JPB W;  2EYZ A;  1VQ4 T;  1XQH A;  2ATC B;  2VGM A;  3G6E Q;  5GAN g;  1D0Y A;  5GAM j;  1PNJ A;  2JTF A;  2K5L A;  2LCL A;  4E47 A;  2E1H A;  1QVF A;  1D1B A;  1DJ7 B;  3LH0 A;  1X6G A;  2QEX Q;  4AG2 C;  1BI3 A;  4PJO F;  5KYX B;  3VUZ A;  3PFS A;  2RHX A;  3EH1 A;  2O9S A;  2P0Q A;  1M3B A;  1U8R A;  1M4Z A;  2CSI A;  4MZT A;  1N8R U;  3UF4 A;  3CCU A;  1KK7 A;  1BKB A;  2LVM A;  3QWY A;  1ARK A;  1YJN T;  3GLX A;  1YHQ A;  2HBP A;  5CKF A;  1PSE A;  3CCE T;  4KH1 B;  2JMC A;  5LJ5 d;  2J7I A;  2EPD A;  3HFO A;  2EGE A;  1MHN A;  2DPP B;  3QO3 A;  1NEB A;  3L2Q A;  2ESW A;  2B8A A;  2DK3 A;  1VQK T;  1QVP A;  2VGN A;  1M8M A;  2X4W A;  3JB9 F;  2QQR A;  3O5Z A;  4J7I A;  4A4E A;  1YIJ T;  2ZPE B;  5LJ5 h;  4EMH A;  1MMD A;  3EGU A;  1OQK A;  2HCK A;  1D09 B;  1H64 1;  4OMO A;  1UHC A;  2GFU A;  2W0Z A;  2NUP A;  2LP5 A;  3DLL A;  1UGV A;  1X6O A;  1UEB A;  1E7O A;  1OOT A;  3A98 A;  2EJ9 A;  2FZG B;  4IKF A;  3L42 A;  4M75 B;  3BY7 A;  1ZA2 B;  4AG1 C;  2FPD A;  1M1F A;  1VQ8 A;  1U3O A;  4LXC A;  2O9V A;  2JJ9 A;  3EG1 A;  5GAO m;  5HK3 A;  1VQ4 Q;  1YWO A;  3TRE A;  1N9R A;  1XTD A;  2JXB A;  3E1S A;  4RCB A;  3JCM f;  2RQW A;  2E64 A;  1GRI A;  1TUG B;  3QSU A;  3IQL A;  1D1C A;  3J7A F;  3SWN B;  4J6X A;  3CCV A;  2COZ A;  1SRL A;  1Q82 C;  1FMK A;  1N27 A;  3FLG A;  2QYZ A;  2RO0 A;  2OX7 A;  1M1K U;  2RM4 A;  3X20 B;  1LVK A;  1Y0M A;  5GAN 7;  2QQ9 A;  1W2B A;  4PKC C;  4M78 D;  1AWJ A;  2KR3 A;  4C0D C;  2Y4X A;  3VRY A;  1KD1 C;  3DB4 A;  3SD4 A;  3CC7 T;  1YJN Q;  2LRQ A;  2EYQ A;  2M51 A;  2GQV A;  3CCE Q;  3A8M B;  4R0K A;  1Q7Y C;  2CKK A;  2AKK A;  2DO3 A;  1B07 A;  1D0Z A;  2ED0 A;  1IRE B;  2C0O A;  4J9E A;  1WQW A;  3TCJ A;  2DE0 X;  4M78 G;  5AYF A;  1YCY A;  3REB B;  1VQK Q;  1TUC A;  2E70 A;  4DQ2 A;  2LQN A;  4IUV A;  4WTO B;  3A8G B;  1YIJ Q;  5KYW B;  2H8H A;  2XDD A;  2RJC A;  2FPF A;  2LQ8 A;  4M77 B;  2DL5 A;  2DD4 A;  1XNI A;  5J3B A;  1G8X A;  1VQM A;  2BIV A;  4PJM A;  2AZV A;  2YXY A;  3JCM W;  1VYT A;  1E6G A;  4CC3 A;  1Q81 C;  2ZCF B;  1JU5 C;  2DBM A;  4C92 F;  3S3O A;  5FRO A;  1SF9 A;  3VS0 A;  1JRI A;  4II1 A;  1QMC A;  1EZZ B;  1LPL A;  2F2X A;  4OGC A;  1OYX A;  5CQY A;  1KQS A;  5FU6 C;  2K9G A;  2EYW A;  4B9W A;  5KYX A;  1MMA A;  4EMK B;  3V7C A;  2D1X A;  3AT1 B;  4B6M A;  3PGG A;  2AT1 B;  4JUV A;  4M7A D;  1RAF B;  2H3E B;  3HPW A;  3H6Z A;  5CCA A;  2D8H A;  3OYH A;  1JBM A;  1QVG A;  1YIT T;  2A7Y A;  4LDU A;  2JS2 A;  2HQX A;  4QQD A;  3T9N A;  5GAM d;  2CDT A;  1K73 R;  1AZG B;  3OS5 A;  5LJ3 j;  1A0N B;  4F7U G;  3CXC S;  1YCS B;  3H0F A;  3CCS T;  3FEO A;  2PZ1 A;  4JJB A;  3CC7 Q;  3OB9 A;  1T0H A;  4M7A G;  5GAN 6;  3E19 A;  5J39 A;  1SHG A;  7AT1 B;  5D7U A;  4M75 C;  2E4H A;  2QI2 A;  2GTO A;  2A36 A;  3H0I A;  3DB3 A;  2K3B A;  3GNF B;  2LZ6 B;  1T3S A;  3JCM g;  5GAM h;  1PKT A;  3ZFJ A;  4C8Q E;  5GAM f;  4JDS A;  4J8O A;  2XHC A;  4L59 A;  1YFN A;  4M4Z A;  3OYY A;  4ESR A;  4BE0 A;  3CMA T;  1GBR A;  4FM4 B;  3SWN C;  2QDL A;  1X6B A;  1XJW B;  3OW2 S;  3CME A;  1Y7X A;  2P4T A;  1UGQ B;  4OGE A;  4M75 A;  1YJ9 A;  1IGU A;  1JEG A;  2DET A;  2VXF A;  3QHS A;  2OJ2 A;  2HKN A;  5FW9 A;  3MP1 A;  2JM9 A;  5J26 A;  2RI5 A;  4PNO A;  4PLL A;  8ATC B;  4XU1 A;  1QP3 A;  1VQO T;  1QVF S;  2VC8 A;  2QQS A;  2OAU A;  3ASK A;  2LJ3 A;  3L2V A;  3CCR A;  1R8O B;  1I8F A;  2M9U A;  4J9I A;  3QII A;  2OTJ A;  3SWN A;  2KRS A;  2MK5 A;  3JCM P;  2MF2 A;  5A0D A;  1CKB A;  1WXU A;  2R57 A;  1EIF A;  2E10 A;  5CAI A;  1F1B B;  4E7K A;  1PCX A;  3M0Q A;  2YUN A;  4QVD A;  1AHJ B;  1VQ9 T;  2QG9 B;  4XU2 A;  4M77 C;  1VYU A;  2DJQ A;  1P92 A;  4M7D D;  3KUF A;  3MEW A;  3CCS Q;  4GLM A;  2BKD N;  5KE3 A;  3OYJ A;  3LYI A;  2VYT A;  1KC8 C;  4C5I A;  2NUT B;  4RTY A;  3CD6 T;  3V8L A;  5KE2 A;  4RMO A;  1YNZ A;  3OYF A;  4PJN A;  3SHW A;  2MI6 A;  1VQN T;  2IVW A;  2KT1 A;  4BI8 B;  2DZ9 A;  4M7D G;  5KYW A;  4PL6 A;  3I56 T;  5LJ5 j;  1G3S A;  4X9D A;  4EMK C;  3CMA Q;  1ZHI A;  3H8Z A;  2LMJ A;  1LCK A;  1NE8 A;  3RMQ A;  1WHM A;  1Q86 R;  4M77 A;  4VUB A;  2HMA A;  2L89 A;  4MZP A;  1AWX A;  4LDW A;  2F5T X;  3OY9 A;  2LNV A;  2HQE A;  5A0G A;  1R0B G;  3G71 T;  1RAH B;  2KE9 A;  3HTR A;  2HNI A;  2K6D A;  2SRC A;  2LJ0 A;  4E6R A;  1RI0 A;  5DLO A;  3GOX A;  1I07 A;  3ME9 A;  2XIC A;  1I0C A;  1W1F A;  4JLG A;  3WXM B;  1VQO Q;  2VV5 A;  2CP0 A;  1AD5 A;  4XTZ A;  4KUL A;  1Q82 U;  4EMK A;  4JS5 A;  1N6A A;  1H92 A;  1X75 C;  1G3Y A;  4C8Q D;  1BI0 A;  4LDY A;  1H3H A;  1IRX A;  2ZPF B;  2MPX C;  5GAN 4;  3OYC A;  1PG5 B;  4ME7 A;  3J81 E;  1KQ1 A;  1OZ3 A;  1YI2 A;  3OMG A;  2BZ8 A;  2EQU A;  3M0P A;  4L5G A;  1KJW A;  2KK4 A;  4C8Q G;  1VA7 A;  4M78 F;  2PU9 B;  2DBK A;  1VQ9 Q;  5C6S A;  4JRI A;  2GBQ A;  3QPH A;  2FRW A;  1JJ2 A;  2D6F A;  3OS0 A;  2X4J A;  1IXD A;  3NPF A;  1TXQ A;  1YWP A;  2A0F B;  2EIF A;  3CD6 Q;  2EQK A;  5DLQ E;  1WHL A;  3G7Z A;  5GMK m;  1J3T A;  3MP6 A;  3CBO A;  3CCE A;  4J7F A;  5IHN A;  3JCM X;  3OSV A;  4XAX B;  5GAO p;  1VQN Q;  4KUI A;  2LTO A;  3OQ5 A;  5GAN e;  5KYN A;  2O31 A;  4RCC A;  1VQ6 T;  1K1Z A;  2DRK A;  2L3R A;  1G2B A;  1Q81 U;  3I9Q A;  3G4S A;  1B34 B;  4JRK A;  4LE9 A;  1RL2 A;  2DTI A;  4OMN A;  1OX8 A;  2X3X D;  1W2B P;  2DEU A;  1UHF A;  3MET A;  2KYM A;  3UA7 A;  3L2U A;  2RHU A;  5LJ3 f;  2XD0 A;  3EH2 A;  3V7S A;  1KQS S;  1TUD A;  2FYK A;  3CCQ A;  2QA4 T;  3CC4 A;  1D3B B;  4MZM A;  3L2W A;  2D9T A;  1RI9 A;  3RNJ A;  4BDY A;  5GAN 8;  3I55 T;  4HCZ A;  1ABQ A;  1QVG S;  3VU3 C;  4F7U F;  3CC2 T;  1MMG A;  5CKE A;  2RD1 A;  1ABO A;  2DL4 A;  4J83 A;  5HKC A;  4M7A F;  2DAQ A;  4C5E A;  1ZSG A;  4KGV B;  4BAC A;  1G83 A;  2KRM A;  4A4K A;  4AFQ C;  3TEE A;  2RA2 A;  2XI9 A;  5DM7 R;  2IPO B;  1UFF A;  1Z9Z A;  4N0A C;  3S3M A;  3FIF A;  2EJG A;  3LH5 A;  2DEQ A;  1AWO A;  2NUT A;  3OW2 A;  1NZ9 A;  4RTU A;  4BD3 A;  2D8J A;  3OS2 A;  3QYG B;  2QQB A;  2K57 A;  3UAT A;  2K79 A;  2ZPI B;  3LGF A;  1PRM C;  2DIQ A;  3O8V A;  4E7J A;  3V7R A;  2JNG A;  3VS2 A;  4MDX A;  3OYI A;  3MEA A;  1BK2 A;  2PUO B;  5L8R E;  1R77 A;  3CC7 A;  1MNE A;  1KQS P;  4WF2 A;  1RLQ C;  3EGD B;  4F7U B;  3M57 A;  3U23 A;  3JAM E;  2XG8 D;  3M5A A;  2E6Z A;  2LQW A;  2MWP A;  4N0A A;  2PNI A;  1KHI A;  2OAW A;  2CP2 A;  1VQ6 Q;  1QVG P;  2ABL A;  1RAB B;  3EFR A;  4XTX A;  3PE0 A;  3OYN A;  1NJI R;  2KEA A;  1M2V B;  1MMN A;  2IG0 A;  3CBM A;  2MMP A;  1S1N A;  3CCM A;  4NL3 A;  5A0L A;  1AOJ A;  4IIO A;  2CP5 A;  3A8L B;  3LGL A;  2QA4 Q;  5FU6 B;  5CR2 A;  4PJJ A;  2NYS A;  2JN0 A;  2F1L A;  2QTV A;  2CS7 A;  3G1J A;  2RMO A;  3JCM J;  1YJW T;  2J6F A;  3MKD A;  1LNX A;  3I55 Q;  3QZ5 B;  1OX9 A;  4J9G A;  1WHH A;  4PJO B;  3X28 B;  2YUQ A;  3CC2 Q;  4JS4 A;  1WJQ A;  2NLU A;  2DKG A;  1K76 A;  3MPU B;  2R5M A;  4X9C A;  3H9N A;  1PC0 A;  2CP6 A;  2RQV A;  5LJ5 f;  2YUP A;  3R6O A;  4IUT A;  2RK1 A;  1KC8 U;  3CCL T;  2V8K A;  2COY A;  5IHK A;  4FYX B;  1U06 A;  4OMF B;  5FRN A;  3V8K A;  3C12 A;  2V8J A;  1WPY A;  2KRO A;  3PMI A;  4M7D F;  2E41 A;  2HBW A;  3EAE A;  3D7S B;  4XTU A;  3BW1 A;  4ORZ A;  1WYX A;  2G3R A;  2MWO A; 
#chains in the Genus database with same CATH homology
 2CP2 A;  2E3H A;  2HKQ B;  2MPX C;  2HKN A;  2E3I A;  2HQH A;  1WHK A;  2CP7 A;  3TQ7 P;  4B6M A;  1IXD A;  1TOV A;  1TXQ A;  1WHG A;  1WHM A;  3E2U A;  2QK0 A;  2COY A;  2HL5 C;  2HL3 A;  2CP0 A;  1WHJ A;  1WHL A;  2Z0W A;  1WHH A;  2E4H A;  2COZ A;  2CP3 A;  2M02 A;  1LPL A;  3RDV A;  2CP5 A;  2CP6 A;  2COW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...