2HKQB

Crystal structure of the c-terminal domain of human eb1 in complex with the cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
b'PLRVGSRVEVIGKGHRGTVAYVGATLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2006-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hkqB00
2COYA 1LPLA 2CP7A 2CP6A 2CP0A 2HKQB 3RDVA 2HL5C 1TXQA 2HKNA 2M02A 2CP2A 1WHMA 2QK0A 3TQ7P 1WHJA 1WHLA 2COWA 4B6MA 1TOVA 1WHHA 2HL3A 3E2UA 2E3HA 2HQHA 2CP5A 1IXDA 2MPXC 1WHGA 2COZA 2CP3A 1WHKA 2E3IA 2Z0WA 2E4HA
chains in the Genus database with same CATH superfamily
3E9FA 4HVVA 2ROTA 2JTMA 1G3YA 4RTZA 2VYTA 3VU3C 2K7AA 5EG2A 4BI4A 1N6AA 2RHYA 1N8RC 3EHRA 5CAIA 2XI9A 2EGEA 3EGDA 2DFUA 4CC7A 1YIJA 3A8GB 4EIKA 1QVGS 3PGGA 1Q81C 3QZ9B 3CBOA 3GLXA 1TWBA 4NS5A 1QMCA 2HD0A 4OB2B 1NYFA 3CPFA 5I21A 3EG3A 3VKIA 3OA6A 2RI3A 2E10A 1VA7A 1RLQC 2KNBB 1WQ7A 5KE2A 3VS7A 4KGVB 1Y71A 2NUZA 4J9IA 1H641 2JNGA 4IIMA 1D09B 1M3CA 3OYGA 1LPLA 4M7DA 1AOJA 4Y91A 2NUTA 2AK5A 3RIRA 4PJOB 5GAOn 3TEEA 3KUFA 3O5ZA 1VQ5Q 2HL3A 1YI2A 4Y92A 2AIRB 1RUWA 3CXCS 4M77D 3CC7A 1Q7YC 2JOYA 2QEXT 4CC3A 1UDLA 4D8KA 3ZBDA 1EX4A 4C8QC 4N4GA 2O4XA 2W10A 1YIJT 2F2WA 3OB9A 3KXTA 2HBWA 3RDVA 2WSFE 2X9HA 2M02A 2PVDB 1MHNA 2O01E 3JCMh 4PJOC 5GAMh 3AHUA 2DZ9A 1N9RA 2RI2A 2RHXA 2D1XA 2DTOA 4JRPA 4F14A 2RH2A 1M9SA 2JZ2A 4EMKB 3M0SA 3WXMB 2A28A 5FLXE 2GNCA 2Y4XA 2Y90A 3OYLA 3RNJA 4C5GA 1FYNA 3HFNA 4RG2A 1PSEA 3M54A 2QA4A 2KAFA 4X9CA 4HCKA 1YJ9Q 1CKBA 3CC7T 3CMEQ 5GAN4 4WF2A 2XK0A 2K3YA 3REBB 4EMKC 1RACB 2E41A 4LD6A 4HCCA 5GAOr 2R57A 3L2VA 3I56Q 1AHJB 4BY6B 1PKSA 2QK0A 2L0AA 3OSSC 3EHQA 1NE8A 3LGFA 4OB1B 4HVUA 4FT2A 1JJ2S 1N8RU 1KIKA 5GMKe 2LCLA 1Y0MA 3LLRA 1N5ZA 3JCMW 3QHSA 4GLMA 3V7CA 2C0TA 2BUDA 4M78A 2C06A 3HFOA 2YDLA 1RAFB 4M7DG 3L2WA 1LJOA 1V29B 4L6V5 3OS5A 1Q81U 2CREA 2HSEB 2MAMA 3MKDA 2R58A 2VXEA 2QA4T 1PKTA 1WGSA 1B34B 1ZA1B 3LGLA 5LJ5j 1G3TA 4B9XA 3JV3A 3X25B 2K57A 2B8AA 3FLGA 2DA9A 2EKOA 3JSCA 1M2VA 1G8XA 2XDPA 4ZGDB 4XTXA 2A7YA 3PVLA 2X4YA 1WJSA 2WACA 2FEIA 3J81E 1GBQA 4EDUA 4N0AC 3I5SA 1HK9A 2L89A 1QWEA 4J9BA 5GAN8 3ER0A 1QKWA 4ZTFA 1NZ9A 3A8LB 4BD3A 3ASKA 3GOXA 1Q7YU 3NTIA 2DK3A 2DXBA 4ME7A 1WYXA 2EYYA 2F5KA 1VQ5A 2AKLA 4Z88A 3VV0A 2EQIA 4HA8A 1SSFA 2DVJA 4HXJA 1R77A 1OZ3A 1C1AA 2YRDA 4J83A 4TVRA 4C5IA 2QI2A 2CT3A 2HQEA 5CQYA 5IH2A 2CSQA 1ABQA 2MMPA 5GAOl 1PC0A 2BE7D 2VXFA 2DYIA 1BCMA 1OEBA 3RUXA 1W2BS 2L3PA 2RI5A 4A54A 2QGFB 1VOMA 1OV3A 3A8OB 5IT9E 1ZSGA 1MMDA 2CYZB 1LCKA 3URGA 3H6ZA 1OPKA 4R56A 1YP5A 3CPWA 4FCYA 2COYA 4KUIA 4QVZA 2LJ3A 2DLPA 5GAOm 2E12A 1G2BA 4M7AA 2CZ6B 2K9GA 1RI9A 1YJ9A 4M78G 5A2QE 3JB9G 1UGVA 4RTUA 3CMEA 2LJ0A 1JB0E 1F1BB 2A37A 2K2MA 1FMKA 5J3BA 1S72Q 3HRTA 4J6XA 2FPDA 1GCQA 3I56A 3EG9A 1K73R 2DL7A 3JCMg 3PT9A 2NUPA 2CP0A 4J9GA 5GAMg 2MIOA 2VV5A 3PIOA 5KYUA 4M75D 1IRXA 1GXIE 4A63B 1I5OB 3PVQA 3CXCA 1KC8R 4B6MA 1YJWQ 1KSWA 1K0SA 1YCSB 2HQHA 1PSFA 3LW5E 2P4TA 3M55A 4FL6A 1WHGA 3OYJA 1GFDA 2RK2A 4F7UG 2RHZA 4J6YA 4X9DA 4XTWA 1KQSA 2CZ7B 2FG0A 5GJWB 3M5AA 2IPOB 2LMJA 1YJ9T 3OYIA 2FO0A 5KYWB 3CMET 2IIMA 3M4YA 3NHNA 4OGCA 2HAXA 1JQQA 3OW2A 1R8OB 2HMAA 1PD0A 3I56T 3CCUQ 2OTJQ 2A08A 4KH1B 3M53A 5GAN7 4AFUC 1WHLA 1C6VX 1M2OA 3JCMf 4ZTJA 3ZEHA 2YWWA 4CC4B 5GAMf 4C92E 2G6FX 2EJ9A 2QYZA 1BI1A 3EFOA 2LQ8A 4FU6A 4Z8AA 2NYSA 2FYKA 3S3OA 2G3RA 4M7AG 1BU1A 1NJIR 1QQJA 4J9CA 5HKCA 3G6EQ 3LX7A 3TSWA 1YWOA 2D8HA 4C8QE 4M77G 1OPLA 1IB8A 1Q95G 5FU7B 4M7DD 4EMGA 1NYGA 4BE1A 2HL5C 1YFNA 4OMMA 4FYWB 3UA7A 4RTXA 4OVAA 3RR6A 4PJOE 2KMTA 1WFWA 1RADB 1ZBXA 3VRYA 1PHTA 5I2MA 1I1JA 5AYFA 1KQ2A 1HYOA 2HEQA 5FWCA 3A8HB 2VGMA 1UHCA 3M57A 2ZPEB 4J9DA 2QEXQ 4C92F 1A0NB 1I8FA 2EGCA 2AT1B 5FW9A 2FZGB 1IHVA 5FU7C 5FU6B 1KQ1A 2DIGA 1S72A 1I81A 1UFFA 2FL7A 2JM8A 4LDWA 2JMAA 5GANe 2CUDA 1FXXA 1H3ZA 3C94A 2SRCA 4C8QF 3M0QA 2DRMA 1QVPA 3A98A 4RCBA 1YJWA 3ME9A 2ECZA 2DEUA 2PUOB 3QPHA 5FU6C 2EYQA 4GLKA 1YITQ 4E2FB 1KD1C 5LJ3e 2DIQA 1V1CA 2EKHA 1Q82R 2E1HA 1AD5A 3HL8A 4QQ6A 4DBFA 1MUZA 1W2BA 4XQ3A 1YCYA 3V7SA 2K4YA 1DJ7B 5IXBA 4C0GA 2FPEA 3SWNA 5HK3A 1VQKQ 4LDXA 1KFZA 4JJBA 4LNPA 1SKUB 1IHWA 3CCUA 1ZA2B 2KYMA 4II1A 1P92A 5ECAA 1JU5C 1X2KA 3MCAB 2L5QA 5LJ3f 4PFZA 2PUKB 4ATOA 2QGGA 3WVEB 4M78D 3JB9D 2YUPA 1YJWT 5GANd 4BACA 4LD9K 3RBBB 3VJPA 1AWWA 2FZCB 4RCCA 3CXCP 2DBKA 1QKXA 2C0OA 2ENMA 2D9TA 3X24B 4EMHA 5LL6S 4HVWA 1IO6A 1AZEA 3OBYA 2DE0X 3CCEQ 1X69A 2E3IA 2QG9B 2NWMA 2X4JA 2EQJA 3CCQQ 1ZQ1A 3V8KA 1WXTA 3G6EA 1TXQA 3QBYA 3NMZC 2CS7A 5CKHA 1KK7A 5LJ3d 3NFCA 3VUBA 3CCRQ 4AFQC 1AWXA 1BBZA 5KYYA 2A0FB 3F70A 2CH4A 4RTTA 4P5NA 1XQHA 5AT1B 2CDTA 2YRCA 4UC4A 2OTJT 1UG1A 2J06A 1U06A 2RHUA 4ANJA 3MEWA 3P8HA 2JW4A 3QSUA 2IG0A 3FB9A 2DTIA 4AT1B 1VQMT 2QEXA 3QWYA 2E6NA 5J39A 2DYBA 2CP3A 4C92B 2M16A 1M90U 2DM1A 2ZAEA 5KCOA 3I55Q 4AFZC 2JS0A 5GMKl 1K9MR 4A4KA 3G6ET 2MWOA 1G83A 4WTOB 2F1LA 1GRIA 4JJCA 1JJ2P 4B9WA 1OX8A 3QWXX 4RG8A 2HNIA 2ATCB 1WI7A 3HTRA 4C8QB 1UECA 1YNZA 4IUQA 3VS5A 2EIFA 2M51A 1KD1U 2DD5A 2OTLT 1NG2A 3SD4A 1OYXA 4C92C 2CP6A 4KT0E 3HHTB 5GMKm 3HPWA 2LT1A 4QKUA 1ZSZB 4M7AD 4J6WA 1VQNQ 4F7UB 1YITA 3EGUA 2EGAA 1H8KA 1R0BG 2EPDA 4J5YA 3HRUA 4M75G 4JRIA 1VQ6Q 4KULA 1S1NA 2YT6A 1JRIA 1RAIB 2H3JA 2KVQG 1MMGA 2FRWA 3CBPA 2COZA 2V8JA 5CIUA 1VQPT 2AZSA 1M1KU 5IHKA 4JJNK 3L2UA 1D0YA 1ZSZC 1Q86R 4AMCA 2P0QA 3OMCA 4KUDK 4FIBA 2YUQA 1BIBA 2DRKA 4KGZB 4ORZA 2K2VA 2L2PA 1ZHIA 2LCCA 3BE3A 1OU8A 2DTHA 2EAYA 3QDRB 3G7ZA 3NPFA 1SRMA 2KK4A 3GPLA 2LJ1A 2LNHB 3G1JA 1YJNQ 1SSHA 5DM7R 2HZYA 2CP2A 1YITT 2A3LA 3CCEA 4J8OA 5CCAA 2RJFA 5GAN6 3G4ST 3CC4T 1YBYA 3CCQA 2XU8A 4J7FA 5D6XA 3DLLA 1Y57A 1AEYA 4Z89A 1M4ZA 1NEBA 4IIOA 2GBQA 4PKCC 1W2BP 3CCRA 1PWTA 1CSKA 1VQKT 1RL2A 4M77B 5CR2A 2SEMA 4FYVB 1YWPA 2RPNA 3QUIA 2VVKA 1RLPC 2EVRA 1AWJA 3X26B 4KGXB 3QG1A 2YHTA 5IAYA 1TUDA 4OMPA 2JVVA 4M7AC 2KYBA 3UT1A 5LJ5e 2EYXA 4XK8E 2CZ1B 1J3TA 3H0FA 2CT4A 3FIFA 4BDYA 3R6NA 2RF0A 4M77C 2JTFA 3CCET 1M30A 1GCQC 3GF5A 3I55A 2YLBA 1XNIA 5FROA 3CCQT 3AT1B 1QCNA 2E70A 2CSIA 3GP8A 2JS2A 2E65A 1CKAA 1BI2A 1ZUUA 2DJQA 1QP2A 3M0TA 1BKBA 5GAN2 3CCRT 3EGXA 4X1VA 5GANh 3LH0A 3JRZA 1T0HA 1K8AR 4ZN1A 2DVEA 2VUBA 1VQNA 1M5Q1 4HCZA 3D7SB 2GFUA 3CCMQ 2DERA 1WIEA 1QW1A 2KGTA 4NL3A 3JCMJ 2PZ1A 3CQTA 3SDZA 1XOVA 2XKOC 3P8DA 1TUGB 4NOYA 5IN1A 3RESA 5LJ3h 1WXUA 1SHFA 4PJOA 2EQKA 1PNJA 5LJ5d 4LN2A 2P0PA 4KBMB 3OS0A 3I55T 4J7IA 4FM4B 3C95A 3JCMc 5KYXB 3JCMX 4RKUE 1WLPB 3T9NA 2DF6A 3C4SA 4QQDA 2QTVA 1JXOA 3VS4A 3CC2Q 4JRQA 1D3BB 2KDSA 1D1CA 3FJ5A 4VUBA 1U3OA 4F17A 4C0DC 5KE3A 4LDVA 1NPRA 1NM7A 2XMFA 3LH5A 1D1BA 1YJNA 1QP3A 4LXCA 2Z0WA 1QVGA 4DA4A 1VQNT 2E5KA 4EMKA 3MP1A 3CD6Q 2EQUA 4JLGA 4L5GA 1K73C 1VQ6T 2ED1A 3PMIA 3FEOA 3M9QA 1U8RA 2DZCA 2HSPA 3CMAQ 2LRQA 3OYKA 1X43A 2X4WA 2X3XD 3CCSQ 1KC8C 5GAN5 3ZL7C 2E64A 2LQWA 2RB6A 4OMNA 1ZLMA 3CBMA 5D6YA 2D8JA 4A4EA 1X2QA 2K6DA 4RMOA 4J9HA 3I5RA 2QASA 3RMQA 2KRNA 4AFSC 4PJLA 1UUEA 2J6OA 3GNFB 2PTKA 3FJPA 1VYTA 5CKEA 2BTTA 1YJNT 2QTXA 5FWBA 2EYWA 1M3AA 2Y4YA 2RQVA 3JB9H 4PLIA 2RN8A 3FDRA 2VGNA 1VUBA 2DEQA 1XTDA 3QYHB 3VS0A 1N27A 1AT1B 4KRTA 3L42A 2LDMA 2KROA 2O9VA 4JUVA 4N0AA 2ESWA 3FC3A 4PJOG 4PL6A 5KCHA 1B34A 2O2OA 1VQOQ 3E1SA 3OY9A 5CQXA 3VYGA 1KJWA 1B07A 1I5LA 1LOJA 1BI3A 2HCKA 2I2LA 1TUCA 2GF7A 4FT4A 2FVUA 3TQ7P 1FX7A 2LC4A 3E2UA 1K0XA 2M0YA 2RD1A 3CCMA 4OMQA 1JBMA 5J26A 2YSQA 3I9QA 1NJIC 1Y96B 4M75B 4JRKA 1VQMQ 3WVDB 1WJRA 4ELYC 3SWNC 2K5FA 2GQIA 1W6XA 1K4US 3OYHA 4RTYA 5GAMj 1KHCA 1JJ2A 4RTWA 5HK0A 3G71Q 2L3SA 3E9GA 3CC2A 5EC7A 3OYBA 2E4HA 1Z9ZA 1T3LA 3MP8A 5GANg 2XD0A 4M75C 3IQLA 2OTLQ 2W0ZA 2DMOA 2H3EB 3O8VA 4RUGA 5KYNA 4F7UE 4PJMA 1KHIA 2LCSA 1K73U 1HSQA 4A4HA 4DEXA 1W70A 5I22A 3M58A 1IXDA 3SB2A 3CCMT 4E7LA 1WNLA 3CD6A 4M78F 2JXBA 3JB9F 5IXFA 1KC8U 1TH7A 2E5QA 1T0JA 5LJ3g 1G5VA 4OMOA 2D6FA 1VQPQ 2DL5A 3CMAA 3V8LA 1OQKA 1VQ7Q 2COWA 1NBEB 5GAOp 3CCSA 3EGDB 3VS2A 4HKEA 4C5HA 1RAGB 1TS9A 4QT7A 2GFAA 2EBPA 3LYIA 1E6HA 3PNWC 1EIFA 4PLLA 2V1RA 5CVIA 2VKNA 4IUPA 1VIFA 1B3QA 1UJ0A 2L3RA 3CC2T 3BFMA 3JCMb 2RJDA 5CK9A 3BY7A 3SEMA 3THKA 1Q82C 3FRNA 1ARKA 2MOXA 1GCPA 4KH0B 4F7UF 1IGQA 1PRLC 5GMKh 4E7KA 1WJQA 2JMCA 3QJYA 4M7DB 1WA7A 2HBPA 5LJ5h 3H0IA 5GANf 3G4SQ 2PQWA 4M7AE 3J80E 2NUTB 3CC4Q 1QVGP 3CD6T 4OMLA 1UGPB 1RAEB 2CH4W 3RKYA 3M59A 2EWNA 1M90R 1H92A 3NTKA 3CMAT 2OX7A 3R6OA 4M77E 5FRMA 1X01A 1V76A 3CCST 2O4XB 1VQOA 2LQKA 2VC8A 4D6WA 1RAHB 2MPXC 2OTJA 5KYWA 1YI2Q 4M7DC 3UATA 3REAB 1NJIU 3PFSA 4JJDA 4LUDA 2ZPBB 3UA6A 5DLQE 1EFNA 2DAQA 4AG1C 3Q1JA 4FYXB 5GMKi 1VQ9T 1X6OA 4DOVA 5LJ3j 3MJXA 3JCMV 3BW1A 2HQXA 3S6WA 3QYGB 1O9SA 1VQMA 3OMGA 4ZGJB 2GTOA 4MZTA 4O6JA 1UTIA 4M7AF 2F2VA 4M4ZA 1OOTA 1ZBJA 3SFMA 5FRNA 1M8MA 2BZYA 3BDLA 3OQ5A 3G71A 3UF4A 1M1KR 4XTVA 4M77F 2ZPHB 5D7UA 3EG2A 4DEYA 1QLYA 2QQ9A 2KXDA 4ZGEB 3H41A 2E6ZA 1VQOT 4DQ2A 3E19A 4IUVA 2KR3A 5GAOq 2OTLA 3MEVA 1GL5A 2K5IA 1C0MA 5GAN3 1BI0A 4MDXA 3BDUA 4XU0A 2DL4A 4E7IA 4YTLA 7AT1B 1GBRA 4N4HA 5IHNA 2EJFA 3CCJQ 3CEYA 3QDFA 1K9MC 4PJOD 2EFIA 4HCBA 2PVOB 3OYYA 1JEGA 4M78B 4MMKA 1TU0B 3LWIA 1VQPA 2RQTA 4BUGA 5IHIA 3RKXA 2KQWA 1VQ7A 3OYCA 1WZOA 3OS2A 4BE0A 1AWOA 4PJNA 4QVCA 5CKDA 1WHMA 2I0NA 2K5LA 1Q82U 3G71T 5C6SA 3VS3A 4L59A 2BZ8A 5CKFA 1OULA 3KBGA 3MPUB 3EH1A 1N9SA 4O5VA 1M2VB 1UE9A 3EGXB 4M78C 2LX9A 3CPWS 2J05A 1SG5A 4N4IA 3GIBA 1N8RR 2RO0A 4XU3A 1ZUYA 1BB9A 2PU9B 1QVFS 1GFCA 3SHWA 3C12A 5A0LA 3G4SA 3TSZA 3CC4A 1RABB 3OYAA 2FPFA 1UB4A 4Q5WA 1Q81R 4LE9A 2MYSA 1X6BA 1Q86C 3NGPA 2GGRA 1K76A 4FSXA 1ACMB 1MV3A 3TCJA 1VQKA 1VQ7T 3H9NA 2QAZA 2QQSA 1WHJA 3PIPA 1VIEA 3L1AA 3M0UA 2DD4A 1VQ4Q 5A0GA 2LX7A 3QZ5B 4QW2A 1IREB 2P4RA 2O9SA 3JCMQ 1UGSB 4OGEA 4GBQA 1Z9QA 3DB4A 4MMLA 4OF1A 4FYYB 2B86A 1KQSS 3OYFA 2DL8A 4HT8A 1O75A 1NPPA 5M9OA 1OZ2A 1Q7YR 3UPUA 2EQMA 3OYDA 5LJ5g 1WQWA 5DLOA 1IZ6A 3V7RA 2DNUA 1WPYA 1T3SA 2XDBA 2E3HA 1I4K1 2LZ6B 1Y07A 2GQVA 4JDSA 4DBRA 4V2SA 4M7AB 4PK4A 2VWFA 3OW2S 3DKMA 2KY9A 4J9FA 2KT8A 4IKFA 2EYZA 4BI8B 4WCIA 2F69A 1VQLQ 1W1FA 2FZKB 2WSEE 3M0RA 4OP0A 2ZCFB 2JUFA 3L2ZA 3CCVQ 1YI2T 3EG9B 2ED0A 1ABOA 2DXCA 2RMOA 3L2RA 2X3WD 1M1FA 2NUPB 8AT1B 1K9MU 2DILA 3OSVA 5L23A 3JB9J 5C0MA 3RKWA 4E7HA 1UGRB 5KYUB 1FWZA 4E47A 2M0OA 4M75E 4FSSA 3S3NA 2FB7A 3CCJA 3M0PA 3ZFJA 4BE2A 3OS1A 1TTHB 3S3MA 3X20B 2RQUA 2V1QA 4XAXB 1K1ZA 3C0CA 2EJGA 1TSFA 2DETA 1NLOC 2RK1A 2XDDA 4XU2A 1PRMC 1K8AC 4IUUA 4C92A 5LJ5f 4XTUA 3TREA 4K11A 4PJJA 2P84A 3RMSA 4QVDA 1SF9A 4BY6C 5GMKj 2DO3A 2BE9B 4CRIA 4JPBW 2DJZA 1FMWA 2F5TX 2BKDN 4QQGA 3H8ZA 1XJWB 4C8QA 1Q86U 2CP7A 5HCKA 2X51A 4M75F 2DKGA 4XTZA 3CCJT 1VQ6A 2LQNA 3GNGA 4FW1A 4C0DB 1ZSZA 1BYMA 1R0CB 4E7ZA 4F7UA 5HY6A 3CCLQ 3U23A 3QJ6A 2J6FA 3EFOB 3HKSA 5I11A 3OBWA 1I0CA 2QDLA 2QQBA 3VS6A 1VQ8Q 1VQ4A 2F2XA 3EFRA 3EG0A 1HD3A 1M1GA 2X35A 2ZPGB 3RERA 4C0FA 3EH2A 1YN8A 2KBTA 4M7DE 3QXEB 2K79A 1MMNA 4A4GA 2FHDA 4Z02A 2KRSA 4AG2C 2LT4A 3A5ZB 1QCFA 2PVGB 3UWNA 1Y7XA 2DX1A 4JS5A 2YUOA 1VQLA 1SHGA 4XU1A 3QKJA 2RNAA 4LDUA 2KRMA 2ZPFB 3PTAA 1QVFA 4PNOA 1BIAA 3CCVA 1VQ5T 3N5BB 1NEGA 1VQ4T 2AHJB 1MV0B 4C92G 1G3WA 3MO8A 1M8VA 2DPPB 1MNDA 1U1TA 5I2SA 2RQWA 4M77A 2DXUA 1RI0A 1VQ9Q 3P8BB 1SPKA 4E7SA 1M3BA 4FW2A 3QO3A 4M7DF 2V8KA 3JAME 4DOWA 2HDAA 4GY5A 4C8QG 4JZ3A 1K8AU 5KH6A 1FMVA 2DL3A 2EW3A 5L8RE 3A1PA 1D1AA 2QXFA 2K3XA 2XICA 1MMAA 1OU9A 3MEAA 4LUEA 2P0KA 1VQLT 2RQRA 3NTHA 3SWNB 3UDCA 4CI0C 3I35A 2QDYB 1W4SA 4DBHA 3INZA 2O31A 3CCVT 4C5EA 1X6GA 8ATCB 3HSBA 2PNIA 3GBQA 1X27A 2CP5A 3JCMe 4OMFB 5GAMe 2BZXA 2K3BA 2KE9A 1YHQQ 4M78E 1VYUA 2D0QB 2VB6A 3LWHA 1SEMA 5GJVB 4PFPA 3DB3A 3MP6A 2XG8D 2XHCA 2RJCA 3CCLA 2MF2A 3M4GA 1NLPC 3PMTA 1IGUA 2KI7A 4IURA 1VQ8A 2RA2A 4J9EA 3VYHB 4NL2A 4E6RA 3DLMA 1JXMA 1RAAB 2CZ0B 2J6KA 5KYXA 4C0ZA 1WX6A 5KYYB 4HT9A 2OI3A 1JO8A 3KFVA 4JS4A 3L2QA 1PM3A 3MHXA 4PFOA 1D3BA 3JB9I 2LP5A 2KSSA 4D8DA 2RM4A 4R0KA 1MNEA 1PCXA 1X75C 1LNXA 2AZVA 4ESRA 1H3HA 2OAWA 2O88A 2OAUA 3JCMd 2HKNA 1MGQA 2D0NA 5GAMd 2JJ9A 3CCLT 2QQRA 4A53A 1OX9A 1EZZB 4JZ4A 4BB7A 4F04B 1M27C 1WHKA 1TG0A 3VRZA 1VQ8T 2YXYA 2VASA 2L3QA 3VUZA 4RTVA 2ABLA 2CKKA 3OYEA 2HKQB 2OJ2A 1YIJQ 1VQ9A 4EPCA 1B7TA 3J7AF 3JCMP 2IVWA 1TOVA 1E6GA 4MZMA 4ZN3A 2YLCA 1M90C 2QQAA 1BK2A 1D0XA 1ZUKA 4ELZC 2A36A 1AVZC 2KT1A 3ULRB 2V8IA 3HRSA 2GCXA 4BI3A 1U5SA 4MDWA 2LTOA 3MEUA 2MI6A 2ZZDA 1U1SA 2LVMA 2H8HA 2JT4A 3HP9A 2V26A 5GANj 1PD1A 3QIIA 4PJOF 3META 2JM9A 1KG1A 1BCOA 4DBQA 4LDYA 2KEAA 4XTYA 1I07A 2MK5A 6AT1B 2YRVA 1WXBA 1D0ZA 3CPWP 2RHIA 2M9UA 2R5MA 3CC7Q 3EG1A 2GTJA 2JN0A 2ZGWA 1SRLA 1UJYA 5DY9A 1QVFP 2FRYA 3PE0A 4R55A 2MWPA 3A8MB 1KD1R 2C0IA 4X34A 2MCNA 1S72T 2ZPIB 2KXCA 2M1HA 2ROLA 5CO7A 1WHHA 4JLIA 1YHQA 1AZGB 1HJDA 1LVKA 2LNVA 4ZNXA 3H0HA 2XIDA 1M1KC 2DXTA 2L8DA 3VS1A 4Y28E 3TU4K 1Y96A 3M56A 4C92D 4M75A 1UGQB 2CUBA 2WSCE 5CKBA 3TVTA 1HXDA 1PG5B 2X4XA 2DBMA 2JTEA 1UEBA 4OB3B 2R5AA 3OYMA 2BIVA 1ZX6A 4E7JA 4MZPA 2QA4Q 2AKKA 1KQSP 5D6WA 4C8QD 4F16A 3X28B 1WDXA 9ATCB 1QCOA 2RJEA 3V8JA 3EAEA 4CC2A 1VYVA 4OB0B 4BDZA 1OI1A 2CGHA 3OYNA 1YHQT 1E7OA 1UHFA 5A0DA 3CCUT 1G3SA 3OW2P 2J7IA 4IUTA 4A4FA 2NLUA 2YUNA 1K9AA 3EFSA 1QWFA
chains in the Genus database with same CATH topology
2COYA 1LPLA 2CP7A 2CP6A 2CP0A 2HKQB 3RDVA 2HL5C 1TXQA 2HKNA 2M02A 2CP2A 1WHMA 2QK0A 3TQ7P 1WHJA 1WHLA 2COWA 4B6MA 1TOVA 1WHHA 2HL3A 3E2UA 2E3HA 2HQHA 2CP5A 1IXDA 2MPXC 1WHGA 2COZA 2CP3A 1WHKA 2E3IA 2Z0WA 2E4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COY A;  1LPL A;  2CP7 A;  2CP6 A;  2CP0 A;  2HKQ B;  3RDV A;  2HL5 C;  1TXQ A;  2HKN A;  2M02 A;  2CP2 A;  1WHM A;  2QK0 A;  3TQ7 P;  1WHJ A;  1WHL A;  2COW A;  4B6M A;  1TOV A;  1WHH A;  2HL3 A;  3E2U A;  2E3H A;  2HQH A;  2CP5 A;  1IXD A;  2MPX C;  1WHG A;  2COZ A;  2CP3 A;  1WHK A;  2E3I A;  2Z0W A;  2E4H A; 
#chains in the Genus database with same CATH topology
 3E9F A;  4HVV A;  2ROT A;  2JTM A;  1G3Y A;  4RTZ A;  2VYT A;  3VU3 C;  2K7A A;  5EG2 A;  4BI4 A;  1N6A A;  2RHY A;  1N8R C;  3EHR A;  5CAI A;  2XI9 A;  2EGE A;  3EGD A;  2DFU A;  4CC7 A;  1YIJ A;  3A8G B;  4EIK A;  1QVG S;  3PGG A;  1Q81 C;  3QZ9 B;  3CBO A;  3GLX A;  1TWB A;  4NS5 A;  1QMC A;  2HD0 A;  4OB2 B;  1NYF A;  3CPF A;  5I21 A;  3EG3 A;  3VKI A;  3OA6 A;  2RI3 A;  2E10 A;  1VA7 A;  1RLQ C;  2KNB B;  1WQ7 A;  5KE2 A;  3VS7 A;  4KGV B;  1Y71 A;  2NUZ A;  4J9I A;  1H64 1;  2JNG A;  4IIM A;  1D09 B;  1M3C A;  3OYG A;  1LPL A;  4M7D A;  1AOJ A;  4Y91 A;  2NUT A;  2AK5 A;  3RIR A;  4PJO B;  5GAO n;  3TEE A;  3KUF A;  3O5Z A;  1VQ5 Q;  2HL3 A;  1YI2 A;  4Y92 A;  2AIR B;  1RUW A;  3CXC S;  4M77 D;  3CC7 A;  1Q7Y C;  2JOY A;  2QEX T;  4CC3 A;  1UDL A;  4D8K A;  3ZBD A;  1EX4 A;  4C8Q C;  4N4G A;  2O4X A;  2W10 A;  1YIJ T;  2F2W A;  3OB9 A;  3KXT A;  2HBW A;  3RDV A;  2WSF E;  2X9H A;  2M02 A;  2PVD B;  1MHN A;  2O01 E;  3JCM h;  4PJO C;  5GAM h;  3AHU A;  2DZ9 A;  1N9R A;  2RI2 A;  2RHX A;  2D1X A;  2DTO A;  4JRP A;  4F14 A;  2RH2 A;  1M9S A;  2JZ2 A;  4EMK B;  3M0S A;  3WXM B;  2A28 A;  5FLX E;  2GNC A;  2Y4X A;  2Y90 A;  3OYL A;  3RNJ A;  4C5G A;  1FYN A;  3HFN A;  4RG2 A;  1PSE A;  3M54 A;  2QA4 A;  2KAF A;  4X9C A;  4HCK A;  1YJ9 Q;  1CKB A;  3CC7 T;  3CME Q;  5GAN 4;  4WF2 A;  2XK0 A;  2K3Y A;  3REB B;  4EMK C;  1RAC B;  2E41 A;  4LD6 A;  4HCC A;  5GAO r;  2R57 A;  3L2V A;  3I56 Q;  1AHJ B;  4BY6 B;  1PKS A;  2QK0 A;  2L0A A;  3OSS C;  3EHQ A;  1NE8 A;  3LGF A;  4OB1 B;  4HVU A;  4FT2 A;  1JJ2 S;  1N8R U;  1KIK A;  5GMK e;  2LCL A;  1Y0M A;  3LLR A;  1N5Z A;  3JCM W;  3QHS A;  4GLM A;  3V7C A;  2C0T A;  2BUD A;  4M78 A;  2C06 A;  3HFO A;  2YDL A;  1RAF B;  4M7D G;  3L2W A;  1LJO A;  1V29 B;  4L6V 5;  3OS5 A;  1Q81 U;  2CRE A;  2HSE B;  2MAM A;  3MKD A;  2R58 A;  2VXE A;  2QA4 T;  1PKT A;  1WGS A;  1B34 B;  1ZA1 B;  3LGL A;  5LJ5 j;  1G3T A;  4B9X A;  3JV3 A;  3X25 B;  2K57 A;  2B8A A;  3FLG A;  2DA9 A;  2EKO A;  3JSC A;  1M2V A;  1G8X A;  2XDP A;  4ZGD B;  4XTX A;  2A7Y A;  3PVL A;  2X4Y A;  1WJS A;  2WAC A;  2FEI A;  3J81 E;  1GBQ A;  4EDU A;  4N0A C;  3I5S A;  1HK9 A;  2L89 A;  1QWE A;  4J9B A;  5GAN 8;  3ER0 A;  1QKW A;  4ZTF A;  1NZ9 A;  3A8L B;  4BD3 A;  3ASK A;  3GOX A;  1Q7Y U;  3NTI A;  2DK3 A;  2DXB A;  4ME7 A;  1WYX A;  2EYY A;  2F5K A;  1VQ5 A;  2AKL A;  4Z88 A;  3VV0 A;  2EQI A;  4HA8 A;  1SSF A;  2DVJ A;  4HXJ A;  1R77 A;  1OZ3 A;  1C1A A;  2YRD A;  4J83 A;  4TVR A;  4C5I A;  2QI2 A;  2CT3 A;  2HQE A;  5CQY A;  5IH2 A;  2CSQ A;  1ABQ A;  2MMP A;  5GAO l;  1PC0 A;  2BE7 D;  2VXF A;  2DYI A;  1BCM A;  1OEB A;  3RUX A;  1W2B S;  2L3P A;  2RI5 A;  4A54 A;  2QGF B;  1VOM A;  1OV3 A;  3A8O B;  5IT9 E;  1ZSG A;  1MMD A;  2CYZ B;  1LCK A;  3URG A;  3H6Z A;  1OPK A;  4R56 A;  1YP5 A;  3CPW A;  4FCY A;  2COY A;  4KUI A;  4QVZ A;  2LJ3 A;  2DLP A;  5GAO m;  2E12 A;  1G2B A;  4M7A A;  2CZ6 B;  2K9G A;  1RI9 A;  1YJ9 A;  4M78 G;  5A2Q E;  3JB9 G;  1UGV A;  4RTU A;  3CME A;  2LJ0 A;  1JB0 E;  1F1B B;  2A37 A;  2K2M A;  1FMK A;  5J3B A;  1S72 Q;  3HRT A;  4J6X A;  2FPD A;  1GCQ A;  3I56 A;  3EG9 A;  1K73 R;  2DL7 A;  3JCM g;  3PT9 A;  2NUP A;  2CP0 A;  4J9G A;  5GAM g;  2MIO A;  2VV5 A;  3PIO A;  5KYU A;  4M75 D;  1IRX A;  1GXI E;  4A63 B;  1I5O B;  3PVQ A;  3CXC A;  1KC8 R;  4B6M A;  1YJW Q;  1KSW A;  1K0S A;  1YCS B;  2HQH A;  1PSF A;  3LW5 E;  2P4T A;  3M55 A;  4FL6 A;  1WHG A;  3OYJ A;  1GFD A;  2RK2 A;  4F7U G;  2RHZ A;  4J6Y A;  4X9D A;  4XTW A;  1KQS A;  2CZ7 B;  2FG0 A;  5GJW B;  3M5A A;  2IPO B;  2LMJ A;  1YJ9 T;  3OYI A;  2FO0 A;  5KYW B;  3CME T;  2IIM A;  3M4Y A;  3NHN A;  4OGC A;  2HAX A;  1JQQ A;  3OW2 A;  1R8O B;  2HMA A;  1PD0 A;  3I56 T;  3CCU Q;  2OTJ Q;  2A08 A;  4KH1 B;  3M53 A;  5GAN 7;  4AFU C;  1WHL A;  1C6V X;  1M2O A;  3JCM f;  4ZTJ A;  3ZEH A;  2YWW A;  4CC4 B;  5GAM f;  4C92 E;  2G6F X;  2EJ9 A;  2QYZ A;  1BI1 A;  3EFO A;  2LQ8 A;  4FU6 A;  4Z8A A;  2NYS A;  2FYK A;  3S3O A;  2G3R A;  4M7A G;  1BU1 A;  1NJI R;  1QQJ A;  4J9C A;  5HKC A;  3G6E Q;  3LX7 A;  3TSW A;  1YWO A;  2D8H A;  4C8Q E;  4M77 G;  1OPL A;  1IB8 A;  1Q95 G;  5FU7 B;  4M7D D;  4EMG A;  1NYG A;  4BE1 A;  2HL5 C;  1YFN A;  4OMM A;  4FYW B;  3UA7 A;  4RTX A;  4OVA A;  3RR6 A;  4PJO E;  2KMT A;  1WFW A;  1RAD B;  1ZBX A;  3VRY A;  1PHT A;  5I2M A;  1I1J A;  5AYF A;  1KQ2 A;  1HYO A;  2HEQ A;  5FWC A;  3A8H B;  2VGM A;  1UHC A;  3M57 A;  2ZPE B;  4J9D A;  2QEX Q;  4C92 F;  1A0N B;  1I8F A;  2EGC A;  2AT1 B;  5FW9 A;  2FZG B;  1IHV A;  5FU7 C;  5FU6 B;  1KQ1 A;  2DIG A;  1S72 A;  1I81 A;  1UFF A;  2FL7 A;  2JM8 A;  4LDW A;  2JMA A;  5GAN e;  2CUD A;  1FXX A;  1H3Z A;  3C94 A;  2SRC A;  4C8Q F;  3M0Q A;  2DRM A;  1QVP A;  3A98 A;  4RCB A;  1YJW A;  3ME9 A;  2ECZ A;  2DEU A;  2PUO B;  3QPH A;  5FU6 C;  2EYQ A;  4GLK A;  1YIT Q;  4E2F B;  1KD1 C;  5LJ3 e;  2DIQ A;  1V1C A;  2EKH A;  1Q82 R;  2E1H A;  1AD5 A;  3HL8 A;  4QQ6 A;  4DBF A;  1MUZ A;  1W2B A;  4XQ3 A;  1YCY A;  3V7S A;  2K4Y A;  1DJ7 B;  5IXB A;  4C0G A;  2FPE A;  3SWN A;  5HK3 A;  1VQK Q;  4LDX A;  1KFZ A;  4JJB A;  4LNP A;  1SKU B;  1IHW A;  3CCU A;  1ZA2 B;  2KYM A;  4II1 A;  1P92 A;  5ECA A;  1JU5 C;  1X2K A;  3MCA B;  2L5Q A;  5LJ3 f;  4PFZ A;  2PUK B;  4ATO A;  2QGG A;  3WVE B;  4M78 D;  3JB9 D;  2YUP A;  1YJW T;  5GAN d;  4BAC A;  4LD9 K;  3RBB B;  3VJP A;  1AWW A;  2FZC B;  4RCC A;  3CXC P;  2DBK A;  1QKX A;  2C0O A;  2ENM A;  2D9T A;  3X24 B;  4EMH A;  5LL6 S;  4HVW A;  1IO6 A;  1AZE A;  3OBY A;  2DE0 X;  3CCE Q;  1X69 A;  2E3I A;  2QG9 B;  2NWM A;  2X4J A;  2EQJ A;  3CCQ Q;  1ZQ1 A;  3V8K A;  1WXT A;  3G6E A;  1TXQ A;  3QBY A;  3NMZ C;  2CS7 A;  5CKH A;  1KK7 A;  5LJ3 d;  3NFC A;  3VUB A;  3CCR Q;  4AFQ C;  1AWX A;  1BBZ A;  5KYY A;  2A0F B;  3F70 A;  2CH4 A;  4RTT A;  4P5N A;  1XQH A;  5AT1 B;  2CDT A;  2YRC A;  4UC4 A;  2OTJ T;  1UG1 A;  2J06 A;  1U06 A;  2RHU A;  4ANJ A;  3MEW A;  3P8H A;  2JW4 A;  3QSU A;  2IG0 A;  3FB9 A;  2DTI A;  4AT1 B;  1VQM T;  2QEX A;  3QWY A;  2E6N A;  5J39 A;  2DYB A;  2CP3 A;  4C92 B;  2M16 A;  1M90 U;  2DM1 A;  2ZAE A;  5KCO A;  3I55 Q;  4AFZ C;  2JS0 A;  5GMK l;  1K9M R;  4A4K A;  3G6E T;  2MWO A;  1G83 A;  4WTO B;  2F1L A;  1GRI A;  4JJC A;  1JJ2 P;  4B9W A;  1OX8 A;  3QWX X;  4RG8 A;  2HNI A;  2ATC B;  1WI7 A;  3HTR A;  4C8Q B;  1UEC A;  1YNZ A;  4IUQ A;  3VS5 A;  2EIF A;  2M51 A;  1KD1 U;  2DD5 A;  2OTL T;  1NG2 A;  3SD4 A;  1OYX A;  4C92 C;  2CP6 A;  4KT0 E;  3HHT B;  5GMK m;  3HPW A;  2LT1 A;  4QKU A;  1ZSZ B;  4M7A D;  4J6W A;  1VQN Q;  4F7U B;  1YIT A;  3EGU A;  2EGA A;  1H8K A;  1R0B G;  2EPD A;  4J5Y A;  3HRU A;  4M75 G;  4JRI A;  1VQ6 Q;  4KUL A;  1S1N A;  2YT6 A;  1JRI A;  1RAI B;  2H3J A;  2KVQ G;  1MMG A;  2FRW A;  3CBP A;  2COZ A;  2V8J A;  5CIU A;  1VQP T;  2AZS A;  1M1K U;  5IHK A;  4JJN K;  3L2U A;  1D0Y A;  1ZSZ C;  1Q86 R;  4AMC A;  2P0Q A;  3OMC A;  4KUD K;  4FIB A;  2YUQ A;  1BIB A;  2DRK A;  4KGZ B;  4ORZ A;  2K2V A;  2L2P A;  1ZHI A;  2LCC A;  3BE3 A;  1OU8 A;  2DTH A;  2EAY A;  3QDR B;  3G7Z A;  3NPF A;  1SRM A;  2KK4 A;  3GPL A;  2LJ1 A;  2LNH B;  3G1J A;  1YJN Q;  1SSH A;  5DM7 R;  2HZY A;  2CP2 A;  1YIT T;  2A3L A;  3CCE A;  4J8O A;  5CCA A;  2RJF A;  5GAN 6;  3G4S T;  3CC4 T;  1YBY A;  3CCQ A;  2XU8 A;  4J7F A;  5D6X A;  3DLL A;  1Y57 A;  1AEY A;  4Z89 A;  1M4Z A;  1NEB A;  4IIO A;  2GBQ A;  4PKC C;  1W2B P;  3CCR A;  1PWT A;  1CSK A;  1VQK T;  1RL2 A;  4M77 B;  5CR2 A;  2SEM A;  4FYV B;  1YWP A;  2RPN A;  3QUI A;  2VVK A;  1RLP C;  2EVR A;  1AWJ A;  3X26 B;  4KGX B;  3QG1 A;  2YHT A;  5IAY A;  1TUD A;  4OMP A;  2JVV A;  4M7A C;  2KYB A;  3UT1 A;  5LJ5 e;  2EYX A;  4XK8 E;  2CZ1 B;  1J3T A;  3H0F A;  2CT4 A;  3FIF A;  4BDY A;  3R6N A;  2RF0 A;  4M77 C;  2JTF A;  3CCE T;  1M30 A;  1GCQ C;  3GF5 A;  3I55 A;  2YLB A;  1XNI A;  5FRO A;  3CCQ T;  3AT1 B;  1QCN A;  2E70 A;  2CSI A;  3GP8 A;  2JS2 A;  2E65 A;  1CKA A;  1BI2 A;  1ZUU A;  2DJQ A;  1QP2 A;  3M0T A;  1BKB A;  5GAN 2;  3CCR T;  3EGX A;  4X1V A;  5GAN h;  3LH0 A;  3JRZ A;  1T0H A;  1K8A R;  4ZN1 A;  2DVE A;  2VUB A;  1VQN A;  1M5Q 1;  4HCZ A;  3D7S B;  2GFU A;  3CCM Q;  2DER A;  1WIE A;  1QW1 A;  2KGT A;  4NL3 A;  3JCM J;  2PZ1 A;  3CQT A;  3SDZ A;  1XOV A;  2XKO C;  3P8D A;  1TUG B;  4NOY A;  5IN1 A;  3RES A;  5LJ3 h;  1WXU A;  1SHF A;  4PJO A;  2EQK A;  1PNJ A;  5LJ5 d;  4LN2 A;  2P0P A;  4KBM B;  3OS0 A;  3I55 T;  4J7I A;  4FM4 B;  3C95 A;  3JCM c;  5KYX B;  3JCM X;  4RKU E;  1WLP B;  3T9N A;  2DF6 A;  3C4S A;  4QQD A;  2QTV A;  1JXO A;  3VS4 A;  3CC2 Q;  4JRQ A;  1D3B B;  2KDS A;  1D1C A;  3FJ5 A;  4VUB A;  1U3O A;  4F17 A;  4C0D C;  5KE3 A;  4LDV A;  1NPR A;  1NM7 A;  2XMF A;  3LH5 A;  1D1B A;  1YJN A;  1QP3 A;  4LXC A;  2Z0W A;  1QVG A;  4DA4 A;  1VQN T;  2E5K A;  4EMK A;  3MP1 A;  3CD6 Q;  2EQU A;  4JLG A;  4L5G A;  1K73 C;  1VQ6 T;  2ED1 A;  3PMI A;  3FEO A;  3M9Q A;  1U8R A;  2DZC A;  2HSP A;  3CMA Q;  2LRQ A;  3OYK A;  1X43 A;  2X4W A;  2X3X D;  3CCS Q;  1KC8 C;  5GAN 5;  3ZL7 C;  2E64 A;  2LQW A;  2RB6 A;  4OMN A;  1ZLM A;  3CBM A;  5D6Y A;  2D8J A;  4A4E A;  1X2Q A;  2K6D A;  4RMO A;  4J9H A;  3I5R A;  2QAS A;  3RMQ A;  2KRN A;  4AFS C;  4PJL A;  1UUE A;  2J6O A;  3GNF B;  2PTK A;  3FJP A;  1VYT A;  5CKE A;  2BTT A;  1YJN T;  2QTX A;  5FWB A;  2EYW A;  1M3A A;  2Y4Y A;  2RQV A;  3JB9 H;  4PLI A;  2RN8 A;  3FDR A;  2VGN A;  1VUB A;  2DEQ A;  1XTD A;  3QYH B;  3VS0 A;  1N27 A;  1AT1 B;  4KRT A;  3L42 A;  2LDM A;  2KRO A;  2O9V A;  4JUV A;  4N0A A;  2ESW A;  3FC3 A;  4PJO G;  4PL6 A;  5KCH A;  1B34 A;  2O2O A;  1VQO Q;  3E1S A;  3OY9 A;  5CQX A;  3VYG A;  1KJW A;  1B07 A;  1I5L A;  1LOJ A;  1BI3 A;  2HCK A;  2I2L A;  1TUC A;  2GF7 A;  4FT4 A;  2FVU A;  3TQ7 P;  1FX7 A;  2LC4 A;  3E2U A;  1K0X A;  2M0Y A;  2RD1 A;  3CCM A;  4OMQ A;  1JBM A;  5J26 A;  2YSQ A;  3I9Q A;  1NJI C;  1Y96 B;  4M75 B;  4JRK A;  1VQM Q;  3WVD B;  1WJR A;  4ELY C;  3SWN C;  2K5F A;  2GQI A;  1W6X A;  1K4U S;  3OYH A;  4RTY A;  5GAM j;  1KHC A;  1JJ2 A;  4RTW A;  5HK0 A;  3G71 Q;  2L3S A;  3E9G A;  3CC2 A;  5EC7 A;  3OYB A;  2E4H A;  1Z9Z A;  1T3L A;  3MP8 A;  5GAN g;  2XD0 A;  4M75 C;  3IQL A;  2OTL Q;  2W0Z A;  2DMO A;  2H3E B;  3O8V A;  4RUG A;  5KYN A;  4F7U E;  4PJM A;  1KHI A;  2LCS A;  1K73 U;  1HSQ A;  4A4H A;  4DEX A;  1W70 A;  5I22 A;  3M58 A;  1IXD A;  3SB2 A;  3CCM T;  4E7L A;  1WNL A;  3CD6 A;  4M78 F;  2JXB A;  3JB9 F;  5IXF A;  1KC8 U;  1TH7 A;  2E5Q A;  1T0J A;  5LJ3 g;  1G5V A;  4OMO A;  2D6F A;  1VQP Q;  2DL5 A;  3CMA A;  3V8L A;  1OQK A;  1VQ7 Q;  2COW A;  1NBE B;  5GAO p;  3CCS A;  3EGD B;  3VS2 A;  4HKE A;  4C5H A;  1RAG B;  1TS9 A;  4QT7 A;  2GFA A;  2EBP A;  3LYI A;  1E6H A;  3PNW C;  1EIF A;  4PLL A;  2V1R A;  5CVI A;  2VKN A;  4IUP A;  1VIF A;  1B3Q A;  1UJ0 A;  2L3R A;  3CC2 T;  3BFM A;  3JCM b;  2RJD A;  5CK9 A;  3BY7 A;  3SEM A;  3THK A;  1Q82 C;  3FRN A;  1ARK A;  2MOX A;  1GCP A;  4KH0 B;  4F7U F;  1IGQ A;  1PRL C;  5GMK h;  4E7K A;  1WJQ A;  2JMC A;  3QJY A;  4M7D B;  1WA7 A;  2HBP A;  5LJ5 h;  3H0I A;  5GAN f;  3G4S Q;  2PQW A;  4M7A E;  3J80 E;  2NUT B;  3CC4 Q;  1QVG P;  3CD6 T;  4OML A;  1UGP B;  1RAE B;  2CH4 W;  3RKY A;  3M59 A;  2EWN A;  1M90 R;  1H92 A;  3NTK A;  3CMA T;  2OX7 A;  3R6O A;  4M77 E;  5FRM A;  1X01 A;  1V76 A;  3CCS T;  2O4X B;  1VQO A;  2LQK A;  2VC8 A;  4D6W A;  1RAH B;  2MPX C;  2OTJ A;  5KYW A;  1YI2 Q;  4M7D C;  3UAT A;  3REA B;  1NJI U;  3PFS A;  4JJD A;  4LUD A;  2ZPB B;  3UA6 A;  5DLQ E;  1EFN A;  2DAQ A;  4AG1 C;  3Q1J A;  4FYX B;  5GMK i;  1VQ9 T;  1X6O A;  4DOV A;  5LJ3 j;  3MJX A;  3JCM V;  3BW1 A;  2HQX A;  3S6W A;  3QYG B;  1O9S A;  1VQM A;  3OMG A;  4ZGJ B;  2GTO A;  4MZT A;  4O6J A;  1UTI A;  4M7A F;  2F2V A;  4M4Z A;  1OOT A;  1ZBJ A;  3SFM A;  5FRN A;  1M8M A;  2BZY A;  3BDL A;  3OQ5 A;  3G71 A;  3UF4 A;  1M1K R;  4XTV A;  4M77 F;  2ZPH B;  5D7U A;  3EG2 A;  4DEY A;  1QLY A;  2QQ9 A;  2KXD A;  4ZGE B;  3H41 A;  2E6Z A;  1VQO T;  4DQ2 A;  3E19 A;  4IUV A;  2KR3 A;  5GAO q;  2OTL A;  3MEV A;  1GL5 A;  2K5I A;  1C0M A;  5GAN 3;  1BI0 A;  4MDX A;  3BDU A;  4XU0 A;  2DL4 A;  4E7I A;  4YTL A;  7AT1 B;  1GBR A;  4N4H A;  5IHN A;  2EJF A;  3CCJ Q;  3CEY A;  3QDF A;  1K9M C;  4PJO D;  2EFI A;  4HCB A;  2PVO B;  3OYY A;  1JEG A;  4M78 B;  4MMK A;  1TU0 B;  3LWI A;  1VQP A;  2RQT A;  4BUG A;  5IHI A;  3RKX A;  2KQW A;  1VQ7 A;  3OYC A;  1WZO A;  3OS2 A;  4BE0 A;  1AWO A;  4PJN A;  4QVC A;  5CKD A;  1WHM A;  2I0N A;  2K5L A;  1Q82 U;  3G71 T;  5C6S A;  3VS3 A;  4L59 A;  2BZ8 A;  5CKF A;  1OUL A;  3KBG A;  3MPU B;  3EH1 A;  1N9S A;  4O5V A;  1M2V B;  1UE9 A;  3EGX B;  4M78 C;  2LX9 A;  3CPW S;  2J05 A;  1SG5 A;  4N4I A;  3GIB A;  1N8R R;  2RO0 A;  4XU3 A;  1ZUY A;  1BB9 A;  2PU9 B;  1QVF S;  1GFC A;  3SHW A;  3C12 A;  5A0L A;  3G4S A;  3TSZ A;  3CC4 A;  1RAB B;  3OYA A;  2FPF A;  1UB4 A;  4Q5W A;  1Q81 R;  4LE9 A;  2MYS A;  1X6B A;  1Q86 C;  3NGP A;  2GGR A;  1K76 A;  4FSX A;  1ACM B;  1MV3 A;  3TCJ A;  1VQK A;  1VQ7 T;  3H9N A;  2QAZ A;  2QQS A;  1WHJ A;  3PIP A;  1VIE A;  3L1A A;  3M0U A;  2DD4 A;  1VQ4 Q;  5A0G A;  2LX7 A;  3QZ5 B;  4QW2 A;  1IRE B;  2P4R A;  2O9S A;  3JCM Q;  1UGS B;  4OGE A;  4GBQ A;  1Z9Q A;  3DB4 A;  4MML A;  4OF1 A;  4FYY B;  2B86 A;  1KQS S;  3OYF A;  2DL8 A;  4HT8 A;  1O75 A;  1NPP A;  5M9O A;  1OZ2 A;  1Q7Y R;  3UPU A;  2EQM A;  3OYD A;  5LJ5 g;  1WQW A;  5DLO A;  1IZ6 A;  3V7R A;  2DNU A;  1WPY A;  1T3S A;  2XDB A;  2E3H A;  1I4K 1;  2LZ6 B;  1Y07 A;  2GQV A;  4JDS A;  4DBR A;  4V2S A;  4M7A B;  4PK4 A;  2VWF A;  3OW2 S;  3DKM A;  2KY9 A;  4J9F A;  2KT8 A;  4IKF A;  2EYZ A;  4BI8 B;  4WCI A;  2F69 A;  1VQL Q;  1W1F A;  2FZK B;  2WSE E;  3M0R A;  4OP0 A;  2ZCF B;  2JUF A;  3L2Z A;  3CCV Q;  1YI2 T;  3EG9 B;  2ED0 A;  1ABO A;  2DXC A;  2RMO A;  3L2R A;  2X3W D;  1M1F A;  2NUP B;  8AT1 B;  1K9M U;  2DIL A;  3OSV A;  5L23 A;  3JB9 J;  5C0M A;  3RKW A;  4E7H A;  1UGR B;  5KYU B;  1FWZ A;  4E47 A;  2M0O A;  4M75 E;  4FSS A;  3S3N A;  2FB7 A;  3CCJ A;  3M0P A;  3ZFJ A;  4BE2 A;  3OS1 A;  1TTH B;  3S3M A;  3X20 B;  2RQU A;  2V1Q A;  4XAX B;  1K1Z A;  3C0C A;  2EJG A;  1TSF A;  2DET A;  1NLO C;  2RK1 A;  2XDD A;  4XU2 A;  1PRM C;  1K8A C;  4IUU A;  4C92 A;  5LJ5 f;  4XTU A;  3TRE A;  4K11 A;  4PJJ A;  2P84 A;  3RMS A;  4QVD A;  1SF9 A;  4BY6 C;  5GMK j;  2DO3 A;  2BE9 B;  4CRI A;  4JPB W;  2DJZ A;  1FMW A;  2F5T X;  2BKD N;  4QQG A;  3H8Z A;  1XJW B;  4C8Q A;  1Q86 U;  2CP7 A;  5HCK A;  2X51 A;  4M75 F;  2DKG A;  4XTZ A;  3CCJ T;  1VQ6 A;  2LQN A;  3GNG A;  4FW1 A;  4C0D B;  1ZSZ A;  1BYM A;  1R0C B;  4E7Z A;  4F7U A;  5HY6 A;  3CCL Q;  3U23 A;  3QJ6 A;  2J6F A;  3EFO B;  3HKS A;  5I11 A;  3OBW A;  1I0C A;  2QDL A;  2QQB A;  3VS6 A;  1VQ8 Q;  1VQ4 A;  2F2X A;  3EFR A;  3EG0 A;  1HD3 A;  1M1G A;  2X35 A;  2ZPG B;  3RER A;  4C0F A;  3EH2 A;  1YN8 A;  2KBT A;  4M7D E;  3QXE B;  2K79 A;  1MMN A;  4A4G A;  2FHD A;  4Z02 A;  2KRS A;  4AG2 C;  2LT4 A;  3A5Z B;  1QCF A;  2PVG B;  3UWN A;  1Y7X A;  2DX1 A;  4JS5 A;  2YUO A;  1VQL A;  1SHG A;  4XU1 A;  3QKJ A;  2RNA A;  4LDU A;  2KRM A;  2ZPF B;  3PTA A;  1QVF A;  4PNO A;  1BIA A;  3CCV A;  1VQ5 T;  3N5B B;  1NEG A;  1VQ4 T;  2AHJ B;  1MV0 B;  4C92 G;  1G3W A;  3MO8 A;  1M8V A;  2DPP B;  1MND A;  1U1T A;  5I2S A;  2RQW A;  4M77 A;  2DXU A;  1RI0 A;  1VQ9 Q;  3P8B B;  1SPK A;  4E7S A;  1M3B A;  4FW2 A;  3QO3 A;  4M7D F;  2V8K A;  3JAM E;  4DOW A;  2HDA A;  4GY5 A;  4C8Q G;  4JZ3 A;  1K8A U;  5KH6 A;  1FMV A;  2DL3 A;  2EW3 A;  5L8R E;  3A1P A;  1D1A A;  2QXF A;  2K3X A;  2XIC A;  1MMA A;  1OU9 A;  3MEA A;  4LUE A;  2P0K A;  1VQL T;  2RQR A;  3NTH A;  3SWN B;  3UDC A;  4CI0 C;  3I35 A;  2QDY B;  1W4S A;  4DBH A;  3INZ A;  2O31 A;  3CCV T;  4C5E A;  1X6G A;  8ATC B;  3HSB A;  2PNI A;  3GBQ A;  1X27 A;  2CP5 A;  3JCM e;  4OMF B;  5GAM e;  2BZX A;  2K3B A;  2KE9 A;  1YHQ Q;  4M78 E;  1VYU A;  2D0Q B;  2VB6 A;  3LWH A;  1SEM A;  5GJV B;  4PFP A;  3DB3 A;  3MP6 A;  2XG8 D;  2XHC A;  2RJC A;  3CCL A;  2MF2 A;  3M4G A;  1NLP C;  3PMT A;  1IGU A;  2KI7 A;  4IUR A;  1VQ8 A;  2RA2 A;  4J9E A;  3VYH B;  4NL2 A;  4E6R A;  3DLM A;  1JXM A;  1RAA B;  2CZ0 B;  2J6K A;  5KYX A;  4C0Z A;  1WX6 A;  5KYY B;  4HT9 A;  2OI3 A;  1JO8 A;  3KFV A;  4JS4 A;  3L2Q A;  1PM3 A;  3MHX A;  4PFO A;  1D3B A;  3JB9 I;  2LP5 A;  2KSS A;  4D8D A;  2RM4 A;  4R0K A;  1MNE A;  1PCX A;  1X75 C;  1LNX A;  2AZV A;  4ESR A;  1H3H A;  2OAW A;  2O88 A;  2OAU A;  3JCM d;  2HKN A;  1MGQ A;  2D0N A;  5GAM d;  2JJ9 A;  3CCL T;  2QQR A;  4A53 A;  1OX9 A;  1EZZ B;  4JZ4 A;  4BB7 A;  4F04 B;  1M27 C;  1WHK A;  1TG0 A;  3VRZ A;  1VQ8 T;  2YXY A;  2VAS A;  2L3Q A;  3VUZ A;  4RTV A;  2ABL A;  2CKK A;  3OYE A;  2HKQ B;  2OJ2 A;  1YIJ Q;  1VQ9 A;  4EPC A;  1B7T A;  3J7A F;  3JCM P;  2IVW A;  1TOV A;  1E6G A;  4MZM A;  4ZN3 A;  2YLC A;  1M90 C;  2QQA A;  1BK2 A;  1D0X A;  1ZUK A;  4ELZ C;  2A36 A;  1AVZ C;  2KT1 A;  3ULR B;  2V8I A;  3HRS A;  2GCX A;  4BI3 A;  1U5S A;  4MDW A;  2LTO A;  3MEU A;  2MI6 A;  2ZZD A;  1U1S A;  2LVM A;  2H8H A;  2JT4 A;  3HP9 A;  2V26 A;  5GAN j;  1PD1 A;  3QII A;  4PJO F;  3MET A;  2JM9 A;  1KG1 A;  1BCO A;  4DBQ A;  4LDY A;  2KEA A;  4XTY A;  1I07 A;  2MK5 A;  6AT1 B;  2YRV A;  1WXB A;  1D0Z A;  3CPW P;  2RHI A;  2M9U A;  2R5M A;  3CC7 Q;  3EG1 A;  2GTJ A;  2JN0 A;  2ZGW A;  1SRL A;  1UJY A;  5DY9 A;  1QVF P;  2FRY A;  3PE0 A;  4R55 A;  2MWP A;  3A8M B;  1KD1 R;  2C0I A;  4X34 A;  2MCN A;  1S72 T;  2ZPI B;  2KXC A;  2M1H A;  2ROL A;  5CO7 A;  1WHH A;  4JLI A;  1YHQ A;  1AZG B;  1HJD A;  1LVK A;  2LNV A;  4ZNX A;  3H0H A;  2XID A;  1M1K C;  2DXT A;  2L8D A;  3VS1 A;  4Y28 E;  3TU4 K;  1Y96 A;  3M56 A;  4C92 D;  4M75 A;  1UGQ B;  2CUB A;  2WSC E;  5CKB A;  3TVT A;  1HXD A;  1PG5 B;  2X4X A;  2DBM A;  2JTE A;  1UEB A;  4OB3 B;  2R5A A;  3OYM A;  2BIV A;  1ZX6 A;  4E7J A;  4MZP A;  2QA4 Q;  2AKK A;  1KQS P;  5D6W A;  4C8Q D;  4F16 A;  3X28 B;  1WDX A;  9ATC B;  1QCO A;  2RJE A;  3V8J A;  3EAE A;  4CC2 A;  1VYV A;  4OB0 B;  4BDZ A;  1OI1 A;  2CGH A;  3OYN A;  1YHQ T;  1E7O A;  1UHF A;  5A0D A;  3CCU T;  1G3S A;  3OW2 P;  2J7I A;  4IUT A;  4A4F A;  2NLU A;  2YUN A;  1K9A A;  3EFS A;  1QWF A; 
#chains in the Genus database with same CATH homology
 2COY A;  1LPL A;  2CP7 A;  2CP6 A;  2CP0 A;  2HKQ B;  3RDV A;  2HL5 C;  1TXQ A;  2HKN A;  2M02 A;  2CP2 A;  1WHM A;  2QK0 A;  3TQ7 P;  1WHJ A;  1WHL A;  2COW A;  4B6M A;  1TOV A;  1WHH A;  2HL3 A;  3E2U A;  2E3H A;  2HQH A;  2CP5 A;  1IXD A;  2MPX C;  1WHG A;  2COZ A;  2CP3 A;  1WHK A;  2E3I A;  2Z0W A;  2E4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...