2V1RA

Yeast pex13 sh3 domain complexed with a peptide from pex14 at 2.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
DPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PAS20
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2v1rA00
1BB9A 2J6OA 2QDLA 2D0NA 4JJCA 1ABQA 3I9QA 1J3TA 2JMCA 3M0PA 2CUDA 4IIMA 2EKHA 4M4ZA 1WXUA 2DMOA 1YN8A 3M0RA 1OPLA 2KBTA 3ULRB 1G2BA 4RTWA 2FPDA 1T0HA 1FYNA 3M0TA 2K6DA 2LP5A 2KEAA 1QWFA 1QKXA 2ABLA 4CC2A 1WX6A 2W0ZA 4RTXA 1K0SA 2D8HA 1U06A 2LCSA 3REBB 4Z88A 1WFWA 4F17A 2ED0A 1RUWA 1UFFA 4LNPA 2OJ2A 3O5ZA 2I0NA 1X2KA 2YUPA 1UTIA 1LCKA 2KRNA 2DBMA 1I1JA 1GBQA 1GRIA 2DL4A 1H8KA 2EW3A 2L3SA 1NLOC 4Z89A 1CSKA 4J9IA 2FEIA 1PRLC 4AFSC 1AD5A 1X2QA 2KXDA 4X1VA 2AZSA 1M8MA 1WDXA 3VS3A 1MV0B 4DEXA 2EGAA 2LX7A 4KRTA 1GCQA 1V1CA 1M3CA 2YUQA 2CT4A 4D8DA 2O9SA 1E6GA 4RTZA 1SRMA 4LUEA 2RQUA 1G83A 1IO6A 4GLMA 2BZYA 2EVRA 1JEGA 5L23A 4J9CA 2KRSA 3EHQA 3EG3A 1ZUYA 4RTYA 1NM7A 1K0XA 2DL8A 4J9GA 2K2MA 1RLPC 1H3HA 1BBZA 1AWOA 1K9AA 2KT8A 3UA7A 4LE9A 3REAB 3FJ5A 2LJ3A 4Y92A 1AOJA 2OAWA 2J6KA 1A0NB 2HBWA 1AWWA 2DJQA 1QKWA 4J9DA 1UUEA 2RNAA 3VS1A 2JT4A 2AKKA 2DE0X 2KNBB 4HVUA 3TSZA 1JXMA 1KIKA 4HCKA 1ARKA 1X69A 2YUNA 2JXBA 1W70A 2IIMA 2RMOA 3VS5A 3M0SA 2F2XA 2A36A 2HSPA 4E6RA 1JQQA 4DEYA 1SRLA 2GTJA 1MUZA 1PKSA 2EYWA 3EG2A 3TSWA 2F2WA 1AEYA 1Y57A 4HVWA 2DL5A 4ESRA 1GCQC 4OMLA 1UE9A 1ZBJA 1YWOA 2AZVA 1OPKA 4EIKA 1JO8A 1RLQC 3QWYA 2ESWA 2FRYA 4R0KA 4JZ3A 2CDTA 1NEGA 2DNUA 5I11A 2DM1A 2KT1A 3RBBB 2JS2A 2DILA 2ECZA 1ZUKA 5I22A 2RQRA 2O9VA 1PHTA 2JM9A 2CT3A 3KFVA 3VS6A 1ZUUA 2BZ8A 1U5SA 5FWCA 2ROLA 1KJWA 4GBQA 4ORZA 2RQWA 4AFZC 3H41A 1B3QA 4FSSA 5ECAA 1CKAA 2PNIA 2JM8A 2L0AA 2CSIA 4Z8AA 1GFDA 2C0TA 4IIOA 1HJDA 2L3QA 3C0CA 2GGRA 1AWJA 1WXBA 3PE0A 1WXTA 2JS0A 5FWBA 3NMZC 4OMQA 3I5SA 2EPDA 1W6XA 1S1NA 2HDAA 2KXCA 2X3XD 3VS4A 2V1RA 2MCNA 1VYTA 1X27A 4RTTA 1U3OA 2C0IA 1VYVA 4AFQC 1HSQA 2GBQA 2VVKA 1WI7A 1M30A 2CREA 2DVJA 3I35A 4OMOA 4RTUA 1X6GA 2LMJA 2EYYA 2EGEA 2CUBA 3EHRA 1K4US 2M0YA 2O88A 3LH5A 2GNCA 2DL7A 1SHFA 2DX1A 1AZGB 2DRMA 2RN8A 3RNJA 2EGCA 1KSWA 1AVZC 5HCKA 1E6HA 2NUZA 2ED1A 3UF4A 1EFNA 1WIEA 4K11A 1OEBA 3JV3A 2FRWA 2ENMA 2A37A 1JXOA 3NPFA 3VS7A 1TUDA 2EYXA 2K3BA 4JJDA 1NLPC 1JU5C 5GJWB 2BZXA 4D8KA 3THKA 2L3PA 1KFZA 1GCPA 1M3AA 1Z9QA 1WYXA 2DL3A 4AG1C 2RQTA 1W1FA 2MOXA 2DLPA 1UGVA 1T3SA 2A08A 3VS0A 1HD3A 2FPFA 2HEQA 3CQTA 1MV3A 1OOTA 3H0FA 2E5KA 2XMFA 1B07A 3PVQA 2AKLA 2KYMA 2JMAA 1FMKA 2EYZA 3U23A 4OMMA 2KRMA 1UECA 1AZEA 2O2OA 2DYBA 2LQWA 2LZ6B 2CH4W 5IHNA 1ZX6A 2FG0A 3H0HA 3NHNA 2YSQA 4A63B 1K1ZA 2H8HA 5IHKA 1YP5A 4QT7A 2YDLA 2G6FX 1VYUA 2DRKA 4CC4B 1T0JA 2J7IA 5GJVB 3SEMA 1X43A 3M0QA 2JTEA 1Y0MA 3M0UA 4RTVA 2VWFA 1ZLMA 1SHGA 1YCSB 2AK5A 4J9EA 2FPEA 1SPKA 4F14A 1T3LA 4J9BA 1PRMC 1QWEA 2OI3A 2W10A 4AFUC 1UG1A 5IH2A 1BK2A 4CC3A 4OMPA 1UDLA 4JPBW 1E7OA 1UHCA 3PVLA 1ZSGA 2EBPA 3UA6A 3NGPA 2V1QA 4AG2C 1UJYA 1M3BA 2K79A 1QLYA 3VS2A 2K7AA 4F16A 2D8JA 3VRYA 1SEMA 3GBQA 1WA7A 2DF6A 2FO0A 2CH4A 2PZ1A 2RQVA 5EC7A 2LQNA 3H0IA 4RUGA 2KYBA 1NEBA 5IXFA 2PTKA 2C0OA 2A28A 2F2VA 2O31A 1BU1A 2YT6A 1ABOA 2RF0A 1M27C 1YWPA 1VA7A 3A98A 3EGUA 1YNZA 1GBRA 4WCIA 4JJBA 1PKTA 1PWTA 4ZNXA 1H92A 1TUCA 3EG1A 4J9FA 3SHWA 2CSQA 2J06A 2J6FA 2X3WD 5IXBA 1K76A 2JW4A 3EG0A 3QWXX 2NWMA 1PNJA 3R6NA 2KROA 2DBKA 1Z9ZA 5IHIA 1GFCA 2B86A 1AWXA 1NYGA 1QCFA 1UJ0A 1UHFA 2LNHB 2KR3A 2P4RA 1X6BA 2L2PA 2KE9A 1I0CA 2DA9A 2GQIA 1WLPB 2HCKA 2M51A 1CKBA 4LUDA 1TG0A 4J9HA 2LJ1A 1NYFA 1N5ZA 3VRZA 4LN2A 2BTTA 2ROTA 2YUOA 3I5RA 3UATA 2RPNA 2EQIA 2KGTA 3TVTA 1RI9A 1NG2A 2D1XA 2GTOA 2J05A 5FW9A 3IQLA 1GL5A 4JZ4A 1OV3A 1SSHA 2MIOA 2VKNA 2K9GA 2LJ0A 4HVVA 1XOVA 1I07A 2SEMA 4OMNA 4CC7A 2SRCA 4HXJA 3ZL7C
chains in the Genus database with same CATH superfamily
2BIVA 3CXCA 2D0NA 3M55A 4JJCA 1ABQA 2X35A 1B7TA 4ANJA 4QKUA 3DB4A 3I9QA 1Q81R 4PJMA 2EKHA 4M4ZA 1WXUA 5FROA 4R56A 4LD6A 2AT1B 2ZZDA 5KYXA 3CMAQ 4M78E 2JOYA 4FT4A 3DKMA 4EMGA 3OS5A 1VQ9Q 2DD4A 2FPDA 2BE7D 4MZMA 4HT9A 1FYNA 2LP5A 3HP9A 1IZ6A 3P8HA 3I56A 4JLIA 4C8QE 3MHXA 1K9MC 4Y91A 2O4XA 2D8HA 4LDYA 2E3IA 3QZ5B 1UFFA 5KYWB 4XTUA 2I0NA 2KRNA 2DBMA 1KC8C 4M75E 2DL4A 3V7CA 4M78C 4RCCA 1R0BG 4LDUA 1WNLA 2FEIA 1AD5A 3CC2Q 2FZKB 3V7SA 3H6ZA 5KYNA 3CCVA 1RACB 2WACA 2P0QA 3OYDA 2CP5A 1V1CA 1VQ9T 1KQSP 1XNIA 3D7SB 4LUEA 1I4K1 2ATCB 4C0FA 4FSXA 2LQKA 1IO6A 4GLMA 4ZGEB 5CO7A 4EMHA 5L23A 1NE8A 4M7AG 2QQAA 2AIRB 2VGMA 3EG3A 4RTYA 2DZ9A 4JRIA 4FYWB 4BD3A 1K9AA 4LDWA 3UA7A 2YXYA 2E6NA 4Y92A 2OX7A 4E7HA 1WHKA 1A0NB 3EH1A 1AT1B 1C0MA 3KXTA 2EJGA 1UUEA 1VQLQ 2AKKA 2KNBB 3H8ZA 1JXMA 2CZ0B 1Q7YR 4C92F 3HFNA 1KQSA 1KD1U 1RAGB 4N4GA 4BY6B 3HPWA 2DXTA 3EGDB 4E6RA 3I56T 4DEYA 4WTOB 4OGEA 3VU3C 3G7ZA 1PKSA 2EYWA 3JB9F 3EG2A 3TSWA 1Y57A 1OQKA 3OYAA 3CCMA 2P4TA 2NLUA 2VASA 4C5IA 2LRQA 1N8RR 1KG1A 4R0KA 2CDTA 3WVDB 1OX8A 2DNUA 4LXCA 2PVGB 1VQNQ 4XTVA 2JS2A 3RBBB 1TH7A 2ECZA 3CCVT 1D0YA 3L2VA 4MZTA 1YITA 2HSEB 3M53A 3JCMJ 3GIBA 2RHYA 2DK3A 3KFVA 1RAIB 2XG8D 4RKUE 4HCCA 2PNIA 1MMDA 2L0AA 4DBFA 2C0TA 1HJDA 2L3QA 2NYSA 1B34B 3RERA 3VYHB 1WXBA 3WVEB 3NMZC 4TVRA 3I5SA 2EPDA 3L2RA 3EAEA 4F7UE 4D6WA 2MCNA 1VYTA 1RABB 1YITQ 3QJ6A 3CXCS 1HSQA 1M1KU 5HY6A 3LWHA 1BCMA 4PJNA 2HD0A 2EGEA 2IPOB 2RJCA 3EHRA 5GANj 2WSFE 4L5GA 3LH5A 1K73U 2YLBA 1KD1C 2V26A 1JB0E 5DLQE 3CCMT 3J7AF 3JV3A 1UEBA 2HAXA 2ENMA 5LJ5h 3J80E 1NLPC 2K5LA 3THKA 2L3PA 2PVDB 2K3XA 3OSSC 4NS5A 2DKGA 4AG1C 1YITT 1X75C 4C0GA 1PCXA 4XU2A 4BI3A 3FB9A 5I2MA 3HSBA 4PJLA 2XKOC 3VS0A 3M4YA 2HMAA 2CP6A 4JLGA 2HKQB 1W2BP 1Y96B 1BI1A 3CCSA 3PVQA 1BI2A 3SWNB 5FLXE 1FMKA 2X9HA 3U23A 4OMMA 4BDYA 4BE0A 1HXDA 2DZCA 2GF7A 2KRMA 1Y07A 1K8AU 3HFOA 4C92A 4IUUA 3MCAB 2COWA 2YSQA 2E5QA 1NZ9A 1MNDA 4BDZA 4EDUA 2CZ6B 2FZCB 2E3HA 4CC4B 3OYIA 5GJVB 3CC7Q 2NUTB 2JTEA 3OYEA 3DLLA 4ZN1A 2VWFA 4A4GA 4E7JA 1SHGA 1YCSB 2DEQA 2VB6A 1W2BA 1TWBA 1OZ2A 2MF2A 2R5MA 4J9BA 4KGZB 4J7IA 1OYXA 2RHIA 4QQDA 1KQSS 4PFOA 4MDXA 1QWEA 1M1KC 4KBMB 2HQHA 1JRIA 1YCYA 4A4FA 2QG9B 4OMPA 1UDLA 1UHCA 1ZSGA 4PJOB 2K4YA 3UA6A 2GFUA 2V1QA 1K73C 4M7DF 1RAAB 2K79A 2KQWA 1QLYA 1VQ4Q 2D8JA 1SEMA 1WA7A 4M77B 2FO0A 5EC7A 2LQNA 3H0IA 5GAMe 1ZSZC 3GNGA 1XQHA 2RF0A 4IKFA 3EGUA 3CCST 3CCLQ 1GBRA 4FU6A 4JJBA 2QA4A 4M7AE 1PWTA 3I55Q 3RKXA 1H92A 2LQ8A 3MEAA 3SHWA 5CKHA 5CVIA 2L8DA 3EG0A 2NWMA 3OB9A 4FIBA 2DBKA 5IHIA 1QP3A 3PNWC 3PMTA 1GFCA 1Y96A 3X28B 4OGCA 4N0AC 3OY9A 2K5IA 4E7SA 4NL2A 1X6BA 1K8AC 3AHUA 2KE9A 3LX7A 4LUDA 2EIFA 2Z0WA 4J9HA 3ER0A 3PGGA 2ROTA 2YUOA 3I5RA 3R6OA 1OI1A 2RPNA 1QW1A 2EQIA 3OYFA 4C8QF 1TU0B 1NG2A 2GTOA 2NUTA 4A4EA 2OTJQ 2K5FA 2MIOA 2VKNA 2LJ0A 3LGLA 3M5AA 2DIQA 2SEMA 1YJWQ 3CCRA 3ZL7C 2E1HA 4XU3A 2J6OA 1WHLA 2QDLA 4QVDA 2HQEA 3G1JA 2QGGA 4O6JA 2CUDA 4FYYB 2IVWA 2VUBA 5IN1A 2OTLQ 2DMOA 1YN8A 3M0RA 1IREB 2X51A 3JCMg 1M90R 3M57A 4M78B 1U8RA 1T0HA 4N4HA 3M0TA 2DTIA 1PSFA 2KEAA 2QAZA 5LJ3e 2QA4T 1QKXA 4Z02A 2ABLA 4CC2A 1WX6A 3EGXB 1D3BA 3ZFJA 5GAOn 1YI2A 4C8QB 4RCBA 4AT1B 3OS0A 5LJ5j 3UWNA 3JCMe 3TCJA 5GAOm 3P8BB 5GANg 2HL3A 1I1JA 2LT4A 3RKWA 1UGQB 2KVQG 3NFCA 2JNGA 2JJ9A 1NLOC 4Z89A 4M75B 3ASKA 3ME9A 1PRLC 4AFSC 2MI6A 4X1VA 3CCJQ 1M8MA 1KHCA 4DEXA 2EGAA 2LX7A 4J6XA 1C1AA 5GANe 1VQOA 1C6VX 2Y90A 2RHXA 4HA8A 2R58A 3RUXA 1E6GA 4M7DA 3RDVA 3EH2A 2LTOA 4J9CA 1PM3A 5GAOr 1YJNA 3QKJA 2M02A 1W2BS 3CCRT 2I2LA 3PMIA 1K0XA 2IG0A 2K2MA 1H3HA 4E7IA 4V2SA 2DFUA 2RI5A 3REAB 3FJ5A 2LJ3A 3S3MA 4C92D 1OU9A 2DAQA 1IRXA 2J6KA 3OYHA 4ATOA 4J9DA 3CMAA 2RNAA 4B9WA 3OQ5A 2DJZA 2DE0X 1PSEA 1KIKA 4HCKA 4XAXB 4FW2A 2RJDA 1PG5B 2RMOA 4Y28E 5KYUA 3V7RA 3M0SA 3JB9D 1YHQQ 2F2XA 3CMEA 2A36A 2HSPA 4F04B 3JCMP 3V8LA 1JQQA 3M58A 1QVGP 1M8VA 2A7YA 1MUZA 1YI2T 5GAN7 4FL6A 3LLRA 3M54A 2COYA 1I8FA 1N9RA 1AEYA 2XHCA 2DL5A 4J6WA 2MYSA 2X4WA 3FRNA 5GMKm 2CP3A 4OMLA 1YWOA 2LCLA 1OPKA 1JO8A 7AT1B 1KQ2A 3JRZA 1RLQC 2HNIA 3CC2A 3A1PA 3OYNA 4J8OA 4C8QA 4MZPA 1QCOA 2EQKA 1NEGA 3VUZA 1LNXA 3M59A 2KT1A 3C4SA 2P0KA 1ZUKA 2RQRA 1VQOT 1PHTA 1UGRB 2FL7A 1YBYA 4IUTA 3VS6A 3CMEQ 1M4ZA 2BZ8A 5FWCA 2ROLA 3KUFA 4GBQA 2DXBA 4C92G 2C06A 2PQWA 2RQWA 2NUPB 3H41A 5ECAA 1CKAA 3MEUA 1YJNT 4GY5A 5LL6S 4Z8AA 9ATCB 1GFDA 4J83A 2XU8A 4IIOA 3C0CA 2RI3A 1RL2A 2YLCA 2JS0A 3JB9G 1W6XA 1S1NA 1TUGB 5HK0A 3OBYA 3JCMX 3CCQQ 3CMAT 3OBWA 1VQLA 1OZ3A 2HDAA 2RI2A 3G6EQ 2X3XD 3VS4A 4F7UB 2V1RA 5GAOq 2ZPEB 3H9NA 4RTTA 1TS9A 2C0IA 3OYKA 1VYVA 1WHHA 5KCOA 2VVKA 2DVJA 3FIFA 4OMOA 3JCMQ 1VQ8Q 3CMET 3CCUQ 3QYGB 4ZGDB 3HRSA 1K4US 4ZTJA 3J81E 2LVMA 1WZOA 3MO8A 5HCKA 2MWOA 4A4KA 2ED1A 3UF4A 1WIEA 3SDZA 1OEBA 3CC2T 2A37A 1JXOA 5KCHA 3VS7A 3MP1A 5KYYB 2K3BA 1YJ9Q 1VQNA 5GJWB 4ZGJB 5DY9A 1M3AA 3O8VA 1Z9QA 1QMCA 2CZ7B 1WYXA 1TOVA 2COZA 4II1A 3L2ZA 3V8JA 2DLPA 2A08A 5FU7C 1HD3A 5D6YA 3A8OB 2QK0A 3CQTA 4PJOD 4IUVA 1OOTA 1BYMA 2XMFA 2AKLA 2KYMA 4IUQA 2O2OA 2ZPIB 4M77D 2LZ6B 1M1GA 1Q86U 1G3YA 2RM4A 1NJIU 2FG0A 3QIIA 2EWNA 3JAME 4FW1A 3SD4A 2XDDA 5LJ5g 5KYWA 3LH0A 1VQLT 1RADB 2H8HA 5IHKA 2YDLA 2FB7A 2HZYA 2G6FX 2X4XA 2Y4XA 1T0JA 3SEMA 2V8KA 1X43A 3M0QA 1VIEA 4KUDK 1G8XA 4X9DA 1R8OB 4J9EA 2FPEA 1SPKA 4F14A 3N5BB 5LJ5e 2ZCFB 5GAMf 1ZSZB 2W10A 2QQ9A 1M1FA 5FU6C 4M7DD 4NL3A 4CC3A 1VQ5A 2HQXA 3CBMA 4XTWA 1HK9A 1QQJA 2K3YA 4AG2C 1UJYA 2A0FB 1M3BA 3VYGA 3JB9I 3META 1VQNT 2EQJA 3VUBA 2DXUA 3GBQA 2GFAA 1Q81U 3JCMc 2RQVA 4KH0B 2HKNA 1NEBA 1MMGA 5IXFA 2A28A 4ELZC 5J39A 2F5KA 3S6WA 4E47A 5FRMA 1VA7A 2KI7A 2XI9A 5AYFA 4PLLA 4ZNXA 2CKKA 3EG1A 4J9FA 1Q82R 4M7AB 4DBRA 3EGDA 2J06A 5IXBA 4HKEA 2KSSA 1VQ5Q 1PNJA 1UGSB 2RHUA 3MEWA 1QVGS 3QPHA 3T9NA 1V29B 2X4YA 3QBYA 1UJ0A 4M78D 2LNHB 3VJPA 2KY9A 3CC7A 1Q86C 2YWWA 1NJIC 1YFNA 4X34A 2DA9A 2GQIA 1WLPB 2HCKA 3BY7A 4M7DG 1IXDA 4R55A 1NYFA 2DD5A 4C8QD 4LN2A 3RKYA 1SKUB 1G3TA 3OYGA 1UGPB 2KGTA 3TVTA 4PJOF 2D1XA 1W4SA 4M75D 2JVVA 1ZBXA 2L89A 2MPXC 3CPWS 1VQ5T 1VQKA 1IGUA 5LJ3f 1VQ6Q 4M77F 4HXJA 2LX9A 1BB9A 1QCNA 1VQ4A 3EG9B 1B34A 4IIMA 2DYIA 5GAOl 1FWZA 2LC4A 3CC4Q 4BY6C 2YRVA 1K9MR 3PT9A 3RR6A 5I2SA 2KBTA 3ULRB 1G2BA 4PKCC 4XK8E 3EFOB 3BDLA 3G4SQ 1Q7YU 5GAN4 5CAIA 4ZN3A 3CCLA 4C92E 1Q81C 1KC8R 3M56A 1WHGA 1N6AA 3I55A 3HRTA 1QWFA 1WHMA 3OYBA 3OSVA 1JJ2P 2F69A 1U06A 3LW5E 3REBB 2X4JA 1WFWA 4F17A 4GLKA 1VQKQ 4DQ2A 1RUWA 1M2VB 3O5ZA 4C8QG 3M9QA 2DTOA 1X2KA 3PTAA 1UTIA 1RAEB 1GBQA 1GRIA 1XJWB 1H8KA 2L3SA 4QQ6A 4EMKB 3RIRA 1N8RU 3CC7T 2KXDA 3G71Q 5GAN8 3CC4T 4C92C 3JSCA 4RMOA 1MV0B 1GCQA 2E64A 1M3CA 1O9SA 2YUQA 1SF9A 3QJYA 3QDRB 1X01A 1XTDA 2QYZA 2O9SA 1NPRA 1FMWA 3E9FA 2RK2A 2OTJA 5GAOp 4FCYA 2CZ1B 1JJ2A 2EVRA 4OB1B 4OB0B 2KRSA 3PFSA 3EHQA 1ZUYA 2BKDN 1YJWA 1VQKT 1R0CB 3SWNA 1NM7A 3VV0A 4C0DC 2DL8A 3OA6A 1ZA2B 4BUGA 1FMVA 1RLPC 1VQ4T 3M4GA 4LE9A 1V76A 2OAWA 2OTLA 2HBWA 1FX7A 5GAMd 4M78F 1QKWA 2DJQA 4MMLA 5GMKl 3S3OA 2JUFA 5A0GA 3FDRA 1G5VA 3VS1A 4HVUA 1UB4A 1F1BB 2BE9B 1EIFA 1X69A 2YUNA 2JXBA 3L2QA 2IIMA 4JUVA 3CCLT 2DEUA 1M9SA 3VS5A 3L2WA 3I55T 4BE1A 2YHTA 1R77A 4E7LA 2WSCE 3QSUA 1VQMQ 3EFOA 3QHSA 2DTHA 4HCBA 1Q7YC 4PLIA 4M75F 1WJRA 3CBPA 4ESRA 3LYIA 1GCQC 4OMFB 1BIAA 3OMCA 2AZVA 4EIKA 4O5VA 2RH2A 4BE2A 2FRYA 3CCJA 3GOXA 4PJOA 2EYQA 3MP6A 1YIJQ 5I11A 2DM1A 1BI0A 1N9SA 5I22A 4IUPA 2RJEA 3L1AA 5FRNA 4M77A 1N8RC 2VYTA 4KGXB 3TREA 2RA2A 1ZUUA 2A3LA 4XQ3A 1KJWA 2DIGA 3CD6Q 2OTJT 2DERA 4ORZA 2EJ9A 2D9TA 2FYKA 4AFZC 4ME7A 1B3QA 2P84A 2YRDA 3OS2A 2JM8A 5KH6A 2CSIA 1YJWT 4DA4A 4X9CA 2XDPA 4VUBA 3JCMb 5FWBA 4XTXA 2VV5A 5KYXB 2OTLT 2QQBA 1VQPQ 3F70A 1MGQA 2MAMA 4E7KA 3TU4K 4JS4A 4EPCA 1KD1R 2GBQA 1HYOA 4OVAA 3FC3A 1BCOA 3OYMA 1WI7A 1YHQA 2CREA 2E6ZA 5LJ3d 2M16A 2O4XB 5A0DA 5CR2A 2O01E 2LMJA 2QTVA 3A8HB 2EYYA 4DOWA 2CUBA 2KMTA 2O88A 4PJOC 1G3SA 1SHFA 2DX1A 1IHWA 1QVPA 1AZGB 4B6MA 3JCMd 2DRMA 4PFZA 1AVZC 4E2FB 3BE3A 1EFNA 4K11A 1M2OA 1KK7A 2QEXQ 3JCMW 2FRWA 3CCJT 1TUDA 1H3ZA 2EYXA 4QVZA 3HRUA 1JU5C 2BZXA 3RMQA 2GQVA 2F5TX 2DL3A 5GANd 1RI0A 2RQTA 5KE2A 2MOXA 1G3WA 2QDYB 1UGVA 1OU8A 2KDSA 3QYHB 4JJNK 2FPFA 1S72A 1MV3A 3H0FA 2H3JA 5J26A 5CKBA 4M78A 2JMAA 2EYZA 1ZA1B 3E2UA 2H3EB 2PUKB 1UECA 1AZEA 3QXEB 3OS1A 2DYBA 2LQWA 4C5EA 2CH4W 3EGXA 5IHNA 3H0HA 1OX9A 4M7DC 3C95A 2CP0A 4F7UF 2QXFA 1JJ2S 3UPUA 3CCEA 5J3BA 3CCQA 2EQMA 2KK4A 3G6EA 4JRKA 5FU6B 3OW2P 2GCXA 4QT7A 1VYUA 2DRKA 5GMKh 2E70A 4M75A 3QDFA 1M1KR 2CYZB 4M7AD 1YHQT 1VQ8A 4RTVA 3CCUA 1I5LA 3CPWP 1QVGA 1ZLMA 3CBOA 2JTMA 1S72Q 2P0PA 5CQXA 1T3LA 1K73R 4YTLA 2OI3A 1LOJA 4AFUC 4HCZA 3OYCA 4A53A 1VQ7A 4JPBW 1E7OA 3BFMA 5GAN5 3PVLA 3CCEQ 2BUDA 5A2QE 3HHTB 3NGPA 2RO0A 2QQSA 1YJ9A 1N27A 2K7AA 4C5GA 3OW2A 1OULA 3VRYA 3DLMA 2L5QA 2CH4A 2PZ1A 2EJFA 1TTHB 4DBHA 1BI3A 5CIUA 2C0OA 2RJFA 4QQGA 4RG8A 5DLOA 4BB7A 2F2VA 3CPWA 1X6OA 1BU1A 2YT6A 1M5Q1 5I21A 1S72T 1M90U 1IB8A 1YWPA 2G3RA 4C8QC 4BACA 4JRQA 5GAN3 3A98A 1YNZA 4UC4A 4IURA 2B8AA 4OP0A 1PKTA 5GAMj 4J6YA 1U1SA 2DETA 3I56Q 1TUCA 1WJQA 1K8AR 2CSQA 2X3WD 3GP8A 1VQ7Q 2JW4A 3URGA 4M75C 3R6NA 3BW1A 4LD9K 3CCET 2B86A 4FT2A 3CCQT 3ZBDA 1NYGA 3UT1A 3Q1JA 3G6ET 1UHFA 3OYYA 4KUIA 1Q95G 1LJOA 2KR3A 2P4RA 2MWPA 4LDXA 2EAYA 3FLGA 1GXIE 1CKBA 1TG0A 1VQ8T 3CCUT 1N5ZA 3VRZA 3CCVQ 2XD0A 2BTTA 1Y7XA 3GLXA 1IGQA 3UATA 5L8RE 1WJSA 2JTFA 4HT8A 4XU0A 2J05A 3IQLA 4JZ4A 2QGFB 1SSFA 3SB2A 1VQ7T 1XOVA 2NUPA 1WGSA 4L6V5 4OMNA 1YJ9T 1EZZB 2XDBA 2M0OA 1J3TA 2JMCA 3M0PA 3HTRA 3C94A 3CEYA 3X26B 2R5AA 6AT1B 3PIPA 4JRPA 1OPLA 3MEVA 3KBGA 4BI4A 4RTWA 2QASA 3OMGA 4F7UA 2RHZA 4M7AF 3INZA 2K6DA 5DM7R 1BKBA 4C92B 2W0ZA 3A8MB 4RTXA 1K0SA 5HKCA 2R57A 2LCSA 2F1LA 2YRCA 4Z88A 3UDCA 4PNOA 2ED0A 4OB2B 3A8GB 1M90C 4LNPA 2OJ2A 2HBPA 3OYLA 4PJOG 2YUPA 1NBEB 1LCKA 5LJ3j 3CCMQ 2DPPB 4E7ZA 2EW3A 1NPPA 1QP2A 1IHVA 1CSKA 4J9IA 1H641 1TXQA 1X2QA 4M77G 2RK1A 2AZSA 1WDXA 2L3RA 3VS3A 1D0XA 1QVFP 4C0DB 1SG5A 4KRTA 5KYYA 2VGNA 4KULA 2CT4A 4D8DA 5LJ5d 5CKFA 5D7UA 4RG2A 4RTZA 1SRMA 4XU1A 3MJXA 2RQUA 1G83A 3X24B 2BZYA 1JEGA 4CI0C 1VQ6A 4CRIA 2K2VA 1MMAA 4A54A 4FYXB 4J9GA 4DBQA 1BBZA 5GAN6 1AWOA 2KT8A 2QQRA 5GMKj 4PFPA 4NOYA 1AOJA 3CC4A 4J5YA 2EKOA 2ZPHB 2PU9B 1AWWA 3GF5A 1QVFA 2JT4A 3TSZA 1VUBA 5CKEA 3G4SA 1ARKA 1W70A 3OW2S 4N4IA 3JB9H 5GAN2 1SRLA 1BIBA 1DJ7B 2GTJA 2CP7A 2F2WA 4ZTFA 4HVWA 3NTIA 1WQWA 2KAFA 4PJJA 2VXEA 1ZSZA 1VIFA 5EG2A 5KE3A 1UE9A 1ZBJA 4BI8B 4C5HA 3JCMf 1WHJA 3EFSA 3G71A 3NTHA 3QWYA 2ESWA 2Y4YA 4JZ3A 3CPFA 3QO3A 2ZPFB 2DILA 1LVKA 3A5ZB 2O9VA 4M78G 2JM9A 5GMKi 2CT3A 2MK5A 2PUOB 1U5SA 1AHJB 2D0QB 5GANf 1U1TA 4N0AA 4FSSA 1ZQ1A 2WSEE 3CCSQ 4PK4A 1VQ6T 1LPLA 4AMCA 3HKSA 2V8IA 2D6FA 4WF2A 3E1SA 2GGRA 2LNVA 1PD0A 1AWJA 3PE0A 5GAMg 1WXTA 4M7AA 4OMQA 4XTZA 3LWIA 4M75G 1KQ1A 4Q5WA 5HK3A 1O75A 2KXCA 2LT1A 4J7FA 4MMKA 3BDUA 5IT9E 3G4ST 3GPLA 1X27A 2VXFA 4B9XA 1U3OA 4AFQC 3C12A 4PL6A 1M30A 1D3BB 3NTKA 3I35A 5M9OA 1ZHIA 4RTUA 2M9UA 1X6GA 5C6SA 1D1BA 1VQMA 4DOVA 3JCMV 2M0YA 2GNCA 2DL7A 1D09B 2RN8A 3RNJA 2EGCA 1KSWA 3AT1B 1E6HA 2NUZA 3MPUB 8AT1B 2EFIA 5CKDA 2JZ2A 2VC8A 3G71T 2E4HA 1MHNA 2ZAEA 3NPFA 1YIJA 4KGVB 4JJDA 4FYVB 2XK0A 2JN0A 4D8KA 1KFZA 1GCPA 3EG9A 3QUIA 1PD1A 2OAUA 4M7DB 4ELYC 1W1FA 3RESA 5CQYA 3QG1A 3MKDA 3ZEHA 1T3SA 5CCAA 3CD6A 5D6WA 4M7AC 2HEQA 2E12A 4P5NA 4KT0E 2FZGB 3GNFB 2FHDA 2E5KA 1B07A 2QI2A 1I81A 2QA4Q 4KH1B 5GAMh 1Q82U 3QZ9B 4OF1A 1ZX6A 1TSFA 3NHNA 1D1CA 8ATCB 4A63B 2QTXA 1VQPA 2CGHA 2V8JA 1M2VA 2RB6A 1K1ZA 3JB9J 5C0MA 1EX4A 3DB3A 1YP5A 1VOMA 5KYUB 3SWNC 5LJ3g 1MNEA 2RD1A 2J7IA 4EMKA 1FXXA 1Y0MA 3M0UA 3EFRA 4JS5A 1RAHB 1MMNA 2M1HA 2ZPGB 1KHIA 1D0ZA 2AK5A 4OB3B 3P8DA 1VQMT 1QVFS 2AHJB 1PRMC 5AT1B 2EQUA 3L2UA 1UG1A 5IH2A 4PJOE 1BK2A 2PVOB 4XTYA 2QEXA 2EBPA 2CP2A 2XIDA 2LCCA 2DXCA 4L59A 3TQ7P 1ACMB 3CCRQ 2E41A 1YIJT 3SFMA 1PC0A 4M77E 3VS2A 2DVEA 4F16A 4F7UG 2DF6A 3FEOA 4RUGA 3MP8A 2KYBA 2MMPA 2PTKA 4A4HA 2FVUA 4FM4B 1K9MU 2HL5C 2O31A 1P92A 2ZGWA 1ABOA 3CD6T 5IAYA 2E65A 1M27C 3E19A 2E10A 1KC8U 4WCIA 4JDSA 2CS7A 4QVCA 5FU7B 5GMKe 1Q86R 2J6FA 4M77C 1NJIR 4EMKC 1K76A 3QWXX 3TEEA 3V8KA 1YI2Q 1Y71A 1D1AA 2XICA 4LDVA 2KROA 3X20B 1Z9ZA 5CK9A 1WQ7A 3LGFA 1VQPT 1AWXA 1QCFA 3OYJA 3HL8A 3CXCP 4M7DE 3A8LB 5D6XA 5LJ3h 1I5OB 3RMSA 3X25B 1Q82C 2L2PA 3PIOA 1RAFB 1I0CA 4MDWA 1JBMA 2M51A 3L42A 2LJ1A 2ZPBB 3JCMh 5A0LA 1VQ9A 1VQOQ 2K57A 2DO3A 3E9GA 3S3NA 1RI9A 2LDMA 4QW2A 4C0ZA 3VKIA 5FW9A 5LJ5f 1WPYA 1GL5A 1OV3A 1SSHA 2K9GA 4HVVA 3FJPA 2QEXT 1YJNQ 1I07A 3WXMB 4CC7A 2SRCA 5GANh
chains in the Genus database with same CATH topology
1BB9A 2J6OA 2QDLA 2D0NA 4JJCA 1ABQA 3I9QA 1J3TA 2JMCA 3M0PA 2CUDA 4IIMA 2EKHA 4M4ZA 1WXUA 2DMOA 1YN8A 3M0RA 1OPLA 2KBTA 3ULRB 1G2BA 4RTWA 2FPDA 1T0HA 1FYNA 3M0TA 2K6DA 2LP5A 2KEAA 1QWFA 1QKXA 2ABLA 4CC2A 1WX6A 2W0ZA 4RTXA 1K0SA 2D8HA 1U06A 2LCSA 3REBB 4Z88A 1WFWA 4F17A 2ED0A 1RUWA 1UFFA 4LNPA 2OJ2A 3O5ZA 2I0NA 1X2KA 2YUPA 1UTIA 1LCKA 2KRNA 2DBMA 1I1JA 1GBQA 1GRIA 2DL4A 1H8KA 2EW3A 2L3SA 1NLOC 4Z89A 1CSKA 4J9IA 2FEIA 1PRLC 4AFSC 1AD5A 1X2QA 2KXDA 4X1VA 2AZSA 1M8MA 1WDXA 3VS3A 1MV0B 4DEXA 2EGAA 2LX7A 4KRTA 1GCQA 1V1CA 1M3CA 2YUQA 2CT4A 4D8DA 2O9SA 1E6GA 4RTZA 1SRMA 4LUEA 2RQUA 1G83A 1IO6A 4GLMA 2BZYA 2EVRA 1JEGA 5L23A 4J9CA 2KRSA 3EHQA 3EG3A 1ZUYA 4RTYA 1NM7A 1K0XA 2DL8A 4J9GA 2K2MA 1RLPC 1H3HA 1BBZA 1AWOA 1K9AA 2KT8A 3UA7A 4LE9A 3REAB 3FJ5A 2LJ3A 4Y92A 1AOJA 2OAWA 2J6KA 1A0NB 2HBWA 1AWWA 2DJQA 1QKWA 4J9DA 1UUEA 2RNAA 3VS1A 2JT4A 2AKKA 2DE0X 2KNBB 4HVUA 3TSZA 1JXMA 1KIKA 4HCKA 1ARKA 1X69A 2YUNA 2JXBA 1W70A 2IIMA 2RMOA 3VS5A 3M0SA 2F2XA 2A36A 2HSPA 4E6RA 1JQQA 4DEYA 1SRLA 2GTJA 1MUZA 1PKSA 2EYWA 3EG2A 3TSWA 2F2WA 1AEYA 1Y57A 4HVWA 2DL5A 4ESRA 1GCQC 4OMLA 1UE9A 1ZBJA 1YWOA 2AZVA 1OPKA 4EIKA 1JO8A 1RLQC 3QWYA 2ESWA 2FRYA 4R0KA 4JZ3A 2CDTA 1NEGA 2DNUA 5I11A 2DM1A 2KT1A 3RBBB 2JS2A 2DILA 2ECZA 1ZUKA 5I22A 2RQRA 2O9VA 1PHTA 2JM9A 2CT3A 3KFVA 3VS6A 1ZUUA 2BZ8A 1U5SA 5FWCA 2ROLA 1KJWA 4GBQA 4ORZA 2RQWA 4AFZC 3H41A 1B3QA 4FSSA 5ECAA 1CKAA 2PNIA 2JM8A 2L0AA 2CSIA 4Z8AA 1GFDA 2C0TA 4IIOA 1HJDA 2L3QA 3C0CA 2GGRA 1AWJA 1WXBA 3PE0A 1WXTA 2JS0A 5FWBA 3NMZC 4OMQA 3I5SA 2EPDA 1W6XA 1S1NA 2HDAA 2KXCA 2X3XD 3VS4A 2V1RA 2MCNA 1VYTA 1X27A 4RTTA 1U3OA 2C0IA 1VYVA 4AFQC 1HSQA 2GBQA 2VVKA 1WI7A 1M30A 2CREA 2DVJA 3I35A 4OMOA 4RTUA 1X6GA 2LMJA 2EYYA 2EGEA 2CUBA 3EHRA 1K4US 2M0YA 2O88A 3LH5A 2GNCA 2DL7A 1SHFA 2DX1A 1AZGB 2DRMA 2RN8A 3RNJA 2EGCA 1KSWA 1AVZC 5HCKA 1E6HA 2NUZA 2ED1A 3UF4A 1EFNA 1WIEA 4K11A 1OEBA 3JV3A 2FRWA 2ENMA 2A37A 1JXOA 3NPFA 3VS7A 1TUDA 2EYXA 2K3BA 4JJDA 1NLPC 1JU5C 5GJWB 2BZXA 4D8KA 3THKA 2L3PA 1KFZA 1GCPA 1M3AA 1Z9QA 1WYXA 2DL3A 4AG1C 2RQTA 1W1FA 2MOXA 2DLPA 1UGVA 1T3SA 2A08A 3VS0A 1HD3A 2FPFA 2HEQA 3CQTA 1MV3A 1OOTA 3H0FA 2E5KA 2XMFA 1B07A 3PVQA 2AKLA 2KYMA 2JMAA 1FMKA 2EYZA 3U23A 4OMMA 2KRMA 1UECA 1AZEA 2O2OA 2DYBA 2LQWA 2LZ6B 2CH4W 5IHNA 1ZX6A 2FG0A 3H0HA 3NHNA 2YSQA 4A63B 1K1ZA 2H8HA 5IHKA 1YP5A 4QT7A 2YDLA 2G6FX 1VYUA 2DRKA 4CC4B 1T0JA 2J7IA 5GJVB 3SEMA 1X43A 3M0QA 2JTEA 1Y0MA 3M0UA 4RTVA 2VWFA 1ZLMA 1SHGA 1YCSB 2AK5A 4J9EA 2FPEA 1SPKA 4F14A 1T3LA 4J9BA 1PRMC 1QWEA 2OI3A 2W10A 4AFUC 1UG1A 5IH2A 1BK2A 4CC3A 4OMPA 1UDLA 4JPBW 1E7OA 1UHCA 3PVLA 1ZSGA 2EBPA 3UA6A 3NGPA 2V1QA 4AG2C 1UJYA 1M3BA 2K79A 1QLYA 3VS2A 2K7AA 4F16A 2D8JA 3VRYA 1SEMA 3GBQA 1WA7A 2DF6A 2FO0A 2CH4A 2PZ1A 2RQVA 5EC7A 2LQNA 3H0IA 4RUGA 2KYBA 1NEBA 5IXFA 2PTKA 2C0OA 2A28A 2F2VA 2O31A 1BU1A 2YT6A 1ABOA 2RF0A 1M27C 1YWPA 1VA7A 3A98A 3EGUA 1YNZA 1GBRA 4WCIA 4JJBA 1PKTA 1PWTA 4ZNXA 1H92A 1TUCA 3EG1A 4J9FA 3SHWA 2CSQA 2J06A 2J6FA 2X3WD 5IXBA 1K76A 2JW4A 3EG0A 3QWXX 2NWMA 1PNJA 3R6NA 2KROA 2DBKA 1Z9ZA 5IHIA 1GFCA 2B86A 1AWXA 1NYGA 1QCFA 1UJ0A 1UHFA 2LNHB 2KR3A 2P4RA 1X6BA 2L2PA 2KE9A 1I0CA 2DA9A 2GQIA 1WLPB 2HCKA 2M51A 1CKBA 4LUDA 1TG0A 4J9HA 2LJ1A 1NYFA 1N5ZA 3VRZA 4LN2A 2BTTA 2ROTA 2YUOA 3I5RA 3UATA 2RPNA 2EQIA 2KGTA 3TVTA 1RI9A 1NG2A 2D1XA 2GTOA 2J05A 5FW9A 3IQLA 1GL5A 4JZ4A 1OV3A 1SSHA 2MIOA 2VKNA 2K9GA 2LJ0A 4HVVA 1XOVA 1I07A 2SEMA 4OMNA 4CC7A 2SRCA 4HXJA 3ZL7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BB9 A;  2J6O A;  2QDL A;  2D0N A;  4JJC A;  1ABQ A;  3I9Q A;  1J3T A;  2JMC A;  3M0P A;  2CUD A;  4IIM A;  2EKH A;  4M4Z A;  1WXU A;  2DMO A;  1YN8 A;  3M0R A;  1OPL A;  2KBT A;  3ULR B;  1G2B A;  4RTW A;  2FPD A;  1T0H A;  1FYN A;  3M0T A;  2K6D A;  2LP5 A;  2KEA A;  1QWF A;  1QKX A;  2ABL A;  4CC2 A;  1WX6 A;  2W0Z A;  4RTX A;  1K0S A;  2D8H A;  1U06 A;  2LCS A;  3REB B;  4Z88 A;  1WFW A;  4F17 A;  2ED0 A;  1RUW A;  1UFF A;  4LNP A;  2OJ2 A;  3O5Z A;  2I0N A;  1X2K A;  2YUP A;  1UTI A;  1LCK A;  2KRN A;  2DBM A;  1I1J A;  1GBQ A;  1GRI A;  2DL4 A;  1H8K A;  2EW3 A;  2L3S A;  1NLO C;  4Z89 A;  1CSK A;  4J9I A;  2FEI A;  1PRL C;  4AFS C;  1AD5 A;  1X2Q A;  2KXD A;  4X1V A;  2AZS A;  1M8M A;  1WDX A;  3VS3 A;  1MV0 B;  4DEX A;  2EGA A;  2LX7 A;  4KRT A;  1GCQ A;  1V1C A;  1M3C A;  2YUQ A;  2CT4 A;  4D8D A;  2O9S A;  1E6G A;  4RTZ A;  1SRM A;  4LUE A;  2RQU A;  1G83 A;  1IO6 A;  4GLM A;  2BZY A;  2EVR A;  1JEG A;  5L23 A;  4J9C A;  2KRS A;  3EHQ A;  3EG3 A;  1ZUY A;  4RTY A;  1NM7 A;  1K0X A;  2DL8 A;  4J9G A;  2K2M A;  1RLP C;  1H3H A;  1BBZ A;  1AWO A;  1K9A A;  2KT8 A;  3UA7 A;  4LE9 A;  3REA B;  3FJ5 A;  2LJ3 A;  4Y92 A;  1AOJ A;  2OAW A;  2J6K A;  1A0N B;  2HBW A;  1AWW A;  2DJQ A;  1QKW A;  4J9D A;  1UUE A;  2RNA A;  3VS1 A;  2JT4 A;  2AKK A;  2DE0 X;  2KNB B;  4HVU A;  3TSZ A;  1JXM A;  1KIK A;  4HCK A;  1ARK A;  1X69 A;  2YUN A;  2JXB A;  1W70 A;  2IIM A;  2RMO A;  3VS5 A;  3M0S A;  2F2X A;  2A36 A;  2HSP A;  4E6R A;  1JQQ A;  4DEY A;  1SRL A;  2GTJ A;  1MUZ A;  1PKS A;  2EYW A;  3EG2 A;  3TSW A;  2F2W A;  1AEY A;  1Y57 A;  4HVW A;  2DL5 A;  4ESR A;  1GCQ C;  4OML A;  1UE9 A;  1ZBJ A;  1YWO A;  2AZV A;  1OPK A;  4EIK A;  1JO8 A;  1RLQ C;  3QWY A;  2ESW A;  2FRY A;  4R0K A;  4JZ3 A;  2CDT A;  1NEG A;  2DNU A;  5I11 A;  2DM1 A;  2KT1 A;  3RBB B;  2JS2 A;  2DIL A;  2ECZ A;  1ZUK A;  5I22 A;  2RQR A;  2O9V A;  1PHT A;  2JM9 A;  2CT3 A;  3KFV A;  3VS6 A;  1ZUU A;  2BZ8 A;  1U5S A;  5FWC A;  2ROL A;  1KJW A;  4GBQ A;  4ORZ A;  2RQW A;  4AFZ C;  3H41 A;  1B3Q A;  4FSS A;  5ECA A;  1CKA A;  2PNI A;  2JM8 A;  2L0A A;  2CSI A;  4Z8A A;  1GFD A;  2C0T A;  4IIO A;  1HJD A;  2L3Q A;  3C0C A;  2GGR A;  1AWJ A;  1WXB A;  3PE0 A;  1WXT A;  2JS0 A;  5FWB A;  3NMZ C;  4OMQ A;  3I5S A;  2EPD A;  1W6X A;  1S1N A;  2HDA A;  2KXC A;  2X3X D;  3VS4 A;  2V1R A;  2MCN A;  1VYT A;  1X27 A;  4RTT A;  1U3O A;  2C0I A;  1VYV A;  4AFQ C;  1HSQ A;  2GBQ A;  2VVK A;  1WI7 A;  1M30 A;  2CRE A;  2DVJ A;  3I35 A;  4OMO A;  4RTU A;  1X6G A;  2LMJ A;  2EYY A;  2EGE A;  2CUB A;  3EHR A;  1K4U S;  2M0Y A;  2O88 A;  3LH5 A;  2GNC A;  2DL7 A;  1SHF A;  2DX1 A;  1AZG B;  2DRM A;  2RN8 A;  3RNJ A;  2EGC A;  1KSW A;  1AVZ C;  5HCK A;  1E6H A;  2NUZ A;  2ED1 A;  3UF4 A;  1EFN A;  1WIE A;  4K11 A;  1OEB A;  3JV3 A;  2FRW A;  2ENM A;  2A37 A;  1JXO A;  3NPF A;  3VS7 A;  1TUD A;  2EYX A;  2K3B A;  4JJD A;  1NLP C;  1JU5 C;  5GJW B;  2BZX A;  4D8K A;  3THK A;  2L3P A;  1KFZ A;  1GCP A;  1M3A A;  1Z9Q A;  1WYX A;  2DL3 A;  4AG1 C;  2RQT A;  1W1F A;  2MOX A;  2DLP A;  1UGV A;  1T3S A;  2A08 A;  3VS0 A;  1HD3 A;  2FPF A;  2HEQ A;  3CQT A;  1MV3 A;  1OOT A;  3H0F A;  2E5K A;  2XMF A;  1B07 A;  3PVQ A;  2AKL A;  2KYM A;  2JMA A;  1FMK A;  2EYZ A;  3U23 A;  4OMM A;  2KRM A;  1UEC A;  1AZE A;  2O2O A;  2DYB A;  2LQW A;  2LZ6 B;  2CH4 W;  5IHN A;  1ZX6 A;  2FG0 A;  3H0H A;  3NHN A;  2YSQ A;  4A63 B;  1K1Z A;  2H8H A;  5IHK A;  1YP5 A;  4QT7 A;  2YDL A;  2G6F X;  1VYU A;  2DRK A;  4CC4 B;  1T0J A;  2J7I A;  5GJV B;  3SEM A;  1X43 A;  3M0Q A;  2JTE A;  1Y0M A;  3M0U A;  4RTV A;  2VWF A;  1ZLM A;  1SHG A;  1YCS B;  2AK5 A;  4J9E A;  2FPE A;  1SPK A;  4F14 A;  1T3L A;  4J9B A;  1PRM C;  1QWE A;  2OI3 A;  2W10 A;  4AFU C;  1UG1 A;  5IH2 A;  1BK2 A;  4CC3 A;  4OMP A;  1UDL A;  4JPB W;  1E7O A;  1UHC A;  3PVL A;  1ZSG A;  2EBP A;  3UA6 A;  3NGP A;  2V1Q A;  4AG2 C;  1UJY A;  1M3B A;  2K79 A;  1QLY A;  3VS2 A;  2K7A A;  4F16 A;  2D8J A;  3VRY A;  1SEM A;  3GBQ A;  1WA7 A;  2DF6 A;  2FO0 A;  2CH4 A;  2PZ1 A;  2RQV A;  5EC7 A;  2LQN A;  3H0I A;  4RUG A;  2KYB A;  1NEB A;  5IXF A;  2PTK A;  2C0O A;  2A28 A;  2F2V A;  2O31 A;  1BU1 A;  2YT6 A;  1ABO A;  2RF0 A;  1M27 C;  1YWP A;  1VA7 A;  3A98 A;  3EGU A;  1YNZ A;  1GBR A;  4WCI A;  4JJB A;  1PKT A;  1PWT A;  4ZNX A;  1H92 A;  1TUC A;  3EG1 A;  4J9F A;  3SHW A;  2CSQ A;  2J06 A;  2J6F A;  2X3W D;  5IXB A;  1K76 A;  2JW4 A;  3EG0 A;  3QWX X;  2NWM A;  1PNJ A;  3R6N A;  2KRO A;  2DBK A;  1Z9Z A;  5IHI A;  1GFC A;  2B86 A;  1AWX A;  1NYG A;  1QCF A;  1UJ0 A;  1UHF A;  2LNH B;  2KR3 A;  2P4R A;  1X6B A;  2L2P A;  2KE9 A;  1I0C A;  2DA9 A;  2GQI A;  1WLP B;  2HCK A;  2M51 A;  1CKB A;  4LUD A;  1TG0 A;  4J9H A;  2LJ1 A;  1NYF A;  1N5Z A;  3VRZ A;  4LN2 A;  2BTT A;  2ROT A;  2YUO A;  3I5R A;  3UAT A;  2RPN A;  2EQI A;  2KGT A;  3TVT A;  1RI9 A;  1NG2 A;  2D1X A;  2GTO A;  2J05 A;  5FW9 A;  3IQL A;  1GL5 A;  4JZ4 A;  1OV3 A;  1SSH A;  2MIO A;  2VKN A;  2K9G A;  2LJ0 A;  4HVV A;  1XOV A;  1I07 A;  2SEM A;  4OMN A;  4CC7 A;  2SRC A;  4HXJ A;  3ZL7 C; 
#chains in the Genus database with same CATH topology
 2BIV A;  3CXC A;  2D0N A;  3M55 A;  4JJC A;  1ABQ A;  2X35 A;  1B7T A;  4ANJ A;  4QKU A;  3DB4 A;  3I9Q A;  1Q81 R;  4PJM A;  2EKH A;  4M4Z A;  1WXU A;  5FRO A;  4R56 A;  4LD6 A;  2AT1 B;  2ZZD A;  5KYX A;  3CMA Q;  4M78 E;  2JOY A;  4FT4 A;  3DKM A;  4EMG A;  3OS5 A;  1VQ9 Q;  2DD4 A;  2FPD A;  2BE7 D;  4MZM A;  4HT9 A;  1FYN A;  2LP5 A;  3HP9 A;  1IZ6 A;  3P8H A;  3I56 A;  4JLI A;  4C8Q E;  3MHX A;  1K9M C;  4Y91 A;  2O4X A;  2D8H A;  4LDY A;  2E3I A;  3QZ5 B;  1UFF A;  5KYW B;  4XTU A;  2I0N A;  2KRN A;  2DBM A;  1KC8 C;  4M75 E;  2DL4 A;  3V7C A;  4M78 C;  4RCC A;  1R0B G;  4LDU A;  1WNL A;  2FEI A;  1AD5 A;  3CC2 Q;  2FZK B;  3V7S A;  3H6Z A;  5KYN A;  3CCV A;  1RAC B;  2WAC A;  2P0Q A;  3OYD A;  2CP5 A;  1V1C A;  1VQ9 T;  1KQS P;  1XNI A;  3D7S B;  4LUE A;  1I4K 1;  2ATC B;  4C0F A;  4FSX A;  2LQK A;  1IO6 A;  4GLM A;  4ZGE B;  5CO7 A;  4EMH A;  5L23 A;  1NE8 A;  4M7A G;  2QQA A;  2AIR B;  2VGM A;  3EG3 A;  4RTY A;  2DZ9 A;  4JRI A;  4FYW B;  4BD3 A;  1K9A A;  4LDW A;  3UA7 A;  2YXY A;  2E6N A;  4Y92 A;  2OX7 A;  4E7H A;  1WHK A;  1A0N B;  3EH1 A;  1AT1 B;  1C0M A;  3KXT A;  2EJG A;  1UUE A;  1VQL Q;  2AKK A;  2KNB B;  3H8Z A;  1JXM A;  2CZ0 B;  1Q7Y R;  4C92 F;  3HFN A;  1KQS A;  1KD1 U;  1RAG B;  4N4G A;  4BY6 B;  3HPW A;  2DXT A;  3EGD B;  4E6R A;  3I56 T;  4DEY A;  4WTO B;  4OGE A;  3VU3 C;  3G7Z A;  1PKS A;  2EYW A;  3JB9 F;  3EG2 A;  3TSW A;  1Y57 A;  1OQK A;  3OYA A;  3CCM A;  2P4T A;  2NLU A;  2VAS A;  4C5I A;  2LRQ A;  1N8R R;  1KG1 A;  4R0K A;  2CDT A;  3WVD B;  1OX8 A;  2DNU A;  4LXC A;  2PVG B;  1VQN Q;  4XTV A;  2JS2 A;  3RBB B;  1TH7 A;  2ECZ A;  3CCV T;  1D0Y A;  3L2V A;  4MZT A;  1YIT A;  2HSE B;  3M53 A;  3JCM J;  3GIB A;  2RHY A;  2DK3 A;  3KFV A;  1RAI B;  2XG8 D;  4RKU E;  4HCC A;  2PNI A;  1MMD A;  2L0A A;  4DBF A;  2C0T A;  1HJD A;  2L3Q A;  2NYS A;  1B34 B;  3RER A;  3VYH B;  1WXB A;  3WVE B;  3NMZ C;  4TVR A;  3I5S A;  2EPD A;  3L2R A;  3EAE A;  4F7U E;  4D6W A;  2MCN A;  1VYT A;  1RAB B;  1YIT Q;  3QJ6 A;  3CXC S;  1HSQ A;  1M1K U;  5HY6 A;  3LWH A;  1BCM A;  4PJN A;  2HD0 A;  2EGE A;  2IPO B;  2RJC A;  3EHR A;  5GAN j;  2WSF E;  4L5G A;  3LH5 A;  1K73 U;  2YLB A;  1KD1 C;  2V26 A;  1JB0 E;  5DLQ E;  3CCM T;  3J7A F;  3JV3 A;  1UEB A;  2HAX A;  2ENM A;  5LJ5 h;  3J80 E;  1NLP C;  2K5L A;  3THK A;  2L3P A;  2PVD B;  2K3X A;  3OSS C;  4NS5 A;  2DKG A;  4AG1 C;  1YIT T;  1X75 C;  4C0G A;  1PCX A;  4XU2 A;  4BI3 A;  3FB9 A;  5I2M A;  3HSB A;  4PJL A;  2XKO C;  3VS0 A;  3M4Y A;  2HMA A;  2CP6 A;  4JLG A;  2HKQ B;  1W2B P;  1Y96 B;  1BI1 A;  3CCS A;  3PVQ A;  1BI2 A;  3SWN B;  5FLX E;  1FMK A;  2X9H A;  3U23 A;  4OMM A;  4BDY A;  4BE0 A;  1HXD A;  2DZC A;  2GF7 A;  2KRM A;  1Y07 A;  1K8A U;  3HFO A;  4C92 A;  4IUU A;  3MCA B;  2COW A;  2YSQ A;  2E5Q A;  1NZ9 A;  1MND A;  4BDZ A;  4EDU A;  2CZ6 B;  2FZC B;  2E3H A;  4CC4 B;  3OYI A;  5GJV B;  3CC7 Q;  2NUT B;  2JTE A;  3OYE A;  3DLL A;  4ZN1 A;  2VWF A;  4A4G A;  4E7J A;  1SHG A;  1YCS B;  2DEQ A;  2VB6 A;  1W2B A;  1TWB A;  1OZ2 A;  2MF2 A;  2R5M A;  4J9B A;  4KGZ B;  4J7I A;  1OYX A;  2RHI A;  4QQD A;  1KQS S;  4PFO A;  4MDX A;  1QWE A;  1M1K C;  4KBM B;  2HQH A;  1JRI A;  1YCY A;  4A4F A;  2QG9 B;  4OMP A;  1UDL A;  1UHC A;  1ZSG A;  4PJO B;  2K4Y A;  3UA6 A;  2GFU A;  2V1Q A;  1K73 C;  4M7D F;  1RAA B;  2K79 A;  2KQW A;  1QLY A;  1VQ4 Q;  2D8J A;  1SEM A;  1WA7 A;  4M77 B;  2FO0 A;  5EC7 A;  2LQN A;  3H0I A;  5GAM e;  1ZSZ C;  3GNG A;  1XQH A;  2RF0 A;  4IKF A;  3EGU A;  3CCS T;  3CCL Q;  1GBR A;  4FU6 A;  4JJB A;  2QA4 A;  4M7A E;  1PWT A;  3I55 Q;  3RKX A;  1H92 A;  2LQ8 A;  3MEA A;  3SHW A;  5CKH A;  5CVI A;  2L8D A;  3EG0 A;  2NWM A;  3OB9 A;  4FIB A;  2DBK A;  5IHI A;  1QP3 A;  3PNW C;  3PMT A;  1GFC A;  1Y96 A;  3X28 B;  4OGC A;  4N0A C;  3OY9 A;  2K5I A;  4E7S A;  4NL2 A;  1X6B A;  1K8A C;  3AHU A;  2KE9 A;  3LX7 A;  4LUD A;  2EIF A;  2Z0W A;  4J9H A;  3ER0 A;  3PGG A;  2ROT A;  2YUO A;  3I5R A;  3R6O A;  1OI1 A;  2RPN A;  1QW1 A;  2EQI A;  3OYF A;  4C8Q F;  1TU0 B;  1NG2 A;  2GTO A;  2NUT A;  4A4E A;  2OTJ Q;  2K5F A;  2MIO A;  2VKN A;  2LJ0 A;  3LGL A;  3M5A A;  2DIQ A;  2SEM A;  1YJW Q;  3CCR A;  3ZL7 C;  2E1H A;  4XU3 A;  2J6O A;  1WHL A;  2QDL A;  4QVD A;  2HQE A;  3G1J A;  2QGG A;  4O6J A;  2CUD A;  4FYY B;  2IVW A;  2VUB A;  5IN1 A;  2OTL Q;  2DMO A;  1YN8 A;  3M0R A;  1IRE B;  2X51 A;  3JCM g;  1M90 R;  3M57 A;  4M78 B;  1U8R A;  1T0H A;  4N4H A;  3M0T A;  2DTI A;  1PSF A;  2KEA A;  2QAZ A;  5LJ3 e;  2QA4 T;  1QKX A;  4Z02 A;  2ABL A;  4CC2 A;  1WX6 A;  3EGX B;  1D3B A;  3ZFJ A;  5GAO n;  1YI2 A;  4C8Q B;  4RCB A;  4AT1 B;  3OS0 A;  5LJ5 j;  3UWN A;  3JCM e;  3TCJ A;  5GAO m;  3P8B B;  5GAN g;  2HL3 A;  1I1J A;  2LT4 A;  3RKW A;  1UGQ B;  2KVQ G;  3NFC A;  2JNG A;  2JJ9 A;  1NLO C;  4Z89 A;  4M75 B;  3ASK A;  3ME9 A;  1PRL C;  4AFS C;  2MI6 A;  4X1V A;  3CCJ Q;  1M8M A;  1KHC A;  4DEX A;  2EGA A;  2LX7 A;  4J6X A;  1C1A A;  5GAN e;  1VQO A;  1C6V X;  2Y90 A;  2RHX A;  4HA8 A;  2R58 A;  3RUX A;  1E6G A;  4M7D A;  3RDV A;  3EH2 A;  2LTO A;  4J9C A;  1PM3 A;  5GAO r;  1YJN A;  3QKJ A;  2M02 A;  1W2B S;  3CCR T;  2I2L A;  3PMI A;  1K0X A;  2IG0 A;  2K2M A;  1H3H A;  4E7I A;  4V2S A;  2DFU A;  2RI5 A;  3REA B;  3FJ5 A;  2LJ3 A;  3S3M A;  4C92 D;  1OU9 A;  2DAQ A;  1IRX A;  2J6K A;  3OYH A;  4ATO A;  4J9D A;  3CMA A;  2RNA A;  4B9W A;  3OQ5 A;  2DJZ A;  2DE0 X;  1PSE A;  1KIK A;  4HCK A;  4XAX B;  4FW2 A;  2RJD A;  1PG5 B;  2RMO A;  4Y28 E;  5KYU A;  3V7R A;  3M0S A;  3JB9 D;  1YHQ Q;  2F2X A;  3CME A;  2A36 A;  2HSP A;  4F04 B;  3JCM P;  3V8L A;  1JQQ A;  3M58 A;  1QVG P;  1M8V A;  2A7Y A;  1MUZ A;  1YI2 T;  5GAN 7;  4FL6 A;  3LLR A;  3M54 A;  2COY A;  1I8F A;  1N9R A;  1AEY A;  2XHC A;  2DL5 A;  4J6W A;  2MYS A;  2X4W A;  3FRN A;  5GMK m;  2CP3 A;  4OML A;  1YWO A;  2LCL A;  1OPK A;  1JO8 A;  7AT1 B;  1KQ2 A;  3JRZ A;  1RLQ C;  2HNI A;  3CC2 A;  3A1P A;  3OYN A;  4J8O A;  4C8Q A;  4MZP A;  1QCO A;  2EQK A;  1NEG A;  3VUZ A;  1LNX A;  3M59 A;  2KT1 A;  3C4S A;  2P0K A;  1ZUK A;  2RQR A;  1VQO T;  1PHT A;  1UGR B;  2FL7 A;  1YBY A;  4IUT A;  3VS6 A;  3CME Q;  1M4Z A;  2BZ8 A;  5FWC A;  2ROL A;  3KUF A;  4GBQ A;  2DXB A;  4C92 G;  2C06 A;  2PQW A;  2RQW A;  2NUP B;  3H41 A;  5ECA A;  1CKA A;  3MEU A;  1YJN T;  4GY5 A;  5LL6 S;  4Z8A A;  9ATC B;  1GFD A;  4J83 A;  2XU8 A;  4IIO A;  3C0C A;  2RI3 A;  1RL2 A;  2YLC A;  2JS0 A;  3JB9 G;  1W6X A;  1S1N A;  1TUG B;  5HK0 A;  3OBY A;  3JCM X;  3CCQ Q;  3CMA T;  3OBW A;  1VQL A;  1OZ3 A;  2HDA A;  2RI2 A;  3G6E Q;  2X3X D;  3VS4 A;  4F7U B;  2V1R A;  5GAO q;  2ZPE B;  3H9N A;  4RTT A;  1TS9 A;  2C0I A;  3OYK A;  1VYV A;  1WHH A;  5KCO A;  2VVK A;  2DVJ A;  3FIF A;  4OMO A;  3JCM Q;  1VQ8 Q;  3CME T;  3CCU Q;  3QYG B;  4ZGD B;  3HRS A;  1K4U S;  4ZTJ A;  3J81 E;  2LVM A;  1WZO A;  3MO8 A;  5HCK A;  2MWO A;  4A4K A;  2ED1 A;  3UF4 A;  1WIE A;  3SDZ A;  1OEB A;  3CC2 T;  2A37 A;  1JXO A;  5KCH A;  3VS7 A;  3MP1 A;  5KYY B;  2K3B A;  1YJ9 Q;  1VQN A;  5GJW B;  4ZGJ B;  5DY9 A;  1M3A A;  3O8V A;  1Z9Q A;  1QMC A;  2CZ7 B;  1WYX A;  1TOV A;  2COZ A;  4II1 A;  3L2Z A;  3V8J A;  2DLP A;  2A08 A;  5FU7 C;  1HD3 A;  5D6Y A;  3A8O B;  2QK0 A;  3CQT A;  4PJO D;  4IUV A;  1OOT A;  1BYM A;  2XMF A;  2AKL A;  2KYM A;  4IUQ A;  2O2O A;  2ZPI B;  4M77 D;  2LZ6 B;  1M1G A;  1Q86 U;  1G3Y A;  2RM4 A;  1NJI U;  2FG0 A;  3QII A;  2EWN A;  3JAM E;  4FW1 A;  3SD4 A;  2XDD A;  5LJ5 g;  5KYW A;  3LH0 A;  1VQL T;  1RAD B;  2H8H A;  5IHK A;  2YDL A;  2FB7 A;  2HZY A;  2G6F X;  2X4X A;  2Y4X A;  1T0J A;  3SEM A;  2V8K A;  1X43 A;  3M0Q A;  1VIE A;  4KUD K;  1G8X A;  4X9D A;  1R8O B;  4J9E A;  2FPE A;  1SPK A;  4F14 A;  3N5B B;  5LJ5 e;  2ZCF B;  5GAM f;  1ZSZ B;  2W10 A;  2QQ9 A;  1M1F A;  5FU6 C;  4M7D D;  4NL3 A;  4CC3 A;  1VQ5 A;  2HQX A;  3CBM A;  4XTW A;  1HK9 A;  1QQJ A;  2K3Y A;  4AG2 C;  1UJY A;  2A0F B;  1M3B A;  3VYG A;  3JB9 I;  3MET A;  1VQN T;  2EQJ A;  3VUB A;  2DXU A;  3GBQ A;  2GFA A;  1Q81 U;  3JCM c;  2RQV A;  4KH0 B;  2HKN A;  1NEB A;  1MMG A;  5IXF A;  2A28 A;  4ELZ C;  5J39 A;  2F5K A;  3S6W A;  4E47 A;  5FRM A;  1VA7 A;  2KI7 A;  2XI9 A;  5AYF A;  4PLL A;  4ZNX A;  2CKK A;  3EG1 A;  4J9F A;  1Q82 R;  4M7A B;  4DBR A;  3EGD A;  2J06 A;  5IXB A;  4HKE A;  2KSS A;  1VQ5 Q;  1PNJ A;  1UGS B;  2RHU A;  3MEW A;  1QVG S;  3QPH A;  3T9N A;  1V29 B;  2X4Y A;  3QBY A;  1UJ0 A;  4M78 D;  2LNH B;  3VJP A;  2KY9 A;  3CC7 A;  1Q86 C;  2YWW A;  1NJI C;  1YFN A;  4X34 A;  2DA9 A;  2GQI A;  1WLP B;  2HCK A;  3BY7 A;  4M7D G;  1IXD A;  4R55 A;  1NYF A;  2DD5 A;  4C8Q D;  4LN2 A;  3RKY A;  1SKU B;  1G3T A;  3OYG A;  1UGP B;  2KGT A;  3TVT A;  4PJO F;  2D1X A;  1W4S A;  4M75 D;  2JVV A;  1ZBX A;  2L89 A;  2MPX C;  3CPW S;  1VQ5 T;  1VQK A;  1IGU A;  5LJ3 f;  1VQ6 Q;  4M77 F;  4HXJ A;  2LX9 A;  1BB9 A;  1QCN A;  1VQ4 A;  3EG9 B;  1B34 A;  4IIM A;  2DYI A;  5GAO l;  1FWZ A;  2LC4 A;  3CC4 Q;  4BY6 C;  2YRV A;  1K9M R;  3PT9 A;  3RR6 A;  5I2S A;  2KBT A;  3ULR B;  1G2B A;  4PKC C;  4XK8 E;  3EFO B;  3BDL A;  3G4S Q;  1Q7Y U;  5GAN 4;  5CAI A;  4ZN3 A;  3CCL A;  4C92 E;  1Q81 C;  1KC8 R;  3M56 A;  1WHG A;  1N6A A;  3I55 A;  3HRT A;  1QWF A;  1WHM A;  3OYB A;  3OSV A;  1JJ2 P;  2F69 A;  1U06 A;  3LW5 E;  3REB B;  2X4J A;  1WFW A;  4F17 A;  4GLK A;  1VQK Q;  4DQ2 A;  1RUW A;  1M2V B;  3O5Z A;  4C8Q G;  3M9Q A;  2DTO A;  1X2K A;  3PTA A;  1UTI A;  1RAE B;  1GBQ A;  1GRI A;  1XJW B;  1H8K A;  2L3S A;  4QQ6 A;  4EMK B;  3RIR A;  1N8R U;  3CC7 T;  2KXD A;  3G71 Q;  5GAN 8;  3CC4 T;  4C92 C;  3JSC A;  4RMO A;  1MV0 B;  1GCQ A;  2E64 A;  1M3C A;  1O9S A;  2YUQ A;  1SF9 A;  3QJY A;  3QDR B;  1X01 A;  1XTD A;  2QYZ A;  2O9S A;  1NPR A;  1FMW A;  3E9F A;  2RK2 A;  2OTJ A;  5GAO p;  4FCY A;  2CZ1 B;  1JJ2 A;  2EVR A;  4OB1 B;  4OB0 B;  2KRS A;  3PFS A;  3EHQ A;  1ZUY A;  2BKD N;  1YJW A;  1VQK T;  1R0C B;  3SWN A;  1NM7 A;  3VV0 A;  4C0D C;  2DL8 A;  3OA6 A;  1ZA2 B;  4BUG A;  1FMV A;  1RLP C;  1VQ4 T;  3M4G A;  4LE9 A;  1V76 A;  2OAW A;  2OTL A;  2HBW A;  1FX7 A;  5GAM d;  4M78 F;  1QKW A;  2DJQ A;  4MML A;  5GMK l;  3S3O A;  2JUF A;  5A0G A;  3FDR A;  1G5V A;  3VS1 A;  4HVU A;  1UB4 A;  1F1B B;  2BE9 B;  1EIF A;  1X69 A;  2YUN A;  2JXB A;  3L2Q A;  2IIM A;  4JUV A;  3CCL T;  2DEU A;  1M9S A;  3VS5 A;  3L2W A;  3I55 T;  4BE1 A;  2YHT A;  1R77 A;  4E7L A;  2WSC E;  3QSU A;  1VQM Q;  3EFO A;  3QHS A;  2DTH A;  4HCB A;  1Q7Y C;  4PLI A;  4M75 F;  1WJR A;  3CBP A;  4ESR A;  3LYI A;  1GCQ C;  4OMF B;  1BIA A;  3OMC A;  2AZV A;  4EIK A;  4O5V A;  2RH2 A;  4BE2 A;  2FRY A;  3CCJ A;  3GOX A;  4PJO A;  2EYQ A;  3MP6 A;  1YIJ Q;  5I11 A;  2DM1 A;  1BI0 A;  1N9S A;  5I22 A;  4IUP A;  2RJE A;  3L1A A;  5FRN A;  4M77 A;  1N8R C;  2VYT A;  4KGX B;  3TRE A;  2RA2 A;  1ZUU A;  2A3L A;  4XQ3 A;  1KJW A;  2DIG A;  3CD6 Q;  2OTJ T;  2DER A;  4ORZ A;  2EJ9 A;  2D9T A;  2FYK A;  4AFZ C;  4ME7 A;  1B3Q A;  2P84 A;  2YRD A;  3OS2 A;  2JM8 A;  5KH6 A;  2CSI A;  1YJW T;  4DA4 A;  4X9C A;  2XDP A;  4VUB A;  3JCM b;  5FWB A;  4XTX A;  2VV5 A;  5KYX B;  2OTL T;  2QQB A;  1VQP Q;  3F70 A;  1MGQ A;  2MAM A;  4E7K A;  3TU4 K;  4JS4 A;  4EPC A;  1KD1 R;  2GBQ A;  1HYO A;  4OVA A;  3FC3 A;  1BCO A;  3OYM A;  1WI7 A;  1YHQ A;  2CRE A;  2E6Z A;  5LJ3 d;  2M16 A;  2O4X B;  5A0D A;  5CR2 A;  2O01 E;  2LMJ A;  2QTV A;  3A8H B;  2EYY A;  4DOW A;  2CUB A;  2KMT A;  2O88 A;  4PJO C;  1G3S A;  1SHF A;  2DX1 A;  1IHW A;  1QVP A;  1AZG B;  4B6M A;  3JCM d;  2DRM A;  4PFZ A;  1AVZ C;  4E2F B;  3BE3 A;  1EFN A;  4K11 A;  1M2O A;  1KK7 A;  2QEX Q;  3JCM W;  2FRW A;  3CCJ T;  1TUD A;  1H3Z A;  2EYX A;  4QVZ A;  3HRU A;  1JU5 C;  2BZX A;  3RMQ A;  2GQV A;  2F5T X;  2DL3 A;  5GAN d;  1RI0 A;  2RQT A;  5KE2 A;  2MOX A;  1G3W A;  2QDY B;  1UGV A;  1OU8 A;  2KDS A;  3QYH B;  4JJN K;  2FPF A;  1S72 A;  1MV3 A;  3H0F A;  2H3J A;  5J26 A;  5CKB A;  4M78 A;  2JMA A;  2EYZ A;  1ZA1 B;  3E2U A;  2H3E B;  2PUK B;  1UEC A;  1AZE A;  3QXE B;  3OS1 A;  2DYB A;  2LQW A;  4C5E A;  2CH4 W;  3EGX A;  5IHN A;  3H0H A;  1OX9 A;  4M7D C;  3C95 A;  2CP0 A;  4F7U F;  2QXF A;  1JJ2 S;  3UPU A;  3CCE A;  5J3B A;  3CCQ A;  2EQM A;  2KK4 A;  3G6E A;  4JRK A;  5FU6 B;  3OW2 P;  2GCX A;  4QT7 A;  1VYU A;  2DRK A;  5GMK h;  2E70 A;  4M75 A;  3QDF A;  1M1K R;  2CYZ B;  4M7A D;  1YHQ T;  1VQ8 A;  4RTV A;  3CCU A;  1I5L A;  3CPW P;  1QVG A;  1ZLM A;  3CBO A;  2JTM A;  1S72 Q;  2P0P A;  5CQX A;  1T3L A;  1K73 R;  4YTL A;  2OI3 A;  1LOJ A;  4AFU C;  4HCZ A;  3OYC A;  4A53 A;  1VQ7 A;  4JPB W;  1E7O A;  3BFM A;  5GAN 5;  3PVL A;  3CCE Q;  2BUD A;  5A2Q E;  3HHT B;  3NGP A;  2RO0 A;  2QQS A;  1YJ9 A;  1N27 A;  2K7A A;  4C5G A;  3OW2 A;  1OUL A;  3VRY A;  3DLM A;  2L5Q A;  2CH4 A;  2PZ1 A;  2EJF A;  1TTH B;  4DBH A;  1BI3 A;  5CIU A;  2C0O A;  2RJF A;  4QQG A;  4RG8 A;  5DLO A;  4BB7 A;  2F2V A;  3CPW A;  1X6O A;  1BU1 A;  2YT6 A;  1M5Q 1;  5I21 A;  1S72 T;  1M90 U;  1IB8 A;  1YWP A;  2G3R A;  4C8Q C;  4BAC A;  4JRQ A;  5GAN 3;  3A98 A;  1YNZ A;  4UC4 A;  4IUR A;  2B8A A;  4OP0 A;  1PKT A;  5GAM j;  4J6Y A;  1U1S A;  2DET A;  3I56 Q;  1TUC A;  1WJQ A;  1K8A R;  2CSQ A;  2X3W D;  3GP8 A;  1VQ7 Q;  2JW4 A;  3URG A;  4M75 C;  3R6N A;  3BW1 A;  4LD9 K;  3CCE T;  2B86 A;  4FT2 A;  3CCQ T;  3ZBD A;  1NYG A;  3UT1 A;  3Q1J A;  3G6E T;  1UHF A;  3OYY A;  4KUI A;  1Q95 G;  1LJO A;  2KR3 A;  2P4R A;  2MWP A;  4LDX A;  2EAY A;  3FLG A;  1GXI E;  1CKB A;  1TG0 A;  1VQ8 T;  3CCU T;  1N5Z A;  3VRZ A;  3CCV Q;  2XD0 A;  2BTT A;  1Y7X A;  3GLX A;  1IGQ A;  3UAT A;  5L8R E;  1WJS A;  2JTF A;  4HT8 A;  4XU0 A;  2J05 A;  3IQL A;  4JZ4 A;  2QGF B;  1SSF A;  3SB2 A;  1VQ7 T;  1XOV A;  2NUP A;  1WGS A;  4L6V 5;  4OMN A;  1YJ9 T;  1EZZ B;  2XDB A;  2M0O A;  1J3T A;  2JMC A;  3M0P A;  3HTR A;  3C94 A;  3CEY A;  3X26 B;  2R5A A;  6AT1 B;  3PIP A;  4JRP A;  1OPL A;  3MEV A;  3KBG A;  4BI4 A;  4RTW A;  2QAS A;  3OMG A;  4F7U A;  2RHZ A;  4M7A F;  3INZ A;  2K6D A;  5DM7 R;  1BKB A;  4C92 B;  2W0Z A;  3A8M B;  4RTX A;  1K0S A;  5HKC A;  2R57 A;  2LCS A;  2F1L A;  2YRC A;  4Z88 A;  3UDC A;  4PNO A;  2ED0 A;  4OB2 B;  3A8G B;  1M90 C;  4LNP A;  2OJ2 A;  2HBP A;  3OYL A;  4PJO G;  2YUP A;  1NBE B;  1LCK A;  5LJ3 j;  3CCM Q;  2DPP B;  4E7Z A;  2EW3 A;  1NPP A;  1QP2 A;  1IHV A;  1CSK A;  4J9I A;  1H64 1;  1TXQ A;  1X2Q A;  4M77 G;  2RK1 A;  2AZS A;  1WDX A;  2L3R A;  3VS3 A;  1D0X A;  1QVF P;  4C0D B;  1SG5 A;  4KRT A;  5KYY A;  2VGN A;  4KUL A;  2CT4 A;  4D8D A;  5LJ5 d;  5CKF A;  5D7U A;  4RG2 A;  4RTZ A;  1SRM A;  4XU1 A;  3MJX A;  2RQU A;  1G83 A;  3X24 B;  2BZY A;  1JEG A;  4CI0 C;  1VQ6 A;  4CRI A;  2K2V A;  1MMA A;  4A54 A;  4FYX B;  4J9G A;  4DBQ A;  1BBZ A;  5GAN 6;  1AWO A;  2KT8 A;  2QQR A;  5GMK j;  4PFP A;  4NOY A;  1AOJ A;  3CC4 A;  4J5Y A;  2EKO A;  2ZPH B;  2PU9 B;  1AWW A;  3GF5 A;  1QVF A;  2JT4 A;  3TSZ A;  1VUB A;  5CKE A;  3G4S A;  1ARK A;  1W70 A;  3OW2 S;  4N4I A;  3JB9 H;  5GAN 2;  1SRL A;  1BIB A;  1DJ7 B;  2GTJ A;  2CP7 A;  2F2W A;  4ZTF A;  4HVW A;  3NTI A;  1WQW A;  2KAF A;  4PJJ A;  2VXE A;  1ZSZ A;  1VIF A;  5EG2 A;  5KE3 A;  1UE9 A;  1ZBJ A;  4BI8 B;  4C5H A;  3JCM f;  1WHJ A;  3EFS A;  3G71 A;  3NTH A;  3QWY A;  2ESW A;  2Y4Y A;  4JZ3 A;  3CPF A;  3QO3 A;  2ZPF B;  2DIL A;  1LVK A;  3A5Z B;  2O9V A;  4M78 G;  2JM9 A;  5GMK i;  2CT3 A;  2MK5 A;  2PUO B;  1U5S A;  1AHJ B;  2D0Q B;  5GAN f;  1U1T A;  4N0A A;  4FSS A;  1ZQ1 A;  2WSE E;  3CCS Q;  4PK4 A;  1VQ6 T;  1LPL A;  4AMC A;  3HKS A;  2V8I A;  2D6F A;  4WF2 A;  3E1S A;  2GGR A;  2LNV A;  1PD0 A;  1AWJ A;  3PE0 A;  5GAM g;  1WXT A;  4M7A A;  4OMQ A;  4XTZ A;  3LWI A;  4M75 G;  1KQ1 A;  4Q5W A;  5HK3 A;  1O75 A;  2KXC A;  2LT1 A;  4J7F A;  4MMK A;  3BDU A;  5IT9 E;  3G4S T;  3GPL A;  1X27 A;  2VXF A;  4B9X A;  1U3O A;  4AFQ C;  3C12 A;  4PL6 A;  1M30 A;  1D3B B;  3NTK A;  3I35 A;  5M9O A;  1ZHI A;  4RTU A;  2M9U A;  1X6G A;  5C6S A;  1D1B A;  1VQM A;  4DOV A;  3JCM V;  2M0Y A;  2GNC A;  2DL7 A;  1D09 B;  2RN8 A;  3RNJ A;  2EGC A;  1KSW A;  3AT1 B;  1E6H A;  2NUZ A;  3MPU B;  8AT1 B;  2EFI A;  5CKD A;  2JZ2 A;  2VC8 A;  3G71 T;  2E4H A;  1MHN A;  2ZAE A;  3NPF A;  1YIJ A;  4KGV B;  4JJD A;  4FYV B;  2XK0 A;  2JN0 A;  4D8K A;  1KFZ A;  1GCP A;  3EG9 A;  3QUI A;  1PD1 A;  2OAU A;  4M7D B;  4ELY C;  1W1F A;  3RES A;  5CQY A;  3QG1 A;  3MKD A;  3ZEH A;  1T3S A;  5CCA A;  3CD6 A;  5D6W A;  4M7A C;  2HEQ A;  2E12 A;  4P5N A;  4KT0 E;  2FZG B;  3GNF B;  2FHD A;  2E5K A;  1B07 A;  2QI2 A;  1I81 A;  2QA4 Q;  4KH1 B;  5GAM h;  1Q82 U;  3QZ9 B;  4OF1 A;  1ZX6 A;  1TSF A;  3NHN A;  1D1C A;  8ATC B;  4A63 B;  2QTX A;  1VQP A;  2CGH A;  2V8J A;  1M2V A;  2RB6 A;  1K1Z A;  3JB9 J;  5C0M A;  1EX4 A;  3DB3 A;  1YP5 A;  1VOM A;  5KYU B;  3SWN C;  5LJ3 g;  1MNE A;  2RD1 A;  2J7I A;  4EMK A;  1FXX A;  1Y0M A;  3M0U A;  3EFR A;  4JS5 A;  1RAH B;  1MMN A;  2M1H A;  2ZPG B;  1KHI A;  1D0Z A;  2AK5 A;  4OB3 B;  3P8D A;  1VQM T;  1QVF S;  2AHJ B;  1PRM C;  5AT1 B;  2EQU A;  3L2U A;  1UG1 A;  5IH2 A;  4PJO E;  1BK2 A;  2PVO B;  4XTY A;  2QEX A;  2EBP A;  2CP2 A;  2XID A;  2LCC A;  2DXC A;  4L59 A;  3TQ7 P;  1ACM B;  3CCR Q;  2E41 A;  1YIJ T;  3SFM A;  1PC0 A;  4M77 E;  3VS2 A;  2DVE A;  4F16 A;  4F7U G;  2DF6 A;  3FEO A;  4RUG A;  3MP8 A;  2KYB A;  2MMP A;  2PTK A;  4A4H A;  2FVU A;  4FM4 B;  1K9M U;  2HL5 C;  2O31 A;  1P92 A;  2ZGW A;  1ABO A;  3CD6 T;  5IAY A;  2E65 A;  1M27 C;  3E19 A;  2E10 A;  1KC8 U;  4WCI A;  4JDS A;  2CS7 A;  4QVC A;  5FU7 B;  5GMK e;  1Q86 R;  2J6F A;  4M77 C;  1NJI R;  4EMK C;  1K76 A;  3QWX X;  3TEE A;  3V8K A;  1YI2 Q;  1Y71 A;  1D1A A;  2XIC A;  4LDV A;  2KRO A;  3X20 B;  1Z9Z A;  5CK9 A;  1WQ7 A;  3LGF A;  1VQP T;  1AWX A;  1QCF A;  3OYJ A;  3HL8 A;  3CXC P;  4M7D E;  3A8L B;  5D6X A;  5LJ3 h;  1I5O B;  3RMS A;  3X25 B;  1Q82 C;  2L2P A;  3PIO A;  1RAF B;  1I0C A;  4MDW A;  1JBM A;  2M51 A;  3L42 A;  2LJ1 A;  2ZPB B;  3JCM h;  5A0L A;  1VQ9 A;  1VQO Q;  2K57 A;  2DO3 A;  3E9G A;  3S3N A;  1RI9 A;  2LDM A;  4QW2 A;  4C0Z A;  3VKI A;  5FW9 A;  5LJ5 f;  1WPY A;  1GL5 A;  1OV3 A;  1SSH A;  2K9G A;  4HVV A;  3FJP A;  2QEX T;  1YJN Q;  1I07 A;  3WXM B;  4CC7 A;  2SRC A;  5GAN h; 
#chains in the Genus database with same CATH homology
 1BB9 A;  2J6O A;  2QDL A;  2D0N A;  4JJC A;  1ABQ A;  3I9Q A;  1J3T A;  2JMC A;  3M0P A;  2CUD A;  4IIM A;  2EKH A;  4M4Z A;  1WXU A;  2DMO A;  1YN8 A;  3M0R A;  1OPL A;  2KBT A;  3ULR B;  1G2B A;  4RTW A;  2FPD A;  1T0H A;  1FYN A;  3M0T A;  2K6D A;  2LP5 A;  2KEA A;  1QWF A;  1QKX A;  2ABL A;  4CC2 A;  1WX6 A;  2W0Z A;  4RTX A;  1K0S A;  2D8H A;  1U06 A;  2LCS A;  3REB B;  4Z88 A;  1WFW A;  4F17 A;  2ED0 A;  1RUW A;  1UFF A;  4LNP A;  2OJ2 A;  3O5Z A;  2I0N A;  1X2K A;  2YUP A;  1UTI A;  1LCK A;  2KRN A;  2DBM A;  1I1J A;  1GBQ A;  1GRI A;  2DL4 A;  1H8K A;  2EW3 A;  2L3S A;  1NLO C;  4Z89 A;  1CSK A;  4J9I A;  2FEI A;  1PRL C;  4AFS C;  1AD5 A;  1X2Q A;  2KXD A;  4X1V A;  2AZS A;  1M8M A;  1WDX A;  3VS3 A;  1MV0 B;  4DEX A;  2EGA A;  2LX7 A;  4KRT A;  1GCQ A;  1V1C A;  1M3C A;  2YUQ A;  2CT4 A;  4D8D A;  2O9S A;  1E6G A;  4RTZ A;  1SRM A;  4LUE A;  2RQU A;  1G83 A;  1IO6 A;  4GLM A;  2BZY A;  2EVR A;  1JEG A;  5L23 A;  4J9C A;  2KRS A;  3EHQ A;  3EG3 A;  1ZUY A;  4RTY A;  1NM7 A;  1K0X A;  2DL8 A;  4J9G A;  2K2M A;  1RLP C;  1H3H A;  1BBZ A;  1AWO A;  1K9A A;  2KT8 A;  3UA7 A;  4LE9 A;  3REA B;  3FJ5 A;  2LJ3 A;  4Y92 A;  1AOJ A;  2OAW A;  2J6K A;  1A0N B;  2HBW A;  1AWW A;  2DJQ A;  1QKW A;  4J9D A;  1UUE A;  2RNA A;  3VS1 A;  2JT4 A;  2AKK A;  2DE0 X;  2KNB B;  4HVU A;  3TSZ A;  1JXM A;  1KIK A;  4HCK A;  1ARK A;  1X69 A;  2YUN A;  2JXB A;  1W70 A;  2IIM A;  2RMO A;  3VS5 A;  3M0S A;  2F2X A;  2A36 A;  2HSP A;  4E6R A;  1JQQ A;  4DEY A;  1SRL A;  2GTJ A;  1MUZ A;  1PKS A;  2EYW A;  3EG2 A;  3TSW A;  2F2W A;  1AEY A;  1Y57 A;  4HVW A;  2DL5 A;  4ESR A;  1GCQ C;  4OML A;  1UE9 A;  1ZBJ A;  1YWO A;  2AZV A;  1OPK A;  4EIK A;  1JO8 A;  1RLQ C;  3QWY A;  2ESW A;  2FRY A;  4R0K A;  4JZ3 A;  2CDT A;  1NEG A;  2DNU A;  5I11 A;  2DM1 A;  2KT1 A;  3RBB B;  2JS2 A;  2DIL A;  2ECZ A;  1ZUK A;  5I22 A;  2RQR A;  2O9V A;  1PHT A;  2JM9 A;  2CT3 A;  3KFV A;  3VS6 A;  1ZUU A;  2BZ8 A;  1U5S A;  5FWC A;  2ROL A;  1KJW A;  4GBQ A;  4ORZ A;  2RQW A;  4AFZ C;  3H41 A;  1B3Q A;  4FSS A;  5ECA A;  1CKA A;  2PNI A;  2JM8 A;  2L0A A;  2CSI A;  4Z8A A;  1GFD A;  2C0T A;  4IIO A;  1HJD A;  2L3Q A;  3C0C A;  2GGR A;  1AWJ A;  1WXB A;  3PE0 A;  1WXT A;  2JS0 A;  5FWB A;  3NMZ C;  4OMQ A;  3I5S A;  2EPD A;  1W6X A;  1S1N A;  2HDA A;  2KXC A;  2X3X D;  3VS4 A;  2V1R A;  2MCN A;  1VYT A;  1X27 A;  4RTT A;  1U3O A;  2C0I A;  1VYV A;  4AFQ C;  1HSQ A;  2GBQ A;  2VVK A;  1WI7 A;  1M30 A;  2CRE A;  2DVJ A;  3I35 A;  4OMO A;  4RTU A;  1X6G A;  2LMJ A;  2EYY A;  2EGE A;  2CUB A;  3EHR A;  1K4U S;  2M0Y A;  2O88 A;  3LH5 A;  2GNC A;  2DL7 A;  1SHF A;  2DX1 A;  1AZG B;  2DRM A;  2RN8 A;  3RNJ A;  2EGC A;  1KSW A;  1AVZ C;  5HCK A;  1E6H A;  2NUZ A;  2ED1 A;  3UF4 A;  1EFN A;  1WIE A;  4K11 A;  1OEB A;  3JV3 A;  2FRW A;  2ENM A;  2A37 A;  1JXO A;  3NPF A;  3VS7 A;  1TUD A;  2EYX A;  2K3B A;  4JJD A;  1NLP C;  1JU5 C;  5GJW B;  2BZX A;  4D8K A;  3THK A;  2L3P A;  1KFZ A;  1GCP A;  1M3A A;  1Z9Q A;  1WYX A;  2DL3 A;  4AG1 C;  2RQT A;  1W1F A;  2MOX A;  2DLP A;  1UGV A;  1T3S A;  2A08 A;  3VS0 A;  1HD3 A;  2FPF A;  2HEQ A;  3CQT A;  1MV3 A;  1OOT A;  3H0F A;  2E5K A;  2XMF A;  1B07 A;  3PVQ A;  2AKL A;  2KYM A;  2JMA A;  1FMK A;  2EYZ A;  3U23 A;  4OMM A;  2KRM A;  1UEC A;  1AZE A;  2O2O A;  2DYB A;  2LQW A;  2LZ6 B;  2CH4 W;  5IHN A;  1ZX6 A;  2FG0 A;  3H0H A;  3NHN A;  2YSQ A;  4A63 B;  1K1Z A;  2H8H A;  5IHK A;  1YP5 A;  4QT7 A;  2YDL A;  2G6F X;  1VYU A;  2DRK A;  4CC4 B;  1T0J A;  2J7I A;  5GJV B;  3SEM A;  1X43 A;  3M0Q A;  2JTE A;  1Y0M A;  3M0U A;  4RTV A;  2VWF A;  1ZLM A;  1SHG A;  1YCS B;  2AK5 A;  4J9E A;  2FPE A;  1SPK A;  4F14 A;  1T3L A;  4J9B A;  1PRM C;  1QWE A;  2OI3 A;  2W10 A;  4AFU C;  1UG1 A;  5IH2 A;  1BK2 A;  4CC3 A;  4OMP A;  1UDL A;  4JPB W;  1E7O A;  1UHC A;  3PVL A;  1ZSG A;  2EBP A;  3UA6 A;  3NGP A;  2V1Q A;  4AG2 C;  1UJY A;  1M3B A;  2K79 A;  1QLY A;  3VS2 A;  2K7A A;  4F16 A;  2D8J A;  3VRY A;  1SEM A;  3GBQ A;  1WA7 A;  2DF6 A;  2FO0 A;  2CH4 A;  2PZ1 A;  2RQV A;  5EC7 A;  2LQN A;  3H0I A;  4RUG A;  2KYB A;  1NEB A;  5IXF A;  2PTK A;  2C0O A;  2A28 A;  2F2V A;  2O31 A;  1BU1 A;  2YT6 A;  1ABO A;  2RF0 A;  1M27 C;  1YWP A;  1VA7 A;  3A98 A;  3EGU A;  1YNZ A;  1GBR A;  4WCI A;  4JJB A;  1PKT A;  1PWT A;  4ZNX A;  1H92 A;  1TUC A;  3EG1 A;  4J9F A;  3SHW A;  2CSQ A;  2J06 A;  2J6F A;  2X3W D;  5IXB A;  1K76 A;  2JW4 A;  3EG0 A;  3QWX X;  2NWM A;  1PNJ A;  3R6N A;  2KRO A;  2DBK A;  1Z9Z A;  5IHI A;  1GFC A;  2B86 A;  1AWX A;  1NYG A;  1QCF A;  1UJ0 A;  1UHF A;  2LNH B;  2KR3 A;  2P4R A;  1X6B A;  2L2P A;  2KE9 A;  1I0C A;  2DA9 A;  2GQI A;  1WLP B;  2HCK A;  2M51 A;  1CKB A;  4LUD A;  1TG0 A;  4J9H A;  2LJ1 A;  1NYF A;  1N5Z A;  3VRZ A;  4LN2 A;  2BTT A;  2ROT A;  2YUO A;  3I5R A;  3UAT A;  2RPN A;  2EQI A;  2KGT A;  3TVT A;  1RI9 A;  1NG2 A;  2D1X A;  2GTO A;  2J05 A;  5FW9 A;  3IQL A;  1GL5 A;  4JZ4 A;  1OV3 A;  1SSH A;  2MIO A;  2VKN A;  2K9G A;  2LJ0 A;  4HVV A;  1XOV A;  1I07 A;  2SEM A;  4OMN A;  4CC7 A;  2SRC A;  4HXJ A;  3ZL7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...