2V1RA

Yeast pex13 sh3 domain complexed with a peptide from pex14 at 2.1 a resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
DPSKLEFARALYDFVPENPEMEVALKKGDLMAILSKKDPLGRDSDWWKVRTKNGNIGYIPYNYIEII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords PEROXISOMAL MEMBRANE PROTEIN PAS20
publication title Structural Genomics of Yeast SH3 Domains
rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 67
sequence length 67
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2v1rA00
5IHNA 1WLPB 1QWEA 2RF0A 2LZ6B 2D0NA 1CKBA 1SRLA 1TUDA 2I0NA 1WYXA 3C0CA 1VYTA 2V1QA 1WXTA 2CT3A 1H3HA 1M30A 2L3QA 1RI9A 2VWFA 1AVZC 2YUNA 3UA7A 1YNZA 1AD5A 2GTOA 2K9GA 2YSQA 4IIMA 3EG0A 5IH2A 1K4US 1U06A 2KROA 1X43A 2A37A 4OMLA 1H92A 2DILA 2A36A 1N5ZA 2DVJA 2NWMA 1K0SA 2W10A 1NLOC 2HCKA 3VRZA 1AEYA 2DE0X 2B86A 3EG1A 1QKXA 2LJ0A 2D8JA 2BZ8A 4Z8AA 2EYWA 1WIEA 2L2PA 1X69A 3PVQA 1QKWA 2GGRA 2SRCA 5GJVB 1JO8A 2D8HA 4CC4B 4JJCA 2O2OA 2F2VA 2RN8A 4J9EA 1B07A 2AK5A 2AKLA 2F2WA 4OMMA 1NYFA 2JS0A 1JEGA 2OJ2A 1KJWA 1K76A 2CSQA 2O9SA 2YUPA 3FJ5A 1PNJA 2YUOA 1PWTA 3GBQA 4JZ3A 3I9QA 4Z88A 1PKTA 2JMAA 1M3AA 3M0UA 3PVLA 3VS1A 1ZX6A 1AWJA 2DNUA 2KEAA 3UATA 2J6FA 2LX7A 2RMOA 2EGAA 4HCKA 2CDTA 2AKKA 1WI7A 1ZUUA 2HSPA 4E6RA 3ULRB 2MOXA 4A63B 2RNAA 1KSWA 3UA6A 4OMOA 3M0RA 4DEYA 1AWXA 2CUDA 2OAWA 1NYGA 1WA7A 2KBTA 1GBRA 4FSSA 1GCQA 2CH4W 5HCKA 2FPFA 1Y0MA 1AOJA 1OPKA 1B3QA 1UJ0A 2VKNA 3VS6A 1UECA 2DL7A 1SHFA 2ED0A 4RTUA 2L0AA 2RQUA 1BB9A 1YWPA 2JMCA 1KIKA 2EGEA 3NPFA 1UTIA 1VYVA 2PTKA 2L3SA 1M3CA 1YCSB 2G6FX 2HEQA 3QWYA 2KT8A 1E7OA 2M0YA 5IHKA 1U3OA 4M4ZA 1PHTA 1AWWA 4F14A 4CC3A 2LMJA 3H0IA 1K0XA 1SEMA 1M3BA 5IHIA 2DF6A 2DL3A 2CSIA 1Z9QA 2EVRA 2FG0A 2O88A 1ABOA 5IXBA 2ROLA 2ROTA 2AZSA 2DYBA 4GLMA 2EYXA 1QLYA 3A98A 4HVWA 4X1VA 2QDLA 2DBMA 2FRYA 1UHCA 1AZEA 1MV0B 2KGTA 2PZ1A 4ORZA 1PRLC 2KRNA 1X27A 4JJDA 1T0HA 3NMZC 4RTZA 4DEXA 1WX6A 1JU5C 2EPDA 2KT1A 2GTJA 2H8HA 2JS2A 2W0ZA 2RQRA 2DLPA 3I5SA 1AWOA 1HJDA 2RPNA 4R0KA 2DRKA 2AZVA 1XOVA 5IXFA 1TG0A 2NUZA 2OI3A 5FW9A 3EG3A 4ESRA 4OMNA 3EHQA 3VRYA 2ECZA 2YUQA 5I11A 5FWBA 2KNBB 2O9VA 3SHWA 1M8MA 1OPLA 2YT6A 4LUDA 3M0SA 3VS3A 3O5ZA 2RQTA 2F2XA 1WXUA 2EQIA 3RBBB 2CUBA 3VS4A 1RUWA 1M27C 3H41A 2JTEA 2LCSA 4F16A 2JT4A 4LUEA 2RQWA 4RTVA 1QWFA 1W70A 3KFVA 2P4RA 2KYBA 5GJWB 2DA9A 4LN2A 1GCPA 2GBQA 2MIOA 4Z89A 1RLQC 3I35A 2FPEA 1ARKA 3RNJA 4K11A 3REAB 2YDLA 5FWCA 1T3LA 3TVTA 1IO6A 2EGCA 2DMOA 4EIKA 4IIOA 2BZXA 5I22A 2LJ3A 1HSQA 1Z9ZA 4F17A 1G83A 1T0JA 2LQNA 4LE9A 3H0HA 2EKHA 2DBKA 2HBWA 4JZ4A 2A08A 2ENMA 2DL4A 1QCFA 3THKA 1K9AA 1X6BA 2FPDA 2BZYA 1W1FA 2CREA 4HVVA 2DL5A 2DRMA 1E6HA 1YN8A 3EHRA 4Y92A 3ZL7C 1I0CA 1MUZA 1BU1A 1PKSA 1UE9A 1YP5A 5ECAA 4RTYA 3EG2A 4J9GA 2EBPA 1OOTA 1NG2A 1NM7A 3I5RA 2FRWA 2ED1A 4HXJA 4JPBW 4CC7A 1GRIA 4OMPA 3JV3A 1X2QA 2K2MA 1GL5A 2BTTA 4J9FA 4LNPA 4RTTA 1NLPC 2CH4A 2LJ1A 3IQLA 1UGVA 2J6KA 3VS5A 1SSHA 2K6DA 4D8KA 1WDXA 1TUCA 2C0IA 4J9IA 3LH5A 2FEIA 1E6GA 2O31A 1SHGA 1VA7A 2HDAA 1OEBA 3VS7A 3UF4A 1JXOA 1I1JA 3REBB 1Y57A 4RTXA 1GFDA 1UJYA 1A0NB 5EC7A 4RTWA 1SRMA 3TSZA 4AFUC 1YWOA 2EW3A 1KFZA 2KE9A 4AFSC 2DL8A 4CC2A 4J9CA 2E5KA 1MV3A 2VVKA 1CSKA 1EFNA 2K79A 2A28A 2RQVA 4J9DA 1K1ZA 2PNIA 1W6XA 4J9BA 1ABQA 1WXBA 2EYZA 4KRTA 2C0TA 2K3BA 2JW4A 2X3XD 2ESWA 1H8KA 1GCQC 1NEGA 3M0PA 2LP5A 2SEMA 1JXMA 1GFCA 4J9HA 2KXDA 2DJQA 3CQTA 3R6NA 1LCKA 1ZLMA 2FO0A 3TSWA 1JQQA 2EYYA 2M51A 3SEMA 1VYUA 3QWXX 2LQWA 4HVUA 2KRSA 4JJBA 1UDLA 2JXBA 2J7IA 3M0TA 3H0FA 2KR3A 4OMQA 4AFQC 4AG2C 2KRMA 3NHNA 1UG1A 2MCNA 1I07A 4RUGA 1V1CA 1NEBA 4ZNXA 1BK2A 1U5SA 2DX1A 1FYNA 1FMKA 2ABLA 2GNCA 1J3TA 2KXCA 1ZUKA 1OV3A 2L3PA 4GBQA 1BBZA 2D1XA 1CKAA 4AFZC 2J06A 2J6OA 2CT4A 1ZSGA 1AZGB 1UHFA 3EGUA 2JM9A 5L23A 2J05A 2V1RA 1RLPC 1PRMC 2KYMA 1T3SA 2C0OA 1ZBJA 2XMFA 1S1NA 2DM1A 3NGPA 2X3WD 4D8DA 2IIMA 2K7AA 3U23A 1UFFA 1X2KA 3VS0A 2JM8A 3VS2A 1G2BA 2LNHB 3PE0A 4QT7A 1HD3A 3M0QA 4AG1C 1SPKA 1GBQA 1ZUYA 1UUEA 1WFWA 1X6GA 4WCIA 2GQIA
chains in the Genus database with same CATH superfamily
5IHNA 2RF0A 2EQUA 1VQ6A 4C0ZA 4JRKA 3HFOA 1WXTA 5D7UA 4RG2A 2VWFA 5KYWA 2YUNA 3UA7A 2GTOA 2YSQA 1VQMA 1ZQ1A 1UEBA 5IH2A 1LOJA 2KROA 1X43A 5J3BA 4OMLA 2NWMA 2OTLQ 2RJCA 1AEYA 4X9DA 2YLCA 3EG1A 2IPOB 3SDZA 2EYWA 3X28B 3PVQA 3JB9F 1WHGA 3VV0A 2GGRA 1BIAA 1RAGB 2HD0A 4XK8E 2O2OA 2F2VA 3G71T 2RN8A 1VQ8T 1VQ9Q 2XI9A 4FYWB 1M1KC 4QQGA 2YHTA 1R8OB 2JS0A 1KQSA 4KGVB 4PJNA 5KE3A 2QA4T 3A8GB 2PVOB 1KJWA 2CSQA 4M78G 5CIUA 3HPWA 3OB9A 5LJ5d 4NL2A 3G7ZA 3CCVQ 1N8RC 1VQ7T 3PNWC 3GBQA 3R6OA 4FL6A 3MHXA 3A8MB 3N5BB 4E7LA 4JZ3A 2JTMA 1M3AA 3PVLA 1FMWA 4IUPA 5LJ3d 2ZPFB 2QTXA 2DNUA 2RI2A 3UATA 2EJFA 2LX7A 3CCSA 3SWNC 4ANJA 1ZUUA 4Y91A 4FM4B 3ULRB 2CZ6B 1OZ2A 3FJPA 2DTIA 1OQKA 4DEYA 2CUDA 4M75G 3G6ET 4M77E 2LC4A 2R5MA 2C06A 5KCHA 2FPFA 2X4XA 3BW1A 1UJ0A 4J6YA 2MI6A 4XAXB 1VUBA 1UECA 3EG9A 1VQ6T 4EMKC 4XU1A 5GMKh 1K9MU 3NPFA 1VYVA 3NTIA 3QBYA 3OYKA 2L3SA 1VQMT 1D1BA 1M3CA 4KT0E 2X9HA 4GLKA 4DOVA 4F14A 3MJXA 1K0XA 1SEMA 4KBMB 3FB9A 3OSVA 2DF6A 5CK9A 4C8QF 3G4SA 5J39A 2ROTA 1MMNA 2DYBA 4EDUA 4M7AA 1K73U 3H9NA 3BY7A 4X1VA 3RMSA 2QDLA 1M2OA 4C8QB 4A4KA 2EFIA 3EFRA 3JCMe 4BY6B 1NZ9A 2Y4YA 1YJWQ 5GAN6 2HQEA 2KRNA 2CP7A 1X27A 6AT1B 4FT2A 5LJ5f 1JU5C 4PFOA 2QA4Q 1TU0B 2JS2A 2W0ZA 1O9SA 2CZ1B 3I5SA 1YJ9Q 2JUFA 3CCEQ 4R0KA 1TG0A 2NUZA 1Q7YC 4FYXB 5LJ3f 5FW9A 2E64A 4OMNA 3HFNA 2ECZA 2YXYA 1VQLA 4J6XA 4QVZA 3SHWA 1DJ7B 3O5ZA 3CCST 2F2XA 3RBBB 3ZEHA 3VS4A 1M27C 4JRPA 3H41A 5GAN4 4OMFB 5GMKj 1N27A 4XTXA 1Y71A 2HQXA 2NUPB 4XTVA 3G6EQ 4C0FA 1QP2A 2DZ9A 2KYBA 4NS5A 2DA9A 2MIOA 2GBQA 1TTHB 3RNJA 4K11A 3REAB 4L59A 4RMOA 5GMKl 1T3LA 3L2UA 5C6SA 4OB0B 2P84A 4ZN1A 4WTOB 1OULA 2EGCA 4IUTA 2Z0WA 4JLIA 4MZTA 2BZXA 3BDLA 1I81A 5I22A 2LJ3A 1HSQA 2CZ7B 1Q81R 1Z9ZA 1B34B 4B6MA 8AT1B 3Q1JA 1BYMA 1P92A 2HBWA 3MEVA 2ENMA 2DKGA 4II1A 3THKA 4BI3A 5KYNA 1W1FA 2ZPHB 4M78A 1E6HA 4E7JA 1Q82C 4MZMA 1YN8A 4JRQA 4Y92A 1KG1A 2WSCE 2PVGB 1EIFA 5GAMd 3G4ST 1UE9A 2AHJB 3EG2A 2EBPA 1OOTA 3QZ5B 4PJOF 2V8IA 3PGGA 2FRWA 1WHMA 3L1AA 1S72A 1ZBXA 1YI2T 2CS7A 3V8JA 4XTYA 2QTVA 1GL5A 4PJOB 3MEWA 4RTTA 3CMAA 3HL8A 1IZ6A 4M75A 4D8KA 1WDXA 4M7DF 1OX8A 1ACMB 4BB7A 2CP3A 4DQ2A 1W4SA 3MP6A 5CQYA 5FRNA 4MMKA 4NOYA 1SHGA 4C8QC 4M7DB 3TU4K 4BY6C 4JDSA 3UF4A 1N9RA 4RTXA 4L5GA 1YITA 1EX4A 1LVKA 1OU9A 1KFZA 4LDXA 4E7SA 3CCSQ 2EQKA 3M53A 2RM4A 3A8OB 5DLQE 1CSKA 3OS1A 4FW1A 4PJLA 4M7AE 2A28A 2DAQA 4JRIA 4E7KA 1W6XA 4J9BA 3OQ5A 3SD4A 3JCMQ 1YCYA 5DM7R 4R55A 2DXCA 2SEMA 1HK9A 1NJIU 2QDYB 4J9HA 3CCJA 1WGSA 3R6NA 2EQJA 3LYIA 2CZ0B 1IHVA 1UGQB 1KQ2A 3V7RA 2JXBA 3CPWP 2DTOA 4OMQA 3E9GA 4AFQC 5DLOA 5IN1A 4AG2C 5GAMf 2RO0A 2LQKA 4KUDK 1IRXA 2DIGA 1ZA1B 3G4SQ 3LWHA 2VC8A 2BIVA 1LNXA 4KH1B 2DK3A 1VQ4A 4A4GA 1S72T 4C0GA 2KXCA 2RHIA 1BBZA 2D1XA 2KK4A 1YI2Q 3CMAT 1B7TA 1C0MA 3EGUA 2E6ZA 4IURA 3V8LA 4C92A 2V1RA 3JSCA 1RLPC 2NLUA 1VQNA 4RCCA 1PRMC 5HKCA 1ZBJA 3OS2A 2HL3A 2E3IA 3D7SB 1Q81C 2E10A 2IIMA 2P0PA 4J7FA 3OS0A 2FL7A 2LNHB 3JB9D 2XHCA 2MMPA 2F5KA 3C94A 2DIQA 3M0QA 1SPKA 2K4YA 2HKNA 2XDBA 1YITT 3JCMh 1PSFA 4PJOC 4WCIA 5FWCA 4M78E 1MMAA 2LZ6B 2D0NA 3OY9A 2PUOB 4XU2A 1SRLA 4M77F 3E9FA 1VYTA 4MDXA 3GP8A 2X4WA 3GNFB 4BUGA 2L3QA 1KQSP 3HRUA 5D6XA 5LJ5e 4PLIA 4BD3A 2JTFA 4IIMA 4M77B 3EG0A 4C5EA 2A37A 1BCMA 4A4EA 2A36A 1N5ZA 1HXDA 5GAOl 3E1SA 2E65A 5KYXB 3CCJT 5FROA 4XQ3A 5LJ3e 2CP6A 2D8JA 2F5TX 4IUQA 3QXEB 4M75E 1X69A 1QKWA 1YIJA 2LDMA 2SRCA 2D8HA 1YFNA 4CC4B 4JJCA 3J80E 2CP2A 3EH1A 4ELZC 1KK7A 2OTJA 1BI3A 2F2WA 5IT9E 3X20B 4OMMA 1QVGA 2K5IA 1O75A 4ME7A 4OB3B 1K76A 3DLMA 2VXFA 2QQRA 1NE8A 3PIPA 1MMDA 3JCMb 1UGPB 3CCLA 1M2VB 1ZSZB 3I56Q 2JMAA 3M0UA 1VQ4T 1ZX6A 2QQSA 2O4XB 4LDYA 1K8AR 4HCKA 2HNIA 3VYHB 3EFOB 2QEXA 1IREB 1H641 5KYYA 3CMAQ 4A63B 5CKBA 2RNAA 1VQNT 3GPLA 5A0LA 4KH0B 4OMOA 1AWXA 5D6YA 1JBMA 1NYGA 1WA7A 2KBTA 5KH6A 3MP1A 2XDPA 4C8QD 1MNEA 1BI1A 1D0ZA 1OI1A 2ZPBB 5KYWB 2FHDA 2MWOA 4XTUA 1AOJA 1OPKA 3VS6A 2GQVA 1WQ7A 4RTUA 2MAMA 4DBHA 2M1HA 3RESA 4CI0C 1R0BG 1QVFS 1ZHIA 2LX9A 1K9MC 1XJWB 3OW2P 2PU9B 1YCSB 2G6FX 1E7OA 5IHKA 2QYZA 4M4ZA 3S3OA 4ZTJA 2LMJA 3H0IA 1RAEB 2JZ2A 1M3BA 2HZYA 3SWNA 2CSIA 2DXTA 2M9UA 8ATCB 3WVDB 5FU6C 4C92E 1WHJA 5IXBA 1WHKA 2AZSA 1K73C 4GLMA 3JRZA 1YIJT 1QLYA 1G3YA 3MCAB 2FRYA 3T9NA 1AZEA 3VYGA 4ZN3A 2KGTA 3AT1B 4DBQA 2OTJT 2PZ1A 3L2WA 3WXMB 4FW2A 4DEXA 1NJIR 2RHUA 2DD4A 2V8JA 4JJNK 2QG9B 1LPLA 4EMKA 2L5QA 1KHCA 2DLPA 3CC4Q 1Q86U 3CCUQ 1AWOA 5KYUA 1I4K1 2AZVA 2XDDA 3CCLT 2PVDB 1FXXA 5LJ5g 2O9VA 2R58A 3L2VA 1R0CB 2RQTA 2RJFA 2QEXT 2EQIA 1VQOA 1D09B 5FLXE 3EG9B 3OBYA 2VXEA 1PD0A 1VQNQ 3LWIA 5LJ3g 1RI0A 2RQWA 4BDZA 2P0QA 5GAMe 1ZSZC 5GJWB 1C6VX 1X01A 1M90U 4LN2A 1GCPA 3JAME 2DD5A 3X25B 4PJOD 4AT1B 2FZGB 3E19A 9ATCB 4XU3A 2V26A 2RB6A 4EMHA 4M7AF 1M8VA 2DTHA 3ASKA 2WSEE 4RKUE 4E47A 4EIKA 1VQ5Q 3SFMA 4J83A 4BE0A 3M9QA 4F17A 4M7AB 5GANg 1T0JA 3H6ZA 3MP8A 4LE9A 2V8KA 1KQ1A 3NTHA 5GANd 4M7DD 2A08A 1RAIB 1QCFA 1RABB 2LQ8A 3LH0A 3HRTA 4A54A 2GFAA 4JS5A 2RJDA 1QP3A 2VUBA 2VYTA 3EHRA 2Y90A 1MUZA 1M1FA 1BU1A 2HSEB 1YP5A 5ECAA 2XG8D 4RTYA 5D6WA 4BDYA 3PMIA 2DEQA 1NM7A 1C1AA 2K3XA 3I5RA 1D3BA 4DBRA 1G3WA 3BDUA 1TWBA 2YLBA 5GAN8 3RMQA 4CC7A 5KE2A 1W2BP 1GRIA 1BI2A 3MEUA 4OMPA 1XTDA 1X2QA 2EWNA 4LNPA 2ZPIB 3J7AF 2LJ1A 2J6KA 1TUCA 5KCOA 5HK0A 4J9IA 5GAN3 5LJ3h 2FEIA 3G71Q 1BCOA 1VQ8Q 5L8RE 3OMGA 1OEBA 2LTOA 2DZCA 3VS7A 1I1JA 3INZA 3OW2A 2E4HA 3CCQA 5EC7A 4RTWA 2RI3A 2QK0A 3WVEB 5CKDA 3H8ZA 1VQOT 2DL8A 2AIRB 2JJ9A 1VQ7Q 2E5KA 1MV3A 2VVKA 2K79A 4J9DA 3UDCA 2DETA 1ABQA 4ZGJB 4ZGEB 3META 2JW4A 1Q95G 2X3XD 2ESWA 4M78F 3OYBA 2E1HA 2LP5A 1GFCA 2FB7A 5CKFA 4ZGDB 1NJIC 2KXDA 4C92G 3CQTA 5HK3A 4Z02A 4M78B 1LCKA 1ZLMA 2FO0A 2HKQB 1JQQA 2K3YA 2EYYA 3CCMA 5GANf 1VYUA 3RKXA 3CC2A 1UDLA 4C8QA 4OVAA 4C5GA 4XTWA 3CBMA 3QDRB 4A4FA 3A5ZB 5LJ5j 2KR3A 4PFZA 4M75F 4FYYB 1VQ6Q 2MCNA 3MPUB 4OGCA 1Y96A 4ZNXA 2RA2A 1BK2A 4M75B 1U5SA 1VQMQ 5I2MA 5LJ3j 1K8AU 2ABLA 4M77D 3CCRA 1WJQA 4M7AC 1VQKA 1SSFA 2IVWA 1J3TA 1OV3A 2L3PA 5GAMg 2VV5A 1CKAA 4FIBA 3L2QA 3FEOA 2RJEA 2J05A 4OB2B 1IGQA 5CCAA 2KYMA 2C0OA 3KXTA 1S1NA 2DM1A 2X3WD 4D8DA 4LDWA 2LCCA 4O6JA 2K7AA 3U23A 1UFFA 3VS0A 4PL6A 3VS2A 1G2BA 3PE0A 1KHIA 3HP9A 5AYFA 1TH7A 1R77A 3QG1A 4PNOA 4DOWA 3CCQT 2A3LA 2LRQA 1F1BB 1WJRA 3M56A 1NBEB 1CKBA 2ZPEB 2I0NA 2KAFA 3EAEA 2BE7D 2COZA 3C0CA 2QQBA 2V1QA 2CT3A 1H3HA 1RACB 1M30A 1QVGP 1D1CA 1Q86R 1AVZC 1NPPA 2ZCFB 1AD5A 2K9GA 1VQLT 1YJNA 1K4US 1U06A 1H92A 3QJ6A 4XU0A 2LNVA 2DILA 4C0DB 2F69A 1W2BA 1NLOC 2HCKA 3VRZA 2DEUA 3LGFA 3V7SA 3MO8A 2EIFA 2NUTA 2BZ8A 3RDVA 1MNDA 4C5HA 3C12A 3CCMT 1N6AA 3J81E 1WHLA 4B9WA 1M4ZA 5CKEA 3CC2T 2E12A 1D1AA 5CQXA 4CRIA 5CO7A 4J9EA 3RIRA 1QMCA 2AK5A 3CMEA 4PJMA 1M90R 2AKLA 3QYGB 5GAMh 3GOXA 1JJ2P 4YTLA 2DJZA 4MMLA 4C92F 1IB8A 2DO3A 2G3RA 2OJ2A 5LL6S 2O01E 4FU6A 4BI4A 1RAAB 3A8HB 2JVVA 3FJ5A 4C92B 4FCYA 1PNJA 4PLLA 1PM3A 1FX7A 1N9SA 1UB4A 3QO3A 1PKTA 4N0AC 4Z88A 3CCRT 1VQKT 4D6WA 3RERA 2YRVA 1SKUB 2J6FA 2FVUA 2OTLA 2RMOA 2NYSA 2AKKA 1OYXA 3CBPA 3X24B 4E6RA 2BE9B 2MOXA 3OYCA 1VQPA 3EGDA 1KD1U 1KC8U 4EMGA 2OAWA 1GBRA 4FSSA 3ER0A 4M75C 1GCQA 1D0XA 2CH4W 3A8LB 1UGRB 2RD1A 5HCKA 2EYQA 1VQ9A 4E7ZA 4E7HA 1B3QA 3M59A 4J5YA 1U8RA 1YBYA 2DL7A 2RK2A 2HBPA 2RQUA 4A4HA 1BB9A 2GFUA 1YWPA 2YRDA 1I8FA 2EGEA 3S6WA 1UTIA 3RUXA 3CCVA 5I21A 1YJNT 4LXCA 4Q5WA 1VQLQ 4JUVA 3UPUA 3X26B 2M0YA 3BE3A 1PHTA 1AWWA 2DVEA 5GAMj 4ATOA 3EH2A 5IHIA 2L8DA 2KY9A 3DLLA 1Y7XA 1XNIA 4PKCC 2EVRA 2FG0A 2WACA 1EZZB 1TSFA 2CP0A 2JN0A 3OYDA 3TCJA 4NL3A 2XD0A 4M7DC 1UHCA 1AT1B 1MV0B 2ATCB 4WF2A 3CMET 4ORZA 3KBGA 1XQHA 3CXCA 4JJDA 2KVQG 4B9XA 2RHYA 2ZAEA 2HQHA 1WX6A 2KT1A 2H8HA 5KYYB 2RH2A 3CEYA 1Q86C 2RPNA 4M7AD 3M54A 5IXFA 3L2RA 4ESRA 3VRYA 2YUQA 3CCRQ 3JB9G 5I11A 5FWBA 1M8MA 4LUDA 3M0SA 3VU3C 2OTLT 5FRMA 5GANe 1WXUA 1WNLA 5CKHA 3JCMV 1RUWA 1WZOA 1G3TA 1IXDA 2JTEA 1VQPT 2LCSA 4F16A 1IGUA 1QVPA 1SF9A 4VUBA 4LUEA 3JCMW 4RTVA 1QWFA 1W70A 1S72Q 3QZ9B 2E41A 1RL2A 2DPPB 1M90C 2D9TA 3M5AA 3CPWS 5CR2A 1YJWA 2YDLA 3OA6A 2HL5C 3NFCA 3TVTA 2MF2A 1G5VA 1IO6A 2DMOA 1JJ2A 4F7UA 4JS4A 1ZA2B 3CCVT 1YJ9A 1G83A 2XU8A 1GXIE 4IUVA 3CCEA 2DXBA 4TVRA 2DBKA 3M55A 5AT1B 1YJNQ 1YITQ 4QVCA 1K9AA 2CREA 2QGFB 3FRNA 2DL5A 2FYKA 1WHHA 4J9GA 4EMKB 3OYMA 4IUUA 1WJSA 2RI5A 3G6EA 5J26A 5KYUB 3CC7A 3C4SA 5GAN2 3OYJA 3QHSA 2K2MA 2KMTA 2X35A 2BTTA 4J9FA 3CCJQ 2K5FA 1X6OA 3OYEA 1NLPC 2CH4A 1FMVA 3VKIA 1UGVA 3VS5A 4M78D 2K6DA 2CYZB 2L3RA 3ZFJA 2VASA 2P4TA 1KQSS 2GCXA 4M77C 3EGXA 1QW1A 3OMCA 4C8QG 5GAN5 1MMGA 3NTKA 1G8XA 3O8VA 1HYOA 4OB1B 1JXOA 3REBB 1YHQA 1Q7YR 2K2VA 1UJYA 1QVFA 1YWOA 1TUGB 2KE9A 4AFSC 4XTZA 2KSSA 1VQPQ 2RQVA 1K1ZA 4M75D 2PNIA 2VGMA 4P5NA 4GY5A 1VQ4Q 4KRTA 2C0TA 3P8HA 3LW5E 3JB9H 2QXFA 3OYNA 5GAOr 3TREA 2M0OA 1RAHB 1YJWT 3M4GA 3DB4A 4N4GA 3M57A 4Y28E 4N4IA 3QUIA 1KD1R 1KC8R 2VB6A 1MGQA 2M51A 3JB9J 3QWXX 2M16A 1YJ9T 2KRSA 4JJBA 3VUBA 4HKEA 3CCET 3JCMJ 4HA8A 4LDUA 2LVMA 1D3BB 2J7IA 2LT4A 2BKDN 4UC4A 4F04B 2GF7A 2KRMA 3QKJA 1UG1A 1U1SA 3KUFA 2RHXA 5FU7B 1I07A 2X4YA 4X9CA 4RUGA 1V1CA 1NEBA 1Q82R 3CBOA 2DX1A 2RK1A 1VIFA 3PT9A 1FMKA 1V76A 2GNCA 1K8AC 3G1JA 4L6V5 3AHUA 3CC7T 4LD9K 2EJ9A 2H3JA 4RG8A 2J06A 1ZSGA 1AZGB 1UHFA 5L23A 2YWWA 4F7UE 3A1PA 3TQ7P 1WPYA 1T3SA 1YIJQ 2XMFA 3P8DA 5LJ5h 3PFSA 5GMKi 3OW2S 2OTJQ 4OF1A 2AT1B 2OX7A 2JM8A 4QT7A 2MWPA 1HD3A 4PJOG 1YHQT 1GBQA 3FDRA 1UUEA 1X6GA 4V2SA 2GQIA 5GAOm 1WLPB 1QWEA 1TUDA 1WYXA 3LGLA 2E6NA 3V7CA 4C92D 4HT8A 1V29B 3CCLQ 4C5IA 1RI9A 1YNZA 2HMAA 3OYFA 3EFSA 5A0DA 4M7DG 2E3HA 2DVJA 4A53A 1K0SA 2W10A 2CP5A 2QEXQ 3JCMX 3CD6A 2DE0X 2F1LA 2B86A 3VJPA 1YI2A 1QKXA 3BFMA 3HRSA 2LJ0A 3FLGA 5GANh 4Z8AA 1WIEA 4QVDA 3M58A 2L2PA 4MZPA 2XICA 4J7IA 5GJVB 1JO8A 1Y96B 1JB0E 3P8BB 3C95A 1TS9A 1B07A 4FT4A 1M1KU 2LCLA 3F70A 2DERA 1NYFA 2BUDA 2QASA 2E70A 1JEGA 2YRCA 2O9SA 2ZZDA 3JB9I 2YUPA 4HCZA 2A0FB 1N8RU 4QQDA 2DYIA 2K5LA 2YUOA 1PWTA 4EPCA 3I9QA 2JOYA 3VS1A 5A2QE 1SG5A 1AWJA 3OSSC 3CC7Q 2KEAA 2MYSA 4FSXA 2EGAA 1G3SA 2CDTA 3RKYA 3RR6A 1RADB 1WI7A 1MHNA 2HSPA 4KGXB 4QKUA 4HCCA 1KSWA 2DXUA 5FU7C 3QDFA 1KD1C 3UA6A 5A0GA 1KC8C 1IHWA 3M0RA 2OAUA 2R57A 4OP0A 3L2ZA 3PMTA 5CAIA 1Y0MA 3E2UA 2VKNA 1YHQQ 3V8KA 1SHFA 2ED0A 4J8OA 2L0AA 2L89A 4LDVA 2JMCA 2NUPA 2X4JA 5GANj 2NUTB 1KIKA 2MK5A 3CXCP 3L42A 2MPXC 1OZ3A 2PTKA 2KQWA 4N0AA 1W2BS 3I56A 1TOVA 2HEQA 3QWYA 2KT8A 1U3OA 4CC3A 2K57A 1AHJB 3FC3A 3CD6T 1VQOQ 2DL3A 4HT9A 1Z9QA 2O88A 4J6WA 1ABOA 2ROLA 1PC0A 4BI8B 1B34A 4O5VA 1QQJA 2EYXA 3A98A 4HVWA 2DBMA 4M77G 2B8AA 4OGEA 4FYVB 5DY9A 3OYIA 1PRLC 1T0HA 3NMZC 4RTZA 2A7YA 2P0KA 4LD6A 2EPDA 2E5QA 4F7UG 1M1GA 4DBFA 3I55A 2GTJA 3HKSA 3QIIA 4E2FB 2RQRA 4BE2A 3S3MA 3GIBA 3EGDB 2HAXA 1HJDA 2DRKA 4MDWA 1XOVA 1Q7YU 2OI3A 3EG3A 3EHQA 4PJOA 2D0QB 4JLGA 3URGA 5GAN7 5CVIA 2KNBB 4DA4A 1OPLA 2YT6A 3VS3A 4X34A 2QQAA 1H3ZA 3HHTB 4M78C 5IAYA 2EKOA 2CUBA 2D6FA 2FZCB 2XKOC 3QPHA 3JCMg 1M9SA 4IKFA 2JT4A 3JCMd 4BE1A 3GNGA 4M7DA 2R5AA 1NPRA 3KFVA 1PG5B 2P4RA 4PK4A 4Z89A 1RLQC 3I35A 2FPEA 1ARKA 2CKKA 1LJOA 3OYLA 1D0YA 4R56A 5GAOn 4IIOA 4C8QE 7AT1B 5GAOq 3CC4A 3CCUA 1WQWA 2H3EB 2I2LA 2LQNA 3OYGA 3H0HA 2EKHA 1K9MR 4JZ4A 3I56T 2VGNA 3OYAA 2DL4A 3OBWA 3CCQQ 3PTAA 1X6BA 2FPDA 1I5OB 2BZYA 4HVVA 4HCBA 1Q82U 2DRMA 3CD6Q 3ZL7C 3ZBDA 2XIDA 5M9OA 1I0CA 1PKSA 3VUZA 2IG0A 1NG2A 1QVFP 1OX9A 2ED1A 4HXJA 3CXCS 4JPBW 1K73R 4N4HA 3LLRA 2XK0A 3JV3A 5GMKe 3IQLA 1PD1A 3I55T 2PUKB 1SSHA 2DFUA 2EAYA 3CCMQ 2C0IA 3UWNA 1QVGS 4ZTFA 5FU6B 3GLXA 3LH5A 3DB3A 1VQ5A 3CC2Q 1E6GA 2FZKB 2X51A 4PJJA 2O31A 2WSFE 4QW2A 2PQWA 4C0DC 4KULA 1VA7A 2HDAA 3HTRA 5C0MA 2Y4XA 1M1KR 1Y57A 1GFDA 1BKBA 1A0NB 4KGZB 3QJYA 4F7UF 1PSEA 1SRMA 3TEEA 3TSZA 4AFUC 2EW3A 3CPFA 1RAFB 3JCMf 4CC2A 3QYHB 4J9CA 1X75C 4KUIA 4PFPA 1EFNA 4F7UB 1N8RR 1QCNA 3M4YA 1WXBA 2EYZA 1VQKQ 5I2SA 2K3BA 4ELYC 3MEAA 1H8KA 1GCQC 1NEGA 1UGSB 3M0PA 3OS5A 1JJ2S 5GMKm 1JXMA 1PCXA 2QGGA 2DJQA 3GF5A 4C92C 1FWZA 1U1TA 1M5Q1 3TSWA 2COYA 1Y07A 3JCMP 4AMCA 3SEMA 4M77A 2ZPGB 4HVUA 2LQWA 3CC4T 5EG2A 2QQ9A 5HY6A 3CCUT 3G71A 1I5LA 1VQ9T 1VQ8A 4PJOE 4E7IA 3MKDA 3M0TA 3H0FA 1BIBA 5KYXA 5GAOp 3DKMA 4RCBA 2COWA 2EJGA 2QA4A 3SWNB 2JNGA 3NHNA 4BACA 2ZGWA 2KDSA 1BI0A 3HSBA 1TXQA 1VQ7A 2EQMA 2QAZA 3ME9A 4M7AG 1FYNA 4M7DE 3EGXB 2QI2A 3UT1A 1ZUKA 1VIEA 4GBQA 4QQ6A 3LX7A 1OU8A 3S3NA 4AFZC 2J6OA 1QCOA 2CT4A 2JM9A 3OYYA 3RKWA 3FIFA 3SB2A 3OYHA 3I55Q 3QSUA 3CPWA 1M2VA 1VOMA 1ZSZA 3NGPA 3JCMc 1Q81U 1VQ5T 2LT1A 2M02A 1JRIA 2O4XA 3CMEQ 1X2KA 3PIOA 3EFOA 4AG1C 2CGHA 2RHZA 1ZUYA 1WFWA 2KI7A
chains in the Genus database with same CATH topology
5IHNA 1WLPB 1QWEA 2RF0A 2LZ6B 2D0NA 1CKBA 1SRLA 1TUDA 2I0NA 1WYXA 3C0CA 1VYTA 2V1QA 1WXTA 2CT3A 1H3HA 1M30A 2L3QA 1RI9A 2VWFA 1AVZC 2YUNA 3UA7A 1YNZA 1AD5A 2GTOA 2K9GA 2YSQA 4IIMA 3EG0A 5IH2A 1K4US 1U06A 2KROA 1X43A 2A37A 4OMLA 1H92A 2DILA 2A36A 1N5ZA 2DVJA 2NWMA 1K0SA 2W10A 1NLOC 2HCKA 3VRZA 1AEYA 2DE0X 2B86A 3EG1A 1QKXA 2LJ0A 2D8JA 2BZ8A 4Z8AA 2EYWA 1WIEA 2L2PA 1X69A 3PVQA 1QKWA 2GGRA 2SRCA 5GJVB 1JO8A 2D8HA 4CC4B 4JJCA 2O2OA 2F2VA 2RN8A 4J9EA 1B07A 2AK5A 2AKLA 2F2WA 4OMMA 1NYFA 2JS0A 1JEGA 2OJ2A 1KJWA 1K76A 2CSQA 2O9SA 2YUPA 3FJ5A 1PNJA 2YUOA 1PWTA 3GBQA 4JZ3A 3I9QA 4Z88A 1PKTA 2JMAA 1M3AA 3M0UA 3PVLA 3VS1A 1ZX6A 1AWJA 2DNUA 2KEAA 3UATA 2J6FA 2LX7A 2RMOA 2EGAA 4HCKA 2CDTA 2AKKA 1WI7A 1ZUUA 2HSPA 4E6RA 3ULRB 2MOXA 4A63B 2RNAA 1KSWA 3UA6A 4OMOA 3M0RA 4DEYA 1AWXA 2CUDA 2OAWA 1NYGA 1WA7A 2KBTA 1GBRA 4FSSA 1GCQA 2CH4W 5HCKA 2FPFA 1Y0MA 1AOJA 1OPKA 1B3QA 1UJ0A 2VKNA 3VS6A 1UECA 2DL7A 1SHFA 2ED0A 4RTUA 2L0AA 2RQUA 1BB9A 1YWPA 2JMCA 1KIKA 2EGEA 3NPFA 1UTIA 1VYVA 2PTKA 2L3SA 1M3CA 1YCSB 2G6FX 2HEQA 3QWYA 2KT8A 1E7OA 2M0YA 5IHKA 1U3OA 4M4ZA 1PHTA 1AWWA 4F14A 4CC3A 2LMJA 3H0IA 1K0XA 1SEMA 1M3BA 5IHIA 2DF6A 2DL3A 2CSIA 1Z9QA 2EVRA 2FG0A 2O88A 1ABOA 5IXBA 2ROLA 2ROTA 2AZSA 2DYBA 4GLMA 2EYXA 1QLYA 3A98A 4HVWA 4X1VA 2QDLA 2DBMA 2FRYA 1UHCA 1AZEA 1MV0B 2KGTA 2PZ1A 4ORZA 1PRLC 2KRNA 1X27A 4JJDA 1T0HA 3NMZC 4RTZA 4DEXA 1WX6A 1JU5C 2EPDA 2KT1A 2GTJA 2H8HA 2JS2A 2W0ZA 2RQRA 2DLPA 3I5SA 1AWOA 1HJDA 2RPNA 4R0KA 2DRKA 2AZVA 1XOVA 5IXFA 1TG0A 2NUZA 2OI3A 5FW9A 3EG3A 4ESRA 4OMNA 3EHQA 3VRYA 2ECZA 2YUQA 5I11A 5FWBA 2KNBB 2O9VA 3SHWA 1M8MA 1OPLA 2YT6A 4LUDA 3M0SA 3VS3A 3O5ZA 2RQTA 2F2XA 1WXUA 2EQIA 3RBBB 2CUBA 3VS4A 1RUWA 1M27C 3H41A 2JTEA 2LCSA 4F16A 2JT4A 4LUEA 2RQWA 4RTVA 1QWFA 1W70A 3KFVA 2P4RA 2KYBA 5GJWB 2DA9A 4LN2A 1GCPA 2GBQA 2MIOA 4Z89A 1RLQC 3I35A 2FPEA 1ARKA 3RNJA 4K11A 3REAB 2YDLA 5FWCA 1T3LA 3TVTA 1IO6A 2EGCA 2DMOA 4EIKA 4IIOA 2BZXA 5I22A 2LJ3A 1HSQA 1Z9ZA 4F17A 1G83A 1T0JA 2LQNA 4LE9A 3H0HA 2EKHA 2DBKA 2HBWA 4JZ4A 2A08A 2ENMA 2DL4A 1QCFA 3THKA 1K9AA 1X6BA 2FPDA 2BZYA 1W1FA 2CREA 4HVVA 2DL5A 2DRMA 1E6HA 1YN8A 3EHRA 4Y92A 3ZL7C 1I0CA 1MUZA 1BU1A 1PKSA 1UE9A 1YP5A 5ECAA 4RTYA 3EG2A 4J9GA 2EBPA 1OOTA 1NG2A 1NM7A 3I5RA 2FRWA 2ED1A 4HXJA 4JPBW 4CC7A 1GRIA 4OMPA 3JV3A 1X2QA 2K2MA 1GL5A 2BTTA 4J9FA 4LNPA 4RTTA 1NLPC 2CH4A 2LJ1A 3IQLA 1UGVA 2J6KA 3VS5A 1SSHA 2K6DA 4D8KA 1WDXA 1TUCA 2C0IA 4J9IA 3LH5A 2FEIA 1E6GA 2O31A 1SHGA 1VA7A 2HDAA 1OEBA 3VS7A 3UF4A 1JXOA 1I1JA 3REBB 1Y57A 4RTXA 1GFDA 1UJYA 1A0NB 5EC7A 4RTWA 1SRMA 3TSZA 4AFUC 1YWOA 2EW3A 1KFZA 2KE9A 4AFSC 2DL8A 4CC2A 4J9CA 2E5KA 1MV3A 2VVKA 1CSKA 1EFNA 2K79A 2A28A 2RQVA 4J9DA 1K1ZA 2PNIA 1W6XA 4J9BA 1ABQA 1WXBA 2EYZA 4KRTA 2C0TA 2K3BA 2JW4A 2X3XD 2ESWA 1H8KA 1GCQC 1NEGA 3M0PA 2LP5A 2SEMA 1JXMA 1GFCA 4J9HA 2KXDA 2DJQA 3CQTA 3R6NA 1LCKA 1ZLMA 2FO0A 3TSWA 1JQQA 2EYYA 2M51A 3SEMA 1VYUA 3QWXX 2LQWA 4HVUA 2KRSA 4JJBA 1UDLA 2JXBA 2J7IA 3M0TA 3H0FA 2KR3A 4OMQA 4AFQC 4AG2C 2KRMA 3NHNA 1UG1A 2MCNA 1I07A 4RUGA 1V1CA 1NEBA 4ZNXA 1BK2A 1U5SA 2DX1A 1FYNA 1FMKA 2ABLA 2GNCA 1J3TA 2KXCA 1ZUKA 1OV3A 2L3PA 4GBQA 1BBZA 2D1XA 1CKAA 4AFZC 2J06A 2J6OA 2CT4A 1ZSGA 1AZGB 1UHFA 3EGUA 2JM9A 5L23A 2J05A 2V1RA 1RLPC 1PRMC 2KYMA 1T3SA 2C0OA 1ZBJA 2XMFA 1S1NA 2DM1A 3NGPA 2X3WD 4D8DA 2IIMA 2K7AA 3U23A 1UFFA 1X2KA 3VS0A 2JM8A 3VS2A 1G2BA 2LNHB 3PE0A 4QT7A 1HD3A 3M0QA 4AG1C 1SPKA 1GBQA 1ZUYA 1UUEA 1WFWA 1X6GA 4WCIA 2GQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IHN A;  1WLP B;  1QWE A;  2RF0 A;  2LZ6 B;  2D0N A;  1CKB A;  1SRL A;  1TUD A;  2I0N A;  1WYX A;  3C0C A;  1VYT A;  2V1Q A;  1WXT A;  2CT3 A;  1H3H A;  1M30 A;  2L3Q A;  1RI9 A;  2VWF A;  1AVZ C;  2YUN A;  3UA7 A;  1YNZ A;  1AD5 A;  2GTO A;  2K9G A;  2YSQ A;  4IIM A;  3EG0 A;  5IH2 A;  1K4U S;  1U06 A;  2KRO A;  1X43 A;  2A37 A;  4OML A;  1H92 A;  2DIL A;  2A36 A;  1N5Z A;  2DVJ A;  2NWM A;  1K0S A;  2W10 A;  1NLO C;  2HCK A;  3VRZ A;  1AEY A;  2DE0 X;  2B86 A;  3EG1 A;  1QKX A;  2LJ0 A;  2D8J A;  2BZ8 A;  4Z8A A;  2EYW A;  1WIE A;  2L2P A;  1X69 A;  3PVQ A;  1QKW A;  2GGR A;  2SRC A;  5GJV B;  1JO8 A;  2D8H A;  4CC4 B;  4JJC A;  2O2O A;  2F2V A;  2RN8 A;  4J9E A;  1B07 A;  2AK5 A;  2AKL A;  2F2W A;  4OMM A;  1NYF A;  2JS0 A;  1JEG A;  2OJ2 A;  1KJW A;  1K76 A;  2CSQ A;  2O9S A;  2YUP A;  3FJ5 A;  1PNJ A;  2YUO A;  1PWT A;  3GBQ A;  4JZ3 A;  3I9Q A;  4Z88 A;  1PKT A;  2JMA A;  1M3A A;  3M0U A;  3PVL A;  3VS1 A;  1ZX6 A;  1AWJ A;  2DNU A;  2KEA A;  3UAT A;  2J6F A;  2LX7 A;  2RMO A;  2EGA A;  4HCK A;  2CDT A;  2AKK A;  1WI7 A;  1ZUU A;  2HSP A;  4E6R A;  3ULR B;  2MOX A;  4A63 B;  2RNA A;  1KSW A;  3UA6 A;  4OMO A;  3M0R A;  4DEY A;  1AWX A;  2CUD A;  2OAW A;  1NYG A;  1WA7 A;  2KBT A;  1GBR A;  4FSS A;  1GCQ A;  2CH4 W;  5HCK A;  2FPF A;  1Y0M A;  1AOJ A;  1OPK A;  1B3Q A;  1UJ0 A;  2VKN A;  3VS6 A;  1UEC A;  2DL7 A;  1SHF A;  2ED0 A;  4RTU A;  2L0A A;  2RQU A;  1BB9 A;  1YWP A;  2JMC A;  1KIK A;  2EGE A;  3NPF A;  1UTI A;  1VYV A;  2PTK A;  2L3S A;  1M3C A;  1YCS B;  2G6F X;  2HEQ A;  3QWY A;  2KT8 A;  1E7O A;  2M0Y A;  5IHK A;  1U3O A;  4M4Z A;  1PHT A;  1AWW A;  4F14 A;  4CC3 A;  2LMJ A;  3H0I A;  1K0X A;  1SEM A;  1M3B A;  5IHI A;  2DF6 A;  2DL3 A;  2CSI A;  1Z9Q A;  2EVR A;  2FG0 A;  2O88 A;  1ABO A;  5IXB A;  2ROL A;  2ROT A;  2AZS A;  2DYB A;  4GLM A;  2EYX A;  1QLY A;  3A98 A;  4HVW A;  4X1V A;  2QDL A;  2DBM A;  2FRY A;  1UHC A;  1AZE A;  1MV0 B;  2KGT A;  2PZ1 A;  4ORZ A;  1PRL C;  2KRN A;  1X27 A;  4JJD A;  1T0H A;  3NMZ C;  4RTZ A;  4DEX A;  1WX6 A;  1JU5 C;  2EPD A;  2KT1 A;  2GTJ A;  2H8H A;  2JS2 A;  2W0Z A;  2RQR A;  2DLP A;  3I5S A;  1AWO A;  1HJD A;  2RPN A;  4R0K A;  2DRK A;  2AZV A;  1XOV A;  5IXF A;  1TG0 A;  2NUZ A;  2OI3 A;  5FW9 A;  3EG3 A;  4ESR A;  4OMN A;  3EHQ A;  3VRY A;  2ECZ A;  2YUQ A;  5I11 A;  5FWB A;  2KNB B;  2O9V A;  3SHW A;  1M8M A;  1OPL A;  2YT6 A;  4LUD A;  3M0S A;  3VS3 A;  3O5Z A;  2RQT A;  2F2X A;  1WXU A;  2EQI A;  3RBB B;  2CUB A;  3VS4 A;  1RUW A;  1M27 C;  3H41 A;  2JTE A;  2LCS A;  4F16 A;  2JT4 A;  4LUE A;  2RQW A;  4RTV A;  1QWF A;  1W70 A;  3KFV A;  2P4R A;  2KYB A;  5GJW B;  2DA9 A;  4LN2 A;  1GCP A;  2GBQ A;  2MIO A;  4Z89 A;  1RLQ C;  3I35 A;  2FPE A;  1ARK A;  3RNJ A;  4K11 A;  3REA B;  2YDL A;  5FWC A;  1T3L A;  3TVT A;  1IO6 A;  2EGC A;  2DMO A;  4EIK A;  4IIO A;  2BZX A;  5I22 A;  2LJ3 A;  1HSQ A;  1Z9Z A;  4F17 A;  1G83 A;  1T0J A;  2LQN A;  4LE9 A;  3H0H A;  2EKH A;  2DBK A;  2HBW A;  4JZ4 A;  2A08 A;  2ENM A;  2DL4 A;  1QCF A;  3THK A;  1K9A A;  1X6B A;  2FPD A;  2BZY A;  1W1F A;  2CRE A;  4HVV A;  2DL5 A;  2DRM A;  1E6H A;  1YN8 A;  3EHR A;  4Y92 A;  3ZL7 C;  1I0C A;  1MUZ A;  1BU1 A;  1PKS A;  1UE9 A;  1YP5 A;  5ECA A;  4RTY A;  3EG2 A;  4J9G A;  2EBP A;  1OOT A;  1NG2 A;  1NM7 A;  3I5R A;  2FRW A;  2ED1 A;  4HXJ A;  4JPB W;  4CC7 A;  1GRI A;  4OMP A;  3JV3 A;  1X2Q A;  2K2M A;  1GL5 A;  2BTT A;  4J9F A;  4LNP A;  4RTT A;  1NLP C;  2CH4 A;  2LJ1 A;  3IQL A;  1UGV A;  2J6K A;  3VS5 A;  1SSH A;  2K6D A;  4D8K A;  1WDX A;  1TUC A;  2C0I A;  4J9I A;  3LH5 A;  2FEI A;  1E6G A;  2O31 A;  1SHG A;  1VA7 A;  2HDA A;  1OEB A;  3VS7 A;  3UF4 A;  1JXO A;  1I1J A;  3REB B;  1Y57 A;  4RTX A;  1GFD A;  1UJY A;  1A0N B;  5EC7 A;  4RTW A;  1SRM A;  3TSZ A;  4AFU C;  1YWO A;  2EW3 A;  1KFZ A;  2KE9 A;  4AFS C;  2DL8 A;  4CC2 A;  4J9C A;  2E5K A;  1MV3 A;  2VVK A;  1CSK A;  1EFN A;  2K79 A;  2A28 A;  2RQV A;  4J9D A;  1K1Z A;  2PNI A;  1W6X A;  4J9B A;  1ABQ A;  1WXB A;  2EYZ A;  4KRT A;  2C0T A;  2K3B A;  2JW4 A;  2X3X D;  2ESW A;  1H8K A;  1GCQ C;  1NEG A;  3M0P A;  2LP5 A;  2SEM A;  1JXM A;  1GFC A;  4J9H A;  2KXD A;  2DJQ A;  3CQT A;  3R6N A;  1LCK A;  1ZLM A;  2FO0 A;  3TSW A;  1JQQ A;  2EYY A;  2M51 A;  3SEM A;  1VYU A;  3QWX X;  2LQW A;  4HVU A;  2KRS A;  4JJB A;  1UDL A;  2JXB A;  2J7I A;  3M0T A;  3H0F A;  2KR3 A;  4OMQ A;  4AFQ C;  4AG2 C;  2KRM A;  3NHN A;  1UG1 A;  2MCN A;  1I07 A;  4RUG A;  1V1C A;  1NEB A;  4ZNX A;  1BK2 A;  1U5S A;  2DX1 A;  1FYN A;  1FMK A;  2ABL A;  2GNC A;  1J3T A;  2KXC A;  1ZUK A;  1OV3 A;  2L3P A;  4GBQ A;  1BBZ A;  2D1X A;  1CKA A;  4AFZ C;  2J06 A;  2J6O A;  2CT4 A;  1ZSG A;  1AZG B;  1UHF A;  3EGU A;  2JM9 A;  5L23 A;  2J05 A;  2V1R A;  1RLP C;  1PRM C;  2KYM A;  1T3S A;  2C0O A;  1ZBJ A;  2XMF A;  1S1N A;  2DM1 A;  3NGP A;  2X3W D;  4D8D A;  2IIM A;  2K7A A;  3U23 A;  1UFF A;  1X2K A;  3VS0 A;  2JM8 A;  3VS2 A;  1G2B A;  2LNH B;  3PE0 A;  4QT7 A;  1HD3 A;  3M0Q A;  4AG1 C;  1SPK A;  1GBQ A;  1ZUY A;  1UUE A;  1WFW A;  1X6G A;  4WCI A;  2GQI A; 
#chains in the Genus database with same CATH topology
 5IHN A;  2RF0 A;  2EQU A;  1VQ6 A;  4C0Z A;  4JRK A;  3HFO A;  1WXT A;  5D7U A;  4RG2 A;  2VWF A;  5KYW A;  2YUN A;  3UA7 A;  2GTO A;  2YSQ A;  1VQM A;  1ZQ1 A;  1UEB A;  5IH2 A;  1LOJ A;  2KRO A;  1X43 A;  5J3B A;  4OML A;  2NWM A;  2OTL Q;  2RJC A;  1AEY A;  4X9D A;  2YLC A;  3EG1 A;  2IPO B;  3SDZ A;  2EYW A;  3X28 B;  3PVQ A;  3JB9 F;  1WHG A;  3VV0 A;  2GGR A;  1BIA A;  1RAG B;  2HD0 A;  4XK8 E;  2O2O A;  2F2V A;  3G71 T;  2RN8 A;  1VQ8 T;  1VQ9 Q;  2XI9 A;  4FYW B;  1M1K C;  4QQG A;  2YHT A;  1R8O B;  2JS0 A;  1KQS A;  4KGV B;  4PJN A;  5KE3 A;  2QA4 T;  3A8G B;  2PVO B;  1KJW A;  2CSQ A;  4M78 G;  5CIU A;  3HPW A;  3OB9 A;  5LJ5 d;  4NL2 A;  3G7Z A;  3CCV Q;  1N8R C;  1VQ7 T;  3PNW C;  3GBQ A;  3R6O A;  4FL6 A;  3MHX A;  3A8M B;  3N5B B;  4E7L A;  4JZ3 A;  2JTM A;  1M3A A;  3PVL A;  1FMW A;  4IUP A;  5LJ3 d;  2ZPF B;  2QTX A;  2DNU A;  2RI2 A;  3UAT A;  2EJF A;  2LX7 A;  3CCS A;  3SWN C;  4ANJ A;  1ZUU A;  4Y91 A;  4FM4 B;  3ULR B;  2CZ6 B;  1OZ2 A;  3FJP A;  2DTI A;  1OQK A;  4DEY A;  2CUD A;  4M75 G;  3G6E T;  4M77 E;  2LC4 A;  2R5M A;  2C06 A;  5KCH A;  2FPF A;  2X4X A;  3BW1 A;  1UJ0 A;  4J6Y A;  2MI6 A;  4XAX B;  1VUB A;  1UEC A;  3EG9 A;  1VQ6 T;  4EMK C;  4XU1 A;  5GMK h;  1K9M U;  3NPF A;  1VYV A;  3NTI A;  3QBY A;  3OYK A;  2L3S A;  1VQM T;  1D1B A;  1M3C A;  4KT0 E;  2X9H A;  4GLK A;  4DOV A;  4F14 A;  3MJX A;  1K0X A;  1SEM A;  4KBM B;  3FB9 A;  3OSV A;  2DF6 A;  5CK9 A;  4C8Q F;  3G4S A;  5J39 A;  2ROT A;  1MMN A;  2DYB A;  4EDU A;  4M7A A;  1K73 U;  3H9N A;  3BY7 A;  4X1V A;  3RMS A;  2QDL A;  1M2O A;  4C8Q B;  4A4K A;  2EFI A;  3EFR A;  3JCM e;  4BY6 B;  1NZ9 A;  2Y4Y A;  1YJW Q;  5GAN 6;  2HQE A;  2KRN A;  2CP7 A;  1X27 A;  6AT1 B;  4FT2 A;  5LJ5 f;  1JU5 C;  4PFO A;  2QA4 Q;  1TU0 B;  2JS2 A;  2W0Z A;  1O9S A;  2CZ1 B;  3I5S A;  1YJ9 Q;  2JUF A;  3CCE Q;  4R0K A;  1TG0 A;  2NUZ A;  1Q7Y C;  4FYX B;  5LJ3 f;  5FW9 A;  2E64 A;  4OMN A;  3HFN A;  2ECZ A;  2YXY A;  1VQL A;  4J6X A;  4QVZ A;  3SHW A;  1DJ7 B;  3O5Z A;  3CCS T;  2F2X A;  3RBB B;  3ZEH A;  3VS4 A;  1M27 C;  4JRP A;  3H41 A;  5GAN 4;  4OMF B;  5GMK j;  1N27 A;  4XTX A;  1Y71 A;  2HQX A;  2NUP B;  4XTV A;  3G6E Q;  4C0F A;  1QP2 A;  2DZ9 A;  2KYB A;  4NS5 A;  2DA9 A;  2MIO A;  2GBQ A;  1TTH B;  3RNJ A;  4K11 A;  3REA B;  4L59 A;  4RMO A;  5GMK l;  1T3L A;  3L2U A;  5C6S A;  4OB0 B;  2P84 A;  4ZN1 A;  4WTO B;  1OUL A;  2EGC A;  4IUT A;  2Z0W A;  4JLI A;  4MZT A;  2BZX A;  3BDL A;  1I81 A;  5I22 A;  2LJ3 A;  1HSQ A;  2CZ7 B;  1Q81 R;  1Z9Z A;  1B34 B;  4B6M A;  8AT1 B;  3Q1J A;  1BYM A;  1P92 A;  2HBW A;  3MEV A;  2ENM A;  2DKG A;  4II1 A;  3THK A;  4BI3 A;  5KYN A;  1W1F A;  2ZPH B;  4M78 A;  1E6H A;  4E7J A;  1Q82 C;  4MZM A;  1YN8 A;  4JRQ A;  4Y92 A;  1KG1 A;  2WSC E;  2PVG B;  1EIF A;  5GAM d;  3G4S T;  1UE9 A;  2AHJ B;  3EG2 A;  2EBP A;  1OOT A;  3QZ5 B;  4PJO F;  2V8I A;  3PGG A;  2FRW A;  1WHM A;  3L1A A;  1S72 A;  1ZBX A;  1YI2 T;  2CS7 A;  3V8J A;  4XTY A;  2QTV A;  1GL5 A;  4PJO B;  3MEW A;  4RTT A;  3CMA A;  3HL8 A;  1IZ6 A;  4M75 A;  4D8K A;  1WDX A;  4M7D F;  1OX8 A;  1ACM B;  4BB7 A;  2CP3 A;  4DQ2 A;  1W4S A;  3MP6 A;  5CQY A;  5FRN A;  4MMK A;  4NOY A;  1SHG A;  4C8Q C;  4M7D B;  3TU4 K;  4BY6 C;  4JDS A;  3UF4 A;  1N9R A;  4RTX A;  4L5G A;  1YIT A;  1EX4 A;  1LVK A;  1OU9 A;  1KFZ A;  4LDX A;  4E7S A;  3CCS Q;  2EQK A;  3M53 A;  2RM4 A;  3A8O B;  5DLQ E;  1CSK A;  3OS1 A;  4FW1 A;  4PJL A;  4M7A E;  2A28 A;  2DAQ A;  4JRI A;  4E7K A;  1W6X A;  4J9B A;  3OQ5 A;  3SD4 A;  3JCM Q;  1YCY A;  5DM7 R;  4R55 A;  2DXC A;  2SEM A;  1HK9 A;  1NJI U;  2QDY B;  4J9H A;  3CCJ A;  1WGS A;  3R6N A;  2EQJ A;  3LYI A;  2CZ0 B;  1IHV A;  1UGQ B;  1KQ2 A;  3V7R A;  2JXB A;  3CPW P;  2DTO A;  4OMQ A;  3E9G A;  4AFQ C;  5DLO A;  5IN1 A;  4AG2 C;  5GAM f;  2RO0 A;  2LQK A;  4KUD K;  1IRX A;  2DIG A;  1ZA1 B;  3G4S Q;  3LWH A;  2VC8 A;  2BIV A;  1LNX A;  4KH1 B;  2DK3 A;  1VQ4 A;  4A4G A;  1S72 T;  4C0G A;  2KXC A;  2RHI A;  1BBZ A;  2D1X A;  2KK4 A;  1YI2 Q;  3CMA T;  1B7T A;  1C0M A;  3EGU A;  2E6Z A;  4IUR A;  3V8L A;  4C92 A;  2V1R A;  3JSC A;  1RLP C;  2NLU A;  1VQN A;  4RCC A;  1PRM C;  5HKC A;  1ZBJ A;  3OS2 A;  2HL3 A;  2E3I A;  3D7S B;  1Q81 C;  2E10 A;  2IIM A;  2P0P A;  4J7F A;  3OS0 A;  2FL7 A;  2LNH B;  3JB9 D;  2XHC A;  2MMP A;  2F5K A;  3C94 A;  2DIQ A;  3M0Q A;  1SPK A;  2K4Y A;  2HKN A;  2XDB A;  1YIT T;  3JCM h;  1PSF A;  4PJO C;  4WCI A;  5FWC A;  4M78 E;  1MMA A;  2LZ6 B;  2D0N A;  3OY9 A;  2PUO B;  4XU2 A;  1SRL A;  4M77 F;  3E9F A;  1VYT A;  4MDX A;  3GP8 A;  2X4W A;  3GNF B;  4BUG A;  2L3Q A;  1KQS P;  3HRU A;  5D6X A;  5LJ5 e;  4PLI A;  4BD3 A;  2JTF A;  4IIM A;  4M77 B;  3EG0 A;  4C5E A;  2A37 A;  1BCM A;  4A4E A;  2A36 A;  1N5Z A;  1HXD A;  5GAO l;  3E1S A;  2E65 A;  5KYX B;  3CCJ T;  5FRO A;  4XQ3 A;  5LJ3 e;  2CP6 A;  2D8J A;  2F5T X;  4IUQ A;  3QXE B;  4M75 E;  1X69 A;  1QKW A;  1YIJ A;  2LDM A;  2SRC A;  2D8H A;  1YFN A;  4CC4 B;  4JJC A;  3J80 E;  2CP2 A;  3EH1 A;  4ELZ C;  1KK7 A;  2OTJ A;  1BI3 A;  2F2W A;  5IT9 E;  3X20 B;  4OMM A;  1QVG A;  2K5I A;  1O75 A;  4ME7 A;  4OB3 B;  1K76 A;  3DLM A;  2VXF A;  2QQR A;  1NE8 A;  3PIP A;  1MMD A;  3JCM b;  1UGP B;  3CCL A;  1M2V B;  1ZSZ B;  3I56 Q;  2JMA A;  3M0U A;  1VQ4 T;  1ZX6 A;  2QQS A;  2O4X B;  4LDY A;  1K8A R;  4HCK A;  2HNI A;  3VYH B;  3EFO B;  2QEX A;  1IRE B;  1H64 1;  5KYY A;  3CMA Q;  4A63 B;  5CKB A;  2RNA A;  1VQN T;  3GPL A;  5A0L A;  4KH0 B;  4OMO A;  1AWX A;  5D6Y A;  1JBM A;  1NYG A;  1WA7 A;  2KBT A;  5KH6 A;  3MP1 A;  2XDP A;  4C8Q D;  1MNE A;  1BI1 A;  1D0Z A;  1OI1 A;  2ZPB B;  5KYW B;  2FHD A;  2MWO A;  4XTU A;  1AOJ A;  1OPK A;  3VS6 A;  2GQV A;  1WQ7 A;  4RTU A;  2MAM A;  4DBH A;  2M1H A;  3RES A;  4CI0 C;  1R0B G;  1QVF S;  1ZHI A;  2LX9 A;  1K9M C;  1XJW B;  3OW2 P;  2PU9 B;  1YCS B;  2G6F X;  1E7O A;  5IHK A;  2QYZ A;  4M4Z A;  3S3O A;  4ZTJ A;  2LMJ A;  3H0I A;  1RAE B;  2JZ2 A;  1M3B A;  2HZY A;  3SWN A;  2CSI A;  2DXT A;  2M9U A;  8ATC B;  3WVD B;  5FU6 C;  4C92 E;  1WHJ A;  5IXB A;  1WHK A;  2AZS A;  1K73 C;  4GLM A;  3JRZ A;  1YIJ T;  1QLY A;  1G3Y A;  3MCA B;  2FRY A;  3T9N A;  1AZE A;  3VYG A;  4ZN3 A;  2KGT A;  3AT1 B;  4DBQ A;  2OTJ T;  2PZ1 A;  3L2W A;  3WXM B;  4FW2 A;  4DEX A;  1NJI R;  2RHU A;  2DD4 A;  2V8J A;  4JJN K;  2QG9 B;  1LPL A;  4EMK A;  2L5Q A;  1KHC A;  2DLP A;  3CC4 Q;  1Q86 U;  3CCU Q;  1AWO A;  5KYU A;  1I4K 1;  2AZV A;  2XDD A;  3CCL T;  2PVD B;  1FXX A;  5LJ5 g;  2O9V A;  2R58 A;  3L2V A;  1R0C B;  2RQT A;  2RJF A;  2QEX T;  2EQI A;  1VQO A;  1D09 B;  5FLX E;  3EG9 B;  3OBY A;  2VXE A;  1PD0 A;  1VQN Q;  3LWI A;  5LJ3 g;  1RI0 A;  2RQW A;  4BDZ A;  2P0Q A;  5GAM e;  1ZSZ C;  5GJW B;  1C6V X;  1X01 A;  1M90 U;  4LN2 A;  1GCP A;  3JAM E;  2DD5 A;  3X25 B;  4PJO D;  4AT1 B;  2FZG B;  3E19 A;  9ATC B;  4XU3 A;  2V26 A;  2RB6 A;  4EMH A;  4M7A F;  1M8V A;  2DTH A;  3ASK A;  2WSE E;  4RKU E;  4E47 A;  4EIK A;  1VQ5 Q;  3SFM A;  4J83 A;  4BE0 A;  3M9Q A;  4F17 A;  4M7A B;  5GAN g;  1T0J A;  3H6Z A;  3MP8 A;  4LE9 A;  2V8K A;  1KQ1 A;  3NTH A;  5GAN d;  4M7D D;  2A08 A;  1RAI B;  1QCF A;  1RAB B;  2LQ8 A;  3LH0 A;  3HRT A;  4A54 A;  2GFA A;  4JS5 A;  2RJD A;  1QP3 A;  2VUB A;  2VYT A;  3EHR A;  2Y90 A;  1MUZ A;  1M1F A;  1BU1 A;  2HSE B;  1YP5 A;  5ECA A;  2XG8 D;  4RTY A;  5D6W A;  4BDY A;  3PMI A;  2DEQ A;  1NM7 A;  1C1A A;  2K3X A;  3I5R A;  1D3B A;  4DBR A;  1G3W A;  3BDU A;  1TWB A;  2YLB A;  5GAN 8;  3RMQ A;  4CC7 A;  5KE2 A;  1W2B P;  1GRI A;  1BI2 A;  3MEU A;  4OMP A;  1XTD A;  1X2Q A;  2EWN A;  4LNP A;  2ZPI B;  3J7A F;  2LJ1 A;  2J6K A;  1TUC A;  5KCO A;  5HK0 A;  4J9I A;  5GAN 3;  5LJ3 h;  2FEI A;  3G71 Q;  1BCO A;  1VQ8 Q;  5L8R E;  3OMG A;  1OEB A;  2LTO A;  2DZC A;  3VS7 A;  1I1J A;  3INZ A;  3OW2 A;  2E4H A;  3CCQ A;  5EC7 A;  4RTW A;  2RI3 A;  2QK0 A;  3WVE B;  5CKD A;  3H8Z A;  1VQO T;  2DL8 A;  2AIR B;  2JJ9 A;  1VQ7 Q;  2E5K A;  1MV3 A;  2VVK A;  2K79 A;  4J9D A;  3UDC A;  2DET A;  1ABQ A;  4ZGJ B;  4ZGE B;  3MET A;  2JW4 A;  1Q95 G;  2X3X D;  2ESW A;  4M78 F;  3OYB A;  2E1H A;  2LP5 A;  1GFC A;  2FB7 A;  5CKF A;  4ZGD B;  1NJI C;  2KXD A;  4C92 G;  3CQT A;  5HK3 A;  4Z02 A;  4M78 B;  1LCK A;  1ZLM A;  2FO0 A;  2HKQ B;  1JQQ A;  2K3Y A;  2EYY A;  3CCM A;  5GAN f;  1VYU A;  3RKX A;  3CC2 A;  1UDL A;  4C8Q A;  4OVA A;  4C5G A;  4XTW A;  3CBM A;  3QDR B;  4A4F A;  3A5Z B;  5LJ5 j;  2KR3 A;  4PFZ A;  4M75 F;  4FYY B;  1VQ6 Q;  2MCN A;  3MPU B;  4OGC A;  1Y96 A;  4ZNX A;  2RA2 A;  1BK2 A;  4M75 B;  1U5S A;  1VQM Q;  5I2M A;  5LJ3 j;  1K8A U;  2ABL A;  4M77 D;  3CCR A;  1WJQ A;  4M7A C;  1VQK A;  1SSF A;  2IVW A;  1J3T A;  1OV3 A;  2L3P A;  5GAM g;  2VV5 A;  1CKA A;  4FIB A;  3L2Q A;  3FEO A;  2RJE A;  2J05 A;  4OB2 B;  1IGQ A;  5CCA A;  2KYM A;  2C0O A;  3KXT A;  1S1N A;  2DM1 A;  2X3W D;  4D8D A;  4LDW A;  2LCC A;  4O6J A;  2K7A A;  3U23 A;  1UFF A;  3VS0 A;  4PL6 A;  3VS2 A;  1G2B A;  3PE0 A;  1KHI A;  3HP9 A;  5AYF A;  1TH7 A;  1R77 A;  3QG1 A;  4PNO A;  4DOW A;  3CCQ T;  2A3L A;  2LRQ A;  1F1B B;  1WJR A;  3M56 A;  1NBE B;  1CKB A;  2ZPE B;  2I0N A;  2KAF A;  3EAE A;  2BE7 D;  2COZ A;  3C0C A;  2QQB A;  2V1Q A;  2CT3 A;  1H3H A;  1RAC B;  1M30 A;  1QVG P;  1D1C A;  1Q86 R;  1AVZ C;  1NPP A;  2ZCF B;  1AD5 A;  2K9G A;  1VQL T;  1YJN A;  1K4U S;  1U06 A;  1H92 A;  3QJ6 A;  4XU0 A;  2LNV A;  2DIL A;  4C0D B;  2F69 A;  1W2B A;  1NLO C;  2HCK A;  3VRZ A;  2DEU A;  3LGF A;  3V7S A;  3MO8 A;  2EIF A;  2NUT A;  2BZ8 A;  3RDV A;  1MND A;  4C5H A;  3C12 A;  3CCM T;  1N6A A;  3J81 E;  1WHL A;  4B9W A;  1M4Z A;  5CKE A;  3CC2 T;  2E12 A;  1D1A A;  5CQX A;  4CRI A;  5CO7 A;  4J9E A;  3RIR A;  1QMC A;  2AK5 A;  3CME A;  4PJM A;  1M90 R;  2AKL A;  3QYG B;  5GAM h;  3GOX A;  1JJ2 P;  4YTL A;  2DJZ A;  4MML A;  4C92 F;  1IB8 A;  2DO3 A;  2G3R A;  2OJ2 A;  5LL6 S;  2O01 E;  4FU6 A;  4BI4 A;  1RAA B;  3A8H B;  2JVV A;  3FJ5 A;  4C92 B;  4FCY A;  1PNJ A;  4PLL A;  1PM3 A;  1FX7 A;  1N9S A;  1UB4 A;  3QO3 A;  1PKT A;  4N0A C;  4Z88 A;  3CCR T;  1VQK T;  4D6W A;  3RER A;  2YRV A;  1SKU B;  2J6F A;  2FVU A;  2OTL A;  2RMO A;  2NYS A;  2AKK A;  1OYX A;  3CBP A;  3X24 B;  4E6R A;  2BE9 B;  2MOX A;  3OYC A;  1VQP A;  3EGD A;  1KD1 U;  1KC8 U;  4EMG A;  2OAW A;  1GBR A;  4FSS A;  3ER0 A;  4M75 C;  1GCQ A;  1D0X A;  2CH4 W;  3A8L B;  1UGR B;  2RD1 A;  5HCK A;  2EYQ A;  1VQ9 A;  4E7Z A;  4E7H A;  1B3Q A;  3M59 A;  4J5Y A;  1U8R A;  1YBY A;  2DL7 A;  2RK2 A;  2HBP A;  2RQU A;  4A4H A;  1BB9 A;  2GFU A;  1YWP A;  2YRD A;  1I8F A;  2EGE A;  3S6W A;  1UTI A;  3RUX A;  3CCV A;  5I21 A;  1YJN T;  4LXC A;  4Q5W A;  1VQL Q;  4JUV A;  3UPU A;  3X26 B;  2M0Y A;  3BE3 A;  1PHT A;  1AWW A;  2DVE A;  5GAM j;  4ATO A;  3EH2 A;  5IHI A;  2L8D A;  2KY9 A;  3DLL A;  1Y7X A;  1XNI A;  4PKC C;  2EVR A;  2FG0 A;  2WAC A;  1EZZ B;  1TSF A;  2CP0 A;  2JN0 A;  3OYD A;  3TCJ A;  4NL3 A;  2XD0 A;  4M7D C;  1UHC A;  1AT1 B;  1MV0 B;  2ATC B;  4WF2 A;  3CME T;  4ORZ A;  3KBG A;  1XQH A;  3CXC A;  4JJD A;  2KVQ G;  4B9X A;  2RHY A;  2ZAE A;  2HQH A;  1WX6 A;  2KT1 A;  2H8H A;  5KYY B;  2RH2 A;  3CEY A;  1Q86 C;  2RPN A;  4M7A D;  3M54 A;  5IXF A;  3L2R A;  4ESR A;  3VRY A;  2YUQ A;  3CCR Q;  3JB9 G;  5I11 A;  5FWB A;  1M8M A;  4LUD A;  3M0S A;  3VU3 C;  2OTL T;  5FRM A;  5GAN e;  1WXU A;  1WNL A;  5CKH A;  3JCM V;  1RUW A;  1WZO A;  1G3T A;  1IXD A;  2JTE A;  1VQP T;  2LCS A;  4F16 A;  1IGU A;  1QVP A;  1SF9 A;  4VUB A;  4LUE A;  3JCM W;  4RTV A;  1QWF A;  1W70 A;  1S72 Q;  3QZ9 B;  2E41 A;  1RL2 A;  2DPP B;  1M90 C;  2D9T A;  3M5A A;  3CPW S;  5CR2 A;  1YJW A;  2YDL A;  3OA6 A;  2HL5 C;  3NFC A;  3TVT A;  2MF2 A;  1G5V A;  1IO6 A;  2DMO A;  1JJ2 A;  4F7U A;  4JS4 A;  1ZA2 B;  3CCV T;  1YJ9 A;  1G83 A;  2XU8 A;  1GXI E;  4IUV A;  3CCE A;  2DXB A;  4TVR A;  2DBK A;  3M55 A;  5AT1 B;  1YJN Q;  1YIT Q;  4QVC A;  1K9A A;  2CRE A;  2QGF B;  3FRN A;  2DL5 A;  2FYK A;  1WHH A;  4J9G A;  4EMK B;  3OYM A;  4IUU A;  1WJS A;  2RI5 A;  3G6E A;  5J26 A;  5KYU B;  3CC7 A;  3C4S A;  5GAN 2;  3OYJ A;  3QHS A;  2K2M A;  2KMT A;  2X35 A;  2BTT A;  4J9F A;  3CCJ Q;  2K5F A;  1X6O A;  3OYE A;  1NLP C;  2CH4 A;  1FMV A;  3VKI A;  1UGV A;  3VS5 A;  4M78 D;  2K6D A;  2CYZ B;  2L3R A;  3ZFJ A;  2VAS A;  2P4T A;  1KQS S;  2GCX A;  4M77 C;  3EGX A;  1QW1 A;  3OMC A;  4C8Q G;  5GAN 5;  1MMG A;  3NTK A;  1G8X A;  3O8V A;  1HYO A;  4OB1 B;  1JXO A;  3REB B;  1YHQ A;  1Q7Y R;  2K2V A;  1UJY A;  1QVF A;  1YWO A;  1TUG B;  2KE9 A;  4AFS C;  4XTZ A;  2KSS A;  1VQP Q;  2RQV A;  1K1Z A;  4M75 D;  2PNI A;  2VGM A;  4P5N A;  4GY5 A;  1VQ4 Q;  4KRT A;  2C0T A;  3P8H A;  3LW5 E;  3JB9 H;  2QXF A;  3OYN A;  5GAO r;  3TRE A;  2M0O A;  1RAH B;  1YJW T;  3M4G A;  3DB4 A;  4N4G A;  3M57 A;  4Y28 E;  4N4I A;  3QUI A;  1KD1 R;  1KC8 R;  2VB6 A;  1MGQ A;  2M51 A;  3JB9 J;  3QWX X;  2M16 A;  1YJ9 T;  2KRS A;  4JJB A;  3VUB A;  4HKE A;  3CCE T;  3JCM J;  4HA8 A;  4LDU A;  2LVM A;  1D3B B;  2J7I A;  2LT4 A;  2BKD N;  4UC4 A;  4F04 B;  2GF7 A;  2KRM A;  3QKJ A;  1UG1 A;  1U1S A;  3KUF A;  2RHX A;  5FU7 B;  1I07 A;  2X4Y A;  4X9C A;  4RUG A;  1V1C A;  1NEB A;  1Q82 R;  3CBO A;  2DX1 A;  2RK1 A;  1VIF A;  3PT9 A;  1FMK A;  1V76 A;  2GNC A;  1K8A C;  3G1J A;  4L6V 5;  3AHU A;  3CC7 T;  4LD9 K;  2EJ9 A;  2H3J A;  4RG8 A;  2J06 A;  1ZSG A;  1AZG B;  1UHF A;  5L23 A;  2YWW A;  4F7U E;  3A1P A;  3TQ7 P;  1WPY A;  1T3S A;  1YIJ Q;  2XMF A;  3P8D A;  5LJ5 h;  3PFS A;  5GMK i;  3OW2 S;  2OTJ Q;  4OF1 A;  2AT1 B;  2OX7 A;  2JM8 A;  4QT7 A;  2MWP A;  1HD3 A;  4PJO G;  1YHQ T;  1GBQ A;  3FDR A;  1UUE A;  1X6G A;  4V2S A;  2GQI A;  5GAO m;  1WLP B;  1QWE A;  1TUD A;  1WYX A;  3LGL A;  2E6N A;  3V7C A;  4C92 D;  4HT8 A;  1V29 B;  3CCL Q;  4C5I A;  1RI9 A;  1YNZ A;  2HMA A;  3OYF A;  3EFS A;  5A0D A;  4M7D G;  2E3H A;  2DVJ A;  4A53 A;  1K0S A;  2W10 A;  2CP5 A;  2QEX Q;  3JCM X;  3CD6 A;  2DE0 X;  2F1L A;  2B86 A;  3VJP A;  1YI2 A;  1QKX A;  3BFM A;  3HRS A;  2LJ0 A;  3FLG A;  5GAN h;  4Z8A A;  1WIE A;  4QVD A;  3M58 A;  2L2P A;  4MZP A;  2XIC A;  4J7I A;  5GJV B;  1JO8 A;  1Y96 B;  1JB0 E;  3P8B B;  3C95 A;  1TS9 A;  1B07 A;  4FT4 A;  1M1K U;  2LCL A;  3F70 A;  2DER A;  1NYF A;  2BUD A;  2QAS A;  2E70 A;  1JEG A;  2YRC A;  2O9S A;  2ZZD A;  3JB9 I;  2YUP A;  4HCZ A;  2A0F B;  1N8R U;  4QQD A;  2DYI A;  2K5L A;  2YUO A;  1PWT A;  4EPC A;  3I9Q A;  2JOY A;  3VS1 A;  5A2Q E;  1SG5 A;  1AWJ A;  3OSS C;  3CC7 Q;  2KEA A;  2MYS A;  4FSX A;  2EGA A;  1G3S A;  2CDT A;  3RKY A;  3RR6 A;  1RAD B;  1WI7 A;  1MHN A;  2HSP A;  4KGX B;  4QKU A;  4HCC A;  1KSW A;  2DXU A;  5FU7 C;  3QDF A;  1KD1 C;  3UA6 A;  5A0G A;  1KC8 C;  1IHW A;  3M0R A;  2OAU A;  2R57 A;  4OP0 A;  3L2Z A;  3PMT A;  5CAI A;  1Y0M A;  3E2U A;  2VKN A;  1YHQ Q;  3V8K A;  1SHF A;  2ED0 A;  4J8O A;  2L0A A;  2L89 A;  4LDV A;  2JMC A;  2NUP A;  2X4J A;  5GAN j;  2NUT B;  1KIK A;  2MK5 A;  3CXC P;  3L42 A;  2MPX C;  1OZ3 A;  2PTK A;  2KQW A;  4N0A A;  1W2B S;  3I56 A;  1TOV A;  2HEQ A;  3QWY A;  2KT8 A;  1U3O A;  4CC3 A;  2K57 A;  1AHJ B;  3FC3 A;  3CD6 T;  1VQO Q;  2DL3 A;  4HT9 A;  1Z9Q A;  2O88 A;  4J6W A;  1ABO A;  2ROL A;  1PC0 A;  4BI8 B;  1B34 A;  4O5V A;  1QQJ A;  2EYX A;  3A98 A;  4HVW A;  2DBM A;  4M77 G;  2B8A A;  4OGE A;  4FYV B;  5DY9 A;  3OYI A;  1PRL C;  1T0H A;  3NMZ C;  4RTZ A;  2A7Y A;  2P0K A;  4LD6 A;  2EPD A;  2E5Q A;  4F7U G;  1M1G A;  4DBF A;  3I55 A;  2GTJ A;  3HKS A;  3QII A;  4E2F B;  2RQR A;  4BE2 A;  3S3M A;  3GIB A;  3EGD B;  2HAX A;  1HJD A;  2DRK A;  4MDW A;  1XOV A;  1Q7Y U;  2OI3 A;  3EG3 A;  3EHQ A;  4PJO A;  2D0Q B;  4JLG A;  3URG A;  5GAN 7;  5CVI A;  2KNB B;  4DA4 A;  1OPL A;  2YT6 A;  3VS3 A;  4X34 A;  2QQA A;  1H3Z A;  3HHT B;  4M78 C;  5IAY A;  2EKO A;  2CUB A;  2D6F A;  2FZC B;  2XKO C;  3QPH A;  3JCM g;  1M9S A;  4IKF A;  2JT4 A;  3JCM d;  4BE1 A;  3GNG A;  4M7D A;  2R5A A;  1NPR A;  3KFV A;  1PG5 B;  2P4R A;  4PK4 A;  4Z89 A;  1RLQ C;  3I35 A;  2FPE A;  1ARK A;  2CKK A;  1LJO A;  3OYL A;  1D0Y A;  4R56 A;  5GAO n;  4IIO A;  4C8Q E;  7AT1 B;  5GAO q;  3CC4 A;  3CCU A;  1WQW A;  2H3E B;  2I2L A;  2LQN A;  3OYG A;  3H0H A;  2EKH A;  1K9M R;  4JZ4 A;  3I56 T;  2VGN A;  3OYA A;  2DL4 A;  3OBW A;  3CCQ Q;  3PTA A;  1X6B A;  2FPD A;  1I5O B;  2BZY A;  4HVV A;  4HCB A;  1Q82 U;  2DRM A;  3CD6 Q;  3ZL7 C;  3ZBD A;  2XID A;  5M9O A;  1I0C A;  1PKS A;  3VUZ A;  2IG0 A;  1NG2 A;  1QVF P;  1OX9 A;  2ED1 A;  4HXJ A;  3CXC S;  4JPB W;  1K73 R;  4N4H A;  3LLR A;  2XK0 A;  3JV3 A;  5GMK e;  3IQL A;  1PD1 A;  3I55 T;  2PUK B;  1SSH A;  2DFU A;  2EAY A;  3CCM Q;  2C0I A;  3UWN A;  1QVG S;  4ZTF A;  5FU6 B;  3GLX A;  3LH5 A;  3DB3 A;  1VQ5 A;  3CC2 Q;  1E6G A;  2FZK B;  2X51 A;  4PJJ A;  2O31 A;  2WSF E;  4QW2 A;  2PQW A;  4C0D C;  4KUL A;  1VA7 A;  2HDA A;  3HTR A;  5C0M A;  2Y4X A;  1M1K R;  1Y57 A;  1GFD A;  1BKB A;  1A0N B;  4KGZ B;  3QJY A;  4F7U F;  1PSE A;  1SRM A;  3TEE A;  3TSZ A;  4AFU C;  2EW3 A;  3CPF A;  1RAF B;  3JCM f;  4CC2 A;  3QYH B;  4J9C A;  1X75 C;  4KUI A;  4PFP A;  1EFN A;  4F7U B;  1N8R R;  1QCN A;  3M4Y A;  1WXB A;  2EYZ A;  1VQK Q;  5I2S A;  2K3B A;  4ELY C;  3MEA A;  1H8K A;  1GCQ C;  1NEG A;  1UGS B;  3M0P A;  3OS5 A;  1JJ2 S;  5GMK m;  1JXM A;  1PCX A;  2QGG A;  2DJQ A;  3GF5 A;  4C92 C;  1FWZ A;  1U1T A;  1M5Q 1;  3TSW A;  2COY A;  1Y07 A;  3JCM P;  4AMC A;  3SEM A;  4M77 A;  2ZPG B;  4HVU A;  2LQW A;  3CC4 T;  5EG2 A;  2QQ9 A;  5HY6 A;  3CCU T;  3G71 A;  1I5L A;  1VQ9 T;  1VQ8 A;  4PJO E;  4E7I A;  3MKD A;  3M0T A;  3H0F A;  1BIB A;  5KYX A;  5GAO p;  3DKM A;  4RCB A;  2COW A;  2EJG A;  2QA4 A;  3SWN B;  2JNG A;  3NHN A;  4BAC A;  2ZGW A;  2KDS A;  1BI0 A;  3HSB A;  1TXQ A;  1VQ7 A;  2EQM A;  2QAZ A;  3ME9 A;  4M7A G;  1FYN A;  4M7D E;  3EGX B;  2QI2 A;  3UT1 A;  1ZUK A;  1VIE A;  4GBQ A;  4QQ6 A;  3LX7 A;  1OU8 A;  3S3N A;  4AFZ C;  2J6O A;  1QCO A;  2CT4 A;  2JM9 A;  3OYY A;  3RKW A;  3FIF A;  3SB2 A;  3OYH A;  3I55 Q;  3QSU A;  3CPW A;  1M2V A;  1VOM A;  1ZSZ A;  3NGP A;  3JCM c;  1Q81 U;  1VQ5 T;  2LT1 A;  2M02 A;  1JRI A;  2O4X A;  3CME Q;  1X2K A;  3PIO A;  3EFO A;  4AG1 C;  2CGH A;  2RHZ A;  1ZUY A;  1WFW A;  2KI7 A; 
#chains in the Genus database with same CATH homology
 5IHN A;  1WLP B;  1QWE A;  2RF0 A;  2LZ6 B;  2D0N A;  1CKB A;  1SRL A;  1TUD A;  2I0N A;  1WYX A;  3C0C A;  1VYT A;  2V1Q A;  1WXT A;  2CT3 A;  1H3H A;  1M30 A;  2L3Q A;  1RI9 A;  2VWF A;  1AVZ C;  2YUN A;  3UA7 A;  1YNZ A;  1AD5 A;  2GTO A;  2K9G A;  2YSQ A;  4IIM A;  3EG0 A;  5IH2 A;  1K4U S;  1U06 A;  2KRO A;  1X43 A;  2A37 A;  4OML A;  1H92 A;  2DIL A;  2A36 A;  1N5Z A;  2DVJ A;  2NWM A;  1K0S A;  2W10 A;  1NLO C;  2HCK A;  3VRZ A;  1AEY A;  2DE0 X;  2B86 A;  3EG1 A;  1QKX A;  2LJ0 A;  2D8J A;  2BZ8 A;  4Z8A A;  2EYW A;  1WIE A;  2L2P A;  1X69 A;  3PVQ A;  1QKW A;  2GGR A;  2SRC A;  5GJV B;  1JO8 A;  2D8H A;  4CC4 B;  4JJC A;  2O2O A;  2F2V A;  2RN8 A;  4J9E A;  1B07 A;  2AK5 A;  2AKL A;  2F2W A;  4OMM A;  1NYF A;  2JS0 A;  1JEG A;  2OJ2 A;  1KJW A;  1K76 A;  2CSQ A;  2O9S A;  2YUP A;  3FJ5 A;  1PNJ A;  2YUO A;  1PWT A;  3GBQ A;  4JZ3 A;  3I9Q A;  4Z88 A;  1PKT A;  2JMA A;  1M3A A;  3M0U A;  3PVL A;  3VS1 A;  1ZX6 A;  1AWJ A;  2DNU A;  2KEA A;  3UAT A;  2J6F A;  2LX7 A;  2RMO A;  2EGA A;  4HCK A;  2CDT A;  2AKK A;  1WI7 A;  1ZUU A;  2HSP A;  4E6R A;  3ULR B;  2MOX A;  4A63 B;  2RNA A;  1KSW A;  3UA6 A;  4OMO A;  3M0R A;  4DEY A;  1AWX A;  2CUD A;  2OAW A;  1NYG A;  1WA7 A;  2KBT A;  1GBR A;  4FSS A;  1GCQ A;  2CH4 W;  5HCK A;  2FPF A;  1Y0M A;  1AOJ A;  1OPK A;  1B3Q A;  1UJ0 A;  2VKN A;  3VS6 A;  1UEC A;  2DL7 A;  1SHF A;  2ED0 A;  4RTU A;  2L0A A;  2RQU A;  1BB9 A;  1YWP A;  2JMC A;  1KIK A;  2EGE A;  3NPF A;  1UTI A;  1VYV A;  2PTK A;  2L3S A;  1M3C A;  1YCS B;  2G6F X;  2HEQ A;  3QWY A;  2KT8 A;  1E7O A;  2M0Y A;  5IHK A;  1U3O A;  4M4Z A;  1PHT A;  1AWW A;  4F14 A;  4CC3 A;  2LMJ A;  3H0I A;  1K0X A;  1SEM A;  1M3B A;  5IHI A;  2DF6 A;  2DL3 A;  2CSI A;  1Z9Q A;  2EVR A;  2FG0 A;  2O88 A;  1ABO A;  5IXB A;  2ROL A;  2ROT A;  2AZS A;  2DYB A;  4GLM A;  2EYX A;  1QLY A;  3A98 A;  4HVW A;  4X1V A;  2QDL A;  2DBM A;  2FRY A;  1UHC A;  1AZE A;  1MV0 B;  2KGT A;  2PZ1 A;  4ORZ A;  1PRL C;  2KRN A;  1X27 A;  4JJD A;  1T0H A;  3NMZ C;  4RTZ A;  4DEX A;  1WX6 A;  1JU5 C;  2EPD A;  2KT1 A;  2GTJ A;  2H8H A;  2JS2 A;  2W0Z A;  2RQR A;  2DLP A;  3I5S A;  1AWO A;  1HJD A;  2RPN A;  4R0K A;  2DRK A;  2AZV A;  1XOV A;  5IXF A;  1TG0 A;  2NUZ A;  2OI3 A;  5FW9 A;  3EG3 A;  4ESR A;  4OMN A;  3EHQ A;  3VRY A;  2ECZ A;  2YUQ A;  5I11 A;  5FWB A;  2KNB B;  2O9V A;  3SHW A;  1M8M A;  1OPL A;  2YT6 A;  4LUD A;  3M0S A;  3VS3 A;  3O5Z A;  2RQT A;  2F2X A;  1WXU A;  2EQI A;  3RBB B;  2CUB A;  3VS4 A;  1RUW A;  1M27 C;  3H41 A;  2JTE A;  2LCS A;  4F16 A;  2JT4 A;  4LUE A;  2RQW A;  4RTV A;  1QWF A;  1W70 A;  3KFV A;  2P4R A;  2KYB A;  5GJW B;  2DA9 A;  4LN2 A;  1GCP A;  2GBQ A;  2MIO A;  4Z89 A;  1RLQ C;  3I35 A;  2FPE A;  1ARK A;  3RNJ A;  4K11 A;  3REA B;  2YDL A;  5FWC A;  1T3L A;  3TVT A;  1IO6 A;  2EGC A;  2DMO A;  4EIK A;  4IIO A;  2BZX A;  5I22 A;  2LJ3 A;  1HSQ A;  1Z9Z A;  4F17 A;  1G83 A;  1T0J A;  2LQN A;  4LE9 A;  3H0H A;  2EKH A;  2DBK A;  2HBW A;  4JZ4 A;  2A08 A;  2ENM A;  2DL4 A;  1QCF A;  3THK A;  1K9A A;  1X6B A;  2FPD A;  2BZY A;  1W1F A;  2CRE A;  4HVV A;  2DL5 A;  2DRM A;  1E6H A;  1YN8 A;  3EHR A;  4Y92 A;  3ZL7 C;  1I0C A;  1MUZ A;  1BU1 A;  1PKS A;  1UE9 A;  1YP5 A;  5ECA A;  4RTY A;  3EG2 A;  4J9G A;  2EBP A;  1OOT A;  1NG2 A;  1NM7 A;  3I5R A;  2FRW A;  2ED1 A;  4HXJ A;  4JPB W;  4CC7 A;  1GRI A;  4OMP A;  3JV3 A;  1X2Q A;  2K2M A;  1GL5 A;  2BTT A;  4J9F A;  4LNP A;  4RTT A;  1NLP C;  2CH4 A;  2LJ1 A;  3IQL A;  1UGV A;  2J6K A;  3VS5 A;  1SSH A;  2K6D A;  4D8K A;  1WDX A;  1TUC A;  2C0I A;  4J9I A;  3LH5 A;  2FEI A;  1E6G A;  2O31 A;  1SHG A;  1VA7 A;  2HDA A;  1OEB A;  3VS7 A;  3UF4 A;  1JXO A;  1I1J A;  3REB B;  1Y57 A;  4RTX A;  1GFD A;  1UJY A;  1A0N B;  5EC7 A;  4RTW A;  1SRM A;  3TSZ A;  4AFU C;  1YWO A;  2EW3 A;  1KFZ A;  2KE9 A;  4AFS C;  2DL8 A;  4CC2 A;  4J9C A;  2E5K A;  1MV3 A;  2VVK A;  1CSK A;  1EFN A;  2K79 A;  2A28 A;  2RQV A;  4J9D A;  1K1Z A;  2PNI A;  1W6X A;  4J9B A;  1ABQ A;  1WXB A;  2EYZ A;  4KRT A;  2C0T A;  2K3B A;  2JW4 A;  2X3X D;  2ESW A;  1H8K A;  1GCQ C;  1NEG A;  3M0P A;  2LP5 A;  2SEM A;  1JXM A;  1GFC A;  4J9H A;  2KXD A;  2DJQ A;  3CQT A;  3R6N A;  1LCK A;  1ZLM A;  2FO0 A;  3TSW A;  1JQQ A;  2EYY A;  2M51 A;  3SEM A;  1VYU A;  3QWX X;  2LQW A;  4HVU A;  2KRS A;  4JJB A;  1UDL A;  2JXB A;  2J7I A;  3M0T A;  3H0F A;  2KR3 A;  4OMQ A;  4AFQ C;  4AG2 C;  2KRM A;  3NHN A;  1UG1 A;  2MCN A;  1I07 A;  4RUG A;  1V1C A;  1NEB A;  4ZNX A;  1BK2 A;  1U5S A;  2DX1 A;  1FYN A;  1FMK A;  2ABL A;  2GNC A;  1J3T A;  2KXC A;  1ZUK A;  1OV3 A;  2L3P A;  4GBQ A;  1BBZ A;  2D1X A;  1CKA A;  4AFZ C;  2J06 A;  2J6O A;  2CT4 A;  1ZSG A;  1AZG B;  1UHF A;  3EGU A;  2JM9 A;  5L23 A;  2J05 A;  2V1R A;  1RLP C;  1PRM C;  2KYM A;  1T3S A;  2C0O A;  1ZBJ A;  2XMF A;  1S1N A;  2DM1 A;  3NGP A;  2X3W D;  4D8D A;  2IIM A;  2K7A A;  3U23 A;  1UFF A;  1X2K A;  3VS0 A;  2JM8 A;  3VS2 A;  1G2B A;  2LNH B;  3PE0 A;  4QT7 A;  1HD3 A;  3M0Q A;  4AG1 C;  1SPK A;  1GBQ A;  1ZUY A;  1UUE A;  1WFW A;  1X6G A;  4WCI A;  2GQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...