2L8DA

Structure/function of the lbr tudor domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
GAMGMPNRKYADGEVVMGRWPGSVLYYEVQVTSYDDASHLYTVKYKDGTELALKESDIRLQSSFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lamin-B receptor
publication title Solution structure and molecular interactions of lamin B receptor tudor domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Dna binding protein
total genus 12
structure length 66
sequence length 66
ec nomenclature ec 1.3.1.70: Delta(14)-sterol reductase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09465 LBR_tudor Lamin-B receptor of TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l8dA00
4UC4A 2LDMA 4A4GA 2MWPA 3FC3A 4E7LA 3OYIA 4E7HA 4IUUA 4CRIA 4C5EA 2R58A 2XDPA 3MEAA 4BACA 3LGLA 3OS0A 1WJSA 3PFSA 1MHNA 2HQXA 1WGSA 2GFUA 4X34A 3S3OA 1XNIA 2O4XB 4QQDA 5IAYA 2QQSA 2BUDA 2DAQA 3MEVA 4QQGA 4RG2A 5KE2A 3E9FA 3OS2A 2M1HA 4HCZA 3UT1A 3OYBA 4BE1A 4II1A 2RJDA 5FRMA 1SSFA 3QKJA 3S3MA 3O8VA 2X4XA 3MP6A 5J26A 3OYKA 4ZTFA 4PLIA 2LTOA 3OYFA 5D6WA 1OZ2A 2L3RA 4BD3A 4BDYA 4LD6A 3UWNA 3NTHA 2X35A 3OMGA 4EDUA 3L42A 3FEOA 5KCHA 2BKDN 3OYCA 4B9XA 4QW2A 3L2RA 2PQWA 4N4GA 2L8DA 5D6YA 3EAEA 2YRVA 3QJ6A 3MEWA 2NLUA 2QQRA 4PLLA 2JZ2A 3LH0A 4E7JA 4N4HA 1WJRA 5KH6A 4OVAA 2RHUA 3OYEA 2BIVA 2MWOA 2EQKA 2E5QA 4BE2A 3C4SA 2CKKA 2R57A 3OYMA 3LX7A 3L2WA 4A4EA 1WJQA 3LLRA 4IUPA 2IG0A 3DLMA 4Q5WA 2LCCA 4QQ6A 2RHIA 3P8HA 2D9TA 2O4XA 3MO8A 2K3XA 2R5AA 3META 2EQJA 1OZ3A 4B9WA 2RJFA 2X4YA 2LVMA 3H6ZA 3OMCA 5FRNA 1N27A 2WACA 4QVZA 2RHZA 3OYJA 2F5KA 2RJCA 3M9QA 2L89A 5KE3A 4E7IA 3OA6A 3OYDA 3L2QA 3S3NA 3NTKA 3OB9A 4GY5A 4NS5A 3OYNA 5C6SA 2P0KA 3CEYA 4A4FA 3F70A 4IURA 1G5VA 3Q1JA 3OQ5A 2RI2A 2RHXA 2EQUA 3FDRA 2RJEA 3DB4A 3PNWC 4N4IA 3KUFA 2K3YA 3OYAA 4E7KA 4IUQA 2B8AA 2VYTA 3MP1A 3PMTA 3QBYA 3OYHA 5FROA 2X4WA 5IN1A 1KHCA 2LRQA 3ASKA 3S6WA 3OY9A 4C5IA 1RI0A 5D6XA 2GFAA 3PMIA 3L2VA 2M16A 4ZTJA 3LYIA 3LGFA 3OYLA 2FHDA 2M0OA 2GF7A 5KCOA 3L2UA 3OYGA 3DB3A 4PL6A 2EQMA 2G3RA 1H3ZA 2HQEA 3SD4A 3ZEHA 4C5HA 4FL6A 4Z02A 3GOXA 2R5MA 2EFIA 2RHYA 4IUTA 2RI5A 5M9OA 3MEUA 3MP8A 1OYXA 4BDZA 3OS1A 2RO0A 2XK0A 3ME9A 1OI1A 3BDLA 3E9GA 4IKFA 2E6NA 2DIQA 3H8ZA 5J39A 5C0MA 2DIGA 2RI3A 5CIUA 3FLGA 3QIIA 3P8DA 4C5GA 4L59A 4BE0A 4A4HA 4IUVA 2JTFA 3NTIA 2EKOA 4FU6A
chains in the Genus database with same CATH superfamily
1VUBA 3QZ9B 2YUPA 4UC4A 4CRIA 1S72A 1Q86R 1X6BA 3C95A 4MDWA 2VASA 2BUDA 3V8LA 4BI4A 1PKTA 5GMKe 1IXDA 1VQ8T 1VYVA 3EFSA 1M1KR 5J26A 1WHHA 2HSPA 2JVVA 5D6WA 5CO7A 3UWNA 1M1GA 4KBMB 1K9MU 1QKXA 1SHFA 2CH4W 1K8AR 2L8DA 4M77G 5KYYA 1VQOT 4EMKA 4PJOC 4N4HA 1X01A 2KGTA 5KH6A 1JXOA 1NPPA 2MWOA 1ZSZA 3C4SA 3UPUA 2CKKA 5GMKm 1M8MA 1WJQA 3LLRA 2IG0A 3CCJQ 4J7IA 1X43A 1XOVA 2NWMA 2L3QA 4XU1A 2RHIA 1CKAA 2EYXA 3I5RA 1U1TA 1P92A 2E41A 4RMOA 3VJPA 3OYJA 4C92B 4M75F 1HSQA 1JBMA 2VB6A 3JAME 2GQVA 4NS5A 1VQMQ 1BBZA 1W6XA 4DBHA 2EW3A 2EJGA 2AKKA 1YJ9T 3JSCA 1M27C 1NEGA 2EYQA 2F1LA 3MP1A 2ZGWA 3EGXB 1KJWA 1X69A 1VQ8A 3OW2S 3NFCA 3S6WA 5I21A 4PJJA 4FYWB 1IGQA 1OX9A 2RQUA 1GRIA 3ZFJA 1X2QA 3PIPA 3OBWA 2LQ8A 1H92A 3RKXA 1EIFA 1H3ZA 1VQOA 2KRSA 3GOXA 2LQKA 3PVLA 2NUZA 2EJ9A 1YIJQ 1GXIE 3QIIA 5I22A 1GL5A 1QLYA 2JM9A 2YUQA 5LJ5j 3LWHA 4KUDK 3OS0A 1BIAA 1TG0A 4J9IA 2OAWA 2O4XB 3RKWA 3X24B 4LDXA 2PNIA 2WSFE 4GLMA 3V7RA 4OGEA 2M1HA 3UT1A 1QVGP 1WIEA 4OB1B 1YJ9A 5IH2A 2MMPA 1KD1U 1N8RU 5CQXA 1NE8A 4R56A 3RMSA 1BKBA 5D6YA 3CCUT 3EAEA 2G6FX 2A0FB 3CXCS 2EKHA 4DA4A 5GAMf 3G4SQ 4HT9A 5LJ3d 3D7SB 3JCMQ 2CDTA 3QYHB 2DBMA 5HCKA 1MMGA 2BZ8A 1Q7YR 1RABB 4QKUA 2OAUA 2FPFA 1Q86C 3RKYA 3G71Q 4HCBA 1Q95G 1RAGB 2E12A 2RJFA 2ZPEB 4M77D 4NL3A 4LE9A 5CAIA 1PM3A 3I56Q 3ER0A 4KT0E 2QK0A 5DY9A 3CEYA 1VQ5Q 1JJ2S 1V29B 2V1RA 1OQKA 5A0GA 3UA7A 4FIBA 2OTJT 3KXTA 4M78C 3IQLA 3OYYA 4OB3B 4CC7A 5FROA 1X6OA 3FB9A 3I55Q 2EGCA 1TOVA 3EFOB 3NPFA 3H0IA 3VYHB 2VWFA 1ZUKA 4E2FB 4PL6A 3CCUA 2HKNA 1KC8U 1R77A 2E6ZA 1YJNT 1M30A 1KQSS 2J05A 2CH4A 5LJ5e 3M56A 1MGQA 2JMAA 2YDLA 3NTIA 1PWTA 2DILA 3LW5E 3JCMg 3FJ5A 3OYIA 4OB2B 2XDPA 4V2SA 2FRYA 3LGLA 3CCMT 4XTXA 1MHNA 2HQXA 1WGSA 2EWNA 2DPPB 4RUGA 3OS2A 2XICA 1FMWA 2Y4YA 1FXXA 4JZ4A 2OTJA 2D1XA 3E19A 2CZ6B 1VQ4T 2E4HA 2FVUA 2AKLA 3L42A 1Q82R 3FEOA 1WHLA 1K9MC 1QVFP 5KYNA 3GP8A 2AK5A 1K1ZA 1M90U 2JXBA 2QAZA 3AT1B 2IIMA 3CC4T 4E7JA 1RL2A 4KULA 4YTLA 2BIVA 2E5QA 3TSWA 3CCSA 4P5NA 1YJNA 2LCCA 3P8HA 1M1FA 1FX7A 1BK2A 1JU5C 3HHTB 2MF2A 4E6RA 4JJNK 1HD3A 1UB4A 1QCOA 3S3NA 4XU3A 2LNVA 4AFUC 3NMZC 3CCMA 2P0KA 3M4YA 4AFSC 1M3AA 2L3SA 2KYMA 2CZ0B 4LDVA 2HQHA 1WZOA 3WVEB 3FRNA 3CPWA 3RUXA 1PRMC 7AT1B 1VIFA 4C8QC 4HCCA 4Y28E 1Q7YC 1VQ4A 1QMCA 3V7CA 1A0NB 4DBFA 1VYUA 4ZGDB 2DRMA 3X20B 2KMTA 3L2ZA 4DBRA 1BI3A 2H3EB 2F2VA 2RN8A 3CC4A 1YN8A 2HMAA 4RTYA 2DERA 1SSHA 1YFNA 1IHWA 2QQBA 2RO0A 1MMDA 2W0ZA 3QDFA 3BDLA 1W70A 1G3SA 3J7AF 3L1AA 4R55A 3EG9A 4C0FA 4JLIA 2R58A 2LQNA 1G3YA 4O6JA 3CD6Q 2V8JA 1XNIA 1NJIU 2DF6A 1VQ7T 3WVDB 4BE1A 5KYXA 2AZVA 1SSFA 2WSCE 4ZTFA 4M77B 1PG5B 1G3WA 2H8HA 1MNEA 4C0ZA 2E10A 3PT9A 1KD1C 1N8RC 2AHJB 1O75A 2J6OA 2ATCB 4M78A 4NOYA 2NLUA 2QQRA 3HP9A 1VQPQ 1N9SA 5CVIA 3RNJA 4F04B 4PJOG 1EX4A 5FW9A 3QSUA 3EGDA 5A0DA 1OPLA 1BCMA 5GAMd 2HBPA 2ESWA 2LX9A 4M7DD 3ULRB 1SPKA 2JTMA 4Y91A 2CUBA 2KRNA 3JB9G 4Z88A 2YRCA 4DEXA 3OB9A 5LJ5h 1QVGA 2DETA 2VXFA 5C6SA 3EHRA 2VGNA 2BE9B 1U5SA 1BI2A 3JCMh 3PVQA 3OYAA 4E7KA 2BZXA 2VYTA 2LJ1A 1VQ7A 5CKEA 2HBWA 1TTHB 4HVVA 4FW1A 2M16A 2KXDA 4RCBA 3LGFA 3OYLA 5GANg 5KCOA 4WCIA 4QT7A 4AFQC 2LMJA 3JCMV 2COYA 4C5HA 1B34A 4AT1B 1KC8C 4DQ2A 4J83A 2EQIA 3SWNB 4M7DE 5CQYA 4JS4A 4WF2A 1WXBA 1PNJA 3H8ZA 3CCLQ 3P8DA 2DTIA 1X75C 4BY6B 3HRUA 5AYFA 3JCMW 2VKNA 4HKEA 4L5GA 4HCZA 1NYFA 2F2WA 4PLIA 4A54A 2KT8A 4J9BA 2KROA 3OMGA 2FPDA 2OTLQ 3C94A 2KBTA 2LX7A 3SDZA 3TU4K 4LD9K 4J9FA 2KI7A 3EG0A 5CK9A 4C8QA 1ZBJA 1AVZC 1M90C 1TUGB 1NPRA 2QASA 1BU1A 2X9HA 1KQ1A 2A28A 4JRPA 3QWXX 2DYIA 1U06A 4ZGJB 2X3XD 2YLCA 4C92E 2EIFA 5IXBA 5KE3A 1SKUB 4BI3A 3OYDA 4XAXB 3M53A 1WHMA 4OB0B 2J6KA 2YHTA 4PJOD 2KXCA 2X3WD 1Q86U 5KYYB 3QBYA 1UHCA 2X4WA 4EMKB 1R8OB 2M51A 1MUZA 4M78G 5CCAA 2GFAA 4JRQA 2CUDA 4OGCA 2K9GA 1ZSZB 3A8HB 3I5SA 5GMKi 5IHNA 2ZCFB 1M1KU 3OYGA 1QP3A 3N5BB 2G3RA 3ZEHA 2CZ1B 2DD5A 2V8KA 2RHYA 1K8AU 1YHQT 5M9OA 1OU8A 3RERA 3X25B 3E9GA 2DBKA 1WFWA 4C5GA 4BE0A 4LUDA 2EKOA 4II1A 1H641 4XTYA 2RNAA 4LN2A 2VUBA 1M3CA 5LJ5f 1I81A 4M7AD 5IAYA 1WNLA 3WXMB 2JMCA 1VA7A 1NJIC 4M75C 1CSKA 3G4ST 4M7DB 1YCYA 9ATCB 1JEGA 2AZSA 2X4XA 1IGUA 4ELZC 2J06A 4KGZB 1TUCA 5CKBA 2RQVA 4B9XA 2A36A 4M7DF 1VIEA 1H3HA 3RESA 1WJRA 4A53A 1WI7A 1OV3A 3I56T 5EC7A 1RAAB 1YHQA 2K5IA 3JB9I 3VS1A 1G8XA 3MO8A 4J6WA 2R5AA 1SHGA 2ABLA 1U1SA 2FZKB 4M7AE 4QVZA 5FU6B 3CPWP 3EG1A 4RTZA 4XTUA 2VVKA 5FU7C 3DLLA 2CYZB 2QI2A 1EZZB 3NTKA 3PTAA 3J81E 1ZLMA 2GGRA 1QCFA 2NUTB 3URGA 4AMCA 3A98A 2OX7A 2HNIA 3M5AA 2LC4A 1Y96A 2DXTA 5IN1A 4Y92A 3G4SA 1O9SA 2EGAA 4C0DC 1ABQA 5GAN8 4ZTJA 1YITQ 1AWOA 3G6EQ 4C8QG 1E7OA 2CP2A 3VUZA 4ZNXA 2EFIA 4HVUA 4C92F 4B6MA 2VXEA 3I56A 2DIQA 1GCPA 4CC4B 2ED1A 4M78D 5CIUA 5L23A 4MZMA 1Q7YU 4JJCA 3VS0A 1R0BG 4BB7A 4J7FA 4X9CA 4E7SA 1H8KA 2GFUA 5FLXE 2A3LA 3MEVA 4RG2A 2KY9A 3RBBB 1C1AA 2DL4A 2P4TA 3CMAQ 3BW1A 4PJLA 3O8VA 1YJWQ 1WHJA 1NLPC 1WHKA 5CKDA 1KFZA 3CCQQ 2RK1A 4EDUA 3OYCA 1UJ0A 2HEQA 1BYMA 1Z9QA 1LPLA 4J9EA 4PJOB 2P84A 1RADB 2LT1A 1S72Q 2J7IA 2E65A 3I35A 4J6YA 3JCMb 1M4ZA 4QQ6A 4PJOF 1UTIA 2K3XA 2JTEA 2EYYA 2DFUA 2MK5A 2DTOA 3CMEQ 5GAN2 3A8MB 4OMLA 3M9QA 1PRLC 5GAN4 2RPNA 1I5OB 3DB4A 2H3JA 1GCQC 3CC2T 3ASKA 4KH1B 1RI0A 4F7UE 3L2VA 4M75A 4M7AB 5DLOA 1LVKA 2F69A 3CBMA 1M1KC 5LJ3g 1IREB 1JRIA 3M57A 1Q82U 3CCVT 2R5MA 4ZGEB 1ZSGA 4ZN1A 4F14A 2ROLA 1K73R 1K8AC 3MP8A 4M7AF 1D0ZA 1RAFB 4JLGA 1I5LA 5J39A 4RTTA 3EHQA 2JTFA 4MMKA 2DX1A 4C8QD 4JZ3A 2PVDB 4QVDA 3HL8A 4DOVA 4RTUA 4X34A 1K76A 1KG1A 1ZQ1A 3HSBA 3CCST 3OYBA 2VGMA 2A08A 1VQPT 1QVPA 3EH1A 2FO0A 4M77E 1KHIA 5LJ5d 2KT1A 3CC2A 4KRTA 2Y90A 2DL8A 5L8RE 2DXUA 3JCMe 5A0LA 1W4SA 2FB7A 3CCRQ 1T0HA 3QWYA 1WLPB 3LH0A 3TREA 4PNOA 3OYEA 2ZPBB 2KQWA 2RM4A 2FG0A 3EG9B 4BE2A 5GAOl 2R57A 3CCVA 2DJZA 1M2VA 4XU2A 2O4XA 3V8KA 1AD5A 1AWJA 2QEXT 4OMFB 5FRNA 1K0XA 1UUEA 1YJ9Q 2RJCA 4LXCA 1F1BB 5KYWA 2DM1A 3CXCA 4F16A 2E1HA 1VQ9T 2D6FA 1GBRA 3OQ5A 2HL3A 1NEBA 3PNWC 4M78B 3EH2A 4D6WA 2OI3A 3RIRA 5GAN7 3OY9A 1VQPA 3TVTA 4J9CA 2MYSA 5EG2A 2HKQB 1S1NA 2Z0WA 4Z8AA 2MCNA 1N6AA 4LUEA 3EGDB 2V8IA 3EG2A 3V7SA 1PD1A 1VQLQ 1JJ2A 1JB0E 1UDLA 1N5ZA 4R0KA 1OYXA 4ANJA 3VYGA 4F7UB 1RAHB 2LQWA 2QEXA 2MWPA 1AHJB 1QVGS 2LT4A 2K3BA 4JJDA 2OTLT 3PFSA 1Y0MA 3NHNA 1QQJA 2QQSA 4F7UF 5GANj 1VQ9A 5KE2A 2V26A 2YSQA 5FRMA 2JUFA 1YCSB 3JV3A 3TQ7P 3AHUA 2ZPFB 2CS7A 4BDYA 4M75G 3GBQA 2EVRA 5GJVB 1W2BP 2SEMA 1XTDA 3M59A 3MCAB 4J8OA 5CKFA 3H0HA 4N4GA 1GCQA 3MEWA 3CCLA 2ZPIB 4LNPA 3RR6A 3GIBA 4Q5WA 2DMOA 3RDVA 2C0OA 2DLPA 3X28B 3JCMX 5CR2A 2QDLA 1GFCA 3JCMc 2OTJQ 2VV5A 3OA6A 1SEMA 3TSZA 3JCMP 4M77F 1T3LA 4FYVB 2OTLA 2RH2A 5I2MA 1MV0B 4K11A 2DD4A 2JW4A 3PMTA 1NBEB 2P0PA 1KHCA 2PVOB 4C8QB 1PCXA 1QW1A 1FMVA 3A5ZB 2QXFA 1MV3A 3CC7Q 1X27A 2LNHB 2L3PA 1YJNQ 4EMGA 1YNZA 3M4GA 1ZUYA 3L2UA 3DB3A 2M9UA 1ZUUA 1MNDA 2M0YA 4IIOA 3DKMA 3KBGA 4Z02A 1Q82C 2BZYA 4O5VA 4OMOA 2XHCA 3SHWA 4L6V5 3ME9A 3V8JA 2LJ3A 4IKFA 5GAMg 2E6NA 2YLBA 3U23A 4A4HA 4LDWA 2O9VA 2MIOA 4LDUA 1HK9A 4FU6A 1ZA1B 2DJQA 5DLQE 4A4GA 3CPFA 3JB9H 2COZA 5GANe 1D09B 4J9HA 2DKGA 4QQDA 1VQ4Q 3QJYA 3VUBA 3M0QA 1QVFS 2JJ9A 1Q81R 3S3MA 4D8DA 3OYKA 3HKSA 3JCMJ 4BD3A 3QDRB 1WYXA 2DEUA 2BKDN 2C06A 2XU8A 1KSWA 2EAYA 4AG1C 1TUDA 2YT6A 4PFOA 2DL7A 1WQWA 2CSQA 2COWA 1Y07A 3M0RA 2FL7A 2NUPA 2PUOB 2D9TA 2O2OA 4M75D 3QO3A 5FWBA 4B9WA 1T0JA 1D0XA 4ATOA 2FRWA 2GCXA 2QDYB 3CCJT 2E3IA 4AG2C 4JUVA 2XIDA 1FMKA 4IURA 2D8JA 2DL3A 3G6ET 2EGEA 5FWCA 1NYGA 4IUQA 1VQMT 4PJNA 1J3TA 1B7TA 5IHKA 2QA4Q 2PTKA 2DXBA 1D3BA 1NG2A 3M58A 2D8HA 3LYIA 1WA7A 2DZ9A 3HFNA 4BI8B 2M0OA 2E64A 3OW2P 2V1QA 2MPXC 2EQMA 1WHGA 4HVWA 1BCOA 2RA2A 3MKDA 1I07A 2D0QB 2DE0X 2DEQA 3QZ5B 2E5KA 2PU9B 4PK4A 3VRZA 5GAN6 3QHSA 2XMFA 2O01E 3TCJA 3VS7A 1HJDA 3MJXA 4KGXB 1HXDA 1YIJT 4AFZC 1QWFA 1RACB 4XK8E 4IUUA 3JB9D 4C5EA 1YJWT 1VQ7Q 4ME7A 2AT1B 1Y96B 2HSEB 3CCJA 3CCQT 3UF4A 2CGHA 2E3HA 1D1CA 1VQKQ 4CC2A 1VQNQ 3SB2A 3EGUA 2EJFA 1JXMA 2KR3A 3G6EA 1ZA2B 4HXJA 3QKJA 4FYYB 1VQMA 1GBQA 3OYFA 2O31A 2P4RA 3OBYA 2BTTA 2FEIA 2C0TA 4QW2A 2MAMA 2PQWA 3BE3A 4FT4A 3ZL7C 4PJOE 3CMET 3CCEQ 2CZ7B 1I4K1 2EBPA 1VQ6Q 2RHUA 3JCMf 4ESRA 2QGFB 3C12A 3LX7A 3CXCP 4KH0B 3EFRA 2BE7D 4F17A 3H6ZA 1N27A 2RQRA 1UEBA 2O88A 4C92C 4CI0C 2L89A 1DJ7B 3G71T 1YIJA 2PVGB 3L2QA 2LCLA 5GAMh 5LL6S 2NYSA 1YJWA 5GAN5 4HCKA 3CCQA 1NZ9A 2X51A 2EQUA 1ARKA 1W2BA 1UGVA 2ROTA 5GANh 3VU3C 3QUIA 4WTOB 1VQ5T 1TXQA 3KFVA 4JS5A 1JJ2P 1G2BA 2YXYA 1RAIB 3ZBDA 2WSEE 2ZZDA 3J80E 4A63B 1BIBA 3I55T 3JB9J 3HPWA 2PZ1A 2HQEA 1LOJA 2KK4A 3A8LB 2B86A 3CMEA 2FYKA 4J6XA 4VUBA 1ZX6A 2DK3A 2XK0A 1KQ2A 4BUGA 1Y71A 2DVJA 1C6VX 4Z89A 4E7LA 1KQSP 1FYNA 1AZEA 1WJSA 3G71A 1TSFA 4EMHA 3FIFA 2QG9B 1JQQA 4ZN3A 1UE9A 4X1VA 3CCRT 2GBQA 2K5FA 4M75B 3E9FA 5LJ3j 2PUKB 2RJDA 3P8BB 3MP6A 2LTOA 4JRIA 1K4US 3A8OB 1VQ5A 4RCCA 3BDUA 3L2RA 2ENMA 1OOTA 1JO8A 2Y4XA 5ECAA 1WXTA 3QJ6A 4PLLA 2HD0A 1G83A 2DNUA 5AT1B 3I55A 1QP2A 4EPCA 2QQ9A 3M0SA 4A4EA 3DLMA 5KYUA 3T9NA 1YI2Q 3LWIA 3R6OA 4IIMA 2YWWA 3A1PA 4RG8A 1K73U 2EPDA 4M7DA 4M7AC 5FU7B 5GAOr 1OPKA 4GY5A 2CREA 2DYBA 3OYNA 4E7ZA 1Y57A 5GJWB 1PSEA 2RHXA 4M78E 2K6DA 1K9MR 2K3YA 3CCRA 1AWWA 2QTVA 4MZPA 1VQLT 3VV0A 4J9DA 2KE9A 4C0DB 1V1CA 2RQWA 3PE0A 5J3BA 1YHQQ 1M2VB 2FZCB 1CKBA 1WPYA 3JB9F 2MI6A 4FL6A 3I9QA 1UGQB 3MEUA 1PD0A 3VRYA 4BDZA 2DL5A 5KYWB 2NUTA 4PFPA 2RI3A 3M55A 4L59A 2CP3A 2ZPGB 5DM7R 1I0CA 1RLQC 4QVCA 3MEAA 1VOMA 2XDDA 5LJ3e 2GTOA 6AT1B 3FJPA 1LJOA 4MMLA 1U8RA 4C92A 3HRTA 3CD6T 5GANf 1IHVA 1M9SA 2XKOC 4LDYA 3GNGA 1E6HA 3OW2A 1OULA 5KCHA 1VQLA 3EG3A 2KVQG 4DEYA 2LZ6B 1K0SA 5HK0A 1K9AA 2CP0A 3EGXA 4X9DA 4RTXA 4N0AC 1VQ8Q 1BI1A 2JZ2A 1NLOC 1TS9A 2DO3A 1XQHA 3CPWS 3L2WA 3OYMA 2DTHA 2QGGA 3UA6A 1FWZA 3META 1VYTA 1OZ3A 1VQOQ 1SF9A 3OMCA 2CT4A 5GMKh 2KRMA 5I11A 3JCMd 1IRXA 1B3QA 4GLKA 4JPBW 2YUOA 3CC7T 2LCSA 1KD1R 3F70A 1N8RR 3Q1JA 1BI0A 2CSIA 1KIKA 2X4JA 4JDSA 4RTWA 4A4KA 1TH7A 2HCKA 3OYHA 4PJOA 2QYZA 5LJ5g 3CD6A 4C8QE 1D0YA 5GAOq 3G7ZA 3C0CA 1PSFA 2RD1A 5KYXB 2DVEA 3GF5A 2P0QA 1ACMB 3OS1A 1OI1A 1OU9A 2J6FA 1AOJA 8ATCB 4JRKA 2QTXA 3VKIA 4M7DG 4PFZA 1PHTA 3FC3A 4M78F 4E7HA 2VC8A 3MPUB 4FYXB 3CCLT 4JJBA 2YRDA 1ZBXA 4C0GA 3G1JA 4XTVA 3CC7A 1SG5A 3A8GB 2DAQA 4M7AA 2RF0A 2K2VA 2XDBA 3VS6A 4M77C 4HT8A 2GTJA 1OZ2A 2L3RA 4MZTA 3NTHA 2X35A 1GFDA 1KC8R 2KYBA 4KUIA 1B07A 5GAMj 2E70A 1NM7A 4FSXA 1YWPA 4GBQA 1XJWB 4RTVA 3EFOA 2F2XA 2KAFA 1G3TA 5A2QE 2DRKA 5GAN3 2EQKA 4OMNA 2RB6A 5IHIA 2RQTA 2L2PA 4IUPA 3R6NA 4OF1A 3CCUQ 1KQSA 4XQ3A 3BFMA 2EYWA 4NL2A 4PKCC 1B34B 2WACA 4ELYC 1K73C 3HFOA 2A7YA 3VS5A 1R0CB 2FPEA 1E6GA 2QA4T 1M3BA 3GLXA 3CC2Q 2MOXA 4C92G 4PJMA 3REBB 2D0NA 3TEEA 2RJEA 1QWEA 4N4IA 3KUFA 4M4ZA 3PIOA 1M90R 3QPHA 5LJ3h 3X26B 3VS3A 4EIKA 5HK3A 2CP7A 3CCVQ 2RK2A 3BY7A 3REAB 1Q81U 2NUPB 4OP0A 1D1AA 8AT1B 1YP5A 3SD4A 2K57A 4OMQA 3SFMA 2JM8A 2M02A 1AZGB 3SWNC 1UGRB 1UGSB 2JOYA 4N0AA 2GNCA 1VQKT 1VQNT 2DIGA 3VS2A 3FLGA 4IUVA 1EFNA 1U3OA 2LDMA 1BB9A 4BY6C 2HZYA 3CCSQ 4TVRA 4BACA 4RKUE 3M0TA 1UG1A 2QA4A 4C8QF 3S3OA 1D3BB 1HYOA 1TWBA 1WX6A 1I8FA 3CCET 1MMAA 3CBOA 5GAMe 2DA9A 1VQ6T 2CP6A 2K2MA 3CCMQ 1N9RA 1MMNA 1I1JA 1LCKA 1RUWA 2YRVA 3UDCA 3M54A 5GANd 3M0PA 4F7UA 5GAOm 1M2OA 4XTZA 2QEXQ 3HTRA 4XU0A 2HAXA 2JN0A 1UECA 1QKWA 2A37A 1WDXA 4ORZA 4D8KA 1OEBA 5HY6A 2IVWA 3OSVA 2IPOB 2JNGA 1VQKA 2EQJA 3GNFB 2ED0A 1VQNA 2X4YA 1VQ9Q 1WQ7A 3CC4Q 1NJIR 2RHZA 2K79A 1SRLA 2GQIA 3SEMA 2L5QA 1PKSA 4E47A 5GAOp 1AWXA 4M7AG 1G5VA 1YBYA 3QYGB 2AIRB 2K5LA 2XD0A 1LNXA 4J5YA 2K7AA 2B8AA 4OMMA 1ABOA 2DXCA 5D7UA 2LRQA 3CCEA 4EMKC 5GMKl 1VQ6A 1M8VA 2I2LA 3M0UA 3LH5A 2K4YA 1ZSZC 3RMQA 1UFFA 1IB8A 4M77A 3E1SA 4C92D 1TU0B 2KSSA 3HRSA 1YITT 4IUTA 2RI5A 1KK7A 2KEAA 4MDXA 1Z9ZA 5CKHA 2O9SA 1PC0A 2SRCA 2QQAA 1M5Q1 3H0FA 2OJ2A 1W1FA 1RLPC 3OS5A 2HDAA 4HA8A 4FCYA 3CQTA 1X2KA 2XG8D 2JT4A 2LP5A 4QQGA 1W2BS 4M75E 3VS4A 2YUNA 4FW2A 4M7DC 5LJ3f 2KNBB 5GMKj 5IXFA 4LD6A 3OSSC 4FM4B 1IO6A 3CMAT 1YI2T 1AEYA 1Y7XA 2L0AA 2DZCA 2EYZA 1C0MA 5HKCA 3QXEB 4OVAA 2ECZA 1YITA 2KDSA 1V76A 1UGPB 1UHFA 1QVFA 3CBPA 3UATA 3E2UA 1OX8A 3INZA 2LVMA 2XI9A 3JRZA 1S72T 1YWOA 3SWNA 2CT3A 5FU6C 2F5KA 2JS0A 4E7IA 5GAOn 1T3SA 2W10A 4FT2A 5I2SA 2JS2A 3QG1A 4A4FA 3GPLA 1SRMA 2RI2A 3FDRA 1D1BA 5IT9E 1AT1B 3THKA 1UJYA 2I0NA 4C5IA 3H9NA 5D6XA 3NGPA 3PMIA 4DOWA 2ZAEA 1QCNA 2FHDA 3CMAA 2F5TX 2C0IA 2FZGB 2GF7A 5KYUB 1YI2A 1Q81C 4F7UG 1ZHIA 1WXUA 3H41A 4DBQA 1IZ6A 4XTWA 2RMOA 3O5ZA 1RI9A 4J9GA 4OMPA 2LJ0A 4FSSA 2HL5C 1RAEB 2ZPHB 5C0MA 1X6GA 3PGGA 3MHXA 4KGVB 2CP5A 4CC3A
chains in the Genus database with same CATH topology
1VUBA 3QZ9B 4UC4A 2MWPA 2QEXA 1AHJB 4CRIA 1QVGS 3MEAA 1S72A 2LT4A 2XDDA 3HRUA 5AYFA 3JCMW 5LJ3e 2OTLT 3PFSA 3C95A 2QQSA 3FJPA 4MDWA 4F7UF 5GANj 1LJOA 2BUDA 4MMLA 3V8LA 4BI4A 4HKEA 1U8RA 4L5GA 3HRTA 4C92A 5KE2A 5GMKe 1VQ9A 5FRMA 1VQ8T 4HCZA 2JUFA 3CD6T 5GANf 3EFSA 5J26A 1M9SA 4PLIA 4A54A 3AHUA 2XKOC 2ZPFB 2JVVA 2CS7A 5D6WA 4LDYA 5CO7A 3GNGA 4M75G 4BDYA 3UWNA 3OW2A 1M1GA 3OMGA 4KBMB 3C94A 1XTDA 3M59A 3MCAB 4J8OA 5CKFA 3SDZA 5KCHA 2KVQG 3TU4K 1K9MU 1VQLA 4N4GA 4LD9K 2L8DA 4M77G 5HK0A 4X9DA 3MEWA 4N0AC 4EMKA 1VQOT 1BI1A 2JZ2A 5CK9A 4C8QA 1M90C 3CCLA 2DO3A 4PJOC 2ZPIB 4N4HA 1X01A 5KH6A 1NPRA 3GIBA 1NPPA 1XQHA 1KQ1A 2MWOA 4JRPA 3C4SA 3UPUA 2CKKA 3L2WA 3OYMA 3CPWS 5GMKm 1WJQA 2DTHA 3LLRA 2IG0A 4Q5WA 4J7IA 4ZGJB 1XOVA 4XU1A 2RHIA 1YJWT 2YLCA 1FWZA 3META 3X28B 1OZ3A 3JCMX 1U1TA 1P92A 3OMCA 5CR2A 4C92E 2E41A 4RMOA 3VJPA 5GMKh 3OYJA 4C92B 4M75F 2EIFA 3JCMd 3JCMc 2VV5A 5KE3A 1JBMA 4BI3A 3OA6A 3OYDA 4XAXB 4GLKA 3JAME 3M53A 2GQVA 4NS5A 3JCMP 4M77F 3CC7T 4OB0B 3F70A 2EJGA 3Q1JA 1BI0A 2RH2A 5I2MA 3JSCA 1YJ9T 2OTLA 2YHTA 2X4JA 4JDSA 4PJOD 2EYQA 4A4KA 1TH7A 1Q86U 2DD4A 3MP1A 2ZGWA 3PMTA 3QBYA 3OYHA 4PJOA 2P0PA 2X4WA 5LJ5g 3OW2S 3NFCA 1KHCA 3S6WA 2PVOB 4C8QE 4EMKB 5I21A 3CD6A 4C8QB 1R8OB 1QW1A 5GAOq 3A5ZB 2QXFA 4M78G 5CCAA 2GFAA 4JRQA 3G7ZA 4OGCA 3ZFJA 3A8HB 5GMKi 4EMGA 2ZCFB 1M1KU 1PSFA 3M4GA 2RD1A 3L2UA 3PIPA 3OYGA 1QP3A 3DB3A 2M9UA 2LQ8A 3N5BB 2DVEA 2G3RA 3OBWA 3RKXA 1EIFA 1H3ZA 3DKMA 3GF5A 3ZEHA 1VQOA 2CZ1B 2DD5A 2P0QA 3KBGA 4Z02A 3GOXA 2LQKA 1Q82C 2V8KA 2RHYA 4O5VA 1K8AU 1YHQT 2XHCA 5M9OA 2EJ9A 4L6V5 3OS1A 3RERA 3ME9A 3V8JA 3X25B 1GXIE 1OI1A 3E9GA 5GAMg 2E6NA 4IKFA 4JRKA 4C5GA 2QTXA 3QIIA 3VKIA 2YLBA 4BE0A 4A4HA 4M7DG 4LDWA 2EKOA 4LDUA 1HK9A 1H641 4FU6A 4II1A 4XTYA 5DLQE 4A4GA 3CPFA 4M78F 5LJ5j 3LWHA 3FC3A 4E7HA 5GANe 4KUDK 3JB9H 2VC8A 2VUBA 3OS0A 5LJ5f 3CCLT 1BIAA 1ZBXA 1I81A 2DKGA 4C0GA 2O4XB 4QQDA 5IAYA 4M7AD 3RKWA 4XTVA 3CC7A 3X24B 3A8GB 1WNLA 2DAQA 3QJYA 3VUBA 3WXMB 2WSFE 4LDXA 4M7AA 4M7AE 1NJIC 3V7RA 4OGEA 2M1HA 4M75C 3UT1A 2K2VA 4OB1B 3G4ST 1YJ9A 1QVFS 2XDBA 4M7DB 1YCYA 3S3MA 2X4XA 3OYKA 2MMPA 4M77C 4HT8A 1KD1U 3HKSA 4ELZC 1OZ2A 2L3RA 3QDRB 4MZTA 5CQXA 4BD3A 3JCMJ 1N8RU 1NE8A 3NTHA 2X35A 5CKBA 4R56A 2BKDN 4KUIA 3RMSA 4B9XA 5GAMj 2E70A 4FSXA 1BKBA 5D6YA 2XU8A 3CCUT 2C06A 3EAEA 4M7DF 1VIEA 2EAYA 3CXCS 3CC2A 4DA4A 5GAMf 4HT9A 5LJ3d 3RESA 1WJRA 1WQWA 2KAFA 4QVCA 1G3TA 4A53A 3JCMQ 3QYHB 5A2QE 5GAN3 1Y07A 2EQKA 2RB6A 2FL7A 3I56T 2OAUA 1Q86C 4IUPA 4OF1A 1YHQA 2K5IA 3JB9I 3RKYA 4HCBA 2PUOB 4XQ3A 1KQSA 3BFMA 2D9TA 3MO8A 4J6WA 4M75D 3QO3A 2R5AA 1U1SA 4B9WA 2E12A 2RJFA 2ZPEB 4NL2A 4PKCC 4ATOA 1B34B 2WACA 4QVZA 4M77D 5FU6B 2GCXA 2QDYB 4ELYC 4XTUA 3CCJT 1K73C 3HFOA 4NL3A 2A7YA 5FU7C 5CAIA 3DLLA 2CYZB 2QI2A 2QA4T 3NTKA 4JUVA 3PTAA 2XIDA 3GLXA 3ER0A 4KT0E 5DY9A 3J81E 3CEYA 4IURA 4C92G 1V29B 1JJ2S 3URGA 5A0GA 4FIBA 3G6ET 3TEEA 2RJEA 2OTJT 3KXTA 4N4IA 3KUFA 2HNIA 4M78C 4OB3B 3M5AA 3OYYA 4IUQA 1VQMT 2LC4A 1Y96A 2DXTA 3PIOA 5FROA 5IN1A 1X6OA 3FB9A 3G4SA 3QPHA 5LJ3h 3X26B 2DXBA 1D3BA 3M58A 3VYHB 1O9SA 5HK3A 4C0DC 5GAN8 4ZTJA 3LYIA 2DZ9A 2RK2A 3HFNA 3BY7A 4BI8B 1Q81U 2M0OA 4C8QG 2E64A 4PL6A 3CCUA 2EQMA 4OP0A 3SD4A 3VUZA 2K57A 1KC8U 3SFMA 2RA2A 2EFIA 2D0QB 2E6ZA 1YJNT 2DEQA 3QZ5B 4C92F 3SWNC 1KQSS 2PU9B 1UGRB 2VXEA 1UGSB 2JOYA 4N0AA 5GAN6 3QHSA 1VQKT 5LJ5e 3I56A 3M56A 2DIQA 1VQNT 2DIGA 1MGQA 4M78D 2O01E 3FLGA 5CIUA 3TCJA 4IUVA 4MZMA 1HXDA 3NTIA 1YIJT 1Q7YU 3LW5E 4BY6C 2LDMA 3JCMg 4BB7A 3OYIA 4XK8E 4IUUA 4OB2B 4TVRA 2XDPA 4C5EA 4BACA 3JB9D 4ME7A 4J7FA 3CCMT 3LGLA 4RKUE 1Y96B 4X9CA 3CCJA 4XTXA 3CCQT 2CGHA 1MHNA 2HQXA 1WGSA 2GFUA 2QA4A 4C8QF 5FLXE 3S3OA 2EWNA 1D3BB 2A3LA 2DPPB 3MEVA 1I8FA 2KY9A 2EJFA 4RG2A 3SB2A 3OS2A 2P4TA 2XICA 3CCET 2Y4YA 3G6EA 1FXXA 3BW1A 2OTJA 3CBOA 3QKJA 3O8VA 5GAMe 3E19A 1VQ6T 1VQMA 2CZ6B 3OYFA 1VQ4T 5CKDA 2FVUA 1N9RA 3OBYA 2RK1A 4EDUA 3L42A 3FEOA 3OYCA 4QW2A 1K9MC 2MAMA 2PQWA 3GP8A 2YRVA 3UDCA 4FT4A 3M54A 1BYMA 5GANd 1M90U 4PJOE 3CMET 4PJOB 2CZ7B 3CC4T 4E7JA 1I4K1 1RL2A 4F7UA 5GAOm 4KULA 4YTLA 2RHUA 4XTZA 2BIVA 2E5QA 4XU0A 3JCMf 2LT1A 2HAXA 2JN0A 3CCSA 3LX7A 3C12A 1VQ8A 2E65A 4P5NA 3EFRA 1YJNA 4J6YA 2LCCA 3JCMb 1M4ZA 5HY6A 4QQ6A 3P8HA 2IVWA 4PJOF 3OSVA 1M1FA 2K3XA 2JNGA 1VQKA 2EQJA 1FX7A 3GNFB 1VQNA 2DTOA 2X4YA 3H6ZA 3A8MB 1WQ7A 5GAN2 1N27A 3HHTB 1UEBA 2RHZA 2MF2A 4C92C 4CI0C 4JJNK 3M9QA 2L89A 1DJ7B 3G71T 5GAN4 1YIJA 2L5QA 2PVGB 2LCLA 1UB4A 4E47A 5GAMh 5LL6S 3L2QA 3S3NA 5GAOp 1YJWA 4XU3A 2LNVA 3CCMA 2P0KA 3M4YA 5GAN5 3CCQA 4M7AG 1YBYA 3QYGB 1G5VA 1NZ9A 2EQUA 3DB4A 2K5LA 2XD0A 1LNXA 2CZ0B 4J5YA 2H3JA 4LDVA 3WVEB 2B8AA 3FRNA 1W2BA 2DXCA 5GANh 3VU3C 3QUIA 3CPWA 3CC2T 3RUXA 3ASKA 2LRQA 3CCEA 1VQ5T 4EMKC 5GMKl 1VIFA 4JS5A 4C8QC 1RI0A 4F7UE 4HCCA 4Y28E 1VQ6A 1M8VA 2I2LA 1Q7YC 3L2VA 1VQ4A 4M75A 3V7CA 2K4YA 3ZBDA 2WSEE 2ZZDA 4M7AB 5DLOA 3J80E 4ZGDB 3RMQA 2F69A 1BIBA 4M77A 3CBMA 3E1SA 2KMTA 3X20B 3I55T 3L2ZA 3HPWA 3JB9J 1M1KC 5LJ3g 1IREB 4C92D 1JRIA 2HQEA 1LOJA 2KSSA 3M57A 2KK4A 1BI3A 3A8LB 3HRSA 3CMEA 3CCVT 2FYKA 2R5MA 1YITT 1Q82U 3CC4A 4IUTA 4ZGEB 2RI5A 4ZN1A 1K8AC 4M7AF 3MP8A 4J6XA 4VUBA 2QQBA 2RO0A 2DK3A 2XK0A 4MDXA 5CKHA 4JLGA 3BDLA 1I5LA 1KQ2A 5J39A 4BUGA 1Y71A 2QQAA 1G3SA 1M5Q1 3L1AA 3J7AF 4R55A 2JTFA 4MMKA 4C0FA 4E7LA 4C8QD 4JLIA 2R58A 3OS5A 2PVDB 4QVDA 4HA8A 1G3YA 3HL8A 1WJSA 4O6JA 4DOVA 3G71A 4X34A 2V8JA 2XG8D 1XNIA 4EMHA 3FIFA 1KG1A 1ZQ1A 3HSBA 4QQGA 4ZN3A 1W2BS 4M75E 3CCST 1NJIU 3CCRT 2K5FA 4M75B 1VQ7T 3E9FA 3WVDB 3OYBA 5LJ3j 4BE1A 2PUKB 2RJDA 2VGMA 3P8BB 1VQPT 1QVPA 1SSFA 4M77E 1KHIA 4M7DC 2WSCE 3MP6A 4M77B 4ZTFA 2LTOA 1G3WA 5LJ3f 5LJ5d 4JRIA 4C0ZA 2E10A 3A8OB 3PT9A 5GMKj 4LD6A 2Y90A 1N8RC 1KD1C 2AHJB 3OSSC 1VQ5A 4FM4B 5L8RE 4RCCA 1O75A 2DXUA 4V2SA 3JCMe 3BDUA 4M78A 3CMAT 1YI2T 3L2RA 5A0LA 2Y4XA 1W4SA 1Y7XA 2FB7A 3QJ6A 4NOYA 2NLUA 2DZCA 2QQRA 4PLLA 5HKCA 2HD0A 3HP9A 1N9SA 3LH0A 3TREA 3I55A 3QXEB 4PNOA 4OVAA 3OYEA 5CVIA 2ZPBB 2KQWA 2RM4A 1QP2A 4EPCA 4BE2A 2QQ9A 5GAOl 2R57A 3CCVA 2DJZA 4A4EA 1YITA 4PJOG 2KDSA 3DLMA 3QSUA 1QVFA 1UGPB 3T9NA 3LWIA 5A0DA 3R6OA 4XU2A 3CBPA 2O4XA 5GAMd 3V8KA 2HBPA 3INZA 2QEXT 2LX9A 4M7DD 2LVMA 4OMFB 2XI9A 3JRZA 4RG8A 5FRNA 1S72T 3SWNA 1K73U 5FU6C 2F5KA 2JTMA 2RJCA 4M7DA 5FU7B 4Y91A 4M7AC 5GAOr 4E7IA 5GAOn 3JB9G 3OB9A 4FT2A 4GY5A 5LJ5h 3CXCA 1QVGA 3OYNA 5I2SA 2E1HA 2VXFA 5C6SA 1VQ9T 3QG1A 4A4FA 2D6FA 3OQ5A 3GPLA 2VGNA 2RI2A 1PSEA 2RHXA 3FDRA 1BI2A 3PNWC 4M78E 3JCMh 4M78B 2K3YA 5IT9E 3OYAA 4E7KA 2VYTA 4D6WA 3CCRA 1VQ7A 3RIRA 5GAN7 5CKEA 3OY9A 1VQPA 4C5IA 4MZPA 1VQLT 5EG2A 3VV0A 5D6XA 3PMIA 4C0DB 4DOWA 2M16A 4RCBA 3LGFA 3OYLA 1N6AA 5J3BA 2FHDA 5GANg 3CMAA 2F5TX 2GF7A 5KCOA 1YI2A 1Q81C 2V8IA 4F7UG 1WPYA 3JCMV 3JB9F 3V7SA 1ZHIA 4C5HA 2MI6A 1B34A 4FL6A 1IZ6A 1KC8C 4DQ2A 1JB0E 4J83A 1JJ2A 1UGQB 3SWNB 3MEUA 4M7DE 4XTWA 1OYXA 4BDZA 5CQYA 4JS4A 4WF2A 3H8ZA 2ZPHB 5C0MA 2RI3A 3P8DA 3M55A 2DTIA 3MHXA 3PGGA 4L59A 3VYGA 1X75C 2ZPGB 5DM7R 4F7UB 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UC4 A;  2LDM A;  4A4G A;  2MWP A;  3FC3 A;  4E7L A;  3OYI A;  4E7H A;  4IUU A;  4CRI A;  4C5E A;  2R58 A;  2XDP A;  3MEA A;  4BAC A;  3LGL A;  3OS0 A;  1WJS A;  3PFS A;  1MHN A;  2HQX A;  1WGS A;  2GFU A;  4X34 A;  3S3O A;  1XNI A;  2O4X B;  4QQD A;  5IAY A;  2QQS A;  2BUD A;  2DAQ A;  3MEV A;  4QQG A;  4RG2 A;  5KE2 A;  3E9F A;  3OS2 A;  2M1H A;  4HCZ A;  3UT1 A;  3OYB A;  4BE1 A;  4II1 A;  2RJD A;  5FRM A;  1SSF A;  3QKJ A;  3S3M A;  3O8V A;  2X4X A;  3MP6 A;  5J26 A;  3OYK A;  4ZTF A;  4PLI A;  2LTO A;  3OYF A;  5D6W A;  1OZ2 A;  2L3R A;  4BD3 A;  4BDY A;  4LD6 A;  3UWN A;  3NTH A;  2X35 A;  3OMG A;  4EDU A;  3L42 A;  3FEO A;  5KCH A;  2BKD N;  3OYC A;  4B9X A;  4QW2 A;  3L2R A;  2PQW A;  4N4G A;  2L8D A;  5D6Y A;  3EAE A;  2YRV A;  3QJ6 A;  3MEW A;  2NLU A;  2QQR A;  4PLL A;  2JZ2 A;  3LH0 A;  4E7J A;  4N4H A;  1WJR A;  5KH6 A;  4OVA A;  2RHU A;  3OYE A;  2BIV A;  2MWO A;  2EQK A;  2E5Q A;  4BE2 A;  3C4S A;  2CKK A;  2R57 A;  3OYM A;  3LX7 A;  3L2W A;  4A4E A;  1WJQ A;  3LLR A;  4IUP A;  2IG0 A;  3DLM A;  4Q5W A;  2LCC A;  4QQ6 A;  2RHI A;  3P8H A;  2D9T A;  2O4X A;  3MO8 A;  2K3X A;  2R5A A;  3MET A;  2EQJ A;  1OZ3 A;  4B9W A;  2RJF A;  2X4Y A;  2LVM A;  3H6Z A;  3OMC A;  5FRN A;  1N27 A;  2WAC A;  4QVZ A;  2RHZ A;  3OYJ A;  2F5K A;  2RJC A;  3M9Q A;  2L89 A;  5KE3 A;  4E7I A;  3OA6 A;  3OYD A;  3L2Q A;  3S3N A;  3NTK A;  3OB9 A;  4GY5 A;  4NS5 A;  3OYN A;  5C6S A;  2P0K A;  3CEY A;  4A4F A;  3F70 A;  4IUR A;  1G5V A;  3Q1J A;  3OQ5 A;  2RI2 A;  2RHX A;  2EQU A;  3FDR A;  2RJE A;  3DB4 A;  3PNW C;  4N4I A;  3KUF A;  2K3Y A;  3OYA A;  4E7K A;  4IUQ A;  2B8A A;  2VYT A;  3MP1 A;  3PMT A;  3QBY A;  3OYH A;  5FRO A;  2X4W A;  5IN1 A;  1KHC A;  2LRQ A;  3ASK A;  3S6W A;  3OY9 A;  4C5I A;  1RI0 A;  5D6X A;  2GFA A;  3PMI A;  3L2V A;  2M16 A;  4ZTJ A;  3LYI A;  3LGF A;  3OYL A;  2FHD A;  2M0O A;  2GF7 A;  5KCO A;  3L2U A;  3OYG A;  3DB3 A;  4PL6 A;  2EQM A;  2G3R A;  1H3Z A;  2HQE A;  3SD4 A;  3ZEH A;  4C5H A;  4FL6 A;  4Z02 A;  3GOX A;  2R5M A;  2EFI A;  2RHY A;  4IUT A;  2RI5 A;  5M9O A;  3MEU A;  3MP8 A;  1OYX A;  4BDZ A;  3OS1 A;  2RO0 A;  2XK0 A;  3ME9 A;  1OI1 A;  3BDL A;  3E9G A;  4IKF A;  2E6N A;  2DIQ A;  3H8Z A;  5J39 A;  5C0M A;  2DIG A;  2RI3 A;  5CIU A;  3FLG A;  3QII A;  3P8D A;  4C5G A;  4L59 A;  4BE0 A;  4A4H A;  4IUV A;  2JTF A;  3NTI A;  2EKO A;  4FU6 A; 
#chains in the Genus database with same CATH topology
 1VUB A;  3QZ9 B;  2YUP A;  4UC4 A;  4CRI A;  1S72 A;  1Q86 R;  1X6B A;  3C95 A;  4MDW A;  2VAS A;  2BUD A;  3V8L A;  4BI4 A;  1PKT A;  5GMK e;  1IXD A;  1VQ8 T;  1VYV A;  3EFS A;  1M1K R;  5J26 A;  1WHH A;  2HSP A;  2JVV A;  5D6W A;  5CO7 A;  3UWN A;  1M1G A;  4KBM B;  1K9M U;  1QKX A;  1SHF A;  2CH4 W;  1K8A R;  2L8D A;  4M77 G;  5KYY A;  1VQO T;  4EMK A;  4PJO C;  4N4H A;  1X01 A;  2KGT A;  5KH6 A;  1JXO A;  1NPP A;  2MWO A;  1ZSZ A;  3C4S A;  3UPU A;  2CKK A;  5GMK m;  1M8M A;  1WJQ A;  3LLR A;  2IG0 A;  3CCJ Q;  4J7I A;  1X43 A;  1XOV A;  2NWM A;  2L3Q A;  4XU1 A;  2RHI A;  1CKA A;  2EYX A;  3I5R A;  1U1T A;  1P92 A;  2E41 A;  4RMO A;  3VJP A;  3OYJ A;  4C92 B;  4M75 F;  1HSQ A;  1JBM A;  2VB6 A;  3JAM E;  2GQV A;  4NS5 A;  1VQM Q;  1BBZ A;  1W6X A;  4DBH A;  2EW3 A;  2EJG A;  2AKK A;  1YJ9 T;  3JSC A;  1M27 C;  1NEG A;  2EYQ A;  2F1L A;  3MP1 A;  2ZGW A;  3EGX B;  1KJW A;  1X69 A;  1VQ8 A;  3OW2 S;  3NFC A;  3S6W A;  5I21 A;  4PJJ A;  4FYW B;  1IGQ A;  1OX9 A;  2RQU A;  1GRI A;  3ZFJ A;  1X2Q A;  3PIP A;  3OBW A;  2LQ8 A;  1H92 A;  3RKX A;  1EIF A;  1H3Z A;  1VQO A;  2KRS A;  3GOX A;  2LQK A;  3PVL A;  2NUZ A;  2EJ9 A;  1YIJ Q;  1GXI E;  3QII A;  5I22 A;  1GL5 A;  1QLY A;  2JM9 A;  2YUQ A;  5LJ5 j;  3LWH A;  4KUD K;  3OS0 A;  1BIA A;  1TG0 A;  4J9I A;  2OAW A;  2O4X B;  3RKW A;  3X24 B;  4LDX A;  2PNI A;  2WSF E;  4GLM A;  3V7R A;  4OGE A;  2M1H A;  3UT1 A;  1QVG P;  1WIE A;  4OB1 B;  1YJ9 A;  5IH2 A;  2MMP A;  1KD1 U;  1N8R U;  5CQX A;  1NE8 A;  4R56 A;  3RMS A;  1BKB A;  5D6Y A;  3CCU T;  3EAE A;  2G6F X;  2A0F B;  3CXC S;  2EKH A;  4DA4 A;  5GAM f;  3G4S Q;  4HT9 A;  5LJ3 d;  3D7S B;  3JCM Q;  2CDT A;  3QYH B;  2DBM A;  5HCK A;  1MMG A;  2BZ8 A;  1Q7Y R;  1RAB B;  4QKU A;  2OAU A;  2FPF A;  1Q86 C;  3RKY A;  3G71 Q;  4HCB A;  1Q95 G;  1RAG B;  2E12 A;  2RJF A;  2ZPE B;  4M77 D;  4NL3 A;  4LE9 A;  5CAI A;  1PM3 A;  3I56 Q;  3ER0 A;  4KT0 E;  2QK0 A;  5DY9 A;  3CEY A;  1VQ5 Q;  1JJ2 S;  1V29 B;  2V1R A;  1OQK A;  5A0G A;  3UA7 A;  4FIB A;  2OTJ T;  3KXT A;  4M78 C;  3IQL A;  3OYY A;  4OB3 B;  4CC7 A;  5FRO A;  1X6O A;  3FB9 A;  3I55 Q;  2EGC A;  1TOV A;  3EFO B;  3NPF A;  3H0I A;  3VYH B;  2VWF A;  1ZUK A;  4E2F B;  4PL6 A;  3CCU A;  2HKN A;  1KC8 U;  1R77 A;  2E6Z A;  1YJN T;  1M30 A;  1KQS S;  2J05 A;  2CH4 A;  5LJ5 e;  3M56 A;  1MGQ A;  2JMA A;  2YDL A;  3NTI A;  1PWT A;  2DIL A;  3LW5 E;  3JCM g;  3FJ5 A;  3OYI A;  4OB2 B;  2XDP A;  4V2S A;  2FRY A;  3LGL A;  3CCM T;  4XTX A;  1MHN A;  2HQX A;  1WGS A;  2EWN A;  2DPP B;  4RUG A;  3OS2 A;  2XIC A;  1FMW A;  2Y4Y A;  1FXX A;  4JZ4 A;  2OTJ A;  2D1X A;  3E19 A;  2CZ6 B;  1VQ4 T;  2E4H A;  2FVU A;  2AKL A;  3L42 A;  1Q82 R;  3FEO A;  1WHL A;  1K9M C;  1QVF P;  5KYN A;  3GP8 A;  2AK5 A;  1K1Z A;  1M90 U;  2JXB A;  2QAZ A;  3AT1 B;  2IIM A;  3CC4 T;  4E7J A;  1RL2 A;  4KUL A;  4YTL A;  2BIV A;  2E5Q A;  3TSW A;  3CCS A;  4P5N A;  1YJN A;  2LCC A;  3P8H A;  1M1F A;  1FX7 A;  1BK2 A;  1JU5 C;  3HHT B;  2MF2 A;  4E6R A;  4JJN K;  1HD3 A;  1UB4 A;  1QCO A;  3S3N A;  4XU3 A;  2LNV A;  4AFU C;  3NMZ C;  3CCM A;  2P0K A;  3M4Y A;  4AFS C;  1M3A A;  2L3S A;  2KYM A;  2CZ0 B;  4LDV A;  2HQH A;  1WZO A;  3WVE B;  3FRN A;  3CPW A;  3RUX A;  1PRM C;  7AT1 B;  1VIF A;  4C8Q C;  4HCC A;  4Y28 E;  1Q7Y C;  1VQ4 A;  1QMC A;  3V7C A;  1A0N B;  4DBF A;  1VYU A;  4ZGD B;  2DRM A;  3X20 B;  2KMT A;  3L2Z A;  4DBR A;  1BI3 A;  2H3E B;  2F2V A;  2RN8 A;  3CC4 A;  1YN8 A;  2HMA A;  4RTY A;  2DER A;  1SSH A;  1YFN A;  1IHW A;  2QQB A;  2RO0 A;  1MMD A;  2W0Z A;  3QDF A;  3BDL A;  1W70 A;  1G3S A;  3J7A F;  3L1A A;  4R55 A;  3EG9 A;  4C0F A;  4JLI A;  2R58 A;  2LQN A;  1G3Y A;  4O6J A;  3CD6 Q;  2V8J A;  1XNI A;  1NJI U;  2DF6 A;  1VQ7 T;  3WVD B;  4BE1 A;  5KYX A;  2AZV A;  1SSF A;  2WSC E;  4ZTF A;  4M77 B;  1PG5 B;  1G3W A;  2H8H A;  1MNE A;  4C0Z A;  2E10 A;  3PT9 A;  1KD1 C;  1N8R C;  2AHJ B;  1O75 A;  2J6O A;  2ATC B;  4M78 A;  4NOY A;  2NLU A;  2QQR A;  3HP9 A;  1VQP Q;  1N9S A;  5CVI A;  3RNJ A;  4F04 B;  4PJO G;  1EX4 A;  5FW9 A;  3QSU A;  3EGD A;  5A0D A;  1OPL A;  1BCM A;  5GAM d;  2HBP A;  2ESW A;  2LX9 A;  4M7D D;  3ULR B;  1SPK A;  2JTM A;  4Y91 A;  2CUB A;  2KRN A;  3JB9 G;  4Z88 A;  2YRC A;  4DEX A;  3OB9 A;  5LJ5 h;  1QVG A;  2DET A;  2VXF A;  5C6S A;  3EHR A;  2VGN A;  2BE9 B;  1U5S A;  1BI2 A;  3JCM h;  3PVQ A;  3OYA A;  4E7K A;  2BZX A;  2VYT A;  2LJ1 A;  1VQ7 A;  5CKE A;  2HBW A;  1TTH B;  4HVV A;  4FW1 A;  2M16 A;  2KXD A;  4RCB A;  3LGF A;  3OYL A;  5GAN g;  5KCO A;  4WCI A;  4QT7 A;  4AFQ C;  2LMJ A;  3JCM V;  2COY A;  4C5H A;  1B34 A;  4AT1 B;  1KC8 C;  4DQ2 A;  4J83 A;  2EQI A;  3SWN B;  4M7D E;  5CQY A;  4JS4 A;  4WF2 A;  1WXB A;  1PNJ A;  3H8Z A;  3CCL Q;  3P8D A;  2DTI A;  1X75 C;  4BY6 B;  3HRU A;  5AYF A;  3JCM W;  2VKN A;  4HKE A;  4L5G A;  4HCZ A;  1NYF A;  2F2W A;  4PLI A;  4A54 A;  2KT8 A;  4J9B A;  2KRO A;  3OMG A;  2FPD A;  2OTL Q;  3C94 A;  2KBT A;  2LX7 A;  3SDZ A;  3TU4 K;  4LD9 K;  4J9F A;  2KI7 A;  3EG0 A;  5CK9 A;  4C8Q A;  1ZBJ A;  1AVZ C;  1M90 C;  1TUG B;  1NPR A;  2QAS A;  1BU1 A;  2X9H A;  1KQ1 A;  2A28 A;  4JRP A;  3QWX X;  2DYI A;  1U06 A;  4ZGJ B;  2X3X D;  2YLC A;  4C92 E;  2EIF A;  5IXB A;  5KE3 A;  1SKU B;  4BI3 A;  3OYD A;  4XAX B;  3M53 A;  1WHM A;  4OB0 B;  2J6K A;  2YHT A;  4PJO D;  2KXC A;  2X3W D;  1Q86 U;  5KYY B;  3QBY A;  1UHC A;  2X4W A;  4EMK B;  1R8O B;  2M51 A;  1MUZ A;  4M78 G;  5CCA A;  2GFA A;  4JRQ A;  2CUD A;  4OGC A;  2K9G A;  1ZSZ B;  3A8H B;  3I5S A;  5GMK i;  5IHN A;  2ZCF B;  1M1K U;  3OYG A;  1QP3 A;  3N5B B;  2G3R A;  3ZEH A;  2CZ1 B;  2DD5 A;  2V8K A;  2RHY A;  1K8A U;  1YHQ T;  5M9O A;  1OU8 A;  3RER A;  3X25 B;  3E9G A;  2DBK A;  1WFW A;  4C5G A;  4BE0 A;  4LUD A;  2EKO A;  4II1 A;  1H64 1;  4XTY A;  2RNA A;  4LN2 A;  2VUB A;  1M3C A;  5LJ5 f;  1I81 A;  4M7A D;  5IAY A;  1WNL A;  3WXM B;  2JMC A;  1VA7 A;  1NJI C;  4M75 C;  1CSK A;  3G4S T;  4M7D B;  1YCY A;  9ATC B;  1JEG A;  2AZS A;  2X4X A;  1IGU A;  4ELZ C;  2J06 A;  4KGZ B;  1TUC A;  5CKB A;  2RQV A;  4B9X A;  2A36 A;  4M7D F;  1VIE A;  1H3H A;  3RES A;  1WJR A;  4A53 A;  1WI7 A;  1OV3 A;  3I56 T;  5EC7 A;  1RAA B;  1YHQ A;  2K5I A;  3JB9 I;  3VS1 A;  1G8X A;  3MO8 A;  4J6W A;  2R5A A;  1SHG A;  2ABL A;  1U1S A;  2FZK B;  4M7A E;  4QVZ A;  5FU6 B;  3CPW P;  3EG1 A;  4RTZ A;  4XTU A;  2VVK A;  5FU7 C;  3DLL A;  2CYZ B;  2QI2 A;  1EZZ B;  3NTK A;  3PTA A;  3J81 E;  1ZLM A;  2GGR A;  1QCF A;  2NUT B;  3URG A;  4AMC A;  3A98 A;  2OX7 A;  2HNI A;  3M5A A;  2LC4 A;  1Y96 A;  2DXT A;  5IN1 A;  4Y92 A;  3G4S A;  1O9S A;  2EGA A;  4C0D C;  1ABQ A;  5GAN 8;  4ZTJ A;  1YIT Q;  1AWO A;  3G6E Q;  4C8Q G;  1E7O A;  2CP2 A;  3VUZ A;  4ZNX A;  2EFI A;  4HVU A;  4C92 F;  4B6M A;  2VXE A;  3I56 A;  2DIQ A;  1GCP A;  4CC4 B;  2ED1 A;  4M78 D;  5CIU A;  5L23 A;  4MZM A;  1Q7Y U;  4JJC A;  3VS0 A;  1R0B G;  4BB7 A;  4J7F A;  4X9C A;  4E7S A;  1H8K A;  2GFU A;  5FLX E;  2A3L A;  3MEV A;  4RG2 A;  2KY9 A;  3RBB B;  1C1A A;  2DL4 A;  2P4T A;  3CMA Q;  3BW1 A;  4PJL A;  3O8V A;  1YJW Q;  1WHJ A;  1NLP C;  1WHK A;  5CKD A;  1KFZ A;  3CCQ Q;  2RK1 A;  4EDU A;  3OYC A;  1UJ0 A;  2HEQ A;  1BYM A;  1Z9Q A;  1LPL A;  4J9E A;  4PJO B;  2P84 A;  1RAD B;  2LT1 A;  1S72 Q;  2J7I A;  2E65 A;  3I35 A;  4J6Y A;  3JCM b;  1M4Z A;  4QQ6 A;  4PJO F;  1UTI A;  2K3X A;  2JTE A;  2EYY A;  2DFU A;  2MK5 A;  2DTO A;  3CME Q;  5GAN 2;  3A8M B;  4OML A;  3M9Q A;  1PRL C;  5GAN 4;  2RPN A;  1I5O B;  3DB4 A;  2H3J A;  1GCQ C;  3CC2 T;  3ASK A;  4KH1 B;  1RI0 A;  4F7U E;  3L2V A;  4M75 A;  4M7A B;  5DLO A;  1LVK A;  2F69 A;  3CBM A;  1M1K C;  5LJ3 g;  1IRE B;  1JRI A;  3M57 A;  1Q82 U;  3CCV T;  2R5M A;  4ZGE B;  1ZSG A;  4ZN1 A;  4F14 A;  2ROL A;  1K73 R;  1K8A C;  3MP8 A;  4M7A F;  1D0Z A;  1RAF B;  4JLG A;  1I5L A;  5J39 A;  4RTT A;  3EHQ A;  2JTF A;  4MMK A;  2DX1 A;  4C8Q D;  4JZ3 A;  2PVD B;  4QVD A;  3HL8 A;  4DOV A;  4RTU A;  4X34 A;  1K76 A;  1KG1 A;  1ZQ1 A;  3HSB A;  3CCS T;  3OYB A;  2VGM A;  2A08 A;  1VQP T;  1QVP A;  3EH1 A;  2FO0 A;  4M77 E;  1KHI A;  5LJ5 d;  2KT1 A;  3CC2 A;  4KRT A;  2Y90 A;  2DL8 A;  5L8R E;  2DXU A;  3JCM e;  5A0L A;  1W4S A;  2FB7 A;  3CCR Q;  1T0H A;  3QWY A;  1WLP B;  3LH0 A;  3TRE A;  4PNO A;  3OYE A;  2ZPB B;  2KQW A;  2RM4 A;  2FG0 A;  3EG9 B;  4BE2 A;  5GAO l;  2R57 A;  3CCV A;  2DJZ A;  1M2V A;  4XU2 A;  2O4X A;  3V8K A;  1AD5 A;  1AWJ A;  2QEX T;  4OMF B;  5FRN A;  1K0X A;  1UUE A;  1YJ9 Q;  2RJC A;  4LXC A;  1F1B B;  5KYW A;  2DM1 A;  3CXC A;  4F16 A;  2E1H A;  1VQ9 T;  2D6F A;  1GBR A;  3OQ5 A;  2HL3 A;  1NEB A;  3PNW C;  4M78 B;  3EH2 A;  4D6W A;  2OI3 A;  3RIR A;  5GAN 7;  3OY9 A;  1VQP A;  3TVT A;  4J9C A;  2MYS A;  5EG2 A;  2HKQ B;  1S1N A;  2Z0W A;  4Z8A A;  2MCN A;  1N6A A;  4LUE A;  3EGD B;  2V8I A;  3EG2 A;  3V7S A;  1PD1 A;  1VQL Q;  1JJ2 A;  1JB0 E;  1UDL A;  1N5Z A;  4R0K A;  1OYX A;  4ANJ A;  3VYG A;  4F7U B;  1RAH B;  2LQW A;  2QEX A;  2MWP A;  1AHJ B;  1QVG S;  2LT4 A;  2K3B A;  4JJD A;  2OTL T;  3PFS A;  1Y0M A;  3NHN A;  1QQJ A;  2QQS A;  4F7U F;  5GAN j;  1VQ9 A;  5KE2 A;  2V26 A;  2YSQ A;  5FRM A;  2JUF A;  1YCS B;  3JV3 A;  3TQ7 P;  3AHU A;  2ZPF B;  2CS7 A;  4BDY A;  4M75 G;  3GBQ A;  2EVR A;  5GJV B;  1W2B P;  2SEM A;  1XTD A;  3M59 A;  3MCA B;  4J8O A;  5CKF A;  3H0H A;  4N4G A;  1GCQ A;  3MEW A;  3CCL A;  2ZPI B;  4LNP A;  3RR6 A;  3GIB A;  4Q5W A;  2DMO A;  3RDV A;  2C0O A;  2DLP A;  3X28 B;  3JCM X;  5CR2 A;  2QDL A;  1GFC A;  3JCM c;  2OTJ Q;  2VV5 A;  3OA6 A;  1SEM A;  3TSZ A;  3JCM P;  4M77 F;  1T3L A;  4FYV B;  2OTL A;  2RH2 A;  5I2M A;  1MV0 B;  4K11 A;  2DD4 A;  2JW4 A;  3PMT A;  1NBE B;  2P0P A;  1KHC A;  2PVO B;  4C8Q B;  1PCX A;  1QW1 A;  1FMV A;  3A5Z B;  2QXF A;  1MV3 A;  3CC7 Q;  1X27 A;  2LNH B;  2L3P A;  1YJN Q;  4EMG A;  1YNZ A;  3M4G A;  1ZUY A;  3L2U A;  3DB3 A;  2M9U A;  1ZUU A;  1MND A;  2M0Y A;  4IIO A;  3DKM A;  3KBG A;  4Z02 A;  1Q82 C;  2BZY A;  4O5V A;  4OMO A;  2XHC A;  3SHW A;  4L6V 5;  3ME9 A;  3V8J A;  2LJ3 A;  4IKF A;  5GAM g;  2E6N A;  2YLB A;  3U23 A;  4A4H A;  4LDW A;  2O9V A;  2MIO A;  4LDU A;  1HK9 A;  4FU6 A;  1ZA1 B;  2DJQ A;  5DLQ E;  4A4G A;  3CPF A;  3JB9 H;  2COZ A;  5GAN e;  1D09 B;  4J9H A;  2DKG A;  4QQD A;  1VQ4 Q;  3QJY A;  3VUB A;  3M0Q A;  1QVF S;  2JJ9 A;  1Q81 R;  3S3M A;  4D8D A;  3OYK A;  3HKS A;  3JCM J;  4BD3 A;  3QDR B;  1WYX A;  2DEU A;  2BKD N;  2C06 A;  2XU8 A;  1KSW A;  2EAY A;  4AG1 C;  1TUD A;  2YT6 A;  4PFO A;  2DL7 A;  1WQW A;  2CSQ A;  2COW A;  1Y07 A;  3M0R A;  2FL7 A;  2NUP A;  2PUO B;  2D9T A;  2O2O A;  4M75 D;  3QO3 A;  5FWB A;  4B9W A;  1T0J A;  1D0X A;  4ATO A;  2FRW A;  2GCX A;  2QDY B;  3CCJ T;  2E3I A;  4AG2 C;  4JUV A;  2XID A;  1FMK A;  4IUR A;  2D8J A;  2DL3 A;  3G6E T;  2EGE A;  5FWC A;  1NYG A;  4IUQ A;  1VQM T;  4PJN A;  1J3T A;  1B7T A;  5IHK A;  2QA4 Q;  2PTK A;  2DXB A;  1D3B A;  1NG2 A;  3M58 A;  2D8H A;  3LYI A;  1WA7 A;  2DZ9 A;  3HFN A;  4BI8 B;  2M0O A;  2E64 A;  3OW2 P;  2V1Q A;  2MPX C;  2EQM A;  1WHG A;  4HVW A;  1BCO A;  2RA2 A;  3MKD A;  1I07 A;  2D0Q B;  2DE0 X;  2DEQ A;  3QZ5 B;  2E5K A;  2PU9 B;  4PK4 A;  3VRZ A;  5GAN 6;  3QHS A;  2XMF A;  2O01 E;  3TCJ A;  3VS7 A;  1HJD A;  3MJX A;  4KGX B;  1HXD A;  1YIJ T;  4AFZ C;  1QWF A;  1RAC B;  4XK8 E;  4IUU A;  3JB9 D;  4C5E A;  1YJW T;  1VQ7 Q;  4ME7 A;  2AT1 B;  1Y96 B;  2HSE B;  3CCJ A;  3CCQ T;  3UF4 A;  2CGH A;  2E3H A;  1D1C A;  1VQK Q;  4CC2 A;  1VQN Q;  3SB2 A;  3EGU A;  2EJF A;  1JXM A;  2KR3 A;  3G6E A;  1ZA2 B;  4HXJ A;  3QKJ A;  4FYY B;  1VQM A;  1GBQ A;  3OYF A;  2O31 A;  2P4R A;  3OBY A;  2BTT A;  2FEI A;  2C0T A;  4QW2 A;  2MAM A;  2PQW A;  3BE3 A;  4FT4 A;  3ZL7 C;  4PJO E;  3CME T;  3CCE Q;  2CZ7 B;  1I4K 1;  2EBP A;  1VQ6 Q;  2RHU A;  3JCM f;  4ESR A;  2QGF B;  3C12 A;  3LX7 A;  3CXC P;  4KH0 B;  3EFR A;  2BE7 D;  4F17 A;  3H6Z A;  1N27 A;  2RQR A;  1UEB A;  2O88 A;  4C92 C;  4CI0 C;  2L89 A;  1DJ7 B;  3G71 T;  1YIJ A;  2PVG B;  3L2Q A;  2LCL A;  5GAM h;  5LL6 S;  2NYS A;  1YJW A;  5GAN 5;  4HCK A;  3CCQ A;  1NZ9 A;  2X51 A;  2EQU A;  1ARK A;  1W2B A;  1UGV A;  2ROT A;  5GAN h;  3VU3 C;  3QUI A;  4WTO B;  1VQ5 T;  1TXQ A;  3KFV A;  4JS5 A;  1JJ2 P;  1G2B A;  2YXY A;  1RAI B;  3ZBD A;  2WSE E;  2ZZD A;  3J80 E;  4A63 B;  1BIB A;  3I55 T;  3JB9 J;  3HPW A;  2PZ1 A;  2HQE A;  1LOJ A;  2KK4 A;  3A8L B;  2B86 A;  3CME A;  2FYK A;  4J6X A;  4VUB A;  1ZX6 A;  2DK3 A;  2XK0 A;  1KQ2 A;  4BUG A;  1Y71 A;  2DVJ A;  1C6V X;  4Z89 A;  4E7L A;  1KQS P;  1FYN A;  1AZE A;  1WJS A;  3G71 A;  1TSF A;  4EMH A;  3FIF A;  2QG9 B;  1JQQ A;  4ZN3 A;  1UE9 A;  4X1V A;  3CCR T;  2GBQ A;  2K5F A;  4M75 B;  3E9F A;  5LJ3 j;  2PUK B;  2RJD A;  3P8B B;  3MP6 A;  2LTO A;  4JRI A;  1K4U S;  3A8O B;  1VQ5 A;  4RCC A;  3BDU A;  3L2R A;  2ENM A;  1OOT A;  1JO8 A;  2Y4X A;  5ECA A;  1WXT A;  3QJ6 A;  4PLL A;  2HD0 A;  1G83 A;  2DNU A;  5AT1 B;  3I55 A;  1QP2 A;  4EPC A;  2QQ9 A;  3M0S A;  4A4E A;  3DLM A;  5KYU A;  3T9N A;  1YI2 Q;  3LWI A;  3R6O A;  4IIM A;  2YWW A;  3A1P A;  4RG8 A;  1K73 U;  2EPD A;  4M7D A;  4M7A C;  5FU7 B;  5GAO r;  1OPK A;  4GY5 A;  2CRE A;  2DYB A;  3OYN A;  4E7Z A;  1Y57 A;  5GJW B;  1PSE A;  2RHX A;  4M78 E;  2K6D A;  1K9M R;  2K3Y A;  3CCR A;  1AWW A;  2QTV A;  4MZP A;  1VQL T;  3VV0 A;  4J9D A;  2KE9 A;  4C0D B;  1V1C A;  2RQW A;  3PE0 A;  5J3B A;  1YHQ Q;  1M2V B;  2FZC B;  1CKB A;  1WPY A;  3JB9 F;  2MI6 A;  4FL6 A;  3I9Q A;  1UGQ B;  3MEU A;  1PD0 A;  3VRY A;  4BDZ A;  2DL5 A;  5KYW B;  2NUT A;  4PFP A;  2RI3 A;  3M55 A;  4L59 A;  2CP3 A;  2ZPG B;  5DM7 R;  1I0C A;  1RLQ C;  4QVC A;  3MEA A;  1VOM A;  2XDD A;  5LJ3 e;  2GTO A;  6AT1 B;  3FJP A;  1LJO A;  4MML A;  1U8R A;  4C92 A;  3HRT A;  3CD6 T;  5GAN f;  1IHV A;  1M9S A;  2XKO C;  4LDY A;  3GNG A;  1E6H A;  3OW2 A;  1OUL A;  5KCH A;  1VQL A;  3EG3 A;  2KVQ G;  4DEY A;  2LZ6 B;  1K0S A;  5HK0 A;  1K9A A;  2CP0 A;  3EGX A;  4X9D A;  4RTX A;  4N0A C;  1VQ8 Q;  1BI1 A;  2JZ2 A;  1NLO C;  1TS9 A;  2DO3 A;  1XQH A;  3CPW S;  3L2W A;  3OYM A;  2DTH A;  2QGG A;  3UA6 A;  1FWZ A;  3MET A;  1VYT A;  1OZ3 A;  1VQO Q;  1SF9 A;  3OMC A;  2CT4 A;  5GMK h;  2KRM A;  5I11 A;  3JCM d;  1IRX A;  1B3Q A;  4GLK A;  4JPB W;  2YUO A;  3CC7 T;  2LCS A;  1KD1 R;  3F70 A;  1N8R R;  3Q1J A;  1BI0 A;  2CSI A;  1KIK A;  2X4J A;  4JDS A;  4RTW A;  4A4K A;  1TH7 A;  2HCK A;  3OYH A;  4PJO A;  2QYZ A;  5LJ5 g;  3CD6 A;  4C8Q E;  1D0Y A;  5GAO q;  3G7Z A;  3C0C A;  1PSF A;  2RD1 A;  5KYX B;  2DVE A;  3GF5 A;  2P0Q A;  1ACM B;  3OS1 A;  1OI1 A;  1OU9 A;  2J6F A;  1AOJ A;  8ATC B;  4JRK A;  2QTX A;  3VKI A;  4M7D G;  4PFZ A;  1PHT A;  3FC3 A;  4M78 F;  4E7H A;  2VC8 A;  3MPU B;  4FYX B;  3CCL T;  4JJB A;  2YRD A;  1ZBX A;  4C0G A;  3G1J A;  4XTV A;  3CC7 A;  1SG5 A;  3A8G B;  2DAQ A;  4M7A A;  2RF0 A;  2K2V A;  2XDB A;  3VS6 A;  4M77 C;  4HT8 A;  2GTJ A;  1OZ2 A;  2L3R A;  4MZT A;  3NTH A;  2X35 A;  1GFD A;  1KC8 R;  2KYB A;  4KUI A;  1B07 A;  5GAM j;  2E70 A;  1NM7 A;  4FSX A;  1YWP A;  4GBQ A;  1XJW B;  4RTV A;  3EFO A;  2F2X A;  2KAF A;  1G3T A;  5A2Q E;  2DRK A;  5GAN 3;  2EQK A;  4OMN A;  2RB6 A;  5IHI A;  2RQT A;  2L2P A;  4IUP A;  3R6N A;  4OF1 A;  3CCU Q;  1KQS A;  4XQ3 A;  3BFM A;  2EYW A;  4NL2 A;  4PKC C;  1B34 B;  2WAC A;  4ELY C;  1K73 C;  3HFO A;  2A7Y A;  3VS5 A;  1R0C B;  2FPE A;  1E6G A;  2QA4 T;  1M3B A;  3GLX A;  3CC2 Q;  2MOX A;  4C92 G;  4PJM A;  3REB B;  2D0N A;  3TEE A;  2RJE A;  1QWE A;  4N4I A;  3KUF A;  4M4Z A;  3PIO A;  1M90 R;  3QPH A;  5LJ3 h;  3X26 B;  3VS3 A;  4EIK A;  5HK3 A;  2CP7 A;  3CCV Q;  2RK2 A;  3BY7 A;  3REA B;  1Q81 U;  2NUP B;  4OP0 A;  1D1A A;  8AT1 B;  1YP5 A;  3SD4 A;  2K57 A;  4OMQ A;  3SFM A;  2JM8 A;  2M02 A;  1AZG B;  3SWN C;  1UGR B;  1UGS B;  2JOY A;  4N0A A;  2GNC A;  1VQK T;  1VQN T;  2DIG A;  3VS2 A;  3FLG A;  4IUV A;  1EFN A;  1U3O A;  2LDM A;  1BB9 A;  4BY6 C;  2HZY A;  3CCS Q;  4TVR A;  4BAC A;  4RKU E;  3M0T A;  1UG1 A;  2QA4 A;  4C8Q F;  3S3O A;  1D3B B;  1HYO A;  1TWB A;  1WX6 A;  1I8F A;  3CCE T;  1MMA A;  3CBO A;  5GAM e;  2DA9 A;  1VQ6 T;  2CP6 A;  2K2M A;  3CCM Q;  1N9R A;  1MMN A;  1I1J A;  1LCK A;  1RUW A;  2YRV A;  3UDC A;  3M54 A;  5GAN d;  3M0P A;  4F7U A;  5GAO m;  1M2O A;  4XTZ A;  2QEX Q;  3HTR A;  4XU0 A;  2HAX A;  2JN0 A;  1UEC A;  1QKW A;  2A37 A;  1WDX A;  4ORZ A;  4D8K A;  1OEB A;  5HY6 A;  2IVW A;  3OSV A;  2IPO B;  2JNG A;  1VQK A;  2EQJ A;  3GNF B;  2ED0 A;  1VQN A;  2X4Y A;  1VQ9 Q;  1WQ7 A;  3CC4 Q;  1NJI R;  2RHZ A;  2K79 A;  1SRL A;  2GQI A;  3SEM A;  2L5Q A;  1PKS A;  4E47 A;  5GAO p;  1AWX A;  4M7A G;  1G5V A;  1YBY A;  3QYG B;  2AIR B;  2K5L A;  2XD0 A;  1LNX A;  4J5Y A;  2K7A A;  2B8A A;  4OMM A;  1ABO A;  2DXC A;  5D7U A;  2LRQ A;  3CCE A;  4EMK C;  5GMK l;  1VQ6 A;  1M8V A;  2I2L A;  3M0U A;  3LH5 A;  2K4Y A;  1ZSZ C;  3RMQ A;  1UFF A;  1IB8 A;  4M77 A;  3E1S A;  4C92 D;  1TU0 B;  2KSS A;  3HRS A;  1YIT T;  4IUT A;  2RI5 A;  1KK7 A;  2KEA A;  4MDX A;  1Z9Z A;  5CKH A;  2O9S A;  1PC0 A;  2SRC A;  2QQA A;  1M5Q 1;  3H0F A;  2OJ2 A;  1W1F A;  1RLP C;  3OS5 A;  2HDA A;  4HA8 A;  4FCY A;  3CQT A;  1X2K A;  2XG8 D;  2JT4 A;  2LP5 A;  4QQG A;  1W2B S;  4M75 E;  3VS4 A;  2YUN A;  4FW2 A;  4M7D C;  5LJ3 f;  2KNB B;  5GMK j;  5IXF A;  4LD6 A;  3OSS C;  4FM4 B;  1IO6 A;  3CMA T;  1YI2 T;  1AEY A;  1Y7X A;  2L0A A;  2DZC A;  2EYZ A;  1C0M A;  5HKC A;  3QXE B;  4OVA A;  2ECZ A;  1YIT A;  2KDS A;  1V76 A;  1UGP B;  1UHF A;  1QVF A;  3CBP A;  3UAT A;  3E2U A;  1OX8 A;  3INZ A;  2LVM A;  2XI9 A;  3JRZ A;  1S72 T;  1YWO A;  3SWN A;  2CT3 A;  5FU6 C;  2F5K A;  2JS0 A;  4E7I A;  5GAO n;  1T3S A;  2W10 A;  4FT2 A;  5I2S A;  2JS2 A;  3QG1 A;  4A4F A;  3GPL A;  1SRM A;  2RI2 A;  3FDR A;  1D1B A;  5IT9 E;  1AT1 B;  3THK A;  1UJY A;  2I0N A;  4C5I A;  3H9N A;  5D6X A;  3NGP A;  3PMI A;  4DOW A;  2ZAE A;  1QCN A;  2FHD A;  3CMA A;  2F5T X;  2C0I A;  2FZG B;  2GF7 A;  5KYU B;  1YI2 A;  1Q81 C;  4F7U G;  1ZHI A;  1WXU A;  3H41 A;  4DBQ A;  1IZ6 A;  4XTW A;  2RMO A;  3O5Z A;  1RI9 A;  4J9G A;  4OMP A;  2LJ0 A;  4FSS A;  2HL5 C;  1RAE B;  2ZPH B;  5C0M A;  1X6G A;  3PGG A;  3MHX A;  4KGV B;  2CP5 A;  4CC3 A; 
#chains in the Genus database with same CATH homology
 1VUB A;  3QZ9 B;  4UC4 A;  2MWP A;  2QEX A;  1AHJ B;  4CRI A;  1QVG S;  3MEA A;  1S72 A;  2LT4 A;  2XDD A;  3HRU A;  5AYF A;  3JCM W;  5LJ3 e;  2OTL T;  3PFS A;  3C95 A;  2QQS A;  3FJP A;  4MDW A;  4F7U F;  5GAN j;  1LJO A;  2BUD A;  4MML A;  3V8L A;  4BI4 A;  4HKE A;  1U8R A;  4L5G A;  3HRT A;  4C92 A;  5KE2 A;  5GMK e;  1VQ9 A;  5FRM A;  1VQ8 T;  4HCZ A;  2JUF A;  3CD6 T;  5GAN f;  3EFS A;  5J26 A;  1M9S A;  4PLI A;  4A54 A;  3AHU A;  2XKO C;  2ZPF B;  2JVV A;  2CS7 A;  5D6W A;  4LDY A;  5CO7 A;  3GNG A;  4M75 G;  4BDY A;  3UWN A;  3OW2 A;  1M1G A;  3OMG A;  4KBM B;  3C94 A;  1XTD A;  3M59 A;  3MCA B;  4J8O A;  5CKF A;  3SDZ A;  5KCH A;  2KVQ G;  3TU4 K;  1K9M U;  1VQL A;  4N4G A;  4LD9 K;  2L8D A;  4M77 G;  5HK0 A;  4X9D A;  3MEW A;  4N0A C;  4EMK A;  1VQO T;  1BI1 A;  2JZ2 A;  5CK9 A;  4C8Q A;  1M90 C;  3CCL A;  2DO3 A;  4PJO C;  2ZPI B;  4N4H A;  1X01 A;  5KH6 A;  1NPR A;  3GIB A;  1NPP A;  1XQH A;  1KQ1 A;  2MWO A;  4JRP A;  3C4S A;  3UPU A;  2CKK A;  3L2W A;  3OYM A;  3CPW S;  5GMK m;  1WJQ A;  2DTH A;  3LLR A;  2IG0 A;  4Q5W A;  4J7I A;  4ZGJ B;  1XOV A;  4XU1 A;  2RHI A;  1YJW T;  2YLC A;  1FWZ A;  3MET A;  3X28 B;  1OZ3 A;  3JCM X;  1U1T A;  1P92 A;  3OMC A;  5CR2 A;  4C92 E;  2E41 A;  4RMO A;  3VJP A;  5GMK h;  3OYJ A;  4C92 B;  4M75 F;  2EIF A;  3JCM d;  3JCM c;  2VV5 A;  5KE3 A;  1JBM A;  4BI3 A;  3OA6 A;  3OYD A;  4XAX B;  4GLK A;  3JAM E;  3M53 A;  2GQV A;  4NS5 A;  3JCM P;  4M77 F;  3CC7 T;  4OB0 B;  3F70 A;  2EJG A;  3Q1J A;  1BI0 A;  2RH2 A;  5I2M A;  3JSC A;  1YJ9 T;  2OTL A;  2YHT A;  2X4J A;  4JDS A;  4PJO D;  2EYQ A;  4A4K A;  1TH7 A;  1Q86 U;  2DD4 A;  3MP1 A;  2ZGW A;  3PMT A;  3QBY A;  3OYH A;  4PJO A;  2P0P A;  2X4W A;  5LJ5 g;  3OW2 S;  3NFC A;  1KHC A;  3S6W A;  2PVO B;  4C8Q E;  4EMK B;  5I21 A;  3CD6 A;  4C8Q B;  1R8O B;  1QW1 A;  5GAO q;  3A5Z B;  2QXF A;  4M78 G;  5CCA A;  2GFA A;  4JRQ A;  3G7Z A;  4OGC A;  3ZFJ A;  3A8H B;  5GMK i;  4EMG A;  2ZCF B;  1M1K U;  1PSF A;  3M4G A;  2RD1 A;  3L2U A;  3PIP A;  3OYG A;  1QP3 A;  3DB3 A;  2M9U A;  2LQ8 A;  3N5B B;  2DVE A;  2G3R A;  3OBW A;  3RKX A;  1EIF A;  1H3Z A;  3DKM A;  3GF5 A;  3ZEH A;  1VQO A;  2CZ1 B;  2DD5 A;  2P0Q A;  3KBG A;  4Z02 A;  3GOX A;  2LQK A;  1Q82 C;  2V8K A;  2RHY A;  4O5V A;  1K8A U;  1YHQ T;  2XHC A;  5M9O A;  2EJ9 A;  4L6V 5;  3OS1 A;  3RER A;  3ME9 A;  3V8J A;  3X25 B;  1GXI E;  1OI1 A;  3E9G A;  5GAM g;  2E6N A;  4IKF A;  4JRK A;  4C5G A;  2QTX A;  3QII A;  3VKI A;  2YLB A;  4BE0 A;  4A4H A;  4M7D G;  4LDW A;  2EKO A;  4LDU A;  1HK9 A;  1H64 1;  4FU6 A;  4II1 A;  4XTY A;  5DLQ E;  4A4G A;  3CPF A;  4M78 F;  5LJ5 j;  3LWH A;  3FC3 A;  4E7H A;  5GAN e;  4KUD K;  3JB9 H;  2VC8 A;  2VUB A;  3OS0 A;  5LJ5 f;  3CCL T;  1BIA A;  1ZBX A;  1I81 A;  2DKG A;  4C0G A;  2O4X B;  4QQD A;  5IAY A;  4M7A D;  3RKW A;  4XTV A;  3CC7 A;  3X24 B;  3A8G B;  1WNL A;  2DAQ A;  3QJY A;  3VUB A;  3WXM B;  2WSF E;  4LDX A;  4M7A A;  4M7A E;  1NJI C;  3V7R A;  4OGE A;  2M1H A;  4M75 C;  3UT1 A;  2K2V A;  4OB1 B;  3G4S T;  1YJ9 A;  1QVF S;  2XDB A;  4M7D B;  1YCY A;  3S3M A;  2X4X A;  3OYK A;  2MMP A;  4M77 C;  4HT8 A;  1KD1 U;  3HKS A;  4ELZ C;  1OZ2 A;  2L3R A;  3QDR B;  4MZT A;  5CQX A;  4BD3 A;  3JCM J;  1N8R U;  1NE8 A;  3NTH A;  2X35 A;  5CKB A;  4R56 A;  2BKD N;  4KUI A;  3RMS A;  4B9X A;  5GAM j;  2E70 A;  4FSX A;  1BKB A;  5D6Y A;  2XU8 A;  3CCU T;  2C06 A;  3EAE A;  4M7D F;  1VIE A;  2EAY A;  3CXC S;  3CC2 A;  4DA4 A;  5GAM f;  4HT9 A;  5LJ3 d;  3RES A;  1WJR A;  1WQW A;  2KAF A;  4QVC A;  1G3T A;  4A53 A;  3JCM Q;  3QYH B;  5A2Q E;  5GAN 3;  1Y07 A;  2EQK A;  2RB6 A;  2FL7 A;  3I56 T;  2OAU A;  1Q86 C;  4IUP A;  4OF1 A;  1YHQ A;  2K5I A;  3JB9 I;  3RKY A;  4HCB A;  2PUO B;  4XQ3 A;  1KQS A;  3BFM A;  2D9T A;  3MO8 A;  4J6W A;  4M75 D;  3QO3 A;  2R5A A;  1U1S A;  4B9W A;  2E12 A;  2RJF A;  2ZPE B;  4NL2 A;  4PKC C;  4ATO A;  1B34 B;  2WAC A;  4QVZ A;  4M77 D;  5FU6 B;  2GCX A;  2QDY B;  4ELY C;  4XTU A;  3CCJ T;  1K73 C;  3HFO A;  4NL3 A;  2A7Y A;  5FU7 C;  5CAI A;  3DLL A;  2CYZ B;  2QI2 A;  2QA4 T;  3NTK A;  4JUV A;  3PTA A;  2XID A;  3GLX A;  3ER0 A;  4KT0 E;  5DY9 A;  3J81 E;  3CEY A;  4IUR A;  4C92 G;  1V29 B;  1JJ2 S;  3URG A;  5A0G A;  4FIB A;  3G6E T;  3TEE A;  2RJE A;  2OTJ T;  3KXT A;  4N4I A;  3KUF A;  2HNI A;  4M78 C;  4OB3 B;  3M5A A;  3OYY A;  4IUQ A;  1VQM T;  2LC4 A;  1Y96 A;  2DXT A;  3PIO A;  5FRO A;  5IN1 A;  1X6O A;  3FB9 A;  3G4S A;  3QPH A;  5LJ3 h;  3X26 B;  2DXB A;  1D3B A;  3M58 A;  3VYH B;  1O9S A;  5HK3 A;  4C0D C;  5GAN 8;  4ZTJ A;  3LYI A;  2DZ9 A;  2RK2 A;  3HFN A;  3BY7 A;  4BI8 B;  1Q81 U;  2M0O A;  4C8Q G;  2E64 A;  4PL6 A;  3CCU A;  2EQM A;  4OP0 A;  3SD4 A;  3VUZ A;  2K57 A;  1KC8 U;  3SFM A;  2RA2 A;  2EFI A;  2D0Q B;  2E6Z A;  1YJN T;  2DEQ A;  3QZ5 B;  4C92 F;  3SWN C;  1KQS S;  2PU9 B;  1UGR B;  2VXE A;  1UGS B;  2JOY A;  4N0A A;  5GAN 6;  3QHS A;  1VQK T;  5LJ5 e;  3I56 A;  3M56 A;  2DIQ A;  1VQN T;  2DIG A;  1MGQ A;  4M78 D;  2O01 E;  3FLG A;  5CIU A;  3TCJ A;  4IUV A;  4MZM A;  1HXD A;  3NTI A;  1YIJ T;  1Q7Y U;  3LW5 E;  4BY6 C;  2LDM A;  3JCM g;  4BB7 A;  3OYI A;  4XK8 E;  4IUU A;  4OB2 B;  4TVR A;  2XDP A;  4C5E A;  4BAC A;  3JB9 D;  4ME7 A;  4J7F A;  3CCM T;  3LGL A;  4RKU E;  1Y96 B;  4X9C A;  3CCJ A;  4XTX A;  3CCQ T;  2CGH A;  1MHN A;  2HQX A;  1WGS A;  2GFU A;  2QA4 A;  4C8Q F;  5FLX E;  3S3O A;  2EWN A;  1D3B B;  2A3L A;  2DPP B;  3MEV A;  1I8F A;  2KY9 A;  2EJF A;  4RG2 A;  3SB2 A;  3OS2 A;  2P4T A;  2XIC A;  3CCE T;  2Y4Y A;  3G6E A;  1FXX A;  3BW1 A;  2OTJ A;  3CBO A;  3QKJ A;  3O8V A;  5GAM e;  3E19 A;  1VQ6 T;  1VQM A;  2CZ6 B;  3OYF A;  1VQ4 T;  5CKD A;  2FVU A;  1N9R A;  3OBY A;  2RK1 A;  4EDU A;  3L42 A;  3FEO A;  3OYC A;  4QW2 A;  1K9M C;  2MAM A;  2PQW A;  3GP8 A;  2YRV A;  3UDC A;  4FT4 A;  3M54 A;  1BYM A;  5GAN d;  1M90 U;  4PJO E;  3CME T;  4PJO B;  2CZ7 B;  3CC4 T;  4E7J A;  1I4K 1;  1RL2 A;  4F7U A;  5GAO m;  4KUL A;  4YTL A;  2RHU A;  4XTZ A;  2BIV A;  2E5Q A;  4XU0 A;  3JCM f;  2LT1 A;  2HAX A;  2JN0 A;  3CCS A;  3LX7 A;  3C12 A;  1VQ8 A;  2E65 A;  4P5N A;  3EFR A;  1YJN A;  4J6Y A;  2LCC A;  3JCM b;  1M4Z A;  5HY6 A;  4QQ6 A;  3P8H A;  2IVW A;  4PJO F;  3OSV A;  1M1F A;  2K3X A;  2JNG A;  1VQK A;  2EQJ A;  1FX7 A;  3GNF B;  1VQN A;  2DTO A;  2X4Y A;  3H6Z A;  3A8M B;  1WQ7 A;  5GAN 2;  1N27 A;  3HHT B;  1UEB A;  2RHZ A;  2MF2 A;  4C92 C;  4CI0 C;  4JJN K;  3M9Q A;  2L89 A;  1DJ7 B;  3G71 T;  5GAN 4;  1YIJ A;  2L5Q A;  2PVG B;  2LCL A;  1UB4 A;  4E47 A;  5GAM h;  5LL6 S;  3L2Q A;  3S3N A;  5GAO p;  1YJW A;  4XU3 A;  2LNV A;  3CCM A;  2P0K A;  3M4Y A;  5GAN 5;  3CCQ A;  4M7A G;  1YBY A;  3QYG B;  1G5V A;  1NZ9 A;  2EQU A;  3DB4 A;  2K5L A;  2XD0 A;  1LNX A;  2CZ0 B;  4J5Y A;  2H3J A;  4LDV A;  3WVE B;  2B8A A;  3FRN A;  1W2B A;  2DXC A;  5GAN h;  3VU3 C;  3QUI A;  3CPW A;  3CC2 T;  3RUX A;  3ASK A;  2LRQ A;  3CCE A;  1VQ5 T;  4EMK C;  5GMK l;  1VIF A;  4JS5 A;  4C8Q C;  1RI0 A;  4F7U E;  4HCC A;  4Y28 E;  1VQ6 A;  1M8V A;  2I2L A;  1Q7Y C;  3L2V A;  1VQ4 A;  4M75 A;  3V7C A;  2K4Y A;  3ZBD A;  2WSE E;  2ZZD A;  4M7A B;  5DLO A;  3J80 E;  4ZGD B;  3RMQ A;  2F69 A;  1BIB A;  4M77 A;  3CBM A;  3E1S A;  2KMT A;  3X20 B;  3I55 T;  3L2Z A;  3HPW A;  3JB9 J;  1M1K C;  5LJ3 g;  1IRE B;  4C92 D;  1JRI A;  2HQE A;  1LOJ A;  2KSS A;  3M57 A;  2KK4 A;  1BI3 A;  3A8L B;  3HRS A;  3CME A;  3CCV T;  2FYK A;  2R5M A;  1YIT T;  1Q82 U;  3CC4 A;  4IUT A;  4ZGE B;  2RI5 A;  4ZN1 A;  1K8A C;  4M7A F;  3MP8 A;  4J6X A;  4VUB A;  2QQB A;  2RO0 A;  2DK3 A;  2XK0 A;  4MDX A;  5CKH A;  4JLG A;  3BDL A;  1I5L A;  1KQ2 A;  5J39 A;  4BUG A;  1Y71 A;  2QQA A;  1G3S A;  1M5Q 1;  3L1A A;  3J7A F;  4R55 A;  2JTF A;  4MMK A;  4C0F A;  4E7L A;  4C8Q D;  4JLI A;  2R58 A;  3OS5 A;  2PVD B;  4QVD A;  4HA8 A;  1G3Y A;  3HL8 A;  1WJS A;  4O6J A;  4DOV A;  3G71 A;  4X34 A;  2V8J A;  2XG8 D;  1XNI A;  4EMH A;  3FIF A;  1KG1 A;  1ZQ1 A;  3HSB A;  4QQG A;  4ZN3 A;  1W2B S;  4M75 E;  3CCS T;  1NJI U;  3CCR T;  2K5F A;  4M75 B;  1VQ7 T;  3E9F A;  3WVD B;  3OYB A;  5LJ3 j;  4BE1 A;  2PUK B;  2RJD A;  2VGM A;  3P8B B;  1VQP T;  1QVP A;  1SSF A;  4M77 E;  1KHI A;  4M7D C;  2WSC E;  3MP6 A;  4M77 B;  4ZTF A;  2LTO A;  1G3W A;  5LJ3 f;  5LJ5 d;  4JRI A;  4C0Z A;  2E10 A;  3A8O B;  3PT9 A;  5GMK j;  4LD6 A;  2Y90 A;  1N8R C;  1KD1 C;  2AHJ B;  3OSS C;  1VQ5 A;  4FM4 B;  5L8R E;  4RCC A;  1O75 A;  2DXU A;  4V2S A;  3JCM e;  3BDU A;  4M78 A;  3CMA T;  1YI2 T;  3L2R A;  5A0L A;  2Y4X A;  1W4S A;  1Y7X A;  2FB7 A;  3QJ6 A;  4NOY A;  2NLU A;  2DZC A;  2QQR A;  4PLL A;  5HKC A;  2HD0 A;  3HP9 A;  1N9S A;  3LH0 A;  3TRE A;  3I55 A;  3QXE B;  4PNO A;  4OVA A;  3OYE A;  5CVI A;  2ZPB B;  2KQW A;  2RM4 A;  1QP2 A;  4EPC A;  4BE2 A;  2QQ9 A;  5GAO l;  2R57 A;  3CCV A;  2DJZ A;  4A4E A;  1YIT A;  4PJO G;  2KDS A;  3DLM A;  3QSU A;  1QVF A;  1UGP B;  3T9N A;  3LWI A;  5A0D A;  3R6O A;  4XU2 A;  3CBP A;  2O4X A;  5GAM d;  3V8K A;  2HBP A;  3INZ A;  2QEX T;  2LX9 A;  4M7D D;  2LVM A;  4OMF B;  2XI9 A;  3JRZ A;  4RG8 A;  5FRN A;  1S72 T;  3SWN A;  1K73 U;  5FU6 C;  2F5K A;  2JTM A;  2RJC A;  4M7D A;  5FU7 B;  4Y91 A;  4M7A C;  5GAO r;  4E7I A;  5GAO n;  3JB9 G;  3OB9 A;  4FT2 A;  4GY5 A;  5LJ5 h;  3CXC A;  1QVG A;  3OYN A;  5I2S A;  2E1H A;  2VXF A;  5C6S A;  1VQ9 T;  3QG1 A;  4A4F A;  2D6F A;  3OQ5 A;  3GPL A;  2VGN A;  2RI2 A;  1PSE A;  2RHX A;  3FDR A;  1BI2 A;  3PNW C;  4M78 E;  3JCM h;  4M78 B;  2K3Y A;  5IT9 E;  3OYA A;  4E7K A;  2VYT A;  4D6W A;  3CCR A;  1VQ7 A;  3RIR A;  5GAN 7;  5CKE A;  3OY9 A;  1VQP A;  4C5I A;  4MZP A;  1VQL T;  5EG2 A;  3VV0 A;  5D6X A;  3PMI A;  4C0D B;  4DOW A;  2M16 A;  4RCB A;  3LGF A;  3OYL A;  1N6A A;  5J3B A;  2FHD A;  5GAN g;  3CMA A;  2F5T X;  2GF7 A;  5KCO A;  1YI2 A;  1Q81 C;  2V8I A;  4F7U G;  1WPY A;  3JCM V;  3JB9 F;  3V7S A;  1ZHI A;  4C5H A;  2MI6 A;  1B34 A;  4FL6 A;  1IZ6 A;  1KC8 C;  4DQ2 A;  1JB0 E;  4J83 A;  1JJ2 A;  1UGQ B;  3SWN B;  3MEU A;  4M7D E;  4XTW A;  1OYX A;  4BDZ A;  5CQY A;  4JS4 A;  4WF2 A;  3H8Z A;  2ZPH B;  5C0M A;  2RI3 A;  3P8D A;  3M55 A;  2DTI A;  3MHX A;  3PGG A;  4L59 A;  3VYG A;  1X75 C;  2ZPG B;  5DM7 R;  4F7U B;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...