2L8DA

Structure/function of the lbr tudor domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
GAMGMPNRKYADGEVVMGRWPGSVLYYEVQVTSYDDASHLYTVKYKDGTELALKESDIRLQSSFKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Lamin-B receptor
publication title Solution structure and molecular interactions of lamin B receptor tudor domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 12
structure length 66
sequence length 66
ec nomenclature ec 1.3.1.70: Delta(14)-sterol reductase.
pdb deposition date 2011-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09465 LBR_tudor Lamin-B receptor of TUDOR domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2l8dA00
2R57A 3M9QA 3QBYA 4FL6A 1RI0A 2HQEA 5D6XA 2FHDA 2MWPA 3L2RA 3LYIA 2RJCA 3DLMA 4BDYA 3OB9A 2BUDA 4FU6A 3OA6A 2PQWA 1H3ZA 3OYLA 3OYAA 3L2WA 4BE2A 3LX7A 4A4FA 2X35A 4CRIA 3UT1A 2RI3A 4Z02A 3OY9A 4II1A 3OYDA 3META 2EQKA 5D6WA 2GF7A 3C4SA 1OYXA 5KE2A 2R58A 4PLLA 3KUFA 4QVZA 2GFAA 2RHIA 3CEYA 2G3RA 4IKFA 4C5HA 4QQDA 3PMIA 3OYHA 4A4EA 5FROA 3L2UA 3MP1A 4E7JA 3ME9A 3MP8A 3OYJA 4E7HA 4IUTA 4QQ6A 3F70A 1WJSA 3OYNA 4Q5WA 3L2QA 1KHCA 2K3XA 2LCCA 5KH6A 3H8ZA 4HCZA 2IG0A 2RJEA 2VYTA 3EAEA 3LGFA 4N4IA 2D9TA 2F5KA 3QJ6A 3FC3A 5FRMA 4C5EA 3MEWA 2JTFA 4GY5A 2RHZA 5J26A 4PLIA 5IN1A 4A4HA 3P8DA 3OYIA 2B8AA 2E5QA 2L3RA 4IUPA 5C6SA 4N4GA 3UWNA 2M16A 2RHXA 3DB4A 3MP6A 4IUUA 2E6NA 2LVMA 1SSFA 3BDLA 1MHNA 1G5VA 3FLGA 4IUQA 3ZEHA 2X4WA 4QW2A 3P8HA 3NTHA 3SD4A 4IURA 2RO0A 5CIUA 2DIQA 3E9FA 2LTOA 3LH0A 3PNWC 3MEAA 2EKOA 3MEVA 3H6ZA 3OS1A 2EFIA 2DAQA 2EQJA 1OI1A 4OVAA 2XDPA 2R5MA 3L42A 3PMTA 2QQSA 1OZ2A 2DIGA 4C5GA 1WJQA 4L59A 3S6WA 2CKKA 2R5AA 3OS0A 2YRVA 4A4GA 3L2VA 2BKDN 4PL6A 4UC4A 5KCOA 2EQMA 3OYGA 4C5IA 2RJFA 2RHYA 3S3MA 4BDZA 3S3OA 2RJDA 3PFSA 1WGSA 2HQXA 3OQ5A 3QKJA 5J39A 1WJRA 4BE0A 5FRNA 4BD3A 2K3YA 3ASKA 2RHUA 2RI5A 2EQUA 2RI2A 2M0OA 3Q1JA 4B9XA 3MO8A 3NTIA 2LRQA 4ZTJA 3E9GA 3FDRA 4BACA 5D6YA 5KCHA 2MWOA 3OYKA 2JZ2A 2BIVA 3OYEA 2M1HA 3DB3A 4LD6A 2L89A 4ZTFA 1XNIA 3MEUA 2QQRA 1N27A 2GFUA 2O4XB 3S3NA 3OMGA 4B9WA 4NS5A 3FEOA 4E7KA 2L8DA 3LGLA 4E7LA 4IUVA 3OYFA 1OZ3A 4BE1A 2X4XA 5C0MA 3OYBA 4X34A 4QQGA 5KE3A 3OYMA 2NLUA 4RG2A 3GOXA 3OS2A 3QIIA 2XK0A 3OMCA 3NTKA 5M9OA 4E7IA 2X4YA 4N4HA 2P0KA 3OYCA 3O8VA 5IAYA 3LLRA 2LDMA 2WACA 2O4XA 4EDUA
chains in the Genus database with same CATH superfamily
2R57A 2XDDA 3V8LA 2FHDA 1K73R 5GAMh 1JXOA 3M4YA 1M1KC 2RA2A 3X20B 2QTXA 2JM9A 3QZ5B 1D0ZA 2G3RA 3C12A 1YJ9Q 5LJ3f 4A4EA 3CC2T 4AFZC 3EGXB 1B3QA 1V1CA 8AT1B 4M4ZA 4Q5WA 2K3XA 1VQOQ 2MPXC 1M1GA 1AHJB 2ROLA 2QYZA 1ABQA 1TXQA 3M0QA 3OS5A 1YHQT 1ZLMA 2IVWA 2K2VA 4PK4A 4PJLA 1MMDA 2GNCA 5I2MA 2CDTA 3EG3A 1PSFA 3LH0A 1UB4A 2DAQA 2KROA 3MCAB 1VQ7A 1OZ2A 2DIGA 2HL3A 1M2VA 4DBFA 4ESRA 4A4GA 2DO3A 3SB2A 4UC4A 3JB9D 2OTJA 2V1QA 3EH1A 3CCVT 5I21A 4GLKA 2JS2A 5GANg 1G3YA 1X69A 1PM3A 5KCHA 1Q82R 3GNFB 3RKWA 3DLLA 1RAGB 3CCST 3V8KA 3GF5A 2FZGB 3TU4K 1SKUB 2PVDB 1IHVA 2JM8A 4DOVA 2J05A 2FZKB 2HBPA 1UHCA 4KULA 3OYMA 1Q81U 3ZL7C 2DKGA 1BIBA 3OMCA 2DRMA 4E7IA 1SHGA 2FRWA 3O8VA 2E1HA 1W2BP 1ACMB 5L23A 3FB9A 4PJOF 1X2QA 2XHCA 2XIDA 1QVFP 3HSBA 1G8XA 2DD4A 3OYLA 1VQLT 1UJYA 4M75C 3OY9A 2PUKB 2MIOA 4C0GA 2DE0X 2LX7A 1U1SA 2PVGB 2RHIA 1VQNT 4XQ3A 2LJ1A 4M77G 2QQAA 4M7DE 2COYA 3JCMV 4C0FA 2HKQB 4LUDA 2FL7A 2FB7A 3HTRA 3BW1A 4GY5A 5J26A 3CCMQ 4A4HA 4C8QE 3UF4A 4MZPA 2HSPA 3G4SA 3EG9B 3CMET 3VS3A 4N4GA 1QKWA 2O01E 2DPPB 1NE8A 4IUUA 5LJ5d 1I81A 3FLGA 4Y91A 3CC7Q 1LVKA 1UFFA 1UHFA 2HMAA 2EFIA 4AT1B 3M0UA 4BUGA 1WYXA 2RPNA 4XAXB 1WJQA 2H3EB 1RAIB 3AT1B 1VYVA 1VQ9A 5GMKe 1X6BA 2E65A 3SFMA 3QDFA 5CKEA 1U5SA 3GP8A 1VQ8A 4BE0A 3ASKA 6AT1B 3JCMP 2LCSA 2DX1A 4RTUA 2CT4A 3SWNA 2L0AA 1U8RA 1QKXA 2K79A 1ZUYA 4BE1A 1YBYA 3UATA 1N5ZA 5C0MA 3I35A 4QQGA 3OS2A 4M77D 2K5IA 3LWIA 3OYCA 4PFOA 5IAYA 2WACA 3JCMd 2KNBB 1YITT 4RTXA 3NMZC 4M77A 1BI2A 3CMAA 1O9SA 2CP5A 3V7CA 4J6XA 1KQSP 2R58A 4OGCA 3G6ET 1M90C 1ZSZA 2KR3A 5CVIA 4HCKA 4IKFA 2DJZA 1RLQC 1I5OB 1Q86U 3N5BB 2WSFE 2FYKA 1C1AA 5ECAA 1A0NB 4ZNXA 1SPKA 3M5AA 4BI8B 2ATCB 3CCUT 3OSVA 1G2BA 2K7AA 1M3BA 2HEQA 4LXCA 3R6NA 2JVVA 2DEQA 1VIEA 1WA7A 1JBMA 1VQPA 1KG1A 2CZ0B 3P8HA 2EBPA 2YRCA 3PE0A 2X4JA 1YI2A 1SF9A 3NHNA 1B34B 1YJ9T 2ABLA 3H0HA 4OMFB 5I2SA 4WCIA 4MDWA 2E5KA 1YCSB 2YRVA 3BY7A 1VQOT 4C92E 1W2BA 1Q81R 1XJWB 2RHYA 4BDZA 3S3OA 3TQ7P 2JTEA 2KRSA 2M0YA 1HSQA 2D0NA 2DXCA 5FRNA 3FRNA 2L3QA 2IIMA 5GAMe 4B9XA 1JEGA 4F17A 3E9GA 1MNDA 2O9SA 1K76A 2CH4A 1N27A 2L5QA 2DL7A 2O4XB 3WVEB 2RQVA 2Y90A 4JJDA 3OW2S 1G3TA 1QWFA 1YJNA 1QVGA 1Y96A 1ZQ1A 1M1KU 4FL6A 3EFRA 2DL3A 2EGCA 2BE7D 1OOTA 1JJ2P 1OV3A 4JZ3A 2V1RA 2DBKA 1I4K1 3JCMb 1D0YA 1K9MU 3CBOA 1NEBA 3H0IA 4PLLA 5GAOr 4QVZA 1WXBA 1RADB 4QQDA 1UGQB 3BFMA 4QT7A 1YIJA 1PG5B 4AG2C 1ABOA 1KHCA 1S72A 4HCZA 2VYTA 2YWWA 5GJWB 1YNZA 2JTFA 3I9QA 4P5NA 5L8RE 3EGXA 2KXCA 3I5SA 2HL5C 5IH2A 2GGRA 1E6GA 5C6SA 5DM7R 1NEGA 2LZ6B 3GBQA 2RO0A 2ZPHB 3CQTA 2RH2A 1UEBA 2E10A 5CKFA 3SWNC 3G1JA 3CC4A 3ZBDA 1UGVA 2R5AA 2VXEA 4FIBA 4OB1B 4GLMA 1YWPA 3URGA 3CBMA 3CCMT 4FSXA 4BI4A 1H8KA 2EJFA 2YSQA 2RHUA 2LJ0A 1YJWT 3M56A 3U23A 5GANh 4M77C 1KQSA 1HD3A 3CC7T 3CCQQ 1W70A 5GMKm 3S3NA 2RB6A 2W10A 2L8DA 2O9VA 2NLUA 2PUOB 1ZSZC 4KH0B 2XK0A 2MCNA 5FU6C 1Q86R 1WQ7A 3QUIA 3L2RA 1OPKA 3E2UA 1VUBA 1QWEA 1AT1B 2NYSA 3CCLA 2DZCA 4JRQA 2J6FA 3CPWP 1YP5A 3X26B 2ZCFB 2K5FA 3EHQA 1H641 3CD6Q 1W1FA 1YWOA 3RERA 2YUOA 3VYHB 1TH7A 3L2UA 3RESA 2RQWA 1QCFA 1N9RA 1B7TA 3EAEA 5FU6B 2EW3A 3QJ6A 4VUBA 4LE9A 2XG8D 4M75E 1ZBJA 2ZPBB 2Y4XA 1NM7A 5GMKj 4AG1C 4XTWA 3DB4A 2EWNA 4BY6B 4EPCA 4QVDA 2LTOA 4ME7A 3H6ZA 4JLIA 1NZ9A 2A36A 3EG9A 4M7AF 3HKSA 2LNVA 2XDPA 1B07A 3VS6A 5LJ3g 3CCJA 1D1AA 4M75A 3QYHB 5FU7C 3CXCA 4Z8AA 7AT1B 4OB2B 1WHLA 1PC0A 2KAFA 4LD9K 3OYYA 3I56T 2K3BA 4J9HA 2Y4YA 4C8QF 1M1KR 1PKSA 2FPEA 1VQMA 3BDUA 2D8JA 4FCYA 2EQIA 1D0XA 1MNEA 2RNAA 2EYWA 2C06A 1VIFA 3I55Q 1TUGB 4LD6A 1QLYA 1NLOC 2RF0A 1QCOA 1TS9A 1VQ4A 1Z9ZA 2CP0A 4E7LA 1K9MR 1GL5A 3P8BB 1KQ1A 2HZYA 2JTMA 1X75C 2MOXA 3NTKA 5GAN7 4FSSA 5HK3A 2OJ2A 1NBEB 4J8OA 3UDCA 2J06A 2P4RA 4DEYA 4CC3A 1GFDA 3QXEB 2NUTB 3O5ZA 3JSCA 3GIBA 4Y92A 2B86A 1MMNA 5LJ3e 1M90U 3CCEQ 1BU1A 3M0RA 3J7AF 4JDSA 1VQ9Q 2QTVA 3EG2A 1KC8C 4ZN3A 4PJOC 3KUFA 2F2WA 2VB6A 3RMSA 3A8HB 3PMIA 5EC7A 2CZ7B 2D1XA 1RAAB 3X24B 1NJIU 4OMMA 3L2QA 2EVRA 1YHQA 4N4IA 2DTOA 4J5YA 3HFNA 4JS4A 2GBQA 2V8JA 4C5EA 1RUWA 1PHTA 3OBYA 2JUFA 2LQWA 2B8AA 4HVVA 2L3RA 5LL6S 4LDVA 1IHWA 1PRMC 4PJMA 4E7ZA 1K9MC 1F1BB 5GAMj 2JW4A 4PJOB 1HXDA 4FT2A 2EYZA 1GBRA 2ZAEA 3MEVA 5IHKA 3OS1A 2EQJA 1BI3A 1N6AA 2EIFA 2CYZB 1EIFA 1FMWA 1QP3A 2YUNA 2NUZA 3CCVA 3OS0A 2LT1A 1G83A 3RBBB 4E7SA 4RUGA 4HCCA 5KCOA 2JJ9A 1B34A 2K2MA 4DOWA 3G71Q 2O2OA 1KK7A 3Q1JA 2RI5A 2KXDA 5GAOq 3CCSA 1WI7A 3MO8A 2DZ9A 3NTIA 2L3SA 3CPWA 2KY9A 1M3AA 1GCQC 4EMKC 5CQXA 1TG0A 1XQHA 1QP2A 2C0OA 3QJYA 4IUVA 4OGEA 1TSFA 2KRNA 4WF2A 2QEXA 1M5Q1 1M30A 1XOVA 2QG9B 4RCCA 3V7RA 1OU9A 1WQWA 4HKEA 2LDMA 2O4XA 2KEAA 5CQYA 1VQLA 1YI2Q 1XTDA 4C92F 5D6XA 3RUXA 4J9CA 1OX9A 3PIOA 2PTKA 4MZTA 4J7IA 1UUEA 4LDXA 4FM4B 4F7UF 3H9NA 2RI3A 1VQNA 1MGQA 2BZ8A 3HL8A 1D09B 3OYDA 3META 1Y07A 2O31A 3THKA 1OYXA 5KYYA 2MF2A 4JS5A 4EMKB 2GFAA 3CEYA 3CCQT 2DNUA 3A1PA 1KQ2A 3MHXA 1U3OA 4RKUE 2E41A 4J9DA 1OX8A 4J7FA 1RAFB 2AHJB 3VJPA 3CMEA 2AZSA 1VQ6Q 1CKAA 2Z0WA 1ZBXA 2BZYA 5CKHA 2HQHA 3MP6A 2ZPIB 1T3SA 1RACB 1G3SA 3CD6T 5AT1B 5GANe 2ZPGB 1UJ0A 5CO7A 2KYMA 2YHTA 2QGGA 3TREA 2FO0A 2R5MA 5I11A 4DA4A 5KYXB 1QMCA 2QQSA 4HXJA 1ZHIA 2KBTA 2PNIA 2GQIA 4R56A 5FWCA 2BKDN 3V7SA 1DJ7B 1X6OA 5GAN8 5CCAA 3ER0A 3QDRB 3UPUA 2QGFB 4CC2A 1M3CA 1KFZA 4M78F 3JRZA 3MJXA 2X9HA 3E1SA 3MEUA 1M90R 3M55A 2P4TA 2F1LA 4FT4A 2J6KA 4KRTA 2FVUA 4X34A 1YITA 2M02A 3R6OA 4D8KA 1BK2A 4X9CA 1WFWA 1BI1A 2FZCB 1NJIR 2AZVA 5HY6A 2RK1A 2FRYA 5LJ5g 4A4FA 4M77E 4PFZA 4DEXA 4Z02A 4KUIA 2XI9A 2MMPA 1PNJA 3I55T 3KXTA 1CSKA 2VGMA 4C5HA 1PRLC 3M54A 2XKOC 3CCUA 3OBWA 2DYIA 4IUTA 5IT9E 1WJSA 3QZ9B 4EIKA 1VQ5Q 2IG0A 2RJEA 2YXYA 5GAMd 1SG5A 2ZGWA 2OTLT 2VC8A 1IRXA 2MK5A 1JQQA 2RHXA 2G6FX 3CCET 1MHNA 1YJ9A 1W4SA 2DJQA 4QW2A 3PIPA 1I1JA 3HP9A 1IB8A 3CCLQ 1WHGA 2RMOA 2BE9B 4OP0A 1AVZC 4F7UG 4C5GA 3S6WA 1NJIC 3JCMg 3ZFJA 4EMHA 3CCRA 1FYNA 3VS5A 3EFOB 5LJ3h 2E4HA 2XD0A 2DTHA 4LDWA 2A0FB 2GQVA 1SEMA 3OQ5A 1TUDA 1Y71A 2EGEA 4BACA 4ZTJA 1KIKA 5D6YA 4PJOG 2JZ2A 4C0ZA 2M1HA 3DB3A 2L89A 4ZTFA 4IIOA 3VS0A 2ENMA 1SRMA 4RCBA 5D7UA 2QA4A 3IQLA 3QIIA 2XICA 2QI2A 2QK0A 1TOVA 1X01A 3MKDA 1QVFA 4EDUA 5LJ5f 1IGUA 2HSEB 2W0ZA 2MYSA 3JCMX 4RTZA 3G71T 1GXIE 1KC8U 1UDLA 4CRIA 2FG0A 1X6GA 4II1A 3HHTB 4MDXA 2GF7A 3A5ZB 2EAYA 1E7OA 3GLXA 1ZUKA 4HVWA 3H41A 2DM1A 2HKNA 1YFNA 3ME9A 2QAZA 4JRKA 3JV3A 3H8ZA 2LQNA 4KH1B 1VQKA 1Z9QA 1KJWA 1YI2T 3FIFA 3RMQA 4E2FB 4ZGEB 4L6V5 5CR2A 2E6NA 4TVRA 4XU3A 1SSFA 2L2PA 1M9SA 1ZSGA 1BI0A 4HVUA 4PJOD 3JCMf 1WHKA 2DL5A 2HCKA 3L42A 2CZ1B 3PMTA 2CP7A 4PJOA 2DEUA 3L2VA 4C5IA 1QVGS 4HT8A 4M7AC 1YJWA 1VQ6T 2OAUA 2A7YA 4DBQA 4BD3A 3VS7A 2EQUA 2X51A 3CC7A 2QDLA 5IHIA 2DL4A 1X2KA 2V26A 1FX7A 2EYQA 4NS5A 5GAOp 2COWA 1OZ3A 1IXDA 2LQKA 2DD5A 2NUPB 1K0XA 5M9OA 2AK5A 4N4HA 1KD1C 2ZZDA 1R0BG 3TEEA 2DLPA 2ROTA 4RTVA 2YLCA 3EG1A 4M7AB 2RJCA 3DLMA 3QHSA 4M7DB 2E64A 3LX7A 3INZA 2CUDA 1N8RU 3UT1A 4ZGJB 2JXBA 2ZPEB 2KDSA 3M4GA 3RIRA 1WX6A 3JB9H 1FXXA 3QPHA 5KE2A 4OMOA 3QO3A 1ZA1B 4KBMB 3RNJA 2AKKA 4OB0B 2EYYA 4J9GA 3C94A 2P0QA 4C8QB 1PSEA 2KE9A 3CBPA 2SEMA 5GANj 3PTAA 3VS2A 1GCQA 4FYVB 1IZ6A 2LCCA 4JZ4A 4MZMA 4EMKA 5KH6A 1VQ7Q 3LGFA 3M58A 5HKCA 4AFUC 4J9BA 1VA7A 1BCOA 1WZOA 4BY6C 1FMVA 2QEXQ 2D6FA 2HBWA 2OTJQ 4XK8E 3KBGA 2DBMA 2M16A 4JPBW 1OPLA 5HCKA 4BI3A 5EG2A 1NG2A 5GAN4 3A8OB 3WXMB 3A8GB 2HD0A 1V76A 1FWZA 4D8DA 3I56A 4JJCA 2X3XD 1UGSB 1VQ5T 1TTHB 1P92A 2P0PA 3OYGA 3QG1A 3J80E 1Q7YC 5LJ3d 1RI9A 3PFSA 5KYXA 4RTTA 2ESWA 3A98A 3X28B 3SDZA 2M0OA 2RD1A 2RI2A 3D7SB 5GAN5 2LNHB 1KC8R 3CMEQ 2VV5A 2VGNA 2QQRA 4ORZA 4M7DF 4NL3A 3HPWA 2QQBA 4L5GA 4R55A 3CCLT 2ZPFB 4MMKA 4CC7A 5KE3A 2F2VA 4PJNA 2X4YA 1I07A 3LLRA 4PJJA 3V8JA 1JJ2A 2VASA 4O6JA 2MWPA 2OI3A 2K9GA 2EJGA 3OB9A 2QQ9A 1QVPA 2A28A 2M9UA 2X35A 3TSWA 1PD0A 1E6HA 3G4SQ 3VKIA 3C4SA 1M8VA 1K8AC 5GAN3 5LJ5h 1AZEA 4PNOA 3L1AA 1T0HA 1Y7XA 2LJ3A 3MP8A 3I5RA 4E7HA 4ELYC 1VYUA 4PKCC 3CXCS 5FRMA 3NPFA 2CH4W 4JLGA 5FWBA 4PLIA 5IN1A 2K6DA 4KGZB 3OYIA 4DQ2A 3CC2A 2OAWA 1M2OA 1O75A 1HYOA 4M77F 3T9NA 1VQ8Q 4A53A 3LW5E 2AIRB 4C92B 1AWJA 3RKYA 4C0DC 2F5TX 4F7UB 1T0JA 3FJ5A 4AFQC 3WVDB 1KSWA 2H3JA 5GAN2 3JCMh 4JJNK 2HQXA 1VOMA 2XMFA 4BB7A 2XDBA 1RL2A 5GAN6 4KT0E 4ATOA 2PZ1A 3CCUQ 1VYTA 1TUCA 3EFOA 2CGHA 4NL2A 1GFCA 2JS0A 3OYEA 2J6OA 3REAB 3CMAQ 2FEIA 2RQRA 2DRKA 1XNIA 1N8RR 4V2SA 4AMCA 1NYFA 4C0DB 4LDYA 2DXBA 1GRIA 4M78C 2O88A 2SRCA 5GMKl 1UTIA 3JCMW 2EKHA 1QW1A 5FLXE 2CSQA 1H3ZA 3L2WA 3AHUA 2VXFA 5CKBA 3PVQA 3UA6A 5A0LA 3CCQA 5GANd 1K0SA 5DLOA 3CCRQ 2CP2A 1LJOA 2DXUA 2MI6A 1VQPQ 5FROA 2RK2A 5GAOl 4JRIA 4M78B 3OYNA 1GBQA 1BB9A 4M7AG 2HDAA 1K73C 1AWWA 4M7DG 3X25B 4XTUA 1Y0MA 2K57A 1N8RC 2E5QA 2QA4Q 4IUPA 3CD6A 2EYXA 4J9IA 4X1VA 1Y57A 3FJPA 4IUQA 2X4WA 2DVJA 3CPWS 4HT9A 3SD4A 4XTZA 4C8QG 1AWOA 1PKTA 4RTYA 3OW2P 2K5LA 3ULRB 2QXFA 1EZZB 1T3LA 2DVEA 5A2QE 3EGDB 5DY9A 2KT8A 4LUEA 4PL6A 1VQ7T 4J9FA 3PVLA 1D3BB 5J39A 3QKJA 1YJNQ 2QEXT 2OTJT 4XU0A 4OMQA 5CKDA 4LN2A 1VQKQ 1G3WA 1JU5C 2VKNA 2RM4A 1YCYA 2GFUA 2GTJA 3OMGA 3FEOA 3EG0A 1D1BA 3OYFA 2A37A 1C0MA 1KD1U 2ED1A 5CK9A 5I22A 4F14A 4M7AE 2CP3A 2P0KA 1UE9A 3A8MB 1MMAA 2KSSA 2F5KA 2I2LA 1QVGP 2D0QB 4J6WA 1YIJQ 2V8IA 1S72Q 4M7AD 2NUPA 3I55A 1R77A 4M7DD 1Q82C 4N0AA 4M7AA 3VUBA 4JUVA 3JCMQ 1YJWQ 3RDVA 4M75B 3JCMJ 4M7DA 1ZA2B 5KYUB 4DBHA 5IXFA 4C8QD 2IPOB 3F70A 2OTLA 1RLPC 2DL8A 3CC4Q 3G6EA 4C8QA 1MMGA 4FYWB 2VVKA 3CCEA 2VUBA 5GANf 1X43A 2YUQA 2DF6A 4EMGA 2GTOA 3M59A 4OMLA 4ZN1A 2LVMA 5HK0A 2V8KA 3G4ST 1UECA 3NTHA 4RTWA 1OQKA 5GJVB 2DIQA 3E9FA 5KYWB 1SRLA 1SHFA 3M53A 4J83A 1M4ZA 2I0NA 1WXUA 3REBB 1Q7YU 1AEYA 1WPYA 4QVCA 2JMAA 1TWBA 2KGTA 2ED0A 4K11A 5GMKi 1GCPA 1VQ9T 4O5VA 1U06A 3VYGA 2LRQA 4YTLA 1J3TA 3HRTA 2E3IA 4ZGDB 2MWOA 1VQ8T 4C92G 4FYYB 2E3HA 2DMOA 1VQOA 4B9WA 5LJ5e 4JJBA 3RR6A 2X4XA 2LP5A 3HRUA 1EFNA 3VV0A 5GAMg 3G71A 4M75F 2JNGA 3QBYA 2WSCE 3C0CA 1TU0B 3CPFA 3LYIA 4FU6A 2KVQG 2PU9B 3TCJA 3MPUB 2C0IA 1K8AU 3I56Q 2BTTA 3QWYA 5LJ3j 3RKXA 1HJDA 1PCXA 4E47A 3CMAT 1KHIA 2K4YA 2F2XA 1RABB 4CC4B 4WTOB 3OW2A 3VRZA 1AOJA 3MP1A 4E7JA 4FYXB 2KI7A 3VUZA 1NLPC 5AYFA 3L2ZA 1NPRA 3FC3A 2HNIA 1MV3A 2CUBA 3CCJQ 2D9TA 2CP6A 3TSZA 3EHRA 3SHWA 3VU3C 4IIMA 2QASA 3QWXX 3DKMA 3JCMe 4XTXA 4F16A 2NUTA 3UWNA 1I8FA 3H0FA 1V29B 3EGUA 3CCRT 4F7UE 4E6RA 3ZEHA 1M2VB 1VQMQ 5IHNA 4IURA 3LWHA 2CZ6B 3JB9I 4C92D 1UGRB 1AD5A 2CSIA 4OVAA 1OI1A 1VQPT 4KUDK 4M78G 2P84A 9ATCB 1WLPB 2BZXA 2DFUA 1VQ4Q 5J3BA 1K1ZA 2RQTA 4C92A 1VQ6A 2YRDA 2KT1A 2VWFA 4NOYA 1W2BS 1KD1R 3CXCP 2DETA 1AZGB 4PJOE 2EQMA 2RJFA 4F7UA 1QVFS 1BYMA 1LNXA 3OSSC 1WGSA 2DYBA 2K3YA 2PVOB 4OMNA 1CKBA 1MUZA 3SEMA 1HK9A 5KYYB 2QA4T 1BIAA 4QKUA 2BIVA 3PT9A 2JMCA 2EJ9A 3PGGA 1WHHA 1S1NA 3HFOA 4KGXB 5GAMf 3LGLA 1NPPA 3CCMA 1IO6A 2E12A 3CC2Q 4N0AC 3G7ZA 3GOXA 1JXMA 2KK4A 1BKBA 4XTYA 4M7DC 4FW1A 1MV0B 3JCMc 5CAIA 2AKLA 1Q81C 4XTVA 2AT1B 1RI0A 4BDYA 1JB0E 2JT4A 1YJNT 1YHQQ 3OA6A 2JN0A 4BE2A 4C8QC 2EQKA 4HCBA 1VQKT 1IREB 3EH2A 4M78E 2DA9A 4R0KA 8ATCB 1OU8A 1LOJA 4Z89A 4JRPA 3TVTA 4KGVB 3OYJA 3M57A 1JO8A 4J6YA 4AFSC 1K73U 2C0TA 4A63B 4M78D 4LDUA 3KFVA 1M8MA 2RHZA 3CCVQ 1Q7YR 1YIJT 3P8DA 1S72T 4M78A 1WHMA 1WIEA 2YDLA 3JB9F 1N9SA 4X9DA 3A8LB 3EFSA 2QDYB 3BDLA 1BBZA 3CCSQ 4M75G 1WNLA 1SSHA 5CIUA 2HAXA 2OX7A 3M0TA 1WHJA 1K9AA 2KRMA 4OB3B 3MEAA 2XU8A 1X27A 1VQ5A 1QCNA 4FW2A 5A0GA 4XU2A 1RAEB 2E6ZA 1JRIA 4L59A 4OF1A 2ECZA 2CKKA 4B6MA 2YUPA 5KYNA 2LC4A 3SWNB 2DK3A 2YLBA 3CC4T 3GPLA 4OMPA 2RJDA 3UA7A 1UG1A 4MMLA 2LQ8A 1VQLQ 3EGDA 3OYKA 2WSEE 3JB9J 1KQSS 2A3LA 2GCXA 1D3BA 1H92A 1K8AR 1R0CB 5GAOn 1VQNQ 1BCMA 3OYBA 4M77B 5GAOm 2LMJA 2DERA 1RAHB 5GMKh 2D8HA 1OEBA 2KMTA 2YT6A 3VS4A 1LPLA 3M9QA 2HQEA 2LX9A 1ZSZB 5A0DA 1Q82U 2BUDA 2PQWA 1M27C 3OYAA 2RQUA 2MAMA 2NWMA 2EGAA 4CI0C 1D1CA 5D6WA 1Q95G 2EPDA 3GNGA 2X3WD 1K4US 3C95A 3J81E 3OYHA 4Z88A 4M75D 5IXBA 4HA8A 1IGQA 3NGPA 4QQ6A 4J9EA 3LH5A 3BE3A 1UGPB 1U1TA 2DXTA 1Q86C 5KYUA 1R8OB 3MEWA 2JOYA 1EX4A 1PWTA 3QYGB 3M0PA 2KQWA 2CT3A 1PD1A 4C92C 3M0SA 4A4KA 4ELZC 1G5VA 2E70A 2FPFA 3PNWC 2EKOA 3QSUA 2DILA 2COZA 4A54A 1ARKA 5FW9A 4GBQA 4ANJA 1WDXA 3HRSA 5LJ5j 2CREA 1ZX6A 5KYWA 3CCJT 1YN8A 4DBRA 1YITQ 4XU1A 2LCLA 1M1FA 2A08A 5FU7B 3S3MA 1ZUUA 1JJ2S 1WJRA 3JAME 5DLQE 3NFCA 1W6XA 2FPDA 1I5LA 4F04B 2OTLQ 2KYBA 3FDRA 1AWXA 4PFPA 4Y28E 1NYGA 1OULA 3G6EQ 2F69A 2M51A 1VQMT 4LNPA 2DTIA 1Y96B 1I0CA 1QQJA 4E7KA 2RN8A 2CS7A 2LT4A 1H3HA 1FMKA 2J7IA 3VS1A 1WXTA 3VRYA 3JB9G 4RG2A 1LCKA 1VQ4T 4RMOA 2H8HA 4D6WA 1C6VX 3E19A 2L3PA 4RG8A
chains in the Genus database with same CATH topology
2R57A 1WQ7A 2XDDA 2D0QB 2FHDA 3QUIA 4J6WA 3V8LA 5GAMh 3L2RA 2V8IA 3JCMX 1VUBA 3G71T 1GXIE 3M4YA 4M7AD 1M1KC 3I55A 1KC8U 3CCLA 4CRIA 2DZCA 2RA2A 4JRQA 4M7DD 3X20B 1Q82C 2QTXA 4II1A 3X26B 2ZCFB 2K5FA 3HHTB 4N0AA 2GF7A 4MDXA 3A5ZB 2EAYA 3QZ5B 4M7AA 3VUBA 4JUVA 1H641 3JCMQ 3GLXA 3RERA 4M75B 2G3RA 3JCMJ 4M7DA 3C12A 5LJ3f 4A4EA 3CC2T 3VYHB 4C8QD 1TH7A 3L2UA 3ME9A 3RESA 3F70A 2OTLA 1N9RA 4Q5WA 2K3XA 4JRKA 3H8ZA 3EAEA 5FU6B 3QJ6A 1M1GA 1VQKA 1AHJB 3G6EA 4C8QA 4VUBA 1YI2T 2XG8D 3FIFA 4M75E 3RMQA 2ZPBB 4ZGEB 3CCEA 2VUBA 2Y4XA 5GANf 3OS5A 1YHQT 5GMKj 4EMGA 4XTWA 2IVWA 3DB4A 4L6V5 2K2VA 5CR2A 2EWNA 3M59A 2E6NA 2LVMA 4TVRA 4XU3A 1SSFA 4ZN1A 5HK0A 4BY6B 4EPCA 1M9SA 2V8KA 5I2MA 3G4ST 3NTHA 4QVDA 1BI0A 1PSFA 2DIQA 3E9FA 2LTOA 3LH0A 4ME7A 4PJOD 1UB4A 3JCMf 3M53A 3H6ZA 4JLIA 1NZ9A 2DAQA 4M7AF 3HKSA 2LNVA 2XDPA 4J83A 5LJ3g 3MCAB 3L42A 3CCJA 1M4ZA 2CZ1B 1VQ7A 3PMTA 4M75A 3QYHB 5FU7C 1OZ2A 2DIGA 3CXCA 1Q7YU 4PJOA 4A4GA 2DO3A 1WPYA 4OB2B 3SB2A 3L2VA 4QVCA 4UC4A 3JB9D 4C5IA 1QVGS 4HT8A 4M7AC 2OTJA 2KAFA 1YJWA 4LD9K 3CCVT 3OYYA 3I56T 1VQ6T 2OAUA 5GMKi 2A7YA 5I21A 4GLKA 4BD3A 5GANg 4C8QF 2Y4YA 2EQUA 4O5VA 1VQ9T 1YHQA 1G3YA 3VYGA 1VQMA 3BDUA 2LRQA 4YTLA 3CC7A 3HRTA 4ZGDB 5KCHA 2MWOA 3GNFB 4C92G 3RKWA 1VQ8T 3DLLA 2QEXA 1VIFA 2C06A 4LD6A 3CCST 1VQOA 3V8KA 3GF5A 1VQ4A 1FX7A 2EYQA 2PVDB 4B9WA 4NS5A 5LJ5e 5GAOp 3TU4K 4DOVA 4E7LA 3P8BB 1OZ3A 2X4XA 2HBPA 3HRUA 1KQ1A 4KULA 2LQKA 3OYMA 1Q81U 2JTMA 2DKGA 2DD5A 1X75C 1BIBA 3OMCA 3VV0A 3NTKA 5M9OA 5GAMg 4E7IA 4N4HA 5GAN7 3G71A 3O8VA 1KD1C 2E1HA 2ZZDA 4M75F 5HK3A 2JNGA 4J8OA 3TEEA 3UDCA 3QBYA 3FB9A 4PJOF 2YLCA 2WSCE 4M7AB 3QXEB 2XHCA 2XIDA 2RJCA 3CPFA 3DLMA 3LYIA 3HSBA 3QHSA 2DD4A 2KVQG 2PU9B 3JSCA 4FU6A 3TCJA 4M7DB 2E64A 3OYLA 3LX7A 3INZA 1VQLT 1N8RU 3GIBA 3UT1A 1K8AU 4ZGJB 1M90U 5LJ3e 4M75C 2ZPEB 2KDSA 3OY9A 5LJ3j 3M4GA 3RKXA 3J7AF 4JDSA 2PUKB 3RIRA 3JB9H 1KC8C 1FXXA 3QPHA 4ZN3A 4PJOC 4E47A 3CMAT 5KE2A 1KHIA 2K4YA 3QO3A 4KBMB 4C0GA 1U1SA 2PVGB 3KUFA 2RHIA 4OB0B 1VQNT 4XQ3A 3C94A 3RMSA 2P0QA 3A8HB 3PMIA 1PSEA 4M77G 4C8QB 2QQAA 4M7DE 3OW2A 3CBPA 2CZ7B 3MP1A 4E7JA 3VUZA 3JCMV 4C0FA 3X24B 5GANj 3PTAA 1NJIU 5AYFA 3L2ZA 3L2QA 1IZ6A 2LCCA 4MZMA 1NPRA 4EMKA 2HNIA 5KH6A 3LGFA 3FC3A 4N4IA 2D9TA 2DTOA 2FL7A 3HFNA 3M58A 4J5YA 5HKCA 2FB7A 4C5EA 2V8JA 4JS4A 3BW1A 4GY5A 5J26A 3OBYA 3VU3C 2JUFA 4A4HA 4BY6C 4C8QE 4MZPA 3DKMA 3G4SA 3JCMe 2B8AA 4XTXA 2D6FA 2L3RA 5LL6S 3CMET 4XK8E 3KBGA 4N4GA 4LDVA 3UWNA 2M16A 2O01E 2DPPB 1I8FA 1NE8A 4IUUA 1V29B 5LJ5d 3CCRT 4F7UE 1I81A 1K9MC 3FLGA 3ZEHA 5GAMj 4PJOB 4Y91A 4IURA 3LWHA 1HXDA 4FT2A 2CZ6B 4BI3A 4C92D 3JB9I 1UGRB 5EG2A 3MEVA 3OS1A 2EFIA 5GAN4 2EQJA 1BI3A 1OI1A 1N6AA 2EIFA 4OVAA 4M78G 2CYZB 1VQPT 1EIFA 3A8OB 3WXMB 4BUGA 4KUDK 3A8GB 1QP3A 2HD0A 4XAXB 1WJQA 1FWZA 3CCVA 3I56A 5J3BA 4C92A 3OS0A 1VQ6A 1W2BS 4NOYA 1UGSB 2LT1A 1VQ5T 1VQ9A 4HCCA 5KCOA 5GMKe 1P92A 2P0PA 2E65A 3SFMA 2EQMA 3OYGA 3QG1A 1B34A 3J80E 4PJOE 1Q7YC 2RJFA 5LJ3d 4F7UA 5CKEA 1QVFS 1BYMA 3GP8A 1LNXA 3OSSC 1WGSA 3PFSA 4DOWA 1VQ8A 4BE0A 2K3YA 2PVOB 3ASKA 3SDZA 3X28B 2RI5A 3Q1JA 2M0OA 2RD1A 2RI2A 5GAOq 3CCSA 3MO8A 1HK9A 2DZ9A 3NTIA 2QA4T 3JCMP 3CPWA 2KY9A 1BIAA 3SWNA 2BIVA 3PT9A 5GAN5 1U8RA 2VV5A 4EMKC 5CQXA 2VGNA 2EJ9A 2QQRA 3PGGA 4M7DF 1XQHA 4NL3A 3HFOA 3HPWA 5GAMf 2QQBA 1QP2A 4L5GA 4R55A 3LGLA 1NPPA 3CCMA 2E12A 3QJYA 4IUVA 4OGEA 4BE1A 1YBYA 3CCLT 5C0MA 4N0AC 4WF2A 2ZPFB 4MMKA 4QQGA 1M5Q1 1XOVA 4RCCA 3V7RA 3G7ZA 5KE3A 3OS2A 3GOXA 4M77D 2K5IA 2KK4A 1BKBA 3LWIA 2X4YA 4XTYA 1WQWA 3OYCA 5IAYA 4M7DC 3LLRA 2LDMA 4HKEA 3V8JA 3JCMc 2WACA 5CAIA 3JCMd 2O4XA 1Q81C 1VQLA 5CQYA 4XTVA 1JJ2A 1YITT 1RI0A 1XTDA 4O6JA 4C92F 5D6XA 2MWPA 3RUXA 3PIOA 4M77A 4BDYA 1JB0E 2EJGA 1BI2A 3OB9A 2QQ9A 1QVPA 4J7IA 4MZTA 3OA6A 2JN0A 1O9SA 3CMAA 1YJNT 2M9UA 4LDXA 4BE2A 4FM4B 4F7UF 2X35A 2RI3A 1VQNA 1MGQA 3HL8A 4C8QC 3OYDA 3META 2EQKA 1Y07A 3V7CA 4J6XA 4HCBA 3VKIA 3C4SA 1VQKT 1OYXA 1M8VA 2R58A 4OGCA 2MF2A 3G6ET 1IREB 5LJ5h 5GAN3 4PNOA 4JS5A 5CVIA 4EMKB 1K8AC 1M90C 2GFAA 3CEYA 4M78E 3CCQT 4IKFA 2DJZA 5LJ5f 1KQ2A 3L1AA 1LOJA 1Y7XA 3MHXA 4JRPA 4RKUE 1Q86U 3MP8A 3OYJA 2E41A 3M57A 3N5BB 4J6YA 2WSFE 4J7FA 4E7HA 2FYKA 4ELYC 1K73U 2AHJB 4PKCC 4M78D 4LDUA 3CXCS 3VJPA 5FRMA 3M5AA 3CMEA 4BI8B 3CCUT 3OSVA 4JLGA 2RHZA 1YIJT 4PLIA 1ZBXA 5IN1A 3P8DA 1S72T 3OYIA 2JVVA 4DQ2A 4M78A 5CKHA 3CC2A 2DEQA 1O75A 3JB9F 1N9SA 4X9DA 3A8LB 1VIEA 3MP6A 4M77F 2ZPIB 3EFSA 3T9NA 2QDYB 3BDLA 4A53A 1JBMA 3LW5E 1VQPA 4M75G 1WNLA 2CZ0B 3P8HA 4C92B 1KG1A 1G3SA 5CIUA 3RKYA 2HAXA 3CD6T 5GANe 2X4JA 2ZPGB 4OB3B 4C0DC 2F5TX 3MEAA 5CO7A 1YI2A 1B34B 1YJ9T 2XU8A 4F7UB 2YHTA 3TREA 4DA4A 2R5MA 5A0GA 1VQ5A 4XU2A 4OMFB 2E6ZA 2QQSA 5I2SA 1JRIA 4L59A 4MDWA 4OF1A 2CKKA 1ZHIA 3WVDB 2LC4A 2YRVA 2H3JA 4R56A 3BY7A 1VQOT 2BKDN 2DK3A 3SWNB 3V7SA 4C92E 1W2BA 2YLBA 3CC4T 2RHYA 1DJ7B 3GPLA 5GAN2 4BDZA 3JCMh 1X6OA 2RJDA 5GAN8 4JJNK 2HQXA 4BB7A 3S3OA 5CCAA 3ER0A 2XDBA 1RL2A 3QDRB 4KT0E 2DXCA 5GAN6 3FRNA 3UPUA 4MMLA 2LQ8A 5FRNA 5GAMe 4ATOA 4B9XA 3E9GA 2CGHA 4NL2A 3OYKA 2WSEE 3JB9J 4M78F 3OYEA 1KQSS 3JRZA 2A3LA 3E1SA 2GCXA 1D3BA 1XNIA 3MEUA 4V2SA 5GAOn 3M55A 1N27A 2L5QA 2P4TA 2O4XB 4FT4A 3WVEB 4C0DB 4LDYA 3OYBA 2Y90A 4M77B 2DXBA 2FVUA 4M78C 4X34A 5GAOm 1YITA 5GMKl 3OW2S 5GMKh 3JCMW 3R6OA 1G3TA 1YJNA 1QVGA 2KMTA 1Y96A 4X9CA 1ZQ1A 1QW1A 5FLXE 1M1KU 1BI1A 3M9QA 4FL6A 2HQEA 5HY6A 3EFRA 2LX9A 5A0DA 2RK1A 1Q82U 2BUDA 2PQWA 1H3ZA 3OYAA 3L2WA 3AHUA 5LJ5g 4A4FA 2MAMA 2VXFA 4M77E 5CKBA 5A0LA 4CI0C 3CCQA 4Z02A 5GANd 5DLOA 4KUIA 1I4K1 2XI9A 3JCMb 2MMPA 5D6WA 1K9MU 3CBOA 3GNGA 4PLLA 3I55T 3KXTA 5GAOr 4QVZA 1LJOA 2VGMA 2DXUA 3C95A 3J81E 4C5HA 4QQDA 3OYHA 2MI6A 4M75D 3M54A 1UGQB 2XKOC 3BFMA 5FROA 2RK2A 3CCUA 3OBWA 5GAOl 4HA8A 4JRIA 4M78B 4IUTA 4QQ6A 5IT9E 1WJSA 1YIJA 3OYNA 3QZ9B 1KHCA 1S72A 4HCZA 2IG0A 1UGPB 1U1TA 2DXTA 2RJEA 2VYTA 1Q86C 5GAMd 4M7AG 1R8OB 3MEWA 2JTFA 2JOYA 1K73C 2ZGWA 4M7DG 4P5NA 3X25B 2VC8A 2OTLT 5L8RE 3QYGB 2KQWA 4XTUA 2K57A 4C92C 1N8RC 2E5QA 4IUPA 5C6SA 5DM7R 3CD6A 2RHXA 4A4KA 3CCET 4ELZC 1MHNA 1G5VA 1YJ9A 1W4SA 3FJPA 4IUQA 2X4WA 4QW2A 2E70A 3CPWS 4HT9A 3SD4A 4XTZA 4C8QG 2RO0A 3PIPA 3PNWC 2EKOA 2ZPHB 3HP9A 3QSUA 2RH2A 1UEBA 2E10A 5CKFA 3SWNC 2K5LA 4OP0A 2QXFA 4A54A 4F7UG 2DVEA 3CC4A 4C5GA 3S6WA 3ZBDA 5A2QE 1NJIC 3JCMg 3ZFJA 2R5AA 2VXEA 3HRSA 4EMHA 5LJ5j 4FIBA 5DY9A 3CCRA 4OB1B 5LJ3h 4PL6A 3CCJT 1VQ7T 2XD0A 4XU1A 2LCLA 2DTHA 1M1FA 3CBMA 4LDWA 5FU7B 3URGA 3S3MA 1D3BB 2GQVA 3CCMT 3OQ5A 4FSXA 3QKJA 5J39A 1JJ2S 4BI4A 1WJRA 3JAME 2EJFA 5DLQE 2RHUA 3NFCA 2QEXT 1I5LA 1Y71A 4ZTJA 3FDRA 4XU0A 5CKDA 5D6YA 4BACA 1YJWT 2OTJT 3M56A 4PJOG 4Y28E 2JZ2A 4C0ZA 1G3WA 2M1HA 3DB3A 5GANh 2F69A 2L89A 4M77C 4ZTFA 1VQMT 1KQSA 3CC7T 2RM4A 2DTIA 1YCYA 2GFUA 1Y96B 5GMKm 3S3NA 3OMGA 2RB6A 3FEOA 4E7KA 2L8DA 4RCBA 2CS7A 2LT4A 3OYFA 1KD1U 5CK9A 3JB9G 2NLUA 2PUOB 4RG2A 2QA4A 4M7AE 3QIIA 2XICA 2XK0A 4RMOA 1VQ4T 2QI2A 5FU6C 2P0KA 4D6WA 3A8MB 2KSSA 3E19A 1X01A 1QVFA 2F5KA 4RG8A 4EDUA 2I2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R57 A;  3M9Q A;  3QBY A;  4FL6 A;  1RI0 A;  2HQE A;  5D6X A;  2FHD A;  2MWP A;  3L2R A;  3LYI A;  2RJC A;  3DLM A;  4BDY A;  3OB9 A;  2BUD A;  4FU6 A;  3OA6 A;  2PQW A;  1H3Z A;  3OYL A;  3OYA A;  3L2W A;  4BE2 A;  3LX7 A;  4A4F A;  2X35 A;  4CRI A;  3UT1 A;  2RI3 A;  4Z02 A;  3OY9 A;  4II1 A;  3OYD A;  3MET A;  2EQK A;  5D6W A;  2GF7 A;  3C4S A;  1OYX A;  5KE2 A;  2R58 A;  4PLL A;  3KUF A;  4QVZ A;  2GFA A;  2RHI A;  3CEY A;  2G3R A;  4IKF A;  4C5H A;  4QQD A;  3PMI A;  3OYH A;  4A4E A;  5FRO A;  3L2U A;  3MP1 A;  4E7J A;  3ME9 A;  3MP8 A;  3OYJ A;  4E7H A;  4IUT A;  4QQ6 A;  3F70 A;  1WJS A;  3OYN A;  4Q5W A;  3L2Q A;  1KHC A;  2K3X A;  2LCC A;  5KH6 A;  3H8Z A;  4HCZ A;  2IG0 A;  2RJE A;  2VYT A;  3EAE A;  3LGF A;  4N4I A;  2D9T A;  2F5K A;  3QJ6 A;  3FC3 A;  5FRM A;  4C5E A;  3MEW A;  2JTF A;  4GY5 A;  2RHZ A;  5J26 A;  4PLI A;  5IN1 A;  4A4H A;  3P8D A;  3OYI A;  2B8A A;  2E5Q A;  2L3R A;  4IUP A;  5C6S A;  4N4G A;  3UWN A;  2M16 A;  2RHX A;  3DB4 A;  3MP6 A;  4IUU A;  2E6N A;  2LVM A;  1SSF A;  3BDL A;  1MHN A;  1G5V A;  3FLG A;  4IUQ A;  3ZEH A;  2X4W A;  4QW2 A;  3P8H A;  3NTH A;  3SD4 A;  4IUR A;  2RO0 A;  5CIU A;  2DIQ A;  3E9F A;  2LTO A;  3LH0 A;  3PNW C;  3MEA A;  2EKO A;  3MEV A;  3H6Z A;  3OS1 A;  2EFI A;  2DAQ A;  2EQJ A;  1OI1 A;  4OVA A;  2XDP A;  2R5M A;  3L42 A;  3PMT A;  2QQS A;  1OZ2 A;  2DIG A;  4C5G A;  1WJQ A;  4L59 A;  3S6W A;  2CKK A;  2R5A A;  3OS0 A;  2YRV A;  4A4G A;  3L2V A;  2BKD N;  4PL6 A;  4UC4 A;  5KCO A;  2EQM A;  3OYG A;  4C5I A;  2RJF A;  2RHY A;  3S3M A;  4BDZ A;  3S3O A;  2RJD A;  3PFS A;  1WGS A;  2HQX A;  3OQ5 A;  3QKJ A;  5J39 A;  1WJR A;  4BE0 A;  5FRN A;  4BD3 A;  2K3Y A;  3ASK A;  2RHU A;  2RI5 A;  2EQU A;  2RI2 A;  2M0O A;  3Q1J A;  4B9X A;  3MO8 A;  3NTI A;  2LRQ A;  4ZTJ A;  3E9G A;  3FDR A;  4BAC A;  5D6Y A;  5KCH A;  2MWO A;  3OYK A;  2JZ2 A;  2BIV A;  3OYE A;  2M1H A;  3DB3 A;  4LD6 A;  2L89 A;  4ZTF A;  1XNI A;  3MEU A;  2QQR A;  1N27 A;  2GFU A;  2O4X B;  3S3N A;  3OMG A;  4B9W A;  4NS5 A;  3FEO A;  4E7K A;  2L8D A;  3LGL A;  4E7L A;  4IUV A;  3OYF A;  1OZ3 A;  4BE1 A;  2X4X A;  5C0M A;  3OYB A;  4X34 A;  4QQG A;  5KE3 A;  3OYM A;  2NLU A;  4RG2 A;  3GOX A;  3OS2 A;  3QII A;  2XK0 A;  3OMC A;  3NTK A;  5M9O A;  4E7I A;  2X4Y A;  4N4H A;  2P0K A;  3OYC A;  3O8V A;  5IAY A;  3LLR A;  2LDM A;  2WAC A;  2O4X A;  4EDU A; 
#chains in the Genus database with same CATH topology
 2R57 A;  2XDD A;  3V8L A;  2FHD A;  1K73 R;  5GAM h;  1JXO A;  3M4Y A;  1M1K C;  2RA2 A;  3X20 B;  2QTX A;  2JM9 A;  3QZ5 B;  1D0Z A;  2G3R A;  3C12 A;  1YJ9 Q;  5LJ3 f;  4A4E A;  3CC2 T;  4AFZ C;  3EGX B;  1B3Q A;  1V1C A;  8AT1 B;  4M4Z A;  4Q5W A;  2K3X A;  1VQO Q;  2MPX C;  1M1G A;  1AHJ B;  2ROL A;  2QYZ A;  1ABQ A;  1TXQ A;  3M0Q A;  3OS5 A;  1YHQ T;  1ZLM A;  2IVW A;  2K2V A;  4PK4 A;  4PJL A;  1MMD A;  2GNC A;  5I2M A;  2CDT A;  3EG3 A;  1PSF A;  3LH0 A;  1UB4 A;  2DAQ A;  2KRO A;  3MCA B;  1VQ7 A;  1OZ2 A;  2DIG A;  2HL3 A;  1M2V A;  4DBF A;  4ESR A;  4A4G A;  2DO3 A;  3SB2 A;  4UC4 A;  3JB9 D;  2OTJ A;  2V1Q A;  3EH1 A;  3CCV T;  5I21 A;  4GLK A;  2JS2 A;  5GAN g;  1G3Y A;  1X69 A;  1PM3 A;  5KCH A;  1Q82 R;  3GNF B;  3RKW A;  3DLL A;  1RAG B;  3CCS T;  3V8K A;  3GF5 A;  2FZG B;  3TU4 K;  1SKU B;  2PVD B;  1IHV A;  2JM8 A;  4DOV A;  2J05 A;  2FZK B;  2HBP A;  1UHC A;  4KUL A;  3OYM A;  1Q81 U;  3ZL7 C;  2DKG A;  1BIB A;  3OMC A;  2DRM A;  4E7I A;  1SHG A;  2FRW A;  3O8V A;  2E1H A;  1W2B P;  1ACM B;  5L23 A;  3FB9 A;  4PJO F;  1X2Q A;  2XHC A;  2XID A;  1QVF P;  3HSB A;  1G8X A;  2DD4 A;  3OYL A;  1VQL T;  1UJY A;  4M75 C;  3OY9 A;  2PUK B;  2MIO A;  4C0G A;  2DE0 X;  2LX7 A;  1U1S A;  2PVG B;  2RHI A;  1VQN T;  4XQ3 A;  2LJ1 A;  4M77 G;  2QQA A;  4M7D E;  2COY A;  3JCM V;  4C0F A;  2HKQ B;  4LUD A;  2FL7 A;  2FB7 A;  3HTR A;  3BW1 A;  4GY5 A;  5J26 A;  3CCM Q;  4A4H A;  4C8Q E;  3UF4 A;  4MZP A;  2HSP A;  3G4S A;  3EG9 B;  3CME T;  3VS3 A;  4N4G A;  1QKW A;  2O01 E;  2DPP B;  1NE8 A;  4IUU A;  5LJ5 d;  1I81 A;  3FLG A;  4Y91 A;  3CC7 Q;  1LVK A;  1UFF A;  1UHF A;  2HMA A;  2EFI A;  4AT1 B;  3M0U A;  4BUG A;  1WYX A;  2RPN A;  4XAX B;  1WJQ A;  2H3E B;  1RAI B;  3AT1 B;  1VYV A;  1VQ9 A;  5GMK e;  1X6B A;  2E65 A;  3SFM A;  3QDF A;  5CKE A;  1U5S A;  3GP8 A;  1VQ8 A;  4BE0 A;  3ASK A;  6AT1 B;  3JCM P;  2LCS A;  2DX1 A;  4RTU A;  2CT4 A;  3SWN A;  2L0A A;  1U8R A;  1QKX A;  2K79 A;  1ZUY A;  4BE1 A;  1YBY A;  3UAT A;  1N5Z A;  5C0M A;  3I35 A;  4QQG A;  3OS2 A;  4M77 D;  2K5I A;  3LWI A;  3OYC A;  4PFO A;  5IAY A;  2WAC A;  3JCM d;  2KNB B;  1YIT T;  4RTX A;  3NMZ C;  4M77 A;  1BI2 A;  3CMA A;  1O9S A;  2CP5 A;  3V7C A;  4J6X A;  1KQS P;  2R58 A;  4OGC A;  3G6E T;  1M90 C;  1ZSZ A;  2KR3 A;  5CVI A;  4HCK A;  4IKF A;  2DJZ A;  1RLQ C;  1I5O B;  1Q86 U;  3N5B B;  2WSF E;  2FYK A;  1C1A A;  5ECA A;  1A0N B;  4ZNX A;  1SPK A;  3M5A A;  4BI8 B;  2ATC B;  3CCU T;  3OSV A;  1G2B A;  2K7A A;  1M3B A;  2HEQ A;  4LXC A;  3R6N A;  2JVV A;  2DEQ A;  1VIE A;  1WA7 A;  1JBM A;  1VQP A;  1KG1 A;  2CZ0 B;  3P8H A;  2EBP A;  2YRC A;  3PE0 A;  2X4J A;  1YI2 A;  1SF9 A;  3NHN A;  1B34 B;  1YJ9 T;  2ABL A;  3H0H A;  4OMF B;  5I2S A;  4WCI A;  4MDW A;  2E5K A;  1YCS B;  2YRV A;  3BY7 A;  1VQO T;  4C92 E;  1W2B A;  1Q81 R;  1XJW B;  2RHY A;  4BDZ A;  3S3O A;  3TQ7 P;  2JTE A;  2KRS A;  2M0Y A;  1HSQ A;  2D0N A;  2DXC A;  5FRN A;  3FRN A;  2L3Q A;  2IIM A;  5GAM e;  4B9X A;  1JEG A;  4F17 A;  3E9G A;  1MND A;  2O9S A;  1K76 A;  2CH4 A;  1N27 A;  2L5Q A;  2DL7 A;  2O4X B;  3WVE B;  2RQV A;  2Y90 A;  4JJD A;  3OW2 S;  1G3T A;  1QWF A;  1YJN A;  1QVG A;  1Y96 A;  1ZQ1 A;  1M1K U;  4FL6 A;  3EFR A;  2DL3 A;  2EGC A;  2BE7 D;  1OOT A;  1JJ2 P;  1OV3 A;  4JZ3 A;  2V1R A;  2DBK A;  1I4K 1;  3JCM b;  1D0Y A;  1K9M U;  3CBO A;  1NEB A;  3H0I A;  4PLL A;  5GAO r;  4QVZ A;  1WXB A;  1RAD B;  4QQD A;  1UGQ B;  3BFM A;  4QT7 A;  1YIJ A;  1PG5 B;  4AG2 C;  1ABO A;  1KHC A;  1S72 A;  4HCZ A;  2VYT A;  2YWW A;  5GJW B;  1YNZ A;  2JTF A;  3I9Q A;  4P5N A;  5L8R E;  3EGX A;  2KXC A;  3I5S A;  2HL5 C;  5IH2 A;  2GGR A;  1E6G A;  5C6S A;  5DM7 R;  1NEG A;  2LZ6 B;  3GBQ A;  2RO0 A;  2ZPH B;  3CQT A;  2RH2 A;  1UEB A;  2E10 A;  5CKF A;  3SWN C;  3G1J A;  3CC4 A;  3ZBD A;  1UGV A;  2R5A A;  2VXE A;  4FIB A;  4OB1 B;  4GLM A;  1YWP A;  3URG A;  3CBM A;  3CCM T;  4FSX A;  4BI4 A;  1H8K A;  2EJF A;  2YSQ A;  2RHU A;  2LJ0 A;  1YJW T;  3M56 A;  3U23 A;  5GAN h;  4M77 C;  1KQS A;  1HD3 A;  3CC7 T;  3CCQ Q;  1W70 A;  5GMK m;  3S3N A;  2RB6 A;  2W10 A;  2L8D A;  2O9V A;  2NLU A;  2PUO B;  1ZSZ C;  4KH0 B;  2XK0 A;  2MCN A;  5FU6 C;  1Q86 R;  1WQ7 A;  3QUI A;  3L2R A;  1OPK A;  3E2U A;  1VUB A;  1QWE A;  1AT1 B;  2NYS A;  3CCL A;  2DZC A;  4JRQ A;  2J6F A;  3CPW P;  1YP5 A;  3X26 B;  2ZCF B;  2K5F A;  3EHQ A;  1H64 1;  3CD6 Q;  1W1F A;  1YWO A;  3RER A;  2YUO A;  3VYH B;  1TH7 A;  3L2U A;  3RES A;  2RQW A;  1QCF A;  1N9R A;  1B7T A;  3EAE A;  5FU6 B;  2EW3 A;  3QJ6 A;  4VUB A;  4LE9 A;  2XG8 D;  4M75 E;  1ZBJ A;  2ZPB B;  2Y4X A;  1NM7 A;  5GMK j;  4AG1 C;  4XTW A;  3DB4 A;  2EWN A;  4BY6 B;  4EPC A;  4QVD A;  2LTO A;  4ME7 A;  3H6Z A;  4JLI A;  1NZ9 A;  2A36 A;  3EG9 A;  4M7A F;  3HKS A;  2LNV A;  2XDP A;  1B07 A;  3VS6 A;  5LJ3 g;  3CCJ A;  1D1A A;  4M75 A;  3QYH B;  5FU7 C;  3CXC A;  4Z8A A;  7AT1 B;  4OB2 B;  1WHL A;  1PC0 A;  2KAF A;  4LD9 K;  3OYY A;  3I56 T;  2K3B A;  4J9H A;  2Y4Y A;  4C8Q F;  1M1K R;  1PKS A;  2FPE A;  1VQM A;  3BDU A;  2D8J A;  4FCY A;  2EQI A;  1D0X A;  1MNE A;  2RNA A;  2EYW A;  2C06 A;  1VIF A;  3I55 Q;  1TUG B;  4LD6 A;  1QLY A;  1NLO C;  2RF0 A;  1QCO A;  1TS9 A;  1VQ4 A;  1Z9Z A;  2CP0 A;  4E7L A;  1K9M R;  1GL5 A;  3P8B B;  1KQ1 A;  2HZY A;  2JTM A;  1X75 C;  2MOX A;  3NTK A;  5GAN 7;  4FSS A;  5HK3 A;  2OJ2 A;  1NBE B;  4J8O A;  3UDC A;  2J06 A;  2P4R A;  4DEY A;  4CC3 A;  1GFD A;  3QXE B;  2NUT B;  3O5Z A;  3JSC A;  3GIB A;  4Y92 A;  2B86 A;  1MMN A;  5LJ3 e;  1M90 U;  3CCE Q;  1BU1 A;  3M0R A;  3J7A F;  4JDS A;  1VQ9 Q;  2QTV A;  3EG2 A;  1KC8 C;  4ZN3 A;  4PJO C;  3KUF A;  2F2W A;  2VB6 A;  3RMS A;  3A8H B;  3PMI A;  5EC7 A;  2CZ7 B;  2D1X A;  1RAA B;  3X24 B;  1NJI U;  4OMM A;  3L2Q A;  2EVR A;  1YHQ A;  4N4I A;  2DTO A;  4J5Y A;  3HFN A;  4JS4 A;  2GBQ A;  2V8J A;  4C5E A;  1RUW A;  1PHT A;  3OBY A;  2JUF A;  2LQW A;  2B8A A;  4HVV A;  2L3R A;  5LL6 S;  4LDV A;  1IHW A;  1PRM C;  4PJM A;  4E7Z A;  1K9M C;  1F1B B;  5GAM j;  2JW4 A;  4PJO B;  1HXD A;  4FT2 A;  2EYZ A;  1GBR A;  2ZAE A;  3MEV A;  5IHK A;  3OS1 A;  2EQJ A;  1BI3 A;  1N6A A;  2EIF A;  2CYZ B;  1EIF A;  1FMW A;  1QP3 A;  2YUN A;  2NUZ A;  3CCV A;  3OS0 A;  2LT1 A;  1G83 A;  3RBB B;  4E7S A;  4RUG A;  4HCC A;  5KCO A;  2JJ9 A;  1B34 A;  2K2M A;  4DOW A;  3G71 Q;  2O2O A;  1KK7 A;  3Q1J A;  2RI5 A;  2KXD A;  5GAO q;  3CCS A;  1WI7 A;  3MO8 A;  2DZ9 A;  3NTI A;  2L3S A;  3CPW A;  2KY9 A;  1M3A A;  1GCQ C;  4EMK C;  5CQX A;  1TG0 A;  1XQH A;  1QP2 A;  2C0O A;  3QJY A;  4IUV A;  4OGE A;  1TSF A;  2KRN A;  4WF2 A;  2QEX A;  1M5Q 1;  1M30 A;  1XOV A;  2QG9 B;  4RCC A;  3V7R A;  1OU9 A;  1WQW A;  4HKE A;  2LDM A;  2O4X A;  2KEA A;  5CQY A;  1VQL A;  1YI2 Q;  1XTD A;  4C92 F;  5D6X A;  3RUX A;  4J9C A;  1OX9 A;  3PIO A;  2PTK A;  4MZT A;  4J7I A;  1UUE A;  4LDX A;  4FM4 B;  4F7U F;  3H9N A;  2RI3 A;  1VQN A;  1MGQ A;  2BZ8 A;  3HL8 A;  1D09 B;  3OYD A;  3MET A;  1Y07 A;  2O31 A;  3THK A;  1OYX A;  5KYY A;  2MF2 A;  4JS5 A;  4EMK B;  2GFA A;  3CEY A;  3CCQ T;  2DNU A;  3A1P A;  1KQ2 A;  3MHX A;  1U3O A;  4RKU E;  2E41 A;  4J9D A;  1OX8 A;  4J7F A;  1RAF B;  2AHJ B;  3VJP A;  3CME A;  2AZS A;  1VQ6 Q;  1CKA A;  2Z0W A;  1ZBX A;  2BZY A;  5CKH A;  2HQH A;  3MP6 A;  2ZPI B;  1T3S A;  1RAC B;  1G3S A;  3CD6 T;  5AT1 B;  5GAN e;  2ZPG B;  1UJ0 A;  5CO7 A;  2KYM A;  2YHT A;  2QGG A;  3TRE A;  2FO0 A;  2R5M A;  5I11 A;  4DA4 A;  5KYX B;  1QMC A;  2QQS A;  4HXJ A;  1ZHI A;  2KBT A;  2PNI A;  2GQI A;  4R56 A;  5FWC A;  2BKD N;  3V7S A;  1DJ7 B;  1X6O A;  5GAN 8;  5CCA A;  3ER0 A;  3QDR B;  3UPU A;  2QGF B;  4CC2 A;  1M3C A;  1KFZ A;  4M78 F;  3JRZ A;  3MJX A;  2X9H A;  3E1S A;  3MEU A;  1M90 R;  3M55 A;  2P4T A;  2F1L A;  4FT4 A;  2J6K A;  4KRT A;  2FVU A;  4X34 A;  1YIT A;  2M02 A;  3R6O A;  4D8K A;  1BK2 A;  4X9C A;  1WFW A;  1BI1 A;  2FZC B;  1NJI R;  2AZV A;  5HY6 A;  2RK1 A;  2FRY A;  5LJ5 g;  4A4F A;  4M77 E;  4PFZ A;  4DEX A;  4Z02 A;  4KUI A;  2XI9 A;  2MMP A;  1PNJ A;  3I55 T;  3KXT A;  1CSK A;  2VGM A;  4C5H A;  1PRL C;  3M54 A;  2XKO C;  3CCU A;  3OBW A;  2DYI A;  4IUT A;  5IT9 E;  1WJS A;  3QZ9 B;  4EIK A;  1VQ5 Q;  2IG0 A;  2RJE A;  2YXY A;  5GAM d;  1SG5 A;  2ZGW A;  2OTL T;  2VC8 A;  1IRX A;  2MK5 A;  1JQQ A;  2RHX A;  2G6F X;  3CCE T;  1MHN A;  1YJ9 A;  1W4S A;  2DJQ A;  4QW2 A;  3PIP A;  1I1J A;  3HP9 A;  1IB8 A;  3CCL Q;  1WHG A;  2RMO A;  2BE9 B;  4OP0 A;  1AVZ C;  4F7U G;  4C5G A;  3S6W A;  1NJI C;  3JCM g;  3ZFJ A;  4EMH A;  3CCR A;  1FYN A;  3VS5 A;  3EFO B;  5LJ3 h;  2E4H A;  2XD0 A;  2DTH A;  4LDW A;  2A0F B;  2GQV A;  1SEM A;  3OQ5 A;  1TUD A;  1Y71 A;  2EGE A;  4BAC A;  4ZTJ A;  1KIK A;  5D6Y A;  4PJO G;  2JZ2 A;  4C0Z A;  2M1H A;  3DB3 A;  2L89 A;  4ZTF A;  4IIO A;  3VS0 A;  2ENM A;  1SRM A;  4RCB A;  5D7U A;  2QA4 A;  3IQL A;  3QII A;  2XIC A;  2QI2 A;  2QK0 A;  1TOV A;  1X01 A;  3MKD A;  1QVF A;  4EDU A;  5LJ5 f;  1IGU A;  2HSE B;  2W0Z A;  2MYS A;  3JCM X;  4RTZ A;  3G71 T;  1GXI E;  1KC8 U;  1UDL A;  4CRI A;  2FG0 A;  1X6G A;  4II1 A;  3HHT B;  4MDX A;  2GF7 A;  3A5Z B;  2EAY A;  1E7O A;  3GLX A;  1ZUK A;  4HVW A;  3H41 A;  2DM1 A;  2HKN A;  1YFN A;  3ME9 A;  2QAZ A;  4JRK A;  3JV3 A;  3H8Z A;  2LQN A;  4KH1 B;  1VQK A;  1Z9Q A;  1KJW A;  1YI2 T;  3FIF A;  3RMQ A;  4E2F B;  4ZGE B;  4L6V 5;  5CR2 A;  2E6N A;  4TVR A;  4XU3 A;  1SSF A;  2L2P A;  1M9S A;  1ZSG A;  1BI0 A;  4HVU A;  4PJO D;  3JCM f;  1WHK A;  2DL5 A;  2HCK A;  3L42 A;  2CZ1 B;  3PMT A;  2CP7 A;  4PJO A;  2DEU A;  3L2V A;  4C5I A;  1QVG S;  4HT8 A;  4M7A C;  1YJW A;  1VQ6 T;  2OAU A;  2A7Y A;  4DBQ A;  4BD3 A;  3VS7 A;  2EQU A;  2X51 A;  3CC7 A;  2QDL A;  5IHI A;  2DL4 A;  1X2K A;  2V26 A;  1FX7 A;  2EYQ A;  4NS5 A;  5GAO p;  2COW A;  1OZ3 A;  1IXD A;  2LQK A;  2DD5 A;  2NUP B;  1K0X A;  5M9O A;  2AK5 A;  4N4H A;  1KD1 C;  2ZZD A;  1R0B G;  3TEE A;  2DLP A;  2ROT A;  4RTV A;  2YLC A;  3EG1 A;  4M7A B;  2RJC A;  3DLM A;  3QHS A;  4M7D B;  2E64 A;  3LX7 A;  3INZ A;  2CUD A;  1N8R U;  3UT1 A;  4ZGJ B;  2JXB A;  2ZPE B;  2KDS A;  3M4G A;  3RIR A;  1WX6 A;  3JB9 H;  1FXX A;  3QPH A;  5KE2 A;  4OMO A;  3QO3 A;  1ZA1 B;  4KBM B;  3RNJ A;  2AKK A;  4OB0 B;  2EYY A;  4J9G A;  3C94 A;  2P0Q A;  4C8Q B;  1PSE A;  2KE9 A;  3CBP A;  2SEM A;  5GAN j;  3PTA A;  3VS2 A;  1GCQ A;  4FYV B;  1IZ6 A;  2LCC A;  4JZ4 A;  4MZM A;  4EMK A;  5KH6 A;  1VQ7 Q;  3LGF A;  3M58 A;  5HKC A;  4AFU C;  4J9B A;  1VA7 A;  1BCO A;  1WZO A;  4BY6 C;  1FMV A;  2QEX Q;  2D6F A;  2HBW A;  2OTJ Q;  4XK8 E;  3KBG A;  2DBM A;  2M16 A;  4JPB W;  1OPL A;  5HCK A;  4BI3 A;  5EG2 A;  1NG2 A;  5GAN 4;  3A8O B;  3WXM B;  3A8G B;  2HD0 A;  1V76 A;  1FWZ A;  4D8D A;  3I56 A;  4JJC A;  2X3X D;  1UGS B;  1VQ5 T;  1TTH B;  1P92 A;  2P0P A;  3OYG A;  3QG1 A;  3J80 E;  1Q7Y C;  5LJ3 d;  1RI9 A;  3PFS A;  5KYX A;  4RTT A;  2ESW A;  3A98 A;  3X28 B;  3SDZ A;  2M0O A;  2RD1 A;  2RI2 A;  3D7S B;  5GAN 5;  2LNH B;  1KC8 R;  3CME Q;  2VV5 A;  2VGN A;  2QQR A;  4ORZ A;  4M7D F;  4NL3 A;  3HPW A;  2QQB A;  4L5G A;  4R55 A;  3CCL T;  2ZPF B;  4MMK A;  4CC7 A;  5KE3 A;  2F2V A;  4PJN A;  2X4Y A;  1I07 A;  3LLR A;  4PJJ A;  3V8J A;  1JJ2 A;  2VAS A;  4O6J A;  2MWP A;  2OI3 A;  2K9G A;  2EJG A;  3OB9 A;  2QQ9 A;  1QVP A;  2A28 A;  2M9U A;  2X35 A;  3TSW A;  1PD0 A;  1E6H A;  3G4S Q;  3VKI A;  3C4S A;  1M8V A;  1K8A C;  5GAN 3;  5LJ5 h;  1AZE A;  4PNO A;  3L1A A;  1T0H A;  1Y7X A;  2LJ3 A;  3MP8 A;  3I5R A;  4E7H A;  4ELY C;  1VYU A;  4PKC C;  3CXC S;  5FRM A;  3NPF A;  2CH4 W;  4JLG A;  5FWB A;  4PLI A;  5IN1 A;  2K6D A;  4KGZ B;  3OYI A;  4DQ2 A;  3CC2 A;  2OAW A;  1M2O A;  1O75 A;  1HYO A;  4M77 F;  3T9N A;  1VQ8 Q;  4A53 A;  3LW5 E;  2AIR B;  4C92 B;  1AWJ A;  3RKY A;  4C0D C;  2F5T X;  4F7U B;  1T0J A;  3FJ5 A;  4AFQ C;  3WVD B;  1KSW A;  2H3J A;  5GAN 2;  3JCM h;  4JJN K;  2HQX A;  1VOM A;  2XMF A;  4BB7 A;  2XDB A;  1RL2 A;  5GAN 6;  4KT0 E;  4ATO A;  2PZ1 A;  3CCU Q;  1VYT A;  1TUC A;  3EFO A;  2CGH A;  4NL2 A;  1GFC A;  2JS0 A;  3OYE A;  2J6O A;  3REA B;  3CMA Q;  2FEI A;  2RQR A;  2DRK A;  1XNI A;  1N8R R;  4V2S A;  4AMC A;  1NYF A;  4C0D B;  4LDY A;  2DXB A;  1GRI A;  4M78 C;  2O88 A;  2SRC A;  5GMK l;  1UTI A;  3JCM W;  2EKH A;  1QW1 A;  5FLX E;  2CSQ A;  1H3Z A;  3L2W A;  3AHU A;  2VXF A;  5CKB A;  3PVQ A;  3UA6 A;  5A0L A;  3CCQ A;  5GAN d;  1K0S A;  5DLO A;  3CCR Q;  2CP2 A;  1LJO A;  2DXU A;  2MI6 A;  1VQP Q;  5FRO A;  2RK2 A;  5GAO l;  4JRI A;  4M78 B;  3OYN A;  1GBQ A;  1BB9 A;  4M7A G;  2HDA A;  1K73 C;  1AWW A;  4M7D G;  3X25 B;  4XTU A;  1Y0M A;  2K57 A;  1N8R C;  2E5Q A;  2QA4 Q;  4IUP A;  3CD6 A;  2EYX A;  4J9I A;  4X1V A;  1Y57 A;  3FJP A;  4IUQ A;  2X4W A;  2DVJ A;  3CPW S;  4HT9 A;  3SD4 A;  4XTZ A;  4C8Q G;  1AWO A;  1PKT A;  4RTY A;  3OW2 P;  2K5L A;  3ULR B;  2QXF A;  1EZZ B;  1T3L A;  2DVE A;  5A2Q E;  3EGD B;  5DY9 A;  2KT8 A;  4LUE A;  4PL6 A;  1VQ7 T;  4J9F A;  3PVL A;  1D3B B;  5J39 A;  3QKJ A;  1YJN Q;  2QEX T;  2OTJ T;  4XU0 A;  4OMQ A;  5CKD A;  4LN2 A;  1VQK Q;  1G3W A;  1JU5 C;  2VKN A;  2RM4 A;  1YCY A;  2GFU A;  2GTJ A;  3OMG A;  3FEO A;  3EG0 A;  1D1B A;  3OYF A;  2A37 A;  1C0M A;  1KD1 U;  2ED1 A;  5CK9 A;  5I22 A;  4F14 A;  4M7A E;  2CP3 A;  2P0K A;  1UE9 A;  3A8M B;  1MMA A;  2KSS A;  2F5K A;  2I2L A;  1QVG P;  2D0Q B;  4J6W A;  1YIJ Q;  2V8I A;  1S72 Q;  4M7A D;  2NUP A;  3I55 A;  1R77 A;  4M7D D;  1Q82 C;  4N0A A;  4M7A A;  3VUB A;  4JUV A;  3JCM Q;  1YJW Q;  3RDV A;  4M75 B;  3JCM J;  4M7D A;  1ZA2 B;  5KYU B;  4DBH A;  5IXF A;  4C8Q D;  2IPO B;  3F70 A;  2OTL A;  1RLP C;  2DL8 A;  3CC4 Q;  3G6E A;  4C8Q A;  1MMG A;  4FYW B;  2VVK A;  3CCE A;  2VUB A;  5GAN f;  1X43 A;  2YUQ A;  2DF6 A;  4EMG A;  2GTO A;  3M59 A;  4OML A;  4ZN1 A;  2LVM A;  5HK0 A;  2V8K A;  3G4S T;  1UEC A;  3NTH A;  4RTW A;  1OQK A;  5GJV B;  2DIQ A;  3E9F A;  5KYW B;  1SRL A;  1SHF A;  3M53 A;  4J83 A;  1M4Z A;  2I0N A;  1WXU A;  3REB B;  1Q7Y U;  1AEY A;  1WPY A;  4QVC A;  2JMA A;  1TWB A;  2KGT A;  2ED0 A;  4K11 A;  5GMK i;  1GCP A;  1VQ9 T;  4O5V A;  1U06 A;  3VYG A;  2LRQ A;  4YTL A;  1J3T A;  3HRT A;  2E3I A;  4ZGD B;  2MWO A;  1VQ8 T;  4C92 G;  4FYY B;  2E3H A;  2DMO A;  1VQO A;  4B9W A;  5LJ5 e;  4JJB A;  3RR6 A;  2X4X A;  2LP5 A;  3HRU A;  1EFN A;  3VV0 A;  5GAM g;  3G71 A;  4M75 F;  2JNG A;  3QBY A;  2WSC E;  3C0C A;  1TU0 B;  3CPF A;  3LYI A;  4FU6 A;  2KVQ G;  2PU9 B;  3TCJ A;  3MPU B;  2C0I A;  1K8A U;  3I56 Q;  2BTT A;  3QWY A;  5LJ3 j;  3RKX A;  1HJD A;  1PCX A;  4E47 A;  3CMA T;  1KHI A;  2K4Y A;  2F2X A;  1RAB B;  4CC4 B;  4WTO B;  3OW2 A;  3VRZ A;  1AOJ A;  3MP1 A;  4E7J A;  4FYX B;  2KI7 A;  3VUZ A;  1NLP C;  5AYF A;  3L2Z A;  1NPR A;  3FC3 A;  2HNI A;  1MV3 A;  2CUB A;  3CCJ Q;  2D9T A;  2CP6 A;  3TSZ A;  3EHR A;  3SHW A;  3VU3 C;  4IIM A;  2QAS A;  3QWX X;  3DKM A;  3JCM e;  4XTX A;  4F16 A;  2NUT A;  3UWN A;  1I8F A;  3H0F A;  1V29 B;  3EGU A;  3CCR T;  4F7U E;  4E6R A;  3ZEH A;  1M2V B;  1VQM Q;  5IHN A;  4IUR A;  3LWH A;  2CZ6 B;  3JB9 I;  4C92 D;  1UGR B;  1AD5 A;  2CSI A;  4OVA A;  1OI1 A;  1VQP T;  4KUD K;  4M78 G;  2P84 A;  9ATC B;  1WLP B;  2BZX A;  2DFU A;  1VQ4 Q;  5J3B A;  1K1Z A;  2RQT A;  4C92 A;  1VQ6 A;  2YRD A;  2KT1 A;  2VWF A;  4NOY A;  1W2B S;  1KD1 R;  3CXC P;  2DET A;  1AZG B;  4PJO E;  2EQM A;  2RJF A;  4F7U A;  1QVF S;  1BYM A;  1LNX A;  3OSS C;  1WGS A;  2DYB A;  2K3Y A;  2PVO B;  4OMN A;  1CKB A;  1MUZ A;  3SEM A;  1HK9 A;  5KYY B;  2QA4 T;  1BIA A;  4QKU A;  2BIV A;  3PT9 A;  2JMC A;  2EJ9 A;  3PGG A;  1WHH A;  1S1N A;  3HFO A;  4KGX B;  5GAM f;  3LGL A;  1NPP A;  3CCM A;  1IO6 A;  2E12 A;  3CC2 Q;  4N0A C;  3G7Z A;  3GOX A;  1JXM A;  2KK4 A;  1BKB A;  4XTY A;  4M7D C;  4FW1 A;  1MV0 B;  3JCM c;  5CAI A;  2AKL A;  1Q81 C;  4XTV A;  2AT1 B;  1RI0 A;  4BDY A;  1JB0 E;  2JT4 A;  1YJN T;  1YHQ Q;  3OA6 A;  2JN0 A;  4BE2 A;  4C8Q C;  2EQK A;  4HCB A;  1VQK T;  1IRE B;  3EH2 A;  4M78 E;  2DA9 A;  4R0K A;  8ATC B;  1OU8 A;  1LOJ A;  4Z89 A;  4JRP A;  3TVT A;  4KGV B;  3OYJ A;  3M57 A;  1JO8 A;  4J6Y A;  4AFS C;  1K73 U;  2C0T A;  4A63 B;  4M78 D;  4LDU A;  3KFV A;  1M8M A;  2RHZ A;  3CCV Q;  1Q7Y R;  1YIJ T;  3P8D A;  1S72 T;  4M78 A;  1WHM A;  1WIE A;  2YDL A;  3JB9 F;  1N9S A;  4X9D A;  3A8L B;  3EFS A;  2QDY B;  3BDL A;  1BBZ A;  3CCS Q;  4M75 G;  1WNL A;  1SSH A;  5CIU A;  2HAX A;  2OX7 A;  3M0T A;  1WHJ A;  1K9A A;  2KRM A;  4OB3 B;  3MEA A;  2XU8 A;  1X27 A;  1VQ5 A;  1QCN A;  4FW2 A;  5A0G A;  4XU2 A;  1RAE B;  2E6Z A;  1JRI A;  4L59 A;  4OF1 A;  2ECZ A;  2CKK A;  4B6M A;  2YUP A;  5KYN A;  2LC4 A;  3SWN B;  2DK3 A;  2YLB A;  3CC4 T;  3GPL A;  4OMP A;  2RJD A;  3UA7 A;  1UG1 A;  4MML A;  2LQ8 A;  1VQL Q;  3EGD A;  3OYK A;  2WSE E;  3JB9 J;  1KQS S;  2A3L A;  2GCX A;  1D3B A;  1H92 A;  1K8A R;  1R0C B;  5GAO n;  1VQN Q;  1BCM A;  3OYB A;  4M77 B;  5GAO m;  2LMJ A;  2DER A;  1RAH B;  5GMK h;  2D8H A;  1OEB A;  2KMT A;  2YT6 A;  3VS4 A;  1LPL A;  3M9Q A;  2HQE A;  2LX9 A;  1ZSZ B;  5A0D A;  1Q82 U;  2BUD A;  2PQW A;  1M27 C;  3OYA A;  2RQU A;  2MAM A;  2NWM A;  2EGA A;  4CI0 C;  1D1C A;  5D6W A;  1Q95 G;  2EPD A;  3GNG A;  2X3W D;  1K4U S;  3C95 A;  3J81 E;  3OYH A;  4Z88 A;  4M75 D;  5IXB A;  4HA8 A;  1IGQ A;  3NGP A;  4QQ6 A;  4J9E A;  3LH5 A;  3BE3 A;  1UGP B;  1U1T A;  2DXT A;  1Q86 C;  5KYU A;  1R8O B;  3MEW A;  2JOY A;  1EX4 A;  1PWT A;  3QYG B;  3M0P A;  2KQW A;  2CT3 A;  1PD1 A;  4C92 C;  3M0S A;  4A4K A;  4ELZ C;  1G5V A;  2E70 A;  2FPF A;  3PNW C;  2EKO A;  3QSU A;  2DIL A;  2COZ A;  4A54 A;  1ARK A;  5FW9 A;  4GBQ A;  4ANJ A;  1WDX A;  3HRS A;  5LJ5 j;  2CRE A;  1ZX6 A;  5KYW A;  3CCJ T;  1YN8 A;  4DBR A;  1YIT Q;  4XU1 A;  2LCL A;  1M1F A;  2A08 A;  5FU7 B;  3S3M A;  1ZUU A;  1JJ2 S;  1WJR A;  3JAM E;  5DLQ E;  3NFC A;  1W6X A;  2FPD A;  1I5L A;  4F04 B;  2OTL Q;  2KYB A;  3FDR A;  1AWX A;  4PFP A;  4Y28 E;  1NYG A;  1OUL A;  3G6E Q;  2F69 A;  2M51 A;  1VQM T;  4LNP A;  2DTI A;  1Y96 B;  1I0C A;  1QQJ A;  4E7K A;  2RN8 A;  2CS7 A;  2LT4 A;  1H3H A;  1FMK A;  2J7I A;  3VS1 A;  1WXT A;  3VRY A;  3JB9 G;  4RG2 A;  1LCK A;  1VQ4 T;  4RMO A;  2H8H A;  4D6W A;  1C6V X;  3E19 A;  2L3P A;  4RG8 A; 
#chains in the Genus database with same CATH homology
 2R57 A;  1WQ7 A;  2XDD A;  2D0Q B;  2FHD A;  3QUI A;  4J6W A;  3V8L A;  5GAM h;  3L2R A;  2V8I A;  3JCM X;  1VUB A;  3G71 T;  1GXI E;  3M4Y A;  4M7A D;  1M1K C;  3I55 A;  1KC8 U;  3CCL A;  4CRI A;  2DZC A;  2RA2 A;  4JRQ A;  4M7D D;  3X20 B;  1Q82 C;  2QTX A;  4II1 A;  3X26 B;  2ZCF B;  2K5F A;  3HHT B;  4N0A A;  2GF7 A;  4MDX A;  3A5Z B;  2EAY A;  3QZ5 B;  4M7A A;  3VUB A;  4JUV A;  1H64 1;  3JCM Q;  3GLX A;  3RER A;  4M75 B;  2G3R A;  3JCM J;  4M7D A;  3C12 A;  5LJ3 f;  4A4E A;  3CC2 T;  3VYH B;  4C8Q D;  1TH7 A;  3L2U A;  3ME9 A;  3RES A;  3F70 A;  2OTL A;  1N9R A;  4Q5W A;  2K3X A;  4JRK A;  3H8Z A;  3EAE A;  5FU6 B;  3QJ6 A;  1M1G A;  1VQK A;  1AHJ B;  3G6E A;  4C8Q A;  4VUB A;  1YI2 T;  2XG8 D;  3FIF A;  4M75 E;  3RMQ A;  2ZPB B;  4ZGE B;  3CCE A;  2VUB A;  2Y4X A;  5GAN f;  3OS5 A;  1YHQ T;  5GMK j;  4EMG A;  4XTW A;  2IVW A;  3DB4 A;  4L6V 5;  2K2V A;  5CR2 A;  2EWN A;  3M59 A;  2E6N A;  2LVM A;  4TVR A;  4XU3 A;  1SSF A;  4ZN1 A;  5HK0 A;  4BY6 B;  4EPC A;  1M9S A;  2V8K A;  5I2M A;  3G4S T;  3NTH A;  4QVD A;  1BI0 A;  1PSF A;  2DIQ A;  3E9F A;  2LTO A;  3LH0 A;  4ME7 A;  4PJO D;  1UB4 A;  3JCM f;  3M53 A;  3H6Z A;  4JLI A;  1NZ9 A;  2DAQ A;  4M7A F;  3HKS A;  2LNV A;  2XDP A;  4J83 A;  5LJ3 g;  3MCA B;  3L42 A;  3CCJ A;  1M4Z A;  2CZ1 B;  1VQ7 A;  3PMT A;  4M75 A;  3QYH B;  5FU7 C;  1OZ2 A;  2DIG A;  3CXC A;  1Q7Y U;  4PJO A;  4A4G A;  2DO3 A;  1WPY A;  4OB2 B;  3SB2 A;  3L2V A;  4QVC A;  4UC4 A;  3JB9 D;  4C5I A;  1QVG S;  4HT8 A;  4M7A C;  2OTJ A;  2KAF A;  1YJW A;  4LD9 K;  3CCV T;  3OYY A;  3I56 T;  1VQ6 T;  2OAU A;  5GMK i;  2A7Y A;  5I21 A;  4GLK A;  4BD3 A;  5GAN g;  4C8Q F;  2Y4Y A;  2EQU A;  4O5V A;  1VQ9 T;  1YHQ A;  1G3Y A;  3VYG A;  1VQM A;  3BDU A;  2LRQ A;  4YTL A;  3CC7 A;  3HRT A;  4ZGD B;  5KCH A;  2MWO A;  3GNF B;  4C92 G;  3RKW A;  1VQ8 T;  3DLL A;  2QEX A;  1VIF A;  2C06 A;  4LD6 A;  3CCS T;  1VQO A;  3V8K A;  3GF5 A;  1VQ4 A;  1FX7 A;  2EYQ A;  2PVD B;  4B9W A;  4NS5 A;  5LJ5 e;  5GAO p;  3TU4 K;  4DOV A;  4E7L A;  3P8B B;  1OZ3 A;  2X4X A;  2HBP A;  3HRU A;  1KQ1 A;  4KUL A;  2LQK A;  3OYM A;  1Q81 U;  2JTM A;  2DKG A;  2DD5 A;  1X75 C;  1BIB A;  3OMC A;  3VV0 A;  3NTK A;  5M9O A;  5GAM g;  4E7I A;  4N4H A;  5GAN 7;  3G71 A;  3O8V A;  1KD1 C;  2E1H A;  2ZZD A;  4M75 F;  5HK3 A;  2JNG A;  4J8O A;  3TEE A;  3UDC A;  3QBY A;  3FB9 A;  4PJO F;  2YLC A;  2WSC E;  4M7A B;  3QXE B;  2XHC A;  2XID A;  2RJC A;  3CPF A;  3DLM A;  3LYI A;  3HSB A;  3QHS A;  2DD4 A;  2KVQ G;  2PU9 B;  3JSC A;  4FU6 A;  3TCJ A;  4M7D B;  2E64 A;  3OYL A;  3LX7 A;  3INZ A;  1VQL T;  1N8R U;  3GIB A;  3UT1 A;  1K8A U;  4ZGJ B;  1M90 U;  5LJ3 e;  4M75 C;  2ZPE B;  2KDS A;  3OY9 A;  5LJ3 j;  3M4G A;  3RKX A;  3J7A F;  4JDS A;  2PUK B;  3RIR A;  3JB9 H;  1KC8 C;  1FXX A;  3QPH A;  4ZN3 A;  4PJO C;  4E47 A;  3CMA T;  5KE2 A;  1KHI A;  2K4Y A;  3QO3 A;  4KBM B;  4C0G A;  1U1S A;  2PVG B;  3KUF A;  2RHI A;  4OB0 B;  1VQN T;  4XQ3 A;  3C94 A;  3RMS A;  2P0Q A;  3A8H B;  3PMI A;  1PSE A;  4M77 G;  4C8Q B;  2QQA A;  4M7D E;  3OW2 A;  3CBP A;  2CZ7 B;  3MP1 A;  4E7J A;  3VUZ A;  3JCM V;  4C0F A;  3X24 B;  5GAN j;  3PTA A;  1NJI U;  5AYF A;  3L2Z A;  3L2Q A;  1IZ6 A;  2LCC A;  4MZM A;  1NPR A;  4EMK A;  2HNI A;  5KH6 A;  3LGF A;  3FC3 A;  4N4I A;  2D9T A;  2DTO A;  2FL7 A;  3HFN A;  3M58 A;  4J5Y A;  5HKC A;  2FB7 A;  4C5E A;  2V8J A;  4JS4 A;  3BW1 A;  4GY5 A;  5J26 A;  3OBY A;  3VU3 C;  2JUF A;  4A4H A;  4BY6 C;  4C8Q E;  4MZP A;  3DKM A;  3G4S A;  3JCM e;  2B8A A;  4XTX A;  2D6F A;  2L3R A;  5LL6 S;  3CME T;  4XK8 E;  3KBG A;  4N4G A;  4LDV A;  3UWN A;  2M16 A;  2O01 E;  2DPP B;  1I8F A;  1NE8 A;  4IUU A;  1V29 B;  5LJ5 d;  3CCR T;  4F7U E;  1I81 A;  1K9M C;  3FLG A;  3ZEH A;  5GAM j;  4PJO B;  4Y91 A;  4IUR A;  3LWH A;  1HXD A;  4FT2 A;  2CZ6 B;  4BI3 A;  4C92 D;  3JB9 I;  1UGR B;  5EG2 A;  3MEV A;  3OS1 A;  2EFI A;  5GAN 4;  2EQJ A;  1BI3 A;  1OI1 A;  1N6A A;  2EIF A;  4OVA A;  4M78 G;  2CYZ B;  1VQP T;  1EIF A;  3A8O B;  3WXM B;  4BUG A;  4KUD K;  3A8G B;  1QP3 A;  2HD0 A;  4XAX B;  1WJQ A;  1FWZ A;  3CCV A;  3I56 A;  5J3B A;  4C92 A;  3OS0 A;  1VQ6 A;  1W2B S;  4NOY A;  1UGS B;  2LT1 A;  1VQ5 T;  1VQ9 A;  4HCC A;  5KCO A;  5GMK e;  1P92 A;  2P0P A;  2E65 A;  3SFM A;  2EQM A;  3OYG A;  3QG1 A;  1B34 A;  3J80 E;  4PJO E;  1Q7Y C;  2RJF A;  5LJ3 d;  4F7U A;  5CKE A;  1QVF S;  1BYM A;  3GP8 A;  1LNX A;  3OSS C;  1WGS A;  3PFS A;  4DOW A;  1VQ8 A;  4BE0 A;  2K3Y A;  2PVO B;  3ASK A;  3SDZ A;  3X28 B;  2RI5 A;  3Q1J A;  2M0O A;  2RD1 A;  2RI2 A;  5GAO q;  3CCS A;  3MO8 A;  1HK9 A;  2DZ9 A;  3NTI A;  2QA4 T;  3JCM P;  3CPW A;  2KY9 A;  1BIA A;  3SWN A;  2BIV A;  3PT9 A;  5GAN 5;  1U8R A;  2VV5 A;  4EMK C;  5CQX A;  2VGN A;  2EJ9 A;  2QQR A;  3PGG A;  4M7D F;  1XQH A;  4NL3 A;  3HFO A;  3HPW A;  5GAM f;  2QQB A;  1QP2 A;  4L5G A;  4R55 A;  3LGL A;  1NPP A;  3CCM A;  2E12 A;  3QJY A;  4IUV A;  4OGE A;  4BE1 A;  1YBY A;  3CCL T;  5C0M A;  4N0A C;  4WF2 A;  2ZPF B;  4MMK A;  4QQG A;  1M5Q 1;  1XOV A;  4RCC A;  3V7R A;  3G7Z A;  5KE3 A;  3OS2 A;  3GOX A;  4M77 D;  2K5I A;  2KK4 A;  1BKB A;  3LWI A;  2X4Y A;  4XTY A;  1WQW A;  3OYC A;  5IAY A;  4M7D C;  3LLR A;  2LDM A;  4HKE A;  3V8J A;  3JCM c;  2WAC A;  5CAI A;  3JCM d;  2O4X A;  1Q81 C;  1VQL A;  5CQY A;  4XTV A;  1JJ2 A;  1YIT T;  1RI0 A;  1XTD A;  4O6J A;  4C92 F;  5D6X A;  2MWP A;  3RUX A;  3PIO A;  4M77 A;  4BDY A;  1JB0 E;  2EJG A;  1BI2 A;  3OB9 A;  2QQ9 A;  1QVP A;  4J7I A;  4MZT A;  3OA6 A;  2JN0 A;  1O9S A;  3CMA A;  1YJN T;  2M9U A;  4LDX A;  4BE2 A;  4FM4 B;  4F7U F;  2X35 A;  2RI3 A;  1VQN A;  1MGQ A;  3HL8 A;  4C8Q C;  3OYD A;  3MET A;  2EQK A;  1Y07 A;  3V7C A;  4J6X A;  4HCB A;  3VKI A;  3C4S A;  1VQK T;  1OYX A;  1M8V A;  2R58 A;  4OGC A;  2MF2 A;  3G6E T;  1IRE B;  5LJ5 h;  5GAN 3;  4PNO A;  4JS5 A;  5CVI A;  4EMK B;  1K8A C;  1M90 C;  2GFA A;  3CEY A;  4M78 E;  3CCQ T;  4IKF A;  2DJZ A;  5LJ5 f;  1KQ2 A;  3L1A A;  1LOJ A;  1Y7X A;  3MHX A;  4JRP A;  4RKU E;  1Q86 U;  3MP8 A;  3OYJ A;  2E41 A;  3M57 A;  3N5B B;  4J6Y A;  2WSF E;  4J7F A;  4E7H A;  2FYK A;  4ELY C;  1K73 U;  2AHJ B;  4PKC C;  4M78 D;  4LDU A;  3CXC S;  3VJP A;  5FRM A;  3M5A A;  3CME A;  4BI8 B;  3CCU T;  3OSV A;  4JLG A;  2RHZ A;  1YIJ T;  4PLI A;  1ZBX A;  5IN1 A;  3P8D A;  1S72 T;  3OYI A;  2JVV A;  4DQ2 A;  4M78 A;  5CKH A;  3CC2 A;  2DEQ A;  1O75 A;  3JB9 F;  1N9S A;  4X9D A;  3A8L B;  1VIE A;  3MP6 A;  4M77 F;  2ZPI B;  3EFS A;  3T9N A;  2QDY B;  3BDL A;  4A53 A;  1JBM A;  3LW5 E;  1VQP A;  4M75 G;  1WNL A;  2CZ0 B;  3P8H A;  4C92 B;  1KG1 A;  1G3S A;  5CIU A;  3RKY A;  2HAX A;  3CD6 T;  5GAN e;  2X4J A;  2ZPG B;  4OB3 B;  4C0D C;  2F5T X;  3MEA A;  5CO7 A;  1YI2 A;  1B34 B;  1YJ9 T;  2XU8 A;  4F7U B;  2YHT A;  3TRE A;  4DA4 A;  2R5M A;  5A0G A;  1VQ5 A;  4XU2 A;  4OMF B;  2E6Z A;  2QQS A;  5I2S A;  1JRI A;  4L59 A;  4MDW A;  4OF1 A;  2CKK A;  1ZHI A;  3WVD B;  2LC4 A;  2YRV A;  2H3J A;  4R56 A;  3BY7 A;  1VQO T;  2BKD N;  2DK3 A;  3SWN B;  3V7S A;  4C92 E;  1W2B A;  2YLB A;  3CC4 T;  2RHY A;  1DJ7 B;  3GPL A;  5GAN 2;  4BDZ A;  3JCM h;  1X6O A;  2RJD A;  5GAN 8;  4JJN K;  2HQX A;  4BB7 A;  3S3O A;  5CCA A;  3ER0 A;  2XDB A;  1RL2 A;  3QDR B;  4KT0 E;  2DXC A;  5GAN 6;  3FRN A;  3UPU A;  4MML A;  2LQ8 A;  5FRN A;  5GAM e;  4ATO A;  4B9X A;  3E9G A;  2CGH A;  4NL2 A;  3OYK A;  2WSE E;  3JB9 J;  4M78 F;  3OYE A;  1KQS S;  3JRZ A;  2A3L A;  3E1S A;  2GCX A;  1D3B A;  1XNI A;  3MEU A;  4V2S A;  5GAO n;  3M55 A;  1N27 A;  2L5Q A;  2P4T A;  2O4X B;  4FT4 A;  3WVE B;  4C0D B;  4LDY A;  3OYB A;  2Y90 A;  4M77 B;  2DXB A;  2FVU A;  4M78 C;  4X34 A;  5GAO m;  1YIT A;  5GMK l;  3OW2 S;  5GMK h;  3JCM W;  3R6O A;  1G3T A;  1YJN A;  1QVG A;  2KMT A;  1Y96 A;  4X9C A;  1ZQ1 A;  1QW1 A;  5FLX E;  1M1K U;  1BI1 A;  3M9Q A;  4FL6 A;  2HQE A;  5HY6 A;  3EFR A;  2LX9 A;  5A0D A;  2RK1 A;  1Q82 U;  2BUD A;  2PQW A;  1H3Z A;  3OYA A;  3L2W A;  3AHU A;  5LJ5 g;  4A4F A;  2MAM A;  2VXF A;  4M77 E;  5CKB A;  5A0L A;  4CI0 C;  3CCQ A;  4Z02 A;  5GAN d;  5DLO A;  4KUI A;  1I4K 1;  2XI9 A;  3JCM b;  2MMP A;  5D6W A;  1K9M U;  3CBO A;  3GNG A;  4PLL A;  3I55 T;  3KXT A;  5GAO r;  4QVZ A;  1LJO A;  2VGM A;  2DXU A;  3C95 A;  3J81 E;  4C5H A;  4QQD A;  3OYH A;  2MI6 A;  4M75 D;  3M54 A;  1UGQ B;  2XKO C;  3BFM A;  5FRO A;  2RK2 A;  3CCU A;  3OBW A;  5GAO l;  4HA8 A;  4JRI A;  4M78 B;  4IUT A;  4QQ6 A;  5IT9 E;  1WJS A;  1YIJ A;  3OYN A;  3QZ9 B;  1KHC A;  1S72 A;  4HCZ A;  2IG0 A;  1UGP B;  1U1T A;  2DXT A;  2RJE A;  2VYT A;  1Q86 C;  5GAM d;  4M7A G;  1R8O B;  3MEW A;  2JTF A;  2JOY A;  1K73 C;  2ZGW A;  4M7D G;  4P5N A;  3X25 B;  2VC8 A;  2OTL T;  5L8R E;  3QYG B;  2KQW A;  4XTU A;  2K57 A;  4C92 C;  1N8R C;  2E5Q A;  4IUP A;  5C6S A;  5DM7 R;  3CD6 A;  2RHX A;  4A4K A;  3CCE T;  4ELZ C;  1MHN A;  1G5V A;  1YJ9 A;  1W4S A;  3FJP A;  4IUQ A;  2X4W A;  4QW2 A;  2E70 A;  3CPW S;  4HT9 A;  3SD4 A;  4XTZ A;  4C8Q G;  2RO0 A;  3PIP A;  3PNW C;  2EKO A;  2ZPH B;  3HP9 A;  3QSU A;  2RH2 A;  1UEB A;  2E10 A;  5CKF A;  3SWN C;  2K5L A;  4OP0 A;  2QXF A;  4A54 A;  4F7U G;  2DVE A;  3CC4 A;  4C5G A;  3S6W A;  3ZBD A;  5A2Q E;  1NJI C;  3JCM g;  3ZFJ A;  2R5A A;  2VXE A;  3HRS A;  4EMH A;  5LJ5 j;  4FIB A;  5DY9 A;  3CCR A;  4OB1 B;  5LJ3 h;  4PL6 A;  3CCJ T;  1VQ7 T;  2XD0 A;  4XU1 A;  2LCL A;  2DTH A;  1M1F A;  3CBM A;  4LDW A;  5FU7 B;  3URG A;  3S3M A;  1D3B B;  2GQV A;  3CCM T;  3OQ5 A;  4FSX A;  3QKJ A;  5J39 A;  1JJ2 S;  4BI4 A;  1WJR A;  3JAM E;  2EJF A;  5DLQ E;  2RHU A;  3NFC A;  2QEX T;  1I5L A;  1Y71 A;  4ZTJ A;  3FDR A;  4XU0 A;  5CKD A;  5D6Y A;  4BAC A;  1YJW T;  2OTJ T;  3M56 A;  4PJO G;  4Y28 E;  2JZ2 A;  4C0Z A;  1G3W A;  2M1H A;  3DB3 A;  5GAN h;  2F69 A;  2L89 A;  4M77 C;  4ZTF A;  1VQM T;  1KQS A;  3CC7 T;  2RM4 A;  2DTI A;  1YCY A;  2GFU A;  1Y96 B;  5GMK m;  3S3N A;  3OMG A;  2RB6 A;  3FEO A;  4E7K A;  2L8D A;  4RCB A;  2CS7 A;  2LT4 A;  3OYF A;  1KD1 U;  5CK9 A;  3JB9 G;  2NLU A;  2PUO B;  4RG2 A;  2QA4 A;  4M7A E;  3QII A;  2XIC A;  2XK0 A;  4RMO A;  1VQ4 T;  2QI2 A;  5FU6 C;  2P0K A;  4D6W A;  3A8M B;  2KSS A;  3E19 A;  1X01 A;  1QVF A;  2F5K A;  4RG8 A;  4EDU A;  2I2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...