1IGQA

C-terminal domain of transcriptional repressor protein korb
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
KKAIVQVEHDERPARLILNRRPPAEGYAWLKYEDDGQEFEANLADVKLVALIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcriptional repressor protein KorB
publication title An Src homology 3-like domain is responsible for dimerization of the repressor protein KorB encoded by the promiscuous IncP plasmid RP4.
pubmed doi rcsb
source organism Escherichia coli
total genus 9
structure length 54
sequence length 54
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06613 KorB_C KorB C-terminal beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.150 Mainly Beta Roll SH3 type barrels. KorB, C-terminal domain 1igqA00
1IGQA 1IGUA
chains in the Genus database with same CATH superfamily
4M77F 3CCJT 2A08A 1QP3A 2MOXA 4MZTA 3QIIA 2X51A 1YITQ 1VQNT 1PKSA 1WNLA 2L0AA 2RI5A 1D1BA 1M27C 2BZYA 5D6YA 1MMGA 1KC8C 1IB8A 4OB3B 5DY9A 3MCAB 3OQ5A 5LJ5f 4A53A 1UHFA 4M78E 4GLMA 1WX6A 6AT1B 2VV5A 4C5GA 1YIJT 2JMAA 2DL3A 3CCQT 1VQ8T 3CMAT 4IIMA 1TS9A 1AZGB 3KBGA 2EQIA 1BU1A 1VQPT 1R0BG 4E7IA 2ED1A 2DL5A 3CPFA 5LJ3h 2QEXA 3CCMA 2CT4A 1QKWA 5HCKA 1XJWB 4Y28E 3NMZC 1T3SA 1QW1A 5DLOA 3OBYA 2EYQA 3L2RA 3RBBB 2OJ2A 2DTOA 4AMCA 2KGTA 1NPPA 3LGLA 3NTKA 4EMGA 2OTJT 1T0HA 2YHTA 4JRIA 4M7AD 1U1SA 4JDSA 3CCMQ 4F7UB 1YNZA 1X43A 2FPDA 3AT1B 2VGMA 1PD1A 2D9TA 5FRMA 4MZMA 2HL3A 4OMOA 1N27A 1NJIR 2E5QA 3MO8A 2GQVA 3PE0A 4OGEA 4C8QG 4JRQA 4FSXA 2VASA 2YWWA 4CC7A 2LNHB 4C92D 3LGFA 4QQ6A 5HKCA 4M77E 1OEBA 4OMQA 2JM8A 4WTOB 3UATA 1YFNA 4C0ZA 3H0IA 4FT4A 3M59A 4LNPA 3CD6T 3G1JA 3OYEA 4R56A 3OS2A 1NLPC 5GMKi 2HDAA 2H8HA 2YDLA 2COYA 3VUBA 2RHUA 2W0ZA 2RH2A 3IQLA 1M2VB 4WF2A 2Z0WA 4J9IA 5CO7A 2QQRA 4XTZA 3TQ7P 1WHJA 4J9EA 4MDWA 4M7AG 2KK4A 2V8KA 2G6FX 2DILA 5KYXB 3QPHA 3H41A 1OPLA 2FEIA 4BACA 3I35A 4LUEA 1V29B 1TUGB 2RD1A 1B34B 2DBMA 4J83A 3QWYA 1EZZB 4VUBA 5LJ5e 1QVGP 3GNFB 1SRLA 2DXUA 4M7AF 1SSHA 3CCRA 1KD1R 4Z02A 1WGSA 1VQKT 3EG9B 1BIBA 3ZL7C 1RLQC 1VQ4Q 1XNIA 1ARKA 5I2SA 2IIMA 1YBYA 3QZ9B 4AFZC 1X01A 2NUZA 2HAXA 2QG9B 1K9MR 3CXCA 3DB4A 1KFZA 2CP0A 3C95A 4BI4A 2DVJA 5GANf 4J7IA 1I5OB 1K76A 4C92F 1TXQA 4OF1A 1QCOA 4PJOC 4B9XA 1FX7A 1M2VA 4KT0E 1K1ZA 5CCAA 5EC7A 2COWA 4PJOB 9ATCB 1NEGA 1UECA 2LQNA 1UJYA 3VS2A 1ZUUA 5AT1B 4EMKB 2JM9A 3RNJA 2YUOA 3FRNA 4JRPA 4QQDA 2HKQB 2JTEA 4MDXA 1TUCA 3L2WA 2LQKA 4PKCC 2L3QA 2DETA 2RK2A 2VXFA 2BKDN 4BD3A 1T0JA 2HNIA 2JZ2A 3QG1A 4E7SA 1IZ6A 1W2BS 1X27A 1ABOA 3G71T 3EG9A 4GBQA 1NYGA 1VQ5Q 3OYCA 5HK3A 4KGVB 1GXIE 5I11A 3OYHA 1H3ZA 3ZFJA 1KD1U 2V8JA 2HQHA 2MYSA 3JV3A 3OBWA 4PL6A 3ULRB 1WXBA 1YJWT 2MPXC 4E7ZA 3HFOA 2QQAA 1D1AA 5GAOm 3BFMA 1H3HA 3CC2A 1M30A 3CCUT 2PTKA 4RCCA 1K9MU 5CR2A 1JBMA 3H0FA 2HCKA 2PVGB 4M7AE 1M1KU 4PJOA 1ACMB 1AWWA 5IN1A 2QTVA 3VYGA 3N5BB 1UHCA 1D1CA 3LWIA 4LE9A 4E47A 3LLRA 1G8XA 2DPPB 4X1VA 4JPBW 1GBQA 1WJSA 1Q7YC 3CMEQ 2NUPB 3V8KA 2K9GA 5A0GA 5LJ3f 1VQMA 2DTIA 3JCMb 1M4ZA 4LN2A 3DLMA 2E65A 4J6WA 3E2UA 4XU2A 4O6JA 1LVKA 1HYOA 4C92E 4ZGEB 2VKNA 4OB1B 1D3BB 5LJ5g 4RKUE 3GIBA 4OVAA 5LJ5d 2GQIA 3QJ6A 1VQMQ 1YCYA 1IGQA 1JXMA 2O9SA 1BBZA 4XTVA 1IRXA 2HMAA 1SF9A 2DL4A 1OX9A 3JCMX 4N4HA 1Y7XA 5A2QE 1KK7A 1QKXA 1H641 3X26B 2RJCA 2MF2A 4N0AC 1N9RA 5GANe 4C8QC 2K5LA 4LXCA 5GAN5 3A8HB 1R8OB 2JOYA 4NL3A 4C8QB 2O4XB 4ZGDB 4OMMA 1LOJA 3CCLQ 3I55A 3CCJQ 4OMNA 2NUPA 1KJWA 5GAMh 1VQLT 4QVCA 1BI1A 2ATCB 1WDXA 2M16A 1VQNQ 1VQ7A 3G4SA 2KR3A 1KQ2A 2DTHA 1Q81R 5LJ5j 1HSQA 3JAME 4F7UF 3HRUA 5D7UA 1NPRA 2KY9A 1VQPA 4XTYA 2QASA 4EMHA 3CCVT 2RQWA 2B86A 2XICA 1VQ9A 3OYNA 1D3BA 4IIOA 3FB9A 4PK4A 2DA9A 1JJ2S 4OGCA 1E6GA 4DBHA 1VYVA 5KE2A 4EPCA 2CP6A 1JU5C 3G4SQ 4V2SA 4M7AC 1VQ8Q 2RB6A 2EQJA 2HEQA 3QSUA 4X9CA 1I81A 1VQPQ 4HKEA 2CT3A 1RADB 1U3OA 1VQ9Q 1OI1A 1LJOA 3REAB 3GOXA 4J7FA 1IREB 2EYZA 2X3WD 2C0IA 4PJOD 1Q82R 1PWTA 4FIBA 1BCOA 3SEMA 2VVKA 3JCMc 3BE3A 4N0AA 1KHCA 1WA7A 3CCST 2WACA 2EQUA 3M0QA 4C8QA 2O4XA 3RUXA 5AYFA 4R55A 1SEMA 3CC7A 3M0RA 4XTWA 2OTLT 2OTJQ 2KRNA 3META 3MP8A 2DYIA 4LD6A 4BDYA 2BZ8A 2QA4T 2FRWA 4BE2A 3QZ5B 5LJ3e 2CUBA 4QW2A 2QAZA 1OV3A 2X35A 1Z9ZA 2LC4A 2X4JA 5C0MA 2FRYA 4PJLA 3CD6A 1YWPA 1PD0A 1Q81U 1OULA 2AIRB 4NOYA 3M58A 2LJ1A 1IXDA 1KHIA 2MIOA 2JTMA 1AD5A 2CDTA 3GP8A 1W2BA 2V8IA 2ZPFB 3JCMd 3G6ET 3MPUB 3V7RA 4B9WA 4M7AA 2GF7A 1N8RR 1YHQA 2EW3A 2QQBA 3CD6Q 2EYWA 2W10A 3EG3A 3A8GB 1C6VX 5GANh 3QO3A 1YJNT 3RKXA 4F7UE 4E7KA 3EGUA 3GNGA 3GBQA 1WFWA 3LYIA 3UA7A 2BIVA 2RPNA 3I56T 5GANg 1D0YA 2RNAA 2CP3A 3NTHA 1Q82U 2VWFA 2V1QA 4GY5A 1X6BA 1TTHB 5GAOr 1N9SA 3THKA 5FWCA 3CQTA 2KI7A 4RCBA 3PMIA 4C0DC 1TUDA 2RQVA 4ESRA 2HBPA 4PJOF 1OPKA 5FU7C 1U5SA 5CKFA 1YITA 4CRIA 4MMKA 2DO3A 3VKIA 3CCET 1QVPA 4BE1A 1EFNA 1PKTA 2KYBA 2EBPA 4N4IA 3VYHB 2LCSA 2RM4A 3OSSC 3ER0A 1OOTA 1G5VA 2AKKA 1ZA1B 4TVRA 2PNIA 3S6WA 2KDSA 5LL6S 2KT8A 3G7ZA 2A28A 1S72T 4JS4A 1VQKQ 3NGPA 2R57A 3Q1JA 5GAOl 1VIFA 2XDBA 4QVZA 3CC4A 2J6FA 2P4TA 4YTLA 4JJNK 5GANj 1OYXA 4RG8A 2EQMA 5EG2A 2QGFB 4C8QD 4LDYA 3OW2S 3RESA 1N8RU 4LDVA 3OYIA 5KCHA 3FDRA 1UGPB 1QVFS 1QCFA 3OYLA 1NZ9A 3EG2A 4MZPA 3A8OB 4RUGA 3CC4Q 4HVWA 4BUGA 2AKLA 1OU8A 2J6KA 4L5GA 1HK9A 5GAN7 3LH0A 1IHVA 4PJMA 1AT1B 4HT8A 1K8AU 1R0CB 2K5IA 1WI7A 1U8RA 5GMKe 5LJ3g 3RMSA 3SHWA 1V76A 5LJ3d 1G2BA 4JS5A 2FHDA 2ZPGB 2CUDA 2RN8A 3OYBA 2QQ9A 5D6WA 4DOWA 4ZNXA 3JCMJ 2XK0A 4LUDA 4AFUC 2CREA 2EGCA 2HBWA 2E4HA 3E1SA 5GAMf 1JJ2A 1RAHB 1VQOT 4BB7A 3ZBDA 1M90R 4PJOE 4Z8AA 3OYFA 2CZ1B 2M9UA 3FJPA 2F1LA 2GCXA 2JUFA 2LP5A 3V8JA 4KULA 1YJWQ 4BI8B 2KRMA 1Y07A 2P4RA 4M75G 1YI2A 2LTOA 3P8DA 3KXTA 2C06A 2LJ3A 1M9SA 2KSSA 3CCUQ 3EHQA 1M2OA 2NLUA 3QBYA 3FEOA 3WXMB 3E9FA 1AOJA 4A63B 2K7AA 5KYNA 3BY7A 4J9BA 1UG1A 4PNOA 3E19A 1I0CA 5LJ3j 1EX4A 2C0TA 1BK2A 1UGVA 1FYNA 2YSQA 4C8QF 1W2BP 2CS7A 2EJ9A 1N5ZA 3A8MB 1YI2Q 1HD3A 5CQXA 4D8KA 1AVZC 1X2KA 1GCQC 2I0NA 4LDXA 1BB9A 1Y57A 5CKHA 4FT2A 1RAAB 1TOVA 4N4GA 2M0YA 4J9DA 3JB9J 5GAN8 4ZN3A 3JB9I 3F70A 2O31A 4F7UA 2COZA 3PVLA 5IHIA 3L1AA 1Y96B 1O75A 2ABLA 2DD4A 3OS0A 3HKSA 2DFUA 3ASKA 5FRNA 2KYMA 3EH2A 3M5AA 2DK3A 1VQ4A 3QHSA 3HPWA 1G3YA 4KUIA 5CQYA 2DBKA 2KEAA 5CVIA 3RKYA 3PGGA 4Y91A 5GAOn 1Y0MA 4BY6B 3JRZA 1M90U 4DBFA 2L8DA 4IUVA 4UC4A 2DE0X 2OI3A 2DXTA 2K79A 1I07A 1NJIU 2LNVA 4K11A 2FVUA 4OP0A 2LJ0A 2YRVA 4RTZA 1WIEA 2QQSA 2M0OA 4FW1A 4P5NA 5KE3A 4L6V5 4EDUA 4PLIA 3V7SA 2P0QA 3R6NA 2PU9B 1CKAA 1VQLQ 5KH6A 1VOMA 5GMKh 4OB2B 2EAYA 2CZ0B 3UDCA 3C94A 3M0UA 2A7YA 2CH4A 2ENMA 2KXDA 3U23A 1OQKA 2F69A 4PJJA 4Q5WA 3H0HA 4HA8A 2P84A 2F5KA 3LW5E 2LDMA 3CCVQ 1GCQA 2EIFA 4EMKC 5GJVB 5CKDA 2EFIA 2G3RA 1M3BA 1Y96A 3JCMQ 4IUQA 1MUZA 1QWEA 3MJXA 3GLXA 1VQ5A 5KYXA 5FU6B 5GAMe 4A4FA 4DA4A 5GMKm 2B8AA 4C8QE 1MNEA 1B34A 3JSCA 3WVEB 4Y92A 3PTAA 2HZYA 3AHUA 8AT1B 1XTDA 2L3PA 1KD1C 4KBMB 1YJ9A 2QA4A 3REBB 3A5ZB 1ZLMA 2ZPEB 2NUTB 1Q7YR 5J26A 2DZ9A 2IPOB 1K0SA 1DJ7B 2R5MA 3OW2A 2VXEA 2BZXA 1D09B 3EFSA 2X4XA 2H3JA 1QVFA 3M55A 3MKDA 2YUPA 2X3XD 3QYGB 3QWXX 3L2UA 1K9MC 1BI2A 1GFDA 2PQWA 3PVQA 5GMKj 1M1KC 1VA7A 2E1HA 2DEUA 3CMEA 2RHZA 1JJ2P 1YJ9Q 2QEXT 3CCMT 1YWOA 4FM4B 2QA4Q 2ED0A 2A0FB 2GGRA 4F14A 1G3TA 5I2MA 2EWNA 1I1JA 1I8FA 3EG1A 3J81E 1M8MA 3FIFA 4RTXA 3V8LA 2LCLA 4L59A 2BUDA 3L2VA 1FMVA 5L8RE 1WZOA 3I5SA 4JJCA 1HJDA 1LPLA 4XK8E 4C0GA 3L2QA 3A8LB 1RACB 4FL6A 4EMKA 3D7SB 1GRIA 2K5FA 3I56A 3RDVA 5IH2A 3VUZA 3G6EQ 3X25B 3INZA 4LD9K 2K6DA 2HD0A 3X24B 1K73R 1YJNQ 1RLPC 2NUTA 4RTWA 3UT1A 2KQWA 1X75C 3I56Q 1QP2A 2YT6A 2DXCA 2X4WA 2FZKB 4DOVA 3PIPA 1Q86R 2DIGA 2DYBA 2DJQA 1G3WA 3OMGA 2XHCA 2HQXA 3SWNC 1MV0B 1IO6A 3CCLA 2P0PA 4QT7A 3CCJA 2KXCA 1UGSB 2FG0A 3CEYA 3SWNB 4PFOA 3CPWS 1VQNA 3EFOB 2RHYA 1QMCA 2DIQA 1PC0A 2FZGB 1RAFB 3PFSA 4M75C 4FU6A 2DL8A 3EFRA 3VU3C 2R5AA 3I9QA 2MCNA 2D8JA 2LT1A 2NYSA 4R0KA 5J39A 1QQJA 3M57A 1ZQ1A 4M75B 2RHXA 1WJRA 1PG5B 2Y4XA 1SHGA 3GPLA 2M51A 3MEVA 3EGDB 4ZGJB 5L23A 1YIJA 3SFMA 4X9DA 3CCQA 1VQ8A 3CMAA 2X9HA 3C4SA 2D0QB 4M4ZA 5GAMg 1RI0A 4JLIA 5GAMd 2J06A 2WSEE 3OYYA 2YRCA 4J9GA 2QI2A 5FROA 4XAXB 3M0TA 2E70A 4X34A 3LX7A 4A4EA 4RMOA 3CCRT 4LDUA 4HT9A 2ZPBB 1MNDA 3JB9D 1YIJQ 3WVDB 1K73U 2ZPIB 1BYMA 3CCQQ 3CMAQ 4M7DG 1VYUA 1ZUKA 2F2XA 2MI6A 1UFFA 1H8KA 4C5EA 4E7LA 1MMDA 2OTJA 3RR6A 3PMTA 3SWNA 1Q86U 3EFOA 3S3MA 4KGZB 3DB3A 1PSEA 4F04B 1NM7A 2RO0A 1JO8A 1TG0A 4FCYA 1WHLA 3ZEHA 4PJNA 5CKEA 5GAN2 3M56A 4M75A 2QXFA 4J9CA 1U06A 5GAMj 1HXDA 3OYJA 4JLGA 3EGDA 3OW2P 2KBTA 3QJYA 1Q81C 2EYYA 5J3BA 4AG2C 1M1GA 4RG2A 1P92A 1QVFP 4M78G 2Y90A 1VQOQ 4XQ3A 2M1HA 2MWOA 4LDWA 4ELZC 1KQ1A 3TREA 2E12A 3VRZA 1X2QA 1PM3A 2GTJA 1F1BB 1BKBA 3PT9A 2DRKA 3EGXB 3VJPA 1RUWA 3MHXA 3JB9G 2E6NA 2EKHA 3SD4A 5KYWB 3I5RA 1C1AA 1EIFA 1YCSB 2CP2A 7AT1B 4IUPA 1LNXA 2CH4W 2RI2A 2YUNA 4GLKA 4J6YA 2XD0A 1Q82C 2LT4A 2JN0A 2QYZA 3NHNA 4B6MA 4NL2A 4ORZA 3OYKA 3HHTB 2L89A 2JT4A 2OX7A 2XMFA 3CC2T 3JB9F 3C0CA 4JUVA 4XU1A 1W70A 5A0DA 5GANd 1QCNA 1AWJA 3OYDA 5GMKl 1YN8A 2JTFA 4HCZA 2DERA 1FMKA 4BDZA 2KRSA 1KC8R 5D6XA 2RMOA 5HK0A 2ROTA 1VQKA 2RJDA 2MAMA 1WYXA 4JZ4A 2AK5A 4EIKA 3L42A 2I2LA 4FW2A 1VQ6T 1W4SA 3TEEA 4M77G 3GF5A 5FW9A 3BDUA 2JJ9A 5I22A 4PFPA 1MMNA 3TSZA 3EGXA 3HL8A 4E2FB 1Z9QA 4RTYA 3QYHB 5IXFA 1ZBJA 2SEMA 1M5Q1 1ZBXA 1G83A 3JCMV 5CIUA 1WQ7A 2EGEA 1FMWA 1RAEB 1CSKA 4M75D 5ECAA 1UGQB 4DEXA 2E41A 2GTOA 3CPWA 1K8AC 2E3HA 3HP9A 1M3CA 3S3NA 1I4K1 3CBMA 4BE0A 2LX9A 3LH5A 3I55T 1KG1A 5KCOA 3G71A 1OX8A 4CC3A 3TVTA 2E3IA 1VQ7T 3G4ST 2KVQG 1UUEA 3MEUA 1KC8U 5GAOq 5IAYA 2XI9A 2RQUA 1JQQA 4ZTFA 3QXEB 1YJWA 2ZGWA 1VQ9T 3VS4A 2DF6A 4E7HA 3H9NA 2DAQA 2FL7A 3V7CA 1RL2A 4HCKA 3UWNA 3G71Q 1KIKA 2Y4YA 3QDRB 4AFQC 3CCUA 2QDLA 4QKUA 1TH7A 1UB4A 1ABQA 4DQ2A 1W6XA 1C0MA 2KE9A 2XIDA 1X6OA 4E6RA 1PHTA 2XG8D 2QTXA 2CKKA 3DLLA 1JXOA 1AWOA 1RAIB 2QEXQ 2VGNA 1SSFA 2FPFA 2QK0A 1E6HA 2EJFA 1QLYA 4KH0B 5GJWB 2L3SA 1WPYA 1G3SA 2XDDA 2HQEA 2IG0A 1X6GA 3CC7T 2MWPA 4M7DC 1Y71A 3TSWA 4ANJA 2EKOA 1OZ2A 2EYXA 1O9SA 2M02A 3HFNA 3FLGA 4M75F 4M7DB 1M8VA 3OMCA 2EQKA 2F2WA 2O2OA 2PUOB 4XU0A 3VS0A 4JZ3A 4KUDK 4FYXB 4OMFB 2L3RA 1NLOC 2LVMA 2QGGA 2CSQA 4CI0C 4II1A 5HY6A 1AEYA 4XTUA 4KRTA 5I21A 2CGHA 2DL7A 1B07A 3OA6A 1M90C 2K4YA 4F16A 2DMOA 1NJIC 1SPKA 3KUFA 4BY6C 2IVWA 4M78C 1PRMC 5DM7R 1YHQT 2CP7A 2KAFA 2YRDA 3M0SA 1VQLA 4M78B 1RABB 4RTVA 2L2PA 1BIAA 2D8HA 1ZSZC 1FXXA 1TSFA 2HL5C 3MP6A 1ZSZB 2V1RA 4Z89A 2DM1A 3CCVA 1WHMA 2JXBA 2CSIA 1JRIA 2DVEA 2DXBA 3O5ZA 4J9FA 4A54A 3M54A 1M1FA 3VS1A 2OAUA 4C5IA 3VS7A 1UDLA 4C92G 3JCMf 1PRLC 2FO0A 4M7DA 3RERA 2FPEA 1YITT 2O88A 2EGAA 1KQSA 1IHWA 1GFCA 2C0OA 1AHJB 1K0XA 2XDPA 3ME9A 1VUBA 2PVDB 1ZA2B 3CBPA 4ME7A 4J9HA 2FZCB 3OYMA 5FU6C 3BDLA 3CPWP 2E64A 3VS3A 1PSFA 1M1KR 4HCCA 3CCRQ 1XQHA 2JS0A 2CZ6B 2PUKB 3M0PA 1SG5A 3VS6A 3CCSA 2XKOC 4OMLA 2BE9B 3CC4T 2OAWA 3NPFA 4M75E 2L5QA 1RAGB 2OTLA 1WLPB 1V1CA 1W1FA 4M78A 4QQGA 2ESWA 4E7JA 2A37A 3HSBA 1GBRA 2X4YA 4XU3A 3QUIA 1ZSGA 4M77C 2AZSA 3UF4A 5CAIA 2AT1B 2SRCA 3X28B 2E10A 4M77B 1ZSZA 4AG1C 3CCSQ 2A3LA 2DX1A 4AFSC 3HTRA 4FYWB 4ELYC 4Z88A 2OTLQ 4CC2A 3M4GA 2DEQA 2RJFA 4C0FA 2E5KA 2GNCA 4IUUA 2LRQA 3VV0A 3OY9A 4DBRA 1WXTA 2JNGA 1PCXA 1OU9A 3P8BB 1J3TA 1KSWA 2LCCA 4ZTJA 3H6ZA 3FC3A 3G6EA 2LZ6B 3C12A 1AZEA 1YJNA 5IT9E 1T3LA 1RI9A 5KYUB 1VIEA 2JS2A 1UE9A 2DNUA 3QDFA 2K3BA 2FB7A 3NFCA 1VYTA 3VRYA 1D0ZA 3OS5A 4FYVB 8ATCB 2BE7D 2RJEA 1QVGS 4XTXA 1WXUA 4FSSA 1YI2T 3A1PA 5CKBA 3CC2Q 5CK9A 3CCEA 2DJZA 2ROLA 2CYZB 1XOVA 4HXJA 4M77A 1NBEB 2GFAA 1VQ6A 4M7DD 5LJ5h 1Q7YU 1MV3A 4JJDA 1WHKA 1K4US 5IHKA 2J7IA 2A36A 3OB9A 1S72A 2F2VA 3UPUA 3OYAA 1GCPA 1WHGA 1BI3A 3E9GA 1N6AA 3JCMe 2VYTA 1BI0A 3CCEQ 1UTIA 3M53A 2DD5A 1VQ6Q 3SDZA 1MMAA 1WHHA 2VUBA 3UA6A 1ZUYA 2JW4A 3M4YA 5KYUA 3M9QA 5KYYB 4PLLA 4AT1B 2P0KA 1A0NB 1NE8A 1S72Q 1OZ3A 2ZCFB 3TU4K 4M78D 4F7UG 2D0NA 1VQ4T 1MHNA 2VB6A 4HCBA 5GAN6 1K73C 3OSVA 3O8VA 3VS5A 3JCMP 3OYGA 2K2VA 2K3XA 1KQSP 2GBQA 4WCIA 4RTUA 2RI3A 4RTTA 1Q86C 3FJ5A 4DBQA 4A4HA 1LCKA 4KGXB 1SHFA 2AHJB 3CXCP 2LX7A 4HVUA 4JJBA 1FWZA 3MEWA 2H3EB 2QDYB 1PNJA 1U1TA 1NEBA 3I55Q 2V26A 1BCMA 2WSFE 2LQ8A 3CBOA 3OS1A 4CC4B 1VQ7Q 1AWXA 1VQOA 5IXBA 2KNBB 2RHIA 1UGRB 1CKBA 4M7DF 2ZZDA 1NG2A 4M7AB 4J8OA 4C5HA 3LWHA 2HSPA 1B7TA 2MMPA 5KYYA 2VC8A 2AZVA 2EVRA 3KFVA 2LQWA 2NWMA 2O9VA 2RQRA 1ZX6A 1VQ5T 2KMTA 3RIRA 4NS5A 1UJ0A 5A0LA 4C92C 1D0XA 4OMPA 2YXYA 4BI3A 2D1XA 2BTTA 4QVDA 4M77D 1JEGA 4C92B 3URGA 5GAOp 1YJ9T 3MEAA 2YUQA 4HVVA 2WSCE 1SRMA 3L2ZA 2PVOB 2EJGA 4IUTA 4ATOA 2XU8A 3JCMW 4M78F 3RMQA 2J6OA 2HSEB 1IGUA 1WJQA 3R6OA 2HKNA 5FLXE 2RA2A 2CP5A 2F5TX 2EPDA 1ZHIA 3CC7Q 5GAN4 1S1NA 2K57A 3JCMh 3EH1A 1K9AA 3MP1A 2LMJA 3CMET 3QKJA 1UEBA 3S3OA 4D8DA 2ECZA 4D6WA 3PIOA 2MK5A 2DLPA 4DEYA 5M9OA 1I5LA 2DKGA 2K2MA 3P8HA 3JCMg 2ZAEA 3X20B 2PZ1A 2D6FA 1MGQA 2GFUA 3T9NA 2RQTA 3DKMA 4FYYB 1TU0B 3TCJA 1H92A 2RF0A 4J5YA 1Q95G 1QWFA 3EHRA 2O01E 3HRTA 4MMLA 3EAEA 4PJOG 2DRMA 2FYKA 2JMCA 1KQSS 4IURA 2J05A 3A98A 1WQWA 1M3AA 4KH1B 2JVVA 1VQMT 1JB0E 3J80E 2YLBA 1GL5A 4PFZA 1B3QA 4A4GA 1R77A 3BW1A 1X69A 1K8AR 3EG0A 2E6ZA 4ZN1A 5DLQE 3CXCS 1YP5A 2KROA 4OB0B 1YHQQ 4C92A 5GAN3 2KT1A 3J7AF 4O5VA 3PNWC 2ZPHB 4JRKA 2CZ7B 3SB2A 4M7DE 2R58A 2DZCA 5FWBA 2YLCA 3NTIA 4A4KA 4C0DB 3RKWA 1QVGA 4F17A 3HRSA 1TWBA 3JB9H 4J6XA 2RK1A 1E7OA 2K3YA 3H8ZA 5KYWA 5FU7B 1N8RC 5IHNA 5C6SA 1NYFA 4IKFA 1SKUB 3CCLT
chains in the Genus database with same CATH topology
1IGQA 1IGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IGQ A;  1IGU A; 
#chains in the Genus database with same CATH topology
 4M77 F;  3CCJ T;  2A08 A;  1QP3 A;  2MOX A;  4MZT A;  3QII A;  2X51 A;  1YIT Q;  1VQN T;  1PKS A;  1WNL A;  2L0A A;  2RI5 A;  1D1B A;  1M27 C;  2BZY A;  5D6Y A;  1MMG A;  1KC8 C;  1IB8 A;  4OB3 B;  5DY9 A;  3MCA B;  3OQ5 A;  5LJ5 f;  4A53 A;  1UHF A;  4M78 E;  4GLM A;  1WX6 A;  6AT1 B;  2VV5 A;  4C5G A;  1YIJ T;  2JMA A;  2DL3 A;  3CCQ T;  1VQ8 T;  3CMA T;  4IIM A;  1TS9 A;  1AZG B;  3KBG A;  2EQI A;  1BU1 A;  1VQP T;  1R0B G;  4E7I A;  2ED1 A;  2DL5 A;  3CPF A;  5LJ3 h;  2QEX A;  3CCM A;  2CT4 A;  1QKW A;  5HCK A;  1XJW B;  4Y28 E;  3NMZ C;  1T3S A;  1QW1 A;  5DLO A;  3OBY A;  2EYQ A;  3L2R A;  3RBB B;  2OJ2 A;  2DTO A;  4AMC A;  2KGT A;  1NPP A;  3LGL A;  3NTK A;  4EMG A;  2OTJ T;  1T0H A;  2YHT A;  4JRI A;  4M7A D;  1U1S A;  4JDS A;  3CCM Q;  4F7U B;  1YNZ A;  1X43 A;  2FPD A;  3AT1 B;  2VGM A;  1PD1 A;  2D9T A;  5FRM A;  4MZM A;  2HL3 A;  4OMO A;  1N27 A;  1NJI R;  2E5Q A;  3MO8 A;  2GQV A;  3PE0 A;  4OGE A;  4C8Q G;  4JRQ A;  4FSX A;  2VAS A;  2YWW A;  4CC7 A;  2LNH B;  4C92 D;  3LGF A;  4QQ6 A;  5HKC A;  4M77 E;  1OEB A;  4OMQ A;  2JM8 A;  4WTO B;  3UAT A;  1YFN A;  4C0Z A;  3H0I A;  4FT4 A;  3M59 A;  4LNP A;  3CD6 T;  3G1J A;  3OYE A;  4R56 A;  3OS2 A;  1NLP C;  5GMK i;  2HDA A;  2H8H A;  2YDL A;  2COY A;  3VUB A;  2RHU A;  2W0Z A;  2RH2 A;  3IQL A;  1M2V B;  4WF2 A;  2Z0W A;  4J9I A;  5CO7 A;  2QQR A;  4XTZ A;  3TQ7 P;  1WHJ A;  4J9E A;  4MDW A;  4M7A G;  2KK4 A;  2V8K A;  2G6F X;  2DIL A;  5KYX B;  3QPH A;  3H41 A;  1OPL A;  2FEI A;  4BAC A;  3I35 A;  4LUE A;  1V29 B;  1TUG B;  2RD1 A;  1B34 B;  2DBM A;  4J83 A;  3QWY A;  1EZZ B;  4VUB A;  5LJ5 e;  1QVG P;  3GNF B;  1SRL A;  2DXU A;  4M7A F;  1SSH A;  3CCR A;  1KD1 R;  4Z02 A;  1WGS A;  1VQK T;  3EG9 B;  1BIB A;  3ZL7 C;  1RLQ C;  1VQ4 Q;  1XNI A;  1ARK A;  5I2S A;  2IIM A;  1YBY A;  3QZ9 B;  4AFZ C;  1X01 A;  2NUZ A;  2HAX A;  2QG9 B;  1K9M R;  3CXC A;  3DB4 A;  1KFZ A;  2CP0 A;  3C95 A;  4BI4 A;  2DVJ A;  5GAN f;  4J7I A;  1I5O B;  1K76 A;  4C92 F;  1TXQ A;  4OF1 A;  1QCO A;  4PJO C;  4B9X A;  1FX7 A;  1M2V A;  4KT0 E;  1K1Z A;  5CCA A;  5EC7 A;  2COW A;  4PJO B;  9ATC B;  1NEG A;  1UEC A;  2LQN A;  1UJY A;  3VS2 A;  1ZUU A;  5AT1 B;  4EMK B;  2JM9 A;  3RNJ A;  2YUO A;  3FRN A;  4JRP A;  4QQD A;  2HKQ B;  2JTE A;  4MDX A;  1TUC A;  3L2W A;  2LQK A;  4PKC C;  2L3Q A;  2DET A;  2RK2 A;  2VXF A;  2BKD N;  4BD3 A;  1T0J A;  2HNI A;  2JZ2 A;  3QG1 A;  4E7S A;  1IZ6 A;  1W2B S;  1X27 A;  1ABO A;  3G71 T;  3EG9 A;  4GBQ A;  1NYG A;  1VQ5 Q;  3OYC A;  5HK3 A;  4KGV B;  1GXI E;  5I11 A;  3OYH A;  1H3Z A;  3ZFJ A;  1KD1 U;  2V8J A;  2HQH A;  2MYS A;  3JV3 A;  3OBW A;  4PL6 A;  3ULR B;  1WXB A;  1YJW T;  2MPX C;  4E7Z A;  3HFO A;  2QQA A;  1D1A A;  5GAO m;  3BFM A;  1H3H A;  3CC2 A;  1M30 A;  3CCU T;  2PTK A;  4RCC A;  1K9M U;  5CR2 A;  1JBM A;  3H0F A;  2HCK A;  2PVG B;  4M7A E;  1M1K U;  4PJO A;  1ACM B;  1AWW A;  5IN1 A;  2QTV A;  3VYG A;  3N5B B;  1UHC A;  1D1C A;  3LWI A;  4LE9 A;  4E47 A;  3LLR A;  1G8X A;  2DPP B;  4X1V A;  4JPB W;  1GBQ A;  1WJS A;  1Q7Y C;  3CME Q;  2NUP B;  3V8K A;  2K9G A;  5A0G A;  5LJ3 f;  1VQM A;  2DTI A;  3JCM b;  1M4Z A;  4LN2 A;  3DLM A;  2E65 A;  4J6W A;  3E2U A;  4XU2 A;  4O6J A;  1LVK A;  1HYO A;  4C92 E;  4ZGE B;  2VKN A;  4OB1 B;  1D3B B;  5LJ5 g;  4RKU E;  3GIB A;  4OVA A;  5LJ5 d;  2GQI A;  3QJ6 A;  1VQM Q;  1YCY A;  1IGQ A;  1JXM A;  2O9S A;  1BBZ A;  4XTV A;  1IRX A;  2HMA A;  1SF9 A;  2DL4 A;  1OX9 A;  3JCM X;  4N4H A;  1Y7X A;  5A2Q E;  1KK7 A;  1QKX A;  1H64 1;  3X26 B;  2RJC A;  2MF2 A;  4N0A C;  1N9R A;  5GAN e;  4C8Q C;  2K5L A;  4LXC A;  5GAN 5;  3A8H B;  1R8O B;  2JOY A;  4NL3 A;  4C8Q B;  2O4X B;  4ZGD B;  4OMM A;  1LOJ A;  3CCL Q;  3I55 A;  3CCJ Q;  4OMN A;  2NUP A;  1KJW A;  5GAM h;  1VQL T;  4QVC A;  1BI1 A;  2ATC B;  1WDX A;  2M16 A;  1VQN Q;  1VQ7 A;  3G4S A;  2KR3 A;  1KQ2 A;  2DTH A;  1Q81 R;  5LJ5 j;  1HSQ A;  3JAM E;  4F7U F;  3HRU A;  5D7U A;  1NPR A;  2KY9 A;  1VQP A;  4XTY A;  2QAS A;  4EMH A;  3CCV T;  2RQW A;  2B86 A;  2XIC A;  1VQ9 A;  3OYN A;  1D3B A;  4IIO A;  3FB9 A;  4PK4 A;  2DA9 A;  1JJ2 S;  4OGC A;  1E6G A;  4DBH A;  1VYV A;  5KE2 A;  4EPC A;  2CP6 A;  1JU5 C;  3G4S Q;  4V2S A;  4M7A C;  1VQ8 Q;  2RB6 A;  2EQJ A;  2HEQ A;  3QSU A;  4X9C A;  1I81 A;  1VQP Q;  4HKE A;  2CT3 A;  1RAD B;  1U3O A;  1VQ9 Q;  1OI1 A;  1LJO A;  3REA B;  3GOX A;  4J7F A;  1IRE B;  2EYZ A;  2X3W D;  2C0I A;  4PJO D;  1Q82 R;  1PWT A;  4FIB A;  1BCO A;  3SEM A;  2VVK A;  3JCM c;  3BE3 A;  4N0A A;  1KHC A;  1WA7 A;  3CCS T;  2WAC A;  2EQU A;  3M0Q A;  4C8Q A;  2O4X A;  3RUX A;  5AYF A;  4R55 A;  1SEM A;  3CC7 A;  3M0R A;  4XTW A;  2OTL T;  2OTJ Q;  2KRN A;  3MET A;  3MP8 A;  2DYI A;  4LD6 A;  4BDY A;  2BZ8 A;  2QA4 T;  2FRW A;  4BE2 A;  3QZ5 B;  5LJ3 e;  2CUB A;  4QW2 A;  2QAZ A;  1OV3 A;  2X35 A;  1Z9Z A;  2LC4 A;  2X4J A;  5C0M A;  2FRY A;  4PJL A;  3CD6 A;  1YWP A;  1PD0 A;  1Q81 U;  1OUL A;  2AIR B;  4NOY A;  3M58 A;  2LJ1 A;  1IXD A;  1KHI A;  2MIO A;  2JTM A;  1AD5 A;  2CDT A;  3GP8 A;  1W2B A;  2V8I A;  2ZPF B;  3JCM d;  3G6E T;  3MPU B;  3V7R A;  4B9W A;  4M7A A;  2GF7 A;  1N8R R;  1YHQ A;  2EW3 A;  2QQB A;  3CD6 Q;  2EYW A;  2W10 A;  3EG3 A;  3A8G B;  1C6V X;  5GAN h;  3QO3 A;  1YJN T;  3RKX A;  4F7U E;  4E7K A;  3EGU A;  3GNG A;  3GBQ A;  1WFW A;  3LYI A;  3UA7 A;  2BIV A;  2RPN A;  3I56 T;  5GAN g;  1D0Y A;  2RNA A;  2CP3 A;  3NTH A;  1Q82 U;  2VWF A;  2V1Q A;  4GY5 A;  1X6B A;  1TTH B;  5GAO r;  1N9S A;  3THK A;  5FWC A;  3CQT A;  2KI7 A;  4RCB A;  3PMI A;  4C0D C;  1TUD A;  2RQV A;  4ESR A;  2HBP A;  4PJO F;  1OPK A;  5FU7 C;  1U5S A;  5CKF A;  1YIT A;  4CRI A;  4MMK A;  2DO3 A;  3VKI A;  3CCE T;  1QVP A;  4BE1 A;  1EFN A;  1PKT A;  2KYB A;  2EBP A;  4N4I A;  3VYH B;  2LCS A;  2RM4 A;  3OSS C;  3ER0 A;  1OOT A;  1G5V A;  2AKK A;  1ZA1 B;  4TVR A;  2PNI A;  3S6W A;  2KDS A;  5LL6 S;  2KT8 A;  3G7Z A;  2A28 A;  1S72 T;  4JS4 A;  1VQK Q;  3NGP A;  2R57 A;  3Q1J A;  5GAO l;  1VIF A;  2XDB A;  4QVZ A;  3CC4 A;  2J6F A;  2P4T A;  4YTL A;  4JJN K;  5GAN j;  1OYX A;  4RG8 A;  2EQM A;  5EG2 A;  2QGF B;  4C8Q D;  4LDY A;  3OW2 S;  3RES A;  1N8R U;  4LDV A;  3OYI A;  5KCH A;  3FDR A;  1UGP B;  1QVF S;  1QCF A;  3OYL A;  1NZ9 A;  3EG2 A;  4MZP A;  3A8O B;  4RUG A;  3CC4 Q;  4HVW A;  4BUG A;  2AKL A;  1OU8 A;  2J6K A;  4L5G A;  1HK9 A;  5GAN 7;  3LH0 A;  1IHV A;  4PJM A;  1AT1 B;  4HT8 A;  1K8A U;  1R0C B;  2K5I A;  1WI7 A;  1U8R A;  5GMK e;  5LJ3 g;  3RMS A;  3SHW A;  1V76 A;  5LJ3 d;  1G2B A;  4JS5 A;  2FHD A;  2ZPG B;  2CUD A;  2RN8 A;  3OYB A;  2QQ9 A;  5D6W A;  4DOW A;  4ZNX A;  3JCM J;  2XK0 A;  4LUD A;  4AFU C;  2CRE A;  2EGC A;  2HBW A;  2E4H A;  3E1S A;  5GAM f;  1JJ2 A;  1RAH B;  1VQO T;  4BB7 A;  3ZBD A;  1M90 R;  4PJO E;  4Z8A A;  3OYF A;  2CZ1 B;  2M9U A;  3FJP A;  2F1L A;  2GCX A;  2JUF A;  2LP5 A;  3V8J A;  4KUL A;  1YJW Q;  4BI8 B;  2KRM A;  1Y07 A;  2P4R A;  4M75 G;  1YI2 A;  2LTO A;  3P8D A;  3KXT A;  2C06 A;  2LJ3 A;  1M9S A;  2KSS A;  3CCU Q;  3EHQ A;  1M2O A;  2NLU A;  3QBY A;  3FEO A;  3WXM B;  3E9F A;  1AOJ A;  4A63 B;  2K7A A;  5KYN A;  3BY7 A;  4J9B A;  1UG1 A;  4PNO A;  3E19 A;  1I0C A;  5LJ3 j;  1EX4 A;  2C0T A;  1BK2 A;  1UGV A;  1FYN A;  2YSQ A;  4C8Q F;  1W2B P;  2CS7 A;  2EJ9 A;  1N5Z A;  3A8M B;  1YI2 Q;  1HD3 A;  5CQX A;  4D8K A;  1AVZ C;  1X2K A;  1GCQ C;  2I0N A;  4LDX A;  1BB9 A;  1Y57 A;  5CKH A;  4FT2 A;  1RAA B;  1TOV A;  4N4G A;  2M0Y A;  4J9D A;  3JB9 J;  5GAN 8;  4ZN3 A;  3JB9 I;  3F70 A;  2O31 A;  4F7U A;  2COZ A;  3PVL A;  5IHI A;  3L1A A;  1Y96 B;  1O75 A;  2ABL A;  2DD4 A;  3OS0 A;  3HKS A;  2DFU A;  3ASK A;  5FRN A;  2KYM A;  3EH2 A;  3M5A A;  2DK3 A;  1VQ4 A;  3QHS A;  3HPW A;  1G3Y A;  4KUI A;  5CQY A;  2DBK A;  2KEA A;  5CVI A;  3RKY A;  3PGG A;  4Y91 A;  5GAO n;  1Y0M A;  4BY6 B;  3JRZ A;  1M90 U;  4DBF A;  2L8D A;  4IUV A;  4UC4 A;  2DE0 X;  2OI3 A;  2DXT A;  2K79 A;  1I07 A;  1NJI U;  2LNV A;  4K11 A;  2FVU A;  4OP0 A;  2LJ0 A;  2YRV A;  4RTZ A;  1WIE A;  2QQS A;  2M0O A;  4FW1 A;  4P5N A;  5KE3 A;  4L6V 5;  4EDU A;  4PLI A;  3V7S A;  2P0Q A;  3R6N A;  2PU9 B;  1CKA A;  1VQL Q;  5KH6 A;  1VOM A;  5GMK h;  4OB2 B;  2EAY A;  2CZ0 B;  3UDC A;  3C94 A;  3M0U A;  2A7Y A;  2CH4 A;  2ENM A;  2KXD A;  3U23 A;  1OQK A;  2F69 A;  4PJJ A;  4Q5W A;  3H0H A;  4HA8 A;  2P84 A;  2F5K A;  3LW5 E;  2LDM A;  3CCV Q;  1GCQ A;  2EIF A;  4EMK C;  5GJV B;  5CKD A;  2EFI A;  2G3R A;  1M3B A;  1Y96 A;  3JCM Q;  4IUQ A;  1MUZ A;  1QWE A;  3MJX A;  3GLX A;  1VQ5 A;  5KYX A;  5FU6 B;  5GAM e;  4A4F A;  4DA4 A;  5GMK m;  2B8A A;  4C8Q E;  1MNE A;  1B34 A;  3JSC A;  3WVE B;  4Y92 A;  3PTA A;  2HZY A;  3AHU A;  8AT1 B;  1XTD A;  2L3P A;  1KD1 C;  4KBM B;  1YJ9 A;  2QA4 A;  3REB B;  3A5Z B;  1ZLM A;  2ZPE B;  2NUT B;  1Q7Y R;  5J26 A;  2DZ9 A;  2IPO B;  1K0S A;  1DJ7 B;  2R5M A;  3OW2 A;  2VXE A;  2BZX A;  1D09 B;  3EFS A;  2X4X A;  2H3J A;  1QVF A;  3M55 A;  3MKD A;  2YUP A;  2X3X D;  3QYG B;  3QWX X;  3L2U A;  1K9M C;  1BI2 A;  1GFD A;  2PQW A;  3PVQ A;  5GMK j;  1M1K C;  1VA7 A;  2E1H A;  2DEU A;  3CME A;  2RHZ A;  1JJ2 P;  1YJ9 Q;  2QEX T;  3CCM T;  1YWO A;  4FM4 B;  2QA4 Q;  2ED0 A;  2A0F B;  2GGR A;  4F14 A;  1G3T A;  5I2M A;  2EWN A;  1I1J A;  1I8F A;  3EG1 A;  3J81 E;  1M8M A;  3FIF A;  4RTX A;  3V8L A;  2LCL A;  4L59 A;  2BUD A;  3L2V A;  1FMV A;  5L8R E;  1WZO A;  3I5S A;  4JJC A;  1HJD A;  1LPL A;  4XK8 E;  4C0G A;  3L2Q A;  3A8L B;  1RAC B;  4FL6 A;  4EMK A;  3D7S B;  1GRI A;  2K5F A;  3I56 A;  3RDV A;  5IH2 A;  3VUZ A;  3G6E Q;  3X25 B;  3INZ A;  4LD9 K;  2K6D A;  2HD0 A;  3X24 B;  1K73 R;  1YJN Q;  1RLP C;  2NUT A;  4RTW A;  3UT1 A;  2KQW A;  1X75 C;  3I56 Q;  1QP2 A;  2YT6 A;  2DXC A;  2X4W A;  2FZK B;  4DOV A;  3PIP A;  1Q86 R;  2DIG A;  2DYB A;  2DJQ A;  1G3W A;  3OMG A;  2XHC A;  2HQX A;  3SWN C;  1MV0 B;  1IO6 A;  3CCL A;  2P0P A;  4QT7 A;  3CCJ A;  2KXC A;  1UGS B;  2FG0 A;  3CEY A;  3SWN B;  4PFO A;  3CPW S;  1VQN A;  3EFO B;  2RHY A;  1QMC A;  2DIQ A;  1PC0 A;  2FZG B;  1RAF B;  3PFS A;  4M75 C;  4FU6 A;  2DL8 A;  3EFR A;  3VU3 C;  2R5A A;  3I9Q A;  2MCN A;  2D8J A;  2LT1 A;  2NYS A;  4R0K A;  5J39 A;  1QQJ A;  3M57 A;  1ZQ1 A;  4M75 B;  2RHX A;  1WJR A;  1PG5 B;  2Y4X A;  1SHG A;  3GPL A;  2M51 A;  3MEV A;  3EGD B;  4ZGJ B;  5L23 A;  1YIJ A;  3SFM A;  4X9D A;  3CCQ A;  1VQ8 A;  3CMA A;  2X9H A;  3C4S A;  2D0Q B;  4M4Z A;  5GAM g;  1RI0 A;  4JLI A;  5GAM d;  2J06 A;  2WSE E;  3OYY A;  2YRC A;  4J9G A;  2QI2 A;  5FRO A;  4XAX B;  3M0T A;  2E70 A;  4X34 A;  3LX7 A;  4A4E A;  4RMO A;  3CCR T;  4LDU A;  4HT9 A;  2ZPB B;  1MND A;  3JB9 D;  1YIJ Q;  3WVD B;  1K73 U;  2ZPI B;  1BYM A;  3CCQ Q;  3CMA Q;  4M7D G;  1VYU A;  1ZUK A;  2F2X A;  2MI6 A;  1UFF A;  1H8K A;  4C5E A;  4E7L A;  1MMD A;  2OTJ A;  3RR6 A;  3PMT A;  3SWN A;  1Q86 U;  3EFO A;  3S3M A;  4KGZ B;  3DB3 A;  1PSE A;  4F04 B;  1NM7 A;  2RO0 A;  1JO8 A;  1TG0 A;  4FCY A;  1WHL A;  3ZEH A;  4PJN A;  5CKE A;  5GAN 2;  3M56 A;  4M75 A;  2QXF A;  4J9C A;  1U06 A;  5GAM j;  1HXD A;  3OYJ A;  4JLG A;  3EGD A;  3OW2 P;  2KBT A;  3QJY A;  1Q81 C;  2EYY A;  5J3B A;  4AG2 C;  1M1G A;  4RG2 A;  1P92 A;  1QVF P;  4M78 G;  2Y90 A;  1VQO Q;  4XQ3 A;  2M1H A;  2MWO A;  4LDW A;  4ELZ C;  1KQ1 A;  3TRE A;  2E12 A;  3VRZ A;  1X2Q A;  1PM3 A;  2GTJ A;  1F1B B;  1BKB A;  3PT9 A;  2DRK A;  3EGX B;  3VJP A;  1RUW A;  3MHX A;  3JB9 G;  2E6N A;  2EKH A;  3SD4 A;  5KYW B;  3I5R A;  1C1A A;  1EIF A;  1YCS B;  2CP2 A;  7AT1 B;  4IUP A;  1LNX A;  2CH4 W;  2RI2 A;  2YUN A;  4GLK A;  4J6Y A;  2XD0 A;  1Q82 C;  2LT4 A;  2JN0 A;  2QYZ A;  3NHN A;  4B6M A;  4NL2 A;  4ORZ A;  3OYK A;  3HHT B;  2L89 A;  2JT4 A;  2OX7 A;  2XMF A;  3CC2 T;  3JB9 F;  3C0C A;  4JUV A;  4XU1 A;  1W70 A;  5A0D A;  5GAN d;  1QCN A;  1AWJ A;  3OYD A;  5GMK l;  1YN8 A;  2JTF A;  4HCZ A;  2DER A;  1FMK A;  4BDZ A;  2KRS A;  1KC8 R;  5D6X A;  2RMO A;  5HK0 A;  2ROT A;  1VQK A;  2RJD A;  2MAM A;  1WYX A;  4JZ4 A;  2AK5 A;  4EIK A;  3L42 A;  2I2L A;  4FW2 A;  1VQ6 T;  1W4S A;  3TEE A;  4M77 G;  3GF5 A;  5FW9 A;  3BDU A;  2JJ9 A;  5I22 A;  4PFP A;  1MMN A;  3TSZ A;  3EGX A;  3HL8 A;  4E2F B;  1Z9Q A;  4RTY A;  3QYH B;  5IXF A;  1ZBJ A;  2SEM A;  1M5Q 1;  1ZBX A;  1G83 A;  3JCM V;  5CIU A;  1WQ7 A;  2EGE A;  1FMW A;  1RAE B;  1CSK A;  4M75 D;  5ECA A;  1UGQ B;  4DEX A;  2E41 A;  2GTO A;  3CPW A;  1K8A C;  2E3H A;  3HP9 A;  1M3C A;  3S3N A;  1I4K 1;  3CBM A;  4BE0 A;  2LX9 A;  3LH5 A;  3I55 T;  1KG1 A;  5KCO A;  3G71 A;  1OX8 A;  4CC3 A;  3TVT A;  2E3I A;  1VQ7 T;  3G4S T;  2KVQ G;  1UUE A;  3MEU A;  1KC8 U;  5GAO q;  5IAY A;  2XI9 A;  2RQU A;  1JQQ A;  4ZTF A;  3QXE B;  1YJW A;  2ZGW A;  1VQ9 T;  3VS4 A;  2DF6 A;  4E7H A;  3H9N A;  2DAQ A;  2FL7 A;  3V7C A;  1RL2 A;  4HCK A;  3UWN A;  3G71 Q;  1KIK A;  2Y4Y A;  3QDR B;  4AFQ C;  3CCU A;  2QDL A;  4QKU A;  1TH7 A;  1UB4 A;  1ABQ A;  4DQ2 A;  1W6X A;  1C0M A;  2KE9 A;  2XID A;  1X6O A;  4E6R A;  1PHT A;  2XG8 D;  2QTX A;  2CKK A;  3DLL A;  1JXO A;  1AWO A;  1RAI B;  2QEX Q;  2VGN A;  1SSF A;  2FPF A;  2QK0 A;  1E6H A;  2EJF A;  1QLY A;  4KH0 B;  5GJW B;  2L3S A;  1WPY A;  1G3S A;  2XDD A;  2HQE A;  2IG0 A;  1X6G A;  3CC7 T;  2MWP A;  4M7D C;  1Y71 A;  3TSW A;  4ANJ A;  2EKO A;  1OZ2 A;  2EYX A;  1O9S A;  2M02 A;  3HFN A;  3FLG A;  4M75 F;  4M7D B;  1M8V A;  3OMC A;  2EQK A;  2F2W A;  2O2O A;  2PUO B;  4XU0 A;  3VS0 A;  4JZ3 A;  4KUD K;  4FYX B;  4OMF B;  2L3R A;  1NLO C;  2LVM A;  2QGG A;  2CSQ A;  4CI0 C;  4II1 A;  5HY6 A;  1AEY A;  4XTU A;  4KRT A;  5I21 A;  2CGH A;  2DL7 A;  1B07 A;  3OA6 A;  1M90 C;  2K4Y A;  4F16 A;  2DMO A;  1NJI C;  1SPK A;  3KUF A;  4BY6 C;  2IVW A;  4M78 C;  1PRM C;  5DM7 R;  1YHQ T;  2CP7 A;  2KAF A;  2YRD A;  3M0S A;  1VQL A;  4M78 B;  1RAB B;  4RTV A;  2L2P A;  1BIA A;  2D8H A;  1ZSZ C;  1FXX A;  1TSF A;  2HL5 C;  3MP6 A;  1ZSZ B;  2V1R A;  4Z89 A;  2DM1 A;  3CCV A;  1WHM A;  2JXB A;  2CSI A;  1JRI A;  2DVE A;  2DXB A;  3O5Z A;  4J9F A;  4A54 A;  3M54 A;  1M1F A;  3VS1 A;  2OAU A;  4C5I A;  3VS7 A;  1UDL A;  4C92 G;  3JCM f;  1PRL C;  2FO0 A;  4M7D A;  3RER A;  2FPE A;  1YIT T;  2O88 A;  2EGA A;  1KQS A;  1IHW A;  1GFC A;  2C0O A;  1AHJ B;  1K0X A;  2XDP A;  3ME9 A;  1VUB A;  2PVD B;  1ZA2 B;  3CBP A;  4ME7 A;  4J9H A;  2FZC B;  3OYM A;  5FU6 C;  3BDL A;  3CPW P;  2E64 A;  3VS3 A;  1PSF A;  1M1K R;  4HCC A;  3CCR Q;  1XQH A;  2JS0 A;  2CZ6 B;  2PUK B;  3M0P A;  1SG5 A;  3VS6 A;  3CCS A;  2XKO C;  4OML A;  2BE9 B;  3CC4 T;  2OAW A;  3NPF A;  4M75 E;  2L5Q A;  1RAG B;  2OTL A;  1WLP B;  1V1C A;  1W1F A;  4M78 A;  4QQG A;  2ESW A;  4E7J A;  2A37 A;  3HSB A;  1GBR A;  2X4Y A;  4XU3 A;  3QUI A;  1ZSG A;  4M77 C;  2AZS A;  3UF4 A;  5CAI A;  2AT1 B;  2SRC A;  3X28 B;  2E10 A;  4M77 B;  1ZSZ A;  4AG1 C;  3CCS Q;  2A3L A;  2DX1 A;  4AFS C;  3HTR A;  4FYW B;  4ELY C;  4Z88 A;  2OTL Q;  4CC2 A;  3M4G A;  2DEQ A;  2RJF A;  4C0F A;  2E5K A;  2GNC A;  4IUU A;  2LRQ A;  3VV0 A;  3OY9 A;  4DBR A;  1WXT A;  2JNG A;  1PCX A;  1OU9 A;  3P8B B;  1J3T A;  1KSW A;  2LCC A;  4ZTJ A;  3H6Z A;  3FC3 A;  3G6E A;  2LZ6 B;  3C12 A;  1AZE A;  1YJN A;  5IT9 E;  1T3L A;  1RI9 A;  5KYU B;  1VIE A;  2JS2 A;  1UE9 A;  2DNU A;  3QDF A;  2K3B A;  2FB7 A;  3NFC A;  1VYT A;  3VRY A;  1D0Z A;  3OS5 A;  4FYV B;  8ATC B;  2BE7 D;  2RJE A;  1QVG S;  4XTX A;  1WXU A;  4FSS A;  1YI2 T;  3A1P A;  5CKB A;  3CC2 Q;  5CK9 A;  3CCE A;  2DJZ A;  2ROL A;  2CYZ B;  1XOV A;  4HXJ A;  4M77 A;  1NBE B;  2GFA A;  1VQ6 A;  4M7D D;  5LJ5 h;  1Q7Y U;  1MV3 A;  4JJD A;  1WHK A;  1K4U S;  5IHK A;  2J7I A;  2A36 A;  3OB9 A;  1S72 A;  2F2V A;  3UPU A;  3OYA A;  1GCP A;  1WHG A;  1BI3 A;  3E9G A;  1N6A A;  3JCM e;  2VYT A;  1BI0 A;  3CCE Q;  1UTI A;  3M53 A;  2DD5 A;  1VQ6 Q;  3SDZ A;  1MMA A;  1WHH A;  2VUB A;  3UA6 A;  1ZUY A;  2JW4 A;  3M4Y A;  5KYU A;  3M9Q A;  5KYY B;  4PLL A;  4AT1 B;  2P0K A;  1A0N B;  1NE8 A;  1S72 Q;  1OZ3 A;  2ZCF B;  3TU4 K;  4M78 D;  4F7U G;  2D0N A;  1VQ4 T;  1MHN A;  2VB6 A;  4HCB A;  5GAN 6;  1K73 C;  3OSV A;  3O8V A;  3VS5 A;  3JCM P;  3OYG A;  2K2V A;  2K3X A;  1KQS P;  2GBQ A;  4WCI A;  4RTU A;  2RI3 A;  4RTT A;  1Q86 C;  3FJ5 A;  4DBQ A;  4A4H A;  1LCK A;  4KGX B;  1SHF A;  2AHJ B;  3CXC P;  2LX7 A;  4HVU A;  4JJB A;  1FWZ A;  3MEW A;  2H3E B;  2QDY B;  1PNJ A;  1U1T A;  1NEB A;  3I55 Q;  2V26 A;  1BCM A;  2WSF E;  2LQ8 A;  3CBO A;  3OS1 A;  4CC4 B;  1VQ7 Q;  1AWX A;  1VQO A;  5IXB A;  2KNB B;  2RHI A;  1UGR B;  1CKB A;  4M7D F;  2ZZD A;  1NG2 A;  4M7A B;  4J8O A;  4C5H A;  3LWH A;  2HSP A;  1B7T A;  2MMP A;  5KYY A;  2VC8 A;  2AZV A;  2EVR A;  3KFV A;  2LQW A;  2NWM A;  2O9V A;  2RQR A;  1ZX6 A;  1VQ5 T;  2KMT A;  3RIR A;  4NS5 A;  1UJ0 A;  5A0L A;  4C92 C;  1D0X A;  4OMP A;  2YXY A;  4BI3 A;  2D1X A;  2BTT A;  4QVD A;  4M77 D;  1JEG A;  4C92 B;  3URG A;  5GAO p;  1YJ9 T;  3MEA A;  2YUQ A;  4HVV A;  2WSC E;  1SRM A;  3L2Z A;  2PVO B;  2EJG A;  4IUT A;  4ATO A;  2XU8 A;  3JCM W;  4M78 F;  3RMQ A;  2J6O A;  2HSE B;  1IGU A;  1WJQ A;  3R6O A;  2HKN A;  5FLX E;  2RA2 A;  2CP5 A;  2F5T X;  2EPD A;  1ZHI A;  3CC7 Q;  5GAN 4;  1S1N A;  2K57 A;  3JCM h;  3EH1 A;  1K9A A;  3MP1 A;  2LMJ A;  3CME T;  3QKJ A;  1UEB A;  3S3O A;  4D8D A;  2ECZ A;  4D6W A;  3PIO A;  2MK5 A;  2DLP A;  4DEY A;  5M9O A;  1I5L A;  2DKG A;  2K2M A;  3P8H A;  3JCM g;  2ZAE A;  3X20 B;  2PZ1 A;  2D6F A;  1MGQ A;  2GFU A;  3T9N A;  2RQT A;  3DKM A;  4FYY B;  1TU0 B;  3TCJ A;  1H92 A;  2RF0 A;  4J5Y A;  1Q95 G;  1QWF A;  3EHR A;  2O01 E;  3HRT A;  4MML A;  3EAE A;  4PJO G;  2DRM A;  2FYK A;  2JMC A;  1KQS S;  4IUR A;  2J05 A;  3A98 A;  1WQW A;  1M3A A;  4KH1 B;  2JVV A;  1VQM T;  1JB0 E;  3J80 E;  2YLB A;  1GL5 A;  4PFZ A;  1B3Q A;  4A4G A;  1R77 A;  3BW1 A;  1X69 A;  1K8A R;  3EG0 A;  2E6Z A;  4ZN1 A;  5DLQ E;  3CXC S;  1YP5 A;  2KRO A;  4OB0 B;  1YHQ Q;  4C92 A;  5GAN 3;  2KT1 A;  3J7A F;  4O5V A;  3PNW C;  2ZPH B;  4JRK A;  2CZ7 B;  3SB2 A;  4M7D E;  2R58 A;  2DZC A;  5FWB A;  2YLC A;  3NTI A;  4A4K A;  4C0D B;  3RKW A;  1QVG A;  4F17 A;  3HRS A;  1TWB A;  3JB9 H;  4J6X A;  2RK1 A;  1E7O A;  2K3Y A;  3H8Z A;  5KYW A;  5FU7 B;  1N8R C;  5IHN A;  5C6S A;  1NYF A;  4IKF A;  1SKU B;  3CCL T; 
#chains in the Genus database with same CATH homology
 1IGQ A;  1IGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...