2JVVA

Solution structure of e. coli nusg carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
b'RPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription antitermination protein nusG
molecule tags Transcription
source organism Escherichia coli
publication title Two structurally independent domains of E. coli NusG create regulatory plasticity via distinct interactions with RNA polymerase and regulators.
pubmed doi rcsb
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jvvA00
5J3BA 1VQ4T 3CCQT 1VQ9T 2CKKA 2JVVA 3CD6A 3CCUA 4QQDA 1YBYA 5DLQE 1YI2A 3DB3A 1YJNA 2DO3A 1VQNA 3P8BB 1M1GA 4X34A 3JAME 5A2QE 1NPRA 3CXCA 3OW2S 1S72T 1M1KU 1VQMA 2IG0A 2OTLT 1KC8U 1QVFS 2JNGA 3CCST 4CRIA 3CC7A 5FLXE 1N8RC 1K73U 3CMAA 2JUFA 3LH0A 5LL6S 1Q86C 1QVGS 2LCLA 3CCVT 1VQ5A 2G3RA 2MWOA 3CC7T 3CCRT 1VQ8T 1VQ7A 1YIJT 1Q7YC 1M90C 3LGLA 1NJIC 2OTJA 1EIFA 5IT9E 1NZ9A 3I55A 1K9MU 2JOYA 1VQ6A 3DLLA 1KC8C 3I56T 1VQNT 1VQPA 3A5ZB 1XTDA 3J81E 3LGFA 3CCSA 2E6ZA 4YTLA 3I56A 1M90U 5DM7R 1KHIA 1S72A 2LQ8A 3CC2A 5HY6A 1NPPA 1YIJA 5J26A 3CPFA 3KBGA 1Q82U 2XHCA 3J7AF 1BKBA 3G6ET 4TVRA 1VQ4A 3CCQA 1VQ9A 3CCEA 1VQ8A 3CXCS 3OW2A 4ZN1A 3CC2T 1YJ9T 2QEXA 2EIFA 1K9MC 3CCLT 1YJWA 1QVGA 1VQLT 1X6OA 1YHQA 1VQ6T 1QVFA 1VQKT 1YJWT 3CCLA 2L3RA 2MI6A 3CC4T 2MWPA 1VQKA 1RL2A 1N8RU 3TREA 3CCJT 1Q81U 1KD1C 4RG2A 1M1KC 3J80E 3G71T 3CMAT 3CPWS 3G4SA 3CCVA 3CMET 1Q7YU 1VQOT 2QA4A 1Q81C 1KD1U 1Q86U 1YHQT 2QA4T 1JJ2A 3G6EA 1YITA 2QEXT 3CCMA 1Q82C 1K8AC 1XNIA 3CCET 1YITT 3CCJA 1YI2T 1K8AU 2KVQG 1VQMT 2OTLA 1W2BA 1KQSS 3CMEA 1W2BS 3CD6T 3G4ST 2E70A 4ZN3A 1VQPT 1YJNT 1UEBA 2KDSA 1VQLA 3CCRA 1VQ7T 1K73C 5IAYA 3CCMT 3CCUT 1KQSA 2OTJT 3I55T 3PIOA 3CC4A 3HKSA 1NJIU 3ER0A 1VQOA 1IZ6A 3DB4A 3PIPA 2LVMA 3CPWA 1SSFA 1YJ9A 3OYYA 1VQ5T 1JJ2S 3G71A
chains in the Genus database with same CATH superfamily
2M16A 5J3BA 3CXCP 2ZPBB 1VQ4T 4BY6C 4A54A 1B7TA 1IHVA 1F1BB 2RM4A 4QT7A 3CMAQ 1MMNA 1QKXA 3PE0A 2WSCE 4RG8A 4ZGDB 1VQMA 3E1SA 1WLPB 4XTZA 4JRQA 2JW4A 3CCST 3M0RA 3C94A 1Y96B 2EBPA 2L3QA 4E7ZA 2DL4A 2GQVA 2RK1A 5GMKe 1GXIE 3IQLA 4OMFB 5CO7A 1YJ9Q 5C6SA 4KGZB 3M4YA 1YN8A 2DRMA 4EMGA 1TUDA 1J3TA 2XU8A 1OU9A 5GAMe 5CK9A 4C8QE 2OTLQ 4E7HA 4MMKA 4Q5WA 5FU6C 2CP2A 4MMLA 2HKNA 1AT1B 2J6KA 1YWPA 2ROTA 2FPEA 4J9CA 1X6GA 3TREA 2EJGA 2R57A 3M0UA 1A0NB 4C5HA 1VQPQ 1NM7A 2DIGA 3CD6Q 1ZA2B 6AT1B 1U8RA 3QPHA 2EGEA 4B6MA 2KVQG 3EG3A 3H0HA 2RHZA 1Y0MA 4XU3A 1VQ7Q 3RMSA 3BY7A 2X3WD 1WHKA 4M75A 3OMGA 2QG9B 2FYKA 2FVUA 1WI7A 1WQ7A 2LC4A 3CPWA 4OP0A 4PL6A 1JJ2S 3JCMh 4HKEA 3PMTA 5GANg 2LDMA 1W6XA 8ATCB 1SKUB 3A8OB 2EPDA 1FMKA 3R6NA 1N6AA 5IXFA 2F2XA 1Y7XA 1JO8A 2DIQA 1S72T 2L8DA 1YCSB 1FMWA 1QKWA 4JDSA 1MMAA 1VQ6Q 2FG0A 3LH0A 1N9SA 3A1PA 1EFNA 3I55A 4M7DC 2K2MA 2KXDA 1UJYA 2FHDA 2NUPB 3VRZA 3OYLA 1VQPA 1PM3A 2KYMA 4XAXB 4Z02A 3FLGA 2HKQB 2LZ6B 1NE8A 2RJCA 5GANh 4M77D 1KSWA 3ZFJA 5IHNA 1KIKA 4NS5A 4NL2A 2COWA 5HKCA 2RK2A 4FW1A 4F7UF 1SF9A 1WHJA 1VQ6T 1VQKT 1ZHIA 2BE7D 3M55A 1VQKA 2OTJQ 4BI8B 1TG0A 4M75G 2I2LA 5KYYA 1KJWA 1BCOA 3A8HB 3NMZC 5CKEA 1V29B 3FIFA 1AWXA 2DA9A 3CCMA 4BACA 1K73R 1OV3A 3JCMX 2DL5A 4WCIA 2FB7A 4DBRA 2L3SA 3VS6A 2K5IA 2EQKA 4ZN3A 1B3QA 1G3WA 2RI3A 1X75C 3VV0A 1KQSA 3I55Q 4L59A 7AT1B 2DXCA 3OY9A 3EFOA 2LT1A 4HT9A 1NYGA 1ZSGA 2EGAA 3CC4Q 3OYMA 1MMGA 1QWEA 3JSCA 1RADB 1RLPC 5IN1A 4M78G 4Z89A 5GAMh 1WJSA 1M1GA 4D6WA 3G71Q 5DY9A 1XJWB 3P8HA 3JCMV 1X2QA 1S1NA 3C95A 3OYHA 3TCJA 5LL6S 2OI3A 4X9CA 3HPWA 2RQTA 5A0DA 2JMCA 2OTJA 2COYA 3E19A 1U5SA 3DLLA 2RMOA 3I5RA 1QCOA 2NUTA 2KE9A 3NTKA 4RCCA 4YTLA 2JJ9A 1AVZC 4C0GA 3JCMQ 3M4GA 1U3OA 3WVDB 1VYUA 3OYCA 4M77F 4FL6A 3CXCS 2XIDA 4E2FB 3EFSA 4IUVA 2Y4YA 1MHNA 4LE9A 2E6NA 3CC4T 1M3CA 2L3PA 3ZBDA 2KI7A 3V7CA 4C8QA 3FJ5A 4GLMA 3I35A 3CPWS 2SRCA 1E7OA 2RD1A 3META 1QVGP 3Q1JA 4AMCA 3G6EA 2ZPFB 2F2WA 2EYZA 1EX4A 3H9NA 5IHKA 4XTUA 1BB9A 2RHIA 4N4GA 2OTLA 2KRSA 1VA7A 1VQPT 1WHGA 1SRMA 1M2VB 3HRUA 1JJ2P 2E1HA 1OPKA 3M9QA 2YUQA 4OMNA 2DVEA 5KCOA 2ZPGB 3RNJA 1SPKA 5IH2A 1X43A 3LLRA 1NG2A 4R0KA 4JJBA 2KT1A 1K4US 1I8FA 2GFUA 1SSFA 1XOVA 1YJNQ 3JCMg 2CSQA 3HRTA 1H8KA 2JVVA 3CD6A 2IIMA 3BE3A 2ZCFB 1LPLA 5LJ5j 1VQNA 5DLOA 1M4ZA 3EGDA 3EH2A 3GIBA 2H3JA 3OS5A 2JNGA 2XICA 4C8QC 1JXOA 3CQTA 3V7SA 1ABOA 1WJQA 1Y71A 4BY6B 1NJIC 2BTTA 2JOYA 2A3LA 5I22A 4N4IA 4JJDA 1PRLC 3A8GB 4Y28E 3EG9A 3G6EQ 5ECAA 2HQXA 1VQ8Q 1BU1A 2CS7A 4C8QB 5LJ5h 3ULRB 3PT9A 5A0LA 3FB9A 5GANj 3LW5E 3V8LA 1VQ9A 3OYFA 2DFUA 3VRYA 1V76A 1VQ8A 4PJOD 2QASA 2QEXA 1WIEA 3M54A 1YHQA 3FC3A 4PJOC 3TVTA 3MCAB 2PTKA 3NGPA 4FU6A 4JS5A 1VQ9Q 1M2OA 1RL2A 4RTUA 2HD0A 4FYVB 1M2VA 4XU1A 3CCVA 4Z88A 2E5KA 1T3LA 3M0SA 2ZAEA 5CVIA 5FRMA 4MZTA 1VQMT 1QVPA 5D6YA 1GCQC 2V8JA 4PJMA 1WHHA 3CCEQ 3EGXB 4V2SA 4JRIA 1NEBA 4F7UA 2HBWA 4UC4A 1K73C 1ZUKA 2YUPA 3QXEB 3R6OA 3OYGA 4M7DF 3PIOA 4C92E 3QO3A 2X4JA 2BZXA 1X69A 5C0MA 2DAQA 2CUBA 1O75A 1Z9ZA 2LNVA 3EGXA 2DYIA 5HK0A 4FSXA 3UPUA 2BE9B 2FRWA 5LJ5e 3UA6A 1IREB 3KUFA 2L2PA 2MCNA 2F5KA 2MYSA 3OW2S 1D0XA 2ROLA 2NUPA 5GAMj 1KC8U 2JN0A 1PC0A 1SSHA 2ZGWA 3SWNB 4F7UE 2G6FX 2OAWA 1VQ5A 1W70A 1D0ZA 1T0HA 2Y4XA 4FM4B 3L2WA 1YIJT 2CP0A 2XI9A 5IT9E 2M0YA 3LWHA 1HD3A 3CCVQ 4KGVB 4J9IA 2EKHA 3JCMf 2X3XD 3VKIA 5GMKh 3NFCA 1M90U 2DE0X 5GANe 5HY6A 3OYBA 1GRIA 4KGXB 1NPPA 4QQGA 3CPFA 4IKFA 4N0AC 1Q82U 1BKBA 2RF0A 1P92A 1FYNA 3A8MB 3M57A 4BE1A 1TXQA 3OYJA 2CP5A 2E41A 2HL5C 1YFNA 5CIUA 3U23A 3ZEHA 1QVFA 2RQRA 2KXCA 4Z8AA 2XDDA 3CBPA 3HL8A 2B86A 1KD1C 1UJ0A 1GL5A 2WACA 3VYGA 5GANf 1Q86U 3OMCA 4DBQA 2O4XB 1YI2Q 1BCMA 2FO0A 3TQ7P 5GMKl 4M7DA 5GAN6 3CCET 1TSFA 1UGQB 2DTHA 1PSFA 1WHLA 3EFOB 3JCMb 4B9XA 4M7AB 2K6DA 8AT1B 1YITQ 1O9SA 4DEYA 3CCMQ 4EMKC 1YJNT 3SWNC 2KDSA 4OGCA 4IIOA 1TTHB 1YWOA 3ER0A 2CUDA 5GAMg 1QP2A 3OSSC 1YP5A 2PZ1A 4PFPA 3VS0A 1MV0B 5KYNA 1VQ9T 1I4K1 1U06A 3OYDA 4HVUA 5EC7A 2JTMA 3VS1A 4DEXA 1YBYA 2EGCA 2VWFA 3QJYA 2FL7A 2H8HA 3P8BB 1ZQ1A 2KNBB 3JAME 1OI1A 4M77E 3T9NA 1KC8R 3EAEA 4M75D 2LQNA 1KHCA 1QVGS 1Q86C 3CCVT 1MNEA 2MWOA 4PFOA 2M1HA 4AT1B 3JCMd 5GAN3 4OVAA 3OYAA 4LDXA 5FWBA 4JUVA 2M9UA 1C1AA 3NTIA 3CBOA 4J7FA 2HSEB 1BI1A 5GAMf 3EH1A 3HRSA 2JM8A 3RERA 1I81A 3GLXA 4LN2A 1LNXA 2L5QA 4HA8A 1CSKA 2KY9A 2MAMA 1QCFA 2PUOB 1YJWA 3CC7Q 2FEIA 5AT1B 1UGPB 1YJWT 4R55A 1X01A 4KH1B 2C0OA 2K2VA 3CCJT 4XQ3A 5GAN4 5FRNA 2DD5A 3M56A 3CMET 1VQOT 4XU0A 2EAYA 2AZVA 2M0OA 2LCSA 2DMOA 4MZPA 2CZ7B 3I9QA 3MEVA 2A36A 2NYSA 2NLUA 4HXJA 3FDRA 1RACB 4B9WA 3FEOA 4CC3A 3FJPA 5GMKj 1K0SA 4BE2A 1RLQC 3MPUB 2LCCA 2OTJT 2DX1A 2MIOA 3I55T 1Q81R 4IUPA 4MDWA 3DB4A 1YJ9A 1XQHA 2CZ1B 4FCYA 3G4SQ 1PD1A 1R77A 4RTYA 3QZ5B 3QG1A 2QGFB 2DETA 5LJ3f 4OB1B 4M7AG 4MZMA 3EFRA 1M1KU 5CKHA 1X27A 3CMEQ 2FZKB 1AZGB 2GQIA 2ENMA 4M75F 5FROA 2DL8A 1K9MU 4M7AE 2R58A 2MF2A 5GAN7 4C92B 2EJ9A 3CCSA 1AD5A 4AFQC 5LJ5g 2JXBA 1M27C 2D9TA 1KHIA 3PVQA 1OYXA 4GLKA 3BFMA 4M78B 1H3HA 2CYZB 2YXYA 3UT1A 4PJNA 4OB3B 4X1VA 5KYYB 4J9HA 3C4SA 3QDFA 2XHCA 3TSWA 4JZ4A 4O5VA 2CGHA 2YHTA 4C0ZA 1KD1R 4J83A 3VS4A 1ZBXA 1BI0A 4J9EA 2O01E 3LX7A 4M7AD 2KROA 2L3RA 1OQKA 2SEMA 4LDYA 3OW2P 5I11A 3CMAT 3G4SA 1QVFP 4ZTFA 4ZGJB 3DLMA 2V1RA 2CH4W 2LT4A 5LJ3g 1S72Q 1UE9A 1ZA1B 4CC2A 3RKXA 1NYFA 1ZBJA 5GAOp 1K8AC 2JZ2A 4BUGA 4R56A 2MMPA 2VXFA 4M78A 2QI2A 1LOJA 1OULA 1W2BS 1SHFA 2DZCA 3L42A 2XD0A 3MP1A 1G83A 1VQLA 3S6WA 1VIEA 2R5AA 2RHUA 2DEQA 1BIBA 3V7RA 3LYIA 3L2RA 1ZLMA 3TU4K 2KBTA 5CQYA 2J6OA 2QDLA 2ZZDA 3EHQA 1ACMB 4J5YA 4PJOG 1UHFA 1YI2A 4HT8A 5GAN2 1HSQA 4QQ6A 2LRQA 4IIMA 1M90R 2K79A 2DRKA 4LDWA 3RKWA 2KRMA 2CREA 3JCMJ 1JQQA 2DL3A 3QJ6A 3CXCA 1M1FA 5IXBA 1C0MA 4FT2A 1Q95G 5FLXE 4RTWA 2LCLA 5FU7B 2GTOA 1ARKA 3NPFA 2K3BA 5KYWA 1KC8C 1B34B 2O4XA 4XU2A 4EMKB 1X2KA 1I5LA 1S72A 3MEWA 4RKUE 4F7UG 1K0XA 1IO6A 1ZUYA 1N8RR 3V8JA 1IXDA 3SB2A 4A4HA 4E7KA 4A4GA 2RQUA 1FWZA 1YJ9T 4RTTA 3CCRQ 4A4EA 2EYWA 1PHTA 5CQXA 2O9SA 2RI2A 2J7IA 4M7AF 1GBRA 3JB9I 5CAIA 4DBFA 4RUGA 4M77C 1WA7A 2QTXA 3OA6A 4C5EA 2X4WA 2HBPA 1R8OB 2O2OA 3A98A 3OSVA 3OS1A 1M1KR 1G2BA 1K8AU 3OYNA 3L2QA 1SEMA 2E70A 1M5Q1 2E64A 4RCBA 4LNPA 1N27A 2QQ9A 2AIRB 3CCMT 5D7UA 5LJ3e 2XK0A 2V26A 2IPOB 1Q86R 3OB9A 1G3SA 1Q82R 3HFNA 3UDCA 1E6HA 3X25B 2VGNA 1VQMQ 1Y96A 2COZA 3PMIA 4KH0B 3TEEA 2RB6A 4LD6A 2J6FA 4C5GA 3EG0A 3JB9D 1JEGA 3PNWC 4J8OA 1AHJB 2V1QA 3JRZA 3CMAA 1RAAB 5GAOm 1VQ7A 4FYYB 2H3EB 4QVDA 4DOWA 2A08A 1PD0A 2BZYA 2EVRA 3I56T 1BI2A 4II1A 3M0PA 1ZSZC 2D6FA 4J6YA 1CKAA 3I56A 4D8DA 2GF7A 3A8LB 4LUDA 5EG2A 2DJQA 2KEAA 1GFDA 3I56Q 1H641 1BIAA 5AYFA 4C5IA 1N9RA 2EIFA 1IRXA 3CCLT 1UUEA 1K9MC 3MP6A 3CCLA 2K9GA 1RAEB 3D7SB 4OGEA 2C0TA 4C8QG 1D1CA 3EG2A 1RI9A 1ZX6A 3UATA 3VS7A 1QWFA 2PVGB 3GNGA 1MNDA 3MKDA 4IUUA 4KT0E 2PU9B 2PVOB 2P84A 4OB0B 1T0JA 5IAYA 3CCUT 2K57A 5L23A 2XDPA 3SWNA 2JT4A 3PIPA 1WDXA 1GCQA 2E10A 4ZTJA 4KBMB 3F70A 1OX9A 2AT1B 1K9AA 3JV3A 3HTRA 2QK0A 4QW2A 2E12A 4C8QD 3INZA 2IVWA 4KUDK 1V1CA 1TS9A 2LTOA 4C92A 2E3HA 1M90C 4O6JA 2EYQA 2VVKA 3VS3A 2KR3A 3VS2A 3M5AA 1EIFA 3VS5A 3KXTA 2EW3A 1FXXA 1ZUUA 1WPYA 1YIJQ 1VQ6A 1VQNT 2MPXC 2ZPIB 3A5ZB 1TUGB 4EPCA 4XTWA 4DOVA 3CC2A 2YWWA 2EFIA 4OMPA 3REAB 1HXDA 1YIJA 1FX7A 2HAXA 2VYTA 4LDUA 2JTEA 4IURA 3J7AF 3DKMA 1K1ZA 1KQ1A 1PG5B 3CCQA 3AT1B 4N4HA 2CSIA 1TWBA 1WZOA 4OMQA 2QGGA 3CCQQ 2MWPA 4M78D 4J9FA 4M7DD 4WF2A 2QQAA 2LJ0A 3LH5A 4JS4A 1M1KC 2D0NA 1IB8A 1KQ2A 1PWTA 2EKOA 2YLBA 1TH7A 2P0PA 1YHQT 4RTXA 3HFOA 4RMOA 2Z0WA 2XKOC 4DQ2A 2ZPEB 1YITA 4FYXB 2MK5A 2QEXT 2XDBA 1VYVA 1YITT 4HCCA 2CP6A 3ME9A 4M75E 1M3AA 1QCNA 1G5VA 1VQ5Q 4M78E 5KYWB 3QZ9B 4N0AA 3JB9H 2JTFA 3OS0A 3GF5A 1CKBA 2KSSA 4M75C 3QBYA 1IZ6A 4RTVA 4F04B 3RR6A 1EZZB 2EJFA 4M7AA 2DBMA 4QVZA 3M58A 2CH4A 3G71A 2J05A 3CC2Q 4Y92A 2E65A 1JXMA 2HDAA 4GBQA 2ATCB 2VV5A 1G3TA 4A4FA 1B07A 3DB3A 1OEBA 2K4YA 2QXFA 3URGA 3L1AA 1BI3A 4FYWB 4K11A 3WVEB 3X28B 2ED0A 4JLGA 1N8RC 2DTOA 4IUTA 2AKKA 3M0TA 3E9GA 3OYEA 1YCYA 4PJOE 2DXUA 1UTIA 2ED1A 4M7AC 3OYIA 4A63B 4C0FA 2DK3A 2GFAA 3QWXX 2RO0A 3RKYA 4WTOB 1K9MR 3H8ZA 4VUBA 1H3ZA 1OX8A 2DVJA 3QYHB 4PJJA 2O9VA 1OZ3A 1UHCA 2ABLA 2DPPB 3G6ET 2HSPA 5KE2A 3VJPA 3V8KA 3EGUA 2A0FB 1KFZA 1VQLT 2DD4A 4OB2B 2DTIA 5I2MA 2X4YA 2YSQA 2RQVA 4DA4A 3GP8A 1W1FA 1Q7YU 1DJ7B 4EMHA 3M53A 3BW1A 3QUIA 3N5BB 2E3IA 1IGUA 2LX7A 4XTYA 1C6VX 2AK5A 1UGRB 2DF6A 1Z9QA 3CCJA 2D8JA 4ESRA 1NBEB 4NL3A 3OS2A 1I5OB 4BE0A 2HQHA 5FU6B 1RAHB 4HCBA 2QEXQ 2LQKA 2KGTA 1YHQQ 3SDZA 3REBB 2P4RA 2P0KA 3CEYA 2HL3A 2RJDA 2LP5A 4XK8E 2XG8D 2ESWA 1WX6A 2K5FA 3CCQT 2GGRA 3PTAA 4QQDA 1AZEA 2GNCA 1YJNA 4AG2C 2CP7A 3RBBB 2P4TA 2EYXA 1FMVA 2DZ9A 2RH2A 4ATOA 2M02A 3H0IA 4A53A 3CC7A 1YJWQ 1K73U 2HZYA 2G3RA 1TU0B 3CCRT 1VQ8T 3CC7T 2D8HA 4IUQA 1KG1A 4Y91A 1OOTA 5CKFA 2DKGA 1TOVA 3VU3C 2YLCA 3J81E 2E6ZA 5FW9A 2X35A 1PKSA 3NTHA 3PFSA 4L6V5 3QSUA 2KRNA 4PJOA 1JB0E 3EGDB 2C0IA 4C92F 3C12A 2WSEE 4PLIA 3TSZA 1TUCA 1E6GA 3LWIA 4JLIA 3HHTB 5GAOn 1VUBA 2X4XA 1U1TA 2A37A 2OAUA 1Q81U 2KYBA 4RG2A 3X26B 4QVCA 5LJ5d 1KD1U 1PRMC 4JPBW 4KUIA 1RAGB 3PGGA 4HCZA 3HP9A 1NEGA 1JBMA 3MEAA 4BDZA 1HK9A 4OF1A 5L8RE 2K5LA 2CDTA 2CT4A 2K3XA 3CMEA 3G4ST 4J9DA 2EYYA 2EQMA 1KK7A 4DBHA 3S3MA 4LXCA 3OBYA 1VQ7T 2C06A 9ATCB 2ECZA 2E5QA 1UG1A 2CP3A 4L5GA 1VQKQ 3OBWA 5LJ3h 2J06A 3QKJA 1WXUA 2BKDN 4LD9K 1SRLA 2DJZA 4C0DC 1AWJA 5DLQE 5CCAA 1MMDA 2DO3A 1G3YA 5FWCA 1K76A 2PNIA 1LCKA 2GBQA 4C92G 2IG0A 3QIIA 2R5MA 4E7IA 1M30A 1VOMA 5CKDA 2VKNA 2WSFE 3LGLA 2YRCA 2QDYB 2DYBA 2EQJA 4ANJA 2CZ0B 4ELZC 2LJ1A 4ZNXA 3LGFA 4AG1C 2F5TX 1M3BA 4M77B 5CR2A 2LQ8A 3MEUA 3X20B 1PNJA 5GJWB 3QYGB 2FPFA 4ORZA 2EWNA 3BDLA 4KULA 2O31A 1NJIR 1ABQA 3CCEA 3MP8A 4GY5A 2O88A 2YRDA 1X6OA 4A4KA 2F1LA 2KMTA 4C92D 2DXBA 2NUZA 4PFZA 1N8RU 1OZ2A 1RI0A 5HK3A 4BI3A 1RABB 3RDVA 2X9HA 5J39A 1Q81C 2DILA 4E47A 5GAN5 3SEMA 5LJ3d 1D3BA 1SG5A 1XNIA 2KK4A 3MHXA 3CPWP 1QQJA 3E9FA 4LDVA 3JCMW 1W2BA 1WGSA 2NWMA 3CD6T 2RHYA 2AKLA 3RESA 2HNIA 3UA7A 1UGVA 1BYMA 1RAFB 4JZ3A 3MO8A 3AHUA 4CI0C 3THKA 2JS0A 3BDUA 2VUBA 4XTXA 1W2BP 4M77G 5LJ5f 1I1JA 5GMKi 1QMCA 1MGQA 2RI5A 3OYYA 5D6XA 2I0NA 4BI4A 4ZGEB 2DXTA 3L2VA 4HVWA 3L2ZA 2AZSA 3M59A 2QTVA 2HQEA 1AOJA 2LMJA 3ZL7C 1ZSZB 2FZGB 5A2QE 2V8IA 4M77A 2BUDA 3JCMc 1QVFS 4OMMA 4CRIA 4JJCA 3H0FA 2M51A 1MUZA 2PVDB 4PJOB 1NZ9A 1WJRA 4PLLA 5CKBA 4BD3A 1M9SA 4KRTA 2CZ6B 2OX7A 2HEQA 2K7AA 4CC7A 1Q7YR 3UF4A 5J26A 1AWOA 4OMLA 1VQNQ 1NLPC 1WNLA 1Y07A 4PNOA 4MDXA 2FZCB 2EQUA 3E2UA 4LUEA 5KYUB 3HSBA 3OYKA 2XMFA 4JJNK 1ZSZA 5LJ3j 1I0CA 2VASA 1K8AR 4JRKA 3H41A 1G8XA 5HCKA 1WYXA 2PQWA 1AEYA 4PK4A 2MI6A 4JRPA 4FT4A 5GJVB 3JCMP 2LJ3A 1UGSB 5I21A 2V8KA 3CCSQ 4M75B 1D1AA 3NHNA 3P8DA 2F2VA 1JJ2A 2JM9A 3VUZA 2QQRA 2RPNA 2JMAA 4NOYA 5KH6A 2FRYA 3JB9F 4PJOF 2KAFA 3KFVA 1VQ4Q 4RTZA 1VQOQ 2MOXA 1UECA 4F14A 3CCJQ 1IGQA 4FW2A 2CT3A 4D8KA 2LQWA 1VQOA 4PJLA 2LNHB 1UFFA 2JS2A 2LVMA 5GAN8 5GAOq 1WXTA 2RA2A 5GAOr 1VQ5T 4J9GA 1PKTA 3GBQA 1R0CB 2QA4Q 1UDLA 1BBZA 4M7DG 2VXEA 2GTJA 3S3NA 2X51A 2W0ZA 1IHWA 1RAIB 2BZ8A 2YUOA 3M0QA 2HCKA 2HMAA 2RJFA 2OTLT 4QKUA 1LJOA 1PCXA 1YNZA 2F69A 1H92A 1M8MA 3CCLQ 4EIKA 1SHGA 4P5NA 3H6ZA 4M7DE 1GCPA 2RHXA 1HJDA 2A7YA 2ZPHB 1KQSP 1Y57A 2KT8A 4J9BA 3FRNA 3VUBA 5DM7R 1LVKA 4HCKA 2GCXA 4X9DA 3G7ZA 3UWNA 4E7SA 2DBKA 1R0BG 2VC8A 1GFCA 5KCHA 4XTVA 3SD4A 1AWWA 1VQ4A 4ZN1A 5I2SA 2B8AA 1B34A 2DNUA 1RUWA 3X24B 2FPDA 2L0AA 3WXMB 2K3YA 4AFSC 3J80E 3G71T 4E6RA 2EQIA 2QA4A 5GAOl 2QA4T 4HVVA 1Q82C 1QW1A 3SFMA 3RUXA 1MV3A 4E7JA 4C8QF 1YI2T 1WFWA 5M9OA 4J7IA 3PVLA 3RMQA 2QAZA 1UEBA 2DM1A 4FIBA 5GMKm 3CCRA 1D09B 2LX9A 4E7LA 2AHJB 3CC4A 1QP3A 3ASKA 4J6XA 2P0QA 1I07A 4PKCC 1VQLQ 2W10A 2QQSA 4F17A 2BIVA 4F16A 2CKKA 2E4HA 1WXBA 4M78C 3CCUA 1D0YA 2OJ2A 3GNFB 1UB4A 4X34A 4FSSA 1NPRA 1GBQA 1T3SA 4BB7A 1QLYA 3I5SA 3G1JA 2Y90A 4EMKA 2JUFA 1X6BA 1Q7YC 2L89A 5KYUA 3L2UA 3JB9J 1W4SA 2KQWA 4C0DB 5D6WA 3EHRA 3QHSA 5GAMd 4M78F 3VYHB 5KE3A 1XTDA 2QYZA 3GPLA 1U1SA 1D3BB 2VB6A 4BDYA 3EG1A 1WQWA 3QWYA 3JCMe 2PUKB 3KBGA 3GOXA 2RN8A 1N5ZA 4OMOA 4TVRA 5A0GA 4AFUC 2DL7A 5FU7C 3SHWA 2D1XA 3OW2A 2DERA 3CC2T 1QVGA 1JRIA 4EDUA 3OQ5A 1NLOC 4ELYC 1WHMA 3EG9B 2A28A 4M7DB 2RQWA 4CC4B 4F7UB 5KYXA 3JB9G 2VGMA 1D1BA 3MJXA 3CCUQ 2NUTB 2D0QB 4ME7A 1PSEA 2QQBA 1VIFA 2YRVA 1BK2A 2RJEA 1VYTA 3O8VA 1JU5C 3O5ZA 4J6WA 1KQSS 5KYXB 3CBMA 2DEUA 1M8VA 3S3OA 3RIRA 4C92C 5IHIA 2DLPA 4AFZC 3QDRB 2YT6A 1HYOA 3HKSA 1NJIU 2RNAA 4M4ZA 2YDLA 1OPLA 1OU8A 5GANd 2YUNA 3C0CA
chains in the Genus database with same CATH topology
1O75A 2M16A 3HFNA 5J3BA 2LNVA 2ZPBB 2BKDN 3UDCA 4A54A 4BY6C 1VQ4T 3X25B 2VGNA 4LD9K 2DJZA 5HK0A 1Y96A 4FSXA 4C0DC 3UPUA 3PMIA 5LJ5e 1IREB 3TEEA 2RM4A 3KUFA 5DLQE 2RB6A 4LD6A 2DO3A 5CCAA 1G3YA 4C5GA 3JB9D 2F5KA 4C92G 3OW2S 4RG8A 2WSCE 4ZGDB 1VQMA 3E1SA 3PNWC 4XTZA 4JRQA 2IG0A 4J8OA 5GAMj 1KC8U 2JN0A 3CCST 1AHJB 3QIIA 2R5MA 2ZGWA 3C94A 4E7IA 3JRZA 3SWNB 3CMAA 1Y96B 4F7UE 5GAOm 1VQ5A 1VQ7A 5CKDA 3L2WA 2Y4XA 1YIJT 2WSFE 4FM4B 3LGLA 4QVDA 4DOWA 2XI9A 2QDYB 2EQJA 2GQVA 5IT9E 2RK1A 5GMKe 1GXIE 3LWHA 4OMFB 2CZ0B 3I56T 4ELZC 1BI2A 4II1A 3LGFA 5CO7A 2F5TX 3JCMf 4J6YA 3VKIA 5C6SA 5GMKh 3NFCA 3I56A 2GF7A 1M90U 2D6FA 4M77B 3M4YA 5CR2A 2LQ8A 3A8LB 5GANe 3MEUA 5HY6A 3X20B 3OYBA 1NPPA 4QQGA 3CPFA 4IKFA 4EMGA 3QYGB 2EWNA 5EG2A 2XU8A 3BDLA 4KULA 4N0AC 1Q82U 5GAMe 5CK9A 4C8QE 1BKBA 1H641 1P92A 3A8MB 4E7HA 4MMKA 3M57A 4Q5WA 4BE1A 3OYJA 1BIAA 3CCEA 5FU6C 5AYFA 4C5IA 1N9RA 2E41A 3MP8A 4GY5A 2EIFA 1K9MC 3CCLT 5CIUA 1X6OA 4MMLA 3ZEHA 4A4KA 3MP6A 1QVFA 3CCLA 2KMTA 4C92D 2XDDA 2DXBA 3CBPA 3HL8A 4OGEA 1N8RU 3TREA 1OZ2A 1RI0A 2EJGA 2R57A 4BI3A 5HK3A 1KD1C 4C8QG 4C5HA 2WACA 3VYGA 5J39A 1Q81C 2DIGA 5GANf 1Q86U 4E47A 5GAN5 3OMCA 1U8RA 2O4XB 2PVGB 3QPHA 5LJ3d 1D3BA 3GNGA 5GMKl 1XNIA 4M7DA 2KK4A 5GAN6 3CCET 3MHXA 1UGQB 3E9FA 4IUUA 2DTHA 4KT0E 4LDVA 1PSFA 2PU9B 2KVQG 2PVOB 3JCMW 1W2BA 1WGSA 4B9XA 3JCMb 4M7AB 2RHYA 3CD6T 2RHZA 3RESA 1O9SA 2HNIA 1BYMA 4EMKC 4XU3A 3SWNC 1YJNT 2KDSA 4OGCA 3RMSA 3MO8A 4OB0B 3BY7A 3AHUA 4CI0C 5IAYA 4M75A 3CCUT 3BDUA 2K57A 3OMGA 2VUBA 2FYKA 2FVUA 3ER0A 4XTXA 2XDPA 4M77G 5GAMg 1WQ7A 1QP2A 3SWNA 5LJ5f 2LC4A 3PIPA 3CPWA 4OP0A 5GMKi 4PL6A 1MGQA 2RI5A 3OSSC 3OYYA 5D6XA 1JJ2S 3JCMh 4HKEA 3PMTA 5GANg 2LDMA 2E10A 4ZTJA 4BI4A 4KBMB 4ZGEB 1I4K1 2DXTA 3F70A 3OYDA 3L2VA 1VQ9T 2JTMA 3L2ZA 3M59A 3A8OB 2HQEA 1YBYA 2FL7A 3QJYA 4QW2A 1N6AA 3P8BB 2E12A 1ZQ1A 1Y7XA 3INZA 2IVWA 4C8QD 4KUDK 3JAME 1OI1A 5A2QE 2DIQA 2V8IA 4M77A 1S72T 4M77E 2BUDA 3T9NA 2L8DA 2LTOA 4C92A 3JCMc 1QVFS 3EAEA 4M75D 4CRIA 1KHCA 4JDSA 3LH0A 1QVGS 1Q86C 3CCVT 1N9SA 2MWOA 1M90C 2PVDB 4O6JA 2EYQA 4PJOB 2M1HA 3JCMd 5GAN3 3M5AA 1EIFA 4OVAA 3OYAA 1NZ9A 1WJRA 3I55A 3KXTA 4LDXA 4M7DC 1FXXA 4PLLA 1WPYA 1VQ6A 4JUVA 5CKBA 2FHDA 2M9UA 4BD3A 2ZPIB 3OYLA 1VQPA 3A5ZB 1VQNT 1M9SA 4EPCA 4XTWA 2CZ6B 4XAXB 3FLGA 4Z02A 4DOVA 3NTIA 1NE8A 3CBOA 3CC2A 2RJCA 2EFIA 4J7FA 5GANh 1BI1A 1HXDA 5GAMf 1YIJA 3HRSA 5J26A 4M77D 1FX7A 2HAXA 2VYTA 1I81A 4LDUA 3ZFJA 3RERA 3GLXA 4IURA 1WNLA 1Y07A 3J7AF 3DKMA 1LNXA 2L5QA 4HA8A 4PNOA 2EQUA 4MDXA 1KQ1A 3HSBA 3OYKA 2KY9A 4JJNK 5LJ3j 3CCQA 2MAMA 4NS5A 4NL2A 4JRKA 2PUOB 4N4HA 5HKCA 2RK2A 1YJWA 4F7UF 1UGPB 2PQWA 1VQ6T 1VQKT 1YJWT 2MI6A 1ZHIA 4FT4A 4R55A 4JRPA 1X01A 3JCMP 2MWPA 3M55A 4M78D 4BI8B 2K2VA 1UGSB 1VQKA 4WF2A 2QQAA 4M7DD 4M75G 3CCJT 4JS4A 2I2LA 1M1KC 4XQ3A 5I21A 5GAN4 5FRNA 2V8KA 2DD5A 3A8HB 3M56A 3CMET 1VQOT 4M75B 2EKOA 1KQ2A 5CKEA 2YLBA 1TH7A 1V29B 2P0PA 1YHQT 4XU0A 2EAYA 3P8DA 3HFOA 4RMOA 2M0OA 2XKOC 4DQ2A 2ZPEB 1JJ2A 3FIFA 1YITA 4MZPA 2QEXT 3CCMA 4BACA 2CZ7B 2XDBA 3MEVA 3JCMX 3VUZA 1YITT 2QQRA 2NLUA 3FDRA 4NOYA 4HCCA 5KH6A 2FB7A 3ME9A 4M75E 4PJOF 3JB9F 2KAFA 4B9WA 2K5IA 1G5VA 2EQKA 3FEOA 4ZN3A 3FJPA 5GMKj 4M78E 4BE2A 1G3WA 3QZ9B 2RI3A 4N0AA 3JB9H 2JTFA 2LCCA 3OS0A 1X75C 3GF5A 2KSSA 4M75C 3VV0A 1KQSA 2OTJT 3I55T 4L59A 2DXCA 3QBYA 1VQOA 1IZ6A 4IUPA 3OY9A 4MDWA 3DB4A 2EJFA 2LVMA 2LT1A 1YJ9A 5GAN8 5GAOq 4M7AA 2RA2A 1XQHA 4QVZA 2CZ1B 3M58A 5GAOr 1VQ5T 3G71A 4HT9A 2E65A 3OYMA 2VV5A 3QZ5B 5IN1A 1G3TA 3JSCA 5GAMh 3QG1A 4M78G 4A4FA 4M7DG 2VXEA 5LJ3f 3S3NA 3DB3A 1WJSA 4OB1B 1M1GA 4D6WA 2K4YA 4M7AG 2QXFA 5DY9A 4MZMA 3P8HA 3JCMV 3EFRA 2RJFA 3URGA 3L1AA 1M1KU 1BI3A 3X28B 3WVEB 5CKHA 2OTLT 1LJOA 2F69A 4JLGA 3C95A 3OYHA 1N8RC 3TCJA 5LL6S 2DTOA 4IUTA 4X9CA 3HPWA 3E9GA 3OYEA 5A0DA 4P5NA 1YCYA 4M75F 3H6ZA 2DXUA 4M7DE 4PJOE 2OTJA 5FROA 1K9MU 2RHXA 3E19A 4M7AE 2A7YA 2R58A 2MF2A 2ZPHB 3DLLA 5GAN7 4C92B 2EJ9A 3CCSA 5LJ5g 3NTKA 4RCCA 4YTLA 4M7AC 3OYIA 3FRNA 4C0FA 2DK3A 2D9TA 1KHIA 2GFAA 2RO0A 3RKYA 3VUBA 1OYXA 4C0GA 3JCMQ 5DM7R 4GLKA 3BFMA 4M78B 2CYZB 2GCXA 3G7ZA 3H8ZA 4X9DA 3M4GA 3UT1A 4VUBA 1H3ZA 4OB3B 3UWNA 3WVDB 3QYHB 3C4SA 1OZ3A 2VC8A 2XHCA 5KCHA 2DPPB 4XTVA 3G6ET 3SD4A 4O5VA 5KE2A 3OYCA 2CGHA 2YHTA 3V8KA 4M77F 3VJPA 4C0ZA 1VQ4A 4FL6A 4J83A 3CXCS 4ZN1A 1ZBXA 2XIDA 5I2SA 2B8AA 3EFSA 1BI0A 4IUVA 1VQLT 2DD4A 1B34A 2O01E 3LX7A 4OB2B 4M7AD 2Y4YA 2DTIA 5I2MA 3X24B 2L3RA 1MHNA 2X4YA 2E6NA 3CC4T 3WXMB 4LDYA 3ZBDA 2K3YA 3V7CA 4DA4A 4C8QA 3J80E 3G71T 3GP8A 3CMAT 3CPWS 3G4SA 1Q7YU 1DJ7B 4ZTFA 4ZGJB 4EMHA 3DLMA 2QA4A 2LT4A 3BW1A 3M53A 2RD1A 3META 5LJ3g 5GAOl 2QA4T 3Q1JA 3RKXA 3G6EA 2ZPFB 3N5BB 3QUIA 5GAOp 1Q82C 1K8AC 1QW1A 3SFMA 2JZ2A 4BUGA 4R56A 2MMPA 2VXFA 4M78A 4XTYA 3RUXA 1UGRB 4E7JA 2QI2A 4XTUA 4C8QF 1LOJA 2RHIA 4N4GA 3CCJA 1YI2T 2OTLA 4NL3A 3OS2A 4BE0A 1W2BS 5M9OA 4J7IA 5FU6B 2DZCA 3L42A 3RMQA 2XD0A 1VQPT 4HCBA 3MP1A 1UEBA 3HRUA 4FIBA 5GMKm 3CCRA 2E1HA 2LX9A 3S6WA 1VQLA 2LQKA 1VIEA 3M9QA 2R5AA 2RHUA 4E7LA 2DVEA 5KCOA 2ZPGB 3SDZA 2AHJB 2DEQA 1BIBA 3V7RA 3LYIA 3L2RA 1QP3A 3CC4A 3ASKA 2P0KA 3LLRA 2P0QA 4J6XA 1I8FA 2GFUA 3CEYA 3TU4K 4PKCC 1SSFA 1XOVA 5CQYA 3JCMg 2QQSA 3HRTA 2RJDA 4XK8E 2BIVA 2XG8D 2K5FA 3CCQT 2CKKA 2JVVA 2ZZDA 4M78C 3CD6A 4J5YA 4PJOG 3CCUA 3PTAA 4QQDA 2ZCFB 1YI2A 5GAN2 4HT8A 4QQ6A 2LRQA 3GNFB 5LJ5j 1YJNA 5DLOA 1M4ZA 1UB4A 1VQNA 3QSUA 4X34A 4LDWA 3RKWA 3JCMJ 3GIBA 2H3JA 3QJ6A 1NPRA 2P4TA 3CXCA 4BB7A 1M1FA 3OS5A 2DZ9A 2RH2A 2JNGA 2XICA 4ATOA 4A53A 4FT2A 4C8QC 2Y90A 3CC7A 5FLXE 4EMKA 1K73U 2JUFA 2LCLA 2G3RA 3CC7T 3CCRT 1VQ8T 3V7SA 4IUQA 1KG1A 1Q7YC 2L89A 1WJQA 1Y71A 5FU7B 4Y91A 4BY6B 3L2UA 1W4SA 3JB9J 1NJIC 5CKFA 2DKGA 2KQWA 4C0DB 5D6WA 2JOYA 3QHSA 5GAMd 2A3LA 3VU3C 4M78F 3VYHB 5KE3A 1KC8C 2YLCA 1XTDA 3J81E 1B34B 3GPLA 2O4XA 2E6ZA 1U1SA 4N4IA 4XU2A 4EMKB 1D3BB 4BDYA 1I5LA 1S72A 3A8GB 4Y28E 2X35A 1WQWA 3MEWA 2HQXA 4RKUE 2PUKB 4F7UG 3KBGA 3JCMe 3GOXA 2CS7A 4C8QB 5LJ5h 3NTHA 3PFSA 3PT9A 4L6V5 3V8JA 5A0LA 3SB2A 4TVRA 3FB9A 5A0GA 5FU7C 4A4HA 1JB0E 3LW5E 5GANj 4PJOA 3V8LA 1VQ9A 3OYFA 1VQ8A 4E7KA 4C92F 4A4GA 3C12A 3OW2A 2WSEE 4PLIA 1FWZA 1YJ9T 2QEXA 3CC2T 4PJOD 1QVGA 3M54A 1JRIA 4EDUA 4A4EA 1YHQA 3OQ5A 3FC3A 4PJOC 3MCAB 4FU6A 4ELYC 5CQXA 4JS5A 3LWIA 4JLIA 2RI2A 1RL2A 4M7DB 3HHTB 5GAOn 1VUBA 2X4XA 1U1TA 2HD0A 2OAUA 1Q81U 4M7AF 4RG2A 3JB9I 3X26B 5CAIA 4XU1A 4F7UB 3CCVA 3JB9G 4QVCA 5LJ5d 1KD1U 4M77C 2VGMA 4KUIA 2D0QB 2QTXA 5CVIA 4ME7A 1PSEA 2QQBA 3PGGA 3OA6A 1VIFA 4C5EA 5FRMA 2YRVA 2X4WA 2HBPA 4HCZA 1R8OB 3HP9A 4MZTA 2RJEA 1JBMA 3MEAA 4BDZA 3O8VA 3OSVA 3OS1A 1HK9A 4OF1A 5L8RE 1K8AU 4J6WA 1QVPA 2K5LA 2K3XA 3OYNA 5D6YA 3L2QA 1VQMT 1KQSS 3CMEA 3CBMA 2E70A 1M5Q1 3G4ST 3S3MA 2EQMA 2V8JA 1M8VA 3OBYA 2E64A 4RCBA 4V2SA 3S3OA 1N27A 2QQ9A 4JRIA 3RIRA 1VQ7T 2C06A 4F7UA 4C92C 4UC4A 1K73C 3CCMT 5LJ3e 3QXEB 3R6OA 2XK0A 3QDRB 3OYGA 2E5QA 4M7DF 3PIOA 3HKSA 4C92E 1NJIU 3QO3A 4L5GA 2X4JA 3OBWA 5C0MA 5LJ3h 2DAQA 5GANd 3QKJA 3OB9A 1G3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J3B A;  1VQ4 T;  3CCQ T;  1VQ9 T;  2CKK A;  2JVV A;  3CD6 A;  3CCU A;  4QQD A;  1YBY A;  5DLQ E;  1YI2 A;  3DB3 A;  1YJN A;  2DO3 A;  1VQN A;  3P8B B;  1M1G A;  4X34 A;  3JAM E;  5A2Q E;  1NPR A;  3CXC A;  3OW2 S;  1S72 T;  1M1K U;  1VQM A;  2IG0 A;  2OTL T;  1KC8 U;  1QVF S;  2JNG A;  3CCS T;  4CRI A;  3CC7 A;  5FLX E;  1N8R C;  1K73 U;  3CMA A;  2JUF A;  3LH0 A;  5LL6 S;  1Q86 C;  1QVG S;  2LCL A;  3CCV T;  1VQ5 A;  2G3R A;  2MWO A;  3CC7 T;  3CCR T;  1VQ8 T;  1VQ7 A;  1YIJ T;  1Q7Y C;  1M90 C;  3LGL A;  1NJI C;  2OTJ A;  1EIF A;  5IT9 E;  1NZ9 A;  3I55 A;  1K9M U;  2JOY A;  1VQ6 A;  3DLL A;  1KC8 C;  3I56 T;  1VQN T;  1VQP A;  3A5Z B;  1XTD A;  3J81 E;  3LGF A;  3CCS A;  2E6Z A;  4YTL A;  3I56 A;  1M90 U;  5DM7 R;  1KHI A;  1S72 A;  2LQ8 A;  3CC2 A;  5HY6 A;  1NPP A;  1YIJ A;  5J26 A;  3CPF A;  3KBG A;  1Q82 U;  2XHC A;  3J7A F;  1BKB A;  3G6E T;  4TVR A;  1VQ4 A;  3CCQ A;  1VQ9 A;  3CCE A;  1VQ8 A;  3CXC S;  3OW2 A;  4ZN1 A;  3CC2 T;  1YJ9 T;  2QEX A;  2EIF A;  1K9M C;  3CCL T;  1YJW A;  1QVG A;  1VQL T;  1X6O A;  1YHQ A;  1VQ6 T;  1QVF A;  1VQK T;  1YJW T;  3CCL A;  2L3R A;  2MI6 A;  3CC4 T;  2MWP A;  1VQK A;  1RL2 A;  1N8R U;  3TRE A;  3CCJ T;  1Q81 U;  1KD1 C;  4RG2 A;  1M1K C;  3J80 E;  3G71 T;  3CMA T;  3CPW S;  3G4S A;  3CCV A;  3CME T;  1Q7Y U;  1VQO T;  2QA4 A;  1Q81 C;  1KD1 U;  1Q86 U;  1YHQ T;  2QA4 T;  1JJ2 A;  3G6E A;  1YIT A;  2QEX T;  3CCM A;  1Q82 C;  1K8A C;  1XNI A;  3CCE T;  1YIT T;  3CCJ A;  1YI2 T;  1K8A U;  2KVQ G;  1VQM T;  2OTL A;  1W2B A;  1KQS S;  3CME A;  1W2B S;  3CD6 T;  3G4S T;  2E70 A;  4ZN3 A;  1VQP T;  1YJN T;  1UEB A;  2KDS A;  1VQL A;  3CCR A;  1VQ7 T;  1K73 C;  5IAY A;  3CCM T;  3CCU T;  1KQS A;  2OTJ T;  3I55 T;  3PIO A;  3CC4 A;  3HKS A;  1NJI U;  3ER0 A;  1VQO A;  1IZ6 A;  3DB4 A;  3PIP A;  2LVM A;  3CPW A;  1SSF A;  1YJ9 A;  3OYY A;  1VQ5 T;  1JJ2 S;  3G71 A; 
#chains in the Genus database with same CATH topology
 2M16 A;  5J3B A;  3CXC P;  2ZPB B;  1VQ4 T;  4BY6 C;  4A54 A;  1B7T A;  1IHV A;  1F1B B;  2RM4 A;  4QT7 A;  3CMA Q;  1MMN A;  1QKX A;  3PE0 A;  2WSC E;  4RG8 A;  4ZGD B;  1VQM A;  3E1S A;  1WLP B;  4XTZ A;  4JRQ A;  2JW4 A;  3CCS T;  3M0R A;  3C94 A;  1Y96 B;  2EBP A;  2L3Q A;  4E7Z A;  2DL4 A;  2GQV A;  2RK1 A;  5GMK e;  1GXI E;  3IQL A;  4OMF B;  5CO7 A;  1YJ9 Q;  5C6S A;  4KGZ B;  3M4Y A;  1YN8 A;  2DRM A;  4EMG A;  1TUD A;  1J3T A;  2XU8 A;  1OU9 A;  5GAM e;  5CK9 A;  4C8Q E;  2OTL Q;  4E7H A;  4MMK A;  4Q5W A;  5FU6 C;  2CP2 A;  4MML A;  2HKN A;  1AT1 B;  2J6K A;  1YWP A;  2ROT A;  2FPE A;  4J9C A;  1X6G A;  3TRE A;  2EJG A;  2R57 A;  3M0U A;  1A0N B;  4C5H A;  1VQP Q;  1NM7 A;  2DIG A;  3CD6 Q;  1ZA2 B;  6AT1 B;  1U8R A;  3QPH A;  2EGE A;  4B6M A;  2KVQ G;  3EG3 A;  3H0H A;  2RHZ A;  1Y0M A;  4XU3 A;  1VQ7 Q;  3RMS A;  3BY7 A;  2X3W D;  1WHK A;  4M75 A;  3OMG A;  2QG9 B;  2FYK A;  2FVU A;  1WI7 A;  1WQ7 A;  2LC4 A;  3CPW A;  4OP0 A;  4PL6 A;  1JJ2 S;  3JCM h;  4HKE A;  3PMT A;  5GAN g;  2LDM A;  1W6X A;  8ATC B;  1SKU B;  3A8O B;  2EPD A;  1FMK A;  3R6N A;  1N6A A;  5IXF A;  2F2X A;  1Y7X A;  1JO8 A;  2DIQ A;  1S72 T;  2L8D A;  1YCS B;  1FMW A;  1QKW A;  4JDS A;  1MMA A;  1VQ6 Q;  2FG0 A;  3LH0 A;  1N9S A;  3A1P A;  1EFN A;  3I55 A;  4M7D C;  2K2M A;  2KXD A;  1UJY A;  2FHD A;  2NUP B;  3VRZ A;  3OYL A;  1VQP A;  1PM3 A;  2KYM A;  4XAX B;  4Z02 A;  3FLG A;  2HKQ B;  2LZ6 B;  1NE8 A;  2RJC A;  5GAN h;  4M77 D;  1KSW A;  3ZFJ A;  5IHN A;  1KIK A;  4NS5 A;  4NL2 A;  2COW A;  5HKC A;  2RK2 A;  4FW1 A;  4F7U F;  1SF9 A;  1WHJ A;  1VQ6 T;  1VQK T;  1ZHI A;  2BE7 D;  3M55 A;  1VQK A;  2OTJ Q;  4BI8 B;  1TG0 A;  4M75 G;  2I2L A;  5KYY A;  1KJW A;  1BCO A;  3A8H B;  3NMZ C;  5CKE A;  1V29 B;  3FIF A;  1AWX A;  2DA9 A;  3CCM A;  4BAC A;  1K73 R;  1OV3 A;  3JCM X;  2DL5 A;  4WCI A;  2FB7 A;  4DBR A;  2L3S A;  3VS6 A;  2K5I A;  2EQK A;  4ZN3 A;  1B3Q A;  1G3W A;  2RI3 A;  1X75 C;  3VV0 A;  1KQS A;  3I55 Q;  4L59 A;  7AT1 B;  2DXC A;  3OY9 A;  3EFO A;  2LT1 A;  4HT9 A;  1NYG A;  1ZSG A;  2EGA A;  3CC4 Q;  3OYM A;  1MMG A;  1QWE A;  3JSC A;  1RAD B;  1RLP C;  5IN1 A;  4M78 G;  4Z89 A;  5GAM h;  1WJS A;  1M1G A;  4D6W A;  3G71 Q;  5DY9 A;  1XJW B;  3P8H A;  3JCM V;  1X2Q A;  1S1N A;  3C95 A;  3OYH A;  3TCJ A;  5LL6 S;  2OI3 A;  4X9C A;  3HPW A;  2RQT A;  5A0D A;  2JMC A;  2OTJ A;  2COY A;  3E19 A;  1U5S A;  3DLL A;  2RMO A;  3I5R A;  1QCO A;  2NUT A;  2KE9 A;  3NTK A;  4RCC A;  4YTL A;  2JJ9 A;  1AVZ C;  4C0G A;  3JCM Q;  3M4G A;  1U3O A;  3WVD B;  1VYU A;  3OYC A;  4M77 F;  4FL6 A;  3CXC S;  2XID A;  4E2F B;  3EFS A;  4IUV A;  2Y4Y A;  1MHN A;  4LE9 A;  2E6N A;  3CC4 T;  1M3C A;  2L3P A;  3ZBD A;  2KI7 A;  3V7C A;  4C8Q A;  3FJ5 A;  4GLM A;  3I35 A;  3CPW S;  2SRC A;  1E7O A;  2RD1 A;  3MET A;  1QVG P;  3Q1J A;  4AMC A;  3G6E A;  2ZPF B;  2F2W A;  2EYZ A;  1EX4 A;  3H9N A;  5IHK A;  4XTU A;  1BB9 A;  2RHI A;  4N4G A;  2OTL A;  2KRS A;  1VA7 A;  1VQP T;  1WHG A;  1SRM A;  1M2V B;  3HRU A;  1JJ2 P;  2E1H A;  1OPK A;  3M9Q A;  2YUQ A;  4OMN A;  2DVE A;  5KCO A;  2ZPG B;  3RNJ A;  1SPK A;  5IH2 A;  1X43 A;  3LLR A;  1NG2 A;  4R0K A;  4JJB A;  2KT1 A;  1K4U S;  1I8F A;  2GFU A;  1SSF A;  1XOV A;  1YJN Q;  3JCM g;  2CSQ A;  3HRT A;  1H8K A;  2JVV A;  3CD6 A;  2IIM A;  3BE3 A;  2ZCF B;  1LPL A;  5LJ5 j;  1VQN A;  5DLO A;  1M4Z A;  3EGD A;  3EH2 A;  3GIB A;  2H3J A;  3OS5 A;  2JNG A;  2XIC A;  4C8Q C;  1JXO A;  3CQT A;  3V7S A;  1ABO A;  1WJQ A;  1Y71 A;  4BY6 B;  1NJI C;  2BTT A;  2JOY A;  2A3L A;  5I22 A;  4N4I A;  4JJD A;  1PRL C;  3A8G B;  4Y28 E;  3EG9 A;  3G6E Q;  5ECA A;  2HQX A;  1VQ8 Q;  1BU1 A;  2CS7 A;  4C8Q B;  5LJ5 h;  3ULR B;  3PT9 A;  5A0L A;  3FB9 A;  5GAN j;  3LW5 E;  3V8L A;  1VQ9 A;  3OYF A;  2DFU A;  3VRY A;  1V76 A;  1VQ8 A;  4PJO D;  2QAS A;  2QEX A;  1WIE A;  3M54 A;  1YHQ A;  3FC3 A;  4PJO C;  3TVT A;  3MCA B;  2PTK A;  3NGP A;  4FU6 A;  4JS5 A;  1VQ9 Q;  1M2O A;  1RL2 A;  4RTU A;  2HD0 A;  4FYV B;  1M2V A;  4XU1 A;  3CCV A;  4Z88 A;  2E5K A;  1T3L A;  3M0S A;  2ZAE A;  5CVI A;  5FRM A;  4MZT A;  1VQM T;  1QVP A;  5D6Y A;  1GCQ C;  2V8J A;  4PJM A;  1WHH A;  3CCE Q;  3EGX B;  4V2S A;  4JRI A;  1NEB A;  4F7U A;  2HBW A;  4UC4 A;  1K73 C;  1ZUK A;  2YUP A;  3QXE B;  3R6O A;  3OYG A;  4M7D F;  3PIO A;  4C92 E;  3QO3 A;  2X4J A;  2BZX A;  1X69 A;  5C0M A;  2DAQ A;  2CUB A;  1O75 A;  1Z9Z A;  2LNV A;  3EGX A;  2DYI A;  5HK0 A;  4FSX A;  3UPU A;  2BE9 B;  2FRW A;  5LJ5 e;  3UA6 A;  1IRE B;  3KUF A;  2L2P A;  2MCN A;  2F5K A;  2MYS A;  3OW2 S;  1D0X A;  2ROL A;  2NUP A;  5GAM j;  1KC8 U;  2JN0 A;  1PC0 A;  1SSH A;  2ZGW A;  3SWN B;  4F7U E;  2G6F X;  2OAW A;  1VQ5 A;  1W70 A;  1D0Z A;  1T0H A;  2Y4X A;  4FM4 B;  3L2W A;  1YIJ T;  2CP0 A;  2XI9 A;  5IT9 E;  2M0Y A;  3LWH A;  1HD3 A;  3CCV Q;  4KGV B;  4J9I A;  2EKH A;  3JCM f;  2X3X D;  3VKI A;  5GMK h;  3NFC A;  1M90 U;  2DE0 X;  5GAN e;  5HY6 A;  3OYB A;  1GRI A;  4KGX B;  1NPP A;  4QQG A;  3CPF A;  4IKF A;  4N0A C;  1Q82 U;  1BKB A;  2RF0 A;  1P92 A;  1FYN A;  3A8M B;  3M57 A;  4BE1 A;  1TXQ A;  3OYJ A;  2CP5 A;  2E41 A;  2HL5 C;  1YFN A;  5CIU A;  3U23 A;  3ZEH A;  1QVF A;  2RQR A;  2KXC A;  4Z8A A;  2XDD A;  3CBP A;  3HL8 A;  2B86 A;  1KD1 C;  1UJ0 A;  1GL5 A;  2WAC A;  3VYG A;  5GAN f;  1Q86 U;  3OMC A;  4DBQ A;  2O4X B;  1YI2 Q;  1BCM A;  2FO0 A;  3TQ7 P;  5GMK l;  4M7D A;  5GAN 6;  3CCE T;  1TSF A;  1UGQ B;  2DTH A;  1PSF A;  1WHL A;  3EFO B;  3JCM b;  4B9X A;  4M7A B;  2K6D A;  8AT1 B;  1YIT Q;  1O9S A;  4DEY A;  3CCM Q;  4EMK C;  1YJN T;  3SWN C;  2KDS A;  4OGC A;  4IIO A;  1TTH B;  1YWO A;  3ER0 A;  2CUD A;  5GAM g;  1QP2 A;  3OSS C;  1YP5 A;  2PZ1 A;  4PFP A;  3VS0 A;  1MV0 B;  5KYN A;  1VQ9 T;  1I4K 1;  1U06 A;  3OYD A;  4HVU A;  5EC7 A;  2JTM A;  3VS1 A;  4DEX A;  1YBY A;  2EGC A;  2VWF A;  3QJY A;  2FL7 A;  2H8H A;  3P8B B;  1ZQ1 A;  2KNB B;  3JAM E;  1OI1 A;  4M77 E;  3T9N A;  1KC8 R;  3EAE A;  4M75 D;  2LQN A;  1KHC A;  1QVG S;  1Q86 C;  3CCV T;  1MNE A;  2MWO A;  4PFO A;  2M1H A;  4AT1 B;  3JCM d;  5GAN 3;  4OVA A;  3OYA A;  4LDX A;  5FWB A;  4JUV A;  2M9U A;  1C1A A;  3NTI A;  3CBO A;  4J7F A;  2HSE B;  1BI1 A;  5GAM f;  3EH1 A;  3HRS A;  2JM8 A;  3RER A;  1I81 A;  3GLX A;  4LN2 A;  1LNX A;  2L5Q A;  4HA8 A;  1CSK A;  2KY9 A;  2MAM A;  1QCF A;  2PUO B;  1YJW A;  3CC7 Q;  2FEI A;  5AT1 B;  1UGP B;  1YJW T;  4R55 A;  1X01 A;  4KH1 B;  2C0O A;  2K2V A;  3CCJ T;  4XQ3 A;  5GAN 4;  5FRN A;  2DD5 A;  3M56 A;  3CME T;  1VQO T;  4XU0 A;  2EAY A;  2AZV A;  2M0O A;  2LCS A;  2DMO A;  4MZP A;  2CZ7 B;  3I9Q A;  3MEV A;  2A36 A;  2NYS A;  2NLU A;  4HXJ A;  3FDR A;  1RAC B;  4B9W A;  3FEO A;  4CC3 A;  3FJP A;  5GMK j;  1K0S A;  4BE2 A;  1RLQ C;  3MPU B;  2LCC A;  2OTJ T;  2DX1 A;  2MIO A;  3I55 T;  1Q81 R;  4IUP A;  4MDW A;  3DB4 A;  1YJ9 A;  1XQH A;  2CZ1 B;  4FCY A;  3G4S Q;  1PD1 A;  1R77 A;  4RTY A;  3QZ5 B;  3QG1 A;  2QGF B;  2DET A;  5LJ3 f;  4OB1 B;  4M7A G;  4MZM A;  3EFR A;  1M1K U;  5CKH A;  1X27 A;  3CME Q;  2FZK B;  1AZG B;  2GQI A;  2ENM A;  4M75 F;  5FRO A;  2DL8 A;  1K9M U;  4M7A E;  2R58 A;  2MF2 A;  5GAN 7;  4C92 B;  2EJ9 A;  3CCS A;  1AD5 A;  4AFQ C;  5LJ5 g;  2JXB A;  1M27 C;  2D9T A;  1KHI A;  3PVQ A;  1OYX A;  4GLK A;  3BFM A;  4M78 B;  1H3H A;  2CYZ B;  2YXY A;  3UT1 A;  4PJN A;  4OB3 B;  4X1V A;  5KYY B;  4J9H A;  3C4S A;  3QDF A;  2XHC A;  3TSW A;  4JZ4 A;  4O5V A;  2CGH A;  2YHT A;  4C0Z A;  1KD1 R;  4J83 A;  3VS4 A;  1ZBX A;  1BI0 A;  4J9E A;  2O01 E;  3LX7 A;  4M7A D;  2KRO A;  2L3R A;  1OQK A;  2SEM A;  4LDY A;  3OW2 P;  5I11 A;  3CMA T;  3G4S A;  1QVF P;  4ZTF A;  4ZGJ B;  3DLM A;  2V1R A;  2CH4 W;  2LT4 A;  5LJ3 g;  1S72 Q;  1UE9 A;  1ZA1 B;  4CC2 A;  3RKX A;  1NYF A;  1ZBJ A;  5GAO p;  1K8A C;  2JZ2 A;  4BUG A;  4R56 A;  2MMP A;  2VXF A;  4M78 A;  2QI2 A;  1LOJ A;  1OUL A;  1W2B S;  1SHF A;  2DZC A;  3L42 A;  2XD0 A;  3MP1 A;  1G83 A;  1VQL A;  3S6W A;  1VIE A;  2R5A A;  2RHU A;  2DEQ A;  1BIB A;  3V7R A;  3LYI A;  3L2R A;  1ZLM A;  3TU4 K;  2KBT A;  5CQY A;  2J6O A;  2QDL A;  2ZZD A;  3EHQ A;  1ACM B;  4J5Y A;  4PJO G;  1UHF A;  1YI2 A;  4HT8 A;  5GAN 2;  1HSQ A;  4QQ6 A;  2LRQ A;  4IIM A;  1M90 R;  2K79 A;  2DRK A;  4LDW A;  3RKW A;  2KRM A;  2CRE A;  3JCM J;  1JQQ A;  2DL3 A;  3QJ6 A;  3CXC A;  1M1F A;  5IXB A;  1C0M A;  4FT2 A;  1Q95 G;  5FLX E;  4RTW A;  2LCL A;  5FU7 B;  2GTO A;  1ARK A;  3NPF A;  2K3B A;  5KYW A;  1KC8 C;  1B34 B;  2O4X A;  4XU2 A;  4EMK B;  1X2K A;  1I5L A;  1S72 A;  3MEW A;  4RKU E;  4F7U G;  1K0X A;  1IO6 A;  1ZUY A;  1N8R R;  3V8J A;  1IXD A;  3SB2 A;  4A4H A;  4E7K A;  4A4G A;  2RQU A;  1FWZ A;  1YJ9 T;  4RTT A;  3CCR Q;  4A4E A;  2EYW A;  1PHT A;  5CQX A;  2O9S A;  2RI2 A;  2J7I A;  4M7A F;  1GBR A;  3JB9 I;  5CAI A;  4DBF A;  4RUG A;  4M77 C;  1WA7 A;  2QTX A;  3OA6 A;  4C5E A;  2X4W A;  2HBP A;  1R8O B;  2O2O A;  3A98 A;  3OSV A;  3OS1 A;  1M1K R;  1G2B A;  1K8A U;  3OYN A;  3L2Q A;  1SEM A;  2E70 A;  1M5Q 1;  2E64 A;  4RCB A;  4LNP A;  1N27 A;  2QQ9 A;  2AIR B;  3CCM T;  5D7U A;  5LJ3 e;  2XK0 A;  2V26 A;  2IPO B;  1Q86 R;  3OB9 A;  1G3S A;  1Q82 R;  3HFN A;  3UDC A;  1E6H A;  3X25 B;  2VGN A;  1VQM Q;  1Y96 A;  2COZ A;  3PMI A;  4KH0 B;  3TEE A;  2RB6 A;  4LD6 A;  2J6F A;  4C5G A;  3EG0 A;  3JB9 D;  1JEG A;  3PNW C;  4J8O A;  1AHJ B;  2V1Q A;  3JRZ A;  3CMA A;  1RAA B;  5GAO m;  1VQ7 A;  4FYY B;  2H3E B;  4QVD A;  4DOW A;  2A08 A;  1PD0 A;  2BZY A;  2EVR A;  3I56 T;  1BI2 A;  4II1 A;  3M0P A;  1ZSZ C;  2D6F A;  4J6Y A;  1CKA A;  3I56 A;  4D8D A;  2GF7 A;  3A8L B;  4LUD A;  5EG2 A;  2DJQ A;  2KEA A;  1GFD A;  3I56 Q;  1H64 1;  1BIA A;  5AYF A;  4C5I A;  1N9R A;  2EIF A;  1IRX A;  3CCL T;  1UUE A;  1K9M C;  3MP6 A;  3CCL A;  2K9G A;  1RAE B;  3D7S B;  4OGE A;  2C0T A;  4C8Q G;  1D1C A;  3EG2 A;  1RI9 A;  1ZX6 A;  3UAT A;  3VS7 A;  1QWF A;  2PVG B;  3GNG A;  1MND A;  3MKD A;  4IUU A;  4KT0 E;  2PU9 B;  2PVO B;  2P84 A;  4OB0 B;  1T0J A;  5IAY A;  3CCU T;  2K57 A;  5L23 A;  2XDP A;  3SWN A;  2JT4 A;  3PIP A;  1WDX A;  1GCQ A;  2E10 A;  4ZTJ A;  4KBM B;  3F70 A;  1OX9 A;  2AT1 B;  1K9A A;  3JV3 A;  3HTR A;  2QK0 A;  4QW2 A;  2E12 A;  4C8Q D;  3INZ A;  2IVW A;  4KUD K;  1V1C A;  1TS9 A;  2LTO A;  4C92 A;  2E3H A;  1M90 C;  4O6J A;  2EYQ A;  2VVK A;  3VS3 A;  2KR3 A;  3VS2 A;  3M5A A;  1EIF A;  3VS5 A;  3KXT A;  2EW3 A;  1FXX A;  1ZUU A;  1WPY A;  1YIJ Q;  1VQ6 A;  1VQN T;  2MPX C;  2ZPI B;  3A5Z B;  1TUG B;  4EPC A;  4XTW A;  4DOV A;  3CC2 A;  2YWW A;  2EFI A;  4OMP A;  3REA B;  1HXD A;  1YIJ A;  1FX7 A;  2HAX A;  2VYT A;  4LDU A;  2JTE A;  4IUR A;  3J7A F;  3DKM A;  1K1Z A;  1KQ1 A;  1PG5 B;  3CCQ A;  3AT1 B;  4N4H A;  2CSI A;  1TWB A;  1WZO A;  4OMQ A;  2QGG A;  3CCQ Q;  2MWP A;  4M78 D;  4J9F A;  4M7D D;  4WF2 A;  2QQA A;  2LJ0 A;  3LH5 A;  4JS4 A;  1M1K C;  2D0N A;  1IB8 A;  1KQ2 A;  1PWT A;  2EKO A;  2YLB A;  1TH7 A;  2P0P A;  1YHQ T;  4RTX A;  3HFO A;  4RMO A;  2Z0W A;  2XKO C;  4DQ2 A;  2ZPE B;  1YIT A;  4FYX B;  2MK5 A;  2QEX T;  2XDB A;  1VYV A;  1YIT T;  4HCC A;  2CP6 A;  3ME9 A;  4M75 E;  1M3A A;  1QCN A;  1G5V A;  1VQ5 Q;  4M78 E;  5KYW B;  3QZ9 B;  4N0A A;  3JB9 H;  2JTF A;  3OS0 A;  3GF5 A;  1CKB A;  2KSS A;  4M75 C;  3QBY A;  1IZ6 A;  4RTV A;  4F04 B;  3RR6 A;  1EZZ B;  2EJF A;  4M7A A;  2DBM A;  4QVZ A;  3M58 A;  2CH4 A;  3G71 A;  2J05 A;  3CC2 Q;  4Y92 A;  2E65 A;  1JXM A;  2HDA A;  4GBQ A;  2ATC B;  2VV5 A;  1G3T A;  4A4F A;  1B07 A;  3DB3 A;  1OEB A;  2K4Y A;  2QXF A;  3URG A;  3L1A A;  1BI3 A;  4FYW B;  4K11 A;  3WVE B;  3X28 B;  2ED0 A;  4JLG A;  1N8R C;  2DTO A;  4IUT A;  2AKK A;  3M0T A;  3E9G A;  3OYE A;  1YCY A;  4PJO E;  2DXU A;  1UTI A;  2ED1 A;  4M7A C;  3OYI A;  4A63 B;  4C0F A;  2DK3 A;  2GFA A;  3QWX X;  2RO0 A;  3RKY A;  4WTO B;  1K9M R;  3H8Z A;  4VUB A;  1H3Z A;  1OX8 A;  2DVJ A;  3QYH B;  4PJJ A;  2O9V A;  1OZ3 A;  1UHC A;  2ABL A;  2DPP B;  3G6E T;  2HSP A;  5KE2 A;  3VJP A;  3V8K A;  3EGU A;  2A0F B;  1KFZ A;  1VQL T;  2DD4 A;  4OB2 B;  2DTI A;  5I2M A;  2X4Y A;  2YSQ A;  2RQV A;  4DA4 A;  3GP8 A;  1W1F A;  1Q7Y U;  1DJ7 B;  4EMH A;  3M53 A;  3BW1 A;  3QUI A;  3N5B B;  2E3I A;  1IGU A;  2LX7 A;  4XTY A;  1C6V X;  2AK5 A;  1UGR B;  2DF6 A;  1Z9Q A;  3CCJ A;  2D8J A;  4ESR A;  1NBE B;  4NL3 A;  3OS2 A;  1I5O B;  4BE0 A;  2HQH A;  5FU6 B;  1RAH B;  4HCB A;  2QEX Q;  2LQK A;  2KGT A;  1YHQ Q;  3SDZ A;  3REB B;  2P4R A;  2P0K A;  3CEY A;  2HL3 A;  2RJD A;  2LP5 A;  4XK8 E;  2XG8 D;  2ESW A;  1WX6 A;  2K5F A;  3CCQ T;  2GGR A;  3PTA A;  4QQD A;  1AZE A;  2GNC A;  1YJN A;  4AG2 C;  2CP7 A;  3RBB B;  2P4T A;  2EYX A;  1FMV A;  2DZ9 A;  2RH2 A;  4ATO A;  2M02 A;  3H0I A;  4A53 A;  3CC7 A;  1YJW Q;  1K73 U;  2HZY A;  2G3R A;  1TU0 B;  3CCR T;  1VQ8 T;  3CC7 T;  2D8H A;  4IUQ A;  1KG1 A;  4Y91 A;  1OOT A;  5CKF A;  2DKG A;  1TOV A;  3VU3 C;  2YLC A;  3J81 E;  2E6Z A;  5FW9 A;  2X35 A;  1PKS A;  3NTH A;  3PFS A;  4L6V 5;  3QSU A;  2KRN A;  4PJO A;  1JB0 E;  3EGD B;  2C0I A;  4C92 F;  3C12 A;  2WSE E;  4PLI A;  3TSZ A;  1TUC A;  1E6G A;  3LWI A;  4JLI A;  3HHT B;  5GAO n;  1VUB A;  2X4X A;  1U1T A;  2A37 A;  2OAU A;  1Q81 U;  2KYB A;  4RG2 A;  3X26 B;  4QVC A;  5LJ5 d;  1KD1 U;  1PRM C;  4JPB W;  4KUI A;  1RAG B;  3PGG A;  4HCZ A;  3HP9 A;  1NEG A;  1JBM A;  3MEA A;  4BDZ A;  1HK9 A;  4OF1 A;  5L8R E;  2K5L A;  2CDT A;  2CT4 A;  2K3X A;  3CME A;  3G4S T;  4J9D A;  2EYY A;  2EQM A;  1KK7 A;  4DBH A;  3S3M A;  4LXC A;  3OBY A;  1VQ7 T;  2C06 A;  9ATC B;  2ECZ A;  2E5Q A;  1UG1 A;  2CP3 A;  4L5G A;  1VQK Q;  3OBW A;  5LJ3 h;  2J06 A;  3QKJ A;  1WXU A;  2BKD N;  4LD9 K;  1SRL A;  2DJZ A;  4C0D C;  1AWJ A;  5DLQ E;  5CCA A;  1MMD A;  2DO3 A;  1G3Y A;  5FWC A;  1K76 A;  2PNI A;  1LCK A;  2GBQ A;  4C92 G;  2IG0 A;  3QII A;  2R5M A;  4E7I A;  1M30 A;  1VOM A;  5CKD A;  2VKN A;  2WSF E;  3LGL A;  2YRC A;  2QDY B;  2DYB A;  2EQJ A;  4ANJ A;  2CZ0 B;  4ELZ C;  2LJ1 A;  4ZNX A;  3LGF A;  4AG1 C;  2F5T X;  1M3B A;  4M77 B;  5CR2 A;  2LQ8 A;  3MEU A;  3X20 B;  1PNJ A;  5GJW B;  3QYG B;  2FPF A;  4ORZ A;  2EWN A;  3BDL A;  4KUL A;  2O31 A;  1NJI R;  1ABQ A;  3CCE A;  3MP8 A;  4GY5 A;  2O88 A;  2YRD A;  1X6O A;  4A4K A;  2F1L A;  2KMT A;  4C92 D;  2DXB A;  2NUZ A;  4PFZ A;  1N8R U;  1OZ2 A;  1RI0 A;  5HK3 A;  4BI3 A;  1RAB B;  3RDV A;  2X9H A;  5J39 A;  1Q81 C;  2DIL A;  4E47 A;  5GAN 5;  3SEM A;  5LJ3 d;  1D3B A;  1SG5 A;  1XNI A;  2KK4 A;  3MHX A;  3CPW P;  1QQJ A;  3E9F A;  4LDV A;  3JCM W;  1W2B A;  1WGS A;  2NWM A;  3CD6 T;  2RHY A;  2AKL A;  3RES A;  2HNI A;  3UA7 A;  1UGV A;  1BYM A;  1RAF B;  4JZ3 A;  3MO8 A;  3AHU A;  4CI0 C;  3THK A;  2JS0 A;  3BDU A;  2VUB A;  4XTX A;  1W2B P;  4M77 G;  5LJ5 f;  1I1J A;  5GMK i;  1QMC A;  1MGQ A;  2RI5 A;  3OYY A;  5D6X A;  2I0N A;  4BI4 A;  4ZGE B;  2DXT A;  3L2V A;  4HVW A;  3L2Z A;  2AZS A;  3M59 A;  2QTV A;  2HQE A;  1AOJ A;  2LMJ A;  3ZL7 C;  1ZSZ B;  2FZG B;  5A2Q E;  2V8I A;  4M77 A;  2BUD A;  3JCM c;  1QVF S;  4OMM A;  4CRI A;  4JJC A;  3H0F A;  2M51 A;  1MUZ A;  2PVD B;  4PJO B;  1NZ9 A;  1WJR A;  4PLL A;  5CKB A;  4BD3 A;  1M9S A;  4KRT A;  2CZ6 B;  2OX7 A;  2HEQ A;  2K7A A;  4CC7 A;  1Q7Y R;  3UF4 A;  5J26 A;  1AWO A;  4OML A;  1VQN Q;  1NLP C;  1WNL A;  1Y07 A;  4PNO A;  4MDX A;  2FZC B;  2EQU A;  3E2U A;  4LUE A;  5KYU B;  3HSB A;  3OYK A;  2XMF A;  4JJN K;  1ZSZ A;  5LJ3 j;  1I0C A;  2VAS A;  1K8A R;  4JRK A;  3H41 A;  1G8X A;  5HCK A;  1WYX A;  2PQW A;  1AEY A;  4PK4 A;  2MI6 A;  4JRP A;  4FT4 A;  5GJV B;  3JCM P;  2LJ3 A;  1UGS B;  5I21 A;  2V8K A;  3CCS Q;  4M75 B;  1D1A A;  3NHN A;  3P8D A;  2F2V A;  1JJ2 A;  2JM9 A;  3VUZ A;  2QQR A;  2RPN A;  2JMA A;  4NOY A;  5KH6 A;  2FRY A;  3JB9 F;  4PJO F;  2KAF A;  3KFV A;  1VQ4 Q;  4RTZ A;  1VQO Q;  2MOX A;  1UEC A;  4F14 A;  3CCJ Q;  1IGQ A;  4FW2 A;  2CT3 A;  4D8K A;  2LQW A;  1VQO A;  4PJL A;  2LNH B;  1UFF A;  2JS2 A;  2LVM A;  5GAN 8;  5GAO q;  1WXT A;  2RA2 A;  5GAO r;  1VQ5 T;  4J9G A;  1PKT A;  3GBQ A;  1R0C B;  2QA4 Q;  1UDL A;  1BBZ A;  4M7D G;  2VXE A;  2GTJ A;  3S3N A;  2X51 A;  2W0Z A;  1IHW A;  1RAI B;  2BZ8 A;  2YUO A;  3M0Q A;  2HCK A;  2HMA A;  2RJF A;  2OTL T;  4QKU A;  1LJO A;  1PCX A;  1YNZ A;  2F69 A;  1H92 A;  1M8M A;  3CCL Q;  4EIK A;  1SHG A;  4P5N A;  3H6Z A;  4M7D E;  1GCP A;  2RHX A;  1HJD A;  2A7Y A;  2ZPH B;  1KQS P;  1Y57 A;  2KT8 A;  4J9B A;  3FRN A;  3VUB A;  5DM7 R;  1LVK A;  4HCK A;  2GCX A;  4X9D A;  3G7Z A;  3UWN A;  4E7S A;  2DBK A;  1R0B G;  2VC8 A;  1GFC A;  5KCH A;  4XTV A;  3SD4 A;  1AWW A;  1VQ4 A;  4ZN1 A;  5I2S A;  2B8A A;  1B34 A;  2DNU A;  1RUW A;  3X24 B;  2FPD A;  2L0A A;  3WXM B;  2K3Y A;  4AFS C;  3J80 E;  3G71 T;  4E6R A;  2EQI A;  2QA4 A;  5GAO l;  2QA4 T;  4HVV A;  1Q82 C;  1QW1 A;  3SFM A;  3RUX A;  1MV3 A;  4E7J A;  4C8Q F;  1YI2 T;  1WFW A;  5M9O A;  4J7I A;  3PVL A;  3RMQ A;  2QAZ A;  1UEB A;  2DM1 A;  4FIB A;  5GMK m;  3CCR A;  1D09 B;  2LX9 A;  4E7L A;  2AHJ B;  3CC4 A;  1QP3 A;  3ASK A;  4J6X A;  2P0Q A;  1I07 A;  4PKC C;  1VQL Q;  2W10 A;  2QQS A;  4F17 A;  2BIV A;  4F16 A;  2CKK A;  2E4H A;  1WXB A;  4M78 C;  3CCU A;  1D0Y A;  2OJ2 A;  3GNF B;  1UB4 A;  4X34 A;  4FSS A;  1NPR A;  1GBQ A;  1T3S A;  4BB7 A;  1QLY A;  3I5S A;  3G1J A;  2Y90 A;  4EMK A;  2JUF A;  1X6B A;  1Q7Y C;  2L89 A;  5KYU A;  3L2U A;  3JB9 J;  1W4S A;  2KQW A;  4C0D B;  5D6W A;  3EHR A;  3QHS A;  5GAM d;  4M78 F;  3VYH B;  5KE3 A;  1XTD A;  2QYZ A;  3GPL A;  1U1S A;  1D3B B;  2VB6 A;  4BDY A;  3EG1 A;  1WQW A;  3QWY A;  3JCM e;  2PUK B;  3KBG A;  3GOX A;  2RN8 A;  1N5Z A;  4OMO A;  4TVR A;  5A0G A;  4AFU C;  2DL7 A;  5FU7 C;  3SHW A;  2D1X A;  3OW2 A;  2DER A;  3CC2 T;  1QVG A;  1JRI A;  4EDU A;  3OQ5 A;  1NLO C;  4ELY C;  1WHM A;  3EG9 B;  2A28 A;  4M7D B;  2RQW A;  4CC4 B;  4F7U B;  5KYX A;  3JB9 G;  2VGM A;  1D1B A;  3MJX A;  3CCU Q;  2NUT B;  2D0Q B;  4ME7 A;  1PSE A;  2QQB A;  1VIF A;  2YRV A;  1BK2 A;  2RJE A;  1VYT A;  3O8V A;  1JU5 C;  3O5Z A;  4J6W A;  1KQS S;  5KYX B;  3CBM A;  2DEU A;  1M8V A;  3S3O A;  3RIR A;  4C92 C;  5IHI A;  2DLP A;  4AFZ C;  3QDR B;  2YT6 A;  1HYO A;  3HKS A;  1NJI U;  2RNA A;  4M4Z A;  2YDL A;  1OPL A;  1OU8 A;  5GAN d;  2YUN A;  3C0C A; 
#chains in the Genus database with same CATH homology
 1O75 A;  2M16 A;  3HFN A;  5J3B A;  2LNV A;  2ZPB B;  2BKD N;  3UDC A;  4A54 A;  4BY6 C;  1VQ4 T;  3X25 B;  2VGN A;  4LD9 K;  2DJZ A;  5HK0 A;  1Y96 A;  4FSX A;  4C0D C;  3UPU A;  3PMI A;  5LJ5 e;  1IRE B;  3TEE A;  2RM4 A;  3KUF A;  5DLQ E;  2RB6 A;  4LD6 A;  2DO3 A;  5CCA A;  1G3Y A;  4C5G A;  3JB9 D;  2F5K A;  4C92 G;  3OW2 S;  4RG8 A;  2WSC E;  4ZGD B;  1VQM A;  3E1S A;  3PNW C;  4XTZ A;  4JRQ A;  2IG0 A;  4J8O A;  5GAM j;  1KC8 U;  2JN0 A;  3CCS T;  1AHJ B;  3QII A;  2R5M A;  2ZGW A;  3C94 A;  4E7I A;  3JRZ A;  3SWN B;  3CMA A;  1Y96 B;  4F7U E;  5GAO m;  1VQ5 A;  1VQ7 A;  5CKD A;  3L2W A;  2Y4X A;  1YIJ T;  2WSF E;  4FM4 B;  3LGL A;  4QVD A;  4DOW A;  2XI9 A;  2QDY B;  2EQJ A;  2GQV A;  5IT9 E;  2RK1 A;  5GMK e;  1GXI E;  3LWH A;  4OMF B;  2CZ0 B;  3I56 T;  4ELZ C;  1BI2 A;  4II1 A;  3LGF A;  5CO7 A;  2F5T X;  3JCM f;  4J6Y A;  3VKI A;  5C6S A;  5GMK h;  3NFC A;  3I56 A;  2GF7 A;  1M90 U;  2D6F A;  4M77 B;  3M4Y A;  5CR2 A;  2LQ8 A;  3A8L B;  5GAN e;  3MEU A;  5HY6 A;  3X20 B;  3OYB A;  1NPP A;  4QQG A;  3CPF A;  4IKF A;  4EMG A;  3QYG B;  2EWN A;  5EG2 A;  2XU8 A;  3BDL A;  4KUL A;  4N0A C;  1Q82 U;  5GAM e;  5CK9 A;  4C8Q E;  1BKB A;  1H64 1;  1P92 A;  3A8M B;  4E7H A;  4MMK A;  3M57 A;  4Q5W A;  4BE1 A;  3OYJ A;  1BIA A;  3CCE A;  5FU6 C;  5AYF A;  4C5I A;  1N9R A;  2E41 A;  3MP8 A;  4GY5 A;  2EIF A;  1K9M C;  3CCL T;  5CIU A;  1X6O A;  4MML A;  3ZEH A;  4A4K A;  3MP6 A;  1QVF A;  3CCL A;  2KMT A;  4C92 D;  2XDD A;  2DXB A;  3CBP A;  3HL8 A;  4OGE A;  1N8R U;  3TRE A;  1OZ2 A;  1RI0 A;  2EJG A;  2R57 A;  4BI3 A;  5HK3 A;  1KD1 C;  4C8Q G;  4C5H A;  2WAC A;  3VYG A;  5J39 A;  1Q81 C;  2DIG A;  5GAN f;  1Q86 U;  4E47 A;  5GAN 5;  3OMC A;  1U8R A;  2O4X B;  2PVG B;  3QPH A;  5LJ3 d;  1D3B A;  3GNG A;  5GMK l;  1XNI A;  4M7D A;  2KK4 A;  5GAN 6;  3CCE T;  3MHX A;  1UGQ B;  3E9F A;  4IUU A;  2DTH A;  4KT0 E;  4LDV A;  1PSF A;  2PU9 B;  2KVQ G;  2PVO B;  3JCM W;  1W2B A;  1WGS A;  4B9X A;  3JCM b;  4M7A B;  2RHY A;  3CD6 T;  2RHZ A;  3RES A;  1O9S A;  2HNI A;  1BYM A;  4EMK C;  4XU3 A;  3SWN C;  1YJN T;  2KDS A;  4OGC A;  3RMS A;  3MO8 A;  4OB0 B;  3BY7 A;  3AHU A;  4CI0 C;  5IAY A;  4M75 A;  3CCU T;  3BDU A;  2K57 A;  3OMG A;  2VUB A;  2FYK A;  2FVU A;  3ER0 A;  4XTX A;  2XDP A;  4M77 G;  5GAM g;  1WQ7 A;  1QP2 A;  3SWN A;  5LJ5 f;  2LC4 A;  3PIP A;  3CPW A;  4OP0 A;  5GMK i;  4PL6 A;  1MGQ A;  2RI5 A;  3OSS C;  3OYY A;  5D6X A;  1JJ2 S;  3JCM h;  4HKE A;  3PMT A;  5GAN g;  2LDM A;  2E10 A;  4ZTJ A;  4BI4 A;  4KBM B;  4ZGE B;  1I4K 1;  2DXT A;  3F70 A;  3OYD A;  3L2V A;  1VQ9 T;  2JTM A;  3L2Z A;  3M59 A;  3A8O B;  2HQE A;  1YBY A;  2FL7 A;  3QJY A;  4QW2 A;  1N6A A;  3P8B B;  2E12 A;  1ZQ1 A;  1Y7X A;  3INZ A;  2IVW A;  4C8Q D;  4KUD K;  3JAM E;  1OI1 A;  5A2Q E;  2DIQ A;  2V8I A;  4M77 A;  1S72 T;  4M77 E;  2BUD A;  3T9N A;  2L8D A;  2LTO A;  4C92 A;  3JCM c;  1QVF S;  3EAE A;  4M75 D;  4CRI A;  1KHC A;  4JDS A;  3LH0 A;  1QVG S;  1Q86 C;  3CCV T;  1N9S A;  2MWO A;  1M90 C;  2PVD B;  4O6J A;  2EYQ A;  4PJO B;  2M1H A;  3JCM d;  5GAN 3;  3M5A A;  1EIF A;  4OVA A;  3OYA A;  1NZ9 A;  1WJR A;  3I55 A;  3KXT A;  4LDX A;  4M7D C;  1FXX A;  4PLL A;  1WPY A;  1VQ6 A;  4JUV A;  5CKB A;  2FHD A;  2M9U A;  4BD3 A;  2ZPI B;  3OYL A;  1VQP A;  3A5Z B;  1VQN T;  1M9S A;  4EPC A;  4XTW A;  2CZ6 B;  4XAX B;  3FLG A;  4Z02 A;  4DOV A;  3NTI A;  1NE8 A;  3CBO A;  3CC2 A;  2RJC A;  2EFI A;  4J7F A;  5GAN h;  1BI1 A;  1HXD A;  5GAM f;  1YIJ A;  3HRS A;  5J26 A;  4M77 D;  1FX7 A;  2HAX A;  2VYT A;  1I81 A;  4LDU A;  3ZFJ A;  3RER A;  3GLX A;  4IUR A;  1WNL A;  1Y07 A;  3J7A F;  3DKM A;  1LNX A;  2L5Q A;  4HA8 A;  4PNO A;  2EQU A;  4MDX A;  1KQ1 A;  3HSB A;  3OYK A;  2KY9 A;  4JJN K;  5LJ3 j;  3CCQ A;  2MAM A;  4NS5 A;  4NL2 A;  4JRK A;  2PUO B;  4N4H A;  5HKC A;  2RK2 A;  1YJW A;  4F7U F;  1UGP B;  2PQW A;  1VQ6 T;  1VQK T;  1YJW T;  2MI6 A;  1ZHI A;  4FT4 A;  4R55 A;  4JRP A;  1X01 A;  3JCM P;  2MWP A;  3M55 A;  4M78 D;  4BI8 B;  2K2V A;  1UGS B;  1VQK A;  4WF2 A;  2QQA A;  4M7D D;  4M75 G;  3CCJ T;  4JS4 A;  2I2L A;  1M1K C;  4XQ3 A;  5I21 A;  5GAN 4;  5FRN A;  2V8K A;  2DD5 A;  3A8H B;  3M56 A;  3CME T;  1VQO T;  4M75 B;  2EKO A;  1KQ2 A;  5CKE A;  2YLB A;  1TH7 A;  1V29 B;  2P0P A;  1YHQ T;  4XU0 A;  2EAY A;  3P8D A;  3HFO A;  4RMO A;  2M0O A;  2XKO C;  4DQ2 A;  2ZPE B;  1JJ2 A;  3FIF A;  1YIT A;  4MZP A;  2QEX T;  3CCM A;  4BAC A;  2CZ7 B;  2XDB A;  3MEV A;  3JCM X;  3VUZ A;  1YIT T;  2QQR A;  2NLU A;  3FDR A;  4NOY A;  4HCC A;  5KH6 A;  2FB7 A;  3ME9 A;  4M75 E;  4PJO F;  3JB9 F;  2KAF A;  4B9W A;  2K5I A;  1G5V A;  2EQK A;  3FEO A;  4ZN3 A;  3FJP A;  5GMK j;  4M78 E;  4BE2 A;  1G3W A;  3QZ9 B;  2RI3 A;  4N0A A;  3JB9 H;  2JTF A;  2LCC A;  3OS0 A;  1X75 C;  3GF5 A;  2KSS A;  4M75 C;  3VV0 A;  1KQS A;  2OTJ T;  3I55 T;  4L59 A;  2DXC A;  3QBY A;  1VQO A;  1IZ6 A;  4IUP A;  3OY9 A;  4MDW A;  3DB4 A;  2EJF A;  2LVM A;  2LT1 A;  1YJ9 A;  5GAN 8;  5GAO q;  4M7A A;  2RA2 A;  1XQH A;  4QVZ A;  2CZ1 B;  3M58 A;  5GAO r;  1VQ5 T;  3G71 A;  4HT9 A;  2E65 A;  3OYM A;  2VV5 A;  3QZ5 B;  5IN1 A;  1G3T A;  3JSC A;  5GAM h;  3QG1 A;  4M78 G;  4A4F A;  4M7D G;  2VXE A;  5LJ3 f;  3S3N A;  3DB3 A;  1WJS A;  4OB1 B;  1M1G A;  4D6W A;  2K4Y A;  4M7A G;  2QXF A;  5DY9 A;  4MZM A;  3P8H A;  3JCM V;  3EFR A;  2RJF A;  3URG A;  3L1A A;  1M1K U;  1BI3 A;  3X28 B;  3WVE B;  5CKH A;  2OTL T;  1LJO A;  2F69 A;  4JLG A;  3C95 A;  3OYH A;  1N8R C;  3TCJ A;  5LL6 S;  2DTO A;  4IUT A;  4X9C A;  3HPW A;  3E9G A;  3OYE A;  5A0D A;  4P5N A;  1YCY A;  4M75 F;  3H6Z A;  2DXU A;  4M7D E;  4PJO E;  2OTJ A;  5FRO A;  1K9M U;  2RHX A;  3E19 A;  4M7A E;  2A7Y A;  2R58 A;  2MF2 A;  2ZPH B;  3DLL A;  5GAN 7;  4C92 B;  2EJ9 A;  3CCS A;  5LJ5 g;  3NTK A;  4RCC A;  4YTL A;  4M7A C;  3OYI A;  3FRN A;  4C0F A;  2DK3 A;  2D9T A;  1KHI A;  2GFA A;  2RO0 A;  3RKY A;  3VUB A;  1OYX A;  4C0G A;  3JCM Q;  5DM7 R;  4GLK A;  3BFM A;  4M78 B;  2CYZ B;  2GCX A;  3G7Z A;  3H8Z A;  4X9D A;  3M4G A;  3UT1 A;  4VUB A;  1H3Z A;  4OB3 B;  3UWN A;  3WVD B;  3QYH B;  3C4S A;  1OZ3 A;  2VC8 A;  2XHC A;  5KCH A;  2DPP B;  4XTV A;  3G6E T;  3SD4 A;  4O5V A;  5KE2 A;  3OYC A;  2CGH A;  2YHT A;  3V8K A;  4M77 F;  3VJP A;  4C0Z A;  1VQ4 A;  4FL6 A;  4J83 A;  3CXC S;  4ZN1 A;  1ZBX A;  2XID A;  5I2S A;  2B8A A;  3EFS A;  1BI0 A;  4IUV A;  1VQL T;  2DD4 A;  1B34 A;  2O01 E;  3LX7 A;  4OB2 B;  4M7A D;  2Y4Y A;  2DTI A;  5I2M A;  3X24 B;  2L3R A;  1MHN A;  2X4Y A;  2E6N A;  3CC4 T;  3WXM B;  4LDY A;  3ZBD A;  2K3Y A;  3V7C A;  4DA4 A;  4C8Q A;  3J80 E;  3G71 T;  3GP8 A;  3CMA T;  3CPW S;  3G4S A;  1Q7Y U;  1DJ7 B;  4ZTF A;  4ZGJ B;  4EMH A;  3DLM A;  2QA4 A;  2LT4 A;  3BW1 A;  3M53 A;  2RD1 A;  3MET A;  5LJ3 g;  5GAO l;  2QA4 T;  3Q1J A;  3RKX A;  3G6E A;  2ZPF B;  3N5B B;  3QUI A;  5GAO p;  1Q82 C;  1K8A C;  1QW1 A;  3SFM A;  2JZ2 A;  4BUG A;  4R56 A;  2MMP A;  2VXF A;  4M78 A;  4XTY A;  3RUX A;  1UGR B;  4E7J A;  2QI2 A;  4XTU A;  4C8Q F;  1LOJ A;  2RHI A;  4N4G A;  3CCJ A;  1YI2 T;  2OTL A;  4NL3 A;  3OS2 A;  4BE0 A;  1W2B S;  5M9O A;  4J7I A;  5FU6 B;  2DZC A;  3L42 A;  3RMQ A;  2XD0 A;  1VQP T;  4HCB A;  3MP1 A;  1UEB A;  3HRU A;  4FIB A;  5GMK m;  3CCR A;  2E1H A;  2LX9 A;  3S6W A;  1VQL A;  2LQK A;  1VIE A;  3M9Q A;  2R5A A;  2RHU A;  4E7L A;  2DVE A;  5KCO A;  2ZPG B;  3SDZ A;  2AHJ B;  2DEQ A;  1BIB A;  3V7R A;  3LYI A;  3L2R A;  1QP3 A;  3CC4 A;  3ASK A;  2P0K A;  3LLR A;  2P0Q A;  4J6X A;  1I8F A;  2GFU A;  3CEY A;  3TU4 K;  4PKC C;  1SSF A;  1XOV A;  5CQY A;  3JCM g;  2QQS A;  3HRT A;  2RJD A;  4XK8 E;  2BIV A;  2XG8 D;  2K5F A;  3CCQ T;  2CKK A;  2JVV A;  2ZZD A;  4M78 C;  3CD6 A;  4J5Y A;  4PJO G;  3CCU A;  3PTA A;  4QQD A;  2ZCF B;  1YI2 A;  5GAN 2;  4HT8 A;  4QQ6 A;  2LRQ A;  3GNF B;  5LJ5 j;  1YJN A;  5DLO A;  1M4Z A;  1UB4 A;  1VQN A;  3QSU A;  4X34 A;  4LDW A;  3RKW A;  3JCM J;  3GIB A;  2H3J A;  3QJ6 A;  1NPR A;  2P4T A;  3CXC A;  4BB7 A;  1M1F A;  3OS5 A;  2DZ9 A;  2RH2 A;  2JNG A;  2XIC A;  4ATO A;  4A53 A;  4FT2 A;  4C8Q C;  2Y90 A;  3CC7 A;  5FLX E;  4EMK A;  1K73 U;  2JUF A;  2LCL A;  2G3R A;  3CC7 T;  3CCR T;  1VQ8 T;  3V7S A;  4IUQ A;  1KG1 A;  1Q7Y C;  2L89 A;  1WJQ A;  1Y71 A;  5FU7 B;  4Y91 A;  4BY6 B;  3L2U A;  1W4S A;  3JB9 J;  1NJI C;  5CKF A;  2DKG A;  2KQW A;  4C0D B;  5D6W A;  2JOY A;  3QHS A;  5GAM d;  2A3L A;  3VU3 C;  4M78 F;  3VYH B;  5KE3 A;  1KC8 C;  2YLC A;  1XTD A;  3J81 E;  1B34 B;  3GPL A;  2O4X A;  2E6Z A;  1U1S A;  4N4I A;  4XU2 A;  4EMK B;  1D3B B;  4BDY A;  1I5L A;  1S72 A;  3A8G B;  4Y28 E;  2X35 A;  1WQW A;  3MEW A;  2HQX A;  4RKU E;  2PUK B;  4F7U G;  3KBG A;  3JCM e;  3GOX A;  2CS7 A;  4C8Q B;  5LJ5 h;  3NTH A;  3PFS A;  3PT9 A;  4L6V 5;  3V8J A;  5A0L A;  3SB2 A;  4TVR A;  3FB9 A;  5A0G A;  5FU7 C;  4A4H A;  1JB0 E;  3LW5 E;  5GAN j;  4PJO A;  3V8L A;  1VQ9 A;  3OYF A;  1VQ8 A;  4E7K A;  4C92 F;  4A4G A;  3C12 A;  3OW2 A;  2WSE E;  4PLI A;  1FWZ A;  1YJ9 T;  2QEX A;  3CC2 T;  4PJO D;  1QVG A;  3M54 A;  1JRI A;  4EDU A;  4A4E A;  1YHQ A;  3OQ5 A;  3FC3 A;  4PJO C;  3MCA B;  4FU6 A;  4ELY C;  5CQX A;  4JS5 A;  3LWI A;  4JLI A;  2RI2 A;  1RL2 A;  4M7D B;  3HHT B;  5GAO n;  1VUB A;  2X4X A;  1U1T A;  2HD0 A;  2OAU A;  1Q81 U;  4M7A F;  4RG2 A;  3JB9 I;  3X26 B;  5CAI A;  4XU1 A;  4F7U B;  3CCV A;  3JB9 G;  4QVC A;  5LJ5 d;  1KD1 U;  4M77 C;  2VGM A;  4KUI A;  2D0Q B;  2QTX A;  5CVI A;  4ME7 A;  1PSE A;  2QQB A;  3PGG A;  3OA6 A;  1VIF A;  4C5E A;  5FRM A;  2YRV A;  2X4W A;  2HBP A;  4HCZ A;  1R8O B;  3HP9 A;  4MZT A;  2RJE A;  1JBM A;  3MEA A;  4BDZ A;  3O8V A;  3OSV A;  3OS1 A;  1HK9 A;  4OF1 A;  5L8R E;  1K8A U;  4J6W A;  1QVP A;  2K5L A;  2K3X A;  3OYN A;  5D6Y A;  3L2Q A;  1VQM T;  1KQS S;  3CME A;  3CBM A;  2E70 A;  1M5Q 1;  3G4S T;  3S3M A;  2EQM A;  2V8J A;  1M8V A;  3OBY A;  2E64 A;  4RCB A;  4V2S A;  3S3O A;  1N27 A;  2QQ9 A;  4JRI A;  3RIR A;  1VQ7 T;  2C06 A;  4F7U A;  4C92 C;  4UC4 A;  1K73 C;  3CCM T;  5LJ3 e;  3QXE B;  3R6O A;  2XK0 A;  3QDR B;  3OYG A;  2E5Q A;  4M7D F;  3PIO A;  3HKS A;  4C92 E;  1NJI U;  3QO3 A;  4L5G A;  2X4J A;  3OBW A;  5C0M A;  5LJ3 h;  2DAQ A;  5GAN d;  3QKJ A;  3OB9 A;  1G3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...