2JVVA

Solution structure of e. coli nusg carboxyterminal domain
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
59
structure length
59
Chain Sequence
RPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKVSVSIFGRATPVELDFSQVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords Transcription antitermination protein nusG
publication title Two structurally independent domains of E. coli NusG create regulatory plasticity via distinct interactions with RNA polymerase and regulators.
pubmed doi rcsb
source organism Escherichia coli
total genus 8
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00467 KOW KOW motif
A PF02357 NusG Transcription termination factor nusG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.30 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2jvvA00
3CCJA 3CCQA 3CCST 3CCUA 3OW2S 1VQMA 2OTJT 1VQ9A 3CCET 3CPWA 4X34A 1Q82C 1NJIU 3G4SA 1NPRA 5HY6A 1X6OA 1VQOT 1KQSA 3CC2T 3LGLA 1M1KU 1M90U 1YI2A 3I56A 1BKBA 1QVGS 1KD1U 3KBGA 4ZN3A 1QVFS 3I55T 3G71A 3CMET 1YIJT 1YJNT 2MWPA 1KHIA 1VQKA 1W2BA 1YHQA 1VQ8A 1K73C 1YJWT 1K9MU 3CD6T 1VQLT 1VQ6T 1YITT 3CCJT 3CXCA 5J26A 1Q7YC 1YJ9A 2JUFA 1S72A 2LQ8A 5DLQE 1VQ9T 1EIFA 1Q86U 1K8AC 2QA4A 5J3BA 3G4ST 2G3RA 2MWOA 2QEXT 5DM7R 1VQ4A 3CCMT 3I56T 1YI2T 3CCVT 1RL2A 2E70A 2JVVA 4RG2A 2OTLT 2IG0A 1VQ5A 1IZ6A 2L3RA 3CC7T 3LH0A 3CCLA 3OW2A 3G71T 1KC8C 2JOYA 1N8RU 2JNGA 2XHCA 2MI6A 5FLXE 1VQKT 1YHQT 1VQ8T 3CC4A 3CCRT 3G6ET 1VQPA 1QVGA 4ZN1A 1YJ9T 1XNIA 1NJIC 1VQ7A 3CCQT 2QA4T 3CCUT 1M1KC 1VQMT 1QVFA 1NZ9A 2OTJA 1JJ2S 1KD1C 3DLLA 1Q7YU 5LL6S 4YTLA 3CC2A 2DO3A 2EIFA 3PIPA 2E6ZA 1VQ5T 5IT9E 1VQNA 4QQDA 3CMAA 3CCLT 1Q82U 1M1GA 3PIOA 1K9MC 3CC4T 3P8BB 1NPPA 5IAYA 3CPWS 1VQPT 1KQSS 1Q81C 1SSFA 1Q86C 3J7AF 1XTDA 1VQ7T 1YJWA 3CD6A 3TREA 1YITA 3HKSA 1S72T 4CRIA 1K73U 1M90C 3CCSA 1VQ4T 3ER0A 2QEXA 3OYYA 3CCEA 3CCMA 2KDSA 1VQ6A 3CCVA 1W2BS 1K8AU 1VQOA 3CMAT 1VQNT 1N8RC 5A2QE 2LVMA 3CPFA 3J80E 2LCLA 2OTLA 3CXCS 3CC7A 2CKKA 1JJ2A 3LGFA 3I55A 1YIJA 1UEBA 3A5ZB 3DB4A 3CMEA 1YJNA 3DB3A 2KVQG 1YBYA 3JAME 3J81E 3G6EA 3CCRA 1KC8U 4TVRA 1VQLA 1Q81U
chains in the Genus database with same CATH superfamily
3S3MA 3SFMA 2DEQA 4M7AE 2M0OA 4J9HA 1V76A 3UF4A 1RAEB 5KYXB 4IUVA 3L2WA 5FROA 3QIIA 4J9CA 5GANf 2KRNA 2D0NA 3ZFJA 5KCOA 1ZUKA 4AFQC 1WA7A 4M77D 4F04B 2FZKB 3CCVT 2QEXQ 4M7DB 2OX7A 2QI2A 1RI9A 2LT4A 2XICA 2D0QB 4C92C 2JOYA 1M9SA 2EJ9A 1RAIB 3QKJA 1YJNQ 9ATCB 2QDLA 2DERA 5CQYA 3H41A 3HRTA 2X51A 1MV0B 2PUKB 2AKLA 2EKHA 1K76A 3QYHB 3RBBB 2YT6A 1TG0A 2CZ1B 1H92A 2EFIA 1X01A 1Y7XA 1JU5C 1KJWA 3GOXA 1NPPA 1RAGB 2DXUA 3VS4A 4C8QB 4CRIA 1K73U 1S72Q 2J6FA 2RJDA 3EAEA 2QEXA 5C6SA 2FO0A 3OBWA 1NEGA 2Y4XA 3OYNA 1M3BA 4M7AA 3CCLQ 3EHQA 3R6NA 2VXFA 8ATCB 1YJNA 3VS3A 4EMHA 1BIBA 1I0CA 1H8KA 5CIUA 2EWNA 1D1BA 3S3NA 1KSWA 1M1KR 1NJIU 1MNEA 3NGPA 1C6VX 4OGCA 3M0TA 3LX7A 2PQWA 3LH5A 4FIBA 5KYYB 5GJVB 3GBQA 5CVIA 1QVFS 2K3YA 1YJNT 5LJ5d 2O4XA 5FRNA 1U3OA 1YHQA 2CSQA 5CKDA 2K79A 3SD4A 4X1VA 2ZPFB 1S72A 2V8JA 4J9DA 2XKOC 3JB9D 4JLGA 1H641 4C92D 3QJYA 1QLYA 5DM7R 3CCMT 4WTOB 1PC0A 2KI7A 5HK3A 1WHMA 3RUXA 1SKUB 3R6OA 2K3BA 3OYIA 2E4HA 2F2VA 3CCLA 3TEEA 1FMKA 4MZTA 1HSQA 2CS7A 1AD5A 4JZ3A 1YHQT 1WIEA 4E2FB 1UGRB 1QQJA 1WQ7A 4JJNK 4NS5A 3CCUT 3UT1A 1IRXA 3CCQQ 2QA4Q 2JMCA 2WSCE 1TWBA 2V26A 3SWNC 1VQNA 1SEMA 3CCLT 4A4HA 3CBPA 2GGRA 5FW9A 5LJ3d 1EZZB 3GLXA 2QXFA 1NE8A 2EPDA 2G6FX 4VUBA 3L2VA 4O6JA 1QP2A 3BFMA 3TREA 1X6BA 4M77G 1NM7A 1JRIA 2EQIA 1MV3A 4OB2B 2H3EB 1VQ4T 4J9IA 1W2BS 1VQNT 1TU0B 1TOVA 1BBZA 1OYXA 3VS7A 2R57A 3JCMQ 3OS1A 1JJ2A 2J6OA 3RKWA 4ANJA 2IVWA 3F70A 2MPXC 3A1PA 2GNCA 3CCQA 2LP5A 4KH1B 3V7CA 1KQSA 2VYTA 2CSIA 1M90U 1YN8A 2YUNA 4CC2A 2P0QA 4XU3A 1PRMC 3CBMA 2AT1B 1MGQA 3UA6A 5A0LA 3NTIA 1BI2A 1OQKA 1LOJA 4FW2A 4RKUE 5LJ3e 4M75C 1YJ9A 2OAWA 1TH7A 4PFPA 4D8DA 1C1AA 2KSSA 4KRTA 1RL2A 4EMGA 3FIFA 1WHHA 5CO7A 1QCNA 3EFOB 3BDLA 4PJOC 4BI8B 3CC4A 4GY5A 1YJ9T 4E7HA 4M7AB 1ZUYA 3JV3A 1SPKA 7AT1B 2CP2A 2DPPB 3PVLA 2CP0A 1VQMQ 2NWMA 1WLPB 4E6RA 4YTLA 2NUTA 4L5GA 2FPDA 2YLBA 2RQWA 5GAMf 1ABOA 1GFCA 4WF2A 3OY9A 3CC4T 4HA8A 3VUBA 5KYNA 1XJWB 1B34B 3LWHA 1TUCA 3JB9G 1XTDA 4FU6A 1B7TA 4C92G 2JM8A 4N4GA 3RMQA 2CH4W 1R0BG 2Z0WA 5CKFA 2EYQA 3VS1A 5LJ5h 2P4RA 3LWIA 4J8OA 2D9TA 2RF0A 1W70A 2KT1A 1R0CB 2LQNA 2YRCA 1Q81R 2W0ZA 3META 2BUDA 1PKSA 1RLPC 4M75F 3JCMd 1VQMA 4RCCA 3JCMX 1Q82C 2GFUA 1YP5A 2XI9A 1I07A 1E7OA 5LJ5j 4HVWA 3CMAQ 4OB0B 3REAB 3OYAA 3X26B 4PJOF 5GAOl 4LUEA 2DJZA 1TUDA 5A0DA 3EGXA 3FEOA 5DLQE 1OPKA 4M78D 1PD1A 2HSPA 1N9SA 2L3SA 2XDBA 2DZCA 4PFZA 4PJJA 2FZCB 4AFZC 1NLPC 2NUZA 2RK1A 2PTKA 3HTRA 1K73R 1SHFA 2E5KA 2MF2A 2RHIA 2QQBA 1BK2A 2RQRA 3EG9A 2J7IA 4CC7A 4ME7A 2ESWA 2ECZA 2EIFA 3HFNA 3JCMe 2FEIA 4IIMA 3CMAA 1UFFA 3M57A 2QGGA 2HAXA 1RUWA 1PD0A 3M53A 1D0YA 5GMKl 1AWJA 3J7AF 4PLIA 1M5Q1 2E3HA 3M0QA 4HKEA 2QQAA 2LMJA 5KYXA 1K8AR 3FRNA 2QQ9A 3GF5A 5LJ5g 3CMAT 1G5VA 2KQWA 2CGHA 2HQEA 2JMAA 4DOVA 1BB9A 4Y28E 3FB9A 3MHXA 1H3HA 2QYZA 3DB3A 3FC3A 3JAME 4X9CA 2K5IA 2LJ3A 2EJFA 4LNPA 1WGSA 2A37A 2GFAA 3C95A 4X34A 2OTJQ 5CK9A 2DNUA 3CC2Q 2DXBA 1CKBA 2D8HA 3LW5E 4QT7A 4EMKC 3CXCP 4LDYA 1KHIA 3E19A 2DXCA 2QTVA 2GCXA 4PJNA 2RI5A 4C5HA 3JCMW 2JVVA 3CEYA 2M16A 5GANd 4RTTA 3LH0A 4OVAA 3PGGA 2K2MA 2DBMA 1IREB 2JNGA 4ZNXA 3RR6A 4CC4B 1VYTA 4M7DD 1YIJQ 3G6ET 2V8KA 4BY6C 4ZN1A 1NG2A 3CCRQ 2ATCB 2LCCA 3UWNA 2OTJA 4ATOA 2EAYA 5EC7A 4V2SA 5LL6S 1ZSGA 2FRWA 4LUDA 3CC2A 5KH6A 3PIPA 4JJDA 4PNOA 4DOWA 1Q82U 1GCQA 4FYXB 1ZBXA 4RMOA 1I5LA 3X25B 4M77C 3RMSA 3TSZA 2EW3A 2PNIA 5GAOm 1TS9A 1WXUA 2ABLA 1RACB 3JCMh 1X75C 4M78G 4PJLA 1VQ8Q 1WI7A 5DLOA 4QVZA 2EGCA 3MEVA 5IHIA 1JXOA 5KYYA 3BE3A 2KRMA 2L2PA 2ZGWA 1VA7A 3FJPA 4QVCA 3EGXB 3V8LA 3VKIA 3GP8A 1N8RC 3E2UA 1UJYA 4C8QD 5I21A 4C5IA 2CKKA 2EQKA 2PZ1A 5GAN8 1YIJA 5GANe 2XDDA 2DL5A 4XTUA 4RTYA 1I1JA 2QASA 3CCRA 2LNVA 1VQPQ 3URGA 5C0MA 2M9UA 2MYSA 3G7ZA 4LDVA 1Y96A 3LGLA 1X69A 3JCMV 4XTWA 4DBFA 4OF1A 3M5AA 3X24B 2E64A 4A4GA 2IIMA 1SRLA 2RD1A 3OQ5A 1YIJT 1WXTA 2MMPA 2GTOA 1BCMA 4MZMA 1VQ8A 3C4SA 5GMKm 4Z88A 2EQUA 4J9BA 1YITT 4IUTA 3L2RA 2RO0A 2DTHA 2RJEA 2DXTA 1LJOA 4XU2A 4N0AA 4A63B 2DL4A 4Z02A 4FT4A 1WPYA 2JXBA 5IHKA 3TCJA 1G3TA 2KBTA 2OTLQ 2JZ2A 2LX9A 2VV5A 1XOVA 1EX4A 1GRIA 1VQ8T 3BW1A 1I8FA 2RQTA 1VQPA 4A54A 5HCKA 4C92E 4RUGA 3MEAA 3CCJQ 3QDRB 2RA2A 3GIBA 1IHVA 2FYKA 5ECAA 3RKYA 2QQSA 1CKAA 1M2VB 1PG5B 2O31A 1SSHA 5KYWA 3I56Q 2HSEB 5IHNA 1KIKA 4N4HA 3PT9A 4C5EA 1MNDA 4GLKA 1K9MC 3JCMg 2DF6A 4BD3A 1VQPT 1SSFA 4M7AC 2JTFA 3OYHA 3OSVA 1WZOA 4RTUA 2FRYA 2RI3A 2DZ9A 2RJCA 1M90C 1GBRA 4PK4A 4R55A 2C06A 2XK0A 1UJ0A 3EFSA 5GAN5 2VASA 2OTLA 4BI4A 3HPWA 4M7DG 3HL8A 3OYBA 1BI3A 4J83A 2NLUA 5I2MA 4XTZA 1J3TA 3CPWP 2D1XA 4TVRA 4OMOA 1ZX6A 1UHFA 2HCKA 3V7RA 3CCJA 1X2KA 3EFOA 2KK4A 2E3IA 5GANh 1X6OA 4LD9K 3I56A 2CH4A 2E41A 2QG9B 4HCBA 2JT4A 3KBGA 4MDXA 2XG8D 2FB7A 4E7SA 4GBQA 4NOYA 3OYJA 4ZTFA 2ZZDA 5GMKi 2ED0A 3E9GA 3CCJT 2ZPHB 1YJWQ 4JUVA 4FYYB 2F2WA 2YWWA 2QEXT 3H0FA 2DYIA 4EIKA 4C8QG 3I56T 5GANj 2DD5A 4BUGA 4C0DC 1B34A 1OULA 3M59A 4J9FA 4DQ2A 3QSUA 2EYYA 2KYBA 4ORZA 3D7SB 1N8RU 4FYVB 2DBKA 4KGXB 4C92F 2AZVA 1HK9A 2SRCA 4BB7A 1M8VA 1RI0A 4JRIA 4IUQA 2NYSA 2HL5C 1NZ9A 2HKNA 4LDWA 2BE7D 1NEBA 3M9QA 1OX9A 4PKCC 1Q7YU 5D6WA 2JJ9A 2K5LA 3H0IA 3I5RA 4ESRA 2HBPA 4M7AD 5GMKe 2EVRA 3X28B 2KR3A 5IH2A 3HRSA 2SEMA 1Y96B 1TUGB 4JJBA 2ROTA 2HDAA 4OMFB 3QJ6A 2QDYB 4EPCA 2X4JA 1YJWA 1PCXA 2LTOA 1S72T 3Q1JA 5GAMd 3MO8A 2BZ8A 2EYXA 4OP0A 4MMLA 4C0FA 5A0GA 1NLOC 4C5GA 2K4YA 4C0GA 2VGNA 2DM1A 1WNLA 5CCAA 2B86A 2X4XA 4IUPA 3RESA 3OYDA 2LT1A 5GANg 2RHZA 1T0HA 4ZGEB 3THKA 1OEBA 2HMAA 2BZYA 2P4TA 1JBMA 3M58A 3QDFA 2ZCFB 1UGSB 3SEMA 2K57A 4FCYA 3A8MB 2HQHA 5KYWB 1K9MU 3QO3A 1YFNA 1M8MA 1AWXA 5J26A 3CD6Q 3M0RA 4D8KA 4F7UE 2QA4A 5J3BA 3RDVA 5I11A 4DEXA 1YCYA 1Q82R 5GAMe 3LLRA 3H9NA 2LQWA 4M75E 2X9HA 3OW2A 1Z9ZA 2KT8A 3CC7Q 3VS5A 5FU7C 1QVFP 2RM4A 3JB9H 3HHTB 1ZA2B 3JSCA 1QVGA 4L59A 1XNIA 2LQKA 2M1HA 1MMAA 2BKDN 4OMMA 4E7KA 3CCQT 2QA4T 1M1KC 4PLLA 4PJOE 1VQLQ 3SWNA 2QTXA 2LJ1A 1WJSA 1JJ2S 1VQ9Q 1S1NA 1YI2Q 2C0IA 2DA9A 1M4ZA 2QQRA 2DFUA 4M78C 1M1GA 2QAZA 5M9OA 1KQSS 4XK8E 2JS0A 3CD6A 1DJ7B 1V1CA 3QBYA 2PVGB 1UTIA 5L8RE 5FU6C 3OS2A 1HJDA 2F5KA 3OMCA 3OYFA 5A2QE 1M27C 1U5SA 2HQXA 4ELZC 2LCLA 2LCSA 3CC7A 4C92B 2FL7A 1TSFA 1HXDA 3M0SA 1VQLA 1M2OA 4XU1A 3PMIA 4B9WA 4II1A 1QWEA 1VQ9A 1IHWA 4M7AG 2D6FA 3QUIA 1YI2A 2CP3A 2BIVA 2RPNA 2CREA 2O2OA 2JM9A 1W2BP 1MMDA 2DX1A 1KK7A 2Y4YA 4XTXA 2KE9A 3E9FA 4JRKA 2L3PA 2RJFA 4F7UF 5J39A 1VQLT 4NL3A 3CXCA 2JUFA 2LX7A 5GAOn 1VQ9T 1HD3A 3TSWA 1YI2T 1ZSZC 1KHCA 2E12A 1PNJA 3JB9J 2E10A 2K5FA 2LDMA 1Y57A 4PJOA 3C94A 4UC4A 2LC4A 2P0PA 2RHYA 1X27A 3A8GB 3OSSC 2YXYA 4M78F 2VUBA 2DTIA 3JB9I 3MJXA 1T3SA 3EH2A 5GAMh 3CMEQ 1TXQA 1KG1A 1E6HA 4QQ6A 2RB6A 2R5MA 1VQMT 4OMLA 1UE9A 3EGUA 1KD1C 2CT4A 2XDPA 1JJ2P 5KYUB 5IT9E 5LJ3h 4QQDA 1FYNA 1WXBA 4PJMA 1RADB 5GAN6 4FYWB 2PUOB 3UA7A 4OMQA 4C0ZA 3FLGA 1HYOA 4AT1B 3NFCA 5GAMj 2KRSA 2JS2A 2GBQA 1VQKQ 5DY9A 3H8ZA 1JQQA 4M7DC 1CSKA 2KDSA 4F14A 2LVMA 1WJQA 5LJ3j 1G8XA 3INZA 1VQ5Q 2DIQA 1IB8A 4KULA 2K6DA 3CMEA 4HCCA 4FSSA 3MP8A 2DL3A 1YBYA 2RNAA 3S3OA 1UB4A 3KFVA 3N5BB 1IGUA 3PFSA 1NJIR 1ACMB 4A4FA 1NPRA 1NYGA 2CUBA 1M1KU 1WHKA 1G3YA 2K9GA 4XU0A 3VS2A 1N8RR 3SWNB 2RI2A 2WSEE 3QWXX 3DKMA 3CMET 3EFRA 3OMGA 2MWPA 1VQKA 1NYFA 4C8QC 5CKEA 1BYMA 1M2VA 2GTJA 3AHUA 1FWZA 5D6XA 2COWA 2F1LA 2G3RA 4HVUA 1UUEA 3MP1A 1AOJA 2FPEA 3NPFA 3IQLA 2IG0A 1VQ5A 2L3RA 5GAMg 1VQKT 2MI6A 2CT3A 3RERA 5EG2A 1VYVA 1FX7A 4ELYC 5LJ3g 4M7DF 2VVKA 1VQ5T 4AG2C 1WDXA 2L89A 1T3LA 5GAOr 2VWFA 1I5OB 1YWOA 2FG0A 2PVOB 3M54A 1WFWA 2OI3A 2V1RA 2DL8A 4F7UB 2GQIA 1Q86C 2YRDA 3H6ZA 3OYKA 2X4WA 2RK2A 4M77E 4HT8A 3DLMA 4M75B 3HSBA 1VYUA 4MDWA 1Y71A 1MMGA 3JCMJ 4AFSC 4JJCA 1ABQA 4DBQA 1X43A 3OS0A 3FDRA 1K9MR 4PJOB 3EG1A 2H8HA 1PRLC 4C8QF 4QKUA 1W1FA 1WX6A 2XD0A 1JB0E 2OTJT 4F17A 1M90R 3CPWA 2YHTA 1AT1B 4J7IA 4BE2A 3CC2T 2CZ6B 2DJQA 1SF9A 3QZ9B 2LRQA 4EMKA 1VIEA 1KD1U 5KCHA 3L42A 2FPFA 1KQ2A 3QXEB 3OBYA 1D1AA 2COZA 2BE9B 2E5QA 2KNBB 2MOXA 3ZL7C 5FWBA 1Q7YC 2VXEA 1K8AC 2X3XD 4KGVB 2MIOA 2NUPA 3CCEQ 4J7FA 3C12A 3CCVQ 2DIGA 2LZ6B 1KC8C 2A3LA 5I2SA 3JRZA 2HZYA 4P5NA 4E7ZA 4OGEA 3I55Q 3CCRT 2MK5A 2VB6A 2C0TA 2OAUA 2CUDA 3SDZA 3LYIA 4LXCA 2XMFA 5HK0A 1PWTA 2AKKA 2E6ZA 5L23A 3I35A 4Q5WA 2DLPA 1MMNA 3OYMA 2W10A 3L2UA 1QMCA 2XU8A 4M77F 1ZUUA 1PSEA 2AHJB 3BY7A 4E7JA 3HKSA 2V8IA 3TQ7P 2KROA 3VS0A 1M30A 1W4SA 1GFDA 2KMTA 3WVEB 1MHNA 4FW1A 4E47A 3OYYA 3CCEA 1LNXA 1BCOA 3CCVA 2DRKA 2L8DA 2O9VA 4J6YA 2EYWA 2O9SA 4BDZA 3FJ5A 3I55A 3QPHA 1D0XA 2L5QA 1WHLA 3ZBDA 4CI0C 1Q81U 1D3BB 1UDLA 1UGPB 2J6KA 3CCET 2XIDA 2YLCA 5CAIA 3HRUA 1BKBA 2CYZB 4JPBW 1B07A 1BI0A 4ZN3A 4IKFA 3I55T 1W6XA 1RLQC 3KXTA 1OZ3A 3HFOA 2JTEA 2X3WD 1R8OB 2LQ8A 1EFNA 1Q86U 4KBMB 2MWOA 2DVJA 2DRMA 2K2VA 2YSQA 1QVPA 2DD4A 4ZGJB 3CCMQ 4QVDA 4KT0E 2OTLT 4RTXA 4J9GA 3OA6A 4HT9A 2DL7A 4KGZB 4JZ4A 1YHQQ 1OX8A 4K11A 3PMTA 1QVFA 3A8OB 3CCUQ 4C92A 1ZBJA 3UATA 1GCPA 1G2BA 4MMKA 2ROLA 1ZA1B 3M4YA 3PIOA 3JB9F 1ZQ1A 5AT1B 3PE0A 3G71Q 3I5SA 4EMKB 3NHNA 1BI1A 3RIRA 4E7LA 3VRZA 4M7AF 3M0PA 1N27A 1B3QA 1E6GA 1R77A 1K0SA 3CCMA 2IPOB 1VQ4Q 3HP9A 1K8AU 1WYXA 3CPFA 4AMCA 1VQNQ 3ASKA 1GL5A 1N9RA 5CR2A 3QZ5B 1OZ2A 4F16A 2NUPB 3DB4A 2KXCA 1KC8U 1G3SA 2L0AA 2FVUA 4BY6B 1I4K1 1VQ7Q 3CCUA 2CZ0B 3T9NA 2HD0A 2JN0A 3QHSA 2A28A 3PNWC 2M51A 3MPUB 4L6V5 1U1TA 4LDUA 3G71A 4ZTJA 2EBPA 3TVTA 4M77B 1W2BA 3EG3A 2FHDA 1YWPA 1YJWT 4JRQA 4LE9A 3GNFB 1I81A 3A98A 3EHRA 2B8AA 5KYUA 1QKXA 1EIFA 4FT2A 3ZEHA 4BI3A 1VQ4A 4BDYA 1FMVA 2M02A 2I2LA 2PVDB 4M4ZA 3G71T 3EGDA 1LCKA 4Y92A 5GAOp 4J6XA 4QQGA 1QP3A 2E1HA 5LJ5e 1X6GA 4ZGDB 3CBOA 3E1SA 1VQ7A 3GPLA 4J6WA 1YJ9Q 4XQ3A 1F1BB 2E6NA 2ENMA 2QK0A 5CKHA 3A8HB 4FSXA 1UG1A 1ARKA 3OYLA 4WCIA 4DA4A 4B6MA 2DETA 4HCKA 1IO6A 4JLIA 1PSFA 3CC4Q 1WHJA 3OB9A 2GF7A 4OB3B 2R5AA 1VQ7T 1QKWA 4M78E 1PM3A 1UHCA 1PKTA 3NMZC 3S6WA 4GLMA 3H0HA 3WVDB 1PHTA 1KD1R 3TU4K 1X2QA 4RCBA 1IXDA 1VOMA 1OPLA 3ME9A 3OYEA 1FMWA 1O75A 3P8HA 1BIAA 1SHGA 1UEBA 1JO8A 3BDUA 2EKOA 2RMOA 2A36A 4KUIA 1WHGA 3VUZA 5GMKh 3M56A 5LJ5f 3OW2S 1YNZA 4Z89A 4R0KA 3UPUA 3NTKA 4HVVA 1QVGS 1ZHIA 3L2ZA 1Y0MA 1AZGB 3A8LB 3C0CA 3CD6T 1AZEA 4Y91A 1ZLMA 3CQTA 5GMKj 1N5ZA 5FWCA 2F2XA 1MUZA 1JXMA 1Y07A 3ULRB 4LN2A 1WQWA 4PL6A 5HKCA 4F7UA 3CC7T 2JW4A 2VGMA 2KGTA 5FLXE 2M0YA 4M75A 2EQJA 2ZPIB 4BACA 3EG2A 1U06A 5LJ3f 2D8JA 2O4XB 4IUUA 6AT1B 3EG0A 4FL6A 3V7SA 4M78A 2KXDA 3MEUA 2L3QA 1NBEB 2I0NA 1RAHB 2YUOA 1XQHA 1V29B 2ED1A 2KAFA 3VJPA 3OYCA 1SRMA 3KUFA 3OYGA 3M4GA 1A0NB 3P8BB 2AK5A 5IAYA 1H3ZA 2HNIA 3VV0A 4AG1C 4QW2A 1RAAB 2BZXA 1OI1A 5I22A 1UGVA 5CKBA 1VUBA 1K0XA 1LVKA 2EYZA 2DILA 1T0JA 5KE2A 3EH1A 3L2QA 1Z9QA 2WACA 3MEWA 5IN1A 4C0DB 5GAN3 3CXCS 4M75D 2R58A 2LJ0A 4M7DE 2CP5A 2E65A 2RQVA 3LGFA 1AWOA 2K7AA 1Q95G 2DMOA 1N6AA 2CP6A 1Q86R 3O8VA 1KQSP 3M55A 2A7YA 4J5YA 3EGDB 1BU1A 1M1FA 2DE0X 1U8RA 1TTHB 2EGAA 2RH2A 1QW1A 2A08A 1VIFA 3OW2P 5HY6A 2ZPGB 4PJOD 5D6YA 1FXXA 4OMPA 4JDSA 2EGEA 5D7UA 1K9AA 4AFUC 2YUQA 3RNJA 1D09B 1QVGP 4FM4B 1D0ZA 2KYMA 3VRYA 1ZSZA 4RTVA 2J05A 3AT1B 2LNHB 4RTZA 2X4YA 4JS5A 3JCMP 3V8KA 4OMNA 5GJWB 3CCSQ 5GAN7 3OS5A 4C8QE 1P92A 2CDTA 2E70A 4JRPA 1VQ6Q 1VQOQ 1IZ6A 3X20B 1RABB 4CC3A 1KFZA 2XHCA 3QG1A 2KY9A 1IGQA 8AT1B 1LPLA 5GAOq 2RQUA 3G6EQ 2YUPA 1Q7YR 3UDCA 3M0UA 3WXMB 3MCAB 2EJGA 1M3AA 3GNGA 2OJ2A 4J9EA 4E7IA 1OU9A 2DO3A 3G4SQ 2RHUA 4R56A 2FZGB 2V1QA 4HXJA 1K4US 2A0FB 2QGFB 3VU3C 1U1SA 2EQMA 1D3BA 1KC8R 1GCQC 1Q81C 4XTYA 1AHJB 2MAMA 5KE3A 2O88A 2GQVA 4M7DA 2J06A 1AWWA 2RHXA 3JCMc 3L1AA 3CCSA 1AVZC 1GXIE 3ER0A 4EDUA 1VQ6A 1VQOA 2K3XA 2DK3A 3MP6A 3J80E 3JCMf 1D1CA 2P84A 2JTMA 4A4KA 1QWFA 2DAQA 2KEAA 2WSFE 2NUTB 1G83A 5CQXA 2KVQG 2DVEA 2X35A 3J81E 3G6EA 2CP7A 5FU7B 2CZ7B 1UGQB 3I9QA 3SHWA 3CCST 3PVQA 3NTHA 3VYHB 5IXFA 3REBB 1KQ1A 3G4SA 1VQ6T 1AEYA 1VQOT 4LD6A 4BE0A 1GBQA 4JS4A 5IXBA 2HKQB 4C8QA 2HL3A 2AIRB 4M78B 1OV3A 1OOTA 4IIOA 2RN8A 1K73C 2HEQA 4BE1A 2DYBA 4F7UG 1YITQ 1M3CA 4Z8AA 3G4ST 2ZAEA 3U23A 2F5TX 5FU6B 1G3WA 4M75G 4RG8A 3RKXA 4LDXA 4RG2A 4N0AC 2O01E 2HBWA 5GAN4 2DEUA 3MKDA 1OU8A 4XTVA 3SB2A 4DBHA 4XAXB 1K1ZA 3VS6A 1NJIC 4A53A 1QCOA 4PJOG 2AZSA 4KH0B 4N4IA 3DLLA 2H3JA 4IURA 5AYFA 1WJRA 4MZPA 1SG5A 1YCSB 3JCMb 2ZPBB 2PU9B 1O9SA 3G1JA 3O5ZA 5GAN2 2YDLA 3CPWS 2C0OA 1UECA 4KUDK 2MCNA 2COYA 4O5VA 1JEGA 2BTTA 2ZPEB 4A4EA 1YITA 2VC8A 2DTOA 4D6WA 4X9DA 2Y90A 4DBRA 4RTWA 3V8JA 3QYGB 3PTAA 4HCZA 3QWYA 4PFOA 2DKGA 1QCFA 2F69A 1ZSZB 4M77A 1RAFB 3VYGA 4OB1B 5FRMA 3EG9B 4B9XA 4DEYA 2VKNA 3P8DA 3A5ZB 2YRVA 2P0KA 4NL2A 1C0MA
chains in the Genus database with same CATH topology
2K5IA 1I4K1 3S3MA 2EJFA 4II1A 3CCUA 1WGSA 2CZ0B 3SFMA 3T9NA 2HD0A 1VQ9A 2GFAA 2JN0A 3C95A 4X34A 4M7AG 3QHSA 2D6FA 2DEQA 4M7AE 3QUIA 1YI2A 3PNWC 2M0OA 2BIVA 5CK9A 2DXBA 4L6V5 2Y4YA 1U1TA 4IUVA 3LW5E 4LDUA 4XTXA 3E9FA 4JRKA 3G71A 3L2WA 4EMKC 4ZTJA 5FROA 4M7DB 4LDYA 2RJFA 1KHIA 3QIIA 4M77B 1W2BA 2FHDA 4F7UF 3E19A 1YJWT 5GANf 2DXCA 5J39A 1VQLT 4NL3A 4JRQA 3GNFB 1I81A 3CXCA 2GCXA 2B8AA 2JUFA 5GAOn 1VQ9T 3ZFJA 1EIFA 2RI5A 4FT2A 3ZEHA 4BI3A 5KCOA 4M77D 1VQ4A 4BDYA 1YI2T 1KHCA 3CCVT 2E12A 3JB9J 2E10A 2K5FA 2LDMA 4C5HA 3JCMW 2JVVA 3C94A 2M16A 2LT4A 2QI2A 3CEYA 2XICA 4UC4A 2I2LA 2D0QB 4BY6B 5GANd 2LC4A 2P0PA 4C92C 2PVDB 2RHYA 3LH0A 4OVAA 3G71T 3PGGA 3A8GB 3OSSC 2JOYA 4M78F 1IREB 2VUBA 2DTIA 1M9SA 2JNGA 5GAOp 4J6XA 4QQGA 3JB9I 1QP3A 2EJ9A 5GAMh 4M7DD 3QKJA 3G6ET 1KG1A 2E1HA 5LJ5e 2V8KA 4BY6C 4ZN1A 4ZGDB 3CBOA 3E1SA 4QQ6A 1VQ7A 5CQYA 2RB6A 3GPLA 2R5MA 3HRTA 2LCCA 4J6WA 4XQ3A 3UWNA 1VQMT 2E6NA 2PUKB 2OTJA 4ATOA 1KD1C 2EAYA 4V2SA 5CKHA 2XDPA 5LL6S 3CC2A 3A8HB 4FSXA 3QYHB 5KH6A 3PIPA 4PNOA 5IT9E 2CZ1B 5LJ3h 4QQDA 4DOWA 1Q82U 3OYLA 2EFIA 4DA4A 1ZBXA 1X01A 5GAN6 4RMOA 2PUOB 3X25B 4C0ZA 1I5LA 4M77C 3FLGA 1Y7XA 3GOXA 4JLIA 3RMSA 1NPPA 1PSFA 3NFCA 5GAMj 5GAOm 3JCMh 3OB9A 1X75C 2GF7A 2R5AA 4M78G 4OB3B 1VQ7T 4M78E 2DXUA 5DLOA 4QVZA 3S6WA 3MEVA 4C8QB 4CRIA 5DY9A 1K73U 3H8ZA 2RJDA 3EAEA 2ZGWA 3WVDB 4M7DC 2QEXA 5C6SA 3TU4K 3FJPA 2KDSA 4QVCA 3OBWA 4RCBA 3V8LA 3VKIA 2Y4XA 3GP8A 1N8RC 2LVMA 1WJQA 5LJ3j 3ME9A 4C8QD 3OYEA 3INZA 3OYNA 5I21A 1O75A 3P8HA 4M7AA 1BIAA 2DIQA 4C5IA 2CKKA 4KULA 2VXFA 2EQKA 5GAN8 1YIJA 1UEBA 5GANe 4EMHA 2XDDA 3CMEA 1YJNA 4HCCA 4XTUA 1BIBA 3BDUA 2EKOA 1YBYA 3MP8A 3CCRA 2LNVA 4KUIA 3S3OA 5CIUA 1UB4A 3N5BB 2EWNA 3VUZA 3PFSA 5GMKh 3M56A 5LJ5f 3URGA 3OW2S 3S3NA 5C0MA 2M9UA 3G7ZA 4A4FA 3UPUA 3AHUA 1NJIU 4LDVA 3NTKA 1NPRA 1Y96A 4OGCA 3LGLA 3LX7A 1M1KU 1G3YA 3JCMV 4XTWA 2PQWA 4XU0A 4FIBA 1QVGS 4OF1A 3M5AA 3X24B 2E64A 1ZHIA 3SWNB 2RI2A 2WSEE 3L2ZA 4A4GA 2RD1A 5CVIA 3DKMA 1QVFS 2K3YA 3OQ5A 3CMET 1YIJT 1YJNT 2MMPA 3EFRA 3OMGA 2MWPA 5LJ5d 2O4XA 5FRNA 4MZMA 1VQKA 4PJOD 1YHQA 1VQ8A 3C4SA 5GMKm 3A8LB 3CD6T 4C8QC 5CKDA 5CKEA 1BYMA 2EQUA 1YITT 4Y91A 4IUTA 3SD4A 3L2RA 2RO0A 2ZPFB 5GMKj 2DTHA 1S72A 2RJEA 2V8JA 3JB9D 1FWZA 2XKOC 4JLGA 5D6XA 1H641 2DXTA 1LJOA 4XU2A 4C92D 4N0AA 2G3RA 3QJYA 5DM7R 3CCMT 3MP1A 4Z02A 1Y07A 4FT4A 5HK3A 3RUXA 1WPYA 1WQWA 4PL6A 5HKCA 3R6OA 4F7UA 3TCJA 1G3TA 2IG0A 1VQ5A 2L3RA 3OYIA 3CC7T 3CCLA 2VGMA 3TEEA 4MZTA 2JZ2A 2LX9A 2CS7A 2VV5A 1XOVA 5GAMg 1VQKT 2MI6A 5FLXE 1YHQT 1VQ8T 3RERA 4M75A 3BW1A 1I8FA 1VQPA 5EG2A 1UGRB 2EQJA 4A54A 2ZPIB 4C92E 4BACA 1WQ7A 5LJ3f 1FX7A 4JJNK 4NS5A 3CCUT 3MEAA 3UT1A 2O4XB 4IUUA 3QDRB 2RA2A 3GIBA 2WSCE 4FL6A 3V7SA 2FYKA 4M78A 3RKYA 3MEUA 2QQSA 4ELYC 5LJ3g 4M7DF 3SWNC 1VQ5T 1VQNA 3CCLT 4A4HA 3CBPA 1XQHA 1V29B 2KAFA 4N4HA 3VJPA 2L89A 3PT9A 3OYCA 3KUFA 4C5EA 4GLKA 5GAOr 3OYGA 3M4GA 1K9MC 5LJ3d 3GLXA 2QXFA 3P8BB 3JCMg 4BD3A 2PVOB 5IAYA 1NE8A 2HNIA 3M54A 3VV0A 1VQPT 1H3ZA 4QW2A 1SSFA 4F7UB 1Q86C 2XDBA 2JTFA 3OYHA 4VUBA 4M7AC 3H6ZA 3L2VA 1OI1A 3OSVA 3OYKA 2X4WA 1QP2A 2RK2A 3BFMA 4O6JA 3TREA 4M77G 2RI3A 2DZ9A 5CKBA 1JRIA 2RJCA 4M77E 1M90C 4HT8A 3DLMA 4M75B 4OB2B 1VUBA 3HSBA 4R55A 2C06A 1VQ4T 4MDWA 2XK0A 1Y71A 1W2BS 1VQNT 3EFSA 5GAN5 5KE2A 1OYXA 3L2QA 3JCMJ 2WACA 2R57A 3MEWA 5IN1A 4C0DB 3JCMQ 5GAN3 3CXCS 4BI4A 2OTLA 3HPWA 4M75D 4M7DG 2R58A 3HL8A 3OS1A 3OYBA 3OS0A 1JJ2A 4M7DE 3RKWA 1BI3A 4J83A 2E65A 3FDRA 3LGFA 2NLUA 5I2MA 4PJOB 1N6AA 4XTZA 2IVWA 3F70A 3O8VA 4TVRA 2A7YA 3M55A 4C8QF 4J5YA 3V7RA 1M1FA 3CCJA 3CCQA 1U8RA 2XD0A 1JB0E 2OTJT 2KK4A 2RH2A 1QW1A 3CPWA 3V7CA 1VIFA 5GANh 5HY6A 2ZPGB 1X6OA 2VYTA 2YHTA 4J7IA 5D6YA 4BE2A 1M90U 1FXXA 3CC2T 4LD9K 2CZ6B 3I56A 4JDSA 3QZ9B 2LRQA 4EMKA 2P0QA 1VIEA 1KD1U 4XU3A 5KCHA 2E41A 4HCBA 3L42A 3KBGA 4MDXA 1KQ2A 3QXEB 3CBMA 3OBYA 2XG8D 1MGQA 2FB7A 4FM4B 4NOYA 2E5QA 5A0LA 3NTIA 1BI2A 3OYJA 4ZTFA 2ZZDA 1LOJA 4RKUE 5GMKi 5LJ3e 3E9GA 3CCJT 2ZPHB 4M75C 1Q7YC 1YJ9A 4JUVA 2VXEA 2X4YA 1K8AC 4JS5A 3JCMP 3V8KA 1TH7A 2QEXT 4C8QG 3I56T 5GANj 2DD5A 5GAN7 2KSSA 4BUGA 1RL2A 3OS5A 4C8QE 4EMGA 3FIFA 4C0DC 1P92A 2E70A 5CO7A 4JRPA 1B34A 3M59A 3C12A 4J7FA 1IZ6A 2DIGA 4DQ2A 3QSUA 3BDLA 3X20B 1KC8C 1N8RU 2A3LA 4PJOC 4BI8B 4C92F 2XHCA 3QG1A 2KY9A 5I2SA 3CC4A 3JRZA 1HK9A 4P5NA 5GAOq 4GY5A 4OGEA 3CCRT 4BB7A 1M8VA 2OAUA 3SDZA 1YJ9T 4E7HA 1RI0A 4JRIA 4M7AB 4IUQA 3LYIA 3UDCA 3WXMB 1NZ9A 3MCAB 4LDWA 2EJGA 5HK0A 2DPPB 3M9QA 3GNGA 4PKCC 1Q7YU 5D6WA 4E7IA 2K5LA 4YTLA 2DO3A 4L5GA 2E6ZA 2YLBA 2HBPA 5GAMf 4M7AD 2RHUA 5GMKe 4WF2A 3X28B 4R56A 4Q5WA 3HRSA 3OY9A 3VU3C 3OYMA 3CC4T 1Y96B 1U1SA 2EQMA 1D3BA 3L2UA 4HA8A 3VUBA 4OMFB 1B34B 2XU8A 4M77F 4XTYA 3LWHA 1AHJB 3JB9G 3QJ6A 1Q81C 2MAMA 5KE3A 1XTDA 2QDYB 4EPCA 1PSEA 2X4JA 4FU6A 2GQVA 4C92G 2AHJB 4B9WA 1YJWA 3BY7A 4M7DA 2LTOA 4E7JA 3HKSA 2V8IA 1S72T 3Q1JA 2RHXA 3JCMc 5GAMd 1W4SA 3MO8A 4N4GA 3L1AA 3RMQA 3CCSA 2KMTA 1GXIE 3ER0A 1MHNA 3WVEB 4E47A 3OYYA 4EDUA 3CCEA 5CKFA 1LNXA 2EYQA 3CCVA 1VQ6A 1VQOA 2K3XA 2L8DA 2DK3A 4J6YA 4OP0A 5LJ5h 3MP6A 3J80E 3JCMf 4A4KA 4MMLA 2JTMA 4C0FA 5A0GA 4C5GA 2DAQA 2WSFE 3LWIA 4J8OA 2D9TA 4BDZA 3I55A 5CQXA 2K4YA 2KVQG 2DVEA 4C0GA 2VGNA 3QPHA 2L5QA 2X35A 3J81E 1WNLA 3G6EA 5FU7B 5CCAA 3ZBDA 2CZ7B 1UGQB 2X4XA 3META 4CI0C 4IUPA 1Q81U 2BUDA 3RESA 1D3BB 3CCST 3OYDA 4M75F 2LT1A 3JCMd 5GANg 3NTHA 3VYHB 1VQMA 1UGPB 3CCET 4RCCA 3JCMX 1Q82C 2GFUA 1KQ1A 2RHZA 2XIDA 3G4SA 1VQOT 2XI9A 2YLCA 4ZGEB 4LD6A 3HRUA 5CAIA 4BE0A 1BKBA 2CYZB 5LJ5j 2P4TA 1JBMA 3M58A 2ZCFB 1UGSB 4JS4A 1BI0A 4ZN3A 4C8QA 2K57A 4OB0B 4IKFA 3OYAA 3I55T 4M78B 3X26B 3A8MB 4PJOF 5GAOl 1K73C 3KXTA 2DJZA 1K9MU 3QO3A 4BE1A 1OZ3A 3HFOA 5A0DA 1VQ6T 3FEOA 5J26A 1R8OB 4F7UG 2LQ8A 5DLQE 1Q86U 4KBMB 4M78D 4F7UE 2QA4A 5J3BA 3G4ST 1N9SA 2MWOA 2F5TX 1YCYA 5FU6B 1G3WA 2K2VA 2DZCA 3LLRA 1QVPA 5GAMe 2DD4A 4M75G 4RG8A 1KQSA 3RKXA 4ZGJB 4LDXA 4QVDA 4M75E 4RG2A 4KT0E 2OTLT 4N0AC 2O01E 3OW2A 2RK1A 5GAN4 3OA6A 4HT9A 4XTVA 5FU7C 3SB2A 3JB9H 2RM4A 4XAXB 3HHTB 3JSCA 1QVGA 4L59A 1XNIA 1NJIC 2LQKA 4A53A 2M1HA 2BKDN 4PJOG 4E7KA 2MF2A 2RHIA 3PMTA 3CCQT 2QA4T 1M1KC 4PLLA 4PJOE 1QVFA 2QQBA 3SWNA 2QTXA 3A8OB 1WJSA 4N4IA 1JJ2S 3DLLA 2H3JA 4ME7A 4IURA 4C92A 2EIFA 3HFNA 5AYFA 3JCMe 1WJRA 4MZPA 3CMAA 3M57A 1M4ZA 2QQRA 2HAXA 4MMKA 4M78C 3M4YA 3JCMb 1M1GA 2ZPBB 2PU9B 3PIOA 1O9SA 3JB9F 1ZQ1A 3M53A 5GAN2 5M9OA 3CPWS 1KQSS 5GMKl 4KUDK 4EMKB 3J7AF 4XK8E 4PLIA 4O5VA 1BI1A 1M5Q1 3RIRA 4E7LA 2ZPEB 4A4EA 3CD6A 1YITA 4M7AF 2VC8A 3PMIA 1DJ7B 2DTOA 2PVGB 3QBYA 1N27A 4D6WA 4HKEA 5L8RE 2QQAA 4X9DA 2Y90A 5FU6C 3QYGB 3V8JA 3PTAA 4HCZA 3OS2A 2F5KA 3OMCA 3CCMA 3FRNA 2QQ9A 3GF5A 5LJ5g 2DKGA 3OYFA 3HP9A 1K8AU 3CMAT 2F69A 5A2QE 4M77A 2KQWA 1G5VA 3CPFA 4OB1B 2HQXA 3VYGA 4ELZC 2LCLA 5FRMA 2CGHA 2HQEA 3CC7A 3ASKA 4DOVA 4Y28E 4B9XA 3FB9A 3MHXA 4C92B 1N9RA 3P8DA 3QZ5B 1OZ2A 5CR2A 3A5ZB 4PJOA 3DB4A 2YRVA 2FL7A 3DB3A 3FC3A 3JAME 1KC8U 1G3SA 2P0KA 1HXDA 4NL2A 1VQLA 4XU1A 4X9CA 2FVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ A;  3CCQ A;  3CCS T;  3CCU A;  3OW2 S;  1VQM A;  2OTJ T;  1VQ9 A;  3CCE T;  3CPW A;  4X34 A;  1Q82 C;  1NJI U;  3G4S A;  1NPR A;  5HY6 A;  1X6O A;  1VQO T;  1KQS A;  3CC2 T;  3LGL A;  1M1K U;  1M90 U;  1YI2 A;  3I56 A;  1BKB A;  1QVG S;  1KD1 U;  3KBG A;  4ZN3 A;  1QVF S;  3I55 T;  3G71 A;  3CME T;  1YIJ T;  1YJN T;  2MWP A;  1KHI A;  1VQK A;  1W2B A;  1YHQ A;  1VQ8 A;  1K73 C;  1YJW T;  1K9M U;  3CD6 T;  1VQL T;  1VQ6 T;  1YIT T;  3CCJ T;  3CXC A;  5J26 A;  1Q7Y C;  1YJ9 A;  2JUF A;  1S72 A;  2LQ8 A;  5DLQ E;  1VQ9 T;  1EIF A;  1Q86 U;  1K8A C;  2QA4 A;  5J3B A;  3G4S T;  2G3R A;  2MWO A;  2QEX T;  5DM7 R;  1VQ4 A;  3CCM T;  3I56 T;  1YI2 T;  3CCV T;  1RL2 A;  2E70 A;  2JVV A;  4RG2 A;  2OTL T;  2IG0 A;  1VQ5 A;  1IZ6 A;  2L3R A;  3CC7 T;  3LH0 A;  3CCL A;  3OW2 A;  3G71 T;  1KC8 C;  2JOY A;  1N8R U;  2JNG A;  2XHC A;  2MI6 A;  5FLX E;  1VQK T;  1YHQ T;  1VQ8 T;  3CC4 A;  3CCR T;  3G6E T;  1VQP A;  1QVG A;  4ZN1 A;  1YJ9 T;  1XNI A;  1NJI C;  1VQ7 A;  3CCQ T;  2QA4 T;  3CCU T;  1M1K C;  1VQM T;  1QVF A;  1NZ9 A;  2OTJ A;  1JJ2 S;  1KD1 C;  3DLL A;  1Q7Y U;  5LL6 S;  4YTL A;  3CC2 A;  2DO3 A;  2EIF A;  3PIP A;  2E6Z A;  1VQ5 T;  5IT9 E;  1VQN A;  4QQD A;  3CMA A;  3CCL T;  1Q82 U;  1M1G A;  3PIO A;  1K9M C;  3CC4 T;  3P8B B;  1NPP A;  5IAY A;  3CPW S;  1VQP T;  1KQS S;  1Q81 C;  1SSF A;  1Q86 C;  3J7A F;  1XTD A;  1VQ7 T;  1YJW A;  3CD6 A;  3TRE A;  1YIT A;  3HKS A;  1S72 T;  4CRI A;  1K73 U;  1M90 C;  3CCS A;  1VQ4 T;  3ER0 A;  2QEX A;  3OYY A;  3CCE A;  3CCM A;  2KDS A;  1VQ6 A;  3CCV A;  1W2B S;  1K8A U;  1VQO A;  3CMA T;  1VQN T;  1N8R C;  5A2Q E;  2LVM A;  3CPF A;  3J80 E;  2LCL A;  2OTL A;  3CXC S;  3CC7 A;  2CKK A;  1JJ2 A;  3LGF A;  3I55 A;  1YIJ A;  1UEB A;  3A5Z B;  3DB4 A;  3CME A;  1YJN A;  3DB3 A;  2KVQ G;  1YBY A;  3JAM E;  3J81 E;  3G6E A;  3CCR A;  1KC8 U;  4TVR A;  1VQL A;  1Q81 U; 
#chains in the Genus database with same CATH topology
 3S3M A;  3SFM A;  2DEQ A;  4M7A E;  2M0O A;  4J9H A;  1V76 A;  3UF4 A;  1RAE B;  5KYX B;  4IUV A;  3L2W A;  5FRO A;  3QII A;  4J9C A;  5GAN f;  2KRN A;  2D0N A;  3ZFJ A;  5KCO A;  1ZUK A;  4AFQ C;  1WA7 A;  4M77 D;  4F04 B;  2FZK B;  3CCV T;  2QEX Q;  4M7D B;  2OX7 A;  2QI2 A;  1RI9 A;  2LT4 A;  2XIC A;  2D0Q B;  4C92 C;  2JOY A;  1M9S A;  2EJ9 A;  1RAI B;  3QKJ A;  1YJN Q;  9ATC B;  2QDL A;  2DER A;  5CQY A;  3H41 A;  3HRT A;  2X51 A;  1MV0 B;  2PUK B;  2AKL A;  2EKH A;  1K76 A;  3QYH B;  3RBB B;  2YT6 A;  1TG0 A;  2CZ1 B;  1H92 A;  2EFI A;  1X01 A;  1Y7X A;  1JU5 C;  1KJW A;  3GOX A;  1NPP A;  1RAG B;  2DXU A;  3VS4 A;  4C8Q B;  4CRI A;  1K73 U;  1S72 Q;  2J6F A;  2RJD A;  3EAE A;  2QEX A;  5C6S A;  2FO0 A;  3OBW A;  1NEG A;  2Y4X A;  3OYN A;  1M3B A;  4M7A A;  3CCL Q;  3EHQ A;  3R6N A;  2VXF A;  8ATC B;  1YJN A;  3VS3 A;  4EMH A;  1BIB A;  1I0C A;  1H8K A;  5CIU A;  2EWN A;  1D1B A;  3S3N A;  1KSW A;  1M1K R;  1NJI U;  1MNE A;  3NGP A;  1C6V X;  4OGC A;  3M0T A;  3LX7 A;  2PQW A;  3LH5 A;  4FIB A;  5KYY B;  5GJV B;  3GBQ A;  5CVI A;  1QVF S;  2K3Y A;  1YJN T;  5LJ5 d;  2O4X A;  5FRN A;  1U3O A;  1YHQ A;  2CSQ A;  5CKD A;  2K79 A;  3SD4 A;  4X1V A;  2ZPF B;  1S72 A;  2V8J A;  4J9D A;  2XKO C;  3JB9 D;  4JLG A;  1H64 1;  4C92 D;  3QJY A;  1QLY A;  5DM7 R;  3CCM T;  4WTO B;  1PC0 A;  2KI7 A;  5HK3 A;  1WHM A;  3RUX A;  1SKU B;  3R6O A;  2K3B A;  3OYI A;  2E4H A;  2F2V A;  3CCL A;  3TEE A;  1FMK A;  4MZT A;  1HSQ A;  2CS7 A;  1AD5 A;  4JZ3 A;  1YHQ T;  1WIE A;  4E2F B;  1UGR B;  1QQJ A;  1WQ7 A;  4JJN K;  4NS5 A;  3CCU T;  3UT1 A;  1IRX A;  3CCQ Q;  2QA4 Q;  2JMC A;  2WSC E;  1TWB A;  2V26 A;  3SWN C;  1VQN A;  1SEM A;  3CCL T;  4A4H A;  3CBP A;  2GGR A;  5FW9 A;  5LJ3 d;  1EZZ B;  3GLX A;  2QXF A;  1NE8 A;  2EPD A;  2G6F X;  4VUB A;  3L2V A;  4O6J A;  1QP2 A;  3BFM A;  3TRE A;  1X6B A;  4M77 G;  1NM7 A;  1JRI A;  2EQI A;  1MV3 A;  4OB2 B;  2H3E B;  1VQ4 T;  4J9I A;  1W2B S;  1VQN T;  1TU0 B;  1TOV A;  1BBZ A;  1OYX A;  3VS7 A;  2R57 A;  3JCM Q;  3OS1 A;  1JJ2 A;  2J6O A;  3RKW A;  4ANJ A;  2IVW A;  3F70 A;  2MPX C;  3A1P A;  2GNC A;  3CCQ A;  2LP5 A;  4KH1 B;  3V7C A;  1KQS A;  2VYT A;  2CSI A;  1M90 U;  1YN8 A;  2YUN A;  4CC2 A;  2P0Q A;  4XU3 A;  1PRM C;  3CBM A;  2AT1 B;  1MGQ A;  3UA6 A;  5A0L A;  3NTI A;  1BI2 A;  1OQK A;  1LOJ A;  4FW2 A;  4RKU E;  5LJ3 e;  4M75 C;  1YJ9 A;  2OAW A;  1TH7 A;  4PFP A;  4D8D A;  1C1A A;  2KSS A;  4KRT A;  1RL2 A;  4EMG A;  3FIF A;  1WHH A;  5CO7 A;  1QCN A;  3EFO B;  3BDL A;  4PJO C;  4BI8 B;  3CC4 A;  4GY5 A;  1YJ9 T;  4E7H A;  4M7A B;  1ZUY A;  3JV3 A;  1SPK A;  7AT1 B;  2CP2 A;  2DPP B;  3PVL A;  2CP0 A;  1VQM Q;  2NWM A;  1WLP B;  4E6R A;  4YTL A;  2NUT A;  4L5G A;  2FPD A;  2YLB A;  2RQW A;  5GAM f;  1ABO A;  1GFC A;  4WF2 A;  3OY9 A;  3CC4 T;  4HA8 A;  3VUB A;  5KYN A;  1XJW B;  1B34 B;  3LWH A;  1TUC A;  3JB9 G;  1XTD A;  4FU6 A;  1B7T A;  4C92 G;  2JM8 A;  4N4G A;  3RMQ A;  2CH4 W;  1R0B G;  2Z0W A;  5CKF A;  2EYQ A;  3VS1 A;  5LJ5 h;  2P4R A;  3LWI A;  4J8O A;  2D9T A;  2RF0 A;  1W70 A;  2KT1 A;  1R0C B;  2LQN A;  2YRC A;  1Q81 R;  2W0Z A;  3MET A;  2BUD A;  1PKS A;  1RLP C;  4M75 F;  3JCM d;  1VQM A;  4RCC A;  3JCM X;  1Q82 C;  2GFU A;  1YP5 A;  2XI9 A;  1I07 A;  1E7O A;  5LJ5 j;  4HVW A;  3CMA Q;  4OB0 B;  3REA B;  3OYA A;  3X26 B;  4PJO F;  5GAO l;  4LUE A;  2DJZ A;  1TUD A;  5A0D A;  3EGX A;  3FEO A;  5DLQ E;  1OPK A;  4M78 D;  1PD1 A;  2HSP A;  1N9S A;  2L3S A;  2XDB A;  2DZC A;  4PFZ A;  4PJJ A;  2FZC B;  4AFZ C;  1NLP C;  2NUZ A;  2RK1 A;  2PTK A;  3HTR A;  1K73 R;  1SHF A;  2E5K A;  2MF2 A;  2RHI A;  2QQB A;  1BK2 A;  2RQR A;  3EG9 A;  2J7I A;  4CC7 A;  4ME7 A;  2ESW A;  2ECZ A;  2EIF A;  3HFN A;  3JCM e;  2FEI A;  4IIM A;  3CMA A;  1UFF A;  3M57 A;  2QGG A;  2HAX A;  1RUW A;  1PD0 A;  3M53 A;  1D0Y A;  5GMK l;  1AWJ A;  3J7A F;  4PLI A;  1M5Q 1;  2E3H A;  3M0Q A;  4HKE A;  2QQA A;  2LMJ A;  5KYX A;  1K8A R;  3FRN A;  2QQ9 A;  3GF5 A;  5LJ5 g;  3CMA T;  1G5V A;  2KQW A;  2CGH A;  2HQE A;  2JMA A;  4DOV A;  1BB9 A;  4Y28 E;  3FB9 A;  3MHX A;  1H3H A;  2QYZ A;  3DB3 A;  3FC3 A;  3JAM E;  4X9C A;  2K5I A;  2LJ3 A;  2EJF A;  4LNP A;  1WGS A;  2A37 A;  2GFA A;  3C95 A;  4X34 A;  2OTJ Q;  5CK9 A;  2DNU A;  3CC2 Q;  2DXB A;  1CKB A;  2D8H A;  3LW5 E;  4QT7 A;  4EMK C;  3CXC P;  4LDY A;  1KHI A;  3E19 A;  2DXC A;  2QTV A;  2GCX A;  4PJN A;  2RI5 A;  4C5H A;  3JCM W;  2JVV A;  3CEY A;  2M16 A;  5GAN d;  4RTT A;  3LH0 A;  4OVA A;  3PGG A;  2K2M A;  2DBM A;  1IRE B;  2JNG A;  4ZNX A;  3RR6 A;  4CC4 B;  1VYT A;  4M7D D;  1YIJ Q;  3G6E T;  2V8K A;  4BY6 C;  4ZN1 A;  1NG2 A;  3CCR Q;  2ATC B;  2LCC A;  3UWN A;  2OTJ A;  4ATO A;  2EAY A;  5EC7 A;  4V2S A;  5LL6 S;  1ZSG A;  2FRW A;  4LUD A;  3CC2 A;  5KH6 A;  3PIP A;  4JJD A;  4PNO A;  4DOW A;  1Q82 U;  1GCQ A;  4FYX B;  1ZBX A;  4RMO A;  1I5L A;  3X25 B;  4M77 C;  3RMS A;  3TSZ A;  2EW3 A;  2PNI A;  5GAO m;  1TS9 A;  1WXU A;  2ABL A;  1RAC B;  3JCM h;  1X75 C;  4M78 G;  4PJL A;  1VQ8 Q;  1WI7 A;  5DLO A;  4QVZ A;  2EGC A;  3MEV A;  5IHI A;  1JXO A;  5KYY A;  3BE3 A;  2KRM A;  2L2P A;  2ZGW A;  1VA7 A;  3FJP A;  4QVC A;  3EGX B;  3V8L A;  3VKI A;  3GP8 A;  1N8R C;  3E2U A;  1UJY A;  4C8Q D;  5I21 A;  4C5I A;  2CKK A;  2EQK A;  2PZ1 A;  5GAN 8;  1YIJ A;  5GAN e;  2XDD A;  2DL5 A;  4XTU A;  4RTY A;  1I1J A;  2QAS A;  3CCR A;  2LNV A;  1VQP Q;  3URG A;  5C0M A;  2M9U A;  2MYS A;  3G7Z A;  4LDV A;  1Y96 A;  3LGL A;  1X69 A;  3JCM V;  4XTW A;  4DBF A;  4OF1 A;  3M5A A;  3X24 B;  2E64 A;  4A4G A;  2IIM A;  1SRL A;  2RD1 A;  3OQ5 A;  1YIJ T;  1WXT A;  2MMP A;  2GTO A;  1BCM A;  4MZM A;  1VQ8 A;  3C4S A;  5GMK m;  4Z88 A;  2EQU A;  4J9B A;  1YIT T;  4IUT A;  3L2R A;  2RO0 A;  2DTH A;  2RJE A;  2DXT A;  1LJO A;  4XU2 A;  4N0A A;  4A63 B;  2DL4 A;  4Z02 A;  4FT4 A;  1WPY A;  2JXB A;  5IHK A;  3TCJ A;  1G3T A;  2KBT A;  2OTL Q;  2JZ2 A;  2LX9 A;  2VV5 A;  1XOV A;  1EX4 A;  1GRI A;  1VQ8 T;  3BW1 A;  1I8F A;  2RQT A;  1VQP A;  4A54 A;  5HCK A;  4C92 E;  4RUG A;  3MEA A;  3CCJ Q;  3QDR B;  2RA2 A;  3GIB A;  1IHV A;  2FYK A;  5ECA A;  3RKY A;  2QQS A;  1CKA A;  1M2V B;  1PG5 B;  2O31 A;  1SSH A;  5KYW A;  3I56 Q;  2HSE B;  5IHN A;  1KIK A;  4N4H A;  3PT9 A;  4C5E A;  1MND A;  4GLK A;  1K9M C;  3JCM g;  2DF6 A;  4BD3 A;  1VQP T;  1SSF A;  4M7A C;  2JTF A;  3OYH A;  3OSV A;  1WZO A;  4RTU A;  2FRY A;  2RI3 A;  2DZ9 A;  2RJC A;  1M90 C;  1GBR A;  4PK4 A;  4R55 A;  2C06 A;  2XK0 A;  1UJ0 A;  3EFS A;  5GAN 5;  2VAS A;  2OTL A;  4BI4 A;  3HPW A;  4M7D G;  3HL8 A;  3OYB A;  1BI3 A;  4J83 A;  2NLU A;  5I2M A;  4XTZ A;  1J3T A;  3CPW P;  2D1X A;  4TVR A;  4OMO A;  1ZX6 A;  1UHF A;  2HCK A;  3V7R A;  3CCJ A;  1X2K A;  3EFO A;  2KK4 A;  2E3I A;  5GAN h;  1X6O A;  4LD9 K;  3I56 A;  2CH4 A;  2E41 A;  2QG9 B;  4HCB A;  2JT4 A;  3KBG A;  4MDX A;  2XG8 D;  2FB7 A;  4E7S A;  4GBQ A;  4NOY A;  3OYJ A;  4ZTF A;  2ZZD A;  5GMK i;  2ED0 A;  3E9G A;  3CCJ T;  2ZPH B;  1YJW Q;  4JUV A;  4FYY B;  2F2W A;  2YWW A;  2QEX T;  3H0F A;  2DYI A;  4EIK A;  4C8Q G;  3I56 T;  5GAN j;  2DD5 A;  4BUG A;  4C0D C;  1B34 A;  1OUL A;  3M59 A;  4J9F A;  4DQ2 A;  3QSU A;  2EYY A;  2KYB A;  4ORZ A;  3D7S B;  1N8R U;  4FYV B;  2DBK A;  4KGX B;  4C92 F;  2AZV A;  1HK9 A;  2SRC A;  4BB7 A;  1M8V A;  1RI0 A;  4JRI A;  4IUQ A;  2NYS A;  2HL5 C;  1NZ9 A;  2HKN A;  4LDW A;  2BE7 D;  1NEB A;  3M9Q A;  1OX9 A;  4PKC C;  1Q7Y U;  5D6W A;  2JJ9 A;  2K5L A;  3H0I A;  3I5R A;  4ESR A;  2HBP A;  4M7A D;  5GMK e;  2EVR A;  3X28 B;  2KR3 A;  5IH2 A;  3HRS A;  2SEM A;  1Y96 B;  1TUG B;  4JJB A;  2ROT A;  2HDA A;  4OMF B;  3QJ6 A;  2QDY B;  4EPC A;  2X4J A;  1YJW A;  1PCX A;  2LTO A;  1S72 T;  3Q1J A;  5GAM d;  3MO8 A;  2BZ8 A;  2EYX A;  4OP0 A;  4MML A;  4C0F A;  5A0G A;  1NLO C;  4C5G A;  2K4Y A;  4C0G A;  2VGN A;  2DM1 A;  1WNL A;  5CCA A;  2B86 A;  2X4X A;  4IUP A;  3RES A;  3OYD A;  2LT1 A;  5GAN g;  2RHZ A;  1T0H A;  4ZGE B;  3THK A;  1OEB A;  2HMA A;  2BZY A;  2P4T A;  1JBM A;  3M58 A;  3QDF A;  2ZCF B;  1UGS B;  3SEM A;  2K57 A;  4FCY A;  3A8M B;  2HQH A;  5KYW B;  1K9M U;  3QO3 A;  1YFN A;  1M8M A;  1AWX A;  5J26 A;  3CD6 Q;  3M0R A;  4D8K A;  4F7U E;  2QA4 A;  5J3B A;  3RDV A;  5I11 A;  4DEX A;  1YCY A;  1Q82 R;  5GAM e;  3LLR A;  3H9N A;  2LQW A;  4M75 E;  2X9H A;  3OW2 A;  1Z9Z A;  2KT8 A;  3CC7 Q;  3VS5 A;  5FU7 C;  1QVF P;  2RM4 A;  3JB9 H;  3HHT B;  1ZA2 B;  3JSC A;  1QVG A;  4L59 A;  1XNI A;  2LQK A;  2M1H A;  1MMA A;  2BKD N;  4OMM A;  4E7K A;  3CCQ T;  2QA4 T;  1M1K C;  4PLL A;  4PJO E;  1VQL Q;  3SWN A;  2QTX A;  2LJ1 A;  1WJS A;  1JJ2 S;  1VQ9 Q;  1S1N A;  1YI2 Q;  2C0I A;  2DA9 A;  1M4Z A;  2QQR A;  2DFU A;  4M78 C;  1M1G A;  2QAZ A;  5M9O A;  1KQS S;  4XK8 E;  2JS0 A;  3CD6 A;  1DJ7 B;  1V1C A;  3QBY A;  2PVG B;  1UTI A;  5L8R E;  5FU6 C;  3OS2 A;  1HJD A;  2F5K A;  3OMC A;  3OYF A;  5A2Q E;  1M27 C;  1U5S A;  2HQX A;  4ELZ C;  2LCL A;  2LCS A;  3CC7 A;  4C92 B;  2FL7 A;  1TSF A;  1HXD A;  3M0S A;  1VQL A;  1M2O A;  4XU1 A;  3PMI A;  4B9W A;  4II1 A;  1QWE A;  1VQ9 A;  1IHW A;  4M7A G;  2D6F A;  3QUI A;  1YI2 A;  2CP3 A;  2BIV A;  2RPN A;  2CRE A;  2O2O A;  2JM9 A;  1W2B P;  1MMD A;  2DX1 A;  1KK7 A;  2Y4Y A;  4XTX A;  2KE9 A;  3E9F A;  4JRK A;  2L3P A;  2RJF A;  4F7U F;  5J39 A;  1VQL T;  4NL3 A;  3CXC A;  2JUF A;  2LX7 A;  5GAO n;  1VQ9 T;  1HD3 A;  3TSW A;  1YI2 T;  1ZSZ C;  1KHC A;  2E12 A;  1PNJ A;  3JB9 J;  2E10 A;  2K5F A;  2LDM A;  1Y57 A;  4PJO A;  3C94 A;  4UC4 A;  2LC4 A;  2P0P A;  2RHY A;  1X27 A;  3A8G B;  3OSS C;  2YXY A;  4M78 F;  2VUB A;  2DTI A;  3JB9 I;  3MJX A;  1T3S A;  3EH2 A;  5GAM h;  3CME Q;  1TXQ A;  1KG1 A;  1E6H A;  4QQ6 A;  2RB6 A;  2R5M A;  1VQM T;  4OML A;  1UE9 A;  3EGU A;  1KD1 C;  2CT4 A;  2XDP A;  1JJ2 P;  5KYU B;  5IT9 E;  5LJ3 h;  4QQD A;  1FYN A;  1WXB A;  4PJM A;  1RAD B;  5GAN 6;  4FYW B;  2PUO B;  3UA7 A;  4OMQ A;  4C0Z A;  3FLG A;  1HYO A;  4AT1 B;  3NFC A;  5GAM j;  2KRS A;  2JS2 A;  2GBQ A;  1VQK Q;  5DY9 A;  3H8Z A;  1JQQ A;  4M7D C;  1CSK A;  2KDS A;  4F14 A;  2LVM A;  1WJQ A;  5LJ3 j;  1G8X A;  3INZ A;  1VQ5 Q;  2DIQ A;  1IB8 A;  4KUL A;  2K6D A;  3CME A;  4HCC A;  4FSS A;  3MP8 A;  2DL3 A;  1YBY A;  2RNA A;  3S3O A;  1UB4 A;  3KFV A;  3N5B B;  1IGU A;  3PFS A;  1NJI R;  1ACM B;  4A4F A;  1NPR A;  1NYG A;  2CUB A;  1M1K U;  1WHK A;  1G3Y A;  2K9G A;  4XU0 A;  3VS2 A;  1N8R R;  3SWN B;  2RI2 A;  2WSE E;  3QWX X;  3DKM A;  3CME T;  3EFR A;  3OMG A;  2MWP A;  1VQK A;  1NYF A;  4C8Q C;  5CKE A;  1BYM A;  1M2V A;  2GTJ A;  3AHU A;  1FWZ A;  5D6X A;  2COW A;  2F1L A;  2G3R A;  4HVU A;  1UUE A;  3MP1 A;  1AOJ A;  2FPE A;  3NPF A;  3IQL A;  2IG0 A;  1VQ5 A;  2L3R A;  5GAM g;  1VQK T;  2MI6 A;  2CT3 A;  3RER A;  5EG2 A;  1VYV A;  1FX7 A;  4ELY C;  5LJ3 g;  4M7D F;  2VVK A;  1VQ5 T;  4AG2 C;  1WDX A;  2L89 A;  1T3L A;  5GAO r;  2VWF A;  1I5O B;  1YWO A;  2FG0 A;  2PVO B;  3M54 A;  1WFW A;  2OI3 A;  2V1R A;  2DL8 A;  4F7U B;  2GQI A;  1Q86 C;  2YRD A;  3H6Z A;  3OYK A;  2X4W A;  2RK2 A;  4M77 E;  4HT8 A;  3DLM A;  4M75 B;  3HSB A;  1VYU A;  4MDW A;  1Y71 A;  1MMG A;  3JCM J;  4AFS C;  4JJC A;  1ABQ A;  4DBQ A;  1X43 A;  3OS0 A;  3FDR A;  1K9M R;  4PJO B;  3EG1 A;  2H8H A;  1PRL C;  4C8Q F;  4QKU A;  1W1F A;  1WX6 A;  2XD0 A;  1JB0 E;  2OTJ T;  4F17 A;  1M90 R;  3CPW A;  2YHT A;  1AT1 B;  4J7I A;  4BE2 A;  3CC2 T;  2CZ6 B;  2DJQ A;  1SF9 A;  3QZ9 B;  2LRQ A;  4EMK A;  1VIE A;  1KD1 U;  5KCH A;  3L42 A;  2FPF A;  1KQ2 A;  3QXE B;  3OBY A;  1D1A A;  2COZ A;  2BE9 B;  2E5Q A;  2KNB B;  2MOX A;  3ZL7 C;  5FWB A;  1Q7Y C;  2VXE A;  1K8A C;  2X3X D;  4KGV B;  2MIO A;  2NUP A;  3CCE Q;  4J7F A;  3C12 A;  3CCV Q;  2DIG A;  2LZ6 B;  1KC8 C;  2A3L A;  5I2S A;  3JRZ A;  2HZY A;  4P5N A;  4E7Z A;  4OGE A;  3I55 Q;  3CCR T;  2MK5 A;  2VB6 A;  2C0T A;  2OAU A;  2CUD A;  3SDZ A;  3LYI A;  4LXC A;  2XMF A;  5HK0 A;  1PWT A;  2AKK A;  2E6Z A;  5L23 A;  3I35 A;  4Q5W A;  2DLP A;  1MMN A;  3OYM A;  2W10 A;  3L2U A;  1QMC A;  2XU8 A;  4M77 F;  1ZUU A;  1PSE A;  2AHJ B;  3BY7 A;  4E7J A;  3HKS A;  2V8I A;  3TQ7 P;  2KRO A;  3VS0 A;  1M30 A;  1W4S A;  1GFD A;  2KMT A;  3WVE B;  1MHN A;  4FW1 A;  4E47 A;  3OYY A;  3CCE A;  1LNX A;  1BCO A;  3CCV A;  2DRK A;  2L8D A;  2O9V A;  4J6Y A;  2EYW A;  2O9S A;  4BDZ A;  3FJ5 A;  3I55 A;  3QPH A;  1D0X A;  2L5Q A;  1WHL A;  3ZBD A;  4CI0 C;  1Q81 U;  1D3B B;  1UDL A;  1UGP B;  2J6K A;  3CCE T;  2XID A;  2YLC A;  5CAI A;  3HRU A;  1BKB A;  2CYZ B;  4JPB W;  1B07 A;  1BI0 A;  4ZN3 A;  4IKF A;  3I55 T;  1W6X A;  1RLQ C;  3KXT A;  1OZ3 A;  3HFO A;  2JTE A;  2X3W D;  1R8O B;  2LQ8 A;  1EFN A;  1Q86 U;  4KBM B;  2MWO A;  2DVJ A;  2DRM A;  2K2V A;  2YSQ A;  1QVP A;  2DD4 A;  4ZGJ B;  3CCM Q;  4QVD A;  4KT0 E;  2OTL T;  4RTX A;  4J9G A;  3OA6 A;  4HT9 A;  2DL7 A;  4KGZ B;  4JZ4 A;  1YHQ Q;  1OX8 A;  4K11 A;  3PMT A;  1QVF A;  3A8O B;  3CCU Q;  4C92 A;  1ZBJ A;  3UAT A;  1GCP A;  1G2B A;  4MMK A;  2ROL A;  1ZA1 B;  3M4Y A;  3PIO A;  3JB9 F;  1ZQ1 A;  5AT1 B;  3PE0 A;  3G71 Q;  3I5S A;  4EMK B;  3NHN A;  1BI1 A;  3RIR A;  4E7L A;  3VRZ A;  4M7A F;  3M0P A;  1N27 A;  1B3Q A;  1E6G A;  1R77 A;  1K0S A;  3CCM A;  2IPO B;  1VQ4 Q;  3HP9 A;  1K8A U;  1WYX A;  3CPF A;  4AMC A;  1VQN Q;  3ASK A;  1GL5 A;  1N9R A;  5CR2 A;  3QZ5 B;  1OZ2 A;  4F16 A;  2NUP B;  3DB4 A;  2KXC A;  1KC8 U;  1G3S A;  2L0A A;  2FVU A;  4BY6 B;  1I4K 1;  1VQ7 Q;  3CCU A;  2CZ0 B;  3T9N A;  2HD0 A;  2JN0 A;  3QHS A;  2A28 A;  3PNW C;  2M51 A;  3MPU B;  4L6V 5;  1U1T A;  4LDU A;  3G71 A;  4ZTJ A;  2EBP A;  3TVT A;  4M77 B;  1W2B A;  3EG3 A;  2FHD A;  1YWP A;  1YJW T;  4JRQ A;  4LE9 A;  3GNF B;  1I81 A;  3A98 A;  3EHR A;  2B8A A;  5KYU A;  1QKX A;  1EIF A;  4FT2 A;  3ZEH A;  4BI3 A;  1VQ4 A;  4BDY A;  1FMV A;  2M02 A;  2I2L A;  2PVD B;  4M4Z A;  3G71 T;  3EGD A;  1LCK A;  4Y92 A;  5GAO p;  4J6X A;  4QQG A;  1QP3 A;  2E1H A;  5LJ5 e;  1X6G A;  4ZGD B;  3CBO A;  3E1S A;  1VQ7 A;  3GPL A;  4J6W A;  1YJ9 Q;  4XQ3 A;  1F1B B;  2E6N A;  2ENM A;  2QK0 A;  5CKH A;  3A8H B;  4FSX A;  1UG1 A;  1ARK A;  3OYL A;  4WCI A;  4DA4 A;  4B6M A;  2DET A;  4HCK A;  1IO6 A;  4JLI A;  1PSF A;  3CC4 Q;  1WHJ A;  3OB9 A;  2GF7 A;  4OB3 B;  2R5A A;  1VQ7 T;  1QKW A;  4M78 E;  1PM3 A;  1UHC A;  1PKT A;  3NMZ C;  3S6W A;  4GLM A;  3H0H A;  3WVD B;  1PHT A;  1KD1 R;  3TU4 K;  1X2Q A;  4RCB A;  1IXD A;  1VOM A;  1OPL A;  3ME9 A;  3OYE A;  1FMW A;  1O75 A;  3P8H A;  1BIA A;  1SHG A;  1UEB A;  1JO8 A;  3BDU A;  2EKO A;  2RMO A;  2A36 A;  4KUI A;  1WHG A;  3VUZ A;  5GMK h;  3M56 A;  5LJ5 f;  3OW2 S;  1YNZ A;  4Z89 A;  4R0K A;  3UPU A;  3NTK A;  4HVV A;  1QVG S;  1ZHI A;  3L2Z A;  1Y0M A;  1AZG B;  3A8L B;  3C0C A;  3CD6 T;  1AZE A;  4Y91 A;  1ZLM A;  3CQT A;  5GMK j;  1N5Z A;  5FWC A;  2F2X A;  1MUZ A;  1JXM A;  1Y07 A;  3ULR B;  4LN2 A;  1WQW A;  4PL6 A;  5HKC A;  4F7U A;  3CC7 T;  2JW4 A;  2VGM A;  2KGT A;  5FLX E;  2M0Y A;  4M75 A;  2EQJ A;  2ZPI B;  4BAC A;  3EG2 A;  1U06 A;  5LJ3 f;  2D8J A;  2O4X B;  4IUU A;  6AT1 B;  3EG0 A;  4FL6 A;  3V7S A;  4M78 A;  2KXD A;  3MEU A;  2L3Q A;  1NBE B;  2I0N A;  1RAH B;  2YUO A;  1XQH A;  1V29 B;  2ED1 A;  2KAF A;  3VJP A;  3OYC A;  1SRM A;  3KUF A;  3OYG A;  3M4G A;  1A0N B;  3P8B B;  2AK5 A;  5IAY A;  1H3Z A;  2HNI A;  3VV0 A;  4AG1 C;  4QW2 A;  1RAA B;  2BZX A;  1OI1 A;  5I22 A;  1UGV A;  5CKB A;  1VUB A;  1K0X A;  1LVK A;  2EYZ A;  2DIL A;  1T0J A;  5KE2 A;  3EH1 A;  3L2Q A;  1Z9Q A;  2WAC A;  3MEW A;  5IN1 A;  4C0D B;  5GAN 3;  3CXC S;  4M75 D;  2R58 A;  2LJ0 A;  4M7D E;  2CP5 A;  2E65 A;  2RQV A;  3LGF A;  1AWO A;  2K7A A;  1Q95 G;  2DMO A;  1N6A A;  2CP6 A;  1Q86 R;  3O8V A;  1KQS P;  3M55 A;  2A7Y A;  4J5Y A;  3EGD B;  1BU1 A;  1M1F A;  2DE0 X;  1U8R A;  1TTH B;  2EGA A;  2RH2 A;  1QW1 A;  2A08 A;  1VIF A;  3OW2 P;  5HY6 A;  2ZPG B;  4PJO D;  5D6Y A;  1FXX A;  4OMP A;  4JDS A;  2EGE A;  5D7U A;  1K9A A;  4AFU C;  2YUQ A;  3RNJ A;  1D09 B;  1QVG P;  4FM4 B;  1D0Z A;  2KYM A;  3VRY A;  1ZSZ A;  4RTV A;  2J05 A;  3AT1 B;  2LNH B;  4RTZ A;  2X4Y A;  4JS5 A;  3JCM P;  3V8K A;  4OMN A;  5GJW B;  3CCS Q;  5GAN 7;  3OS5 A;  4C8Q E;  1P92 A;  2CDT A;  2E70 A;  4JRP A;  1VQ6 Q;  1VQO Q;  1IZ6 A;  3X20 B;  1RAB B;  4CC3 A;  1KFZ A;  2XHC A;  3QG1 A;  2KY9 A;  1IGQ A;  8AT1 B;  1LPL A;  5GAO q;  2RQU A;  3G6E Q;  2YUP A;  1Q7Y R;  3UDC A;  3M0U A;  3WXM B;  3MCA B;  2EJG A;  1M3A A;  3GNG A;  2OJ2 A;  4J9E A;  4E7I A;  1OU9 A;  2DO3 A;  3G4S Q;  2RHU A;  4R56 A;  2FZG B;  2V1Q A;  4HXJ A;  1K4U S;  2A0F B;  2QGF B;  3VU3 C;  1U1S A;  2EQM A;  1D3B A;  1KC8 R;  1GCQ C;  1Q81 C;  4XTY A;  1AHJ B;  2MAM A;  5KE3 A;  2O88 A;  2GQV A;  4M7D A;  2J06 A;  1AWW A;  2RHX A;  3JCM c;  3L1A A;  3CCS A;  1AVZ C;  1GXI E;  3ER0 A;  4EDU A;  1VQ6 A;  1VQO A;  2K3X A;  2DK3 A;  3MP6 A;  3J80 E;  3JCM f;  1D1C A;  2P84 A;  2JTM A;  4A4K A;  1QWF A;  2DAQ A;  2KEA A;  2WSF E;  2NUT B;  1G83 A;  5CQX A;  2KVQ G;  2DVE A;  2X35 A;  3J81 E;  3G6E A;  2CP7 A;  5FU7 B;  2CZ7 B;  1UGQ B;  3I9Q A;  3SHW A;  3CCS T;  3PVQ A;  3NTH A;  3VYH B;  5IXF A;  3REB B;  1KQ1 A;  3G4S A;  1VQ6 T;  1AEY A;  1VQO T;  4LD6 A;  4BE0 A;  1GBQ A;  4JS4 A;  5IXB A;  2HKQ B;  4C8Q A;  2HL3 A;  2AIR B;  4M78 B;  1OV3 A;  1OOT A;  4IIO A;  2RN8 A;  1K73 C;  2HEQ A;  4BE1 A;  2DYB A;  4F7U G;  1YIT Q;  1M3C A;  4Z8A A;  3G4S T;  2ZAE A;  3U23 A;  2F5T X;  5FU6 B;  1G3W A;  4M75 G;  4RG8 A;  3RKX A;  4LDX A;  4RG2 A;  4N0A C;  2O01 E;  2HBW A;  5GAN 4;  2DEU A;  3MKD A;  1OU8 A;  4XTV A;  3SB2 A;  4DBH A;  4XAX B;  1K1Z A;  3VS6 A;  1NJI C;  4A53 A;  1QCO A;  4PJO G;  2AZS A;  4KH0 B;  4N4I A;  3DLL A;  2H3J A;  4IUR A;  5AYF A;  1WJR A;  4MZP A;  1SG5 A;  1YCS B;  3JCM b;  2ZPB B;  2PU9 B;  1O9S A;  3G1J A;  3O5Z A;  5GAN 2;  2YDL A;  3CPW S;  2C0O A;  1UEC A;  4KUD K;  2MCN A;  2COY A;  4O5V A;  1JEG A;  2BTT A;  2ZPE B;  4A4E A;  1YIT A;  2VC8 A;  2DTO A;  4D6W A;  4X9D A;  2Y90 A;  4DBR A;  4RTW A;  3V8J A;  3QYG B;  3PTA A;  4HCZ A;  3QWY A;  4PFO A;  2DKG A;  1QCF A;  2F69 A;  1ZSZ B;  4M77 A;  1RAF B;  3VYG A;  4OB1 B;  5FRM A;  3EG9 B;  4B9X A;  4DEY A;  2VKN A;  3P8D A;  3A5Z B;  2YRV A;  2P0K A;  4NL2 A;  1C0M A; 
#chains in the Genus database with same CATH homology
 2K5I A;  1I4K 1;  3S3M A;  2EJF A;  4II1 A;  3CCU A;  1WGS A;  2CZ0 B;  3SFM A;  3T9N A;  2HD0 A;  1VQ9 A;  2GFA A;  2JN0 A;  3C95 A;  4X34 A;  4M7A G;  3QHS A;  2D6F A;  2DEQ A;  4M7A E;  3QUI A;  1YI2 A;  3PNW C;  2M0O A;  2BIV A;  5CK9 A;  2DXB A;  4L6V 5;  2Y4Y A;  1U1T A;  4IUV A;  3LW5 E;  4LDU A;  4XTX A;  3E9F A;  4JRK A;  3G71 A;  3L2W A;  4EMK C;  4ZTJ A;  5FRO A;  4M7D B;  4LDY A;  2RJF A;  1KHI A;  3QII A;  4M77 B;  1W2B A;  2FHD A;  4F7U F;  3E19 A;  1YJW T;  5GAN f;  2DXC A;  5J39 A;  1VQL T;  4NL3 A;  4JRQ A;  3GNF B;  1I81 A;  3CXC A;  2GCX A;  2B8A A;  2JUF A;  5GAO n;  1VQ9 T;  3ZFJ A;  1EIF A;  2RI5 A;  4FT2 A;  3ZEH A;  4BI3 A;  5KCO A;  4M77 D;  1VQ4 A;  4BDY A;  1YI2 T;  1KHC A;  3CCV T;  2E12 A;  3JB9 J;  2E10 A;  2K5F A;  2LDM A;  4C5H A;  3JCM W;  2JVV A;  3C94 A;  2M16 A;  2LT4 A;  2QI2 A;  3CEY A;  2XIC A;  4UC4 A;  2I2L A;  2D0Q B;  4BY6 B;  5GAN d;  2LC4 A;  2P0P A;  4C92 C;  2PVD B;  2RHY A;  3LH0 A;  4OVA A;  3G71 T;  3PGG A;  3A8G B;  3OSS C;  2JOY A;  4M78 F;  1IRE B;  2VUB A;  2DTI A;  1M9S A;  2JNG A;  5GAO p;  4J6X A;  4QQG A;  3JB9 I;  1QP3 A;  2EJ9 A;  5GAM h;  4M7D D;  3QKJ A;  3G6E T;  1KG1 A;  2E1H A;  5LJ5 e;  2V8K A;  4BY6 C;  4ZN1 A;  4ZGD B;  3CBO A;  3E1S A;  4QQ6 A;  1VQ7 A;  5CQY A;  2RB6 A;  3GPL A;  2R5M A;  3HRT A;  2LCC A;  4J6W A;  4XQ3 A;  3UWN A;  1VQM T;  2E6N A;  2PUK B;  2OTJ A;  4ATO A;  1KD1 C;  2EAY A;  4V2S A;  5CKH A;  2XDP A;  5LL6 S;  3CC2 A;  3A8H B;  4FSX A;  3QYH B;  5KH6 A;  3PIP A;  4PNO A;  5IT9 E;  2CZ1 B;  5LJ3 h;  4QQD A;  4DOW A;  1Q82 U;  3OYL A;  2EFI A;  4DA4 A;  1ZBX A;  1X01 A;  5GAN 6;  4RMO A;  2PUO B;  3X25 B;  4C0Z A;  1I5L A;  4M77 C;  3FLG A;  1Y7X A;  3GOX A;  4JLI A;  3RMS A;  1NPP A;  1PSF A;  3NFC A;  5GAM j;  5GAO m;  3JCM h;  3OB9 A;  1X75 C;  2GF7 A;  2R5A A;  4M78 G;  4OB3 B;  1VQ7 T;  4M78 E;  2DXU A;  5DLO A;  4QVZ A;  3S6W A;  3MEV A;  4C8Q B;  4CRI A;  5DY9 A;  1K73 U;  3H8Z A;  2RJD A;  3EAE A;  2ZGW A;  3WVD B;  4M7D C;  2QEX A;  5C6S A;  3TU4 K;  3FJP A;  2KDS A;  4QVC A;  3OBW A;  4RCB A;  3V8L A;  3VKI A;  2Y4X A;  3GP8 A;  1N8R C;  2LVM A;  1WJQ A;  5LJ3 j;  3ME9 A;  4C8Q D;  3OYE A;  3INZ A;  3OYN A;  5I21 A;  1O75 A;  3P8H A;  4M7A A;  1BIA A;  2DIQ A;  4C5I A;  2CKK A;  4KUL A;  2VXF A;  2EQK A;  5GAN 8;  1YIJ A;  1UEB A;  5GAN e;  4EMH A;  2XDD A;  3CME A;  1YJN A;  4HCC A;  4XTU A;  1BIB A;  3BDU A;  2EKO A;  1YBY A;  3MP8 A;  3CCR A;  2LNV A;  4KUI A;  3S3O A;  5CIU A;  1UB4 A;  3N5B B;  2EWN A;  3VUZ A;  3PFS A;  5GMK h;  3M56 A;  5LJ5 f;  3URG A;  3OW2 S;  3S3N A;  5C0M A;  2M9U A;  3G7Z A;  4A4F A;  3UPU A;  3AHU A;  1NJI U;  4LDV A;  3NTK A;  1NPR A;  1Y96 A;  4OGC A;  3LGL A;  3LX7 A;  1M1K U;  1G3Y A;  3JCM V;  4XTW A;  2PQW A;  4XU0 A;  4FIB A;  1QVG S;  4OF1 A;  3M5A A;  3X24 B;  2E64 A;  1ZHI A;  3SWN B;  2RI2 A;  2WSE E;  3L2Z A;  4A4G A;  2RD1 A;  5CVI A;  3DKM A;  1QVF S;  2K3Y A;  3OQ5 A;  3CME T;  1YIJ T;  1YJN T;  2MMP A;  3EFR A;  3OMG A;  2MWP A;  5LJ5 d;  2O4X A;  5FRN A;  4MZM A;  1VQK A;  4PJO D;  1YHQ A;  1VQ8 A;  3C4S A;  5GMK m;  3A8L B;  3CD6 T;  4C8Q C;  5CKD A;  5CKE A;  1BYM A;  2EQU A;  1YIT T;  4Y91 A;  4IUT A;  3SD4 A;  3L2R A;  2RO0 A;  2ZPF B;  5GMK j;  2DTH A;  1S72 A;  2RJE A;  2V8J A;  3JB9 D;  1FWZ A;  2XKO C;  4JLG A;  5D6X A;  1H64 1;  2DXT A;  1LJO A;  4XU2 A;  4C92 D;  4N0A A;  2G3R A;  3QJY A;  5DM7 R;  3CCM T;  3MP1 A;  4Z02 A;  1Y07 A;  4FT4 A;  5HK3 A;  3RUX A;  1WPY A;  1WQW A;  4PL6 A;  5HKC A;  3R6O A;  4F7U A;  3TCJ A;  1G3T A;  2IG0 A;  1VQ5 A;  2L3R A;  3OYI A;  3CC7 T;  3CCL A;  2VGM A;  3TEE A;  4MZT A;  2JZ2 A;  2LX9 A;  2CS7 A;  2VV5 A;  1XOV A;  5GAM g;  1VQK T;  2MI6 A;  5FLX E;  1YHQ T;  1VQ8 T;  3RER A;  4M75 A;  3BW1 A;  1I8F A;  1VQP A;  5EG2 A;  1UGR B;  2EQJ A;  4A54 A;  2ZPI B;  4C92 E;  4BAC A;  1WQ7 A;  5LJ3 f;  1FX7 A;  4JJN K;  4NS5 A;  3CCU T;  3MEA A;  3UT1 A;  2O4X B;  4IUU A;  3QDR B;  2RA2 A;  3GIB A;  2WSC E;  4FL6 A;  3V7S A;  2FYK A;  4M78 A;  3RKY A;  3MEU A;  2QQS A;  4ELY C;  5LJ3 g;  4M7D F;  3SWN C;  1VQ5 T;  1VQN A;  3CCL T;  4A4H A;  3CBP A;  1XQH A;  1V29 B;  2KAF A;  4N4H A;  3VJP A;  2L89 A;  3PT9 A;  3OYC A;  3KUF A;  4C5E A;  4GLK A;  5GAO r;  3OYG A;  3M4G A;  1K9M C;  5LJ3 d;  3GLX A;  2QXF A;  3P8B B;  3JCM g;  4BD3 A;  2PVO B;  5IAY A;  1NE8 A;  2HNI A;  3M54 A;  3VV0 A;  1VQP T;  1H3Z A;  4QW2 A;  1SSF A;  4F7U B;  1Q86 C;  2XDB A;  2JTF A;  3OYH A;  4VUB A;  4M7A C;  3H6Z A;  3L2V A;  1OI1 A;  3OSV A;  3OYK A;  2X4W A;  1QP2 A;  2RK2 A;  3BFM A;  4O6J A;  3TRE A;  4M77 G;  2RI3 A;  2DZ9 A;  5CKB A;  1JRI A;  2RJC A;  4M77 E;  1M90 C;  4HT8 A;  3DLM A;  4M75 B;  4OB2 B;  1VUB A;  3HSB A;  4R55 A;  2C06 A;  1VQ4 T;  4MDW A;  2XK0 A;  1Y71 A;  1W2B S;  1VQN T;  3EFS A;  5GAN 5;  5KE2 A;  1OYX A;  3L2Q A;  3JCM J;  2WAC A;  2R57 A;  3MEW A;  5IN1 A;  4C0D B;  3JCM Q;  5GAN 3;  3CXC S;  4BI4 A;  2OTL A;  3HPW A;  4M75 D;  4M7D G;  2R58 A;  3HL8 A;  3OS1 A;  3OYB A;  3OS0 A;  1JJ2 A;  4M7D E;  3RKW A;  1BI3 A;  4J83 A;  2E65 A;  3FDR A;  3LGF A;  2NLU A;  5I2M A;  4PJO B;  1N6A A;  4XTZ A;  2IVW A;  3F70 A;  3O8V A;  4TVR A;  2A7Y A;  3M55 A;  4C8Q F;  4J5Y A;  3V7R A;  1M1F A;  3CCJ A;  3CCQ A;  1U8R A;  2XD0 A;  1JB0 E;  2OTJ T;  2KK4 A;  2RH2 A;  1QW1 A;  3CPW A;  3V7C A;  1VIF A;  5GAN h;  5HY6 A;  2ZPG B;  1X6O A;  2VYT A;  2YHT A;  4J7I A;  5D6Y A;  4BE2 A;  1M90 U;  1FXX A;  3CC2 T;  4LD9 K;  2CZ6 B;  3I56 A;  4JDS A;  3QZ9 B;  2LRQ A;  4EMK A;  2P0Q A;  1VIE A;  1KD1 U;  4XU3 A;  5KCH A;  2E41 A;  4HCB A;  3L42 A;  3KBG A;  4MDX A;  1KQ2 A;  3QXE B;  3CBM A;  3OBY A;  2XG8 D;  1MGQ A;  2FB7 A;  4FM4 B;  4NOY A;  2E5Q A;  5A0L A;  3NTI A;  1BI2 A;  3OYJ A;  4ZTF A;  2ZZD A;  1LOJ A;  4RKU E;  5GMK i;  5LJ3 e;  3E9G A;  3CCJ T;  2ZPH B;  4M75 C;  1Q7Y C;  1YJ9 A;  4JUV A;  2VXE A;  2X4Y A;  1K8A C;  4JS5 A;  3JCM P;  3V8K A;  1TH7 A;  2QEX T;  4C8Q G;  3I56 T;  5GAN j;  2DD5 A;  5GAN 7;  2KSS A;  4BUG A;  1RL2 A;  3OS5 A;  4C8Q E;  4EMG A;  3FIF A;  4C0D C;  1P92 A;  2E70 A;  5CO7 A;  4JRP A;  1B34 A;  3M59 A;  3C12 A;  4J7F A;  1IZ6 A;  2DIG A;  4DQ2 A;  3QSU A;  3BDL A;  3X20 B;  1KC8 C;  1N8R U;  2A3L A;  4PJO C;  4BI8 B;  4C92 F;  2XHC A;  3QG1 A;  2KY9 A;  5I2S A;  3CC4 A;  3JRZ A;  1HK9 A;  4P5N A;  5GAO q;  4GY5 A;  4OGE A;  3CCR T;  4BB7 A;  1M8V A;  2OAU A;  3SDZ A;  1YJ9 T;  4E7H A;  1RI0 A;  4JRI A;  4M7A B;  4IUQ A;  3LYI A;  3UDC A;  3WXM B;  1NZ9 A;  3MCA B;  4LDW A;  2EJG A;  5HK0 A;  2DPP B;  3M9Q A;  3GNG A;  4PKC C;  1Q7Y U;  5D6W A;  4E7I A;  2K5L A;  4YTL A;  2DO3 A;  4L5G A;  2E6Z A;  2YLB A;  2HBP A;  5GAM f;  4M7A D;  2RHU A;  5GMK e;  4WF2 A;  3X28 B;  4R56 A;  4Q5W A;  3HRS A;  3OY9 A;  3VU3 C;  3OYM A;  3CC4 T;  1Y96 B;  1U1S A;  2EQM A;  1D3B A;  3L2U A;  4HA8 A;  3VUB A;  4OMF B;  1B34 B;  2XU8 A;  4M77 F;  4XTY A;  3LWH A;  1AHJ B;  3JB9 G;  3QJ6 A;  1Q81 C;  2MAM A;  5KE3 A;  1XTD A;  2QDY B;  4EPC A;  1PSE A;  2X4J A;  4FU6 A;  2GQV A;  4C92 G;  2AHJ B;  4B9W A;  1YJW A;  3BY7 A;  4M7D A;  2LTO A;  4E7J A;  3HKS A;  2V8I A;  1S72 T;  3Q1J A;  2RHX A;  3JCM c;  5GAM d;  1W4S A;  3MO8 A;  4N4G A;  3L1A A;  3RMQ A;  3CCS A;  2KMT A;  1GXI E;  3ER0 A;  1MHN A;  3WVE B;  4E47 A;  3OYY A;  4EDU A;  3CCE A;  5CKF A;  1LNX A;  2EYQ A;  3CCV A;  1VQ6 A;  1VQO A;  2K3X A;  2L8D A;  2DK3 A;  4J6Y A;  4OP0 A;  5LJ5 h;  3MP6 A;  3J80 E;  3JCM f;  4A4K A;  4MML A;  2JTM A;  4C0F A;  5A0G A;  4C5G A;  2DAQ A;  2WSF E;  3LWI A;  4J8O A;  2D9T A;  4BDZ A;  3I55 A;  5CQX A;  2K4Y A;  2KVQ G;  2DVE A;  4C0G A;  2VGN A;  3QPH A;  2L5Q A;  2X35 A;  3J81 E;  1WNL A;  3G6E A;  5FU7 B;  5CCA A;  3ZBD A;  2CZ7 B;  1UGQ B;  2X4X A;  3MET A;  4CI0 C;  4IUP A;  1Q81 U;  2BUD A;  3RES A;  1D3B B;  3CCS T;  3OYD A;  4M75 F;  2LT1 A;  3JCM d;  5GAN g;  3NTH A;  3VYH B;  1VQM A;  1UGP B;  3CCE T;  4RCC A;  3JCM X;  1Q82 C;  2GFU A;  1KQ1 A;  2RHZ A;  2XID A;  3G4S A;  1VQO T;  2XI9 A;  2YLC A;  4ZGE B;  4LD6 A;  3HRU A;  5CAI A;  4BE0 A;  1BKB A;  2CYZ B;  5LJ5 j;  2P4T A;  1JBM A;  3M58 A;  2ZCF B;  1UGS B;  4JS4 A;  1BI0 A;  4ZN3 A;  4C8Q A;  2K57 A;  4OB0 B;  4IKF A;  3OYA A;  3I55 T;  4M78 B;  3X26 B;  3A8M B;  4PJO F;  5GAO l;  1K73 C;  3KXT A;  2DJZ A;  1K9M U;  3QO3 A;  4BE1 A;  1OZ3 A;  3HFO A;  5A0D A;  1VQ6 T;  3FEO A;  5J26 A;  1R8O B;  4F7U G;  2LQ8 A;  5DLQ E;  1Q86 U;  4KBM B;  4M78 D;  4F7U E;  2QA4 A;  5J3B A;  3G4S T;  1N9S A;  2MWO A;  2F5T X;  1YCY A;  5FU6 B;  1G3W A;  2K2V A;  2DZC A;  3LLR A;  1QVP A;  5GAM e;  2DD4 A;  4M75 G;  4RG8 A;  1KQS A;  3RKX A;  4ZGJ B;  4LDX A;  4QVD A;  4M75 E;  4RG2 A;  4KT0 E;  2OTL T;  4N0A C;  2O01 E;  3OW2 A;  2RK1 A;  5GAN 4;  3OA6 A;  4HT9 A;  4XTV A;  5FU7 C;  3SB2 A;  3JB9 H;  2RM4 A;  4XAX B;  3HHT B;  3JSC A;  1QVG A;  4L59 A;  1XNI A;  1NJI C;  2LQK A;  4A53 A;  2M1H A;  2BKD N;  4PJO G;  4E7K A;  2MF2 A;  2RHI A;  3PMT A;  3CCQ T;  2QA4 T;  1M1K C;  4PLL A;  4PJO E;  1QVF A;  2QQB A;  3SWN A;  2QTX A;  3A8O B;  1WJS A;  4N4I A;  1JJ2 S;  3DLL A;  2H3J A;  4ME7 A;  4IUR A;  4C92 A;  2EIF A;  3HFN A;  5AYF A;  3JCM e;  1WJR A;  4MZP A;  3CMA A;  3M57 A;  1M4Z A;  2QQR A;  2HAX A;  4MMK A;  4M78 C;  3M4Y A;  3JCM b;  1M1G A;  2ZPB B;  2PU9 B;  3PIO A;  1O9S A;  3JB9 F;  1ZQ1 A;  3M53 A;  5GAN 2;  5M9O A;  3CPW S;  1KQS S;  5GMK l;  4KUD K;  4EMK B;  3J7A F;  4XK8 E;  4PLI A;  4O5V A;  1BI1 A;  1M5Q 1;  3RIR A;  4E7L A;  2ZPE B;  4A4E A;  3CD6 A;  1YIT A;  4M7A F;  2VC8 A;  3PMI A;  1DJ7 B;  2DTO A;  2PVG B;  3QBY A;  1N27 A;  4D6W A;  4HKE A;  5L8R E;  2QQA A;  4X9D A;  2Y90 A;  5FU6 C;  3QYG B;  3V8J A;  3PTA A;  4HCZ A;  3OS2 A;  2F5K A;  3OMC A;  3CCM A;  3FRN A;  2QQ9 A;  3GF5 A;  5LJ5 g;  2DKG A;  3OYF A;  3HP9 A;  1K8A U;  3CMA T;  2F69 A;  5A2Q E;  4M77 A;  2KQW A;  1G5V A;  3CPF A;  4OB1 B;  2HQX A;  3VYG A;  4ELZ C;  2LCL A;  5FRM A;  2CGH A;  2HQE A;  3CC7 A;  3ASK A;  4DOV A;  4Y28 E;  4B9X A;  3FB9 A;  3MHX A;  4C92 B;  1N9R A;  3P8D A;  3QZ5 B;  1OZ2 A;  5CR2 A;  3A5Z B;  4PJO A;  3DB4 A;  2YRV A;  2FL7 A;  3DB3 A;  3FC3 A;  3JAM E;  1KC8 U;  1G3S A;  2P0K A;  1HXD A;  4NL2 A;  1VQL A;  4XU1 A;  4X9C A;  2FVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...