2F5KA

Crystal structure of the chromo domain of human mrg15
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
83
structure length
83
Chain Sequence
DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords MORF-related gene 15 isoform 1
publication title Structure of human MRG15 chromo domain and its binding to Lys36-methylated histone H3.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 83
sequence length 83
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-11-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2f5kA01
2RI2A 4B9WA 3OY9A 5KCOA 2JZ2A 3EAEA 2O4XA 4A4EA 4HCZA 2BUDA 3NTIA 2EQJA 3ASKA 3FLGA 2X4YA 1XNIA 2O4XB 3MO8A 4II1A 3SD4A 4IUTA 2RHUA 4C5HA 3OYLA 3L2VA 3GOXA 3FEOA 3QKJA 3E9FA 3PFSA 2DIQA 3NTHA 3C4SA 4PLIA 4B9XA 3OYEA 2RHYA 4BD3A 1MHNA 4C5GA 3L2WA 4BE1A 4C5IA 4BACA 4RG2A 3DB4A 3OYDA 3LGLA 3L2QA 2YRVA 5FROA 2WACA 4E7LA 5CIUA 4N4HA 4C5EA 3META 3MP1A 4OVAA 1RI0A 4E7JA 2RJDA 3MP6A 2D9TA 3Q1JA 4IUQA 4NS5A 5J39A 3S6WA 3OYBA 2RJEA 3MEWA 5D6YA 2GFUA 4A4GA 4FU6A 3OS1A 3FDRA 2MWPA 2L89A 3PNWC 2E5QA 2M1HA 2K3YA 2IG0A 1N27A 2QQRA 4N4IA 3DLMA 4QQDA 3OYGA 3ME9A 4N4GA 5IN1A 4ZTJA 2LCCA 4E7KA 2PQWA 3OS2A 3PMIA 5KE2A 3E9GA 1WJQA 3FC3A 2E6NA 5KE3A 3BDLA 3MP8A 4QVZA 4Z02A 1SSFA 2G3RA 3PMTA 2JTFA 1WJRA 2B8AA 3OYAA 3OYMA 2RHXA 2RJCA 2MWOA 3OYCA 4QQGA 3MEUA 4IUUA 3P8HA 3L2RA 2R57A 3MEVA 1WJSA 4L59A 2BIVA 3UT1A 4A4FA 4BDYA 2BKDN 2HQEA 3LX7A 3UWNA 3LYIA 2XK0A 2EQUA 3OB9A 4IUVA 3QJ6A 4CRIA 1WGSA 1OYXA 2QQSA 4PL6A 4X34A 3QIIA 4QQ6A 2R58A 4FL6A 4LD6A 3ZEHA 2P0KA 3MEAA 3NTKA 4IURA 3OA6A 1OZ3A 2NLUA 4E7IA 2K3XA 3OYNA 1G5VA 3DB3A 1KHCA 3L2UA 4Q5WA 3S3NA 5C0MA 3KUFA 1OZ2A 3OMGA 5IAYA 3S3OA 2HQXA 4UC4A 2M16A 2VYTA 3QBYA 2EFIA 3H8ZA 4GY5A 4EDUA 5C6SA 3P8DA 5KCHA 2EQKA 4PLLA 3H6ZA 4BDZA 3LH0A 4IKFA 4A4HA 2X35A 2CKKA 2EQMA 3OYKA 4BE2A 2LRQA 4BE0A 3CEYA 2RI5A 4E7HA 5FRNA 3L42A 4ZTFA 3OYFA 3O8VA 3OYHA 3S3MA 2RJFA 2X4XA 2R5MA 3OQ5A 2GFAA 3F70A 2LVMA 2F5KA 2X4WA 2R5AA 2RHIA 2DAQA 1OI1A 2RI3A 3LLRA 3OYIA 4IUPA 5D6XA 5D6WA 2LTOA 3LGFA 2FHDA 2LDMA 2XDPA 2DIGA 4QW2A 5KH6A 3OS0A 3OYJA 1H3ZA 2GF7A 2RHZA 3M9QA 5M9OA 5FRMA 2EKOA 3OMCA 2M0OA 2L3RA 2RO0A 2L8DA 5J26A
chains in the Genus database with same CATH superfamily
1S72A 2M02A 3M0SA 3G4ST 2FZKB 3J80E 1K9MC 2W0ZA 3HFNA 2CZ6B 2KDSA 4M7AD 3CCUA 2XIDA 4J7IA 3RMQA 2F2WA 1W2BP 5EG2A 1VQNT 1NBEB 1ZBJA 2M9UA 2DIQA 4B9XA 2E5KA 3LW5E 3CCSQ 2HSPA 3DB4A 1YFNA 4ELZC 1WQ7A 3CCMQ 1Q82C 3CC4Q 1RI9A 1EFNA 2QA4T 1OU8A 1VQLA 1OQKA 2LC4A 5FWCA 1UTIA 2FRYA 1RABB 4AG1C 3O5ZA 1N8RU 1CKAA 2LX7A 3OYYA 3PNWC 4LUEA 2M1HA 5GAOp 1V1CA 2KXCA 1QCOA 1VQKT 3G71A 1QP2A 3VV0A 4ZTJA 2EGAA 2LCCA 1SRMA 3REAB 2DFUA 4ANJA 2E6NA 3G4SA 4JLIA 3TCJA 4C92C 2JTFA 1PRLC 3CCLA 3H0FA 1WA7A 3UA6A 2CS7A 4FT4A 3EGDB 2BZYA 1ZBXA 3LH5A 1N9RA 1Y71A 5IXFA 4M7DG 4KGXB 2A36A 2FG0A 4E2FB 2PU9B 2D1XA 2ZPFB 2ZAEA 1M4ZA 1M8MA 2C0TA 1G5VA 4R56A 1GBRA 2KAFA 4UC4A 3H8ZA 5KCHA 5KYXA 5KYXB 1VQPQ 1BI3A 3GNGA 2R5MA 2DM1A 2CP5A 2F5KA 1CKBA 2DBMA 2VV5A 2RI3A 2CZ0B 4LDUA 5D6XA 2CUDA 4MZTA 1NJIU 2SEMA 1IZ6A 1NJIR 2E41A 2AK5A 3GLXA 4M78F 4EMHA 5GAOl 4F17A 5ECAA 2WSCE 3JB9J 2KSSA 2RNAA 4F7UA 2YUOA 4II1A 3CQTA 2FL7A 1NLPC 4QKUA 1VA7A 1U1TA 3VRZA 4KUIA 2FEIA 1QP3A 5FROA 5KYYB 1YN8A 3V8JA 4KGVB 2COYA 1M27C 2QXFA 3MEWA 5D6YA 2GFUA 3SDZA 2NUPA 3KFVA 4PJOF 1LPLA 4J9IA 3UA7A 4HT8A 2K3YA 1T0JA 1D09B 5GANd 3PMIA 2RK1A 4K11A 1SHGA 2PUOB 2HQHA 5GAMh 2B8AA 4Y92A 2DO3A 2JUFA 4L59A 4LN2A 2EQUA 4FT2A 1BB9A 1RACB 2M51A 5L8RE 2E12A 4M78D 1X6GA 1Q7YU 4AFQC 2C0IA 3SHWA 2VYTA 5CR2A 2CSIA 2F2XA 1VQ8T 1VQMQ 1LVKA 1EZZB 1RAEB 4A54A 3EHRA 4ZTFA 5GMKl 3FJ5A 2QI2A 1ARKA 1AT1B 1MGQA 2JVVA 4JRQA 2GFAA 4OMLA 1AWWA 5J3BA 3PVLA 1JO8A 1MUZA 1NPRA 2XDPA 4RCCA 4P5NA 3VJPA 1WX6A 1BK2A 3L2ZA 4KRTA 3VS0A 3EG2A 5J26A 2DL4A 1G3YA 4HVUA 1N9SA 1O9SA 2KR3A 4A4EA 4PJOD 1BCOA 2EQJA 3QUIA 1ZX6A 1P92A 4DBQA 4Z89A 1Z9ZA 4BD3A 3L2WA 4C5IA 4BUGA 3G6EA 3RESA 1JJ2P 4JUVA 4M7AA 4IIMA 3CCQA 3OYDA 3CCEA 3TSWA 4M7AB 3HRUA 5DLOA 4TVRA 1YWOA 4KT0E 3RDVA 4JRIA 4J7FA 3EG3A 3OYBA 5GAN8 4OGEA 4M77D 3FRNA 5GAMj 2CT4A 5D7UA 2E3IA 1WHJA 1I5LA 4BY6B 1NG2A 8AT1B 3E9GA 5KE3A 3X28B 2M0YA 3CCRT 2RF0A 3JB9G 2F1LA 1PD0A 1Y0MA 2QGGA 2X3XD 3OSSC 2C0OA 1JQQA 4C8QD 2R58A 1QW1A 2LMJA 1PM3A 3MEAA 3NTKA 1F1BB 3JCMc 1YJWA 2YSQA 3OYNA 4E47A 1VQ6Q 2HEQA 2E10A 2OJ2A 2HCKA 3HL8A 5IAYA 1RLPC 3S3OA 1N5ZA 2DEQA 1VIFA 3RKWA 1YHQT 4AG2C 1R8OB 4BDZA 1PG5B 3QXEB 1VQ7T 2DA9A 1JB0E 3VS6A 1TU0B 2X4XA 4OB2B 2QEXQ 3SWNA 4HKEA 1B07A 2AT1B 3SWNB 2LTOA 3LGFA 2DL7A 5HK0A 2L3RA 3HTRA 2H3EB 5LL6S 1UB4A 3TU4K 1PNJA 2DL3A 2V8KA 2FZGB 2NUZA 1FMKA 2D6FA 2GCXA 1N6AA 1X43A 3VRYA 2FB7A 3TQ7P 3MO8A 3QYHB 2LT1A 4LDWA 4EPCA 3PIPA 1HK9A 1H3HA 4XTZA 4PLIA 4C5GA 2OAWA 1VQ4Q 2QG9B 2XHCA 4M7AC 2LZ6B 4WCIA 2OAUA 1SHFA 2MCNA 2RB6A 2YRDA 3CXCA 1VQ7A 5I22A 4OVAA 3CMAQ 2DL5A 2D9TA 4IUQA 1TXQA 3CCVT 3CD6A 2OTJQ 2QQRA 1T3SA 2BE7D 5GAMf 2ROTA 5CO7A 3ZL7C 3I56T 1UGVA 2DRMA 1WJQA 3VYGA 4OMMA 2EPDA 1D1CA 3C0CA 1RAIB 1VYVA 4IUUA 2R57A 1WJSA 3EG1A 2JMAA 3UWNA 1ZQ1A 3EHQA 2ZPBB 1VQOA 1TG0A 4FL6A 1KD1C 2HDAA 4F14A 4XTVA 2VB6A 3OMGA 5GMKe 3CCVA 3HFOA 2ZPGB 1PWTA 1W4SA 2A7YA 2YUNA 2NWMA 2LRQA 4M78A 3CXCS 4JS4A 2A3LA 3HKSA 2QDYB 4M78B 3A1PA 3JV3A 2KE9A 3I56A 2PZ1A 3H0HA 3SWNC 2COZA 2CREA 5CCAA 1FYNA 2DAQA 2K7AA 1W70A 1OU9A 1WQWA 1VQPT 2FRWA 2LJ3A 1VQ5A 3FB9A 2EKOA 3OMCA 1PSEA 2FPEA 1Y7XA 2ZPIB 3CMEQ 2KT1A 2L3PA 4RCBA 5I21A 1TWBA 3RUXA 1R0CB 4C92G 2DL8A 4A4KA 3FIFA 1KQ1A 3SD4A 4C5HA 1J3TA 4LUDA 3MCAB 2BE9B 4JJDA 1TUGB 4RTVA 3OYEA 4PJOA 4QVCA 2KYBA 3ER0A 2QK0A 3TREA 2DJQA 1W2BA 1RAAB 2OX7A 1QVFA 2ED0A 2CH4A 1M2OA 1NPPA 1ACMB 1G2BA 1M3AA 4A4GA 3M55A 4ELYC 5KYUA 4LD9K 2DTIA 1UGQB 4AFZC 3JCMg 2DVJA 5KYUB 2DD5A 4YTLA 3CXCP 4FYXB 1KC8C 1JEGA 4RKUE 2LQNA 1Q81C 1WHHA 3HSBA 4M77A 4M77B 1M90C 2RA2A 4X34A 4XU2A 4NL2A 3NMZC 8ATCB 3R6NA 1YI2Q 2AIRB 2DXBA 2XDBA 2QASA 4C8QA 1I8FA 3OS5A 1K9MR 2LQWA 4C8QB 2HQXA 4MDXA 3P8DA 2CP7A 3PVQA 1QVFS 4M78C 3OYKA 1YP5A 1Q82U 2KNBB 1WFWA 2K3BA 1YITQ 2CGHA 1Q82R 4AFUC 1NE8A 1ABOA 3E2UA 2XG8D 3LLRA 3C12A 5D6WA 3OS0A 3T9NA 2GTOA 3M9QA 3CC2A 1G83A 5GAN5 3PE0A 1U5SA 2CDTA 2EJ9A 5KYWB 2HZYA 1Q86U 1Q86R 3VYHB 4C0FA 3THKA 4PFOA 4HCBA 4F04B 2YUQA 4BI4A 2HD0A 3QKJA 1UEBA 2BZ8A 4X9DA 4BE1A 1GCQA 2GBQA 2YDLA 3KBGA 5GJWB 1KIKA 1WXBA 2ATCB 4J8OA 5LJ5g 1FMVA 4PNOA 4ZGDB 2LQKA 2P0QA 3BW1A 2VASA 2DJZA 4N4HA 4RTZA 1W1FA 4M75E 4R0KA 4J6WA 2RJEA 5GMKm 1C0MA 1XOVA 1UE9A 1X75C 1GFDA 1QVFP 5DLQE 2XICA 5FU7B 3GIBA 2O9VA 1UHFA 4HCCA 1QKXA 5CKFA 3SFMA 3VS4A 4M77C 3OYAA 2PNIA 2E6ZA 5FU6B 3L2RA 2BZXA 4A4FA 1BKBA 4QQ6A 1YIJA 1HYOA 5IT9E 1AEYA 4BI3A 1QCNA 4OMQA 2YUPA 3OA6A 3BFMA 2NLUA 4C8QC 4F7UG 1RAFB 1U1SA 1VQ9Q 1YJ9Q 2K9GA 1KHIA 3M0QA 2RQRA 1NZ9A 1FX7A 1UJYA 3TVTA 3QPHA 5FWBA 1NEBA 3EGDA 4OMNA 2EKHA 1VQNA 2O01E 2JW4A 1I0CA 4MZMA 1VQ6T 3OYFA 2OTLQ 3OQ5A 1WIEA 4RTUA 4KH0B 3J81E 3OW2A 3CC7T 4ZNXA 1JBMA 2GF7A 2QA4A 4XU1A 2QEXT 5HKCA 3N5BB 3CBPA 3OBWA 4M75B 3OY9A 1SF9A 1KG1A 2O4XA 4M7DE 4XTUA 1XNIA 1M1KU 2O4XB 5CKBA 1VQKA 3X24B 3L2VA 1M1KR 3V8KA 1YNZA 1QMCA 3E9FA 3PFSA 4XU0A 4KULA 1GCQC 3LWIA 2WSFE 2FO0A 4RG2A 5CKDA 2MYSA 1NEGA 3ZBDA 2F2VA 4FIBA 1VQ4T 1JJ2A 1WYXA 2KRSA 4FU6A 3FDRA 1EIFA 1WHLA 5FU7C 3CC7A 3DLMA 1SEMA 1UFFA 3R6OA 3MJXA 4PJLA 2VXEA 1IHWA 1N8RC 2X9HA 2JXBA 2EW3A 4Z02A 2EJGA 5KYYA 3OW2S 5FU6C 2OTJT 5GAN2 4ZN3A 5LJ3e 2KEAA 1YWPA 4FW1A 2X3WD 2QTVA 2XK0A 1GBQA 4PL6A 3X26B 4BB7A 1NLOC 2EWNA 3CCJQ 3M58A 3MKDA 2PVOB 4CC3A 2EGCA 1PKSA 3EFRA 3KUFA 2EYYA 5GAMd 2LCLA 4DOVA 4M7AG 5LJ3g 4GBQA 1H8KA 1ZSZB 4XQ3A 2RI5A 4HCKA 5CQYA 1UUEA 4XTWA 1JJ2S 1D1BA 4LDVA 1I81A 4OMPA 4M77F 2C06A 1GL5A 4V2SA 1B7TA 4M75C 1U8RA 5FRMA 1BIBA 4ZGJB 5GAOq 4ORZA 3H41A 1YBYA 1NYGA 1VOMA 1CSKA 3OW2P 2KYMA 2DXUA 2X4YA 4OB0B 4CC4B 1TSFA 4RTTA 3GOXA 2DILA 2ENMA 1UGSB 3UATA 4C8QF 2KQWA 1S1NA 3CMET 1S72Q 2HL3A 3GF5A 1K9AA 1WNLA 5L23A 4E7LA 4X1VA 3CCUQ 1AVZC 3MP1A 1AWXA 2PVGB 3MP6A 2VKNA 3A8HB 1U06A 2A0FB 2IPOB 4JLGA 3A98A 2MOXA 3CBMA 2L89A 1H641 2A28A 1N27A 2SRCA 4XK8E 1NM7A 4B6MA 4N4GA 2DTOA 1JU5C 5KE2A 5A0GA 1VQLQ 1VQ8A 4FYVB 4F16A 3PMTA 4JJNK 4IIOA 2J6OA 2MWOA 4QQGA 4RTWA 2DK3A 3JSCA 4DBFA 3G71Q 5GAOn 1BI2A 3NGPA 1WGSA 3QHSA 2QQSA 1H92A 4FM4B 2P4TA 3G4SQ 1D0ZA 3I55T 3QWXX 3CCLQ 1M8VA 3X25B 1QQJA 3DB3A 2K5IA 1TOVA 2YLBA 5KYNA 2M16A 4EDUA 1ZHIA 1ZA1B 1ZSZC 4GLMA 1YI2T 1Q7YC 1WHGA 3JB9H 2H3JA 3A8LB 1OEBA 4ZGEB 2RQVA 2RD1A 2RQUA 1G3SA 2L2PA 3M53A 1H3ZA 1RLQC 4L5GA 2HSEB 1YITT 2WSEE 4XTXA 4Q5WA 2L8DA 1VQKQ 5GAN7 4B9WA 2OI3A 5KCOA 2K57A 1WPYA 1G3WA 2JTMA 1C1AA 3FLGA 3I55A 2P4RA 1AZGB 2RHUA 4J83A 1ABQA 1R77A 1YJNT 3CCRA 4L6V5 2YRVA 4NL3A 2RN8A 3A8MB 1KD1U 1GRIA 1E6GA 1KD1R 2KBTA 3I5SA 3SB2A 2DMOA 5GANe 2E5QA 2O9SA 2IG0A 3A5ZB 2DD4A 5GMKj 4M78G 4M75F 3VU3C 5CK9A 1X6BA 3AHUA 3VUZA 1D3BA 1VYTA 1AD5A 3EFSA 1YHQA 1IHVA 1D3BB 2DZ9A 1AWOA 1SG5A 2KXDA 3HPWA 1FWZA 2MF2A 1OOTA 1KQ2A 2V1RA 2ZGWA 2FPFA 3CCST 3VS2A 1YJNA 2A37A 2RQTA 4OB3B 1SRLA 1QWFA 4M4ZA 3CCMT 5I2SA 2E64A 3CC4T 2IIMA 5AYFA 5GANg 2ROLA 4JPBW 5A2QE 2E1HA 5A0LA 3OYIA 5GAMg 3NFCA 1M1GA 4PJOG 2V26A 2J6FA 2I0NA 2J06A 3LH0A 4IKFA 2D8HA 2DETA 4HVVA 1VQ9T 1YJ9T 4A53A 1TUCA 2DZCA 2FZCB 3D7SB 1W6XA 3CPWP 3JCMP 4QW2A 1X69A 2VGNA 2KMTA 2ZZDA 1WHKA 3QYGB 4OF1A 2PTKA 3CCSA 1JRIA 1K1ZA 1Y57A 4RTYA 2O2OA 3CCMA 4QVDA 3DKMA 2B86A 3CC4A 1T3LA 4M77G 4ZN1A 2CP2A 1IGQA 3EGUA 4M75D 3OYLA 3FEOA 1WHMA 2LX9A 2KRNA 3VUBA 2QDLA 3A8OB 4FCYA 1UGRB 2EQIA 5IXBA 2YT6A 3HRTA 3P8BB 1I1JA 2K79A 4EMGA 4C8QG 3AT1B 5IH2A 5FW9A 2RJDA 2XKOC 1B34B 5GJVB 1GCPA 3OS1A 4FSSA 4OMOA 4PJMA 3JCMe 3G6EQ 3CCQQ 1X2KA 3CCEQ 2LNHB 5AT1B 4ME7A 5CVIA 4E7KA 2J05A 1O75A 3JCMb 1BI0A 5HK3A 5GAN3 4Z88A 2VVKA 2RHXA 4C92E 2EAYA 4MMKA 1VIEA 3LX7A 4E7ZA 1K0SA 2CP6A 4OP0A 2DX1A 4J9DA 2QAZA 1VQPA 4FW2A 3PTAA 4E7IA 1KFZA 2DXTA 1I5OB 2CH4W 1QWEA 1D1AA 3HP9A 1FXXA 3JB9I 2EFIA 2Z0WA 3CCJT 2MMPA 1LCKA 3BDUA 4DEXA 2KROA 3CEYA 1YJWQ 3PT9A 3S3MA 1K8AC 4CC2A 3EFOB 4FYYB 4M7DD 3ULRB 2XU8A 1OI1A 2E4HA 1ZUUA 4J6XA 1K9MU 4XAXB 1K73C 1PRMC 3QDRB 4RTXA 1E6HA 2LT4A 1FMWA 3UPUA 1BYMA 3TEEA 4C0GA 3JCMX 3NTIA 3QWYA 5I2MA 2LJ1A 4IUTA 3VS5A 1RUWA 2XDDA 2D8JA 2NUTA 3C4SA 1VQMT 1HXDA 2NUTB 5LJ5e 4J6YA 4ESRA 2HNIA 5KYWA 1VUBA 4PJNA 1LOJA 3EH2A 2JNGA 1KJWA 1S72T 2DRKA 1M5Q1 5HCKA 1BI1A 1DJ7B 4N4IA 1K0XA 1AHJB 3ZFJA 2YXYA 1K76A 5IN1A 3A8GB 3H0IA 4PJJA 1MV3A 4LDXA 1VQ7Q 1QVPA 2JS2A 5GAOr 3GBQA 2DE0X 2I2LA 3CD6Q 2AZSA 4E7SA 2JT4A 4LNPA 2EYQA 4PFPA 3WVEB 4RG8A 1OX9A 1VQLT 3OB9A 3QJYA 1VQMA 1ZSGA 2O31A 4N0AA 2DLPA 1KSWA 1RAHB 3I9QA 3G71T 4XTYA 4X9CA 5C6SA 5A0DA 4J9FA 3TSZA 2EQKA 3INZA 1C6VX 2GGRA 4A4HA 3MPUB 1VQOQ 3CCLT 1TH7A 4J9GA 1SKUB 1TUDA 2LCSA 1X01A 4XU3A 2X4JA 3M59A 4PK4A 2X4WA 2O88A 2JOYA 2BTTA 3V8LA 3CCVQ 2DYIA 3JCMJ 2ABLA 5CAIA 3QSUA 1SSHA 2H8HA 4AMCA 3GP8A 3I56Q 3GNFB 3H9NA 3JB9F 4PFZA 1N8RR 2DNUA 3PGGA 3U23A 1VQ5Q 4F7UE 2J6KA 1Q86C 4OB1B 1JXOA 5LJ3j 3L2QA 2GQVA 2HMAA 1OPKA 5GAN4 2NYSA 2E65A 4M75A 1AOJA 3META 1RL2A 1RI0A 3UF4A 1PKTA 1G3TA 4D8KA 2MWPA 3RNJA 3OYGA 1XJWB 2DTHA 4MDWA 3WVDB 2PQWA 3HHTB 3OS2A 5GAN6 1M1FA 4J9EA 3BDLA 3RMSA 1WJRA 3LWHA 3M0PA 3JCMV 1XTDA 4RMOA 1VQ6A 3MEUA 2VUBA 3P8HA 3MEVA 2KY9A 3PIOA 2BKDN 3EGXA 2HQEA 4J9HA 3LYIA 4IUVA 3E1SA 3EGXB 1D0YA 2FYKA 2CYZB 3V7RA 3BY7A 1TS9A 9ATCB 1RADB 4N0AC 4FSXA 5CKHA 3CMAT 1B3QA 4Y91A 2QEXA 3QDFA 1D0XA 3S3NA 2K2MA 3QBYA 2COWA 1AWJA 1PSFA 3H6ZA 1MMNA 3JB9D 1RAGB 1MNEA 3OSVA 2K5FA 4OGCA 2Y90A 4JJBA 2RJFA 4F7UB 4AFSC 3FJPA 3CBOA 1PC0A 1QKWA 3L1AA 2HL5C 4KUDK 2QTXA 2RO0A 1VQ4A 2QGFB 4M7DA 4HXJA 1MMGA 1ZSZA 4M7DB 2E3HA 4HCZA 2V8IA 3ASKA 3CMAA 2NUPB 1R0BG 3G7ZA 5GANh 1Y07A 3CC2Q 3M54A 4FYWB 1MHNA 4JZ3A 1AZEA 2OTJA 2JMCA 4ATOA 5LJ3f 2KK4A 4D6WA 1M1KC 3RERA 2CUBA 1OPLA 1U3OA 2GTJA 4DEYA 2L3QA 4M7AE 5CIUA 3X20B 1MMAA 2P0PA 2VWFA 1NJIC 2A08A 3M0TA 4HVWA 3V7SA 1V76A 1X6OA 2LNVA 2JJ9A 4D8DA 4HA8A 3I5RA 1Q7YR 2MAMA 4WTOB 3G6ET 2ZCFB 3CCQT 2EJFA 3CCET 1PD1A 3E19A 2DPPB 1X2QA 4BDYA 5GMKi 3QJ6A 5DY9A 2RPNA 1VYUA 3RBBB 3QIIA 3ZEHA 4MMLA 3IQLA 4C92F 2DYBA 1OZ3A 2CZ7B 2K5LA 5C0MA 1OZ2A 1JXMA 2K6DA 1LNXA 1WXUA 1BCMA 4PLLA 5GMKh 3VS3A 1YIJQ 3NPFA 3RKXA 1PCXA 7AT1B 1WLPB 1UJ0A 1M30A 2AKKA 2QQBA 3O8VA 4J9BA 3CMEA 1GFCA 4QT7A 3SEMA 2D0QB 3REBB 2RHZA 5M9OA 1YJWT 1VQNQ 4M7DC 5HY6A 4LDYA 2V1QA 5GANj 3G1JA 3CPWA 4DBHA 3URGA 2V8JA 2EYXA 1M2VA 4J5YA 4KBMB 2DEUA 2L0AA 1M2VB 1ZUYA 5EC7A 1UDLA 3JCMd 2QA4Q 3JCMh 1GXIE 5CKEA 1HD3A 2RH2A 2X51A 1M3BA 4LXCA 1ZLMA 3BE3A 4BACA 4JRKA 2EYZA 3VS1A 2HBPA 4CI0C 3JCMW 1LJOA 1K4US 2WACA 3RIRA 1OX8A 2HBWA 2L5QA 5CQXA 4E7JA 3Q1JA 2CP0A 4NS5A 1KQSA 3M5AA 1NYFA 2E70A 4QQDA 2CSQA 1BBZA 2XMFA 4C92D 2ECZA 3ME9A 2EIFA 1I4K1 2PUKB 2KGTA 1WDXA 1YCSB 2KRMA 3DLLA 2Y4XA 1X27A 3MP8A 1SSFA 2W10A 2MK5A 2QQ9A 1YI2A 4WF2A 2ZPEB 1HJDA 2RQWA 3CC7Q 4BI8B 3V7CA 2F69A 2KI7A 3QZ9B 1YCYA 4GLKA 3CPWS 2DXCA 1Y96A 3CD6T 2ESWA 4LD6A 2KVQG 2P0KA 4IURA 1Y96B 1YITA 2FPDA 1KHCA 3EG0A 1KK7A 2JS0A 5GAMe 4KH1B 2MI6A 3M57A 1UGPB 1Q95G 2CT3A 3M0RA 4C0ZA 1Z9QA 2CKKA 5FRNA 4DA4A 3L42A 3OYHA 1KQSS 4M78E 2RHIA 3UDCA 4PKCC 4R55A 1VQOT 4IUPA 2CZ1B 2XI9A 2YWWA 3GPLA 5LJ5d 1OV3A 1SPKA 5LJ5h 2EVRA 2RK2A 2KT8A 1XQHA 2F5TX 2Y4YA 2RI2A 3EAEA 5GANf 1MV0B 3JAME 2BUDA 1V29B 1WI7A 2DERA 4BY6C 2AZVA 4O6JA 1MMDA 4LE9A 1HSQA 2JM8A 2VC8A 3M0UA 2HKNA 3LGLA 4PJOE 3C94A 4DQ2A 4E6RA 2OTLT 1VQ5T 4F7UF 1BIAA 1QVGA 1KC8U 3VS7A 6AT1B 2IVWA 2CP3A 1KC8R 1Q81U 1ZUKA 2K4YA 3RKYA 1Q81R 2GQIA 1M90U 2ZPHB 4Y28E 2LJ0A 4JZ4A 1KQSP 1M90R 4M7DF 3J7AF 1K8AU 4QVZA 3MHXA 1K8AR 3M56A 2RJCA 3OYCA 4JRPA 1VQ9A 2DF6A 1B34A 4M77E 1YJ9A 1MNDA 2AKLA 1UECA 1ZA2B 1K73U 1IB8A 1OYXA 2MPXC 1K73R 1WZOA 1VQ8Q 3QG1A 2JM9A 2OTLA 5I11A 2RMOA 4VUBA 4CC7A 4C8QE 1TTHB 2QQAA 3WXMB 4RUGA 2HKQB 1UHCA 2JN0A 3EH1A 4BE2A 1I07A 1PHTA 1OULA 4JDSA 1QVGS 5LJ5j 4JJCA 2D0NA 4JS5A 3F70A 3RR6A 2DVEA 4O5VA 1IRXA 2VGMA 4EIKA 2P84A 2LP5A 1IGUA 2FHDA 2LDMA 3KXTA 2J7IA 3OYJA 4PJOB 3JCMQ 4HT9A 1EX4A 4NOYA 5IHKA 4EMKA 1IREB 2JZ2A 3EG9A 3JCMf 4C0DB 4EMKB 1E7OA 2VXFA 3EG9B 3EFOA 1WXTA 4KGZB 3NTHA 2RHYA 3M4GA 2YRCA 5DM7R 2ED1A 2FVUA 3I35A 5GAOm 4C5EA 1T0HA 2XD0A 3OBYA 4DOWA 3M4YA 3I55Q 3CC2T 4DBRA 2QYZA 5J39A 3S6WA 1IO6A 5FLXE 1G8XA 3CCRQ 3QO3A 4M7AF 3CPFA 4Z8AA 2LQ8A 2RM4A 1QVGP 1M3CA 2MIOA 3FC3A 3CCJA 5IHIA 1A0NB 2G3RA 3NHNA 2JTEA 4C92A 2HAXA 1W2BS 3OYMA 4C92B 4OMFB 1QLYA 2DKGA 3QZ5B 2EBPA 5LJ3d 3UT1A 5LJ3h 2BIVA 1IXDA 2K2VA 2EGEA 2YLCA 4A63B 4CRIA 3HRSA 1YHQQ 2GNCA 3CCUT 2K3XA 2PVDB 3L2UA 5IHNA 4AT1B 2G6FX 4GY5A 1QCFA 2AHJB 1YJNQ 1UG1A 2X35A 2EQMA 4BE0A 4E7HA 4M75G 2L3SA 3VKIA 2YHTA 2DBKA 4J9CA 3JRZA 5LJ5f 2LVMA 4PJOC 2R5AA 3C95A 1YIJT 4MZPA 5KH6A 2DIGA 1M9SA 1BU1A 2M0OA 2EYWA 4C0DC 4EMKC
chains in the Genus database with same CATH topology
1S72A 1Y7XA 2ZPIB 4B9WA 5KCOA 5GAN7 3G4ST 3J80E 2K57A 1WPYA 1K9MC 1G3WA 4M7DB 4HCZA 3HFNA 4RCBA 5I21A 3RUXA 2JTMA 2V8IA 3ASKA 4C92G 2CZ6B 2KDSA 3FLGA 3CCUA 4M7AD 2XIDA 4J7IA 3RMQA 4A4KA 3FIFA 5EG2A 1KQ1A 4OMFB 3I55A 3CMAA 1VQNT 3SD4A 4C5HA 2RHUA 3G7ZA 3MCAB 2M9UA 5GANh 1Y07A 3M54A 2DIQA 4J83A 1YJNT 4B9XA 3OYEA 1MHNA 3LW5E 4PJOA 3CCRA 4QVCA 4ATOA 2OTJA 3ER0A 4L6V5 5LJ3f 2KK4A 3TREA 3DB4A 4D6WA 4ELZC 1WQ7A 1M1KC 1W2BA 1Q82C 3RERA 2YRVA 4NL3A 3A8MB 1QVFA 4M7AE 5CIUA 2QA4T 1VQLA 1KD1U 2LC4A 1NPPA 3X20B 2P0PA 1NJIC 4A4GA 1N8RU 3M55A 3SB2A 4ELYC 3V7SA 3OYYA 3PNWC 5GANe 2E5QA 2M1HA 5GAOp 2DTIA 1UGQB 2IG0A 3A5ZB 1X6OA 4LD9K 2DD4A 5GMKj 2LNVA 3JCMg 4M78G 1VQKT 3G71A 1QP2A 2DD5A 4YTLA 3VV0A 4ZTJA 4M75F 2LCCA 4HA8A 1KC8C 3VU3C 5CK9A 3AHUA 3VUZA 4RKUE 1D3BA 3EFSA 2E6NA 1YHQA 3G4SA 4JLIA 1Q81C 3TCJA 2MAMA 3HSBA 4C92C 2JTFA 1D3BB 4M77A 3G6ET 2ZCFB 2DZ9A 3CCQT 3CCLA 2EJFA 3CCET 3E19A 3HPWA 4M77B 1FWZA 1M90C 2MF2A 2CS7A 2DPPB 4FT4A 1KQ2A 4BDYA 2ZGWA 1ZBXA 3CCST 5GMKi 1N9RA 1Y71A 3QJ6A 5DY9A 1YJNA 4M7DG 2RA2A 4OB3B 4X34A 3CCMT 3QIIA 4XU2A 5I2SA 2E64A 4NL2A 3CC4T 5AYFA 3ZEHA 2PU9B 2ZPFB 4MMLA 5GANg 1M4ZA 4C92F 1OZ3A 2DXBA 5A2QE 2XDBA 2CZ7B 4C8QA 1I8FA 3OS5A 1G5VA 4R56A 2E1HA 2K5LA 2KAFA 5C0MA 1OZ2A 4C8QB 5A0LA 2HQXA 4UC4A 3OYIA 1LNXA 5GAMg 3NFCA 1M1GA 3H8ZA 5KCHA 4MDXA 3P8DA 4PJOG 4PLLA 5GMKh 3LH0A 3RKXA 4IKFA 1QVFS 4M78C 3OYKA 2QQBA 1VQ9T 1BI3A 1Q82U 1YJ9T 3GNGA 3O8VA 4A53A 3CMEA 2R5MA 2CGHA 2DZCA 2D0QB 2F5KA 1NE8A 2XG8D 2VV5A 2RI3A 2CZ0B 3LLRA 4LDUA 5D6XA 3C12A 5D6WA 4MZTA 4QW2A 3OS0A 3JCMP 1NJIU 2VGNA 2KMTA 3T9NA 2ZZDA 1IZ6A 2RHZA 3M9QA 5M9OA 1YJWT 3QYGB 3CC2A 2E41A 3GLXA 5GAN5 4M78F 4OF1A 4EMHA 4M7DC 3CCSA 1JRIA 2EJ9A 5HY6A 4LDYA 5GANj 1Q86U 5GAOl 3CCMA 3CPWA 4QVDA 3DKMA 3JB9J 2WSCE 3CC4A 3URGA 2KSSA 2V8JA 4M77G 4ZN1A 3VYHB 4C0FA 4J5YA 4F7UA 4KBMB 4II1A 4M75D 3OYLA 2FL7A 4HCBA 3JCMd 3FEOA 3JCMh 4BI4A 1GXIE 2HD0A 3QKJA 5CKEA 1U1TA 1UEBA 2LX9A 2RH2A 4X9DA 4BE1A 3VUBA 3A8OB 4BACA 4JRKA 3KBGA 1UGRB 4KUIA 2HBPA 4CI0C 3JCMW 1QP3A 1LJOA 4J8OA 5FROA 3HRTA 3P8BB 4PNOA 2WACA 2LQKA 4ZGDB 5LJ5g 3RIRA 2P0QA 4EMGA 3BW1A 2DJZA 2L5QA 4N4HA 3V8JA 4C8QG 1Q7YC 5CQXA 4E7JA 2RJDA 2XKOC 4M75E 3Q1JA 4NS5A 1KQSA 1B34B 4J6WA 2QXFA 2RJEA 3MEWA 5D6YA 2GFUA 3SDZA 5GMKm 3M5AA 3OS1A 1XOVA 4PJOF 3JCMe 4HT8A 2E70A 2K3YA 1X75C 4QQDA 4C92D 4ME7A 3ME9A 5GANd 5DLQE 2EIFA 1I4K1 2XICA 5CVIA 5FU7B 2PUKB 4E7KA 3GIBA 3PMIA 1O75A 2RK1A 3DLLA 4HCCA 2Y4XA 3JCMb 1BI0A 5CKFA 3SFMA 5HK3A 3MP8A 1SSFA 4M77C 5GAN3 2PUOB 2QQ9A 5GAMh 1YI2A 2B8AA 4WF2A 3OYAA 2DO3A 2JUFA 2RHXA 2E6ZA 5FU6B 2ZPEB 4C92E 3L2RA 2EAYA 4MMKA 4L59A 1VIEA 4A4FA 4BI8B 3V7CA 2F69A 3LX7A 2EQUA 3QZ9B 1YCYA 4FT2A 4GLKA 1BKBA 3CPWS 2DXCA 4OP0A 4QQ6A 1YIJA 1Y96A 5IT9E 3CD6T 4BI3A 4LD6A 2KVQG 1VQPA 2P0KA 4IURA 1Y96B 5L8RE 3OA6A 2E12A 3BFMA 2NLUA 4C8QC 4F7UG 3PTAA 4E7IA 1YITA 4M78D 1U1SA 1KHCA 1Q7YU 2DXTA 5GAMe 1KHIA 3M57A 2MI6A 1UGPB 1NZ9A 2VYTA 1FX7A 1FXXA 2EFIA 3HP9A 5CR2A 3JB9I 3CCJT 1VQ8T 3QPHA 2MMPA 4C0ZA 4PJOD 3BDUA 1VQNA 2CKKA 2O01E 3CEYA 4MZMA 4A54A 4DA4A 5FRNA 1VQ6T 3L42A 4ZTFA 3OYFA 3PT9A 5GMKl 3OYHA 3S3MA 1K8AC 2QI2A 3OQ5A 4M78E 1KQSS 5GAMj 1MGQA 2JVVA 4JRQA 2GFAA 4M7DD 2XU8A 2RHIA 3UDCA 1OI1A 4PKCC 4R55A 3J81E 4IUPA 5J3BA 3OW2A 1VQOT 1NPRA 2XDPA 4J6XA 4RCCA 1JBMA 1K9MU 3CC7T 4P5NA 3VJPA 4XAXB 2GF7A 2CZ1B 2XI9A 3L2ZA 3QDRB 3GPLA 5LJ5d 2QA4A 1K73C 4XU1A 5LJ5h 2QEXT 2RK2A 3N5BB 5HKCA 1XQHA 2F5TX 2LT4A 2Y4YA 5J26A 3CBPA 3OBWA 4M75B 2RI2A 3UPUA 3OY9A 1BYMA 1G3YA 1KG1A 3EAEA 1N9SA 1O9SA 2O4XA 4A4EA 5GANf 3TEEA 2BUDA 4C0GA 3NTIA 3JCMX 2EQJA 3JAME 3QUIA 4XTUA 4M7DE 5I2MA 1XNIA 1M1KU 2O4XB 5CKBA 1VQKA 1V29B 1P92A 3X24B 4IUTA 4BY6C 3L2VA 3V8KA 2XDDA 4O6JA 3E9FA 3PFSA 4XU0A 3C4SA 4KULA 2VC8A 4BD3A 3L2WA 1VQMT 3LWIA 4C5IA 1HXDA 4BUGA 3RESA 2WSFE 3G6EA 4JUVA 4RG2A 4J6YA 5LJ5e 3OYDA 3CCEA 3CCQA 2HNIA 3LGLA 5CKDA 4M7AA 4PJOE 3C94A 4M7AB 3HRUA 1VUBA 4DQ2A 5DLOA 4TVRA 2OTLT 3ZBDA 1VQ5T 1LOJA 4KT0E 4F7UF 4FIBA 2JNGA 1BIAA 1QVGA 4JRIA 4J7FA 1VQ4T 1KC8U 1JJ2A 1S72T 3OYBA 1M5Q1 2IVWA 4FU6A 5GAN8 3FDRA 1EIFA 1Q81U 4OGEA 1BI1A 4M77D 3FRNA 1DJ7B 4N4IA 2K4YA 3DLMA 1AHJB 5FU7C 3RKYA 3ZFJA 3CC7A 5IN1A 3A8GB 3R6OA 2ZPHB 1M90U 4LDXA 4Y28E 2VXEA 1I5LA 4BY6B 1QVPA 3E9GA 1N8RC 4M7DF 5GAOr 3J7AF 5KE3A 3X28B 4Z02A 1K8AU 4QVZA 2EJGA 3MHXA 3OW2S 5FU6C 3CCRT 5GAN2 3JB9G 2OTJT 2I2LA 4ZN3A 5LJ3e 3M56A 2RJCA 3OYCA 4JRPA 2EYQA 1VQ9A 3OSSC 1B34A 3WVEB 4M77E 1YJ9A 4RG8A 4C8QD 1VQLT 2XK0A 3OB9A 1K73U 3QJYA 1OYXA 4PL6A 3X26B 1VQMA 4BB7A 2EWNA 2R58A 1QW1A 3M58A 3QG1A 3MEAA 3NTKA 3JCMc 4N0AA 2PVOB 1YJWA 4XTXA 2OTLA 3OYNA 4E47A 2E10A 3G71T 4Q5WA 3HL8A 4VUBA 3EFRA 4XTYA 3KUFA 5IAYA 4X9CA 3S3OA 4C8QE 2QQAA 2DEQA 5GAMd 1VIFA 2LCLA 3RKWA 3WXMB 4DOVA 5A0DA 5C6SA 1YHQT 2EQKA 2JN0A 1R8OB 4M7AG 4BDZA 3INZA 4A4HA 5LJ3g 4BE2A 3CCLT 3QXEB 4XQ3A 2RI5A 1VQ7T 1VQ4A 4JDSA 1JB0E 1TH7A 1QVGS 5LJ5j 2X4XA 4OB2B 5CQYA 4XTWA 1JJ2S 1X01A 4XU3A 4JS5A 3F70A 2X4JA 3M59A 3SWNA 2DVEA 4HKEA 4LDVA 4O5VA 2X4WA 2VGMA 2JOYA 1I81A 3SWNB 3V8LA 4M77F 2LTOA 3LGFA 2FHDA 2LDMA 3KXTA 2C06A 3JCMJ 3OYJA 4PJOB 4V2SA 3JCMQ 4M75C 1U8RA 5FRMA 4HT9A 5HK0A 1BIBA 2L3RA 5LL6S 5CAIA 4ZGJB 3QSUA 1UB4A 4NOYA 3TU4K 5GAOq 4EMKA 2V8KA 1IREB 3GP8A 3GNFB 2JZ2A 1YBYA 3JCMf 4C0DB 4EMKB 2D6FA 2GCXA 2DXUA 2VXFA 3JB9F 1N6AA 2X4YA 4OB0B 2FB7A 3MO8A 3QYHB 2LT1A 3GOXA 4LDWA 1UGSB 3PGGA 4C8QF 4EPCA 2KQWA 4F7UE 3PIPA 1HK9A 1Q86C 4XTZA 4OB1B 3NTHA 4PLIA 3CMET 5LJ3j 2RHYA 4C5GA 3M4GA 2XHCA 4M7AC 5DM7R 2OAUA 3L2QA 2FVUA 3GF5A 1WNLA 2GQVA 2RB6A 5GAN4 4M75A 2E65A 4E7LA 5GAOm 1VQ7A 4C5EA 3CXCA 3META 2XD0A 3OBYA 3MP1A 1RL2A 3M4YA 1RI0A 4OVAA 4DOWA 3CC2T 2PVGB 3MP6A 2D9TA 4IUQA 5J39A 3A8HB 3S6WA 3CCVT 3CD6A 1G3TA 4JLGA 5FLXE 2MWPA 3CBMA 2L89A 1H641 3QO3A 2QQRA 1N27A 4M7AF 3OYGA 4M7DA 4XK8E 2DTHA 5GAMf 3CPFA 4MDWA 4N4GA 2LQ8A 5CO7A 2DTOA 3WVDB 2PQWA 3HHTB 3OS2A 2RM4A 5KE2A 3I56T 5GAN6 1M1FA 1WJQA 5A0GA 3FC3A 3CCJA 1VQ8A 3BDLA 3VYGA 3RMSA 3PMTA 2G3RA 4C92A 4JJNK 2HAXA 1WJRA 3LWHA 1W2BS 3JCMV 1XTDA 3OYMA 4RMOA 1VQ6A 2MWOA 4C92B 4QQGA 3MEUA 2DK3A 3JSCA 2DKGA 2VUBA 3P8HA 3QZ5B 2R57A 3MEVA 1WJSA 4IUUA 2BIVA 5LJ3d 2KY9A 2K2VA 2BKDN 5LJ3h 2HQEA 3UT1A 3UWNA 3PIOA 3LYIA 1ZQ1A 2YLCA 4IUVA 5GAOn 1BI2A 3E1SA 4CRIA 1WGSA 3QHSA 2QQSA 2ZPBB 1VQOA 3HRSA 2FYKA 2CYZB 4FM4B 2P4TA 3BY7A 3V7RA 4FL6A 3CCUT 4N0AC 4FSXA 1KD1C 5CKHA 3I55T 3CMAT 4Y91A 1M8VA 3X25B 2QEXA 2K3XA 4XTVA 2PVDB 3DB3A 3L2UA 3S3NA 2K5IA 3OMGA 5GMKe 2YLBA 2M16A 3QBYA 4GY5A 4EDUA 3CCVA 2AHJB 1ZHIA 3HFOA 1PSFA 2ZPGB 3H6ZA 3JB9D 1W4SA 2A7YA 3OSVA 2K5FA 1YI2T 2X35A 2EQMA 4M78A 2LRQA 4BE0A 4E7HA 3CXCS 4JS4A 4OGCA 4M75G 2Y90A 2H3JA 2A3LA 3A8LB 3HKSA 3JB9H 2QDYB 3VKIA 2YHTA 4M78B 2RJFA 3I56A 4F7UB 3SWNC 3FJPA 4ZGEB 3JRZA 5LJ5f 2LVMA 5CCAA 4PJOC 2R5AA 2RD1A 2DAQA 3C95A 3CBOA 1YIJT 4MZPA 1G3SA 5KH6A 3M53A 1WQWA 2DIGA 3L1AA 4KUDK 1H3ZA 1VQPT 2QTXA 1VQ5A 1M9SA 3FB9A 2EKOA 3OMCA 2M0OA 4L5GA 2RO0A 1YITT 2WSEE 1PSEA 2L8DA 4C0DC 4EMKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI2 A;  4B9W A;  3OY9 A;  5KCO A;  2JZ2 A;  3EAE A;  2O4X A;  4A4E A;  4HCZ A;  2BUD A;  3NTI A;  2EQJ A;  3ASK A;  3FLG A;  2X4Y A;  1XNI A;  2O4X B;  3MO8 A;  4II1 A;  3SD4 A;  4IUT A;  2RHU A;  4C5H A;  3OYL A;  3L2V A;  3GOX A;  3FEO A;  3QKJ A;  3E9F A;  3PFS A;  2DIQ A;  3NTH A;  3C4S A;  4PLI A;  4B9X A;  3OYE A;  2RHY A;  4BD3 A;  1MHN A;  4C5G A;  3L2W A;  4BE1 A;  4C5I A;  4BAC A;  4RG2 A;  3DB4 A;  3OYD A;  3LGL A;  3L2Q A;  2YRV A;  5FRO A;  2WAC A;  4E7L A;  5CIU A;  4N4H A;  4C5E A;  3MET A;  3MP1 A;  4OVA A;  1RI0 A;  4E7J A;  2RJD A;  3MP6 A;  2D9T A;  3Q1J A;  4IUQ A;  4NS5 A;  5J39 A;  3S6W A;  3OYB A;  2RJE A;  3MEW A;  5D6Y A;  2GFU A;  4A4G A;  4FU6 A;  3OS1 A;  3FDR A;  2MWP A;  2L89 A;  3PNW C;  2E5Q A;  2M1H A;  2K3Y A;  2IG0 A;  1N27 A;  2QQR A;  4N4I A;  3DLM A;  4QQD A;  3OYG A;  3ME9 A;  4N4G A;  5IN1 A;  4ZTJ A;  2LCC A;  4E7K A;  2PQW A;  3OS2 A;  3PMI A;  5KE2 A;  3E9G A;  1WJQ A;  3FC3 A;  2E6N A;  5KE3 A;  3BDL A;  3MP8 A;  4QVZ A;  4Z02 A;  1SSF A;  2G3R A;  3PMT A;  2JTF A;  1WJR A;  2B8A A;  3OYA A;  3OYM A;  2RHX A;  2RJC A;  2MWO A;  3OYC A;  4QQG A;  3MEU A;  4IUU A;  3P8H A;  3L2R A;  2R57 A;  3MEV A;  1WJS A;  4L59 A;  2BIV A;  3UT1 A;  4A4F A;  4BDY A;  2BKD N;  2HQE A;  3LX7 A;  3UWN A;  3LYI A;  2XK0 A;  2EQU A;  3OB9 A;  4IUV A;  3QJ6 A;  4CRI A;  1WGS A;  1OYX A;  2QQS A;  4PL6 A;  4X34 A;  3QII A;  4QQ6 A;  2R58 A;  4FL6 A;  4LD6 A;  3ZEH A;  2P0K A;  3MEA A;  3NTK A;  4IUR A;  3OA6 A;  1OZ3 A;  2NLU A;  4E7I A;  2K3X A;  3OYN A;  1G5V A;  3DB3 A;  1KHC A;  3L2U A;  4Q5W A;  3S3N A;  5C0M A;  3KUF A;  1OZ2 A;  3OMG A;  5IAY A;  3S3O A;  2HQX A;  4UC4 A;  2M16 A;  2VYT A;  3QBY A;  2EFI A;  3H8Z A;  4GY5 A;  4EDU A;  5C6S A;  3P8D A;  5KCH A;  2EQK A;  4PLL A;  3H6Z A;  4BDZ A;  3LH0 A;  4IKF A;  4A4H A;  2X35 A;  2CKK A;  2EQM A;  3OYK A;  4BE2 A;  2LRQ A;  4BE0 A;  3CEY A;  2RI5 A;  4E7H A;  5FRN A;  3L42 A;  4ZTF A;  3OYF A;  3O8V A;  3OYH A;  3S3M A;  2RJF A;  2X4X A;  2R5M A;  3OQ5 A;  2GFA A;  3F70 A;  2LVM A;  2F5K A;  2X4W A;  2R5A A;  2RHI A;  2DAQ A;  1OI1 A;  2RI3 A;  3LLR A;  3OYI A;  4IUP A;  5D6X A;  5D6W A;  2LTO A;  3LGF A;  2FHD A;  2LDM A;  2XDP A;  2DIG A;  4QW2 A;  5KH6 A;  3OS0 A;  3OYJ A;  1H3Z A;  2GF7 A;  2RHZ A;  3M9Q A;  5M9O A;  5FRM A;  2EKO A;  3OMC A;  2M0O A;  2L3R A;  2RO0 A;  2L8D A;  5J26 A; 
#chains in the Genus database with same CATH topology
 1S72 A;  2M02 A;  3M0S A;  3G4S T;  2FZK B;  3J80 E;  1K9M C;  2W0Z A;  3HFN A;  2CZ6 B;  2KDS A;  4M7A D;  3CCU A;  2XID A;  4J7I A;  3RMQ A;  2F2W A;  1W2B P;  5EG2 A;  1VQN T;  1NBE B;  1ZBJ A;  2M9U A;  2DIQ A;  4B9X A;  2E5K A;  3LW5 E;  3CCS Q;  2HSP A;  3DB4 A;  1YFN A;  4ELZ C;  1WQ7 A;  3CCM Q;  1Q82 C;  3CC4 Q;  1RI9 A;  1EFN A;  2QA4 T;  1OU8 A;  1VQL A;  1OQK A;  2LC4 A;  5FWC A;  1UTI A;  2FRY A;  1RAB B;  4AG1 C;  3O5Z A;  1N8R U;  1CKA A;  2LX7 A;  3OYY A;  3PNW C;  4LUE A;  2M1H A;  5GAO p;  1V1C A;  2KXC A;  1QCO A;  1VQK T;  3G71 A;  1QP2 A;  3VV0 A;  4ZTJ A;  2EGA A;  2LCC A;  1SRM A;  3REA B;  2DFU A;  4ANJ A;  2E6N A;  3G4S A;  4JLI A;  3TCJ A;  4C92 C;  2JTF A;  1PRL C;  3CCL A;  3H0F A;  1WA7 A;  3UA6 A;  2CS7 A;  4FT4 A;  3EGD B;  2BZY A;  1ZBX A;  3LH5 A;  1N9R A;  1Y71 A;  5IXF A;  4M7D G;  4KGX B;  2A36 A;  2FG0 A;  4E2F B;  2PU9 B;  2D1X A;  2ZPF B;  2ZAE A;  1M4Z A;  1M8M A;  2C0T A;  1G5V A;  4R56 A;  1GBR A;  2KAF A;  4UC4 A;  3H8Z A;  5KCH A;  5KYX A;  5KYX B;  1VQP Q;  1BI3 A;  3GNG A;  2R5M A;  2DM1 A;  2CP5 A;  2F5K A;  1CKB A;  2DBM A;  2VV5 A;  2RI3 A;  2CZ0 B;  4LDU A;  5D6X A;  2CUD A;  4MZT A;  1NJI U;  2SEM A;  1IZ6 A;  1NJI R;  2E41 A;  2AK5 A;  3GLX A;  4M78 F;  4EMH A;  5GAO l;  4F17 A;  5ECA A;  2WSC E;  3JB9 J;  2KSS A;  2RNA A;  4F7U A;  2YUO A;  4II1 A;  3CQT A;  2FL7 A;  1NLP C;  4QKU A;  1VA7 A;  1U1T A;  3VRZ A;  4KUI A;  2FEI A;  1QP3 A;  5FRO A;  5KYY B;  1YN8 A;  3V8J A;  4KGV B;  2COY A;  1M27 C;  2QXF A;  3MEW A;  5D6Y A;  2GFU A;  3SDZ A;  2NUP A;  3KFV A;  4PJO F;  1LPL A;  4J9I A;  3UA7 A;  4HT8 A;  2K3Y A;  1T0J A;  1D09 B;  5GAN d;  3PMI A;  2RK1 A;  4K11 A;  1SHG A;  2PUO B;  2HQH A;  5GAM h;  2B8A A;  4Y92 A;  2DO3 A;  2JUF A;  4L59 A;  4LN2 A;  2EQU A;  4FT2 A;  1BB9 A;  1RAC B;  2M51 A;  5L8R E;  2E12 A;  4M78 D;  1X6G A;  1Q7Y U;  4AFQ C;  2C0I A;  3SHW A;  2VYT A;  5CR2 A;  2CSI A;  2F2X A;  1VQ8 T;  1VQM Q;  1LVK A;  1EZZ B;  1RAE B;  4A54 A;  3EHR A;  4ZTF A;  5GMK l;  3FJ5 A;  2QI2 A;  1ARK A;  1AT1 B;  1MGQ A;  2JVV A;  4JRQ A;  2GFA A;  4OML A;  1AWW A;  5J3B A;  3PVL A;  1JO8 A;  1MUZ A;  1NPR A;  2XDP A;  4RCC A;  4P5N A;  3VJP A;  1WX6 A;  1BK2 A;  3L2Z A;  4KRT A;  3VS0 A;  3EG2 A;  5J26 A;  2DL4 A;  1G3Y A;  4HVU A;  1N9S A;  1O9S A;  2KR3 A;  4A4E A;  4PJO D;  1BCO A;  2EQJ A;  3QUI A;  1ZX6 A;  1P92 A;  4DBQ A;  4Z89 A;  1Z9Z A;  4BD3 A;  3L2W A;  4C5I A;  4BUG A;  3G6E A;  3RES A;  1JJ2 P;  4JUV A;  4M7A A;  4IIM A;  3CCQ A;  3OYD A;  3CCE A;  3TSW A;  4M7A B;  3HRU A;  5DLO A;  4TVR A;  1YWO A;  4KT0 E;  3RDV A;  4JRI A;  4J7F A;  3EG3 A;  3OYB A;  5GAN 8;  4OGE A;  4M77 D;  3FRN A;  5GAM j;  2CT4 A;  5D7U A;  2E3I A;  1WHJ A;  1I5L A;  4BY6 B;  1NG2 A;  8AT1 B;  3E9G A;  5KE3 A;  3X28 B;  2M0Y A;  3CCR T;  2RF0 A;  3JB9 G;  2F1L A;  1PD0 A;  1Y0M A;  2QGG A;  2X3X D;  3OSS C;  2C0O A;  1JQQ A;  4C8Q D;  2R58 A;  1QW1 A;  2LMJ A;  1PM3 A;  3MEA A;  3NTK A;  1F1B B;  3JCM c;  1YJW A;  2YSQ A;  3OYN A;  4E47 A;  1VQ6 Q;  2HEQ A;  2E10 A;  2OJ2 A;  2HCK A;  3HL8 A;  5IAY A;  1RLP C;  3S3O A;  1N5Z A;  2DEQ A;  1VIF A;  3RKW A;  1YHQ T;  4AG2 C;  1R8O B;  4BDZ A;  1PG5 B;  3QXE B;  1VQ7 T;  2DA9 A;  1JB0 E;  3VS6 A;  1TU0 B;  2X4X A;  4OB2 B;  2QEX Q;  3SWN A;  4HKE A;  1B07 A;  2AT1 B;  3SWN B;  2LTO A;  3LGF A;  2DL7 A;  5HK0 A;  2L3R A;  3HTR A;  2H3E B;  5LL6 S;  1UB4 A;  3TU4 K;  1PNJ A;  2DL3 A;  2V8K A;  2FZG B;  2NUZ A;  1FMK A;  2D6F A;  2GCX A;  1N6A A;  1X43 A;  3VRY A;  2FB7 A;  3TQ7 P;  3MO8 A;  3QYH B;  2LT1 A;  4LDW A;  4EPC A;  3PIP A;  1HK9 A;  1H3H A;  4XTZ A;  4PLI A;  4C5G A;  2OAW A;  1VQ4 Q;  2QG9 B;  2XHC A;  4M7A C;  2LZ6 B;  4WCI A;  2OAU A;  1SHF A;  2MCN A;  2RB6 A;  2YRD A;  3CXC A;  1VQ7 A;  5I22 A;  4OVA A;  3CMA Q;  2DL5 A;  2D9T A;  4IUQ A;  1TXQ A;  3CCV T;  3CD6 A;  2OTJ Q;  2QQR A;  1T3S A;  2BE7 D;  5GAM f;  2ROT A;  5CO7 A;  3ZL7 C;  3I56 T;  1UGV A;  2DRM A;  1WJQ A;  3VYG A;  4OMM A;  2EPD A;  1D1C A;  3C0C A;  1RAI B;  1VYV A;  4IUU A;  2R57 A;  1WJS A;  3EG1 A;  2JMA A;  3UWN A;  1ZQ1 A;  3EHQ A;  2ZPB B;  1VQO A;  1TG0 A;  4FL6 A;  1KD1 C;  2HDA A;  4F14 A;  4XTV A;  2VB6 A;  3OMG A;  5GMK e;  3CCV A;  3HFO A;  2ZPG B;  1PWT A;  1W4S A;  2A7Y A;  2YUN A;  2NWM A;  2LRQ A;  4M78 A;  3CXC S;  4JS4 A;  2A3L A;  3HKS A;  2QDY B;  4M78 B;  3A1P A;  3JV3 A;  2KE9 A;  3I56 A;  2PZ1 A;  3H0H A;  3SWN C;  2COZ A;  2CRE A;  5CCA A;  1FYN A;  2DAQ A;  2K7A A;  1W70 A;  1OU9 A;  1WQW A;  1VQP T;  2FRW A;  2LJ3 A;  1VQ5 A;  3FB9 A;  2EKO A;  3OMC A;  1PSE A;  2FPE A;  1Y7X A;  2ZPI B;  3CME Q;  2KT1 A;  2L3P A;  4RCB A;  5I21 A;  1TWB A;  3RUX A;  1R0C B;  4C92 G;  2DL8 A;  4A4K A;  3FIF A;  1KQ1 A;  3SD4 A;  4C5H A;  1J3T A;  4LUD A;  3MCA B;  2BE9 B;  4JJD A;  1TUG B;  4RTV A;  3OYE A;  4PJO A;  4QVC A;  2KYB A;  3ER0 A;  2QK0 A;  3TRE A;  2DJQ A;  1W2B A;  1RAA B;  2OX7 A;  1QVF A;  2ED0 A;  2CH4 A;  1M2O A;  1NPP A;  1ACM B;  1G2B A;  1M3A A;  4A4G A;  3M55 A;  4ELY C;  5KYU A;  4LD9 K;  2DTI A;  1UGQ B;  4AFZ C;  3JCM g;  2DVJ A;  5KYU B;  2DD5 A;  4YTL A;  3CXC P;  4FYX B;  1KC8 C;  1JEG A;  4RKU E;  2LQN A;  1Q81 C;  1WHH A;  3HSB A;  4M77 A;  4M77 B;  1M90 C;  2RA2 A;  4X34 A;  4XU2 A;  4NL2 A;  3NMZ C;  8ATC B;  3R6N A;  1YI2 Q;  2AIR B;  2DXB A;  2XDB A;  2QAS A;  4C8Q A;  1I8F A;  3OS5 A;  1K9M R;  2LQW A;  4C8Q B;  2HQX A;  4MDX A;  3P8D A;  2CP7 A;  3PVQ A;  1QVF S;  4M78 C;  3OYK A;  1YP5 A;  1Q82 U;  2KNB B;  1WFW A;  2K3B A;  1YIT Q;  2CGH A;  1Q82 R;  4AFU C;  1NE8 A;  1ABO A;  3E2U A;  2XG8 D;  3LLR A;  3C12 A;  5D6W A;  3OS0 A;  3T9N A;  2GTO A;  3M9Q A;  3CC2 A;  1G83 A;  5GAN 5;  3PE0 A;  1U5S A;  2CDT A;  2EJ9 A;  5KYW B;  2HZY A;  1Q86 U;  1Q86 R;  3VYH B;  4C0F A;  3THK A;  4PFO A;  4HCB A;  4F04 B;  2YUQ A;  4BI4 A;  2HD0 A;  3QKJ A;  1UEB A;  2BZ8 A;  4X9D A;  4BE1 A;  1GCQ A;  2GBQ A;  2YDL A;  3KBG A;  5GJW B;  1KIK A;  1WXB A;  2ATC B;  4J8O A;  5LJ5 g;  1FMV A;  4PNO A;  4ZGD B;  2LQK A;  2P0Q A;  3BW1 A;  2VAS A;  2DJZ A;  4N4H A;  4RTZ A;  1W1F A;  4M75 E;  4R0K A;  4J6W A;  2RJE A;  5GMK m;  1C0M A;  1XOV A;  1UE9 A;  1X75 C;  1GFD A;  1QVF P;  5DLQ E;  2XIC A;  5FU7 B;  3GIB A;  2O9V A;  1UHF A;  4HCC A;  1QKX A;  5CKF A;  3SFM A;  3VS4 A;  4M77 C;  3OYA A;  2PNI A;  2E6Z A;  5FU6 B;  3L2R A;  2BZX A;  4A4F A;  1BKB A;  4QQ6 A;  1YIJ A;  1HYO A;  5IT9 E;  1AEY A;  4BI3 A;  1QCN A;  4OMQ A;  2YUP A;  3OA6 A;  3BFM A;  2NLU A;  4C8Q C;  4F7U G;  1RAF B;  1U1S A;  1VQ9 Q;  1YJ9 Q;  2K9G A;  1KHI A;  3M0Q A;  2RQR A;  1NZ9 A;  1FX7 A;  1UJY A;  3TVT A;  3QPH A;  5FWB A;  1NEB A;  3EGD A;  4OMN A;  2EKH A;  1VQN A;  2O01 E;  2JW4 A;  1I0C A;  4MZM A;  1VQ6 T;  3OYF A;  2OTL Q;  3OQ5 A;  1WIE A;  4RTU A;  4KH0 B;  3J81 E;  3OW2 A;  3CC7 T;  4ZNX A;  1JBM A;  2GF7 A;  2QA4 A;  4XU1 A;  2QEX T;  5HKC A;  3N5B B;  3CBP A;  3OBW A;  4M75 B;  3OY9 A;  1SF9 A;  1KG1 A;  2O4X A;  4M7D E;  4XTU A;  1XNI A;  1M1K U;  2O4X B;  5CKB A;  1VQK A;  3X24 B;  3L2V A;  1M1K R;  3V8K A;  1YNZ A;  1QMC A;  3E9F A;  3PFS A;  4XU0 A;  4KUL A;  1GCQ C;  3LWI A;  2WSF E;  2FO0 A;  4RG2 A;  5CKD A;  2MYS A;  1NEG A;  3ZBD A;  2F2V A;  4FIB A;  1VQ4 T;  1JJ2 A;  1WYX A;  2KRS A;  4FU6 A;  3FDR A;  1EIF A;  1WHL A;  5FU7 C;  3CC7 A;  3DLM A;  1SEM A;  1UFF A;  3R6O A;  3MJX A;  4PJL A;  2VXE A;  1IHW A;  1N8R C;  2X9H A;  2JXB A;  2EW3 A;  4Z02 A;  2EJG A;  5KYY A;  3OW2 S;  5FU6 C;  2OTJ T;  5GAN 2;  4ZN3 A;  5LJ3 e;  2KEA A;  1YWP A;  4FW1 A;  2X3W D;  2QTV A;  2XK0 A;  1GBQ A;  4PL6 A;  3X26 B;  4BB7 A;  1NLO C;  2EWN A;  3CCJ Q;  3M58 A;  3MKD A;  2PVO B;  4CC3 A;  2EGC A;  1PKS A;  3EFR A;  3KUF A;  2EYY A;  5GAM d;  2LCL A;  4DOV A;  4M7A G;  5LJ3 g;  4GBQ A;  1H8K A;  1ZSZ B;  4XQ3 A;  2RI5 A;  4HCK A;  5CQY A;  1UUE A;  4XTW A;  1JJ2 S;  1D1B A;  4LDV A;  1I81 A;  4OMP A;  4M77 F;  2C06 A;  1GL5 A;  4V2S A;  1B7T A;  4M75 C;  1U8R A;  5FRM A;  1BIB A;  4ZGJ B;  5GAO q;  4ORZ A;  3H41 A;  1YBY A;  1NYG A;  1VOM A;  1CSK A;  3OW2 P;  2KYM A;  2DXU A;  2X4Y A;  4OB0 B;  4CC4 B;  1TSF A;  4RTT A;  3GOX A;  2DIL A;  2ENM A;  1UGS B;  3UAT A;  4C8Q F;  2KQW A;  1S1N A;  3CME T;  1S72 Q;  2HL3 A;  3GF5 A;  1K9A A;  1WNL A;  5L23 A;  4E7L A;  4X1V A;  3CCU Q;  1AVZ C;  3MP1 A;  1AWX A;  2PVG B;  3MP6 A;  2VKN A;  3A8H B;  1U06 A;  2A0F B;  2IPO B;  4JLG A;  3A98 A;  2MOX A;  3CBM A;  2L89 A;  1H64 1;  2A28 A;  1N27 A;  2SRC A;  4XK8 E;  1NM7 A;  4B6M A;  4N4G A;  2DTO A;  1JU5 C;  5KE2 A;  5A0G A;  1VQL Q;  1VQ8 A;  4FYV B;  4F16 A;  3PMT A;  4JJN K;  4IIO A;  2J6O A;  2MWO A;  4QQG A;  4RTW A;  2DK3 A;  3JSC A;  4DBF A;  3G71 Q;  5GAO n;  1BI2 A;  3NGP A;  1WGS A;  3QHS A;  2QQS A;  1H92 A;  4FM4 B;  2P4T A;  3G4S Q;  1D0Z A;  3I55 T;  3QWX X;  3CCL Q;  1M8V A;  3X25 B;  1QQJ A;  3DB3 A;  2K5I A;  1TOV A;  2YLB A;  5KYN A;  2M16 A;  4EDU A;  1ZHI A;  1ZA1 B;  1ZSZ C;  4GLM A;  1YI2 T;  1Q7Y C;  1WHG A;  3JB9 H;  2H3J A;  3A8L B;  1OEB A;  4ZGE B;  2RQV A;  2RD1 A;  2RQU A;  1G3S A;  2L2P A;  3M53 A;  1H3Z A;  1RLQ C;  4L5G A;  2HSE B;  1YIT T;  2WSE E;  4XTX A;  4Q5W A;  2L8D A;  1VQK Q;  5GAN 7;  4B9W A;  2OI3 A;  5KCO A;  2K57 A;  1WPY A;  1G3W A;  2JTM A;  1C1A A;  3FLG A;  3I55 A;  2P4R A;  1AZG B;  2RHU A;  4J83 A;  1ABQ A;  1R77 A;  1YJN T;  3CCR A;  4L6V 5;  2YRV A;  4NL3 A;  2RN8 A;  3A8M B;  1KD1 U;  1GRI A;  1E6G A;  1KD1 R;  2KBT A;  3I5S A;  3SB2 A;  2DMO A;  5GAN e;  2E5Q A;  2O9S A;  2IG0 A;  3A5Z B;  2DD4 A;  5GMK j;  4M78 G;  4M75 F;  3VU3 C;  5CK9 A;  1X6B A;  3AHU A;  3VUZ A;  1D3B A;  1VYT A;  1AD5 A;  3EFS A;  1YHQ A;  1IHV A;  1D3B B;  2DZ9 A;  1AWO A;  1SG5 A;  2KXD A;  3HPW A;  1FWZ A;  2MF2 A;  1OOT A;  1KQ2 A;  2V1R A;  2ZGW A;  2FPF A;  3CCS T;  3VS2 A;  1YJN A;  2A37 A;  2RQT A;  4OB3 B;  1SRL A;  1QWF A;  4M4Z A;  3CCM T;  5I2S A;  2E64 A;  3CC4 T;  2IIM A;  5AYF A;  5GAN g;  2ROL A;  4JPB W;  5A2Q E;  2E1H A;  5A0L A;  3OYI A;  5GAM g;  3NFC A;  1M1G A;  4PJO G;  2V26 A;  2J6F A;  2I0N A;  2J06 A;  3LH0 A;  4IKF A;  2D8H A;  2DET A;  4HVV A;  1VQ9 T;  1YJ9 T;  4A53 A;  1TUC A;  2DZC A;  2FZC B;  3D7S B;  1W6X A;  3CPW P;  3JCM P;  4QW2 A;  1X69 A;  2VGN A;  2KMT A;  2ZZD A;  1WHK A;  3QYG B;  4OF1 A;  2PTK A;  3CCS A;  1JRI A;  1K1Z A;  1Y57 A;  4RTY A;  2O2O A;  3CCM A;  4QVD A;  3DKM A;  2B86 A;  3CC4 A;  1T3L A;  4M77 G;  4ZN1 A;  2CP2 A;  1IGQ A;  3EGU A;  4M75 D;  3OYL A;  3FEO A;  1WHM A;  2LX9 A;  2KRN A;  3VUB A;  2QDL A;  3A8O B;  4FCY A;  1UGR B;  2EQI A;  5IXB A;  2YT6 A;  3HRT A;  3P8B B;  1I1J A;  2K79 A;  4EMG A;  4C8Q G;  3AT1 B;  5IH2 A;  5FW9 A;  2RJD A;  2XKO C;  1B34 B;  5GJV B;  1GCP A;  3OS1 A;  4FSS A;  4OMO A;  4PJM A;  3JCM e;  3G6E Q;  3CCQ Q;  1X2K A;  3CCE Q;  2LNH B;  5AT1 B;  4ME7 A;  5CVI A;  4E7K A;  2J05 A;  1O75 A;  3JCM b;  1BI0 A;  5HK3 A;  5GAN 3;  4Z88 A;  2VVK A;  2RHX A;  4C92 E;  2EAY A;  4MMK A;  1VIE A;  3LX7 A;  4E7Z A;  1K0S A;  2CP6 A;  4OP0 A;  2DX1 A;  4J9D A;  2QAZ A;  1VQP A;  4FW2 A;  3PTA A;  4E7I A;  1KFZ A;  2DXT A;  1I5O B;  2CH4 W;  1QWE A;  1D1A A;  3HP9 A;  1FXX A;  3JB9 I;  2EFI A;  2Z0W A;  3CCJ T;  2MMP A;  1LCK A;  3BDU A;  4DEX A;  2KRO A;  3CEY A;  1YJW Q;  3PT9 A;  3S3M A;  1K8A C;  4CC2 A;  3EFO B;  4FYY B;  4M7D D;  3ULR B;  2XU8 A;  1OI1 A;  2E4H A;  1ZUU A;  4J6X A;  1K9M U;  4XAX B;  1K73 C;  1PRM C;  3QDR B;  4RTX A;  1E6H A;  2LT4 A;  1FMW A;  3UPU A;  1BYM A;  3TEE A;  4C0G A;  3JCM X;  3NTI A;  3QWY A;  5I2M A;  2LJ1 A;  4IUT A;  3VS5 A;  1RUW A;  2XDD A;  2D8J A;  2NUT A;  3C4S A;  1VQM T;  1HXD A;  2NUT B;  5LJ5 e;  4J6Y A;  4ESR A;  2HNI A;  5KYW A;  1VUB A;  4PJN A;  1LOJ A;  3EH2 A;  2JNG A;  1KJW A;  1S72 T;  2DRK A;  1M5Q 1;  5HCK A;  1BI1 A;  1DJ7 B;  4N4I A;  1K0X A;  1AHJ B;  3ZFJ A;  2YXY A;  1K76 A;  5IN1 A;  3A8G B;  3H0I A;  4PJJ A;  1MV3 A;  4LDX A;  1VQ7 Q;  1QVP A;  2JS2 A;  5GAO r;  3GBQ A;  2DE0 X;  2I2L A;  3CD6 Q;  2AZS A;  4E7S A;  2JT4 A;  4LNP A;  2EYQ A;  4PFP A;  3WVE B;  4RG8 A;  1OX9 A;  1VQL T;  3OB9 A;  3QJY A;  1VQM A;  1ZSG A;  2O31 A;  4N0A A;  2DLP A;  1KSW A;  1RAH B;  3I9Q A;  3G71 T;  4XTY A;  4X9C A;  5C6S A;  5A0D A;  4J9F A;  3TSZ A;  2EQK A;  3INZ A;  1C6V X;  2GGR A;  4A4H A;  3MPU B;  1VQO Q;  3CCL T;  1TH7 A;  4J9G A;  1SKU B;  1TUD A;  2LCS A;  1X01 A;  4XU3 A;  2X4J A;  3M59 A;  4PK4 A;  2X4W A;  2O88 A;  2JOY A;  2BTT A;  3V8L A;  3CCV Q;  2DYI A;  3JCM J;  2ABL A;  5CAI A;  3QSU A;  1SSH A;  2H8H A;  4AMC A;  3GP8 A;  3I56 Q;  3GNF B;  3H9N A;  3JB9 F;  4PFZ A;  1N8R R;  2DNU A;  3PGG A;  3U23 A;  1VQ5 Q;  4F7U E;  2J6K A;  1Q86 C;  4OB1 B;  1JXO A;  5LJ3 j;  3L2Q A;  2GQV A;  2HMA A;  1OPK A;  5GAN 4;  2NYS A;  2E65 A;  4M75 A;  1AOJ A;  3MET A;  1RL2 A;  1RI0 A;  3UF4 A;  1PKT A;  1G3T A;  4D8K A;  2MWP A;  3RNJ A;  3OYG A;  1XJW B;  2DTH A;  4MDW A;  3WVD B;  2PQW A;  3HHT B;  3OS2 A;  5GAN 6;  1M1F A;  4J9E A;  3BDL A;  3RMS A;  1WJR A;  3LWH A;  3M0P A;  3JCM V;  1XTD A;  4RMO A;  1VQ6 A;  3MEU A;  2VUB A;  3P8H A;  3MEV A;  2KY9 A;  3PIO A;  2BKD N;  3EGX A;  2HQE A;  4J9H A;  3LYI A;  4IUV A;  3E1S A;  3EGX B;  1D0Y A;  2FYK A;  2CYZ B;  3V7R A;  3BY7 A;  1TS9 A;  9ATC B;  1RAD B;  4N0A C;  4FSX A;  5CKH A;  3CMA T;  1B3Q A;  4Y91 A;  2QEX A;  3QDF A;  1D0X A;  3S3N A;  2K2M A;  3QBY A;  2COW A;  1AWJ A;  1PSF A;  3H6Z A;  1MMN A;  3JB9 D;  1RAG B;  1MNE A;  3OSV A;  2K5F A;  4OGC A;  2Y90 A;  4JJB A;  2RJF A;  4F7U B;  4AFS C;  3FJP A;  3CBO A;  1PC0 A;  1QKW A;  3L1A A;  2HL5 C;  4KUD K;  2QTX A;  2RO0 A;  1VQ4 A;  2QGF B;  4M7D A;  4HXJ A;  1MMG A;  1ZSZ A;  4M7D B;  2E3H A;  4HCZ A;  2V8I A;  3ASK A;  3CMA A;  2NUP B;  1R0B G;  3G7Z A;  5GAN h;  1Y07 A;  3CC2 Q;  3M54 A;  4FYW B;  1MHN A;  4JZ3 A;  1AZE A;  2OTJ A;  2JMC A;  4ATO A;  5LJ3 f;  2KK4 A;  4D6W A;  1M1K C;  3RER A;  2CUB A;  1OPL A;  1U3O A;  2GTJ A;  4DEY A;  2L3Q A;  4M7A E;  5CIU A;  3X20 B;  1MMA A;  2P0P A;  2VWF A;  1NJI C;  2A08 A;  3M0T A;  4HVW A;  3V7S A;  1V76 A;  1X6O A;  2LNV A;  2JJ9 A;  4D8D A;  4HA8 A;  3I5R A;  1Q7Y R;  2MAM A;  4WTO B;  3G6E T;  2ZCF B;  3CCQ T;  2EJF A;  3CCE T;  1PD1 A;  3E19 A;  2DPP B;  1X2Q A;  4BDY A;  5GMK i;  3QJ6 A;  5DY9 A;  2RPN A;  1VYU A;  3RBB B;  3QII A;  3ZEH A;  4MML A;  3IQL A;  4C92 F;  2DYB A;  1OZ3 A;  2CZ7 B;  2K5L A;  5C0M A;  1OZ2 A;  1JXM A;  2K6D A;  1LNX A;  1WXU A;  1BCM A;  4PLL A;  5GMK h;  3VS3 A;  1YIJ Q;  3NPF A;  3RKX A;  1PCX A;  7AT1 B;  1WLP B;  1UJ0 A;  1M30 A;  2AKK A;  2QQB A;  3O8V A;  4J9B A;  3CME A;  1GFC A;  4QT7 A;  3SEM A;  2D0Q B;  3REB B;  2RHZ A;  5M9O A;  1YJW T;  1VQN Q;  4M7D C;  5HY6 A;  4LDY A;  2V1Q A;  5GAN j;  3G1J A;  3CPW A;  4DBH A;  3URG A;  2V8J A;  2EYX A;  1M2V A;  4J5Y A;  4KBM B;  2DEU A;  2L0A A;  1M2V B;  1ZUY A;  5EC7 A;  1UDL A;  3JCM d;  2QA4 Q;  3JCM h;  1GXI E;  5CKE A;  1HD3 A;  2RH2 A;  2X51 A;  1M3B A;  4LXC A;  1ZLM A;  3BE3 A;  4BAC A;  4JRK A;  2EYZ A;  3VS1 A;  2HBP A;  4CI0 C;  3JCM W;  1LJO A;  1K4U S;  2WAC A;  3RIR A;  1OX8 A;  2HBW A;  2L5Q A;  5CQX A;  4E7J A;  3Q1J A;  2CP0 A;  4NS5 A;  1KQS A;  3M5A A;  1NYF A;  2E70 A;  4QQD A;  2CSQ A;  1BBZ A;  2XMF A;  4C92 D;  2ECZ A;  3ME9 A;  2EIF A;  1I4K 1;  2PUK B;  2KGT A;  1WDX A;  1YCS B;  2KRM A;  3DLL A;  2Y4X A;  1X27 A;  3MP8 A;  1SSF A;  2W10 A;  2MK5 A;  2QQ9 A;  1YI2 A;  4WF2 A;  2ZPE B;  1HJD A;  2RQW A;  3CC7 Q;  4BI8 B;  3V7C A;  2F69 A;  2KI7 A;  3QZ9 B;  1YCY A;  4GLK A;  3CPW S;  2DXC A;  1Y96 A;  3CD6 T;  2ESW A;  4LD6 A;  2KVQ G;  2P0K A;  4IUR A;  1Y96 B;  1YIT A;  2FPD A;  1KHC A;  3EG0 A;  1KK7 A;  2JS0 A;  5GAM e;  4KH1 B;  2MI6 A;  3M57 A;  1UGP B;  1Q95 G;  2CT3 A;  3M0R A;  4C0Z A;  1Z9Q A;  2CKK A;  5FRN A;  4DA4 A;  3L42 A;  3OYH A;  1KQS S;  4M78 E;  2RHI A;  3UDC A;  4PKC C;  4R55 A;  1VQO T;  4IUP A;  2CZ1 B;  2XI9 A;  2YWW A;  3GPL A;  5LJ5 d;  1OV3 A;  1SPK A;  5LJ5 h;  2EVR A;  2RK2 A;  2KT8 A;  1XQH A;  2F5T X;  2Y4Y A;  2RI2 A;  3EAE A;  5GAN f;  1MV0 B;  3JAM E;  2BUD A;  1V29 B;  1WI7 A;  2DER A;  4BY6 C;  2AZV A;  4O6J A;  1MMD A;  4LE9 A;  1HSQ A;  2JM8 A;  2VC8 A;  3M0U A;  2HKN A;  3LGL A;  4PJO E;  3C94 A;  4DQ2 A;  4E6R A;  2OTL T;  1VQ5 T;  4F7U F;  1BIA A;  1QVG A;  1KC8 U;  3VS7 A;  6AT1 B;  2IVW A;  2CP3 A;  1KC8 R;  1Q81 U;  1ZUK A;  2K4Y A;  3RKY A;  1Q81 R;  2GQI A;  1M90 U;  2ZPH B;  4Y28 E;  2LJ0 A;  4JZ4 A;  1KQS P;  1M90 R;  4M7D F;  3J7A F;  1K8A U;  4QVZ A;  3MHX A;  1K8A R;  3M56 A;  2RJC A;  3OYC A;  4JRP A;  1VQ9 A;  2DF6 A;  1B34 A;  4M77 E;  1YJ9 A;  1MND A;  2AKL A;  1UEC A;  1ZA2 B;  1K73 U;  1IB8 A;  1OYX A;  2MPX C;  1K73 R;  1WZO A;  1VQ8 Q;  3QG1 A;  2JM9 A;  2OTL A;  5I11 A;  2RMO A;  4VUB A;  4CC7 A;  4C8Q E;  1TTH B;  2QQA A;  3WXM B;  4RUG A;  2HKQ B;  1UHC A;  2JN0 A;  3EH1 A;  4BE2 A;  1I07 A;  1PHT A;  1OUL A;  4JDS A;  1QVG S;  5LJ5 j;  4JJC A;  2D0N A;  4JS5 A;  3F70 A;  3RR6 A;  2DVE A;  4O5V A;  1IRX A;  2VGM A;  4EIK A;  2P84 A;  2LP5 A;  1IGU A;  2FHD A;  2LDM A;  3KXT A;  2J7I A;  3OYJ A;  4PJO B;  3JCM Q;  4HT9 A;  1EX4 A;  4NOY A;  5IHK A;  4EMK A;  1IRE B;  2JZ2 A;  3EG9 A;  3JCM f;  4C0D B;  4EMK B;  1E7O A;  2VXF A;  3EG9 B;  3EFO A;  1WXT A;  4KGZ B;  3NTH A;  2RHY A;  3M4G A;  2YRC A;  5DM7 R;  2ED1 A;  2FVU A;  3I35 A;  5GAO m;  4C5E A;  1T0H A;  2XD0 A;  3OBY A;  4DOW A;  3M4Y A;  3I55 Q;  3CC2 T;  4DBR A;  2QYZ A;  5J39 A;  3S6W A;  1IO6 A;  5FLX E;  1G8X A;  3CCR Q;  3QO3 A;  4M7A F;  3CPF A;  4Z8A A;  2LQ8 A;  2RM4 A;  1QVG P;  1M3C A;  2MIO A;  3FC3 A;  3CCJ A;  5IHI A;  1A0N B;  2G3R A;  3NHN A;  2JTE A;  4C92 A;  2HAX A;  1W2B S;  3OYM A;  4C92 B;  4OMF B;  1QLY A;  2DKG A;  3QZ5 B;  2EBP A;  5LJ3 d;  3UT1 A;  5LJ3 h;  2BIV A;  1IXD A;  2K2V A;  2EGE A;  2YLC A;  4A63 B;  4CRI A;  3HRS A;  1YHQ Q;  2GNC A;  3CCU T;  2K3X A;  2PVD B;  3L2U A;  5IHN A;  4AT1 B;  2G6F X;  4GY5 A;  1QCF A;  2AHJ B;  1YJN Q;  1UG1 A;  2X35 A;  2EQM A;  4BE0 A;  4E7H A;  4M75 G;  2L3S A;  3VKI A;  2YHT A;  2DBK A;  4J9C A;  3JRZ A;  5LJ5 f;  2LVM A;  4PJO C;  2R5A A;  3C95 A;  1YIJ T;  4MZP A;  5KH6 A;  2DIG A;  1M9S A;  1BU1 A;  2M0O A;  2EYW A;  4C0D C;  4EMK C; 
#chains in the Genus database with same CATH homology
 1S72 A;  1Y7X A;  2ZPI B;  4B9W A;  5KCO A;  5GAN 7;  3G4S T;  3J80 E;  2K57 A;  1WPY A;  1K9M C;  1G3W A;  4M7D B;  4HCZ A;  3HFN A;  4RCB A;  5I21 A;  3RUX A;  2JTM A;  2V8I A;  3ASK A;  4C92 G;  2CZ6 B;  2KDS A;  3FLG A;  3CCU A;  4M7A D;  2XID A;  4J7I A;  3RMQ A;  4A4K A;  3FIF A;  5EG2 A;  1KQ1 A;  4OMF B;  3I55 A;  3CMA A;  1VQN T;  3SD4 A;  4C5H A;  2RHU A;  3G7Z A;  3MCA B;  2M9U A;  5GAN h;  1Y07 A;  3M54 A;  2DIQ A;  4J83 A;  1YJN T;  4B9X A;  3OYE A;  1MHN A;  3LW5 E;  4PJO A;  3CCR A;  4QVC A;  4ATO A;  2OTJ A;  3ER0 A;  4L6V 5;  5LJ3 f;  2KK4 A;  3TRE A;  3DB4 A;  4D6W A;  4ELZ C;  1WQ7 A;  1M1K C;  1W2B A;  1Q82 C;  3RER A;  2YRV A;  4NL3 A;  3A8M B;  1QVF A;  4M7A E;  5CIU A;  2QA4 T;  1VQL A;  1KD1 U;  2LC4 A;  1NPP A;  3X20 B;  2P0P A;  1NJI C;  4A4G A;  1N8R U;  3M55 A;  3SB2 A;  4ELY C;  3V7S A;  3OYY A;  3PNW C;  5GAN e;  2E5Q A;  2M1H A;  5GAO p;  2DTI A;  1UGQ B;  2IG0 A;  3A5Z B;  1X6O A;  4LD9 K;  2DD4 A;  5GMK j;  2LNV A;  3JCM g;  4M78 G;  1VQK T;  3G71 A;  1QP2 A;  2DD5 A;  4YTL A;  3VV0 A;  4ZTJ A;  4M75 F;  2LCC A;  4HA8 A;  1KC8 C;  3VU3 C;  5CK9 A;  3AHU A;  3VUZ A;  4RKU E;  1D3B A;  3EFS A;  2E6N A;  1YHQ A;  3G4S A;  4JLI A;  1Q81 C;  3TCJ A;  2MAM A;  3HSB A;  4C92 C;  2JTF A;  1D3B B;  4M77 A;  3G6E T;  2ZCF B;  2DZ9 A;  3CCQ T;  3CCL A;  2EJF A;  3CCE T;  3E19 A;  3HPW A;  4M77 B;  1FWZ A;  1M90 C;  2MF2 A;  2CS7 A;  2DPP B;  4FT4 A;  1KQ2 A;  4BDY A;  2ZGW A;  1ZBX A;  3CCS T;  5GMK i;  1N9R A;  1Y71 A;  3QJ6 A;  5DY9 A;  1YJN A;  4M7D G;  2RA2 A;  4OB3 B;  4X34 A;  3CCM T;  3QII A;  4XU2 A;  5I2S A;  2E64 A;  4NL2 A;  3CC4 T;  5AYF A;  3ZEH A;  2PU9 B;  2ZPF B;  4MML A;  5GAN g;  1M4Z A;  4C92 F;  1OZ3 A;  2DXB A;  5A2Q E;  2XDB A;  2CZ7 B;  4C8Q A;  1I8F A;  3OS5 A;  1G5V A;  4R56 A;  2E1H A;  2K5L A;  2KAF A;  5C0M A;  1OZ2 A;  4C8Q B;  5A0L A;  2HQX A;  4UC4 A;  3OYI A;  1LNX A;  5GAM g;  3NFC A;  1M1G A;  3H8Z A;  5KCH A;  4MDX A;  3P8D A;  4PJO G;  4PLL A;  5GMK h;  3LH0 A;  3RKX A;  4IKF A;  1QVF S;  4M78 C;  3OYK A;  2QQB A;  1VQ9 T;  1BI3 A;  1Q82 U;  1YJ9 T;  3GNG A;  3O8V A;  4A53 A;  3CME A;  2R5M A;  2CGH A;  2DZC A;  2D0Q B;  2F5K A;  1NE8 A;  2XG8 D;  2VV5 A;  2RI3 A;  2CZ0 B;  3LLR A;  4LDU A;  5D6X A;  3C12 A;  5D6W A;  4MZT A;  4QW2 A;  3OS0 A;  3JCM P;  1NJI U;  2VGN A;  2KMT A;  3T9N A;  2ZZD A;  1IZ6 A;  2RHZ A;  3M9Q A;  5M9O A;  1YJW T;  3QYG B;  3CC2 A;  2E41 A;  3GLX A;  5GAN 5;  4M78 F;  4OF1 A;  4EMH A;  4M7D C;  3CCS A;  1JRI A;  2EJ9 A;  5HY6 A;  4LDY A;  5GAN j;  1Q86 U;  5GAO l;  3CCM A;  3CPW A;  4QVD A;  3DKM A;  3JB9 J;  2WSC E;  3CC4 A;  3URG A;  2KSS A;  2V8J A;  4M77 G;  4ZN1 A;  3VYH B;  4C0F A;  4J5Y A;  4F7U A;  4KBM B;  4II1 A;  4M75 D;  3OYL A;  2FL7 A;  4HCB A;  3JCM d;  3FEO A;  3JCM h;  4BI4 A;  1GXI E;  2HD0 A;  3QKJ A;  5CKE A;  1U1T A;  1UEB A;  2LX9 A;  2RH2 A;  4X9D A;  4BE1 A;  3VUB A;  3A8O B;  4BAC A;  4JRK A;  3KBG A;  1UGR B;  4KUI A;  2HBP A;  4CI0 C;  3JCM W;  1QP3 A;  1LJO A;  4J8O A;  5FRO A;  3HRT A;  3P8B B;  4PNO A;  2WAC A;  2LQK A;  4ZGD B;  5LJ5 g;  3RIR A;  2P0Q A;  4EMG A;  3BW1 A;  2DJZ A;  2L5Q A;  4N4H A;  3V8J A;  4C8Q G;  1Q7Y C;  5CQX A;  4E7J A;  2RJD A;  2XKO C;  4M75 E;  3Q1J A;  4NS5 A;  1KQS A;  1B34 B;  4J6W A;  2QXF A;  2RJE A;  3MEW A;  5D6Y A;  2GFU A;  3SDZ A;  5GMK m;  3M5A A;  3OS1 A;  1XOV A;  4PJO F;  3JCM e;  4HT8 A;  2E70 A;  2K3Y A;  1X75 C;  4QQD A;  4C92 D;  4ME7 A;  3ME9 A;  5GAN d;  5DLQ E;  2EIF A;  1I4K 1;  2XIC A;  5CVI A;  5FU7 B;  2PUK B;  4E7K A;  3GIB A;  3PMI A;  1O75 A;  2RK1 A;  3DLL A;  4HCC A;  2Y4X A;  3JCM b;  1BI0 A;  5CKF A;  3SFM A;  5HK3 A;  3MP8 A;  1SSF A;  4M77 C;  5GAN 3;  2PUO B;  2QQ9 A;  5GAM h;  1YI2 A;  2B8A A;  4WF2 A;  3OYA A;  2DO3 A;  2JUF A;  2RHX A;  2E6Z A;  5FU6 B;  2ZPE B;  4C92 E;  3L2R A;  2EAY A;  4MMK A;  4L59 A;  1VIE A;  4A4F A;  4BI8 B;  3V7C A;  2F69 A;  3LX7 A;  2EQU A;  3QZ9 B;  1YCY A;  4FT2 A;  4GLK A;  1BKB A;  3CPW S;  2DXC A;  4OP0 A;  4QQ6 A;  1YIJ A;  1Y96 A;  5IT9 E;  3CD6 T;  4BI3 A;  4LD6 A;  2KVQ G;  1VQP A;  2P0K A;  4IUR A;  1Y96 B;  5L8R E;  3OA6 A;  2E12 A;  3BFM A;  2NLU A;  4C8Q C;  4F7U G;  3PTA A;  4E7I A;  1YIT A;  4M78 D;  1U1S A;  1KHC A;  1Q7Y U;  2DXT A;  5GAM e;  1KHI A;  3M57 A;  2MI6 A;  1UGP B;  1NZ9 A;  2VYT A;  1FX7 A;  1FXX A;  2EFI A;  3HP9 A;  5CR2 A;  3JB9 I;  3CCJ T;  1VQ8 T;  3QPH A;  2MMP A;  4C0Z A;  4PJO D;  3BDU A;  1VQN A;  2CKK A;  2O01 E;  3CEY A;  4MZM A;  4A54 A;  4DA4 A;  5FRN A;  1VQ6 T;  3L42 A;  4ZTF A;  3OYF A;  3PT9 A;  5GMK l;  3OYH A;  3S3M A;  1K8A C;  2QI2 A;  3OQ5 A;  4M78 E;  1KQS S;  5GAM j;  1MGQ A;  2JVV A;  4JRQ A;  2GFA A;  4M7D D;  2XU8 A;  2RHI A;  3UDC A;  1OI1 A;  4PKC C;  4R55 A;  3J81 E;  4IUP A;  5J3B A;  3OW2 A;  1VQO T;  1NPR A;  2XDP A;  4J6X A;  4RCC A;  1JBM A;  1K9M U;  3CC7 T;  4P5N A;  3VJP A;  4XAX B;  2GF7 A;  2CZ1 B;  2XI9 A;  3L2Z A;  3QDR B;  3GPL A;  5LJ5 d;  2QA4 A;  1K73 C;  4XU1 A;  5LJ5 h;  2QEX T;  2RK2 A;  3N5B B;  5HKC A;  1XQH A;  2F5T X;  2LT4 A;  2Y4Y A;  5J26 A;  3CBP A;  3OBW A;  4M75 B;  2RI2 A;  3UPU A;  3OY9 A;  1BYM A;  1G3Y A;  1KG1 A;  3EAE A;  1N9S A;  1O9S A;  2O4X A;  4A4E A;  5GAN f;  3TEE A;  2BUD A;  4C0G A;  3NTI A;  3JCM X;  2EQJ A;  3JAM E;  3QUI A;  4XTU A;  4M7D E;  5I2M A;  1XNI A;  1M1K U;  2O4X B;  5CKB A;  1VQK A;  1V29 B;  1P92 A;  3X24 B;  4IUT A;  4BY6 C;  3L2V A;  3V8K A;  2XDD A;  4O6J A;  3E9F A;  3PFS A;  4XU0 A;  3C4S A;  4KUL A;  2VC8 A;  4BD3 A;  3L2W A;  1VQM T;  3LWI A;  4C5I A;  1HXD A;  4BUG A;  3RES A;  2WSF E;  3G6E A;  4JUV A;  4RG2 A;  4J6Y A;  5LJ5 e;  3OYD A;  3CCE A;  3CCQ A;  2HNI A;  3LGL A;  5CKD A;  4M7A A;  4PJO E;  3C94 A;  4M7A B;  3HRU A;  1VUB A;  4DQ2 A;  5DLO A;  4TVR A;  2OTL T;  3ZBD A;  1VQ5 T;  1LOJ A;  4KT0 E;  4F7U F;  4FIB A;  2JNG A;  1BIA A;  1QVG A;  4JRI A;  4J7F A;  1VQ4 T;  1KC8 U;  1JJ2 A;  1S72 T;  3OYB A;  1M5Q 1;  2IVW A;  4FU6 A;  5GAN 8;  3FDR A;  1EIF A;  1Q81 U;  4OGE A;  1BI1 A;  4M77 D;  3FRN A;  1DJ7 B;  4N4I A;  2K4Y A;  3DLM A;  1AHJ B;  5FU7 C;  3RKY A;  3ZFJ A;  3CC7 A;  5IN1 A;  3A8G B;  3R6O A;  2ZPH B;  1M90 U;  4LDX A;  4Y28 E;  2VXE A;  1I5L A;  4BY6 B;  1QVP A;  3E9G A;  1N8R C;  4M7D F;  5GAO r;  3J7A F;  5KE3 A;  3X28 B;  4Z02 A;  1K8A U;  4QVZ A;  2EJG A;  3MHX A;  3OW2 S;  5FU6 C;  3CCR T;  5GAN 2;  3JB9 G;  2OTJ T;  2I2L A;  4ZN3 A;  5LJ3 e;  3M56 A;  2RJC A;  3OYC A;  4JRP A;  2EYQ A;  1VQ9 A;  3OSS C;  1B34 A;  3WVE B;  4M77 E;  1YJ9 A;  4RG8 A;  4C8Q D;  1VQL T;  2XK0 A;  3OB9 A;  1K73 U;  3QJY A;  1OYX A;  4PL6 A;  3X26 B;  1VQM A;  4BB7 A;  2EWN A;  2R58 A;  1QW1 A;  3M58 A;  3QG1 A;  3MEA A;  3NTK A;  3JCM c;  4N0A A;  2PVO B;  1YJW A;  4XTX A;  2OTL A;  3OYN A;  4E47 A;  2E10 A;  3G71 T;  4Q5W A;  3HL8 A;  4VUB A;  3EFR A;  4XTY A;  3KUF A;  5IAY A;  4X9C A;  3S3O A;  4C8Q E;  2QQA A;  2DEQ A;  5GAM d;  1VIF A;  2LCL A;  3RKW A;  3WXM B;  4DOV A;  5A0D A;  5C6S A;  1YHQ T;  2EQK A;  2JN0 A;  1R8O B;  4M7A G;  4BDZ A;  3INZ A;  4A4H A;  5LJ3 g;  4BE2 A;  3CCL T;  3QXE B;  4XQ3 A;  2RI5 A;  1VQ7 T;  1VQ4 A;  4JDS A;  1JB0 E;  1TH7 A;  1QVG S;  5LJ5 j;  2X4X A;  4OB2 B;  5CQY A;  4XTW A;  1JJ2 S;  1X01 A;  4XU3 A;  4JS5 A;  3F70 A;  2X4J A;  3M59 A;  3SWN A;  2DVE A;  4HKE A;  4LDV A;  4O5V A;  2X4W A;  2VGM A;  2JOY A;  1I81 A;  3SWN B;  3V8L A;  4M77 F;  2LTO A;  3LGF A;  2FHD A;  2LDM A;  3KXT A;  2C06 A;  3JCM J;  3OYJ A;  4PJO B;  4V2S A;  3JCM Q;  4M75 C;  1U8R A;  5FRM A;  4HT9 A;  5HK0 A;  1BIB A;  2L3R A;  5LL6 S;  5CAI A;  4ZGJ B;  3QSU A;  1UB4 A;  4NOY A;  3TU4 K;  5GAO q;  4EMK A;  2V8K A;  1IRE B;  3GP8 A;  3GNF B;  2JZ2 A;  1YBY A;  3JCM f;  4C0D B;  4EMK B;  2D6F A;  2GCX A;  2DXU A;  2VXF A;  3JB9 F;  1N6A A;  2X4Y A;  4OB0 B;  2FB7 A;  3MO8 A;  3QYH B;  2LT1 A;  3GOX A;  4LDW A;  1UGS B;  3PGG A;  4C8Q F;  4EPC A;  2KQW A;  4F7U E;  3PIP A;  1HK9 A;  1Q86 C;  4XTZ A;  4OB1 B;  3NTH A;  4PLI A;  3CME T;  5LJ3 j;  2RHY A;  4C5G A;  3M4G A;  2XHC A;  4M7A C;  5DM7 R;  2OAU A;  3L2Q A;  2FVU A;  3GF5 A;  1WNL A;  2GQV A;  2RB6 A;  5GAN 4;  4M75 A;  2E65 A;  4E7L A;  5GAO m;  1VQ7 A;  4C5E A;  3CXC A;  3MET A;  2XD0 A;  3OBY A;  3MP1 A;  1RL2 A;  3M4Y A;  1RI0 A;  4OVA A;  4DOW A;  3CC2 T;  2PVG B;  3MP6 A;  2D9T A;  4IUQ A;  5J39 A;  3A8H B;  3S6W A;  3CCV T;  3CD6 A;  1G3T A;  4JLG A;  5FLX E;  2MWP A;  3CBM A;  2L89 A;  1H64 1;  3QO3 A;  2QQR A;  1N27 A;  4M7A F;  3OYG A;  4M7D A;  4XK8 E;  2DTH A;  5GAM f;  3CPF A;  4MDW A;  4N4G A;  2LQ8 A;  5CO7 A;  2DTO A;  3WVD B;  2PQW A;  3HHT B;  3OS2 A;  2RM4 A;  5KE2 A;  3I56 T;  5GAN 6;  1M1F A;  1WJQ A;  5A0G A;  3FC3 A;  3CCJ A;  1VQ8 A;  3BDL A;  3VYG A;  3RMS A;  3PMT A;  2G3R A;  4C92 A;  4JJN K;  2HAX A;  1WJR A;  3LWH A;  1W2B S;  3JCM V;  1XTD A;  3OYM A;  4RMO A;  1VQ6 A;  2MWO A;  4C92 B;  4QQG A;  3MEU A;  2DK3 A;  3JSC A;  2DKG A;  2VUB A;  3P8H A;  3QZ5 B;  2R57 A;  3MEV A;  1WJS A;  4IUU A;  2BIV A;  5LJ3 d;  2KY9 A;  2K2V A;  2BKD N;  5LJ3 h;  2HQE A;  3UT1 A;  3UWN A;  3PIO A;  3LYI A;  1ZQ1 A;  2YLC A;  4IUV A;  5GAO n;  1BI2 A;  3E1S A;  4CRI A;  1WGS A;  3QHS A;  2QQS A;  2ZPB B;  1VQO A;  3HRS A;  2FYK A;  2CYZ B;  4FM4 B;  2P4T A;  3BY7 A;  3V7R A;  4FL6 A;  3CCU T;  4N0A C;  4FSX A;  1KD1 C;  5CKH A;  3I55 T;  3CMA T;  4Y91 A;  1M8V A;  3X25 B;  2QEX A;  2K3X A;  4XTV A;  2PVD B;  3DB3 A;  3L2U A;  3S3N A;  2K5I A;  3OMG A;  5GMK e;  2YLB A;  2M16 A;  3QBY A;  4GY5 A;  4EDU A;  3CCV A;  2AHJ B;  1ZHI A;  3HFO A;  1PSF A;  2ZPG B;  3H6Z A;  3JB9 D;  1W4S A;  2A7Y A;  3OSV A;  2K5F A;  1YI2 T;  2X35 A;  2EQM A;  4M78 A;  2LRQ A;  4BE0 A;  4E7H A;  3CXC S;  4JS4 A;  4OGC A;  4M75 G;  2Y90 A;  2H3J A;  2A3L A;  3A8L B;  3HKS A;  3JB9 H;  2QDY B;  3VKI A;  2YHT A;  4M78 B;  2RJF A;  3I56 A;  4F7U B;  3SWN C;  3FJP A;  4ZGE B;  3JRZ A;  5LJ5 f;  2LVM A;  5CCA A;  4PJO C;  2R5A A;  2RD1 A;  2DAQ A;  3C95 A;  3CBO A;  1YIJ T;  4MZP A;  1G3S A;  5KH6 A;  3M53 A;  1WQW A;  2DIG A;  3L1A A;  4KUD K;  1H3Z A;  1VQP T;  2QTX A;  1VQ5 A;  1M9S A;  3FB9 A;  2EKO A;  3OMC A;  2M0O A;  4L5G A;  2RO0 A;  1YIT T;  2WSE E;  1PSE A;  2L8D A;  4C0D C;  4EMK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...