2LNHB

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural Wiskott-Aldrich syndrome protein
publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lnhB00
3M0PA 2PZ1A 2J6OA 3M0TA 4OMPA 1QWFA 3I5SA 2BZXA 1Y0MA 2KR3A 3ULRB 2KE9A 1M3BA 3VS1A 1Z9QA 2AK5A 2LJ0A 4R0KA 1ARKA 2D0NA 3UA6A 2EGAA 2D8HA 2KROA 3JV3A 1PRLC 1X2KA 2LQWA 3EG1A 2OAWA 1K9AA 1WXTA 1AZEA 2MIOA 2GQIA 2L2PA 2DBMA 1T0JA 2CREA 1WX6A 1GRIA 1NM7A 2EGCA 3M0QA 2YUQA 3VS5A 4LE9A 2YUNA 2EGEA 2HBWA 2JM9A 1JO8A 1UECA 1VYUA 2C0IA 2J6FA 2RQWA 2YDLA 3REBB 3NHNA 2X3WD 3VS4A 1MUZA 1UDLA 2D1XA 1GCQC 2DL8A 2RN8A 4RTYA 4EIKA 1OPKA 4FSSA 4AFUC 2DJQA 2RMOA 1K0XA 4GBQA 2X3XD 4M4ZA 1ZX6A 1AEYA 2VKNA 2RQRA 1TUDA 3EGUA 5EC7A 3EG0A 2LP5A 4ORZA 1TUCA 2L3SA 5GJWB 2KGTA 2LZ6B 1NEGA 1NYFA 1CKBA 5IHIA 2LNHB 2CH4A 1UJ0A 2RQTA 1OV3A 1CKAA 3O5ZA 2MCNA 2EVRA 3TSWA 2YUPA 2RPNA 4OMQA 1WXUA 1G83A 1AZGB 1RUWA 4OMLA 2HDAA 1K76A 1QKWA 3VRYA 2A08A 1YNZA 1FMKA 4CC3A 4DEYA 1IO6A 2KT1A 4KRTA 2RF0A 1VA7A 4LUEA 1GCPA 2YSQA 1U5SA 2IIMA 1AWJA 1SEMA 3I35A 2CT3A 4RTVA 1GCQA 4CC4B 2M0YA 2O9SA 3M0SA 2K2MA 4J9BA 1NLPC 4IIMA 2KXCA 2FPFA 1E6HA 1UTIA 1GL5A 2LCSA 1GBQA 3UATA 4F16A 1WXBA 2DNUA 4ESRA 2EYXA 5ECAA 1HSQA 2CSIA 2FPDA 3H0FA 2KRMA 1YP5A 2ED1A 1Z9ZA 1B07A 2KNBB 3LH5A 1W70A 2FRYA 1RLQC 2L3PA 2XMFA 3QWXX 2HSPA 4AG1C 2HCKA 1I07A 1ZBJA 4J9FA 2PNIA 2MOXA 2B86A 2VWFA 1SSHA 1QCFA 1RI9A 2LQNA 2QDLA 3IQLA 1AWOA 1FYNA 2O2OA 2JS2A 2L0AA 2JS0A 3REAB 2ROTA 1YWOA 1KIKA 1KFZA 2ROLA 2JW4A 4RTZA 3VS7A 3A98A 1SRLA 1WI7A 1PNJA 2FG0A 4RTUA 2FO0A 5GJVB 1SPKA 4J9HA 1CSKA 4LN2A 2P4RA 1M27C 1MV0B 1UE9A 3PVLA 2F2VA 4AG2C 1T3LA 3FJ5A 1QKXA 2A37A 2DRMA 5FWBA 1UHCA 1M3CA 1BU1A 4WCIA 1VYTA 1JEGA 1H3HA 3I9QA 4Z8AA 3VS2A 1QWEA 3TSZA 1K4US 2BTTA 1G2BA 1ABOA 2DL3A 4X1VA 4Z88A 1ZUKA 4F17A 4OMNA 4HCKA 1J3TA 1M3AA 1PRMC 2ECZA 4JJBA 2DBKA 1M8MA 5FW9A 1X69A 3GBQA 1ZSGA 2GTOA 4OMMA 1ZUYA 2FRWA 1UJYA 2AKLA 2DL5A 4JZ4A 1KJWA 2F2WA 4ZNXA 1PWTA 1X6BA 2O9VA 1AVZC 2OJ2A 3TVTA 4Y92A 3NGPA 1K0SA 1UGVA 2GNCA 4GLMA 1GFDA 2DLPA 2E5KA 2K3BA 1ZLMA 1NLOC 3NPFA 2NUZA 1YN8A 1KSWA 2NWMA 2VVKA 1N5ZA 2CUDA 1X43A 2EYWA 3M0RA 1U3OA 1UUEA 2H8HA 1UG1A 2CSQA 5FWCA 4JPBW 1EFNA 4HVUA 4RTWA 4J9IA 4J9GA 2J05A 2EQIA 1ABQA 1AWWA 2W10A 2JTEA 2DL7A 1V1CA 3CQTA 2DILA 1UFFA 2ENMA 2AKKA 1T3SA 2CT4A 2DA9A 3PVQA 2RQUA 4RTXA 3H0IA 1AD5A 2OI3A 4RTTA 4HVVA 4CC2A 1BBZA 2EKHA 5IHKA 1H92A 2D8JA 2JXBA 2HEQA 1JXOA 3PE0A 2DL4A 2SRCA 3THKA 2DMOA 2J06A 1UHFA 1X27A 1NYGA 2CDTA 1E6GA 1E7OA 2A36A 1K1ZA 2C0OA 2KRNA 4J9DA 1WDXA 2JT4A 1I0CA 2FEIA 4D8DA 3ZL7C 2M51A 3M0UA 1SHFA 2LX7A 2RQVA 1VYVA 1B3QA 1OPLA 4J9EA 1WYXA 2F2XA 1M30A 3SEMA 2V1RA 3EG3A 1TG0A 2ED0A 1PHTA 3H0HA 3NMZC 4HXJA 2W0ZA 4IIOA 4E6RA 5L23A 1X6GA 4A63B 1WIEA 2JMCA 4K11A 1NG2A 2JMAA 1QLYA 4JJCA 1H8KA 2K6DA 3QWYA 4HVWA 2CUBA 1YCSB 2EYYA 1WA7A 3RBBB 1LCKA 3I5RA 2O88A 2K9GA 5I11A 1OEBA 2KYMA 1JQQA 4JZ3A 1I1JA 4LNPA 2DM1A 1WLPB 2PTKA 2LJ3A 4J9CA 1AOJA 1AWXA 2J7IA 1HJDA 2K79A 2SEMA 1BK2A 5IH2A 5I22A 3KFVA 3VS3A 1BB9A 1ZUUA 4DEXA 2A28A 2KYBA 1PKSA 1T0HA 2AZVA 1S1NA 1MV3A 4F14A 2KRSA 2DVJA 3SHWA 1GFCA 3UA7A 4AFZC 2JM8A 3EG2A 1XOVA 3EHRA 1GBRA 2L3QA 2DYBA 1HD3A 4AFSC 1W6XA 3C0CA 2KBTA 4RUGA 1YWPA 1NEBA 3H41A 2YT6A 1SRMA 2GBQA 3VRZA 1X2QA 2V1QA 2LJ1A 4CC7A 2EW3A 2DE0X 4AFQC 2C0TA 2KEAA 2EBPA 4D8KA 3R6NA 2YUOA 1JXMA 1JU5C 1W1FA 3RNJA 2K7AA 3VS6A 2J6KA 2LMJA 3U23A 2I0NA 5IXFA 3VS0A 2GGRA 1OOTA 1Y57A 2BZYA 2ABLA 3UF4A 3EHQA 2FPEA 4OMOA 1PKTA 4JJDA 2DX1A 1RLPC 4LUDA 1SHGA 2BZ8A 2G6FX 2O31A 2DF6A 2ESWA 1U06A 2AZSA 2KXDA 2CH4W 2RNAA 2EYZA 4QT7A 2DRKA 2EPDA 2GTJA 5IXBA 5IHNA 1WFWA 1A0NB 4Z89A 2KT8A 5HCKA
chains in the Genus database with same CATH superfamily
2RHXA 2PZ1A 2K2VA 2K5IA 1Y0MA 2KE9A 4ZN3A 3QUIA 3OYAA 2AK5A 4PJLA 2MI6A 2FZGB 4CRIA 1QMCA 3UA6A 3G4SQ 2EGAA 4M7AG 5HK3A 1NE8A 5GMKm 2KQWA 4DBRA 2MYSA 3M55A 3NTKA 4QKUA 3J80E 3CCLA 5LL6S 1AZEA 2DERA 2MIOA 1MNDA 5DY9A 5KYUB 3HFNA 2XU8A 3CXCA 2QA4Q 3JB9G 4LDXA 2C06A 2QI2A 1KQ2A 1VQ6Q 4LE9A 1BYMA 1M1KU 1VQOQ 3CCEQ 1OYXA 3NHNA 3HRSA 3RUXA 3OA6A 3OBWA 1GCQC 4RTYA 2RN8A 1NJIC 5IT9E 4ZGJB 1VQOT 1OPKA 1YHQA 4L6V5 4F7UF 2RMOA 1K0XA 3UT1A 4M4ZA 5AYFA 2JN0A 1UGPB 2DKGA 3QYHB 4BY6C 3EG0A 1ZA1B 1TUCA 2L3SA 5GJWB 4FT2A 4FYWB 1UGSB 4KH0B 5IHIA 1M1FA 2CH4A 2RQTA 3O5ZA 3RR6A 2EVRA 3SWNC 4OMQA 1KG1A 2DEQA 2FZKB 1RUWA 1JJ2S 4OMLA 3JB9H 1K76A 4Y91A 2LT4A 4F7UG 3GOXA 2NYSA 4KRTA 2DIGA 1GCPA 3JCMd 2IIMA 3I35A 2O9SA 2KAFA 5HKCA 2M9UA 1W2BS 1OU8A 4J9BA 2K4YA 2KDSA 3G71Q 4M7DB 1Y07A 1Q95G 4J5YA 3CMAQ 1YJNQ 1M5Q1 1RAGB 2DNUA 5GAN5 3M53A 1JRIA 4BACA 1YJNT 3SFMA 2DEUA 3OYIA 4FCYA 4KT0E 1YP5A 2VXFA 2ED1A 4BDYA 5FU6C 2M16A 2JVVA 4E7IA 1U8RA 1VIEA 3EGXB 4MZMA 3X28B 3RERA 1AHJB 4VUBA 1EX4A 4AG1C 2HCKA 1I07A 4J9FA 5KCOA 1QVGP 1QW1A 2B86A 4RKUE 2VWFA 1SSHA 1QCFA 1RI9A 2RH2A 5LJ3j 3UWNA 2L0AA 3JCMg 1U1TA 2ROTA 5LJ5d 2E65A 1YJ9Q 3CC2Q 1KFZA 2ROLA 1QVFS 1D09B 3S3MA 1WHLA 2FG0A 1ACMB 1YJ9T 2D9TA 4J9HA 2JOYA 4EDUA 1VQ7A 2B8AA 4AG2C 1T3LA 3FJ5A 1M1GA 1ZA2B 2V8IA 1N8RU 3CC7Q 2VC8A 2QXFA 1YJNA 3I9QA 2EQMA 5C6SA 1K4US 5GAMf 3SDZA 3JCMV 1QVGA 2CGHA 1G2BA 3TQ7P 4X1VA 3QDFA 3CC7T 3CPWS 4A4KA 3RKWA 4F17A 4HKEA 2CP0A 4FSXA 1J3TA 1I81A 1PRMC 4HCCA 4JJBA 4XTXA 2K5FA 2WSEE 1N9SA 2DBKA 2NUPB 4QVCA 1ZSGA 5GAMe 2V8KA 3X26B 1Q82R 2AKLA 1X6BA 3HHTB 2FHDA 1AVZC 4Y92A 1D0ZA 3NGPA 1K0SA 1UGVA 2GNCA 3INZA 2RK2A 2COZA 1Q82U 4J8OA 4C92A 1YJ9A 2NUZA 2VVKA 3C94A 2CZ6B 4IKFA 2CSQA 5FWCA 4JPBW 3OW2P 5GANd 5CQYA 5GMKe 4XU1A 3SD4A 4OMFB 2HMAA 3MJXA 3CC7A 3EG9A 2RQUA 5IAYA 4ZGEB 1BBZA 1KC8U 4M77E 2J06A 1UHFA 1X27A 1RAFB 1NYGA 4BI8B 2CDTA 5L8RE 1E6GA 1E7OA 2A36A 5CKFA 1VIFA 1D0YA 2X9HA 4N0AA 3MHXA 3OYJA 3I55T 2E70A 1I0CA 4A53A 3ZL7C 2DD4A 2M51A 2X35A 4QQDA 2RB6A 3A8GB 1Q86U 2LX7A 2RQVA 4E7SA 2D0QB 4HCBA 2EWNA 1WYXA 1VQPA 2XDBA 1M2VB 2E64A 2EJ9A 3EG3A 1IREB 1I8FA 1PHTA 5GANg 1VQLQ 2O01E 2RI2A 4HXJA 2CZ7B 4FYVB 4M75B 1JB0E 4C5HA 1C0MA 4WTOB 1YI2T 1X6GA 3OYDA 2JMCA 2HSEB 2V8JA 4K11A 2JMAA 4JJCA 5KYYB 1YJWT 1G3SA 1S72A 2DYIA 2GCXA 3QWYA 4HVWA 1YCSB 2EYYA 1YIJT 2M1HA 2LRQA 4KUDK 1RL2A 3I5RA 5D6WA 2O4XA 3OS5A 5I11A 2KYMA 3NTHA 4M78A 1Q82C 2EJGA 2XICA 4M7AB 3A8MB 4J9CA 2PTKA 1X01A 1HJDA 2YRVA 1WPYA 2K79A 3D7SB 5IH2A 1R0CB 3KFVA 3RMQA 1ZUUA 2YLBA 1MNEA 4JLIA 1T0HA 4M77F 1S1NA 4FW2A 3I55A 4F14A 5IN1A 3ER0A 3FIFA 3RMSA 1IZ6A 3EG2A 3EHRA 3OS0A 2DYBA 1NBEB 4OB1B 3C0CA 1JJ2P 3H41A 1SKUB 1VOMA 3VRZA 3DLLA 1D1AA 2EW3A 2DE0X 3PT9A 4PKCC 2EKOA 3CCQA 3CPFA 3TREA 1JU5C 2K7AA 3VS6A 2V26A 1YI2A 2E5QA 1W2BP 1YJWA 3CBOA 3V8JA 4M77G 2PU9B 2VYTA 4WF2A 1GXIE 3S6WA 1YIJA 3V8LA 1PC0A 4C0GA 3UF4A 3CBMA 2PUKB 3EHQA 2LDMA 1Q86C 5DM7R 1K9MR 2YLCA 2FPEA 4JJDA 5FU7C 2IG0A 2DX1A 2EAYA 3VUBA 2QQBA 2XIDA 1Q7YR 2DF6A 2ESWA 9ATCB 1U06A 2RNAA 2LVMA 4QT7A 4C8QC 3E9GA 1R0BG 4C8QD 4E2FB 2YHTA 5IHNA 4C92G 1A0NB 4Z89A 2XK0A 3M0PA 4JRQA 2J6OA 5EG2A 5LJ3d 1BI0A 2EJFA 2Z0WA 5GAMj 1Z9QA 1W2BA 2VXEA 3OY9A 7AT1B 2XDDA 3KUFA 2BUDA 2QQRA 2JTFA 1TSFA 1RACB 2CZ0B 3JV3A 1PRLC 1QVFP 3MEAA 2LQWA 3EG1A 2OAWA 3LLRA 2VGNA 2DIQA 4OF1A 2LTOA 1M9SA 4MDWA 4PJOA 1YBYA 2GQIA 2I2LA 3FEOA 2MAMA 4QQGA 1GRIA 1NM7A 2HD0A 3M0QA 1KQSS 2K3XA 3QHSA 4QQ6A 2YUNA 2ZAEA 3MO8A 2JM9A 1JO8A 1VYUA 2J6FA 3X20B 2RQWA 4BD3A 5GMKj 3REBB 4BY6B 1PCXA 2X3WD 4M75C 1WHKA 4M75D 2D1XA 2DL8A 4EIKA 5GAOq 1XNIA 4AFUC 3P8BB 1N27A 3CPWP 1ZX6A 4XTVA 1AEYA 2RQRA 4KGVB 3SWNB 3JSCA 4RCBA 4XU3A 4L5GA 5KE3A 2QG9B 2LP5A 4ORZA 1QVFA 4J6WA 4NS5A 2KGTA 4JS5A 2YXYA 3PIOA 4M7AC 4M7AD 1CKAA 3OSVA 4NL2A 2OX7A 2AIRB 3VKIA 4R55A 4E7KA 3VRYA 1YNZA 2DD5A 3LYIA 3OSSC 5AT1B 4DEYA 3T9NA 3CC4T 2RF0A 4MMLA 2RHYA 1M90R 2AHJB 3EFRA 1AWJA 4PJOE 3QO3A 1GCQA 3CCMT 2M02A 3CCUT 3M0SA 1Q7YC 1OI1A 3EH2A 4IIMA 2FPFA 4TVRA 1YHQQ 3N5BB 5FU6B 1GL5A 2LCSA 3PTAA 3JCMQ 1BIAA 1WXBA 1YHQT 2X4WA 3WVEB 1HSQA 2H3EB 4PLIA 3H0FA 1VQKQ 4ELZC 4LXCA 3CCST 2E3HA 3JB9F 1Z9ZA 3DKMA 2EQJA 4QVZA 1VQKT 1W70A 2FRYA 4A4EA 2GFUA 1RLQC 3RKYA 3RIRA 2COYA 3QWXX 2HAXA 4MDXA 1QCOA 1MMNA 2HSPA 2RJEA 5CAIA 1O75A 5GMKi 2LCLA 1R77A 1AWOA 3GIBA 2JS0A 2CKKA 1YWOA 1KIKA 3CC4A 2VGMA 2XI9A 2QEXT 4KULA 3P8DA 2HL3A 1YITQ 3A98A 1H641 3JAME 1SRLA 1WI7A 1OZ3A 1PNJA 1SSFA 4ELYC 5GJVB 3CCMA 1CSKA 3CCUA 1YITT 1M27C 1MV0B 2HQHA 2PVGB 1QKXA 1YCYA 2A37A 5FWBA 2NUTA 2FVUA 1M3CA 1BU1A 4WCIA 3HSBA 2EYQA 3TSZA 3CCSA 1ABOA 4Z88A 1Y96A 4EMKC 5I21A 1N9RA 2L5QA 1ZUKA 1TXQA 5GAN7 1VQKA 2HNIA 1BI2A 3OB9A 2RD1A 4HCKA 4LDYA 2CYZB 1HXDA 4A4FA 4PJOG 4IUTA 5FW9A 2MWOA 5CKBA 1C6VX 2GTOA 4OMMA 1ZUYA 2FRWA 4A54A 3V8KA 2DL5A 2XHCA 1PWTA 3LW5E 2E1HA 3EFOB 1Y71A 2OJ2A 4IUUA 1B34B 3TVTA 1VQ7Q 1M2OA 2QEXA 2DLPA 2E5KA 2RJDA 5KYUA 1ZLMA 1NLOC 2DTOA 3NPFA 3JCMX 1YN8A 1VQ7T 1YITA 2CUDA 1X43A 2LX9A 2EYWA 3M0RA 3OYFA 1UUEA 2H8HA 1UG1A 3MP1A 2RJFA 5CVIA 1WZOA 4HVUA 3M58A 4J9IA 2HKQB 1V76A 1TOVA 1V1CA 4IURA 3CQTA 3G1JA 1UFFA 3QSUA 2AKKA 2MWPA 2DA9A 2ZPBB 1AD5A 2GQVA 1KD1R 1LPLA 5GAMh 2VB6A 1JXOA 2DL4A 3THKA 4Y28E 3MCAB 3I56Q 3RDVA 1K1ZA 2IPOB 4IUQA 1WHMA 1R8OB 1KD1U 3I56T 4D8DA 4XTWA 3OYNA 4M77B 1M4ZA 1D1BA 2YRDA 1VYVA 1B34A 2Y4YA 3MEWA 3JCMf 2F2XA 3E2UA 1M30A 3GNGA 5KYXB 4E7HA 3O8VA 4II1A 1AT1B 3OYEA 4HT9A 2DAQA 5GMKh 4M7DA 4IIOA 1OQKA 4A63B 1WIEA 1KQSP 2HL5C 2K6DA 3JCMe 5DLOA 3PMTA 5A0GA 2QQAA 2IVWA 2QTXA 2O88A 2K9GA 1P92A 1FXXA 5M9OA 4LNPA 1WLPB 1VQNT 2LJ3A 4BUGA 2J7IA 3EGXA 1RAAB 3VS3A 2XG8D 3OYBA 2A28A 1PKSA 5LJ5g 3I56A 3SHWA 1GFCA 5D6YA 1DJ7B 1XOVA 1VQPQ 4OP0A 1W6XA 2K3YA 5LJ5f 3CCRT 1YWPA 2BE7D 2DXTA 3EFSA 2RJCA 1VQPT 1SRMA 1IXDA 2GBQA 1D3BB 3JCMb 4GLKA 3QZ5B 4AFQC 5KYXA 2C0TA 2WSFE 2KEAA 3H9NA 1S72Q 4E47A 4IUPA 4XTZA 4M7DE 1QP2A 2YUOA 5FU7B 1TTHB 1RAIB 2J6KA 2LMJA 3BE3A 1S72T 3U23A 5LJ5e 1QQJA 1KD1C 2DETA 3M59A 3CD6T 1OOTA 2BZYA 4C8QB 1VQ8A 3JCMW 3HP9A 1LNXA 4OMOA 5GANh 2COWA 3M4GA 1SHGA 4HCZA 2G6FX 1VQNA 2OTLA 2O31A 3NTIA 3PFSA 1XTDA 2MPXC 3OMGA 3TEEA 2CH4W 3I55Q 2L3RA 2QTVA 3PGGA 1LJOA 4A4HA 2EPDA 2NUPA 1WFWA 4BI3A 1MGQA 3QZ9B 1KQ1A 1OZ2A 3M0TA 4OMPA 1QWFA 2PQWA 3I5SA 3G6ET 2BZXA 3ULRB 1RADB 2R57A 3OW2A 3VS1A 3L2RA 5CIUA 1FX7A 2LJ0A 3FJPA 1ARKA 4XAXB 4L59A 4Z02A 3CCQQ 2D0NA 3CCRA 5J3BA 2QASA 2KY9A 4C92E 2ZGWA 5KYWB 1TH7A 3BW1A 1YI2Q 3CCQT 1MMDA 2QYZA 1YJWQ 1BI1A 3CCVQ 4M77C 1EZZB 1K9AA 1WXTA 5KE2A 4M77D 1KK7A 1VQ9A 4J7IA 3LWIA 1YIJQ 1NZ9A 2P0QA 2XD0A 5GAOn 1F1BB 5GANf 2L2PA 3CCVT 1QVPA 1SF9A 4M7DF 2DTHA 2EGCA 3OYGA 1I5OB 3CD6A 1WJQA 3C12A 1VQ5T 1EIFA 2HBWA 4C8QA 3VS4A 1MUZA 2Y4XA 1UDLA 2RI5A 1FMWA 1Q81R 2DK3A 2AT1B 2DJQA 3HRUA 5GANe 4GBQA 1FMVA 2E4HA 3FRNA 2G3RA 4DOVA 3TCJA 1IRXA 3E9FA 2DZ9A 2E3IA 1O9SA 2LZ6B 1NEGA 2DXUA 1ZSZC 3G6EA 3SB2A 1BCMA 4M7DG 1OV3A 1I5LA 1KHCA 1BI3A 1K73R 2RPNA 3C95A 5A2QE 3PMIA 1H3ZA 3BFMA 1G83A 4AT1B 1M2VA 2QGFB 2LNVA 3LX7A 5A0DA 1HYOA 1RI0A 4CC3A 4C92F 4LD9K 2KT1A 4QW2A 4LUEA 4M75A 1SEMA 2CT3A 4RTVA 3CCVA 4CC4B 5KYYA 2HKNA 2M0YA 2RHUA 4OGCA 2CS7A 4C0DC 2K2MA 4FL6A 2RM4A 2KXCA 4KBMB 1VQ5A 1UTIA 4RG2A 1GBQA 4F16A 3GLXA 4M78E 4ESRA 5ECAA 4M7AA 2L8DA 1JJ2A 2KRMA 4N4GA 1K9MU 4F7UB 3M56A 2CP6A 5FRNA 4HA8A 4RMOA 1B07A 8ATCB 2KNBB 1PD1A 2MMPA 2KK4A 1Q7YU 2X4JA 3WXMB 2L3PA 2ZCFB 2HQXA 2EIFA 1SG5A 3VJPA 2PNIA 4FW1A 4CI0C 2LQNA 3CMEA 3QG1A 2QDLA 3IQLA 1Y7XA 1FYNA 4LDUA 2O2OA 3A8LB 3VYHB 4C0ZA 2F69A 3OS2A 2WSCE 5GAN2 3EH1A 4M75E 4DBHA 3PIPA 2DZCA 1Q81C 1SPKA 4LN2A 4J6XA 1UE9A 3RKXA 3EAEA 5LJ5j 2F2VA 4EMKB 4DA4A 1OX8A 4QVDA 1UHCA 3L2UA 4BB7A 1JEGA 4Z8AA 1XJWB 3VS2A 4M78F 3UPUA 2BTTA 5LJ3g 5I2MA 1TS9A 3OYKA 3A1PA 4HT8A 2FZCB 1G3YA 3GP8A 3FC3A 4OMNA 5GAOr 5LJ3f 2KVQG 1M3AA 1ZQ1A 1WJRA 2ECZA 5CKHA 4DOWA 3GBQA 1D0XA 3CC4Q 4JZ4A 4B6MA 1KJWA 3WVDB 1UB4A 2E41A 4ZNXA 3QPHA 4XU2A 3JB9D 2QAZA 2O9VA 3C4SA 3CEYA 1UGQB 5GMKl 3CCMQ 5LJ3e 3CCUQ 1K9MC 3H8ZA 4M78G 8AT1B 4GLMA 1GFDA 3CPWA 4ZTJA 3Q1JA 1KSWA 5GAN6 5CCAA 1N5ZA 4X9DA 4LD6A 4OB2B 1M90U 4N4IA 1U3OA 5GAOl 1WHGA 2F1LA 3CCSQ 4RTWA 2DXCA 4J9GA 2J05A 3KBGA 2EQIA 1BIBA 1ABQA 1AWWA 4MZTA 2W10A 2DILA 1VQ4A 2EQKA 3PNWC 3SWNA 1T3SA 3X24B 5GANj 3PVQA 3H0IA 3CCJA 4RCCA 4CC2A 5C0MA 4NL3A 5IHKA 3LWHA 1H92A 2JXBA 2DVEA 2SRCA 3PE0A 2DMOA 4M75G 3M5AA 3RESA 5CR2A 4PJNA 1V29B 3M57A 4J9DA 1WDXA 1PSEA 1FWZA 2FEIA 2QEXQ 2RA2A 1QP3A 4AMCA 2BE9B 3EGDB 1SHFA 1B3QA 1MMGA 1OPLA 3JCMP 2E10A 4DBFA 2OAUA 1PG5B 4DQ2A 5J39A 1TG0A 2ED0A 4ZTFA 3A8OB 4PJOF 3G4ST 3H0HA 2W0ZA 4E6RA 4Q5WA 1M1KR 3QXEB 2RHZA 2DPPB 5DLQE 4A4GA 3R6OA 2CP3A 3QDRB 1WA7A 4J83A 3AT1B 3RBBB 5GAOm 1LCKA 2QA4T 5FRMA 1OEBA 2DO3A 1JQQA 4JZ3A 3META 1VQ6T 3QJ6A 4JS4A 2P0KA 1AOJA 4JUVA 1AWXA 3L42A 3CCET 3UDCA 2QDYB 1W4SA 3FDRA 4F04B 1M90C 5I22A 4DEXA 3OBYA 3ME9A 1WHHA 2KYBA 5CK9A 2DFUA 2ZPGB 2KRSA 4AFZC 2JM8A 3ZFJA 2MF2A 2K5LA 1GBRA 5GAN8 3QIIA 4AFSC 3MPUB 1WGSA 3E19A 3F70A 3EGDA 4RUGA 2ZZDA 3L2WA 2YT6A 2ATCB 3AHUA 2VUBA 2V1QA 3DB3A 1TWBA 1LOJA 2EBPA 4D8KA 3NFCA 3G4SA 3R6NA 4ME7A 3JCMh 3BDUA 1WJSA 2MK5A 1OU9A 2HQEA 2E12A 2DJZA 4FYXB 2GGRA 4ANJA 4E7ZA 3L2QA 2QA4A 3J81E 4BE0A 1PKTA 3V7CA 1RAHB 3LGFA 4LUDA 1VQ6A 1PM3A 2BZ8A 1G3WA 2PVDB 3G71T 2H3JA 4JRKA 5HK0A 1VQOA 4FU6A 3CCEA 3DB4A 2EQUA 3CMAT 5GAMd 1PSFA 2DRKA 1MMAA 2DTIA 2XDPA 5IXBA 4PJJA 1G5VA 2KT8A 2JUFA 3L2ZA 4OGEA 5HCKA 3QJYA 1IB8A 1IHWA 3JB9I 2KR3A 3HFOA 1M3BA 5HY6A 4C0FA 3EFOA 3P8HA 4R0KA 4BE2A 3M9QA 1C1AA 1M1KC 4J6YA 4MMKA 4XTUA 3VYGA 2HZYA 2D8HA 2KROA 1X2KA 3BY7A 4C5IA 1RAEB 3LH0A 1HK9A 5LJ5h 4R56A 4KGXB 1X75C 4ZN1A 4PL6A 1VQ8Q 4P5NA 4C92B 5CO7A 3OYMA 3X25B 2DBMA 1PD0A 1T0JA 3CC2T 2CREA 1WX6A 5KCHA 2YUQA 3VS5A 1QCNA 1N8RR 1VQ8T 2EGEA 4FIBA 1UECA 2C0IA 1VQNQ 2OTLQ 2YDLA 3MP6A 3JCMc 4E7LA 1ZSZB 3JB9J 5GAMg 3G71A 2OTLT 2X4XA 4FSSA 3HKSA 2QGGA 2OTJQ 2X3XD 3CMAA 2VKNA 4PLLA 3MEUA 1TUDA 2FL7A 4PNOA 3EGUA 4EPCA 5EC7A 5D6XA 4LDVA 2CP5A 3EG9B 2WACA 2OTJT 3QYGB 2FB7A 3H6ZA 3V7RA 1NYFA 3CCRQ 1CKBA 3G7ZA 4N4HA 2LNHB 1UJ0A 4JRPA 2L89A 1KQSA 4M77A 4D6WA 2MCNA 3S3OA 2D6FA 3TSWA 3LGLA 2YUPA 1I4K1 4X9CA 1D1CA 4XQ3A 1VQ9Q 1WXUA 4C0DB 1AZGB 2HDAA 1QKWA 2A08A 2F5TX 1FMKA 4V2SA 2LCCA 3VV0A 4NOYA 1VQ9T 1IO6A 1VA7A 1VUBA 2YSQA 1U5SA 3CD6Q 3CBPA 3J7AF 1TUGB 3CC2A 1NLPC 1IGUA 2K57A 1E6HA 1UGRB 4KGZB 5I2SA 3HL8A 3UATA 4O5VA 4XU0A 1B7TA 2EYXA 3MP8A 1ZSZA 3HRTA 4EMHA 2CSIA 2P84A 4IUVA 2FPDA 3G6EQ 1KC8R 2O4XB 4M7DC 3CXCS 4JRIA 2LQKA 4M7DD 4M78B 2OTJA 3LH5A 3OYCA 2QQSA 2X4YA 3HPWA 4OB0B 1LVKA 2XMFA 2JNGA 3OQ5A 1ZBJA 1UEBA 3L2VA 1Q86R 2MOXA 3L1AA 1D3BA 3DLMA 2F5KA 2LT1A 2JS2A 1N8RC 3REAB 1ZHIA 5A0LA 2E6NA 2JW4A 1IGQA 4RTZA 3VS7A 2CP2A 2A0FB 1VQ5Q 2RK1A 3ZBDA 4RTUA 3M4YA 2FO0A 3FLGA 2P4RA 1G8XA 3PVLA 2KI7A 2GF7A 2DRMA 3VU3C 2RO0A 4C92C 5KH6A 1VQLT 1K8AR 4C92D 1IHVA 4C5EA 4GY5A 4MZPA 3A8HB 1VYTA 1H3HA 1QWEA 1NPPA 1VQMQ 2DL3A 1Q81U 1K8AU 4PJMA 2FYKA 4FM4B 1VQMT 4BDZA 3URGA 2RI3A 4LDWA 3CMEQ 1TU0B 4BE1A 5GAOp 1M8MA 1BKBA 1X69A 3V7SA 3CMET 4OB3B 1UJYA 4J7FA 5KYWA 2F2WA 1K73U 2ZPEB 1N6AA 3BDLA 4N0AC 1WQWA 1WHJA 2K3BA 2NWMA 3OYLA 2A7YA 2DXBA 1ZBXA 2JJ9A 4C8QE 3S3NA 1KC8C 2E6ZA 5D7UA 1EFNA 1KHIA 4PJOB 3M54A 3QBYA 2PVOB 1VQLA 2M0OA 1MHNA 3OS1A 3JCMJ 2BIVA 2CZ1B 2JTEA 2DL7A 1OULA 2JZ2A 3TU4K 2ENMA 4PK4A 2CT4A 2KMTA 4RTXA 4ATOA 3OYHA 2OI3A 4RTTA 4HVVA 2VASA 4B9XA 2BKDN 1VQMA 2EKHA 1OX9A 2D8JA 2HEQA 4PFPA 2ZPHB 4E7JA 4JJNK 2C0OA 2KRNA 2JT4A 2VV5A 4M78C 5LJ3h 4M78D 4ZGDB 5FLXE 1QVGS 1YFNA 4OVAA 2YWWA 4XK8E 3M0UA 5KYNA 5CKEA 4FT4A 1JBMA 4KUIA 4J9EA 2PUOB 4JDSA 4KH1B 3SEMA 1K8AC 2V1RA 3OYYA 1NPRA 2EFIA 3OMCA 3NMZC 2XKOC 5L23A 1BCOA 2R58A 1NG2A 1QLYA 1X6OA 1VQ4Q 1H8KA 4M7AE 4C8QF 2NLUA 2CUBA 3GNFB 4C5GA 2LC4A 4X34A 5GAN3 3CCJQ 1RABB 6AT1B 1VQ4T 1U1SA 4F7UA 2HBPA 1K73C 3CCJT 2CP7A 2Y90A 1I1JA 3VUZA 2DM1A 2LQ8A 2QQ9A 4YTLA 4JLGA 3GPLA 2SEMA 1BK2A 5FROA 1BB9A 3GF5A 5GAN4 2ZPFB 2AZVA 1MV3A 1NJIR 2DVJA 3MKDA 4UC4A 3UA7A 4C8QG 5CQXA 2P4TA 2L3QA 1HD3A 2KBTA 1NEBA 3ASKA 1NJIU 1M8VA 1X2QA 3CCLQ 2LJ1A 4CC7A 4O6JA 4PFOA 4M75F 2GFAA 4BI4A 4DBQA 2P0PA 3CCLT 5J26A 1JXMA 3E1SA 4EMKA 1W1FA 3RNJA 3A5ZB 2RHIA 2I0NA 2R5MA 3OW2S 5IXFA 5CKDA 3VS0A 3MEVA 2A3LA 1Y57A 4EMGA 2ABLA 2YRCA 2ZPIB 3KXTA 3ZEHA 4F7UE 4FYYB 4PFZA 4M7AF 4RG8A 1G3TA 4PJOC 2QK0A 1RLPC 2NUTB 4PJOD 1WNLA 3JRZA 2JTMA 3CXCP 3FB9A 2AZSA 4XTYA 2KXDA 2EYZA 3HTRA 2GTJA 1XQHA 2KSSA 1Y96B 2X51A 4B9WA 1WQ7A 3QKJA 2R5AA
chains in the Genus database with same CATH topology
3M0PA 2PZ1A 2J6OA 3M0TA 4OMPA 1QWFA 3I5SA 2BZXA 1Y0MA 2KR3A 3ULRB 2KE9A 1M3BA 3VS1A 1Z9QA 2AK5A 2LJ0A 4R0KA 1ARKA 2D0NA 3UA6A 2EGAA 2D8HA 2KROA 3JV3A 1PRLC 1X2KA 2LQWA 3EG1A 2OAWA 1K9AA 1WXTA 1AZEA 2MIOA 2GQIA 2L2PA 2DBMA 1T0JA 2CREA 1WX6A 1GRIA 1NM7A 2EGCA 3M0QA 2YUQA 3VS5A 4LE9A 2YUNA 2EGEA 2HBWA 2JM9A 1JO8A 1UECA 1VYUA 2C0IA 2J6FA 2RQWA 2YDLA 3REBB 3NHNA 2X3WD 3VS4A 1MUZA 1UDLA 2D1XA 1GCQC 2DL8A 2RN8A 4RTYA 4EIKA 1OPKA 4FSSA 4AFUC 2DJQA 2RMOA 1K0XA 4GBQA 2X3XD 4M4ZA 1ZX6A 1AEYA 2VKNA 2RQRA 1TUDA 3EGUA 5EC7A 3EG0A 2LP5A 4ORZA 1TUCA 2L3SA 5GJWB 2KGTA 2LZ6B 1NEGA 1NYFA 1CKBA 5IHIA 2LNHB 2CH4A 1UJ0A 2RQTA 1OV3A 1CKAA 3O5ZA 2MCNA 2EVRA 3TSWA 2YUPA 2RPNA 4OMQA 1WXUA 1G83A 1AZGB 1RUWA 4OMLA 2HDAA 1K76A 1QKWA 3VRYA 2A08A 1YNZA 1FMKA 4CC3A 4DEYA 1IO6A 2KT1A 4KRTA 2RF0A 1VA7A 4LUEA 1GCPA 2YSQA 1U5SA 2IIMA 1AWJA 1SEMA 3I35A 2CT3A 4RTVA 1GCQA 4CC4B 2M0YA 2O9SA 3M0SA 2K2MA 4J9BA 1NLPC 4IIMA 2KXCA 2FPFA 1E6HA 1UTIA 1GL5A 2LCSA 1GBQA 3UATA 4F16A 1WXBA 2DNUA 4ESRA 2EYXA 5ECAA 1HSQA 2CSIA 2FPDA 3H0FA 2KRMA 1YP5A 2ED1A 1Z9ZA 1B07A 2KNBB 3LH5A 1W70A 2FRYA 1RLQC 2L3PA 2XMFA 3QWXX 2HSPA 4AG1C 2HCKA 1I07A 1ZBJA 4J9FA 2PNIA 2MOXA 2B86A 2VWFA 1SSHA 1QCFA 1RI9A 2LQNA 2QDLA 3IQLA 1AWOA 1FYNA 2O2OA 2JS2A 2L0AA 2JS0A 3REAB 2ROTA 1YWOA 1KIKA 1KFZA 2ROLA 2JW4A 4RTZA 3VS7A 3A98A 1SRLA 1WI7A 1PNJA 2FG0A 4RTUA 2FO0A 5GJVB 1SPKA 4J9HA 1CSKA 4LN2A 2P4RA 1M27C 1MV0B 1UE9A 3PVLA 2F2VA 4AG2C 1T3LA 3FJ5A 1QKXA 2A37A 2DRMA 5FWBA 1UHCA 1M3CA 1BU1A 4WCIA 1VYTA 1JEGA 1H3HA 3I9QA 4Z8AA 3VS2A 1QWEA 3TSZA 1K4US 2BTTA 1G2BA 1ABOA 2DL3A 4X1VA 4Z88A 1ZUKA 4F17A 4OMNA 4HCKA 1J3TA 1M3AA 1PRMC 2ECZA 4JJBA 2DBKA 1M8MA 5FW9A 1X69A 3GBQA 1ZSGA 2GTOA 4OMMA 1ZUYA 2FRWA 1UJYA 2AKLA 2DL5A 4JZ4A 1KJWA 2F2WA 4ZNXA 1PWTA 1X6BA 2O9VA 1AVZC 2OJ2A 3TVTA 4Y92A 3NGPA 1K0SA 1UGVA 2GNCA 4GLMA 1GFDA 2DLPA 2E5KA 2K3BA 1ZLMA 1NLOC 3NPFA 2NUZA 1YN8A 1KSWA 2NWMA 2VVKA 1N5ZA 2CUDA 1X43A 2EYWA 3M0RA 1U3OA 1UUEA 2H8HA 1UG1A 2CSQA 5FWCA 4JPBW 1EFNA 4HVUA 4RTWA 4J9IA 4J9GA 2J05A 2EQIA 1ABQA 1AWWA 2W10A 2JTEA 2DL7A 1V1CA 3CQTA 2DILA 1UFFA 2ENMA 2AKKA 1T3SA 2CT4A 2DA9A 3PVQA 2RQUA 4RTXA 3H0IA 1AD5A 2OI3A 4RTTA 4HVVA 4CC2A 1BBZA 2EKHA 5IHKA 1H92A 2D8JA 2JXBA 2HEQA 1JXOA 3PE0A 2DL4A 2SRCA 3THKA 2DMOA 2J06A 1UHFA 1X27A 1NYGA 2CDTA 1E6GA 1E7OA 2A36A 1K1ZA 2C0OA 2KRNA 4J9DA 1WDXA 2JT4A 1I0CA 2FEIA 4D8DA 3ZL7C 2M51A 3M0UA 1SHFA 2LX7A 2RQVA 1VYVA 1B3QA 1OPLA 4J9EA 1WYXA 2F2XA 1M30A 3SEMA 2V1RA 3EG3A 1TG0A 2ED0A 1PHTA 3H0HA 3NMZC 4HXJA 2W0ZA 4IIOA 4E6RA 5L23A 1X6GA 4A63B 1WIEA 2JMCA 4K11A 1NG2A 2JMAA 1QLYA 4JJCA 1H8KA 2K6DA 3QWYA 4HVWA 2CUBA 1YCSB 2EYYA 1WA7A 3RBBB 1LCKA 3I5RA 2O88A 2K9GA 5I11A 1OEBA 2KYMA 1JQQA 4JZ3A 1I1JA 4LNPA 2DM1A 1WLPB 2PTKA 2LJ3A 4J9CA 1AOJA 1AWXA 2J7IA 1HJDA 2K79A 2SEMA 1BK2A 5IH2A 5I22A 3KFVA 3VS3A 1BB9A 1ZUUA 4DEXA 2A28A 2KYBA 1PKSA 1T0HA 2AZVA 1S1NA 1MV3A 4F14A 2KRSA 2DVJA 3SHWA 1GFCA 3UA7A 4AFZC 2JM8A 3EG2A 1XOVA 3EHRA 1GBRA 2L3QA 2DYBA 1HD3A 4AFSC 1W6XA 3C0CA 2KBTA 4RUGA 1YWPA 1NEBA 3H41A 2YT6A 1SRMA 2GBQA 3VRZA 1X2QA 2V1QA 2LJ1A 4CC7A 2EW3A 2DE0X 4AFQC 2C0TA 2KEAA 2EBPA 4D8KA 3R6NA 2YUOA 1JXMA 1JU5C 1W1FA 3RNJA 2K7AA 3VS6A 2J6KA 2LMJA 3U23A 2I0NA 5IXFA 3VS0A 2GGRA 1OOTA 1Y57A 2BZYA 2ABLA 3UF4A 3EHQA 2FPEA 4OMOA 1PKTA 4JJDA 2DX1A 1RLPC 4LUDA 1SHGA 2BZ8A 2G6FX 2O31A 2DF6A 2ESWA 1U06A 2AZSA 2KXDA 2CH4W 2RNAA 2EYZA 4QT7A 2DRKA 2EPDA 2GTJA 5IXBA 5IHNA 1WFWA 1A0NB 4Z89A 2KT8A 5HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0P A;  2PZ1 A;  2J6O A;  3M0T A;  4OMP A;  1QWF A;  3I5S A;  2BZX A;  1Y0M A;  2KR3 A;  3ULR B;  2KE9 A;  1M3B A;  3VS1 A;  1Z9Q A;  2AK5 A;  2LJ0 A;  4R0K A;  1ARK A;  2D0N A;  3UA6 A;  2EGA A;  2D8H A;  2KRO A;  3JV3 A;  1PRL C;  1X2K A;  2LQW A;  3EG1 A;  2OAW A;  1K9A A;  1WXT A;  1AZE A;  2MIO A;  2GQI A;  2L2P A;  2DBM A;  1T0J A;  2CRE A;  1WX6 A;  1GRI A;  1NM7 A;  2EGC A;  3M0Q A;  2YUQ A;  3VS5 A;  4LE9 A;  2YUN A;  2EGE A;  2HBW A;  2JM9 A;  1JO8 A;  1UEC A;  1VYU A;  2C0I A;  2J6F A;  2RQW A;  2YDL A;  3REB B;  3NHN A;  2X3W D;  3VS4 A;  1MUZ A;  1UDL A;  2D1X A;  1GCQ C;  2DL8 A;  2RN8 A;  4RTY A;  4EIK A;  1OPK A;  4FSS A;  4AFU C;  2DJQ A;  2RMO A;  1K0X A;  4GBQ A;  2X3X D;  4M4Z A;  1ZX6 A;  1AEY A;  2VKN A;  2RQR A;  1TUD A;  3EGU A;  5EC7 A;  3EG0 A;  2LP5 A;  4ORZ A;  1TUC A;  2L3S A;  5GJW B;  2KGT A;  2LZ6 B;  1NEG A;  1NYF A;  1CKB A;  5IHI A;  2LNH B;  2CH4 A;  1UJ0 A;  2RQT A;  1OV3 A;  1CKA A;  3O5Z A;  2MCN A;  2EVR A;  3TSW A;  2YUP A;  2RPN A;  4OMQ A;  1WXU A;  1G83 A;  1AZG B;  1RUW A;  4OML A;  2HDA A;  1K76 A;  1QKW A;  3VRY A;  2A08 A;  1YNZ A;  1FMK A;  4CC3 A;  4DEY A;  1IO6 A;  2KT1 A;  4KRT A;  2RF0 A;  1VA7 A;  4LUE A;  1GCP A;  2YSQ A;  1U5S A;  2IIM A;  1AWJ A;  1SEM A;  3I35 A;  2CT3 A;  4RTV A;  1GCQ A;  4CC4 B;  2M0Y A;  2O9S A;  3M0S A;  2K2M A;  4J9B A;  1NLP C;  4IIM A;  2KXC A;  2FPF A;  1E6H A;  1UTI A;  1GL5 A;  2LCS A;  1GBQ A;  3UAT A;  4F16 A;  1WXB A;  2DNU A;  4ESR A;  2EYX A;  5ECA A;  1HSQ A;  2CSI A;  2FPD A;  3H0F A;  2KRM A;  1YP5 A;  2ED1 A;  1Z9Z A;  1B07 A;  2KNB B;  3LH5 A;  1W70 A;  2FRY A;  1RLQ C;  2L3P A;  2XMF A;  3QWX X;  2HSP A;  4AG1 C;  2HCK A;  1I07 A;  1ZBJ A;  4J9F A;  2PNI A;  2MOX A;  2B86 A;  2VWF A;  1SSH A;  1QCF A;  1RI9 A;  2LQN A;  2QDL A;  3IQL A;  1AWO A;  1FYN A;  2O2O A;  2JS2 A;  2L0A A;  2JS0 A;  3REA B;  2ROT A;  1YWO A;  1KIK A;  1KFZ A;  2ROL A;  2JW4 A;  4RTZ A;  3VS7 A;  3A98 A;  1SRL A;  1WI7 A;  1PNJ A;  2FG0 A;  4RTU A;  2FO0 A;  5GJV B;  1SPK A;  4J9H A;  1CSK A;  4LN2 A;  2P4R A;  1M27 C;  1MV0 B;  1UE9 A;  3PVL A;  2F2V A;  4AG2 C;  1T3L A;  3FJ5 A;  1QKX A;  2A37 A;  2DRM A;  5FWB A;  1UHC A;  1M3C A;  1BU1 A;  4WCI A;  1VYT A;  1JEG A;  1H3H A;  3I9Q A;  4Z8A A;  3VS2 A;  1QWE A;  3TSZ A;  1K4U S;  2BTT A;  1G2B A;  1ABO A;  2DL3 A;  4X1V A;  4Z88 A;  1ZUK A;  4F17 A;  4OMN A;  4HCK A;  1J3T A;  1M3A A;  1PRM C;  2ECZ A;  4JJB A;  2DBK A;  1M8M A;  5FW9 A;  1X69 A;  3GBQ A;  1ZSG A;  2GTO A;  4OMM A;  1ZUY A;  2FRW A;  1UJY A;  2AKL A;  2DL5 A;  4JZ4 A;  1KJW A;  2F2W A;  4ZNX A;  1PWT A;  1X6B A;  2O9V A;  1AVZ C;  2OJ2 A;  3TVT A;  4Y92 A;  3NGP A;  1K0S A;  1UGV A;  2GNC A;  4GLM A;  1GFD A;  2DLP A;  2E5K A;  2K3B A;  1ZLM A;  1NLO C;  3NPF A;  2NUZ A;  1YN8 A;  1KSW A;  2NWM A;  2VVK A;  1N5Z A;  2CUD A;  1X43 A;  2EYW A;  3M0R A;  1U3O A;  1UUE A;  2H8H A;  1UG1 A;  2CSQ A;  5FWC A;  4JPB W;  1EFN A;  4HVU A;  4RTW A;  4J9I A;  4J9G A;  2J05 A;  2EQI A;  1ABQ A;  1AWW A;  2W10 A;  2JTE A;  2DL7 A;  1V1C A;  3CQT A;  2DIL A;  1UFF A;  2ENM A;  2AKK A;  1T3S A;  2CT4 A;  2DA9 A;  3PVQ A;  2RQU A;  4RTX A;  3H0I A;  1AD5 A;  2OI3 A;  4RTT A;  4HVV A;  4CC2 A;  1BBZ A;  2EKH A;  5IHK A;  1H92 A;  2D8J A;  2JXB A;  2HEQ A;  1JXO A;  3PE0 A;  2DL4 A;  2SRC A;  3THK A;  2DMO A;  2J06 A;  1UHF A;  1X27 A;  1NYG A;  2CDT A;  1E6G A;  1E7O A;  2A36 A;  1K1Z A;  2C0O A;  2KRN A;  4J9D A;  1WDX A;  2JT4 A;  1I0C A;  2FEI A;  4D8D A;  3ZL7 C;  2M51 A;  3M0U A;  1SHF A;  2LX7 A;  2RQV A;  1VYV A;  1B3Q A;  1OPL A;  4J9E A;  1WYX A;  2F2X A;  1M30 A;  3SEM A;  2V1R A;  3EG3 A;  1TG0 A;  2ED0 A;  1PHT A;  3H0H A;  3NMZ C;  4HXJ A;  2W0Z A;  4IIO A;  4E6R A;  5L23 A;  1X6G A;  4A63 B;  1WIE A;  2JMC A;  4K11 A;  1NG2 A;  2JMA A;  1QLY A;  4JJC A;  1H8K A;  2K6D A;  3QWY A;  4HVW A;  2CUB A;  1YCS B;  2EYY A;  1WA7 A;  3RBB B;  1LCK A;  3I5R A;  2O88 A;  2K9G A;  5I11 A;  1OEB A;  2KYM A;  1JQQ A;  4JZ3 A;  1I1J A;  4LNP A;  2DM1 A;  1WLP B;  2PTK A;  2LJ3 A;  4J9C A;  1AOJ A;  1AWX A;  2J7I A;  1HJD A;  2K79 A;  2SEM A;  1BK2 A;  5IH2 A;  5I22 A;  3KFV A;  3VS3 A;  1BB9 A;  1ZUU A;  4DEX A;  2A28 A;  2KYB A;  1PKS A;  1T0H A;  2AZV A;  1S1N A;  1MV3 A;  4F14 A;  2KRS A;  2DVJ A;  3SHW A;  1GFC A;  3UA7 A;  4AFZ C;  2JM8 A;  3EG2 A;  1XOV A;  3EHR A;  1GBR A;  2L3Q A;  2DYB A;  1HD3 A;  4AFS C;  1W6X A;  3C0C A;  2KBT A;  4RUG A;  1YWP A;  1NEB A;  3H41 A;  2YT6 A;  1SRM A;  2GBQ A;  3VRZ A;  1X2Q A;  2V1Q A;  2LJ1 A;  4CC7 A;  2EW3 A;  2DE0 X;  4AFQ C;  2C0T A;  2KEA A;  2EBP A;  4D8K A;  3R6N A;  2YUO A;  1JXM A;  1JU5 C;  1W1F A;  3RNJ A;  2K7A A;  3VS6 A;  2J6K A;  2LMJ A;  3U23 A;  2I0N A;  5IXF A;  3VS0 A;  2GGR A;  1OOT A;  1Y57 A;  2BZY A;  2ABL A;  3UF4 A;  3EHQ A;  2FPE A;  4OMO A;  1PKT A;  4JJD A;  2DX1 A;  1RLP C;  4LUD A;  1SHG A;  2BZ8 A;  2G6F X;  2O31 A;  2DF6 A;  2ESW A;  1U06 A;  2AZS A;  2KXD A;  2CH4 W;  2RNA A;  2EYZ A;  4QT7 A;  2DRK A;  2EPD A;  2GTJ A;  5IXB A;  5IHN A;  1WFW A;  1A0N B;  4Z89 A;  2KT8 A;  5HCK A; 
#chains in the Genus database with same CATH topology
 2RHX A;  2PZ1 A;  2K2V A;  2K5I A;  1Y0M A;  2KE9 A;  4ZN3 A;  3QUI A;  3OYA A;  2AK5 A;  4PJL A;  2MI6 A;  2FZG B;  4CRI A;  1QMC A;  3UA6 A;  3G4S Q;  2EGA A;  4M7A G;  5HK3 A;  1NE8 A;  5GMK m;  2KQW A;  4DBR A;  2MYS A;  3M55 A;  3NTK A;  4QKU A;  3J80 E;  3CCL A;  5LL6 S;  1AZE A;  2DER A;  2MIO A;  1MND A;  5DY9 A;  5KYU B;  3HFN A;  2XU8 A;  3CXC A;  2QA4 Q;  3JB9 G;  4LDX A;  2C06 A;  2QI2 A;  1KQ2 A;  1VQ6 Q;  4LE9 A;  1BYM A;  1M1K U;  1VQO Q;  3CCE Q;  1OYX A;  3NHN A;  3HRS A;  3RUX A;  3OA6 A;  3OBW A;  1GCQ C;  4RTY A;  2RN8 A;  1NJI C;  5IT9 E;  4ZGJ B;  1VQO T;  1OPK A;  1YHQ A;  4L6V 5;  4F7U F;  2RMO A;  1K0X A;  3UT1 A;  4M4Z A;  5AYF A;  2JN0 A;  1UGP B;  2DKG A;  3QYH B;  4BY6 C;  3EG0 A;  1ZA1 B;  1TUC A;  2L3S A;  5GJW B;  4FT2 A;  4FYW B;  1UGS B;  4KH0 B;  5IHI A;  1M1F A;  2CH4 A;  2RQT A;  3O5Z A;  3RR6 A;  2EVR A;  3SWN C;  4OMQ A;  1KG1 A;  2DEQ A;  2FZK B;  1RUW A;  1JJ2 S;  4OML A;  3JB9 H;  1K76 A;  4Y91 A;  2LT4 A;  4F7U G;  3GOX A;  2NYS A;  4KRT A;  2DIG A;  1GCP A;  3JCM d;  2IIM A;  3I35 A;  2O9S A;  2KAF A;  5HKC A;  2M9U A;  1W2B S;  1OU8 A;  4J9B A;  2K4Y A;  2KDS A;  3G71 Q;  4M7D B;  1Y07 A;  1Q95 G;  4J5Y A;  3CMA Q;  1YJN Q;  1M5Q 1;  1RAG B;  2DNU A;  5GAN 5;  3M53 A;  1JRI A;  4BAC A;  1YJN T;  3SFM A;  2DEU A;  3OYI A;  4FCY A;  4KT0 E;  1YP5 A;  2VXF A;  2ED1 A;  4BDY A;  5FU6 C;  2M16 A;  2JVV A;  4E7I A;  1U8R A;  1VIE A;  3EGX B;  4MZM A;  3X28 B;  3RER A;  1AHJ B;  4VUB A;  1EX4 A;  4AG1 C;  2HCK A;  1I07 A;  4J9F A;  5KCO A;  1QVG P;  1QW1 A;  2B86 A;  4RKU E;  2VWF A;  1SSH A;  1QCF A;  1RI9 A;  2RH2 A;  5LJ3 j;  3UWN A;  2L0A A;  3JCM g;  1U1T A;  2ROT A;  5LJ5 d;  2E65 A;  1YJ9 Q;  3CC2 Q;  1KFZ A;  2ROL A;  1QVF S;  1D09 B;  3S3M A;  1WHL A;  2FG0 A;  1ACM B;  1YJ9 T;  2D9T A;  4J9H A;  2JOY A;  4EDU A;  1VQ7 A;  2B8A A;  4AG2 C;  1T3L A;  3FJ5 A;  1M1G A;  1ZA2 B;  2V8I A;  1N8R U;  3CC7 Q;  2VC8 A;  2QXF A;  1YJN A;  3I9Q A;  2EQM A;  5C6S A;  1K4U S;  5GAM f;  3SDZ A;  3JCM V;  1QVG A;  2CGH A;  1G2B A;  3TQ7 P;  4X1V A;  3QDF A;  3CC7 T;  3CPW S;  4A4K A;  3RKW A;  4F17 A;  4HKE A;  2CP0 A;  4FSX A;  1J3T A;  1I81 A;  1PRM C;  4HCC A;  4JJB A;  4XTX A;  2K5F A;  2WSE E;  1N9S A;  2DBK A;  2NUP B;  4QVC A;  1ZSG A;  5GAM e;  2V8K A;  3X26 B;  1Q82 R;  2AKL A;  1X6B A;  3HHT B;  2FHD A;  1AVZ C;  4Y92 A;  1D0Z A;  3NGP A;  1K0S A;  1UGV A;  2GNC A;  3INZ A;  2RK2 A;  2COZ A;  1Q82 U;  4J8O A;  4C92 A;  1YJ9 A;  2NUZ A;  2VVK A;  3C94 A;  2CZ6 B;  4IKF A;  2CSQ A;  5FWC A;  4JPB W;  3OW2 P;  5GAN d;  5CQY A;  5GMK e;  4XU1 A;  3SD4 A;  4OMF B;  2HMA A;  3MJX A;  3CC7 A;  3EG9 A;  2RQU A;  5IAY A;  4ZGE B;  1BBZ A;  1KC8 U;  4M77 E;  2J06 A;  1UHF A;  1X27 A;  1RAF B;  1NYG A;  4BI8 B;  2CDT A;  5L8R E;  1E6G A;  1E7O A;  2A36 A;  5CKF A;  1VIF A;  1D0Y A;  2X9H A;  4N0A A;  3MHX A;  3OYJ A;  3I55 T;  2E70 A;  1I0C A;  4A53 A;  3ZL7 C;  2DD4 A;  2M51 A;  2X35 A;  4QQD A;  2RB6 A;  3A8G B;  1Q86 U;  2LX7 A;  2RQV A;  4E7S A;  2D0Q B;  4HCB A;  2EWN A;  1WYX A;  1VQP A;  2XDB A;  1M2V B;  2E64 A;  2EJ9 A;  3EG3 A;  1IRE B;  1I8F A;  1PHT A;  5GAN g;  1VQL Q;  2O01 E;  2RI2 A;  4HXJ A;  2CZ7 B;  4FYV B;  4M75 B;  1JB0 E;  4C5H A;  1C0M A;  4WTO B;  1YI2 T;  1X6G A;  3OYD A;  2JMC A;  2HSE B;  2V8J A;  4K11 A;  2JMA A;  4JJC A;  5KYY B;  1YJW T;  1G3S A;  1S72 A;  2DYI A;  2GCX A;  3QWY A;  4HVW A;  1YCS B;  2EYY A;  1YIJ T;  2M1H A;  2LRQ A;  4KUD K;  1RL2 A;  3I5R A;  5D6W A;  2O4X A;  3OS5 A;  5I11 A;  2KYM A;  3NTH A;  4M78 A;  1Q82 C;  2EJG A;  2XIC A;  4M7A B;  3A8M B;  4J9C A;  2PTK A;  1X01 A;  1HJD A;  2YRV A;  1WPY A;  2K79 A;  3D7S B;  5IH2 A;  1R0C B;  3KFV A;  3RMQ A;  1ZUU A;  2YLB A;  1MNE A;  4JLI A;  1T0H A;  4M77 F;  1S1N A;  4FW2 A;  3I55 A;  4F14 A;  5IN1 A;  3ER0 A;  3FIF A;  3RMS A;  1IZ6 A;  3EG2 A;  3EHR A;  3OS0 A;  2DYB A;  1NBE B;  4OB1 B;  3C0C A;  1JJ2 P;  3H41 A;  1SKU B;  1VOM A;  3VRZ A;  3DLL A;  1D1A A;  2EW3 A;  2DE0 X;  3PT9 A;  4PKC C;  2EKO A;  3CCQ A;  3CPF A;  3TRE A;  1JU5 C;  2K7A A;  3VS6 A;  2V26 A;  1YI2 A;  2E5Q A;  1W2B P;  1YJW A;  3CBO A;  3V8J A;  4M77 G;  2PU9 B;  2VYT A;  4WF2 A;  1GXI E;  3S6W A;  1YIJ A;  3V8L A;  1PC0 A;  4C0G A;  3UF4 A;  3CBM A;  2PUK B;  3EHQ A;  2LDM A;  1Q86 C;  5DM7 R;  1K9M R;  2YLC A;  2FPE A;  4JJD A;  5FU7 C;  2IG0 A;  2DX1 A;  2EAY A;  3VUB A;  2QQB A;  2XID A;  1Q7Y R;  2DF6 A;  2ESW A;  9ATC B;  1U06 A;  2RNA A;  2LVM A;  4QT7 A;  4C8Q C;  3E9G A;  1R0B G;  4C8Q D;  4E2F B;  2YHT A;  5IHN A;  4C92 G;  1A0N B;  4Z89 A;  2XK0 A;  3M0P A;  4JRQ A;  2J6O A;  5EG2 A;  5LJ3 d;  1BI0 A;  2EJF A;  2Z0W A;  5GAM j;  1Z9Q A;  1W2B A;  2VXE A;  3OY9 A;  7AT1 B;  2XDD A;  3KUF A;  2BUD A;  2QQR A;  2JTF A;  1TSF A;  1RAC B;  2CZ0 B;  3JV3 A;  1PRL C;  1QVF P;  3MEA A;  2LQW A;  3EG1 A;  2OAW A;  3LLR A;  2VGN A;  2DIQ A;  4OF1 A;  2LTO A;  1M9S A;  4MDW A;  4PJO A;  1YBY A;  2GQI A;  2I2L A;  3FEO A;  2MAM A;  4QQG A;  1GRI A;  1NM7 A;  2HD0 A;  3M0Q A;  1KQS S;  2K3X A;  3QHS A;  4QQ6 A;  2YUN A;  2ZAE A;  3MO8 A;  2JM9 A;  1JO8 A;  1VYU A;  2J6F A;  3X20 B;  2RQW A;  4BD3 A;  5GMK j;  3REB B;  4BY6 B;  1PCX A;  2X3W D;  4M75 C;  1WHK A;  4M75 D;  2D1X A;  2DL8 A;  4EIK A;  5GAO q;  1XNI A;  4AFU C;  3P8B B;  1N27 A;  3CPW P;  1ZX6 A;  4XTV A;  1AEY A;  2RQR A;  4KGV B;  3SWN B;  3JSC A;  4RCB A;  4XU3 A;  4L5G A;  5KE3 A;  2QG9 B;  2LP5 A;  4ORZ A;  1QVF A;  4J6W A;  4NS5 A;  2KGT A;  4JS5 A;  2YXY A;  3PIO A;  4M7A C;  4M7A D;  1CKA A;  3OSV A;  4NL2 A;  2OX7 A;  2AIR B;  3VKI A;  4R55 A;  4E7K A;  3VRY A;  1YNZ A;  2DD5 A;  3LYI A;  3OSS C;  5AT1 B;  4DEY A;  3T9N A;  3CC4 T;  2RF0 A;  4MML A;  2RHY A;  1M90 R;  2AHJ B;  3EFR A;  1AWJ A;  4PJO E;  3QO3 A;  1GCQ A;  3CCM T;  2M02 A;  3CCU T;  3M0S A;  1Q7Y C;  1OI1 A;  3EH2 A;  4IIM A;  2FPF A;  4TVR A;  1YHQ Q;  3N5B B;  5FU6 B;  1GL5 A;  2LCS A;  3PTA A;  3JCM Q;  1BIA A;  1WXB A;  1YHQ T;  2X4W A;  3WVE B;  1HSQ A;  2H3E B;  4PLI A;  3H0F A;  1VQK Q;  4ELZ C;  4LXC A;  3CCS T;  2E3H A;  3JB9 F;  1Z9Z A;  3DKM A;  2EQJ A;  4QVZ A;  1VQK T;  1W70 A;  2FRY A;  4A4E A;  2GFU A;  1RLQ C;  3RKY A;  3RIR A;  2COY A;  3QWX X;  2HAX A;  4MDX A;  1QCO A;  1MMN A;  2HSP A;  2RJE A;  5CAI A;  1O75 A;  5GMK i;  2LCL A;  1R77 A;  1AWO A;  3GIB A;  2JS0 A;  2CKK A;  1YWO A;  1KIK A;  3CC4 A;  2VGM A;  2XI9 A;  2QEX T;  4KUL A;  3P8D A;  2HL3 A;  1YIT Q;  3A98 A;  1H64 1;  3JAM E;  1SRL A;  1WI7 A;  1OZ3 A;  1PNJ A;  1SSF A;  4ELY C;  5GJV B;  3CCM A;  1CSK A;  3CCU A;  1YIT T;  1M27 C;  1MV0 B;  2HQH A;  2PVG B;  1QKX A;  1YCY A;  2A37 A;  5FWB A;  2NUT A;  2FVU A;  1M3C A;  1BU1 A;  4WCI A;  3HSB A;  2EYQ A;  3TSZ A;  3CCS A;  1ABO A;  4Z88 A;  1Y96 A;  4EMK C;  5I21 A;  1N9R A;  2L5Q A;  1ZUK A;  1TXQ A;  5GAN 7;  1VQK A;  2HNI A;  1BI2 A;  3OB9 A;  2RD1 A;  4HCK A;  4LDY A;  2CYZ B;  1HXD A;  4A4F A;  4PJO G;  4IUT A;  5FW9 A;  2MWO A;  5CKB A;  1C6V X;  2GTO A;  4OMM A;  1ZUY A;  2FRW A;  4A54 A;  3V8K A;  2DL5 A;  2XHC A;  1PWT A;  3LW5 E;  2E1H A;  3EFO B;  1Y71 A;  2OJ2 A;  4IUU A;  1B34 B;  3TVT A;  1VQ7 Q;  1M2O A;  2QEX A;  2DLP A;  2E5K A;  2RJD A;  5KYU A;  1ZLM A;  1NLO C;  2DTO A;  3NPF A;  3JCM X;  1YN8 A;  1VQ7 T;  1YIT A;  2CUD A;  1X43 A;  2LX9 A;  2EYW A;  3M0R A;  3OYF A;  1UUE A;  2H8H A;  1UG1 A;  3MP1 A;  2RJF A;  5CVI A;  1WZO A;  4HVU A;  3M58 A;  4J9I A;  2HKQ B;  1V76 A;  1TOV A;  1V1C A;  4IUR A;  3CQT A;  3G1J A;  1UFF A;  3QSU A;  2AKK A;  2MWP A;  2DA9 A;  2ZPB B;  1AD5 A;  2GQV A;  1KD1 R;  1LPL A;  5GAM h;  2VB6 A;  1JXO A;  2DL4 A;  3THK A;  4Y28 E;  3MCA B;  3I56 Q;  3RDV A;  1K1Z A;  2IPO B;  4IUQ A;  1WHM A;  1R8O B;  1KD1 U;  3I56 T;  4D8D A;  4XTW A;  3OYN A;  4M77 B;  1M4Z A;  1D1B A;  2YRD A;  1VYV A;  1B34 A;  2Y4Y A;  3MEW A;  3JCM f;  2F2X A;  3E2U A;  1M30 A;  3GNG A;  5KYX B;  4E7H A;  3O8V A;  4II1 A;  1AT1 B;  3OYE A;  4HT9 A;  2DAQ A;  5GMK h;  4M7D A;  4IIO A;  1OQK A;  4A63 B;  1WIE A;  1KQS P;  2HL5 C;  2K6D A;  3JCM e;  5DLO A;  3PMT A;  5A0G A;  2QQA A;  2IVW A;  2QTX A;  2O88 A;  2K9G A;  1P92 A;  1FXX A;  5M9O A;  4LNP A;  1WLP B;  1VQN T;  2LJ3 A;  4BUG A;  2J7I A;  3EGX A;  1RAA B;  3VS3 A;  2XG8 D;  3OYB A;  2A28 A;  1PKS A;  5LJ5 g;  3I56 A;  3SHW A;  1GFC A;  5D6Y A;  1DJ7 B;  1XOV A;  1VQP Q;  4OP0 A;  1W6X A;  2K3Y A;  5LJ5 f;  3CCR T;  1YWP A;  2BE7 D;  2DXT A;  3EFS A;  2RJC A;  1VQP T;  1SRM A;  1IXD A;  2GBQ A;  1D3B B;  3JCM b;  4GLK A;  3QZ5 B;  4AFQ C;  5KYX A;  2C0T A;  2WSF E;  2KEA A;  3H9N A;  1S72 Q;  4E47 A;  4IUP A;  4XTZ A;  4M7D E;  1QP2 A;  2YUO A;  5FU7 B;  1TTH B;  1RAI B;  2J6K A;  2LMJ A;  3BE3 A;  1S72 T;  3U23 A;  5LJ5 e;  1QQJ A;  1KD1 C;  2DET A;  3M59 A;  3CD6 T;  1OOT A;  2BZY A;  4C8Q B;  1VQ8 A;  3JCM W;  3HP9 A;  1LNX A;  4OMO A;  5GAN h;  2COW A;  3M4G A;  1SHG A;  4HCZ A;  2G6F X;  1VQN A;  2OTL A;  2O31 A;  3NTI A;  3PFS A;  1XTD A;  2MPX C;  3OMG A;  3TEE A;  2CH4 W;  3I55 Q;  2L3R A;  2QTV A;  3PGG A;  1LJO A;  4A4H A;  2EPD A;  2NUP A;  1WFW A;  4BI3 A;  1MGQ A;  3QZ9 B;  1KQ1 A;  1OZ2 A;  3M0T A;  4OMP A;  1QWF A;  2PQW A;  3I5S A;  3G6E T;  2BZX A;  3ULR B;  1RAD B;  2R57 A;  3OW2 A;  3VS1 A;  3L2R A;  5CIU A;  1FX7 A;  2LJ0 A;  3FJP A;  1ARK A;  4XAX B;  4L59 A;  4Z02 A;  3CCQ Q;  2D0N A;  3CCR A;  5J3B A;  2QAS A;  2KY9 A;  4C92 E;  2ZGW A;  5KYW B;  1TH7 A;  3BW1 A;  1YI2 Q;  3CCQ T;  1MMD A;  2QYZ A;  1YJW Q;  1BI1 A;  3CCV Q;  4M77 C;  1EZZ B;  1K9A A;  1WXT A;  5KE2 A;  4M77 D;  1KK7 A;  1VQ9 A;  4J7I A;  3LWI A;  1YIJ Q;  1NZ9 A;  2P0Q A;  2XD0 A;  5GAO n;  1F1B B;  5GAN f;  2L2P A;  3CCV T;  1QVP A;  1SF9 A;  4M7D F;  2DTH A;  2EGC A;  3OYG A;  1I5O B;  3CD6 A;  1WJQ A;  3C12 A;  1VQ5 T;  1EIF A;  2HBW A;  4C8Q A;  3VS4 A;  1MUZ A;  2Y4X A;  1UDL A;  2RI5 A;  1FMW A;  1Q81 R;  2DK3 A;  2AT1 B;  2DJQ A;  3HRU A;  5GAN e;  4GBQ A;  1FMV A;  2E4H A;  3FRN A;  2G3R A;  4DOV A;  3TCJ A;  1IRX A;  3E9F A;  2DZ9 A;  2E3I A;  1O9S A;  2LZ6 B;  1NEG A;  2DXU A;  1ZSZ C;  3G6E A;  3SB2 A;  1BCM A;  4M7D G;  1OV3 A;  1I5L A;  1KHC A;  1BI3 A;  1K73 R;  2RPN A;  3C95 A;  5A2Q E;  3PMI A;  1H3Z A;  3BFM A;  1G83 A;  4AT1 B;  1M2V A;  2QGF B;  2LNV A;  3LX7 A;  5A0D A;  1HYO A;  1RI0 A;  4CC3 A;  4C92 F;  4LD9 K;  2KT1 A;  4QW2 A;  4LUE A;  4M75 A;  1SEM A;  2CT3 A;  4RTV A;  3CCV A;  4CC4 B;  5KYY A;  2HKN A;  2M0Y A;  2RHU A;  4OGC A;  2CS7 A;  4C0D C;  2K2M A;  4FL6 A;  2RM4 A;  2KXC A;  4KBM B;  1VQ5 A;  1UTI A;  4RG2 A;  1GBQ A;  4F16 A;  3GLX A;  4M78 E;  4ESR A;  5ECA A;  4M7A A;  2L8D A;  1JJ2 A;  2KRM A;  4N4G A;  1K9M U;  4F7U B;  3M56 A;  2CP6 A;  5FRN A;  4HA8 A;  4RMO A;  1B07 A;  8ATC B;  2KNB B;  1PD1 A;  2MMP A;  2KK4 A;  1Q7Y U;  2X4J A;  3WXM B;  2L3P A;  2ZCF B;  2HQX A;  2EIF A;  1SG5 A;  3VJP A;  2PNI A;  4FW1 A;  4CI0 C;  2LQN A;  3CME A;  3QG1 A;  2QDL A;  3IQL A;  1Y7X A;  1FYN A;  4LDU A;  2O2O A;  3A8L B;  3VYH B;  4C0Z A;  2F69 A;  3OS2 A;  2WSC E;  5GAN 2;  3EH1 A;  4M75 E;  4DBH A;  3PIP A;  2DZC A;  1Q81 C;  1SPK A;  4LN2 A;  4J6X A;  1UE9 A;  3RKX A;  3EAE A;  5LJ5 j;  2F2V A;  4EMK B;  4DA4 A;  1OX8 A;  4QVD A;  1UHC A;  3L2U A;  4BB7 A;  1JEG A;  4Z8A A;  1XJW B;  3VS2 A;  4M78 F;  3UPU A;  2BTT A;  5LJ3 g;  5I2M A;  1TS9 A;  3OYK A;  3A1P A;  4HT8 A;  2FZC B;  1G3Y A;  3GP8 A;  3FC3 A;  4OMN A;  5GAO r;  5LJ3 f;  2KVQ G;  1M3A A;  1ZQ1 A;  1WJR A;  2ECZ A;  5CKH A;  4DOW A;  3GBQ A;  1D0X A;  3CC4 Q;  4JZ4 A;  4B6M A;  1KJW A;  3WVD B;  1UB4 A;  2E41 A;  4ZNX A;  3QPH A;  4XU2 A;  3JB9 D;  2QAZ A;  2O9V A;  3C4S A;  3CEY A;  1UGQ B;  5GMK l;  3CCM Q;  5LJ3 e;  3CCU Q;  1K9M C;  3H8Z A;  4M78 G;  8AT1 B;  4GLM A;  1GFD A;  3CPW A;  4ZTJ A;  3Q1J A;  1KSW A;  5GAN 6;  5CCA A;  1N5Z A;  4X9D A;  4LD6 A;  4OB2 B;  1M90 U;  4N4I A;  1U3O A;  5GAO l;  1WHG A;  2F1L A;  3CCS Q;  4RTW A;  2DXC A;  4J9G A;  2J05 A;  3KBG A;  2EQI A;  1BIB A;  1ABQ A;  1AWW A;  4MZT A;  2W10 A;  2DIL A;  1VQ4 A;  2EQK A;  3PNW C;  3SWN A;  1T3S A;  3X24 B;  5GAN j;  3PVQ A;  3H0I A;  3CCJ A;  4RCC A;  4CC2 A;  5C0M A;  4NL3 A;  5IHK A;  3LWH A;  1H92 A;  2JXB A;  2DVE A;  2SRC A;  3PE0 A;  2DMO A;  4M75 G;  3M5A A;  3RES A;  5CR2 A;  4PJN A;  1V29 B;  3M57 A;  4J9D A;  1WDX A;  1PSE A;  1FWZ A;  2FEI A;  2QEX Q;  2RA2 A;  1QP3 A;  4AMC A;  2BE9 B;  3EGD B;  1SHF A;  1B3Q A;  1MMG A;  1OPL A;  3JCM P;  2E10 A;  4DBF A;  2OAU A;  1PG5 B;  4DQ2 A;  5J39 A;  1TG0 A;  2ED0 A;  4ZTF A;  3A8O B;  4PJO F;  3G4S T;  3H0H A;  2W0Z A;  4E6R A;  4Q5W A;  1M1K R;  3QXE B;  2RHZ A;  2DPP B;  5DLQ E;  4A4G A;  3R6O A;  2CP3 A;  3QDR B;  1WA7 A;  4J83 A;  3AT1 B;  3RBB B;  5GAO m;  1LCK A;  2QA4 T;  5FRM A;  1OEB A;  2DO3 A;  1JQQ A;  4JZ3 A;  3MET A;  1VQ6 T;  3QJ6 A;  4JS4 A;  2P0K A;  1AOJ A;  4JUV A;  1AWX A;  3L42 A;  3CCE T;  3UDC A;  2QDY B;  1W4S A;  3FDR A;  4F04 B;  1M90 C;  5I22 A;  4DEX A;  3OBY A;  3ME9 A;  1WHH A;  2KYB A;  5CK9 A;  2DFU A;  2ZPG B;  2KRS A;  4AFZ C;  2JM8 A;  3ZFJ A;  2MF2 A;  2K5L A;  1GBR A;  5GAN 8;  3QII A;  4AFS C;  3MPU B;  1WGS A;  3E19 A;  3F70 A;  3EGD A;  4RUG A;  2ZZD A;  3L2W A;  2YT6 A;  2ATC B;  3AHU A;  2VUB A;  2V1Q A;  3DB3 A;  1TWB A;  1LOJ A;  2EBP A;  4D8K A;  3NFC A;  3G4S A;  3R6N A;  4ME7 A;  3JCM h;  3BDU A;  1WJS A;  2MK5 A;  1OU9 A;  2HQE A;  2E12 A;  2DJZ A;  4FYX B;  2GGR A;  4ANJ A;  4E7Z A;  3L2Q A;  2QA4 A;  3J81 E;  4BE0 A;  1PKT A;  3V7C A;  1RAH B;  3LGF A;  4LUD A;  1VQ6 A;  1PM3 A;  2BZ8 A;  1G3W A;  2PVD B;  3G71 T;  2H3J A;  4JRK A;  5HK0 A;  1VQO A;  4FU6 A;  3CCE A;  3DB4 A;  2EQU A;  3CMA T;  5GAM d;  1PSF A;  2DRK A;  1MMA A;  2DTI A;  2XDP A;  5IXB A;  4PJJ A;  1G5V A;  2KT8 A;  2JUF A;  3L2Z A;  4OGE A;  5HCK A;  3QJY A;  1IB8 A;  1IHW A;  3JB9 I;  2KR3 A;  3HFO A;  1M3B A;  5HY6 A;  4C0F A;  3EFO A;  3P8H A;  4R0K A;  4BE2 A;  3M9Q A;  1C1A A;  1M1K C;  4J6Y A;  4MMK A;  4XTU A;  3VYG A;  2HZY A;  2D8H A;  2KRO A;  1X2K A;  3BY7 A;  4C5I A;  1RAE B;  3LH0 A;  1HK9 A;  5LJ5 h;  4R56 A;  4KGX B;  1X75 C;  4ZN1 A;  4PL6 A;  1VQ8 Q;  4P5N A;  4C92 B;  5CO7 A;  3OYM A;  3X25 B;  2DBM A;  1PD0 A;  1T0J A;  3CC2 T;  2CRE A;  1WX6 A;  5KCH A;  2YUQ A;  3VS5 A;  1QCN A;  1N8R R;  1VQ8 T;  2EGE A;  4FIB A;  1UEC A;  2C0I A;  1VQN Q;  2OTL Q;  2YDL A;  3MP6 A;  3JCM c;  4E7L A;  1ZSZ B;  3JB9 J;  5GAM g;  3G71 A;  2OTL T;  2X4X A;  4FSS A;  3HKS A;  2QGG A;  2OTJ Q;  2X3X D;  3CMA A;  2VKN A;  4PLL A;  3MEU A;  1TUD A;  2FL7 A;  4PNO A;  3EGU A;  4EPC A;  5EC7 A;  5D6X A;  4LDV A;  2CP5 A;  3EG9 B;  2WAC A;  2OTJ T;  3QYG B;  2FB7 A;  3H6Z A;  3V7R A;  1NYF A;  3CCR Q;  1CKB A;  3G7Z A;  4N4H A;  2LNH B;  1UJ0 A;  4JRP A;  2L89 A;  1KQS A;  4M77 A;  4D6W A;  2MCN A;  3S3O A;  2D6F A;  3TSW A;  3LGL A;  2YUP A;  1I4K 1;  4X9C A;  1D1C A;  4XQ3 A;  1VQ9 Q;  1WXU A;  4C0D B;  1AZG B;  2HDA A;  1QKW A;  2A08 A;  2F5T X;  1FMK A;  4V2S A;  2LCC A;  3VV0 A;  4NOY A;  1VQ9 T;  1IO6 A;  1VA7 A;  1VUB A;  2YSQ A;  1U5S A;  3CD6 Q;  3CBP A;  3J7A F;  1TUG B;  3CC2 A;  1NLP C;  1IGU A;  2K57 A;  1E6H A;  1UGR B;  4KGZ B;  5I2S A;  3HL8 A;  3UAT A;  4O5V A;  4XU0 A;  1B7T A;  2EYX A;  3MP8 A;  1ZSZ A;  3HRT A;  4EMH A;  2CSI A;  2P84 A;  4IUV A;  2FPD A;  3G6E Q;  1KC8 R;  2O4X B;  4M7D C;  3CXC S;  4JRI A;  2LQK A;  4M7D D;  4M78 B;  2OTJ A;  3LH5 A;  3OYC A;  2QQS A;  2X4Y A;  3HPW A;  4OB0 B;  1LVK A;  2XMF A;  2JNG A;  3OQ5 A;  1ZBJ A;  1UEB A;  3L2V A;  1Q86 R;  2MOX A;  3L1A A;  1D3B A;  3DLM A;  2F5K A;  2LT1 A;  2JS2 A;  1N8R C;  3REA B;  1ZHI A;  5A0L A;  2E6N A;  2JW4 A;  1IGQ A;  4RTZ A;  3VS7 A;  2CP2 A;  2A0F B;  1VQ5 Q;  2RK1 A;  3ZBD A;  4RTU A;  3M4Y A;  2FO0 A;  3FLG A;  2P4R A;  1G8X A;  3PVL A;  2KI7 A;  2GF7 A;  2DRM A;  3VU3 C;  2RO0 A;  4C92 C;  5KH6 A;  1VQL T;  1K8A R;  4C92 D;  1IHV A;  4C5E A;  4GY5 A;  4MZP A;  3A8H B;  1VYT A;  1H3H A;  1QWE A;  1NPP A;  1VQM Q;  2DL3 A;  1Q81 U;  1K8A U;  4PJM A;  2FYK A;  4FM4 B;  1VQM T;  4BDZ A;  3URG A;  2RI3 A;  4LDW A;  3CME Q;  1TU0 B;  4BE1 A;  5GAO p;  1M8M A;  1BKB A;  1X69 A;  3V7S A;  3CME T;  4OB3 B;  1UJY A;  4J7F A;  5KYW A;  2F2W A;  1K73 U;  2ZPE B;  1N6A A;  3BDL A;  4N0A C;  1WQW A;  1WHJ A;  2K3B A;  2NWM A;  3OYL A;  2A7Y A;  2DXB A;  1ZBX A;  2JJ9 A;  4C8Q E;  3S3N A;  1KC8 C;  2E6Z A;  5D7U A;  1EFN A;  1KHI A;  4PJO B;  3M54 A;  3QBY A;  2PVO B;  1VQL A;  2M0O A;  1MHN A;  3OS1 A;  3JCM J;  2BIV A;  2CZ1 B;  2JTE A;  2DL7 A;  1OUL A;  2JZ2 A;  3TU4 K;  2ENM A;  4PK4 A;  2CT4 A;  2KMT A;  4RTX A;  4ATO A;  3OYH A;  2OI3 A;  4RTT A;  4HVV A;  2VAS A;  4B9X A;  2BKD N;  1VQM A;  2EKH A;  1OX9 A;  2D8J A;  2HEQ A;  4PFP A;  2ZPH B;  4E7J A;  4JJN K;  2C0O A;  2KRN A;  2JT4 A;  2VV5 A;  4M78 C;  5LJ3 h;  4M78 D;  4ZGD B;  5FLX E;  1QVG S;  1YFN A;  4OVA A;  2YWW A;  4XK8 E;  3M0U A;  5KYN A;  5CKE A;  4FT4 A;  1JBM A;  4KUI A;  4J9E A;  2PUO B;  4JDS A;  4KH1 B;  3SEM A;  1K8A C;  2V1R A;  3OYY A;  1NPR A;  2EFI A;  3OMC A;  3NMZ C;  2XKO C;  5L23 A;  1BCO A;  2R58 A;  1NG2 A;  1QLY A;  1X6O A;  1VQ4 Q;  1H8K A;  4M7A E;  4C8Q F;  2NLU A;  2CUB A;  3GNF B;  4C5G A;  2LC4 A;  4X34 A;  5GAN 3;  3CCJ Q;  1RAB B;  6AT1 B;  1VQ4 T;  1U1S A;  4F7U A;  2HBP A;  1K73 C;  3CCJ T;  2CP7 A;  2Y90 A;  1I1J A;  3VUZ A;  2DM1 A;  2LQ8 A;  2QQ9 A;  4YTL A;  4JLG A;  3GPL A;  2SEM A;  1BK2 A;  5FRO A;  1BB9 A;  3GF5 A;  5GAN 4;  2ZPF B;  2AZV A;  1MV3 A;  1NJI R;  2DVJ A;  3MKD A;  4UC4 A;  3UA7 A;  4C8Q G;  5CQX A;  2P4T A;  2L3Q A;  1HD3 A;  2KBT A;  1NEB A;  3ASK A;  1NJI U;  1M8V A;  1X2Q A;  3CCL Q;  2LJ1 A;  4CC7 A;  4O6J A;  4PFO A;  4M75 F;  2GFA A;  4BI4 A;  4DBQ A;  2P0P A;  3CCL T;  5J26 A;  1JXM A;  3E1S A;  4EMK A;  1W1F A;  3RNJ A;  3A5Z B;  2RHI A;  2I0N A;  2R5M A;  3OW2 S;  5IXF A;  5CKD A;  3VS0 A;  3MEV A;  2A3L A;  1Y57 A;  4EMG A;  2ABL A;  2YRC A;  2ZPI B;  3KXT A;  3ZEH A;  4F7U E;  4FYY B;  4PFZ A;  4M7A F;  4RG8 A;  1G3T A;  4PJO C;  2QK0 A;  1RLP C;  2NUT B;  4PJO D;  1WNL A;  3JRZ A;  2JTM A;  3CXC P;  3FB9 A;  2AZS A;  4XTY A;  2KXD A;  2EYZ A;  3HTR A;  2GTJ A;  1XQH A;  2KSS A;  1Y96 B;  2X51 A;  4B9W A;  1WQ7 A;  3QKJ A;  2R5A A; 
#chains in the Genus database with same CATH homology
 3M0P A;  2PZ1 A;  2J6O A;  3M0T A;  4OMP A;  1QWF A;  3I5S A;  2BZX A;  1Y0M A;  2KR3 A;  3ULR B;  2KE9 A;  1M3B A;  3VS1 A;  1Z9Q A;  2AK5 A;  2LJ0 A;  4R0K A;  1ARK A;  2D0N A;  3UA6 A;  2EGA A;  2D8H A;  2KRO A;  3JV3 A;  1PRL C;  1X2K A;  2LQW A;  3EG1 A;  2OAW A;  1K9A A;  1WXT A;  1AZE A;  2MIO A;  2GQI A;  2L2P A;  2DBM A;  1T0J A;  2CRE A;  1WX6 A;  1GRI A;  1NM7 A;  2EGC A;  3M0Q A;  2YUQ A;  3VS5 A;  4LE9 A;  2YUN A;  2EGE A;  2HBW A;  2JM9 A;  1JO8 A;  1UEC A;  1VYU A;  2C0I A;  2J6F A;  2RQW A;  2YDL A;  3REB B;  3NHN A;  2X3W D;  3VS4 A;  1MUZ A;  1UDL A;  2D1X A;  1GCQ C;  2DL8 A;  2RN8 A;  4RTY A;  4EIK A;  1OPK A;  4FSS A;  4AFU C;  2DJQ A;  2RMO A;  1K0X A;  4GBQ A;  2X3X D;  4M4Z A;  1ZX6 A;  1AEY A;  2VKN A;  2RQR A;  1TUD A;  3EGU A;  5EC7 A;  3EG0 A;  2LP5 A;  4ORZ A;  1TUC A;  2L3S A;  5GJW B;  2KGT A;  2LZ6 B;  1NEG A;  1NYF A;  1CKB A;  5IHI A;  2LNH B;  2CH4 A;  1UJ0 A;  2RQT A;  1OV3 A;  1CKA A;  3O5Z A;  2MCN A;  2EVR A;  3TSW A;  2YUP A;  2RPN A;  4OMQ A;  1WXU A;  1G83 A;  1AZG B;  1RUW A;  4OML A;  2HDA A;  1K76 A;  1QKW A;  3VRY A;  2A08 A;  1YNZ A;  1FMK A;  4CC3 A;  4DEY A;  1IO6 A;  2KT1 A;  4KRT A;  2RF0 A;  1VA7 A;  4LUE A;  1GCP A;  2YSQ A;  1U5S A;  2IIM A;  1AWJ A;  1SEM A;  3I35 A;  2CT3 A;  4RTV A;  1GCQ A;  4CC4 B;  2M0Y A;  2O9S A;  3M0S A;  2K2M A;  4J9B A;  1NLP C;  4IIM A;  2KXC A;  2FPF A;  1E6H A;  1UTI A;  1GL5 A;  2LCS A;  1GBQ A;  3UAT A;  4F16 A;  1WXB A;  2DNU A;  4ESR A;  2EYX A;  5ECA A;  1HSQ A;  2CSI A;  2FPD A;  3H0F A;  2KRM A;  1YP5 A;  2ED1 A;  1Z9Z A;  1B07 A;  2KNB B;  3LH5 A;  1W70 A;  2FRY A;  1RLQ C;  2L3P A;  2XMF A;  3QWX X;  2HSP A;  4AG1 C;  2HCK A;  1I07 A;  1ZBJ A;  4J9F A;  2PNI A;  2MOX A;  2B86 A;  2VWF A;  1SSH A;  1QCF A;  1RI9 A;  2LQN A;  2QDL A;  3IQL A;  1AWO A;  1FYN A;  2O2O A;  2JS2 A;  2L0A A;  2JS0 A;  3REA B;  2ROT A;  1YWO A;  1KIK A;  1KFZ A;  2ROL A;  2JW4 A;  4RTZ A;  3VS7 A;  3A98 A;  1SRL A;  1WI7 A;  1PNJ A;  2FG0 A;  4RTU A;  2FO0 A;  5GJV B;  1SPK A;  4J9H A;  1CSK A;  4LN2 A;  2P4R A;  1M27 C;  1MV0 B;  1UE9 A;  3PVL A;  2F2V A;  4AG2 C;  1T3L A;  3FJ5 A;  1QKX A;  2A37 A;  2DRM A;  5FWB A;  1UHC A;  1M3C A;  1BU1 A;  4WCI A;  1VYT A;  1JEG A;  1H3H A;  3I9Q A;  4Z8A A;  3VS2 A;  1QWE A;  3TSZ A;  1K4U S;  2BTT A;  1G2B A;  1ABO A;  2DL3 A;  4X1V A;  4Z88 A;  1ZUK A;  4F17 A;  4OMN A;  4HCK A;  1J3T A;  1M3A A;  1PRM C;  2ECZ A;  4JJB A;  2DBK A;  1M8M A;  5FW9 A;  1X69 A;  3GBQ A;  1ZSG A;  2GTO A;  4OMM A;  1ZUY A;  2FRW A;  1UJY A;  2AKL A;  2DL5 A;  4JZ4 A;  1KJW A;  2F2W A;  4ZNX A;  1PWT A;  1X6B A;  2O9V A;  1AVZ C;  2OJ2 A;  3TVT A;  4Y92 A;  3NGP A;  1K0S A;  1UGV A;  2GNC A;  4GLM A;  1GFD A;  2DLP A;  2E5K A;  2K3B A;  1ZLM A;  1NLO C;  3NPF A;  2NUZ A;  1YN8 A;  1KSW A;  2NWM A;  2VVK A;  1N5Z A;  2CUD A;  1X43 A;  2EYW A;  3M0R A;  1U3O A;  1UUE A;  2H8H A;  1UG1 A;  2CSQ A;  5FWC A;  4JPB W;  1EFN A;  4HVU A;  4RTW A;  4J9I A;  4J9G A;  2J05 A;  2EQI A;  1ABQ A;  1AWW A;  2W10 A;  2JTE A;  2DL7 A;  1V1C A;  3CQT A;  2DIL A;  1UFF A;  2ENM A;  2AKK A;  1T3S A;  2CT4 A;  2DA9 A;  3PVQ A;  2RQU A;  4RTX A;  3H0I A;  1AD5 A;  2OI3 A;  4RTT A;  4HVV A;  4CC2 A;  1BBZ A;  2EKH A;  5IHK A;  1H92 A;  2D8J A;  2JXB A;  2HEQ A;  1JXO A;  3PE0 A;  2DL4 A;  2SRC A;  3THK A;  2DMO A;  2J06 A;  1UHF A;  1X27 A;  1NYG A;  2CDT A;  1E6G A;  1E7O A;  2A36 A;  1K1Z A;  2C0O A;  2KRN A;  4J9D A;  1WDX A;  2JT4 A;  1I0C A;  2FEI A;  4D8D A;  3ZL7 C;  2M51 A;  3M0U A;  1SHF A;  2LX7 A;  2RQV A;  1VYV A;  1B3Q A;  1OPL A;  4J9E A;  1WYX A;  2F2X A;  1M30 A;  3SEM A;  2V1R A;  3EG3 A;  1TG0 A;  2ED0 A;  1PHT A;  3H0H A;  3NMZ C;  4HXJ A;  2W0Z A;  4IIO A;  4E6R A;  5L23 A;  1X6G A;  4A63 B;  1WIE A;  2JMC A;  4K11 A;  1NG2 A;  2JMA A;  1QLY A;  4JJC A;  1H8K A;  2K6D A;  3QWY A;  4HVW A;  2CUB A;  1YCS B;  2EYY A;  1WA7 A;  3RBB B;  1LCK A;  3I5R A;  2O88 A;  2K9G A;  5I11 A;  1OEB A;  2KYM A;  1JQQ A;  4JZ3 A;  1I1J A;  4LNP A;  2DM1 A;  1WLP B;  2PTK A;  2LJ3 A;  4J9C A;  1AOJ A;  1AWX A;  2J7I A;  1HJD A;  2K79 A;  2SEM A;  1BK2 A;  5IH2 A;  5I22 A;  3KFV A;  3VS3 A;  1BB9 A;  1ZUU A;  4DEX A;  2A28 A;  2KYB A;  1PKS A;  1T0H A;  2AZV A;  1S1N A;  1MV3 A;  4F14 A;  2KRS A;  2DVJ A;  3SHW A;  1GFC A;  3UA7 A;  4AFZ C;  2JM8 A;  3EG2 A;  1XOV A;  3EHR A;  1GBR A;  2L3Q A;  2DYB A;  1HD3 A;  4AFS C;  1W6X A;  3C0C A;  2KBT A;  4RUG A;  1YWP A;  1NEB A;  3H41 A;  2YT6 A;  1SRM A;  2GBQ A;  3VRZ A;  1X2Q A;  2V1Q A;  2LJ1 A;  4CC7 A;  2EW3 A;  2DE0 X;  4AFQ C;  2C0T A;  2KEA A;  2EBP A;  4D8K A;  3R6N A;  2YUO A;  1JXM A;  1JU5 C;  1W1F A;  3RNJ A;  2K7A A;  3VS6 A;  2J6K A;  2LMJ A;  3U23 A;  2I0N A;  5IXF A;  3VS0 A;  2GGR A;  1OOT A;  1Y57 A;  2BZY A;  2ABL A;  3UF4 A;  3EHQ A;  2FPE A;  4OMO A;  1PKT A;  4JJD A;  2DX1 A;  1RLP C;  4LUD A;  1SHG A;  2BZ8 A;  2G6F X;  2O31 A;  2DF6 A;  2ESW A;  1U06 A;  2AZS A;  2KXD A;  2CH4 W;  2RNA A;  2EYZ A;  4QT7 A;  2DRK A;  2EPD A;  2GTJ A;  5IXB A;  5IHN A;  1WFW A;  1A0N B;  4Z89 A;  2KT8 A;  5HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...