2LNHB

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neural Wiskott-Aldrich syndrome protein
publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/protein binding
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lnhB00
1U3OA 1X43A 4ESRA 3UA6A 1SEMA 2JXBA 3R6NA 1MV0B 2O9SA 2YUPA 2CUBA 4Z89A 1OV3A 4R0KA 1OPKA 1CSKA 1H3HA 3RNJA 2ED0A 3REBB 2KYMA 2JS0A 1NG2A 1YNZA 1ABQA 1I1JA 3VRZA 1KIKA 2LNHB 1VYUA 1Y57A 1UJYA 3H0HA 3I35A 2LQNA 1MV3A 5IHIA 3FJ5A 2D8JA 2AKKA 1GCQC 1ZX6A 4QT7A 3REAB 1ZLMA 2GTOA 3NHNA 1T0JA 2VKNA 2OI3A 4FSSA 1YCSB 2KGTA 4IIOA 3H41A 1SSHA 4CC7A 1AWOA 1NEBA 1AZEA 4AFZC 2A08A 2LP5A 1GRIA 3RBBB 2HEQA 1AWWA 1V1CA 1QWEA 1WI7A 1M3BA 2BZ8A 2C0OA 1WXUA 1UDLA 2ESWA 4LE9A 2X3XD 3M0RA 1E7OA 1M8MA 3EG0A 1K0SA 1X27A 2KRNA 2SEMA 2K2MA 2KNBB 2FPFA 2VVKA 3M0TA 4AFUC 2JMCA 1E6GA 4J9DA 2JTEA 2B86A 2CH4W 2EKHA 1UUEA 1PRLC 1VYVA 3IQLA 4JJBA 4ORZA 2W0ZA 4Y92A 1OPLA 2KXDA 2YUNA 4AFQC 1A0NB 2AZSA 4AFSC 2KE9A 1EFNA 2EGCA 5IHNA 1X6BA 4LN2A 3ULRB 4D8KA 2DX1A 2M51A 1RUWA 2FEIA 2J6KA 4HXJA 4X1VA 1YP5A 3EGUA 1H92A 1W6XA 2AZVA 1TUCA 2MIOA 1NLOC 3VS3A 2J7IA 1N5ZA 2GNCA 1KSWA 3C0CA 1UG1A 2G6FX 1AWXA 1AWJA 2LJ0A 1UHCA 1K1ZA 1H8KA 1BK2A 2CDTA 1BBZA 2K9GA 2DNUA 2F2WA 4JJCA 3VS4A 2W10A 1SHFA 1GCPA 4RTTA 3EG2A 2A36A 4GBQA 5HCKA 1M3AA 2GGRA 2YT6A 1QCFA 4J9EA 1UJ0A 2DL4A 2DLPA 1JQQA 1UECA 4OMPA 1T0HA 2DMOA 2K3BA 2A28A 2EGAA 4Z88A 2HCKA 1SPKA 3TSZA 3PE0A 1VA7A 2AKLA 2HDAA 2K79A 1CKAA 3NMZC 1UTIA 3VRYA 4M4ZA 2X3WD 3PVQA 1NYGA 3O5ZA 4RTUA 2DA9A 1Z9QA 3SEMA 2J05A 1JXMA 4OMOA 2BZYA 2IIMA 4JZ4A 4AG2C 1K4US 3VS1A 2V1QA 2KROA 3I5SA 2RQUA 4HVVA 5I11A 1WDXA 3VS5A 2GBQA 1QWFA 2FRWA 2DBKA 1TG0A 2LJ1A 1I0CA 1T3SA 2CREA 1HJDA 2SRCA 2C0IA 2FPEA 4GLMA 4F17A 1SRMA 4J9IA 3M0PA 2EQIA 1KFZA 1MUZA 2KEAA 2JS2A 2LQWA 1G83A 1LCKA 1BB9A 1ZSGA 2DF6A 5FW9A 2DYBA 1IO6A 2LZ6B 4RTZA 2DJQA 1I07A 4LUEA 4Z8AA 2I0NA 5I22A 1AEYA 2DM1A 1X6GA 1GBRA 2KYBA 1X2KA 1GL5A 1PKTA 2L2PA 1K0XA 2JMAA 1WLPB 1UHFA 2J6FA 3ZL7C 2KBTA 3THKA 1OOTA 1HD3A 1SHGA 3GBQA 2DRMA 1RI9A 2D0NA 1PKSA 4DEXA 5IHKA 3EG1A 3H0IA 2JT4A 1AVZC 4K11A 3QWYA 4J9FA 2GTJA 2FO0A 2QDLA 2JM9A 2XMFA 4A63B 1B07A 3H0FA 1RLQC 1GCQA 1QKWA 2DRKA 2FPDA 1UE9A 5EC7A 4D8DA 1PRMC 1NYFA 2KT1A 3A98A 2LCSA 1XOVA 2YUQA 4DEYA 1M27C 2EW3A 4CC4B 1HSQA 4LNPA 2PNIA 2MOXA 2O88A 2PZ1A 2FRYA 1BU1A 1YWPA 2EVRA 2V1RA 2CUDA 2LX7A 4OMNA 1GFCA 3UATA 1QLYA 1AZGB 1T3LA 1ZUUA 2RPNA 2RQTA 2E5KA 3EHRA 4J9HA 3UF4A 5L23A 4E6RA 4RTVA 1PNJA 4EIKA 2DL7A 2EBPA 4OMMA 4HVWA 1X2QA 3CQTA 3VS6A 4LUDA 3U23A 1J3TA 4HCKA 2P4RA 2ROTA 3I9QA 5IXFA 3VS0A 1PWTA 1ZUKA 2J6OA 1PHTA 5FWBA 1FYNA 2MCNA 2A37A 1X69A 2ENMA 2OAWA 3TSWA 1FMKA 2L0AA 2DBMA 2CT4A 2GQIA 2ABLA 2L3PA 2HBWA 1W70A 2EPDA 1WIEA 2DL8A 4JZ3A 5GJWB 2BTTA 1JU5C 2NWMA 4IIMA 2JW4A 3SHWA 1JO8A 2KXCA 3JV3A 2CSIA 3EG3A 2F2VA 2LJ3A 1K9AA 1JXOA 1WYXA 5IXBA 1RLPC 2L3SA 3QWXX 2H8HA 4JPBW 3VS7A 1TUDA 2CH4A 4ZNXA 2RQVA 2DILA 2EYXA 2KRMA 3M0QA 1NM7A 1OEBA 1M30A 1NEGA 2HSPA 4J9GA 1WX6A 4CC2A 1WFWA 2ROLA 3M0SA 4F16A 1WA7A 2F2XA 1VYTA 1AD5A 1U5SA 5ECAA 2KT8A 2KRSA 2M0YA 2EYZA 2RQRA 2RNAA 2YUOA 1UGVA 4AG1C 1NLPC 4RTXA 1JEGA 1WXBA 2RMOA 1Z9ZA 1K76A 1E6HA 4KRTA 2DL3A 1ZUYA 1CKBA 2AK5A 2O9VA 2DE0X 4RUGA 2EYYA 1AOJA 2C0TA 5GJVB 4OMLA 3NGPA 2LMJA 1UFFA 3KFVA 2ECZA 2YSQA 2DVJA 1ARKA 5IH2A 4F14A 4OMQA 3NPFA 2DL5A 2RQWA 1GBQA 2RF0A 2K7AA 1KJWA 1GFDA 3UA7A 1W1FA 2O2OA 1YN8A 1WXTA 2RN8A 4RTYA 4JJDA 2FG0A 2L3QA 2VWFA 5FWCA 4WCIA 2CT3A 4HVUA 2NUZA 3PVLA 1QKXA 2D1XA 2J06A 2O31A 1U06A 4J9CA 1Y0MA 2EGEA 4RTWA 2BZXA 3VS2A 1SRLA 1B3QA 1G2BA 2JM8A 3I5RA 3LH5A 2EYWA 2CSQA 2D8HA 2YDLA 1ZBJA 2K6DA 4J9BA 2PTKA 3M0UA 1YWOA 1S1NA 2KR3A 2OJ2A 1ABOA 1M3CA 3TVTA 3EHQA 2ED1A 4CC3A
chains in the Genus database with same CATH superfamily
2VV5A 3UA6A 3UT1A 1D1CA 3CC4Q 3P8BB 4FYWB 4OB1B 4Z89A 4BACA 3M58A 1RI0A 5GAMe 1AT1B 2EJGA 2ED0A 3OMGA 5A0DA 1YNZA 1Q86U 3G7ZA 5AYFA 3VRZA 4A4GA 1QMCA 1KIKA 3NTHA 5KYYA 2DVEA 1OZ2A 2LQNA 1MV3A 3JCMh 2E41A 1C0MA 3EH2A 4C8QB 3C12A 1VQ8T 2QTXA 4M7DE 2PVOB 3E9FA 2M16A 4M75C 1T0JA 2VKNA 2LRQA 3H41A 2IG0A 3A8MB 5J39A 4CC7A 5GAN3 1AZEA 2XK0A 2CKKA 1D3BA 5GAN6 2HBPA 3X26B 4C5HA 3I55T 2PUKB 2X3XD 3WXMB 4RG8A 1VQ4T 5L8RE 4ZN1A 1K0SA 1PCXA 2RHYA 1X27A 4PJNA 2KRNA 2SEMA 2KNBB 2QGFB 4M77A 3M0TA 4AFUC 3X25B 2ZPHB 4J9DA 4C92C 1LJOA 2RJCA 4PJOB 2V26A 5GAOr 1XNIA 3ZEHA 4PKCC 1UUEA 2DJZA 1TOVA 4DBRA 4N0AC 2W0ZA 2KY9A 1TS9A 2ZPBB 2AZSA 5AT1B 2KE9A 5GANe 2EGCA 5IHNA 1X6BA 4E7SA 4LDWA 4X9DA 2DX1A 2M51A 2FEIA 2J6KA 4HXJA 3L2ZA 1IGQA 4AT1B 1VQ5A 3GF5A 3UDCA 5GANf 4M75B 2MIOA 1MMDA 2KK4A 2CYZB 4LDUA 4B6MA 4PL6A 2G6FX 4L5GA 3G4ST 1UHCA 4LXCA 1H8KA 2K5LA 3QDFA 1BBZA 2K9GA 2DNUA 2D0QB 3LH0A 4JJCA 1RABB 3CCQQ 5CKEA 2E4HA 3FDRA 5HCKA 2GGRA 2QYZA 2X4XA 5GAN2 2ZCFB 3HRSA 1PSEA 2I2LA 1JQQA 1UECA 3C95A 1VQKQ 1TWBA 2EGAA 2XDPA 2HCKA 3L2QA 2JTMA 3TSZA 2HDAA 2KSSA 3NMZC 1UTIA 4M4ZA 4KBMB 3MEUA 1B34A 3PVQA 2K3YA 3DB3A 5KYWB 4UC4A 3GNFB 2DA9A 1Z9QA 3G71A 1JXMA 2BZYA 2IIMA 3PIPA 2RK2A 4OP0A 3VS1A 2CZ1B 4PJMA 5I2SA 4FW1A 3QZ9B 3DLLA 1YJNQ 3VS5A 2E12A 2LX9A 2DFUA 2DBKA 3OYAA 1I0CA 1T3SA 3RERA 1M1KC 1HJDA 1PG5B 1UGSB 2FPEA 2DETA 2XU8A 3M0PA 2EQIA 2K4YA 1MUZA 3OS5A 1VQ7Q 1Q81C 5CR2A 1R0BG 3CCLA 1OQKA 4O5VA 5FW9A 3CCQT 2DYBA 2LZ6B 4RTZA 2DJQA 4Z8AA 4YTLA 1VQMA 3CCMA 3V7CA 3PMTA 4NS5A 1H641 2DTIA 4XU1A 1UHFA 3HHTB 1XQHA 3OYKA 2VXFA 1TUGB 2Z0WA 3THKA 1K9MR 4N4IA 5CKBA 3CD6A 1I8FA 1ZHIA 3GBQA 2DRMA 3JCMd 1PKSA 2DAQA 3EG1A 3H0IA 1WJRA 1KQSA 2NLUA 2RH2A 3QYGB 1G3WA 2K5IA 2PQWA 4M77D 4M7DG 2YHTA 4C0GA 3H0FA 4QQDA 1QKWA 4D8DA 1X75C 3A98A 4M75A 2EIFA 2YWWA 1YJNT 1M27C 3MKDA 2EYQA 2QASA 1HSQA 2O88A 4B9XA 3PGGA 2PZ1A 2FRYA 3QJYA 2X35A 2EVRA 2O4XB 2QK0A 1BYMA 2LX7A 4M7DF 3UATA 3JCMP 3QJ6A 2JUFA 3V8JA 4E6RA 1LOJA 4RTVA 1WHHA 2CGHA 4DBQA 2PVDB 4FYYB 2EBPA 1OULA 4DBHA 1VQ7T 1J3TA 2EQMA 3RIRA 3FLGA 3HTRA 5GAMh 5LJ3j 4C92A 5FWBA 1FYNA 2MCNA 3JAME 5DM7R 1I5LA 2A37A 1S72Q 4KUIA 1KQSP 4JJNK 1X69A 3NTIA 3V8KA 3CC2Q 2OTJT 4N0AA 4OB0B 3A8LB 4EDUA 4A4HA 1R0CB 2E1HA 3CC7A 5KYWA 2EPDA 4JZ3A 1WHMA 1IHWA 2BTTA 1JU5C 1U8RA 3SWNB 2DZ9A 3FEOA 3I55A 2KXCA 2DO3A 1VQ4A 4M77E 4ZTJA 4FT2A 1N8RC 1K9AA 4A54A 2L3SA 2DILA 2DK3A 1VUBA 2KRMA 1VQPQ 2HQHA 5LJ5g 3GIBA 1WFWA 2MWPA 1WA7A 4J7IA 2F2XA 3MEWA 1VYTA 5ECAA 4QQGA 3JCMf 3S3OA 3VKIA 3OBYA 2YUOA 1UGVA 3CXCS 2VGNA 5IN1A 3L2UA 4E7KA 2WSFE 4BI3A 4C8QD 3M59A 1NLPC 1YITT 3A5ZB 1JEGA 3OYCA 1Z9ZA 3EFSA 1SKUB 1VIFA 3PIOA 4KRTA 3JCMc 3G4SA 5D6WA 3WVEB 1ZUYA 2F1LA 3HL8A 4ZN3A 2E5QA 4RUGA 2EYYA 3CCST 2Y90A 4OMLA 3GNGA 1S72T 1VQ6Q 2DERA 2XD0A 2DVJA 1NJIU 4Y91A 5KYXB 1YFNA 5CQXA 2K3XA 2OTLQ 2DZCA 2E65A 1GBQA 3ER0A 2EFIA 2HAXA 4PJOD 1GFDA 3I56Q 1WXTA 4BE0A 4PJLA 2FG0A 2MWOA 3OYFA 5FWCA 4WCIA 5KYUA 2CT3A 4HVUA 4PK4A 2J06A 2OAUA 4V2SA 4KGVB 4HCCA 2EGEA 3R6OA 1Q86R 1G2BA 2LT1A 4LDVA 3I5RA 3QG1A 5LJ5j 4M75D 1NPPA 1JB0E 4C8QE 4IUPA 1ZBJA 4J9BA 2PTKA 3M0UA 3CMEQ 1YWOA 2QI2A 2KR3A 4M78B 5C0MA 3JCMX 2H3JA 1X01A 1ABOA 1M3CA 3QDRB 3M4GA 1V76A 4XQ3A 3LX7A 5C6SA 1Q7YC 2CP6A 3V7SA 1MV0B 1RAHB 2YUPA 4QKUA 3T9NA 3LWHA 4D6WA 1Q81R 3BFMA 1MNEA 4KGXB 1NG2A 3CCQA 1IB8A 4C92D 1ABQA 1MMAA 2EQUA 1I1JA 3E1SA 3CCEQ 1K8AU 1VYUA 3H0HA 3I35A 1UEBA 4PJOE 3EAEA 4PLIA 1QCNA 3G6ET 2R57A 3FJ5A 1VQKA 3CCUT 2V8JA 1GCQC 1IHVA 3REAB 4Z02A 4FSSA 4KGZB 5GAMd 3CBOA 4AFZC 2A08A 2LP5A 3OYBA 1GRIA 4M75E 4M7AG 1V1CA 4RMOA 1YJNA 2BZ8A 2ESWA 3ASKA 2K2VA 1UGQB 4LE9A 1E7OA 3EG0A 1M2OA 3AHUA 4LD6A 2K2MA 2FPFA 3VYGA 2JMCA 2IVWA 2HKQB 2JTEA 1V29B 3SDZA 2B86A 3PTAA 2CH4W 2LCLA 4M7AF 1VYVA 3OA6A 3IQLA 4ORZA 2KXDA 2YUNA 1VQ7A 4C5EA 4IKFA 1EFNA 4C92E 3L2WA 3TQ7P 1SG5A 1F1BB 3ULRB 1P92A 1YIJT 2COYA 3CCMT 2OTJA 3EGUA 2XIDA 2MI6A 1TH7A 3VS3A 4C8QC 3OYMA 4E7LA 4BE2A 2J7IA 2L5QA 4JS5A 1AWJA 5DLQE 1N9SA 2LJ0A 1C1AA 1BK2A 4C5IA 2CDTA 3CBMA 1WHGA 4J6WA 2F2WA 5D7UA 3VS4A 2KQWA 4OB3B 2RHUA 2B8AA 2YRDA 1W2BS 2LT4A 4E7IA 5GANd 1M3AA 4J9EA 2VUBA 1UJ0A 2RHZA 2YXYA 1LVKA 2E6NA 2DMOA 2YRVA 2HMAA 3EGDB 4E7ZA 2YLCA 1VA7A 4PJOC 2MF2A 3OQ5A 1YITA 5GAMf 2DEUA 1BIAA 1OI1A 3C94A 3QHSA 2ZPGB 5IAYA 4AG2C 5LL6S 3A8OB 4ME7A 3FC3A 2RQUA 1KD1U 8ATCB 3RMSA 3CCSA 3JB9I 1GXIE 1S72A 4RG2A 2DPPB 2CREA 1IREB 3CPWA 1IZ6A 4GLMA 5GAOl 3CC7T 4F17A 1I81A 3JB9D 2QG9B 3CXCA 5CIUA 1NPRA 2JS2A 2LQWA 3MJXA 1SF9A 1G83A 1BB9A 5KE2A 5D6YA 1IO6A 3EGXB 4OF1A 1M90C 4HT9A 4MZMA 2CZ7B 1PKTA 2L2PA 2NUTB 3GP8A 2JMAA 4A4EA 3EG9B 4ELYC 4QVZA 3CC4T 3GPLA 1SHGA 4CI0C 1RI9A 2D0NA 4DEXA 2HQEA 5FRNA 2CP2A 2QEXQ 1Q82C 2QQRA 2JT4A 1YBYA 1XTDA 3OS1A 2QDYB 4J9FA 2FO0A 3OYGA 2JM9A 2XI9A 2NUPA 2P0QA 1Q7YR 1GCQA 4BDZA 2NYSA 2DRKA 1UE9A 5EC7A 2FYKA 1PRMC 5DLOA 3CEYA 2KT1A 2LCSA 1BI2A 2DKGA 5CCAA 3CXCP 2LQKA 2MOXA 1VOMA 1BU1A 2O01E 1YWPA 1YJ9Q 3A8GB 1ZUUA 2RQTA 2E5KA 4J9HA 5L23A 1TSFA 3QIIA 3M54A 5GAN5 4LDXA 4A4KA 3G6EA 2AIRB 2OTLA 4OMMA 3CCUA 4HVWA 1IXDA 1X2QA 2JTFA 3VS6A 4J83A 4LUDA 1TTHB 4QW2A 4O6JA 3U23A 4M75F 1Y96B 1PWTA 1PHTA 4BI4A 1HXDA 1O75A 1KC8U 3HSBA 3INZA 4EMHA 4XU3A 1FMKA 3LGLA 4C92G 2DBMA 2GQIA 4FIBA 2L3PA 5GMKl 2HBWA 1QW1A 4ZGJB 4KUDK 5GJWB 2XHCA 1Q86C 1G5VA 4IIMA 2JW4A 1SSFA 3SHWA 5FU6B 2L89A 3J81E 2QEXT 2LQ8A 2GF7A 3EG3A 3CMEA 5GAOn 4C8QA 4C92F 1WYXA 3FB9A 4JPBW 1RLPC 3QBYA 2LDMA 3VS7A 1TUDA 1BIBA 2CH4A 4ZNXA 1N8RU 3VV0A 1OEBA 1NEGA 3CCJQ 4P5NA 2VB6A 1G3TA 2ATCB 4NL2A 1K73U 3H9NA 8AT1B 3OYIA 3L2VA 3RDVA 1U5SA 2DTHA 5LJ3g 1YIJA 3C4SA 4JRQA 1VQ9Q 3KXTA 2YRCA 1YI2Q 3FIFA 1U1TA 1WXBA 2FZGB 1K76A 5GMKj 1VQKT 4PJOA 2X4JA 3F70A 3OYYA 5CKHA 4C0FA 2O9VA 3M53A 2DE0X 2CP0A 3OS2A 5GJVB 3RKWA 4XTUA 4HCZA 2LMJA 1G3YA 3HP9A 2YSQA 2XICA 5I2MA 1WQ7A 2X9HA 3SWNC 3L42A 4DBFA 4LDYA 1VQNQ 2YLBA 1EIFA 4E7HA 3JSCA 4M7DB 2RF0A 2K7AA 3UA7A 3J80E 2FB7A 2O2OA 5IT9E 2DXCA 2E3IA 1MHNA 2RN8A 1M9SA 4FL6A 1WHKA 3E9GA 4X9CA 1OZ3A 3SB2A 3L2RA 3DKMA 2O31A 2D1XA 3JCMV 1Y0MA 4RTWA 2BE9B 2JM8A 1MGQA 2E6ZA 4FYXB 1W2BA 1TXQA 2CSQA 2D8HA 2YDLA 3QKJA 1KHCA 3E2UA 1OU9A 1VQ9T 1WJQA 1D0YA 1Y96A 1BCMA 3JCMb 1M1FA 1YHQQ 2HL3A 3AT1B 3EFOB 2ZPIB 1SEMA 1W4SA 2JXBA 1RACB 2CUBA 2P0KA 4BB7A 4R0KA 1UB4A 4EMKB 1FXXA 1H3HA 3CMAQ 4IUTA 4DQ2A 4BUGA 2JS0A 4Q5WA 3MP6A 4XTZA 1M90R 2H3EB 2HNIA 2AT1B 1FWZA 3VJPA 1Y57A 2G3RA 4L6V5 4IUVA 5IHIA 2BE7D 2GQVA 3CC4A 4XK8E 2QGGA 1JBMA 2AKKA 2DIQA 2HD0A 4ATOA 4R56A 1QVFS 3VUZA 3CPWS 1W2BP 3JB9G 4JLGA 2LCCA 3NHNA 2P4TA 2VGMA 2GFUA 1Q82R 1VQOQ 5GAN8 2QA4Q 1ZSZC 1AWOA 1NEBA 3NTKA 2GCXA 1I5OB 5LJ5h 3RBBB 1B7TA 2RHXA 3RR6A 1QWEA 1WI7A 3JB9F 4GY5A 2RI5A 4ANJA 4M78C 3X28B 1U1SA 1UDLA 1WJSA 3M0RA 3CCVQ 3UPUA 5GANg 2VVKA 1E6GA 3CC2T 1YHQT 3D7SB 5A2QE 2EKHA 3P8DA 3META 1PRLC 4XAXB 3LWIA 1N9RA 4JJBA 1KK7A 1OPLA 5FROA 1A0NB 3HFNA 4AFSC 1JJ2S 3JB9H 1WNLA 2P0PA 4LN2A 4D8KA 1ZBXA 4JRIA 4C0DB 1NZ9A 4II1A 4X1VA 4PFOA 2AZVA 2O4XA 5KH6A 1VQPT 2GNCA 3EFRA 1UG1A 4J7FA 1ZSZB 2QXFA 2IPOB 2VXEA 3HRTA 2QEXA 1K9MU 1SHFA 1VQOT 4RTTA 2A36A 4GBQA 2YT6A 3G71Q 1QCFA 4PFPA 1D0XA 2DL4A 2DLPA 1KD1R 4FYVB 4M7AC 1T0HA 3H8ZA 4F7UB 2A28A 3EFOA 2COWA 1O9SA 3PE0A 1RADB 2K79A 3KUFA 5KCHA 2LTOA 4MDWA 1D09B 1YJ9A 2X3WD 3SWNA 4JLIA 4EMKA 2DEQA 4FT4A 1NYGA 3ZFJA 5GANj 5GMKe 1VQ6T 4RTUA 3LW5E 3QO3A 4OVAA 2J05A 2VC8A 4FU6A 5CQYA 3CPFA 5GAOm 4JZ4A 2OTLT 3I5SA 1WQWA 3HRUA 3CCLQ 4HVVA 5I11A 5I21A 3I56T 1WDXA 2FRWA 2EQJA 2HQXA 1D1BA 2RD1A 1VQMQ 1PD1A 4WTOB 1TG0A 3JCMQ 3TU4K 3VUBA 2LJ1A 2SRCA 2M02A 2RA2A 2Y4YA 2RI2A 4MMLA 1KFZA 2RB6A 5CO7A 2M1HA 3SD4A 4CRIA 2EKOA 1BI1A 1IRXA 2ZPEB 1ZSGA 2DF6A 5CVIA 4M7AB 1FMVA 3JCMJ 2KDSA 2BIVA 3CMET 1I07A 2I0NA 2MK5A 2DM1A 2KYBA 4TVRA 1OX9A 1PC0A 1K0XA 5EG2A 1WLPB 4IUUA 4EPCA 2J6FA 4M77G 5LJ3e 2KBTA 1D1AA 1OOTA 5KYXA 5IHKA 4JS4A 1RAGB 1DJ7B 1D0ZA 2GFAA 3FJPA 1ZQ1A 1AVZC 2KAFA 3DB4A 2AHJB 4MMKA 1VQ9A 4K11A 4FCYA 2QDLA 2XMFA 2FL7A 1B07A 1R77A 3CCET 4M77F 2QQ9A 1RLQC 2FPDA 2BUDA 2DXTA 2WACA 4DEYA 3V8LA 3UWNA 3HFOA 6AT1B 3HKSA 1VQ8Q 4J6XA 2CP3A 4CC4B 4LNPA 3VYHB 1ZSZA 1YJWQ 2A7YA 2JZ2A 1GFCA 4ZGDB 1LNXA 1Q95G 1T3LA 2CP5A 2RPNA 1N6AA 4M78A 1PNJA 3ME9A 1VQNA 2DL7A 4HCKA 2P4RA 2ROTA 3I55Q 4QQ6A 2WSEE 1VQ4Q 4KT0E 5CK9A 1IGUA 4F7UA 5FLXE 2DD4A 1I4K1 2C06A 5HKCA 3PFSA 3OYHA 3LGFA 2OAWA 3MCAB 3TSWA 1C6VX 3OYDA 2F5KA 2CT4A 1QQJA 1YCYA 3J7AF 4EMGA 2K5FA 3OW2A 1UGRB 1B34B 3JCMg 2QAZA 3JRZA 1JO8A 3JV3A 4PJJA 2CSIA 5KYNA 1K8AC 5KE3A 2F2VA 3S3MA 1JXOA 5M9OA 1XJWB 2H8HA 3MEVA 3CC2A 1YHQA 2MYSA 2MAMA 1QVGS 1NE8A 2EYXA 1QP3A 4C8QG 1QVFA 2QQBA 3LLRA 3OB9A 1M30A 2JNGA 2MMPA 3G4SQ 1QCOA 2HSPA 1WX6A 3L1AA 1M1KU 4CC2A 2ROLA 4XTXA 4F16A 2MPXC 2R58A 3CMAA 1AD5A 2M0YA 1YJWT 2RQRA 2RNAA 3A8HB 5DY9A 1Q81U 4ZGEB 1MMNA 4C8QF 4M7AA 1BKBA 2RMOA 5LJ5e 3BE3A 2EJFA 1VQPA 1E6HA 4XU0A 1OYXA 3OW2P 3A1PA 1CKBA 3BW1A 3OYJA 5LJ5f 3RKXA 3M5AA 4PFZA 3KBGA 4PJOG 1MMGA 1AOJA 1VQOA 3KFVA 2QA4A 2F5TX 4JRPA 2CP7A 1ARKA 1RAAB 1JJ2A 1QVFP 3CPWP 2DL5A 5J3BA 5FU6C 5KCOA 4DOWA 1KJWA 1W1FA 4PJOF 1YN8A 4RCBA 4BD3A 2A0FB 2CS7A 3CCVA 4M75G 2E70A 3MP1A 2ZGWA 1RAFB 1VQ6A 5CAIA 1U06A 4HCBA 2BZXA 3CCRQ 3LH5A 3MEAA 2QTVA 1N27A 3I56A 4OGCA 2RM4A 3EGDA 1S1NA 2X51A 2RK1A 3TVTA 5GMKh 3EHQA 2COZA 1U3OA 1X43A 3OY9A 1JJ2P 4ESRA 4M78D 3R6NA 2O9SA 4JDSA 4C92B 3PNWC 1G8XA 1OV3A 3M56A 5HY6A 3RKYA 1KQ1A 1CSKA 1OPKA 2DIGA 2KMTA 1OU8A 3RNJA 2A3LA 3REBB 3E19A 2KYMA 2ZZDA 2L3RA 2KVQG 2VASA 4RKUE 2EWNA 2LNHB 2RO0A 4M7DC 3JB9J 4WF2A 1UJYA 4XTYA 2JJ9A 2L8DA 1KD1C 2V8IA 2D8JA 1BI3A 2V8KA 1ZX6A 3MP8A 4QT7A 2CZ6B 1ZLMA 1NJIR 2GTOA 2OI3A 1YCSB 2KGTA 4IIOA 1YJ9T 1FMWA 1SSHA 1VIEA 1QP2A 3CCEA 3P8HA 3BDUA 2WSCE 3EGXA 2FZKB 3ZBDA 2HEQA 3QPHA 1AWWA 3CCRT 2JN0A 2NUTA 7AT1B 5LJ3h 1M3BA 2C0OA 3EG9A 1WXUA 3V7RA 1Y07A 1M8MA 2LVMA 2VYTA 3PT9A 3Q1JA 3MPUB 2OTJQ 5A0LA 4M78E 4A53A 2DD5A 4M7AD 4EMKC 4C0ZA 2E3HA 1VQLQ 1PM3A 1G3SA 4Y92A 4AFQC 4F7UE 2LNVA 4XTWA 4BE1A 1M1GA 3GLXA 2LC4A 3BDLA 1RUWA 3OMCA 3RMQA 1YP5A 1LPLA 1H92A 1W6XA 1M4ZA 1TUCA 4HT8A 1NLOC 2DXBA 1N5ZA 3C0CA 1KSWA 1PD0A 1AWXA 2EQKA 3CCJT 1K1ZA 5KYUB 2CZ0B 1K8AR 3LYIA 2W10A 1GCPA 3EG2A 2M9UA 5GAMg 3QZ5B 2QQAA 1YITQ 1RAEB 2BKDN 4PNOA 1YI2T 1KHIA 4JUVA 1JRIA 3TCJA 3M9QA 4OMPA 3DLMA 4BDYA 3O8VA 3OYEA 2K3BA 4QVDA 4Z88A 1KC8C 1VQ8A 2HZYA 3X20B 1SPKA 1Q7YU 2AKLA 2RJFA 1CKAA 4R55A 2RJEA 3VRYA 3OW2S 1YJWA 3CCSQ 2M0OA 4M7AE 3O5ZA 2XDDA 2DTOA 2JOYA 3SEMA 2HL5C 3N5BB 3SFMA 4OMOA 5GAN4 1VQNT 1Y71A 1VQLT 3EH1A 1K4US 4RCCA 4ELZC 2V1QA 2KROA 2ZPFB 4C0DC 1WZOA 3OBWA 1OX8A 2GBQA 1QWFA 1QVGA 4MDXA 3G1JA 4DA4A 1Y7XA 3TREA 3PMIA 3BY7A 1K73C 1WGSA 3URGA 2C0IA 3JCMe 2HKNA 4HA8A 5HK0A 3VU3C 1SRMA 4X34A 4J9IA 4E47A 2KEAA 2RJDA 1LCKA 2DXUA 9ATCB 1BI0A 4LUEA 5I22A 5GAMj 1VQ5Q 1AEYA 5HK3A 1GBRA 1X6GA 3OYNA 1X2KA 1GL5A 2OX7A 2R5MA 3RUXA 1ZA1B 2EJ9A 3ZL7C 5GAOp 1PSFA 3S3NA 4VUBA 1HD3A 4MZTA 5GMKi 4AMCA 4KULA 3CMAT 5GANh 2XDBA 1UGPB 4M7DA 1QVGP 1AHJB 2JVVA 3QWYA 2GTJA 5GAOq 4A63B 5CKFA 5FRMA 3G6EQ 3CCUQ 1NYFA 1M2VB 1RAIB 1XOVA 2YUQA 4OB2B 2D6FA 4PLLA 2EW3A 3NFCA 5GAN7 4GLKA 2PNIA 1WPYA 4L59A 2P84A 5LJ3d 2FVUA 2V1RA 2CUDA 4J6YA 4OMNA 3MHXA 2E64A 1QLYA 2QA4T 1TU0B 1AZGB 3QXEB 3EHRA 3UF4A 4C5GA 4EIKA 3M55A 2FHDA 3CQTA 4KH0B 4ZTFA 4M78G 4DOVA 3I9QA 1HYOA 3OSVA 5IXFA 3VS0A 1ZUKA 2J6OA 3CCVT 3GOXA 1VQ5T 5J26A 2ENMA 1KG1A 1M1KR 2L0AA 2FZCB 4F7UG 2XG8D 4OMFB 2ABLA 4A4FA 3MO8A 4M77C 1W70A 2X4WA 1WIEA 2DL8A 2XKOC 4M78F 1R8OB 3OS0A 2NWMA 3CCRA 4OGEA 4IURA 4QVCA 1MNDA 4NL3A 4F04B 5KYYB 1YIJQ 2LJ3A 4BI8B 4F7UF 2X4YA 5IXBA 1KQ2A 3CCMQ 3QWXX 1M5Q1 2E10A 1BCOA 2RQVA 2RHIA 3HPWA 3M0QA 1NM7A 5CKDA 1FX7A 4J9GA 3CBPA 3CD6Q 2ZAEA 3M0SA 2RI3A 2PUOB 4HKEA 2KT8A 2KRSA 2F69A 2EYZA 4BY6C 4AG1C 4XU2A 3FRNA 5A0GA 3M4YA 1QVPA 4RTXA 4E7JA 1HK9A 1D3BB 3G71T 1M8VA 1WHLA 3OSSC 4B9WA 2EAYA 4XTVA 2HSEB 1M90U 4E2FB 2DL3A 4FW2A 3CCJA 4J5YA 1H3ZA 2QQSA 2K57A 2AK5A 4KH1B 4IUQA 3OYLA 4FSXA 4M77B 5FU7C 1NJIC 2C0TA 2PU9B 3NGPA 5LJ3f 2PVGB 1NBEB 3QSUA 1UFFA 1RL2A 2ECZA 4FM4B 1YI2A 5IH2A 1Q82U 4F14A 4OMQA 4N4HA 1KQSS 3NPFA 2RQWA 1X6OA 1KC8R 5LJ5d 5D6XA 3CCLT 3X24B 1M2VA 2NUPB 3M57A 4RTYA 1EX4A 4JJDA 3TEEA 4M7DD 1VQMT 3H6ZA 2L3QA 2VWFA 4N4GA 3RESA 2R5AA 4J8OA 2Y4XA 2NUZA 3JCMW 4LD9K 2D9TA 4BY6B 1ZA2B 3PVLA 4Y28E 1QKXA 2DYIA 4J9CA 3CC7Q 1WHJA 3VS2A 1EZZB 1SRLA 1VQLA 1B3QA 5GMKm 1K9MC 3CD6T 2EYWA 3S6WA 2KI7A 2K6DA 3QUIA 1N8RR 4MZPA 3QYHB 4JRKA 2OJ2A 3WVDB 1K73R 1ACMB 5FU7B 4NOYA 2ED1A 4CC3A
chains in the Genus database with same CATH topology
1U3OA 1X43A 4ESRA 3UA6A 1SEMA 2JXBA 3R6NA 1MV0B 2O9SA 2YUPA 2CUBA 4Z89A 1OV3A 4R0KA 1OPKA 1CSKA 1H3HA 3RNJA 2ED0A 3REBB 2KYMA 2JS0A 1NG2A 1YNZA 1ABQA 1I1JA 3VRZA 1KIKA 2LNHB 1VYUA 1Y57A 1UJYA 3H0HA 3I35A 2LQNA 1MV3A 5IHIA 3FJ5A 2D8JA 2AKKA 1GCQC 1ZX6A 4QT7A 3REAB 1ZLMA 2GTOA 3NHNA 1T0JA 2VKNA 2OI3A 4FSSA 1YCSB 2KGTA 4IIOA 3H41A 1SSHA 4CC7A 1AWOA 1NEBA 1AZEA 4AFZC 2A08A 2LP5A 1GRIA 3RBBB 2HEQA 1AWWA 1V1CA 1QWEA 1WI7A 1M3BA 2BZ8A 2C0OA 1WXUA 1UDLA 2ESWA 4LE9A 2X3XD 3M0RA 1E7OA 1M8MA 3EG0A 1K0SA 1X27A 2KRNA 2SEMA 2K2MA 2KNBB 2FPFA 2VVKA 3M0TA 4AFUC 2JMCA 1E6GA 4J9DA 2JTEA 2B86A 2CH4W 2EKHA 1UUEA 1PRLC 1VYVA 3IQLA 4JJBA 4ORZA 2W0ZA 4Y92A 1OPLA 2KXDA 2YUNA 4AFQC 1A0NB 2AZSA 4AFSC 2KE9A 1EFNA 2EGCA 5IHNA 1X6BA 4LN2A 3ULRB 4D8KA 2DX1A 2M51A 1RUWA 2FEIA 2J6KA 4HXJA 4X1VA 1YP5A 3EGUA 1H92A 1W6XA 2AZVA 1TUCA 2MIOA 1NLOC 3VS3A 2J7IA 1N5ZA 2GNCA 1KSWA 3C0CA 1UG1A 2G6FX 1AWXA 1AWJA 2LJ0A 1UHCA 1K1ZA 1H8KA 1BK2A 2CDTA 1BBZA 2K9GA 2DNUA 2F2WA 4JJCA 3VS4A 2W10A 1SHFA 1GCPA 4RTTA 3EG2A 2A36A 4GBQA 5HCKA 1M3AA 2GGRA 2YT6A 1QCFA 4J9EA 1UJ0A 2DL4A 2DLPA 1JQQA 1UECA 4OMPA 1T0HA 2DMOA 2K3BA 2A28A 2EGAA 4Z88A 2HCKA 1SPKA 3TSZA 3PE0A 1VA7A 2AKLA 2HDAA 2K79A 1CKAA 3NMZC 1UTIA 3VRYA 4M4ZA 2X3WD 3PVQA 1NYGA 3O5ZA 4RTUA 2DA9A 1Z9QA 3SEMA 2J05A 1JXMA 4OMOA 2BZYA 2IIMA 4JZ4A 4AG2C 1K4US 3VS1A 2V1QA 2KROA 3I5SA 2RQUA 4HVVA 5I11A 1WDXA 3VS5A 2GBQA 1QWFA 2FRWA 2DBKA 1TG0A 2LJ1A 1I0CA 1T3SA 2CREA 1HJDA 2SRCA 2C0IA 2FPEA 4GLMA 4F17A 1SRMA 4J9IA 3M0PA 2EQIA 1KFZA 1MUZA 2KEAA 2JS2A 2LQWA 1G83A 1LCKA 1BB9A 1ZSGA 2DF6A 5FW9A 2DYBA 1IO6A 2LZ6B 4RTZA 2DJQA 1I07A 4LUEA 4Z8AA 2I0NA 5I22A 1AEYA 2DM1A 1X6GA 1GBRA 2KYBA 1X2KA 1GL5A 1PKTA 2L2PA 1K0XA 2JMAA 1WLPB 1UHFA 2J6FA 3ZL7C 2KBTA 3THKA 1OOTA 1HD3A 1SHGA 3GBQA 2DRMA 1RI9A 2D0NA 1PKSA 4DEXA 5IHKA 3EG1A 3H0IA 2JT4A 1AVZC 4K11A 3QWYA 4J9FA 2GTJA 2FO0A 2QDLA 2JM9A 2XMFA 4A63B 1B07A 3H0FA 1RLQC 1GCQA 1QKWA 2DRKA 2FPDA 1UE9A 5EC7A 4D8DA 1PRMC 1NYFA 2KT1A 3A98A 2LCSA 1XOVA 2YUQA 4DEYA 1M27C 2EW3A 4CC4B 1HSQA 4LNPA 2PNIA 2MOXA 2O88A 2PZ1A 2FRYA 1BU1A 1YWPA 2EVRA 2V1RA 2CUDA 2LX7A 4OMNA 1GFCA 3UATA 1QLYA 1AZGB 1T3LA 1ZUUA 2RPNA 2RQTA 2E5KA 3EHRA 4J9HA 3UF4A 5L23A 4E6RA 4RTVA 1PNJA 4EIKA 2DL7A 2EBPA 4OMMA 4HVWA 1X2QA 3CQTA 3VS6A 4LUDA 3U23A 1J3TA 4HCKA 2P4RA 2ROTA 3I9QA 5IXFA 3VS0A 1PWTA 1ZUKA 2J6OA 1PHTA 5FWBA 1FYNA 2MCNA 2A37A 1X69A 2ENMA 2OAWA 3TSWA 1FMKA 2L0AA 2DBMA 2CT4A 2GQIA 2ABLA 2L3PA 2HBWA 1W70A 2EPDA 1WIEA 2DL8A 4JZ3A 5GJWB 2BTTA 1JU5C 2NWMA 4IIMA 2JW4A 3SHWA 1JO8A 2KXCA 3JV3A 2CSIA 3EG3A 2F2VA 2LJ3A 1K9AA 1JXOA 1WYXA 5IXBA 1RLPC 2L3SA 3QWXX 2H8HA 4JPBW 3VS7A 1TUDA 2CH4A 4ZNXA 2RQVA 2DILA 2EYXA 2KRMA 3M0QA 1NM7A 1OEBA 1M30A 1NEGA 2HSPA 4J9GA 1WX6A 4CC2A 1WFWA 2ROLA 3M0SA 4F16A 1WA7A 2F2XA 1VYTA 1AD5A 1U5SA 5ECAA 2KT8A 2KRSA 2M0YA 2EYZA 2RQRA 2RNAA 2YUOA 1UGVA 4AG1C 1NLPC 4RTXA 1JEGA 1WXBA 2RMOA 1Z9ZA 1K76A 1E6HA 4KRTA 2DL3A 1ZUYA 1CKBA 2AK5A 2O9VA 2DE0X 4RUGA 2EYYA 1AOJA 2C0TA 5GJVB 4OMLA 3NGPA 2LMJA 1UFFA 3KFVA 2ECZA 2YSQA 2DVJA 1ARKA 5IH2A 4F14A 4OMQA 3NPFA 2DL5A 2RQWA 1GBQA 2RF0A 2K7AA 1KJWA 1GFDA 3UA7A 1W1FA 2O2OA 1YN8A 1WXTA 2RN8A 4RTYA 4JJDA 2FG0A 2L3QA 2VWFA 5FWCA 4WCIA 2CT3A 4HVUA 2NUZA 3PVLA 1QKXA 2D1XA 2J06A 2O31A 1U06A 4J9CA 1Y0MA 2EGEA 4RTWA 2BZXA 3VS2A 1SRLA 1B3QA 1G2BA 2JM8A 3I5RA 3LH5A 2EYWA 2CSQA 2D8HA 2YDLA 1ZBJA 2K6DA 4J9BA 2PTKA 3M0UA 1YWOA 1S1NA 2KR3A 2OJ2A 1ABOA 1M3CA 3TVTA 3EHQA 2ED1A 4CC3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U3O A;  1X43 A;  4ESR A;  3UA6 A;  1SEM A;  2JXB A;  3R6N A;  1MV0 B;  2O9S A;  2YUP A;  2CUB A;  4Z89 A;  1OV3 A;  4R0K A;  1OPK A;  1CSK A;  1H3H A;  3RNJ A;  2ED0 A;  3REB B;  2KYM A;  2JS0 A;  1NG2 A;  1YNZ A;  1ABQ A;  1I1J A;  3VRZ A;  1KIK A;  2LNH B;  1VYU A;  1Y57 A;  1UJY A;  3H0H A;  3I35 A;  2LQN A;  1MV3 A;  5IHI A;  3FJ5 A;  2D8J A;  2AKK A;  1GCQ C;  1ZX6 A;  4QT7 A;  3REA B;  1ZLM A;  2GTO A;  3NHN A;  1T0J A;  2VKN A;  2OI3 A;  4FSS A;  1YCS B;  2KGT A;  4IIO A;  3H41 A;  1SSH A;  4CC7 A;  1AWO A;  1NEB A;  1AZE A;  4AFZ C;  2A08 A;  2LP5 A;  1GRI A;  3RBB B;  2HEQ A;  1AWW A;  1V1C A;  1QWE A;  1WI7 A;  1M3B A;  2BZ8 A;  2C0O A;  1WXU A;  1UDL A;  2ESW A;  4LE9 A;  2X3X D;  3M0R A;  1E7O A;  1M8M A;  3EG0 A;  1K0S A;  1X27 A;  2KRN A;  2SEM A;  2K2M A;  2KNB B;  2FPF A;  2VVK A;  3M0T A;  4AFU C;  2JMC A;  1E6G A;  4J9D A;  2JTE A;  2B86 A;  2CH4 W;  2EKH A;  1UUE A;  1PRL C;  1VYV A;  3IQL A;  4JJB A;  4ORZ A;  2W0Z A;  4Y92 A;  1OPL A;  2KXD A;  2YUN A;  4AFQ C;  1A0N B;  2AZS A;  4AFS C;  2KE9 A;  1EFN A;  2EGC A;  5IHN A;  1X6B A;  4LN2 A;  3ULR B;  4D8K A;  2DX1 A;  2M51 A;  1RUW A;  2FEI A;  2J6K A;  4HXJ A;  4X1V A;  1YP5 A;  3EGU A;  1H92 A;  1W6X A;  2AZV A;  1TUC A;  2MIO A;  1NLO C;  3VS3 A;  2J7I A;  1N5Z A;  2GNC A;  1KSW A;  3C0C A;  1UG1 A;  2G6F X;  1AWX A;  1AWJ A;  2LJ0 A;  1UHC A;  1K1Z A;  1H8K A;  1BK2 A;  2CDT A;  1BBZ A;  2K9G A;  2DNU A;  2F2W A;  4JJC A;  3VS4 A;  2W10 A;  1SHF A;  1GCP A;  4RTT A;  3EG2 A;  2A36 A;  4GBQ A;  5HCK A;  1M3A A;  2GGR A;  2YT6 A;  1QCF A;  4J9E A;  1UJ0 A;  2DL4 A;  2DLP A;  1JQQ A;  1UEC A;  4OMP A;  1T0H A;  2DMO A;  2K3B A;  2A28 A;  2EGA A;  4Z88 A;  2HCK A;  1SPK A;  3TSZ A;  3PE0 A;  1VA7 A;  2AKL A;  2HDA A;  2K79 A;  1CKA A;  3NMZ C;  1UTI A;  3VRY A;  4M4Z A;  2X3W D;  3PVQ A;  1NYG A;  3O5Z A;  4RTU A;  2DA9 A;  1Z9Q A;  3SEM A;  2J05 A;  1JXM A;  4OMO A;  2BZY A;  2IIM A;  4JZ4 A;  4AG2 C;  1K4U S;  3VS1 A;  2V1Q A;  2KRO A;  3I5S A;  2RQU A;  4HVV A;  5I11 A;  1WDX A;  3VS5 A;  2GBQ A;  1QWF A;  2FRW A;  2DBK A;  1TG0 A;  2LJ1 A;  1I0C A;  1T3S A;  2CRE A;  1HJD A;  2SRC A;  2C0I A;  2FPE A;  4GLM A;  4F17 A;  1SRM A;  4J9I A;  3M0P A;  2EQI A;  1KFZ A;  1MUZ A;  2KEA A;  2JS2 A;  2LQW A;  1G83 A;  1LCK A;  1BB9 A;  1ZSG A;  2DF6 A;  5FW9 A;  2DYB A;  1IO6 A;  2LZ6 B;  4RTZ A;  2DJQ A;  1I07 A;  4LUE A;  4Z8A A;  2I0N A;  5I22 A;  1AEY A;  2DM1 A;  1X6G A;  1GBR A;  2KYB A;  1X2K A;  1GL5 A;  1PKT A;  2L2P A;  1K0X A;  2JMA A;  1WLP B;  1UHF A;  2J6F A;  3ZL7 C;  2KBT A;  3THK A;  1OOT A;  1HD3 A;  1SHG A;  3GBQ A;  2DRM A;  1RI9 A;  2D0N A;  1PKS A;  4DEX A;  5IHK A;  3EG1 A;  3H0I A;  2JT4 A;  1AVZ C;  4K11 A;  3QWY A;  4J9F A;  2GTJ A;  2FO0 A;  2QDL A;  2JM9 A;  2XMF A;  4A63 B;  1B07 A;  3H0F A;  1RLQ C;  1GCQ A;  1QKW A;  2DRK A;  2FPD A;  1UE9 A;  5EC7 A;  4D8D A;  1PRM C;  1NYF A;  2KT1 A;  3A98 A;  2LCS A;  1XOV A;  2YUQ A;  4DEY A;  1M27 C;  2EW3 A;  4CC4 B;  1HSQ A;  4LNP A;  2PNI A;  2MOX A;  2O88 A;  2PZ1 A;  2FRY A;  1BU1 A;  1YWP A;  2EVR A;  2V1R A;  2CUD A;  2LX7 A;  4OMN A;  1GFC A;  3UAT A;  1QLY A;  1AZG B;  1T3L A;  1ZUU A;  2RPN A;  2RQT A;  2E5K A;  3EHR A;  4J9H A;  3UF4 A;  5L23 A;  4E6R A;  4RTV A;  1PNJ A;  4EIK A;  2DL7 A;  2EBP A;  4OMM A;  4HVW A;  1X2Q A;  3CQT A;  3VS6 A;  4LUD A;  3U23 A;  1J3T A;  4HCK A;  2P4R A;  2ROT A;  3I9Q A;  5IXF A;  3VS0 A;  1PWT A;  1ZUK A;  2J6O A;  1PHT A;  5FWB A;  1FYN A;  2MCN A;  2A37 A;  1X69 A;  2ENM A;  2OAW A;  3TSW A;  1FMK A;  2L0A A;  2DBM A;  2CT4 A;  2GQI A;  2ABL A;  2L3P A;  2HBW A;  1W70 A;  2EPD A;  1WIE A;  2DL8 A;  4JZ3 A;  5GJW B;  2BTT A;  1JU5 C;  2NWM A;  4IIM A;  2JW4 A;  3SHW A;  1JO8 A;  2KXC A;  3JV3 A;  2CSI A;  3EG3 A;  2F2V A;  2LJ3 A;  1K9A A;  1JXO A;  1WYX A;  5IXB A;  1RLP C;  2L3S A;  3QWX X;  2H8H A;  4JPB W;  3VS7 A;  1TUD A;  2CH4 A;  4ZNX A;  2RQV A;  2DIL A;  2EYX A;  2KRM A;  3M0Q A;  1NM7 A;  1OEB A;  1M30 A;  1NEG A;  2HSP A;  4J9G A;  1WX6 A;  4CC2 A;  1WFW A;  2ROL A;  3M0S A;  4F16 A;  1WA7 A;  2F2X A;  1VYT A;  1AD5 A;  1U5S A;  5ECA A;  2KT8 A;  2KRS A;  2M0Y A;  2EYZ A;  2RQR A;  2RNA A;  2YUO A;  1UGV A;  4AG1 C;  1NLP C;  4RTX A;  1JEG A;  1WXB A;  2RMO A;  1Z9Z A;  1K76 A;  1E6H A;  4KRT A;  2DL3 A;  1ZUY A;  1CKB A;  2AK5 A;  2O9V A;  2DE0 X;  4RUG A;  2EYY A;  1AOJ A;  2C0T A;  5GJV B;  4OML A;  3NGP A;  2LMJ A;  1UFF A;  3KFV A;  2ECZ A;  2YSQ A;  2DVJ A;  1ARK A;  5IH2 A;  4F14 A;  4OMQ A;  3NPF A;  2DL5 A;  2RQW A;  1GBQ A;  2RF0 A;  2K7A A;  1KJW A;  1GFD A;  3UA7 A;  1W1F A;  2O2O A;  1YN8 A;  1WXT A;  2RN8 A;  4RTY A;  4JJD A;  2FG0 A;  2L3Q A;  2VWF A;  5FWC A;  4WCI A;  2CT3 A;  4HVU A;  2NUZ A;  3PVL A;  1QKX A;  2D1X A;  2J06 A;  2O31 A;  1U06 A;  4J9C A;  1Y0M A;  2EGE A;  4RTW A;  2BZX A;  3VS2 A;  1SRL A;  1B3Q A;  1G2B A;  2JM8 A;  3I5R A;  3LH5 A;  2EYW A;  2CSQ A;  2D8H A;  2YDL A;  1ZBJ A;  2K6D A;  4J9B A;  2PTK A;  3M0U A;  1YWO A;  1S1N A;  2KR3 A;  2OJ2 A;  1ABO A;  1M3C A;  3TVT A;  3EHQ A;  2ED1 A;  4CC3 A; 
#chains in the Genus database with same CATH topology
 2VV5 A;  3UA6 A;  3UT1 A;  1D1C A;  3CC4 Q;  3P8B B;  4FYW B;  4OB1 B;  4Z89 A;  4BAC A;  3M58 A;  1RI0 A;  5GAM e;  1AT1 B;  2EJG A;  2ED0 A;  3OMG A;  5A0D A;  1YNZ A;  1Q86 U;  3G7Z A;  5AYF A;  3VRZ A;  4A4G A;  1QMC A;  1KIK A;  3NTH A;  5KYY A;  2DVE A;  1OZ2 A;  2LQN A;  1MV3 A;  3JCM h;  2E41 A;  1C0M A;  3EH2 A;  4C8Q B;  3C12 A;  1VQ8 T;  2QTX A;  4M7D E;  2PVO B;  3E9F A;  2M16 A;  4M75 C;  1T0J A;  2VKN A;  2LRQ A;  3H41 A;  2IG0 A;  3A8M B;  5J39 A;  4CC7 A;  5GAN 3;  1AZE A;  2XK0 A;  2CKK A;  1D3B A;  5GAN 6;  2HBP A;  3X26 B;  4C5H A;  3I55 T;  2PUK B;  2X3X D;  3WXM B;  4RG8 A;  1VQ4 T;  5L8R E;  4ZN1 A;  1K0S A;  1PCX A;  2RHY A;  1X27 A;  4PJN A;  2KRN A;  2SEM A;  2KNB B;  2QGF B;  4M77 A;  3M0T A;  4AFU C;  3X25 B;  2ZPH B;  4J9D A;  4C92 C;  1LJO A;  2RJC A;  4PJO B;  2V26 A;  5GAO r;  1XNI A;  3ZEH A;  4PKC C;  1UUE A;  2DJZ A;  1TOV A;  4DBR A;  4N0A C;  2W0Z A;  2KY9 A;  1TS9 A;  2ZPB B;  2AZS A;  5AT1 B;  2KE9 A;  5GAN e;  2EGC A;  5IHN A;  1X6B A;  4E7S A;  4LDW A;  4X9D A;  2DX1 A;  2M51 A;  2FEI A;  2J6K A;  4HXJ A;  3L2Z A;  1IGQ A;  4AT1 B;  1VQ5 A;  3GF5 A;  3UDC A;  5GAN f;  4M75 B;  2MIO A;  1MMD A;  2KK4 A;  2CYZ B;  4LDU A;  4B6M A;  4PL6 A;  2G6F X;  4L5G A;  3G4S T;  1UHC A;  4LXC A;  1H8K A;  2K5L A;  3QDF A;  1BBZ A;  2K9G A;  2DNU A;  2D0Q B;  3LH0 A;  4JJC A;  1RAB B;  3CCQ Q;  5CKE A;  2E4H A;  3FDR A;  5HCK A;  2GGR A;  2QYZ A;  2X4X A;  5GAN 2;  2ZCF B;  3HRS A;  1PSE A;  2I2L A;  1JQQ A;  1UEC A;  3C95 A;  1VQK Q;  1TWB A;  2EGA A;  2XDP A;  2HCK A;  3L2Q A;  2JTM A;  3TSZ A;  2HDA A;  2KSS A;  3NMZ C;  1UTI A;  4M4Z A;  4KBM B;  3MEU A;  1B34 A;  3PVQ A;  2K3Y A;  3DB3 A;  5KYW B;  4UC4 A;  3GNF B;  2DA9 A;  1Z9Q A;  3G71 A;  1JXM A;  2BZY A;  2IIM A;  3PIP A;  2RK2 A;  4OP0 A;  3VS1 A;  2CZ1 B;  4PJM A;  5I2S A;  4FW1 A;  3QZ9 B;  3DLL A;  1YJN Q;  3VS5 A;  2E12 A;  2LX9 A;  2DFU A;  2DBK A;  3OYA A;  1I0C A;  1T3S A;  3RER A;  1M1K C;  1HJD A;  1PG5 B;  1UGS B;  2FPE A;  2DET A;  2XU8 A;  3M0P A;  2EQI A;  2K4Y A;  1MUZ A;  3OS5 A;  1VQ7 Q;  1Q81 C;  5CR2 A;  1R0B G;  3CCL A;  1OQK A;  4O5V A;  5FW9 A;  3CCQ T;  2DYB A;  2LZ6 B;  4RTZ A;  2DJQ A;  4Z8A A;  4YTL A;  1VQM A;  3CCM A;  3V7C A;  3PMT A;  4NS5 A;  1H64 1;  2DTI A;  4XU1 A;  1UHF A;  3HHT B;  1XQH A;  3OYK A;  2VXF A;  1TUG B;  2Z0W A;  3THK A;  1K9M R;  4N4I A;  5CKB A;  3CD6 A;  1I8F A;  1ZHI A;  3GBQ A;  2DRM A;  3JCM d;  1PKS A;  2DAQ A;  3EG1 A;  3H0I A;  1WJR A;  1KQS A;  2NLU A;  2RH2 A;  3QYG B;  1G3W A;  2K5I A;  2PQW A;  4M77 D;  4M7D G;  2YHT A;  4C0G A;  3H0F A;  4QQD A;  1QKW A;  4D8D A;  1X75 C;  3A98 A;  4M75 A;  2EIF A;  2YWW A;  1YJN T;  1M27 C;  3MKD A;  2EYQ A;  2QAS A;  1HSQ A;  2O88 A;  4B9X A;  3PGG A;  2PZ1 A;  2FRY A;  3QJY A;  2X35 A;  2EVR A;  2O4X B;  2QK0 A;  1BYM A;  2LX7 A;  4M7D F;  3UAT A;  3JCM P;  3QJ6 A;  2JUF A;  3V8J A;  4E6R A;  1LOJ A;  4RTV A;  1WHH A;  2CGH A;  4DBQ A;  2PVD B;  4FYY B;  2EBP A;  1OUL A;  4DBH A;  1VQ7 T;  1J3T A;  2EQM A;  3RIR A;  3FLG A;  3HTR A;  5GAM h;  5LJ3 j;  4C92 A;  5FWB A;  1FYN A;  2MCN A;  3JAM E;  5DM7 R;  1I5L A;  2A37 A;  1S72 Q;  4KUI A;  1KQS P;  4JJN K;  1X69 A;  3NTI A;  3V8K A;  3CC2 Q;  2OTJ T;  4N0A A;  4OB0 B;  3A8L B;  4EDU A;  4A4H A;  1R0C B;  2E1H A;  3CC7 A;  5KYW A;  2EPD A;  4JZ3 A;  1WHM A;  1IHW A;  2BTT A;  1JU5 C;  1U8R A;  3SWN B;  2DZ9 A;  3FEO A;  3I55 A;  2KXC A;  2DO3 A;  1VQ4 A;  4M77 E;  4ZTJ A;  4FT2 A;  1N8R C;  1K9A A;  4A54 A;  2L3S A;  2DIL A;  2DK3 A;  1VUB A;  2KRM A;  1VQP Q;  2HQH A;  5LJ5 g;  3GIB A;  1WFW A;  2MWP A;  1WA7 A;  4J7I A;  2F2X A;  3MEW A;  1VYT A;  5ECA A;  4QQG A;  3JCM f;  3S3O A;  3VKI A;  3OBY A;  2YUO A;  1UGV A;  3CXC S;  2VGN A;  5IN1 A;  3L2U A;  4E7K A;  2WSF E;  4BI3 A;  4C8Q D;  3M59 A;  1NLP C;  1YIT T;  3A5Z B;  1JEG A;  3OYC A;  1Z9Z A;  3EFS A;  1SKU B;  1VIF A;  3PIO A;  4KRT A;  3JCM c;  3G4S A;  5D6W A;  3WVE B;  1ZUY A;  2F1L A;  3HL8 A;  4ZN3 A;  2E5Q A;  4RUG A;  2EYY A;  3CCS T;  2Y90 A;  4OML A;  3GNG A;  1S72 T;  1VQ6 Q;  2DER A;  2XD0 A;  2DVJ A;  1NJI U;  4Y91 A;  5KYX B;  1YFN A;  5CQX A;  2K3X A;  2OTL Q;  2DZC A;  2E65 A;  1GBQ A;  3ER0 A;  2EFI A;  2HAX A;  4PJO D;  1GFD A;  3I56 Q;  1WXT A;  4BE0 A;  4PJL A;  2FG0 A;  2MWO A;  3OYF A;  5FWC A;  4WCI A;  5KYU A;  2CT3 A;  4HVU A;  4PK4 A;  2J06 A;  2OAU A;  4V2S A;  4KGV B;  4HCC A;  2EGE A;  3R6O A;  1Q86 R;  1G2B A;  2LT1 A;  4LDV A;  3I5R A;  3QG1 A;  5LJ5 j;  4M75 D;  1NPP A;  1JB0 E;  4C8Q E;  4IUP A;  1ZBJ A;  4J9B A;  2PTK A;  3M0U A;  3CME Q;  1YWO A;  2QI2 A;  2KR3 A;  4M78 B;  5C0M A;  3JCM X;  2H3J A;  1X01 A;  1ABO A;  1M3C A;  3QDR B;  3M4G A;  1V76 A;  4XQ3 A;  3LX7 A;  5C6S A;  1Q7Y C;  2CP6 A;  3V7S A;  1MV0 B;  1RAH B;  2YUP A;  4QKU A;  3T9N A;  3LWH A;  4D6W A;  1Q81 R;  3BFM A;  1MNE A;  4KGX B;  1NG2 A;  3CCQ A;  1IB8 A;  4C92 D;  1ABQ A;  1MMA A;  2EQU A;  1I1J A;  3E1S A;  3CCE Q;  1K8A U;  1VYU A;  3H0H A;  3I35 A;  1UEB A;  4PJO E;  3EAE A;  4PLI A;  1QCN A;  3G6E T;  2R57 A;  3FJ5 A;  1VQK A;  3CCU T;  2V8J A;  1GCQ C;  1IHV A;  3REA B;  4Z02 A;  4FSS A;  4KGZ B;  5GAM d;  3CBO A;  4AFZ C;  2A08 A;  2LP5 A;  3OYB A;  1GRI A;  4M75 E;  4M7A G;  1V1C A;  4RMO A;  1YJN A;  2BZ8 A;  2ESW A;  3ASK A;  2K2V A;  1UGQ B;  4LE9 A;  1E7O A;  3EG0 A;  1M2O A;  3AHU A;  4LD6 A;  2K2M A;  2FPF A;  3VYG A;  2JMC A;  2IVW A;  2HKQ B;  2JTE A;  1V29 B;  3SDZ A;  2B86 A;  3PTA A;  2CH4 W;  2LCL A;  4M7A F;  1VYV A;  3OA6 A;  3IQL A;  4ORZ A;  2KXD A;  2YUN A;  1VQ7 A;  4C5E A;  4IKF A;  1EFN A;  4C92 E;  3L2W A;  3TQ7 P;  1SG5 A;  1F1B B;  3ULR B;  1P92 A;  1YIJ T;  2COY A;  3CCM T;  2OTJ A;  3EGU A;  2XID A;  2MI6 A;  1TH7 A;  3VS3 A;  4C8Q C;  3OYM A;  4E7L A;  4BE2 A;  2J7I A;  2L5Q A;  4JS5 A;  1AWJ A;  5DLQ E;  1N9S A;  2LJ0 A;  1C1A A;  1BK2 A;  4C5I A;  2CDT A;  3CBM A;  1WHG A;  4J6W A;  2F2W A;  5D7U A;  3VS4 A;  2KQW A;  4OB3 B;  2RHU A;  2B8A A;  2YRD A;  1W2B S;  2LT4 A;  4E7I A;  5GAN d;  1M3A A;  4J9E A;  2VUB A;  1UJ0 A;  2RHZ A;  2YXY A;  1LVK A;  2E6N A;  2DMO A;  2YRV A;  2HMA A;  3EGD B;  4E7Z A;  2YLC A;  1VA7 A;  4PJO C;  2MF2 A;  3OQ5 A;  1YIT A;  5GAM f;  2DEU A;  1BIA A;  1OI1 A;  3C94 A;  3QHS A;  2ZPG B;  5IAY A;  4AG2 C;  5LL6 S;  3A8O B;  4ME7 A;  3FC3 A;  2RQU A;  1KD1 U;  8ATC B;  3RMS A;  3CCS A;  3JB9 I;  1GXI E;  1S72 A;  4RG2 A;  2DPP B;  2CRE A;  1IRE B;  3CPW A;  1IZ6 A;  4GLM A;  5GAO l;  3CC7 T;  4F17 A;  1I81 A;  3JB9 D;  2QG9 B;  3CXC A;  5CIU A;  1NPR A;  2JS2 A;  2LQW A;  3MJX A;  1SF9 A;  1G83 A;  1BB9 A;  5KE2 A;  5D6Y A;  1IO6 A;  3EGX B;  4OF1 A;  1M90 C;  4HT9 A;  4MZM A;  2CZ7 B;  1PKT A;  2L2P A;  2NUT B;  3GP8 A;  2JMA A;  4A4E A;  3EG9 B;  4ELY C;  4QVZ A;  3CC4 T;  3GPL A;  1SHG A;  4CI0 C;  1RI9 A;  2D0N A;  4DEX A;  2HQE A;  5FRN A;  2CP2 A;  2QEX Q;  1Q82 C;  2QQR A;  2JT4 A;  1YBY A;  1XTD A;  3OS1 A;  2QDY B;  4J9F A;  2FO0 A;  3OYG A;  2JM9 A;  2XI9 A;  2NUP A;  2P0Q A;  1Q7Y R;  1GCQ A;  4BDZ A;  2NYS A;  2DRK A;  1UE9 A;  5EC7 A;  2FYK A;  1PRM C;  5DLO A;  3CEY A;  2KT1 A;  2LCS A;  1BI2 A;  2DKG A;  5CCA A;  3CXC P;  2LQK A;  2MOX A;  1VOM A;  1BU1 A;  2O01 E;  1YWP A;  1YJ9 Q;  3A8G B;  1ZUU A;  2RQT A;  2E5K A;  4J9H A;  5L23 A;  1TSF A;  3QII A;  3M54 A;  5GAN 5;  4LDX A;  4A4K A;  3G6E A;  2AIR B;  2OTL A;  4OMM A;  3CCU A;  4HVW A;  1IXD A;  1X2Q A;  2JTF A;  3VS6 A;  4J83 A;  4LUD A;  1TTH B;  4QW2 A;  4O6J A;  3U23 A;  4M75 F;  1Y96 B;  1PWT A;  1PHT A;  4BI4 A;  1HXD A;  1O75 A;  1KC8 U;  3HSB A;  3INZ A;  4EMH A;  4XU3 A;  1FMK A;  3LGL A;  4C92 G;  2DBM A;  2GQI A;  4FIB A;  2L3P A;  5GMK l;  2HBW A;  1QW1 A;  4ZGJ B;  4KUD K;  5GJW B;  2XHC A;  1Q86 C;  1G5V A;  4IIM A;  2JW4 A;  1SSF A;  3SHW A;  5FU6 B;  2L89 A;  3J81 E;  2QEX T;  2LQ8 A;  2GF7 A;  3EG3 A;  3CME A;  5GAO n;  4C8Q A;  4C92 F;  1WYX A;  3FB9 A;  4JPB W;  1RLP C;  3QBY A;  2LDM A;  3VS7 A;  1TUD A;  1BIB A;  2CH4 A;  4ZNX A;  1N8R U;  3VV0 A;  1OEB A;  1NEG A;  3CCJ Q;  4P5N A;  2VB6 A;  1G3T A;  2ATC B;  4NL2 A;  1K73 U;  3H9N A;  8AT1 B;  3OYI A;  3L2V A;  3RDV A;  1U5S A;  2DTH A;  5LJ3 g;  1YIJ A;  3C4S A;  4JRQ A;  1VQ9 Q;  3KXT A;  2YRC A;  1YI2 Q;  3FIF A;  1U1T A;  1WXB A;  2FZG B;  1K76 A;  5GMK j;  1VQK T;  4PJO A;  2X4J A;  3F70 A;  3OYY A;  5CKH A;  4C0F A;  2O9V A;  3M53 A;  2DE0 X;  2CP0 A;  3OS2 A;  5GJV B;  3RKW A;  4XTU A;  4HCZ A;  2LMJ A;  1G3Y A;  3HP9 A;  2YSQ A;  2XIC A;  5I2M A;  1WQ7 A;  2X9H A;  3SWN C;  3L42 A;  4DBF A;  4LDY A;  1VQN Q;  2YLB A;  1EIF A;  4E7H A;  3JSC A;  4M7D B;  2RF0 A;  2K7A A;  3UA7 A;  3J80 E;  2FB7 A;  2O2O A;  5IT9 E;  2DXC A;  2E3I A;  1MHN A;  2RN8 A;  1M9S A;  4FL6 A;  1WHK A;  3E9G A;  4X9C A;  1OZ3 A;  3SB2 A;  3L2R A;  3DKM A;  2O31 A;  2D1X A;  3JCM V;  1Y0M A;  4RTW A;  2BE9 B;  2JM8 A;  1MGQ A;  2E6Z A;  4FYX B;  1W2B A;  1TXQ A;  2CSQ A;  2D8H A;  2YDL A;  3QKJ A;  1KHC A;  3E2U A;  1OU9 A;  1VQ9 T;  1WJQ A;  1D0Y A;  1Y96 A;  1BCM A;  3JCM b;  1M1F A;  1YHQ Q;  2HL3 A;  3AT1 B;  3EFO B;  2ZPI B;  1SEM A;  1W4S A;  2JXB A;  1RAC B;  2CUB A;  2P0K A;  4BB7 A;  4R0K A;  1UB4 A;  4EMK B;  1FXX A;  1H3H A;  3CMA Q;  4IUT A;  4DQ2 A;  4BUG A;  2JS0 A;  4Q5W A;  3MP6 A;  4XTZ A;  1M90 R;  2H3E B;  2HNI A;  2AT1 B;  1FWZ A;  3VJP A;  1Y57 A;  2G3R A;  4L6V 5;  4IUV A;  5IHI A;  2BE7 D;  2GQV A;  3CC4 A;  4XK8 E;  2QGG A;  1JBM A;  2AKK A;  2DIQ A;  2HD0 A;  4ATO A;  4R56 A;  1QVF S;  3VUZ A;  3CPW S;  1W2B P;  3JB9 G;  4JLG A;  2LCC A;  3NHN A;  2P4T A;  2VGM A;  2GFU A;  1Q82 R;  1VQO Q;  5GAN 8;  2QA4 Q;  1ZSZ C;  1AWO A;  1NEB A;  3NTK A;  2GCX A;  1I5O B;  5LJ5 h;  3RBB B;  1B7T A;  2RHX A;  3RR6 A;  1QWE A;  1WI7 A;  3JB9 F;  4GY5 A;  2RI5 A;  4ANJ A;  4M78 C;  3X28 B;  1U1S A;  1UDL A;  1WJS A;  3M0R A;  3CCV Q;  3UPU A;  5GAN g;  2VVK A;  1E6G A;  3CC2 T;  1YHQ T;  3D7S B;  5A2Q E;  2EKH A;  3P8D A;  3MET A;  1PRL C;  4XAX B;  3LWI A;  1N9R A;  4JJB A;  1KK7 A;  1OPL A;  5FRO A;  1A0N B;  3HFN A;  4AFS C;  1JJ2 S;  3JB9 H;  1WNL A;  2P0P A;  4LN2 A;  4D8K A;  1ZBX A;  4JRI A;  4C0D B;  1NZ9 A;  4II1 A;  4X1V A;  4PFO A;  2AZV A;  2O4X A;  5KH6 A;  1VQP T;  2GNC A;  3EFR A;  1UG1 A;  4J7F A;  1ZSZ B;  2QXF A;  2IPO B;  2VXE A;  3HRT A;  2QEX A;  1K9M U;  1SHF A;  1VQO T;  4RTT A;  2A36 A;  4GBQ A;  2YT6 A;  3G71 Q;  1QCF A;  4PFP A;  1D0X A;  2DL4 A;  2DLP A;  1KD1 R;  4FYV B;  4M7A C;  1T0H A;  3H8Z A;  4F7U B;  2A28 A;  3EFO A;  2COW A;  1O9S A;  3PE0 A;  1RAD B;  2K79 A;  3KUF A;  5KCH A;  2LTO A;  4MDW A;  1D09 B;  1YJ9 A;  2X3W D;  3SWN A;  4JLI A;  4EMK A;  2DEQ A;  4FT4 A;  1NYG A;  3ZFJ A;  5GAN j;  5GMK e;  1VQ6 T;  4RTU A;  3LW5 E;  3QO3 A;  4OVA A;  2J05 A;  2VC8 A;  4FU6 A;  5CQY A;  3CPF A;  5GAO m;  4JZ4 A;  2OTL T;  3I5S A;  1WQW A;  3HRU A;  3CCL Q;  4HVV A;  5I11 A;  5I21 A;  3I56 T;  1WDX A;  2FRW A;  2EQJ A;  2HQX A;  1D1B A;  2RD1 A;  1VQM Q;  1PD1 A;  4WTO B;  1TG0 A;  3JCM Q;  3TU4 K;  3VUB A;  2LJ1 A;  2SRC A;  2M02 A;  2RA2 A;  2Y4Y A;  2RI2 A;  4MML A;  1KFZ A;  2RB6 A;  5CO7 A;  2M1H A;  3SD4 A;  4CRI A;  2EKO A;  1BI1 A;  1IRX A;  2ZPE B;  1ZSG A;  2DF6 A;  5CVI A;  4M7A B;  1FMV A;  3JCM J;  2KDS A;  2BIV A;  3CME T;  1I07 A;  2I0N A;  2MK5 A;  2DM1 A;  2KYB A;  4TVR A;  1OX9 A;  1PC0 A;  1K0X A;  5EG2 A;  1WLP B;  4IUU A;  4EPC A;  2J6F A;  4M77 G;  5LJ3 e;  2KBT A;  1D1A A;  1OOT A;  5KYX A;  5IHK A;  4JS4 A;  1RAG B;  1DJ7 B;  1D0Z A;  2GFA A;  3FJP A;  1ZQ1 A;  1AVZ C;  2KAF A;  3DB4 A;  2AHJ B;  4MMK A;  1VQ9 A;  4K11 A;  4FCY A;  2QDL A;  2XMF A;  2FL7 A;  1B07 A;  1R77 A;  3CCE T;  4M77 F;  2QQ9 A;  1RLQ C;  2FPD A;  2BUD A;  2DXT A;  2WAC A;  4DEY A;  3V8L A;  3UWN A;  3HFO A;  6AT1 B;  3HKS A;  1VQ8 Q;  4J6X A;  2CP3 A;  4CC4 B;  4LNP A;  3VYH B;  1ZSZ A;  1YJW Q;  2A7Y A;  2JZ2 A;  1GFC A;  4ZGD B;  1LNX A;  1Q95 G;  1T3L A;  2CP5 A;  2RPN A;  1N6A A;  4M78 A;  1PNJ A;  3ME9 A;  1VQN A;  2DL7 A;  4HCK A;  2P4R A;  2ROT A;  3I55 Q;  4QQ6 A;  2WSE E;  1VQ4 Q;  4KT0 E;  5CK9 A;  1IGU A;  4F7U A;  5FLX E;  2DD4 A;  1I4K 1;  2C06 A;  5HKC A;  3PFS A;  3OYH A;  3LGF A;  2OAW A;  3MCA B;  3TSW A;  1C6V X;  3OYD A;  2F5K A;  2CT4 A;  1QQJ A;  1YCY A;  3J7A F;  4EMG A;  2K5F A;  3OW2 A;  1UGR B;  1B34 B;  3JCM g;  2QAZ A;  3JRZ A;  1JO8 A;  3JV3 A;  4PJJ A;  2CSI A;  5KYN A;  1K8A C;  5KE3 A;  2F2V A;  3S3M A;  1JXO A;  5M9O A;  1XJW B;  2H8H A;  3MEV A;  3CC2 A;  1YHQ A;  2MYS A;  2MAM A;  1QVG S;  1NE8 A;  2EYX A;  1QP3 A;  4C8Q G;  1QVF A;  2QQB A;  3LLR A;  3OB9 A;  1M30 A;  2JNG A;  2MMP A;  3G4S Q;  1QCO A;  2HSP A;  1WX6 A;  3L1A A;  1M1K U;  4CC2 A;  2ROL A;  4XTX A;  4F16 A;  2MPX C;  2R58 A;  3CMA A;  1AD5 A;  2M0Y A;  1YJW T;  2RQR A;  2RNA A;  3A8H B;  5DY9 A;  1Q81 U;  4ZGE B;  1MMN A;  4C8Q F;  4M7A A;  1BKB A;  2RMO A;  5LJ5 e;  3BE3 A;  2EJF A;  1VQP A;  1E6H A;  4XU0 A;  1OYX A;  3OW2 P;  3A1P A;  1CKB A;  3BW1 A;  3OYJ A;  5LJ5 f;  3RKX A;  3M5A A;  4PFZ A;  3KBG A;  4PJO G;  1MMG A;  1AOJ A;  1VQO A;  3KFV A;  2QA4 A;  2F5T X;  4JRP A;  2CP7 A;  1ARK A;  1RAA B;  1JJ2 A;  1QVF P;  3CPW P;  2DL5 A;  5J3B A;  5FU6 C;  5KCO A;  4DOW A;  1KJW A;  1W1F A;  4PJO F;  1YN8 A;  4RCB A;  4BD3 A;  2A0F B;  2CS7 A;  3CCV A;  4M75 G;  2E70 A;  3MP1 A;  2ZGW A;  1RAF B;  1VQ6 A;  5CAI A;  1U06 A;  4HCB A;  2BZX A;  3CCR Q;  3LH5 A;  3MEA A;  2QTV A;  1N27 A;  3I56 A;  4OGC A;  2RM4 A;  3EGD A;  1S1N A;  2X51 A;  2RK1 A;  3TVT A;  5GMK h;  3EHQ A;  2COZ A;  1U3O A;  1X43 A;  3OY9 A;  1JJ2 P;  4ESR A;  4M78 D;  3R6N A;  2O9S A;  4JDS A;  4C92 B;  3PNW C;  1G8X A;  1OV3 A;  3M56 A;  5HY6 A;  3RKY A;  1KQ1 A;  1CSK A;  1OPK A;  2DIG A;  2KMT A;  1OU8 A;  3RNJ A;  2A3L A;  3REB B;  3E19 A;  2KYM A;  2ZZD A;  2L3R A;  2KVQ G;  2VAS A;  4RKU E;  2EWN A;  2LNH B;  2RO0 A;  4M7D C;  3JB9 J;  4WF2 A;  1UJY A;  4XTY A;  2JJ9 A;  2L8D A;  1KD1 C;  2V8I A;  2D8J A;  1BI3 A;  2V8K A;  1ZX6 A;  3MP8 A;  4QT7 A;  2CZ6 B;  1ZLM A;  1NJI R;  2GTO A;  2OI3 A;  1YCS B;  2KGT A;  4IIO A;  1YJ9 T;  1FMW A;  1SSH A;  1VIE A;  1QP2 A;  3CCE A;  3P8H A;  3BDU A;  2WSC E;  3EGX A;  2FZK B;  3ZBD A;  2HEQ A;  3QPH A;  1AWW A;  3CCR T;  2JN0 A;  2NUT A;  7AT1 B;  5LJ3 h;  1M3B A;  2C0O A;  3EG9 A;  1WXU A;  3V7R A;  1Y07 A;  1M8M A;  2LVM A;  2VYT A;  3PT9 A;  3Q1J A;  3MPU B;  2OTJ Q;  5A0L A;  4M78 E;  4A53 A;  2DD5 A;  4M7A D;  4EMK C;  4C0Z A;  2E3H A;  1VQL Q;  1PM3 A;  1G3S A;  4Y92 A;  4AFQ C;  4F7U E;  2LNV A;  4XTW A;  4BE1 A;  1M1G A;  3GLX A;  2LC4 A;  3BDL A;  1RUW A;  3OMC A;  3RMQ A;  1YP5 A;  1LPL A;  1H92 A;  1W6X A;  1M4Z A;  1TUC A;  4HT8 A;  1NLO C;  2DXB A;  1N5Z A;  3C0C A;  1KSW A;  1PD0 A;  1AWX A;  2EQK A;  3CCJ T;  1K1Z A;  5KYU B;  2CZ0 B;  1K8A R;  3LYI A;  2W10 A;  1GCP A;  3EG2 A;  2M9U A;  5GAM g;  3QZ5 B;  2QQA A;  1YIT Q;  1RAE B;  2BKD N;  4PNO A;  1YI2 T;  1KHI A;  4JUV A;  1JRI A;  3TCJ A;  3M9Q A;  4OMP A;  3DLM A;  4BDY A;  3O8V A;  3OYE A;  2K3B A;  4QVD A;  4Z88 A;  1KC8 C;  1VQ8 A;  2HZY A;  3X20 B;  1SPK A;  1Q7Y U;  2AKL A;  2RJF A;  1CKA A;  4R55 A;  2RJE A;  3VRY A;  3OW2 S;  1YJW A;  3CCS Q;  2M0O A;  4M7A E;  3O5Z A;  2XDD A;  2DTO A;  2JOY A;  3SEM A;  2HL5 C;  3N5B B;  3SFM A;  4OMO A;  5GAN 4;  1VQN T;  1Y71 A;  1VQL T;  3EH1 A;  1K4U S;  4RCC A;  4ELZ C;  2V1Q A;  2KRO A;  2ZPF B;  4C0D C;  1WZO A;  3OBW A;  1OX8 A;  2GBQ A;  1QWF A;  1QVG A;  4MDX A;  3G1J A;  4DA4 A;  1Y7X A;  3TRE A;  3PMI A;  3BY7 A;  1K73 C;  1WGS A;  3URG A;  2C0I A;  3JCM e;  2HKN A;  4HA8 A;  5HK0 A;  3VU3 C;  1SRM A;  4X34 A;  4J9I A;  4E47 A;  2KEA A;  2RJD A;  1LCK A;  2DXU A;  9ATC B;  1BI0 A;  4LUE A;  5I22 A;  5GAM j;  1VQ5 Q;  1AEY A;  5HK3 A;  1GBR A;  1X6G A;  3OYN A;  1X2K A;  1GL5 A;  2OX7 A;  2R5M A;  3RUX A;  1ZA1 B;  2EJ9 A;  3ZL7 C;  5GAO p;  1PSF A;  3S3N A;  4VUB A;  1HD3 A;  4MZT A;  5GMK i;  4AMC A;  4KUL A;  3CMA T;  5GAN h;  2XDB A;  1UGP B;  4M7D A;  1QVG P;  1AHJ B;  2JVV A;  3QWY A;  2GTJ A;  5GAO q;  4A63 B;  5CKF A;  5FRM A;  3G6E Q;  3CCU Q;  1NYF A;  1M2V B;  1RAI B;  1XOV A;  2YUQ A;  4OB2 B;  2D6F A;  4PLL A;  2EW3 A;  3NFC A;  5GAN 7;  4GLK A;  2PNI A;  1WPY A;  4L59 A;  2P84 A;  5LJ3 d;  2FVU A;  2V1R A;  2CUD A;  4J6Y A;  4OMN A;  3MHX A;  2E64 A;  1QLY A;  2QA4 T;  1TU0 B;  1AZG B;  3QXE B;  3EHR A;  3UF4 A;  4C5G A;  4EIK A;  3M55 A;  2FHD A;  3CQT A;  4KH0 B;  4ZTF A;  4M78 G;  4DOV A;  3I9Q A;  1HYO A;  3OSV A;  5IXF A;  3VS0 A;  1ZUK A;  2J6O A;  3CCV T;  3GOX A;  1VQ5 T;  5J26 A;  2ENM A;  1KG1 A;  1M1K R;  2L0A A;  2FZC B;  4F7U G;  2XG8 D;  4OMF B;  2ABL A;  4A4F A;  3MO8 A;  4M77 C;  1W70 A;  2X4W A;  1WIE A;  2DL8 A;  2XKO C;  4M78 F;  1R8O B;  3OS0 A;  2NWM A;  3CCR A;  4OGE A;  4IUR A;  4QVC A;  1MND A;  4NL3 A;  4F04 B;  5KYY B;  1YIJ Q;  2LJ3 A;  4BI8 B;  4F7U F;  2X4Y A;  5IXB A;  1KQ2 A;  3CCM Q;  3QWX X;  1M5Q 1;  2E10 A;  1BCO A;  2RQV A;  2RHI A;  3HPW A;  3M0Q A;  1NM7 A;  5CKD A;  1FX7 A;  4J9G A;  3CBP A;  3CD6 Q;  2ZAE A;  3M0S A;  2RI3 A;  2PUO B;  4HKE A;  2KT8 A;  2KRS A;  2F69 A;  2EYZ A;  4BY6 C;  4AG1 C;  4XU2 A;  3FRN A;  5A0G A;  3M4Y A;  1QVP A;  4RTX A;  4E7J A;  1HK9 A;  1D3B B;  3G71 T;  1M8V A;  1WHL A;  3OSS C;  4B9W A;  2EAY A;  4XTV A;  2HSE B;  1M90 U;  4E2F B;  2DL3 A;  4FW2 A;  3CCJ A;  4J5Y A;  1H3Z A;  2QQS A;  2K57 A;  2AK5 A;  4KH1 B;  4IUQ A;  3OYL A;  4FSX A;  4M77 B;  5FU7 C;  1NJI C;  2C0T A;  2PU9 B;  3NGP A;  5LJ3 f;  2PVG B;  1NBE B;  3QSU A;  1UFF A;  1RL2 A;  2ECZ A;  4FM4 B;  1YI2 A;  5IH2 A;  1Q82 U;  4F14 A;  4OMQ A;  4N4H A;  1KQS S;  3NPF A;  2RQW A;  1X6O A;  1KC8 R;  5LJ5 d;  5D6X A;  3CCL T;  3X24 B;  1M2V A;  2NUP B;  3M57 A;  4RTY A;  1EX4 A;  4JJD A;  3TEE A;  4M7D D;  1VQM T;  3H6Z A;  2L3Q A;  2VWF A;  4N4G A;  3RES A;  2R5A A;  4J8O A;  2Y4X A;  2NUZ A;  3JCM W;  4LD9 K;  2D9T A;  4BY6 B;  1ZA2 B;  3PVL A;  4Y28 E;  1QKX A;  2DYI A;  4J9C A;  3CC7 Q;  1WHJ A;  3VS2 A;  1EZZ B;  1SRL A;  1VQL A;  1B3Q A;  5GMK m;  1K9M C;  3CD6 T;  2EYW A;  3S6W A;  2KI7 A;  2K6D A;  3QUI A;  1N8R R;  4MZP A;  3QYH B;  4JRK A;  2OJ2 A;  3WVD B;  1K73 R;  1ACM B;  5FU7 B;  4NOY A;  2ED1 A;  4CC3 A; 
#chains in the Genus database with same CATH homology
 1U3O A;  1X43 A;  4ESR A;  3UA6 A;  1SEM A;  2JXB A;  3R6N A;  1MV0 B;  2O9S A;  2YUP A;  2CUB A;  4Z89 A;  1OV3 A;  4R0K A;  1OPK A;  1CSK A;  1H3H A;  3RNJ A;  2ED0 A;  3REB B;  2KYM A;  2JS0 A;  1NG2 A;  1YNZ A;  1ABQ A;  1I1J A;  3VRZ A;  1KIK A;  2LNH B;  1VYU A;  1Y57 A;  1UJY A;  3H0H A;  3I35 A;  2LQN A;  1MV3 A;  5IHI A;  3FJ5 A;  2D8J A;  2AKK A;  1GCQ C;  1ZX6 A;  4QT7 A;  3REA B;  1ZLM A;  2GTO A;  3NHN A;  1T0J A;  2VKN A;  2OI3 A;  4FSS A;  1YCS B;  2KGT A;  4IIO A;  3H41 A;  1SSH A;  4CC7 A;  1AWO A;  1NEB A;  1AZE A;  4AFZ C;  2A08 A;  2LP5 A;  1GRI A;  3RBB B;  2HEQ A;  1AWW A;  1V1C A;  1QWE A;  1WI7 A;  1M3B A;  2BZ8 A;  2C0O A;  1WXU A;  1UDL A;  2ESW A;  4LE9 A;  2X3X D;  3M0R A;  1E7O A;  1M8M A;  3EG0 A;  1K0S A;  1X27 A;  2KRN A;  2SEM A;  2K2M A;  2KNB B;  2FPF A;  2VVK A;  3M0T A;  4AFU C;  2JMC A;  1E6G A;  4J9D A;  2JTE A;  2B86 A;  2CH4 W;  2EKH A;  1UUE A;  1PRL C;  1VYV A;  3IQL A;  4JJB A;  4ORZ A;  2W0Z A;  4Y92 A;  1OPL A;  2KXD A;  2YUN A;  4AFQ C;  1A0N B;  2AZS A;  4AFS C;  2KE9 A;  1EFN A;  2EGC A;  5IHN A;  1X6B A;  4LN2 A;  3ULR B;  4D8K A;  2DX1 A;  2M51 A;  1RUW A;  2FEI A;  2J6K A;  4HXJ A;  4X1V A;  1YP5 A;  3EGU A;  1H92 A;  1W6X A;  2AZV A;  1TUC A;  2MIO A;  1NLO C;  3VS3 A;  2J7I A;  1N5Z A;  2GNC A;  1KSW A;  3C0C A;  1UG1 A;  2G6F X;  1AWX A;  1AWJ A;  2LJ0 A;  1UHC A;  1K1Z A;  1H8K A;  1BK2 A;  2CDT A;  1BBZ A;  2K9G A;  2DNU A;  2F2W A;  4JJC A;  3VS4 A;  2W10 A;  1SHF A;  1GCP A;  4RTT A;  3EG2 A;  2A36 A;  4GBQ A;  5HCK A;  1M3A A;  2GGR A;  2YT6 A;  1QCF A;  4J9E A;  1UJ0 A;  2DL4 A;  2DLP A;  1JQQ A;  1UEC A;  4OMP A;  1T0H A;  2DMO A;  2K3B A;  2A28 A;  2EGA A;  4Z88 A;  2HCK A;  1SPK A;  3TSZ A;  3PE0 A;  1VA7 A;  2AKL A;  2HDA A;  2K79 A;  1CKA A;  3NMZ C;  1UTI A;  3VRY A;  4M4Z A;  2X3W D;  3PVQ A;  1NYG A;  3O5Z A;  4RTU A;  2DA9 A;  1Z9Q A;  3SEM A;  2J05 A;  1JXM A;  4OMO A;  2BZY A;  2IIM A;  4JZ4 A;  4AG2 C;  1K4U S;  3VS1 A;  2V1Q A;  2KRO A;  3I5S A;  2RQU A;  4HVV A;  5I11 A;  1WDX A;  3VS5 A;  2GBQ A;  1QWF A;  2FRW A;  2DBK A;  1TG0 A;  2LJ1 A;  1I0C A;  1T3S A;  2CRE A;  1HJD A;  2SRC A;  2C0I A;  2FPE A;  4GLM A;  4F17 A;  1SRM A;  4J9I A;  3M0P A;  2EQI A;  1KFZ A;  1MUZ A;  2KEA A;  2JS2 A;  2LQW A;  1G83 A;  1LCK A;  1BB9 A;  1ZSG A;  2DF6 A;  5FW9 A;  2DYB A;  1IO6 A;  2LZ6 B;  4RTZ A;  2DJQ A;  1I07 A;  4LUE A;  4Z8A A;  2I0N A;  5I22 A;  1AEY A;  2DM1 A;  1X6G A;  1GBR A;  2KYB A;  1X2K A;  1GL5 A;  1PKT A;  2L2P A;  1K0X A;  2JMA A;  1WLP B;  1UHF A;  2J6F A;  3ZL7 C;  2KBT A;  3THK A;  1OOT A;  1HD3 A;  1SHG A;  3GBQ A;  2DRM A;  1RI9 A;  2D0N A;  1PKS A;  4DEX A;  5IHK A;  3EG1 A;  3H0I A;  2JT4 A;  1AVZ C;  4K11 A;  3QWY A;  4J9F A;  2GTJ A;  2FO0 A;  2QDL A;  2JM9 A;  2XMF A;  4A63 B;  1B07 A;  3H0F A;  1RLQ C;  1GCQ A;  1QKW A;  2DRK A;  2FPD A;  1UE9 A;  5EC7 A;  4D8D A;  1PRM C;  1NYF A;  2KT1 A;  3A98 A;  2LCS A;  1XOV A;  2YUQ A;  4DEY A;  1M27 C;  2EW3 A;  4CC4 B;  1HSQ A;  4LNP A;  2PNI A;  2MOX A;  2O88 A;  2PZ1 A;  2FRY A;  1BU1 A;  1YWP A;  2EVR A;  2V1R A;  2CUD A;  2LX7 A;  4OMN A;  1GFC A;  3UAT A;  1QLY A;  1AZG B;  1T3L A;  1ZUU A;  2RPN A;  2RQT A;  2E5K A;  3EHR A;  4J9H A;  3UF4 A;  5L23 A;  4E6R A;  4RTV A;  1PNJ A;  4EIK A;  2DL7 A;  2EBP A;  4OMM A;  4HVW A;  1X2Q A;  3CQT A;  3VS6 A;  4LUD A;  3U23 A;  1J3T A;  4HCK A;  2P4R A;  2ROT A;  3I9Q A;  5IXF A;  3VS0 A;  1PWT A;  1ZUK A;  2J6O A;  1PHT A;  5FWB A;  1FYN A;  2MCN A;  2A37 A;  1X69 A;  2ENM A;  2OAW A;  3TSW A;  1FMK A;  2L0A A;  2DBM A;  2CT4 A;  2GQI A;  2ABL A;  2L3P A;  2HBW A;  1W70 A;  2EPD A;  1WIE A;  2DL8 A;  4JZ3 A;  5GJW B;  2BTT A;  1JU5 C;  2NWM A;  4IIM A;  2JW4 A;  3SHW A;  1JO8 A;  2KXC A;  3JV3 A;  2CSI A;  3EG3 A;  2F2V A;  2LJ3 A;  1K9A A;  1JXO A;  1WYX A;  5IXB A;  1RLP C;  2L3S A;  3QWX X;  2H8H A;  4JPB W;  3VS7 A;  1TUD A;  2CH4 A;  4ZNX A;  2RQV A;  2DIL A;  2EYX A;  2KRM A;  3M0Q A;  1NM7 A;  1OEB A;  1M30 A;  1NEG A;  2HSP A;  4J9G A;  1WX6 A;  4CC2 A;  1WFW A;  2ROL A;  3M0S A;  4F16 A;  1WA7 A;  2F2X A;  1VYT A;  1AD5 A;  1U5S A;  5ECA A;  2KT8 A;  2KRS A;  2M0Y A;  2EYZ A;  2RQR A;  2RNA A;  2YUO A;  1UGV A;  4AG1 C;  1NLP C;  4RTX A;  1JEG A;  1WXB A;  2RMO A;  1Z9Z A;  1K76 A;  1E6H A;  4KRT A;  2DL3 A;  1ZUY A;  1CKB A;  2AK5 A;  2O9V A;  2DE0 X;  4RUG A;  2EYY A;  1AOJ A;  2C0T A;  5GJV B;  4OML A;  3NGP A;  2LMJ A;  1UFF A;  3KFV A;  2ECZ A;  2YSQ A;  2DVJ A;  1ARK A;  5IH2 A;  4F14 A;  4OMQ A;  3NPF A;  2DL5 A;  2RQW A;  1GBQ A;  2RF0 A;  2K7A A;  1KJW A;  1GFD A;  3UA7 A;  1W1F A;  2O2O A;  1YN8 A;  1WXT A;  2RN8 A;  4RTY A;  4JJD A;  2FG0 A;  2L3Q A;  2VWF A;  5FWC A;  4WCI A;  2CT3 A;  4HVU A;  2NUZ A;  3PVL A;  1QKX A;  2D1X A;  2J06 A;  2O31 A;  1U06 A;  4J9C A;  1Y0M A;  2EGE A;  4RTW A;  2BZX A;  3VS2 A;  1SRL A;  1B3Q A;  1G2B A;  2JM8 A;  3I5R A;  3LH5 A;  2EYW A;  2CSQ A;  2D8H A;  2YDL A;  1ZBJ A;  2K6D A;  4J9B A;  2PTK A;  3M0U A;  1YWO A;  1S1N A;  2KR3 A;  2OJ2 A;  1ABO A;  1M3C A;  3TVT A;  3EHQ A;  2ED1 A;  4CC3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...