2LNHB

Enterohaemorrhagic e. coli (ehec) exploits a tryptophan switch to hijack host f-actin assembly
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSHMKKQKVKTIFPHTAGSNKTLLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/protein binding
molecule keywords Neural Wiskott-Aldrich syndrome protein
publication title Enterohaemorrhagic Escherichia coli exploits a tryptophan switch to hijack host f-actin assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2011-12-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14604 SH3_9 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2lnhB00
1PKTA 2EQIA 1NEGA 2KRNA 5EC7A 2EBPA 1W1FA 2KT8A 1SHFA 2GTJA 2W0ZA 2D0NA 3PVLA 1I0CA 1X27A 2JXBA 4JJBA 2JM8A 2YT6A 1GRIA 1JU5C 3H0HA 1NYFA 2JTEA 2KEAA 1KJWA 2L3SA 3VS5A 2GBQA 1K4US 1BB9A 2DRMA 1X2QA 1K9AA 4JZ3A 3NMZC 2VVKA 3EHRA 2F2XA 1UUEA 1I1JA 3M0SA 2CUBA 5FWBA 1VYVA 2OAWA 1ZUYA 4LUEA 1GBQA 3PVQA 2LQWA 3UA6A 1JEGA 4J9BA 1UHFA 2E5KA 2YUQA 2DBKA 2M51A 4ORZA 3H41A 4AFQC 3M0RA 1OPKA 2J6OA 2DNUA 1GFDA 2O31A 2XMFA 2MIOA 1SHGA 1OV3A 1UTIA 2J6KA 3REAB 2LJ1A 2O9SA 1VYUA 2AK5A 2YUNA 4A63B 2CUDA 2ABLA 1GL5A 2C0TA 2DLPA 2FPFA 2V1RA 2PZ1A 1M27C 2A37A 1S1NA 2EVRA 1YN8A 2K9GA 5HCKA 1V1CA 1H92A 2RQTA 5FW9A 1NYGA 2RQUA 3M0PA 3EGUA 1SRLA 2LCSA 1FMKA 1UJYA 1TG0A 3VS7A 2EYYA 1UFFA 2LJ0A 1E6GA 1UGVA 1YWPA 1QWFA 3M0QA 2JMCA 2IIMA 1M30A 3EG2A 2LZ6B 1HJDA 1WIEA 1PHTA 1ARKA 2RNAA 2SEMA 1X2KA 2VWFA 1T0JA 2CDTA 2DRKA 1CSKA 1WXTA 2V1QA 2HSPA 1U06A 1NLOC 5IXFA 2L2PA 2SRCA 4QT7A 4F16A 5FWCA 2I0NA 2P4RA 3M0TA 2YUOA 2CSQA 3RBBB 3VS2A 2HBWA 5I22A 2C0OA 4Z88A 4OMMA 1QKWA 3NGPA 2DF6A 2K2MA 3C0CA 1M3BA 4LN2A 2QDLA 2CH4A 4OMPA 2M0YA 2W10A 2A28A 2CT3A 2PTKA 1OPLA 1WXUA 4J9EA 3R6NA 1B3QA 2NUZA 2FRYA 2GGRA 2AZSA 1BK2A 4AFSC 2NWMA 1MV0B 1WFWA 2DL7A 2DE0X 4LNPA 2D1XA 2J06A 1K1ZA 2L0AA 2FG0A 5L23A 4EIKA 1M3AA 4HCKA 1SEMA 4JPBW 2O9VA 2K7AA 4WCIA 2DL4A 1FYNA 3FJ5A 2LX7A 4IIOA 1ZBJA 2ED0A 2HDAA 1ZUKA 2DJQA 2YUPA 1VYTA 3I5SA 1N5ZA 2LJ3A 2AZVA 4RTYA 3RNJA 1ZX6A 1NG2A 2KNBB 2CSIA 3EHQA 2DA9A 1YP5A 2O2OA 3U23A 1H3HA 2DILA 2LMJA 3NPFA 5IHNA 1AWXA 4GBQA 3VS3A 1NEBA 2KBTA 2KROA 2CREA 2ED1A 2EGEA 4AFZC 1VA7A 2AKLA 2HEQA 3VRYA 4R0KA 3THKA 1UECA 4OMLA 4JJDA 2DX1A 2AKKA 1TUCA 1WDXA 4AG1C 1QLYA 3PE0A 3SEMA 3I35A 1AEYA 1BU1A 2KE9A 2BZ8A 2FPDA 2DBMA 1ABOA 5IHKA 1KFZA 2KRSA 2OJ2A 2YSQA 1UHCA 2VKNA 4J9GA 4CC7A 2EPDA 2RPNA 1PRMC 2EYZA 1JQQA 4CC4B 2L3PA 3QWXX 4X1VA 4Z89A 2ENMA 1YWOA 1QKXA 1Y57A 4LE9A 1BBZA 3VS4A 2KYMA 3CQTA 4HVWA 2J05A 1AD5A 4CC3A 1JXOA 4RUGA 4DEYA 2EW3A 2JT4A 1GCQC 1SRMA 4M4ZA 5GJWB 2J6FA 1KIKA 2JMAA 4J9DA 3TSWA 5IH2A 1ZSGA 2A08A 2RF0A 4ZNXA 1HD3A 2KT1A 2BZXA 4IIMA 2FEIA 5IXBA 1QCFA 1LCKA 4HVUA 1K0XA 3ZL7C 1UE9A 3QWYA 2CH4W 1T0HA 2KRMA 1X43A 2DL3A 2ESWA 2LNHB 2DL8A 4E6RA 3TVTA 1I07A 2LP5A 2HCKA 4J9FA 3O5ZA 4OMNA 1OOTA 2F2VA 2CT4A 1JO8A 1JXMA 2GNCA 3UF4A 2KYBA 2MCNA 1T3SA 1W70A 4LUDA 2L3QA 4J9CA 1G83A 3VS6A 4FSSA 4J9HA 1ZLMA 2JW4A 2K6DA 3I9QA 1GFCA 3VRZA 2BZYA 2RQRA 3UA7A 2EGAA 2C0IA 2RQVA 2ROLA 1X6BA 2RN8A 4RTTA 3VS0A 2ROTA 2GTOA 4OMQA 2FRWA 1RI9A 1WLPB 1X6GA 2BTTA 4OMOA 5GJVB 2X3XD 1WYXA 3REBB 2KR3A 1RUWA 2K79A 4Y92A 1WXBA 1UG1A 5IHIA 1WI7A 2DYBA 2ECZA 1YCSB 4ESRA 1YNZA 1RLQC 5ECAA 1M8MA 2O88A 1AVZC 1AOJA 2DM1A 3LH5A 1AWWA 2D8JA 2EKHA 1QWEA 4F17A 2EYXA 3VS1A 1Z9ZA 2KGTA 1H8KA 4F14A 1UJ0A 1CKBA 5I11A 2OI3A 1KSWA 1PNJA 2K3BA 2PNIA 1GBRA 2FO0A 2JS2A 1U5SA 1CKAA 2X3WD 1NLPC 4D8KA 2RQWA 1SPKA 2KXCA 3H0IA 4AG2C 2B86A 3NHNA 3EG3A 3KFVA 1A0NB 3H0FA 1M3CA 2A36A 4KRTA 2KXDA 1E6HA 4RTVA 1AWJA 4Z8AA 2DVJA 4HVVA 3TSZA 2G6FX 1PWTA 1PKSA 1IO6A 2DL5A 1E7OA 2DMOA 1PRLC 2YDLA 2FPEA 2EGCA 4RTUA 4J9IA 1J3TA 4D8DA 1XOVA 1Z9QA 2H8HA 1GCPA 1B07A 1RLPC 1AZGB 2JM9A 4DEXA 1X69A 4HXJA 1K76A 1WA7A 2D8HA 3UATA 1OEBA 4JJCA 3I5RA 1EFNA 2F2WA 4JZ4A 2MOXA 3A98A 1Y0MA 4RTZA 2EYWA 3JV3A 1G2BA 1GCQA 1AWOA 4RTWA 2LQNA 1W6XA 1NM7A 2GQIA 4GLMA 1K0SA 2J7IA 1T3LA 4RTXA 1HSQA 1MV3A 2RMOA 3ULRB 2JS0A 3SHWA 1AZEA 1U3OA 1TUDA 3EG1A 1SSHA 3IQLA 4CC2A 1MUZA 1UDLA 4AFUC 3M0UA 3EG0A 1ABQA 4K11A 1WX6A 3GBQA 1ZUUA
chains in the Genus database with same CATH superfamily
1NEGA 2VGNA 4M75A 2KT8A 2XDDA 3LWIA 8ATCB 1HK9A 2HMAA 2F69A 2YRCA 3VU3C 2ZPBB 5KYXA 2OTJQ 3CCUQ 1KJWA 1Q7YC 1UGPB 1B7TA 2GBQA 3FEOA 2DRMA 1X2QA 1K73U 3EHRA 2F2XA 1I1JA 4Q5WA 4M77B 4C8QD 3MP8A 1UGSB 3A8OB 5GAN7 1VYVA 2OAWA 3OYHA 1K8AU 2WSEE 4PJOD 2LRQA 2DXCA 4ATOA 3PVQA 2LQWA 3UA6A 4PJLA 4ORZA 2EIFA 3LYIA 4C0DC 4BE2A 3HL8A 2DIGA 5L8RE 1VQKT 3CC7Q 1VQLT 2X4WA 1QQJA 1UTIA 2BIVA 3CCMQ 3REAB 3X26B 3G4SA 1VYUA 2YUNA 4E2FB 2KDSA 1GL5A 4M7AB 2FPFA 1ZSZC 2DETA 1YN8A 2X35A 1V1CA 4C0FA 2ZPGB 4B9XA 1YIJA 1QVFS 3BDUA 2CS7A 5CKBA 1IZ6A 1FMKA 1UJYA 1U1TA 1K73C 4OB1B 1KQSA 4E7SA 5GAN3 5GANf 1FX7A 1WIEA 2AIRB 2RNAA 3HHTB 2RI3A 2SEMA 1X2KA 2VWFA 3H9NA 3VYHB 2CDTA 2DRKA 3EGDA 1M90R 2V1QA 1NLOC 2ZGWA 2L2PA 5CO7A 2P84A 4M78D 5KYYB 3QDRB 2BUDA 4FW1A 5FWCA 3G6ET 1WHKA 3TREA 2C0OA 4E7LA 2D0QB 2QXFA 4OMMA 4A54A 3L42A 1PD0A 4OVAA 3M54A 1D3BA 1M3BA 4M75B 2CH4A 5HKCA 3OYEA 3P8HA 4UC4A 2A28A 3QPHA 1X01A 2JVVA 4N4HA 3H8ZA 3HRTA 1B3QA 3VUZA 4NOYA 2FRYA 3P8DA 1TS9A 2AZSA 1NPRA 1BK2A 1W2BS 4AFSC 2DVEA 1PSFA 4OP0A 4XTZA 2K3YA 1IREB 5HK3A 1WFWA 2DL7A 1VQ9T 5A0LA 1N8RU 3OBYA 2J06A 4WTOB 3M5AA 3OSVA 3RUXA 3PT9A 3ZEHA 4XTYA 5FU7B 5GMKi 5LJ5d 4J7IA 2FG0A 2DIQA 5L23A 4J6XA 1SEMA 4C8QC 4J83A 2K7AA 1YCYA 1VQ6T 4PJOC 2DL4A 2LCLA 4BE0A 2ATCB 5CKHA 2HDAA 1D0XA 4RTYA 3RNJA 1IHWA 5J39A 3OYFA 4EDUA 3CCSQ 2D9TA 1Q86R 5J3BA 7AT1B 3HRSA 1H3HA 3VS3A 3R6OA 2Z0WA 2CREA 2EGEA 2ED1A 4AFZC 4DQ2A 4EPCA 3NTIA 4MZMA 2HQXA 4M77G 5KCHA 4JJDA 3CCLA 2AKKA 2OTJT 3CCUT 5I21A 4BI4A 2RHZA 3CPWP 3H6ZA 1U8RA 3GF5A 4C92D 1BU1A 2KE9A 2BZ8A 4RCCA 2MK5A 2DBMA 2XU8A 5IHKA 2KRSA 1KFZA 3EGDB 3RMSA 2VKNA 4J9GA 2EPDA 1PRMC 2L3PA 3CPFA 4OB2B 1VIEA 1WJSA 4X1VA 2NUTA 3RMQA 4Z89A 4RG2A 2JZ2A 4M78C 5LJ5g 2KI7A 4E7ZA 3QHSA 3VS4A 3CC7T 1KQ1A 3CQTA 4C5GA 3OYAA 4M7AG 4EMKB 4XU2A 4DEYA 1Q7YR 1VQ9A 4RKUE 1KIKA 2JMAA 4J9DA 3TSWA 5IH2A 1D3BB 3CCMT 4QVZA 1V76A 3MP1A 2BZXA 2FEIA 5IXBA 1QCFA 2PUKB 1LCKA 3SWNC 2IG0A 3GNGA 5DLQE 4MZPA 1T0HA 5CAIA 2LNHB 2DL8A 1LPLA 4E6RA 2BE7D 1I07A 2LP5A 2A3LA 5LJ5h 2HCKA 3X28B 2DTOA 2EWNA 3DB3A 1MMDA 2MCNA 1ZHIA 1T3SA 1NPPA 2JN0A 1M2VA 5DLOA 3OB9A 1YJWA 2QQRA 5GAOl 4V2SA 2L3QA 4J9CA 2JTMA 2DZCA 3UT1A 3VS6A 4AT1B 4J9HA 4XU1A 4HCBA 3VRZA 3L2VA 2BZYA 3G71A 1QVGA 1R0BG 1FMVA 4BUGA 2GTOA 4CI0C 2FRWA 1RI9A 2EJGA 4HT9A 3OW2A 3GIBA 3OS2A 2YXYA 4Y92A 1XJWB 9ATCB 5FRNA 2B8AA 5ECAA 4NL3A 2HKNA 1Y07A 4PK4A 5C0MA 3CXCA 2QGFB 2EKHA 1LJOA 1QWEA 4F17A 2CZ6B 3CMEA 1C0MA 2FZKB 3M9QA 1UGQB 1KG1A 3HFOA 5GAN4 2OI3A 3CC7A 3JCMX 1AHJB 1X75C 4C8QE 1GBRA 4M7DD 2EQMA 2FO0A 2LC4A 4PJOE 4C92C 4D8KA 3H0IA 1R8OB 2B86A 4TVRA 5D6YA 2OAUA 2OTLQ 3KFVA 3M58A 4C8QF 4QQ6A 4Y28E 5CQXA 3JSCA 1VQ8A 4PJOF 1E6HA 2DVJA 4HVVA 2F5TX 2HSEB 2RJDA 2RO0A 5HY6A 4J9IA 1QVGP 3JCMc 1GCPA 1VQOQ 1YBYA 3CCST 4DEXA 4IUTA 3DLLA 2D8HA 5KE3A 3M4YA 4N0AC 5GAN5 1EFNA 3TCJA 3A98A 2EYWA 2RHIA 1GCQA 1WHMA 2LQNA 3ME9A 2GQIA 5GAN2 4MMKA 2FVUA 4RTXA 2FHDA 1G3WA 3I56A 2RMOA 1I5LA 4A4GA 5LL6S 3ULRB 2XDPA 1QCOA 2JS0A 1AZEA 2HL3A 3JCMe 3EG1A 1QVFA 1MUZA 3M0UA 4KUDK 1PKTA 5EC7A 3GP8A 4M78E 4Z02A 2GTJA 3PVLA 1X27A 3NTHA 1VQNT 1YFNA 2X4YA 4OB3B 2C06A 2YT6A 4IUVA 4EMGA 1JU5C 3URGA 4M78F 3ER0A 2DO3A 3SB2A 2Y4YA 2KEAA 3CMAQ 3VS5A 2QA4A 2ZPHB 3V8KA 2VVKA 1UUEA 3OYBA 2DPPB 4EMHA 1TH7A 4LUEA 1GBQA 2CP2A 1Q86U 2QK0A 4M77A 3LX7A 1JEGA 4KH0B 2E5KA 1BI3A 2HQHA 1JJ2S 2HQEA 1UEBA 2O31A 4PJJA 3AHUA 2MIOA 1SHGA 2L3RA 1W2BA 3EH2A 5DY9A 1I5OB 4M7DC 5KYWB 2LJ1A 3CCSA 2QTXA 2CUDA 2EQKA 2C0TA 2DLPA 1M27C 3A8GB 1S1NA 3CCQQ 2EVRA 2K9GA 5HCKA 4MDWA 2QAZA 4M7AA 5FW9A 1NYGA 2HZYA 2H3JA 4WF2A 2CZ7B 2L5QA 1TU0B 4J7FA 3FRNA 4DBRA 2KSSA 1UFFA 1E6GA 1HXDA 4QW2A 1UGVA 2M16A 4R56A 2ZCFB 1YWPA 1M1GA 3M0QA 2JMCA 2EAYA 3EG2A 1HJDA 1PHTA 1Q7YU 1ARKA 4BDYA 2BE9B 3JB9G 2EJ9A 5GAN6 1T0JA 2A7YA 3CCRA 2EFIA 1WXTA 2F1LA 2SRCA 5KH6A 1MNEA 1VQNA 1SSFA 4E47A 4PJMA 2CSQA 2QTVA 1N9RA 4C92E 4BDZA 5KYYA 4JJNK 4Z88A 1JRIA 1TSFA 5LJ5j 2RA2A 1WPYA 1S72A 2DEUA 4LN2A 4C92F 3V7SA 2YHTA 5GAOm 3JCMd 1OPLA 3R6NA 5GANd 2NUZA 3JCMb 1Y7XA 3META 1G3YA 4LDXA 4M75D 2NWMA 4E7KA 5LJ5e 4LNPA 4X9DA 1VQMA 4GY5A 1XTDA 5IN1A 1VQ5A 2LNVA 4FW2A 1AT1B 2QQSA 1YITA 4LXCA 2GQVA 4ME7A 1ZBJA 3MP6A 3SDZA 4J8OA 4C5HA 1ZUKA 1F1BB 3PTAA 2VXFA 1VYTA 4JRKA 2DTHA 4QVDA 1NG2A 3VJPA 2CSIA 3EHQA 4C0DB 1N6AA 2H3EB 2O2OA 3E9FA 4HKEA 1U1SA 3PIOA 5EG2A 4FU6A 4GBQA 3KUFA 4MDXA 3F70A 4IKFA 1WQWA 4CRIA 3V8LA 2PQWA 4DBFA 3JCMP 4OMLA 2LVMA 3L1AA 1RI0A 2DX1A 5CKFA 3JCMJ 3CCVQ 1YJNA 2FB7A 2MF2A 4Y91A 1IGUA 1SF9A 2AT1B 3JCMg 3ZFJA 5GANg 1QLYA 2LCCA 3PE0A 3I35A 3QBYA 1AEYA 3AT1B 2FPDA 2NLUA 1ABOA 3PMTA 3QDFA 2E5QA 1UHCA 1K9MC 4KT0E 3MEVA 4XK8E 3QWXX 3MEWA 1PG5B 1QKXA 2M02A 3FB9A 1Y57A 4ZN1A 4XTVA 3CC2Q 2XIDA 4M7DE 3QYHB 2DTIA 2PU9B 1QCNA 4HVWA 4RUGA 4B9WA 4M4ZA 4PLIA 2CP3A 4FL6A 3JCMh 4EMKA 1EZZB 5GANh 3VV0A 4M7DF 3EFOB 4IIMA 1Q95G 4DBHA 3CCQT 3WXMB 3ZL7C 1QP3A 2DJZA 2KRMA 3LWHA 2R57A 2M0OA 4ZTJA 2ESWA 1X6OA 4PFPA 3OYDA 2PVGB 4M75C 3G7ZA 3RKYA 4J9FA 1VQKA 3LW5E 1D0ZA 1OOTA 2CT4A 4X9CA 1VQLA 2MI6A 1JO8A 3RIRA 3BY7A 1W70A 3S3NA 4RCBA 3MCAB 1G83A 5IT9E 1H3ZA 1KQSP 2RHUA 1KD1C 4FYWB 2VXEA 1ZLMA 2HD0A 4FYXB 2K6DA 1RADB 1VQ4Q 2LTOA 2QI2A 2RQRA 2RQVA 5FU7C 2RN8A 3T9NA 3L2QA 4QVCA 1WYXA 3CCJQ 3QG1A 3REBB 2KR3A 1RUWA 3CC4Q 1M9SA 2G3RA 4DA4A 1TOVA 1N27A 1WXBA 2ZAEA 5IHIA 4ZGDB 1QMCA 3VKIA 2O88A 2K3XA 2ZPEB 3LH5A 2DD5A 3M55A 2MWPA 2D8JA 3S3MA 2EYXA 2XHCA 5I2SA 2XK0A 2AHJB 4GLKA 4YTLA 4A53A 4ZN3A 3G6EA 5FROA 1PNJA 2P0QA 2YRDA 2PNIA 1WGSA 2LDMA 2E65A 2JS2A 1U5SA 3QIIA 2EYQA 1NLPC 2X3WD 3J7AF 2KXCA 4AG2C 3NHNA 2E70A 3OY9A 4JDSA 3H0FA 2VC8A 2A36A 2E4HA 1TXQA 5IAYA 3GNFB 3I55Q 2QDYB 2G6FX 5AYFA 1YJ9Q 2DL5A 3M4GA 4F7UE 4KBMB 2YRVA 2DMOA 2FPEA 4RTUA 4FT4A 1J3TA 1NE8A 1XOVA 1LVKA 2H8HA 3CCEQ 1XNIA 1JJ2A 3N5BB 3TU4K 2QQBA 3A1PA 4F7UF 2HL5C 2JM9A 1X69A 1K76A 1VQPQ 1YHQQ 4LD9K 2M1HA 2MOXA 3A8MB 4FT2A 4ZTFA 4OF1A 1VQ6A 3DLMA 2R58A 3QSUA 1QP2A 1UGRB 4ELZC 2VUBA 4PFZA 2VYTA 1NBEB 1HSQA 3CCVT 1OULA 3JCMQ 1YI2Q 4AFUC 3EFSA 1ABQA 3EAEA 2KRNA 1V29B 6AT1B 2EBPA 2VASA 4JRQA 2D0NA 1I0CA 2LT4A 2JM8A 4XU0A 2QQ9A 1GRIA 3FIFA 3CC2T 3BDLA 2XG8D 4ELYC 2L3SA 4BACA 2HKQB 1K4US 2OTJA 1C1AA 3CCUA 1BB9A 5GAOp 1BCOA 3QJ6A 2KY9A 2O4XB 3JCMV 2E12A 5LJ3d 1NJIC 3QZ5B 1K9MR 4M75E 1KQSS 4DBQA 4J9BA 2YUQA 2DBKA 2GF7A 3MJXA 2WACA 3H41A 2K2VA 4J6YA 3M0RA 4BY6B 4P5NA 2J6OA 1GFDA 3ZBDA 4M75F 3JB9H 1R77A 1OV3A 2RH2A 1C6VX 4A63B 4ZGJB 3A8HB 3CCMA 4C8QG 2ABLA 1TUGB 2V1RA 5KYWA 4PJOG 2RJEA 1VQ4T 2K5FA 4C0ZA 3EGUA 1D09B 1SRLA 3FLGA 3CCJT 1TG0A 2EYYA 2K5IA 2LJ0A 3CC4T 1M8VA 1QWFA 2IIMA 1M30A 3CPWS 3OW2P 4OGEA 1KD1R 5GANj 5GAMd 1VOMA 5KYUA 1O9SA 1U06A 4E7IA 5IXFA 4F16A 2XICA 3HP9A 4HT8A 2I0NA 1IGQA 3CXCP 2E6ZA 4IUUA 2YUOA 3OMCA 5A0GA 5LJ3g 4PJNA 3NGPA 2K2MA 5GANe 3C0CA 3QJYA 3OQ5A 2V8KA 4OMPA 2FZGB 5CK9A 4A4EA 4LDVA 1MNDA 2MYSA 2PTKA 2R5AA 4J9EA 3I55T 3E2UA 4M78G 1YJ9T 4N4GA 1IRXA 1MGQA 2RI2A 3CCET 2GFUA 3CBMA 4E7JA 1KC8C 2WSCE 5LJ3h 2D1XA 1TWBA 2LQ8A 1KQ2A 1SKUB 3RERA 4NL2A 4MZTA 2ZPIB 5FU6B 2L0AA 3VYGA 1YHQT 1G5VA 3KBGA 2HAXA 3L2UA 1M3AA 4HCKA 2O9VA 1GXIE 2GFAA 2PVOB 1MMAA 1FYNA 1OX9A 2LX7A 4IIOA 2X4XA 1JBMA 2ED0A 1D1CA 2V8JA 2LX9A 4B6MA 1RAIB 1FXXA 3I5SA 4M77D 4PKCC 1G3SA 1B34B 3C95A 4A4FA 1WHGA 4KGXB 4BI8B 2DA9A 1YP5A 2RK2A 1YI2T 5GAMg 3LLRA 4LDYA 3U23A 1UB4A 4DOVA 2DILA 2LMJA 2E3IA 3BW1A 1NEBA 1WZOA 2QQAA 3OA6A 1VA7A 1QVFP 1JB0E 3V7RA 2ZPFB 2HEQA 3VRYA 2D6FA 1OU8A 3CCLQ 2F5KA 3THKA 2X9HA 1BI1A 1RL2A 5M9OA 4FYYB 1RAAB 4M7AD 4OGCA 3TQ7P 3DKMA 5CR2A 2KQWA 1ZSZA 4AG1C 3C12A 5DM7R 2FL7A 4XQ3A 3HKSA 4JUVA 5GAMh 3X24B 4R55A 1SG5A 2E41A 3GLXA 2YSQA 5KYUB 4CC7A 1RACB 2RPNA 3PNWC 2COWA 3HTRA 2JJ9A 4CC4B 1JQQA 1Y96A 1RAFB 2ENMA 1YWOA 1WQ7A 1BBZA 2OX7A 1I4K1 2IVWA 2KYMA 2RB6A 1M1KC 3MEUA 2VB6A 1AD5A 4J5YA 4CC3A 1JXOA 1GCQC 1SRMA 5GJWB 1Q81C 3Q1JA 2ZZDA 4C92G 3PIPA 1QVGS 1ZSGA 2A08A 1ACMB 2YLBA 2LQKA 5GMKh 1HD3A 2KT1A 2DK3A 2QYZA 4LD6A 4DOWA 3OW2S 1W2BP 3M57A 1NJIR 2OTLT 3EFOA 4HVUA 1UE9A 1KK7A 5CCAA 3PMIA 1X43A 3FJPA 4N4IA 3C4SA 3LGFA 3CXCS 4OMNA 3O5ZA 1MMNA 1PD1A 2F2VA 1D1BA 1YJWQ 1VQOT 1JXMA 2GNCA 3UF4A 2CZ1B 1EX4A 2DXUA 4A4HA 2RD1A 2CP0A 4OB0B 4FSSA 3G71Q 3E1SA 3I9QA 4RMOA 2XDBA 1MMGA 3INZA 3UA7A 4BE1A 2EGAA 4XTXA 2ROLA 3VS0A 2ROTA 2I2LA 1K9MU 3HSBA 3MPUB 1X6GA 2BTTA 2X3XD 3A8LB 4M77C 3PFSA 1OU9A 4C8QA 2K79A 3S3OA 4PJOA 1UG1A 3OYIA 1WI7A 3MEAA 4ESRA 1BYMA 1ZA1B 2DM1A 5FLXE 4F7UB 1AWWA 2EJFA 3RKXA 3CMEQ 1OZ3A 4HCZA 1HYOA 1KHCA 3VS1A 2RHXA 2KGTA 1H8KA 2CP5A 4F14A 1UJ0A 2QG9B 1ZSZB 1KSWA 4M7AC 3QUIA 2K5LA 1WHHA 3CMAT 1D1AA 2QGGA 4IURA 3L2WA 3EG3A 2V26A 4JS4A 5GAOq 1VQ8Q 1M3CA 1Y96B 2OTLA 3SFMA 4KRTA 5KE2A 3RR6A 3TSZA 1PWTA 3OYYA 1KD1U 4PFOA 4QQGA 1D0YA 4D8DA 2QEXQ 1KC8R 1K8AC 1PCXA 4M7DG 2X51A 3JCMf 1VQOA 5CKEA 1BIAA 3CBPA 1WA7A 3UATA 3DB4A 4XU3A 1OZ2A 4M78A 2F2WA 4JZ4A 4XTUA 3OYMA 2DKGA 2DD4A 3JV3A 2KAFA 4QKUA 2DAQA 3CCLT 4RTWA 3OYCA 1NM7A 5AT1B 3I56Q 4LDWA 3EFRA 3NFCA 3WVDB 1T3LA 3X20B 3M56A 2VV5A 1U3OA 3IQLA 1SSHA 3J80E 3ASKA 4L5GA 2CP6A 3EG0A 3SWNA 1WX6A 2P0KA 4L6V5 1ZUUA 4BB7A 3OYJA 2EQIA 5HK0A 5LJ3j 2L8DA 1IB8A 4L59A 1TTHB 1W1FA 1SHFA 3CPWA 2W0ZA 3V7CA 5KYXB 2JXBA 4JJBA 2E3HA 3E19A 1MHNA 5A2QE 2QA4Q 4XAXB 4C8QB 5FRMA 3H0HA 1NYFA 4LDUA 2JTEA 1BI0A 4PJOB 2P4TA 3EG9A 1ZBXA 1RABB 5LJ3e 3CMAA 2MAMA 1K9AA 4JZ3A 3NMZC 4FCYA 4ZGEB 1BKBA 2RK1A 5CIUA 1O75A 3M0SA 1BCMA 2CUBA 1QVPA 2JOYA 2PVDB 5FWBA 4KULA 1ZUYA 1VQ7Q 2O4XA 2COYA 1UHFA 2M51A 2X4JA 4AFQC 1M5Q1 1OPKA 2YLCA 2LT1A 2DNUA 2Y90A 1IXDA 3D7SB 2XMFA 5KYNA 2CGHA 1M1KR 4RG8A 1YJWT 2J6KA 2XKOC 1Q81R 2L89A 2O9SA 3OYGA 2AK5A 2JUFA 2DZ9A 2PZ1A 1W4SA 3JB9D 2A37A 1WNLA 1Y71A 5I2MA 3G71T 2MPXC 5GAMj 5GMKl 1H92A 2RQTA 3GOXA 3CCQA 4M77E 3X25B 2RQUA 3M0PA 3S6WA 2RJFA 3OS1A 1N8RC 4FM4B 3MKDA 4C92A 2LCSA 3VS7A 4F7UG 1Q82U 4M77F 1OYXA 4KH1B 1LOJA 2DXTA 5GAMe 1ZA2B 2LZ6B 4M78B 4HCCA 5J26A 3CCRQ 3CMET 1CSKA 5GMKj 2XD0A 2HSPA 1VQNQ 4EMKC 1KHIA 4QT7A 4M7AE 2YWWA 1QW1A 1NJIU 2P4RA 1VUBA 3M0TA 5LJ5f 3P8BB 3CD6Q 4N0AA 3RBBB 3VS2A 2HBWA 5I22A 1WHLA 4M7AF 3SWNB 5CVIA 1S72Q 1QKWA 4IUPA 2DF6A 5GMKe 4KGVB 2QDLA 1RAHB 3JRZA 3OYNA 4AMCA 2M0YA 3E9GA 1VQ8T 2W10A 3HFNA 2CT3A 1WXUA 3JCMW 5CKDA 3EGXA 3UWNA 2GGRA 4FIBA 3RKWA 3JB9J 2CYZB 1Q82C 4A4KA 1MV0B 2V8IA 3EG9B 2EKOA 2DE0X 3FC3A 1VQMQ 2QEXT 3GPLA 2WSFE 1VQ5Q 1K1ZA 2E1HA 1YITQ 4EIKA 1I81A 4JPBW 4VUBA 5A0DA 1JJ2P 4WCIA 2R5MA 3FJ5A 4OMFB 2RHYA 5KCOA 2PUOB 5CQYA 2DJQA 3I56T 4M75G 2YUPA 3HPWA 3MO8A 3M59A 1N5ZA 2LJ3A 2CZ0B 1K73R 2AZVA 1WHJA 2FZCB 1ZX6A 2KNBB 3L2ZA 1EIFA 3OS0A 1K8AR 3G4SQ 1B34A 4ANJA 1R0CB 2VGMA 4X34A 3BE3A 1FWZA 3VUBA 4BY6C 3NPFA 5IHNA 3PGGA 1AWXA 4KUIA 1ZQ1A 5D7UA 2KBTA 2KROA 4NS5A 3J81E 2AKLA 3V8JA 4R0KA 1PM3A 5C6SA 3QZ9B 4C5EA 2MWOA 4C92B 1G8XA 1PC0A 2BKDN 1YIJQ 1UECA 4M7DA 1P92A 2QA4T 1FMWA 1YJNQ 1TUCA 1XQHA 1BI2A 1WDXA 3OMGA 4C0GA 3CBOA 4J6WA 3CCVA 3SEMA 4FSXA 3SD4A 1IHVA 1LNXA 5D6XA 1KC8U 2OJ2A 3L2RA 2NUTB 1VQ7T 2EYZA 1I8FA 1M90U 4LE9A 4IUQA 2J05A 3CC2A 2EW3A 2JT4A 2QEXA 3LH0A 1DJ7B 2J6FA 1G3TA 2HBPA 3O8VA 3OBWA 2RF0A 4ZNXA 2JNGA 1OX8A 2P0PA 3OS5A 3EGXB 1K0XA 2K57A 3OYKA 5D6WA 3QWYA 2CH4W 4QQDA 2XI9A 3JAME 2DL3A 2MMPA 3TVTA 3QYGB 1VQKQ 1VQLQ 1M2VB 2M9UA 5LJ3f 4JRIA 3NTKA 2EQJA 2KYBA 2NUPA 3KXTA 4BD3A 2O01E 3RESA 1N9SA 2KVQG 1RAGB 4LUDA 1VQPT 3CCRT 2KMTA 3C94A 1BIBA 1M90C 2JW4A 2RI5A 3M53A 1GFCA 2JTFA 2C0IA 4F04B 1VQ4A 1X6BA 4RTTA 5FU6C 1N8RR 4MMLA 4OMQA 2DEQA 4OMOA 1WLPB 5GJVB 3G1JA 3EH1A 3CD6T 4HA8A 4KGZB 3CCJA 3LGLA 1S72T 2DERA 3CC4A 2DYBA 1PSEA 2ECZA 1YCSB 2A0FB 1M1KU 1YNZA 1RLQC 1M8MA 2NYSA 1WJRA 1AVZC 1AOJA 1Q81U 2CP7A 1WJQA 1VQ7A 2IPOB 2FYKA 4F7UA 4M7DB 1H641 1Z9ZA 4JS5A 5GMKm 3G6EQ 1CKBA 3OYLA 4JLGA 2HNIA 5I11A 2DFUA 5GAN8 3QKJA 1VQMT 4PNOA 2K3BA 4E7HA 4PLLA 1M1FA 3QXEB 1VQ5T 2KK4A 5GAMf 1NZ9A 3FDRA 1CKAA 3WVEB 1YITT 2RQWA 1SPKA 1OQKA 3TEEA 3UDCA 1A0NB 1M4ZA 3RDVA 2E6NA 2KXDA 2RJCA 4RTVA 1AWJA 4Z8AA 3I55A 1PKSA 1IO6A 4JRPA 1E7OA 4FYVB 2COZA 1PRLC 2YDLA 1Q82R 2EGCA 1YJ9A 4D6WA 1Z9QA 4BI3A 3A5ZB 4C5IA 1VQ9Q 1B07A 1RLPC 2E10A 4JLIA 3CCEA 4PL6A 1RAEB 1AZGB 3JB9I 1Q86C 3G4ST 3QO3A 3CEYA 4HXJA 2CKKA 2DXBA 8AT1B 1OEBA 1VQPA 4JJCA 3I5RA 2DYIA 1YHQA 3OSSC 1VQ6Q 1Y0MA 1OI1A 4RTZA 5GAOn 3JB9F 3BFMA 4II1A 1G2BA 2RM4A 5GAOr 1AWOA 2Y4XA 1YIJT 1W6XA 2EQUA 4XTWA 4GLMA 3UPUA 1K0SA 2J7IA 3HRUA 4O6JA 1YJNT 1MV3A 3MHXA 3CD6A 2NUPB 3SHWA 2E64A 1M2OA 2K4YA 1TUDA 4CC2A 1UDLA 1VIFA 4K11A 3GBQA 2QASA 1YI2A 2GCXA 4O5VA
chains in the Genus database with same CATH topology
1PKTA 2EQIA 1NEGA 2KRNA 5EC7A 2EBPA 1W1FA 2KT8A 1SHFA 2GTJA 2W0ZA 2D0NA 3PVLA 1I0CA 1X27A 2JXBA 4JJBA 2JM8A 2YT6A 1GRIA 1JU5C 3H0HA 1NYFA 2JTEA 2KEAA 1KJWA 2L3SA 3VS5A 2GBQA 1K4US 1BB9A 2DRMA 1X2QA 1K9AA 4JZ3A 3NMZC 2VVKA 3EHRA 2F2XA 1UUEA 1I1JA 3M0SA 2CUBA 5FWBA 1VYVA 2OAWA 1ZUYA 4LUEA 1GBQA 3PVQA 2LQWA 3UA6A 1JEGA 4J9BA 1UHFA 2E5KA 2YUQA 2DBKA 2M51A 4ORZA 3H41A 4AFQC 3M0RA 1OPKA 2J6OA 2DNUA 1GFDA 2O31A 2XMFA 2MIOA 1SHGA 1OV3A 1UTIA 2J6KA 3REAB 2LJ1A 2O9SA 1VYUA 2AK5A 2YUNA 4A63B 2CUDA 2ABLA 1GL5A 2C0TA 2DLPA 2FPFA 2V1RA 2PZ1A 1M27C 2A37A 1S1NA 2EVRA 1YN8A 2K9GA 5HCKA 1V1CA 1H92A 2RQTA 5FW9A 1NYGA 2RQUA 3M0PA 3EGUA 1SRLA 2LCSA 1FMKA 1UJYA 1TG0A 3VS7A 2EYYA 1UFFA 2LJ0A 1E6GA 1UGVA 1YWPA 1QWFA 3M0QA 2JMCA 2IIMA 1M30A 3EG2A 2LZ6B 1HJDA 1WIEA 1PHTA 1ARKA 2RNAA 2SEMA 1X2KA 2VWFA 1T0JA 2CDTA 2DRKA 1CSKA 1WXTA 2V1QA 2HSPA 1U06A 1NLOC 5IXFA 2L2PA 2SRCA 4QT7A 4F16A 5FWCA 2I0NA 2P4RA 3M0TA 2YUOA 2CSQA 3RBBB 3VS2A 2HBWA 5I22A 2C0OA 4Z88A 4OMMA 1QKWA 3NGPA 2DF6A 2K2MA 3C0CA 1M3BA 4LN2A 2QDLA 2CH4A 4OMPA 2M0YA 2W10A 2A28A 2CT3A 2PTKA 1OPLA 1WXUA 4J9EA 3R6NA 1B3QA 2NUZA 2FRYA 2GGRA 2AZSA 1BK2A 4AFSC 2NWMA 1MV0B 1WFWA 2DL7A 2DE0X 4LNPA 2D1XA 2J06A 1K1ZA 2L0AA 2FG0A 5L23A 4EIKA 1M3AA 4HCKA 1SEMA 4JPBW 2O9VA 2K7AA 4WCIA 2DL4A 1FYNA 3FJ5A 2LX7A 4IIOA 1ZBJA 2ED0A 2HDAA 1ZUKA 2DJQA 2YUPA 1VYTA 3I5SA 1N5ZA 2LJ3A 2AZVA 4RTYA 3RNJA 1ZX6A 1NG2A 2KNBB 2CSIA 3EHQA 2DA9A 1YP5A 2O2OA 3U23A 1H3HA 2DILA 2LMJA 3NPFA 5IHNA 1AWXA 4GBQA 3VS3A 1NEBA 2KBTA 2KROA 2CREA 2ED1A 2EGEA 4AFZC 1VA7A 2AKLA 2HEQA 3VRYA 4R0KA 3THKA 1UECA 4OMLA 4JJDA 2DX1A 2AKKA 1TUCA 1WDXA 4AG1C 1QLYA 3PE0A 3SEMA 3I35A 1AEYA 1BU1A 2KE9A 2BZ8A 2FPDA 2DBMA 1ABOA 5IHKA 1KFZA 2KRSA 2OJ2A 2YSQA 1UHCA 2VKNA 4J9GA 4CC7A 2EPDA 2RPNA 1PRMC 2EYZA 1JQQA 4CC4B 2L3PA 3QWXX 4X1VA 4Z89A 2ENMA 1YWOA 1QKXA 1Y57A 4LE9A 1BBZA 3VS4A 2KYMA 3CQTA 4HVWA 2J05A 1AD5A 4CC3A 1JXOA 4RUGA 4DEYA 2EW3A 2JT4A 1GCQC 1SRMA 4M4ZA 5GJWB 2J6FA 1KIKA 2JMAA 4J9DA 3TSWA 5IH2A 1ZSGA 2A08A 2RF0A 4ZNXA 1HD3A 2KT1A 2BZXA 4IIMA 2FEIA 5IXBA 1QCFA 1LCKA 4HVUA 1K0XA 3ZL7C 1UE9A 3QWYA 2CH4W 1T0HA 2KRMA 1X43A 2DL3A 2ESWA 2LNHB 2DL8A 4E6RA 3TVTA 1I07A 2LP5A 2HCKA 4J9FA 3O5ZA 4OMNA 1OOTA 2F2VA 2CT4A 1JO8A 1JXMA 2GNCA 3UF4A 2KYBA 2MCNA 1T3SA 1W70A 4LUDA 2L3QA 4J9CA 1G83A 3VS6A 4FSSA 4J9HA 1ZLMA 2JW4A 2K6DA 3I9QA 1GFCA 3VRZA 2BZYA 2RQRA 3UA7A 2EGAA 2C0IA 2RQVA 2ROLA 1X6BA 2RN8A 4RTTA 3VS0A 2ROTA 2GTOA 4OMQA 2FRWA 1RI9A 1WLPB 1X6GA 2BTTA 4OMOA 5GJVB 2X3XD 1WYXA 3REBB 2KR3A 1RUWA 2K79A 4Y92A 1WXBA 1UG1A 5IHIA 1WI7A 2DYBA 2ECZA 1YCSB 4ESRA 1YNZA 1RLQC 5ECAA 1M8MA 2O88A 1AVZC 1AOJA 2DM1A 3LH5A 1AWWA 2D8JA 2EKHA 1QWEA 4F17A 2EYXA 3VS1A 1Z9ZA 2KGTA 1H8KA 4F14A 1UJ0A 1CKBA 5I11A 2OI3A 1KSWA 1PNJA 2K3BA 2PNIA 1GBRA 2FO0A 2JS2A 1U5SA 1CKAA 2X3WD 1NLPC 4D8KA 2RQWA 1SPKA 2KXCA 3H0IA 4AG2C 2B86A 3NHNA 3EG3A 3KFVA 1A0NB 3H0FA 1M3CA 2A36A 4KRTA 2KXDA 1E6HA 4RTVA 1AWJA 4Z8AA 2DVJA 4HVVA 3TSZA 2G6FX 1PWTA 1PKSA 1IO6A 2DL5A 1E7OA 2DMOA 1PRLC 2YDLA 2FPEA 2EGCA 4RTUA 4J9IA 1J3TA 4D8DA 1XOVA 1Z9QA 2H8HA 1GCPA 1B07A 1RLPC 1AZGB 2JM9A 4DEXA 1X69A 4HXJA 1K76A 1WA7A 2D8HA 3UATA 1OEBA 4JJCA 3I5RA 1EFNA 2F2WA 4JZ4A 2MOXA 3A98A 1Y0MA 4RTZA 2EYWA 3JV3A 1G2BA 1GCQA 1AWOA 4RTWA 2LQNA 1W6XA 1NM7A 2GQIA 4GLMA 1K0SA 2J7IA 1T3LA 4RTXA 1HSQA 1MV3A 2RMOA 3ULRB 2JS0A 3SHWA 1AZEA 1U3OA 1TUDA 3EG1A 1SSHA 3IQLA 4CC2A 1MUZA 1UDLA 4AFUC 3M0UA 3EG0A 1ABQA 4K11A 1WX6A 3GBQA 1ZUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PKT A;  2EQI A;  1NEG A;  2KRN A;  5EC7 A;  2EBP A;  1W1F A;  2KT8 A;  1SHF A;  2GTJ A;  2W0Z A;  2D0N A;  3PVL A;  1I0C A;  1X27 A;  2JXB A;  4JJB A;  2JM8 A;  2YT6 A;  1GRI A;  1JU5 C;  3H0H A;  1NYF A;  2JTE A;  2KEA A;  1KJW A;  2L3S A;  3VS5 A;  2GBQ A;  1K4U S;  1BB9 A;  2DRM A;  1X2Q A;  1K9A A;  4JZ3 A;  3NMZ C;  2VVK A;  3EHR A;  2F2X A;  1UUE A;  1I1J A;  3M0S A;  2CUB A;  5FWB A;  1VYV A;  2OAW A;  1ZUY A;  4LUE A;  1GBQ A;  3PVQ A;  2LQW A;  3UA6 A;  1JEG A;  4J9B A;  1UHF A;  2E5K A;  2YUQ A;  2DBK A;  2M51 A;  4ORZ A;  3H41 A;  4AFQ C;  3M0R A;  1OPK A;  2J6O A;  2DNU A;  1GFD A;  2O31 A;  2XMF A;  2MIO A;  1SHG A;  1OV3 A;  1UTI A;  2J6K A;  3REA B;  2LJ1 A;  2O9S A;  1VYU A;  2AK5 A;  2YUN A;  4A63 B;  2CUD A;  2ABL A;  1GL5 A;  2C0T A;  2DLP A;  2FPF A;  2V1R A;  2PZ1 A;  1M27 C;  2A37 A;  1S1N A;  2EVR A;  1YN8 A;  2K9G A;  5HCK A;  1V1C A;  1H92 A;  2RQT A;  5FW9 A;  1NYG A;  2RQU A;  3M0P A;  3EGU A;  1SRL A;  2LCS A;  1FMK A;  1UJY A;  1TG0 A;  3VS7 A;  2EYY A;  1UFF A;  2LJ0 A;  1E6G A;  1UGV A;  1YWP A;  1QWF A;  3M0Q A;  2JMC A;  2IIM A;  1M30 A;  3EG2 A;  2LZ6 B;  1HJD A;  1WIE A;  1PHT A;  1ARK A;  2RNA A;  2SEM A;  1X2K A;  2VWF A;  1T0J A;  2CDT A;  2DRK A;  1CSK A;  1WXT A;  2V1Q A;  2HSP A;  1U06 A;  1NLO C;  5IXF A;  2L2P A;  2SRC A;  4QT7 A;  4F16 A;  5FWC A;  2I0N A;  2P4R A;  3M0T A;  2YUO A;  2CSQ A;  3RBB B;  3VS2 A;  2HBW A;  5I22 A;  2C0O A;  4Z88 A;  4OMM A;  1QKW A;  3NGP A;  2DF6 A;  2K2M A;  3C0C A;  1M3B A;  4LN2 A;  2QDL A;  2CH4 A;  4OMP A;  2M0Y A;  2W10 A;  2A28 A;  2CT3 A;  2PTK A;  1OPL A;  1WXU A;  4J9E A;  3R6N A;  1B3Q A;  2NUZ A;  2FRY A;  2GGR A;  2AZS A;  1BK2 A;  4AFS C;  2NWM A;  1MV0 B;  1WFW A;  2DL7 A;  2DE0 X;  4LNP A;  2D1X A;  2J06 A;  1K1Z A;  2L0A A;  2FG0 A;  5L23 A;  4EIK A;  1M3A A;  4HCK A;  1SEM A;  4JPB W;  2O9V A;  2K7A A;  4WCI A;  2DL4 A;  1FYN A;  3FJ5 A;  2LX7 A;  4IIO A;  1ZBJ A;  2ED0 A;  2HDA A;  1ZUK A;  2DJQ A;  2YUP A;  1VYT A;  3I5S A;  1N5Z A;  2LJ3 A;  2AZV A;  4RTY A;  3RNJ A;  1ZX6 A;  1NG2 A;  2KNB B;  2CSI A;  3EHQ A;  2DA9 A;  1YP5 A;  2O2O A;  3U23 A;  1H3H A;  2DIL A;  2LMJ A;  3NPF A;  5IHN A;  1AWX A;  4GBQ A;  3VS3 A;  1NEB A;  2KBT A;  2KRO A;  2CRE A;  2ED1 A;  2EGE A;  4AFZ C;  1VA7 A;  2AKL A;  2HEQ A;  3VRY A;  4R0K A;  3THK A;  1UEC A;  4OML A;  4JJD A;  2DX1 A;  2AKK A;  1TUC A;  1WDX A;  4AG1 C;  1QLY A;  3PE0 A;  3SEM A;  3I35 A;  1AEY A;  1BU1 A;  2KE9 A;  2BZ8 A;  2FPD A;  2DBM A;  1ABO A;  5IHK A;  1KFZ A;  2KRS A;  2OJ2 A;  2YSQ A;  1UHC A;  2VKN A;  4J9G A;  4CC7 A;  2EPD A;  2RPN A;  1PRM C;  2EYZ A;  1JQQ A;  4CC4 B;  2L3P A;  3QWX X;  4X1V A;  4Z89 A;  2ENM A;  1YWO A;  1QKX A;  1Y57 A;  4LE9 A;  1BBZ A;  3VS4 A;  2KYM A;  3CQT A;  4HVW A;  2J05 A;  1AD5 A;  4CC3 A;  1JXO A;  4RUG A;  4DEY A;  2EW3 A;  2JT4 A;  1GCQ C;  1SRM A;  4M4Z A;  5GJW B;  2J6F A;  1KIK A;  2JMA A;  4J9D A;  3TSW A;  5IH2 A;  1ZSG A;  2A08 A;  2RF0 A;  4ZNX A;  1HD3 A;  2KT1 A;  2BZX A;  4IIM A;  2FEI A;  5IXB A;  1QCF A;  1LCK A;  4HVU A;  1K0X A;  3ZL7 C;  1UE9 A;  3QWY A;  2CH4 W;  1T0H A;  2KRM A;  1X43 A;  2DL3 A;  2ESW A;  2LNH B;  2DL8 A;  4E6R A;  3TVT A;  1I07 A;  2LP5 A;  2HCK A;  4J9F A;  3O5Z A;  4OMN A;  1OOT A;  2F2V A;  2CT4 A;  1JO8 A;  1JXM A;  2GNC A;  3UF4 A;  2KYB A;  2MCN A;  1T3S A;  1W70 A;  4LUD A;  2L3Q A;  4J9C A;  1G83 A;  3VS6 A;  4FSS A;  4J9H A;  1ZLM A;  2JW4 A;  2K6D A;  3I9Q A;  1GFC A;  3VRZ A;  2BZY A;  2RQR A;  3UA7 A;  2EGA A;  2C0I A;  2RQV A;  2ROL A;  1X6B A;  2RN8 A;  4RTT A;  3VS0 A;  2ROT A;  2GTO A;  4OMQ A;  2FRW A;  1RI9 A;  1WLP B;  1X6G A;  2BTT A;  4OMO A;  5GJV B;  2X3X D;  1WYX A;  3REB B;  2KR3 A;  1RUW A;  2K79 A;  4Y92 A;  1WXB A;  1UG1 A;  5IHI A;  1WI7 A;  2DYB A;  2ECZ A;  1YCS B;  4ESR A;  1YNZ A;  1RLQ C;  5ECA A;  1M8M A;  2O88 A;  1AVZ C;  1AOJ A;  2DM1 A;  3LH5 A;  1AWW A;  2D8J A;  2EKH A;  1QWE A;  4F17 A;  2EYX A;  3VS1 A;  1Z9Z A;  2KGT A;  1H8K A;  4F14 A;  1UJ0 A;  1CKB A;  5I11 A;  2OI3 A;  1KSW A;  1PNJ A;  2K3B A;  2PNI A;  1GBR A;  2FO0 A;  2JS2 A;  1U5S A;  1CKA A;  2X3W D;  1NLP C;  4D8K A;  2RQW A;  1SPK A;  2KXC A;  3H0I A;  4AG2 C;  2B86 A;  3NHN A;  3EG3 A;  3KFV A;  1A0N B;  3H0F A;  1M3C A;  2A36 A;  4KRT A;  2KXD A;  1E6H A;  4RTV A;  1AWJ A;  4Z8A A;  2DVJ A;  4HVV A;  3TSZ A;  2G6F X;  1PWT A;  1PKS A;  1IO6 A;  2DL5 A;  1E7O A;  2DMO A;  1PRL C;  2YDL A;  2FPE A;  2EGC A;  4RTU A;  4J9I A;  1J3T A;  4D8D A;  1XOV A;  1Z9Q A;  2H8H A;  1GCP A;  1B07 A;  1RLP C;  1AZG B;  2JM9 A;  4DEX A;  1X69 A;  4HXJ A;  1K76 A;  1WA7 A;  2D8H A;  3UAT A;  1OEB A;  4JJC A;  3I5R A;  1EFN A;  2F2W A;  4JZ4 A;  2MOX A;  3A98 A;  1Y0M A;  4RTZ A;  2EYW A;  3JV3 A;  1G2B A;  1GCQ A;  1AWO A;  4RTW A;  2LQN A;  1W6X A;  1NM7 A;  2GQI A;  4GLM A;  1K0S A;  2J7I A;  1T3L A;  4RTX A;  1HSQ A;  1MV3 A;  2RMO A;  3ULR B;  2JS0 A;  3SHW A;  1AZE A;  1U3O A;  1TUD A;  3EG1 A;  1SSH A;  3IQL A;  4CC2 A;  1MUZ A;  1UDL A;  4AFU C;  3M0U A;  3EG0 A;  1ABQ A;  4K11 A;  1WX6 A;  3GBQ A;  1ZUU A; 
#chains in the Genus database with same CATH topology
 1NEG A;  2VGN A;  4M75 A;  2KT8 A;  2XDD A;  3LWI A;  8ATC B;  1HK9 A;  2HMA A;  2F69 A;  2YRC A;  3VU3 C;  2ZPB B;  5KYX A;  2OTJ Q;  3CCU Q;  1KJW A;  1Q7Y C;  1UGP B;  1B7T A;  2GBQ A;  3FEO A;  2DRM A;  1X2Q A;  1K73 U;  3EHR A;  2F2X A;  1I1J A;  4Q5W A;  4M77 B;  4C8Q D;  3MP8 A;  1UGS B;  3A8O B;  5GAN 7;  1VYV A;  2OAW A;  3OYH A;  1K8A U;  2WSE E;  4PJO D;  2LRQ A;  2DXC A;  4ATO A;  3PVQ A;  2LQW A;  3UA6 A;  4PJL A;  4ORZ A;  2EIF A;  3LYI A;  4C0D C;  4BE2 A;  3HL8 A;  2DIG A;  5L8R E;  1VQK T;  3CC7 Q;  1VQL T;  2X4W A;  1QQJ A;  1UTI A;  2BIV A;  3CCM Q;  3REA B;  3X26 B;  3G4S A;  1VYU A;  2YUN A;  4E2F B;  2KDS A;  1GL5 A;  4M7A B;  2FPF A;  1ZSZ C;  2DET A;  1YN8 A;  2X35 A;  1V1C A;  4C0F A;  2ZPG B;  4B9X A;  1YIJ A;  1QVF S;  3BDU A;  2CS7 A;  5CKB A;  1IZ6 A;  1FMK A;  1UJY A;  1U1T A;  1K73 C;  4OB1 B;  1KQS A;  4E7S A;  5GAN 3;  5GAN f;  1FX7 A;  1WIE A;  2AIR B;  2RNA A;  3HHT B;  2RI3 A;  2SEM A;  1X2K A;  2VWF A;  3H9N A;  3VYH B;  2CDT A;  2DRK A;  3EGD A;  1M90 R;  2V1Q A;  1NLO C;  2ZGW A;  2L2P A;  5CO7 A;  2P84 A;  4M78 D;  5KYY B;  3QDR B;  2BUD A;  4FW1 A;  5FWC A;  3G6E T;  1WHK A;  3TRE A;  2C0O A;  4E7L A;  2D0Q B;  2QXF A;  4OMM A;  4A54 A;  3L42 A;  1PD0 A;  4OVA A;  3M54 A;  1D3B A;  1M3B A;  4M75 B;  2CH4 A;  5HKC A;  3OYE A;  3P8H A;  4UC4 A;  2A28 A;  3QPH A;  1X01 A;  2JVV A;  4N4H A;  3H8Z A;  3HRT A;  1B3Q A;  3VUZ A;  4NOY A;  2FRY A;  3P8D A;  1TS9 A;  2AZS A;  1NPR A;  1BK2 A;  1W2B S;  4AFS C;  2DVE A;  1PSF A;  4OP0 A;  4XTZ A;  2K3Y A;  1IRE B;  5HK3 A;  1WFW A;  2DL7 A;  1VQ9 T;  5A0L A;  1N8R U;  3OBY A;  2J06 A;  4WTO B;  3M5A A;  3OSV A;  3RUX A;  3PT9 A;  3ZEH A;  4XTY A;  5FU7 B;  5GMK i;  5LJ5 d;  4J7I A;  2FG0 A;  2DIQ A;  5L23 A;  4J6X A;  1SEM A;  4C8Q C;  4J83 A;  2K7A A;  1YCY A;  1VQ6 T;  4PJO C;  2DL4 A;  2LCL A;  4BE0 A;  2ATC B;  5CKH A;  2HDA A;  1D0X A;  4RTY A;  3RNJ A;  1IHW A;  5J39 A;  3OYF A;  4EDU A;  3CCS Q;  2D9T A;  1Q86 R;  5J3B A;  7AT1 B;  3HRS A;  1H3H A;  3VS3 A;  3R6O A;  2Z0W A;  2CRE A;  2EGE A;  2ED1 A;  4AFZ C;  4DQ2 A;  4EPC A;  3NTI A;  4MZM A;  2HQX A;  4M77 G;  5KCH A;  4JJD A;  3CCL A;  2AKK A;  2OTJ T;  3CCU T;  5I21 A;  4BI4 A;  2RHZ A;  3CPW P;  3H6Z A;  1U8R A;  3GF5 A;  4C92 D;  1BU1 A;  2KE9 A;  2BZ8 A;  4RCC A;  2MK5 A;  2DBM A;  2XU8 A;  5IHK A;  2KRS A;  1KFZ A;  3EGD B;  3RMS A;  2VKN A;  4J9G A;  2EPD A;  1PRM C;  2L3P A;  3CPF A;  4OB2 B;  1VIE A;  1WJS A;  4X1V A;  2NUT A;  3RMQ A;  4Z89 A;  4RG2 A;  2JZ2 A;  4M78 C;  5LJ5 g;  2KI7 A;  4E7Z A;  3QHS A;  3VS4 A;  3CC7 T;  1KQ1 A;  3CQT A;  4C5G A;  3OYA A;  4M7A G;  4EMK B;  4XU2 A;  4DEY A;  1Q7Y R;  1VQ9 A;  4RKU E;  1KIK A;  2JMA A;  4J9D A;  3TSW A;  5IH2 A;  1D3B B;  3CCM T;  4QVZ A;  1V76 A;  3MP1 A;  2BZX A;  2FEI A;  5IXB A;  1QCF A;  2PUK B;  1LCK A;  3SWN C;  2IG0 A;  3GNG A;  5DLQ E;  4MZP A;  1T0H A;  5CAI A;  2LNH B;  2DL8 A;  1LPL A;  4E6R A;  2BE7 D;  1I07 A;  2LP5 A;  2A3L A;  5LJ5 h;  2HCK A;  3X28 B;  2DTO A;  2EWN A;  3DB3 A;  1MMD A;  2MCN A;  1ZHI A;  1T3S A;  1NPP A;  2JN0 A;  1M2V A;  5DLO A;  3OB9 A;  1YJW A;  2QQR A;  5GAO l;  4V2S A;  2L3Q A;  4J9C A;  2JTM A;  2DZC A;  3UT1 A;  3VS6 A;  4AT1 B;  4J9H A;  4XU1 A;  4HCB A;  3VRZ A;  3L2V A;  2BZY A;  3G71 A;  1QVG A;  1R0B G;  1FMV A;  4BUG A;  2GTO A;  4CI0 C;  2FRW A;  1RI9 A;  2EJG A;  4HT9 A;  3OW2 A;  3GIB A;  3OS2 A;  2YXY A;  4Y92 A;  1XJW B;  9ATC B;  5FRN A;  2B8A A;  5ECA A;  4NL3 A;  2HKN A;  1Y07 A;  4PK4 A;  5C0M A;  3CXC A;  2QGF B;  2EKH A;  1LJO A;  1QWE A;  4F17 A;  2CZ6 B;  3CME A;  1C0M A;  2FZK B;  3M9Q A;  1UGQ B;  1KG1 A;  3HFO A;  5GAN 4;  2OI3 A;  3CC7 A;  3JCM X;  1AHJ B;  1X75 C;  4C8Q E;  1GBR A;  4M7D D;  2EQM A;  2FO0 A;  2LC4 A;  4PJO E;  4C92 C;  4D8K A;  3H0I A;  1R8O B;  2B86 A;  4TVR A;  5D6Y A;  2OAU A;  2OTL Q;  3KFV A;  3M58 A;  4C8Q F;  4QQ6 A;  4Y28 E;  5CQX A;  3JSC A;  1VQ8 A;  4PJO F;  1E6H A;  2DVJ A;  4HVV A;  2F5T X;  2HSE B;  2RJD A;  2RO0 A;  5HY6 A;  4J9I A;  1QVG P;  3JCM c;  1GCP A;  1VQO Q;  1YBY A;  3CCS T;  4DEX A;  4IUT A;  3DLL A;  2D8H A;  5KE3 A;  3M4Y A;  4N0A C;  5GAN 5;  1EFN A;  3TCJ A;  3A98 A;  2EYW A;  2RHI A;  1GCQ A;  1WHM A;  2LQN A;  3ME9 A;  2GQI A;  5GAN 2;  4MMK A;  2FVU A;  4RTX A;  2FHD A;  1G3W A;  3I56 A;  2RMO A;  1I5L A;  4A4G A;  5LL6 S;  3ULR B;  2XDP A;  1QCO A;  2JS0 A;  1AZE A;  2HL3 A;  3JCM e;  3EG1 A;  1QVF A;  1MUZ A;  3M0U A;  4KUD K;  1PKT A;  5EC7 A;  3GP8 A;  4M78 E;  4Z02 A;  2GTJ A;  3PVL A;  1X27 A;  3NTH A;  1VQN T;  1YFN A;  2X4Y A;  4OB3 B;  2C06 A;  2YT6 A;  4IUV A;  4EMG A;  1JU5 C;  3URG A;  4M78 F;  3ER0 A;  2DO3 A;  3SB2 A;  2Y4Y A;  2KEA A;  3CMA Q;  3VS5 A;  2QA4 A;  2ZPH B;  3V8K A;  2VVK A;  1UUE A;  3OYB A;  2DPP B;  4EMH A;  1TH7 A;  4LUE A;  1GBQ A;  2CP2 A;  1Q86 U;  2QK0 A;  4M77 A;  3LX7 A;  1JEG A;  4KH0 B;  2E5K A;  1BI3 A;  2HQH A;  1JJ2 S;  2HQE A;  1UEB A;  2O31 A;  4PJJ A;  3AHU A;  2MIO A;  1SHG A;  2L3R A;  1W2B A;  3EH2 A;  5DY9 A;  1I5O B;  4M7D C;  5KYW B;  2LJ1 A;  3CCS A;  2QTX A;  2CUD A;  2EQK A;  2C0T A;  2DLP A;  1M27 C;  3A8G B;  1S1N A;  3CCQ Q;  2EVR A;  2K9G A;  5HCK A;  4MDW A;  2QAZ A;  4M7A A;  5FW9 A;  1NYG A;  2HZY A;  2H3J A;  4WF2 A;  2CZ7 B;  2L5Q A;  1TU0 B;  4J7F A;  3FRN A;  4DBR A;  2KSS A;  1UFF A;  1E6G A;  1HXD A;  4QW2 A;  1UGV A;  2M16 A;  4R56 A;  2ZCF B;  1YWP A;  1M1G A;  3M0Q A;  2JMC A;  2EAY A;  3EG2 A;  1HJD A;  1PHT A;  1Q7Y U;  1ARK A;  4BDY A;  2BE9 B;  3JB9 G;  2EJ9 A;  5GAN 6;  1T0J A;  2A7Y A;  3CCR A;  2EFI A;  1WXT A;  2F1L A;  2SRC A;  5KH6 A;  1MNE A;  1VQN A;  1SSF A;  4E47 A;  4PJM A;  2CSQ A;  2QTV A;  1N9R A;  4C92 E;  4BDZ A;  5KYY A;  4JJN K;  4Z88 A;  1JRI A;  1TSF A;  5LJ5 j;  2RA2 A;  1WPY A;  1S72 A;  2DEU A;  4LN2 A;  4C92 F;  3V7S A;  2YHT A;  5GAO m;  3JCM d;  1OPL A;  3R6N A;  5GAN d;  2NUZ A;  3JCM b;  1Y7X A;  3MET A;  1G3Y A;  4LDX A;  4M75 D;  2NWM A;  4E7K A;  5LJ5 e;  4LNP A;  4X9D A;  1VQM A;  4GY5 A;  1XTD A;  5IN1 A;  1VQ5 A;  2LNV A;  4FW2 A;  1AT1 B;  2QQS A;  1YIT A;  4LXC A;  2GQV A;  4ME7 A;  1ZBJ A;  3MP6 A;  3SDZ A;  4J8O A;  4C5H A;  1ZUK A;  1F1B B;  3PTA A;  2VXF A;  1VYT A;  4JRK A;  2DTH A;  4QVD A;  1NG2 A;  3VJP A;  2CSI A;  3EHQ A;  4C0D B;  1N6A A;  2H3E B;  2O2O A;  3E9F A;  4HKE A;  1U1S A;  3PIO A;  5EG2 A;  4FU6 A;  4GBQ A;  3KUF A;  4MDX A;  3F70 A;  4IKF A;  1WQW A;  4CRI A;  3V8L A;  2PQW A;  4DBF A;  3JCM P;  4OML A;  2LVM A;  3L1A A;  1RI0 A;  2DX1 A;  5CKF A;  3JCM J;  3CCV Q;  1YJN A;  2FB7 A;  2MF2 A;  4Y91 A;  1IGU A;  1SF9 A;  2AT1 B;  3JCM g;  3ZFJ A;  5GAN g;  1QLY A;  2LCC A;  3PE0 A;  3I35 A;  3QBY A;  1AEY A;  3AT1 B;  2FPD A;  2NLU A;  1ABO A;  3PMT A;  3QDF A;  2E5Q A;  1UHC A;  1K9M C;  4KT0 E;  3MEV A;  4XK8 E;  3QWX X;  3MEW A;  1PG5 B;  1QKX A;  2M02 A;  3FB9 A;  1Y57 A;  4ZN1 A;  4XTV A;  3CC2 Q;  2XID A;  4M7D E;  3QYH B;  2DTI A;  2PU9 B;  1QCN A;  4HVW A;  4RUG A;  4B9W A;  4M4Z A;  4PLI A;  2CP3 A;  4FL6 A;  3JCM h;  4EMK A;  1EZZ B;  5GAN h;  3VV0 A;  4M7D F;  3EFO B;  4IIM A;  1Q95 G;  4DBH A;  3CCQ T;  3WXM B;  3ZL7 C;  1QP3 A;  2DJZ A;  2KRM A;  3LWH A;  2R57 A;  2M0O A;  4ZTJ A;  2ESW A;  1X6O A;  4PFP A;  3OYD A;  2PVG B;  4M75 C;  3G7Z A;  3RKY A;  4J9F A;  1VQK A;  3LW5 E;  1D0Z A;  1OOT A;  2CT4 A;  4X9C A;  1VQL A;  2MI6 A;  1JO8 A;  3RIR A;  3BY7 A;  1W70 A;  3S3N A;  4RCB A;  3MCA B;  1G83 A;  5IT9 E;  1H3Z A;  1KQS P;  2RHU A;  1KD1 C;  4FYW B;  2VXE A;  1ZLM A;  2HD0 A;  4FYX B;  2K6D A;  1RAD B;  1VQ4 Q;  2LTO A;  2QI2 A;  2RQR A;  2RQV A;  5FU7 C;  2RN8 A;  3T9N A;  3L2Q A;  4QVC A;  1WYX A;  3CCJ Q;  3QG1 A;  3REB B;  2KR3 A;  1RUW A;  3CC4 Q;  1M9S A;  2G3R A;  4DA4 A;  1TOV A;  1N27 A;  1WXB A;  2ZAE A;  5IHI A;  4ZGD B;  1QMC A;  3VKI A;  2O88 A;  2K3X A;  2ZPE B;  3LH5 A;  2DD5 A;  3M55 A;  2MWP A;  2D8J A;  3S3M A;  2EYX A;  2XHC A;  5I2S A;  2XK0 A;  2AHJ B;  4GLK A;  4YTL A;  4A53 A;  4ZN3 A;  3G6E A;  5FRO A;  1PNJ A;  2P0Q A;  2YRD A;  2PNI A;  1WGS A;  2LDM A;  2E65 A;  2JS2 A;  1U5S A;  3QII A;  2EYQ A;  1NLP C;  2X3W D;  3J7A F;  2KXC A;  4AG2 C;  3NHN A;  2E70 A;  3OY9 A;  4JDS A;  3H0F A;  2VC8 A;  2A36 A;  2E4H A;  1TXQ A;  5IAY A;  3GNF B;  3I55 Q;  2QDY B;  2G6F X;  5AYF A;  1YJ9 Q;  2DL5 A;  3M4G A;  4F7U E;  4KBM B;  2YRV A;  2DMO A;  2FPE A;  4RTU A;  4FT4 A;  1J3T A;  1NE8 A;  1XOV A;  1LVK A;  2H8H A;  3CCE Q;  1XNI A;  1JJ2 A;  3N5B B;  3TU4 K;  2QQB A;  3A1P A;  4F7U F;  2HL5 C;  2JM9 A;  1X69 A;  1K76 A;  1VQP Q;  1YHQ Q;  4LD9 K;  2M1H A;  2MOX A;  3A8M B;  4FT2 A;  4ZTF A;  4OF1 A;  1VQ6 A;  3DLM A;  2R58 A;  3QSU A;  1QP2 A;  1UGR B;  4ELZ C;  2VUB A;  4PFZ A;  2VYT A;  1NBE B;  1HSQ A;  3CCV T;  1OUL A;  3JCM Q;  1YI2 Q;  4AFU C;  3EFS A;  1ABQ A;  3EAE A;  2KRN A;  1V29 B;  6AT1 B;  2EBP A;  2VAS A;  4JRQ A;  2D0N A;  1I0C A;  2LT4 A;  2JM8 A;  4XU0 A;  2QQ9 A;  1GRI A;  3FIF A;  3CC2 T;  3BDL A;  2XG8 D;  4ELY C;  2L3S A;  4BAC A;  2HKQ B;  1K4U S;  2OTJ A;  1C1A A;  3CCU A;  1BB9 A;  5GAO p;  1BCO A;  3QJ6 A;  2KY9 A;  2O4X B;  3JCM V;  2E12 A;  5LJ3 d;  1NJI C;  3QZ5 B;  1K9M R;  4M75 E;  1KQS S;  4DBQ A;  4J9B A;  2YUQ A;  2DBK A;  2GF7 A;  3MJX A;  2WAC A;  3H41 A;  2K2V A;  4J6Y A;  3M0R A;  4BY6 B;  4P5N A;  2J6O A;  1GFD A;  3ZBD A;  4M75 F;  3JB9 H;  1R77 A;  1OV3 A;  2RH2 A;  1C6V X;  4A63 B;  4ZGJ B;  3A8H B;  3CCM A;  4C8Q G;  2ABL A;  1TUG B;  2V1R A;  5KYW A;  4PJO G;  2RJE A;  1VQ4 T;  2K5F A;  4C0Z A;  3EGU A;  1D09 B;  1SRL A;  3FLG A;  3CCJ T;  1TG0 A;  2EYY A;  2K5I A;  2LJ0 A;  3CC4 T;  1M8V A;  1QWF A;  2IIM A;  1M30 A;  3CPW S;  3OW2 P;  4OGE A;  1KD1 R;  5GAN j;  5GAM d;  1VOM A;  5KYU A;  1O9S A;  1U06 A;  4E7I A;  5IXF A;  4F16 A;  2XIC A;  3HP9 A;  4HT8 A;  2I0N A;  1IGQ A;  3CXC P;  2E6Z A;  4IUU A;  2YUO A;  3OMC A;  5A0G A;  5LJ3 g;  4PJN A;  3NGP A;  2K2M A;  5GAN e;  3C0C A;  3QJY A;  3OQ5 A;  2V8K A;  4OMP A;  2FZG B;  5CK9 A;  4A4E A;  4LDV A;  1MND A;  2MYS A;  2PTK A;  2R5A A;  4J9E A;  3I55 T;  3E2U A;  4M78 G;  1YJ9 T;  4N4G A;  1IRX A;  1MGQ A;  2RI2 A;  3CCE T;  2GFU A;  3CBM A;  4E7J A;  1KC8 C;  2WSC E;  5LJ3 h;  2D1X A;  1TWB A;  2LQ8 A;  1KQ2 A;  1SKU B;  3RER A;  4NL2 A;  4MZT A;  2ZPI B;  5FU6 B;  2L0A A;  3VYG A;  1YHQ T;  1G5V A;  3KBG A;  2HAX A;  3L2U A;  1M3A A;  4HCK A;  2O9V A;  1GXI E;  2GFA A;  2PVO B;  1MMA A;  1FYN A;  1OX9 A;  2LX7 A;  4IIO A;  2X4X A;  1JBM A;  2ED0 A;  1D1C A;  2V8J A;  2LX9 A;  4B6M A;  1RAI B;  1FXX A;  3I5S A;  4M77 D;  4PKC C;  1G3S A;  1B34 B;  3C95 A;  4A4F A;  1WHG A;  4KGX B;  4BI8 B;  2DA9 A;  1YP5 A;  2RK2 A;  1YI2 T;  5GAM g;  3LLR A;  4LDY A;  3U23 A;  1UB4 A;  4DOV A;  2DIL A;  2LMJ A;  2E3I A;  3BW1 A;  1NEB A;  1WZO A;  2QQA A;  3OA6 A;  1VA7 A;  1QVF P;  1JB0 E;  3V7R A;  2ZPF B;  2HEQ A;  3VRY A;  2D6F A;  1OU8 A;  3CCL Q;  2F5K A;  3THK A;  2X9H A;  1BI1 A;  1RL2 A;  5M9O A;  4FYY B;  1RAA B;  4M7A D;  4OGC A;  3TQ7 P;  3DKM A;  5CR2 A;  2KQW A;  1ZSZ A;  4AG1 C;  3C12 A;  5DM7 R;  2FL7 A;  4XQ3 A;  3HKS A;  4JUV A;  5GAM h;  3X24 B;  4R55 A;  1SG5 A;  2E41 A;  3GLX A;  2YSQ A;  5KYU B;  4CC7 A;  1RAC B;  2RPN A;  3PNW C;  2COW A;  3HTR A;  2JJ9 A;  4CC4 B;  1JQQ A;  1Y96 A;  1RAF B;  2ENM A;  1YWO A;  1WQ7 A;  1BBZ A;  2OX7 A;  1I4K 1;  2IVW A;  2KYM A;  2RB6 A;  1M1K C;  3MEU A;  2VB6 A;  1AD5 A;  4J5Y A;  4CC3 A;  1JXO A;  1GCQ C;  1SRM A;  5GJW B;  1Q81 C;  3Q1J A;  2ZZD A;  4C92 G;  3PIP A;  1QVG S;  1ZSG A;  2A08 A;  1ACM B;  2YLB A;  2LQK A;  5GMK h;  1HD3 A;  2KT1 A;  2DK3 A;  2QYZ A;  4LD6 A;  4DOW A;  3OW2 S;  1W2B P;  3M57 A;  1NJI R;  2OTL T;  3EFO A;  4HVU A;  1UE9 A;  1KK7 A;  5CCA A;  3PMI A;  1X43 A;  3FJP A;  4N4I A;  3C4S A;  3LGF A;  3CXC S;  4OMN A;  3O5Z A;  1MMN A;  1PD1 A;  2F2V A;  1D1B A;  1YJW Q;  1VQO T;  1JXM A;  2GNC A;  3UF4 A;  2CZ1 B;  1EX4 A;  2DXU A;  4A4H A;  2RD1 A;  2CP0 A;  4OB0 B;  4FSS A;  3G71 Q;  3E1S A;  3I9Q A;  4RMO A;  2XDB A;  1MMG A;  3INZ A;  3UA7 A;  4BE1 A;  2EGA A;  4XTX A;  2ROL A;  3VS0 A;  2ROT A;  2I2L A;  1K9M U;  3HSB A;  3MPU B;  1X6G A;  2BTT A;  2X3X D;  3A8L B;  4M77 C;  3PFS A;  1OU9 A;  4C8Q A;  2K79 A;  3S3O A;  4PJO A;  1UG1 A;  3OYI A;  1WI7 A;  3MEA A;  4ESR A;  1BYM A;  1ZA1 B;  2DM1 A;  5FLX E;  4F7U B;  1AWW A;  2EJF A;  3RKX A;  3CME Q;  1OZ3 A;  4HCZ A;  1HYO A;  1KHC A;  3VS1 A;  2RHX A;  2KGT A;  1H8K A;  2CP5 A;  4F14 A;  1UJ0 A;  2QG9 B;  1ZSZ B;  1KSW A;  4M7A C;  3QUI A;  2K5L A;  1WHH A;  3CMA T;  1D1A A;  2QGG A;  4IUR A;  3L2W A;  3EG3 A;  2V26 A;  4JS4 A;  5GAO q;  1VQ8 Q;  1M3C A;  1Y96 B;  2OTL A;  3SFM A;  4KRT A;  5KE2 A;  3RR6 A;  3TSZ A;  1PWT A;  3OYY A;  1KD1 U;  4PFO A;  4QQG A;  1D0Y A;  4D8D A;  2QEX Q;  1KC8 R;  1K8A C;  1PCX A;  4M7D G;  2X51 A;  3JCM f;  1VQO A;  5CKE A;  1BIA A;  3CBP A;  1WA7 A;  3UAT A;  3DB4 A;  4XU3 A;  1OZ2 A;  4M78 A;  2F2W A;  4JZ4 A;  4XTU A;  3OYM A;  2DKG A;  2DD4 A;  3JV3 A;  2KAF A;  4QKU A;  2DAQ A;  3CCL T;  4RTW A;  3OYC A;  1NM7 A;  5AT1 B;  3I56 Q;  4LDW A;  3EFR A;  3NFC A;  3WVD B;  1T3L A;  3X20 B;  3M56 A;  2VV5 A;  1U3O A;  3IQL A;  1SSH A;  3J80 E;  3ASK A;  4L5G A;  2CP6 A;  3EG0 A;  3SWN A;  1WX6 A;  2P0K A;  4L6V 5;  1ZUU A;  4BB7 A;  3OYJ A;  2EQI A;  5HK0 A;  5LJ3 j;  2L8D A;  1IB8 A;  4L59 A;  1TTH B;  1W1F A;  1SHF A;  3CPW A;  2W0Z A;  3V7C A;  5KYX B;  2JXB A;  4JJB A;  2E3H A;  3E19 A;  1MHN A;  5A2Q E;  2QA4 Q;  4XAX B;  4C8Q B;  5FRM A;  3H0H A;  1NYF A;  4LDU A;  2JTE A;  1BI0 A;  4PJO B;  2P4T A;  3EG9 A;  1ZBX A;  1RAB B;  5LJ3 e;  3CMA A;  2MAM A;  1K9A A;  4JZ3 A;  3NMZ C;  4FCY A;  4ZGE B;  1BKB A;  2RK1 A;  5CIU A;  1O75 A;  3M0S A;  1BCM A;  2CUB A;  1QVP A;  2JOY A;  2PVD B;  5FWB A;  4KUL A;  1ZUY A;  1VQ7 Q;  2O4X A;  2COY A;  1UHF A;  2M51 A;  2X4J A;  4AFQ C;  1M5Q 1;  1OPK A;  2YLC A;  2LT1 A;  2DNU A;  2Y90 A;  1IXD A;  3D7S B;  2XMF A;  5KYN A;  2CGH A;  1M1K R;  4RG8 A;  1YJW T;  2J6K A;  2XKO C;  1Q81 R;  2L89 A;  2O9S A;  3OYG A;  2AK5 A;  2JUF A;  2DZ9 A;  2PZ1 A;  1W4S A;  3JB9 D;  2A37 A;  1WNL A;  1Y71 A;  5I2M A;  3G71 T;  2MPX C;  5GAM j;  5GMK l;  1H92 A;  2RQT A;  3GOX A;  3CCQ A;  4M77 E;  3X25 B;  2RQU A;  3M0P A;  3S6W A;  2RJF A;  3OS1 A;  1N8R C;  4FM4 B;  3MKD A;  4C92 A;  2LCS A;  3VS7 A;  4F7U G;  1Q82 U;  4M77 F;  1OYX A;  4KH1 B;  1LOJ A;  2DXT A;  5GAM e;  1ZA2 B;  2LZ6 B;  4M78 B;  4HCC A;  5J26 A;  3CCR Q;  3CME T;  1CSK A;  5GMK j;  2XD0 A;  2HSP A;  1VQN Q;  4EMK C;  1KHI A;  4QT7 A;  4M7A E;  2YWW A;  1QW1 A;  1NJI U;  2P4R A;  1VUB A;  3M0T A;  5LJ5 f;  3P8B B;  3CD6 Q;  4N0A A;  3RBB B;  3VS2 A;  2HBW A;  5I22 A;  1WHL A;  4M7A F;  3SWN B;  5CVI A;  1S72 Q;  1QKW A;  4IUP A;  2DF6 A;  5GMK e;  4KGV B;  2QDL A;  1RAH B;  3JRZ A;  3OYN A;  4AMC A;  2M0Y A;  3E9G A;  1VQ8 T;  2W10 A;  3HFN A;  2CT3 A;  1WXU A;  3JCM W;  5CKD A;  3EGX A;  3UWN A;  2GGR A;  4FIB A;  3RKW A;  3JB9 J;  2CYZ B;  1Q82 C;  4A4K A;  1MV0 B;  2V8I A;  3EG9 B;  2EKO A;  2DE0 X;  3FC3 A;  1VQM Q;  2QEX T;  3GPL A;  2WSF E;  1VQ5 Q;  1K1Z A;  2E1H A;  1YIT Q;  4EIK A;  1I81 A;  4JPB W;  4VUB A;  5A0D A;  1JJ2 P;  4WCI A;  2R5M A;  3FJ5 A;  4OMF B;  2RHY A;  5KCO A;  2PUO B;  5CQY A;  2DJQ A;  3I56 T;  4M75 G;  2YUP A;  3HPW A;  3MO8 A;  3M59 A;  1N5Z A;  2LJ3 A;  2CZ0 B;  1K73 R;  2AZV A;  1WHJ A;  2FZC B;  1ZX6 A;  2KNB B;  3L2Z A;  1EIF A;  3OS0 A;  1K8A R;  3G4S Q;  1B34 A;  4ANJ A;  1R0C B;  2VGM A;  4X34 A;  3BE3 A;  1FWZ A;  3VUB A;  4BY6 C;  3NPF A;  5IHN A;  3PGG A;  1AWX A;  4KUI A;  1ZQ1 A;  5D7U A;  2KBT A;  2KRO A;  4NS5 A;  3J81 E;  2AKL A;  3V8J A;  4R0K A;  1PM3 A;  5C6S A;  3QZ9 B;  4C5E A;  2MWO A;  4C92 B;  1G8X A;  1PC0 A;  2BKD N;  1YIJ Q;  1UEC A;  4M7D A;  1P92 A;  2QA4 T;  1FMW A;  1YJN Q;  1TUC A;  1XQH A;  1BI2 A;  1WDX A;  3OMG A;  4C0G A;  3CBO A;  4J6W A;  3CCV A;  3SEM A;  4FSX A;  3SD4 A;  1IHV A;  1LNX A;  5D6X A;  1KC8 U;  2OJ2 A;  3L2R A;  2NUT B;  1VQ7 T;  2EYZ A;  1I8F A;  1M90 U;  4LE9 A;  4IUQ A;  2J05 A;  3CC2 A;  2EW3 A;  2JT4 A;  2QEX A;  3LH0 A;  1DJ7 B;  2J6F A;  1G3T A;  2HBP A;  3O8V A;  3OBW A;  2RF0 A;  4ZNX A;  2JNG A;  1OX8 A;  2P0P A;  3OS5 A;  3EGX B;  1K0X A;  2K57 A;  3OYK A;  5D6W A;  3QWY A;  2CH4 W;  4QQD A;  2XI9 A;  3JAM E;  2DL3 A;  2MMP A;  3TVT A;  3QYG B;  1VQK Q;  1VQL Q;  1M2V B;  2M9U A;  5LJ3 f;  4JRI A;  3NTK A;  2EQJ A;  2KYB A;  2NUP A;  3KXT A;  4BD3 A;  2O01 E;  3RES A;  1N9S A;  2KVQ G;  1RAG B;  4LUD A;  1VQP T;  3CCR T;  2KMT A;  3C94 A;  1BIB A;  1M90 C;  2JW4 A;  2RI5 A;  3M53 A;  1GFC A;  2JTF A;  2C0I A;  4F04 B;  1VQ4 A;  1X6B A;  4RTT A;  5FU6 C;  1N8R R;  4MML A;  4OMQ A;  2DEQ A;  4OMO A;  1WLP B;  5GJV B;  3G1J A;  3EH1 A;  3CD6 T;  4HA8 A;  4KGZ B;  3CCJ A;  3LGL A;  1S72 T;  2DER A;  3CC4 A;  2DYB A;  1PSE A;  2ECZ A;  1YCS B;  2A0F B;  1M1K U;  1YNZ A;  1RLQ C;  1M8M A;  2NYS A;  1WJR A;  1AVZ C;  1AOJ A;  1Q81 U;  2CP7 A;  1WJQ A;  1VQ7 A;  2IPO B;  2FYK A;  4F7U A;  4M7D B;  1H64 1;  1Z9Z A;  4JS5 A;  5GMK m;  3G6E Q;  1CKB A;  3OYL A;  4JLG A;  2HNI A;  5I11 A;  2DFU A;  5GAN 8;  3QKJ A;  1VQM T;  4PNO A;  2K3B A;  4E7H A;  4PLL A;  1M1F A;  3QXE B;  1VQ5 T;  2KK4 A;  5GAM f;  1NZ9 A;  3FDR A;  1CKA A;  3WVE B;  1YIT T;  2RQW A;  1SPK A;  1OQK A;  3TEE A;  3UDC A;  1A0N B;  1M4Z A;  3RDV A;  2E6N A;  2KXD A;  2RJC A;  4RTV A;  1AWJ A;  4Z8A A;  3I55 A;  1PKS A;  1IO6 A;  4JRP A;  1E7O A;  4FYV B;  2COZ A;  1PRL C;  2YDL A;  1Q82 R;  2EGC A;  1YJ9 A;  4D6W A;  1Z9Q A;  4BI3 A;  3A5Z B;  4C5I A;  1VQ9 Q;  1B07 A;  1RLP C;  2E10 A;  4JLI A;  3CCE A;  4PL6 A;  1RAE B;  1AZG B;  3JB9 I;  1Q86 C;  3G4S T;  3QO3 A;  3CEY A;  4HXJ A;  2CKK A;  2DXB A;  8AT1 B;  1OEB A;  1VQP A;  4JJC A;  3I5R A;  2DYI A;  1YHQ A;  3OSS C;  1VQ6 Q;  1Y0M A;  1OI1 A;  4RTZ A;  5GAO n;  3JB9 F;  3BFM A;  4II1 A;  1G2B A;  2RM4 A;  5GAO r;  1AWO A;  2Y4X A;  1YIJ T;  1W6X A;  2EQU A;  4XTW A;  4GLM A;  3UPU A;  1K0S A;  2J7I A;  3HRU A;  4O6J A;  1YJN T;  1MV3 A;  3MHX A;  3CD6 A;  2NUP B;  3SHW A;  2E64 A;  1M2O A;  2K4Y A;  1TUD A;  4CC2 A;  1UDL A;  1VIF A;  4K11 A;  3GBQ A;  2QAS A;  1YI2 A;  2GCX A;  4O5V A; 
#chains in the Genus database with same CATH homology
 1PKT A;  2EQI A;  1NEG A;  2KRN A;  5EC7 A;  2EBP A;  1W1F A;  2KT8 A;  1SHF A;  2GTJ A;  2W0Z A;  2D0N A;  3PVL A;  1I0C A;  1X27 A;  2JXB A;  4JJB A;  2JM8 A;  2YT6 A;  1GRI A;  1JU5 C;  3H0H A;  1NYF A;  2JTE A;  2KEA A;  1KJW A;  2L3S A;  3VS5 A;  2GBQ A;  1K4U S;  1BB9 A;  2DRM A;  1X2Q A;  1K9A A;  4JZ3 A;  3NMZ C;  2VVK A;  3EHR A;  2F2X A;  1UUE A;  1I1J A;  3M0S A;  2CUB A;  5FWB A;  1VYV A;  2OAW A;  1ZUY A;  4LUE A;  1GBQ A;  3PVQ A;  2LQW A;  3UA6 A;  1JEG A;  4J9B A;  1UHF A;  2E5K A;  2YUQ A;  2DBK A;  2M51 A;  4ORZ A;  3H41 A;  4AFQ C;  3M0R A;  1OPK A;  2J6O A;  2DNU A;  1GFD A;  2O31 A;  2XMF A;  2MIO A;  1SHG A;  1OV3 A;  1UTI A;  2J6K A;  3REA B;  2LJ1 A;  2O9S A;  1VYU A;  2AK5 A;  2YUN A;  4A63 B;  2CUD A;  2ABL A;  1GL5 A;  2C0T A;  2DLP A;  2FPF A;  2V1R A;  2PZ1 A;  1M27 C;  2A37 A;  1S1N A;  2EVR A;  1YN8 A;  2K9G A;  5HCK A;  1V1C A;  1H92 A;  2RQT A;  5FW9 A;  1NYG A;  2RQU A;  3M0P A;  3EGU A;  1SRL A;  2LCS A;  1FMK A;  1UJY A;  1TG0 A;  3VS7 A;  2EYY A;  1UFF A;  2LJ0 A;  1E6G A;  1UGV A;  1YWP A;  1QWF A;  3M0Q A;  2JMC A;  2IIM A;  1M30 A;  3EG2 A;  2LZ6 B;  1HJD A;  1WIE A;  1PHT A;  1ARK A;  2RNA A;  2SEM A;  1X2K A;  2VWF A;  1T0J A;  2CDT A;  2DRK A;  1CSK A;  1WXT A;  2V1Q A;  2HSP A;  1U06 A;  1NLO C;  5IXF A;  2L2P A;  2SRC A;  4QT7 A;  4F16 A;  5FWC A;  2I0N A;  2P4R A;  3M0T A;  2YUO A;  2CSQ A;  3RBB B;  3VS2 A;  2HBW A;  5I22 A;  2C0O A;  4Z88 A;  4OMM A;  1QKW A;  3NGP A;  2DF6 A;  2K2M A;  3C0C A;  1M3B A;  4LN2 A;  2QDL A;  2CH4 A;  4OMP A;  2M0Y A;  2W10 A;  2A28 A;  2CT3 A;  2PTK A;  1OPL A;  1WXU A;  4J9E A;  3R6N A;  1B3Q A;  2NUZ A;  2FRY A;  2GGR A;  2AZS A;  1BK2 A;  4AFS C;  2NWM A;  1MV0 B;  1WFW A;  2DL7 A;  2DE0 X;  4LNP A;  2D1X A;  2J06 A;  1K1Z A;  2L0A A;  2FG0 A;  5L23 A;  4EIK A;  1M3A A;  4HCK A;  1SEM A;  4JPB W;  2O9V A;  2K7A A;  4WCI A;  2DL4 A;  1FYN A;  3FJ5 A;  2LX7 A;  4IIO A;  1ZBJ A;  2ED0 A;  2HDA A;  1ZUK A;  2DJQ A;  2YUP A;  1VYT A;  3I5S A;  1N5Z A;  2LJ3 A;  2AZV A;  4RTY A;  3RNJ A;  1ZX6 A;  1NG2 A;  2KNB B;  2CSI A;  3EHQ A;  2DA9 A;  1YP5 A;  2O2O A;  3U23 A;  1H3H A;  2DIL A;  2LMJ A;  3NPF A;  5IHN A;  1AWX A;  4GBQ A;  3VS3 A;  1NEB A;  2KBT A;  2KRO A;  2CRE A;  2ED1 A;  2EGE A;  4AFZ C;  1VA7 A;  2AKL A;  2HEQ A;  3VRY A;  4R0K A;  3THK A;  1UEC A;  4OML A;  4JJD A;  2DX1 A;  2AKK A;  1TUC A;  1WDX A;  4AG1 C;  1QLY A;  3PE0 A;  3SEM A;  3I35 A;  1AEY A;  1BU1 A;  2KE9 A;  2BZ8 A;  2FPD A;  2DBM A;  1ABO A;  5IHK A;  1KFZ A;  2KRS A;  2OJ2 A;  2YSQ A;  1UHC A;  2VKN A;  4J9G A;  4CC7 A;  2EPD A;  2RPN A;  1PRM C;  2EYZ A;  1JQQ A;  4CC4 B;  2L3P A;  3QWX X;  4X1V A;  4Z89 A;  2ENM A;  1YWO A;  1QKX A;  1Y57 A;  4LE9 A;  1BBZ A;  3VS4 A;  2KYM A;  3CQT A;  4HVW A;  2J05 A;  1AD5 A;  4CC3 A;  1JXO A;  4RUG A;  4DEY A;  2EW3 A;  2JT4 A;  1GCQ C;  1SRM A;  4M4Z A;  5GJW B;  2J6F A;  1KIK A;  2JMA A;  4J9D A;  3TSW A;  5IH2 A;  1ZSG A;  2A08 A;  2RF0 A;  4ZNX A;  1HD3 A;  2KT1 A;  2BZX A;  4IIM A;  2FEI A;  5IXB A;  1QCF A;  1LCK A;  4HVU A;  1K0X A;  3ZL7 C;  1UE9 A;  3QWY A;  2CH4 W;  1T0H A;  2KRM A;  1X43 A;  2DL3 A;  2ESW A;  2LNH B;  2DL8 A;  4E6R A;  3TVT A;  1I07 A;  2LP5 A;  2HCK A;  4J9F A;  3O5Z A;  4OMN A;  1OOT A;  2F2V A;  2CT4 A;  1JO8 A;  1JXM A;  2GNC A;  3UF4 A;  2KYB A;  2MCN A;  1T3S A;  1W70 A;  4LUD A;  2L3Q A;  4J9C A;  1G83 A;  3VS6 A;  4FSS A;  4J9H A;  1ZLM A;  2JW4 A;  2K6D A;  3I9Q A;  1GFC A;  3VRZ A;  2BZY A;  2RQR A;  3UA7 A;  2EGA A;  2C0I A;  2RQV A;  2ROL A;  1X6B A;  2RN8 A;  4RTT A;  3VS0 A;  2ROT A;  2GTO A;  4OMQ A;  2FRW A;  1RI9 A;  1WLP B;  1X6G A;  2BTT A;  4OMO A;  5GJV B;  2X3X D;  1WYX A;  3REB B;  2KR3 A;  1RUW A;  2K79 A;  4Y92 A;  1WXB A;  1UG1 A;  5IHI A;  1WI7 A;  2DYB A;  2ECZ A;  1YCS B;  4ESR A;  1YNZ A;  1RLQ C;  5ECA A;  1M8M A;  2O88 A;  1AVZ C;  1AOJ A;  2DM1 A;  3LH5 A;  1AWW A;  2D8J A;  2EKH A;  1QWE A;  4F17 A;  2EYX A;  3VS1 A;  1Z9Z A;  2KGT A;  1H8K A;  4F14 A;  1UJ0 A;  1CKB A;  5I11 A;  2OI3 A;  1KSW A;  1PNJ A;  2K3B A;  2PNI A;  1GBR A;  2FO0 A;  2JS2 A;  1U5S A;  1CKA A;  2X3W D;  1NLP C;  4D8K A;  2RQW A;  1SPK A;  2KXC A;  3H0I A;  4AG2 C;  2B86 A;  3NHN A;  3EG3 A;  3KFV A;  1A0N B;  3H0F A;  1M3C A;  2A36 A;  4KRT A;  2KXD A;  1E6H A;  4RTV A;  1AWJ A;  4Z8A A;  2DVJ A;  4HVV A;  3TSZ A;  2G6F X;  1PWT A;  1PKS A;  1IO6 A;  2DL5 A;  1E7O A;  2DMO A;  1PRL C;  2YDL A;  2FPE A;  2EGC A;  4RTU A;  4J9I A;  1J3T A;  4D8D A;  1XOV A;  1Z9Q A;  2H8H A;  1GCP A;  1B07 A;  1RLP C;  1AZG B;  2JM9 A;  4DEX A;  1X69 A;  4HXJ A;  1K76 A;  1WA7 A;  2D8H A;  3UAT A;  1OEB A;  4JJC A;  3I5R A;  1EFN A;  2F2W A;  4JZ4 A;  2MOX A;  3A98 A;  1Y0M A;  4RTZ A;  2EYW A;  3JV3 A;  1G2B A;  1GCQ A;  1AWO A;  4RTW A;  2LQN A;  1W6X A;  1NM7 A;  2GQI A;  4GLM A;  1K0S A;  2J7I A;  1T3L A;  4RTX A;  1HSQ A;  1MV3 A;  2RMO A;  3ULR B;  2JS0 A;  3SHW A;  1AZE A;  1U3O A;  1TUD A;  3EG1 A;  1SSH A;  3IQL A;  4CC2 A;  1MUZ A;  1UDL A;  4AFU C;  3M0U A;  3EG0 A;  1ABQ A;  4K11 A;  1WX6 A;  3GBQ A;  1ZUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...