5LJ5h

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5h00
4M7AB 1LOJA 3JCMd 3RESA 4N0AA 4M77C 4XTVA 5GMKj 5GAOr 3SWNB 3RERA 4XTYA 4XTUA 5GAOq 4NOYA 5GANh 2EJGA 3L1AA 4NL3A 4HT8A 5LJ5h 5GAN2 1WNLA 2DTIA 4M7DA 4PJOE 4N0AC 1YCYA 4NL2A 4XTWA 3JB9I 4WF2A 4RCCA 5I21A 4M7DG 4M75D 4HA8A 4M78D 1N9SA 3V7RA 4C92D 4F7UE 1M5Q1 3JCMJ 3FJPA 4M75C 4M78C 5GAOm 3V8KA 4C92C 5GMKl 5GAMe 4M7DC 2RB6A 4J6WA 3QUIA 5GAN7 2DTOA 1KQ1A 2K57A 5LJ3e 2DEQA 5GAOn 3JCMQ 5LJ3d 3JB9H 2VXFA 1MGQA 3RKWA 5GANf 3AHUA 1D3BA 4M7AF 5LJ5f 2EJFA 2FB7A 4F7UA 2EWNA 4MMLA 4XU1A 1N9RA 4F7UG 2DVEA 5GMKh 4PJOD 4JLIA 5GAMg 3HFNA 3JB9F 4PJOC 1JBMA 2VC8A 2YLBA 3EFSA 3RUXA 3V8JA 3BW1A 1KQ2A 4M7AD 2RD1A 4M75A 4M78A 3JCMc 4C92A 3BDUA 1I81A 4RCBA 4M75G 4C8QB 4M78G 1JRIA 3JCMg 4C92G 3RIRA 2E64A 3JCMW 3JCMV 3JCMb 4X9DA 4DQ2A 4M77B 3RKYA 4M7AE 4OP0A 4QVDA 3FB9A 2YHTA 2CGHA 2DKGA 3V7SA 3QSUA 2DXUA 1TH7A 1Y96A 2YLCA 4EMKA 5GAN3 5GAN4 4XTZA 4PJOA 2RA2A 5GAMh 5GAOp 1WQ7A 2E1HA 3QHSA 4PJOG 1HXDA 5GANe 4XU3A 2EJ9A 1I4K1 5LJ3h 3L2ZA 1U1TA 2I2LA 2E65A 2VXEA 5GANd 5CAIA 4M75B 3PGGA 4M78B 5LJ5d 4JRIA 4C92B 4Y91A 4EMKC 4HT9A 4M7DB 3JCMh 5GANj 1HK9A 1WPYA 4M7AG 4V2SA 4A53A 5LJ5j 3SWNA 5LJ3g 1LJOA 3VU3C 4JUVA 4C8QF 1BIBA 1I8FA 1U1SA 3M4GA 3EFRA 4M7AC 3JCMX 3INZA 2DZ9A 4M77F 5GAMf 4A54A 5GMKm 3SB2A 4XU2A 3JB9D 1Y96B 2DTHA 3HFOA 3SWNC 1BIAA 4EMGA 4J6YA 4PJOB 2HNIA 3BY7A 4C8QD 3JCMP 4XU0A 1D3BB 3BFMA 4F7UB 1B34A 2Y90A 3JCMf 4EMHA 3V8LA 4M77D 4X9CA 2EAYA 5GMKi 5DY9A 4PNOA 2E10A 5GAN6 4M75F 4M78F 5LJ5e 4C8QE 4C92F 1LNXA 2DXTA 4M7DF 4M7AA 2FYKA 4JRKA 5GAN8 4M77E 1WQWA 2QTXA 5GAN5 2DJZA 1I5LA 2E41A 2RM4A 4MMKA 3GIBA 4XQ3A 2JN0A 4QVCA 5GANg 3JB9G 1M8VA 3RKXA 5LJ5g 4C8QA 4M7DD 4J6XA 4PJOF 1B34B 4C8QG 3JB9J 4EMKB 4J5YA 2ZGWA 5GAMd 3HSBA 4XTXA 5LJ3f 4M77A 4F7UF 5GAOl 2DZCA 4M75E 3FIFA 1H641 4M78E 4M77G 5GMKe 4C92E 5GAMj 4C8QC 4M7DE 3QO3A 3JCMe 3V7CA 1X01A 5LJ3j
chains in the Genus database with same CATH superfamily
2CH4A 2KQWA 4KH0B 1QVFP 3MHXA 4N0AC 2MK5A 2QXFA 4HA8A 3MEWA 1YITT 5CO7A 1N8RR 3NMZC 5LJ5f 3X28B 1XOVA 4XU1A 2YT6A 1QKXA 1YI2T 2CH4W 4OMFB 1D0YA 1MMNA 1VQOT 3EG3A 4IIMA 4AFZC 2D0NA 2ROLA 4C92G 3OYNA 3G4ST 1ZUUA 3ZEHA 2X35A 1VQ9T 4RG8A 1UGQB 4OP0A 1Q81C 1I1JA 3CC4Q 4RTVA 2BIVA 1UGRB 2J7IA 1YFNA 2XDPA 1VQKQ 1K8AR 2CUBA 5FLXE 3OW2P 1UUEA 2K3BA 2LDMA 4BE1A 3OY9A 3CCRQ 5GJVB 5KYXA 1H92A 3HFOA 1M1KR 4IUQA 5KCHA 1BIAA 2HKQB 2ZCFB 1WHKA 1KJWA 2NUZA 1C0MA 2LNVA 2OX7A 4PNOA 4A63B 4RG2A 1OZ3A 1OI1A 4C0GA 1VQLA 2DE0X 2O4XB 3C94A 3OS1A 2EQKA 3EG0A 3NTHA 1D0ZA 3EGUA 1XQHA 2DXCA 4J9GA 3RMQA 5ECAA 3G7ZA 1YCSB 2CYZB 3HRSA 1XJWB 1MMAA 5GJWB 2PZ1A 1X6OA 4XTUA 1QKWA 1N6AA 2EJGA 4ZGDB 2J06A 4OMLA 4A4EA 2MAMA 1MV0B 1PNJA 2DVJA 3CCST 3JCMJ 1ZSZA 2V8JA 5CKDA 3J80E 4M7DC 4IIOA 2DTOA 3AHUA 4MMLA 2DEUA 2EQUA 1JBMA 1NZ9A 2KYMA 2P0QA 4Z89A 1RAIB 2XKOC 4E47A 5FU6B 1HYOA 3JV3A 4RCBA 1WIEA 2JM9A 2E64A 4BD3A 4AFUC 2ZPEB 4FL6A 3FB9A 4RKUE 5A2QE 4EMKA 3CD6T 2LVMA 3VS0A 2E4HA 2R5AA 2ROTA 5GANe 1X6BA 1Y7XA 2R58A 1HK9A 1S1NA 2ZPFB 1RI9A 4J9CA 3GNFB 3SWNA 4A4FA 1UFFA 3VS2A 2NLUA 3HKSA 1WXTA 2X3XD 3VS1A 1VQLQ 1RAEB 2F69A 1Q82R 3CCET 2P4TA 1WHLA 3EFOA 2VYTA 1M8MA 4KRTA 4M75F 1OZ2A 1Q7YC 1Z9QA 1IXDA 2DXBA 4QQDA 3CCLT 1NJIC 2HL5C 1VQ8Q 2O9VA 5GAN5 2LJ3A 1Q86U 3UDCA 5KYUA 1K73R 1W2BA 4VUBA 2RHUA 3OYJA 2OTLT 2RHXA 3CPWS 5HCKA 4LNPA 3OMCA 1FWZA 2DBKA 4KUDK 2HCKA 3QJ6A 2DYBA 3D7SB 2XHCA 1QVGS 3OMGA 2CP2A 3CCUT 1O9SA 2GCXA 4NL3A 3NPFA 5FRNA 6AT1B 3JB9I 1TS9A 5DLOA 2KT1A 1R0CB 4ESRA 2RB6A 4J6WA 3QZ9B 4B9XA 5LJ3e 3OYYA 3I35A 4BDYA 1SHFA 2AZSA 2EJFA 2HSPA 2HMAA 1LPLA 1D0XA 2EW3A 3SDZA 1OV3A 3BW1A 2DL4A 2QAZA 1PSFA 4F14A 1H3HA 3SD4A 4WCIA 4DQ2A 1D1BA 2DERA 2CZ6B 1E6HA 1TH7A 2J6KA 5GAN3 2RA2A 1WQ7A 4MZMA 2HD0A 2P0KA 1I4K1 5DM7R 2E65A 4JJBA 2KYBA 4M75B 2VGMA 2MI6A 2C0OA 3I5RA 3WVDB 2H3EB 2JTFA 4RTYA 1K9MR 5KYWA 1AVZC 2DO3A 5FU7C 2EGAA 1PRMC 1M3CA 1OOTA 2KXDA 1QWEA 4TVRA 3UATA 1EIFA 3OYAA 2CS7A 4LUDA 1G2BA 3H9NA 3OB9A 1R0BG 2K4YA 2CUDA 5KE2A 2X4XA 2FRYA 1YN8A 4PJJA 2WSCE 3C0CA 2QDLA 1UDLA 2MOXA 2CKKA 5M9OA 3J81E 2FZKB 3QO3A 3JCMe 2FZGB 1LOJA 4KBMB 1ZUYA 3QIIA 2XD0A 1JEGA 1GBQA 5CR2A 5CKEA 2KROA 2QQ9A 5IAYA 4NL2A 3CCMT 1BI2A 1PM3A 1TUGB 4CRIA 2ZZDA 2DLPA 3CXCA 3G6EA 1UHFA 2OI3A 5I2MA 1W2BP 2FEIA 1AHJB 1VQ5T 1UB4A 5GANf 2HQHA 4F7UA 2EQIA 2E3IA 2PVGB 3OSSC 1TG0A 1VQ6Q 4AMCA 3HFNA 3CC7Q 2CZ7B 4BDZA 2P84A 3N5BB 4J9HA 5KCOA 3JCMc 2HAXA 3WXMB 3JSCA 2KY9A 4DA4A 4AG2C 3JCMb 1G83A 1M2OA 3A1PA 5A0GA 3M5AA 1I0CA 4R55A 4LDWA 4E7IA 4E7HA 1K9AA 2DA9A 1KQSS 3REBB 1VYTA 1WYXA 1W6XA 2KNBB 3O5ZA 2L89A 4RTUA 3VU3C 3H0HA 1H3ZA 3MP6A 3M4GA 1ZSZB 2O4XA 1RI0A 4KGVB 3INZA 5CK9A 3MP8A 3NGPA 3I5SA 1WGSA 2COWA 5DY9A 5LJ5e 5KYYB 4JS4A 4PK4A 2EYQA 2SEMA 3QDFA 3X20B 4AT1B 2ZPGB 2LJ1A 3L2QA 1SRMA 5LJ5g 2R57A 1M3AA 1I07A 1YJNT 2K2VA 4EMKB 1N8RC 3CC4T 3AT1B 1T0JA 5LJ3f 2NUPB 1ZBXA 2XMFA 1WHGA 4M75E 4JDSA 2RI2A 2F5TX 3G6EQ 3MEUA 2JMCA 2O9SA 4XTVA 1VQKT 3SWNB 5FWCA 4ANJA 3GOXA 3PE0A 5GAN2 4QT7A 3PTAA 2JVVA 3OQ5A 4E7JA 1Y71A 2CP5A 2IIMA 2K5LA 2L5QA 2EPDA 3EFOB 2K57A 1VQ4T 2XI9A 1N9RA 4FSSA 1K8AC 3CCVT 1KQ2A 2M02A 5KYUB 1YJWA 2QGGA 4M7AD 2PUKB 4LDYA 4FW2A 4R0KA 4J9IA 4E6RA 3HTRA 4QVDA 2F2XA 2YHTA 4QQ6A 3CCJA 2LCCA 1GRIA 3KBGA 3CXCP 5HK0A 4JJCA 4N4HA 1X2QA 2KR3A 1K76A 2OAUA 3UA7A 1KD1R 8AT1B 3P8BB 4Y91A 2EIFA 3MJXA 3M9QA 1IHWA 1TUCA 4JUVA 4AG1C 2WACA 3A8MB 2VVKA 1KHIA 2JJ9A 2BTTA 3GNGA 2K7AA 2KVQG 2M1HA 1UE9A 2RK2A 2VGNA 2MYSA 1U8RA 3JCMf 4MDWA 5GAN6 1QCFA 1MMDA 1C1AA 1ZHIA 5D6YA 2GNCA 3CEYA 2RNAA 1VUBA 1RAAB 2E5QA 2PVDB 2CZ1B 5C0MA 2JS0A 2JMAA 4QW2A 2E70A 4LD9K 2EGEA 1VA7A 4F7UF 5FU6C 3ZL7C 1YBYA 3CPFA 1X01A 3V7CA 3HP9A 2QEXQ 5KE3A 1T3SA 2A28A 5GMKj 2QG9B 3CCQA 2BZ8A 4C0ZA 2A36A 4OMOA 3IQLA 2J6FA 4HT8A 4DEYA 3VYGA 3JRZA 2DTIA 2DD4A 1WX6A 1PRLC 3QWXX 2CREA 3FLGA 4GBQA 1M5Q1 1N27A 5IHIA 1P92A 1YP5A 5GAOm 3LH5A 2L3RA 1KC8R 1X75C 1B07A 1RABB 1UGPB 4M7AF 1AZEA 2FB7A 2DYIA 4F7UG 4OMPA 2X4YA 1AWXA 1D1CA 2LP5A 1GFCA 1B7TA 2CDTA 3CCJQ 5DLQE 3SHWA 1VQ8T 4GY5A 3VS4A 4M75A 3BDUA 1HD3A 1I81A 1UHCA 2GTJA 2C06A 3EG2A 2J6OA 4PJNA 1Q82C 4ORZA 4LDVA 4J9FA 1Q81U 2DKGA 1VQMA 1YIJA 3LYIA 1OU9A 3S6WA 2MPXC 2RHYA 5LJ3h 1UECA 3L2ZA 4J9EA 2L3PA 4M7AG 3FJ5A 3E9GA 1K73C 5EG2A 1M90R 1U5SA 3JCMX 2AT1B 4HCKA 1IO6A 2DZ9A 5GAMf 4DBRA 3HRUA 1Y07A 2E3HA 4RTZA 3OW2S 4J9DA 3BFMA 4F7UB 1M3BA 1M27C 3MKDA 2EAYA 1VQPQ 5EC7A 5IXBA 4F04B 2JT4A 3OYLA 3L2RA 5A0LA 2OTJA 4PLIA 4LDXA 2B8AA 3PMTA 5I22A 4EPCA 2VB6A 1ZLMA 1H641 1V76A 1VQ7Q 3THKA 2A08A 4M7AB 3TSZA 5GAOr 1OU8A 1Y0MA 2HBWA 3GBQA 3C12A 1ZQ1A 4RCCA 4M75D 2WSEE 4II1A 2PVOB 3HL8A 1SRLA 2PQWA 4M75C 3M54A 3EAEA 1AWWA 1AT1B 1HSQA 4KGXB 2LQWA 2DK3A 1NPPA 1Q95G 1X43A 3OBWA 2PNIA 1OULA 1SSHA 1GBRA 5IHKA 3RNJA 2LX9A 4GLMA 1C6VX 2NWMA 2FRWA 4DBQA 4CI0C 1VQMQ 1RADB 4C5GA 2YUQA 2FZCB 5CCAA 2M0OA 1K9MC 1M30A 3RMSA 4E7KA 3E19A 4J7IA 2CGHA 5GAN4 1KFZA 1BU1A 3E2UA 4C0DB 2VXEA 3EG9B 2XDBA 1YITA 3PGGA 2A7YA 2K5FA 3BDLA 5I2SA 2X9HA 5KYYA 1OX8A 1U1SA 2EFIA 4JJNK 2E6ZA 1GFDA 1BBZA 2JZ2A 3FRNA 1YI2A 2HNIA 1IRXA 3BY7A 1S72A 1VQOA 2H8HA 3O8VA 3CMAA 2AHJB 3SFMA 2FG0A 2DILA 2BUDA 2OTJQ 3TREA 2NUPA 1WI7A 5FWBA 3G4SA 1VQ6T 1Q7YU 1VQ9A 3CC7T 1UEBA 1YJ9A 1NJIU 4LD6A 1Z9ZA 4MMKA 4C0FA 4QVCA 5CIUA 5GANg 3H41A 4C5EA 2XICA 2A37A 3JB9J 3CQTA 4JRQA 1RAHB 4JZ3A 5FW9A 2GF7A 3R6NA 3M0SA 3SB2A 4QVZA 4HVVA 2Y4XA 1TSFA 1K0XA 2GFAA 5CQYA 1IHVA 4CC4B 2QQRA 4RUGA 2BZYA 4JPBW 2H3JA 5L8RE 1WJQA 2RF0A 5LJ5h 3CBPA 4XTWA 2EGCA 2RQRA 4OB2B 2DF6A 4F7UE 2LCLA 2QK0A 2F2WA 2G6FX 2VKNA 3M59A 4KUIA 1H8KA 4PKCC 4MZPA 1MHNA 1ZSZC 1D3BA 2DBMA 2ATCB 3OYFA 3RUXA 4X34A 4BI3A 1SG5A 4M75G 2HZYA 3FC3A 1QQJA 1YITQ 3NTKA 3OYGA 1AWOA 2K6DA 4M7AE 2KBTA 3OYCA 2IG0A 2QA4T 3G6ET 5AYFA 2BZXA 3QJYA 2I2LA 3CCSA 3MCAB 1UGVA 2YUPA 3ASKA 4EMKC 1S72Q 4MDXA 1Y57A 2MWOA 3P8HA 2AKKA 3CMAQ 5LJ3g 2JW4A 4L5GA 1MMGA 1VQ9Q 1Y96B 2ED0A 2YWWA 3SWNC 2RQUA 4J6YA 1YJ9Q 3ER0A 2K3YA 4HVUA 2CP6A 1PCXA 4BUGA 1JJ2A 5FRMA 3KFVA 5CQXA 4OVAA 2FYKA 2ED1A 3NFCA 3M57A 4KULA 1WQWA 1KQSA 1K0SA 2DJZA 3CD6A 1I5LA 3META 5D6WA 1X2KA 5HK3A 4J6XA 1B34B 3OS0A 4HVWA 4M77A 3I55T 1BYMA 5LJ3j 4KT0E 2XK0A 3PVLA 1NEGA 3VV0A 1TXQA 1WHHA 4OB0B 1WNLA 1BCOA 4ZGJB 2DM1A 1YCYA 4Z8AA 3A8LB 1SEMA 2LQKA 5FROA 4N4GA 1YHQT 1PSEA 2RQTA 3CCLA 3A8HB 2DETA 4E7SA 1FXXA 4Y28E 3JB9H 2YDLA 3QBYA 2DL8A 1G3TA 1KD1C 1ABOA 2RQWA 2QQBA 1TUDA 3EHQA 1W2BS 1VYVA 2W10A 3JCMg 2MF2A 1I5OB 4PL6A 3OSVA 3JCMW 1KHCA 3RKYA 1CKBA 3PT9A 2RJCA 1FYNA 3RDVA 4ELYC 4A4KA 2MMPA 5GAOp 1AEYA 2D9TA 1VQNA 2QEXT 3LW5E 2X3WD 2V8KA 2YUNA 1AZGB 3DB3A 2YRCA 1LJOA 3OYKA 3VS7A 4OMNA 5HY6A 2HQXA 3VRZA 3Q1JA 4D8DA 4A54A 1OPKA 2DTHA 4EMGA 2DPPB 3VUZA 3DLMA 4D8KA 2PUOB 3CD6Q 3QPHA 3LGFA 3RR6A 4M77D 4OF1A 5GMKi 1JU5C 1AD5A 1WJSA 3CCJT 4M7AA 4DBFA 1BK2A 5LL6S 3GP8A 2QTXA 1WXBA 3UF4A 2KMTA 3VS5A 4FT4A 1ZX6A 3URGA 3HPWA 4J9BA 1KC8C 1QWFA 1NLOC 1N8RU 1M1FA 4FW1A 1RACB 2KT8A 5I11A 2DZCA 4ELZC 4FYWB 3H0FA 3RESA 1T3LA 2VUBA 1WJRA 3CCLQ 3QYHB 1JJ2P 5CVIA 2D8HA 5IXFA 1Q86R 2KEAA 1U06A 1MNDA 1KQSP 5GAMe 3M0QA 5GAN7 1KQ1A 7AT1B 2AK5A 1MGQA 4LE9A 1QLYA 1VQPT 3CC2A 2QTVA 1K8AU 5GAMg 4WTOB 3OYHA 3OBYA 2K2MA 1NM7A 3EG9A 2V8IA 1M90C 2RD1A 1AWJA 1VQNQ 1M1KU 3QXEB 3CCRT 1E7OA 1WHJA 2PU9B 5KYNA 3QYGB 3GLXA 2CT4A 2DRMA 3V7SA 2LNHB 1VQ7T 1ZBJA 2EQJA 4HKEA 2E1HA 3TSWA 2B86A 1HXDA 9ATCB 1PC0A 1WFWA 5CAIA 2LRQA 5LJ5j 4OB3B 4JLGA 2C0TA 1QVPA 2IVWA 3VS3A 2Z0WA 4M7AC 2PTKA 4M77F 3S3NA 4XU2A 3L2UA 1D3BB 4X9CA 2DIQA 4M78F 5L23A 4K11A 2QQAA 3LWIA 5D6XA 1VQMT 3MEAA 3L2WA 2RN8A 1M8VA 2O31A 1QP3A 4C8QA 3M4YA 4IKFA 4PJOF 1JB0E 2DD5A 3OYDA 3M58A 1E6GA 5D7UA 4M77G 3F70A 5GMKe 2QYZA 4DEXA 1LCKA 2QDYB 1RUWA 4N0AA 3QDRB 3VYHB 2JTMA 3RERA 3H0IA 4RTTA 5GANh 4FT2A 2ABLA 5IHNA 3CMEA 5I21A 3CC2Q 1N9SA 4C0DC 3UPUA 2EBPA 1RLQC 3V8KA 2DFUA 1YWOA 1X69A 5GAOn 2AKLA 3QKJA 2BE9B 4C5IA 2V1QA 3U23A 4OMQA 2HEQA 1K1ZA 3JB9F 1YJNA 2CZ0B 2RH2A 2K79A 5CKBA 1UJ0A 1QCOA 4D6WA 2QI2A 3PIOA 4XK8E 2FPEA 1BI1A 1M4ZA 2QGFB 4M77B 1PWTA 1ABQA 1VQLT 2FO0A 1VQKA 1DJ7B 1QVFS 1YJWQ 3EG1A 1Y96A 3WVEB 3SEMA 1SPKA 2XG8D 2GBQA 5LJ5d 4M78B 2KDSA 4Q5WA 4Z02A 4AFQC 4F16A 4A53A 2COYA 1ACMB 1GCPA 1K73U 2D0QB 3I56A 1VQ4A 2V1RA 2KE9A 2Y4YA 3TEEA 3G71A 4PJOB 4LXCA 1WHMA 3CCVA 4C8QD 1NE8A 2LJ0A 4XU0A 1B34A 1V1CA 2Y90A 3I9QA 2GQIA 2JNGA 3QZ5B 2LTOA 2NYSA 2KGTA 3KUFA 4C92F 2LC4A 4OB1B 2DXTA 2P4RA 3REAB 2L8DA 4DOVA 3RKXA 4HCCA 3C95A 2GQVA 1FMVA 2ESWA 1UJYA 3CMEQ 1R8OB 2EYXA 1OQKA 2XDDA 2L0AA 4EIKA 4RMOA 4AFSC 1S72T 2MIOA 4RTWA 1GXIE 3CMAT 1WZOA 4NOYA 1BKBA 1ZSGA 4M7DA 8ATCB 4OGEA 5HKCA 4WF2A 4L6V5 2P0PA 3TCJA 3MEVA 3GPLA 3EGXB 3CCQQ 2V26A 1YJNQ 2IPOB 1YJ9T 3PMIA 1YWPA 1IREB 1YNZA 2KXCA 4IUVA 2ECZA 1TOVA 2JM8A 2KK4A 4B9WA 3EFSA 2FHDA 2SRCA 3OS5A 2JXBA 2DJQA 3LWHA 1W1FA 4BY6B 2KAFA 3DB4A 3H6ZA 3R6OA 3RIRA 4YTLA 1K9MU 1G8XA 3EGDB 1G3WA 1N5ZA 2O01E 4J8OA 3QSUA 1O75A 3EHRA 3I56Q 3CPWA 1VQ4Q 3OYBA 3G71Q 4FU6A 3CBOA 4IUUA 3CCVQ 4JRIA 2MWPA 4C92B 4HT9A 3JCMh 2NUTB 1QVGA 4PLLA 3ZBDA 1OPLA 4C8QF 1YIJQ 3X26B 2DL3A 1FX7A 3VKIA 2D6FA 1VQ8A 1BB9A 4EMHA 2QQSA 2E5KA 3LX7A 1LNXA 2DX1A 2LQ8A 3LGLA 2QASA 3J7AF 1TWBA 4PFPA 4M77E 1MUZA 4GLKA 4J83A 1ZA2B 2DIGA 2JN0A 4PFOA 1IGUA 4M7DD 4XAXB 4C8QG 1KK7A 3PFSA 1OYXA 1M2VB 1TTHB 5CKFA 2LT4A 5GAOl 2ENMA 3FIFA 4M78E 1RAFB 3OYEA 2EVRA 4XTYA 1MNEA 5KH6A 1HJDA 4M4ZA 2CSQA 4PJOE 5J3BA 1PKSA 2J05A 2RK1A 4HXJA 4E2FB 4BACA 1NBEB 3P8DA 1WDXA 1D09B 2DEQA 4E7ZA 3M53A 2VASA 5IT9E 3VJPA 2YLBA 1UG1A 2COZA 3HRTA 2HKNA 4C8QB 2M9UA 2M0YA 3TVTA 1NLPC 3X25B 4X9DA 4BE2A 2VWFA 3PNWC 2DXUA 5GAMh 4JJDA 4ME7A 4B6MA 1W4SA 1MV3A 3LLRA 4V2SA 1F1BB 5GANj 2EYYA 4FYVB 2EQMA 3EH1A 5GMKm 1BI3A 1ARKA 2MCNA 4NS5A 5IN1A 1BCMA 4KH1B 1M9SA 1Q81R 3V8LA 1ZA1B 5J39A 4A4GA 1YI2Q 2JTEA 2K3XA 4M7DF 2W0ZA 2EYZA 3CPWP 1VQOQ 2RQVA 5CKHA 2JOYA 4CC3A 4FIBA 1Q86C 1ZUKA 1VQNT 4ATOA 2RM4A 3GIBA 3G4SQ 1B3QA 1UGSB 3ULRB 1QVGP 1GL5A 1SF9A 4XTXA 2ZPBB 5C6SA 4C92E 4J7FA 1JXOA 4HCBA 2F2VA 2L3SA 4EDUA 2I0NA 3OS2A 3ZFJA 4JS5A 3ME9A 2GTOA 4ZTFA 1PD1A 3NHNA 2HL3A 1IGQA 4CC7A 2X4WA 1QP2A 4M7DG 1T0HA 2JS2A 3V7RA 1VQ6A 2WSFE 2RI5A 3OYMA 1JO8A 3E1SA 3CC7A 4HCZA 4UC4A 2YXYA 1U3OA 2KI7A 3S3OA 2FL7A 3A8OB 4RTXA 4Z88A 1KD1U 4O6JA 2DRKA 2EWNA 2HDAA 2E6NA 4QQGA 5GMKh 2ZPHB 2DL7A 4BE0A 2O88A 3CBMA 5IH2A 2VC8A 3V8JA 1JXMA 1RL2A 2ZAEA 4M78A 2CT3A 3CCEA 3MPUB 4OMMA 3M0PA 1X6GA 3JCMV 2DAQA 3KXTA 2YLCA 2D1XA 2HSEB 4PJOA 1IZ6A 1NG2A 4IUTA 4XU3A 1U1TA 1EZZB 5GANd 2EYWA 4M7DB 2OTLA 3G1JA 4OGCA 2RMOA 1BIBA 1QCNA 4X1VA 3CC2T 2LT1A 1EX4A 2FPFA 1G5VA 3CCSQ 4PJMA 2K9GA 1PKTA 3CCUA 2D8JA 3E9FA 2BE7D 3QG1A 2RJEA 4ZTJA 3H8ZA 2DMOA 2AZVA 4C8QE 1XTDA 1W70A 4BB7A 3DLLA 3A8GB 1G3SA 2EKHA 4A4HA 4CC2A 5KYXB 3OYIA 2E41A 2QA4A 2A0FB 2RI3A 1FMWA 2KRNA 2RO0A 1KC8U 2G3RA 1V29B 1YJWT 3EGXA 2M16A 2EKOA 1NYFA 3UA6A 3S3MA 3LH0A 2CP0A 1RAGB 4M77C 2DL5A 4R56A 1FMKA 1UTIA 1RLPC 1Q7YR 1NJIR 2AIRB 3A5ZB 2RJFA 4M78D 1OX9A 1VYUA 4M78C 2GFUA 5GMKl 1JJ2S 4ZN1A 1OEBA 3EGDA 3CCEQ 3JCMQ 1M1GA 1AOJA 4LN2A 5LJ3d 2VXFA 3NTIA 3RKWA 3L2VA 2RPNA 4L59A 2CSIA 2OAWA 4JZ4A 4PJOD 3C4SA 4FCYA 4PJOC 3T9NA 3M56A 1LVKA 1M90U 2K5IA 3I55A 4C92A 3VRYA 1JRIA 2LQNA 2NUTA 2RHZA 2OTLQ 2DNUA 2F1LA 3TQ7P 3CMET 2FPDA 4XTZA 1SHGA 4ZGEB 2E12A 2VV5A 1X27A 3TU4K 1J3TA 3UT1A 2LCSA 3CCUQ 1YHQA 1I8FA 2L2PA 2KRMA 1G3YA 2HBPA 3CCQT 3JB9D 1VIEA 4PFZA 1BI0A 3JCMP 4IURA 4ZN3A 2QA4Q 4BI8B 1QVFA 1M2VA 2LMJA 2LZ6B 3CCMA 4MZTA 1VOMA 3VUBA 1PHTA 3VS6A 4KGZB 1WA7A 1TU0B 4BI4A 3CXCS 3L42A 1VQ5A 3UWNA 2YRDA 4IUPA 2RHIA 2XU8A 2QEXA 2FVUA 2RJDA 4J5YA 3HSBA 3JAME 4ZNXA 5GAMj 3I56T 4BY6C 4FYXB 4M7DE 2GGRA 3G71T 5J26A 3JCMd 4FYYB 1GCQA 1PD0A 2L3QA 5FU7B 4O5VA 1SSFA 5A0DA 5GAOq 3EH2A 3L1AA 2KSSA 1YIJT 4LDUA 2R5MA 3GF5A 1CSKA 1M1KC 4C92D 3RBBB 1D1AA 2C0IA 4Y92A 3FJPA 4C92C 3OA6A 2O2OA 3QUIA 1WLPB 3I55Q 4DOWA 4F17A 3OW2A 3DKMA 2DVEA 4JLIA 1SKUB 1PG5B 4FSXA 3PIPA 3PVQA 3M55A 2CP3A 2YRVA 4M78G 1VIFA 4JRPA 1KG1A 1NPRA 2X51A 1YHQQ 3M0RA 2HQEA 2A3LA 3QWYA 1K4US 3QHSA 4PJOG 2OTJT 1A0NB 2EJ9A 4FM4B 2CP7A 2XIDA 1WXUA 2JUFA 1WPYA 3HHTB 1XNIA 4LUEA 3CC4A 3BE3A 2M51A 3X24B 2KRSA 3FDRA 3EFRA 3M0TA 4N4IA 4DBHA 3CCMQ 1VQPA 1R77A 2YUOA 1NEBA 2YSQA 1Q82U 1CKAA 1KSWA 3M0UA 1JQQA 2BKDN 1VQ5Q 2LX7A 1KIKA 4P5NA 1EFNA 3CCRA 1NYGA 2E10A 2OJ2A 3MP1A 4PJLA 2F5KA 4JRKA 5GAN8 1QMCA 4QKUA 1VQ7A 1GCQC 5KYWB 4XQ3A 3JB9G 1IB8A 4E7LA 2ZPIB 3FEOA 4C5HA 5AT1B 2ZGWA 5GAMd 2X4JA 4C8QC 1QW1A 3A98A 3MO8A
chains in the Genus database with same CATH topology
3OYEA 4KT0E 4XTVA 1VQKT 3SWNB 2XK0A 4XTYA 2KQWA 3GOXA 3VV0A 5KH6A 4OB0B 5GAN2 1WNLA 3MHXA 3PTAA 4PJOE 2JVVA 4N0AC 3OQ5A 4ZGJB 4E7JA 5J3BA 1YCYA 3A8LB 1Y71A 2QXFA 2RK1A 4HA8A 3MEWA 1YITT 2LQKA 2K5LA 2L5QA 5FROA 4BACA 4N4GA 1YHQT 1PSEA 5CO7A 3CCLA 3P8DA 3A8HB 2K57A 2DEQA 1FXXA 4Y28E 1BYMA 3JB9H 3QBYA 3M53A 1VQ4T 1G3TA 5LJ5f 1KD1C 2XI9A 3X28B 1XOVA 4XU1A 1N9RA 2QQBA 1K8AC 5IT9E 1YI2T 4OMFB 3VJPA 3CCVT 2YLBA 1W2BS 1VQOT 1KQ2A 1YJWA 3HRTA 4M7AD 2PUKB 4LDYA 4C8QB 2M9UA 3JCMg 2MF2A 4PL6A 4C92G 3OYNA 3G4ST 3OSVA 3JCMW 1KHCA 3X25B 4X9DA 3ZEHA 2X35A 3RKYA 3PT9A 1VQ9T 4RG8A 1UGQB 2RJCA 3PNWC 4OP0A 4QVDA 4BE2A 1Q81C 2YHTA 4QQ6A 3CCJA 4ELYC 2DXUA 4A4KA 2LCCA 3KBGA 2BIVA 2MMPA 5HK0A 5GAMh 5GAOp 1UGRB 2D9TA 4N4HA 2QEXT 1VQNA 4ME7A 3LW5E 2OAUA 3P8BB 1W4SA 2XDPA 3LLRA 2V8KA 2EIFA 4Y91A 4V2SA 5GANj 3M9QA 3DB3A 1LJOA 5FLXE 4JUVA 3OYKA 2EQMA 2WACA 2LDMA 3A8MB 1KHIA 3OY9A 4BE1A 5HY6A 2HQXA 3GNGA 5GMKm 1BI3A 3Q1JA 4A54A 2DTHA 2KVQG 2M1HA 3HFOA 1BIAA 4IUQA 4EMGA 5KCHA 2DPPB 4NS5A 5IN1A 3VUZA 2ZCFB 2RK2A 3DLMA 1M9SA 2VGNA 2PUOB 3QPHA 3LGFA 1U8RA 3JCMf 4MDWA 4M77D 4OF1A 3V8LA 5J39A 5GMKi 2LNVA 4PNOA 4A4GA 4RG2A 5GAN6 1OZ3A 1WJSA 1OI1A 4C0GA 1VQLA 2K3XA 3CCJT 4M7AA 4M7DF 5LL6S 2O4XB 3GP8A 3C94A 5CKHA 2JOYA 1ZHIA 2EQKA 2QTXA 3OS1A 5D6YA 4FIBA 1Q86C 4ATOA 1VQNT 2KMTA 3CEYA 1VUBA 2RM4A 3NTHA 3GIBA 2E5QA 2PVDB 4FT4A 2CZ1B 3URGA 5C0MA 3HPWA 1KC8C 1UGSB 1N8RU 1M1FA 1XQHA 2DXCA 2E70A 4QW2A 4XTXA 3RMQA 4LD9K 2ZPBB 4F7UF 5C6SA 2DZCA 5FU6C 3G7ZA 4ELZC 4C92E 4J7FA 4HCBA 2CYZB 1YBYA 3CPFA 1X01A 3V7CA 3HP9A 3HRSA 4EDUA 3OS2A 5KE3A 3ZFJA 3RESA 3CCQA 5GMKj 4JS5A 2VUBA 3ME9A 4C0ZA 1WJRA 3QYHB 1X6OA 4XTUA 4ZTFA 1N6AA 2EJGA 4ZGDB 4HT8A 5CVIA 3VYGA 3JRZA 2DTIA 2DD4A 4A4EA 2MAMA 2X4WA 1QP2A 4M7DG 3V7RA 3FLGA 1M5Q1 3CCST 1VQ6A 3JCMJ 1N27A 1P92A 2WSFE 2RI5A 5GAOm 3OYMA 5GAMe 2L3RA 2V8JA 5CKDA 3J80E 5GAN7 3E1SA 4M7DC 3CC7A 2DTOA 1KQ1A 1X75C 4HCZA 4UC4A 3S3OA 1MGQA 2FL7A 3A8OB 1UGPB 3AHUA 4M7AF 1VQPT 2FB7A 4O6JA 1KD1U 2EWNA 3CC2A 4MMLA 2E6NA 2EQUA 4QQGA 4F7UG 5GMKh 2ZPHB 1K8AU 2X4YA 5GAMg 4BE0A 3CBMA 1JBMA 2VC8A 1NZ9A 3V8JA 2P0QA 3OBYA 5DLQE 3OYHA 1VQ8T 1RL2A 4GY5A 2V8IA 2XKOC 4E47A 1M90C 2RD1A 4M75A 4M78A 5FU6B 3BDUA 1I81A 4RCBA 3CCEA 2C06A 2E64A 1M1KU 3QXEB 4BD3A 3CCRT 2ZPEB 3JCMV 2DAQA 4FL6A 2PU9B 1Q82C 3QYGB 3GLXA 4LDVA 3KXTA 3FB9A 1Q81U 2DKGA 3V7SA 4RKUE 5A2QE 2YLCA 4EMKA 1VQ7T 3CD6T 1VQMA 2EQJA 4HKEA 1YIJA 2LVMA 4PJOA 1IZ6A 3LYIA 4IUTA 2E1HA 3S6WA 2R5AA 1HXDA 5GANe 4XU3A 2RHYA 5LJ3h 3L2ZA 1U1TA 5GANd 5CAIA 2LRQA 1Y7XA 2R58A 4M7DB 4M7AG 2OTLA 1HK9A 2ZPFB 4OGCA 5LJ5j 4OB3B 3SWNA 3E9GA 3GNFB 4JLGA 4A4FA 1K73C 1BIBA 2NLUA 1QVPA 2IVWA 3HKSA 5EG2A 3CC2T 2LT1A 4M7AC 3JCMX 2DZ9A 4M77F 5GAMf 3S3NA 3HRUA 4XU2A 3L2UA 1G5VA 1Y07A 3OW2S 2F69A 3CCUA 3CCET 1D3BB 3BFMA 3E9FA 4F7UB 2P4TA 3QG1A 2RJEA 4ZTJA 4X9CA 2VYTA 2EAYA 3H8ZA 5LJ3j 2DIQA 4M75F 4M78F 4C8QE 1OZ2A 2QQAA 1Q7YC 1XTDA 2DXBA 4QQDA 4BB7A 3OYLA 3LWIA 3CCLT 3DLLA 3A8GB 5D6XA 1NJIC 1G3SA 1VQMT 3MEAA 3L2WA 5GAN5 3L2RA 1Q86U 4A4HA 3UDCA 3OYIA 2E41A 2QA4A 2RI3A 5A0LA 1W2BA 1M8VA 2OTJA 2RO0A 4PLIA 4VUBA 2RHUA 4LDXA 1QP3A 2B8AA 4C8QA 3OYJA 2G3RA 3M4YA 3PMTA 1KC8U 4EPCA 4IKFA 4PJOF 1JB0E 2DD5A 1V29B 2RHXA 3CPWS 3OYDA 2OTLT 3M58A 3OMCA 1YJWT 2M16A 1FWZA 2EKOA 1H641 3F70A 4M77G 5GMKe 3MO8A 4KUDK 2QDYB 3QJ6A 4M7AB 3S3MA 3LH0A 2XHCA 1QVGS 4N0AA 3OMGA 4M77C 4R56A 3QDRB 5GAOr 3VYHB 2JTMA 3CCUT 1O9SA 3RERA 2GCXA 3C12A 5GANh 1ZQ1A 4NL3A 4FT2A 3CMEA 5FRNA 3JB9I 3A5ZB 2RJFA 4RCCA 5I21A 4M75D 2WSEE 4II1A 1N9SA 4M78D 2PVOB 4BY6B 3HL8A 4C0DC 2PQWA 5DLOA 3UPUA 4M75C 3M54A 3EAEA 4M78C 2GFUA 3V8KA 5GMKl 1JJ2S 2RB6A 4J6WA 4ZN1A 3QZ9B 4B9XA 5LJ3e 3OYYA 5GAOn 3JCMQ 1M1GA 4BDYA 2DK3A 4BDZA 5LJ3d 2VXFA 1NPPA 3NTIA 3RKWA 3QKJA 2EJFA 3OBWA 3L2VA 4L59A 4C5IA 4PJOD 3C4SA 2LX9A 3JB9F 3T9NA 4PJOC 3SDZA 1YJNA 2CZ0B 3M56A 3BW1A 4CI0C 1M90U 2K5IA 2RH2A 1PSFA 4C5GA 3I55A 5CKBA 4C92A 5CCAA 4D6WA 2QI2A 1JRIA 3SD4A 2M0OA 1K9MC 3PIOA 4XK8E 1BI1A 1M4ZA 4DQ2A 4M77B 3RMSA 1VQLT 1VQKA 4E7KA 2RHZA 1DJ7B 2CZ6B 3E19A 1QVFS 4J7IA 2CGHA 1TH7A 1Y96A 3CMET 5GAN3 5GAN4 4XTZA 2RA2A 4ZGEB 1WQ7A 4MZMA 2E12A 2HD0A 2VV5A 2P0KA 1I4K1 3WVEB 5DM7R 3TU4K 4C0DB 2E65A 2VXEA 3UT1A 2XG8D 2XDBA 1YITA 4M75B 2VGMA 3PGGA 4M78B 5LJ5d 2MI6A 2KDSA 2A7YA 4Q5WA 4Z02A 1YHQA 2K5FA 3BDLA 5I2SA 4A53A 1K73U 1I8FA 2D0QB 1U1SA 2EFIA 3WVDB 4JJNK 2E6ZA 3I56A 1G3YA 2HBPA 1VQ4A 2Y4YA 3TEEA 2JTFA 3CCQT 3G71A 2JZ2A 3JB9D 3FRNA 1VIEA 1YI2A 4PJOB 2DO3A 2HNIA 5FU7C 3CCVA 3BY7A 1S72A 4C8QD 1BI0A 1NE8A 4XU0A 3O8VA 4IURA 3CMAA 3JCMP 1VQOA 2AHJB 3SFMA 4ZN3A 1B34A 4BI8B 2Y90A 2BUDA 1QVFA 2JNGA 3TREA 4TVRA 3QZ5B 3G4SA 1EIFA 2LTOA 3CCMA 4MZTA 1VQ6T 3VUBA 2CS7A 3OYAA 3KUFA 4C92F 2LC4A 3OB9A 1Q7YU 4OB1B 2DXTA 1VQ9A 2K4YA 3CC7T 5KE2A 1UEBA 1YJ9A 1NJIU 4LD6A 2X4XA 4BI4A 3CXCS 2L8DA 3L42A 4DOVA 2WSCE 1VQ5A 3UWNA 4MMKA 4IUPA 4C0FA 4QVCA 5CIUA 2RHIA 2XU8A 5GANg 2QEXA 4C5EA 3RKXA 4HCCA 3C95A 2XICA 2FVUA 3JB9J 4JRQA 2RJDA 4J5YA 3HSBA 2GQVA 3JAME 2CKKA 2GF7A 5M9OA 1R8OB 5GAMj 3J81E 2XDDA 4BY6C 3I56T 4M7DE 3QO3A 4QVZA 3SB2A 3JCMe 4RMOA 3G71T 1LOJA 2Y4XA 5J26A 3JCMd 4KBMB 2GFAA 5CQYA 1S72T 2QQRA 3QIIA 1GXIE 3CMAT 5FU7B 4O5VA 1SSFA 5A0DA 5GAOq 2H3JA 4NOYA 5L8RE 1BKBA 2KSSA 1WJQA 3L1AA 5LJ5h 2XD0A 1YIJT 3CBPA 5CR2A 4LDUA 2QQ9A 2R5MA 5CKEA 3GF5A 5IAYA 4M7DA 4OGEA 4NL2A 4XTWA 5HKCA 1BI2A 4L6V5 4WF2A 2P0PA 3TCJA 3CCMT 1M1KC 4CRIA 2ZZDA 3MEVA 4OB2B 4C92D 4F7UE 2LCLA 3CXCA 3G6EA 3GPLA 3FJPA 1YJ9T 4C92C 3OA6A 3QUIA 3PMIA 3M59A 4KUIA 1IREB 4PKCC 5I2MA 1AHJB 1VQ5T 1UB4A 1MHNA 4IUVA 4MZPA 4DOWA 5GANf 1D3BA 4F7UA 3OW2A 3DKMA 2PVGB 3OSSC 2DVEA 2KK4A 4JLIA 3HFNA 4B9WA 3EFSA 2FHDA 3RUXA 3OYFA 3OS5A 2CZ7B 4X34A 4FSXA 4BI3A 3N5BB 5KCOA 3M55A 3PIPA 3LWHA 3JCMc 2HAXA 3WXMB 2YRVA 4M75G 3JSCA 2KAFA 2KY9A 3DB4A 3H6ZA 3R6OA 4M78G 1VIFA 3RIRA 4YTLA 3FC3A 4JRPA 1K9MU 1KG1A 4DA4A 1NPRA 3NTKA 3JCMb 1G3WA 3OYGA 5A0GA 2O01E 3M5AA 4J8OA 4M7AE 3QSUA 4R55A 2HQEA 3OYCA 2A3LA 2IG0A 4LDWA 1O75A 2QA4T 4E7IA 3CPWA 3G6ET 4E7HA 3QHSA 5AYFA 4PJOG 3OYBA 2OTJT 2EJ9A 4FM4B 2XIDA 3QJYA 2I2LA 4FU6A 2JUFA 3CBOA 4IUUA 3CCSA 3MCAB 1KQSS 4JRIA 2MWPA 3ASKA 4C92B 4EMKC 4MDXA 4HT9A 3JCMh 2MWOA 3P8HA 1WPYA 3HHTB 1QVGA 4PLLA 1XNIA 3CC4A 5LJ3g 2L89A 3ZBDA 3VU3C 4C8QF 3X24B 1H3ZA 3FDRA 4L5GA 3MP6A 3M4GA 3EFRA 2O4XA 1RI0A 4N4IA 3X26B 1VQPA 3INZA 5CK9A 3MP8A 1Y96B 3SWNC 1FX7A 4J6YA 3ER0A 3VKIA 1Q82U 2K3YA 2D6FA 1VQ8A 1WGSA 2BKDN 4BUGA 4EMHA 1JJ2A 5FRMA 2QQSA 4P5NA 5DY9A 5CQXA 3CCRA 3MP1A 2E10A 4OVAA 3LX7A 5LJ5e 4JS4A 1LNXA 2EYQA 2LQ8A 3LGLA 2FYKA 2F5KA 3NFCA 3J7AF 4JRKA 3M57A 5GAN8 4KULA 4M77E 1WQWA 1KQSA 2DJZA 3X20B 1VQ7A 3CD6A 2ZPGB 1I5LA 4GLKA 4J83A 4XQ3A 2JN0A 2DIGA 3META 3JB9G 3L2QA 5LJ5g 4M7DD 5D6WA 2R57A 4E7LA 2ZPIB 3FEOA 4XAXB 4C5HA 4J6XA 5HK3A 1B34B 4C8QG 1YJNT 2K2VA 4EMKB 3OS0A 1N8RC 2ZGWA 5GAMd 3CC4T 3PFSA 1OYXA 2X4JA 4M77A 5LJ3f 1ZBXA 3I55T 5CKFA 5GAOl 2LT4A 4M75E 3FIFA 4M78E 4C8QC 4JDSA 1QW1A 2RI2A 2F5TX 3MEUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7A B;  1LOJ A;  3JCM d;  3RES A;  4N0A A;  4M77 C;  4XTV A;  5GMK j;  5GAO r;  3SWN B;  3RER A;  4XTY A;  4XTU A;  5GAO q;  4NOY A;  5GAN h;  2EJG A;  3L1A A;  4NL3 A;  4HT8 A;  5LJ5 h;  5GAN 2;  1WNL A;  2DTI A;  4M7D A;  4PJO E;  4N0A C;  1YCY A;  4NL2 A;  4XTW A;  3JB9 I;  4WF2 A;  4RCC A;  5I21 A;  4M7D G;  4M75 D;  4HA8 A;  4M78 D;  1N9S A;  3V7R A;  4C92 D;  4F7U E;  1M5Q 1;  3JCM J;  3FJP A;  4M75 C;  4M78 C;  5GAO m;  3V8K A;  4C92 C;  5GMK l;  5GAM e;  4M7D C;  2RB6 A;  4J6W A;  3QUI A;  5GAN 7;  2DTO A;  1KQ1 A;  2K57 A;  5LJ3 e;  2DEQ A;  5GAO n;  3JCM Q;  5LJ3 d;  3JB9 H;  2VXF A;  1MGQ A;  3RKW A;  5GAN f;  3AHU A;  1D3B A;  4M7A F;  5LJ5 f;  2EJF A;  2FB7 A;  4F7U A;  2EWN A;  4MML A;  4XU1 A;  1N9R A;  4F7U G;  2DVE A;  5GMK h;  4PJO D;  4JLI A;  5GAM g;  3HFN A;  3JB9 F;  4PJO C;  1JBM A;  2VC8 A;  2YLB A;  3EFS A;  3RUX A;  3V8J A;  3BW1 A;  1KQ2 A;  4M7A D;  2RD1 A;  4M75 A;  4M78 A;  3JCM c;  4C92 A;  3BDU A;  1I81 A;  4RCB A;  4M75 G;  4C8Q B;  4M78 G;  1JRI A;  3JCM g;  4C92 G;  3RIR A;  2E64 A;  3JCM W;  3JCM V;  3JCM b;  4X9D A;  4DQ2 A;  4M77 B;  3RKY A;  4M7A E;  4OP0 A;  4QVD A;  3FB9 A;  2YHT A;  2CGH A;  2DKG A;  3V7S A;  3QSU A;  2DXU A;  1TH7 A;  1Y96 A;  2YLC A;  4EMK A;  5GAN 3;  5GAN 4;  4XTZ A;  4PJO A;  2RA2 A;  5GAM h;  5GAO p;  1WQ7 A;  2E1H A;  3QHS A;  4PJO G;  1HXD A;  5GAN e;  4XU3 A;  2EJ9 A;  1I4K 1;  5LJ3 h;  3L2Z A;  1U1T A;  2I2L A;  2E65 A;  2VXE A;  5GAN d;  5CAI A;  4M75 B;  3PGG A;  4M78 B;  5LJ5 d;  4JRI A;  4C92 B;  4Y91 A;  4EMK C;  4HT9 A;  4M7D B;  3JCM h;  5GAN j;  1HK9 A;  1WPY A;  4M7A G;  4V2S A;  4A53 A;  5LJ5 j;  3SWN A;  5LJ3 g;  1LJO A;  3VU3 C;  4JUV A;  4C8Q F;  1BIB A;  1I8F A;  1U1S A;  3M4G A;  3EFR A;  4M7A C;  3JCM X;  3INZ A;  2DZ9 A;  4M77 F;  5GAM f;  4A54 A;  5GMK m;  3SB2 A;  4XU2 A;  3JB9 D;  1Y96 B;  2DTH A;  3HFO A;  3SWN C;  1BIA A;  4EMG A;  4J6Y A;  4PJO B;  2HNI A;  3BY7 A;  4C8Q D;  3JCM P;  4XU0 A;  1D3B B;  3BFM A;  4F7U B;  1B34 A;  2Y90 A;  3JCM f;  4EMH A;  3V8L A;  4M77 D;  4X9C A;  2EAY A;  5GMK i;  5DY9 A;  4PNO A;  2E10 A;  5GAN 6;  4M75 F;  4M78 F;  5LJ5 e;  4C8Q E;  4C92 F;  1LNX A;  2DXT A;  4M7D F;  4M7A A;  2FYK A;  4JRK A;  5GAN 8;  4M77 E;  1WQW A;  2QTX A;  5GAN 5;  2DJZ A;  1I5L A;  2E41 A;  2RM4 A;  4MMK A;  3GIB A;  4XQ3 A;  2JN0 A;  4QVC A;  5GAN g;  3JB9 G;  1M8V A;  3RKX A;  5LJ5 g;  4C8Q A;  4M7D D;  4J6X A;  4PJO F;  1B34 B;  4C8Q G;  3JB9 J;  4EMK B;  4J5Y A;  2ZGW A;  5GAM d;  3HSB A;  4XTX A;  5LJ3 f;  4M77 A;  4F7U F;  5GAO l;  2DZC A;  4M75 E;  3FIF A;  1H64 1;  4M78 E;  4M77 G;  5GMK e;  4C92 E;  5GAM j;  4C8Q C;  4M7D E;  3QO3 A;  3JCM e;  3V7C A;  1X01 A;  5LJ3 j; 
#chains in the Genus database with same CATH topology
 2CH4 A;  2KQW A;  4KH0 B;  1QVF P;  3MHX A;  4N0A C;  2MK5 A;  2QXF A;  4HA8 A;  3MEW A;  1YIT T;  5CO7 A;  1N8R R;  3NMZ C;  5LJ5 f;  3X28 B;  1XOV A;  4XU1 A;  2YT6 A;  1QKX A;  1YI2 T;  2CH4 W;  4OMF B;  1D0Y A;  1MMN A;  1VQO T;  3EG3 A;  4IIM A;  4AFZ C;  2D0N A;  2ROL A;  4C92 G;  3OYN A;  3G4S T;  1ZUU A;  3ZEH A;  2X35 A;  1VQ9 T;  4RG8 A;  1UGQ B;  4OP0 A;  1Q81 C;  1I1J A;  3CC4 Q;  4RTV A;  2BIV A;  1UGR B;  2J7I A;  1YFN A;  2XDP A;  1VQK Q;  1K8A R;  2CUB A;  5FLX E;  3OW2 P;  1UUE A;  2K3B A;  2LDM A;  4BE1 A;  3OY9 A;  3CCR Q;  5GJV B;  5KYX A;  1H92 A;  3HFO A;  1M1K R;  4IUQ A;  5KCH A;  1BIA A;  2HKQ B;  2ZCF B;  1WHK A;  1KJW A;  2NUZ A;  1C0M A;  2LNV A;  2OX7 A;  4PNO A;  4A63 B;  4RG2 A;  1OZ3 A;  1OI1 A;  4C0G A;  1VQL A;  2DE0 X;  2O4X B;  3C94 A;  3OS1 A;  2EQK A;  3EG0 A;  3NTH A;  1D0Z A;  3EGU A;  1XQH A;  2DXC A;  4J9G A;  3RMQ A;  5ECA A;  3G7Z A;  1YCS B;  2CYZ B;  3HRS A;  1XJW B;  1MMA A;  5GJW B;  2PZ1 A;  1X6O A;  4XTU A;  1QKW A;  1N6A A;  2EJG A;  4ZGD B;  2J06 A;  4OML A;  4A4E A;  2MAM A;  1MV0 B;  1PNJ A;  2DVJ A;  3CCS T;  3JCM J;  1ZSZ A;  2V8J A;  5CKD A;  3J80 E;  4M7D C;  4IIO A;  2DTO A;  3AHU A;  4MML A;  2DEU A;  2EQU A;  1JBM A;  1NZ9 A;  2KYM A;  2P0Q A;  4Z89 A;  1RAI B;  2XKO C;  4E47 A;  5FU6 B;  1HYO A;  3JV3 A;  4RCB A;  1WIE A;  2JM9 A;  2E64 A;  4BD3 A;  4AFU C;  2ZPE B;  4FL6 A;  3FB9 A;  4RKU E;  5A2Q E;  4EMK A;  3CD6 T;  2LVM A;  3VS0 A;  2E4H A;  2R5A A;  2ROT A;  5GAN e;  1X6B A;  1Y7X A;  2R58 A;  1HK9 A;  1S1N A;  2ZPF B;  1RI9 A;  4J9C A;  3GNF B;  3SWN A;  4A4F A;  1UFF A;  3VS2 A;  2NLU A;  3HKS A;  1WXT A;  2X3X D;  3VS1 A;  1VQL Q;  1RAE B;  2F69 A;  1Q82 R;  3CCE T;  2P4T A;  1WHL A;  3EFO A;  2VYT A;  1M8M A;  4KRT A;  4M75 F;  1OZ2 A;  1Q7Y C;  1Z9Q A;  1IXD A;  2DXB A;  4QQD A;  3CCL T;  1NJI C;  2HL5 C;  1VQ8 Q;  2O9V A;  5GAN 5;  2LJ3 A;  1Q86 U;  3UDC A;  5KYU A;  1K73 R;  1W2B A;  4VUB A;  2RHU A;  3OYJ A;  2OTL T;  2RHX A;  3CPW S;  5HCK A;  4LNP A;  3OMC A;  1FWZ A;  2DBK A;  4KUD K;  2HCK A;  3QJ6 A;  2DYB A;  3D7S B;  2XHC A;  1QVG S;  3OMG A;  2CP2 A;  3CCU T;  1O9S A;  2GCX A;  4NL3 A;  3NPF A;  5FRN A;  6AT1 B;  3JB9 I;  1TS9 A;  5DLO A;  2KT1 A;  1R0C B;  4ESR A;  2RB6 A;  4J6W A;  3QZ9 B;  4B9X A;  5LJ3 e;  3OYY A;  3I35 A;  4BDY A;  1SHF A;  2AZS A;  2EJF A;  2HSP A;  2HMA A;  1LPL A;  1D0X A;  2EW3 A;  3SDZ A;  1OV3 A;  3BW1 A;  2DL4 A;  2QAZ A;  1PSF A;  4F14 A;  1H3H A;  3SD4 A;  4WCI A;  4DQ2 A;  1D1B A;  2DER A;  2CZ6 B;  1E6H A;  1TH7 A;  2J6K A;  5GAN 3;  2RA2 A;  1WQ7 A;  4MZM A;  2HD0 A;  2P0K A;  1I4K 1;  5DM7 R;  2E65 A;  4JJB A;  2KYB A;  4M75 B;  2VGM A;  2MI6 A;  2C0O A;  3I5R A;  3WVD B;  2H3E B;  2JTF A;  4RTY A;  1K9M R;  5KYW A;  1AVZ C;  2DO3 A;  5FU7 C;  2EGA A;  1PRM C;  1M3C A;  1OOT A;  2KXD A;  1QWE A;  4TVR A;  3UAT A;  1EIF A;  3OYA A;  2CS7 A;  4LUD A;  1G2B A;  3H9N A;  3OB9 A;  1R0B G;  2K4Y A;  2CUD A;  5KE2 A;  2X4X A;  2FRY A;  1YN8 A;  4PJJ A;  2WSC E;  3C0C A;  2QDL A;  1UDL A;  2MOX A;  2CKK A;  5M9O A;  3J81 E;  2FZK B;  3QO3 A;  3JCM e;  2FZG B;  1LOJ A;  4KBM B;  1ZUY A;  3QII A;  2XD0 A;  1JEG A;  1GBQ A;  5CR2 A;  5CKE A;  2KRO A;  2QQ9 A;  5IAY A;  4NL2 A;  3CCM T;  1BI2 A;  1PM3 A;  1TUG B;  4CRI A;  2ZZD A;  2DLP A;  3CXC A;  3G6E A;  1UHF A;  2OI3 A;  5I2M A;  1W2B P;  2FEI A;  1AHJ B;  1VQ5 T;  1UB4 A;  5GAN f;  2HQH A;  4F7U A;  2EQI A;  2E3I A;  2PVG B;  3OSS C;  1TG0 A;  1VQ6 Q;  4AMC A;  3HFN A;  3CC7 Q;  2CZ7 B;  4BDZ A;  2P84 A;  3N5B B;  4J9H A;  5KCO A;  3JCM c;  2HAX A;  3WXM B;  3JSC A;  2KY9 A;  4DA4 A;  4AG2 C;  3JCM b;  1G83 A;  1M2O A;  3A1P A;  5A0G A;  3M5A A;  1I0C A;  4R55 A;  4LDW A;  4E7I A;  4E7H A;  1K9A A;  2DA9 A;  1KQS S;  3REB B;  1VYT A;  1WYX A;  1W6X A;  2KNB B;  3O5Z A;  2L89 A;  4RTU A;  3VU3 C;  3H0H A;  1H3Z A;  3MP6 A;  3M4G A;  1ZSZ B;  2O4X A;  1RI0 A;  4KGV B;  3INZ A;  5CK9 A;  3MP8 A;  3NGP A;  3I5S A;  1WGS A;  2COW A;  5DY9 A;  5LJ5 e;  5KYY B;  4JS4 A;  4PK4 A;  2EYQ A;  2SEM A;  3QDF A;  3X20 B;  4AT1 B;  2ZPG B;  2LJ1 A;  3L2Q A;  1SRM A;  5LJ5 g;  2R57 A;  1M3A A;  1I07 A;  1YJN T;  2K2V A;  4EMK B;  1N8R C;  3CC4 T;  3AT1 B;  1T0J A;  5LJ3 f;  2NUP B;  1ZBX A;  2XMF A;  1WHG A;  4M75 E;  4JDS A;  2RI2 A;  2F5T X;  3G6E Q;  3MEU A;  2JMC A;  2O9S A;  4XTV A;  1VQK T;  3SWN B;  5FWC A;  4ANJ A;  3GOX A;  3PE0 A;  5GAN 2;  4QT7 A;  3PTA A;  2JVV A;  3OQ5 A;  4E7J A;  1Y71 A;  2CP5 A;  2IIM A;  2K5L A;  2L5Q A;  2EPD A;  3EFO B;  2K57 A;  1VQ4 T;  2XI9 A;  1N9R A;  4FSS A;  1K8A C;  3CCV T;  1KQ2 A;  2M02 A;  5KYU B;  1YJW A;  2QGG A;  4M7A D;  2PUK B;  4LDY A;  4FW2 A;  4R0K A;  4J9I A;  4E6R A;  3HTR A;  4QVD A;  2F2X A;  2YHT A;  4QQ6 A;  3CCJ A;  2LCC A;  1GRI A;  3KBG A;  3CXC P;  5HK0 A;  4JJC A;  4N4H A;  1X2Q A;  2KR3 A;  1K76 A;  2OAU A;  3UA7 A;  1KD1 R;  8AT1 B;  3P8B B;  4Y91 A;  2EIF A;  3MJX A;  3M9Q A;  1IHW A;  1TUC A;  4JUV A;  4AG1 C;  2WAC A;  3A8M B;  2VVK A;  1KHI A;  2JJ9 A;  2BTT A;  3GNG A;  2K7A A;  2KVQ G;  2M1H A;  1UE9 A;  2RK2 A;  2VGN A;  2MYS A;  1U8R A;  3JCM f;  4MDW A;  5GAN 6;  1QCF A;  1MMD A;  1C1A A;  1ZHI A;  5D6Y A;  2GNC A;  3CEY A;  2RNA A;  1VUB A;  1RAA B;  2E5Q A;  2PVD B;  2CZ1 B;  5C0M A;  2JS0 A;  2JMA A;  4QW2 A;  2E70 A;  4LD9 K;  2EGE A;  1VA7 A;  4F7U F;  5FU6 C;  3ZL7 C;  1YBY A;  3CPF A;  1X01 A;  3V7C A;  3HP9 A;  2QEX Q;  5KE3 A;  1T3S A;  2A28 A;  5GMK j;  2QG9 B;  3CCQ A;  2BZ8 A;  4C0Z A;  2A36 A;  4OMO A;  3IQL A;  2J6F A;  4HT8 A;  4DEY A;  3VYG A;  3JRZ A;  2DTI A;  2DD4 A;  1WX6 A;  1PRL C;  3QWX X;  2CRE A;  3FLG A;  4GBQ A;  1M5Q 1;  1N27 A;  5IHI A;  1P92 A;  1YP5 A;  5GAO m;  3LH5 A;  2L3R A;  1KC8 R;  1X75 C;  1B07 A;  1RAB B;  1UGP B;  4M7A F;  1AZE A;  2FB7 A;  2DYI A;  4F7U G;  4OMP A;  2X4Y A;  1AWX A;  1D1C A;  2LP5 A;  1GFC A;  1B7T A;  2CDT A;  3CCJ Q;  5DLQ E;  3SHW A;  1VQ8 T;  4GY5 A;  3VS4 A;  4M75 A;  3BDU A;  1HD3 A;  1I81 A;  1UHC A;  2GTJ A;  2C06 A;  3EG2 A;  2J6O A;  4PJN A;  1Q82 C;  4ORZ A;  4LDV A;  4J9F A;  1Q81 U;  2DKG A;  1VQM A;  1YIJ A;  3LYI A;  1OU9 A;  3S6W A;  2MPX C;  2RHY A;  5LJ3 h;  1UEC A;  3L2Z A;  4J9E A;  2L3P A;  4M7A G;  3FJ5 A;  3E9G A;  1K73 C;  5EG2 A;  1M90 R;  1U5S A;  3JCM X;  2AT1 B;  4HCK A;  1IO6 A;  2DZ9 A;  5GAM f;  4DBR A;  3HRU A;  1Y07 A;  2E3H A;  4RTZ A;  3OW2 S;  4J9D A;  3BFM A;  4F7U B;  1M3B A;  1M27 C;  3MKD A;  2EAY A;  1VQP Q;  5EC7 A;  5IXB A;  4F04 B;  2JT4 A;  3OYL A;  3L2R A;  5A0L A;  2OTJ A;  4PLI A;  4LDX A;  2B8A A;  3PMT A;  5I22 A;  4EPC A;  2VB6 A;  1ZLM A;  1H64 1;  1V76 A;  1VQ7 Q;  3THK A;  2A08 A;  4M7A B;  3TSZ A;  5GAO r;  1OU8 A;  1Y0M A;  2HBW A;  3GBQ A;  3C12 A;  1ZQ1 A;  4RCC A;  4M75 D;  2WSE E;  4II1 A;  2PVO B;  3HL8 A;  1SRL A;  2PQW A;  4M75 C;  3M54 A;  3EAE A;  1AWW A;  1AT1 B;  1HSQ A;  4KGX B;  2LQW A;  2DK3 A;  1NPP A;  1Q95 G;  1X43 A;  3OBW A;  2PNI A;  1OUL A;  1SSH A;  1GBR A;  5IHK A;  3RNJ A;  2LX9 A;  4GLM A;  1C6V X;  2NWM A;  2FRW A;  4DBQ A;  4CI0 C;  1VQM Q;  1RAD B;  4C5G A;  2YUQ A;  2FZC B;  5CCA A;  2M0O A;  1K9M C;  1M30 A;  3RMS A;  4E7K A;  3E19 A;  4J7I A;  2CGH A;  5GAN 4;  1KFZ A;  1BU1 A;  3E2U A;  4C0D B;  2VXE A;  3EG9 B;  2XDB A;  1YIT A;  3PGG A;  2A7Y A;  2K5F A;  3BDL A;  5I2S A;  2X9H A;  5KYY A;  1OX8 A;  1U1S A;  2EFI A;  4JJN K;  2E6Z A;  1GFD A;  1BBZ A;  2JZ2 A;  3FRN A;  1YI2 A;  2HNI A;  1IRX A;  3BY7 A;  1S72 A;  1VQO A;  2H8H A;  3O8V A;  3CMA A;  2AHJ B;  3SFM A;  2FG0 A;  2DIL A;  2BUD A;  2OTJ Q;  3TRE A;  2NUP A;  1WI7 A;  5FWB A;  3G4S A;  1VQ6 T;  1Q7Y U;  1VQ9 A;  3CC7 T;  1UEB A;  1YJ9 A;  1NJI U;  4LD6 A;  1Z9Z A;  4MMK A;  4C0F A;  4QVC A;  5CIU A;  5GAN g;  3H41 A;  4C5E A;  2XIC A;  2A37 A;  3JB9 J;  3CQT A;  4JRQ A;  1RAH B;  4JZ3 A;  5FW9 A;  2GF7 A;  3R6N A;  3M0S A;  3SB2 A;  4QVZ A;  4HVV A;  2Y4X A;  1TSF A;  1K0X A;  2GFA A;  5CQY A;  1IHV A;  4CC4 B;  2QQR A;  4RUG A;  2BZY A;  4JPB W;  2H3J A;  5L8R E;  1WJQ A;  2RF0 A;  5LJ5 h;  3CBP A;  4XTW A;  2EGC A;  2RQR A;  4OB2 B;  2DF6 A;  4F7U E;  2LCL A;  2QK0 A;  2F2W A;  2G6F X;  2VKN A;  3M59 A;  4KUI A;  1H8K A;  4PKC C;  4MZP A;  1MHN A;  1ZSZ C;  1D3B A;  2DBM A;  2ATC B;  3OYF A;  3RUX A;  4X34 A;  4BI3 A;  1SG5 A;  4M75 G;  2HZY A;  3FC3 A;  1QQJ A;  1YIT Q;  3NTK A;  3OYG A;  1AWO A;  2K6D A;  4M7A E;  2KBT A;  3OYC A;  2IG0 A;  2QA4 T;  3G6E T;  5AYF A;  2BZX A;  3QJY A;  2I2L A;  3CCS A;  3MCA B;  1UGV A;  2YUP A;  3ASK A;  4EMK C;  1S72 Q;  4MDX A;  1Y57 A;  2MWO A;  3P8H A;  2AKK A;  3CMA Q;  5LJ3 g;  2JW4 A;  4L5G A;  1MMG A;  1VQ9 Q;  1Y96 B;  2ED0 A;  2YWW A;  3SWN C;  2RQU A;  4J6Y A;  1YJ9 Q;  3ER0 A;  2K3Y A;  4HVU A;  2CP6 A;  1PCX A;  4BUG A;  1JJ2 A;  5FRM A;  3KFV A;  5CQX A;  4OVA A;  2FYK A;  2ED1 A;  3NFC A;  3M57 A;  4KUL A;  1WQW A;  1KQS A;  1K0S A;  2DJZ A;  3CD6 A;  1I5L A;  3MET A;  5D6W A;  1X2K A;  5HK3 A;  4J6X A;  1B34 B;  3OS0 A;  4HVW A;  4M77 A;  3I55 T;  1BYM A;  5LJ3 j;  4KT0 E;  2XK0 A;  3PVL A;  1NEG A;  3VV0 A;  1TXQ A;  1WHH A;  4OB0 B;  1WNL A;  1BCO A;  4ZGJ B;  2DM1 A;  1YCY A;  4Z8A A;  3A8L B;  1SEM A;  2LQK A;  5FRO A;  4N4G A;  1YHQ T;  1PSE A;  2RQT A;  3CCL A;  3A8H B;  2DET A;  4E7S A;  1FXX A;  4Y28 E;  3JB9 H;  2YDL A;  3QBY A;  2DL8 A;  1G3T A;  1KD1 C;  1ABO A;  2RQW A;  2QQB A;  1TUD A;  3EHQ A;  1W2B S;  1VYV A;  2W10 A;  3JCM g;  2MF2 A;  1I5O B;  4PL6 A;  3OSV A;  3JCM W;  1KHC A;  3RKY A;  1CKB A;  3PT9 A;  2RJC A;  1FYN A;  3RDV A;  4ELY C;  4A4K A;  2MMP A;  5GAO p;  1AEY A;  2D9T A;  1VQN A;  2QEX T;  3LW5 E;  2X3W D;  2V8K A;  2YUN A;  1AZG B;  3DB3 A;  2YRC A;  1LJO A;  3OYK A;  3VS7 A;  4OMN A;  5HY6 A;  2HQX A;  3VRZ A;  3Q1J A;  4D8D A;  4A54 A;  1OPK A;  2DTH A;  4EMG A;  2DPP B;  3VUZ A;  3DLM A;  4D8K A;  2PUO B;  3CD6 Q;  3QPH A;  3LGF A;  3RR6 A;  4M77 D;  4OF1 A;  5GMK i;  1JU5 C;  1AD5 A;  1WJS A;  3CCJ T;  4M7A A;  4DBF A;  1BK2 A;  5LL6 S;  3GP8 A;  2QTX A;  1WXB A;  3UF4 A;  2KMT A;  3VS5 A;  4FT4 A;  1ZX6 A;  3URG A;  3HPW A;  4J9B A;  1KC8 C;  1QWF A;  1NLO C;  1N8R U;  1M1F A;  4FW1 A;  1RAC B;  2KT8 A;  5I11 A;  2DZC A;  4ELZ C;  4FYW B;  3H0F A;  3RES A;  1T3L A;  2VUB A;  1WJR A;  3CCL Q;  3QYH B;  1JJ2 P;  5CVI A;  2D8H A;  5IXF A;  1Q86 R;  2KEA A;  1U06 A;  1MND A;  1KQS P;  5GAM e;  3M0Q A;  5GAN 7;  1KQ1 A;  7AT1 B;  2AK5 A;  1MGQ A;  4LE9 A;  1QLY A;  1VQP T;  3CC2 A;  2QTV A;  1K8A U;  5GAM g;  4WTO B;  3OYH A;  3OBY A;  2K2M A;  1NM7 A;  3EG9 A;  2V8I A;  1M90 C;  2RD1 A;  1AWJ A;  1VQN Q;  1M1K U;  3QXE B;  3CCR T;  1E7O A;  1WHJ A;  2PU9 B;  5KYN A;  3QYG B;  3GLX A;  2CT4 A;  2DRM A;  3V7S A;  2LNH B;  1VQ7 T;  1ZBJ A;  2EQJ A;  4HKE A;  2E1H A;  3TSW A;  2B86 A;  1HXD A;  9ATC B;  1PC0 A;  1WFW A;  5CAI A;  2LRQ A;  5LJ5 j;  4OB3 B;  4JLG A;  2C0T A;  1QVP A;  2IVW A;  3VS3 A;  2Z0W A;  4M7A C;  2PTK A;  4M77 F;  3S3N A;  4XU2 A;  3L2U A;  1D3B B;  4X9C A;  2DIQ A;  4M78 F;  5L23 A;  4K11 A;  2QQA A;  3LWI A;  5D6X A;  1VQM T;  3MEA A;  3L2W A;  2RN8 A;  1M8V A;  2O31 A;  1QP3 A;  4C8Q A;  3M4Y A;  4IKF A;  4PJO F;  1JB0 E;  2DD5 A;  3OYD A;  3M58 A;  1E6G A;  5D7U A;  4M77 G;  3F70 A;  5GMK e;  2QYZ A;  4DEX A;  1LCK A;  2QDY B;  1RUW A;  4N0A A;  3QDR B;  3VYH B;  2JTM A;  3RER A;  3H0I A;  4RTT A;  5GAN h;  4FT2 A;  2ABL A;  5IHN A;  3CME A;  5I21 A;  3CC2 Q;  1N9S A;  4C0D C;  3UPU A;  2EBP A;  1RLQ C;  3V8K A;  2DFU A;  1YWO A;  1X69 A;  5GAO n;  2AKL A;  3QKJ A;  2BE9 B;  4C5I A;  2V1Q A;  3U23 A;  4OMQ A;  2HEQ A;  1K1Z A;  3JB9 F;  1YJN A;  2CZ0 B;  2RH2 A;  2K79 A;  5CKB A;  1UJ0 A;  1QCO A;  4D6W A;  2QI2 A;  3PIO A;  4XK8 E;  2FPE A;  1BI1 A;  1M4Z A;  2QGF B;  4M77 B;  1PWT A;  1ABQ A;  1VQL T;  2FO0 A;  1VQK A;  1DJ7 B;  1QVF S;  1YJW Q;  3EG1 A;  1Y96 A;  3WVE B;  3SEM A;  1SPK A;  2XG8 D;  2GBQ A;  5LJ5 d;  4M78 B;  2KDS A;  4Q5W A;  4Z02 A;  4AFQ C;  4F16 A;  4A53 A;  2COY A;  1ACM B;  1GCP A;  1K73 U;  2D0Q B;  3I56 A;  1VQ4 A;  2V1R A;  2KE9 A;  2Y4Y A;  3TEE A;  3G71 A;  4PJO B;  4LXC A;  1WHM A;  3CCV A;  4C8Q D;  1NE8 A;  2LJ0 A;  4XU0 A;  1B34 A;  1V1C A;  2Y90 A;  3I9Q A;  2GQI A;  2JNG A;  3QZ5 B;  2LTO A;  2NYS A;  2KGT A;  3KUF A;  4C92 F;  2LC4 A;  4OB1 B;  2DXT A;  2P4R A;  3REA B;  2L8D A;  4DOV A;  3RKX A;  4HCC A;  3C95 A;  2GQV A;  1FMV A;  2ESW A;  1UJY A;  3CME Q;  1R8O B;  2EYX A;  1OQK A;  2XDD A;  2L0A A;  4EIK A;  4RMO A;  4AFS C;  1S72 T;  2MIO A;  4RTW A;  1GXI E;  3CMA T;  1WZO A;  4NOY A;  1BKB A;  1ZSG A;  4M7D A;  8ATC B;  4OGE A;  5HKC A;  4WF2 A;  4L6V 5;  2P0P A;  3TCJ A;  3MEV A;  3GPL A;  3EGX B;  3CCQ Q;  2V26 A;  1YJN Q;  2IPO B;  1YJ9 T;  3PMI A;  1YWP A;  1IRE B;  1YNZ A;  2KXC A;  4IUV A;  2ECZ A;  1TOV A;  2JM8 A;  2KK4 A;  4B9W A;  3EFS A;  2FHD A;  2SRC A;  3OS5 A;  2JXB A;  2DJQ A;  3LWH A;  1W1F A;  4BY6 B;  2KAF A;  3DB4 A;  3H6Z A;  3R6O A;  3RIR A;  4YTL A;  1K9M U;  1G8X A;  3EGD B;  1G3W A;  1N5Z A;  2O01 E;  4J8O A;  3QSU A;  1O75 A;  3EHR A;  3I56 Q;  3CPW A;  1VQ4 Q;  3OYB A;  3G71 Q;  4FU6 A;  3CBO A;  4IUU A;  3CCV Q;  4JRI A;  2MWP A;  4C92 B;  4HT9 A;  3JCM h;  2NUT B;  1QVG A;  4PLL A;  3ZBD A;  1OPL A;  4C8Q F;  1YIJ Q;  3X26 B;  2DL3 A;  1FX7 A;  3VKI A;  2D6F A;  1VQ8 A;  1BB9 A;  4EMH A;  2QQS A;  2E5K A;  3LX7 A;  1LNX A;  2DX1 A;  2LQ8 A;  3LGL A;  2QAS A;  3J7A F;  1TWB A;  4PFP A;  4M77 E;  1MUZ A;  4GLK A;  4J83 A;  1ZA2 B;  2DIG A;  2JN0 A;  4PFO A;  1IGU A;  4M7D D;  4XAX B;  4C8Q G;  1KK7 A;  3PFS A;  1OYX A;  1M2V B;  1TTH B;  5CKF A;  2LT4 A;  5GAO l;  2ENM A;  3FIF A;  4M78 E;  1RAF B;  3OYE A;  2EVR A;  4XTY A;  1MNE A;  5KH6 A;  1HJD A;  4M4Z A;  2CSQ A;  4PJO E;  5J3B A;  1PKS A;  2J05 A;  2RK1 A;  4HXJ A;  4E2F B;  4BAC A;  1NBE B;  3P8D A;  1WDX A;  1D09 B;  2DEQ A;  4E7Z A;  3M53 A;  2VAS A;  5IT9 E;  3VJP A;  2YLB A;  1UG1 A;  2COZ A;  3HRT A;  2HKN A;  4C8Q B;  2M9U A;  2M0Y A;  3TVT A;  1NLP C;  3X25 B;  4X9D A;  4BE2 A;  2VWF A;  3PNW C;  2DXU A;  5GAM h;  4JJD A;  4ME7 A;  4B6M A;  1W4S A;  1MV3 A;  3LLR A;  4V2S A;  1F1B B;  5GAN j;  2EYY A;  4FYV B;  2EQM A;  3EH1 A;  5GMK m;  1BI3 A;  1ARK A;  2MCN A;  4NS5 A;  5IN1 A;  1BCM A;  4KH1 B;  1M9S A;  1Q81 R;  3V8L A;  1ZA1 B;  5J39 A;  4A4G A;  1YI2 Q;  2JTE A;  2K3X A;  4M7D F;  2W0Z A;  2EYZ A;  3CPW P;  1VQO Q;  2RQV A;  5CKH A;  2JOY A;  4CC3 A;  4FIB A;  1Q86 C;  1ZUK A;  1VQN T;  4ATO A;  2RM4 A;  3GIB A;  3G4S Q;  1B3Q A;  1UGS B;  3ULR B;  1QVG P;  1GL5 A;  1SF9 A;  4XTX A;  2ZPB B;  5C6S A;  4C92 E;  4J7F A;  1JXO A;  4HCB A;  2F2V A;  2L3S A;  4EDU A;  2I0N A;  3OS2 A;  3ZFJ A;  4JS5 A;  3ME9 A;  2GTO A;  4ZTF A;  1PD1 A;  3NHN A;  2HL3 A;  1IGQ A;  4CC7 A;  2X4W A;  1QP2 A;  4M7D G;  1T0H A;  2JS2 A;  3V7R A;  1VQ6 A;  2WSF E;  2RI5 A;  3OYM A;  1JO8 A;  3E1S A;  3CC7 A;  4HCZ A;  4UC4 A;  2YXY A;  1U3O A;  2KI7 A;  3S3O A;  2FL7 A;  3A8O B;  4RTX A;  4Z88 A;  1KD1 U;  4O6J A;  2DRK A;  2EWN A;  2HDA A;  2E6N A;  4QQG A;  5GMK h;  2ZPH B;  2DL7 A;  4BE0 A;  2O88 A;  3CBM A;  5IH2 A;  2VC8 A;  3V8J A;  1JXM A;  1RL2 A;  2ZAE A;  4M78 A;  2CT3 A;  3CCE A;  3MPU B;  4OMM A;  3M0P A;  1X6G A;  3JCM V;  2DAQ A;  3KXT A;  2YLC A;  2D1X A;  2HSE B;  4PJO A;  1IZ6 A;  1NG2 A;  4IUT A;  4XU3 A;  1U1T A;  1EZZ B;  5GAN d;  2EYW A;  4M7D B;  2OTL A;  3G1J A;  4OGC A;  2RMO A;  1BIB A;  1QCN A;  4X1V A;  3CC2 T;  2LT1 A;  1EX4 A;  2FPF A;  1G5V A;  3CCS Q;  4PJM A;  2K9G A;  1PKT A;  3CCU A;  2D8J A;  3E9F A;  2BE7 D;  3QG1 A;  2RJE A;  4ZTJ A;  3H8Z A;  2DMO A;  2AZV A;  4C8Q E;  1XTD A;  1W70 A;  4BB7 A;  3DLL A;  3A8G B;  1G3S A;  2EKH A;  4A4H A;  4CC2 A;  5KYX B;  3OYI A;  2E41 A;  2QA4 A;  2A0F B;  2RI3 A;  1FMW A;  2KRN A;  2RO0 A;  1KC8 U;  2G3R A;  1V29 B;  1YJW T;  3EGX A;  2M16 A;  2EKO A;  1NYF A;  3UA6 A;  3S3M A;  3LH0 A;  2CP0 A;  1RAG B;  4M77 C;  2DL5 A;  4R56 A;  1FMK A;  1UTI A;  1RLP C;  1Q7Y R;  1NJI R;  2AIR B;  3A5Z B;  2RJF A;  4M78 D;  1OX9 A;  1VYU A;  4M78 C;  2GFU A;  5GMK l;  1JJ2 S;  4ZN1 A;  1OEB A;  3EGD A;  3CCE Q;  3JCM Q;  1M1G A;  1AOJ A;  4LN2 A;  5LJ3 d;  2VXF A;  3NTI A;  3RKW A;  3L2V A;  2RPN A;  4L59 A;  2CSI A;  2OAW A;  4JZ4 A;  4PJO D;  3C4S A;  4FCY A;  4PJO C;  3T9N A;  3M56 A;  1LVK A;  1M90 U;  2K5I A;  3I55 A;  4C92 A;  3VRY A;  1JRI A;  2LQN A;  2NUT A;  2RHZ A;  2OTL Q;  2DNU A;  2F1L A;  3TQ7 P;  3CME T;  2FPD A;  4XTZ A;  1SHG A;  4ZGE B;  2E12 A;  2VV5 A;  1X27 A;  3TU4 K;  1J3T A;  3UT1 A;  2LCS A;  3CCU Q;  1YHQ A;  1I8F A;  2L2P A;  2KRM A;  1G3Y A;  2HBP A;  3CCQ T;  3JB9 D;  1VIE A;  4PFZ A;  1BI0 A;  3JCM P;  4IUR A;  4ZN3 A;  2QA4 Q;  4BI8 B;  1QVF A;  1M2V A;  2LMJ A;  2LZ6 B;  3CCM A;  4MZT A;  1VOM A;  3VUB A;  1PHT A;  3VS6 A;  4KGZ B;  1WA7 A;  1TU0 B;  4BI4 A;  3CXC S;  3L42 A;  1VQ5 A;  3UWN A;  2YRD A;  4IUP A;  2RHI A;  2XU8 A;  2QEX A;  2FVU A;  2RJD A;  4J5Y A;  3HSB A;  3JAM E;  4ZNX A;  5GAM j;  3I56 T;  4BY6 C;  4FYX B;  4M7D E;  2GGR A;  3G71 T;  5J26 A;  3JCM d;  4FYY B;  1GCQ A;  1PD0 A;  2L3Q A;  5FU7 B;  4O5V A;  1SSF A;  5A0D A;  5GAO q;  3EH2 A;  3L1A A;  2KSS A;  1YIJ T;  4LDU A;  2R5M A;  3GF5 A;  1CSK A;  1M1K C;  4C92 D;  3RBB B;  1D1A A;  2C0I A;  4Y92 A;  3FJP A;  4C92 C;  3OA6 A;  2O2O A;  3QUI A;  1WLP B;  3I55 Q;  4DOW A;  4F17 A;  3OW2 A;  3DKM A;  2DVE A;  4JLI A;  1SKU B;  1PG5 B;  4FSX A;  3PIP A;  3PVQ A;  3M55 A;  2CP3 A;  2YRV A;  4M78 G;  1VIF A;  4JRP A;  1KG1 A;  1NPR A;  2X51 A;  1YHQ Q;  3M0R A;  2HQE A;  2A3L A;  3QWY A;  1K4U S;  3QHS A;  4PJO G;  2OTJ T;  1A0N B;  2EJ9 A;  4FM4 B;  2CP7 A;  2XID A;  1WXU A;  2JUF A;  1WPY A;  3HHT B;  1XNI A;  4LUE A;  3CC4 A;  3BE3 A;  2M51 A;  3X24 B;  2KRS A;  3FDR A;  3EFR A;  3M0T A;  4N4I A;  4DBH A;  3CCM Q;  1VQP A;  1R77 A;  2YUO A;  1NEB A;  2YSQ A;  1Q82 U;  1CKA A;  1KSW A;  3M0U A;  1JQQ A;  2BKD N;  1VQ5 Q;  2LX7 A;  1KIK A;  4P5N A;  1EFN A;  3CCR A;  1NYG A;  2E10 A;  2OJ2 A;  3MP1 A;  4PJL A;  2F5K A;  4JRK A;  5GAN 8;  1QMC A;  4QKU A;  1VQ7 A;  1GCQ C;  5KYW B;  4XQ3 A;  3JB9 G;  1IB8 A;  4E7L A;  2ZPI B;  3FEO A;  4C5H A;  5AT1 B;  2ZGW A;  5GAM d;  2X4J A;  4C8Q C;  1QW1 A;  3A98 A;  3MO8 A; 
#chains in the Genus database with same CATH homology
 3OYE A;  4KT0 E;  4XTV A;  1VQK T;  3SWN B;  2XK0 A;  4XTY A;  2KQW A;  3GOX A;  3VV0 A;  5KH6 A;  4OB0 B;  5GAN 2;  1WNL A;  3MHX A;  3PTA A;  4PJO E;  2JVV A;  4N0A C;  3OQ5 A;  4ZGJ B;  4E7J A;  5J3B A;  1YCY A;  3A8L B;  1Y71 A;  2QXF A;  2RK1 A;  4HA8 A;  3MEW A;  1YIT T;  2LQK A;  2K5L A;  2L5Q A;  5FRO A;  4BAC A;  4N4G A;  1YHQ T;  1PSE A;  5CO7 A;  3CCL A;  3P8D A;  3A8H B;  2K57 A;  2DEQ A;  1FXX A;  4Y28 E;  1BYM A;  3JB9 H;  3QBY A;  3M53 A;  1VQ4 T;  1G3T A;  5LJ5 f;  1KD1 C;  2XI9 A;  3X28 B;  1XOV A;  4XU1 A;  1N9R A;  2QQB A;  1K8A C;  5IT9 E;  1YI2 T;  4OMF B;  3VJP A;  3CCV T;  2YLB A;  1W2B S;  1VQO T;  1KQ2 A;  1YJW A;  3HRT A;  4M7A D;  2PUK B;  4LDY A;  4C8Q B;  2M9U A;  3JCM g;  2MF2 A;  4PL6 A;  4C92 G;  3OYN A;  3G4S T;  3OSV A;  3JCM W;  1KHC A;  3X25 B;  4X9D A;  3ZEH A;  2X35 A;  3RKY A;  3PT9 A;  1VQ9 T;  4RG8 A;  1UGQ B;  2RJC A;  3PNW C;  4OP0 A;  4QVD A;  4BE2 A;  1Q81 C;  2YHT A;  4QQ6 A;  3CCJ A;  4ELY C;  2DXU A;  4A4K A;  2LCC A;  3KBG A;  2BIV A;  2MMP A;  5HK0 A;  5GAM h;  5GAO p;  1UGR B;  2D9T A;  4N4H A;  2QEX T;  1VQN A;  4ME7 A;  3LW5 E;  2OAU A;  3P8B B;  1W4S A;  2XDP A;  3LLR A;  2V8K A;  2EIF A;  4Y91 A;  4V2S A;  5GAN j;  3M9Q A;  3DB3 A;  1LJO A;  5FLX E;  4JUV A;  3OYK A;  2EQM A;  2WAC A;  2LDM A;  3A8M B;  1KHI A;  3OY9 A;  4BE1 A;  5HY6 A;  2HQX A;  3GNG A;  5GMK m;  1BI3 A;  3Q1J A;  4A54 A;  2DTH A;  2KVQ G;  2M1H A;  3HFO A;  1BIA A;  4IUQ A;  4EMG A;  5KCH A;  2DPP B;  4NS5 A;  5IN1 A;  3VUZ A;  2ZCF B;  2RK2 A;  3DLM A;  1M9S A;  2VGN A;  2PUO B;  3QPH A;  3LGF A;  1U8R A;  3JCM f;  4MDW A;  4M77 D;  4OF1 A;  3V8L A;  5J39 A;  5GMK i;  2LNV A;  4PNO A;  4A4G A;  4RG2 A;  5GAN 6;  1OZ3 A;  1WJS A;  1OI1 A;  4C0G A;  1VQL A;  2K3X A;  3CCJ T;  4M7A A;  4M7D F;  5LL6 S;  2O4X B;  3GP8 A;  3C94 A;  5CKH A;  2JOY A;  1ZHI A;  2EQK A;  2QTX A;  3OS1 A;  5D6Y A;  4FIB A;  1Q86 C;  4ATO A;  1VQN T;  2KMT A;  3CEY A;  1VUB A;  2RM4 A;  3NTH A;  3GIB A;  2E5Q A;  2PVD B;  4FT4 A;  2CZ1 B;  3URG A;  5C0M A;  3HPW A;  1KC8 C;  1UGS B;  1N8R U;  1M1F A;  1XQH A;  2DXC A;  2E70 A;  4QW2 A;  4XTX A;  3RMQ A;  4LD9 K;  2ZPB B;  4F7U F;  5C6S A;  2DZC A;  5FU6 C;  3G7Z A;  4ELZ C;  4C92 E;  4J7F A;  4HCB A;  2CYZ B;  1YBY A;  3CPF A;  1X01 A;  3V7C A;  3HP9 A;  3HRS A;  4EDU A;  3OS2 A;  5KE3 A;  3ZFJ A;  3RES A;  3CCQ A;  5GMK j;  4JS5 A;  2VUB A;  3ME9 A;  4C0Z A;  1WJR A;  3QYH B;  1X6O A;  4XTU A;  4ZTF A;  1N6A A;  2EJG A;  4ZGD B;  4HT8 A;  5CVI A;  3VYG A;  3JRZ A;  2DTI A;  2DD4 A;  4A4E A;  2MAM A;  2X4W A;  1QP2 A;  4M7D G;  3V7R A;  3FLG A;  1M5Q 1;  3CCS T;  1VQ6 A;  3JCM J;  1N27 A;  1P92 A;  2WSF E;  2RI5 A;  5GAO m;  3OYM A;  5GAM e;  2L3R A;  2V8J A;  5CKD A;  3J80 E;  5GAN 7;  3E1S A;  4M7D C;  3CC7 A;  2DTO A;  1KQ1 A;  1X75 C;  4HCZ A;  4UC4 A;  3S3O A;  1MGQ A;  2FL7 A;  3A8O B;  1UGP B;  3AHU A;  4M7A F;  1VQP T;  2FB7 A;  4O6J A;  1KD1 U;  2EWN A;  3CC2 A;  4MML A;  2E6N A;  2EQU A;  4QQG A;  4F7U G;  5GMK h;  2ZPH B;  1K8A U;  2X4Y A;  5GAM g;  4BE0 A;  3CBM A;  1JBM A;  2VC8 A;  1NZ9 A;  3V8J A;  2P0Q A;  3OBY A;  5DLQ E;  3OYH A;  1VQ8 T;  1RL2 A;  4GY5 A;  2V8I A;  2XKO C;  4E47 A;  1M90 C;  2RD1 A;  4M75 A;  4M78 A;  5FU6 B;  3BDU A;  1I81 A;  4RCB A;  3CCE A;  2C06 A;  2E64 A;  1M1K U;  3QXE B;  4BD3 A;  3CCR T;  2ZPE B;  3JCM V;  2DAQ A;  4FL6 A;  2PU9 B;  1Q82 C;  3QYG B;  3GLX A;  4LDV A;  3KXT A;  3FB9 A;  1Q81 U;  2DKG A;  3V7S A;  4RKU E;  5A2Q E;  2YLC A;  4EMK A;  1VQ7 T;  3CD6 T;  1VQM A;  2EQJ A;  4HKE A;  1YIJ A;  2LVM A;  4PJO A;  1IZ6 A;  3LYI A;  4IUT A;  2E1H A;  3S6W A;  2R5A A;  1HXD A;  5GAN e;  4XU3 A;  2RHY A;  5LJ3 h;  3L2Z A;  1U1T A;  5GAN d;  5CAI A;  2LRQ A;  1Y7X A;  2R58 A;  4M7D B;  4M7A G;  2OTL A;  1HK9 A;  2ZPF B;  4OGC A;  5LJ5 j;  4OB3 B;  3SWN A;  3E9G A;  3GNF B;  4JLG A;  4A4F A;  1K73 C;  1BIB A;  2NLU A;  1QVP A;  2IVW A;  3HKS A;  5EG2 A;  3CC2 T;  2LT1 A;  4M7A C;  3JCM X;  2DZ9 A;  4M77 F;  5GAM f;  3S3N A;  3HRU A;  4XU2 A;  3L2U A;  1G5V A;  1Y07 A;  3OW2 S;  2F69 A;  3CCU A;  3CCE T;  1D3B B;  3BFM A;  3E9F A;  4F7U B;  2P4T A;  3QG1 A;  2RJE A;  4ZTJ A;  4X9C A;  2VYT A;  2EAY A;  3H8Z A;  5LJ3 j;  2DIQ A;  4M75 F;  4M78 F;  4C8Q E;  1OZ2 A;  2QQA A;  1Q7Y C;  1XTD A;  2DXB A;  4QQD A;  4BB7 A;  3OYL A;  3LWI A;  3CCL T;  3DLL A;  3A8G B;  5D6X A;  1NJI C;  1G3S A;  1VQM T;  3MEA A;  3L2W A;  5GAN 5;  3L2R A;  1Q86 U;  4A4H A;  3UDC A;  3OYI A;  2E41 A;  2QA4 A;  2RI3 A;  5A0L A;  1W2B A;  1M8V A;  2OTJ A;  2RO0 A;  4PLI A;  4VUB A;  2RHU A;  4LDX A;  1QP3 A;  2B8A A;  4C8Q A;  3OYJ A;  2G3R A;  3M4Y A;  3PMT A;  1KC8 U;  4EPC A;  4IKF A;  4PJO F;  1JB0 E;  2DD5 A;  1V29 B;  2RHX A;  3CPW S;  3OYD A;  2OTL T;  3M58 A;  3OMC A;  1YJW T;  2M16 A;  1FWZ A;  2EKO A;  1H64 1;  3F70 A;  4M77 G;  5GMK e;  3MO8 A;  4KUD K;  2QDY B;  3QJ6 A;  4M7A B;  3S3M A;  3LH0 A;  2XHC A;  1QVG S;  4N0A A;  3OMG A;  4M77 C;  4R56 A;  3QDR B;  5GAO r;  3VYH B;  2JTM A;  3CCU T;  1O9S A;  3RER A;  2GCX A;  3C12 A;  5GAN h;  1ZQ1 A;  4NL3 A;  4FT2 A;  3CME A;  5FRN A;  3JB9 I;  3A5Z B;  2RJF A;  4RCC A;  5I21 A;  4M75 D;  2WSE E;  4II1 A;  1N9S A;  4M78 D;  2PVO B;  4BY6 B;  3HL8 A;  4C0D C;  2PQW A;  5DLO A;  3UPU A;  4M75 C;  3M54 A;  3EAE A;  4M78 C;  2GFU A;  3V8K A;  5GMK l;  1JJ2 S;  2RB6 A;  4J6W A;  4ZN1 A;  3QZ9 B;  4B9X A;  5LJ3 e;  3OYY A;  5GAO n;  3JCM Q;  1M1G A;  4BDY A;  2DK3 A;  4BDZ A;  5LJ3 d;  2VXF A;  1NPP A;  3NTI A;  3RKW A;  3QKJ A;  2EJF A;  3OBW A;  3L2V A;  4L59 A;  4C5I A;  4PJO D;  3C4S A;  2LX9 A;  3JB9 F;  3T9N A;  4PJO C;  3SDZ A;  1YJN A;  2CZ0 B;  3M56 A;  3BW1 A;  4CI0 C;  1M90 U;  2K5I A;  2RH2 A;  1PSF A;  4C5G A;  3I55 A;  5CKB A;  4C92 A;  5CCA A;  4D6W A;  2QI2 A;  1JRI A;  3SD4 A;  2M0O A;  1K9M C;  3PIO A;  4XK8 E;  1BI1 A;  1M4Z A;  4DQ2 A;  4M77 B;  3RMS A;  1VQL T;  1VQK A;  4E7K A;  2RHZ A;  1DJ7 B;  2CZ6 B;  3E19 A;  1QVF S;  4J7I A;  2CGH A;  1TH7 A;  1Y96 A;  3CME T;  5GAN 3;  5GAN 4;  4XTZ A;  2RA2 A;  4ZGE B;  1WQ7 A;  4MZM A;  2E12 A;  2HD0 A;  2VV5 A;  2P0K A;  1I4K 1;  3WVE B;  5DM7 R;  3TU4 K;  4C0D B;  2E65 A;  2VXE A;  3UT1 A;  2XG8 D;  2XDB A;  1YIT A;  4M75 B;  2VGM A;  3PGG A;  4M78 B;  5LJ5 d;  2MI6 A;  2KDS A;  2A7Y A;  4Q5W A;  4Z02 A;  1YHQ A;  2K5F A;  3BDL A;  5I2S A;  4A53 A;  1K73 U;  1I8F A;  2D0Q B;  1U1S A;  2EFI A;  3WVD B;  4JJN K;  2E6Z A;  3I56 A;  1G3Y A;  2HBP A;  1VQ4 A;  2Y4Y A;  3TEE A;  2JTF A;  3CCQ T;  3G71 A;  2JZ2 A;  3JB9 D;  3FRN A;  1VIE A;  1YI2 A;  4PJO B;  2DO3 A;  2HNI A;  5FU7 C;  3CCV A;  3BY7 A;  1S72 A;  4C8Q D;  1BI0 A;  1NE8 A;  4XU0 A;  3O8V A;  4IUR A;  3CMA A;  3JCM P;  1VQO A;  2AHJ B;  3SFM A;  4ZN3 A;  1B34 A;  4BI8 B;  2Y90 A;  2BUD A;  1QVF A;  2JNG A;  3TRE A;  4TVR A;  3QZ5 B;  3G4S A;  1EIF A;  2LTO A;  3CCM A;  4MZT A;  1VQ6 T;  3VUB A;  2CS7 A;  3OYA A;  3KUF A;  4C92 F;  2LC4 A;  3OB9 A;  1Q7Y U;  4OB1 B;  2DXT A;  1VQ9 A;  2K4Y A;  3CC7 T;  5KE2 A;  1UEB A;  1YJ9 A;  1NJI U;  4LD6 A;  2X4X A;  4BI4 A;  3CXC S;  2L8D A;  3L42 A;  4DOV A;  2WSC E;  1VQ5 A;  3UWN A;  4MMK A;  4IUP A;  4C0F A;  4QVC A;  5CIU A;  2RHI A;  2XU8 A;  5GAN g;  2QEX A;  4C5E A;  3RKX A;  4HCC A;  3C95 A;  2XIC A;  2FVU A;  3JB9 J;  4JRQ A;  2RJD A;  4J5Y A;  3HSB A;  2GQV A;  3JAM E;  2CKK A;  2GF7 A;  5M9O A;  1R8O B;  5GAM j;  3J81 E;  2XDD A;  4BY6 C;  3I56 T;  4M7D E;  3QO3 A;  4QVZ A;  3SB2 A;  3JCM e;  4RMO A;  3G71 T;  1LOJ A;  2Y4X A;  5J26 A;  3JCM d;  4KBM B;  2GFA A;  5CQY A;  1S72 T;  2QQR A;  3QII A;  1GXI E;  3CMA T;  5FU7 B;  4O5V A;  1SSF A;  5A0D A;  5GAO q;  2H3J A;  4NOY A;  5L8R E;  1BKB A;  2KSS A;  1WJQ A;  3L1A A;  5LJ5 h;  2XD0 A;  1YIJ T;  3CBP A;  5CR2 A;  4LDU A;  2QQ9 A;  2R5M A;  5CKE A;  3GF5 A;  5IAY A;  4M7D A;  4OGE A;  4NL2 A;  4XTW A;  5HKC A;  1BI2 A;  4L6V 5;  4WF2 A;  2P0P A;  3TCJ A;  3CCM T;  1M1K C;  4CRI A;  2ZZD A;  3MEV A;  4OB2 B;  4C92 D;  4F7U E;  2LCL A;  3CXC A;  3G6E A;  3GPL A;  3FJP A;  1YJ9 T;  4C92 C;  3OA6 A;  3QUI A;  3PMI A;  3M59 A;  4KUI A;  1IRE B;  4PKC C;  5I2M A;  1AHJ B;  1VQ5 T;  1UB4 A;  1MHN A;  4IUV A;  4MZP A;  4DOW A;  5GAN f;  1D3B A;  4F7U A;  3OW2 A;  3DKM A;  2PVG B;  3OSS C;  2DVE A;  2KK4 A;  4JLI A;  3HFN A;  4B9W A;  3EFS A;  2FHD A;  3RUX A;  3OYF A;  3OS5 A;  2CZ7 B;  4X34 A;  4FSX A;  4BI3 A;  3N5B B;  5KCO A;  3M55 A;  3PIP A;  3LWH A;  3JCM c;  2HAX A;  3WXM B;  2YRV A;  4M75 G;  3JSC A;  2KAF A;  2KY9 A;  3DB4 A;  3H6Z A;  3R6O A;  4M78 G;  1VIF A;  3RIR A;  4YTL A;  3FC3 A;  4JRP A;  1K9M U;  1KG1 A;  4DA4 A;  1NPR A;  3NTK A;  3JCM b;  1G3W A;  3OYG A;  5A0G A;  2O01 E;  3M5A A;  4J8O A;  4M7A E;  3QSU A;  4R55 A;  2HQE A;  3OYC A;  2A3L A;  2IG0 A;  4LDW A;  1O75 A;  2QA4 T;  4E7I A;  3CPW A;  3G6E T;  4E7H A;  3QHS A;  5AYF A;  4PJO G;  3OYB A;  2OTJ T;  2EJ9 A;  4FM4 B;  2XID A;  3QJY A;  2I2L A;  4FU6 A;  2JUF A;  3CBO A;  4IUU A;  3CCS A;  3MCA B;  1KQS S;  4JRI A;  2MWP A;  3ASK A;  4C92 B;  4EMK C;  4MDX A;  4HT9 A;  3JCM h;  2MWO A;  3P8H A;  1WPY A;  3HHT B;  1QVG A;  4PLL A;  1XNI A;  3CC4 A;  5LJ3 g;  2L89 A;  3ZBD A;  3VU3 C;  4C8Q F;  3X24 B;  1H3Z A;  3FDR A;  4L5G A;  3MP6 A;  3M4G A;  3EFR A;  2O4X A;  1RI0 A;  4N4I A;  3X26 B;  1VQP A;  3INZ A;  5CK9 A;  3MP8 A;  1Y96 B;  3SWN C;  1FX7 A;  4J6Y A;  3ER0 A;  3VKI A;  1Q82 U;  2K3Y A;  2D6F A;  1VQ8 A;  1WGS A;  2BKD N;  4BUG A;  4EMH A;  1JJ2 A;  5FRM A;  2QQS A;  4P5N A;  5DY9 A;  5CQX A;  3CCR A;  3MP1 A;  2E10 A;  4OVA A;  3LX7 A;  5LJ5 e;  4JS4 A;  1LNX A;  2EYQ A;  2LQ8 A;  3LGL A;  2FYK A;  2F5K A;  3NFC A;  3J7A F;  4JRK A;  3M57 A;  5GAN 8;  4KUL A;  4M77 E;  1WQW A;  1KQS A;  2DJZ A;  3X20 B;  1VQ7 A;  3CD6 A;  2ZPG B;  1I5L A;  4GLK A;  4J83 A;  4XQ3 A;  2JN0 A;  2DIG A;  3MET A;  3JB9 G;  3L2Q A;  5LJ5 g;  4M7D D;  5D6W A;  2R57 A;  4E7L A;  2ZPI B;  3FEO A;  4XAX B;  4C5H A;  4J6X A;  5HK3 A;  1B34 B;  4C8Q G;  1YJN T;  2K2V A;  4EMK B;  3OS0 A;  1N8R C;  2ZGW A;  5GAM d;  3CC4 T;  3PFS A;  1OYX A;  2X4J A;  4M77 A;  5LJ3 f;  1ZBX A;  3I55 T;  5CKF A;  5GAO l;  2LT4 A;  4M75 E;  3FIF A;  4M78 E;  4C8Q C;  4JDS A;  1QW1 A;  2RI2 A;  2F5T X;  3MEU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...