5LJ5h

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5h00
4F7UB 5GMKm 5GAMd 1I8FA 1D3BB 1HXDA 3V7RA 3JB9J 2E64A 2VXFA 4M75D 4X9CA 4C92D 4F7UG 4QVCA 5I21A 2RD1A 4XTYA 5GAN7 5GAN5 5LJ3e 5GAOl 2EJFA 4NOYA 5GAN3 3RUXA 3RKXA 4EMHA 2RA2A 3V8KA 3JCMX 3JCMQ 4C8QA 4M7AF 4M7AA 4PJOC 4PJOD 3JCMd 2EWNA 4XQ3A 3VU3C 1M5Q1 2CGHA 3JB9F 4XU1A 4EMKB 4M78F 4XTZA 1H641 4M77E 5GAOr 3L2ZA 1HK9A 2DZ9A 4C92F 2FYKA 5LJ3g 4M75A 5GANd 5GAOp 4M7DD 5GAN2 2RM4A 4M7DC 3BW1A 4M78E 4C92G 4M7DG 4M7DE 4PJOF 4QVDA 4EMGA 5LJ3f 3L1AA 3BDUA 2EJ9A 4C92B 4M77A 1Y96B 5LJ3d 4NL2A 1BIBA 2E65A 5LJ5g 5GAOq 1Y96A 4RCCA 3AHUA 3QO3A 1TH7A 2DZCA 4J6WA 3FB9A 1WPYA 5GANf 5GANh 4JUVA 4RCBA 1I81A 5GMKe 3JB9H 1U1SA 5LJ5f 4A53A 3JCMg 3JCMf 3HSBA 3FJPA 2Y90A 1U1TA 3QUIA 5GAMh 4M77D 2JN0A 5GAMg 2VC8A 3RIRA 3SWNA 4XTWA 1N9SA 5LJ3h 3RESA 3V7SA 5GANg 3INZA 4X9DA 1I5LA 4Y91A 3JCMJ 4M7AE 2DJZA 3JCMW 1N9RA 2E1HA 4J5YA 1M8VA 4MMKA 2DXTA 5GMKi 5GAMf 4M77C 1B34A 4M78D 4N0AC 4J6YA 4PNOA 3SWNC 1X01A 1WQ7A 1I4K1 5GMKl 5GAMe 5LJ5d 5GAN6 5GAOn 3QSUA 5GMKj 4M7AB 1BIAA 4NL3A 1JRIA 4M77G 4DQ2A 3PGGA 4F7UA 4MMLA 4JRKA 4C8QC 5GAN8 4M77B 2DEQA 4XTVA 3EFRA 4C8QF 2DVEA 3HFNA 4HT9A 3RERA 2DKGA 2RB6A 3M4GA 5LJ5e 4V2SA 2K57A 4M78C 2YHTA 1B34B 1YCYA 4M75C 3EFSA 5LJ5h 4XTXA 5GAOm 2YLCA 4XU2A 1KQ1A 4M78B 3SB2A 3JB9D 4M75F 5LJ5j 4M75G 4HA8A 4EMKA 2FB7A 4A54A 4EMKC 3JCMe 1LJOA 3JCMb 4M7AD 4PJOA 4N0AA 1WNLA 1WQWA 5GANj 3QHSA 5DY9A 3V8JA 3JCMh 3V7CA 1MGQA 4C8QB 5GANe 3JCMP 1KQ2A 4PJOG 4C8QE 2EJGA 2VXEA 2DTIA 3RKWA 4XTUA 4C8QG 4M7DF 4PJOE 2YLBA 5GAMj 2I2LA 2DTHA 4C92C 1D3BA 5GAN4 3SWNB 2EAYA 2HNIA 2ZGWA 4M78G 2QTXA 1LOJA 4M77F 3JCMc 4C92E 2E41A 3JB9G 4M75B 4M7DB 4XU3A 3RKYA 1JBMA 4M75E 4F7UE 5CAIA 3GIBA 4M7AG 3HFOA 2DXUA 4JLIA 4M78A 4OP0A 4HT8A 4M7DA 4C92A 4J6XA 3BY7A 4PJOB 3JCMV 3FIFA 3JB9I 4C8QD 5GMKh 1LNXA 2E10A 4F7UF 4M7AC 2DTOA 4XU0A 4WF2A 4JRIA 5LJ3j 3BFMA 3V8LA
chains in the Genus database with same CATH superfamily
1BU1A 1S1NA 2HZYA 1ABOA 1KQSP 4M7DD 2MPXC 2EW3A 5I21A 4XTYA 3UWNA 1S72A 2E4HA 4F14A 3P8HA 2DERA 5I2MA 3CCEA 2LQNA 1VQNT 1W1FA 2QK0A 1X6BA 4EMKB 4F17A 2KGTA 2EKOA 5A0LA 3I5RA 3EHQA 4M78E 2DEUA 3CCRA 1FMVA 3VUZA 1ZUUA 5ECAA 4NL2A 2E3IA 5AYFA 3QKJA 1PRLC 2SEMA 4PJJA 2DJQA 4BACA 3MHXA 1ZBXA 2FRWA 1WLPB 3AT1B 1YHQA 2JZ2A 1PD1A 2VV5A 4FYVB 3V7SA 4PLLA 2BZ8A 2L3RA 1BCOA 4ZGEB 4M77G 3CCMT 4MMLA 4R0KA 3OYAA 4IURA 1Q86R 1NPPA 4E47A 1M2VA 3FC3A 2F1LA 2RHUA 4M75F 3CCSQ 2LCLA 2DL3A 4BB7A 4OMPA 1HYOA 1KQ2A 2MWPA 1WHJA 2OTLQ 3X26B 3QWXX 1PKTA 3UPUA 3R6OA 2QGFB 4LDWA 3JB9G 3FRNA 4JZ3A 5KE3A 1BBZA 2LQWA 1M1KR 3CC4Q 3QBYA 4E7ZA 2DIGA 3BY7A 2IVWA 4DA4A 3QDFA 5A0DA 3VV0A 4Z88A 2VWFA 1M1GA 4BI4A 3OBWA 4PJMA 3ASKA 1AT1B 1N8RU 2BZXA 2DO3A 2RK1A 4KRTA 2O31A 4C5GA 3MCAB 2CGHA 2MAMA 1H641 4JLGA 3JAME 1K9MR 3EGUA 2NWMA 3CCLT 2K3BA 2GBQA 4PJOF 4EMGA 4A4KA 2KT1A 3PNWC 3L42A 1Y96B 2LQ8A 2L5QA 5GAOq 2ESWA 5GANf 2V8IA 4BE1A 4A53A 4J9BA 1YWOA 5GAMh 1XTDA 2VC8A 1HD3A 1MUZA 3INZA 5FU6C 2VUBA 1AWXA 2LX9A 3L2RA 1D1CA 1WHHA 2LT1A 3SHWA 2K6DA 1V76A 1GFCA 4CRIA 5GAOn 1UGSB 3I56A 2QXFA 3CCVT 1Y07A 3NHNA 5KCHA 3OBYA 1VQMQ 3HFNA 3CCQA 3M54A 5IXFA 2JUFA 2FZKB 2K57A 3URGA 2EYWA 5LJ5h 3OYBA 2YLCA 1AWJA 1WJQA 2FZGB 2RJCA 3D7SB 5FW9A 1Q7YU 4LUDA 3HL8A 1K8AR 3PFSA 4PJOA 2KBTA 3P8BB 1OZ3A 2OAUA 3VYGA 2OTJA 3A8GB 2HDAA 1ZA2B 1WZOA 2KMTA 4Q5WA 4M7DF 1VQKA 3G4ST 1VQPQ 2A7YA 4F7UE 1KFZA 2D9TA 3M57A 1OEBA 4L6V5 4JDSA 3A8HB 2O4XA 3JB9I 2NLUA 3GOXA 2FPDA 1SHFA 1YHQT 3RKXA 3OYHA 1TS9A 3DLMA 2BKDN 2KEAA 1OX8A 3CBMA 4XQ3A 3VU3C 1C1AA 2VKNA 1GL5A 4OVAA 1HK9A 1RAGB 2L89A 3LH5A 2KE9A 4E2FB 4E7HA 4ZTJA 4GBQA 4HCCA 2V8JA 3PVLA 3QJ6A 4BE0A 3PMTA 1AD5A 2EYQA 1E6GA 4X34A 4J6WA 2CP0A 1WPYA 2HSPA 1MMAA 3JB9H 3QPHA 3OYDA 2LVMA 2YRDA 1G8XA 4R55A 1NG2A 2BIVA 1ZUKA 1X43A 2B86A 4X9DA 2CUBA 2XI9A 1N9RA 2DXTA 3MO8A 2H8HA 3NFCA 4LUEA 3X20B 3SWNC 2RNAA 1X01A 2CP2A 2JOYA 2RQRA 3EGDA 4RG8A 3NTKA 1RLPC 2F2VA 1VQLT 4NL3A 2XMFA 1Q81C 1VUBA 1WHGA 3UATA 2CKKA 3MEWA 2RQTA 1R0CB 3HPWA 2RH2A 1D1BA 5FRNA 1VQ8A 2MWOA 2JMAA 2KNBB 3JSCA 2CT3A 5IHNA 1W2BA 2HMAA 4XK8E 1N8RR 2DK3A 2FB7A 1K4US 2K7AA 3OYEA 3CCST 4OMFB 1G3SA 5KYWA 1YIJT 3JCMh 5GANe 4E7SA 1QCOA 2F2WA 4CI0C 2COZA 1K0SA 1RACB 5KYUB 1UG1A 4PL6A 1JB0E 1YJWA 1G3YA 5HY6A 4FIBA 1HJDA 1GBQA 2JVVA 1M90U 2XKOC 3VRYA 1Y0MA 1YI2Q 3LGLA 3QZ5B 3CPWS 2FPEA 4E7IA 1HXDA 1KSWA 2VXFA 5LL6S 2COWA 1PWTA 4D8DA 1I07A 1FWZA 2EQJA 3VS3A 2FHDA 3REAB 3S3MA 4PJOC 3GLXA 2OTJT 1NPRA 1RLQC 1K76A 1F1BB 3MJXA 3H0HA 5LJ3g 2DZ9A 2WSEE 1M90C 3EG9B 1VQNQ 4J9FA 5CKBA 3G4SA 4M7DG 2K5FA 4UC4A 1YITA 1B07A 1X69A 1BIBA 4FM4B 3TU4K 1Y96A 3A8OB 4RCCA 2DZCA 1PD0A 1I81A 4KGXB 1VQPA 2JNGA 3JCMg 2XIDA 1MMGA 3CCET 2QAZA 2XU8A 4HVUA 3OA6A 1W70A 1D1AA 4HXJA 2J06A 4XAXB 2M0OA 4LD9K 5J39A 5GMKj 4M7AB 3FDRA 2R57A 3CPWA 2QQAA 4PJNA 4BDYA 4OB3B 3RERA 3ZFJA 2EQMA 2ZPEB 3OY9A 4XU2A 2KSSA 3A98A 2DYBA 3JB9D 1IRXA 1BKBA 2ENMA 4EMKA 2RQUA 4M7AD 4J83A 2HQHA 3QHSA 2CDTA 2EVRA 4PJOG 4C8QE 1N6AA 1KC8U 2F69A 2X3XD 4JJNK 4C92E 3QXEB 1B7TA 3NTIA 3JCMc 2OJ2A 2E70A 4IUQA 3H9NA 1IGUA 2HBWA 4MDXA 3MP6A 2W0ZA 3VUBA 3ULRB 1VQOQ 2G3RA 3EGXA 4RTYA 3I55A 3SEMA 2D6FA 3PVQA 3BFMA 1TUCA 5D7UA 3JRZA 3MEAA 3HTRA 5M9OA 1PG5B 4WCIA 1X75C 3JCMQ 2PUKB 2QQRA 4QVZA 2RHYA 4JJCA 1CKAA 2CP6A 1SHGA 3JB9F 1AOJA 4QQ6A 1B3QA 3WXMB 2ZPHB 5GAOr 5GAOp 1VQLA 1EFNA 1OYXA 2FPFA 5LJ3f 5KYXA 3G6ET 1NJIU 4ORZA 3HKSA 1GFDA 2KYBA 3H6ZA 2RPNA 2HAXA 5GANh 3FB9A 1YIJQ 2OTJQ 3JCMf 2GQIA 2F5TX 1IZ6A 5GAMg 2L3SA 2IIMA 2V8KA 1NEBA 2YXYA 1NJIC 2C0TA 5KYUA 2MCNA 2WSCE 3I56T 5IT9E 2KROA 5L8RE 4JJBA 1RAHB 1BIAA 2KK4A 2D0NA 2P0KA 4J9DA 3OS0A 2HEQA 1GXIE 3LH0A 1U06A 1ZLMA 2ROLA 5C0MA 4PFZA 2LJ3A 4RUGA 1T0HA 4GLMA 3M9QA 1ZSZB 2CZ0B 5LJ5e 2NUPB 4MDWA 2DE0X 1WYXA 4B9XA 2X4WA 9ATCB 3THKA 2KI7A 2ZPBB 4J9EA 3UA7A 1WNLA 3CCVQ 3M0QA 2DL5A 2K9GA 3CC2T 4C8QG 4PJOE 3OB9A 3CMEQ 4KT0E 2LNHB 4QW2A 4M75E 1YJ9A 2KAFA 4JLIA 4KUIA 2QQBA 4OP0A 1YCSB 1TG0A 1UGQB 2HQEA 2RI2A 4IKFA 2R58A 1PM3A 4EPCA 3ER0A 4OGEA 1MNDA 2CH4A 2OAWA 1VQPT 5GAMd 5CVIA 4OB0B 3N5BB 2HL5C 4F7UG 1YI2T 3IQLA 2PTKA 3LLRA 1OX9A 3CCUQ 2EWNA 2XG8D 1G3WA 1W2BP 5J26A 1M2OA 1WXUA 3M0UA 3FEOA 3EG3A 2NYSA 4C92B 4MZTA 3E9FA 4AFSC 4FCYA 2B8AA 1MV3A 4IIMA 4B6MA 2GTOA 1QKWA 2KDSA 3VKIA 2JN0A 4ZGDB 4BI3A 2HCKA 2MF2A 4O5VA 2PUOB 3CPFA 2E1HA 3CCJA 2AKLA 3DLLA 2ZZDA 3GPLA 3M58A 4KGZB 3CC7T 1QVGS 5HCKA 4PNOA 1WQ7A 2JTEA 1RL2A 3QSUA 3H0IA 2M9UA 1Q86C 4JPBW 5GAN8 1WHLA 4CC4B 1PNJA 1UJ0A 2K2MA 2D1XA 2YHTA 2BE7D 2L2PA 3G6EQ 4C0DB 2IG0A 1YJNT 1WXTA 2VASA 1W2BS 1VIFA 5FWCA 4LE9A 4RG2A 2EPDA 3EFOB 2DTIA 4AFQC 2RQVA 2YLBA 1FXXA 1I0CA 2EKHA 4ZN3A 3SWNB 4M78G 2YSQA 1NBEB 1LOJA 1LVKA 2QTVA 2E41A 1UB4A 2RI3A 1VQ7A 1WA7A 3RKYA 2EGCA 2LX7A 3OS2A 1Q82C 1W6XA 1MMNA 2E10A 2JS0A 1AZGB 1Q81U 2M1HA 2DF6A 2DYIA 4HVWA 3Q1JA 3VJPA 4RTVA 1TOVA 1AHJB 3M5AA 3CMET 2CREA 2DXBA 4K11A 1N27A 1ZA1B 1FX7A 2RA2A 3VS2A 4ATOA 4EIKA 1KHCA 3JCMd 4PLIA 2X4JA 2LCCA 3VYHB 1GCPA 1JXMA 4C92G 1NLPC 4M7DE 1ZQ1A 1K73C 2CP7A 3BDUA 3OYGA 3MKDA 3RDVA 1K1ZA 3CCSA 3WVDB 2ATCB 1Y7XA 3PMIA 3C12A 2M16A 3TSZA 2EGEA 1ZBJA 1RAEB 1KIKA 2A36A 1VQ9Q 1M4ZA 4AMCA 1PC0A 4C0ZA 2PZ1A 5GANg 2P4TA 3JV3A 5IH2A 1QVFA 1UE9A 2NUZA 3OW2S 1WX6A 2O01E 5CQYA 2X35A 1WDXA 8AT1B 3UDCA 1RABB 4XTVA 3OYIA 3G71Q 1AWWA 2DVEA 4HKEA 1MMDA 2LJ0A 3X25B 4RTXA 1KD1R 2P0QA 5IAYA 1C0MA 1IO6A 5FU7B 2J6OA 2E6NA 1NLOC 1PCXA 5A0GA 5LJ5j 4HA8A 1OZ2A 3OYMA 1SSHA 5DY9A 1RI0A 2W10A 3V8JA 1MGQA 1MNEA 2LP5A 2RF0A 2C0IA 5GAN4 1D3BA 2ZGWA 2ED1A 1Q7YR 3L2QA 3GIBA 4M7AG 1XOVA 2VB6A 3HFOA 1OULA 3CD6A 5GMKh 2X4XA 4M7AC 2X4YA 1TTHB 1AZEA 3V8LA 5AT1B 1D0XA 4X9CA 5GAN7 1EX4A 4DBRA 1UGVA 5GAN3 4EMHA 3V8KA 1JU5C 1SRMA 1YJNQ 1M5Q1 3TSWA 2DM1A 5CKHA 3CXCS 4R56A 1KC8C 3EGDB 2EJ9A 1UEBA 4M77A 3G71A 2MMPA 3M0TA 3C94A 2M0YA 2L0AA 4J7FA 1U1SA 1VIEA 5D6YA 3HSBA 5FRMA 5LJ3h 4XTWA 1BK2A 2K79A 4M7AE 3JCMW 2DRMA 2COYA 1UHFA 1X6OA 3LGFA 1KD1U 1QVPA 1B34A 4ZN1A 1H3HA 1I4K1 5GAMe 5GAN6 2GNCA 2GFAA 1XNIA 3CXCA 4F04B 1BYMA 5FLXE 3ZEHA 3M4GA 2D8JA 1YHQQ 5C6SA 1N8RC 1VQNA 4C0GA 4TVRA 3UF4A 3M53A 1QCNA 1ZX6A 2VYTA 1IXDA 1JEGA 3JCMP 2VXEA 4XTUA 5CKFA 1RAFB 1G83A 2DBMA 3CC2Q 4GY5A 1OU8A 2E12A 4XU3A 2VVKA 3VRZA 4JS5A 3VS7A 3NGPA 3OYNA 4L5GA 5FU6B 2DXUA 4M78A 4DBQA 1IGQA 3OYYA 1ZUYA 3X28B 1PSFA 3FIFA 1CSKA 2C0OA 2CYZB 2RQWA 1NYFA 2K2VA 4NS5A 4JS4A 1TWBA 2DRKA 4J7IA 1OPLA 8ATCB 3LW5E 1QLYA 2QDLA 5CO7A 3CCMA 3CC4A 1WJSA 1M3AA 2BE9B 1UUEA 3OMCA 1Y71A 1VQOA 2O9SA 4M77E 3OYJA 3CCQQ 4E6RA 3QYGB 4M7DC 3BW1A 1S72T 2LMJA 1JXOA 1VQ4Q 3QWYA 1SEMA 3OW2A 3OYFA 1C6VX 5DM7R 2E65A 5LJ5g 4A4EA 2L3PA 2YRCA 2ED0A 1YFNA 1KG1A 4JUVA 3TCJA 3CCMQ 1OQKA 2YDLA 4Z89A 3CCRT 3FJPA 1VQKQ 1Z9ZA 2V1RA 3RIRA 1VQ7Q 2MOXA 4FYWB 4J5YA 5DLQE 1VQ4A 1M1KU 3C4SA 4KBMB 3PGGA 3EH2A 2OTLT 1K9MC 3I35A 1J3TA 1OOTA 1VA7A 2CH4W 4M78C 1YJNA 1LCKA 1YCYA 3L2WA 4BY6C 4C5EA 3SD4A 1LJOA 2A0FB 1JQQA 4PJLA 3CCLA 2QA4Q 2JM8A 3J81E 4DBHA 1BCMA 1V29B 2YRVA 2PU9B 2HBPA 2K4YA 2AIRB 3EFOA 5KYYA 2DVJA 1GRIA 1HSQA 2KYMA 2PNIA 4OMOA 3JCMV 3CPWP 5FWBA 1QWFA 3C0CA 2DAQA 1WXBA 4J9CA 1SSFA 2A08A 3QJYA 3X24B 2EYYA 2ROTA 3KUFA 2KXDA 1WHMA 4FSSA 1VYTA 4C92D 1K8AC 1WFWA 3ZL7C 1Z9QA 2AKKA 4XTZA 5GANd 5GAN2 2RM4A 2JS2A 2P0PA 2D8HA 1O9SA 2L8DA 3O8VA 2F5KA 3CEYA 1K8AU 1KHIA 4IUVA 4IUUA 2OI3A 3OQ5A 2DMOA 4J9GA 1VQ6Q 1NJIR 1ZSZA 3CCVA 4BD3A 1IHWA 2DJZA 2K5IA 1RUWA 2FG0A 1VQ5T 5GAMf 2FEIA 4N4IA 4IUPA 5IHKA 3CD6Q 3HP9A 3VS4A 4OF1A 4F7UA 1U5SA 4JRKA 3CCEQ 4M77B 2KR3A 1UJYA 3G4SQ 2RB6A 1QP2A 4IIOA 2XDDA 1S72Q 2P4RA 3DB3A 3EFSA 2YUPA 1KQ1A 2RMOA 4EMKC 4E7KA 2ZPIB 1UHCA 2ZCFB 3CCQT 4C8QB 2DETA 2LDMA 3BDLA 1SF9A 1R77A 3FLGA 3OS5A 1ABQA 4B9WA 2I2LA 4C0FA 3OYKA 1TU0B 3VS6A 3MEUA 2RJDA 3QDRB 4M7DA 2ZAEA 3LWHA 3MPUB 2ABLA 1H92A 2JT4A 2Y4YA 4C8QD 1VQKT 2QASA 1I5OB 1AEYA 4OGCA 1M3BA 4XU0A 5LJ3j 1GCQA 1D3BB 3GNFB 3I56Q 4BDZA 3G7ZA 1I1JA 1D0YA 2RN8A 2XICA 2C06A 4C8QA 1QMCA 4PKCC 1CKBA 1H3ZA 5I2SA 4C92F 4FT4A 2KRMA 5CCAA 4QVDA 5D6WA 3L1AA 2RJFA 4DBFA 3I55T 1BI0A 3T9NA 3L2VA 1NYGA 5LJ3d 2FVUA 2FZCB 1TH7A 2VGNA 2QQSA 2CSQA 5CKEA 3QZ9B 2DX1A 3BE3A 4KUDK 3CQTA 2DFUA 2KVQG 4CC2A 4BI8B 2Y90A 1U1TA 1R0BG 2Z0WA 1M27C 1I5LA 4ESRA 1BI3A 3CD6T 1QQJA 1PRMC 2AT1B 4MZPA 2K5LA 3CBPA 3M0SA 1JRIA 1G2BA 4C8QC 4QKUA 1JJ2A 1T3LA 2Y4XA 3META 1M90R 2NUPA 3GBQA 2MIOA 2DA9A 1OPKA 4C0DC 4V2SA 2O2OA 4RTWA 4FW1A 3KXTA 5CQXA 3A5ZB 2KXCA 4GLKA 3RBBB 4A54A 3JCMb 2JTFA 3VS1A 4FW2A 1ZSGA 1GCQC 1QCFA 2MI6A 2V26A 2X51A 2MK5A 1YP5A 2LJ1A 4PFOA 3J80E 3OS1A 5L23A 3EG9A 1BI1A 3P8DA 1YIJA 1Q82R 4J6XA 3TREA 2HKNA 3CCUT 3EH1A 2GQVA 2ZPFB 2DL4A 4RTZA 4D6WA 1NM7A 2DTOA 1KQSA 1V1CA 3KBGA 2QI2A 1VQMA 2M51A 3ZBDA 1I8FA 3JB9J 1X27A 4M75D 1VQ9A 2RD1A 1ZHIA 3CC2A 2JW4A 2LQKA 1QP3A 2H3EB 1YWPA 4M4ZA 1G5VA 2HL3A 4LDYA 4M7AA 3QIIA 3MP8A 4RTTA 2LC4A 4ELYC 1YJ9T 4XU1A 1UECA 1K73R 2RK2A 4FYXB 2CZ7B 2RJEA 2EYXA 3GP8A 3GNGA 2G6FX 3OSVA 2CZ1B 4J9IA 4AG2C 2GF7A 5HKCA 4RCBA 1A0NB 1YN8A 3NTHA 4ANJA 1WJRA 2EBPA 1YITT 4DEYA 3QUIA 3MP1A 1ARKA 2BZYA 4FSXA 4C5IA 1VQ4T 5A2QE 4LXCA 1XJWB 1H8KA 2E6ZA 4LNPA 1M8VA 3DKMA 4MMKA 4JRPA 3QG1A 1IB8A 1YBYA 3M59A 1M8MA 1R8OB 2AK5A 5GMKl 3CC7Q 2EQUA 1QVFP 2QQ9A 3PE0A 1KJWA 2R5AA 1DJ7B 4AFZC 5J3BA 4C8QF 2DNUA 2KY9A 3LWIA 1QKXA 4BE2A 4CC3A 5KYYB 1TXQA 4AG1C 2NUTB 4OB2B 4IUTA 2CSIA 4N0AA 5GJWB 2MYSA 3CC7A 2E5KA 1JJ2P 2PVGB 1M9SA 3RKWA 3WVEB 4A4FA 5GAMj 4OB1B 2DBKA 4MZMA 2QTXA 1RI9A 2K3XA 3CMAT 3EG0A 4AFUC 5CAIA 3RMQA 1AWOA 1M1KC 2GTJA 2EYZA 2KRSA 3U23A 5KCOA 4JRQA 2XD0A 7AT1B 1SRLA 2BTTA 1O75A 2QA4T 3OMGA 3SFMA 3L2UA 2M02A 1K73U 1WIEA 4EDUA 1K9MU 4F16A 4QVCA 2RHIA 2CT4A 4HCZA 1X6GA 2DD4A 4VUBA 2QG9B 3G6EA 1YJ9Q 4DEXA 2AZVA 3PIPA 4JZ4A 2OTLA 2LT4A 5KYNA 3EAEA 4KGVB 3L2ZA 1KC8R 3OYCA 2HQXA 2PQWA 2EFIA 3C95A 1P92A 1D0ZA 1KK7A 1T3SA 2JM9A 4J8OA 3HRUA 3AHUA 3QO3A 4PFPA 1K0XA 3RR6A 4FL6A 4WTOB 2YUQA 3UA6A 4AT1B 1VQMT 2O4XB 4FT2A 4D8KA 3G1JA 3S6WA 1VQ9T 4Y91A 1SG5A 4M78D 4N0AC 1FYNA 5I11A 4Z8AA 4E7LA 5LJ5d 2RI5A 1Q82U 3E2UA 6AT1B 2DEQA 3CCUA 1WGSA 3R6NA 4A4GA 1VQ6A 3S3NA 2YUNA 4M78B 2VGMA 3SB2A 5DLOA 3M55A 5CK9A 1E6HA 1WQWA 1XQHA 2FRYA 4HVVA 1UGRB 2DTHA 3H0FA 5GMKm 2LZ6B 5KH6A 1RAIB 2FL7A 3H8ZA 1JBMA 3QYHB 2GCXA 4LDXA 3LYIA 4C92A 1RADB 4KH1B 1OV3A 3E19A 2QYZA 4PJOB 2H3JA 4JJDA 1WI7A 5GJVB 2J6FA 3LX7A 4II1A 1UFFA 1EZZB 3CCJT 2A37A 3KFVA 1PKSA 5LJ3e 4NOYA 2XDBA 3GF5A 3JCMX 2QGGA 4PJOD 1VQ8Q 2LTOA 1VYVA 3DB4A 2DXCA 1W4SA 4FU6A 4L59A 4RTUA 3UT1A 4LD6A 2KT8A 1AVZC 5I22A 4X1VA 4O6JA 2DLPA 4N4HA 5GMKe 2CP3A 1SKUB 2QEXT 4ME7A 2HSEB 2K3YA 3A8LB 1YJWQ 4M77D 2EIFA 2JXBA 3SWNA 4Y92A 2DIQA 3HHTB 3RESA 2EGAA 1K9AA 3NMZC 4DOWA 4J9HA 4OMLA 1YI2A 2OX7A 1IHVA 2WSFE 4J6YA 2J6KA 5FROA 2J7IA 1IREB 1VYUA 4DQ2A 1D09B 2KRNA 1N5ZA 3EGXB 1NEGA 2J05A 3PTAA 3CMEA 1TUGB 1Q81R 5EG2A 2FO0A 5GAOm 4YTLA 4A63B 1X2KA 1RAAB 2RO0A 1U8RA 4OMQA 5CR2A 1E7OA 2R5MA 3O5ZA 2JMCA 2EAYA 1JJ2S 4P5NA 4PK4A 3TQ7P 3M0RA 3CBOA 1PHTA 4QQGA 2A3LA 3PT9A 2HD0A 4ZNXA 2JTMA 1BI2A 3I5SA 3REBB 2SRCA 5HK0A 3CCJQ 2DL7A 1VQ7T 4F7UB 3E9GA 1QVGP 5GAN5 3I9QA 1KD1C 4A4HA 3RMSA 3J7AF 3RUXA 1GBRA 4M7AF 2DILA 2AHJB 2PVOB 2X3WD 3S3OA 3PIOA 2DD5A 3OSSC 5IHIA 3SDZA 3NPFA 2KQWA 2P84A 1Q7YC 2GGRA 1WHKA 3TEEA 1Q95G 3EHRA 1Y57A 2X9HA 5LJ5f 2ECZA 3E1SA 4Z02A 1SPKA 1YNZA 2CZ6B 5D6XA 1M1FA 2HKQB 3JCMJ 3F70A 2DL8A 1PSEA 2AZSA 4M77C 1QVGA 2LCSA 2E5QA 2EQKA 4LDUA 4ZTFA 5IXBA 2RHZA 1YITQ 1QW1A 4KULA 3TVTA 1VOMA 1OI1A 1M2VB 2CS7A 4CC7A 2DKGA 1FMKA 1B34B 4XTXA 4FYYB 2E3HA 3EG1A 5KYXB 3HRSA 3M0PA 4QT7A 2F2XA 5GANj 4ZGJB 5KE2A 3V7CA 2EJGA 4Y28E 2QEXQ 3CMAA 4OMNA 1M3CA 5IN1A 4BY6B 4M75B 4RMOA 4HT8A 3HRTA 1OU9A 2NUTA 4HCBA 2XDPA 1LNXA 2BUDA 3A8MB 3A1PA 4WF2A 4JRIA 1U3OA 3OYLA 3V7RA 4ELZC 2QEXA 3CMAQ 2E64A 2QDYB 5GAOl 2EJFA 3OW2P 1JO8A 1NE8A 2LRQA 3M4YA 1BB9A 4N4GA 5EC7A 4M78F 3MEVA 2FYKA 3H41A 4M75A 5FU7C 2YT6A 1UTIA 3VS0A 4OMMA 1KQSS 4C5HA 2QA4A 1G3TA 2CP5A 2O88A 2EQIA 4RKUE 1TUDA 2GFUA 1LPLA 1T0JA 1UGPB 1X2QA 1QWEA 3G71T 1N9SA 2DPPB 4BUGA 1ZSZC 2L3QA 1EIFA 1ACMB 3I55Q 5GMKi 2XHCA 1QVFS 3EG2A 1VQ5Q 1UDLA 2O9VA 3CCRQ 2YWWA 2ZPGB 3EFRA 1VQ6T 2PVDB 4HT9A 1M30A 4QQDA 2I0NA 4E7JA 4LDVA 4KH0B 4M75C 3CC4T 2D0QB 2YUOA 4M75G 1VQ8T 3JCMe 4LN2A 3ME9A 1VQOT 5CKDA 1VQ5A 1Q86U 3CXCP 1MHNA 5HK3A 2CUDA 2WACA 2A28A 4C92C 1NZ9A 5CIUA 2HNIA 4M77F 2RHXA 4M7DB 2XK0A 1TSFA 4HCKA 2LNVA 3FJ5A 2JJ9A 4DOVA 2IPOB 3RNJA 4F7UF 1YJWT 1VQLQ 1MV0B 5KYWB 1FMWA 3M56A 3VS5A 3CCLQ 2V1QA
chains in the Genus database with same CATH topology
3JRZA 3L2UA 3MEAA 4EDUA 1K73U 1K9MU 5M9OA 4M7DD 4QVCA 2RHIA 4HCZA 4XTYA 3UWNA 5I21A 1S72A 2DD4A 4J7IA 4VUBA 1X75C 3P8HA 3JCMQ 2PUKB 5I2MA 2QQRA 3LW5E 5CO7A 3G6EA 3CCMA 3CC4A 1WJSA 4QVZA 2RHYA 3PIPA 2OTLA 2LT4A 3OMCA 3CCEA 1VQNT 3JB9F 4EMKB 3EAEA 1Y71A 2EKOA 4QQ6A 3WXMB 4M77E 2ZPHB 5A0LA 3L2ZA 5GAOr 5GAOp 3OYJA 1VQOA 3QYGB 1VQLA 4M7DC 3BW1A 4M78E 2HQXA 2PQWA 3OYCA 1S72T 1OYXA 2EFIA 3C95A 5LJ3f 1P92A 3CCRA 3VUZA 3G6ET 1NJIU 3OW2A 3OYFA 3HKSA 4NL2A 5DM7R 2E65A 4J8OA 5AYFA 5LJ5g 4A4EA 3HRUA 3AHUA 3QKJA 3H6ZA 2HAXA 3QO3A 5GANh 3FB9A 1KG1A 4JUVA 3TCJA 4BACA 3MHXA 4FL6A 1ZBXA 3JCMf 3CCRT 3FJPA 2F5TX 1VQMT 1IZ6A 2O4XB 4FT2A 5GAMg 1YHQA 2JZ2A 3RIRA 3S6WA 2VV5A 3V7SA 2V8KA 1VQ9T 4PLLA 4Y91A 4J5YA 1NJIC 5DLQE 2WSCE 1VQ4A 1M1KU 3I56T 4M78D 4N0AC 2L3RA 3C4SA 5IT9E 4E7LA 5LJ5d 2RI5A 1Q82U 5L8RE 4KBMB 4ZGEB 2P0KA 1BIAA 2KK4A 4M77G 3CCMT 3PGGA 4MMLA 3OS0A 1GXIE 2DEQA 3LH0A 3OYAA 3CCUA 2OTLT 5C0MA 1K9MC 1WGSA 4IURA 1NPPA 3M9QA 2CZ0B 4A4GA 4E47A 5LJ5e 1VQ6A 4M78C 4MDWA 1YJNA 1YCYA 3L2WA 3FC3A 4BY6C 3S3NA 2RHUA 2VGMA 4M78B 3SB2A 5DLOA 4M75F 4B9XA 2X4WA 3M55A 4C5EA 2LCLA 3SD4A 1LJOA 5CK9A 2ZPBB 1WNLA 4BB7A 1WQWA 1XQHA 1KQ2A 2MWPA 3CCLA 3CC2T 4C8QG 4PJOE 3X26B 3OB9A 1UGRB 2DTHA 3J81E 3UPUA 3R6OA 5GMKm 1V29B 4LDWA 5KH6A 3JB9G 2FL7A 2YRVA 3FRNA 2PU9B 3H8ZA 4KT0E 2HBPA 2K4YA 4QW2A 5KE3A 1JBMA 3QYHB 2GCXA 3QBYA 2KAFA 4M75E 1YJ9A 4JLIA 4LDXA 4KUIA 2QQBA 3LYIA 4OP0A 4C92A 2DIGA 1UGQB 3E19A 2HQEA 2RI2A 2IVWA 3BY7A 3JCMV 4PJOB 4IKFA 2R58A 2H3JA 2DAQA 1SSFA 4EPCA 3QJYA 3ER0A 3X24B 4OGEA 4DA4A 3LX7A 3KUFA 5A0DA 4II1A 1VQPT 3VV0A 3CCJT 5GAMd 5CVIA 4OB0B 3N5BB 4F7UG 1YI2T 4C92D 1M1GA 4BI4A 3OBWA 4NOYA 5LJ3e 2XDBA 3GF5A 3ASKA 3LLRA 3JCMX 1N8RU 2DO3A 4PJOD 2RK1A 1K8AC 2EWNA 4C5GA 3MCAB 2LTOA 2XG8D 2CGHA 1G3WA 3DB4A 2DXCA 1W4SA 4XTZA 2MAMA 1H641 4FU6A 4JLGA 3JAME 5GANd 4L59A 5J26A 5GAN2 2RM4A 3UT1A 3FEOA 3CCLT 4PJOF 2P0PA 4EMGA 4C92B 4A4KA 4MZTA 3PNWC 3E9FA 3L42A 4LD6A 1Y96B 2LQ8A 2L5QA 5GAOq 2B8AA 1O9SA 2L8DA 3O8VA 4O6JA 5GANf 2V8IA 2F5KA 3CEYA 1K8AU 4N4HA 5GMKe 1KHIA 4IUVA 4BE1A 4A53A 2QEXT 4ME7A 2K3YA 2KDSA 4IUUA 3A8LB 3VKIA 3OQ5A 2JN0A 2EIFA 4M77D 1XTDA 5GAMh 4ZGDB 2VC8A 3SWNA 3CCVA 2DIQA 4BD3A 3HHTB 3RESA 4BI3A 2MF2A 3INZA 5FU6C 4O5VA 2PUOB 2DJZA 2VUBA 3CPFA 2E1HA 4DOWA 2LX9A 2K5IA 3L2RA 3DLLA 3CCJA 2ZZDA 3GPLA 3M58A 2LT1A 5GAMf 1YI2A 1QVGS 4N4IA 4IUPA 1VQ5T 2WSFE 4J6YA 4PNOA 5FROA 1WQ7A 1RL2A 4CRIA 1IREB 5GAOn 3QSUA 1UGSB 3HP9A 3I56A 4DQ2A 4OF1A 4F7UA 2M9UA 2QXFA 4JRKA 3CCVT 1Q86C 5GAN8 4M77B 1Y07A 5KCHA 3OBYA 3HFNA 3CCQA 3PTAA 3CMEA 3M54A 2JUFA 2RB6A 1QP2A 5EG2A 2XDDA 2K57A 2YHTA 3URGA 3DB3A 5LJ5h 3EFSA 5GAOm 3OYBA 2YLCA 4YTLA 1KQ1A 1WJQA 2RJCA 4C0DB 1Q7YU 2IG0A 1YJNT 3HL8A 2RO0A 4EMKC 3PFSA 4E7KA 2ZPIB 1VIFA 1W2BS 4PJOA 2ZCFB 1U8RA 3P8BB 1OZ3A 3CCQT 4C8QB 2OAUA 3VYGA 4RG2A 2OTJA 3A8GB 2LDMA 3BDLA 5CR2A 2R5MA 2DTIA 2KMTA 4Q5WA 4M7DF 3FLGA 2YLBA 3OS5A 1FXXA 4B9WA 2I2LA 1VQKA 4ZN3A 3SWNB 2EAYA 4M78G 4C0FA 3G4ST 1JJ2S 1LOJA 4P5NA 3OYKA 2E41A 1UB4A 2RI3A 1VQ7A 2A7YA 3RKYA 4F7UE 2D9TA 2RJDA 3MEUA 3QDRB 3M57A 4M7DA 3CBOA 4QQGA 2A3LA 3PT9A 4L6V5 4JDSA 3LWHA 2HD0A 3OS2A 3A8HB 2JTMA 2O4XA 3JB9I 1Q82C 2NLUA 2Y4YA 1BI2A 4C8QD 2E10A 1VQKT 5HK0A 3JB9J 4OGCA 3GOXA 4XU0A 5LJ3j 1VQ7T 1Q81U 2M1HA 4F7UB 3Q1JA 3VJPA 1D3BB 1AHJB 3E9GA 3M5AA 3CMET 5GAN5 2DXBA 1KD1C 3GNFB 4A4HA 1N27A 4BDZA 3RMSA 3J7AF 1YHQT 3G7ZA 1FX7A 3RUXA 3RKXA 2RA2A 2XICA 3OYHA 2C06A 4C8QA 3DLMA 2BKDN 4ATOA 4M7AF 1KHCA 4PKCC 2AHJB 3JCMd 2PVOB 3CBMA 4PLIA 4XQ3A 3VU3C 3S3OA 3PIOA 1H3ZA 2DD5A 5I2SA 2X4JA 4OVAA 2LCCA 3VYHB 1HK9A 3OSSC 4FT4A 2L89A 4C92F 4C92G 5CCAA 3SDZA 4M7DE 1ZQ1A 1K73C 4QVDA 4E7HA 4ZTJA 5D6WA 3L1AA 3BDUA 2RJFA 4HCCA 3OYGA 2KQWA 2V8JA 3I55T 3QJ6A 1BI0A 4BE0A 3T9NA 3L2VA 3PMTA 5LJ3d 1Q7YC 3CCSA 2EYQA 3WVDB 2FVUA 1Y7XA 4X34A 3PMIA 3TEEA 3C12A 4J6WA 1TH7A 2VGNA 1WPYA 2QQSA 5CKEA 3QZ9B 2M16A 3JB9H 3QPHA 3OYDA 5LJ5f 4KUDK 2LVMA 3E1SA 4Z02A 2KVQG 4BI8B 4R55A 2Y90A 1U1TA 1M4ZA 2BIVA 4C0ZA 2CZ6B 5GANg 5D6XA 4X9DA 1M1FA 1I5LA 3JCMJ 2XI9A 1N9RA 1BI3A 2DXTA 3MO8A 3NFCA 3CD6T 2P4TA 3F70A 1PSEA 4M77C 1QVFA 3X20B 3SWNC 1QVGA 1X01A 4MZPA 2K5LA 2JOYA 2EQKA 2E5QA 3CBPA 3OW2S 4LDUA 2O01E 3NTKA 4RG8A 4ZTFA 5CQYA 4NL3A 1JRIA 1VQLT 2RHZA 2X35A 4C8QC 3UDCA 1JJ2A 1Q81C 1VUBA 2Y4XA 4XTVA 1QW1A 2CKKA 3META 4KULA 3MEWA 3OYIA 1OI1A 2DVEA 4HKEA 2CS7A 3HPWA 2DKGA 2RH2A 3X25B 4C0DC 5FRNA 2P0QA 5IAYA 4V2SA 1B34B 2MWOA 1VQ8A 4XTXA 3JSCA 5FU7B 3KXTA 5CQXA 1W2BA 2E6NA 4XK8E 5A0GA 3A5ZB 5LJ5j 4HA8A 1OZ2A 4GLKA 2DK3A 2FB7A 4A54A 3JCMb 3HRSA 3OYMA 2JTFA 5GANj 3OYEA 3CCST 4OMFB 1G3SA 4ZGJB 5DY9A 1RI0A 3V8JA 3JCMh 3V7CA 1MGQA 5GANe 5KE2A 2EJGA 2MI6A 4Y28E 3CMAA 3J80E 5GAN4 1D3BA 4CI0C 2ZGWA 3OS1A 5IN1A 4BY6B 4M75B 4RMOA 1BI1A 3L2QA 3GIBA 4M7AG 1XOVA 3HFOA 4PL6A 1JB0E 4HT8A 3HRTA 3P8DA 1YIJA 1YJWA 4J6XA 1G3YA 3TREA 3CCUT 4HCBA 3CD6A 5HY6A 5GMKh 4FIBA 2XDPA 1LNXA 2GQVA 2BUDA 2X4XA 2ZPFB 4D6WA 3A8MB 4M7AC 2X4YA 2DTOA 2JVVA 4WF2A 2XKOC 4JRIA 1M90U 1KQSA 3V8LA 3LGLA 3QZ5B 3KBGA 2QI2A 3CPWS 1VQMA 3CC7T 4E7IA 3OYLA 3ZBDA 1I8FA 3V7RA 1HXDA 4ELZC 2QEXA 2E64A 2VXFA 4M75D 2QDYB 4X9CA 5GAOl 1VQ9A 2RD1A 1ZHIA 5LL6S 5GAN7 3CC2A 2EJFA 5GAN3 2LQKA 4EMHA 1QP3A 3V8KA 1FWZA 2EQJA 1NE8A 2FHDA 3S3MA 1G5VA 4LDYA 4M7AA 3QIIA 4PJOC 3MP8A 2LRQA 3GLXA 2LC4A 1M5Q1 1NPRA 3M4YA 2OTJT 4ELYC 4N4GA 1YJ9T 4XU1A 4M78F 3MEVA 5CKHA 5LJ3g 2DZ9A 2FYKA 2WSEE 2RK2A 4M75A 1M90C 5CKBA 5FU7C 3G4SA 2CZ7B 1KQSS 4M7DG 2K5FA 4R56A 2RJEA 4C5HA 3CXCS 4UC4A 1YITA 3GP8A 1KC8C 2QA4A 2EJ9A 1UEBA 4M77A 1G3TA 3GNGA 3G71A 3OSVA 2MMPA 1BIBA 4FM4B 4RKUE 3TU4K 2CZ1B 1Y96A 3A8OB 2GFUA 4RCCA 2DZCA 3C94A 3OMGA 2GF7A 5HKCA 1UGPB 4RCBA 1I81A 1VQPA 4J7FA 1U1SA 2JNGA 3NTHA 1VIEA 1WJRA 5D6YA 3JCMg 1YITT 3HSBA 2XIDA 3QUIA 3CCET 3MP1A 5FRMA 2XU8A 3G71T 4FSXA 5LJ3h 4XTWA 1N9SA 2DPPB 4C5IA 4BUGA 5A2QE 3OA6A 1VQ4T 2E6ZA 4M7AE 1EIFA 3JCMW 1M8VA 3DKMA 4MMKA 5GMKi 3QG1A 1X6OA 3LGFA 2XHCA 4JRPA 4C8QE 1KD1U 1QVPA 1B34A 1YBYA 3M59A 4ZN1A 1QVFS 1R8OB 1I4K1 2M0OA 4XAXB 5GAMe 5GAN6 5GMKl 5J39A 2EQUA 5GMKj 4LD9K 4M7AB 2GFAA 2QQ9A 3FDRA 1XNIA 2R5AA 1DJ7B 2R57A 2ZPGB 3CXCA 1BYMA 3EFRA 5FLXE 5J3BA 4C8QF 3CPWA 2QQAA 2PVDB 4BDYA 1VQ6T 4HT9A 4QQDA 4OB3B 3ZEHA 3RERA 3ZFJA 2KY9A 3M4GA 4E7JA 4LDVA 3LWIA 5C6SA 2EQMA 2ZPEB 4M75C 4BE2A 1N8RC 3OY9A 3CC4T 4XU2A 2KSSA 2D0QB 1BKBA 3JB9D 4M75G 4EMKA 1VQ8T 1VQNA 4OB2B 4C0GA 4TVRA 4IUTA 3JCMe 4M7AD 4J83A 3ME9A 4N0AA 1VQOT 3M53A 5CKDA 3CC7A 1VQ5A 3QHSA 2VYTA 1Q86U 3JCMP 1MHNA 4PJOG 1N6AA 2PVGB 1M9SA 2VXEA 3RKWA 3WVEB 4XTUA 4A4FA 5HK3A 1KC8U 5CKFA 5GAMj 2WACA 4OB1B 2F69A 2QA4T 4MZMA 4C92C 1YIJT 1NZ9A 5CIUA 2HNIA 3QXEB 4C92E 2QTXA 4M77F 3NTIA 4GY5A 3JCMc 4JJNK 2RHXA 2K3XA 3CMAT 2E12A 4XU3A 4M7DB 2XK0A 4JS5A 5CAIA 2E70A 3OYNA 4IUQA 4L5GA 5FU6B 2DXUA 4M78A 3OYYA 3RMQA 2LNVA 4DOVA 1M1KC 4MDXA 3MP6A 3VUBA 5KCOA 3X28B 1PSFA 3FIFA 4JRQA 2XD0A 4F7UF 1YJWT 2G3RA 2CYZB 3I55A 1O75A 2D6FA 3M56A 2K2VA 3BFMA 4NS5A 4JS4A 3SFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7U B;  5GMK m;  5GAM d;  1I8F A;  1D3B B;  1HXD A;  3V7R A;  3JB9 J;  2E64 A;  2VXF A;  4M75 D;  4X9C A;  4C92 D;  4F7U G;  4QVC A;  5I21 A;  2RD1 A;  4XTY A;  5GAN 7;  5GAN 5;  5LJ3 e;  5GAO l;  2EJF A;  4NOY A;  5GAN 3;  3RUX A;  3RKX A;  4EMH A;  2RA2 A;  3V8K A;  3JCM X;  3JCM Q;  4C8Q A;  4M7A F;  4M7A A;  4PJO C;  4PJO D;  3JCM d;  2EWN A;  4XQ3 A;  3VU3 C;  1M5Q 1;  2CGH A;  3JB9 F;  4XU1 A;  4EMK B;  4M78 F;  4XTZ A;  1H64 1;  4M77 E;  5GAO r;  3L2Z A;  1HK9 A;  2DZ9 A;  4C92 F;  2FYK A;  5LJ3 g;  4M75 A;  5GAN d;  5GAO p;  4M7D D;  5GAN 2;  2RM4 A;  4M7D C;  3BW1 A;  4M78 E;  4C92 G;  4M7D G;  4M7D E;  4PJO F;  4QVD A;  4EMG A;  5LJ3 f;  3L1A A;  3BDU A;  2EJ9 A;  4C92 B;  4M77 A;  1Y96 B;  5LJ3 d;  4NL2 A;  1BIB A;  2E65 A;  5LJ5 g;  5GAO q;  1Y96 A;  4RCC A;  3AHU A;  3QO3 A;  1TH7 A;  2DZC A;  4J6W A;  3FB9 A;  1WPY A;  5GAN f;  5GAN h;  4JUV A;  4RCB A;  1I81 A;  5GMK e;  3JB9 H;  1U1S A;  5LJ5 f;  4A53 A;  3JCM g;  3JCM f;  3HSB A;  3FJP A;  2Y90 A;  1U1T A;  3QUI A;  5GAM h;  4M77 D;  2JN0 A;  5GAM g;  2VC8 A;  3RIR A;  3SWN A;  4XTW A;  1N9S A;  5LJ3 h;  3RES A;  3V7S A;  5GAN g;  3INZ A;  4X9D A;  1I5L A;  4Y91 A;  3JCM J;  4M7A E;  2DJZ A;  3JCM W;  1N9R A;  2E1H A;  4J5Y A;  1M8V A;  4MMK A;  2DXT A;  5GMK i;  5GAM f;  4M77 C;  1B34 A;  4M78 D;  4N0A C;  4J6Y A;  4PNO A;  3SWN C;  1X01 A;  1WQ7 A;  1I4K 1;  5GMK l;  5GAM e;  5LJ5 d;  5GAN 6;  5GAO n;  3QSU A;  5GMK j;  4M7A B;  1BIA A;  4NL3 A;  1JRI A;  4M77 G;  4DQ2 A;  3PGG A;  4F7U A;  4MML A;  4JRK A;  4C8Q C;  5GAN 8;  4M77 B;  2DEQ A;  4XTV A;  3EFR A;  4C8Q F;  2DVE A;  3HFN A;  4HT9 A;  3RER A;  2DKG A;  2RB6 A;  3M4G A;  5LJ5 e;  4V2S A;  2K57 A;  4M78 C;  2YHT A;  1B34 B;  1YCY A;  4M75 C;  3EFS A;  5LJ5 h;  4XTX A;  5GAO m;  2YLC A;  4XU2 A;  1KQ1 A;  4M78 B;  3SB2 A;  3JB9 D;  4M75 F;  5LJ5 j;  4M75 G;  4HA8 A;  4EMK A;  2FB7 A;  4A54 A;  4EMK C;  3JCM e;  1LJO A;  3JCM b;  4M7A D;  4PJO A;  4N0A A;  1WNL A;  1WQW A;  5GAN j;  3QHS A;  5DY9 A;  3V8J A;  3JCM h;  3V7C A;  1MGQ A;  4C8Q B;  5GAN e;  3JCM P;  1KQ2 A;  4PJO G;  4C8Q E;  2EJG A;  2VXE A;  2DTI A;  3RKW A;  4XTU A;  4C8Q G;  4M7D F;  4PJO E;  2YLB A;  5GAM j;  2I2L A;  2DTH A;  4C92 C;  1D3B A;  5GAN 4;  3SWN B;  2EAY A;  2HNI A;  2ZGW A;  4M78 G;  2QTX A;  1LOJ A;  4M77 F;  3JCM c;  4C92 E;  2E41 A;  3JB9 G;  4M75 B;  4M7D B;  4XU3 A;  3RKY A;  1JBM A;  4M75 E;  4F7U E;  5CAI A;  3GIB A;  4M7A G;  3HFO A;  2DXU A;  4JLI A;  4M78 A;  4OP0 A;  4HT8 A;  4M7D A;  4C92 A;  4J6X A;  3BY7 A;  4PJO B;  3JCM V;  3FIF A;  3JB9 I;  4C8Q D;  5GMK h;  1LNX A;  2E10 A;  4F7U F;  4M7A C;  2DTO A;  4XU0 A;  4WF2 A;  4JRI A;  5LJ3 j;  3BFM A;  3V8L A; 
#chains in the Genus database with same CATH topology
 1BU1 A;  1S1N A;  2HZY A;  1ABO A;  1KQS P;  4M7D D;  2MPX C;  2EW3 A;  5I21 A;  4XTY A;  3UWN A;  1S72 A;  2E4H A;  4F14 A;  3P8H A;  2DER A;  5I2M A;  3CCE A;  2LQN A;  1VQN T;  1W1F A;  2QK0 A;  1X6B A;  4EMK B;  4F17 A;  2KGT A;  2EKO A;  5A0L A;  3I5R A;  3EHQ A;  4M78 E;  2DEU A;  3CCR A;  1FMV A;  3VUZ A;  1ZUU A;  5ECA A;  4NL2 A;  2E3I A;  5AYF A;  3QKJ A;  1PRL C;  2SEM A;  4PJJ A;  2DJQ A;  4BAC A;  3MHX A;  1ZBX A;  2FRW A;  1WLP B;  3AT1 B;  1YHQ A;  2JZ2 A;  1PD1 A;  2VV5 A;  4FYV B;  3V7S A;  4PLL A;  2BZ8 A;  2L3R A;  1BCO A;  4ZGE B;  4M77 G;  3CCM T;  4MML A;  4R0K A;  3OYA A;  4IUR A;  1Q86 R;  1NPP A;  4E47 A;  1M2V A;  3FC3 A;  2F1L A;  2RHU A;  4M75 F;  3CCS Q;  2LCL A;  2DL3 A;  4BB7 A;  4OMP A;  1HYO A;  1KQ2 A;  2MWP A;  1WHJ A;  2OTL Q;  3X26 B;  3QWX X;  1PKT A;  3UPU A;  3R6O A;  2QGF B;  4LDW A;  3JB9 G;  3FRN A;  4JZ3 A;  5KE3 A;  1BBZ A;  2LQW A;  1M1K R;  3CC4 Q;  3QBY A;  4E7Z A;  2DIG A;  3BY7 A;  2IVW A;  4DA4 A;  3QDF A;  5A0D A;  3VV0 A;  4Z88 A;  2VWF A;  1M1G A;  4BI4 A;  3OBW A;  4PJM A;  3ASK A;  1AT1 B;  1N8R U;  2BZX A;  2DO3 A;  2RK1 A;  4KRT A;  2O31 A;  4C5G A;  3MCA B;  2CGH A;  2MAM A;  1H64 1;  4JLG A;  3JAM E;  1K9M R;  3EGU A;  2NWM A;  3CCL T;  2K3B A;  2GBQ A;  4PJO F;  4EMG A;  4A4K A;  2KT1 A;  3PNW C;  3L42 A;  1Y96 B;  2LQ8 A;  2L5Q A;  5GAO q;  2ESW A;  5GAN f;  2V8I A;  4BE1 A;  4A53 A;  4J9B A;  1YWO A;  5GAM h;  1XTD A;  2VC8 A;  1HD3 A;  1MUZ A;  3INZ A;  5FU6 C;  2VUB A;  1AWX A;  2LX9 A;  3L2R A;  1D1C A;  1WHH A;  2LT1 A;  3SHW A;  2K6D A;  1V76 A;  1GFC A;  4CRI A;  5GAO n;  1UGS B;  3I56 A;  2QXF A;  3CCV T;  1Y07 A;  3NHN A;  5KCH A;  3OBY A;  1VQM Q;  3HFN A;  3CCQ A;  3M54 A;  5IXF A;  2JUF A;  2FZK B;  2K57 A;  3URG A;  2EYW A;  5LJ5 h;  3OYB A;  2YLC A;  1AWJ A;  1WJQ A;  2FZG B;  2RJC A;  3D7S B;  5FW9 A;  1Q7Y U;  4LUD A;  3HL8 A;  1K8A R;  3PFS A;  4PJO A;  2KBT A;  3P8B B;  1OZ3 A;  2OAU A;  3VYG A;  2OTJ A;  3A8G B;  2HDA A;  1ZA2 B;  1WZO A;  2KMT A;  4Q5W A;  4M7D F;  1VQK A;  3G4S T;  1VQP Q;  2A7Y A;  4F7U E;  1KFZ A;  2D9T A;  3M57 A;  1OEB A;  4L6V 5;  4JDS A;  3A8H B;  2O4X A;  3JB9 I;  2NLU A;  3GOX A;  2FPD A;  1SHF A;  1YHQ T;  3RKX A;  3OYH A;  1TS9 A;  3DLM A;  2BKD N;  2KEA A;  1OX8 A;  3CBM A;  4XQ3 A;  3VU3 C;  1C1A A;  2VKN A;  1GL5 A;  4OVA A;  1HK9 A;  1RAG B;  2L89 A;  3LH5 A;  2KE9 A;  4E2F B;  4E7H A;  4ZTJ A;  4GBQ A;  4HCC A;  2V8J A;  3PVL A;  3QJ6 A;  4BE0 A;  3PMT A;  1AD5 A;  2EYQ A;  1E6G A;  4X34 A;  4J6W A;  2CP0 A;  1WPY A;  2HSP A;  1MMA A;  3JB9 H;  3QPH A;  3OYD A;  2LVM A;  2YRD A;  1G8X A;  4R55 A;  1NG2 A;  2BIV A;  1ZUK A;  1X43 A;  2B86 A;  4X9D A;  2CUB A;  2XI9 A;  1N9R A;  2DXT A;  3MO8 A;  2H8H A;  3NFC A;  4LUE A;  3X20 B;  3SWN C;  2RNA A;  1X01 A;  2CP2 A;  2JOY A;  2RQR A;  3EGD A;  4RG8 A;  3NTK A;  1RLP C;  2F2V A;  1VQL T;  4NL3 A;  2XMF A;  1Q81 C;  1VUB A;  1WHG A;  3UAT A;  2CKK A;  3MEW A;  2RQT A;  1R0C B;  3HPW A;  2RH2 A;  1D1B A;  5FRN A;  1VQ8 A;  2MWO A;  2JMA A;  2KNB B;  3JSC A;  2CT3 A;  5IHN A;  1W2B A;  2HMA A;  4XK8 E;  1N8R R;  2DK3 A;  2FB7 A;  1K4U S;  2K7A A;  3OYE A;  3CCS T;  4OMF B;  1G3S A;  5KYW A;  1YIJ T;  3JCM h;  5GAN e;  4E7S A;  1QCO A;  2F2W A;  4CI0 C;  2COZ A;  1K0S A;  1RAC B;  5KYU B;  1UG1 A;  4PL6 A;  1JB0 E;  1YJW A;  1G3Y A;  5HY6 A;  4FIB A;  1HJD A;  1GBQ A;  2JVV A;  1M90 U;  2XKO C;  3VRY A;  1Y0M A;  1YI2 Q;  3LGL A;  3QZ5 B;  3CPW S;  2FPE A;  4E7I A;  1HXD A;  1KSW A;  2VXF A;  5LL6 S;  2COW A;  1PWT A;  4D8D A;  1I07 A;  1FWZ A;  2EQJ A;  3VS3 A;  2FHD A;  3REA B;  3S3M A;  4PJO C;  3GLX A;  2OTJ T;  1NPR A;  1RLQ C;  1K76 A;  1F1B B;  3MJX A;  3H0H A;  5LJ3 g;  2DZ9 A;  2WSE E;  1M90 C;  3EG9 B;  1VQN Q;  4J9F A;  5CKB A;  3G4S A;  4M7D G;  2K5F A;  4UC4 A;  1YIT A;  1B07 A;  1X69 A;  1BIB A;  4FM4 B;  3TU4 K;  1Y96 A;  3A8O B;  4RCC A;  2DZC A;  1PD0 A;  1I81 A;  4KGX B;  1VQP A;  2JNG A;  3JCM g;  2XID A;  1MMG A;  3CCE T;  2QAZ A;  2XU8 A;  4HVU A;  3OA6 A;  1W70 A;  1D1A A;  4HXJ A;  2J06 A;  4XAX B;  2M0O A;  4LD9 K;  5J39 A;  5GMK j;  4M7A B;  3FDR A;  2R57 A;  3CPW A;  2QQA A;  4PJN A;  4BDY A;  4OB3 B;  3RER A;  3ZFJ A;  2EQM A;  2ZPE B;  3OY9 A;  4XU2 A;  2KSS A;  3A98 A;  2DYB A;  3JB9 D;  1IRX A;  1BKB A;  2ENM A;  4EMK A;  2RQU A;  4M7A D;  4J83 A;  2HQH A;  3QHS A;  2CDT A;  2EVR A;  4PJO G;  4C8Q E;  1N6A A;  1KC8 U;  2F69 A;  2X3X D;  4JJN K;  4C92 E;  3QXE B;  1B7T A;  3NTI A;  3JCM c;  2OJ2 A;  2E70 A;  4IUQ A;  3H9N A;  1IGU A;  2HBW A;  4MDX A;  3MP6 A;  2W0Z A;  3VUB A;  3ULR B;  1VQO Q;  2G3R A;  3EGX A;  4RTY A;  3I55 A;  3SEM A;  2D6F A;  3PVQ A;  3BFM A;  1TUC A;  5D7U A;  3JRZ A;  3MEA A;  3HTR A;  5M9O A;  1PG5 B;  4WCI A;  1X75 C;  3JCM Q;  2PUK B;  2QQR A;  4QVZ A;  2RHY A;  4JJC A;  1CKA A;  2CP6 A;  1SHG A;  3JB9 F;  1AOJ A;  4QQ6 A;  1B3Q A;  3WXM B;  2ZPH B;  5GAO r;  5GAO p;  1VQL A;  1EFN A;  1OYX A;  2FPF A;  5LJ3 f;  5KYX A;  3G6E T;  1NJI U;  4ORZ A;  3HKS A;  1GFD A;  2KYB A;  3H6Z A;  2RPN A;  2HAX A;  5GAN h;  3FB9 A;  1YIJ Q;  2OTJ Q;  3JCM f;  2GQI A;  2F5T X;  1IZ6 A;  5GAM g;  2L3S A;  2IIM A;  2V8K A;  1NEB A;  2YXY A;  1NJI C;  2C0T A;  5KYU A;  2MCN A;  2WSC E;  3I56 T;  5IT9 E;  2KRO A;  5L8R E;  4JJB A;  1RAH B;  1BIA A;  2KK4 A;  2D0N A;  2P0K A;  4J9D A;  3OS0 A;  2HEQ A;  1GXI E;  3LH0 A;  1U06 A;  1ZLM A;  2ROL A;  5C0M A;  4PFZ A;  2LJ3 A;  4RUG A;  1T0H A;  4GLM A;  3M9Q A;  1ZSZ B;  2CZ0 B;  5LJ5 e;  2NUP B;  4MDW A;  2DE0 X;  1WYX A;  4B9X A;  2X4W A;  9ATC B;  3THK A;  2KI7 A;  2ZPB B;  4J9E A;  3UA7 A;  1WNL A;  3CCV Q;  3M0Q A;  2DL5 A;  2K9G A;  3CC2 T;  4C8Q G;  4PJO E;  3OB9 A;  3CME Q;  4KT0 E;  2LNH B;  4QW2 A;  4M75 E;  1YJ9 A;  2KAF A;  4JLI A;  4KUI A;  2QQB A;  4OP0 A;  1YCS B;  1TG0 A;  1UGQ B;  2HQE A;  2RI2 A;  4IKF A;  2R58 A;  1PM3 A;  4EPC A;  3ER0 A;  4OGE A;  1MND A;  2CH4 A;  2OAW A;  1VQP T;  5GAM d;  5CVI A;  4OB0 B;  3N5B B;  2HL5 C;  4F7U G;  1YI2 T;  3IQL A;  2PTK A;  3LLR A;  1OX9 A;  3CCU Q;  2EWN A;  2XG8 D;  1G3W A;  1W2B P;  5J26 A;  1M2O A;  1WXU A;  3M0U A;  3FEO A;  3EG3 A;  2NYS A;  4C92 B;  4MZT A;  3E9F A;  4AFS C;  4FCY A;  2B8A A;  1MV3 A;  4IIM A;  4B6M A;  2GTO A;  1QKW A;  2KDS A;  3VKI A;  2JN0 A;  4ZGD B;  4BI3 A;  2HCK A;  2MF2 A;  4O5V A;  2PUO B;  3CPF A;  2E1H A;  3CCJ A;  2AKL A;  3DLL A;  2ZZD A;  3GPL A;  3M58 A;  4KGZ B;  3CC7 T;  1QVG S;  5HCK A;  4PNO A;  1WQ7 A;  2JTE A;  1RL2 A;  3QSU A;  3H0I A;  2M9U A;  1Q86 C;  4JPB W;  5GAN 8;  1WHL A;  4CC4 B;  1PNJ A;  1UJ0 A;  2K2M A;  2D1X A;  2YHT A;  2BE7 D;  2L2P A;  3G6E Q;  4C0D B;  2IG0 A;  1YJN T;  1WXT A;  2VAS A;  1W2B S;  1VIF A;  5FWC A;  4LE9 A;  4RG2 A;  2EPD A;  3EFO B;  2DTI A;  4AFQ C;  2RQV A;  2YLB A;  1FXX A;  1I0C A;  2EKH A;  4ZN3 A;  3SWN B;  4M78 G;  2YSQ A;  1NBE B;  1LOJ A;  1LVK A;  2QTV A;  2E41 A;  1UB4 A;  2RI3 A;  1VQ7 A;  1WA7 A;  3RKY A;  2EGC A;  2LX7 A;  3OS2 A;  1Q82 C;  1W6X A;  1MMN A;  2E10 A;  2JS0 A;  1AZG B;  1Q81 U;  2M1H A;  2DF6 A;  2DYI A;  4HVW A;  3Q1J A;  3VJP A;  4RTV A;  1TOV A;  1AHJ B;  3M5A A;  3CME T;  2CRE A;  2DXB A;  4K11 A;  1N27 A;  1ZA1 B;  1FX7 A;  2RA2 A;  3VS2 A;  4ATO A;  4EIK A;  1KHC A;  3JCM d;  4PLI A;  2X4J A;  2LCC A;  3VYH B;  1GCP A;  1JXM A;  4C92 G;  1NLP C;  4M7D E;  1ZQ1 A;  1K73 C;  2CP7 A;  3BDU A;  3OYG A;  3MKD A;  3RDV A;  1K1Z A;  3CCS A;  3WVD B;  2ATC B;  1Y7X A;  3PMI A;  3C12 A;  2M16 A;  3TSZ A;  2EGE A;  1ZBJ A;  1RAE B;  1KIK A;  2A36 A;  1VQ9 Q;  1M4Z A;  4AMC A;  1PC0 A;  4C0Z A;  2PZ1 A;  5GAN g;  2P4T A;  3JV3 A;  5IH2 A;  1QVF A;  1UE9 A;  2NUZ A;  3OW2 S;  1WX6 A;  2O01 E;  5CQY A;  2X35 A;  1WDX A;  8AT1 B;  3UDC A;  1RAB B;  4XTV A;  3OYI A;  3G71 Q;  1AWW A;  2DVE A;  4HKE A;  1MMD A;  2LJ0 A;  3X25 B;  4RTX A;  1KD1 R;  2P0Q A;  5IAY A;  1C0M A;  1IO6 A;  5FU7 B;  2J6O A;  2E6N A;  1NLO C;  1PCX A;  5A0G A;  5LJ5 j;  4HA8 A;  1OZ2 A;  3OYM A;  1SSH A;  5DY9 A;  1RI0 A;  2W10 A;  3V8J A;  1MGQ A;  1MNE A;  2LP5 A;  2RF0 A;  2C0I A;  5GAN 4;  1D3B A;  2ZGW A;  2ED1 A;  1Q7Y R;  3L2Q A;  3GIB A;  4M7A G;  1XOV A;  2VB6 A;  3HFO A;  1OUL A;  3CD6 A;  5GMK h;  2X4X A;  4M7A C;  2X4Y A;  1TTH B;  1AZE A;  3V8L A;  5AT1 B;  1D0X A;  4X9C A;  5GAN 7;  1EX4 A;  4DBR A;  1UGV A;  5GAN 3;  4EMH A;  3V8K A;  1JU5 C;  1SRM A;  1YJN Q;  1M5Q 1;  3TSW A;  2DM1 A;  5CKH A;  3CXC S;  4R56 A;  1KC8 C;  3EGD B;  2EJ9 A;  1UEB A;  4M77 A;  3G71 A;  2MMP A;  3M0T A;  3C94 A;  2M0Y A;  2L0A A;  4J7F A;  1U1S A;  1VIE A;  5D6Y A;  3HSB A;  5FRM A;  5LJ3 h;  4XTW A;  1BK2 A;  2K79 A;  4M7A E;  3JCM W;  2DRM A;  2COY A;  1UHF A;  1X6O A;  3LGF A;  1KD1 U;  1QVP A;  1B34 A;  4ZN1 A;  1H3H A;  1I4K 1;  5GAM e;  5GAN 6;  2GNC A;  2GFA A;  1XNI A;  3CXC A;  4F04 B;  1BYM A;  5FLX E;  3ZEH A;  3M4G A;  2D8J A;  1YHQ Q;  5C6S A;  1N8R C;  1VQN A;  4C0G A;  4TVR A;  3UF4 A;  3M53 A;  1QCN A;  1ZX6 A;  2VYT A;  1IXD A;  1JEG A;  3JCM P;  2VXE A;  4XTU A;  5CKF A;  1RAF B;  1G83 A;  2DBM A;  3CC2 Q;  4GY5 A;  1OU8 A;  2E12 A;  4XU3 A;  2VVK A;  3VRZ A;  4JS5 A;  3VS7 A;  3NGP A;  3OYN A;  4L5G A;  5FU6 B;  2DXU A;  4M78 A;  4DBQ A;  1IGQ A;  3OYY A;  1ZUY A;  3X28 B;  1PSF A;  3FIF A;  1CSK A;  2C0O A;  2CYZ B;  2RQW A;  1NYF A;  2K2V A;  4NS5 A;  4JS4 A;  1TWB A;  2DRK A;  4J7I A;  1OPL A;  8ATC B;  3LW5 E;  1QLY A;  2QDL A;  5CO7 A;  3CCM A;  3CC4 A;  1WJS A;  1M3A A;  2BE9 B;  1UUE A;  3OMC A;  1Y71 A;  1VQO A;  2O9S A;  4M77 E;  3OYJ A;  3CCQ Q;  4E6R A;  3QYG B;  4M7D C;  3BW1 A;  1S72 T;  2LMJ A;  1JXO A;  1VQ4 Q;  3QWY A;  1SEM A;  3OW2 A;  3OYF A;  1C6V X;  5DM7 R;  2E65 A;  5LJ5 g;  4A4E A;  2L3P A;  2YRC A;  2ED0 A;  1YFN A;  1KG1 A;  4JUV A;  3TCJ A;  3CCM Q;  1OQK A;  2YDL A;  4Z89 A;  3CCR T;  3FJP A;  1VQK Q;  1Z9Z A;  2V1R A;  3RIR A;  1VQ7 Q;  2MOX A;  4FYW B;  4J5Y A;  5DLQ E;  1VQ4 A;  1M1K U;  3C4S A;  4KBM B;  3PGG A;  3EH2 A;  2OTL T;  1K9M C;  3I35 A;  1J3T A;  1OOT A;  1VA7 A;  2CH4 W;  4M78 C;  1YJN A;  1LCK A;  1YCY A;  3L2W A;  4BY6 C;  4C5E A;  3SD4 A;  1LJO A;  2A0F B;  1JQQ A;  4PJL A;  3CCL A;  2QA4 Q;  2JM8 A;  3J81 E;  4DBH A;  1BCM A;  1V29 B;  2YRV A;  2PU9 B;  2HBP A;  2K4Y A;  2AIR B;  3EFO A;  5KYY A;  2DVJ A;  1GRI A;  1HSQ A;  2KYM A;  2PNI A;  4OMO A;  3JCM V;  3CPW P;  5FWB A;  1QWF A;  3C0C A;  2DAQ A;  1WXB A;  4J9C A;  1SSF A;  2A08 A;  3QJY A;  3X24 B;  2EYY A;  2ROT A;  3KUF A;  2KXD A;  1WHM A;  4FSS A;  1VYT A;  4C92 D;  1K8A C;  1WFW A;  3ZL7 C;  1Z9Q A;  2AKK A;  4XTZ A;  5GAN d;  5GAN 2;  2RM4 A;  2JS2 A;  2P0P A;  2D8H A;  1O9S A;  2L8D A;  3O8V A;  2F5K A;  3CEY A;  1K8A U;  1KHI A;  4IUV A;  4IUU A;  2OI3 A;  3OQ5 A;  2DMO A;  4J9G A;  1VQ6 Q;  1NJI R;  1ZSZ A;  3CCV A;  4BD3 A;  1IHW A;  2DJZ A;  2K5I A;  1RUW A;  2FG0 A;  1VQ5 T;  5GAM f;  2FEI A;  4N4I A;  4IUP A;  5IHK A;  3CD6 Q;  3HP9 A;  3VS4 A;  4OF1 A;  4F7U A;  1U5S A;  4JRK A;  3CCE Q;  4M77 B;  2KR3 A;  1UJY A;  3G4S Q;  2RB6 A;  1QP2 A;  4IIO A;  2XDD A;  1S72 Q;  2P4R A;  3DB3 A;  3EFS A;  2YUP A;  1KQ1 A;  2RMO A;  4EMK C;  4E7K A;  2ZPI B;  1UHC A;  2ZCF B;  3CCQ T;  4C8Q B;  2DET A;  2LDM A;  3BDL A;  1SF9 A;  1R77 A;  3FLG A;  3OS5 A;  1ABQ A;  4B9W A;  2I2L A;  4C0F A;  3OYK A;  1TU0 B;  3VS6 A;  3MEU A;  2RJD A;  3QDR B;  4M7D A;  2ZAE A;  3LWH A;  3MPU B;  2ABL A;  1H92 A;  2JT4 A;  2Y4Y A;  4C8Q D;  1VQK T;  2QAS A;  1I5O B;  1AEY A;  4OGC A;  1M3B A;  4XU0 A;  5LJ3 j;  1GCQ A;  1D3B B;  3GNF B;  3I56 Q;  4BDZ A;  3G7Z A;  1I1J A;  1D0Y A;  2RN8 A;  2XIC A;  2C06 A;  4C8Q A;  1QMC A;  4PKC C;  1CKB A;  1H3Z A;  5I2S A;  4C92 F;  4FT4 A;  2KRM A;  5CCA A;  4QVD A;  5D6W A;  3L1A A;  2RJF A;  4DBF A;  3I55 T;  1BI0 A;  3T9N A;  3L2V A;  1NYG A;  5LJ3 d;  2FVU A;  2FZC B;  1TH7 A;  2VGN A;  2QQS A;  2CSQ A;  5CKE A;  3QZ9 B;  2DX1 A;  3BE3 A;  4KUD K;  3CQT A;  2DFU A;  2KVQ G;  4CC2 A;  4BI8 B;  2Y90 A;  1U1T A;  1R0B G;  2Z0W A;  1M27 C;  1I5L A;  4ESR A;  1BI3 A;  3CD6 T;  1QQJ A;  1PRM C;  2AT1 B;  4MZP A;  2K5L A;  3CBP A;  3M0S A;  1JRI A;  1G2B A;  4C8Q C;  4QKU A;  1JJ2 A;  1T3L A;  2Y4X A;  3MET A;  1M90 R;  2NUP A;  3GBQ A;  2MIO A;  2DA9 A;  1OPK A;  4C0D C;  4V2S A;  2O2O A;  4RTW A;  4FW1 A;  3KXT A;  5CQX A;  3A5Z B;  2KXC A;  4GLK A;  3RBB B;  4A54 A;  3JCM b;  2JTF A;  3VS1 A;  4FW2 A;  1ZSG A;  1GCQ C;  1QCF A;  2MI6 A;  2V26 A;  2X51 A;  2MK5 A;  1YP5 A;  2LJ1 A;  4PFO A;  3J80 E;  3OS1 A;  5L23 A;  3EG9 A;  1BI1 A;  3P8D A;  1YIJ A;  1Q82 R;  4J6X A;  3TRE A;  2HKN A;  3CCU T;  3EH1 A;  2GQV A;  2ZPF B;  2DL4 A;  4RTZ A;  4D6W A;  1NM7 A;  2DTO A;  1KQS A;  1V1C A;  3KBG A;  2QI2 A;  1VQM A;  2M51 A;  3ZBD A;  1I8F A;  3JB9 J;  1X27 A;  4M75 D;  1VQ9 A;  2RD1 A;  1ZHI A;  3CC2 A;  2JW4 A;  2LQK A;  1QP3 A;  2H3E B;  1YWP A;  4M4Z A;  1G5V A;  2HL3 A;  4LDY A;  4M7A A;  3QII A;  3MP8 A;  4RTT A;  2LC4 A;  4ELY C;  1YJ9 T;  4XU1 A;  1UEC A;  1K73 R;  2RK2 A;  4FYX B;  2CZ7 B;  2RJE A;  2EYX A;  3GP8 A;  3GNG A;  2G6F X;  3OSV A;  2CZ1 B;  4J9I A;  4AG2 C;  2GF7 A;  5HKC A;  4RCB A;  1A0N B;  1YN8 A;  3NTH A;  4ANJ A;  1WJR A;  2EBP A;  1YIT T;  4DEY A;  3QUI A;  3MP1 A;  1ARK A;  2BZY A;  4FSX A;  4C5I A;  1VQ4 T;  5A2Q E;  4LXC A;  1XJW B;  1H8K A;  2E6Z A;  4LNP A;  1M8V A;  3DKM A;  4MMK A;  4JRP A;  3QG1 A;  1IB8 A;  1YBY A;  3M59 A;  1M8M A;  1R8O B;  2AK5 A;  5GMK l;  3CC7 Q;  2EQU A;  1QVF P;  2QQ9 A;  3PE0 A;  1KJW A;  2R5A A;  1DJ7 B;  4AFZ C;  5J3B A;  4C8Q F;  2DNU A;  2KY9 A;  3LWI A;  1QKX A;  4BE2 A;  4CC3 A;  5KYY B;  1TXQ A;  4AG1 C;  2NUT B;  4OB2 B;  4IUT A;  2CSI A;  4N0A A;  5GJW B;  2MYS A;  3CC7 A;  2E5K A;  1JJ2 P;  2PVG B;  1M9S A;  3RKW A;  3WVE B;  4A4F A;  5GAM j;  4OB1 B;  2DBK A;  4MZM A;  2QTX A;  1RI9 A;  2K3X A;  3CMA T;  3EG0 A;  4AFU C;  5CAI A;  3RMQ A;  1AWO A;  1M1K C;  2GTJ A;  2EYZ A;  2KRS A;  3U23 A;  5KCO A;  4JRQ A;  2XD0 A;  7AT1 B;  1SRL A;  2BTT A;  1O75 A;  2QA4 T;  3OMG A;  3SFM A;  3L2U A;  2M02 A;  1K73 U;  1WIE A;  4EDU A;  1K9M U;  4F16 A;  4QVC A;  2RHI A;  2CT4 A;  4HCZ A;  1X6G A;  2DD4 A;  4VUB A;  2QG9 B;  3G6E A;  1YJ9 Q;  4DEX A;  2AZV A;  3PIP A;  4JZ4 A;  2OTL A;  2LT4 A;  5KYN A;  3EAE A;  4KGV B;  3L2Z A;  1KC8 R;  3OYC A;  2HQX A;  2PQW A;  2EFI A;  3C95 A;  1P92 A;  1D0Z A;  1KK7 A;  1T3S A;  2JM9 A;  4J8O A;  3HRU A;  3AHU A;  3QO3 A;  4PFP A;  1K0X A;  3RR6 A;  4FL6 A;  4WTO B;  2YUQ A;  3UA6 A;  4AT1 B;  1VQM T;  2O4X B;  4FT2 A;  4D8K A;  3G1J A;  3S6W A;  1VQ9 T;  4Y91 A;  1SG5 A;  4M78 D;  4N0A C;  1FYN A;  5I11 A;  4Z8A A;  4E7L A;  5LJ5 d;  2RI5 A;  1Q82 U;  3E2U A;  6AT1 B;  2DEQ A;  3CCU A;  1WGS A;  3R6N A;  4A4G A;  1VQ6 A;  3S3N A;  2YUN A;  4M78 B;  2VGM A;  3SB2 A;  5DLO A;  3M55 A;  5CK9 A;  1E6H A;  1WQW A;  1XQH A;  2FRY A;  4HVV A;  1UGR B;  2DTH A;  3H0F A;  5GMK m;  2LZ6 B;  5KH6 A;  1RAI B;  2FL7 A;  3H8Z A;  1JBM A;  3QYH B;  2GCX A;  4LDX A;  3LYI A;  4C92 A;  1RAD B;  4KH1 B;  1OV3 A;  3E19 A;  2QYZ A;  4PJO B;  2H3J A;  4JJD A;  1WI7 A;  5GJV B;  2J6F A;  3LX7 A;  4II1 A;  1UFF A;  1EZZ B;  3CCJ T;  2A37 A;  3KFV A;  1PKS A;  5LJ3 e;  4NOY A;  2XDB A;  3GF5 A;  3JCM X;  2QGG A;  4PJO D;  1VQ8 Q;  2LTO A;  1VYV A;  3DB4 A;  2DXC A;  1W4S A;  4FU6 A;  4L59 A;  4RTU A;  3UT1 A;  4LD6 A;  2KT8 A;  1AVZ C;  5I22 A;  4X1V A;  4O6J A;  2DLP A;  4N4H A;  5GMK e;  2CP3 A;  1SKU B;  2QEX T;  4ME7 A;  2HSE B;  2K3Y A;  3A8L B;  1YJW Q;  4M77 D;  2EIF A;  2JXB A;  3SWN A;  4Y92 A;  2DIQ A;  3HHT B;  3RES A;  2EGA A;  1K9A A;  3NMZ C;  4DOW A;  4J9H A;  4OML A;  1YI2 A;  2OX7 A;  1IHV A;  2WSF E;  4J6Y A;  2J6K A;  5FRO A;  2J7I A;  1IRE B;  1VYU A;  4DQ2 A;  1D09 B;  2KRN A;  1N5Z A;  3EGX B;  1NEG A;  2J05 A;  3PTA A;  3CME A;  1TUG B;  1Q81 R;  5EG2 A;  2FO0 A;  5GAO m;  4YTL A;  4A63 B;  1X2K A;  1RAA B;  2RO0 A;  1U8R A;  4OMQ A;  5CR2 A;  1E7O A;  2R5M A;  3O5Z A;  2JMC A;  2EAY A;  1JJ2 S;  4P5N A;  4PK4 A;  3TQ7 P;  3M0R A;  3CBO A;  1PHT A;  4QQG A;  2A3L A;  3PT9 A;  2HD0 A;  4ZNX A;  2JTM A;  1BI2 A;  3I5S A;  3REB B;  2SRC A;  5HK0 A;  3CCJ Q;  2DL7 A;  1VQ7 T;  4F7U B;  3E9G A;  1QVG P;  5GAN 5;  3I9Q A;  1KD1 C;  4A4H A;  3RMS A;  3J7A F;  3RUX A;  1GBR A;  4M7A F;  2DIL A;  2AHJ B;  2PVO B;  2X3W D;  3S3O A;  3PIO A;  2DD5 A;  3OSS C;  5IHI A;  3SDZ A;  3NPF A;  2KQW A;  2P84 A;  1Q7Y C;  2GGR A;  1WHK A;  3TEE A;  1Q95 G;  3EHR A;  1Y57 A;  2X9H A;  5LJ5 f;  2ECZ A;  3E1S A;  4Z02 A;  1SPK A;  1YNZ A;  2CZ6 B;  5D6X A;  1M1F A;  2HKQ B;  3JCM J;  3F70 A;  2DL8 A;  1PSE A;  2AZS A;  4M77 C;  1QVG A;  2LCS A;  2E5Q A;  2EQK A;  4LDU A;  4ZTF A;  5IXB A;  2RHZ A;  1YIT Q;  1QW1 A;  4KUL A;  3TVT A;  1VOM A;  1OI1 A;  1M2V B;  2CS7 A;  4CC7 A;  2DKG A;  1FMK A;  1B34 B;  4XTX A;  4FYY B;  2E3H A;  3EG1 A;  5KYX B;  3HRS A;  3M0P A;  4QT7 A;  2F2X A;  5GAN j;  4ZGJ B;  5KE2 A;  3V7C A;  2EJG A;  4Y28 E;  2QEX Q;  3CMA A;  4OMN A;  1M3C A;  5IN1 A;  4BY6 B;  4M75 B;  4RMO A;  4HT8 A;  3HRT A;  1OU9 A;  2NUT A;  4HCB A;  2XDP A;  1LNX A;  2BUD A;  3A8M B;  3A1P A;  4WF2 A;  4JRI A;  1U3O A;  3OYL A;  3V7R A;  4ELZ C;  2QEX A;  3CMA Q;  2E64 A;  2QDY B;  5GAO l;  2EJF A;  3OW2 P;  1JO8 A;  1NE8 A;  2LRQ A;  3M4Y A;  1BB9 A;  4N4G A;  5EC7 A;  4M78 F;  3MEV A;  2FYK A;  3H41 A;  4M75 A;  5FU7 C;  2YT6 A;  1UTI A;  3VS0 A;  4OMM A;  1KQS S;  4C5H A;  2QA4 A;  1G3T A;  2CP5 A;  2O88 A;  2EQI A;  4RKU E;  1TUD A;  2GFU A;  1LPL A;  1T0J A;  1UGP B;  1X2Q A;  1QWE A;  3G71 T;  1N9S A;  2DPP B;  4BUG A;  1ZSZ C;  2L3Q A;  1EIF A;  1ACM B;  3I55 Q;  5GMK i;  2XHC A;  1QVF S;  3EG2 A;  1VQ5 Q;  1UDL A;  2O9V A;  3CCR Q;  2YWW A;  2ZPG B;  3EFR A;  1VQ6 T;  2PVD B;  4HT9 A;  1M30 A;  4QQD A;  2I0N A;  4E7J A;  4LDV A;  4KH0 B;  4M75 C;  3CC4 T;  2D0Q B;  2YUO A;  4M75 G;  1VQ8 T;  3JCM e;  4LN2 A;  3ME9 A;  1VQO T;  5CKD A;  1VQ5 A;  1Q86 U;  3CXC P;  1MHN A;  5HK3 A;  2CUD A;  2WAC A;  2A28 A;  4C92 C;  1NZ9 A;  5CIU A;  2HNI A;  4M77 F;  2RHX A;  4M7D B;  2XK0 A;  1TSF A;  4HCK A;  2LNV A;  3FJ5 A;  2JJ9 A;  4DOV A;  2IPO B;  3RNJ A;  4F7U F;  1YJW T;  1VQL Q;  1MV0 B;  5KYW B;  1FMW A;  3M56 A;  3VS5 A;  3CCL Q;  2V1Q A; 
#chains in the Genus database with same CATH homology
 3JRZ A;  3L2U A;  3MEA A;  4EDU A;  1K73 U;  1K9M U;  5M9O A;  4M7D D;  4QVC A;  2RHI A;  4HCZ A;  4XTY A;  3UWN A;  5I21 A;  1S72 A;  2DD4 A;  4J7I A;  4VUB A;  1X75 C;  3P8H A;  3JCM Q;  2PUK B;  5I2M A;  2QQR A;  3LW5 E;  5CO7 A;  3G6E A;  3CCM A;  3CC4 A;  1WJS A;  4QVZ A;  2RHY A;  3PIP A;  2OTL A;  2LT4 A;  3OMC A;  3CCE A;  1VQN T;  3JB9 F;  4EMK B;  3EAE A;  1Y71 A;  2EKO A;  4QQ6 A;  3WXM B;  4M77 E;  2ZPH B;  5A0L A;  3L2Z A;  5GAO r;  5GAO p;  3OYJ A;  1VQO A;  3QYG B;  1VQL A;  4M7D C;  3BW1 A;  4M78 E;  2HQX A;  2PQW A;  3OYC A;  1S72 T;  1OYX A;  2EFI A;  3C95 A;  5LJ3 f;  1P92 A;  3CCR A;  3VUZ A;  3G6E T;  1NJI U;  3OW2 A;  3OYF A;  3HKS A;  4NL2 A;  5DM7 R;  2E65 A;  4J8O A;  5AYF A;  5LJ5 g;  4A4E A;  3HRU A;  3AHU A;  3QKJ A;  3H6Z A;  2HAX A;  3QO3 A;  5GAN h;  3FB9 A;  1KG1 A;  4JUV A;  3TCJ A;  4BAC A;  3MHX A;  4FL6 A;  1ZBX A;  3JCM f;  3CCR T;  3FJP A;  2F5T X;  1VQM T;  1IZ6 A;  2O4X B;  4FT2 A;  5GAM g;  1YHQ A;  2JZ2 A;  3RIR A;  3S6W A;  2VV5 A;  3V7S A;  2V8K A;  1VQ9 T;  4PLL A;  4Y91 A;  4J5Y A;  1NJI C;  5DLQ E;  2WSC E;  1VQ4 A;  1M1K U;  3I56 T;  4M78 D;  4N0A C;  2L3R A;  3C4S A;  5IT9 E;  4E7L A;  5LJ5 d;  2RI5 A;  1Q82 U;  5L8R E;  4KBM B;  4ZGE B;  2P0K A;  1BIA A;  2KK4 A;  4M77 G;  3CCM T;  3PGG A;  4MML A;  3OS0 A;  1GXI E;  2DEQ A;  3LH0 A;  3OYA A;  3CCU A;  2OTL T;  5C0M A;  1K9M C;  1WGS A;  4IUR A;  1NPP A;  3M9Q A;  2CZ0 B;  4A4G A;  4E47 A;  5LJ5 e;  1VQ6 A;  4M78 C;  4MDW A;  1YJN A;  1YCY A;  3L2W A;  3FC3 A;  4BY6 C;  3S3N A;  2RHU A;  2VGM A;  4M78 B;  3SB2 A;  5DLO A;  4M75 F;  4B9X A;  2X4W A;  3M55 A;  4C5E A;  2LCL A;  3SD4 A;  1LJO A;  5CK9 A;  2ZPB B;  1WNL A;  4BB7 A;  1WQW A;  1XQH A;  1KQ2 A;  2MWP A;  3CCL A;  3CC2 T;  4C8Q G;  4PJO E;  3X26 B;  3OB9 A;  1UGR B;  2DTH A;  3J81 E;  3UPU A;  3R6O A;  5GMK m;  1V29 B;  4LDW A;  5KH6 A;  3JB9 G;  2FL7 A;  2YRV A;  3FRN A;  2PU9 B;  3H8Z A;  4KT0 E;  2HBP A;  2K4Y A;  4QW2 A;  5KE3 A;  1JBM A;  3QYH B;  2GCX A;  3QBY A;  2KAF A;  4M75 E;  1YJ9 A;  4JLI A;  4LDX A;  4KUI A;  2QQB A;  3LYI A;  4OP0 A;  4C92 A;  2DIG A;  1UGQ B;  3E19 A;  2HQE A;  2RI2 A;  2IVW A;  3BY7 A;  3JCM V;  4PJO B;  4IKF A;  2R58 A;  2H3J A;  2DAQ A;  1SSF A;  4EPC A;  3QJY A;  3ER0 A;  3X24 B;  4OGE A;  4DA4 A;  3LX7 A;  3KUF A;  5A0D A;  4II1 A;  1VQP T;  3VV0 A;  3CCJ T;  5GAM d;  5CVI A;  4OB0 B;  3N5B B;  4F7U G;  1YI2 T;  4C92 D;  1M1G A;  4BI4 A;  3OBW A;  4NOY A;  5LJ3 e;  2XDB A;  3GF5 A;  3ASK A;  3LLR A;  3JCM X;  1N8R U;  2DO3 A;  4PJO D;  2RK1 A;  1K8A C;  2EWN A;  4C5G A;  3MCA B;  2LTO A;  2XG8 D;  2CGH A;  1G3W A;  3DB4 A;  2DXC A;  1W4S A;  4XTZ A;  2MAM A;  1H64 1;  4FU6 A;  4JLG A;  3JAM E;  5GAN d;  4L59 A;  5J26 A;  5GAN 2;  2RM4 A;  3UT1 A;  3FEO A;  3CCL T;  4PJO F;  2P0P A;  4EMG A;  4C92 B;  4A4K A;  4MZT A;  3PNW C;  3E9F A;  3L42 A;  4LD6 A;  1Y96 B;  2LQ8 A;  2L5Q A;  5GAO q;  2B8A A;  1O9S A;  2L8D A;  3O8V A;  4O6J A;  5GAN f;  2V8I A;  2F5K A;  3CEY A;  1K8A U;  4N4H A;  5GMK e;  1KHI A;  4IUV A;  4BE1 A;  4A53 A;  2QEX T;  4ME7 A;  2K3Y A;  2KDS A;  4IUU A;  3A8L B;  3VKI A;  3OQ5 A;  2JN0 A;  2EIF A;  4M77 D;  1XTD A;  5GAM h;  4ZGD B;  2VC8 A;  3SWN A;  3CCV A;  2DIQ A;  4BD3 A;  3HHT B;  3RES A;  4BI3 A;  2MF2 A;  3INZ A;  5FU6 C;  4O5V A;  2PUO B;  2DJZ A;  2VUB A;  3CPF A;  2E1H A;  4DOW A;  2LX9 A;  2K5I A;  3L2R A;  3DLL A;  3CCJ A;  2ZZD A;  3GPL A;  3M58 A;  2LT1 A;  5GAM f;  1YI2 A;  1QVG S;  4N4I A;  4IUP A;  1VQ5 T;  2WSF E;  4J6Y A;  4PNO A;  5FRO A;  1WQ7 A;  1RL2 A;  4CRI A;  1IRE B;  5GAO n;  3QSU A;  1UGS B;  3HP9 A;  3I56 A;  4DQ2 A;  4OF1 A;  4F7U A;  2M9U A;  2QXF A;  4JRK A;  3CCV T;  1Q86 C;  5GAN 8;  4M77 B;  1Y07 A;  5KCH A;  3OBY A;  3HFN A;  3CCQ A;  3PTA A;  3CME A;  3M54 A;  2JUF A;  2RB6 A;  1QP2 A;  5EG2 A;  2XDD A;  2K57 A;  2YHT A;  3URG A;  3DB3 A;  5LJ5 h;  3EFS A;  5GAO m;  3OYB A;  2YLC A;  4YTL A;  1KQ1 A;  1WJQ A;  2RJC A;  4C0D B;  1Q7Y U;  2IG0 A;  1YJN T;  3HL8 A;  2RO0 A;  4EMK C;  3PFS A;  4E7K A;  2ZPI B;  1VIF A;  1W2B S;  4PJO A;  2ZCF B;  1U8R A;  3P8B B;  1OZ3 A;  3CCQ T;  4C8Q B;  2OAU A;  3VYG A;  4RG2 A;  2OTJ A;  3A8G B;  2LDM A;  3BDL A;  5CR2 A;  2R5M A;  2DTI A;  2KMT A;  4Q5W A;  4M7D F;  3FLG A;  2YLB A;  3OS5 A;  1FXX A;  4B9W A;  2I2L A;  1VQK A;  4ZN3 A;  3SWN B;  2EAY A;  4M78 G;  4C0F A;  3G4S T;  1JJ2 S;  1LOJ A;  4P5N A;  3OYK A;  2E41 A;  1UB4 A;  2RI3 A;  1VQ7 A;  2A7Y A;  3RKY A;  4F7U E;  2D9T A;  2RJD A;  3MEU A;  3QDR B;  3M57 A;  4M7D A;  3CBO A;  4QQG A;  2A3L A;  3PT9 A;  4L6V 5;  4JDS A;  3LWH A;  2HD0 A;  3OS2 A;  3A8H B;  2JTM A;  2O4X A;  3JB9 I;  1Q82 C;  2NLU A;  2Y4Y A;  1BI2 A;  4C8Q D;  2E10 A;  1VQK T;  5HK0 A;  3JB9 J;  4OGC A;  3GOX A;  4XU0 A;  5LJ3 j;  1VQ7 T;  1Q81 U;  2M1H A;  4F7U B;  3Q1J A;  3VJP A;  1D3B B;  1AHJ B;  3E9G A;  3M5A A;  3CME T;  5GAN 5;  2DXB A;  1KD1 C;  3GNF B;  4A4H A;  1N27 A;  4BDZ A;  3RMS A;  3J7A F;  1YHQ T;  3G7Z A;  1FX7 A;  3RUX A;  3RKX A;  2RA2 A;  2XIC A;  3OYH A;  2C06 A;  4C8Q A;  3DLM A;  2BKD N;  4ATO A;  4M7A F;  1KHC A;  4PKC C;  2AHJ B;  3JCM d;  2PVO B;  3CBM A;  4PLI A;  4XQ3 A;  3VU3 C;  3S3O A;  3PIO A;  1H3Z A;  2DD5 A;  5I2S A;  2X4J A;  4OVA A;  2LCC A;  3VYH B;  1HK9 A;  3OSS C;  4FT4 A;  2L89 A;  4C92 F;  4C92 G;  5CCA A;  3SDZ A;  4M7D E;  1ZQ1 A;  1K73 C;  4QVD A;  4E7H A;  4ZTJ A;  5D6W A;  3L1A A;  3BDU A;  2RJF A;  4HCC A;  3OYG A;  2KQW A;  2V8J A;  3I55 T;  3QJ6 A;  1BI0 A;  4BE0 A;  3T9N A;  3L2V A;  3PMT A;  5LJ3 d;  1Q7Y C;  3CCS A;  2EYQ A;  3WVD B;  2FVU A;  1Y7X A;  4X34 A;  3PMI A;  3TEE A;  3C12 A;  4J6W A;  1TH7 A;  2VGN A;  1WPY A;  2QQS A;  5CKE A;  3QZ9 B;  2M16 A;  3JB9 H;  3QPH A;  3OYD A;  5LJ5 f;  4KUD K;  2LVM A;  3E1S A;  4Z02 A;  2KVQ G;  4BI8 B;  4R55 A;  2Y90 A;  1U1T A;  1M4Z A;  2BIV A;  4C0Z A;  2CZ6 B;  5GAN g;  5D6X A;  4X9D A;  1M1F A;  1I5L A;  3JCM J;  2XI9 A;  1N9R A;  1BI3 A;  2DXT A;  3MO8 A;  3NFC A;  3CD6 T;  2P4T A;  3F70 A;  1PSE A;  4M77 C;  1QVF A;  3X20 B;  3SWN C;  1QVG A;  1X01 A;  4MZP A;  2K5L A;  2JOY A;  2EQK A;  2E5Q A;  3CBP A;  3OW2 S;  4LDU A;  2O01 E;  3NTK A;  4RG8 A;  4ZTF A;  5CQY A;  4NL3 A;  1JRI A;  1VQL T;  2RHZ A;  2X35 A;  4C8Q C;  3UDC A;  1JJ2 A;  1Q81 C;  1VUB A;  2Y4X A;  4XTV A;  1QW1 A;  2CKK A;  3MET A;  4KUL A;  3MEW A;  3OYI A;  1OI1 A;  2DVE A;  4HKE A;  2CS7 A;  3HPW A;  2DKG A;  2RH2 A;  3X25 B;  4C0D C;  5FRN A;  2P0Q A;  5IAY A;  4V2S A;  1B34 B;  2MWO A;  1VQ8 A;  4XTX A;  3JSC A;  5FU7 B;  3KXT A;  5CQX A;  1W2B A;  2E6N A;  4XK8 E;  5A0G A;  3A5Z B;  5LJ5 j;  4HA8 A;  1OZ2 A;  4GLK A;  2DK3 A;  2FB7 A;  4A54 A;  3JCM b;  3HRS A;  3OYM A;  2JTF A;  5GAN j;  3OYE A;  3CCS T;  4OMF B;  1G3S A;  4ZGJ B;  5DY9 A;  1RI0 A;  3V8J A;  3JCM h;  3V7C A;  1MGQ A;  5GAN e;  5KE2 A;  2EJG A;  2MI6 A;  4Y28 E;  3CMA A;  3J80 E;  5GAN 4;  1D3B A;  4CI0 C;  2ZGW A;  3OS1 A;  5IN1 A;  4BY6 B;  4M75 B;  4RMO A;  1BI1 A;  3L2Q A;  3GIB A;  4M7A G;  1XOV A;  3HFO A;  4PL6 A;  1JB0 E;  4HT8 A;  3HRT A;  3P8D A;  1YIJ A;  1YJW A;  4J6X A;  1G3Y A;  3TRE A;  3CCU T;  4HCB A;  3CD6 A;  5HY6 A;  5GMK h;  4FIB A;  2XDP A;  1LNX A;  2GQV A;  2BUD A;  2X4X A;  2ZPF B;  4D6W A;  3A8M B;  4M7A C;  2X4Y A;  2DTO A;  2JVV A;  4WF2 A;  2XKO C;  4JRI A;  1M90 U;  1KQS A;  3V8L A;  3LGL A;  3QZ5 B;  3KBG A;  2QI2 A;  3CPW S;  1VQM A;  3CC7 T;  4E7I A;  3OYL A;  3ZBD A;  1I8F A;  3V7R A;  1HXD A;  4ELZ C;  2QEX A;  2E64 A;  2VXF A;  4M75 D;  2QDY B;  4X9C A;  5GAO l;  1VQ9 A;  2RD1 A;  1ZHI A;  5LL6 S;  5GAN 7;  3CC2 A;  2EJF A;  5GAN 3;  2LQK A;  4EMH A;  1QP3 A;  3V8K A;  1FWZ A;  2EQJ A;  1NE8 A;  2FHD A;  3S3M A;  1G5V A;  4LDY A;  4M7A A;  3QII A;  4PJO C;  3MP8 A;  2LRQ A;  3GLX A;  2LC4 A;  1M5Q 1;  1NPR A;  3M4Y A;  2OTJ T;  4ELY C;  4N4G A;  1YJ9 T;  4XU1 A;  4M78 F;  3MEV A;  5CKH A;  5LJ3 g;  2DZ9 A;  2FYK A;  2WSE E;  2RK2 A;  4M75 A;  1M90 C;  5CKB A;  5FU7 C;  3G4S A;  2CZ7 B;  1KQS S;  4M7D G;  2K5F A;  4R56 A;  2RJE A;  4C5H A;  3CXC S;  4UC4 A;  1YIT A;  3GP8 A;  1KC8 C;  2QA4 A;  2EJ9 A;  1UEB A;  4M77 A;  1G3T A;  3GNG A;  3G71 A;  3OSV A;  2MMP A;  1BIB A;  4FM4 B;  4RKU E;  3TU4 K;  2CZ1 B;  1Y96 A;  3A8O B;  2GFU A;  4RCC A;  2DZC A;  3C94 A;  3OMG A;  2GF7 A;  5HKC A;  1UGP B;  4RCB A;  1I81 A;  1VQP A;  4J7F A;  1U1S A;  2JNG A;  3NTH A;  1VIE A;  1WJR A;  5D6Y A;  3JCM g;  1YIT T;  3HSB A;  2XID A;  3QUI A;  3CCE T;  3MP1 A;  5FRM A;  2XU8 A;  3G71 T;  4FSX A;  5LJ3 h;  4XTW A;  1N9S A;  2DPP B;  4C5I A;  4BUG A;  5A2Q E;  3OA6 A;  1VQ4 T;  2E6Z A;  4M7A E;  1EIF A;  3JCM W;  1M8V A;  3DKM A;  4MMK A;  5GMK i;  3QG1 A;  1X6O A;  3LGF A;  2XHC A;  4JRP A;  4C8Q E;  1KD1 U;  1QVP A;  1B34 A;  1YBY A;  3M59 A;  4ZN1 A;  1QVF S;  1R8O B;  1I4K 1;  2M0O A;  4XAX B;  5GAM e;  5GAN 6;  5GMK l;  5J39 A;  2EQU A;  5GMK j;  4LD9 K;  4M7A B;  2GFA A;  2QQ9 A;  3FDR A;  1XNI A;  2R5A A;  1DJ7 B;  2R57 A;  2ZPG B;  3CXC A;  1BYM A;  3EFR A;  5FLX E;  5J3B A;  4C8Q F;  3CPW A;  2QQA A;  2PVD B;  4BDY A;  1VQ6 T;  4HT9 A;  4QQD A;  4OB3 B;  3ZEH A;  3RER A;  3ZFJ A;  2KY9 A;  3M4G A;  4E7J A;  4LDV A;  3LWI A;  5C6S A;  2EQM A;  2ZPE B;  4M75 C;  4BE2 A;  1N8R C;  3OY9 A;  3CC4 T;  4XU2 A;  2KSS A;  2D0Q B;  1BKB A;  3JB9 D;  4M75 G;  4EMK A;  1VQ8 T;  1VQN A;  4OB2 B;  4C0G A;  4TVR A;  4IUT A;  3JCM e;  4M7A D;  4J83 A;  3ME9 A;  4N0A A;  1VQO T;  3M53 A;  5CKD A;  3CC7 A;  1VQ5 A;  3QHS A;  2VYT A;  1Q86 U;  3JCM P;  1MHN A;  4PJO G;  1N6A A;  2PVG B;  1M9S A;  2VXE A;  3RKW A;  3WVE B;  4XTU A;  4A4F A;  5HK3 A;  1KC8 U;  5CKF A;  5GAM j;  2WAC A;  4OB1 B;  2F69 A;  2QA4 T;  4MZM A;  4C92 C;  1YIJ T;  1NZ9 A;  5CIU A;  2HNI A;  3QXE B;  4C92 E;  2QTX A;  4M77 F;  3NTI A;  4GY5 A;  3JCM c;  4JJN K;  2RHX A;  2K3X A;  3CMA T;  2E12 A;  4XU3 A;  4M7D B;  2XK0 A;  4JS5 A;  5CAI A;  2E70 A;  3OYN A;  4IUQ A;  4L5G A;  5FU6 B;  2DXU A;  4M78 A;  3OYY A;  3RMQ A;  2LNV A;  4DOV A;  1M1K C;  4MDX A;  3MP6 A;  3VUB A;  5KCO A;  3X28 B;  1PSF A;  3FIF A;  4JRQ A;  2XD0 A;  4F7U F;  1YJW T;  2G3R A;  2CYZ B;  3I55 A;  1O75 A;  2D6F A;  3M56 A;  2K2V A;  3BFM A;  4NS5 A;  4JS4 A;  3SFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...