5LJ5h

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
b'MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
molecule tags Splicing
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5h00
2FB7A 4PJOB 5GANe 2YHTA 3INZA 4J5YA 5GMKm 3JCMJ 3EFSA 1I4K1 3L2ZA 3SWNB 3V7CA 5GANh 4M78G 3BDUA 5LJ3g 4M78A 3JB9H 4EMKA 4M7DE 1TH7A 2RB6A 4OP0A 4N0AC 4XTXA 2YLCA 4XQ3A 3RESA 3JB9D 1D3BA 3JB9F 3BY7A 5LJ5f 5LJ5d 1X01A 2E1HA 3HFOA 3JB9J 4XU3A 4M7AB 5GMKh 4M77B 3JCMg 3JCMc 4QVCA 4RCBA 3JCMe 2YLBA 5LJ5j 4M78E 2DTHA 4PNOA 4M77A 3GIBA 4HT8A 2DZCA 2E65A 2DXTA 4X9CA 2I2LA 2JN0A 3RERA 5GAMf 4M7DF 5GAMd 5GAOq 4JRKA 4M7DA 4C8QG 4J6XA 3V7SA 3VU3C 4C8QA 4M75B 4XU2A 2DEQA 5GAMj 3JCMb 1N9SA 3FIFA 4F7UA 4C92G 5GAN5 4HT9A 5GANg 5GAN3 4M78F 3V7RA 4C92A 4JUVA 1JBMA 4PJOG 3JCMP 3QSUA 3RKXA 5LJ3j 3FJPA 4M7DC 4PJOA 4C8QE 2VXFA 4MMKA 1H641 3SWNA 3JCMX 2DKGA 4NL2A 4C92E 3JB9I 5GMKe 4PJOE 4EMKC 1BIBA 2DTOA 1WPYA 1HK9A 1WNLA 3RIRA 4M7AG 3L1AA 2FYKA 4M77G 3QUIA 3BW1A 5GAMh 5GAN2 5LJ5h 4M7AA 5GAN7 4XTYA 4EMHA 1MGQA 2DJZA 3V8JA 3JCMQ 3HFNA 4M7DD 4WF2A 1HXDA 4DQ2A 4C92F 4J6WA 3QHSA 4RCCA 2DTIA 4X9DA 3EFRA 4M75G 4M77E 4PJOF 2DXUA 4F7UG 3BFMA 4N0AA 4M75A 2E64A 4XU0A 5LJ3f 5LJ3d 5GAN8 4M78D 4JLIA 2VXEA 4JRIA 3RKWA 4NOYA 2EJFA 4M75E 4F7UE 3V8KA 3JCMd 5GAOn 4PJOC 2RA2A 1I81A 4M7AF 4XTWA 4M77F 1Y96B 1I5LA 4XU1A 2E41A 4M78C 2DVEA 5LJ5g 5LJ5e 3FB9A 2K57A 1LOJA 2QTXA 1M5Q1 1U1SA 4Y91A 5I21A 1BIAA 1WQWA 2DZ9A 1B34B 4C8QF 4C8QD 4M7DB 4XTZA 1M8VA 3QO3A 1B34A 4NL3A 4M75F 4A53A 4F7UF 5GAMg 5GANf 4M7AC 4M77C 5GAMe 3PGGA 5GANd 2RD1A 2EJGA 4C92D 5GAOr 2EAYA 3V8LA 5GAN6 2HNIA 2Y90A 3JCMW 3HSBA 4PJOD 4M7AE 4V2SA 4M78B 3JCMV 4EMKB 4J6YA 3SB2A 1KQ2A 5GAOl 4C8QC 1JRIA 4HA8A 5LJ3e 1D3BB 3RKYA 1U1TA 5GMKi 1YCYA 4M75C 1LNXA 1KQ1A 1LJOA 4XTUA 2EJ9A 2RM4A 5LJ3h 2CGHA 5GAOm 2EWNA 2E10A 4C92C 5GMKj 3JCMf 4EMGA 4QVDA 4MMLA 3JB9G 1I8FA 4M7AD 4M77D 3AHUA 1WQ7A 3SWNC 3JCMh 1Y96A 2VC8A 4C8QB 5GANj 2ZGWA 4F7UB 1N9RA 5GMKl 5DY9A 3M4GA 5GAN4 5GAOp 4A54A 4M7DG 3RUXA 4C92B 4M75D 4XTVA 5CAIA
chains in the Genus database with same CATH superfamily
3DKMA 3V7CA 3CC4Q 1ZLMA 1YBYA 4II1A 1WHHA 3KFVA 3JB9F 2E1HA 1NYFA 1LVKA 3HRUA 2EYQA 3FC3A 2M16A 2QGGA 2JN0A 2PU9B 1KHIA 1S1NA 4J6XA 1M1KU 1D1AA 2QQ9A 1VA7A 1ZSGA 4M7DC 2RJFA 2YXYA 2O31A 1NYGA 3EGXB 3SWNA 1WHGA 1HJDA 1GCQC 4LDYA 2CH4W 4OB3B 3I55T 2DJQA 2RQWA 5LJ5h 3CPWA 2M1HA 2K3BA 2PUKB 4MZTA 4OGEA 3LGLA 2VV5A 1M3CA 4PL6A 1ABQA 3CQTA 2GTJA 3OBWA 3PIOA 1DJ7B 5CO7A 3QYGB 2QEXT 4DOVA 2XI9A 4ZTJA 3CBOA 4FYVB 2A36A 2E41A 3S3OA 2A37A 3CMAQ 2J6OA 2XU8A 3VRZA 7AT1B 2HSEB 3MJXA 1QVGA 2ROTA 1AVZC 2ESWA 3VS6A 4CC7A 1JJ2P 5GANf 1ZHIA 4ANJA 1QVFP 1WJQA 4RTVA 1TWBA 3JRZA 3PFSA 1K0XA 3O5ZA 1YIJA 2FRWA 3HHTB 1GBQA 2KMTA 3CCEA 4JRPA 3EG0A 4GBQA 2JTMA 4C8QB 5CKFA 2XDPA 1ZA2B 2K6DA 1M27C 5HK0A 1VQOA 5CAIA 2DL4A 4EPCA 2HQXA 3E1SA 2YWWA 4OB1B 2A0FB 1WA7A 1MUZA 4PNOA 3THKA 4X9CA 5CCAA 1GXIE 2EYXA 3VKIA 3FJ5A 3JCMP 2OI3A 4IUQA 2VXFA 2GFAA 3UWNA 3CC7Q 2F69A 2HMAA 4BUGA 1WZOA 1WJRA 2X3WD 4PJMA 1HK9A 3VUZA 2FYKA 5GAN2 4CI0C 1GRIA 3DLLA 4Z8AA 2PQWA 5D6YA 2AK5A 2QTVA 3G1JA 2QA4Q 3LX7A 1KFZA 3BFMA 1E7OA 2DETA 3QG1A 3EG3A 3EGDB 4FYYB 4MDWA 1KK7A 5LL6S 2DRKA 1VIFA 1I81A 4KUDK 4XU1A 2QDYB 2RN8A 4C5EA 5M9OA 1B34B 2QASA 2J6FA 3RNJA 2M9UA 4A53A 3VYHB 3CCMA 1Y07A 3L2WA 3HSBA 2ZPHB 1XQHA 4QT7A 2CZ6B 4AG1C 2GQIA 2MCNA 3L2RA 3I5RA 1S72Q 8ATCB 1WLPB 4E7SA 1PM3A 3AHUA 1VQPT 4E7JA 3OQ5A 2X51A 1OZ2A 5A2QE 1OX9A 1V29B 3HRTA 2LCCA 2LX7A 5GMKm 2V8JA 1Q82R 4HCBA 2O88A 1JB0E 1RL2A 2BIVA 4EMKA 3EG1A 4ELYC 3BY7A 3E9GA 2H8HA 3HFOA 4M77B 1M1KR 1W6XA 3EFOA 1RLPC 5GAOq 2E4HA 1MMAA 1JJ2A 2MI6A 2FZGB 5FU7C 4PJOG 4J7FA 1RACB 4MMKA 2HD0A 3BDLA 4XAXB 1IGUA 1NEGA 2RHZA 4E7KA 2O4XB 4L59A 4PJOE 2DA9A 1AHJB 1E6GA 3RIRA 2JW4A 3QUIA 1YI2A 4E7ZA 1D0XA 1MNDA 2M0OA 4ZGEB 3TU4K 4FSXA 1GCPA 1ZBJA 4A4FA 2LX9A 2V1RA 3X25B 1Q7YU 1M90C 4A4GA 1VQ8A 4OMLA 2V8IA 4BI8B 4JJNK 2EJFA 1SF9A 2VKNA 3PIPA 2KNBB 2L3PA 2B8AA 4M77F 1GFCA 4WCIA 4RMOA 2BZXA 1G5VA 3OMCA 2OTLQ 1V1CA 2FZKB 4ZGJB 4HXJA 2EJGA 1KJWA 2SRCA 1YIJQ 3OMGA 1LCKA 2JNGA 4V2SA 3OYKA 4C5HA 3REAB 3SB2A 3CPWS 3EAEA 3CD6Q 3CEYA 1QMCA 1Y57A 4A4EA 5I2SA 2K9GA 1FMWA 4Z88A 1PRLC 1TS9A 2ED1A 2ZGWA 3MEAA 3M4GA 3SFMA 5FROA 1N5ZA 1RAFB 5AYFA 1NPRA 2IIMA 2EKHA 1QCOA 1QVGS 1BK2A 1X27A 2RB6A 1PRMC 5AT1B 4FIBA 3JB9D 2KVQG 2CREA 1YWOA 1G3SA 1M3AA 4JLGA 1NJIC 3E9FA 3GIBA 3FLGA 5L8RE 3G4SQ 1YWPA 3G71T 4LDXA 4BY6B 1C6VX 3MEUA 4HKEA 2AIRB 3OS5A 3FIFA 3I5SA 1PG5B 5GAN3 4KH0B 1KC8C 2KT1A 2CSQA 1H641 1VQPQ 2W10A 4ZGDB 1VQLT 2DL7A 3C95A 1ZUKA 2HZYA 2XMFA 2JMCA 3PVLA 5KYXB 2HKNA 3M5AA 1WPYA 1K73C 2ZPFB 2K3YA 4PJLA 1UECA 1B3QA 2F5KA 4Y28E 4E47A 2EW3A 2PUOB 2NUTA 4CC2A 4RCCA 3EFRA 1HSQA 2K5LA 3KXTA 2CP3A 3TVTA 4PFPA 1VQ5T 1VQ7T 1OPLA 3A8GB 1EZZB 3VS2A 4PLLA 1UE9A 2RJCA 3REBB 3CCMQ 1X43A 3QWYA 2E3IA 2WSFE 1YJ9Q 4M77C 2RHXA 2LNHB 1GCQA 2LC4A 2LJ1A 3L2QA 5GAOm 5IHIA 3I9QA 5GJVB 3I56A 2VC8A 1K8AU 1AWWA 5GAN4 4M7DG 1TUGB 4XTVA 2MPXC 1B07A 4DEYA 4AFUC 1I4K1 4J9CA 4RG8A 5FRMA 2MWPA 2LQNA 2F2WA 4M7DE 3M0TA 1JQQA 2EQMA 4HVWA 1U06A 3C4SA 2MWOA 3LWHA 3URGA 3JB9J 4M7AB 1KD1U 1OZ3A 2FEIA 4RCBA 1V76A 1H92A 2L3SA 4KH1B 3CPWP 1K9MU 3G6EQ 1XTDA 4M75B 2DIQA 3MPUB 1N9SA 1X69A 4BE2A 4CRIA 1VQ9Q 1X75C 3FJPA 3MEVA 2F1LA 1PD0A 2G3RA 4N4HA 4ZN1A 3JCMX 3GOXA 1YI2Q 1VQNT 1UJYA 2KY9A 4ME7A 1NE8A 1M2VB 1WNLA 2LTOA 3ZL7C 4EMHA 1QVGP 2SEMA 4IUPA 4WF2A 1YJNQ 1VQ8Q 1YJWQ 5D6XA 3QHSA 4K11A 4JS4A 2DTIA 3CCRA 3ER0A 1VQKA 3JV3A 2YSQA 3PTAA 3CCQT 2KGTA 1FX7A 1VQ6T 1VQ4T 4MDXA 2HSPA 4M7AF 2X4YA 3A5ZB 1OPKA 1I5LA 2K57A 3OS0A 3SD4A 4IIOA 4M75F 3CC2T 2OJ2A 4BE1A 4J8OA 5GAMe 2CDTA 2MAMA 3LGFA 2HNIA 5A0GA 1C0MA 4M78B 4CC4B 4BY6C 1PSEA 1RLQC 1C1AA 4PJJA 1LNXA 4RTUA 3C0CA 3ZFJA 2CGHA 2E10A 1UDLA 2DIGA 3JB9G 3LWIA 1M3BA 1GFDA 3NTIA 1XOVA 5HY6A 5CKBA 2PNIA 2LP5A 5DY9A 3HRSA 2M02A 2QYZA 4C92B 1BI0A 5EC7A 4WTOB 1R0BG 2KXDA 1VQ7Q 3CCST 2HAXA 3EFSA 3PVQA 2RPNA 2DYBA 5GANh 1NLOC 3BDUA 2AT1B 2KYBA 1H3ZA 1VUBA 1OULA 3M53A 2ATCB 3MO8A 4IURA 1IZ6A 4XU3A 1T3LA 3JCMe 5KYYA 1UEBA 2DL5A 2LRQA 1G2BA 1QWFA 1I1JA 2VWFA 4JZ4A 2PTKA 2DX1A 2M0YA 2CP7A 2EYZA 3OSVA 2DMOA 4M78F 4OB2B 3OYIA 1UTIA 2RMOA 5FU6C 3GP8A 3QXEB 1Q82U 3HP9A 3GLXA 2COZA 2BZ8A 3H6ZA 1IHWA 2GNCA 1RAGB 1UG1A 3WVEB 4C92F 2VASA 3ULRB 4EDUA 2XKOC 2WSEE 4RTZA 1YHQT 2QQRA 2RA2A 1NBEB 2OTJT 1D1CA 2K5IA 2RI3A 4A4KA 1VQMT 2QQAA 2DFUA 1YN8A 3EG9A 4F7UF 4FYWB 2RQUA 4BDZA 4M7AC 2FHDA 2QDLA 2EAYA 3JCMW 2LCLA 4OMNA 4HVUA 4PJOD 4QW2A 4RTWA 3X26B 2LCSA 1JRIA 3P8DA 1QW1A 4FW2A 2F2VA 4M75C 1NZ9A 4C5GA 2IPOB 3I56Q 4B9WA 1K8AR 4OB0B 5GMKj 2LQWA 1K76A 2E70A 3A8LB 3NGPA 5GMKl 2EGAA 4GLKA 1M4ZA 4HT8A 3QYHB 3EHQA 2OTLA 3L2ZA 3SWNB 1KD1R 1WXBA 4J9GA 3HTRA 1Q95G 1RUWA 1PWTA 1K9MR 1MMDA 3HL8A 3CC2Q 4PKCC 3JCMc 3EH1A 1ZUUA 1PSFA 2DLPA 2HQEA 3CD6A 1YFNA 1RAEB 4C8QG 2GGRA 1NM7A 2DEQA 2P0KA 3PNWC 5GAN5 2NWMA 1Q81C 2D0NA 3HKSA 3SHWA 2E5KA 1Y71A 4C8QE 3OYGA 3OYAA 2ED0A 3TSZA 1EIFA 1FMVA 3CCRQ 3M4YA 4RUGA 1VQKQ 2J05A 1AT1B 2G6FX 2ZPIB 3G4SA 3LW5E 3QIIA 1MV0B 2BTTA 1YITT 3VUBA 2FVUA 4IUUA 1TU0B 3QWXX 2XK0A 1KG1A 2IG0A 1VQPA 1LOJA 5I21A 3H9NA 1WQWA 3ME9A 4C8QF 5A0LA 1B34A 4ZN3A 4NL3A 2FPDA 1K1ZA 3V8LA 2EPDA 4B6MA 2R5MA 1TXQA 1D1BA 1SEMA 4J9DA 3CCET 1N8RR 1Y7XA 2YUNA 4PJNA 4BDYA 1TUCA 2K2VA 2D9TA 2YT6A 1WHKA 2DYIA 3AT1B 4HCKA 2JVVA 2HBPA 3CMET 2VB6A 4C0GA 2QI2A 1VQOT 1YHQQ 1SKUB 1TOVA 5GANe 4J5YA 4XK8E 3I55Q 1IRXA 4IIMA 1YJ9A 2A3LA 2A28A 4OP0A 1UGSB 2JOYA 5GMKh 2DTHA 1BBZA 4M77A 2DZCA 4IKFA 2K7AA 5GAMd 1X2QA 2BUDA 2EGCA 3CCUT 2DPPB 3L2UA 1H8KA 3TEEA 2QEXQ 5LJ3j 4J83A 4PJOA 1BYMA 1WIEA 3M0UA 2B86A 3CXCA 1M8MA 2WACA 1I5OB 2LT4A 5J26A 4J9EA 3CPFA 1UGQB 2DE0X 2HBWA 4RG2A 2DM1A 4M77G 2JZ2A 4XTYA 5GAN7 2GTOA 1QWEA 1PD1A 4M7DD 4X34A 5I11A 2LDMA 4M77E 2DXUA 1YNZA 5LJ3d 2R58A 2AKLA 4JDSA 3CBPA 4RKUE 2HCKA 2KR3A 3G6EA 2CP5A 1NG2A 5FLXE 2X4XA 2D0QB 3S6WA 3JCMd 2JM9A 3LH0A 1VQ9A 1Q86U 2DVEA 5LJ5e 3QJYA 1NLPC 2NUPA 1JU5C 1J3TA 4DOWA 4Z02A 4DBQA 3R6OA 5GAMg 1QCFA 3UA6A 4GY5A 4JJBA 5GAOr 5GAN6 1M30A 2W0ZA 2LT1A 5IHNA 3T9NA 4EMKB 5GAOl 4C8QC 2JXBA 1YJNA 2C0IA 5GMKi 1YJWA 3MKDA 1Q7YC 2H3EB 3P8BB 2KDSA 2RQRA 2QQSA 2K3XA 4JZ3A 3EFOB 2FPFA 1WQ7A 1QKXA 5L23A 1A0NB 3MHXA 4YTLA 3BE3A 3GNFB 2RK1A 2JT4A 1RADB 4CC3A 5LJ3g 3JAME 2KBTA 4OMOA 1R77A 3VS3A 4D8DA 2VYTA 1D3BA 3OYLA 3CCJT 4IUTA 3M58A 3JCMg 2CH4A 3GBQA 3KUFA 4JRQA 4AG2C 2HEQA 1EFNA 6AT1B 4Y92A 8AT1B 3CCLT 1VQ7A 2CUDA 3M0SA 3CMEQ 1OI1A 5IAYA 1KSWA 1WHJA 4OMFB 2DTOA 2CYZB 3OY9A 2CZ7B 2L89A 2QAZA 3V8JA 4LXCA 4D6WA 2KT8A 1SSHA 2AKKA 4KGVB 1SSFA 2PVOB 4PFOA 2ZCFB 5KYUA 2PVDB 3CCVT 3A8HB 3MP1A 2LQKA 1OU9A 3PT9A 2CZ1B 2LMJA 1X2KA 2KXCA 1BIAA 4LUEA 2COWA 3TQ7P 3X20B 3OW2A 4XTZA 4FSSA 2HL3A 3RMSA 2IVWA 5CQXA 1TG0A 2JS0A 3OBYA 1WDXA 2QQBA 1SHFA 2FZCB 2JM8A 3META 3M9QA 1AEYA 4MMLA 1F1BB 3EG2A 2AZSA 3LH5A 1TSFA 1Y96A 1ZSZB 3GNGA 2RHYA 1W1FA 4JJDA 2P84A 2XDBA 3M0PA 4M7DA 5HCKA 2D6FA 3H41A 2R57A 3QZ5B 1X6GA 2QXFA 2RNAA 3KBGA 1PC0A 3N5BB 4FU6A 2YLCA 3ZEHA 4BE0A 1BU1A 2E65A 2QK0A 3MP6A 3RERA 4AFZC 1SRMA 4BI4A 2NUTB 5GAMf 2HQHA 4JJCA 1U5SA 2E3HA 2K5FA 4O5VA 4HT9A 2GQVA 1Y0MA 2DAQA 3A1PA 4PFZA 4LD9K 3PMTA 2GFUA 3CCQA 4J7IA 2BE7D 3NMZC 2GBQA 5KYWA 3EGUA 2A7YA 2COYA 2Z0WA 2X3XD 2DD5A 4EMKC 3CC4T 4M7AG 1FXXA 5CR2A 1WX6A 4LDUA 1KD1C 9ATCB 1TTHB 3M0RA 1AWXA 5KCHA 2VGNA 3CC2A 1MMNA 2EQJA 1ZA1B 1CSKA 4X9DA 4M7AE 4M75G 4J9HA 4XU0A 5LJ3f 5D6WA 1Q86R 4JRIA 2CUBA 4QQ6A 4EIKA 2VUBA 1R8OB 4M75E 3V8KA 4PLIA 4BI3A 4FT4A 3FB9A 5FRNA 4Y91A 1OOTA 4C8QD 3VYGA 3CXCS 1IO6A 2RHUA 3PGGA 3CCSA 1YP5A 1SPKA 5CKHA 1KQ2A 2DBMA 1YCYA 3G71Q 1AWJA 1VYUA 2CSIA 2MK5A 1FYNA 2H3JA 1VIEA 1VYVA 4PK4A 2ABLA 3S3MA 1UJ0A 4RTXA 2DD4A 1VQLQ 2ZAEA 3VV0A 2CS7A 3GF5A 3IQLA 2C0TA 3CMAT 5CKDA 3INZA 4ZNXA 4M78G 1TH7A 5KE3A 1G3WA 5LJ5d 2RQTA 4J9FA 1PNJA 4M78E 1JO8A 2J6KA 1WXUA 4O6JA 1BI3A 2I2LA 1WXTA 4ATOA 2K4YA 1ZX6A 2E12A 3H0IA 1N8RU 1VQ5Q 1H3HA 4R55A 4F7UA 4C92G 2BE9B 4P5NA 3O8VA 2VGMA 2CZ0B 2EIFA 2KROA 4F16A 1QQJA 2F2XA 4KUIA 1YHQA 3OB9A 4C92E 4KRTA 2OTJA 4D8KA 1BB9A 4A63B 3I55A 4IUVA 1VQMA 2MYSA 1PKSA 1MGQA 2OX7A 3U23A 3HFNA 1KQSS 1WYXA 2XHCA 4J6WA 1NJIR 1BKBA 4F7UG 4R0KA 3UA7A 1WGSA 4HVVA 2E5QA 1ZSZC 3OYHA 4JLIA 4C0FA 1W2BS 1G3YA 1U3OA 2RJDA 2RH2A 3LYIA 4F7UE 1OU8A 2QEXA 3EGXA 1CKBA 4L6V5 4DEXA 2P0QA 3PMIA 5LJ5g 2GCXA 5EG2A 4AMCA 3CC7T 1Q82C 2QG9B 1AD5A 1G3TA 1ZBXA 2DL3A 2YUOA 1K73R 3EH2A 2E6ZA 1M1GA 2HKQB 2M51A 3H0HA 2ZZDA 3OSSC 1M1KC 1WHMA 2RI2A 3QDFA 1U1TA 2EJ9A 2QA4T 2L8DA 1X6BA 4A4HA 5HK3A 5KYYB 4M77D 5ECAA 4J9IA 2YDLA 3C94A 2LJ0A 2X4JA 3A8MB 2RQVA 3VS5A 3QPHA 4KT0E 4E7LA 4A54A 2DILA 4LNPA 2KQWA 3A98A 1MNEA 2YHTA 2KEAA 1VQNQ 5KYNA 4FCYA 1UUEA 1RI0A 3M55A 3NHNA 4QQGA 1K0SA 3OW2S 4FT2A 5C0MA 1D0ZA 3C12A 3R6NA 1HYOA 1PKTA 1MMGA 2L3RA 3CXCP 1UGRB 1W4SA 1IHVA 3J81E 2DXTA 1QVPA 3J80E 4BB7A 1ACMB 3CCQQ 2DO3A 4C8QA 1S72T 1AWOA 3JCMb 1VQ6Q 2ROLA 1VQ4Q 2J06A 4JUVA 1I0CA 4FYXB 4MZPA 5IXFA 2KRNA 1YITA 2KRSA 3ZBDA 4N4IA 3NPFA 2MIOA 3OYEA 4KGXB 1CKAA 4AFSC 1OYXA 3L1AA 5FU7B 5IXBA 3EG9B 2JMAA 2EQKA 2KAFA 4KULA 2HL5C 3GPLA 4E2FB 1VYTA 2NLUA 3H0FA 4ESRA 2VXEA 3MEWA 3FRNA 2AHJB 2YUPA 1XNIA 1BCOA 4M78C 5CQYA 1QP3A 4ORZA 2QTXA 2XG8D 3CCSQ 3QKJA 2DZ9A 2JUFA 2GF7A 3UDCA 3CMEA 1M8VA 2YRCA 1Q81U 4JS5A 4LE9A 1JXMA 3OYMA 2CKKA 5GJWB 3RMQA 2KE9A 2EWNA 4C92C 3EGDA 1KQSP 1VOMA 4QVDA 2FPEA 5DM7R 2RO0A 1I07A 2L5QA 4HCZA 1X6OA 1W2BP 3CCUA 2LZ6B 5CVIA 2DF6A 2OTLT 5KE2A 2LVMA 1M2OA 1RAIB 1WJSA 3SEMA 1B7TA 4N0AC 3RESA 4XQ3A 2E6NA 1YIJT 1E6HA 2CT3A 5LJ5f 4F17A 1UGVA 3QZ9B 2R5AA 5FWCA 1KHCA 3CD6T 2CP0A 4JRKA 2NYSA 3OYDA 5GAMj 4E7HA 3LLRA 1OQKA 4OMMA 1JBMA 2Y4YA 3OA6A 2OTJQ 1OEBA 1PHTA 2DKGA 3PE0A 1VQMQ 2O9SA 3E2UA 1T3SA 4JPBW 3F70A 3FEOA 3OW2P 5KH6A 3G4ST 4AT1B 1ABOA 5GAN8 3DB3A 4NOYA 1JXOA 4KBMB 3ASKA 2P4RA 2V26A 4AFQC 5GAOn 2DNUA 2RF0A 1BI2A 2HDAA 3NTHA 2O4XA 1NEBA 2PZ1A 2ZPEB 2PVGB 5IH2A 2K79A 3QO3A 2X4WA 2RD1A 1QLYA 4Q5WA 4BD3A 3UT1A 5DLOA 4RTTA 4F04B 1LJOA 1K9AA 3CCJA 4R56A 1W70A 3G7ZA 3NTKA 4OGCA 4DBFA 2L0AA 4M7AD 2C06A 3SWNC 2FRYA 3VS4A 1IXDA 1Q86C 1OV3A 1N9RA 2O9VA 1QVFA 1T0JA 2CP6A 1QKWA 4M75D 3HPWA 4M4ZA 4PJOB 2JJ9A 3CCMT 3M54A 3JCMJ 3OYJA 1EX4A 3OYNA 4DA4A 5KCOA 4NS5A 1YJ9T 3JB9H 2BKDN 3CCLA 4VUBA 4XTXA 5I2MA 2EYYA 4N4GA 1YCSB 2YLBA 4LUDA 3M57A 4FL6A 1OX8A 3UATA 3G71A 1RI9A 2P0PA 3V7SA 1YITQ 3P8HA 2DERA 2EBPA 1M90U 2DBKA 3V7RA 4GLMA 2EGEA 3RBBB 1N27A 1VQLA 3X28B 1FWZA 2EYWA 3CCVA 2EFIA 1KQSA 2NUPB 1GL5A 1BIBA 3BW1A 2DJZA 1W2BA 4OMQA 1UHCA 1HXDA 4FW1A 1BI1A 2K2MA 2O2OA 4DBHA 5GAMh 4PJOF 1KIKA 4OF1A 2E64A 2DVJA 3CCEQ 2YRDA 4M78D 3G6ET 1MHNA 1VQ5A 2FO0A 2MMPA 5IHKA 1TUDA 2ZPGB 2JS2A 3UPUA 1VQ9T 1HD3A 1Q81R 1VQOQ 5KYXA 4OVAA 1LPLA 3OS2A 2LQ8A 2XIDA 3L42A 1U1SA 1YI2T 3NFCA 2YRVA 2ECZA 4L5GA 2CP2A 4C92D 2Y90A 3DB4A 3JCMV 1G83A 1YJNT 1D3BB 1VQ8T 3J7AF 1YJWT 1O75A 5LJ3h 1NJIU 3CCUQ 3OYYA 4KGZB 1I8FA 1UHFA 3JCMh 1K4US 3RDVA 2DEUA 2L2PA 2FG0A 1ZSZA 3DLMA 1KC8U 2DL8A 4EMGA 2NUZA 1ZUYA 3M59A 3QJ6A 3FDRA 2ENMA 3OYCA 1UFFA 5CK9A 1K73U 5IN1A 1WHLA 2KSSA 3M56A 3VJPA 3CC4A 5I22A 2KK4A 4Z89A 2JTFA 5J3BA 1AZEA 4C0DB 3TSWA 1JEGA 4C0ZA 3VU3C 2C0OA 3TCJA 1AZGB 1G8XA 3QSUA 1T0HA 5KYUB 4LD6A 2VVKA 3TREA 1M1FA 4ZTFA 2JTEA 3H8ZA 2A08A 4NL2A 2DK3A 2X35A 1VQNA 5GMKe 1Z9QA 1AOJA 3SDZA 1QP2A 4M7AA 2D8JA 2X9HA 3L2VA 3VS1A 5FU6B 1K8AC 5GANj 2DRMA 4M75A 2AZVA 1RAHB 3OYBA 2YUQA 2BZYA 2V1QA 1GBRA 1VQ6A 1VQ4A 4PJOC 3MCAB 3E19A 4XTWA 2FL7A 1Y96B 4E6RA 1SRLA 2RJEA 4F14A 4ELZC 2F5TX 1M5Q1 1M2VA 3S3NA 1SHGA 4M7DB 4J9BA 2LNVA 2OAUA 5GANd 5IT9E 3CMAA 1SG5A 1XJWB 4QQDA 3CCJQ 1K9MC 3RR6A 4QVZA 3D7SB 2EVRA 3RKYA 3A8OB 2P4TA 3OS1A 4XTUA 4BACA 2DXBA 1MV3A 1WI7A 3JCMf 5FW9A 3VRYA 1M9SA 4TVRA 2D8HA 1D09B 3MP8A 3UF4A 3WXMB 2KYMA 4UC4A 5DLQE 4LDVA 5HKCA 2MF2A 3CCLQ 2FB7A 1ZQ1A 4FM4B 1ARKA 1UB4A 5KYWB 2KI7A 4RTYA 4M78A 3JSCA 1FMKA 1QCNA 1IB8A 2EQUA 1X01A 1RABB 4QVCA 1U8RA 4OMPA 5J39A 5LJ5j 1M90R 5CIUA 1IREB 2EQIA 3I56T 1Q7YR 2QGFB 4M7DF 4HCCA 4XU2A 5C6SA 2D1XA 5D7UA 3VS7A 3CBMA 5GANg 1Z9ZA 4C92A 3CCVQ 2ZPBB 1NPPA 3RKXA 1JJ2S 1QVFS 3JB9I 3Q1JA 1D0YA 2Y4XA 3QBYA 3CC7A 2RI5A 4MZMA 1RAAB 4DBRA 2WSCE 3JCMQ 3OYFA 2OAWA 3X24B 4C5IA 1UGPB 4DQ2A 2L3QA 2J7IA 1P92A 4LDWA 2RK2A 2CT4A 1N6AA 4N0AA 1N8RC 3WVDB 2KRMA 4B9XA 1WFWA 3RKWA 2QA4A 2LJ3A 2XICA 1IGQA 2DXCA 2I0NA 2EKOA 1R0CB 3M0QA 2V8KA 5FWBA 2O01E 4J6YA 3CCRT 4C0DC 2MOXA 4HA8A 5LJ3e 1VQKT 5A0DA 3EHRA 3I35A 1KQ1A 1PCXA 2RM4A 4QKUA 4E7IA 2XD0A 5CKEA 1KC8R 2XDDA 4X1VA 1BCMA 3VS0A 2RHIA 4LN2A 3QDRB 1S72A 4F7UB 1O9SA 5GAOp 3RUXA
chains in the Genus database with same CATH topology
3DKMA 2OTLT 1I4K1 4RG8A 5KE2A 5FRMA 3V7CA 2LVMA 2MWPA 5LJ3g 3JAME 4M7DE 1WJSA 4II1A 1YBYA 2EQMA 4N0AC 3RESA 4XQ3A 2E6NA 3C4SA 2VYTA 1D3BA 2MWOA 3OYLA 3URGA 5LJ5f 3LWHA 3CCJT 1YIJT 2E1HA 3JB9J 4M7AB 4IUTA 1OZ3A 3M58A 3JCMg 1KD1U 3HRUA 4RCBA 2EYQA 3QZ9B 2R5AA 3FC3A 2M16A 1KHCA 3CD6T 2JN0A 1K9MU 2PU9B 4JRKA 3OYDA 1KHIA 4J6XA 1XTDA 1M1KU 5GAMj 3KUFA 4M75B 2DIQA 4JRQA 4E7HA 3LLRA 1N9SA 1JBMA 4BE2A 4CRIA 2QQ9A 2Y4YA 1X75C 3OA6A 4M7DC 3FJPA 2RJFA 3MEVA 3SWNA 2G3RA 4N4HA 4ZN1A 3JCMX 3GOXA 2DKGA 3CCLT 1VQ7A 1OI1A 1VQNT 5IAYA 2KY9A 4ME7A 1NE8A 4OMFB 4LDYA 2DTOA 3F70A 2CYZB 1WNLA 2LTOA 4OB3B 3FEOA 3OY9A 3I55T 2CZ7B 2L89A 5LJ5h 4EMHA 3CPWA 2M1HA 3V8JA 4IUPA 5KH6A 4WF2A 4D6WA 2PUKB 4MZTA 5D6XA 3QHSA 4JS4A 2DTIA 4OGEA 3LGLA 1SSFA 2PVOB 3G4ST 2VV5A 3CCRA 3ER0A 5GAN8 1VQKA 3DB3A 3PTAA 3CCQT 4PL6A 2ZCFB 4NOYA 1FX7A 2PVDB 3OBWA 4KBMB 3PIOA 1DJ7B 5CO7A 3ASKA 3QYGB 5GAOn 2QEXT 3CCVT 3A8HB 4DOVA 2XI9A 1VQ4T 2X4YA 3A5ZB 3MP1A 3CBOA 4ZTJA 1BI2A 2LQKA 1I5LA 2E41A 3NTHA 3S3OA 3PT9A 2O4XA 2K57A 3OS0A 2CZ1B 2ZPEB 2XU8A 3SD4A 1BIAA 3X20B 1QVGA 3OW2A 2PVGB 4XTZA 3QO3A 4M75F 3CC2T 5GANf 4BE1A 1ZHIA 4J8OA 3RMSA 2X4WA 5GAMe 2RD1A 1WJQA 2IVWA 4Q5WA 2MAMA 3LGFA 2HNIA 4BD3A 5A0GA 4M78B 5CQXA 3UT1A 3JRZA 4BY6C 5DLOA 1PSEA 3OBYA 2QQBA 3PFSA 1LNXA 1LJOA 1YIJA 3CCJA 3ZFJA 2CGHA 4R56A 2E10A 3META 3M9QA 3HHTB 2DIGA 2KMTA 4MMLA 3G7ZA 3NTKA 4OGCA 3CCEA 4JRPA 3JB9G 4M7AD 2C06A 3LWIA 3SWNC 1Y96A 3NTIA 1XOVA 2JTMA 3GNGA 2RHYA 5HY6A 4C8QB 1Q86C 5CKBA 5CKFA 2XDPA 2XDBA 1N9RA 5DY9A 3HRSA 1QVFA 4C92B 1VQOA 4M75D 5HK0A 1BI0A 4M7DA 3HPWA 5CAIA 2D6FA 3CCST 3CCMT 4PJOB 3M54A 2R57A 3QZ5B 3JCMJ 2HAXA 2QXFA 3EFSA 3OYJA 5GANh 4EPCA 3BDUA 3OYNA 2HQXA 3E1SA 3KBGA 5KCOA 4NS5A 4DA4A 1YJ9T 2BKDN 3JB9H 3CCLA 1H3ZA 1VUBA 3N5BB 4FU6A 4VUBA 2YLCA 4XTXA 5I2MA 3M53A 3MO8A 4OB1B 4N4GA 4IURA 3ZEHA 4BE0A 1IZ6A 4XU3A 3JCMe 2YLBA 4PNOA 3M57A 1UEBA 2E65A 4FL6A 2LRQA 3MP6A 4X9CA 3RERA 5CCAA 4BI4A 5GAMf 3G71A 2P0PA 3V7SA 1GXIE 3P8HA 2K5FA 3VKIA 1M90U 4O5VA 3OSVA 4HT9A 2GQVA 4M78F 3V7RA 2DAQA 3JCMP 4LD9K 4IUQA 3PMTA 2GFUA 4OB2B 3OYIA 3CCQA 4J7IA 2VXFA 1N27A 1VQLA 2GFAA 3UWNA 3X28B 2F69A 1FWZA 4BUGA 2A7YA 3CCVA 1WJRA 2EFIA 5FU6C 2DD5A 3GP8A 3QXEB 1KQSA 1Q82U 3HP9A 3GLXA 4EMKC 1BIBA 1HK9A 3H6ZA 3CC4T 4M7AG 1FXXA 3VUZA 2FYKA 5CR2A 3BW1A 5GAN2 4LDUA 4CI0C 1KD1C 3WVEB 2DJZA 3DLLA 1W2BA 2PQWA 5KCHA 5D6YA 2VGNA 3CC2A 1HXDA 2EQJA 4C92F 1BI1A 4X9DA 4M7AE 4M75G 4PJOF 5GAMh 3LX7A 3BFMA 4OF1A 4XU0A 2E64A 5LJ3f 4EDUA 5D6WA 4M78D 2XKOC 3QG1A 3G6ET 1MHNA 1VQ5A 4JRIA 2MMPA 4MDWA 4QQ6A 2WSEE 5LL6S 2VUBA 2ZPGB 1YHQT 1R8OB 2QQRA 4M75E 3V8KA 4PLIA 3UPUA 2RA2A 1VIFA 1I81A 4BI3A 1VQ9T 4KUDK 4XU1A 2OTJT 4FT4A 2QDYB 4OVAA 3OS2A 3FB9A 5FRNA 2K5IA 2LQ8A 2XIDA 3L42A 1U1SA 2RI3A 4Y91A 4C5EA 4A4KA 3NFCA 5M9OA 2YRVA 1B34B 1VQMT 2QQAA 4C8QD 4MDXA 3VYGA 3CXCS 2M9UA 4F7UF 4A53A 4BDZA 4M7AC 2RHUA 3PGGA 2FHDA 4L5GA 3VYHB 4C92D 2EAYA 3CCSA 1Y07A 3L2WA 2Y90A 3CCMA 3JCMW 2LCLA 3HSBA 3DB4A 4PJOD 3JCMV 4QW2A 3X26B 2ZPHB 5CKHA 1KQ2A 1JRIA 3P8DA 1YJNT 1QW1A 1D3BB 1XQHA 1VQ8T 3J7AF 1YJWT 1YCYA 1O75A 4M75C 1NZ9A 5LJ3h 2CZ6B 4C5GA 4B9WA 1NJIU 4OB0B 5GMKj 3L2RA 3OYYA 1I8FA 3AHUA 3JCMh 2H3JA 2E70A 1VIEA 1VQPT 3A8LB 4E7JA 3S3MA 3OQ5A 1OZ2A 2DD4A 5GMKl 5A2QE 3DLMA 4GLKA 1V29B 3HRTA 1KC8U 3VV0A 2LCCA 4EMGA 2CS7A 3GF5A 1M4ZA 4HT8A 3QYHB 3CMAT 5CKDA 3INZA 5GMKm 2V8JA 4HCBA 2OTLA 1JB0E 1RL2A 3L2ZA 3SWNB 4M78G 3M59A 3QJ6A 2BIVA 3FDRA 4EMKA 1TH7A 3OYCA 5KE3A 5CK9A 1K73U 1G3WA 5IN1A 4ELYC 3BY7A 5LJ5d 3E9GA 3HFOA 3HL8A 2KSSA 3M56A 3VJPA 4M77B 4PKCC 3JCMc 3CC4A 2KK4A 4M78E 2JTFA 5J3BA 4O6JA 1BI3A 1PSFA 2HQEA 2I2LA 3CD6A 4ATOA 4C0DB 5GAOq 2K4YA 4C8QG 1JJ2A 2E12A 4C0ZA 3VU3C 1N8RU 2MI6A 2DEQA 4R55A 2P0KA 3TCJA 3PNWC 4F7UA 4C92G 5GAN5 4P5NA 5FU7C 3O8VA 2VGMA 2CZ0B 4PJOG 1Q81C 4J7FA 3QSUA 4LD6A 3HKSA 2EIFA 3BDLA 1Y71A 2HD0A 1M1FA 4MMKA 4XAXB 3TREA 4C8QE 4KUIA 3OYGA 4ZTFA 3H8ZA 1YHQA 3OB9A 4NL2A 3OYAA 2DK3A 2X35A 2RHZA 4C92E 1VQNA 4E7KA 5GMKe 2O4XB 4L59A 1EIFA 3SDZA 2OTJA 4PJOE 1AHJB 3RIRA 3I55A 1QP2A 3QUIA 1YI2A 4M7AA 4IUVA 1VQMA 3L2VA 1MGQA 3HFNA 3M4YA 1KQSS 2M0OA 4ZGEB 3TU4K 2XHCA 4J6WA 4FSXA 5FU6B 4A4FA 1K8AC 1BKBA 4F7UG 5GANj 1WGSA 2ZPIB 2E5QA 3LW5E 4M75A 3G4SA 3OYHA 2LX9A 1Q7YU 3QIIA 4JLIA 3X25B 4C0FA 1W2BS 1M90C 4A4GA 3OYBA 1VQ8A 1G3YA 2V8IA 1YITT 3VUBA 2RJDA 2RH2A 3LYIA 2FVUA 4IUUA 2EJFA 4BI8B 4JJNK 4F7UE 3PIPA 1VQ6A 1VQ4A 4PJOC 2QEXA 3MCAB 3E19A 4XTWA 2FL7A 2B8AA 4L6V5 1Y96B 4M77F 2P0QA 2RJEA 2XK0A 1KG1A 3PMIA 1VQ6T 5LJ5g 2GCXA 5EG2A 4ELZC 2IG0A 1VQPA 3CC7T 1LOJA 1Q82C 2F5TX 4RMOA 1M5Q1 5I21A 1G5VA 1WQWA 3OMCA 3S3NA 3ME9A 4C8QF 4M7DB 1G3TA 5A0LA 1B34A 4ZN3A 4NL3A 2LNVA 1ZBXA 2OAUA 5GANd 5IT9E 4ZGJB 2EJGA 3CMAA 3V8LA 2E6ZA 1M1GA 4QQDA 2R5MA 3OMGA 1K9MC 2JNGA 3OSSC 2ZZDA 3OYKA 4V2SA 1M1KC 4C5HA 4QVZA 3SB2A 3CPWS 2RI2A 3RKYA 1U1TA 3A8OB 2P4TA 3EAEA 3OS1A 4XTUA 2EJ9A 2QA4T 2DXBA 2L8DA 4A4HA 3CEYA 4BACA 5HK3A 3JCMf 4A4EA 3CCET 5I2SA 1M9SA 1Y7XA 4TVRA 4M77D 3MP8A 4BDYA 3C94A 2K2VA 2X4JA 2D9TA 4UC4A 3WXMB 3A8MB 2JVVA 3QPHA 4KT0E 5DLQE 2HBPA 3CMET 2ZGWA 3MEAA 3M4GA 3SFMA 2QI2A 4LDVA 4A54A 5FROA 4C0GA 5HKCA 4E7LA 1VQOT 2KQWA 2MF2A 2FB7A 5AYFA 5GANe 2YHTA 4J5YA 1NPRA 1ZQ1A 4FM4B 1UB4A 1RI0A 3M55A 4XK8E 4QQGA 1QVGS 3OW2S 4FT2A 4M78A 3JSCA 5C0MA 2A3LA 1YJ9A 2RB6A 3C12A 4OP0A 4FIBA 3JB9D 2L3RA 1UGSB 2EQUA 2KVQG 1X01A 2JOYA 1UGRB 5GMKh 1G3SA 1W4SA 4JLGA 4QVCA 1U8RA 5J39A 5LJ5j 1NJIC 2DTHA 3E9FA 3FLGA 4M77A 3GIBA 5L8RE 2DZCA 1IREB 5CIUA 3J81E 4IKFA 2DXTA 3I56T 3G71T 1QVPA 3J80E 4BB7A 4BY6B 5GAMd 4LDXA 4HCCA 3MEUA 4M7DF 2BUDA 4HKEA 3CCUT 1S72T 2DO3A 4C8QA 2DPPB 4XU2A 3OS5A 3L2UA 4M7AF 5C6SA 3FIFA 3JCMb 3TEEA 3CBMA 5GANg 5GAN3 4C92A 4JUVA 2ZPBB 4MZPA 1KC8C 1NPPA 3RKXA 4J83A 5LJ3j 1YITA 4PJOA 1BYMA 3ZBDA 1JJ2S 1H641 4N4IA 4ZGDB 1VQLT 3C95A 1QVFS 3CXCA 3OYEA 2WACA 3JB9I 3Q1JA 2LT4A 5J26A 3CPFA 3M5AA 1UGQB 1WPYA 2Y4XA 3QBYA 4RG2A 3CC7A 1K73C 1OYXA 3L1AA 4M77G 5FU7B 2RI5A 2ZPFB 2JZ2A 2K3YA 4XTYA 4MZMA 5GAN7 2WSCE 2EQKA 3JCMQ 2F5KA 4Y28E 3X24B 4C5IA 4E47A 3OYFA 4M7DD 4X34A 1UGPB 2KAFA 2PUOB 4DQ2A 4KULA 1P92A 4LDWA 2RK2A 2LDMA 4RCCA 3GPLA 3EFRA 4M77E 1N6AA 2DXUA 2K5LA 4N0AA 3KXTA 1N8RC 5LJ3d 2NLUA 2R58A 4JDSA 3CBPA 4RKUE 3WVDB 4B9XA 2VXEA 3G6EA 3MEWA 1VQ5T 3RKWA 3FRNA 2QA4A 5FLXE 2X4XA 2D0QB 3S6WA 3JCMd 2AHJB 1VQ7T 3A8GB 3LH0A 2XICA 1XNIA 4PLLA 1VQ9A 4M78C 1Q86U 2DVEA 2RJCA 5CQYA 5LJ5e 3QJYA 1QP3A 2DXCA 2QTXA 2XG8D 4DOWA 3QKJA 2DZ9A 2JUFA 4Z02A 3R6OA 2GF7A 3UDCA 3CMEA 1M8VA 2EKOA 2WSFE 5GAMg 4JS5A 4M77C 1Q81U 4GY5A 5GAOr 5GAN6 2V8KA 3OYMA 2RHXA 2LT1A 2O01E 4J6YA 3T9NA 4EMKB 3CCRT 4C0DC 5GAOl 4C8QC 1YI2T 4HA8A 2LC4A 5LJ3e 2CKKA 5A0DA 1YJNA 1VQKT 5GMKi 1YJWA 1KQ1A 3RMQA 3L2QA 1Q7YC 2RM4A 2KDSA 3P8BB 5GAOm 2EWNA 4C92C 4E7IA 2QQSA 4QVDA 2K3XA 5DM7R 2RO0A 2XD0A 5CKEA 1WQ7A 2L5QA 2XDDA 4HCZA 3I56A 1X6OA 2RHIA 2VC8A 3MHXA 3QDRB 4YTLA 1K8AU 3CCUA 3JB9F 1S72A 4F7UB 1O9SA 5GAN4 5GAOp 4M7DG 3GNFB 3RUXA 2RK1A 4XTVA 5CVIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB7 A;  4PJO B;  5GAN e;  2YHT A;  3INZ A;  4J5Y A;  5GMK m;  3JCM J;  3EFS A;  1I4K 1;  3L2Z A;  3SWN B;  3V7C A;  5GAN h;  4M78 G;  3BDU A;  5LJ3 g;  4M78 A;  3JB9 H;  4EMK A;  4M7D E;  1TH7 A;  2RB6 A;  4OP0 A;  4N0A C;  4XTX A;  2YLC A;  4XQ3 A;  3RES A;  3JB9 D;  1D3B A;  3JB9 F;  3BY7 A;  5LJ5 f;  5LJ5 d;  1X01 A;  2E1H A;  3HFO A;  3JB9 J;  4XU3 A;  4M7A B;  5GMK h;  4M77 B;  3JCM g;  3JCM c;  4QVC A;  4RCB A;  3JCM e;  2YLB A;  5LJ5 j;  4M78 E;  2DTH A;  4PNO A;  4M77 A;  3GIB A;  4HT8 A;  2DZC A;  2E65 A;  2DXT A;  4X9C A;  2I2L A;  2JN0 A;  3RER A;  5GAM f;  4M7D F;  5GAM d;  5GAO q;  4JRK A;  4M7D A;  4C8Q G;  4J6X A;  3V7S A;  3VU3 C;  4C8Q A;  4M75 B;  4XU2 A;  2DEQ A;  5GAM j;  3JCM b;  1N9S A;  3FIF A;  4F7U A;  4C92 G;  5GAN 5;  4HT9 A;  5GAN g;  5GAN 3;  4M78 F;  3V7R A;  4C92 A;  4JUV A;  1JBM A;  4PJO G;  3JCM P;  3QSU A;  3RKX A;  5LJ3 j;  3FJP A;  4M7D C;  4PJO A;  4C8Q E;  2VXF A;  4MMK A;  1H64 1;  3SWN A;  3JCM X;  2DKG A;  4NL2 A;  4C92 E;  3JB9 I;  5GMK e;  4PJO E;  4EMK C;  1BIB A;  2DTO A;  1WPY A;  1HK9 A;  1WNL A;  3RIR A;  4M7A G;  3L1A A;  2FYK A;  4M77 G;  3QUI A;  3BW1 A;  5GAM h;  5GAN 2;  5LJ5 h;  4M7A A;  5GAN 7;  4XTY A;  4EMH A;  1MGQ A;  2DJZ A;  3V8J A;  3JCM Q;  3HFN A;  4M7D D;  4WF2 A;  1HXD A;  4DQ2 A;  4C92 F;  4J6W A;  3QHS A;  4RCC A;  2DTI A;  4X9D A;  3EFR A;  4M75 G;  4M77 E;  4PJO F;  2DXU A;  4F7U G;  3BFM A;  4N0A A;  4M75 A;  2E64 A;  4XU0 A;  5LJ3 f;  5LJ3 d;  5GAN 8;  4M78 D;  4JLI A;  2VXE A;  4JRI A;  3RKW A;  4NOY A;  2EJF A;  4M75 E;  4F7U E;  3V8K A;  3JCM d;  5GAO n;  4PJO C;  2RA2 A;  1I81 A;  4M7A F;  4XTW A;  4M77 F;  1Y96 B;  1I5L A;  4XU1 A;  2E41 A;  4M78 C;  2DVE A;  5LJ5 g;  5LJ5 e;  3FB9 A;  2K57 A;  1LOJ A;  2QTX A;  1M5Q 1;  1U1S A;  4Y91 A;  5I21 A;  1BIA A;  1WQW A;  2DZ9 A;  1B34 B;  4C8Q F;  4C8Q D;  4M7D B;  4XTZ A;  1M8V A;  3QO3 A;  1B34 A;  4NL3 A;  4M75 F;  4A53 A;  4F7U F;  5GAM g;  5GAN f;  4M7A C;  4M77 C;  5GAM e;  3PGG A;  5GAN d;  2RD1 A;  2EJG A;  4C92 D;  5GAO r;  2EAY A;  3V8L A;  5GAN 6;  2HNI A;  2Y90 A;  3JCM W;  3HSB A;  4PJO D;  4M7A E;  4V2S A;  4M78 B;  3JCM V;  4EMK B;  4J6Y A;  3SB2 A;  1KQ2 A;  5GAO l;  4C8Q C;  1JRI A;  4HA8 A;  5LJ3 e;  1D3B B;  3RKY A;  1U1T A;  5GMK i;  1YCY A;  4M75 C;  1LNX A;  1KQ1 A;  1LJO A;  4XTU A;  2EJ9 A;  2RM4 A;  5LJ3 h;  2CGH A;  5GAO m;  2EWN A;  2E10 A;  4C92 C;  5GMK j;  3JCM f;  4EMG A;  4QVD A;  4MML A;  3JB9 G;  1I8F A;  4M7A D;  4M77 D;  3AHU A;  1WQ7 A;  3SWN C;  3JCM h;  1Y96 A;  2VC8 A;  4C8Q B;  5GAN j;  2ZGW A;  4F7U B;  1N9R A;  5GMK l;  5DY9 A;  3M4G A;  5GAN 4;  5GAO p;  4A54 A;  4M7D G;  3RUX A;  4C92 B;  4M75 D;  4XTV A;  5CAI A; 
#chains in the Genus database with same CATH topology
 3DKM A;  3V7C A;  3CC4 Q;  1ZLM A;  1YBY A;  4II1 A;  1WHH A;  3KFV A;  3JB9 F;  2E1H A;  1NYF A;  1LVK A;  3HRU A;  2EYQ A;  3FC3 A;  2M16 A;  2QGG A;  2JN0 A;  2PU9 B;  1KHI A;  1S1N A;  4J6X A;  1M1K U;  1D1A A;  2QQ9 A;  1VA7 A;  1ZSG A;  4M7D C;  2RJF A;  2YXY A;  2O31 A;  1NYG A;  3EGX B;  3SWN A;  1WHG A;  1HJD A;  1GCQ C;  4LDY A;  2CH4 W;  4OB3 B;  3I55 T;  2DJQ A;  2RQW A;  5LJ5 h;  3CPW A;  2M1H A;  2K3B A;  2PUK B;  4MZT A;  4OGE A;  3LGL A;  2VV5 A;  1M3C A;  4PL6 A;  1ABQ A;  3CQT A;  2GTJ A;  3OBW A;  3PIO A;  1DJ7 B;  5CO7 A;  3QYG B;  2QEX T;  4DOV A;  2XI9 A;  4ZTJ A;  3CBO A;  4FYV B;  2A36 A;  2E41 A;  3S3O A;  2A37 A;  3CMA Q;  2J6O A;  2XU8 A;  3VRZ A;  7AT1 B;  2HSE B;  3MJX A;  1QVG A;  2ROT A;  1AVZ C;  2ESW A;  3VS6 A;  4CC7 A;  1JJ2 P;  5GAN f;  1ZHI A;  4ANJ A;  1QVF P;  1WJQ A;  4RTV A;  1TWB A;  3JRZ A;  3PFS A;  1K0X A;  3O5Z A;  1YIJ A;  2FRW A;  3HHT B;  1GBQ A;  2KMT A;  3CCE A;  4JRP A;  3EG0 A;  4GBQ A;  2JTM A;  4C8Q B;  5CKF A;  2XDP A;  1ZA2 B;  2K6D A;  1M27 C;  5HK0 A;  1VQO A;  5CAI A;  2DL4 A;  4EPC A;  2HQX A;  3E1S A;  2YWW A;  4OB1 B;  2A0F B;  1WA7 A;  1MUZ A;  4PNO A;  3THK A;  4X9C A;  5CCA A;  1GXI E;  2EYX A;  3VKI A;  3FJ5 A;  3JCM P;  2OI3 A;  4IUQ A;  2VXF A;  2GFA A;  3UWN A;  3CC7 Q;  2F69 A;  2HMA A;  4BUG A;  1WZO A;  1WJR A;  2X3W D;  4PJM A;  1HK9 A;  3VUZ A;  2FYK A;  5GAN 2;  4CI0 C;  1GRI A;  3DLL A;  4Z8A A;  2PQW A;  5D6Y A;  2AK5 A;  2QTV A;  3G1J A;  2QA4 Q;  3LX7 A;  1KFZ A;  3BFM A;  1E7O A;  2DET A;  3QG1 A;  3EG3 A;  3EGD B;  4FYY B;  4MDW A;  1KK7 A;  5LL6 S;  2DRK A;  1VIF A;  1I81 A;  4KUD K;  4XU1 A;  2QDY B;  2RN8 A;  4C5E A;  5M9O A;  1B34 B;  2QAS A;  2J6F A;  3RNJ A;  2M9U A;  4A53 A;  3VYH B;  3CCM A;  1Y07 A;  3L2W A;  3HSB A;  2ZPH B;  1XQH A;  4QT7 A;  2CZ6 B;  4AG1 C;  2GQI A;  2MCN A;  3L2R A;  3I5R A;  1S72 Q;  8ATC B;  1WLP B;  4E7S A;  1PM3 A;  3AHU A;  1VQP T;  4E7J A;  3OQ5 A;  2X51 A;  1OZ2 A;  5A2Q E;  1OX9 A;  1V29 B;  3HRT A;  2LCC A;  2LX7 A;  5GMK m;  2V8J A;  1Q82 R;  4HCB A;  2O88 A;  1JB0 E;  1RL2 A;  2BIV A;  4EMK A;  3EG1 A;  4ELY C;  3BY7 A;  3E9G A;  2H8H A;  3HFO A;  4M77 B;  1M1K R;  1W6X A;  3EFO A;  1RLP C;  5GAO q;  2E4H A;  1MMA A;  1JJ2 A;  2MI6 A;  2FZG B;  5FU7 C;  4PJO G;  4J7F A;  1RAC B;  4MMK A;  2HD0 A;  3BDL A;  4XAX B;  1IGU A;  1NEG A;  2RHZ A;  4E7K A;  2O4X B;  4L59 A;  4PJO E;  2DA9 A;  1AHJ B;  1E6G A;  3RIR A;  2JW4 A;  3QUI A;  1YI2 A;  4E7Z A;  1D0X A;  1MND A;  2M0O A;  4ZGE B;  3TU4 K;  4FSX A;  1GCP A;  1ZBJ A;  4A4F A;  2LX9 A;  2V1R A;  3X25 B;  1Q7Y U;  1M90 C;  4A4G A;  1VQ8 A;  4OML A;  2V8I A;  4BI8 B;  4JJN K;  2EJF A;  1SF9 A;  2VKN A;  3PIP A;  2KNB B;  2L3P A;  2B8A A;  4M77 F;  1GFC A;  4WCI A;  4RMO A;  2BZX A;  1G5V A;  3OMC A;  2OTL Q;  1V1C A;  2FZK B;  4ZGJ B;  4HXJ A;  2EJG A;  1KJW A;  2SRC A;  1YIJ Q;  3OMG A;  1LCK A;  2JNG A;  4V2S A;  3OYK A;  4C5H A;  3REA B;  3SB2 A;  3CPW S;  3EAE A;  3CD6 Q;  3CEY A;  1QMC A;  1Y57 A;  4A4E A;  5I2S A;  2K9G A;  1FMW A;  4Z88 A;  1PRL C;  1TS9 A;  2ED1 A;  2ZGW A;  3MEA A;  3M4G A;  3SFM A;  5FRO A;  1N5Z A;  1RAF B;  5AYF A;  1NPR A;  2IIM A;  2EKH A;  1QCO A;  1QVG S;  1BK2 A;  1X27 A;  2RB6 A;  1PRM C;  5AT1 B;  4FIB A;  3JB9 D;  2KVQ G;  2CRE A;  1YWO A;  1G3S A;  1M3A A;  4JLG A;  1NJI C;  3E9F A;  3GIB A;  3FLG A;  5L8R E;  3G4S Q;  1YWP A;  3G71 T;  4LDX A;  4BY6 B;  1C6V X;  3MEU A;  4HKE A;  2AIR B;  3OS5 A;  3FIF A;  3I5S A;  1PG5 B;  5GAN 3;  4KH0 B;  1KC8 C;  2KT1 A;  2CSQ A;  1H64 1;  1VQP Q;  2W10 A;  4ZGD B;  1VQL T;  2DL7 A;  3C95 A;  1ZUK A;  2HZY A;  2XMF A;  2JMC A;  3PVL A;  5KYX B;  2HKN A;  3M5A A;  1WPY A;  1K73 C;  2ZPF B;  2K3Y A;  4PJL A;  1UEC A;  1B3Q A;  2F5K A;  4Y28 E;  4E47 A;  2EW3 A;  2PUO B;  2NUT A;  4CC2 A;  4RCC A;  3EFR A;  1HSQ A;  2K5L A;  3KXT A;  2CP3 A;  3TVT A;  4PFP A;  1VQ5 T;  1VQ7 T;  1OPL A;  3A8G B;  1EZZ B;  3VS2 A;  4PLL A;  1UE9 A;  2RJC A;  3REB B;  3CCM Q;  1X43 A;  3QWY A;  2E3I A;  2WSF E;  1YJ9 Q;  4M77 C;  2RHX A;  2LNH B;  1GCQ A;  2LC4 A;  2LJ1 A;  3L2Q A;  5GAO m;  5IHI A;  3I9Q A;  5GJV B;  3I56 A;  2VC8 A;  1K8A U;  1AWW A;  5GAN 4;  4M7D G;  1TUG B;  4XTV A;  2MPX C;  1B07 A;  4DEY A;  4AFU C;  1I4K 1;  4J9C A;  4RG8 A;  5FRM A;  2MWP A;  2LQN A;  2F2W A;  4M7D E;  3M0T A;  1JQQ A;  2EQM A;  4HVW A;  1U06 A;  3C4S A;  2MWO A;  3LWH A;  3URG A;  3JB9 J;  4M7A B;  1KD1 U;  1OZ3 A;  2FEI A;  4RCB A;  1V76 A;  1H92 A;  2L3S A;  4KH1 B;  3CPW P;  1K9M U;  3G6E Q;  1XTD A;  4M75 B;  2DIQ A;  3MPU B;  1N9S A;  1X69 A;  4BE2 A;  4CRI A;  1VQ9 Q;  1X75 C;  3FJP A;  3MEV A;  2F1L A;  1PD0 A;  2G3R A;  4N4H A;  4ZN1 A;  3JCM X;  3GOX A;  1YI2 Q;  1VQN T;  1UJY A;  2KY9 A;  4ME7 A;  1NE8 A;  1M2V B;  1WNL A;  2LTO A;  3ZL7 C;  4EMH A;  1QVG P;  2SEM A;  4IUP A;  4WF2 A;  1YJN Q;  1VQ8 Q;  1YJW Q;  5D6X A;  3QHS A;  4K11 A;  4JS4 A;  2DTI A;  3CCR A;  3ER0 A;  1VQK A;  3JV3 A;  2YSQ A;  3PTA A;  3CCQ T;  2KGT A;  1FX7 A;  1VQ6 T;  1VQ4 T;  4MDX A;  2HSP A;  4M7A F;  2X4Y A;  3A5Z B;  1OPK A;  1I5L A;  2K57 A;  3OS0 A;  3SD4 A;  4IIO A;  4M75 F;  3CC2 T;  2OJ2 A;  4BE1 A;  4J8O A;  5GAM e;  2CDT A;  2MAM A;  3LGF A;  2HNI A;  5A0G A;  1C0M A;  4M78 B;  4CC4 B;  4BY6 C;  1PSE A;  1RLQ C;  1C1A A;  4PJJ A;  1LNX A;  4RTU A;  3C0C A;  3ZFJ A;  2CGH A;  2E10 A;  1UDL A;  2DIG A;  3JB9 G;  3LWI A;  1M3B A;  1GFD A;  3NTI A;  1XOV A;  5HY6 A;  5CKB A;  2PNI A;  2LP5 A;  5DY9 A;  3HRS A;  2M02 A;  2QYZ A;  4C92 B;  1BI0 A;  5EC7 A;  4WTO B;  1R0B G;  2KXD A;  1VQ7 Q;  3CCS T;  2HAX A;  3EFS A;  3PVQ A;  2RPN A;  2DYB A;  5GAN h;  1NLO C;  3BDU A;  2AT1 B;  2KYB A;  1H3Z A;  1VUB A;  1OUL A;  3M53 A;  2ATC B;  3MO8 A;  4IUR A;  1IZ6 A;  4XU3 A;  1T3L A;  3JCM e;  5KYY A;  1UEB A;  2DL5 A;  2LRQ A;  1G2B A;  1QWF A;  1I1J A;  2VWF A;  4JZ4 A;  2PTK A;  2DX1 A;  2M0Y A;  2CP7 A;  2EYZ A;  3OSV A;  2DMO A;  4M78 F;  4OB2 B;  3OYI A;  1UTI A;  2RMO A;  5FU6 C;  3GP8 A;  3QXE B;  1Q82 U;  3HP9 A;  3GLX A;  2COZ A;  2BZ8 A;  3H6Z A;  1IHW A;  2GNC A;  1RAG B;  1UG1 A;  3WVE B;  4C92 F;  2VAS A;  3ULR B;  4EDU A;  2XKO C;  2WSE E;  4RTZ A;  1YHQ T;  2QQR A;  2RA2 A;  1NBE B;  2OTJ T;  1D1C A;  2K5I A;  2RI3 A;  4A4K A;  1VQM T;  2QQA A;  2DFU A;  1YN8 A;  3EG9 A;  4F7U F;  4FYW B;  2RQU A;  4BDZ A;  4M7A C;  2FHD A;  2QDL A;  2EAY A;  3JCM W;  2LCL A;  4OMN A;  4HVU A;  4PJO D;  4QW2 A;  4RTW A;  3X26 B;  2LCS A;  1JRI A;  3P8D A;  1QW1 A;  4FW2 A;  2F2V A;  4M75 C;  1NZ9 A;  4C5G A;  2IPO B;  3I56 Q;  4B9W A;  1K8A R;  4OB0 B;  5GMK j;  2LQW A;  1K76 A;  2E70 A;  3A8L B;  3NGP A;  5GMK l;  2EGA A;  4GLK A;  1M4Z A;  4HT8 A;  3QYH B;  3EHQ A;  2OTL A;  3L2Z A;  3SWN B;  1KD1 R;  1WXB A;  4J9G A;  3HTR A;  1Q95 G;  1RUW A;  1PWT A;  1K9M R;  1MMD A;  3HL8 A;  3CC2 Q;  4PKC C;  3JCM c;  3EH1 A;  1ZUU A;  1PSF A;  2DLP A;  2HQE A;  3CD6 A;  1YFN A;  1RAE B;  4C8Q G;  2GGR A;  1NM7 A;  2DEQ A;  2P0K A;  3PNW C;  5GAN 5;  2NWM A;  1Q81 C;  2D0N A;  3HKS A;  3SHW A;  2E5K A;  1Y71 A;  4C8Q E;  3OYG A;  3OYA A;  2ED0 A;  3TSZ A;  1EIF A;  1FMV A;  3CCR Q;  3M4Y A;  4RUG A;  1VQK Q;  2J05 A;  1AT1 B;  2G6F X;  2ZPI B;  3G4S A;  3LW5 E;  3QII A;  1MV0 B;  2BTT A;  1YIT T;  3VUB A;  2FVU A;  4IUU A;  1TU0 B;  3QWX X;  2XK0 A;  1KG1 A;  2IG0 A;  1VQP A;  1LOJ A;  5I21 A;  3H9N A;  1WQW A;  3ME9 A;  4C8Q F;  5A0L A;  1B34 A;  4ZN3 A;  4NL3 A;  2FPD A;  1K1Z A;  3V8L A;  2EPD A;  4B6M A;  2R5M A;  1TXQ A;  1D1B A;  1SEM A;  4J9D A;  3CCE T;  1N8R R;  1Y7X A;  2YUN A;  4PJN A;  4BDY A;  1TUC A;  2K2V A;  2D9T A;  2YT6 A;  1WHK A;  2DYI A;  3AT1 B;  4HCK A;  2JVV A;  2HBP A;  3CME T;  2VB6 A;  4C0G A;  2QI2 A;  1VQO T;  1YHQ Q;  1SKU B;  1TOV A;  5GAN e;  4J5Y A;  4XK8 E;  3I55 Q;  1IRX A;  4IIM A;  1YJ9 A;  2A3L A;  2A28 A;  4OP0 A;  1UGS B;  2JOY A;  5GMK h;  2DTH A;  1BBZ A;  4M77 A;  2DZC A;  4IKF A;  2K7A A;  5GAM d;  1X2Q A;  2BUD A;  2EGC A;  3CCU T;  2DPP B;  3L2U A;  1H8K A;  3TEE A;  2QEX Q;  5LJ3 j;  4J83 A;  4PJO A;  1BYM A;  1WIE A;  3M0U A;  2B86 A;  3CXC A;  1M8M A;  2WAC A;  1I5O B;  2LT4 A;  5J26 A;  4J9E A;  3CPF A;  1UGQ B;  2DE0 X;  2HBW A;  4RG2 A;  2DM1 A;  4M77 G;  2JZ2 A;  4XTY A;  5GAN 7;  2GTO A;  1QWE A;  1PD1 A;  4M7D D;  4X34 A;  5I11 A;  2LDM A;  4M77 E;  2DXU A;  1YNZ A;  5LJ3 d;  2R58 A;  2AKL A;  4JDS A;  3CBP A;  4RKU E;  2HCK A;  2KR3 A;  3G6E A;  2CP5 A;  1NG2 A;  5FLX E;  2X4X A;  2D0Q B;  3S6W A;  3JCM d;  2JM9 A;  3LH0 A;  1VQ9 A;  1Q86 U;  2DVE A;  5LJ5 e;  3QJY A;  1NLP C;  2NUP A;  1JU5 C;  1J3T A;  4DOW A;  4Z02 A;  4DBQ A;  3R6O A;  5GAM g;  1QCF A;  3UA6 A;  4GY5 A;  4JJB A;  5GAO r;  5GAN 6;  1M30 A;  2W0Z A;  2LT1 A;  5IHN A;  3T9N A;  4EMK B;  5GAO l;  4C8Q C;  2JXB A;  1YJN A;  2C0I A;  5GMK i;  1YJW A;  3MKD A;  1Q7Y C;  2H3E B;  3P8B B;  2KDS A;  2RQR A;  2QQS A;  2K3X A;  4JZ3 A;  3EFO B;  2FPF A;  1WQ7 A;  1QKX A;  5L23 A;  1A0N B;  3MHX A;  4YTL A;  3BE3 A;  3GNF B;  2RK1 A;  2JT4 A;  1RAD B;  4CC3 A;  5LJ3 g;  3JAM E;  2KBT A;  4OMO A;  1R77 A;  3VS3 A;  4D8D A;  2VYT A;  1D3B A;  3OYL A;  3CCJ T;  4IUT A;  3M58 A;  3JCM g;  2CH4 A;  3GBQ A;  3KUF A;  4JRQ A;  4AG2 C;  2HEQ A;  1EFN A;  6AT1 B;  4Y92 A;  8AT1 B;  3CCL T;  1VQ7 A;  2CUD A;  3M0S A;  3CME Q;  1OI1 A;  5IAY A;  1KSW A;  1WHJ A;  4OMF B;  2DTO A;  2CYZ B;  3OY9 A;  2CZ7 B;  2L89 A;  2QAZ A;  3V8J A;  4LXC A;  4D6W A;  2KT8 A;  1SSH A;  2AKK A;  4KGV B;  1SSF A;  2PVO B;  4PFO A;  2ZCF B;  5KYU A;  2PVD B;  3CCV T;  3A8H B;  3MP1 A;  2LQK A;  1OU9 A;  3PT9 A;  2CZ1 B;  2LMJ A;  1X2K A;  2KXC A;  1BIA A;  4LUE A;  2COW A;  3TQ7 P;  3X20 B;  3OW2 A;  4XTZ A;  4FSS A;  2HL3 A;  3RMS A;  2IVW A;  5CQX A;  1TG0 A;  2JS0 A;  3OBY A;  1WDX A;  2QQB A;  1SHF A;  2FZC B;  2JM8 A;  3MET A;  3M9Q A;  1AEY A;  4MML A;  1F1B B;  3EG2 A;  2AZS A;  3LH5 A;  1TSF A;  1Y96 A;  1ZSZ B;  3GNG A;  2RHY A;  1W1F A;  4JJD A;  2P84 A;  2XDB A;  3M0P A;  4M7D A;  5HCK A;  2D6F A;  3H41 A;  2R57 A;  3QZ5 B;  1X6G A;  2QXF A;  2RNA A;  3KBG A;  1PC0 A;  3N5B B;  4FU6 A;  2YLC A;  3ZEH A;  4BE0 A;  1BU1 A;  2E65 A;  2QK0 A;  3MP6 A;  3RER A;  4AFZ C;  1SRM A;  4BI4 A;  2NUT B;  5GAM f;  2HQH A;  4JJC A;  1U5S A;  2E3H A;  2K5F A;  4O5V A;  4HT9 A;  2GQV A;  1Y0M A;  2DAQ A;  3A1P A;  4PFZ A;  4LD9 K;  3PMT A;  2GFU A;  3CCQ A;  4J7I A;  2BE7 D;  3NMZ C;  2GBQ A;  5KYW A;  3EGU A;  2A7Y A;  2COY A;  2Z0W A;  2X3X D;  2DD5 A;  4EMK C;  3CC4 T;  4M7A G;  1FXX A;  5CR2 A;  1WX6 A;  4LDU A;  1KD1 C;  9ATC B;  1TTH B;  3M0R A;  1AWX A;  5KCH A;  2VGN A;  3CC2 A;  1MMN A;  2EQJ A;  1ZA1 B;  1CSK A;  4X9D A;  4M7A E;  4M75 G;  4J9H A;  4XU0 A;  5LJ3 f;  5D6W A;  1Q86 R;  4JRI A;  2CUB A;  4QQ6 A;  4EIK A;  2VUB A;  1R8O B;  4M75 E;  3V8K A;  4PLI A;  4BI3 A;  4FT4 A;  3FB9 A;  5FRN A;  4Y91 A;  1OOT A;  4C8Q D;  3VYG A;  3CXC S;  1IO6 A;  2RHU A;  3PGG A;  3CCS A;  1YP5 A;  1SPK A;  5CKH A;  1KQ2 A;  2DBM A;  1YCY A;  3G71 Q;  1AWJ A;  1VYU A;  2CSI A;  2MK5 A;  1FYN A;  2H3J A;  1VIE A;  1VYV A;  4PK4 A;  2ABL A;  3S3M A;  1UJ0 A;  4RTX A;  2DD4 A;  1VQL Q;  2ZAE A;  3VV0 A;  2CS7 A;  3GF5 A;  3IQL A;  2C0T A;  3CMA T;  5CKD A;  3INZ A;  4ZNX A;  4M78 G;  1TH7 A;  5KE3 A;  1G3W A;  5LJ5 d;  2RQT A;  4J9F A;  1PNJ A;  4M78 E;  1JO8 A;  2J6K A;  1WXU A;  4O6J A;  1BI3 A;  2I2L A;  1WXT A;  4ATO A;  2K4Y A;  1ZX6 A;  2E12 A;  3H0I A;  1N8R U;  1VQ5 Q;  1H3H A;  4R55 A;  4F7U A;  4C92 G;  2BE9 B;  4P5N A;  3O8V A;  2VGM A;  2CZ0 B;  2EIF A;  2KRO A;  4F16 A;  1QQJ A;  2F2X A;  4KUI A;  1YHQ A;  3OB9 A;  4C92 E;  4KRT A;  2OTJ A;  4D8K A;  1BB9 A;  4A63 B;  3I55 A;  4IUV A;  1VQM A;  2MYS A;  1PKS A;  1MGQ A;  2OX7 A;  3U23 A;  3HFN A;  1KQS S;  1WYX A;  2XHC A;  4J6W A;  1NJI R;  1BKB A;  4F7U G;  4R0K A;  3UA7 A;  1WGS A;  4HVV A;  2E5Q A;  1ZSZ C;  3OYH A;  4JLI A;  4C0F A;  1W2B S;  1G3Y A;  1U3O A;  2RJD A;  2RH2 A;  3LYI A;  4F7U E;  1OU8 A;  2QEX A;  3EGX A;  1CKB A;  4L6V 5;  4DEX A;  2P0Q A;  3PMI A;  5LJ5 g;  2GCX A;  5EG2 A;  4AMC A;  3CC7 T;  1Q82 C;  2QG9 B;  1AD5 A;  1G3T A;  1ZBX A;  2DL3 A;  2YUO A;  1K73 R;  3EH2 A;  2E6Z A;  1M1G A;  2HKQ B;  2M51 A;  3H0H A;  2ZZD A;  3OSS C;  1M1K C;  1WHM A;  2RI2 A;  3QDF A;  1U1T A;  2EJ9 A;  2QA4 T;  2L8D A;  1X6B A;  4A4H A;  5HK3 A;  5KYY B;  4M77 D;  5ECA A;  4J9I A;  2YDL A;  3C94 A;  2LJ0 A;  2X4J A;  3A8M B;  2RQV A;  3VS5 A;  3QPH A;  4KT0 E;  4E7L A;  4A54 A;  2DIL A;  4LNP A;  2KQW A;  3A98 A;  1MNE A;  2YHT A;  2KEA A;  1VQN Q;  5KYN A;  4FCY A;  1UUE A;  1RI0 A;  3M55 A;  3NHN A;  4QQG A;  1K0S A;  3OW2 S;  4FT2 A;  5C0M A;  1D0Z A;  3C12 A;  3R6N A;  1HYO A;  1PKT A;  1MMG A;  2L3R A;  3CXC P;  1UGR B;  1W4S A;  1IHV A;  3J81 E;  2DXT A;  1QVP A;  3J80 E;  4BB7 A;  1ACM B;  3CCQ Q;  2DO3 A;  4C8Q A;  1S72 T;  1AWO A;  3JCM b;  1VQ6 Q;  2ROL A;  1VQ4 Q;  2J06 A;  4JUV A;  1I0C A;  4FYX B;  4MZP A;  5IXF A;  2KRN A;  1YIT A;  2KRS A;  3ZBD A;  4N4I A;  3NPF A;  2MIO A;  3OYE A;  4KGX B;  1CKA A;  4AFS C;  1OYX A;  3L1A A;  5FU7 B;  5IXB A;  3EG9 B;  2JMA A;  2EQK A;  2KAF A;  4KUL A;  2HL5 C;  3GPL A;  4E2F B;  1VYT A;  2NLU A;  3H0F A;  4ESR A;  2VXE A;  3MEW A;  3FRN A;  2AHJ B;  2YUP A;  1XNI A;  1BCO A;  4M78 C;  5CQY A;  1QP3 A;  4ORZ A;  2QTX A;  2XG8 D;  3CCS Q;  3QKJ A;  2DZ9 A;  2JUF A;  2GF7 A;  3UDC A;  3CME A;  1M8V A;  2YRC A;  1Q81 U;  4JS5 A;  4LE9 A;  1JXM A;  3OYM A;  2CKK A;  5GJW B;  3RMQ A;  2KE9 A;  2EWN A;  4C92 C;  3EGD A;  1KQS P;  1VOM A;  4QVD A;  2FPE A;  5DM7 R;  2RO0 A;  1I07 A;  2L5Q A;  4HCZ A;  1X6O A;  1W2B P;  3CCU A;  2LZ6 B;  5CVI A;  2DF6 A;  2OTL T;  5KE2 A;  2LVM A;  1M2O A;  1RAI B;  1WJS A;  3SEM A;  1B7T A;  4N0A C;  3RES A;  4XQ3 A;  2E6N A;  1YIJ T;  1E6H A;  2CT3 A;  5LJ5 f;  4F17 A;  1UGV A;  3QZ9 B;  2R5A A;  5FWC A;  1KHC A;  3CD6 T;  2CP0 A;  4JRK A;  2NYS A;  3OYD A;  5GAM j;  4E7H A;  3LLR A;  1OQK A;  4OMM A;  1JBM A;  2Y4Y A;  3OA6 A;  2OTJ Q;  1OEB A;  1PHT A;  2DKG A;  3PE0 A;  1VQM Q;  2O9S A;  3E2U A;  1T3S A;  4JPB W;  3F70 A;  3FEO A;  3OW2 P;  5KH6 A;  3G4S T;  4AT1 B;  1ABO A;  5GAN 8;  3DB3 A;  4NOY A;  1JXO A;  4KBM B;  3ASK A;  2P4R A;  2V26 A;  4AFQ C;  5GAO n;  2DNU A;  2RF0 A;  1BI2 A;  2HDA A;  3NTH A;  2O4X A;  1NEB A;  2PZ1 A;  2ZPE B;  2PVG B;  5IH2 A;  2K79 A;  3QO3 A;  2X4W A;  2RD1 A;  1QLY A;  4Q5W A;  4BD3 A;  3UT1 A;  5DLO A;  4RTT A;  4F04 B;  1LJO A;  1K9A A;  3CCJ A;  4R56 A;  1W70 A;  3G7Z A;  3NTK A;  4OGC A;  4DBF A;  2L0A A;  4M7A D;  2C06 A;  3SWN C;  2FRY A;  3VS4 A;  1IXD A;  1Q86 C;  1OV3 A;  1N9R A;  2O9V A;  1QVF A;  1T0J A;  2CP6 A;  1QKW A;  4M75 D;  3HPW A;  4M4Z A;  4PJO B;  2JJ9 A;  3CCM T;  3M54 A;  3JCM J;  3OYJ A;  1EX4 A;  3OYN A;  4DA4 A;  5KCO A;  4NS5 A;  1YJ9 T;  3JB9 H;  2BKD N;  3CCL A;  4VUB A;  4XTX A;  5I2M A;  2EYY A;  4N4G A;  1YCS B;  2YLB A;  4LUD A;  3M57 A;  4FL6 A;  1OX8 A;  3UAT A;  3G71 A;  1RI9 A;  2P0P A;  3V7S A;  1YIT Q;  3P8H A;  2DER A;  2EBP A;  1M90 U;  2DBK A;  3V7R A;  4GLM A;  2EGE A;  3RBB B;  1N27 A;  1VQL A;  3X28 B;  1FWZ A;  2EYW A;  3CCV A;  2EFI A;  1KQS A;  2NUP B;  1GL5 A;  1BIB A;  3BW1 A;  2DJZ A;  1W2B A;  4OMQ A;  1UHC A;  1HXD A;  4FW1 A;  1BI1 A;  2K2M A;  2O2O A;  4DBH A;  5GAM h;  4PJO F;  1KIK A;  4OF1 A;  2E64 A;  2DVJ A;  3CCE Q;  2YRD A;  4M78 D;  3G6E T;  1MHN A;  1VQ5 A;  2FO0 A;  2MMP A;  5IHK A;  1TUD A;  2ZPG B;  2JS2 A;  3UPU A;  1VQ9 T;  1HD3 A;  1Q81 R;  1VQO Q;  5KYX A;  4OVA A;  1LPL A;  3OS2 A;  2LQ8 A;  2XID A;  3L42 A;  1U1S A;  1YI2 T;  3NFC A;  2YRV A;  2ECZ A;  4L5G A;  2CP2 A;  4C92 D;  2Y90 A;  3DB4 A;  3JCM V;  1G83 A;  1YJN T;  1D3B B;  1VQ8 T;  3J7A F;  1YJW T;  1O75 A;  5LJ3 h;  1NJI U;  3CCU Q;  3OYY A;  4KGZ B;  1I8F A;  1UHF A;  3JCM h;  1K4U S;  3RDV A;  2DEU A;  2L2P A;  2FG0 A;  1ZSZ A;  3DLM A;  1KC8 U;  2DL8 A;  4EMG A;  2NUZ A;  1ZUY A;  3M59 A;  3QJ6 A;  3FDR A;  2ENM A;  3OYC A;  1UFF A;  5CK9 A;  1K73 U;  5IN1 A;  1WHL A;  2KSS A;  3M56 A;  3VJP A;  3CC4 A;  5I22 A;  2KK4 A;  4Z89 A;  2JTF A;  5J3B A;  1AZE A;  4C0D B;  3TSW A;  1JEG A;  4C0Z A;  3VU3 C;  2C0O A;  3TCJ A;  1AZG B;  1G8X A;  3QSU A;  1T0H A;  5KYU B;  4LD6 A;  2VVK A;  3TRE A;  1M1F A;  4ZTF A;  2JTE A;  3H8Z A;  2A08 A;  4NL2 A;  2DK3 A;  2X35 A;  1VQN A;  5GMK e;  1Z9Q A;  1AOJ A;  3SDZ A;  1QP2 A;  4M7A A;  2D8J A;  2X9H A;  3L2V A;  3VS1 A;  5FU6 B;  1K8A C;  5GAN j;  2DRM A;  4M75 A;  2AZV A;  1RAH B;  3OYB A;  2YUQ A;  2BZY A;  2V1Q A;  1GBR A;  1VQ6 A;  1VQ4 A;  4PJO C;  3MCA B;  3E19 A;  4XTW A;  2FL7 A;  1Y96 B;  4E6R A;  1SRL A;  2RJE A;  4F14 A;  4ELZ C;  2F5T X;  1M5Q 1;  1M2V A;  3S3N A;  1SHG A;  4M7D B;  4J9B A;  2LNV A;  2OAU A;  5GAN d;  5IT9 E;  3CMA A;  1SG5 A;  1XJW B;  4QQD A;  3CCJ Q;  1K9M C;  3RR6 A;  4QVZ A;  3D7S B;  2EVR A;  3RKY A;  3A8O B;  2P4T A;  3OS1 A;  4XTU A;  4BAC A;  2DXB A;  1MV3 A;  1WI7 A;  3JCM f;  5FW9 A;  3VRY A;  1M9S A;  4TVR A;  2D8H A;  1D09 B;  3MP8 A;  3UF4 A;  3WXM B;  2KYM A;  4UC4 A;  5DLQ E;  4LDV A;  5HKC A;  2MF2 A;  3CCL Q;  2FB7 A;  1ZQ1 A;  4FM4 B;  1ARK A;  1UB4 A;  5KYW B;  2KI7 A;  4RTY A;  4M78 A;  3JSC A;  1FMK A;  1QCN A;  1IB8 A;  2EQU A;  1X01 A;  1RAB B;  4QVC A;  1U8R A;  4OMP A;  5J39 A;  5LJ5 j;  1M90 R;  5CIU A;  1IRE B;  2EQI A;  3I56 T;  1Q7Y R;  2QGF B;  4M7D F;  4HCC A;  4XU2 A;  5C6S A;  2D1X A;  5D7U A;  3VS7 A;  3CBM A;  5GAN g;  1Z9Z A;  4C92 A;  3CCV Q;  2ZPB B;  1NPP A;  3RKX A;  1JJ2 S;  1QVF S;  3JB9 I;  3Q1J A;  1D0Y A;  2Y4X A;  3QBY A;  3CC7 A;  2RI5 A;  4MZM A;  1RAA B;  4DBR A;  2WSC E;  3JCM Q;  3OYF A;  2OAW A;  3X24 B;  4C5I A;  1UGP B;  4DQ2 A;  2L3Q A;  2J7I A;  1P92 A;  4LDW A;  2RK2 A;  2CT4 A;  1N6A A;  4N0A A;  1N8R C;  3WVD B;  2KRM A;  4B9X A;  1WFW A;  3RKW A;  2QA4 A;  2LJ3 A;  2XIC A;  1IGQ A;  2DXC A;  2I0N A;  2EKO A;  1R0C B;  3M0Q A;  2V8K A;  5FWB A;  2O01 E;  4J6Y A;  3CCR T;  4C0D C;  2MOX A;  4HA8 A;  5LJ3 e;  1VQK T;  5A0D A;  3EHR A;  3I35 A;  1KQ1 A;  1PCX A;  2RM4 A;  4QKU A;  4E7I A;  2XD0 A;  5CKE A;  1KC8 R;  2XDD A;  4X1V A;  1BCM A;  3VS0 A;  2RHI A;  4LN2 A;  3QDR B;  1S72 A;  4F7U B;  1O9S A;  5GAO p;  3RUX A; 
#chains in the Genus database with same CATH homology
 3DKM A;  2OTL T;  1I4K 1;  4RG8 A;  5KE2 A;  5FRM A;  3V7C A;  2LVM A;  2MWP A;  5LJ3 g;  3JAM E;  4M7D E;  1WJS A;  4II1 A;  1YBY A;  2EQM A;  4N0A C;  3RES A;  4XQ3 A;  2E6N A;  3C4S A;  2VYT A;  1D3B A;  2MWO A;  3OYL A;  3URG A;  5LJ5 f;  3LWH A;  3CCJ T;  1YIJ T;  2E1H A;  3JB9 J;  4M7A B;  4IUT A;  1OZ3 A;  3M58 A;  3JCM g;  1KD1 U;  3HRU A;  4RCB A;  2EYQ A;  3QZ9 B;  2R5A A;  3FC3 A;  2M16 A;  1KHC A;  3CD6 T;  2JN0 A;  1K9M U;  2PU9 B;  4JRK A;  3OYD A;  1KHI A;  4J6X A;  1XTD A;  1M1K U;  5GAM j;  3KUF A;  4M75 B;  2DIQ A;  4JRQ A;  4E7H A;  3LLR A;  1N9S A;  1JBM A;  4BE2 A;  4CRI A;  2QQ9 A;  2Y4Y A;  1X75 C;  3OA6 A;  4M7D C;  3FJP A;  2RJF A;  3MEV A;  3SWN A;  2G3R A;  4N4H A;  4ZN1 A;  3JCM X;  3GOX A;  2DKG A;  3CCL T;  1VQ7 A;  1OI1 A;  1VQN T;  5IAY A;  2KY9 A;  4ME7 A;  1NE8 A;  4OMF B;  4LDY A;  2DTO A;  3F70 A;  2CYZ B;  1WNL A;  2LTO A;  4OB3 B;  3FEO A;  3OY9 A;  3I55 T;  2CZ7 B;  2L89 A;  5LJ5 h;  4EMH A;  3CPW A;  2M1H A;  3V8J A;  4IUP A;  5KH6 A;  4WF2 A;  4D6W A;  2PUK B;  4MZT A;  5D6X A;  3QHS A;  4JS4 A;  2DTI A;  4OGE A;  3LGL A;  1SSF A;  2PVO B;  3G4S T;  2VV5 A;  3CCR A;  3ER0 A;  5GAN 8;  1VQK A;  3DB3 A;  3PTA A;  3CCQ T;  4PL6 A;  2ZCF B;  4NOY A;  1FX7 A;  2PVD B;  3OBW A;  4KBM B;  3PIO A;  1DJ7 B;  5CO7 A;  3ASK A;  3QYG B;  5GAO n;  2QEX T;  3CCV T;  3A8H B;  4DOV A;  2XI9 A;  1VQ4 T;  2X4Y A;  3A5Z B;  3MP1 A;  3CBO A;  4ZTJ A;  1BI2 A;  2LQK A;  1I5L A;  2E41 A;  3NTH A;  3S3O A;  3PT9 A;  2O4X A;  2K57 A;  3OS0 A;  2CZ1 B;  2ZPE B;  2XU8 A;  3SD4 A;  1BIA A;  3X20 B;  1QVG A;  3OW2 A;  2PVG B;  4XTZ A;  3QO3 A;  4M75 F;  3CC2 T;  5GAN f;  4BE1 A;  1ZHI A;  4J8O A;  3RMS A;  2X4W A;  5GAM e;  2RD1 A;  1WJQ A;  2IVW A;  4Q5W A;  2MAM A;  3LGF A;  2HNI A;  4BD3 A;  5A0G A;  4M78 B;  5CQX A;  3UT1 A;  3JRZ A;  4BY6 C;  5DLO A;  1PSE A;  3OBY A;  2QQB A;  3PFS A;  1LNX A;  1LJO A;  1YIJ A;  3CCJ A;  3ZFJ A;  2CGH A;  4R56 A;  2E10 A;  3MET A;  3M9Q A;  3HHT B;  2DIG A;  2KMT A;  4MML A;  3G7Z A;  3NTK A;  4OGC A;  3CCE A;  4JRP A;  3JB9 G;  4M7A D;  2C06 A;  3LWI A;  3SWN C;  1Y96 A;  3NTI A;  1XOV A;  2JTM A;  3GNG A;  2RHY A;  5HY6 A;  4C8Q B;  1Q86 C;  5CKB A;  5CKF A;  2XDP A;  2XDB A;  1N9R A;  5DY9 A;  3HRS A;  1QVF A;  4C92 B;  1VQO A;  4M75 D;  5HK0 A;  1BI0 A;  4M7D A;  3HPW A;  5CAI A;  2D6F A;  3CCS T;  3CCM T;  4PJO B;  3M54 A;  2R57 A;  3QZ5 B;  3JCM J;  2HAX A;  2QXF A;  3EFS A;  3OYJ A;  5GAN h;  4EPC A;  3BDU A;  3OYN A;  2HQX A;  3E1S A;  3KBG A;  5KCO A;  4NS5 A;  4DA4 A;  1YJ9 T;  2BKD N;  3JB9 H;  3CCL A;  1H3Z A;  1VUB A;  3N5B B;  4FU6 A;  4VUB A;  2YLC A;  4XTX A;  5I2M A;  3M53 A;  3MO8 A;  4OB1 B;  4N4G A;  4IUR A;  3ZEH A;  4BE0 A;  1IZ6 A;  4XU3 A;  3JCM e;  2YLB A;  4PNO A;  3M57 A;  1UEB A;  2E65 A;  4FL6 A;  2LRQ A;  3MP6 A;  4X9C A;  3RER A;  5CCA A;  4BI4 A;  5GAM f;  3G71 A;  2P0P A;  3V7S A;  1GXI E;  3P8H A;  2K5F A;  3VKI A;  1M90 U;  4O5V A;  3OSV A;  4HT9 A;  2GQV A;  4M78 F;  3V7R A;  2DAQ A;  3JCM P;  4LD9 K;  4IUQ A;  3PMT A;  2GFU A;  4OB2 B;  3OYI A;  3CCQ A;  4J7I A;  2VXF A;  1N27 A;  1VQL A;  2GFA A;  3UWN A;  3X28 B;  2F69 A;  1FWZ A;  4BUG A;  2A7Y A;  3CCV A;  1WJR A;  2EFI A;  5FU6 C;  2DD5 A;  3GP8 A;  3QXE B;  1KQS A;  1Q82 U;  3HP9 A;  3GLX A;  4EMK C;  1BIB A;  1HK9 A;  3H6Z A;  3CC4 T;  4M7A G;  1FXX A;  3VUZ A;  2FYK A;  5CR2 A;  3BW1 A;  5GAN 2;  4LDU A;  4CI0 C;  1KD1 C;  3WVE B;  2DJZ A;  3DLL A;  1W2B A;  2PQW A;  5KCH A;  5D6Y A;  2VGN A;  3CC2 A;  1HXD A;  2EQJ A;  4C92 F;  1BI1 A;  4X9D A;  4M7A E;  4M75 G;  4PJO F;  5GAM h;  3LX7 A;  3BFM A;  4OF1 A;  4XU0 A;  2E64 A;  5LJ3 f;  4EDU A;  5D6W A;  4M78 D;  2XKO C;  3QG1 A;  3G6E T;  1MHN A;  1VQ5 A;  4JRI A;  2MMP A;  4MDW A;  4QQ6 A;  2WSE E;  5LL6 S;  2VUB A;  2ZPG B;  1YHQ T;  1R8O B;  2QQR A;  4M75 E;  3V8K A;  4PLI A;  3UPU A;  2RA2 A;  1VIF A;  1I81 A;  4BI3 A;  1VQ9 T;  4KUD K;  4XU1 A;  2OTJ T;  4FT4 A;  2QDY B;  4OVA A;  3OS2 A;  3FB9 A;  5FRN A;  2K5I A;  2LQ8 A;  2XID A;  3L42 A;  1U1S A;  2RI3 A;  4Y91 A;  4C5E A;  4A4K A;  3NFC A;  5M9O A;  2YRV A;  1B34 B;  1VQM T;  2QQA A;  4C8Q D;  4MDX A;  3VYG A;  3CXC S;  2M9U A;  4F7U F;  4A53 A;  4BDZ A;  4M7A C;  2RHU A;  3PGG A;  2FHD A;  4L5G A;  3VYH B;  4C92 D;  2EAY A;  3CCS A;  1Y07 A;  3L2W A;  2Y90 A;  3CCM A;  3JCM W;  2LCL A;  3HSB A;  3DB4 A;  4PJO D;  3JCM V;  4QW2 A;  3X26 B;  2ZPH B;  5CKH A;  1KQ2 A;  1JRI A;  3P8D A;  1YJN T;  1QW1 A;  1D3B B;  1XQH A;  1VQ8 T;  3J7A F;  1YJW T;  1YCY A;  1O75 A;  4M75 C;  1NZ9 A;  5LJ3 h;  2CZ6 B;  4C5G A;  4B9W A;  1NJI U;  4OB0 B;  5GMK j;  3L2R A;  3OYY A;  1I8F A;  3AHU A;  3JCM h;  2H3J A;  2E70 A;  1VIE A;  1VQP T;  3A8L B;  4E7J A;  3S3M A;  3OQ5 A;  1OZ2 A;  2DD4 A;  5GMK l;  5A2Q E;  3DLM A;  4GLK A;  1V29 B;  3HRT A;  1KC8 U;  3VV0 A;  2LCC A;  4EMG A;  2CS7 A;  3GF5 A;  1M4Z A;  4HT8 A;  3QYH B;  3CMA T;  5CKD A;  3INZ A;  5GMK m;  2V8J A;  4HCB A;  2OTL A;  1JB0 E;  1RL2 A;  3L2Z A;  3SWN B;  4M78 G;  3M59 A;  3QJ6 A;  2BIV A;  3FDR A;  4EMK A;  1TH7 A;  3OYC A;  5KE3 A;  5CK9 A;  1K73 U;  1G3W A;  5IN1 A;  4ELY C;  3BY7 A;  5LJ5 d;  3E9G A;  3HFO A;  3HL8 A;  2KSS A;  3M56 A;  3VJP A;  4M77 B;  4PKC C;  3JCM c;  3CC4 A;  2KK4 A;  4M78 E;  2JTF A;  5J3B A;  4O6J A;  1BI3 A;  1PSF A;  2HQE A;  2I2L A;  3CD6 A;  4ATO A;  4C0D B;  5GAO q;  2K4Y A;  4C8Q G;  1JJ2 A;  2E12 A;  4C0Z A;  3VU3 C;  1N8R U;  2MI6 A;  2DEQ A;  4R55 A;  2P0K A;  3TCJ A;  3PNW C;  4F7U A;  4C92 G;  5GAN 5;  4P5N A;  5FU7 C;  3O8V A;  2VGM A;  2CZ0 B;  4PJO G;  1Q81 C;  4J7F A;  3QSU A;  4LD6 A;  3HKS A;  2EIF A;  3BDL A;  1Y71 A;  2HD0 A;  1M1F A;  4MMK A;  4XAX B;  3TRE A;  4C8Q E;  4KUI A;  3OYG A;  4ZTF A;  3H8Z A;  1YHQ A;  3OB9 A;  4NL2 A;  3OYA A;  2DK3 A;  2X35 A;  2RHZ A;  4C92 E;  1VQN A;  4E7K A;  5GMK e;  2O4X B;  4L59 A;  1EIF A;  3SDZ A;  2OTJ A;  4PJO E;  1AHJ B;  3RIR A;  3I55 A;  1QP2 A;  3QUI A;  1YI2 A;  4M7A A;  4IUV A;  1VQM A;  3L2V A;  1MGQ A;  3HFN A;  3M4Y A;  1KQS S;  2M0O A;  4ZGE B;  3TU4 K;  2XHC A;  4J6W A;  4FSX A;  5FU6 B;  4A4F A;  1K8A C;  1BKB A;  4F7U G;  5GAN j;  1WGS A;  2ZPI B;  2E5Q A;  3LW5 E;  4M75 A;  3G4S A;  3OYH A;  2LX9 A;  1Q7Y U;  3QII A;  4JLI A;  3X25 B;  4C0F A;  1W2B S;  1M90 C;  4A4G A;  3OYB A;  1VQ8 A;  1G3Y A;  2V8I A;  1YIT T;  3VUB A;  2RJD A;  2RH2 A;  3LYI A;  2FVU A;  4IUU A;  2EJF A;  4BI8 B;  4JJN K;  4F7U E;  3PIP A;  1VQ6 A;  1VQ4 A;  4PJO C;  2QEX A;  3MCA B;  3E19 A;  4XTW A;  2FL7 A;  2B8A A;  4L6V 5;  1Y96 B;  4M77 F;  2P0Q A;  2RJE A;  2XK0 A;  1KG1 A;  3PMI A;  1VQ6 T;  5LJ5 g;  2GCX A;  5EG2 A;  4ELZ C;  2IG0 A;  1VQP A;  3CC7 T;  1LOJ A;  1Q82 C;  2F5T X;  4RMO A;  1M5Q 1;  5I21 A;  1G5V A;  1WQW A;  3OMC A;  3S3N A;  3ME9 A;  4C8Q F;  4M7D B;  1G3T A;  5A0L A;  1B34 A;  4ZN3 A;  4NL3 A;  2LNV A;  1ZBX A;  2OAU A;  5GAN d;  5IT9 E;  4ZGJ B;  2EJG A;  3CMA A;  3V8L A;  2E6Z A;  1M1G A;  4QQD A;  2R5M A;  3OMG A;  1K9M C;  2JNG A;  3OSS C;  2ZZD A;  3OYK A;  4V2S A;  1M1K C;  4C5H A;  4QVZ A;  3SB2 A;  3CPW S;  2RI2 A;  3RKY A;  1U1T A;  3A8O B;  2P4T A;  3EAE A;  3OS1 A;  4XTU A;  2EJ9 A;  2QA4 T;  2DXB A;  2L8D A;  4A4H A;  3CEY A;  4BAC A;  5HK3 A;  3JCM f;  4A4E A;  3CCE T;  5I2S A;  1M9S A;  1Y7X A;  4TVR A;  4M77 D;  3MP8 A;  4BDY A;  3C94 A;  2K2V A;  2X4J A;  2D9T A;  4UC4 A;  3WXM B;  3A8M B;  2JVV A;  3QPH A;  4KT0 E;  5DLQ E;  2HBP A;  3CME T;  2ZGW A;  3MEA A;  3M4G A;  3SFM A;  2QI2 A;  4LDV A;  4A54 A;  5FRO A;  4C0G A;  5HKC A;  4E7L A;  1VQO T;  2KQW A;  2MF2 A;  2FB7 A;  5AYF A;  5GAN e;  2YHT A;  4J5Y A;  1NPR A;  1ZQ1 A;  4FM4 B;  1UB4 A;  1RI0 A;  3M55 A;  4XK8 E;  4QQG A;  1QVG S;  3OW2 S;  4FT2 A;  4M78 A;  3JSC A;  5C0M A;  2A3L A;  1YJ9 A;  2RB6 A;  3C12 A;  4OP0 A;  4FIB A;  3JB9 D;  2L3R A;  1UGS B;  2EQU A;  2KVQ G;  1X01 A;  2JOY A;  1UGR B;  5GMK h;  1G3S A;  1W4S A;  4JLG A;  4QVC A;  1U8R A;  5J39 A;  5LJ5 j;  1NJI C;  2DTH A;  3E9F A;  3FLG A;  4M77 A;  3GIB A;  5L8R E;  2DZC A;  1IRE B;  5CIU A;  3J81 E;  4IKF A;  2DXT A;  3I56 T;  3G71 T;  1QVP A;  3J80 E;  4BB7 A;  4BY6 B;  5GAM d;  4LDX A;  4HCC A;  3MEU A;  4M7D F;  2BUD A;  4HKE A;  3CCU T;  1S72 T;  2DO3 A;  4C8Q A;  2DPP B;  4XU2 A;  3OS5 A;  3L2U A;  4M7A F;  5C6S A;  3FIF A;  3JCM b;  3TEE A;  3CBM A;  5GAN g;  5GAN 3;  4C92 A;  4JUV A;  2ZPB B;  4MZP A;  1KC8 C;  1NPP A;  3RKX A;  4J83 A;  5LJ3 j;  1YIT A;  4PJO A;  1BYM A;  3ZBD A;  1JJ2 S;  1H64 1;  4N4I A;  4ZGD B;  1VQL T;  3C95 A;  1QVF S;  3CXC A;  3OYE A;  2WAC A;  3JB9 I;  3Q1J A;  2LT4 A;  5J26 A;  3CPF A;  3M5A A;  1UGQ B;  1WPY A;  2Y4X A;  3QBY A;  4RG2 A;  3CC7 A;  1K73 C;  1OYX A;  3L1A A;  4M77 G;  5FU7 B;  2RI5 A;  2ZPF B;  2JZ2 A;  2K3Y A;  4XTY A;  4MZM A;  5GAN 7;  2WSC E;  2EQK A;  3JCM Q;  2F5K A;  4Y28 E;  3X24 B;  4C5I A;  4E47 A;  3OYF A;  4M7D D;  4X34 A;  1UGP B;  2KAF A;  2PUO B;  4DQ2 A;  4KUL A;  1P92 A;  4LDW A;  2RK2 A;  2LDM A;  4RCC A;  3GPL A;  3EFR A;  4M77 E;  1N6A A;  2DXU A;  2K5L A;  4N0A A;  3KXT A;  1N8R C;  5LJ3 d;  2NLU A;  2R58 A;  4JDS A;  3CBP A;  4RKU E;  3WVD B;  4B9X A;  2VXE A;  3G6E A;  3MEW A;  1VQ5 T;  3RKW A;  3FRN A;  2QA4 A;  5FLX E;  2X4X A;  2D0Q B;  3S6W A;  3JCM d;  2AHJ B;  1VQ7 T;  3A8G B;  3LH0 A;  2XIC A;  1XNI A;  4PLL A;  1VQ9 A;  4M78 C;  1Q86 U;  2DVE A;  2RJC A;  5CQY A;  5LJ5 e;  3QJY A;  1QP3 A;  2DXC A;  2QTX A;  2XG8 D;  4DOW A;  3QKJ A;  2DZ9 A;  2JUF A;  4Z02 A;  3R6O A;  2GF7 A;  3UDC A;  3CME A;  1M8V A;  2EKO A;  2WSF E;  5GAM g;  4JS5 A;  4M77 C;  1Q81 U;  4GY5 A;  5GAO r;  5GAN 6;  2V8K A;  3OYM A;  2RHX A;  2LT1 A;  2O01 E;  4J6Y A;  3T9N A;  4EMK B;  3CCR T;  4C0D C;  5GAO l;  4C8Q C;  1YI2 T;  4HA8 A;  2LC4 A;  5LJ3 e;  2CKK A;  5A0D A;  1YJN A;  1VQK T;  5GMK i;  1YJW A;  1KQ1 A;  3RMQ A;  3L2Q A;  1Q7Y C;  2RM4 A;  2KDS A;  3P8B B;  5GAO m;  2EWN A;  4C92 C;  4E7I A;  2QQS A;  4QVD A;  2K3X A;  5DM7 R;  2RO0 A;  2XD0 A;  5CKE A;  1WQ7 A;  2L5Q A;  2XDD A;  4HCZ A;  3I56 A;  1X6O A;  2RHI A;  2VC8 A;  3MHX A;  3QDR B;  4YTL A;  1K8A U;  3CCU A;  3JB9 F;  1S72 A;  4F7U B;  1O9S A;  5GAN 4;  5GAO p;  4M7D G;  3GNF B;  3RUX A;  2RK1 A;  4XTV A;  5CVI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...