5LJ5h

Overall structure of the yeast spliceosome immediately after branching.
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
109
structure length
82
Chain Sequence
MKLVNFLKKLRNEQVTIELKNGTTVWGTLQSVSPQMNAILTDVKLTLPSDNIASLQYINIRGNTIRQIILPDSLNLDSLLVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords U5 snRNA (small nuclear RNA)
publication title Cryo-EM structure of the spliceosome immediately after branching.
pubmed doi rcsb
total genus 11
structure length 82
sequence length 109
chains with identical sequence l
ec nomenclature
pdb deposition date 2016-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5lj5h00
3QUIA 5GAN7 4A54A 4M7DG 5GANh 1WQ7A 2EJ9A 4C92B 5GMKm 2CGHA 4C92D 2E1HA 2DZCA 3EFSA 5GAMg 2YLCA 5CAIA 2E41A 4NOYA 3JCMJ 3JCMf 4PJOD 4F7UB 3JCMP 2QTXA 5GMKl 3FIFA 3L1AA 1WPYA 2RM4A 2RD1A 5GAMe 4M7DB 1WQWA 3JCMV 5GAMj 3HSBA 4M7DD 4M75E 1N9SA 3QSUA 5LJ5j 4XTVA 1B34A 1JRIA 4DQ2A 4OP0A 1N9RA 4JLIA 4M77D 4XQ3A 3RKWA 2JN0A 4M75F 4MMKA 3JCMg 5LJ3g 4M75G 5GAMf 4F7UF 2DTOA 4M78C 3QHSA 5LJ5f 4J6WA 3BFMA 5GMKe 5I21A 3JCMe 1TH7A 5GMKj 4F7UG 4M7DA 4EMGA 4EMKA 3M4GA 3QO3A 5LJ3e 4M78D 4C92C 4C8QE 1JBMA 2EWNA 2YLBA 1B34B 1U1SA 4Y91A 2HNIA 3V8JA 3SWNA 4PJOC 3RKXA 4M75B 4C8QA 5GAMd 1I81A 3FB9A 4M75D 4C8QF 4N0AC 4XU3A 1HK9A 5LJ5g 1WNLA 4X9CA 4M7DC 4C8QG 4M7AE 2E10A 5LJ3f 3JB9I 4RCBA 4M77C 5LJ5e 4EMKB 3JCMW 3BW1A 3SB2A 2ZGWA 4M7AA 4M7AF 5GAMh 4QVCA 1Y96A 4EMHA 4MMLA 5GAOq 3RERA 4NL2A 5LJ5h 5GAOm 1I5LA 4M7AG 1M8VA 3JCMd 1I8FA 3SWNB 2VXFA 4C8QB 5LJ3d 4C8QD 1LOJA 5GANj 3JB9H 3JCMb 5GAOl 1KQ2A 4WF2A 3PGGA 5GAN2 3EFRA 2EJGA 3GIBA 1HXDA 5GAN8 2E65A 2VC8A 4XTYA 5GMKh 4M7AB 2DTIA 4XTXA 4JRIA 4M75C 3RUXA 3JCMh 3V8KA 1LJOA 5LJ3h 5GAN6 1Y96B 3JCMX 5GAOn 1LNXA 3JB9J 1X01A 5GMKi 2VXEA 2DVEA 5LJ5d 4HT9A 4JUVA 3INZA 4XTZA 3RIRA 1BIBA 3RESA 3JCMQ 3BDUA 4XTWA 4PJOA 3FJPA 4J5YA 5GANg 2FYKA 5DY9A 3SWNC 3V7SA 4C8QC 1MGQA 4M77E 2RB6A 3V7RA 1BIAA 5GANe 2RA2A 4QVDA 2Y90A 4J6XA 3V7CA 4M77A 4XU1A 2EJFA 4M77F 5GAN5 2DEQA 2K57A 4HT8A 4M7AC 2DXUA 4M77G 3JB9F 4M78E 4PJOB 5GAOr 4V2SA 4M7AD 2I2LA 2DJZA 1KQ1A 2EAYA 2FB7A 3HFOA 4RCCA 5GANf 1D3BA 3JB9G 3AHUA 3HFNA 3L2ZA 4J6YA 4M78A 4XU2A 4C92E 5GAN4 1U1TA 4M78F 2DTHA 2YHTA 5GAOp 4A53A 4PJOE 4M78G 4C92A 4M77B 2E64A 1H641 4EMKC 1I4K1 4C92F 4M75A 4XTUA 4F7UE 4X9DA 5GANd 4M7DE 2DKGA 3JCMc 4C92G 3JB9D 4PJOF 4PNOA 4F7UA 1M5Q1 4N0AA 5GAN3 4XU0A 4PJOG 2DXTA 1D3BB 4JRKA 3BY7A 3RKYA 3V8LA 3VU3C 4HA8A 2DZ9A 4M78B 4M7DF 1YCYA 4NL3A 5LJ3j
chains in the Genus database with same CATH superfamily
3CMAT 3VRYA 2ESWA 3LGFA 1VOMA 3O8VA 4NOYA 1NJIR 4AFZC 3OB9A 2RQUA 2BUDA 1M9SA 3PMTA 1KJWA 4QQ6A 5CKFA 2X4XA 4AT1B 1AEYA 3HPWA 3P8HA 3QHSA 1I5OB 2BZ8A 3UDCA 1VQ4Q 1M1GA 3A8HB 1KSWA 3ZEHA 4C8QA 5GAMd 1WIEA 4C5HA 5KYUB 2FRWA 3OQ5A 1JJ2S 3DLMA 3G4SA 2ZCFB 4F16A 4ZTJA 1MHNA 2KQWA 1FXXA 3CCQA 1OPKA 4OB1B 4E7LA 2GQIA 4PLIA 1NYGA 4YTLA 3VS3A 4MDWA 2K5FA 1M2VB 2EGAA 3NFCA 2H3JA 1K73U 2D9TA 3CXCA 4EIKA 4JRQA 1QVGA 1ZSGA 2X4WA 1BIBA 2QGFB 1VQNT 2K5LA 2JTFA 3UPUA 3MEAA 3S6WA 3CC4T 3I56T 2HKNA 2V8KA 2A7YA 4Z8AA 2X3XD 2RJCA 2PUKB 1W2BA 1YJWT 4C5EA 3CCMA 4UC4A 1QVFS 2QQAA 3TSZA 7AT1B 3CMAA 4M7DE 1V76A 4MDXA 4Z02A 2NWMA 2VV5A 4PJOG 4M7DF 3M4YA 2WSCE 4ZNXA 1D09B 1WHGA 1OU8A 1G3SA 5GMKm 4C0DC 2DZCA 3EGXA 2QGGA 5CAIA 1O75A 2F2VA 2EPDA 3REBB 2D8HA 2XU8A 3CD6T 1AT1B 3GOXA 4M7DD 1BI2A 1UHFA 4JLIA 2MMPA 2EYXA 1UJ0A 1RABB 3RNJA 3CMET 5CKEA 3TSWA 3M4GA 3M0RA 2LNVA 3QJ6A 2X4JA 4MZPA 3HKSA 2HSEB 1YWPA 1Y0MA 2E10A 1M90C 5CQXA 1K9MC 1JJ2P 2DO3A 1VQ6T 5J3BA 2EKHA 2JS2A 2JZ2A 2X4YA 1I1JA 3M0UA 5GAOq 1I5LA 2J6FA 3JCMd 1J3TA 1ABQA 2LCSA 2QA4Q 3TQ7P 3FEOA 5GMKh 1QQJA 1X75C 1BU1A 2JUFA 2JM8A 1VQNA 1ZLMA 1GBQA 5GMKi 1VQPT 4BY6C 1VQ9T 1WHLA 3CC4A 2LQNA 3I56A 1TXQA 2L3RA 2FYKA 2LTOA 3SWNC 5CCAA 2RQVA 4WTOB 4AFSC 1KQSS 4C5GA 1BIAA 2RA2A 3OA6A 2KNBB 4JS5A 4BDYA 2R58A 4IKFA 2WACA 2LZ6B 4FT4A 3NTKA 3JRZA 1JEGA 2HL5C 2LQKA 4PJOB 1VQOQ 4M7AD 2P4TA 4X34A 5KYYB 3QIIA 3JAME 1H641 4F7UE 1KIKA 3CBOA 2XMFA 1YI2Q 2PTKA 1R0CB 3RKYA 3VU3C 2DK3A 4KRTA 4E2FB 4Z88A 3M5AA 3CD6A 3OW2S 4OGEA 3C95A 1Y57A 4QT7A 1IXDA 2XK0A 4F17A 1PKSA 2QDLA 1NZ9A 2NUZA 4ZN1A 1S72Q 4J9GA 2RNAA 2PUOB 3P8DA 1WI7A 1N9SA 3CMEA 2HD0A 4OP0A 1ZX6A 4RUGA 3M55A 2SRCA 2M0YA 3PT9A 1MV0B 5LJ3e 1VQ8Q 2B8AA 1B3QA 1YCSB 1VQ6A 2D0NA 3CCEQ 4AMCA 1X27A 5LJ3f 1ZUKA 2RJFA 1UG1A 4J9EA 3CCJT 2JT4A 3KBGA 3NTHA 5GAOm 2C0TA 5KE3A 1C1AA 3OS5A 5CQYA 2L3SA 2COWA 4JZ4A 5KYXB 2GQVA 2DIQA 3OS0A 2ZPGB 3VUZA 1MNEA 1WXUA 2EBPA 1XOVA 1KD1C 4WCIA 4E7HA 4OB0B 1NPRA 1X43A 3LW5E 2LVMA 2PVGB 1A0NB 2KROA 4ZGEB 1Q82U 2K7AA 4JS4A 4XTWA 4J5YA 5GANg 4GY5A 1KQSP 1PRMC 2BTTA 3H0HA 1JXOA 4CC3A 1KC8U 5IHIA 4C5IA 1MUZA 2DD4A 3G7ZA 2K3BA 3REAB 4N4GA 1YN8A 3WVDB 1JB0E 4PNOA 2EFIA 3I55Q 4BI3A 1UDLA 2MIOA 3T9NA 3QDFA 4AFQC 2E5QA 1PG5B 4M7DG 3GNGA 4OMPA 2RHYA 5L23A 3EFSA 4TVRA 5GAMg 1YITA 1PCXA 3CCLT 4ATOA 1UE9A 2QTXA 3CBMA 1IREB 4OF1A 3OYIA 4M77D 2QXFA 4A63B 2ZPEB 2DTOA 2DILA 4QKUA 1NJIU 5IT9E 1B34B 3SWNA 3CCJA 3HRTA 1M1FA 3E9FA 4C0FA 5CKDA 1QCFA 4FM4B 2LT4A 3BW1A 1VQ7A 2RPNA 3RERA 4CRIA 1YJNQ 3VS0A 4A4KA 1SEMA 3EG9A 2E70A 2K79A 2FEIA 2EQJA 1H3ZA 1X01A 2O01E 2KGTA 4CC2A 3R6OA 4NS5A 5FROA 2CYZB 2G3RA 3FJPA 1WLPB 3UWNA 4LDXA 2M16A 3TEEA 2PVDB 1AWOA 5FRNA 3V7CA 2F69A 2ED0A 3LWIA 3LX7A 4II1A 2RN8A 4M78E 4JRPA 4V2SA 1F1BB 2K5IA 1KG1A 2COZA 4C92E 2DVJA 4M78F 5CKBA 3PIOA 2DMOA 5IN1A 2E64A 4C92F 1QWFA 2XKOC 2DJQA 1N5ZA 1M1KR 3SHWA 4DOVA 2QA4T 4JJCA 3CCLA 4LN2A 2HBWA 4JPBW 2DFUA 1SF9A 1JXMA 4C92D 6AT1B 1RAGB 2WSFE 4EDUA 3JCMf 2O4XB 5GMKl 2EYZA 5AT1B 2DEUA 3VS6A 3A8GB 1RAEB 4BDZA 5I2SA 4BE0A 2MF2A 3JCMg 2D1XA 5A0GA 5KYUA 2JTEA 3OYNA 1FMWA 5I21A 4CC7A 1WHMA 4K11A 4C8QE 2EYWA 1VQOT 3VS4A 1JJ2A 4C8QF 3PE0A 1ZSZB 4N0AC 4OB2B 1WNLA 2BZYA 1YIJQ 1MMNA 5LL6S 1M2VA 4EMKB 2KYMA 1YI2T 1GFDA 3PNWC 4NL2A 2EQMA 1FX7A 3EFOB 2OTLA 1IGQA 3OMGA 4C8QD 3QG1A 3C12A 3L2QA 4JLGA 2DL7A 4M7AB 2DTIA 1IB8A 1Y71A 1S72T 1FMVA 2VXEA 4JUVA 3INZA 1YBYA 1ZUYA 3BDUA 1TOVA 2OAWA 4JDSA 2DXCA 3O5ZA 1VQ8T 4ESRA 1GFCA 1VQMQ 2E12A 1C0MA 4F14A 3VS2A 2PQWA 2CSQA 4OMLA 4BB7A 3JB9F 3CCET 5GAOr 2RO0A 3NHNA 2JMAA 1QVFA 4QVZA 4DBQA 2QA4A 1I4K1 2CS7A 3A8MB 4L5GA 3JB9D 3TU4K 5KYNA 1W6XA 4OMNA 2EVRA 1AOJA 1S1NA 1M3CA 2ZPIB 2LCCA 4HKEA 4RTWA 1R77A 1U06A 5GAMj 2JW4A 4M75E 2M02A 3PFSA 2KSSA 1K1ZA 3L2UA 4M75F 5FU6B 3NPFA 5L8RE 1VQOA 3META 4KH1B 3CPFA 4ME7A 4KUDK 1OZ3A 3R6NA 1CKBA 1XNIA 1HJDA 1YI2A 2QDYB 4M75D 3M58A 3EG1A 2DAQA 2RHXA 2M9UA 2CT4A 3EHQA 1P92A 2J7IA 3I55T 2DX1A 5D6WA 1PC0A 4KGZB 2VKNA 2ROLA 1S72A 5GAOl 5GAN2 2A08A 1Q86R 4RTVA 3EG0A 5IAYA 4JRIA 5GAOn 1IZ6A 1QP2A 2YRVA 1VYUA 1ZA1B 3RIRA 2ZPBB 1KQSA 1VQ8A 4PJOA 2M51A 2E6ZA 4PLLA 1CKAA 5CO7A 1ACMB 2RB6A 5KYYA 4J6XA 1VUBA 4XU1A 4E7IA 2CT3A 2FVUA 3J81E 3MPUB 2AT1B 3CC7T 2L3PA 1IHVA 1NYFA 2QQSA 1JU5C 4M78G 4M77B 3OMCA 4C92G 2KXDA 1M5Q1 4N0AA 3VV0A 3TCJA 4XU0A 4JRKA 3OW2A 1VQ5A 1NLPC 1YFNA 3OY9A 3EHRA 3G6EQ 1BK2A 2DRKA 4A54A 3QKJA 5IHNA 2O9SA 2EJ9A 1K73C 2BIVA 1GL5A 2Y4XA 4GBQA 4IUTA 1RLPC 4A4GA 2ZZDA 2RH2A 4A4EA 1VQKT 3NMZC 4GLMA 2K9GA 4PJLA 4DQ2A 1D1CA 1Q81R 3UA7A 1WXTA 3URGA 4ZTFA 1G3WA 3VUBA 4BE1A 2J06A 4Y28E 1W1FA 1MV3A 3X20B 2V26A 4RG2A 3GPLA 5KYXA 4C8QG 4VUBA 4LUEA 1Q7YR 4IUUA 2PU9B 4PK4A 3CCUQ 5I2MA 1LOJA 1IRXA 2GBQA 1G3TA 1UFFA 1GCPA 2VUBA 2RQRA 3GIBA 3S3OA 4C0GA 4XTXA 2LX9A 1W4SA 5CK9A 3QDRB 1ZSZC 1LNXA 3H0IA 3VYGA 1RADB 4J9IA 4KBMB 1ZBJA 3CEYA 1GCQA 1GBRA 2QI2A 1WFWA 3SDZA 4Q5WA 1OQKA 3SD4A 1YJ9T 2RK1A 2W10A 1YHQQ 8ATCB 3CC7A 4J83A 2PNIA 4M7AC 3LH0A 2RF0A 1BI1A 1R8OB 3ULRB 4FYYB 3JB9G 5FW9A 3E19A 1YIJT 1FYNA 1T3SA 4ZGDB 2ECZA 1PSEA 2K3XA 2R5AA 4D8KA 2CP0A 1M8MA 3HHTB 3OBYA 3M57A 2KR3A 2E3HA 5FU7B 4ZN3A 4GLKA 2XHCA 2DNUA 5GJWB 5IH2A 3CCSQ 4HCKA 4FIBA 1YJWA 5AYFA 1WHHA 1BCMA 2CGHA 1VQKA 2DE0X 1SHFA 4HXJA 1AZGB 2HAXA 3MP8A 4ELYC 3M54A 2LRQA 4J9BA 2CSIA 3MO8A 4E7ZA 5LJ5j 2LMJA 4KGXB 4HVUA 1B34A 1M1KU 1Y07A 2EQIA 2RHUA 5IXFA 1N9RA 3RKWA 4A4FA 3NTIA 2X3WD 3GNFB 4M75G 4IUVA 2DA9A 2CUDA 4F7UF 2LC4A 2RK2A 4J6WA 1VQMT 4FYVB 4KULA 1N8RU 3H0FA 3CPWP 5DLQE 3NGPA 3V8JA 1X2QA 2W0ZA 1PNJA 1TWBA 1M1KC 1R0BG 1M4ZA 1NLOC 1OX9A 2XIDA 4LE9A 3OYHA 2V1RA 4N4HA 3LWHA 5GJVB 3SB2A 4QVCA 5FU6C 5FLXE 5CR2A 4ORZA 4Z89A 2KE9A 2H8HA 2F5TX 2C06A 1RI0A 1OYXA 3PGGA 4RTZA 1OULA 1D1AA 1UB4A 2VASA 2IVWA 2DRMA 3VS5A 5LJ3h 1VIEA 2QASA 3EAEA 2LCLA 2NUPB 2QQ9A 2M1HA 3I9QA 5LJ5d 3C94A 3VKIA 1YJ9A 4L59A 2GGRA 3H8ZA 4R55A 3JCMQ 3EG2A 3QZ9B 4ZGJB 3JSCA 2KVQG 1MGQA 5CIUA 1UUEA 2CP7A 5D6XA 5GANe 5A0LA 3G4SQ 2P84A 4O6JA 1YIJA 1VQPA 2DETA 2FL7A 1VQ9A 1UGQB 3CCQQ 3F70A 4ELZC 1WA7A 4RCCA 5GANf 2RQTA 4IUQA 1EX4A 3HFNA 4J6YA 3OYDA 2YXYA 5GAN4 1U1TA 2DTHA 2HEQA 3OSVA 3MCAB 1B07A 1QVPA 3JCMc 3BE3A 2O4XA 2AHJB 2GFAA 1D3BB 1XQHA 1VQ4T 2J6KA 3QUIA 2LQ8A 2HSPA 3L2RA 3RBBB 4A4HA 1C6VX 2H3EB 1T0JA 3JCMP 3DKMA 1Q82C 2L8DA 2KXCA 2RM4A 4AG2C 5GAMe 1WX6A 3QSUA 1I0CA 1VQMA 3I5SA 2KI7A 1K76A 2ABLA 2HZYA 2R57A 4QQGA 1ZSZA 2OTJQ 3OYYA 1KC8C 3N5BB 1TG0A 5GAMf 4D8DA 1G2BA 2MWPA 1OZ2A 4EMKA 3CMAQ 1NEBA 3EH1A 3EFOA 2QEXQ 4E47A 2WSEE 1I81A 1TS9A 3EH2A 3QPHA 2GCXA 3IQLA 1WJQA 1QVGP 4BE2A 2ZAEA 5CKHA 5HKCA 4M7AA 4R0KA 1LPLA 3MHXA 1X2KA 3G6ET 5HCKA 4D6WA 3EFRA 2AKKA 2L3QA 1WXBA 3MP1A 9ATCB 2RQWA 3JCMX 1U8RA 1BI3A 4HT9A 1SKUB 2ATCB 1W2BP 2EGCA 2Y4YA 3RESA 2D0QB 1Z9QA 1Q86U 2YUNA 3CCRQ 1NJIC 1K9MR 3UF4A 1RI9A 2JOYA 1NPPA 3AHUA 1H8KA 4J9CA 1K8AU 2JS0A 2NUTB 1SG5A 4J7IA 2CZ7B 3CCUT 1VQ4A 3CQTA 2BZXA 3ME9A 2AKLA 1BBZA 2F5KA 3I56Q 1SRLA 2GF7A 4NL3A 1NG2A 1IGUA 5HY6A 4P5NA 4OMMA 3TVTA 2L0AA 2YRDA 3FDRA 3ZL7C 1UHCA 2LQWA 3FIFA 2RD1A 4M7DB 2B86A 3RMSA 4Y92A 2JTMA 1TTHB 4C0ZA 2NLUA 3DB3A 1E6GA 5FU7C 2JVVA 1AZEA 1UTIA 2CUBA 3JCMe 5GMKj 4F7UG 3PIPA 2KYBA 4M78D 1PHTA 1OEBA 3S3MA 2O2OA 2IG0A 4PJOC 2CREA 1HK9A 4X9CA 1Q81U 1N8RR 1FMKA 2KY9A 1PD1A 5DM7R 3G6EA 1EIFA 3JCMW 1OOTA 2DIGA 5A2QE 5C0MA 3Q1JA 1K9AA 3QJYA 3M53A 4FU6A 5J39A 3BDLA 3JB9H 1I07A 2XI9A 3CCST 2KRNA 3CMEQ 3HRUA 1HXDA 4RG8A 1LCKA 1Y7XA 2BE9B 1AVZC 5FWBA 3E9GA 1UECA 2E5KA 2YT6A 1LJOA 3MEUA 1Q7YU 2CZ6B 4HVVA 1RAAB 1W70A 3UT1A 5I11A 2MWOA 2RJEA 1EZZB 1HD3A 2F2WA 1VYVA 2KMTA 2MAMA 2YRCA 4J7FA 3VS1A 2KT8A 1D1BA 2FRYA 2GTOA 2Y90A 3A8LB 3OYJA 4M77A 3OYKA 2C0IA 5GAN5 2K57A 2X35A 4AG1C 4M4ZA 1VQLQ 2JXBA 3CCUA 2KK4A 2AK5A 1Q95G 3ZBDA 2K2VA 2YHTA 3OYFA 3ER0A 2FZGB 1QMCA 4X9DA 4BI8B 4OMFB 4LDUA 2LT1A 4E7KA 2RHZA 4B9WA 3CCVQ 4X1VA 3VRZA 5EG2A 5LJ3j 4O5VA 4QW2A 1RAFB 4F7UB 3A98A 3PVQA 3OYMA 1QCNA 1WQWA 4N4IA 3G1JA 4DBHA 4XTVA 2KBTA 1FWZA 3MKDA 4OGCA 4DEYA 3QXEB 1OX8A 3G4ST 4LDVA 3FC3A 2RI3A 4FSXA 4XK8E 2GFUA 5LJ5f 3HP9A 3DLLA 3UATA 1G83A 2KDSA 1GCQC 3I5RA 3CC2Q 3DB4A 3RKXA 1NBEB 1WJSA 1M27C 5LJ5g 1AWJA 3FRNA 4RCBA 3CCSA 2ED1A 1X6OA 1YITQ 4PKCC 1M8VA 1VYTA 1ZA2B 2VXFA 5LJ3d 2FO0A 1QLYA 2A36A 3J80E 1AHJB 4B9XA 4OMOA 2VC8A 3V8KA 2HQXA 1KK7A 1D0XA 1PD0A 2DVEA 3A1PA 1JO8A 4OB3B 2EKOA 5IXBA 3VYHB 3CCJQ 2OTJT 1T3LA 3HRSA 5KCHA 2VYTA 1RLQC 3G71Q 1PSFA 3OYLA 1VQ7Q 4J9HA 1H92A 1M3BA 2DXUA 2QEXT 3OYCA 3EGDB 2LNHB 1BKBA 1G3YA 3OYAA 3KXTA 1IO6A 2DERA 1WYXA 2VB6A 3CBPA 1K8AR 5DLOA 3OYGA 3CCEA 2DBKA 1U5SA 2DZ9A 4FT2A 1G8XA 2CZ1B 2OX7A 3QBYA 2V1QA 2EQKA 3LLRA 4BD3A 1SHGA 5EC7A 3E2UA 2AIRB 2VVKA 5J26A 1K0SA 4LNPA 1JRIA 4RTXA 3CCRT 2KAFA 1YJNT 4MMKA 2P0QA 2GTJA 4LD9K 1WJRA 3U23A 3QO3A 1JBMA 1U1SA 2FPFA 4Y91A 1X6BA 1RL2A 3FB9A 4PJJA 3HL8A 3CCLQ 4M7DC 1AWWA 1EFNA 2ZPFB 2DD5A 2D8JA 4MMLA 2NUPA 2SEMA 3THKA 2MCNA 3PVLA 4XAXB 2EGEA 4FYWB 2EJGA 5D6YA 2P0PA 1MNDA 3CPWS 1M2OA 2DL8A 1WDXA 1Y96B 1KHIA 2OTJA 2X51A 1UGVA 3I55A 2YUQA 3QWYA 3M56A 2MOXA 2MYSA 2XICA 1WGSA 3M0SA 3QZ5B 2QEXA 3M0TA 3V7RA 3WVEB 5A0DA 3VS7A 4HVWA 2OTLQ 2A3LA 2I2LA 3FLGA 1KQ1A 2FB7A 1D3BA 1MMGA 2J05A 4L6V5 2MPXC 4EMKC 1M90U 4J8OA 4M75A 4F04B 1K9MU 1UEBA 3C4SA 2KRSA 2DPPB 3OSSC 2QYZA 3V8LA 4HA8A 4M78B 1SRMA 1TSFA 2KT1A 1WQ7A 2LJ3A 4C92B 1ZQ1A 2YLCA 2E41A 2KRMA 3X25B 3CCRA 2VWFA 1YJNA 2Z0WA 4LD6A 3I35A 1OPLA 4HCBA 3D7SB 2XDPA 2JN0A 2OJ2A 3MEWA 3LYIA 1OV3A 4B6MA 2CP6A 3BFMA 5GMKe 4DEXA 2LJ0A 1VQLT 1GXIE 3SEMA 2FZKB 2LJ1A 1D0YA 2RI5A 2CDTA 2NYSA 4KH0B 4M7AE 2RJDA 1UGSB 1Z9ZA 4M7AF 1BYMA 4C8QB 4DBFA 1NM7A 3SFMA 3CCVT 2XG8D 2VGNA 3UA6A 1B7TA 1AWXA 4XTYA 1K4US 5GAN6 3RR6A 2P0KA 5I22A 2QQRA 5FWCA 2JM9A 2CP3A 2LP5A 3CXCS 1PM3A 1QVFP 1QVGS 5HK0A 1ZBXA 3M0QA 2DYIA 1X69A 1KHCA 1OI1A 1N8RC 2K2MA 4FL6A 2HQHA 2QQBA 4J9FA 2EJFA 4MZTA 2NUTA 3CC2T 1VA7A 4XU2A 3HTRA 2CH4W 5GAOp 1W2BS 4DOWA 1YITT 4LDYA 1E7OA 2XDDA 1QW1A 4ANJA 1TUCA 4M7DA 2DM1A 3BY7A 3LGLA 4IIOA 4JJDA 3X28B 5GANh 2EYYA 4RTTA 2O31A 3L2WA 2COYA 3JCMJ 2K4YA 1LVKA 1KD1U 3MP6A 1WPYA 3E1SA 2YSQA 3RMQA 1VIFA 4KUIA 1VQLA 1BCOA 5M9OA 3EGXB 3G71T 5LJ3g 2HMAA 1VQ7T 2L89A 5KYWA 2QTVA 2E4HA 2PZ1A 4EMGA 1QKXA 1WHKA 3ZFJA 2F1LA 1ABOA 4IUPA 1YNZA 4M75B 3OS2A 1VQ5Q 2M0OA 4FYXB 4PFOA 3CCVA 4M77C 1K73R 5GAMh 2PVOB 3X26B 1RACB 1I8FA 2R5MA 2DLPA 1AD5A 3AT1B 3CCMQ 1KQ2A 1PWTA 4WF2A 4J9DA 1M30A 2E65A 3RUXA 3HSBA 3JB9J 1WHJA 2OI3A 2E6NA 2DL3A 2RI2A 5D7UA 1TUGB 1JQQA 1MMAA 3CXCP 1M3AA 2L2PA 2BE7D 5CVIA 1D0ZA 4FW2A 3V7SA 2CKKA 3CC2A 4HCCA 4M77E 4KT0E 3L42A 2C0OA 3OS1A 2QG9B 1QWEA 2BKDN 3EG3A 4M77F 2HCKA 4RMOA 2DEQA 3OW2P 4HT8A 1SSHA 2FG0A 2YWWA 3HFOA 2JNGA 3H41A 3L2ZA 4JJBA 1XTDA 1IHWA 2D6FA 3MJXA 3GP8A 2FHDA 3M0PA 4XTUA 4F7UA 2K3YA 1U3OA 2DYBA 2DXTA 1OU9A 1GRIA 1YCYA 1M90R 5GAN7 4CI0C 2DL5A 4IIMA 2E1HA 5IHKA 4LDWA 2A28A 4FCYA 2YDLA 1UGPB 4R56A 3GLXA 3CC7Q 2OAUA 3JCMV 3G71A 3H6ZA 1Q86C 2FPDA 4JJNK 2ZPHB 4KGVB 1VQNQ 4QQDA 4M78C 3CC4Q 4E7SA 1TH7A 3H9NA 2RHIA 4C92C 2OTLT 2EWNA 2YLBA 4PFZA 4LUDA 1QCOA 1QP3A 5HK3A 3A5ZB 1BB9A 2JJ9A 1K8AC 2CP2A 2ENMA 1DJ7B 1YJWQ 3GF5A 1XJWB 5KCOA 3JB9I 1VQKQ 2O88A 4PJMA 2IIMA 4EMHA 4E7JA 4M7AG 2MK5A 1YHQT 3JCMb 2CH4A 1TU0B 2EIFA 1SPKA 2EQUA 4RKUE 5ECAA 3JCMh 2DXBA 2HQEA 3L2VA 2KEAA 3CD6Q 3OYEA 5KYWB 1ZUUA 2EW3A 3OBWA 3M59A 3J7AF 3EGDA 1V1CA 3QWXX 4C8QC 2K6DA 3JV3A 4QVDA 4MZMA 1UJYA 1SSFA 4CC4B 2CZ0B 2V8JA 5KE2A 4BACA 4C0DB 1G5VA 1Q81C 2DJZA 1BI0A 1NEGA 1HYOA 3M9QA 2MI6A 2XD0A 3PTAA 3MEVA 2J6OA 4PJOE 1HSQA 4RTYA 2XDBA 1VQ6Q 1ARKA 4PJOF 5FRMA 3VJPA 2LX7A 4OVAA 5GAN3 1YJ9Q 3TREA 2JMCA 3OYBA 1KFZA 4FW1A 1Q7YC 2CP5A 1NE8A 2P4RA 1RAIB 3WXMB 2DF6A 4PJOD 1MMDA 2AZVA 4E6RA 4AFUC 3L1AA 3P8BB 1VQPQ 2YUOA 4DA4A 1VQ9Q 2GNCA 3LH5A 4PL6A 4BI4A 4XQ3A 1KD1R 3FJ5A 2HL3A 4RTUA 4HCZA 3EGUA 2HBPA 3PMIA 4BUGA 2HNIA 1T0HA 3X24B 4XU3A 3S3NA 2F2XA 2QAZA 3A8OB 1CSKA 1PRLC 4BY6B 1E6HA 3ASKA 4PJNA 2A37A 1X6GA 1YHQA 5LJ5e 2ZGWA 1Y96A 1WZOA 5LJ5h 1TUDA 3QYGB 2EYQA 3SWNB 1Q82R 2X9HA 5GANj 3RDVA 2YUPA 3CPWA 1ZHIA 2HKQB 2RMOA 1QKWA 5GAN8 3KFVA 2E3IA 2I0NA 2QK0A 3CCQT 4M75C 1KC8R 3KUFA 1UGRB 1H3HA 3C0CA 5C6SA 2LDMA 1RUWA 4XTZA 2AZSA 2IPOB 4OMQA 3EG9B 1YWOA 2FZCB 1N27A 5DY9A 1YP5A 2HDAA 4DBRA 5KH6A 2FPEA 1N6AA 4PFPA 2L5QA 1RAHB 1PKTA 4M77G 1VQ5T 2EAYA 2VGMA 8AT1B 4M78A 2ROTA 2O9VA 4EPCA 4IURA 4LXCA 1V29B 4A53A 4C92A 2DL4A 2V8IA 5GANd 4FSSA 2DBMA 2DKGA 2A0FB 3CCMT 1K0XA 1O9SA 3GBQA 4JZ3A 2G6FX 3QYHB
chains in the Genus database with same CATH topology
3QUIA 3CMAT 2LQ8A 3LGFA 1WQ7A 4C92B 3L2RA 3O8VA 4A4HA 4C92D 2WSFE 1ZQ1A 2YLCA 2E41A 4NOYA 3X25B 4EDUA 3JCMf 3CCRA 2O4XB 3JCMP 3OB9A 3DKMA 5GMKl 4LD6A 2L8DA 1YJNA 1Q82C 2RM4A 2BUDA 1M9SA 5GAMe 3PMTA 3A8GB 4HCBA 3QSUA 4BDZA 2XDPA 4QQ6A 1VQMA 5I2SA 4BE0A 5CKFA 2R57A 2X4XA 2JN0A 2MF2A 4QQGA 3JCMg 3HPWA 3OYYA 3MEWA 3N5BB 1KC8C 5A0GA 3LYIA 3P8HA 5GAMf 2MWPA 3QHSA 3OYNA 3BFMA 1OZ2A 5I21A 5GMKe 3UDCA 4EMKA 4A4GA 4C8QE 1VQLT 1M1GA 3A8HB 1GXIE 1VQOT 2RI5A 3ZEHA 4C8QA 2WSEE 1I81A 4E47A 4C8QF 5GAMd 1JJ2A 4N0AC 3QPHA 4OB2B 1WNLA 2GCXA 4M7AE 1WJQA 4HCCA 4C5HA 1JJ2S 4IKFA 3OQ5A 3DLMA 5LL6S 3G4SA 2RJDA 2ZCFB 1UGSB 4BE2A 5CKHA 4EMKB 5HKCA 4ZTJA 1YI2T 4M7AA 4M7AF 1MHNA 2KQWA 1FXXA 3PNWC 4NL2A 2EQMA 1FX7A 1BYMA 2OTLA 4C8QB 3CCQA 3OMGA 3SFMA 4OB1B 4C8QD 3CCVT 3MHXA 3G6ET 4E7LA 4E7IA 4PLIA 3QG1A 4YTLA 2XG8D 2VGNA 4D6WA 3EFRA 3C12A 4MDWA 2K5FA 3L2QA 4JLGA 4XTYA 4M7AB 2DTIA 5GAN6 3NFCA 2H3JA 3MP1A 3JCMX 1K73U 1Y71A 2P0KA 1S72T 2D9TA 3CXCA 2QQRA 2VXEA 4JRQA 1U8RA 1QVGA 1BI3A 4HT9A 4JUVA 3INZA 1YBYA 2X4WA 2Y4YA 3CXCS 1BIBA 3RESA 2D0QB 1QVGS 5HK0A 3BDUA 1VQNT 2K5LA 1ZBXA 2JTFA 1Q86U 1KHCA 3UPUA 3MEAA 3S6WA 3CC4T 1NJIC 4JDSA 2DXCA 3I56T 1OI1A 1N8RC 1VQ8T 4FL6A 2QQBA 4MZTA 2EJFA 2V8KA 2E12A 2JOYA 2A7YA 3CC2T 1NPPA 2PQWA 4BB7A 3JB9F 3CCET 2RJCA 5GAOr 2RO0A 3AHUA 2PUKB 1W2BA 4XU2A 1YJWT 1QVFA 4C5EA 4QVZA 1K8AU 3CCMA 5GAOp 1W2BS 4UC4A 4DOWA 1YITT 2QA4A 1QVFS 2QQAA 4LDYA 1I4K1 4J7IA 2CS7A 3CCUT 2CZ7B 2XDDA 3CMAA 1QW1A 1VQ4A 3A8MB 4M7DE 4L5GA 4MDXA 3JB9D 4Z02A 3ME9A 2VV5A 3TU4K 2F5KA 4PJOG 4M7DA 3BY7A 4M7DF 3M4YA 3LGLA 2WSCE 2GF7A 4NL3A 3X28B 5GANh 5HY6A 1G3SA 5GMKm 4C0DC 2ZPIB 4P5NA 2DZCA 3L2WA 5CAIA 3JCMJ 2K4YA 1O75A 2LCCA 1KD1U 4HKEA 3FDRA 3MP6A 3FIFA 2XU8A 1WPYA 3CD6T 2RD1A 4M7DB 3E1SA 3RMSA 5GAMj 3GOXA 4M7DD 4M75E 2JTMA 1BI2A 3PFSA 2KSSA 3RMQA 1VIFA 4KUIA 4C0ZA 2NLUA 3DB3A 4JLIA 2MMPA 3L2UA 5FU7C 4M75F 5FU6B 1VQLA 5M9OA 5L8RE 1VQOA 3META 3G71T 5LJ3g 2HAXA 2JVVA 3CPFA 4ME7A 3CMET 1VQ7T 4KUDK 1OZ3A 2L89A 5CKEA 3JCMe 5GMKj 4F7UG 3PIPA 4EMGA 3M4GA 4M78D 2LNVA 3S3MA 3QJ6A 2X4JA 3ZFJA 4IUPA 1XNIA 2IG0A 4MZPA 4PJOC 4M75B 1YI2A 3HKSA 2QDYB 4M75D 3OS2A 1HK9A 3M58A 4X9CA 2M0OA 1Q81U 2E10A 2DAQA 2KY9A 1M90C 5CQXA 1K9MC 5DM7R 2RHXA 3CCVA 3G6EA 1EIFA 2DO3A 2M9UA 4M77C 5J3BA 3JCMW 1VQ6T 2JZ2A 5GAMh 2X4YA 2DIGA 2PVOB 1P92A 5GAOq 3X26B 5A2QE 5C0MA 3I55T 1I5LA 3Q1JA 5D6WA 3JCMd 1I8FA 2R5MA 3M53A 3QJYA 4FU6A 5J39A 3BDLA 3JB9H 2XI9A 3CCST 1S72A 1KQ2A 5GAOl 4WF2A 5GAN2 3HRUA 1HXDA 4RG8A 1Y7XA 2E65A 3FEOA 3RUXA 3E9GA 5IAYA 4JRIA 5GMKh 3HSBA 3MEUA 3JB9J 1LJOA 1Q7YU 1X75C 2CZ6B 2JUFA 5GAOn 2E6NA 1VQNA 2RI2A 1IZ6A 5GMKi 1VQPT 1QP2A 3UT1A 2MWOA 4BY6C 1VQ9T 2YRVA 3CC4A 3I56A 3RIRA 2RJEA 2ZPBB 1KQSA 1VQ8A 2L3RA 5CVIA 4PJOA 2FYKA 2LTOA 3SWNC 3V7SA 2CKKA 2KMTA 2E6ZA 2MAMA 5CCAA 4J7FA 4PLLA 1KQSS 5CO7A 4M77E 2RB6A 4C5GA 1VQ4T 4KT0E 1BIAA 2RA2A 3L42A 2Y90A 4J6XA 3A8LB 3OYJA 3OA6A 3OS1A 4M77A 1VUBA 4XU1A 4JS5A 2BKDN 3OYKA 4M77F 5GAN5 2R58A 2DEQA 2WACA 4FT4A 4RMOA 4BDYA 2K57A 2X35A 4HT8A 3NTKA 3JRZA 2FVUA 2LQKA 4PJOB 3CCUA 4M7AD 3J81E 2P4TA 2KK4A 3HFOA 2JNGA 3L2ZA 3CC7T 1XTDA 4X34A 3ZBDA 2K2VA 2QQSA 3QIIA 3JAME 2YHTA 3OYFA 2D6FA 4M78G 3GP8A 2FHDA 4M77B 1H641 3ER0A 4F7UE 4XTUA 3CBOA 4X9DA 3OMCA 4BI8B 4OMFB 4LDUA 4C92G 4F7UA 2K3YA 1M5Q1 4N0AA 3VV0A 2LT1A 3TCJA 4XU0A 2DXTA 4JRKA 3RKYA 3VU3C 3OW2A 4E7KA 2DK3A 1VQ5A 2RHZA 4B9WA 3OY9A 1YCYA 3M5AA 5EG2A 5LJ3j 5GAN7 3G71A 4A54A 3QKJA 4CI0C 3OW2S 3CD6A 4O5VA 4OGEA 3C95A 2EJ9A 1K73C 2E1HA 2BIVA 4QW2A 2XK0A 4LDWA 2Y4XA 4IUTA 1NZ9A 4F7UB 4ZN1A 3OYMA 1UGPB 4R56A 3GLXA 2OAUA 1WQWA 2ZZDA 2PUOB 3P8DA 2RH2A 3JCMV 3H6ZA 1N9SA 4N4IA 4A4EA 3CMEA 1VQKT 4XTVA 2HD0A 1Q86C 4DQ2A 4OP0A 1FWZA 4JJNK 2ZPHB 4OGCA 3QXEB 3M55A 3URGA 3PT9A 4QQDA 4ZTFA 1G3WA 4LDVA 3VUBA 3G4ST 3FC3A 4BE1A 2RI3A 4FSXA 4M78C 2GFUA 4XK8E 4Y28E 5LJ5f 3HP9A 3DLLA 1TH7A 3X20B 2RHIA 5LJ3e 4C92C 2B8AA 2OTLT 2EWNA 2YLBA 2KDSA 1VQ6A 1QP3A 3DB4A 3RKXA 5HK3A 3A5ZB 1WJSA 1K8AC 4RG2A 3GPLA 5LJ5g 1DJ7B 4C8QG 5LJ3f 4VUBA 3CC2A 3GF5A 5KCOA 2RJFA 3FRNA 3JB9I 4RCBA 3CCSA 4IUUA 2PU9B 1X6OA 3CCJT 4EMHA 3KBGA 3NTHA 5I2MA 4PKCC 5GAOm 4E7JA 4M7AG 1M8VA 5KE3A 2VXFA 5LJ3d 5CQYA 1LOJA 3OS5A 1G3TA 1YHQT 3JCMb 3J80E 1AHJB 2VUBA 2GQVA 2DIQA 4B9XA 3OS0A 2ZPGB 2EIFA 3VUZA 3GIBA 3S3OA 2EQUA 2VC8A 4RKUE 4C0GA 3JCMh 4XTXA 1XOVA 2LX9A 3V8KA 1KD1C 1W4SA 5CK9A 4E7HA 2HQXA 2DXBA 2HQEA 1LNXA 1NPRA 3QDRB 4OB0B 3L2VA 3LW5E 2LVMA 2PVGB 3VYGA 2DVEA 4OB3B 2EKOA 4KBMB 4ZGEB 3OYEA 1Q82U 3CEYA 4JS4A 4XTWA 3VYHB 3OBWA 3M59A 2OTJT 4J5YA 5GANg 4GY5A 2QI2A 3J7AF 4C8QC 3SDZA 3HRSA 5KCHA 4Q5WA 3SD4A 2VYTA 1YJ9T 2RK1A 4QVDA 1PSFA 3OYLA 4MZMA 1KC8U 4C5IA 1SSFA 3CC7A 2CZ0B 4J83A 2V8JA 2DD4A 5KE2A 4M7AC 3G7ZA 4BACA 2DXUA 2QEXT 3LH0A 1BI1A 1R8OB 4C0DB 1G5VA 1Q81C 2DJZA 1BI0A 3OYCA 3JB9G 3E19A 3M9QA 1BKBA 1YIJT 1G3YA 2MI6A 4ZGDB 2XD0A 3OYAA 3KXTA 3PTAA 3MEVA 1PSEA 2K3XA 2R5AA 4PJOE 4N4GA 2XDBA 3WVDB 3HHTB 3OBYA 1JB0E 3M57A 4PJOF 5FRMA 4PNOA 3CBPA 5FU7B 4GLKA 2EFIA 3VJPA 4ZN3A 5DLOA 4BI3A 4OVAA 5GAN3 3OYGA 3T9NA 2XHCA 3TREA 3CCEA 2DZ9A 3OYBA 2E5QA 4M7DG 4FIBA 4FT2A 1YJWA 1Q7YC 3GNGA 5AYFA 2CZ1B 1NE8A 2RHYA 1VQKA 2CGHA 3QBYA 3EFSA 4TVRA 2EQKA 3WXMB 5GAMg 1YITA 3LLRA 3CCLT 4ATOA 4PJOD 4BD3A 2QTXA 3CBMA 1IREB 3MP8A 3L1AA 3P8BB 3M54A 5J26A 2LRQA 4OF1A 4ELYC 3MO8A 4DA4A 5LJ5j 4V2SA 1M1KU 1B34A 1Y07A 1JRIA 2RHUA 4PL6A 3OYIA 4BI4A 1N9RA 4M77D 4XQ3A 3RKWA 4A4FA 3NTIA 2KAFA 2QXFA 3CCRT 1YJNT 4MMKA 3GNFB 2P0QA 4M75G 2ZPEB 4HCZA 4IUVA 2DTOA 4F7UF 2LC4A 1WJRA 2HBPA 2RK2A 4J6WA 4LD9K 1VQMT 1NJIU 3QO3A 3PMIA 4KULA 1N8RU 1JBMA 5IT9E 1B34B 1U1SA 5DLQE 4BUGA 4Y91A 2HNIA 3V8JA 3SWNA 3CCJA 3HRTA 1RL2A 1M1FA 3E9FA 3FB9A 3HL8A 3X24B 4XU3A 4C0FA 3S3NA 5CKDA 1M1KC 1M4ZA 2XIDA 3A8OB 4M7DC 4BY6B 3ASKA 4FM4B 3OYHA 2ZPFB 2DD5A 5LJ5e 1YHQA 2LT4A 4N4HA 3BW1A 3SB2A 2ZGWA 3LWHA 1VQ7A 4QVCA 5FU6C 1Y96A 4MMLA 3RERA 5FLXE 5LJ5h 5CR2A 4CRIA 3QYGB 2EYQA 3SWNB 2F5TX 5GANj 4A4KA 2C06A 1RI0A 4XAXB 1OYXA 3CPWA 1ZHIA 3PGGA 2EJGA 2E70A 5GAN8 5D6YA 2P0PA 1UB4A 2IVWA 3CPWS 3CCQT 4M75C 5LJ3h 1Y96B 1VIEA 2EQJA 1UGRB 3KUFA 2O01E 1X01A 1KHIA 2LCLA 3EAEA 2OTJA 1H3ZA 2QQ9A 5C6SA 2LDMA 2M1HA 5LJ5d 3I55A 3C94A 3R6OA 4NS5A 3VKIA 1YJ9A 4L59A 3H8ZA 4XTZA 5FROA 4R55A 2CYZB 3M56A 3JCMQ 2G3RA 2XICA 3FJPA 3UWNA 4LDXA 1WGSA 2M16A 3QZ9B 1N27A 5DY9A 3JSCA 4ZGJB 2KVQG 3QZ5B 3TEEA 1MGQA 2QEXA 5CIUA 3V7RA 5A0LA 5GANe 5D6XA 2PVDB 5KH6A 5FRNA 4O6JA 2F69A 1N6AA 3V7CA 3LWIA 3WVEB 1YIJA 3LX7A 5A0DA 4II1A 2L5QA 1VQPA 2FL7A 1VQ9A 4M77G 1UGQB 4M78E 4JRPA 2A3LA 3F70A 1VQ5T 4ELZC 2I2LA 3FLGA 1KQ1A 2EAYA 2FB7A 4RCCA 2K5IA 2VGMA 1D3BA 5GANf 1KG1A 4IUQA 3HFNA 4J6YA 3OYDA 4M78A 4C92E 5GAN4 1U1TA 4M78F 5CKBA 2DTHA 3PIOA 4EPCA 3OSVA 4L6V5 4IURA 4A53A 1V29B 5IN1A 4C92A 2E64A 4EMKC 3MCAB 4C92F 4J8OA 4M75A 1M90U 1QVPA 2XKOC 1UEBA 1K9MU 2V8IA 3C4SA 5GANd 2DKGA 3JCMc 2DPPB 2AHJB 2O4XA 2GFAA 3CCMT 3OSSC 1O9SA 1D3BB 3V8LA 4DOVA 2QA4T 4HA8A 3CCLA 4M78B 1XQHA 3QYHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QUI A;  5GAN 7;  4A54 A;  4M7D G;  5GAN h;  1WQ7 A;  2EJ9 A;  4C92 B;  5GMK m;  2CGH A;  4C92 D;  2E1H A;  2DZC A;  3EFS A;  5GAM g;  2YLC A;  5CAI A;  2E41 A;  4NOY A;  3JCM J;  3JCM f;  4PJO D;  4F7U B;  3JCM P;  2QTX A;  5GMK l;  3FIF A;  3L1A A;  1WPY A;  2RM4 A;  2RD1 A;  5GAM e;  4M7D B;  1WQW A;  3JCM V;  5GAM j;  3HSB A;  4M7D D;  4M75 E;  1N9S A;  3QSU A;  5LJ5 j;  4XTV A;  1B34 A;  1JRI A;  4DQ2 A;  4OP0 A;  1N9R A;  4JLI A;  4M77 D;  4XQ3 A;  3RKW A;  2JN0 A;  4M75 F;  4MMK A;  3JCM g;  5LJ3 g;  4M75 G;  5GAM f;  4F7U F;  2DTO A;  4M78 C;  3QHS A;  5LJ5 f;  4J6W A;  3BFM A;  5GMK e;  5I21 A;  3JCM e;  1TH7 A;  5GMK j;  4F7U G;  4M7D A;  4EMG A;  4EMK A;  3M4G A;  3QO3 A;  5LJ3 e;  4M78 D;  4C92 C;  4C8Q E;  1JBM A;  2EWN A;  2YLB A;  1B34 B;  1U1S A;  4Y91 A;  2HNI A;  3V8J A;  3SWN A;  4PJO C;  3RKX A;  4M75 B;  4C8Q A;  5GAM d;  1I81 A;  3FB9 A;  4M75 D;  4C8Q F;  4N0A C;  4XU3 A;  1HK9 A;  5LJ5 g;  1WNL A;  4X9C A;  4M7D C;  4C8Q G;  4M7A E;  2E10 A;  5LJ3 f;  3JB9 I;  4RCB A;  4M77 C;  5LJ5 e;  4EMK B;  3JCM W;  3BW1 A;  3SB2 A;  2ZGW A;  4M7A A;  4M7A F;  5GAM h;  4QVC A;  1Y96 A;  4EMH A;  4MML A;  5GAO q;  3RER A;  4NL2 A;  5LJ5 h;  5GAO m;  1I5L A;  4M7A G;  1M8V A;  3JCM d;  1I8F A;  3SWN B;  2VXF A;  4C8Q B;  5LJ3 d;  4C8Q D;  1LOJ A;  5GAN j;  3JB9 H;  3JCM b;  5GAO l;  1KQ2 A;  4WF2 A;  3PGG A;  5GAN 2;  3EFR A;  2EJG A;  3GIB A;  1HXD A;  5GAN 8;  2E65 A;  2VC8 A;  4XTY A;  5GMK h;  4M7A B;  2DTI A;  4XTX A;  4JRI A;  4M75 C;  3RUX A;  3JCM h;  3V8K A;  1LJO A;  5LJ3 h;  5GAN 6;  1Y96 B;  3JCM X;  5GAO n;  1LNX A;  3JB9 J;  1X01 A;  5GMK i;  2VXE A;  2DVE A;  5LJ5 d;  4HT9 A;  4JUV A;  3INZ A;  4XTZ A;  3RIR A;  1BIB A;  3RES A;  3JCM Q;  3BDU A;  4XTW A;  4PJO A;  3FJP A;  4J5Y A;  5GAN g;  2FYK A;  5DY9 A;  3SWN C;  3V7S A;  4C8Q C;  1MGQ A;  4M77 E;  2RB6 A;  3V7R A;  1BIA A;  5GAN e;  2RA2 A;  4QVD A;  2Y90 A;  4J6X A;  3V7C A;  4M77 A;  4XU1 A;  2EJF A;  4M77 F;  5GAN 5;  2DEQ A;  2K57 A;  4HT8 A;  4M7A C;  2DXU A;  4M77 G;  3JB9 F;  4M78 E;  4PJO B;  5GAO r;  4V2S A;  4M7A D;  2I2L A;  2DJZ A;  1KQ1 A;  2EAY A;  2FB7 A;  3HFO A;  4RCC A;  5GAN f;  1D3B A;  3JB9 G;  3AHU A;  3HFN A;  3L2Z A;  4J6Y A;  4M78 A;  4XU2 A;  4C92 E;  5GAN 4;  1U1T A;  4M78 F;  2DTH A;  2YHT A;  5GAO p;  4A53 A;  4PJO E;  4M78 G;  4C92 A;  4M77 B;  2E64 A;  1H64 1;  4EMK C;  1I4K 1;  4C92 F;  4M75 A;  4XTU A;  4F7U E;  4X9D A;  5GAN d;  4M7D E;  2DKG A;  3JCM c;  4C92 G;  3JB9 D;  4PJO F;  4PNO A;  4F7U A;  1M5Q 1;  4N0A A;  5GAN 3;  4XU0 A;  4PJO G;  2DXT A;  1D3B B;  4JRK A;  3BY7 A;  3RKY A;  3V8L A;  3VU3 C;  4HA8 A;  2DZ9 A;  4M78 B;  4M7D F;  1YCY A;  4NL3 A;  5LJ3 j; 
#chains in the Genus database with same CATH topology
 3CMA T;  3VRY A;  2ESW A;  3LGF A;  1VOM A;  3O8V A;  4NOY A;  1NJI R;  4AFZ C;  3OB9 A;  2RQU A;  2BUD A;  1M9S A;  3PMT A;  1KJW A;  4QQ6 A;  5CKF A;  2X4X A;  4AT1 B;  1AEY A;  3HPW A;  3P8H A;  3QHS A;  1I5O B;  2BZ8 A;  3UDC A;  1VQ4 Q;  1M1G A;  3A8H B;  1KSW A;  3ZEH A;  4C8Q A;  5GAM d;  1WIE A;  4C5H A;  5KYU B;  2FRW A;  3OQ5 A;  1JJ2 S;  3DLM A;  3G4S A;  2ZCF B;  4F16 A;  4ZTJ A;  1MHN A;  2KQW A;  1FXX A;  3CCQ A;  1OPK A;  4OB1 B;  4E7L A;  2GQI A;  4PLI A;  1NYG A;  4YTL A;  3VS3 A;  4MDW A;  2K5F A;  1M2V B;  2EGA A;  3NFC A;  2H3J A;  1K73 U;  2D9T A;  3CXC A;  4EIK A;  4JRQ A;  1QVG A;  1ZSG A;  2X4W A;  1BIB A;  2QGF B;  1VQN T;  2K5L A;  2JTF A;  3UPU A;  3MEA A;  3S6W A;  3CC4 T;  3I56 T;  2HKN A;  2V8K A;  2A7Y A;  4Z8A A;  2X3X D;  2RJC A;  2PUK B;  1W2B A;  1YJW T;  4C5E A;  3CCM A;  4UC4 A;  1QVF S;  2QQA A;  3TSZ A;  7AT1 B;  3CMA A;  4M7D E;  1V76 A;  4MDX A;  4Z02 A;  2NWM A;  2VV5 A;  4PJO G;  4M7D F;  3M4Y A;  2WSC E;  4ZNX A;  1D09 B;  1WHG A;  1OU8 A;  1G3S A;  5GMK m;  4C0D C;  2DZC A;  3EGX A;  2QGG A;  5CAI A;  1O75 A;  2F2V A;  2EPD A;  3REB B;  2D8H A;  2XU8 A;  3CD6 T;  1AT1 B;  3GOX A;  4M7D D;  1BI2 A;  1UHF A;  4JLI A;  2MMP A;  2EYX A;  1UJ0 A;  1RAB B;  3RNJ A;  3CME T;  5CKE A;  3TSW A;  3M4G A;  3M0R A;  2LNV A;  3QJ6 A;  2X4J A;  4MZP A;  3HKS A;  2HSE B;  1YWP A;  1Y0M A;  2E10 A;  1M90 C;  5CQX A;  1K9M C;  1JJ2 P;  2DO3 A;  1VQ6 T;  5J3B A;  2EKH A;  2JS2 A;  2JZ2 A;  2X4Y A;  1I1J A;  3M0U A;  5GAO q;  1I5L A;  2J6F A;  3JCM d;  1J3T A;  1ABQ A;  2LCS A;  2QA4 Q;  3TQ7 P;  3FEO A;  5GMK h;  1QQJ A;  1X75 C;  1BU1 A;  2JUF A;  2JM8 A;  1VQN A;  1ZLM A;  1GBQ A;  5GMK i;  1VQP T;  4BY6 C;  1VQ9 T;  1WHL A;  3CC4 A;  2LQN A;  3I56 A;  1TXQ A;  2L3R A;  2FYK A;  2LTO A;  3SWN C;  5CCA A;  2RQV A;  4WTO B;  4AFS C;  1KQS S;  4C5G A;  1BIA A;  2RA2 A;  3OA6 A;  2KNB B;  4JS5 A;  4BDY A;  2R58 A;  4IKF A;  2WAC A;  2LZ6 B;  4FT4 A;  3NTK A;  3JRZ A;  1JEG A;  2HL5 C;  2LQK A;  4PJO B;  1VQO Q;  4M7A D;  2P4T A;  4X34 A;  5KYY B;  3QII A;  3JAM E;  1H64 1;  4F7U E;  1KIK A;  3CBO A;  2XMF A;  1YI2 Q;  2PTK A;  1R0C B;  3RKY A;  3VU3 C;  2DK3 A;  4KRT A;  4E2F B;  4Z88 A;  3M5A A;  3CD6 A;  3OW2 S;  4OGE A;  3C95 A;  1Y57 A;  4QT7 A;  1IXD A;  2XK0 A;  4F17 A;  1PKS A;  2QDL A;  1NZ9 A;  2NUZ A;  4ZN1 A;  1S72 Q;  4J9G A;  2RNA A;  2PUO B;  3P8D A;  1WI7 A;  1N9S A;  3CME A;  2HD0 A;  4OP0 A;  1ZX6 A;  4RUG A;  3M55 A;  2SRC A;  2M0Y A;  3PT9 A;  1MV0 B;  5LJ3 e;  1VQ8 Q;  2B8A A;  1B3Q A;  1YCS B;  1VQ6 A;  2D0N A;  3CCE Q;  4AMC A;  1X27 A;  5LJ3 f;  1ZUK A;  2RJF A;  1UG1 A;  4J9E A;  3CCJ T;  2JT4 A;  3KBG A;  3NTH A;  5GAO m;  2C0T A;  5KE3 A;  1C1A A;  3OS5 A;  5CQY A;  2L3S A;  2COW A;  4JZ4 A;  5KYX B;  2GQV A;  2DIQ A;  3OS0 A;  2ZPG B;  3VUZ A;  1MNE A;  1WXU A;  2EBP A;  1XOV A;  1KD1 C;  4WCI A;  4E7H A;  4OB0 B;  1NPR A;  1X43 A;  3LW5 E;  2LVM A;  2PVG B;  1A0N B;  2KRO A;  4ZGE B;  1Q82 U;  2K7A A;  4JS4 A;  4XTW A;  4J5Y A;  5GAN g;  4GY5 A;  1KQS P;  1PRM C;  2BTT A;  3H0H A;  1JXO A;  4CC3 A;  1KC8 U;  5IHI A;  4C5I A;  1MUZ A;  2DD4 A;  3G7Z A;  2K3B A;  3REA B;  4N4G A;  1YN8 A;  3WVD B;  1JB0 E;  4PNO A;  2EFI A;  3I55 Q;  4BI3 A;  1UDL A;  2MIO A;  3T9N A;  3QDF A;  4AFQ C;  2E5Q A;  1PG5 B;  4M7D G;  3GNG A;  4OMP A;  2RHY A;  5L23 A;  3EFS A;  4TVR A;  5GAM g;  1YIT A;  1PCX A;  3CCL T;  4ATO A;  1UE9 A;  2QTX A;  3CBM A;  1IRE B;  4OF1 A;  3OYI A;  4M77 D;  2QXF A;  4A63 B;  2ZPE B;  2DTO A;  2DIL A;  4QKU A;  1NJI U;  5IT9 E;  1B34 B;  3SWN A;  3CCJ A;  3HRT A;  1M1F A;  3E9F A;  4C0F A;  5CKD A;  1QCF A;  4FM4 B;  2LT4 A;  3BW1 A;  1VQ7 A;  2RPN A;  3RER A;  4CRI A;  1YJN Q;  3VS0 A;  4A4K A;  1SEM A;  3EG9 A;  2E70 A;  2K79 A;  2FEI A;  2EQJ A;  1H3Z A;  1X01 A;  2O01 E;  2KGT A;  4CC2 A;  3R6O A;  4NS5 A;  5FRO A;  2CYZ B;  2G3R A;  3FJP A;  1WLP B;  3UWN A;  4LDX A;  2M16 A;  3TEE A;  2PVD B;  1AWO A;  5FRN A;  3V7C A;  2F69 A;  2ED0 A;  3LWI A;  3LX7 A;  4II1 A;  2RN8 A;  4M78 E;  4JRP A;  4V2S A;  1F1B B;  2K5I A;  1KG1 A;  2COZ A;  4C92 E;  2DVJ A;  4M78 F;  5CKB A;  3PIO A;  2DMO A;  5IN1 A;  2E64 A;  4C92 F;  1QWF A;  2XKO C;  2DJQ A;  1N5Z A;  1M1K R;  3SHW A;  4DOV A;  2QA4 T;  4JJC A;  3CCL A;  4LN2 A;  2HBW A;  4JPB W;  2DFU A;  1SF9 A;  1JXM A;  4C92 D;  6AT1 B;  1RAG B;  2WSF E;  4EDU A;  3JCM f;  2O4X B;  5GMK l;  2EYZ A;  5AT1 B;  2DEU A;  3VS6 A;  3A8G B;  1RAE B;  4BDZ A;  5I2S A;  4BE0 A;  2MF2 A;  3JCM g;  2D1X A;  5A0G A;  5KYU A;  2JTE A;  3OYN A;  1FMW A;  5I21 A;  4CC7 A;  1WHM A;  4K11 A;  4C8Q E;  2EYW A;  1VQO T;  3VS4 A;  1JJ2 A;  4C8Q F;  3PE0 A;  1ZSZ B;  4N0A C;  4OB2 B;  1WNL A;  2BZY A;  1YIJ Q;  1MMN A;  5LL6 S;  1M2V A;  4EMK B;  2KYM A;  1YI2 T;  1GFD A;  3PNW C;  4NL2 A;  2EQM A;  1FX7 A;  3EFO B;  2OTL A;  1IGQ A;  3OMG A;  4C8Q D;  3QG1 A;  3C12 A;  3L2Q A;  4JLG A;  2DL7 A;  4M7A B;  2DTI A;  1IB8 A;  1Y71 A;  1S72 T;  1FMV A;  2VXE A;  4JUV A;  3INZ A;  1YBY A;  1ZUY A;  3BDU A;  1TOV A;  2OAW A;  4JDS A;  2DXC A;  3O5Z A;  1VQ8 T;  4ESR A;  1GFC A;  1VQM Q;  2E12 A;  1C0M A;  4F14 A;  3VS2 A;  2PQW A;  2CSQ A;  4OML A;  4BB7 A;  3JB9 F;  3CCE T;  5GAO r;  2RO0 A;  3NHN A;  2JMA A;  1QVF A;  4QVZ A;  4DBQ A;  2QA4 A;  1I4K 1;  2CS7 A;  3A8M B;  4L5G A;  3JB9 D;  3TU4 K;  5KYN A;  1W6X A;  4OMN A;  2EVR A;  1AOJ A;  1S1N A;  1M3C A;  2ZPI B;  2LCC A;  4HKE A;  4RTW A;  1R77 A;  1U06 A;  5GAM j;  2JW4 A;  4M75 E;  2M02 A;  3PFS A;  2KSS A;  1K1Z A;  3L2U A;  4M75 F;  5FU6 B;  3NPF A;  5L8R E;  1VQO A;  3MET A;  4KH1 B;  3CPF A;  4ME7 A;  4KUD K;  1OZ3 A;  3R6N A;  1CKB A;  1XNI A;  1HJD A;  1YI2 A;  2QDY B;  4M75 D;  3M58 A;  3EG1 A;  2DAQ A;  2RHX A;  2M9U A;  2CT4 A;  3EHQ A;  1P92 A;  2J7I A;  3I55 T;  2DX1 A;  5D6W A;  1PC0 A;  4KGZ B;  2VKN A;  2ROL A;  1S72 A;  5GAO l;  5GAN 2;  2A08 A;  1Q86 R;  4RTV A;  3EG0 A;  5IAY A;  4JRI A;  5GAO n;  1IZ6 A;  1QP2 A;  2YRV A;  1VYU A;  1ZA1 B;  3RIR A;  2ZPB B;  1KQS A;  1VQ8 A;  4PJO A;  2M51 A;  2E6Z A;  4PLL A;  1CKA A;  5CO7 A;  1ACM B;  2RB6 A;  5KYY A;  4J6X A;  1VUB A;  4XU1 A;  4E7I A;  2CT3 A;  2FVU A;  3J81 E;  3MPU B;  2AT1 B;  3CC7 T;  2L3P A;  1IHV A;  1NYF A;  2QQS A;  1JU5 C;  4M78 G;  4M77 B;  3OMC A;  4C92 G;  2KXD A;  1M5Q 1;  4N0A A;  3VV0 A;  3TCJ A;  4XU0 A;  4JRK A;  3OW2 A;  1VQ5 A;  1NLP C;  1YFN A;  3OY9 A;  3EHR A;  3G6E Q;  1BK2 A;  2DRK A;  4A54 A;  3QKJ A;  5IHN A;  2O9S A;  2EJ9 A;  1K73 C;  2BIV A;  1GL5 A;  2Y4X A;  4GBQ A;  4IUT A;  1RLP C;  4A4G A;  2ZZD A;  2RH2 A;  4A4E A;  1VQK T;  3NMZ C;  4GLM A;  2K9G A;  4PJL A;  4DQ2 A;  1D1C A;  1Q81 R;  3UA7 A;  1WXT A;  3URG A;  4ZTF A;  1G3W A;  3VUB A;  4BE1 A;  2J06 A;  4Y28 E;  1W1F A;  1MV3 A;  3X20 B;  2V26 A;  4RG2 A;  3GPL A;  5KYX A;  4C8Q G;  4VUB A;  4LUE A;  1Q7Y R;  4IUU A;  2PU9 B;  4PK4 A;  3CCU Q;  5I2M A;  1LOJ A;  1IRX A;  2GBQ A;  1G3T A;  1UFF A;  1GCP A;  2VUB A;  2RQR A;  3GIB A;  3S3O A;  4C0G A;  4XTX A;  2LX9 A;  1W4S A;  5CK9 A;  3QDR B;  1ZSZ C;  1LNX A;  3H0I A;  3VYG A;  1RAD B;  4J9I A;  4KBM B;  1ZBJ A;  3CEY A;  1GCQ A;  1GBR A;  2QI2 A;  1WFW A;  3SDZ A;  4Q5W A;  1OQK A;  3SD4 A;  1YJ9 T;  2RK1 A;  2W10 A;  1YHQ Q;  8ATC B;  3CC7 A;  4J83 A;  2PNI A;  4M7A C;  3LH0 A;  2RF0 A;  1BI1 A;  1R8O B;  3ULR B;  4FYY B;  3JB9 G;  5FW9 A;  3E19 A;  1YIJ T;  1FYN A;  1T3S A;  4ZGD B;  2ECZ A;  1PSE A;  2K3X A;  2R5A A;  4D8K A;  2CP0 A;  1M8M A;  3HHT B;  3OBY A;  3M57 A;  2KR3 A;  2E3H A;  5FU7 B;  4ZN3 A;  4GLK A;  2XHC A;  2DNU A;  5GJW B;  5IH2 A;  3CCS Q;  4HCK A;  4FIB A;  1YJW A;  5AYF A;  1WHH A;  1BCM A;  2CGH A;  1VQK A;  2DE0 X;  1SHF A;  4HXJ A;  1AZG B;  2HAX A;  3MP8 A;  4ELY C;  3M54 A;  2LRQ A;  4J9B A;  2CSI A;  3MO8 A;  4E7Z A;  5LJ5 j;  2LMJ A;  4KGX B;  4HVU A;  1B34 A;  1M1K U;  1Y07 A;  2EQI A;  2RHU A;  5IXF A;  1N9R A;  3RKW A;  4A4F A;  3NTI A;  2X3W D;  3GNF B;  4M75 G;  4IUV A;  2DA9 A;  2CUD A;  4F7U F;  2LC4 A;  2RK2 A;  4J6W A;  1VQM T;  4FYV B;  4KUL A;  1N8R U;  3H0F A;  3CPW P;  5DLQ E;  3NGP A;  3V8J A;  1X2Q A;  2W0Z A;  1PNJ A;  1TWB A;  1M1K C;  1R0B G;  1M4Z A;  1NLO C;  1OX9 A;  2XID A;  4LE9 A;  3OYH A;  2V1R A;  4N4H A;  3LWH A;  5GJV B;  3SB2 A;  4QVC A;  5FU6 C;  5FLX E;  5CR2 A;  4ORZ A;  4Z89 A;  2KE9 A;  2H8H A;  2F5T X;  2C06 A;  1RI0 A;  1OYX A;  3PGG A;  4RTZ A;  1OUL A;  1D1A A;  1UB4 A;  2VAS A;  2IVW A;  2DRM A;  3VS5 A;  5LJ3 h;  1VIE A;  2QAS A;  3EAE A;  2LCL A;  2NUP B;  2QQ9 A;  2M1H A;  3I9Q A;  5LJ5 d;  3C94 A;  3VKI A;  1YJ9 A;  4L59 A;  2GGR A;  3H8Z A;  4R55 A;  3JCM Q;  3EG2 A;  3QZ9 B;  4ZGJ B;  3JSC A;  2KVQ G;  1MGQ A;  5CIU A;  1UUE A;  2CP7 A;  5D6X A;  5GAN e;  5A0L A;  3G4S Q;  2P84 A;  4O6J A;  1YIJ A;  1VQP A;  2DET A;  2FL7 A;  1VQ9 A;  1UGQ B;  3CCQ Q;  3F70 A;  4ELZ C;  1WA7 A;  4RCC A;  5GAN f;  2RQT A;  4IUQ A;  1EX4 A;  3HFN A;  4J6Y A;  3OYD A;  2YXY A;  5GAN 4;  1U1T A;  2DTH A;  2HEQ A;  3OSV A;  3MCA B;  1B07 A;  1QVP A;  3JCM c;  3BE3 A;  2O4X A;  2AHJ B;  2GFA A;  1D3B B;  1XQH A;  1VQ4 T;  2J6K A;  3QUI A;  2LQ8 A;  2HSP A;  3L2R A;  3RBB B;  4A4H A;  1C6V X;  2H3E B;  1T0J A;  3JCM P;  3DKM A;  1Q82 C;  2L8D A;  2KXC A;  2RM4 A;  4AG2 C;  5GAM e;  1WX6 A;  3QSU A;  1I0C A;  1VQM A;  3I5S A;  2KI7 A;  1K76 A;  2ABL A;  2HZY A;  2R57 A;  4QQG A;  1ZSZ A;  2OTJ Q;  3OYY A;  1KC8 C;  3N5B B;  1TG0 A;  5GAM f;  4D8D A;  1G2B A;  2MWP A;  1OZ2 A;  4EMK A;  3CMA Q;  1NEB A;  3EH1 A;  3EFO A;  2QEX Q;  4E47 A;  2WSE E;  1I81 A;  1TS9 A;  3EH2 A;  3QPH A;  2GCX A;  3IQL A;  1WJQ A;  1QVG P;  4BE2 A;  2ZAE A;  5CKH A;  5HKC A;  4M7A A;  4R0K A;  1LPL A;  3MHX A;  1X2K A;  3G6E T;  5HCK A;  4D6W A;  3EFR A;  2AKK A;  2L3Q A;  1WXB A;  3MP1 A;  9ATC B;  2RQW A;  3JCM X;  1U8R A;  1BI3 A;  4HT9 A;  1SKU B;  2ATC B;  1W2B P;  2EGC A;  2Y4Y A;  3RES A;  2D0Q B;  1Z9Q A;  1Q86 U;  2YUN A;  3CCR Q;  1NJI C;  1K9M R;  3UF4 A;  1RI9 A;  2JOY A;  1NPP A;  3AHU A;  1H8K A;  4J9C A;  1K8A U;  2JS0 A;  2NUT B;  1SG5 A;  4J7I A;  2CZ7 B;  3CCU T;  1VQ4 A;  3CQT A;  2BZX A;  3ME9 A;  2AKL A;  1BBZ A;  2F5K A;  3I56 Q;  1SRL A;  2GF7 A;  4NL3 A;  1NG2 A;  1IGU A;  5HY6 A;  4P5N A;  4OMM A;  3TVT A;  2L0A A;  2YRD A;  3FDR A;  3ZL7 C;  1UHC A;  2LQW A;  3FIF A;  2RD1 A;  4M7D B;  2B86 A;  3RMS A;  4Y92 A;  2JTM A;  1TTH B;  4C0Z A;  2NLU A;  3DB3 A;  1E6G A;  5FU7 C;  2JVV A;  1AZE A;  1UTI A;  2CUB A;  3JCM e;  5GMK j;  4F7U G;  3PIP A;  2KYB A;  4M78 D;  1PHT A;  1OEB A;  3S3M A;  2O2O A;  2IG0 A;  4PJO C;  2CRE A;  1HK9 A;  4X9C A;  1Q81 U;  1N8R R;  1FMK A;  2KY9 A;  1PD1 A;  5DM7 R;  3G6E A;  1EIF A;  3JCM W;  1OOT A;  2DIG A;  5A2Q E;  5C0M A;  3Q1J A;  1K9A A;  3QJY A;  3M53 A;  4FU6 A;  5J39 A;  3BDL A;  3JB9 H;  1I07 A;  2XI9 A;  3CCS T;  2KRN A;  3CME Q;  3HRU A;  1HXD A;  4RG8 A;  1LCK A;  1Y7X A;  2BE9 B;  1AVZ C;  5FWB A;  3E9G A;  1UEC A;  2E5K A;  2YT6 A;  1LJO A;  3MEU A;  1Q7Y U;  2CZ6 B;  4HVV A;  1RAA B;  1W70 A;  3UT1 A;  5I11 A;  2MWO A;  2RJE A;  1EZZ B;  1HD3 A;  2F2W A;  1VYV A;  2KMT A;  2MAM A;  2YRC A;  4J7F A;  3VS1 A;  2KT8 A;  1D1B A;  2FRY A;  2GTO A;  2Y90 A;  3A8L B;  3OYJ A;  4M77 A;  3OYK A;  2C0I A;  5GAN 5;  2K57 A;  2X35 A;  4AG1 C;  4M4Z A;  1VQL Q;  2JXB A;  3CCU A;  2KK4 A;  2AK5 A;  1Q95 G;  3ZBD A;  2K2V A;  2YHT A;  3OYF A;  3ER0 A;  2FZG B;  1QMC A;  4X9D A;  4BI8 B;  4OMF B;  4LDU A;  2LT1 A;  4E7K A;  2RHZ A;  4B9W A;  3CCV Q;  4X1V A;  3VRZ A;  5EG2 A;  5LJ3 j;  4O5V A;  4QW2 A;  1RAF B;  4F7U B;  3A98 A;  3PVQ A;  3OYM A;  1QCN A;  1WQW A;  4N4I A;  3G1J A;  4DBH A;  4XTV A;  2KBT A;  1FWZ A;  3MKD A;  4OGC A;  4DEY A;  3QXE B;  1OX8 A;  3G4S T;  4LDV A;  3FC3 A;  2RI3 A;  4FSX A;  4XK8 E;  2GFU A;  5LJ5 f;  3HP9 A;  3DLL A;  3UAT A;  1G83 A;  2KDS A;  1GCQ C;  3I5R A;  3CC2 Q;  3DB4 A;  3RKX A;  1NBE B;  1WJS A;  1M27 C;  5LJ5 g;  1AWJ A;  3FRN A;  4RCB A;  3CCS A;  2ED1 A;  1X6O A;  1YIT Q;  4PKC C;  1M8V A;  1VYT A;  1ZA2 B;  2VXF A;  5LJ3 d;  2FO0 A;  1QLY A;  2A36 A;  3J80 E;  1AHJ B;  4B9X A;  4OMO A;  2VC8 A;  3V8K A;  2HQX A;  1KK7 A;  1D0X A;  1PD0 A;  2DVE A;  3A1P A;  1JO8 A;  4OB3 B;  2EKO A;  5IXB A;  3VYH B;  3CCJ Q;  2OTJ T;  1T3L A;  3HRS A;  5KCH A;  2VYT A;  1RLQ C;  3G71 Q;  1PSF A;  3OYL A;  1VQ7 Q;  4J9H A;  1H92 A;  1M3B A;  2DXU A;  2QEX T;  3OYC A;  3EGD B;  2LNH B;  1BKB A;  1G3Y A;  3OYA A;  3KXT A;  1IO6 A;  2DER A;  1WYX A;  2VB6 A;  3CBP A;  1K8A R;  5DLO A;  3OYG A;  3CCE A;  2DBK A;  1U5S A;  2DZ9 A;  4FT2 A;  1G8X A;  2CZ1 B;  2OX7 A;  3QBY A;  2V1Q A;  2EQK A;  3LLR A;  4BD3 A;  1SHG A;  5EC7 A;  3E2U A;  2AIR B;  2VVK A;  5J26 A;  1K0S A;  4LNP A;  1JRI A;  4RTX A;  3CCR T;  2KAF A;  1YJN T;  4MMK A;  2P0Q A;  2GTJ A;  4LD9 K;  1WJR A;  3U23 A;  3QO3 A;  1JBM A;  1U1S A;  2FPF A;  4Y91 A;  1X6B A;  1RL2 A;  3FB9 A;  4PJJ A;  3HL8 A;  3CCL Q;  4M7D C;  1AWW A;  1EFN A;  2ZPF B;  2DD5 A;  2D8J A;  4MML A;  2NUP A;  2SEM A;  3THK A;  2MCN A;  3PVL A;  4XAX B;  2EGE A;  4FYW B;  2EJG A;  5D6Y A;  2P0P A;  1MND A;  3CPW S;  1M2O A;  2DL8 A;  1WDX A;  1Y96 B;  1KHI A;  2OTJ A;  2X51 A;  1UGV A;  3I55 A;  2YUQ A;  3QWY A;  3M56 A;  2MOX A;  2MYS A;  2XIC A;  1WGS A;  3M0S A;  3QZ5 B;  2QEX A;  3M0T A;  3V7R A;  3WVE B;  5A0D A;  3VS7 A;  4HVW A;  2OTL Q;  2A3L A;  2I2L A;  3FLG A;  1KQ1 A;  2FB7 A;  1D3B A;  1MMG A;  2J05 A;  4L6V 5;  2MPX C;  4EMK C;  1M90 U;  4J8O A;  4M75 A;  4F04 B;  1K9M U;  1UEB A;  3C4S A;  2KRS A;  2DPP B;  3OSS C;  2QYZ A;  3V8L A;  4HA8 A;  4M78 B;  1SRM A;  1TSF A;  2KT1 A;  1WQ7 A;  2LJ3 A;  4C92 B;  1ZQ1 A;  2YLC A;  2E41 A;  2KRM A;  3X25 B;  3CCR A;  2VWF A;  1YJN A;  2Z0W A;  4LD6 A;  3I35 A;  1OPL A;  4HCB A;  3D7S B;  2XDP A;  2JN0 A;  2OJ2 A;  3MEW A;  3LYI A;  1OV3 A;  4B6M A;  2CP6 A;  3BFM A;  5GMK e;  4DEX A;  2LJ0 A;  1VQL T;  1GXI E;  3SEM A;  2FZK B;  2LJ1 A;  1D0Y A;  2RI5 A;  2CDT A;  2NYS A;  4KH0 B;  4M7A E;  2RJD A;  1UGS B;  1Z9Z A;  4M7A F;  1BYM A;  4C8Q B;  4DBF A;  1NM7 A;  3SFM A;  3CCV T;  2XG8 D;  2VGN A;  3UA6 A;  1B7T A;  1AWX A;  4XTY A;  1K4U S;  5GAN 6;  3RR6 A;  2P0K A;  5I22 A;  2QQR A;  5FWC A;  2JM9 A;  2CP3 A;  2LP5 A;  3CXC S;  1PM3 A;  1QVF P;  1QVG S;  5HK0 A;  1ZBX A;  3M0Q A;  2DYI A;  1X69 A;  1KHC A;  1OI1 A;  1N8R C;  2K2M A;  4FL6 A;  2HQH A;  2QQB A;  4J9F A;  2EJF A;  4MZT A;  2NUT A;  3CC2 T;  1VA7 A;  4XU2 A;  3HTR A;  2CH4 W;  5GAO p;  1W2B S;  4DOW A;  1YIT T;  4LDY A;  1E7O A;  2XDD A;  1QW1 A;  4ANJ A;  1TUC A;  4M7D A;  2DM1 A;  3BY7 A;  3LGL A;  4IIO A;  4JJD A;  3X28 B;  5GAN h;  2EYY A;  4RTT A;  2O31 A;  3L2W A;  2COY A;  3JCM J;  2K4Y A;  1LVK A;  1KD1 U;  3MP6 A;  1WPY A;  3E1S A;  2YSQ A;  3RMQ A;  1VIF A;  4KUI A;  1VQL A;  1BCO A;  5M9O A;  3EGX B;  3G71 T;  5LJ3 g;  2HMA A;  1VQ7 T;  2L89 A;  5KYW A;  2QTV A;  2E4H A;  2PZ1 A;  4EMG A;  1QKX A;  1WHK A;  3ZFJ A;  2F1L A;  1ABO A;  4IUP A;  1YNZ A;  4M75 B;  3OS2 A;  1VQ5 Q;  2M0O A;  4FYX B;  4PFO A;  3CCV A;  4M77 C;  1K73 R;  5GAM h;  2PVO B;  3X26 B;  1RAC B;  1I8F A;  2R5M A;  2DLP A;  1AD5 A;  3AT1 B;  3CCM Q;  1KQ2 A;  1PWT A;  4WF2 A;  4J9D A;  1M30 A;  2E65 A;  3RUX A;  3HSB A;  3JB9 J;  1WHJ A;  2OI3 A;  2E6N A;  2DL3 A;  2RI2 A;  5D7U A;  1TUG B;  1JQQ A;  1MMA A;  3CXC P;  1M3A A;  2L2P A;  2BE7 D;  5CVI A;  1D0Z A;  4FW2 A;  3V7S A;  2CKK A;  3CC2 A;  4HCC A;  4M77 E;  4KT0 E;  3L42 A;  2C0O A;  3OS1 A;  2QG9 B;  1QWE A;  2BKD N;  3EG3 A;  4M77 F;  2HCK A;  4RMO A;  2DEQ A;  3OW2 P;  4HT8 A;  1SSH A;  2FG0 A;  2YWW A;  3HFO A;  2JNG A;  3H41 A;  3L2Z A;  4JJB A;  1XTD A;  1IHW A;  2D6F A;  3MJX A;  3GP8 A;  2FHD A;  3M0P A;  4XTU A;  4F7U A;  2K3Y A;  1U3O A;  2DYB A;  2DXT A;  1OU9 A;  1GRI A;  1YCY A;  1M90 R;  5GAN 7;  4CI0 C;  2DL5 A;  4IIM A;  2E1H A;  5IHK A;  4LDW A;  2A28 A;  4FCY A;  2YDL A;  1UGP B;  4R56 A;  3GLX A;  3CC7 Q;  2OAU A;  3JCM V;  3G71 A;  3H6Z A;  1Q86 C;  2FPD A;  4JJN K;  2ZPH B;  4KGV B;  1VQN Q;  4QQD A;  4M78 C;  3CC4 Q;  4E7S A;  1TH7 A;  3H9N A;  2RHI A;  4C92 C;  2OTL T;  2EWN A;  2YLB A;  4PFZ A;  4LUD A;  1QCO A;  1QP3 A;  5HK3 A;  3A5Z B;  1BB9 A;  2JJ9 A;  1K8A C;  2CP2 A;  2ENM A;  1DJ7 B;  1YJW Q;  3GF5 A;  1XJW B;  5KCO A;  3JB9 I;  1VQK Q;  2O88 A;  4PJM A;  2IIM A;  4EMH A;  4E7J A;  4M7A G;  2MK5 A;  1YHQ T;  3JCM b;  2CH4 A;  1TU0 B;  2EIF A;  1SPK A;  2EQU A;  4RKU E;  5ECA A;  3JCM h;  2DXB A;  2HQE A;  3L2V A;  2KEA A;  3CD6 Q;  3OYE A;  5KYW B;  1ZUU A;  2EW3 A;  3OBW A;  3M59 A;  3J7A F;  3EGD A;  1V1C A;  3QWX X;  4C8Q C;  2K6D A;  3JV3 A;  4QVD A;  4MZM A;  1UJY A;  1SSF A;  4CC4 B;  2CZ0 B;  2V8J A;  5KE2 A;  4BAC A;  4C0D B;  1G5V A;  1Q81 C;  2DJZ A;  1BI0 A;  1NEG A;  1HYO A;  3M9Q A;  2MI6 A;  2XD0 A;  3PTA A;  3MEV A;  2J6O A;  4PJO E;  1HSQ A;  4RTY A;  2XDB A;  1VQ6 Q;  1ARK A;  4PJO F;  5FRM A;  3VJP A;  2LX7 A;  4OVA A;  5GAN 3;  1YJ9 Q;  3TRE A;  2JMC A;  3OYB A;  1KFZ A;  4FW1 A;  1Q7Y C;  2CP5 A;  1NE8 A;  2P4R A;  1RAI B;  3WXM B;  2DF6 A;  4PJO D;  1MMD A;  2AZV A;  4E6R A;  4AFU C;  3L1A A;  3P8B B;  1VQP Q;  2YUO A;  4DA4 A;  1VQ9 Q;  2GNC A;  3LH5 A;  4PL6 A;  4BI4 A;  4XQ3 A;  1KD1 R;  3FJ5 A;  2HL3 A;  4RTU A;  4HCZ A;  3EGU A;  2HBP A;  3PMI A;  4BUG A;  2HNI A;  1T0H A;  3X24 B;  4XU3 A;  3S3N A;  2F2X A;  2QAZ A;  3A8O B;  1CSK A;  1PRL C;  4BY6 B;  1E6H A;  3ASK A;  4PJN A;  2A37 A;  1X6G A;  1YHQ A;  5LJ5 e;  2ZGW A;  1Y96 A;  1WZO A;  5LJ5 h;  1TUD A;  3QYG B;  2EYQ A;  3SWN B;  1Q82 R;  2X9H A;  5GAN j;  3RDV A;  2YUP A;  3CPW A;  1ZHI A;  2HKQ B;  2RMO A;  1QKW A;  5GAN 8;  3KFV A;  2E3I A;  2I0N A;  2QK0 A;  3CCQ T;  4M75 C;  1KC8 R;  3KUF A;  1UGR B;  1H3H A;  3C0C A;  5C6S A;  2LDM A;  1RUW A;  4XTZ A;  2AZS A;  2IPO B;  4OMQ A;  3EG9 B;  1YWO A;  2FZC B;  1N27 A;  5DY9 A;  1YP5 A;  2HDA A;  4DBR A;  5KH6 A;  2FPE A;  1N6A A;  4PFP A;  2L5Q A;  1RAH B;  1PKT A;  4M77 G;  1VQ5 T;  2EAY A;  2VGM A;  8AT1 B;  4M78 A;  2ROT A;  2O9V A;  4EPC A;  4IUR A;  4LXC A;  1V29 B;  4A53 A;  4C92 A;  2DL4 A;  2V8I A;  5GAN d;  4FSS A;  2DBM A;  2DKG A;  2A0F B;  3CCM T;  1K0X A;  1O9S A;  3GBQ A;  4JZ3 A;  2G6F X;  3QYH B; 
#chains in the Genus database with same CATH homology
 3QUI A;  3CMA T;  2LQ8 A;  3LGF A;  1WQ7 A;  4C92 B;  3L2R A;  3O8V A;  4A4H A;  4C92 D;  2WSF E;  1ZQ1 A;  2YLC A;  2E41 A;  4NOY A;  3X25 B;  4EDU A;  3JCM f;  3CCR A;  2O4X B;  3JCM P;  3OB9 A;  3DKM A;  5GMK l;  4LD6 A;  2L8D A;  1YJN A;  1Q82 C;  2RM4 A;  2BUD A;  1M9S A;  5GAM e;  3PMT A;  3A8G B;  4HCB A;  3QSU A;  4BDZ A;  2XDP A;  4QQ6 A;  1VQM A;  5I2S A;  4BE0 A;  5CKF A;  2R57 A;  2X4X A;  2JN0 A;  2MF2 A;  4QQG A;  3JCM g;  3HPW A;  3OYY A;  3MEW A;  3N5B B;  1KC8 C;  5A0G A;  3LYI A;  3P8H A;  5GAM f;  2MWP A;  3QHS A;  3OYN A;  3BFM A;  1OZ2 A;  5I21 A;  5GMK e;  3UDC A;  4EMK A;  4A4G A;  4C8Q E;  1VQL T;  1M1G A;  3A8H B;  1GXI E;  1VQO T;  2RI5 A;  3ZEH A;  4C8Q A;  2WSE E;  1I81 A;  4E47 A;  4C8Q F;  5GAM d;  1JJ2 A;  4N0A C;  3QPH A;  4OB2 B;  1WNL A;  2GCX A;  4M7A E;  1WJQ A;  4HCC A;  4C5H A;  1JJ2 S;  4IKF A;  3OQ5 A;  3DLM A;  5LL6 S;  3G4S A;  2RJD A;  2ZCF B;  1UGS B;  4BE2 A;  5CKH A;  4EMK B;  5HKC A;  4ZTJ A;  1YI2 T;  4M7A A;  4M7A F;  1MHN A;  2KQW A;  1FXX A;  3PNW C;  4NL2 A;  2EQM A;  1FX7 A;  1BYM A;  2OTL A;  4C8Q B;  3CCQ A;  3OMG A;  3SFM A;  4OB1 B;  4C8Q D;  3CCV T;  3MHX A;  3G6E T;  4E7L A;  4E7I A;  4PLI A;  3QG1 A;  4YTL A;  2XG8 D;  2VGN A;  4D6W A;  3EFR A;  3C12 A;  4MDW A;  2K5F A;  3L2Q A;  4JLG A;  4XTY A;  4M7A B;  2DTI A;  5GAN 6;  3NFC A;  2H3J A;  3MP1 A;  3JCM X;  1K73 U;  1Y71 A;  2P0K A;  1S72 T;  2D9T A;  3CXC A;  2QQR A;  2VXE A;  4JRQ A;  1U8R A;  1QVG A;  1BI3 A;  4HT9 A;  4JUV A;  3INZ A;  1YBY A;  2X4W A;  2Y4Y A;  3CXC S;  1BIB A;  3RES A;  2D0Q B;  1QVG S;  5HK0 A;  3BDU A;  1VQN T;  2K5L A;  1ZBX A;  2JTF A;  1Q86 U;  1KHC A;  3UPU A;  3MEA A;  3S6W A;  3CC4 T;  1NJI C;  4JDS A;  2DXC A;  3I56 T;  1OI1 A;  1N8R C;  1VQ8 T;  4FL6 A;  2QQB A;  4MZT A;  2EJF A;  2V8K A;  2E12 A;  2JOY A;  2A7Y A;  3CC2 T;  1NPP A;  2PQW A;  4BB7 A;  3JB9 F;  3CCE T;  2RJC A;  5GAO r;  2RO0 A;  3AHU A;  2PUK B;  1W2B A;  4XU2 A;  1YJW T;  1QVF A;  4C5E A;  4QVZ A;  1K8A U;  3CCM A;  5GAO p;  1W2B S;  4UC4 A;  4DOW A;  1YIT T;  2QA4 A;  1QVF S;  2QQA A;  4LDY A;  1I4K 1;  4J7I A;  2CS7 A;  3CCU T;  2CZ7 B;  2XDD A;  3CMA A;  1QW1 A;  1VQ4 A;  3A8M B;  4M7D E;  4L5G A;  4MDX A;  3JB9 D;  4Z02 A;  3ME9 A;  2VV5 A;  3TU4 K;  2F5K A;  4PJO G;  4M7D A;  3BY7 A;  4M7D F;  3M4Y A;  3LGL A;  2WSC E;  2GF7 A;  4NL3 A;  3X28 B;  5GAN h;  5HY6 A;  1G3S A;  5GMK m;  4C0D C;  2ZPI B;  4P5N A;  2DZC A;  3L2W A;  5CAI A;  3JCM J;  2K4Y A;  1O75 A;  2LCC A;  1KD1 U;  4HKE A;  3FDR A;  3MP6 A;  3FIF A;  2XU8 A;  1WPY A;  3CD6 T;  2RD1 A;  4M7D B;  3E1S A;  3RMS A;  5GAM j;  3GOX A;  4M7D D;  4M75 E;  2JTM A;  1BI2 A;  3PFS A;  2KSS A;  3RMQ A;  1VIF A;  4KUI A;  4C0Z A;  2NLU A;  3DB3 A;  4JLI A;  2MMP A;  3L2U A;  5FU7 C;  4M75 F;  5FU6 B;  1VQL A;  5M9O A;  5L8R E;  1VQO A;  3MET A;  3G71 T;  5LJ3 g;  2HAX A;  2JVV A;  3CPF A;  4ME7 A;  3CME T;  1VQ7 T;  4KUD K;  1OZ3 A;  2L89 A;  5CKE A;  3JCM e;  5GMK j;  4F7U G;  3PIP A;  4EMG A;  3M4G A;  4M78 D;  2LNV A;  3S3M A;  3QJ6 A;  2X4J A;  3ZFJ A;  4IUP A;  1XNI A;  2IG0 A;  4MZP A;  4PJO C;  4M75 B;  1YI2 A;  3HKS A;  2QDY B;  4M75 D;  3OS2 A;  1HK9 A;  3M58 A;  4X9C A;  2M0O A;  1Q81 U;  2E10 A;  2DAQ A;  2KY9 A;  1M90 C;  5CQX A;  1K9M C;  5DM7 R;  2RHX A;  3CCV A;  3G6E A;  1EIF A;  2DO3 A;  2M9U A;  4M77 C;  5J3B A;  3JCM W;  1VQ6 T;  2JZ2 A;  5GAM h;  2X4Y A;  2DIG A;  2PVO B;  1P92 A;  5GAO q;  3X26 B;  5A2Q E;  5C0M A;  3I55 T;  1I5L A;  3Q1J A;  5D6W A;  3JCM d;  1I8F A;  2R5M A;  3M53 A;  3QJY A;  4FU6 A;  5J39 A;  3BDL A;  3JB9 H;  2XI9 A;  3CCS T;  1S72 A;  1KQ2 A;  5GAO l;  4WF2 A;  5GAN 2;  3HRU A;  1HXD A;  4RG8 A;  1Y7X A;  2E65 A;  3FEO A;  3RUX A;  3E9G A;  5IAY A;  4JRI A;  5GMK h;  3HSB A;  3MEU A;  3JB9 J;  1LJO A;  1Q7Y U;  1X75 C;  2CZ6 B;  2JUF A;  5GAO n;  2E6N A;  1VQN A;  2RI2 A;  1IZ6 A;  5GMK i;  1VQP T;  1QP2 A;  3UT1 A;  2MWO A;  4BY6 C;  1VQ9 T;  2YRV A;  3CC4 A;  3I56 A;  3RIR A;  2RJE A;  2ZPB B;  1KQS A;  1VQ8 A;  2L3R A;  5CVI A;  4PJO A;  2FYK A;  2LTO A;  3SWN C;  3V7S A;  2CKK A;  2KMT A;  2E6Z A;  2MAM A;  5CCA A;  4J7F A;  4PLL A;  1KQS S;  5CO7 A;  4M77 E;  2RB6 A;  4C5G A;  1VQ4 T;  4KT0 E;  1BIA A;  2RA2 A;  3L42 A;  2Y90 A;  4J6X A;  3A8L B;  3OYJ A;  3OA6 A;  3OS1 A;  4M77 A;  1VUB A;  4XU1 A;  4JS5 A;  2BKD N;  3OYK A;  4M77 F;  5GAN 5;  2R58 A;  2DEQ A;  2WAC A;  4FT4 A;  4RMO A;  4BDY A;  2K57 A;  2X35 A;  4HT8 A;  3NTK A;  3JRZ A;  2FVU A;  2LQK A;  4PJO B;  3CCU A;  4M7A D;  3J81 E;  2P4T A;  2KK4 A;  3HFO A;  2JNG A;  3L2Z A;  3CC7 T;  1XTD A;  4X34 A;  3ZBD A;  2K2V A;  2QQS A;  3QII A;  3JAM E;  2YHT A;  3OYF A;  2D6F A;  4M78 G;  3GP8 A;  2FHD A;  4M77 B;  1H64 1;  3ER0 A;  4F7U E;  4XTU A;  3CBO A;  4X9D A;  3OMC A;  4BI8 B;  4OMF B;  4LDU A;  4C92 G;  4F7U A;  2K3Y A;  1M5Q 1;  4N0A A;  3VV0 A;  2LT1 A;  3TCJ A;  4XU0 A;  2DXT A;  4JRK A;  3RKY A;  3VU3 C;  3OW2 A;  4E7K A;  2DK3 A;  1VQ5 A;  2RHZ A;  4B9W A;  3OY9 A;  1YCY A;  3M5A A;  5EG2 A;  5LJ3 j;  5GAN 7;  3G71 A;  4A54 A;  3QKJ A;  4CI0 C;  3OW2 S;  3CD6 A;  4O5V A;  4OGE A;  3C95 A;  2EJ9 A;  1K73 C;  2E1H A;  2BIV A;  4QW2 A;  2XK0 A;  4LDW A;  2Y4X A;  4IUT A;  1NZ9 A;  4F7U B;  4ZN1 A;  3OYM A;  1UGP B;  4R56 A;  3GLX A;  2OAU A;  1WQW A;  2ZZD A;  2PUO B;  3P8D A;  2RH2 A;  3JCM V;  3H6Z A;  1N9S A;  4N4I A;  4A4E A;  3CME A;  1VQK T;  4XTV A;  2HD0 A;  1Q86 C;  4DQ2 A;  4OP0 A;  1FWZ A;  4JJN K;  2ZPH B;  4OGC A;  3QXE B;  3M55 A;  3URG A;  3PT9 A;  4QQD A;  4ZTF A;  1G3W A;  4LDV A;  3VUB A;  3G4S T;  3FC3 A;  4BE1 A;  2RI3 A;  4FSX A;  4M78 C;  2GFU A;  4XK8 E;  4Y28 E;  5LJ5 f;  3HP9 A;  3DLL A;  1TH7 A;  3X20 B;  2RHI A;  5LJ3 e;  4C92 C;  2B8A A;  2OTL T;  2EWN A;  2YLB A;  2KDS A;  1VQ6 A;  1QP3 A;  3DB4 A;  3RKX A;  5HK3 A;  3A5Z B;  1WJS A;  1K8A C;  4RG2 A;  3GPL A;  5LJ5 g;  1DJ7 B;  4C8Q G;  5LJ3 f;  4VUB A;  3CC2 A;  3GF5 A;  5KCO A;  2RJF A;  3FRN A;  3JB9 I;  4RCB A;  3CCS A;  4IUU A;  2PU9 B;  1X6O A;  3CCJ T;  4EMH A;  3KBG A;  3NTH A;  5I2M A;  4PKC C;  5GAO m;  4E7J A;  4M7A G;  1M8V A;  5KE3 A;  2VXF A;  5LJ3 d;  5CQY A;  1LOJ A;  3OS5 A;  1G3T A;  1YHQ T;  3JCM b;  3J80 E;  1AHJ B;  2VUB A;  2GQV A;  2DIQ A;  4B9X A;  3OS0 A;  2ZPG B;  2EIF A;  3VUZ A;  3GIB A;  3S3O A;  2EQU A;  2VC8 A;  4RKU E;  4C0G A;  3JCM h;  4XTX A;  1XOV A;  2LX9 A;  3V8K A;  1KD1 C;  1W4S A;  5CK9 A;  4E7H A;  2HQX A;  2DXB A;  2HQE A;  1LNX A;  1NPR A;  3QDR B;  4OB0 B;  3L2V A;  3LW5 E;  2LVM A;  2PVG B;  3VYG A;  2DVE A;  4OB3 B;  2EKO A;  4KBM B;  4ZGE B;  3OYE A;  1Q82 U;  3CEY A;  4JS4 A;  4XTW A;  3VYH B;  3OBW A;  3M59 A;  2OTJ T;  4J5Y A;  5GAN g;  4GY5 A;  2QI2 A;  3J7A F;  4C8Q C;  3SDZ A;  3HRS A;  5KCH A;  4Q5W A;  3SD4 A;  2VYT A;  1YJ9 T;  2RK1 A;  4QVD A;  1PSF A;  3OYL A;  4MZM A;  1KC8 U;  4C5I A;  1SSF A;  3CC7 A;  2CZ0 B;  4J83 A;  2V8J A;  2DD4 A;  5KE2 A;  4M7A C;  3G7Z A;  4BAC A;  2DXU A;  2QEX T;  3LH0 A;  1BI1 A;  1R8O B;  4C0D B;  1G5V A;  1Q81 C;  2DJZ A;  1BI0 A;  3OYC A;  3JB9 G;  3E19 A;  3M9Q A;  1BKB A;  1YIJ T;  1G3Y A;  2MI6 A;  4ZGD B;  2XD0 A;  3OYA A;  3KXT A;  3PTA A;  3MEV A;  1PSE A;  2K3X A;  2R5A A;  4PJO E;  4N4G A;  2XDB A;  3WVD B;  3HHT B;  3OBY A;  1JB0 E;  3M57 A;  4PJO F;  5FRM A;  4PNO A;  3CBP A;  5FU7 B;  4GLK A;  2EFI A;  3VJP A;  4ZN3 A;  5DLO A;  4BI3 A;  4OVA A;  5GAN 3;  3OYG A;  3T9N A;  2XHC A;  3TRE A;  3CCE A;  2DZ9 A;  3OYB A;  2E5Q A;  4M7D G;  4FIB A;  4FT2 A;  1YJW A;  1Q7Y C;  3GNG A;  5AYF A;  2CZ1 B;  1NE8 A;  2RHY A;  1VQK A;  2CGH A;  3QBY A;  3EFS A;  4TVR A;  2EQK A;  3WXM B;  5GAM g;  1YIT A;  3LLR A;  3CCL T;  4ATO A;  4PJO D;  4BD3 A;  2QTX A;  3CBM A;  1IRE B;  3MP8 A;  3L1A A;  3P8B B;  3M54 A;  5J26 A;  2LRQ A;  4OF1 A;  4ELY C;  3MO8 A;  4DA4 A;  5LJ5 j;  4V2S A;  1M1K U;  1B34 A;  1Y07 A;  1JRI A;  2RHU A;  4PL6 A;  3OYI A;  4BI4 A;  1N9R A;  4M77 D;  4XQ3 A;  3RKW A;  4A4F A;  3NTI A;  2KAF A;  2QXF A;  3CCR T;  1YJN T;  4MMK A;  3GNF B;  2P0Q A;  4M75 G;  2ZPE B;  4HCZ A;  4IUV A;  2DTO A;  4F7U F;  2LC4 A;  1WJR A;  2HBP A;  2RK2 A;  4J6W A;  4LD9 K;  1VQM T;  1NJI U;  3QO3 A;  3PMI A;  4KUL A;  1N8R U;  1JBM A;  5IT9 E;  1B34 B;  1U1S A;  5DLQ E;  4BUG A;  4Y91 A;  2HNI A;  3V8J A;  3SWN A;  3CCJ A;  3HRT A;  1RL2 A;  1M1F A;  3E9F A;  3FB9 A;  3HL8 A;  3X24 B;  4XU3 A;  4C0F A;  3S3N A;  5CKD A;  1M1K C;  1M4Z A;  2XID A;  3A8O B;  4M7D C;  4BY6 B;  3ASK A;  4FM4 B;  3OYH A;  2ZPF B;  2DD5 A;  5LJ5 e;  1YHQ A;  2LT4 A;  4N4H A;  3BW1 A;  3SB2 A;  2ZGW A;  3LWH A;  1VQ7 A;  4QVC A;  5FU6 C;  1Y96 A;  4MML A;  3RER A;  5FLX E;  5LJ5 h;  5CR2 A;  4CRI A;  3QYG B;  2EYQ A;  3SWN B;  2F5T X;  5GAN j;  4A4K A;  2C06 A;  1RI0 A;  4XAX B;  1OYX A;  3CPW A;  1ZHI A;  3PGG A;  2EJG A;  2E70 A;  5GAN 8;  5D6Y A;  2P0P A;  1UB4 A;  2IVW A;  3CPW S;  3CCQ T;  4M75 C;  5LJ3 h;  1Y96 B;  1VIE A;  2EQJ A;  1UGR B;  3KUF A;  2O01 E;  1X01 A;  1KHI A;  2LCL A;  3EAE A;  2OTJ A;  1H3Z A;  2QQ9 A;  5C6S A;  2LDM A;  2M1H A;  5LJ5 d;  3I55 A;  3C94 A;  3R6O A;  4NS5 A;  3VKI A;  1YJ9 A;  4L59 A;  3H8Z A;  4XTZ A;  5FRO A;  4R55 A;  2CYZ B;  3M56 A;  3JCM Q;  2G3R A;  2XIC A;  3FJP A;  3UWN A;  4LDX A;  1WGS A;  2M16 A;  3QZ9 B;  1N27 A;  5DY9 A;  3JSC A;  4ZGJ B;  2KVQ G;  3QZ5 B;  3TEE A;  1MGQ A;  2QEX A;  5CIU A;  3V7R A;  5A0L A;  5GAN e;  5D6X A;  2PVD B;  5KH6 A;  5FRN A;  4O6J A;  2F69 A;  1N6A A;  3V7C A;  3LWI A;  3WVE B;  1YIJ A;  3LX7 A;  5A0D A;  4II1 A;  2L5Q A;  1VQP A;  2FL7 A;  1VQ9 A;  4M77 G;  1UGQ B;  4M78 E;  4JRP A;  2A3L A;  3F70 A;  1VQ5 T;  4ELZ C;  2I2L A;  3FLG A;  1KQ1 A;  2EAY A;  2FB7 A;  4RCC A;  2K5I A;  2VGM A;  1D3B A;  5GAN f;  1KG1 A;  4IUQ A;  3HFN A;  4J6Y A;  3OYD A;  4M78 A;  4C92 E;  5GAN 4;  1U1T A;  4M78 F;  5CKB A;  2DTH A;  3PIO A;  4EPC A;  3OSV A;  4L6V 5;  4IUR A;  4A53 A;  1V29 B;  5IN1 A;  4C92 A;  2E64 A;  4EMK C;  3MCA B;  4C92 F;  4J8O A;  4M75 A;  1M90 U;  1QVP A;  2XKO C;  1UEB A;  1K9M U;  2V8I A;  3C4S A;  5GAN d;  2DKG A;  3JCM c;  2DPP B;  2AHJ B;  2O4X A;  2GFA A;  3CCM T;  3OSS C;  1O9S A;  1D3B B;  3V8L A;  4DOV A;  2QA4 T;  4HA8 A;  3CCL A;  4M78 B;  1XQH A;  3QYH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...