3N5BB

The complex of pii and pipx from anabaena
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3n5bB01
2XKOC 2XG8D 3N5BB
chains in the Genus database with same CATH superfamily
5GANd 3C95A 1LVKA 4IUQA 2YRCA 2FHDA 4R0KA 3FDRA 3VUZA 4M78C 1N9RA 1PRLC 5M9OA 3RBBB 1SF9A 4PJJA 3OW2A 4M7DA 4PJOC 1SKUB 1M90R 2DEUA 3S3OA 2LJ1A 5GAOr 2L3QA 1ZQ1A 3RIRA 2EAYA 4JJCA 3OQ5A 4Z02A 2MI6A 4JPBW 4ZGEB 3HPWA 2EKOA 3T9NA 4B6MA 1I4K1 1UHCA 2DKGA 3NPFA 3Q1JA 1VA7A 1PRMC 1MMAA 4B9XA 1VQ4Q 1I5LA 5A2QE 1MUZA 8AT1B 3MEWA 3M4YA 1GCPA 3MP1A 4XTZA 3MP6A 2HQHA 1BIBA 2F2XA 2KROA 4XU1A 3M0SA 1S72T 1PD1A 2LCCA 3QWYA 4AFSC 5IHNA 2DXUA 4M7DB 1D1CA 1S72A 2DTIA 1K73R 4FU6A 5GMKe 4FW1A 1Q7YR 1ZA1B 1N9SA 3JCMd 3MEAA 2P0KA 3E9FA 2J6KA 3A5ZB 1WJRA 3OB9A 1Q81U 1P92A 1JEGA 4RTVA 1VQ5A 3CC4Q 3LX7A 3CC2T 2DIGA 4PJNA 1WDXA 2KSSA 3JB9D 5LJ5d 2IVWA 1UHFA 4C0FA 2HQXA 4JRQA 3CC2A 1G5VA 4EIKA 3GNGA 1YIJA 1YI2A 2NUTB 2V26A 2HL3A 3RNJA 4C5IA 2K57A 4L5GA 1VQ6T 1NPRA 2RMOA 2CYZB 2CZ7B 3CBMA 1UGQB 1YITT 1VQ6A 1BIAA 2AT1B 2HEQA 1VQMQ 3CCMA 2K4YA 5IHIA 3TEEA 2X3WD 1YITA 4HCKA 2DD4A 2C06A 2O9SA 1FMWA 1D0XA 4C0ZA 4LUEA 5D6WA 1KK7A 1ABQA 1OULA 4KH1B 1AZGB 4Q5WA 1QQJA 1T0HA 3QSUA 2B86A 3M0RA 2MWPA 2XICA 4E7LA 2C0TA 4MZPA 1VQLT 3H9NA 4QKUA 2RQRA 3DLMA 2HAXA 3A8OB 2RF0A 1VQLA 2SEMA 4EPCA 1M3BA 3NFCA 3JCMX 4II1A 1RI9A 3P8HA 1AWXA 1KQ2A 2A7YA 4M75A 1M1FA 2CZ1B 2L8DA 3DLLA 4GLMA 2DL7A 2NYSA 2E6ZA 1K76A 4BDYA 4O6JA 1H92A 2PUKB 1WXUA 2JJ9A 4MDWA 4RTTA 3RESA 4DOWA 4N0AC 4M78G 1R8OB 3OYGA 2YWWA 4PJOG 4M77G 3CBPA 3SHWA 3EGXB 1W6XA 2CSIA 4F17A 1K8AC 4Y92A 5FU7C 1PCXA 4ZGJB 2I0NA 2AK5A 5IH2A 3G6EA 2DTOA 2DZCA 2E64A 1SRMA 4N4HA 4XTUA 1D1AA 1N8RR 1FX7A 5GMKm 4ORZA 1FYNA 3M0PA 4C8QA 1EX4A 2COZA 2O31A 2HDAA 1BI1A 3CCVQ 2EYQA 4M75B 4B9WA 2ZCFB 1Y96A 2RA2A 3CCQT 1MMDA 1HD3A 2HKQB 1H3HA 1X27A 5GJWB 4E7KA 1K0XA 2ED1A 4J8OA 4DA4A 3CCQA 2XG8D 5LJ3j 2Z0WA 2ZPIB 2RHYA 4JLIA 3CD6Q 2CDTA 3OYLA 3SWNC 2DETA 1WQ7A 1RABB 5KYXA 5GANf 1K9MR 1NE8A 4F14A 3PMTA 3EFRA 2VXFA 2L89A 2J7IA 2J6FA 2EJ9A 3UF4A 1OV3A 3LWIA 4ZTFA 4BUGA 3EG2A 2RO0A 1VQ6Q 2O2OA 2JUFA 2BKDN 4CC4B 3CMEA 3OW2P 4M7AF 5GAN7 4OB3B 4WF2A 4M7DC 1I8FA 4KUDK 2E4HA 1PG5B 4J9FA 1Y96B 1KQSA 1S1NA 1NJIC 1VQPQ 4E7HA 5GMKl 2CZ6B 4KH0B 1D0ZA 2FVUA 2A0FB 2YSQA 4OB0B 1VQ9T 3M4GA 2VGNA 1U3OA 3G1JA 3GLXA 4RG2A 1Q7YC 1VQLQ 3JB9J 2JZ2A 1VQ9A 4MDXA 5CKHA 3G71Q 3VS5A 1Y07A 2PZ1A 2DMOA 2ZPHB 4XAXB 1QCOA 2RJEA 1WXBA 4FL6A 2DFUA 1AWOA 2FRYA 5FRNA 4QQDA 3M59A 3MKDA 4M4ZA 2CKKA 3QJYA 3JCMf 4IIMA 2QQBA 4KBMB 1LCKA 1RACB 3ZEHA 4CI0C 2DJQA 1OOTA 2DLPA 2KAFA 3TU4K 2X4WA 1SG5A 3PVLA 4DBQA 3NTHA 2R5MA 5GANh 2XDPA 2JT4A 4M78F 6AT1B 1KC8C 1RAHB 1DJ7B 5LJ3e 4M77F 2QYZA 4EDUA 4J7FA 4KUIA 1PHTA 4VUBA 1I5OB 2OX7A 2LTOA 2LP5A 2BUDA 4E47A 4Z88A 4PJOD 2OTLT 2V8IA 5KE3A 1RAAB 2KYBA 2OTLA 5CO7A 7AT1B 4A4GA 1VQKT 5CQXA 1NBEB 3DB3A 4OMMA 2EGAA 3CCQQ 3QHSA 1AT1B 2E70A 1ZUYA 1KD1C 2F5KA 2JS2A 2BIVA 5CKBA 1U1SA 2K3YA 4BE0A 1GFCA 1Q82R 1KHCA 1AOJA 1LJOA 1I07A 2E5QA 1X6OA 2DRMA 2NWMA 3G7ZA 4QW2A 4F7UF 4NS5A 3EFOB 1M1GA 2DX1A 3CCRQ 3HFNA 2D0NA 1RL2A 5FWCA 1YHQT 5FRMA 1QWFA 3R6OA 2DM1A 4JZ3A 2GFUA 1WQWA 2YXYA 3IQLA 3X25B 3OYCA 5GAMj 1X6BA 1YHQA 2DL4A 4CC7A 1VQ4T 3X24B 2KRSA 1K8AU 2DK3A 1U8RA 1VQNT 2DEQA 3JRZA 1WX6A 2E65A 3JCMh 3H8ZA 1VQ4A 4IIOA 4X1VA 1SSFA 1VQNA 2FG0A 2B8AA 4RKUE 4M75C 1BI0A 1PKSA 4A4FA 2XI9A 1EIFA 5LJ3d 1UB4A 5LJ5h 3OS2A 2PVDB 2DYBA 2FO0A 1VQ9Q 2CT4A 1NM7A 2YLCA 2CP6A 3M0QA 1WIEA 4ZN3A 4N0AA 1G3YA 4M7DG 3JB9G 3RMQA 1XOVA 1BCOA 1N5ZA 1T3LA 1OZ3A 1OPLA 1UE9A 3P8DA 2NUZA 2O88A 4PFOA 2MPXC 4JJBA 1RADB 5HCKA 2GTOA 2HNIA 4GBQA 2RJCA 2QGFB 3EFSA 3EG1A 5GAN4 4JRIA 1IB8A 3QPHA 2MMPA 4XTVA 4C8QC 2KT8A 5CAIA 1WJSA 2LQ8A 5CKFA 3V7CA 2YDLA 1KSWA 3M55A 4J6WA 1M1KC 1Q86C 2JOYA 1OZ2A 3A8LB 4C5EA 3NTIA 3V7SA 1MGQA 2RPNA 1NJIU 4HA8A 1E6GA 2BTTA 4J6XA 1VQMT 2XKOC 2PU9B 3A8HB 2LQWA 1WI7A 3CCLQ 4J9CA 1VQMA 1MMNA 5GAMg 4DQ2A 2QK0A 4E2FB 1ARKA 2QA4T 1SEMA 2JS0A 1WXTA 2OI3A 3PE0A 2L0AA 1X6GA 2L2PA 1VQKQ 5GAMe 2ATCB 2DL3A 2QA4A 1BK2A 2V8JA 5I2MA 3HHTB 5CQYA 1VQOQ 3FC3A 1M5Q1 3L1AA 3CBOA 4ZN1A 1K0SA 5A0LA 3JV3A 4RTYA 2CS7A 2WSEE 4L6V5 1KQSP 2HL5C 4M7DE 2D6FA 3LH0A 2X4JA 1HJDA 1RAEB 4Z89A 2DPPB 1YHQQ 1PM3A 4KRTA 3PIPA 5IXFA 3JB9I 3OYKA 5KH6A 2LC4A 3H0IA 3OSVA 3MHXA 1KC8U 1B3QA 4QVZA 1TU0B 3SWNB 3CPWS 1VQNQ 2K9GA 3TCJA 5GAOp 2RJFA 2FYKA 2MYSA 4UC4A 2KI7A 2QQRA 3I35A 1I1JA 2JTFA 2K6DA 4RTUA 1WPYA 3P8BB 2E6NA 2KRMA 2RN8A 3URGA 4BB7A 2DO3A 3M54A 2W0ZA 4C0DB 2PVGB 3R6NA 3QZ5B 2LMJA 3U23A 2DF6A 1ZA2B 3PMIA 1KD1U 1GBQA 1YJWT 1OQKA 3QUIA 3V7RA 5HK0A 2DBKA 2FPDA 3CCVT 2CH4A 4PNOA 1YJWA 3EGDA 2QDLA 5GAMd 4M75G 3CCVA 2DVEA 3JB9F 2F5TX 4EMHA 3KFVA 4XK8E 4FSXA 2ZPEB 3ME9A 3CD6T 4IURA 4M7DD 3RERA 2QAZA 3CD6A 1IZ6A 1YWOA 3TREA 2RQWA 1X69A 1UECA 1QVGA 1RAIB 4FYXB 4ELZC 2E41A 1PC0A 3VYGA 3GIBA 3UWNA 1QVPA 2QQ9A 3NHNA 2GFAA 3TVTA 1GCQC 3V8JA 1GXIE 4ZNXA 3PTAA 2R58A 4J9EA 1NPPA 3QYHB 2R57A 3RKYA 2OTJT 1UUEA 1QW1A 4C8QG 1WHLA 1AVZC 3EGDB 4FT4A 2BZ8A 2QA4Q 2OTJA 4XTYA 1VQPT 1AWJA 2RI3A 1JJ2A 1OU8A 2VGMA 4HXJA 3PNWC 2L3RA 1MNDA 3CCET 3ZL7C 1VQPA 2FL7A 2CUBA 2P84A 2MF2A 4EMKA 1M30A 5LJ3f 3MO8A 2QASA 3G71T 3JCMQ 1JRIA 2CP3A 2RQVA 1TOVA 2YRDA 5KCOA 3CMAQ 5I11A 2K2VA 1KIKA 3MCAB 2E3IA 1Q95G 3G71A 1PWTA 2MIOA 4A4EA 1E6HA 1XQHA 2E12A 2CT3A 2DERA 3HL8A 4M75E 2LQKA 3RMSA 1WHGA 1M1KU 2RI5A 4IUPA 3JAME 1Q86U 2LCSA 1OEBA 1UJYA 3SFMA 2IG0A 5GMKi 1D1BA 1W70A 1J3TA 1Z9QA 2VUBA 4PK4A 4KULA 4RMOA 2P4RA 3J81E 1SSHA 4HVVA 4KGZB 1Q81R 1JBMA 1YWPA 2EKHA 3JCMV 2EWNA 4E7ZA 2H3JA 3OS5A 4JS5A 1FMVA 4ZGDB 3MJXA 1UFFA 4HCBA 2AHJB 1MV3A 3MEVA 4M7AA 2A37A 4BY6B 1YJWQ 2MK5A 2EYYA 2DILA 2XU8A 1V1CA 3VS7A 1U5SA 2K7AA 4C8QE 3OMCA 4AT1B 3RKWA 3M58A 1NLPC 1UGVA 1QKWA 3M0UA 1M8MA 2P0QA 1PSEA 2X35A 1JXOA 1M90C 2LZ6B 2EJFA 1YJ9T 2PQWA 3ULRB 1FXXA 4FYWB 4R56A 2L5QA 3EHRA 1YJ9A 5CCAA 5GAOn 1M9SA 2JXBA 2C0OA 5LJ3h 3CCRT 4C92A 4M75D 1JO8A 5GJVB 1IRXA 4C92E 2FPEA 3CCRA 1TWBA 1WYXA 1BU1A 2EQIA 4C0DC 1Y0MA 3BFMA 4OMPA 5J26A 3RUXA 4AFZC 2JW4A 2KDSA 1UG1A 2E10A 3CCUQ 4QQ6A 3G4ST 2EFIA 3CCJT 4C8QB 1M2OA 2DRKA 2OTJQ 4TVRA 2CP7A 2EVRA 3G4SA 2ZAEA 2XIDA 2J06A 2OAWA 4PLLA 3CCJA 4GY5A 3SB2A 1G3WA 2C0IA 2EQJA 3ZBDA 1H8KA 1QKXA 1K1ZA 5GAOq 4A63B 2EW3A 4JJNK 3CCEQ 2LNHB 1K73C 2PVOB 1HXDA 3H0FA 4E7IA 5FWBA 3JB9H 5KYXB 3VS1A 3GPLA 1QP3A 1N6AA 1G83A 4PFPA 4C8QD 4QQGA 2AKKA 4D8DA 1I0CA 4C92B 1TUGB 4HVWA 4XTXA 3OW2S 4BI3A 2A36A 3EG3A 3X20B 1YBYA 2DXTA 3GOXA 2RHIA 4F16A 4JS4A 3CEYA 1EZZB 1UTIA 5GAMf 3UATA 5FW9A 4HVUA 5GAOm 2KXCA 4RTXA 4KGXB 2X4XA 3VUBA 1NEBA 3RDVA 4C92D 1Y71A 4A53A 3AT1B 4NL3A 5KE2A 2EQMA 2RD1A 3FEOA 4GLKA 3CXCA 1X2QA 2DE0X 4PJOF 2EYXA 1NYGA 2LX9A 1KJWA 5CK9A 5GANj 2QQSA 2KXDA 1UJ0A 4LE9A 2K3XA 3O5ZA 1IREB 3CCLT 1M3AA 5GAN2 2WACA 2D8HA 2IIMA 2Y4XA 3CCLA 4CRIA 3RKXA 1QVGP 3HRTA 4ANJA 2RK1A 4CC2A 1XTDA 2GNCA 2MAMA 4ELYC 9ATCB 4C5HA 3MPUB 2LCLA 1ZLMA 1C1AA 3H6ZA 1VQKA 1VQOT 1X43A 1MNEA 2DIQA 1ZBJA 3EG0A 3VYHB 3QDFA 5AT1B 1GCQA 3CPFA 1YJ9Q 3BE3A 2W10A 1VQOA 2CREA 3VS0A 5FLXE 2JNGA 3M5AA 1ZSGA 2CP2A 3E1SA 4XU3A 2CSQA 1ZBXA 4FT2A 1BBZA 2E3HA 1SHGA 1JJ2P 5GAOl 2XHCA 1TTHB 3VJPA 1Y7XA 2NUPA 2EBPA 1VYTA 2HBPA 2LQNA 3I56T 2LJ0A 3LLRA 2RI2A 4OMNA 1B34A 2GQIA 4IUVA 2EGCA 3I56A 4EMKC 1RUWA 4DBHA 1QVGS 3LGLA 1D0YA 2DTHA 3OYNA 2GF7A 4J9DA 3L2VA 2K5LA 3G4SQ 2QQAA 4BY6C 1GBRA 2LX7A 3CCJQ 4JZ4A 1RLQC 2OJ2A 4PFZA 1I81A 1V76A 2JTEA 2RQUA 2JN0A 1OI1A 3KUFA 2CGHA 1N8RC 2DL5A 1MMGA 1VQ8Q 3PGGA 4N4IA 4X9CA 2LNVA 3MEUA 1UGRB 4XU0A 1WZOA 2ZPBB 3H0HA 4L59A 5LJ5j 1W2BP 1M90U 3OYEA 3CCSQ 4IKFA 2CH4W 4XQ3A 2R5AA 4FYVB 1YJNQ 1PD0A 5GANg 3LWHA 3S3MA 2NUPB 3C4SA 5D7UA 2QTXA 1YNZA 2CUDA 4AFQC 5GANe 1WFWA 1ACMB 1B34B 2F69A 4JRKA 4OMFB 1YCYA 4OB2B 1K9MC 3UDCA 2KMTA 1UGSB 2FZKB 4ESRA 4PL6A 4M7AC 1WHHA 3E19A 2LT1A 1QVFA 3A8MB 5CVIA 2VVKA 2OAUA 1T0JA 4C0GA 3J7AF 1BB9A 2O01E 2X9HA 4BD3A 1RI0A 1JU5C 1WHJA 4D6WA 2FB7A 1X2KA 2HCKA 2JVVA 5DLOA 5DLQE 1FWZA 4Z8AA 3WVEB 5GMKh 2V1QA 2BE9B 2YRVA 4MZMA 1U06A 4FW2A 4J7IA 2KGTA 5GAN3 4QVDA 1K73U 3OYYA 2QG9B 4QVCA 1Q7YU 4C92C 3VS3A 1TXQA 4A4HA 1RAGB 1KG1A 2RH2A 4RUGA 4X34A 2M51A 2PUOB 2EQUA 2KBTA 3EH1A 1K8AR 2RHUA 4BE2A 2ZPFB 4FCYA 2ABLA 3JCMg 3BDLA 2H3EB 3EG9A 3QYGB 5DM7R 4MZTA 3CMAT 3OYFA 2M9UA 4HT8A 3GP8A 1YN8A 3OS1A 2FZCB 3HRUA 3CMAA 2KK4A 2P4TA 1D3BA 3SD4A 4LDUA 3OMGA 2V1RA 5LJ5g 3I56Q 2F2VA 1AWWA 2LRQA 4JDSA 3I5RA 1XNIA 3JCMc 1G3SA 4J9HA 2SRCA 4M77C 5LJ5e 2JM8A 3HP9A 4MMLA 4DBFA 2VXEA 1IGQA 3ASKA 1UDLA 2DA9A 4OGCA 3KBGA 3HRSA 4QT7A 3QWXX 1WJQA 5KYWA 1JXMA 1O75A 4AFUC 2MOXA 3VS4A 2QTVA 1KQSS 3DKMA 4C5GA 5D6YA 1OYXA 3BDUA 3EG9B 3L42A 2KRNA 2ROLA 1UGPB 1NYFA 2NUTA 5IHKA 2VC8A 4A4KA 3MP8A 1D3BB 2RQTA 2BZYA 3C12A 3CXCP 2XMFA 3CQTA 2L3PA 8ATCB 4MMKA 1F1BB 5GAN8 4M7DF 1NJIR 1SPKA 2KYMA 1Q82C 5HY6A 1D09B 5KCHA 2CP0A 2F1LA 1YFNA 2KR3A 5EC7A 2DNUA 3L2ZA 1U1TA 4LXCA 5CKEA 3PVQA 3M9QA 3M53A 4E7SA 1KHIA 1V29B 2AKLA 3E9GA 4XTWA 2ZGWA 1VQ5T 3HKSA 2JMCA 2P0PA 2ENMA 4LDXA 4BDZA 1OPKA 3UPUA 5KYWB 1M2VA 3THKA 1YIJT 3VU3C 2AIRB 3QG1A 3DB4A 1YI2T 2M1HA 2PNIA 2YUPA 4FYYB 4NL2A 2DAQA 2O4XA 4J9BA 3QKJA 3CCUT 1N8RU 5L8RE 2HD0A 3QO3A 3I55T 2CP5A 1NEGA 3CXCS 2RK2A 5HKCA 4IUTA 3L2UA 4M7AG 4OMQA 2NLUA 2RNAA 2GTJA 3CCUA 4LDYA 5CIUA 2CZ0B 4LUDA 3I55A 2QEXQ 3GBQA 3LH5A 3CCMT 3VKIA 4NOYA 2O9VA 1VQ7Q 1TSFA 1BCMA 4HCCA 5FU6C 1KC8R 2YHTA 1W1FA 1PNJA 2RHZA 4OP0A 3META 1GFDA 2DD5A 3KXTA 1AZEA 1IO6A 1PKTA 3CCEA 4HT9A 1K9MU 2K3BA 2D8JA 2QI2A 5KYYA 3EGXA 4YTLA 3OBYA 4ATOA 2DXBA 2Y4YA 1ZUKA 4C92G 1R0BG 2HSPA 1M2VB 2LDMA 1JB0E 4OMOA 3OSSC 3OYIA 1R0CB 3UA7A 2WSFE 4J83A 3N5BB 1KD1R 3NTKA 4RCBA 1LNXA 3TSWA 2O4XB 1ZSZA 1E7OA 4R55A 2AZVA 1EFNA 3C0CA 4E6RA 4OGEA 5IN1A 3BY7A 4JRPA 2LJ3A 3D7SB 2EQKA 1TUDA 4WCIA 2MCNA 1W2BA 3UA6A 5A0GA 4DBRA 2KNBB 5J39A 3QIIA 2E5KA 4PJMA 1M8VA 1Z9ZA 4X9DA 3M56A 3M57A 4HCZA 2HMAA 5GAN5 2ECZA 1ZUUA 1QLYA 4EMKB 2KY9A 1TH7A 1WNLA 4OVAA 3OA6A 2XDBA 3H41A 4AG1C 4RCCA 1QVFP 2COWA 2DVJA 3A1PA 1W4SA 5KYYB 1HK9A 4M7AE 1A0NB 2X51A 3G6ET 2DZ9A 4OMLA 2ESWA 2FEIA 4P5NA 4E7JA 4LNPA 4FSSA 3OYMA 1S72Q 2YUNA 4J9IA 3PFSA 5CR2A 4BI4A 2QGGA 1ZSZB 1IHWA 2YUOA 5C6SA 1M3CA 4M75F 2JMAA 5A0DA 3FIFA 2FRWA 3QJ6A 1RLPC 2EIFA 3JSCA 2FPFA 4DEYA 2XD0A 3SEMA 1QMCA 3I9QA 3VRYA 1VQ5Q 3CC7T 1B7TA 2EPDA 4F7UG 1QVFS 2ROTA 3TQ7P 2L3SA 3CC7A 2DXCA 3CC2Q 4JLGA 1YIJQ 1YI2Q 1QCFA 3A98A 4KT0E 3NGPA 5IT9E 4M7AB 2ZZDA 4RTWA 3JCMP 3I55Q 1WHMA 1VUBA 3VRZA 3UT1A 1M4ZA 3CMET 3REAB 2RB6A 3CPWA 4EMGA 1KFZA 1KQ1A 2KQWA 2QDYB 2BZXA 4J9GA 3CCMQ 1YP5A 1M27C 4OB1B 1M1KR 5L23A 1Q86R 1VQ8T 3S6WA 2F2WA 4Y28E 3L2QA 1YITQ 1IXDA 4M78A 4N4GA 4C8QF 4WTOB 2K5IA 3FRNA 1TS9A 4PJOA 4M78E 1VQ8A 1CKAA 4M77A 2YUQA 1Q82U 2HBWA 2A08A 4M7AD 4PJOE 3CCST 2YLBA 2HKNA 2HQEA 4M77E 2RHXA 4XU2A 1YJNT 3JCMJ 1C6VX 1VIFA 2V8KA 1BKBA 3CCSA 2X3XD 1SHFA 1TG0A 1YJNA 4BE1A 3FLGA 3OYAA 3VS2A 1ZHIA 1TUCA 2A3LA 4C92F 3M0TA 4F04B 4FM4B 3V8KA 1H641 3HTRA 5FROA 2M16A 5IXBA 2EYWA 2AZSA 5IAYA 1K9AA 4ZTJA 5KYNA 4F7UA 2VKNA 2BE7D 2RM4A 3HSBA 4M78B 4F7UE 3OYJA 1QCNA 1UEBA 2VASA 4PJOB 2LT4A 3EAEA 3VS6A 1OU9A 4M77B 3QBYA 2GCXA 2D0QB 3EFOA 5LJ3g 1CSKA 2D1XA 5LJ5f 2LVMA 1WLPB 4JJDA 4PLIA 2A28A 2M0OA 1RAFB 2VWFA 2I2LA 3LW5E 4BACA 2KVQG 3WXMB 1VYVA 3G6EQ 1LOJA 1OX8A 2GBQA 3AHUA 3PIOA 3QDRB 1B07A 3OYDA 1PSFA 1G3TA 3FJ5A 3NMZC 4M78D 5CKDA 3C94A 1IHVA 3X28B 4M77D 4DEXA 2K5FA 4OF1A 4CC3A 4A54A 2D9TA 3EGUA 3LGFA 4J5YA 1NZ9A 2PTKA 3JCMW 2KEAA 5DY9A 1QP2A 3S3NA 3X26B 4F7UB 3CC7Q 2IPOB 3OYHA 2VYTA 1AHJB 1HYOA 1NLOC 1BYMA 2GGRA 5AYFA 1AEYA 4D8KA 2J05A 3QXEB 5J3BA 1SRLA 4LD6A 4O5VA 1YCSB 3FB9A 5GAMh 1LPLA 1Q81C 1FMKA 2KE9A 2XK0A 2G3RA 3CMEQ 4PJLA 3BW1A 1WHKA 4IUUA 5EG2A 5C0MA 1Y57A 2K79A 2WSCE 3QZ9B 3GF5A 1G2BA 4Y91A 1ZSZC 1H3ZA 1VIEA 2DJZA 2KT1A 1JJ2S 4RTZA 4HKEA 3WVDB 3OBWA 3E2UA 5KYUA 1WA7A 1GRIA 1X01A 3JCMb 3J80E 2DL8A 2HZYA 3L2WA 2M0YA 1T3SA 3FJPA 2E1HA 1OX9A 2COYA 2J6OA 2DBMA 5FU6B 1ZX6A 3TSZA 1NG2A 2X4YA 2EGEA 1N27A 4AG2C 3VV0A 1QWEA 2EYZA 2GQVA 5I22A 3SDZA 4DOVA 2K2MA 2HSEB 1IGUA 5HK3A 4LN2A 1JQQA 4V2SA 5D6XA 3ZFJA 4RG8A 3OYBA 4K11A 2YT6A 2JTMA 2VB6A 1R77A 3F70A 4LD9K 1G8XA 3CC4T 3EHQA 4LDWA 2H8HA 1X75C 5I21A 3OY9A 3RR6A 1W2BS 1BI3A 1BI2A 1O9SA 2M02A 3CC4A 3REBB 2ED0A 1XJWB 3A8GB 3I5SA 3EH2A 1CKBA 2FZGB 1MV0B 5KYUB 4FIBA 2MWOA 3OS0A 2DYIA 4J6YA 1WGSA 1AD5A 5GMKj 1VOMA 2QEXT 3INZA 3L2RA 2RJDA 3V8LA 3PT9A 3O8VA 1VQ7T 1ABOA 4JUVA 5LL6S 2G6FX 2QEXA 2QXFA 2JM9A 4BI8B 2VV5A 3GNFB 1VQ7A 3SWNA 2Y90A 2XDDA 5GAN6 4LDVA 2OTLQ 4AMCA 3HFOA 1HSQA 5I2SA 1MHNA 3CPWP 1VYUA 1K4US 1GL5A 2ZPGB 3JCMe 3LYIA 4ME7A 2EJGA 3ER0A 1C0MA 4KGVB 4PKCC 5FU7B 5ECAA
chains in the Genus database with same CATH topology
5GANd 3C95A 4OP0A 1YHQT 4C8QB 4IUQA 3META 5FRMA 3R6OA 2FHDA 2DD5A 4TVRA 3FDRA 3KXTA 3VUZA 3CCEA 4M78C 2GFUA 1WQWA 1N9RA 3OYCA 2XIDA 3X25B 5M9OA 3G4SA 4PLLA 5GAMj 3CCJA 3OW2A 1K9MU 4HT9A 4M7DA 4GY5A 3SB2A 1YHQA 1G3WA 4PJOC 2QI2A 3S3OA 1VQ4T 2EQJA 5GAOr 4YTLA 3ZBDA 3OBYA 3X24B 1K8AU 1ZQ1A 2DK3A 3RIRA 1U8RA 1VQNT 2DXBA 2EAYA 2DEQA 2Y4YA 4ATOA 5GAOq 3JRZA 2E65A 3OQ5A 4Z02A 4C92G 3JCMh 4JJNK 3H8ZA 1VQ4A 1K73C 2PVOB 1HXDA 2LDMA 1JB0E 1SSFA 2MI6A 3OSSC 4ZGEB 4E7IA 1VQNA 3OYIA 3HPWA 2EKOA 3T9NA 3JB9H 2B8AA 4RKUE 1I4K1 2WSFE 4J83A 3N5BB 4M75C 2DKGA 3GPLA 1BI0A 1QP3A 3NTKA 4RCBA 1LNXA 1N6AA 2O4XB 4A4FA 4C8QD 4QQGA 3Q1JA 4R55A 2XI9A 1EIFA 5LJ3d 4B9XA 4C92B 1I5LA 4OGEA 5IN1A 3BY7A 1UB4A 5A2QE 4XTXA 5LJ5h 4JRPA 3OS2A 2PVDB 3OW2S 2EQKA 4BI3A 3X20B 2YLCA 1W2BA 3MEWA 5A0GA 1YBYA 2DXTA 3M4YA 3GOXA 3MP1A 2RHIA 4ZN3A 4XTZA 4N0AA 1G3YA 3CEYA 4JS4A 5J39A 3QIIA 4M7DG 5GAMf 3JB9G 1M8VA 4X9DA 3M56A 3M57A 3MP6A 4HCZA 3RMQA 5GAOm 1XOVA 5GAN5 1BIBA 1OZ3A 2KY9A 2X4XA 3P8DA 4XU1A 4EMKB 1TH7A 2LCCA 1WNLA 4OVAA 1S72T 3VUBA 3OA6A 2XDBA 4C92D 4RCCA 1Y71A 2DXUA 4M7DB 4A53A 1W4SA 1S72A 4NL3A 2DTIA 2HNIA 1HK9A 5KE2A 2EQMA 2RJCA 2RD1A 4M7AE 3FEOA 4GLKA 3CXCA 3G6ET 3EFSA 2DZ9A 4FU6A 4PJOF 5GMKe 5GAN4 2LX9A 4JRIA 3QPHA 4P5NA 1N9SA 5CK9A 3JCMd 3MEAA 4E7JA 5GANj 2QQSA 2MMPA 4XTVA 2P0KA 3E9FA 4C8QC 3OYMA 2K3XA 3A5ZB 5CAIA 1IREB 3CCLT 1WJSA 2LQ8A 1WJRA 3OB9A 3PFSA 5CR2A 5GAN2 5CKFA 3V7CA 4BI4A 1Q81U 2WACA 3M55A 1P92A 4J6WA 1M1KC 2Y4XA 5C6SA 1Q86C 2JOYA 4M75F 1OZ2A 3RKXA 4CRIA 1VQ5A 3CCLA 3HRTA 3LX7A 3CC2T 2RK1A 3A8LB 2DIGA 4C5EA 3NTIA 5A0DA 3V7SA 1MGQA 2KSSA 3FIFA 3JB9D 5LJ5d 1NJIU 4HA8A 2IVWA 3QJ6A 4J6XA 1XTDA 2EIFA 3JSCA 4C0FA 1VQMT 2HQXA 2MAMA 4JRQA 4ELYC 2XD0A 3CC2A 1G5VA 4C5HA 2XKOC 2PU9B 2LCLA 3GNGA 3A8HB 1YIJA 1YI2A 3H6ZA 1VQKA 1VQOT 3CC7T 2DIQA 3VYHB 1VQMA 4C5IA 2K57A 4F7UG 5GAMg 4L5GA 4DQ2A 1QVFS 3CPFA 2QA4T 1VQ6T 1NPRA 1VQOA 3CC7A 2DXCA 5FLXE 2JNGA 3M5AA 4JLGA 3E1SA 4XU3A 4FT2A 1ZBXA 2CYZB 2CZ7B 3CBMA 5GAMe 1UGQB 4KT0E 2QA4A 1YITT 1VQ6A 1BIAA 5IT9E 3CCMA 4M7AB 5GAOl 2K4YA 2XHCA 2ZZDA 2V8JA 3TEEA 3JCMP 5I2MA 1VUBA 3VJPA 1Y7XA 3HHTB 5CQYA 3UT1A 3FC3A 1M5Q1 2HBPA 3I56T 1YITA 1M4ZA 2DD4A 2C06A 3L1AA 3CMET 4C0ZA 3CBOA 2RB6A 3LLRA 4ZN1A 4EMGA 2RI2A 3CPWA 5A0LA 5D6WA 1B34A 4IUVA 1KQ1A 2CS7A 2KQWA 2QDYB 2WSEE 3I56A 4L6V5 4EMKC 4OB1B 1QVGS 3LGLA 4M7DE 1VQ8T 2D6FA 3S6WA 2DTHA 4Q5WA 4Y28E 3L2QA 3LH0A 3OYNA 4M78A 2GF7A 4N4GA 2X4JA 4C8QF 3QSUA 3L2VA 2K5IA 2K5LA 2QQAA 4BY6C 2MWPA 3FRNA 2XICA 4PJOA 4E7LA 4M78E 1VQ8A 2DPPB 4M77A 4MZPA 1Q82U 1VQLT 3PIPA 1I81A 4M7AD 3JB9I 3CCST 4PJOE 2YLBA 3OYKA 5KH6A 2HQEA 2LC4A 4M77E 3DLMA 2HAXA 2RHXA 3A8OB 3OSVA 4XU2A 1YJNT 2JN0A 3JCMJ 3MHXA 1KC8U 1VQLA 1VIFA 4EPCA 2V8KA 1OI1A 3KUFA 1BKBA 3NFCA 2CGHA 4II1A 4QVZA 3JCMX 3CCSA 3P8HA 1N8RC 3SWNB 3PGGA 4N4IA 4X9CA 3CPWS 2LNVA 1KQ2A 3MEUA 1UGRB 2A7YA 4M75A 1YJNA 3TCJA 5GAOp 1M1FA 4XU0A 2RJFA 4BE1A 2FYKA 2CZ1B 2ZPBB 2L8DA 3FLGA 3OYAA 4L59A 4UC4A 2QQRA 3DLLA 3CCJT 1ZHIA 2JTFA 5LJ5j 1M90U 2E6ZA 3OYEA 4BDYA 2A3LA 4O6JA 4IKFA 4C92F 1WPYA 3P8BB 2E6NA 4XQ3A 3URGA 2R5AA 2PUKB 4BB7A 5GANg 2DO3A 4MDWA 3M54A 4FM4B 3RESA 3LWHA 4DOWA 4N0AC 3V8KA 3S3MA 1H641 4M78G 4C0DB 5FROA 2M16A 2PVGB 3C4SA 2QTXA 1R8OB 3QZ5B 3OYGA 4PJOG 5GANe 3PMIA 4M77G 3CBPA 1KD1U 1B34B 2F69A 4JRKA 4OMFB 1YJWT 3QUIA 1YCYA 4OB2B 5IAYA 3V7RA 4ZTJA 1K9MC 5HK0A 3UDCA 2KMTA 4F7UA 1UGSB 3CCVT 2RM4A 4PNOA 3HSBA 4M78B 1YJWA 4PL6A 4F7UE 1K8AC 3OYJA 4M7AC 1UEBA 5GAMd 3E19A 2LT1A 5FU7C 4PJOB 2LT4A 3EAEA 4ZGJB 4M75G 3CCVA 1QVFA 4M77B 2DVEA 3A8MB 5CVIA 3QBYA 3G6EA 2DTOA 2OAUA 2DZCA 3JB9F 2E64A 2F5TX 4EMHA 4C0GA 2GCXA 2O01E 4N4HA 3J7AF 4XTUA 2D0QB 4BD3A 1RI0A 5LJ3g 4XK8E 4FSXA 1FX7A 5LJ5f 2LVMA 5GMKm 2ZPEB 4PLIA 3ME9A 2M0OA 3CD6T 4C8QA 2I2LA 3LW5E 4BACA 1BI1A 2KVQG 3WXMB 4IURA 4M7DD 4D6WA 3RERA 2EYQA 1LOJA 2FB7A 4M75B 4B9WA 2JVVA 2ZCFB 1Y96A 2RA2A 5DLOA 3AHUA 3PIOA 5DLQE 3CCQT 1FWZA 3CD6A 3WVEB 3QDRB 5GMKh 1IZ6A 3OYDA 1PSFA 1G3TA 2YRVA 4MZMA 3TREA 4M78D 4E7KA 5CKDA 4J7IA 5GAN3 4QVDA 1K73U 4J8OA 4DA4A 3CCQA 2XG8D 3C94A 3OYYA 1QVGA 4QVCA 3X28B 4M77D 5LJ3j 2ZPIB 2K5FA 1Q7YU 2RHYA 2E41A 4ELZC 4OF1A 3VYGA 3GIBA 4C92C 3UWNA 4A54A 2D9TA 4JLIA 3LGFA 1QVPA 4A4HA 3OYLA 3SWNC 4J5YA 1KG1A 2QQ9A 1WQ7A 2RH2A 1NZ9A 4X34A 5GANf 2GFAA 1NE8A 2PUOB 3V8JA 3JCMW 5DY9A 3PMTA 1GXIE 2EQUA 3EFRA 2VXFA 1QP2A 2L89A 3PTAA 2R58A 3S3NA 2RHUA 1NPPA 2EJ9A 4BE2A 3X26B 3QYHB 4F7UB 2R57A 3RKYA 3LWIA 2OTJT 2ZPFB 3OYHA 4ZTFA 2VYTA 1AHJB 1QW1A 3JCMg 4BUGA 3BDLA 2OTLA 4C8QG 3QYGB 1BYMA 5DM7R 4MZTA 2RO0A 4FT4A 3CMAT 3OYFA 2OTJA 2M9UA 4XTYA 5AYFA 1VQPT 2RI3A 1JJ2A 2JUFA 3GP8A 4HT8A 2BKDN 3CMEA 4M7AF 3OS1A 5GAN7 2VGMA 3HRUA 3PNWC 2L3RA 3QXEB 4O5VA 4LD6A 4OB3B 4WF2A 2KK4A 2P4TA 1I8FA 1D3BA 3CMAA 3SD4A 3CCET 3FB9A 1VQPA 4M7DC 2FL7A 4LDUA 5GAMh 3OMGA 4KUDK 2MF2A 1Q81C 4EMKA 5LJ5g 5LJ3f 3MO8A 2LRQA 2XK0A 2G3RA 4JDSA 3G71T 3BW1A 1Y96B 1KQSA 1XNIA 3JCMc 3JCMQ 1G3SA 4IUUA 1JRIA 5EG2A 5KCOA 1NJIC 2K2VA 4M77C 5LJ5e 3HP9A 5GMKl 4MMLA 4E7HA 2CZ6B 3MCAB 2VXEA 5C0MA 2WSCE 3G71A 2FVUA 3QZ9B 3ASKA 4A4EA 3GF5A 1XQHA 4OB0B 1VQ9T 4Y91A 1H3ZA 2E12A 1VIEA 3KBGA 2VGNA 2DJZA 3M4GA 4OGCA 1JJ2S 3HL8A 4M75E 3HRSA 2LQKA 3GLXA 4HKEA 4RG2A 1Q7YC 3RMSA 3OBWA 3WVDB 3JB9J 2JZ2A 1VQ9A 4MDXA 5CKHA 1X01A 3JCMb 2RI5A 4IUPA 3JAME 3J80E 1Q86U 1M1KU 1WJQA 3L2WA 3SFMA 1Y07A 1O75A 1RL2A 2IG0A 2ZPHB 4XAXB 3FJPA 2E1HA 5GMKi 2RJEA 1KQSS 3DKMA 4C5GA 4FL6A 1OYXA 3BDUA 5D6YA 2VUBA 5FU6B 3L42A 4KULA 5FRNA 4QQDA 4RMOA 2X4YA 3M59A 1N27A 3J81E 1UGPB 2CKKA 3QJYA 3JCMf 2VC8A 4A4KA 3MP8A 2QQBA 1JBMA 3VV0A 4KBMB 3JCMV 1D3BB 3C12A 2EWNA 2GQVA 3ZEHA 3SDZA 4DOVA 4CI0C 2H3JA 3OS5A 4JS5A 4MMKA 5GAN8 4M7DF 4ZGDB 2KAFA 3TU4K 2X4WA 4HCBA 5HK3A 2AHJB 1Q82C 5D6XA 4V2SA 3MEVA 3ZFJA 4RG8A 3OYBA 5HY6A 5J3BA 3NTHA 4M7AA 2JTMA 4LD9K 3F70A 4BY6B 2R5MA 5KCHA 5GANh 2XDPA 4M78F 3CC4T 2XU8A 4LDWA 1X75C 5I21A 1KC8C 3OY9A 3L2ZA 1U1TA 1BI3A 1DJ7B 1W2BS 1BI2A 5LJ3e 4M77F 5CKEA 4C8QE 3M9QA 1O9SA 4EDUA 3OMCA 3CC4A 3M53A 1KHIA 1V29B 3A8GB 4J7FA 4KUIA 3E9GA 4VUBA 4XTWA 3RKWA 2ZGWA 4FIBA 3M58A 3HKSA 1VQ5T 2LTOA 2MWOA 2P0PA 3OS0A 2BUDA 2P0QA 1PSEA 4E47A 4J6YA 1WGSA 2X35A 1M90C 4PJOD 2OTLT 4LDXA 5GMKj 2EJFA 4BDZA 2V8IA 2QEXT 3UPUA 3INZA 1YJ9T 3L2RA 2PQWA 2RJDA 1FXXA 5KE3A 3V8LA 3PT9A 3O8VA 4R56A 1YIJT 1VQ7T 3VU3C 3QG1A 5CO7A 3DB4A 4JUVA 5LL6S 4A4GA 1YI2T 2L5QA 2M1HA 1VQKT 5CQXA 2QEXA 2QXFA 3DB3A 1YJ9A 2DAQA 4NL2A 2O4XA 4BI8B 3QKJA 5CCAA 1M9SA 5GAOn 3QHSA 2VV5A 5LJ3h 3GNFB 3CCRT 3CCUT 1N8RU 5L8RE 1VQ7A 2E70A 2HD0A 3QO3A 4C92A 3I55T 3CXCS 2RK2A 4M75D 5HKCA 1KD1C 4IUTA 3L2UA 3SWNA 4M7AG 2F5KA 2NLUA 2Y90A 2XDDA 5GAN6 4C92E 3CCUA 2BIVA 4LDVA 5CKBA 3CCRA 4LDYA 5CIUA 2CZ0B 1U1SA 2K3YA 3HFOA 3I55A 4BE0A 5I2SA 3CCMT 3VKIA 4NOYA 1MHNA 4C0DC 1KHCA 1LJOA 3BFMA 2E5QA 1X6OA 2ZPGB 3G7ZA 3JCMe 4HCCA 5J26A 5FU6C 3RUXA 4QW2A 2KDSA 4F7UF 3LYIA 4NS5A 2YHTA 2E10A 4ME7A 2EJGA 3ER0A 4QQ6A 1M1GA 3G4ST 3HFNA 2EFIA 4PKCC 2RHZA 5FU7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO C;  2XG8 D;  3N5B B; 
#chains in the Genus database with same CATH topology
 5GAN d;  3C95 A;  1LVK A;  4IUQ A;  2YRC A;  2FHD A;  4R0K A;  3FDR A;  3VUZ A;  4M78 C;  1N9R A;  1PRL C;  5M9O A;  3RBB B;  1SF9 A;  4PJJ A;  3OW2 A;  4M7D A;  4PJO C;  1SKU B;  1M90 R;  2DEU A;  3S3O A;  2LJ1 A;  5GAO r;  2L3Q A;  1ZQ1 A;  3RIR A;  2EAY A;  4JJC A;  3OQ5 A;  4Z02 A;  2MI6 A;  4JPB W;  4ZGE B;  3HPW A;  2EKO A;  3T9N A;  4B6M A;  1I4K 1;  1UHC A;  2DKG A;  3NPF A;  3Q1J A;  1VA7 A;  1PRM C;  1MMA A;  4B9X A;  1VQ4 Q;  1I5L A;  5A2Q E;  1MUZ A;  8AT1 B;  3MEW A;  3M4Y A;  1GCP A;  3MP1 A;  4XTZ A;  3MP6 A;  2HQH A;  1BIB A;  2F2X A;  2KRO A;  4XU1 A;  3M0S A;  1S72 T;  1PD1 A;  2LCC A;  3QWY A;  4AFS C;  5IHN A;  2DXU A;  4M7D B;  1D1C A;  1S72 A;  2DTI A;  1K73 R;  4FU6 A;  5GMK e;  4FW1 A;  1Q7Y R;  1ZA1 B;  1N9S A;  3JCM d;  3MEA A;  2P0K A;  3E9F A;  2J6K A;  3A5Z B;  1WJR A;  3OB9 A;  1Q81 U;  1P92 A;  1JEG A;  4RTV A;  1VQ5 A;  3CC4 Q;  3LX7 A;  3CC2 T;  2DIG A;  4PJN A;  1WDX A;  2KSS A;  3JB9 D;  5LJ5 d;  2IVW A;  1UHF A;  4C0F A;  2HQX A;  4JRQ A;  3CC2 A;  1G5V A;  4EIK A;  3GNG A;  1YIJ A;  1YI2 A;  2NUT B;  2V26 A;  2HL3 A;  3RNJ A;  4C5I A;  2K57 A;  4L5G A;  1VQ6 T;  1NPR A;  2RMO A;  2CYZ B;  2CZ7 B;  3CBM A;  1UGQ B;  1YIT T;  1VQ6 A;  1BIA A;  2AT1 B;  2HEQ A;  1VQM Q;  3CCM A;  2K4Y A;  5IHI A;  3TEE A;  2X3W D;  1YIT A;  4HCK A;  2DD4 A;  2C06 A;  2O9S A;  1FMW A;  1D0X A;  4C0Z A;  4LUE A;  5D6W A;  1KK7 A;  1ABQ A;  1OUL A;  4KH1 B;  1AZG B;  4Q5W A;  1QQJ A;  1T0H A;  3QSU A;  2B86 A;  3M0R A;  2MWP A;  2XIC A;  4E7L A;  2C0T A;  4MZP A;  1VQL T;  3H9N A;  4QKU A;  2RQR A;  3DLM A;  2HAX A;  3A8O B;  2RF0 A;  1VQL A;  2SEM A;  4EPC A;  1M3B A;  3NFC A;  3JCM X;  4II1 A;  1RI9 A;  3P8H A;  1AWX A;  1KQ2 A;  2A7Y A;  4M75 A;  1M1F A;  2CZ1 B;  2L8D A;  3DLL A;  4GLM A;  2DL7 A;  2NYS A;  2E6Z A;  1K76 A;  4BDY A;  4O6J A;  1H92 A;  2PUK B;  1WXU A;  2JJ9 A;  4MDW A;  4RTT A;  3RES A;  4DOW A;  4N0A C;  4M78 G;  1R8O B;  3OYG A;  2YWW A;  4PJO G;  4M77 G;  3CBP A;  3SHW A;  3EGX B;  1W6X A;  2CSI A;  4F17 A;  1K8A C;  4Y92 A;  5FU7 C;  1PCX A;  4ZGJ B;  2I0N A;  2AK5 A;  5IH2 A;  3G6E A;  2DTO A;  2DZC A;  2E64 A;  1SRM A;  4N4H A;  4XTU A;  1D1A A;  1N8R R;  1FX7 A;  5GMK m;  4ORZ A;  1FYN A;  3M0P A;  4C8Q A;  1EX4 A;  2COZ A;  2O31 A;  2HDA A;  1BI1 A;  3CCV Q;  2EYQ A;  4M75 B;  4B9W A;  2ZCF B;  1Y96 A;  2RA2 A;  3CCQ T;  1MMD A;  1HD3 A;  2HKQ B;  1H3H A;  1X27 A;  5GJW B;  4E7K A;  1K0X A;  2ED1 A;  4J8O A;  4DA4 A;  3CCQ A;  2XG8 D;  5LJ3 j;  2Z0W A;  2ZPI B;  2RHY A;  4JLI A;  3CD6 Q;  2CDT A;  3OYL A;  3SWN C;  2DET A;  1WQ7 A;  1RAB B;  5KYX A;  5GAN f;  1K9M R;  1NE8 A;  4F14 A;  3PMT A;  3EFR A;  2VXF A;  2L89 A;  2J7I A;  2J6F A;  2EJ9 A;  3UF4 A;  1OV3 A;  3LWI A;  4ZTF A;  4BUG A;  3EG2 A;  2RO0 A;  1VQ6 Q;  2O2O A;  2JUF A;  2BKD N;  4CC4 B;  3CME A;  3OW2 P;  4M7A F;  5GAN 7;  4OB3 B;  4WF2 A;  4M7D C;  1I8F A;  4KUD K;  2E4H A;  1PG5 B;  4J9F A;  1Y96 B;  1KQS A;  1S1N A;  1NJI C;  1VQP Q;  4E7H A;  5GMK l;  2CZ6 B;  4KH0 B;  1D0Z A;  2FVU A;  2A0F B;  2YSQ A;  4OB0 B;  1VQ9 T;  3M4G A;  2VGN A;  1U3O A;  3G1J A;  3GLX A;  4RG2 A;  1Q7Y C;  1VQL Q;  3JB9 J;  2JZ2 A;  1VQ9 A;  4MDX A;  5CKH A;  3G71 Q;  3VS5 A;  1Y07 A;  2PZ1 A;  2DMO A;  2ZPH B;  4XAX B;  1QCO A;  2RJE A;  1WXB A;  4FL6 A;  2DFU A;  1AWO A;  2FRY A;  5FRN A;  4QQD A;  3M59 A;  3MKD A;  4M4Z A;  2CKK A;  3QJY A;  3JCM f;  4IIM A;  2QQB A;  4KBM B;  1LCK A;  1RAC B;  3ZEH A;  4CI0 C;  2DJQ A;  1OOT A;  2DLP A;  2KAF A;  3TU4 K;  2X4W A;  1SG5 A;  3PVL A;  4DBQ A;  3NTH A;  2R5M A;  5GAN h;  2XDP A;  2JT4 A;  4M78 F;  6AT1 B;  1KC8 C;  1RAH B;  1DJ7 B;  5LJ3 e;  4M77 F;  2QYZ A;  4EDU A;  4J7F A;  4KUI A;  1PHT A;  4VUB A;  1I5O B;  2OX7 A;  2LTO A;  2LP5 A;  2BUD A;  4E47 A;  4Z88 A;  4PJO D;  2OTL T;  2V8I A;  5KE3 A;  1RAA B;  2KYB A;  2OTL A;  5CO7 A;  7AT1 B;  4A4G A;  1VQK T;  5CQX A;  1NBE B;  3DB3 A;  4OMM A;  2EGA A;  3CCQ Q;  3QHS A;  1AT1 B;  2E70 A;  1ZUY A;  1KD1 C;  2F5K A;  2JS2 A;  2BIV A;  5CKB A;  1U1S A;  2K3Y A;  4BE0 A;  1GFC A;  1Q82 R;  1KHC A;  1AOJ A;  1LJO A;  1I07 A;  2E5Q A;  1X6O A;  2DRM A;  2NWM A;  3G7Z A;  4QW2 A;  4F7U F;  4NS5 A;  3EFO B;  1M1G A;  2DX1 A;  3CCR Q;  3HFN A;  2D0N A;  1RL2 A;  5FWC A;  1YHQ T;  5FRM A;  1QWF A;  3R6O A;  2DM1 A;  4JZ3 A;  2GFU A;  1WQW A;  2YXY A;  3IQL A;  3X25 B;  3OYC A;  5GAM j;  1X6B A;  1YHQ A;  2DL4 A;  4CC7 A;  1VQ4 T;  3X24 B;  2KRS A;  1K8A U;  2DK3 A;  1U8R A;  1VQN T;  2DEQ A;  3JRZ A;  1WX6 A;  2E65 A;  3JCM h;  3H8Z A;  1VQ4 A;  4IIO A;  4X1V A;  1SSF A;  1VQN A;  2FG0 A;  2B8A A;  4RKU E;  4M75 C;  1BI0 A;  1PKS A;  4A4F A;  2XI9 A;  1EIF A;  5LJ3 d;  1UB4 A;  5LJ5 h;  3OS2 A;  2PVD B;  2DYB A;  2FO0 A;  1VQ9 Q;  2CT4 A;  1NM7 A;  2YLC A;  2CP6 A;  3M0Q A;  1WIE A;  4ZN3 A;  4N0A A;  1G3Y A;  4M7D G;  3JB9 G;  3RMQ A;  1XOV A;  1BCO A;  1N5Z A;  1T3L A;  1OZ3 A;  1OPL A;  1UE9 A;  3P8D A;  2NUZ A;  2O88 A;  4PFO A;  2MPX C;  4JJB A;  1RAD B;  5HCK A;  2GTO A;  2HNI A;  4GBQ A;  2RJC A;  2QGF B;  3EFS A;  3EG1 A;  5GAN 4;  4JRI A;  1IB8 A;  3QPH A;  2MMP A;  4XTV A;  4C8Q C;  2KT8 A;  5CAI A;  1WJS A;  2LQ8 A;  5CKF A;  3V7C A;  2YDL A;  1KSW A;  3M55 A;  4J6W A;  1M1K C;  1Q86 C;  2JOY A;  1OZ2 A;  3A8L B;  4C5E A;  3NTI A;  3V7S A;  1MGQ A;  2RPN A;  1NJI U;  4HA8 A;  1E6G A;  2BTT A;  4J6X A;  1VQM T;  2XKO C;  2PU9 B;  3A8H B;  2LQW A;  1WI7 A;  3CCL Q;  4J9C A;  1VQM A;  1MMN A;  5GAM g;  4DQ2 A;  2QK0 A;  4E2F B;  1ARK A;  2QA4 T;  1SEM A;  2JS0 A;  1WXT A;  2OI3 A;  3PE0 A;  2L0A A;  1X6G A;  2L2P A;  1VQK Q;  5GAM e;  2ATC B;  2DL3 A;  2QA4 A;  1BK2 A;  2V8J A;  5I2M A;  3HHT B;  5CQY A;  1VQO Q;  3FC3 A;  1M5Q 1;  3L1A A;  3CBO A;  4ZN1 A;  1K0S A;  5A0L A;  3JV3 A;  4RTY A;  2CS7 A;  2WSE E;  4L6V 5;  1KQS P;  2HL5 C;  4M7D E;  2D6F A;  3LH0 A;  2X4J A;  1HJD A;  1RAE B;  4Z89 A;  2DPP B;  1YHQ Q;  1PM3 A;  4KRT A;  3PIP A;  5IXF A;  3JB9 I;  3OYK A;  5KH6 A;  2LC4 A;  3H0I A;  3OSV A;  3MHX A;  1KC8 U;  1B3Q A;  4QVZ A;  1TU0 B;  3SWN B;  3CPW S;  1VQN Q;  2K9G A;  3TCJ A;  5GAO p;  2RJF A;  2FYK A;  2MYS A;  4UC4 A;  2KI7 A;  2QQR A;  3I35 A;  1I1J A;  2JTF A;  2K6D A;  4RTU A;  1WPY A;  3P8B B;  2E6N A;  2KRM A;  2RN8 A;  3URG A;  4BB7 A;  2DO3 A;  3M54 A;  2W0Z A;  4C0D B;  2PVG B;  3R6N A;  3QZ5 B;  2LMJ A;  3U23 A;  2DF6 A;  1ZA2 B;  3PMI A;  1KD1 U;  1GBQ A;  1YJW T;  1OQK A;  3QUI A;  3V7R A;  5HK0 A;  2DBK A;  2FPD A;  3CCV T;  2CH4 A;  4PNO A;  1YJW A;  3EGD A;  2QDL A;  5GAM d;  4M75 G;  3CCV A;  2DVE A;  3JB9 F;  2F5T X;  4EMH A;  3KFV A;  4XK8 E;  4FSX A;  2ZPE B;  3ME9 A;  3CD6 T;  4IUR A;  4M7D D;  3RER A;  2QAZ A;  3CD6 A;  1IZ6 A;  1YWO A;  3TRE A;  2RQW A;  1X69 A;  1UEC A;  1QVG A;  1RAI B;  4FYX B;  4ELZ C;  2E41 A;  1PC0 A;  3VYG A;  3GIB A;  3UWN A;  1QVP A;  2QQ9 A;  3NHN A;  2GFA A;  3TVT A;  1GCQ C;  3V8J A;  1GXI E;  4ZNX A;  3PTA A;  2R58 A;  4J9E A;  1NPP A;  3QYH B;  2R57 A;  3RKY A;  2OTJ T;  1UUE A;  1QW1 A;  4C8Q G;  1WHL A;  1AVZ C;  3EGD B;  4FT4 A;  2BZ8 A;  2QA4 Q;  2OTJ A;  4XTY A;  1VQP T;  1AWJ A;  2RI3 A;  1JJ2 A;  1OU8 A;  2VGM A;  4HXJ A;  3PNW C;  2L3R A;  1MND A;  3CCE T;  3ZL7 C;  1VQP A;  2FL7 A;  2CUB A;  2P84 A;  2MF2 A;  4EMK A;  1M30 A;  5LJ3 f;  3MO8 A;  2QAS A;  3G71 T;  3JCM Q;  1JRI A;  2CP3 A;  2RQV A;  1TOV A;  2YRD A;  5KCO A;  3CMA Q;  5I11 A;  2K2V A;  1KIK A;  3MCA B;  2E3I A;  1Q95 G;  3G71 A;  1PWT A;  2MIO A;  4A4E A;  1E6H A;  1XQH A;  2E12 A;  2CT3 A;  2DER A;  3HL8 A;  4M75 E;  2LQK A;  3RMS A;  1WHG A;  1M1K U;  2RI5 A;  4IUP A;  3JAM E;  1Q86 U;  2LCS A;  1OEB A;  1UJY A;  3SFM A;  2IG0 A;  5GMK i;  1D1B A;  1W70 A;  1J3T A;  1Z9Q A;  2VUB A;  4PK4 A;  4KUL A;  4RMO A;  2P4R A;  3J81 E;  1SSH A;  4HVV A;  4KGZ B;  1Q81 R;  1JBM A;  1YWP A;  2EKH A;  3JCM V;  2EWN A;  4E7Z A;  2H3J A;  3OS5 A;  4JS5 A;  1FMV A;  4ZGD B;  3MJX A;  1UFF A;  4HCB A;  2AHJ B;  1MV3 A;  3MEV A;  4M7A A;  2A37 A;  4BY6 B;  1YJW Q;  2MK5 A;  2EYY A;  2DIL A;  2XU8 A;  1V1C A;  3VS7 A;  1U5S A;  2K7A A;  4C8Q E;  3OMC A;  4AT1 B;  3RKW A;  3M58 A;  1NLP C;  1UGV A;  1QKW A;  3M0U A;  1M8M A;  2P0Q A;  1PSE A;  2X35 A;  1JXO A;  1M90 C;  2LZ6 B;  2EJF A;  1YJ9 T;  2PQW A;  3ULR B;  1FXX A;  4FYW B;  4R56 A;  2L5Q A;  3EHR A;  1YJ9 A;  5CCA A;  5GAO n;  1M9S A;  2JXB A;  2C0O A;  5LJ3 h;  3CCR T;  4C92 A;  4M75 D;  1JO8 A;  5GJV B;  1IRX A;  4C92 E;  2FPE A;  3CCR A;  1TWB A;  1WYX A;  1BU1 A;  2EQI A;  4C0D C;  1Y0M A;  3BFM A;  4OMP A;  5J26 A;  3RUX A;  4AFZ C;  2JW4 A;  2KDS A;  1UG1 A;  2E10 A;  3CCU Q;  4QQ6 A;  3G4S T;  2EFI A;  3CCJ T;  4C8Q B;  1M2O A;  2DRK A;  2OTJ Q;  4TVR A;  2CP7 A;  2EVR A;  3G4S A;  2ZAE A;  2XID A;  2J06 A;  2OAW A;  4PLL A;  3CCJ A;  4GY5 A;  3SB2 A;  1G3W A;  2C0I A;  2EQJ A;  3ZBD A;  1H8K A;  1QKX A;  1K1Z A;  5GAO q;  4A63 B;  2EW3 A;  4JJN K;  3CCE Q;  2LNH B;  1K73 C;  2PVO B;  1HXD A;  3H0F A;  4E7I A;  5FWB A;  3JB9 H;  5KYX B;  3VS1 A;  3GPL A;  1QP3 A;  1N6A A;  1G83 A;  4PFP A;  4C8Q D;  4QQG A;  2AKK A;  4D8D A;  1I0C A;  4C92 B;  1TUG B;  4HVW A;  4XTX A;  3OW2 S;  4BI3 A;  2A36 A;  3EG3 A;  3X20 B;  1YBY A;  2DXT A;  3GOX A;  2RHI A;  4F16 A;  4JS4 A;  3CEY A;  1EZZ B;  1UTI A;  5GAM f;  3UAT A;  5FW9 A;  4HVU A;  5GAO m;  2KXC A;  4RTX A;  4KGX B;  2X4X A;  3VUB A;  1NEB A;  3RDV A;  4C92 D;  1Y71 A;  4A53 A;  3AT1 B;  4NL3 A;  5KE2 A;  2EQM A;  2RD1 A;  3FEO A;  4GLK A;  3CXC A;  1X2Q A;  2DE0 X;  4PJO F;  2EYX A;  1NYG A;  2LX9 A;  1KJW A;  5CK9 A;  5GAN j;  2QQS A;  2KXD A;  1UJ0 A;  4LE9 A;  2K3X A;  3O5Z A;  1IRE B;  3CCL T;  1M3A A;  5GAN 2;  2WAC A;  2D8H A;  2IIM A;  2Y4X A;  3CCL A;  4CRI A;  3RKX A;  1QVG P;  3HRT A;  4ANJ A;  2RK1 A;  4CC2 A;  1XTD A;  2GNC A;  2MAM A;  4ELY C;  9ATC B;  4C5H A;  3MPU B;  2LCL A;  1ZLM A;  1C1A A;  3H6Z A;  1VQK A;  1VQO T;  1X43 A;  1MNE A;  2DIQ A;  1ZBJ A;  3EG0 A;  3VYH B;  3QDF A;  5AT1 B;  1GCQ A;  3CPF A;  1YJ9 Q;  3BE3 A;  2W10 A;  1VQO A;  2CRE A;  3VS0 A;  5FLX E;  2JNG A;  3M5A A;  1ZSG A;  2CP2 A;  3E1S A;  4XU3 A;  2CSQ A;  1ZBX A;  4FT2 A;  1BBZ A;  2E3H A;  1SHG A;  1JJ2 P;  5GAO l;  2XHC A;  1TTH B;  3VJP A;  1Y7X A;  2NUP A;  2EBP A;  1VYT A;  2HBP A;  2LQN A;  3I56 T;  2LJ0 A;  3LLR A;  2RI2 A;  4OMN A;  1B34 A;  2GQI A;  4IUV A;  2EGC A;  3I56 A;  4EMK C;  1RUW A;  4DBH A;  1QVG S;  3LGL A;  1D0Y A;  2DTH A;  3OYN A;  2GF7 A;  4J9D A;  3L2V A;  2K5L A;  3G4S Q;  2QQA A;  4BY6 C;  1GBR A;  2LX7 A;  3CCJ Q;  4JZ4 A;  1RLQ C;  2OJ2 A;  4PFZ A;  1I81 A;  1V76 A;  2JTE A;  2RQU A;  2JN0 A;  1OI1 A;  3KUF A;  2CGH A;  1N8R C;  2DL5 A;  1MMG A;  1VQ8 Q;  3PGG A;  4N4I A;  4X9C A;  2LNV A;  3MEU A;  1UGR B;  4XU0 A;  1WZO A;  2ZPB B;  3H0H A;  4L59 A;  5LJ5 j;  1W2B P;  1M90 U;  3OYE A;  3CCS Q;  4IKF A;  2CH4 W;  4XQ3 A;  2R5A A;  4FYV B;  1YJN Q;  1PD0 A;  5GAN g;  3LWH A;  3S3M A;  2NUP B;  3C4S A;  5D7U A;  2QTX A;  1YNZ A;  2CUD A;  4AFQ C;  5GAN e;  1WFW A;  1ACM B;  1B34 B;  2F69 A;  4JRK A;  4OMF B;  1YCY A;  4OB2 B;  1K9M C;  3UDC A;  2KMT A;  1UGS B;  2FZK B;  4ESR A;  4PL6 A;  4M7A C;  1WHH A;  3E19 A;  2LT1 A;  1QVF A;  3A8M B;  5CVI A;  2VVK A;  2OAU A;  1T0J A;  4C0G A;  3J7A F;  1BB9 A;  2O01 E;  2X9H A;  4BD3 A;  1RI0 A;  1JU5 C;  1WHJ A;  4D6W A;  2FB7 A;  1X2K A;  2HCK A;  2JVV A;  5DLO A;  5DLQ E;  1FWZ A;  4Z8A A;  3WVE B;  5GMK h;  2V1Q A;  2BE9 B;  2YRV A;  4MZM A;  1U06 A;  4FW2 A;  4J7I A;  2KGT A;  5GAN 3;  4QVD A;  1K73 U;  3OYY A;  2QG9 B;  4QVC A;  1Q7Y U;  4C92 C;  3VS3 A;  1TXQ A;  4A4H A;  1RAG B;  1KG1 A;  2RH2 A;  4RUG A;  4X34 A;  2M51 A;  2PUO B;  2EQU A;  2KBT A;  3EH1 A;  1K8A R;  2RHU A;  4BE2 A;  2ZPF B;  4FCY A;  2ABL A;  3JCM g;  3BDL A;  2H3E B;  3EG9 A;  3QYG B;  5DM7 R;  4MZT A;  3CMA T;  3OYF A;  2M9U A;  4HT8 A;  3GP8 A;  1YN8 A;  3OS1 A;  2FZC B;  3HRU A;  3CMA A;  2KK4 A;  2P4T A;  1D3B A;  3SD4 A;  4LDU A;  3OMG A;  2V1R A;  5LJ5 g;  3I56 Q;  2F2V A;  1AWW A;  2LRQ A;  4JDS A;  3I5R A;  1XNI A;  3JCM c;  1G3S A;  4J9H A;  2SRC A;  4M77 C;  5LJ5 e;  2JM8 A;  3HP9 A;  4MML A;  4DBF A;  2VXE A;  1IGQ A;  3ASK A;  1UDL A;  2DA9 A;  4OGC A;  3KBG A;  3HRS A;  4QT7 A;  3QWX X;  1WJQ A;  5KYW A;  1JXM A;  1O75 A;  4AFU C;  2MOX A;  3VS4 A;  2QTV A;  1KQS S;  3DKM A;  4C5G A;  5D6Y A;  1OYX A;  3BDU A;  3EG9 B;  3L42 A;  2KRN A;  2ROL A;  1UGP B;  1NYF A;  2NUT A;  5IHK A;  2VC8 A;  4A4K A;  3MP8 A;  1D3B B;  2RQT A;  2BZY A;  3C12 A;  3CXC P;  2XMF A;  3CQT A;  2L3P A;  8ATC B;  4MMK A;  1F1B B;  5GAN 8;  4M7D F;  1NJI R;  1SPK A;  2KYM A;  1Q82 C;  5HY6 A;  1D09 B;  5KCH A;  2CP0 A;  2F1L A;  1YFN A;  2KR3 A;  5EC7 A;  2DNU A;  3L2Z A;  1U1T A;  4LXC A;  5CKE A;  3PVQ A;  3M9Q A;  3M53 A;  4E7S A;  1KHI A;  1V29 B;  2AKL A;  3E9G A;  4XTW A;  2ZGW A;  1VQ5 T;  3HKS A;  2JMC A;  2P0P A;  2ENM A;  4LDX A;  4BDZ A;  1OPK A;  3UPU A;  5KYW B;  1M2V A;  3THK A;  1YIJ T;  3VU3 C;  2AIR B;  3QG1 A;  3DB4 A;  1YI2 T;  2M1H A;  2PNI A;  2YUP A;  4FYY B;  4NL2 A;  2DAQ A;  2O4X A;  4J9B A;  3QKJ A;  3CCU T;  1N8R U;  5L8R E;  2HD0 A;  3QO3 A;  3I55 T;  2CP5 A;  1NEG A;  3CXC S;  2RK2 A;  5HKC A;  4IUT A;  3L2U A;  4M7A G;  4OMQ A;  2NLU A;  2RNA A;  2GTJ A;  3CCU A;  4LDY A;  5CIU A;  2CZ0 B;  4LUD A;  3I55 A;  2QEX Q;  3GBQ A;  3LH5 A;  3CCM T;  3VKI A;  4NOY A;  2O9V A;  1VQ7 Q;  1TSF A;  1BCM A;  4HCC A;  5FU6 C;  1KC8 R;  2YHT A;  1W1F A;  1PNJ A;  2RHZ A;  4OP0 A;  3MET A;  1GFD A;  2DD5 A;  3KXT A;  1AZE A;  1IO6 A;  1PKT A;  3CCE A;  4HT9 A;  1K9M U;  2K3B A;  2D8J A;  2QI2 A;  5KYY A;  3EGX A;  4YTL A;  3OBY A;  4ATO A;  2DXB A;  2Y4Y A;  1ZUK A;  4C92 G;  1R0B G;  2HSP A;  1M2V B;  2LDM A;  1JB0 E;  4OMO A;  3OSS C;  3OYI A;  1R0C B;  3UA7 A;  2WSF E;  4J83 A;  3N5B B;  1KD1 R;  3NTK A;  4RCB A;  1LNX A;  3TSW A;  2O4X B;  1ZSZ A;  1E7O A;  4R55 A;  2AZV A;  1EFN A;  3C0C A;  4E6R A;  4OGE A;  5IN1 A;  3BY7 A;  4JRP A;  2LJ3 A;  3D7S B;  2EQK A;  1TUD A;  4WCI A;  2MCN A;  1W2B A;  3UA6 A;  5A0G A;  4DBR A;  2KNB B;  5J39 A;  3QII A;  2E5K A;  4PJM A;  1M8V A;  1Z9Z A;  4X9D A;  3M56 A;  3M57 A;  4HCZ A;  2HMA A;  5GAN 5;  2ECZ A;  1ZUU A;  1QLY A;  4EMK B;  2KY9 A;  1TH7 A;  1WNL A;  4OVA A;  3OA6 A;  2XDB A;  3H41 A;  4AG1 C;  4RCC A;  1QVF P;  2COW A;  2DVJ A;  3A1P A;  1W4S A;  5KYY B;  1HK9 A;  4M7A E;  1A0N B;  2X51 A;  3G6E T;  2DZ9 A;  4OML A;  2ESW A;  2FEI A;  4P5N A;  4E7J A;  4LNP A;  4FSS A;  3OYM A;  1S72 Q;  2YUN A;  4J9I A;  3PFS A;  5CR2 A;  4BI4 A;  2QGG A;  1ZSZ B;  1IHW A;  2YUO A;  5C6S A;  1M3C A;  4M75 F;  2JMA A;  5A0D A;  3FIF A;  2FRW A;  3QJ6 A;  1RLP C;  2EIF A;  3JSC A;  2FPF A;  4DEY A;  2XD0 A;  3SEM A;  1QMC A;  3I9Q A;  3VRY A;  1VQ5 Q;  3CC7 T;  1B7T A;  2EPD A;  4F7U G;  1QVF S;  2ROT A;  3TQ7 P;  2L3S A;  3CC7 A;  2DXC A;  3CC2 Q;  4JLG A;  1YIJ Q;  1YI2 Q;  1QCF A;  3A98 A;  4KT0 E;  3NGP A;  5IT9 E;  4M7A B;  2ZZD A;  4RTW A;  3JCM P;  3I55 Q;  1WHM A;  1VUB A;  3VRZ A;  3UT1 A;  1M4Z A;  3CME T;  3REA B;  2RB6 A;  3CPW A;  4EMG A;  1KFZ A;  1KQ1 A;  2KQW A;  2QDY B;  2BZX A;  4J9G A;  3CCM Q;  1YP5 A;  1M27 C;  4OB1 B;  1M1K R;  5L23 A;  1Q86 R;  1VQ8 T;  3S6W A;  2F2W A;  4Y28 E;  3L2Q A;  1YIT Q;  1IXD A;  4M78 A;  4N4G A;  4C8Q F;  4WTO B;  2K5I A;  3FRN A;  1TS9 A;  4PJO A;  4M78 E;  1VQ8 A;  1CKA A;  4M77 A;  2YUQ A;  1Q82 U;  2HBW A;  2A08 A;  4M7A D;  4PJO E;  3CCS T;  2YLB A;  2HKN A;  2HQE A;  4M77 E;  2RHX A;  4XU2 A;  1YJN T;  3JCM J;  1C6V X;  1VIF A;  2V8K A;  1BKB A;  3CCS A;  2X3X D;  1SHF A;  1TG0 A;  1YJN A;  4BE1 A;  3FLG A;  3OYA A;  3VS2 A;  1ZHI A;  1TUC A;  2A3L A;  4C92 F;  3M0T A;  4F04 B;  4FM4 B;  3V8K A;  1H64 1;  3HTR A;  5FRO A;  2M16 A;  5IXB A;  2EYW A;  2AZS A;  5IAY A;  1K9A A;  4ZTJ A;  5KYN A;  4F7U A;  2VKN A;  2BE7 D;  2RM4 A;  3HSB A;  4M78 B;  4F7U E;  3OYJ A;  1QCN A;  1UEB A;  2VAS A;  4PJO B;  2LT4 A;  3EAE A;  3VS6 A;  1OU9 A;  4M77 B;  3QBY A;  2GCX A;  2D0Q B;  3EFO A;  5LJ3 g;  1CSK A;  2D1X A;  5LJ5 f;  2LVM A;  1WLP B;  4JJD A;  4PLI A;  2A28 A;  2M0O A;  1RAF B;  2VWF A;  2I2L A;  3LW5 E;  4BAC A;  2KVQ G;  3WXM B;  1VYV A;  3G6E Q;  1LOJ A;  1OX8 A;  2GBQ A;  3AHU A;  3PIO A;  3QDR B;  1B07 A;  3OYD A;  1PSF A;  1G3T A;  3FJ5 A;  3NMZ C;  4M78 D;  5CKD A;  3C94 A;  1IHV A;  3X28 B;  4M77 D;  4DEX A;  2K5F A;  4OF1 A;  4CC3 A;  4A54 A;  2D9T A;  3EGU A;  3LGF A;  4J5Y A;  1NZ9 A;  2PTK A;  3JCM W;  2KEA A;  5DY9 A;  1QP2 A;  3S3N A;  3X26 B;  4F7U B;  3CC7 Q;  2IPO B;  3OYH A;  2VYT A;  1AHJ B;  1HYO A;  1NLO C;  1BYM A;  2GGR A;  5AYF A;  1AEY A;  4D8K A;  2J05 A;  3QXE B;  5J3B A;  1SRL A;  4LD6 A;  4O5V A;  1YCS B;  3FB9 A;  5GAM h;  1LPL A;  1Q81 C;  1FMK A;  2KE9 A;  2XK0 A;  2G3R A;  3CME Q;  4PJL A;  3BW1 A;  1WHK A;  4IUU A;  5EG2 A;  5C0M A;  1Y57 A;  2K79 A;  2WSC E;  3QZ9 B;  3GF5 A;  1G2B A;  4Y91 A;  1ZSZ C;  1H3Z A;  1VIE A;  2DJZ A;  2KT1 A;  1JJ2 S;  4RTZ A;  4HKE A;  3WVD B;  3OBW A;  3E2U A;  5KYU A;  1WA7 A;  1GRI A;  1X01 A;  3JCM b;  3J80 E;  2DL8 A;  2HZY A;  3L2W A;  2M0Y A;  1T3S A;  3FJP A;  2E1H A;  1OX9 A;  2COY A;  2J6O A;  2DBM A;  5FU6 B;  1ZX6 A;  3TSZ A;  1NG2 A;  2X4Y A;  2EGE A;  1N27 A;  4AG2 C;  3VV0 A;  1QWE A;  2EYZ A;  2GQV A;  5I22 A;  3SDZ A;  4DOV A;  2K2M A;  2HSE B;  1IGU A;  5HK3 A;  4LN2 A;  1JQQ A;  4V2S A;  5D6X A;  3ZFJ A;  4RG8 A;  3OYB A;  4K11 A;  2YT6 A;  2JTM A;  2VB6 A;  1R77 A;  3F70 A;  4LD9 K;  1G8X A;  3CC4 T;  3EHQ A;  4LDW A;  2H8H A;  1X75 C;  5I21 A;  3OY9 A;  3RR6 A;  1W2B S;  1BI3 A;  1BI2 A;  1O9S A;  2M02 A;  3CC4 A;  3REB B;  2ED0 A;  1XJW B;  3A8G B;  3I5S A;  3EH2 A;  1CKB A;  2FZG B;  1MV0 B;  5KYU B;  4FIB A;  2MWO A;  3OS0 A;  2DYI A;  4J6Y A;  1WGS A;  1AD5 A;  5GMK j;  1VOM A;  2QEX T;  3INZ A;  3L2R A;  2RJD A;  3V8L A;  3PT9 A;  3O8V A;  1VQ7 T;  1ABO A;  4JUV A;  5LL6 S;  2G6F X;  2QEX A;  2QXF A;  2JM9 A;  4BI8 B;  2VV5 A;  3GNF B;  1VQ7 A;  3SWN A;  2Y90 A;  2XDD A;  5GAN 6;  4LDV A;  2OTL Q;  4AMC A;  3HFO A;  1HSQ A;  5I2S A;  1MHN A;  3CPW P;  1VYU A;  1K4U S;  1GL5 A;  2ZPG B;  3JCM e;  3LYI A;  4ME7 A;  2EJG A;  3ER0 A;  1C0M A;  4KGV B;  4PKC C;  5FU7 B;  5ECA A; 
#chains in the Genus database with same CATH homology
 5GAN d;  3C95 A;  4OP0 A;  1YHQ T;  4C8Q B;  4IUQ A;  3MET A;  5FRM A;  3R6O A;  2FHD A;  2DD5 A;  4TVR A;  3FDR A;  3KXT A;  3VUZ A;  3CCE A;  4M78 C;  2GFU A;  1WQW A;  1N9R A;  3OYC A;  2XID A;  3X25 B;  5M9O A;  3G4S A;  4PLL A;  5GAM j;  3CCJ A;  3OW2 A;  1K9M U;  4HT9 A;  4M7D A;  4GY5 A;  3SB2 A;  1YHQ A;  1G3W A;  4PJO C;  2QI2 A;  3S3O A;  1VQ4 T;  2EQJ A;  5GAO r;  4YTL A;  3ZBD A;  3OBY A;  3X24 B;  1K8A U;  1ZQ1 A;  2DK3 A;  3RIR A;  1U8R A;  1VQN T;  2DXB A;  2EAY A;  2DEQ A;  2Y4Y A;  4ATO A;  5GAO q;  3JRZ A;  2E65 A;  3OQ5 A;  4Z02 A;  4C92 G;  3JCM h;  4JJN K;  3H8Z A;  1VQ4 A;  1K73 C;  2PVO B;  1HXD A;  2LDM A;  1JB0 E;  1SSF A;  2MI6 A;  3OSS C;  4ZGE B;  4E7I A;  1VQN A;  3OYI A;  3HPW A;  2EKO A;  3T9N A;  3JB9 H;  2B8A A;  4RKU E;  1I4K 1;  2WSF E;  4J83 A;  3N5B B;  4M75 C;  2DKG A;  3GPL A;  1BI0 A;  1QP3 A;  3NTK A;  4RCB A;  1LNX A;  1N6A A;  2O4X B;  4A4F A;  4C8Q D;  4QQG A;  3Q1J A;  4R55 A;  2XI9 A;  1EIF A;  5LJ3 d;  4B9X A;  4C92 B;  1I5L A;  4OGE A;  5IN1 A;  3BY7 A;  1UB4 A;  5A2Q E;  4XTX A;  5LJ5 h;  4JRP A;  3OS2 A;  2PVD B;  3OW2 S;  2EQK A;  4BI3 A;  3X20 B;  2YLC A;  1W2B A;  3MEW A;  5A0G A;  1YBY A;  2DXT A;  3M4Y A;  3GOX A;  3MP1 A;  2RHI A;  4ZN3 A;  4XTZ A;  4N0A A;  1G3Y A;  3CEY A;  4JS4 A;  5J39 A;  3QII A;  4M7D G;  5GAM f;  3JB9 G;  1M8V A;  4X9D A;  3M56 A;  3M57 A;  3MP6 A;  4HCZ A;  3RMQ A;  5GAO m;  1XOV A;  5GAN 5;  1BIB A;  1OZ3 A;  2KY9 A;  2X4X A;  3P8D A;  4XU1 A;  4EMK B;  1TH7 A;  2LCC A;  1WNL A;  4OVA A;  1S72 T;  3VUB A;  3OA6 A;  2XDB A;  4C92 D;  4RCC A;  1Y71 A;  2DXU A;  4M7D B;  4A53 A;  1W4S A;  1S72 A;  4NL3 A;  2DTI A;  2HNI A;  1HK9 A;  5KE2 A;  2EQM A;  2RJC A;  2RD1 A;  4M7A E;  3FEO A;  4GLK A;  3CXC A;  3G6E T;  3EFS A;  2DZ9 A;  4FU6 A;  4PJO F;  5GMK e;  5GAN 4;  2LX9 A;  4JRI A;  3QPH A;  4P5N A;  1N9S A;  5CK9 A;  3JCM d;  3MEA A;  4E7J A;  5GAN j;  2QQS A;  2MMP A;  4XTV A;  2P0K A;  3E9F A;  4C8Q C;  3OYM A;  2K3X A;  3A5Z B;  5CAI A;  1IRE B;  3CCL T;  1WJS A;  2LQ8 A;  1WJR A;  3OB9 A;  3PFS A;  5CR2 A;  5GAN 2;  5CKF A;  3V7C A;  4BI4 A;  1Q81 U;  2WAC A;  3M55 A;  1P92 A;  4J6W A;  1M1K C;  2Y4X A;  5C6S A;  1Q86 C;  2JOY A;  4M75 F;  1OZ2 A;  3RKX A;  4CRI A;  1VQ5 A;  3CCL A;  3HRT A;  3LX7 A;  3CC2 T;  2RK1 A;  3A8L B;  2DIG A;  4C5E A;  3NTI A;  5A0D A;  3V7S A;  1MGQ A;  2KSS A;  3FIF A;  3JB9 D;  5LJ5 d;  1NJI U;  4HA8 A;  2IVW A;  3QJ6 A;  4J6X A;  1XTD A;  2EIF A;  3JSC A;  4C0F A;  1VQM T;  2HQX A;  2MAM A;  4JRQ A;  4ELY C;  2XD0 A;  3CC2 A;  1G5V A;  4C5H A;  2XKO C;  2PU9 B;  2LCL A;  3GNG A;  3A8H B;  1YIJ A;  1YI2 A;  3H6Z A;  1VQK A;  1VQO T;  3CC7 T;  2DIQ A;  3VYH B;  1VQM A;  4C5I A;  2K57 A;  4F7U G;  5GAM g;  4L5G A;  4DQ2 A;  1QVF S;  3CPF A;  2QA4 T;  1VQ6 T;  1NPR A;  1VQO A;  3CC7 A;  2DXC A;  5FLX E;  2JNG A;  3M5A A;  4JLG A;  3E1S A;  4XU3 A;  4FT2 A;  1ZBX A;  2CYZ B;  2CZ7 B;  3CBM A;  5GAM e;  1UGQ B;  4KT0 E;  2QA4 A;  1YIT T;  1VQ6 A;  1BIA A;  5IT9 E;  3CCM A;  4M7A B;  5GAO l;  2K4Y A;  2XHC A;  2ZZD A;  2V8J A;  3TEE A;  3JCM P;  5I2M A;  1VUB A;  3VJP A;  1Y7X A;  3HHT B;  5CQY A;  3UT1 A;  3FC3 A;  1M5Q 1;  2HBP A;  3I56 T;  1YIT A;  1M4Z A;  2DD4 A;  2C06 A;  3L1A A;  3CME T;  4C0Z A;  3CBO A;  2RB6 A;  3LLR A;  4ZN1 A;  4EMG A;  2RI2 A;  3CPW A;  5A0L A;  5D6W A;  1B34 A;  4IUV A;  1KQ1 A;  2CS7 A;  2KQW A;  2QDY B;  2WSE E;  3I56 A;  4L6V 5;  4EMK C;  4OB1 B;  1QVG S;  3LGL A;  4M7D E;  1VQ8 T;  2D6F A;  3S6W A;  2DTH A;  4Q5W A;  4Y28 E;  3L2Q A;  3LH0 A;  3OYN A;  4M78 A;  2GF7 A;  4N4G A;  2X4J A;  4C8Q F;  3QSU A;  3L2V A;  2K5I A;  2K5L A;  2QQA A;  4BY6 C;  2MWP A;  3FRN A;  2XIC A;  4PJO A;  4E7L A;  4M78 E;  1VQ8 A;  2DPP B;  4M77 A;  4MZP A;  1Q82 U;  1VQL T;  3PIP A;  1I81 A;  4M7A D;  3JB9 I;  3CCS T;  4PJO E;  2YLB A;  3OYK A;  5KH6 A;  2HQE A;  2LC4 A;  4M77 E;  3DLM A;  2HAX A;  2RHX A;  3A8O B;  3OSV A;  4XU2 A;  1YJN T;  2JN0 A;  3JCM J;  3MHX A;  1KC8 U;  1VQL A;  1VIF A;  4EPC A;  2V8K A;  1OI1 A;  3KUF A;  1BKB A;  3NFC A;  2CGH A;  4II1 A;  4QVZ A;  3JCM X;  3CCS A;  3P8H A;  1N8R C;  3SWN B;  3PGG A;  4N4I A;  4X9C A;  3CPW S;  2LNV A;  1KQ2 A;  3MEU A;  1UGR B;  2A7Y A;  4M75 A;  1YJN A;  3TCJ A;  5GAO p;  1M1F A;  4XU0 A;  2RJF A;  4BE1 A;  2FYK A;  2CZ1 B;  2ZPB B;  2L8D A;  3FLG A;  3OYA A;  4L59 A;  4UC4 A;  2QQR A;  3DLL A;  3CCJ T;  1ZHI A;  2JTF A;  5LJ5 j;  1M90 U;  2E6Z A;  3OYE A;  4BDY A;  2A3L A;  4O6J A;  4IKF A;  4C92 F;  1WPY A;  3P8B B;  2E6N A;  4XQ3 A;  3URG A;  2R5A A;  2PUK B;  4BB7 A;  5GAN g;  2DO3 A;  4MDW A;  3M54 A;  4FM4 B;  3RES A;  3LWH A;  4DOW A;  4N0A C;  3V8K A;  3S3M A;  1H64 1;  4M78 G;  4C0D B;  5FRO A;  2M16 A;  2PVG B;  3C4S A;  2QTX A;  1R8O B;  3QZ5 B;  3OYG A;  4PJO G;  5GAN e;  3PMI A;  4M77 G;  3CBP A;  1KD1 U;  1B34 B;  2F69 A;  4JRK A;  4OMF B;  1YJW T;  3QUI A;  1YCY A;  4OB2 B;  5IAY A;  3V7R A;  4ZTJ A;  1K9M C;  5HK0 A;  3UDC A;  2KMT A;  4F7U A;  1UGS B;  3CCV T;  2RM4 A;  4PNO A;  3HSB A;  4M78 B;  1YJW A;  4PL6 A;  4F7U E;  1K8A C;  3OYJ A;  4M7A C;  1UEB A;  5GAM d;  3E19 A;  2LT1 A;  5FU7 C;  4PJO B;  2LT4 A;  3EAE A;  4ZGJ B;  4M75 G;  3CCV A;  1QVF A;  4M77 B;  2DVE A;  3A8M B;  5CVI A;  3QBY A;  3G6E A;  2DTO A;  2OAU A;  2DZC A;  3JB9 F;  2E64 A;  2F5T X;  4EMH A;  4C0G A;  2GCX A;  2O01 E;  4N4H A;  3J7A F;  4XTU A;  2D0Q B;  4BD3 A;  1RI0 A;  5LJ3 g;  4XK8 E;  4FSX A;  1FX7 A;  5LJ5 f;  2LVM A;  5GMK m;  2ZPE B;  4PLI A;  3ME9 A;  2M0O A;  3CD6 T;  4C8Q A;  2I2L A;  3LW5 E;  4BAC A;  1BI1 A;  2KVQ G;  3WXM B;  4IUR A;  4M7D D;  4D6W A;  3RER A;  2EYQ A;  1LOJ A;  2FB7 A;  4M75 B;  4B9W A;  2JVV A;  2ZCF B;  1Y96 A;  2RA2 A;  5DLO A;  3AHU A;  3PIO A;  5DLQ E;  3CCQ T;  1FWZ A;  3CD6 A;  3WVE B;  3QDR B;  5GMK h;  1IZ6 A;  3OYD A;  1PSF A;  1G3T A;  2YRV A;  4MZM A;  3TRE A;  4M78 D;  4E7K A;  5CKD A;  4J7I A;  5GAN 3;  4QVD A;  1K73 U;  4J8O A;  4DA4 A;  3CCQ A;  2XG8 D;  3C94 A;  3OYY A;  1QVG A;  4QVC A;  3X28 B;  4M77 D;  5LJ3 j;  2ZPI B;  2K5F A;  1Q7Y U;  2RHY A;  2E41 A;  4ELZ C;  4OF1 A;  3VYG A;  3GIB A;  4C92 C;  3UWN A;  4A54 A;  2D9T A;  4JLI A;  3LGF A;  1QVP A;  4A4H A;  3OYL A;  3SWN C;  4J5Y A;  1KG1 A;  2QQ9 A;  1WQ7 A;  2RH2 A;  1NZ9 A;  4X34 A;  5GAN f;  2GFA A;  1NE8 A;  2PUO B;  3V8J A;  3JCM W;  5DY9 A;  3PMT A;  1GXI E;  2EQU A;  3EFR A;  2VXF A;  1QP2 A;  2L89 A;  3PTA A;  2R58 A;  3S3N A;  2RHU A;  1NPP A;  2EJ9 A;  4BE2 A;  3X26 B;  3QYH B;  4F7U B;  2R57 A;  3RKY A;  3LWI A;  2OTJ T;  2ZPF B;  3OYH A;  4ZTF A;  2VYT A;  1AHJ B;  1QW1 A;  3JCM g;  4BUG A;  3BDL A;  2OTL A;  4C8Q G;  3QYG B;  1BYM A;  5DM7 R;  4MZT A;  2RO0 A;  4FT4 A;  3CMA T;  3OYF A;  2OTJ A;  2M9U A;  4XTY A;  5AYF A;  1VQP T;  2RI3 A;  1JJ2 A;  2JUF A;  3GP8 A;  4HT8 A;  2BKD N;  3CME A;  4M7A F;  3OS1 A;  5GAN 7;  2VGM A;  3HRU A;  3PNW C;  2L3R A;  3QXE B;  4O5V A;  4LD6 A;  4OB3 B;  4WF2 A;  2KK4 A;  2P4T A;  1I8F A;  1D3B A;  3CMA A;  3SD4 A;  3CCE T;  3FB9 A;  1VQP A;  4M7D C;  2FL7 A;  4LDU A;  5GAM h;  3OMG A;  4KUD K;  2MF2 A;  1Q81 C;  4EMK A;  5LJ5 g;  5LJ3 f;  3MO8 A;  2LRQ A;  2XK0 A;  2G3R A;  4JDS A;  3G71 T;  3BW1 A;  1Y96 B;  1KQS A;  1XNI A;  3JCM c;  3JCM Q;  1G3S A;  4IUU A;  1JRI A;  5EG2 A;  5KCO A;  1NJI C;  2K2V A;  4M77 C;  5LJ5 e;  3HP9 A;  5GMK l;  4MML A;  4E7H A;  2CZ6 B;  3MCA B;  2VXE A;  5C0M A;  2WSC E;  3G71 A;  2FVU A;  3QZ9 B;  3ASK A;  4A4E A;  3GF5 A;  1XQH A;  4OB0 B;  1VQ9 T;  4Y91 A;  1H3Z A;  2E12 A;  1VIE A;  3KBG A;  2VGN A;  2DJZ A;  3M4G A;  4OGC A;  1JJ2 S;  3HL8 A;  4M75 E;  3HRS A;  2LQK A;  3GLX A;  4HKE A;  4RG2 A;  1Q7Y C;  3RMS A;  3OBW A;  3WVD B;  3JB9 J;  2JZ2 A;  1VQ9 A;  4MDX A;  5CKH A;  1X01 A;  3JCM b;  2RI5 A;  4IUP A;  3JAM E;  3J80 E;  1Q86 U;  1M1K U;  1WJQ A;  3L2W A;  3SFM A;  1Y07 A;  1O75 A;  1RL2 A;  2IG0 A;  2ZPH B;  4XAX B;  3FJP A;  2E1H A;  5GMK i;  2RJE A;  1KQS S;  3DKM A;  4C5G A;  4FL6 A;  1OYX A;  3BDU A;  5D6Y A;  2VUB A;  5FU6 B;  3L42 A;  4KUL A;  5FRN A;  4QQD A;  4RMO A;  2X4Y A;  3M59 A;  1N27 A;  3J81 E;  1UGP B;  2CKK A;  3QJY A;  3JCM f;  2VC8 A;  4A4K A;  3MP8 A;  2QQB A;  1JBM A;  3VV0 A;  4KBM B;  3JCM V;  1D3B B;  3C12 A;  2EWN A;  2GQV A;  3ZEH A;  3SDZ A;  4DOV A;  4CI0 C;  2H3J A;  3OS5 A;  4JS5 A;  4MMK A;  5GAN 8;  4M7D F;  4ZGD B;  2KAF A;  3TU4 K;  2X4W A;  4HCB A;  5HK3 A;  2AHJ B;  1Q82 C;  5D6X A;  4V2S A;  3MEV A;  3ZFJ A;  4RG8 A;  3OYB A;  5HY6 A;  5J3B A;  3NTH A;  4M7A A;  2JTM A;  4LD9 K;  3F70 A;  4BY6 B;  2R5M A;  5KCH A;  5GAN h;  2XDP A;  4M78 F;  3CC4 T;  2XU8 A;  4LDW A;  1X75 C;  5I21 A;  1KC8 C;  3OY9 A;  3L2Z A;  1U1T A;  1BI3 A;  1DJ7 B;  1W2B S;  1BI2 A;  5LJ3 e;  4M77 F;  5CKE A;  4C8Q E;  3M9Q A;  1O9S A;  4EDU A;  3OMC A;  3CC4 A;  3M53 A;  1KHI A;  1V29 B;  3A8G B;  4J7F A;  4KUI A;  3E9G A;  4VUB A;  4XTW A;  3RKW A;  2ZGW A;  4FIB A;  3M58 A;  3HKS A;  1VQ5 T;  2LTO A;  2MWO A;  2P0P A;  3OS0 A;  2BUD A;  2P0Q A;  1PSE A;  4E47 A;  4J6Y A;  1WGS A;  2X35 A;  1M90 C;  4PJO D;  2OTL T;  4LDX A;  5GMK j;  2EJF A;  4BDZ A;  2V8I A;  2QEX T;  3UPU A;  3INZ A;  1YJ9 T;  3L2R A;  2PQW A;  2RJD A;  1FXX A;  5KE3 A;  3V8L A;  3PT9 A;  3O8V A;  4R56 A;  1YIJ T;  1VQ7 T;  3VU3 C;  3QG1 A;  5CO7 A;  3DB4 A;  4JUV A;  5LL6 S;  4A4G A;  1YI2 T;  2L5Q A;  2M1H A;  1VQK T;  5CQX A;  2QEX A;  2QXF A;  3DB3 A;  1YJ9 A;  2DAQ A;  4NL2 A;  2O4X A;  4BI8 B;  3QKJ A;  5CCA A;  1M9S A;  5GAO n;  3QHS A;  2VV5 A;  5LJ3 h;  3GNF B;  3CCR T;  3CCU T;  1N8R U;  5L8R E;  1VQ7 A;  2E70 A;  2HD0 A;  3QO3 A;  4C92 A;  3I55 T;  3CXC S;  2RK2 A;  4M75 D;  5HKC A;  1KD1 C;  4IUT A;  3L2U A;  3SWN A;  4M7A G;  2F5K A;  2NLU A;  2Y90 A;  2XDD A;  5GAN 6;  4C92 E;  3CCU A;  2BIV A;  4LDV A;  5CKB A;  3CCR A;  4LDY A;  5CIU A;  2CZ0 B;  1U1S A;  2K3Y A;  3HFO A;  3I55 A;  4BE0 A;  5I2S A;  3CCM T;  3VKI A;  4NOY A;  1MHN A;  4C0D C;  1KHC A;  1LJO A;  3BFM A;  2E5Q A;  1X6O A;  2ZPG B;  3G7Z A;  3JCM e;  4HCC A;  5J26 A;  5FU6 C;  3RUX A;  4QW2 A;  2KDS A;  4F7U F;  3LYI A;  4NS5 A;  2YHT A;  2E10 A;  4ME7 A;  2EJG A;  3ER0 A;  4QQ6 A;  1M1G A;  3G4S T;  3HFN A;  2EFI A;  4PKC C;  2RHZ A;  5FU7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...