3N5BB

The complex of pii and pipx from anabaena
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
molecule keywords Nitrogen regulatory protein P-II
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3n5bB01
2XG8D 2XKOC 3N5BB
chains in the Genus database with same CATH superfamily
3VS2A 3VYGA 4C8QB 4XTXA 4EMKA 5KYUB 2LT1A 1VQ6T 4E7JA 1VQ5A 4TVRA 2DZ9A 2JJ9A 3OSSC 3CCJT 3MEWA 3VYHB 1B07A 5A0GA 2EBPA 2D1XA 2PVDB 3ZBDA 3EGDA 1NPRA 1K9MU 2E64A 4HVWA 1RAGB 4J6YA 1UE9A 4AG1C 2KE9A 1C1AA 2DERA 5GAMe 2HSPA 4L5GA 4OMQA 2VGMA 2CP2A 5GJVB 4GLKA 3JB9I 4E7IA 2F2VA 4BB7A 1NG2A 2DTIA 2ZPIB 4M7DE 4C92F 5HY6A 4AFSC 1BU1A 3GLXA 1ABQA 4ME7A 2DXCA 4KH0B 2R5MA 2EQKA 2KR3A 2YWWA 2HQEA 3PTAA 3ZL7C 3OMGA 4ZN3A 4OVAA 4EMGA 3CCJA 1W70A 5KYUA 1RABB 4EMKC 2DTOA 3EHQA 4O5VA 5GAMd 4XU0A 5LJ5h 3L2RA 2BUDA 5I22A 3ZEHA 2KY9A 3SWNA 5CO7A 5GAMf 3A98A 2JT4A 5LJ5j 4B6MA 1T0HA 2ZPHB 4KULA 1OU8A 4M78G 4DEYA 3MJXA 3MPUB 3LYIA 1OX8A 1SKUB 1K73R 3V7RA 1UGQB 1HXDA 4OB3B 2LVMA 2V1QA 3EG9A 1ZQ1A 2EGEA 2CT4A 1NYGA 3VJPA 3M0RA 2SRCA 2VB6A 3QIIA 1ACMB 1K9MC 1BYMA 3TREA 2QI2A 5GANd 2EFIA 3PIPA 2D8HA 3S6WA 5A0DA 4M75C 1NJIU 3FDRA 3A8OB 2F2WA 3M0SA 5GANh 2NUPA 2DBKA 1MMAA 2CDTA 1TUDA 2X51A 2EW3A 2EQMA 2RHUA 3R6NA 1E7OA 4UC4A 4M75D 2ZPBB 4JZ4A 4F7UA 2JN0A 5GAMj 4Y28E 4C92D 2W10A 3ER0A 3QJYA 8ATCB 2DM1A 3LH5A 1ZBXA 4LN2A 1WX6A 1Q81U 1KC8R 1AVZC 1I4K1 4F14A 3CQTA 2RI5A 4IUPA 4OB2B 4RTWA 1I8FA 1ARKA 3RERA 3J81E 4R0KA 1M9SA 3OB9A 2XICA 4M77G 1JU5C 2LQWA 5AYFA 2YSQA 5GAOp 5KCHA 2DRKA 3OA6A 4B9XA 2E65A 2FRYA 3AT1B 4M77A 2RN8A 4FT4A 5LL6S 3GPLA 3EFSA 1UHCA 3H41A 2F69A 1Q7YR 2ECZA 1GBQA 3SHWA 3CCST 2PQWA 4E6RA 1W2BP 3DLMA 4GY5A 4II1A 2KGTA 1MV3A 1M3AA 1OQKA 1M2OA 2A37A 1WFWA 1N9RA 1ZA2B 3QYGB 2XDPA 2Y4YA 2E3HA 2ZPGB 3FJ5A 3G4SQ 3JB9D 3GNGA 2CSQA 3M4YA 4HCBA 2E5KA 4XTUA 1K4US 4RTZA 2DXTA 1OV3A 2LJ3A 1KQSA 1K9AA 1UJ0A 1PCXA 1G3TA 2IG0A 1JJ2A 2YXYA 2FPEA 2L3RA 2OX7A 3EGDB 2MK5A 3E9FA 4QKUA 3HL8A 1SRMA 2NYSA 5LJ5e 4XU3A 1YWOA 4M7AE 1N6AA 2LX7A 2MAMA 1AD5A 2OTJT 2CP6A 3MEUA 2RJDA 2VV5A 2Y90A 2ZAEA 3UA7A 1AOJA 4EDUA 2LQKA 2RO0A 4JZ3A 2E70A 1LVKA 1AT1B 1NPPA 2HBPA 3DLLA 1YIJT 2FO0A 2FVUA 5HKCA 2XD0A 4FT2A 2JW4A 1ZSZA 1YJNT 1G3WA 3A8LB 1M1KR 5GAOm 3JCMP 2FHDA 1KQ1A 3M4GA 4HT9A 1RAAB 2NLUA 2H8HA 2P4RA 1SSFA 3META 3QBYA 1G3SA 1YJWT 3MEAA 3UWNA 4J7FA 2WSCE 1VQLT 1GCQC 3QG1A 4CRIA 1WPYA 2K2MA 1VQOT 3T9NA 3QDFA 2YUOA 4OGCA 2KXCA 4BI4A 2AIRB 3I35A 3X20B 4M78E 4M78A 3RMQA 1VQKT 3X24B 2LNHB 5CQXA 5FLXE 3V7SA 3O5ZA 4XAXB 1YWPA 2LCLA 3RKXA 3RKYA 1NJIR 3PE0A 5IHNA 5IT9E 2DBMA 3X28B 3H0HA 3M57A 4M7DB 1Q81C 2DK3A 1U1SA 5KYYB 1UTIA 5IXBA 2CH4W 3UF4A 3MP6A 3JB9J 1RAIB 2M1HA 1M90R 4BDZA 4BI3A 2HZYA 5L23A 5CVIA 3GP8A 3OYMA 2OTLA 1QVFA 5IHIA 4IURA 1I1JA 1WZOA 2MWPA 3HSBA 3OYLA 2EAYA 1NJIC 1VA7A 4MZPA 1KSWA 4JPBW 1RACB 3C4SA 4N4HA 3REBB 3I55T 3FB9A 3VS0A 5GJWB 3M58A 1VQ7Q 2K5IA 2QDLA 2E10A 1QCOA 1U5SA 1S72T 4DBQA 2I0NA 2O01E 5GMKj 4OB0B 5FW9A 3PGGA 2JTFA 2R57A 4F7UF 4E2FB 3JSCA 2P4TA 3FJPA 3OQ5A 4HXJA 3ZFJA 3VUBA 1KQ2A 4C92B 4RCCA 1QVGP 3QXEB 3CXCS 1BKBA 4FL6A 2IIMA 4HVUA 1VQNA 4A53A 1KFZA 2AK5A 1A0NB 3PVLA 3HRTA 3GOXA 2NUZA 2KT8A 2K7AA 4ORZA 2KRSA 2FYKA 2QASA 2AHJB 2DXBA 1VQLQ 3TCJA 3EFRA 1SPKA 2RJFA 3CC2T 3G4ST 2O31A 1TWBA 5GAOn 3TSZA 3E9GA 4ZGDB 1GRIA 4HCZA 3CCET 1FXXA 2ED0A 1YJ9T 3CBPA 5GANe 4C0GA 1SG5A 2YRVA 3MEVA 3RUXA 3CCUQ 3NMZC 4ZTJA 2QYZA 2DZCA 2ESWA 3KFVA 4DOWA 2HSEB 3FIFA 2HAXA 1B34A 2M16A 2PU9B 3C95A 1H8KA 1LNXA 1R77A 1Q7YC 3QUIA 1GCQA 1H641 1VQ4Q 2KBTA 3C94A 4KUDK 1K0XA 4FSSA 1Q82U 1WHJA 2GTJA 3V8KA 2P0PA 3EG2A 4XQ3A 2JS2A 3TVTA 3QHSA 1YHQA 1YNZA 4C5EA 1EX4A 4J9FA 4N0AC 3A1PA 3VS7A 4PJLA 2CZ6B 3VS5A 2V26A 4KGZB 3M0PA 3I55Q 2QQAA 1FMWA 3OYAA 5GANf 1M2VA 5CK9A 4QW2A 4MDXA 2EQIA 1I5OB 2DF6A 2DRMA 4KRTA 1JRIA 2AT1B 1YJWQ 4D8DA 3OBWA 3OW2S 2CGHA 3VRZA 3S3OA 1K76A 4JLIA 5KE3A 1CKBA 1XJWB 1M90C 2HCKA 4MMLA 1M1FA 4C8QD 3RNJA 4LNPA 1K8AC 5GANg 2EWNA 3G71Q 1WA7A 4F16A 1KQSP 5GAMh 1H3HA 4A4EA 1Q86R 4M7AB 4BACA 4OMLA 4J9GA 2K3XA 4M7DF 4J5YA 5LJ5f 2RM4A 1PKTA 4DA4A 3SWNB 1D1AA 2RJCA 1VQPA 3TEEA 4X34A 1PSFA 3WVEB 4E7KA 2DAQA 3CC2A 3G71A 1K0SA 4DBHA 2XIDA 2L3SA 3RMSA 4NOYA 5IXFA 2JZ2A 1E6HA 4JRKA 1NE8A 4XU2A 2FPDA 3CCVT 1R8OB 1G3YA 1F1BB 1M27C 3KBGA 3JB9G 4EIKA 1M1KC 1UHFA 1RLQC 1MHNA 1PHTA 3OYJA 2K6DA 2RPNA 4DBRA 3CCUT 3LWHA 1ZUUA 2NUPB 2LJ1A 2GBQA 2O9VA 2LCSA 3CC7Q 4RKUE 4QVCA 1S72Q 2BTTA 5CKFA 2K5FA 1WXBA 2QDYB 1RL2A 3BW1A 5DY9A 3CPWS 2HQXA 3HTRA 4FCYA 4V2SA 1QMCA 4LD9K 2QQ9A 2QK0A 5LJ3h 3M55A 1B3QA 3OS1A 3L2VA 2RK2A 2RQRA 1TG0A 2NUTA 1VQMA 1X6OA 2QTVA 3H0FA 3JV3A 4LDUA 3U23A 3RKWA 3AHUA 3CBOA 4L6V5 3VS3A 3EG3A 3CCUA 2DYIA 3O8VA 2Z0WA 5IHKA 2DNUA 4QT7A 2BE9B 4FYWB 5I2MA 3OS0A 4JS4A 4L59A 1WI7A 2DETA 2B86A 2O4XB 3MKDA 5J26A 4KH1B 3H0IA 4M75B 1T3SA 2K3YA 5LJ3d 2PNIA 3PFSA 4AFZC 3CCEQ 1WJSA 5IH2A 1YJ9Q 2RHXA 3X26B 3UA6A 4JJCA 4XTZA 2JM8A 1X43A 4ATOA 2J6KA 4BY6B 3LW5E 1NZ9A 2E5QA 1YFNA 1YN8A 3EH1A 2MIOA 3HP9A 3QYHB 3JCMQ 2FRWA 5CAIA 2GQVA 1WDXA 1XNIA 2FPFA 3EG9B 2RQWA 4CI0C 3PT9A 3M5AA 3CMAQ 2YLCA 1GFDA 4QQGA 2I2LA 1M3BA 1X01A 2KSSA 4PJOD 3CD6T 2EGCA 2CP5A 2LP5A 2QGFB 4KGXB 5IN1A 1W4SA 1U1TA 1N27A 1YIJA 4OGEA 1IZ6A 2KT1A 4HCCA 4LDWA 3EGUA 3OYEA 2KQWA 1T0JA 4MZMA 2VVKA 1TS9A 4E7HA 1PD1A 3VU3C 1X6GA 1K9MR 4M75F 4C8QG 5GMKl 3VRYA 1RAFB 3F70A 5FU7B 1KHIA 2QEXQ 1LJOA 2O4XA 4ANJA 3CXCP 3MHXA 3ME9A 3CCMQ 1X69A 3LGFA 5C6SA 3X25B 3UDCA 2L8DA 2HKQB 4CC3A 3RIRA 3G71T 1AWJA 1Y96B 1UGPB 3BDUA 2EIFA 2Y4XA 4BE1A 5LJ3g 5DLOA 1EZZB 4HVVA 2COYA 1E6GA 1V1CA 2EJ9A 3EAEA 2CP7A 1O9SA 4PL6A 2ZPEB 5FROA 1IRXA 2HL5C 4BUGA 3CCEA 1AWOA 1PG5B 2J05A 3TQ7P 4OMNA 2PUKB 1W2BS 2BZ8A 2X4JA 4F7UG 3A8HB 4HKEA 3CCVQ 2CZ7B 1Y07A 4KUIA 1KD1R 2EYYA 2D8JA 1H92A 4D8KA 1ZLMA 3JRZA 4XU1A 1NM7A 4AG2C 3OYYA 1OEBA 2PZ1A 4CC7A 2ED1A 1UGRB 3G7ZA 2L3PA 4ELZC 1ABOA 4Z89A 1KJWA 2XMFA 4RMOA 2QA4A 2OTJQ 1JXOA 5FU6C 2F5KA 4HA8A 3OYCA 1YI2Q 1IHWA 2LJ0A 1RAHB 3E19A 1G83A 2CSIA 5GAOr 4JJDA 2HDAA 3OYBA 3QPHA 4IUVA 4J7IA 2J7IA 1QCFA 2QQSA 4C5HA 4DBFA 1R0BG 2R58A 2G6FX 1KHCA 2C06A 4R56A 4CC2A 1ZUKA 3DB3A 4LXCA 3C12A 5D6WA 5ECAA 2M9UA 1WJQA 1BCOA 5LJ5d 3OW2A 4A54A 1OU9A 3RESA 4QQ6A 1YHQQ 3L1AA 3CCMT 1TH7A 2A08A 2H3EB 2KDSA 2OTLT 2JS0A 1BK2A 2X35A 4F7UE 2E3IA 4KT0E 2CREA 2HEQA 2JXBA 3N5BB 4E47A 1N8RR 1WXTA 1VQKQ 1R0CB 4N0AA 3CC4T 1U3OA 1OPLA 1PKSA 4M77F 4X1VA 2CUDA 1M1KU 2NUTB 5EG2A 2OJ2A 3QDRB 4RUGA 2FG0A 5GAN6 1M30A 3JCMJ 1N8RC 4OMPA 4OF1A 3URGA 1WHKA 4FYYB 2K79A 4C0DC 3VS4A 2VYTA 1ZSZC 3M0QA 4PJJA 1NEBA 1KIKA 1GBRA 4M78F 2RB6A 3REAB 4OP0A 3MP8A 2VUBA 5HCKA 1VQLA 1M90U 2XKOC 1YCYA 2ROLA 5J3BA 1IGQA 4JRPA 1MGQA 4MMKA 1MMGA 1BI2A 2PVOB 1UDLA 3WVDB 2G3RA 3I55A 1SHFA 1QVPA 3CCJQ 1TUGB 5FRMA 4C0DB 5GMKm 3S3NA 2EVRA 1OX9A 3OYIA 2O2OA 3QWXX 1UFFA 1OI1A 4M7AA 2QQRA 1M3CA 3JCMW 2YLBA 2M02A 2JTMA 1TUCA 2EYZA 2GQIA 1VQ9A 2AKKA 3JB9H 1UGVA 4PNOA 1OPKA 1G2BA 4A4HA 1WNLA 2GGRA 2K2VA 4XTWA 4M4ZA 3JCMd 2FL7A 3PNWC 1W1FA 4PJNA 4WCIA 4RG8A 3JCMh 2DE0X 4A63B 3FLGA 2ABLA 2GFUA 4HCKA 5KYWA 2EJGA 5GMKe 1YITQ 4Z88A 5GAOl 3EG0A 4MZTA 4LUDA 2KYBA 2RK1A 3QZ9B 5J39A 2OTLQ 1CKAA 5HK0A 4PJOE 5CR2A 2XDBA 2KXDA 4A4FA 4K11A 1UUEA 2JVVA 2L3QA 4EPCA 2LNVA 2RHZA 2NWMA 2A36A 6AT1B 1H3ZA 1PC0A 1YITA 3OYKA 3D7SB 1WIEA 4DEXA 2LC4A 4RTXA 3A8GB 2CP3A 1KG1A 3CCSA 5FWBA 1VQNQ 3SDZA 1Z9QA 3JCMc 2EJFA 4PJOF 2LQNA 1QWFA 3JAME 2E12A 4J9HA 4PFOA 2O88A 2O9SA 4ZGJB 3PMIA 2X4YA 3KUFA 2RNAA 1VIEA 3EG1A 4XTYA 4LDYA 3MCAB 1VQOA 3Q1JA 1Q86U 3FEOA 3TSWA 1OYXA 4C8QE 3C0CA 1RUWA 2GTOA 5CIUA 4N4IA 2YHTA 1VIFA 3INZA 3OS2A 2A7YA 2QTXA 2FEIA 4IUUA 3E2UA 2EQUA 1TU0B 1NEGA 4M7AG 2DXUA 2X4WA 4M77D 2HL3A 2XU8A 4E7ZA 5GAN8 2COWA 2DL3A 1HSQA 4RTUA 4M78D 1FMVA 3CC4Q 3QO3A 1HK9A 1NBEB 4PLIA 1WGSA 2F5TX 2JM9A 2CH4A 2V8JA 4FU6A 5D7UA 1RADB 4BI8B 2IVWA 4RG2A 2BIVA 4M7AC 1IREB 1PRLC 1BIAA 3P8DA 2LMJA 1GL5A 1VQ5T 3OS5A 4AT1B 1VQKA 2DA9A 4M75G 1JQQA 3QSUA 1ZUYA 1W6XA 1M4ZA 4ESRA 3SFMA 1QVGA 2YUPA 4M7DA 4FYXB 2DVJA 3HRUA 3OYGA 2D6FA 8AT1B 3OY9A 2CKKA 1Q82C 1GXIE 2CP0A 3M59A 2KK4A 3EGXA 2JMAA 2WSFE 2FB7A 4F17A 4AFUC 2MI6A 2HD0A 1ZSGA 2BZXA 2WACA 1UB4A 2VKNA 3SB2A 2YRCA 2LRQA 5GAN7 4E7LA 4BY6C 2RQVA 1XOVA 1VYUA 1WQWA 5GMKh 1D09B 5L8RE 3LGLA 4LDVA 3CMEQ 2E4HA 1UG1A 2L5QA 1MMDA 2FZCB 3OMCA 3JCMf 1UJYA 2OTJA 1NLOC 1Z9ZA 1D3BB 4EMHA 2DO3A 2PVGB 1V76A 2CZ0B 3VUZA 2KMTA 1P92A 1Q95G 1VUBA 4M7AF 1YITT 4JJBA 1D0YA 4N4GA 5KE2A 4J9CA 4F7UB 2LDMA 5LJ3f 1VQOQ 3M53A 1YJNQ 2M0OA 1WQ7A 4LE9A 1WLPB 2DD4A 5CKHA 1MMNA 4C92G 1OZ3A 1I07A 2V8IA 1RI0A 3DB4A 3NPFA 3LWIA 1HYOA 4J9BA 4FSXA 3ULRB 2DIQA 2KYMA 4ELYC 1PM3A 1QVGS 1Q86C 1EIFA 4Z02A 3M56A 3CMAT 1VYVA 4PFZA 2V8KA 3CC4A 3CCLT 2DYBA 2RQUA 1Y96A 3CXCA 1KC8C 4ZTFA 2L2PA 1U06A 1I0CA 2DX1A 1IHVA 2YUQA 5HK3A 3WXMB 4M78B 2VXFA 1VQ9T 2EKOA 2X3WD 4FIBA 2YUNA 3VV0A 3H6ZA 4BE2A 3HRSA 2P84A 3CCMA 3L2WA 3JCMX 2K57A 1Q81R 1VQ7T 5GAN4 4HT8A 3I56A 3V8JA 1HD3A 4AMCA 3GNFB 4WTOB 3J80E 4C92A 4QVDA 1RI9A 3SWNC 4XK8E 1IXDA 4BDYA 4IIMA 2QQBA 4DQ2A 1BIBA 2RHYA 1XTDA 1VQ6A 1G5VA 3L2ZA 3RBBB 1VQMQ 2PUOB 1UGSB 4J8OA 2PTKA 2RI3A 2DFUA 1G8XA 4Y92A 3JCMe 2AZVA 5FU7C 4AFQC 4RTYA 1FX7A 3OSVA 3G1JA 2MMPA 2EPDA 1GCPA 1K73U 2E41A 1FWZA 4M75A 2M0YA 4J9DA 4M75E 2KROA 2QA4T 4O6JA 1J3TA 2F1LA 2LTOA 4OMOA 1X27A 2KAFA 4FW2A 2JNGA 1BI3A 1T3LA 2BZYA 4IKFA 1WHMA 1VQ5Q 1QW1A 2AZSA 3E1SA 2KRNA 4C8QC 2XHCA 4KGVB 3CCRA 3V7CA 3P8HA 5D6XA 3QZ5B 3OYFA 2K4YA 1AHJB 2D9TA 2DJZA 5CKEA 1BI0A 1S1NA 1SSHA 1WYXA 3CC2Q 2KEAA 1VQ8A 3JCMb 4X9DA 3MP1A 1WHHA 2VXEA 1VQPQ 4A4KA 2J6OA 4M7DD 3THKA 1Y71A 4M7AD 3G6EA 2DEQA 3QWYA 1K1ZA 2GF7A 2M51A 5A0LA 2KI7A 2XDDA 4OMMA 4C8QF 1LOJA 1LCKA 1QVFP 1YBYA 2QAZA 2C0TA 1VQ9Q 4EMKB 3TU4K 3L42A 1D0ZA 3CMET 1WJRA 3JCMg 2EGAA 1D3BA 1N8RU 2GFAA 1VQ4T 1KC8U 2ZZDA 2MPXC 2JOYA 4J83A 1DJ7B 5D6YA 4C5GA 4A4GA 3M0TA 2GCXA 1Y57A 1KD1C 1MUZA 5KH6A 4FM4B 1YHQT 4C0ZA 1N9SA 3NHNA 3P8BB 4Y91A 2DL5A 1D1CA 1PNJA 2C0OA 2OAWA 3HFNA 4FW1A 1AWWA 2HNIA 5GAN3 3PVQA 2SEMA 2WSEE 1B34B 4BD3A 2CYZB 1JJ2P 1YI2A 1ZA1B 2QA4Q 4JUVA 1X75C 2CS7A 4LD6A 2A28A 4F04B 4JRQA 1TOVA 1ZSZB 2E6NA 2K5LA 2DL8A 4C92E 4FYVB 1KQSS 3HKSA 1X2KA 3NFCA 2V1RA 2QXFA 4ZN1A 3HFOA 3GBQA 3G6EQ 1JJ2S 2CZ1B 2QG9B 1KK7A 5GAN5 3CCLQ 2LCCA 1TXQA 2XI9A 2R5AA 1VQ8Q 5KYYA 1IB8A 4QQDA 4LUEA 2MWOA 1MNDA 4M77E 2L89A 3CCQT 1K73C 4IIOA 5A2QE 3SEMA 3UPUA 3NTHA 1W2BA 2P0KA 2RH2A 1GFCA 4M77C 3CCRQ 5CKDA 1M8MA 2CUBA 4GBQA 3H8ZA 5CKBA 3ASKA 3JCMV 2VWFA 1NYFA 1YCSB 2J6FA 5LJ3e 3FC3A 1HJDA 3M9QA 4OB1B 3EFOB 4KBMB 1EFNA 1V29B 3CPFA 4P5NA 3CC7T 2DL4A 1OOTA 1VQMT 5LJ3j 1M1GA 2J06A 4Z8AA 1ZHIA 1SHGA 2DKGA 1JO8A 1Q82R 5CCAA 2E1HA 1VYTA 2L0AA 4M78C 1QP3A 1Q7YU 4PFPA 2HBWA 1X6BA 4M7DC 2QEXA 5I11A 5I2SA 2F2XA 2QGGA 2DPPB 2C0IA 2CT3A 5KYNA 1ZX6A 1D0XA 1ZBJA 3RR6A 2COZA 5GANj 1FYNA 5GAOq 4M7DG 1SEMA 5AT1B 2VC8A 4RCBA 1YIJQ 1OULA 1VQ7A 1AEYA 2DJQA 4QVZA 9ATCB 1O75A 2D0QB 4C5IA 1C0MA 4E7SA 5KYXA 2ENMA 1JB0E 2RF0A 4J6XA 4Q5WA 2DL7A 1D1BA 2BE7D 2ROTA 4J9EA 3CCVA 2FZKB 1X2QA 2RD1A 2KVQG 3CCQA 4NL3A 3I5RA 4D6WA 5M9OA 2FZGB 3VS1A 1VOMA 1IO6A 1RLPC 3QJ6A 4PK4A 3CMAA 3JB9F 3CPWA 1Y7XA 2JUFA 3HHTB 1MNEA 4JRIA 3BE3A 1VQPT 3M54A 2KNBB 4VUBA 2A0FB 2RQTA 3OW2P 3DKMA 1VQNT 4OMFB 1K8AU 2DIGA 4PJMA 1YJ9A 3CD6Q 2XK0A 2W0ZA 2A3LA 2LQ8A 2VGNA 3BDLA 2D0NA 3J7AF 3QKJA 3FRNA 5FU6B 3CCQQ 2HKNA 1PSEA 3NGPA 1M2VB 1FMKA 1QKXA 2EYXA 3CPWP 1QCNA 1C6VX 1MV0B 1VQ6Q 2DILA 3IQLA 2EYWA 2DD5A 5FRNA 3CEYA 4C8QA 4R55A 3RDVA 4ZNXA 1M8VA 2YRDA 2IPOB 1WHGA 1BCMA 1JXMA 2ZCFB 3I56Q 2VASA 4JS5A 5KYWB 2H3JA 1SRLA 1BB9A 4IUTA 3VS6A 2E6ZA 3CMEA 4ZGEB 1XQHA 2QEXT 2HMAA 1PRMC 4CC4B 2ATCB 4PJOB 1AZEA 3VKIA 3CD6A 3SD4A 2DMOA 5GAN2 3I9QA 3L2QA 3CC7A 3G6ET 1UEBA 2LX9A 4PJOC 5GMKi 2DTHA 3HPWA 1Y0MA 1TTHB 1SF9A 1AZGB 3PIOA 1VQ8T 4YTLA 1AWXA 1OZ2A 5I21A 4RTTA 2EKHA 2RA2A 1QVFS 4C0FA 5GAMg 1IGUA 2K9GA 2OAUA 3GF5A 4RTVA 2DLPA 5KCOA 3G4SA 2B8AA 1WHLA 2ZGWA 3CCRT 1YJNA 2LZ6B 3CBMA 2RJEA 3CCLA 3R6OA 1I5LA 4JDSA 1QQJA 1RAEB 4BE0A 5DM7R 1BBZA 4B9WA 3NTKA 5C0MA 4JLGA 2K3BA 3LLRA 4X9CA 2EYQA 1PWTA 5IAYA 3NTIA 3EFOA 4XTVA 3OYDA 3EGXB 1LPLA 1I81A 2ZPFB 2X9HA 3V8LA 5KYXB 3EHRA 4MDWA 2RI2A 3I5SA 1TSFA 2RMOA 1YI2T 4PJOA 2MOXA 1B7TA 4JJNK 1YJWA 3M0UA 3KXTA 2X4XA 1S72A 2OI3A 3PMTA 1CSKA 3BY7A 4PJOG 3UT1A 3OBYA 1N5ZA 2P0QA 1WXUA 4WF2A 3EH2A 2MYSA 3A8MB 5EC7A 2EQJA 3UATA 3I56T 5FWCA 1U8RA 1JEGA 3H9NA 2DEUA 1M5Q1 1QKWA 2YDLA 2MCNA 1QP2A 2MF2A 3LX7A 4J6WA 2KRMA 4NL2A 1K8AR 1BI1A 2XG8D 5DLQE 4LDXA 1KD1U 1QWEA 5LJ5g 4GLMA 1VQ4A 2HQHA 2BKDN 1QLYA 2DVEA 4NS5A 2GNCA 2AKLA 3OYNA 1NLPC 1YP5A 7AT1B 4C92C 2RHIA 3A5ZB 3MO8A 3L2UA 2YT6A 4J9IA 2JMCA 3LH0A 4PLLA 3CCSQ 3OYHA 4PKCC 3GIBA 1JBMA 5CQYA 2X3XD 1UECA 2LT4A 4DOVA 4IUQA 4M77B 1PD0A 3S3MA 2JTEA 3BFMA
chains in the Genus database with same CATH topology
1Y71A 4M7AD 3G6EA 4ZTJA 2DEQA 4OP0A 2DZCA 3MP8A 2VUBA 3VYGA 4C8QB 4DOWA 1VQLA 2GF7A 3FIFA 4XTXA 2XKOC 4EMKA 5A0LA 1B34A 1YCYA 1M90U 2HAXA 2M16A 2LT1A 2PU9B 5J3BA 2XDDA 3C95A 4JRPA 4E7JA 1LNXA 1Q7YC 1VQ6T 4C8QF 1LOJA 3QUIA 4TVRA 2DZ9A 3OSSC 1VQ5A 1H641 1MGQA 3MEWA 4MMKA 3VYHB 3CCJT 5A0GA 1BI2A 1YBYA 3C94A 2PVOB 4EMKB 3TU4K 4KUDK 3WVDB 1Q82U 3L42A 3CMET 1WJRA 3V8KA 3JCMg 2P0PA 2PVDB 3ZBDA 1D3BA 2G3RA 4XQ3A 3I55A 1NPRA 1K9MU 1QVPA 2E64A 1N8RU 2GFAA 1VQ4T 3QHSA 2ZZDA 4C5EA 4C0DB 1YHQA 1KC8U 4J6YA 2JOYA 5GMKm 5FRMA 3S3NA 4J83A 1DJ7B 5D6YA 3OYIA 4C5GA 4N0AC 4A4GA 5GAMe 2GCXA 4L5GA 1OI1A 2CZ6B 4M7AA 2VGMA 2QQRA 3JCMW 4GLKA 2QQAA 1KD1C 3JB9I 2YLBA 3OYAA 2JTMA 5KH6A 5CK9A 5GANf 4E7IA 4BB7A 2DTIA 4QW2A 1VQ9A 4MDXA 4FM4B 3JB9H 2ZPIB 4M7DE 4C92F 5HY6A 4PNOA 3GLXA 1YHQT 4C0ZA 1N9SA 4ME7A 2DXCA 3P8BB 1WNLA 1JRIA 2K2VA 2R5MA 4XTWA 4Y91A 4A4HA 3JCMd 2EQKA 2FL7A 3PNWC 3HFNA 2HQEA 3PTAA 3OBWA 3OW2S 2CGHA 2HNIA 4RG8A 3OMGA 3JCMh 4ZN3A 5GAN3 3S3OA 4OVAA 4EMGA 3FLGA 4JLIA 3CCJA 2WSEE 2GFUA 1B34B 5KE3A 4BD3A 1M90C 4C8QD 4MMLA 1M1FA 2DTOA 4EMKC 2CYZB 2EJGA 5GMKe 4O5VA 5GAMd 4XU0A 5LJ5h 5GAOl 1YI2A 3L2RA 4MZTA 2BUDA 1K8AC 5GANg 2EWNA 3ZEHA 2KY9A 5GAMh 4JUVA 2RK1A 1X75C 2CS7A 4LD6A 4A4EA 4M7AB 4JRQA 3QZ9B 5J39A 4BACA 5CO7A 3SWNA 5GAMf 2E6NA 2K5LA 2K3XA 4M78F 5LJ5j 4C92E 4M7DF 1KQSS 3HKSA 3NFCA 2ZPHB 5HK0A 4KULA 2QXFA 4J5YA 4M78G 4ZN1A 2RM4A 3HFOA 5LJ5f 4PJOE 1JJ2S 5CR2A 3LYIA 2CZ1B 4DA4A 3SWNB 2XDBA 3V7RA 5GAN5 4A4FA 1UGQB 2RJCA 1HXDA 2LCCA 2JVVA 2LVMA 4OB3B 3TEEA 2XI9A 1VQPA 4X34A 1PSFA 3WVEB 4EPCA 2LNVA 2RHZA 4E7KA 1ZQ1A 2R5AA 2DAQA 3CC2A 3G71A 1H3ZA 4QQDA 3VJPA 2XIDA 1YITA 3RMSA 2MWOA 3QIIA 3OYKA 4NOYA 1K9MC 2JZ2A 2LC4A 4JRKA 1BYMA 3TREA 1NE8A 2QI2A 3A8GB 4XU2A 5GANd 1KG1A 2EFIA 4M77E 3PIPA 3CCSA 2L89A 3CCQT 3CCVT 1K73C 3S6WA 5A0DA 5A2QE 1W2BA 3UPUA 1R8OB 3NTHA 4M75C 1G3YA 2P0KA 3A8OB 3FDRA 5GANh 1NJIU 2RH2A 4M77C 3KBGA 3JB9G 3SDZA 1M1KC 5CKDA 3JCMc 2EJFA 1MHNA 4PJOF 3OYJA 2RHUA 2EQMA 3JAME 3CCUT 2E12A 4UC4A 3LWHA 4M75D 3H8ZA 2ZPBB 3ASKA 5CKBA 3JCMV 4F7UA 4ZGJB 3PMIA 2JN0A 2X4YA 3KUFA 5GAMj 4RKUE 4QVCA 5LJ3e 3FC3A 1VIEA 4Y28E 3M9QA 4C92D 4XTYA 4OB1B 5CKFA 2K5FA 3ER0A 4KBMB 3MCAB 4LDYA 3QJYA 1VQOA 3Q1JA 1Q86U 1V29B 2QDYB 1RL2A 3CPFA 3BW1A 4P5NA 5DY9A 3FEOA 3CC7T 3CPWS 2HQXA 1ZBXA 5LJ3j 1VQMT 1Q81U 1M1GA 1I4K1 1ZHIA 2DKGA 1OYXA 4C8QE 5CCAA 2E1HA 4V2SA 2RI5A 4IUPA 4LD9K 2QQ9A 4M78C 1QP3A 1Q7YU 5LJ3h 3M55A 5CIUA 3OS1A 4N4IA 4OB2B 4M7DC 2YHTA 1I8FA 1VIFA 3L2VA 3INZA 2RK2A 2QEXA 3RERA 3J81E 3OS2A 1M9SA 5I2SA 1VQMA 3OB9A 2A7YA 1X6OA 2QTXA 4IUUA 2DPPB 2XICA 4LDUA 2EQUA 4M77G 4M7AG 5GANj 5AYFA 5GAOp 5GAOq 4M7DG 2DXUA 2X4WA 5KCHA 4M77D 3OA6A 3RKWA 2VC8A 3AHUA 3CBOA 4RCBA 2E65A 4L6V5 4B9XA 1VQ7A 2XU8A 3CCUA 4QVZA 5GAN8 3O8VA 1O75A 4M77A 2D0QB 4FT4A 4C5IA 5LL6S 3GPLA 4M78D 1JB0E 3EFSA 4J6XA 4Q5WA 2F69A 3QO3A 1HK9A 5I2MA 3OS0A 4JS4A 3CCVA 4L59A 2RD1A 2KVQG 4PLIA 3CCQA 1WGSA 2F5TX 3CCST 2O4XB 2V8JA 4NL3A 4FU6A 4D6WA 5M9OA 2PQWA 2IVWA 4BI8B 5J26A 4RG2A 3DLMA 4GY5A 2BIVA 4M7AC 4II1A 1IREB 4M75B 1BIAA 2K3YA 3P8DA 3QJ6A 5LJ3d 3PFSA 3CMAA 3JB9F 3CPWA 1WJSA 1VQ5T 1Y7XA 2JUFA 3HHTB 2RHXA 3X26B 3OS5A 1VQKA 4JRIA 1N9RA 4XTZA 4M75G 1VQPT 4ATOA 3M54A 3QYGB 4VUBA 3QSUA 2XDPA 2Y4YA 3LW5E 1NZ9A 2E5QA 1M4ZA 4BY6B 3SFMA 1QVGA 3DKMA 1VQNT 4M7DA 4OMFB 1K8AU 2ZPGB 2DIGA 3HP9A 3QYHB 3HRUA 3JCMQ 3OYGA 3JB9D 3GNGA 2D6FA 5CAIA 2GQVA 3M4YA 4HCBA 1XNIA 1YJ9A 4XTUA 3OY9A 2XK0A 2CKKA 4CI0C 1Q82C 1GXIE 3PT9A 3M5AA 2DXTA 3M59A 2A3LA 2LQ8A 2YLCA 2KK4A 2VGNA 3BDLA 3J7AF 4QQGA 2I2LA 1X01A 2KSSA 2WSFE 3FRNA 3QKJA 5FU6B 1KQSA 2FB7A 4PJOD 3CD6T 2MI6A 1G3TA 2IG0A 1JJ2A 1PSEA 2HD0A 2L3RA 2WACA 1UB4A 3E9FA 5IN1A 1W4SA 3SB2A 2LRQA 5GAN7 4E7LA 4BY6C 3HL8A 1XOVA 5LJ5e 1WQWA 4XU3A 4M7AE 5GMKh 1N6AA 2DD5A 2MAMA 5FRNA 2OTJT 1U1TA 5L8RE 1N27A 3LGLA 3MEUA 2RJDA 1YIJA 2VV5A 4OGEA 1IZ6A 3CEYA 4LDVA 4HCCA 4LDWA 3OYEA 2Y90A 2KQWA 4C8QA 4R55A 4MZMA 1M8VA 4EDUA 4E7HA 2L5QA 3VU3C 2LQKA 2RO0A 2E70A 4M75F 4C8QG 5GMKl 3OMCA 2ZCFB 4JS5A 3F70A 5FU7B 1KHIA 2H3JA 3JCMf 1NPPA 1LJOA 2HBPA 2O4XA 3DLLA 1YIJT 2OTJA 2FVUA 3MHXA 1D3BB 3ME9A 4EMHA 2DO3A 5HKCA 3LGFA 5C6SA 3X25B 2PVGB 3UDCA 2XD0A 4FT2A 4IUTA 2CZ0B 3VUZA 2E6ZA 1YJNT 1G3WA 1P92A 1VUBA 2KMTA 3A8LB 1XQHA 4ZGEB 5GAOm 2QEXT 3CMEA 3JCMP 1YITT 4M7AF 2FHDA 1KQ1A 2L8DA 3M4GA 4N4GA 4HT9A 2NLUA 3RIRA 5KE2A 3G71T 4PJOB 1Y96B 1UGPB 3VKIA 3CD6A 3BDUA 4F7UB 2EIFA 1SSFA 3META 2LDMA 5LJ3f 3QBYA 3SD4A 1G3SA 2Y4XA 3M53A 4BE1A 3MEAA 2M0OA 3UWNA 5LJ3g 5GAN2 5DLOA 1YJWT 4J7FA 3L2QA 1WQ7A 2WSCE 1VQLT 3CC7A 3QG1A 4CRIA 2EJ9A 1UEBA 2DD4A 5CKHA 3G6ET 2LX9A 3EAEA 1O9SA 4C92G 1WPYA 1VQOT 3T9NA 4PL6A 4PJOC 2ZPEB 1OZ3A 4OGCA 5FROA 2DTHA 2V8IA 3HPWA 5GMKi 1RI0A 4BI4A 4BUGA 3CCEA 3DB4A 3LWIA 3PIOA 1VQ8T 4YTLA 1OZ2A 5I21A 4FSXA 3X20B 4M78E 2RA2A 2PUKB 4M78A 4C0FA 1W2BS 1QVFS 2X4JA 5GAMg 2DIQA 4F7UG 3RMQA 4ELYC 3A8HB 3X24B 1VQKT 1QVGS 2OAUA 5CQXA 4HKEA 5FLXE 3GF5A 3V7SA 5KCOA 4XAXB 1Q86C 3G4SA 2LCLA 2B8AA 3RKYA 1EIFA 3RKXA 4Z02A 3M56A 3CMAT 2CZ7B 1Y07A 5IT9E 2V8KA 3X28B 3M57A 4KUIA 1Q81C 3CC4A 2ZGWA 2DK3A 4M7DB 3CCRT 3CCLT 1YJNA 3CBMA 1U1SA 1Y96A 3CXCA 2RJEA 1KC8C 3JRZA 4ZTFA 3CCLA 4XU1A 3MP6A 3R6OA 3JB9J 1I5LA 3OYYA 2M1HA 4JDSA 4BDZA 5HK3A 4BI3A 3WXMB 4M78B 2VXFA 1VQ9T 2EKOA 4BE0A 1UGRB 5DM7R 4FIBA 3G7ZA 5CVIA 3VV0A 4ELZC 4B9WA 3GP8A 3OYMA 3H6ZA 4BE2A 3NTKA 2OTLA 3HRSA 5C0MA 3CCMA 4JLGA 3L2WA 1QVFA 3LLRA 4RMOA 4X9CA 2EYQA 4IURA 5IAYA 3NTIA 3JCMX 2QA4A 2K57A 5FU6C 4XTVA 2F5KA 4HA8A 2MWPA 3OYDA 3OYCA 1VQ7T 5GAN4 3HSBA 4HT8A 3OYLA 3I56A 3V8JA 2EAYA 1NJIC 1I81A 2ZPFB 3GNFB 4MZPA 3E19A 3C4SA 4N4HA 3V8LA 3J80E 4C92A 3I55T 3FB9A 4MDWA 2RI2A 4QVDA 5GAOr 3M58A 2K5IA 3SWNC 1YI2T 4PJOA 4XK8E 2E10A 1S72T 4JJNK 2O01E 5GMKj 4BDYA 3OYBA 1YJWA 2QQBA 3QPHA 4IUVA 4J7IA 4OB0B 3PGGA 2JTFA 2R57A 4F7UF 4C5HA 2QQSA 3JSCA 4DQ2A 1BIBA 2RHYA 1XTDA 3KXTA 1VQ6A 2P4TA 1G5VA 2R58A 3L2ZA 3FJPA 1KHCA 2X4XA 2C06A 1S72A 4R56A 3PMTA 3UT1A 3BY7A 2PUOB 3OQ5A 3OBYA 1UGSB 4J8OA 4PJOG 2RI3A 3DB3A 3ZFJA 3C12A 2P0QA 5D6WA 3VUBA 1KQ2A 2M9UA 1WJQA 4WF2A 5LJ5d 4C92B 3JCMe 4RCCA 5FU7C 3OW2A 3QXEB 4A54A 3A8MB 1FX7A 2EQJA 3OSVA 3I56T 3CXCS 3RESA 2MMPA 1BKBA 1U8RA 4FL6A 1VQNA 1K73U 1M5Q1 4QQ6A 2E41A 1FWZA 1QP2A 4M75A 2MF2A 4M75E 3L1AA 3LX7A 4J6WA 4A53A 3CCMT 1TH7A 2QA4T 4O6JA 4NL2A 1BI1A 2KDSA 2OTLT 2LTOA 2XG8D 2X35A 4F7UE 5DLQE 3HRTA 4LDXA 2KAFA 1KD1U 4KT0E 3GOXA 2JNGA 1BI3A 5LJ5g 1VQ4A 3N5BB 4E47A 4IKFA 1QW1A 2BKDN 3E1SA 2DVEA 4NS5A 4N0AA 2FYKA 4C8QC 3CC4T 2AHJB 2DXBA 2XHCA 3TCJA 3OYNA 3CCRA 4M77F 1M1KU 4C92C 2RHIA 3EFRA 3V7CA 3A5ZB 3P8HA 2RJFA 5D6XA 3QZ5B 3MO8A 5EG2A 3L2UA 3CC2T 3OYFA 3G4ST 2K4YA 3QDRB 3LH0A 4PLLA 1AHJB 3OYHA 2D9TA 4PKCC 5GAN6 2DJZA 5GAOn 3JCMJ 1N8RC 3GIBA 1JBMA 5CQYA 3E9GA 4ZGDB 3URGA 4OF1A 5CKEA 1BI0A 4HCZA 3CCET 1FXXA 2LT4A 4C0DC 1VQ8A 4DOVA 3JCMb 2VYTA 1YJ9T 3CBPA 4IUQA 4M77B 4X9DA 4C0GA 5GANe 3MP1A 2YRVA 2VXEA 4A4KA 3S3MA 3MEVA 3RUXA 4M7DD 3BFMA 2RB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG8 D;  2XKO C;  3N5B B; 
#chains in the Genus database with same CATH topology
 3VS2 A;  3VYG A;  4C8Q B;  4XTX A;  4EMK A;  5KYU B;  2LT1 A;  1VQ6 T;  4E7J A;  1VQ5 A;  4TVR A;  2DZ9 A;  2JJ9 A;  3OSS C;  3CCJ T;  3MEW A;  3VYH B;  1B07 A;  5A0G A;  2EBP A;  2D1X A;  2PVD B;  3ZBD A;  3EGD A;  1NPR A;  1K9M U;  2E64 A;  4HVW A;  1RAG B;  4J6Y A;  1UE9 A;  4AG1 C;  2KE9 A;  1C1A A;  2DER A;  5GAM e;  2HSP A;  4L5G A;  4OMQ A;  2VGM A;  2CP2 A;  5GJV B;  4GLK A;  3JB9 I;  4E7I A;  2F2V A;  4BB7 A;  1NG2 A;  2DTI A;  2ZPI B;  4M7D E;  4C92 F;  5HY6 A;  4AFS C;  1BU1 A;  3GLX A;  1ABQ A;  4ME7 A;  2DXC A;  4KH0 B;  2R5M A;  2EQK A;  2KR3 A;  2YWW A;  2HQE A;  3PTA A;  3ZL7 C;  3OMG A;  4ZN3 A;  4OVA A;  4EMG A;  3CCJ A;  1W70 A;  5KYU A;  1RAB B;  4EMK C;  2DTO A;  3EHQ A;  4O5V A;  5GAM d;  4XU0 A;  5LJ5 h;  3L2R A;  2BUD A;  5I22 A;  3ZEH A;  2KY9 A;  3SWN A;  5CO7 A;  5GAM f;  3A98 A;  2JT4 A;  5LJ5 j;  4B6M A;  1T0H A;  2ZPH B;  4KUL A;  1OU8 A;  4M78 G;  4DEY A;  3MJX A;  3MPU B;  3LYI A;  1OX8 A;  1SKU B;  1K73 R;  3V7R A;  1UGQ B;  1HXD A;  4OB3 B;  2LVM A;  2V1Q A;  3EG9 A;  1ZQ1 A;  2EGE A;  2CT4 A;  1NYG A;  3VJP A;  3M0R A;  2SRC A;  2VB6 A;  3QII A;  1ACM B;  1K9M C;  1BYM A;  3TRE A;  2QI2 A;  5GAN d;  2EFI A;  3PIP A;  2D8H A;  3S6W A;  5A0D A;  4M75 C;  1NJI U;  3FDR A;  3A8O B;  2F2W A;  3M0S A;  5GAN h;  2NUP A;  2DBK A;  1MMA A;  2CDT A;  1TUD A;  2X51 A;  2EW3 A;  2EQM A;  2RHU A;  3R6N A;  1E7O A;  4UC4 A;  4M75 D;  2ZPB B;  4JZ4 A;  4F7U A;  2JN0 A;  5GAM j;  4Y28 E;  4C92 D;  2W10 A;  3ER0 A;  3QJY A;  8ATC B;  2DM1 A;  3LH5 A;  1ZBX A;  4LN2 A;  1WX6 A;  1Q81 U;  1KC8 R;  1AVZ C;  1I4K 1;  4F14 A;  3CQT A;  2RI5 A;  4IUP A;  4OB2 B;  4RTW A;  1I8F A;  1ARK A;  3RER A;  3J81 E;  4R0K A;  1M9S A;  3OB9 A;  2XIC A;  4M77 G;  1JU5 C;  2LQW A;  5AYF A;  2YSQ A;  5GAO p;  5KCH A;  2DRK A;  3OA6 A;  4B9X A;  2E65 A;  2FRY A;  3AT1 B;  4M77 A;  2RN8 A;  4FT4 A;  5LL6 S;  3GPL A;  3EFS A;  1UHC A;  3H41 A;  2F69 A;  1Q7Y R;  2ECZ A;  1GBQ A;  3SHW A;  3CCS T;  2PQW A;  4E6R A;  1W2B P;  3DLM A;  4GY5 A;  4II1 A;  2KGT A;  1MV3 A;  1M3A A;  1OQK A;  1M2O A;  2A37 A;  1WFW A;  1N9R A;  1ZA2 B;  3QYG B;  2XDP A;  2Y4Y A;  2E3H A;  2ZPG B;  3FJ5 A;  3G4S Q;  3JB9 D;  3GNG A;  2CSQ A;  3M4Y A;  4HCB A;  2E5K A;  4XTU A;  1K4U S;  4RTZ A;  2DXT A;  1OV3 A;  2LJ3 A;  1KQS A;  1K9A A;  1UJ0 A;  1PCX A;  1G3T A;  2IG0 A;  1JJ2 A;  2YXY A;  2FPE A;  2L3R A;  2OX7 A;  3EGD B;  2MK5 A;  3E9F A;  4QKU A;  3HL8 A;  1SRM A;  2NYS A;  5LJ5 e;  4XU3 A;  1YWO A;  4M7A E;  1N6A A;  2LX7 A;  2MAM A;  1AD5 A;  2OTJ T;  2CP6 A;  3MEU A;  2RJD A;  2VV5 A;  2Y90 A;  2ZAE A;  3UA7 A;  1AOJ A;  4EDU A;  2LQK A;  2RO0 A;  4JZ3 A;  2E70 A;  1LVK A;  1AT1 B;  1NPP A;  2HBP A;  3DLL A;  1YIJ T;  2FO0 A;  2FVU A;  5HKC A;  2XD0 A;  4FT2 A;  2JW4 A;  1ZSZ A;  1YJN T;  1G3W A;  3A8L B;  1M1K R;  5GAO m;  3JCM P;  2FHD A;  1KQ1 A;  3M4G A;  4HT9 A;  1RAA B;  2NLU A;  2H8H A;  2P4R A;  1SSF A;  3MET A;  3QBY A;  1G3S A;  1YJW T;  3MEA A;  3UWN A;  4J7F A;  2WSC E;  1VQL T;  1GCQ C;  3QG1 A;  4CRI A;  1WPY A;  2K2M A;  1VQO T;  3T9N A;  3QDF A;  2YUO A;  4OGC A;  2KXC A;  4BI4 A;  2AIR B;  3I35 A;  3X20 B;  4M78 E;  4M78 A;  3RMQ A;  1VQK T;  3X24 B;  2LNH B;  5CQX A;  5FLX E;  3V7S A;  3O5Z A;  4XAX B;  1YWP A;  2LCL A;  3RKX A;  3RKY A;  1NJI R;  3PE0 A;  5IHN A;  5IT9 E;  2DBM A;  3X28 B;  3H0H A;  3M57 A;  4M7D B;  1Q81 C;  2DK3 A;  1U1S A;  5KYY B;  1UTI A;  5IXB A;  2CH4 W;  3UF4 A;  3MP6 A;  3JB9 J;  1RAI B;  2M1H A;  1M90 R;  4BDZ A;  4BI3 A;  2HZY A;  5L23 A;  5CVI A;  3GP8 A;  3OYM A;  2OTL A;  1QVF A;  5IHI A;  4IUR A;  1I1J A;  1WZO A;  2MWP A;  3HSB A;  3OYL A;  2EAY A;  1NJI C;  1VA7 A;  4MZP A;  1KSW A;  4JPB W;  1RAC B;  3C4S A;  4N4H A;  3REB B;  3I55 T;  3FB9 A;  3VS0 A;  5GJW B;  3M58 A;  1VQ7 Q;  2K5I A;  2QDL A;  2E10 A;  1QCO A;  1U5S A;  1S72 T;  4DBQ A;  2I0N A;  2O01 E;  5GMK j;  4OB0 B;  5FW9 A;  3PGG A;  2JTF A;  2R57 A;  4F7U F;  4E2F B;  3JSC A;  2P4T A;  3FJP A;  3OQ5 A;  4HXJ A;  3ZFJ A;  3VUB A;  1KQ2 A;  4C92 B;  4RCC A;  1QVG P;  3QXE B;  3CXC S;  1BKB A;  4FL6 A;  2IIM A;  4HVU A;  1VQN A;  4A53 A;  1KFZ A;  2AK5 A;  1A0N B;  3PVL A;  3HRT A;  3GOX A;  2NUZ A;  2KT8 A;  2K7A A;  4ORZ A;  2KRS A;  2FYK A;  2QAS A;  2AHJ B;  2DXB A;  1VQL Q;  3TCJ A;  3EFR A;  1SPK A;  2RJF A;  3CC2 T;  3G4S T;  2O31 A;  1TWB A;  5GAO n;  3TSZ A;  3E9G A;  4ZGD B;  1GRI A;  4HCZ A;  3CCE T;  1FXX A;  2ED0 A;  1YJ9 T;  3CBP A;  5GAN e;  4C0G A;  1SG5 A;  2YRV A;  3MEV A;  3RUX A;  3CCU Q;  3NMZ C;  4ZTJ A;  2QYZ A;  2DZC A;  2ESW A;  3KFV A;  4DOW A;  2HSE B;  3FIF A;  2HAX A;  1B34 A;  2M16 A;  2PU9 B;  3C95 A;  1H8K A;  1LNX A;  1R77 A;  1Q7Y C;  3QUI A;  1GCQ A;  1H64 1;  1VQ4 Q;  2KBT A;  3C94 A;  4KUD K;  1K0X A;  4FSS A;  1Q82 U;  1WHJ A;  2GTJ A;  3V8K A;  2P0P A;  3EG2 A;  4XQ3 A;  2JS2 A;  3TVT A;  3QHS A;  1YHQ A;  1YNZ A;  4C5E A;  1EX4 A;  4J9F A;  4N0A C;  3A1P A;  3VS7 A;  4PJL A;  2CZ6 B;  3VS5 A;  2V26 A;  4KGZ B;  3M0P A;  3I55 Q;  2QQA A;  1FMW A;  3OYA A;  5GAN f;  1M2V A;  5CK9 A;  4QW2 A;  4MDX A;  2EQI A;  1I5O B;  2DF6 A;  2DRM A;  4KRT A;  1JRI A;  2AT1 B;  1YJW Q;  4D8D A;  3OBW A;  3OW2 S;  2CGH A;  3VRZ A;  3S3O A;  1K76 A;  4JLI A;  5KE3 A;  1CKB A;  1XJW B;  1M90 C;  2HCK A;  4MML A;  1M1F A;  4C8Q D;  3RNJ A;  4LNP A;  1K8A C;  5GAN g;  2EWN A;  3G71 Q;  1WA7 A;  4F16 A;  1KQS P;  5GAM h;  1H3H A;  4A4E A;  1Q86 R;  4M7A B;  4BAC A;  4OML A;  4J9G A;  2K3X A;  4M7D F;  4J5Y A;  5LJ5 f;  2RM4 A;  1PKT A;  4DA4 A;  3SWN B;  1D1A A;  2RJC A;  1VQP A;  3TEE A;  4X34 A;  1PSF A;  3WVE B;  4E7K A;  2DAQ A;  3CC2 A;  3G71 A;  1K0S A;  4DBH A;  2XID A;  2L3S A;  3RMS A;  4NOY A;  5IXF A;  2JZ2 A;  1E6H A;  4JRK A;  1NE8 A;  4XU2 A;  2FPD A;  3CCV T;  1R8O B;  1G3Y A;  1F1B B;  1M27 C;  3KBG A;  3JB9 G;  4EIK A;  1M1K C;  1UHF A;  1RLQ C;  1MHN A;  1PHT A;  3OYJ A;  2K6D A;  2RPN A;  4DBR A;  3CCU T;  3LWH A;  1ZUU A;  2NUP B;  2LJ1 A;  2GBQ A;  2O9V A;  2LCS A;  3CC7 Q;  4RKU E;  4QVC A;  1S72 Q;  2BTT A;  5CKF A;  2K5F A;  1WXB A;  2QDY B;  1RL2 A;  3BW1 A;  5DY9 A;  3CPW S;  2HQX A;  3HTR A;  4FCY A;  4V2S A;  1QMC A;  4LD9 K;  2QQ9 A;  2QK0 A;  5LJ3 h;  3M55 A;  1B3Q A;  3OS1 A;  3L2V A;  2RK2 A;  2RQR A;  1TG0 A;  2NUT A;  1VQM A;  1X6O A;  2QTV A;  3H0F A;  3JV3 A;  4LDU A;  3U23 A;  3RKW A;  3AHU A;  3CBO A;  4L6V 5;  3VS3 A;  3EG3 A;  3CCU A;  2DYI A;  3O8V A;  2Z0W A;  5IHK A;  2DNU A;  4QT7 A;  2BE9 B;  4FYW B;  5I2M A;  3OS0 A;  4JS4 A;  4L59 A;  1WI7 A;  2DET A;  2B86 A;  2O4X B;  3MKD A;  5J26 A;  4KH1 B;  3H0I A;  4M75 B;  1T3S A;  2K3Y A;  5LJ3 d;  2PNI A;  3PFS A;  4AFZ C;  3CCE Q;  1WJS A;  5IH2 A;  1YJ9 Q;  2RHX A;  3X26 B;  3UA6 A;  4JJC A;  4XTZ A;  2JM8 A;  1X43 A;  4ATO A;  2J6K A;  4BY6 B;  3LW5 E;  1NZ9 A;  2E5Q A;  1YFN A;  1YN8 A;  3EH1 A;  2MIO A;  3HP9 A;  3QYH B;  3JCM Q;  2FRW A;  5CAI A;  2GQV A;  1WDX A;  1XNI A;  2FPF A;  3EG9 B;  2RQW A;  4CI0 C;  3PT9 A;  3M5A A;  3CMA Q;  2YLC A;  1GFD A;  4QQG A;  2I2L A;  1M3B A;  1X01 A;  2KSS A;  4PJO D;  3CD6 T;  2EGC A;  2CP5 A;  2LP5 A;  2QGF B;  4KGX B;  5IN1 A;  1W4S A;  1U1T A;  1N27 A;  1YIJ A;  4OGE A;  1IZ6 A;  2KT1 A;  4HCC A;  4LDW A;  3EGU A;  3OYE A;  2KQW A;  1T0J A;  4MZM A;  2VVK A;  1TS9 A;  4E7H A;  1PD1 A;  3VU3 C;  1X6G A;  1K9M R;  4M75 F;  4C8Q G;  5GMK l;  3VRY A;  1RAF B;  3F70 A;  5FU7 B;  1KHI A;  2QEX Q;  1LJO A;  2O4X A;  4ANJ A;  3CXC P;  3MHX A;  3ME9 A;  3CCM Q;  1X69 A;  3LGF A;  5C6S A;  3X25 B;  3UDC A;  2L8D A;  2HKQ B;  4CC3 A;  3RIR A;  3G71 T;  1AWJ A;  1Y96 B;  1UGP B;  3BDU A;  2EIF A;  2Y4X A;  4BE1 A;  5LJ3 g;  5DLO A;  1EZZ B;  4HVV A;  2COY A;  1E6G A;  1V1C A;  2EJ9 A;  3EAE A;  2CP7 A;  1O9S A;  4PL6 A;  2ZPE B;  5FRO A;  1IRX A;  2HL5 C;  4BUG A;  3CCE A;  1AWO A;  1PG5 B;  2J05 A;  3TQ7 P;  4OMN A;  2PUK B;  1W2B S;  2BZ8 A;  2X4J A;  4F7U G;  3A8H B;  4HKE A;  3CCV Q;  2CZ7 B;  1Y07 A;  4KUI A;  1KD1 R;  2EYY A;  2D8J A;  1H92 A;  4D8K A;  1ZLM A;  3JRZ A;  4XU1 A;  1NM7 A;  4AG2 C;  3OYY A;  1OEB A;  2PZ1 A;  4CC7 A;  2ED1 A;  1UGR B;  3G7Z A;  2L3P A;  4ELZ C;  1ABO A;  4Z89 A;  1KJW A;  2XMF A;  4RMO A;  2QA4 A;  2OTJ Q;  1JXO A;  5FU6 C;  2F5K A;  4HA8 A;  3OYC A;  1YI2 Q;  1IHW A;  2LJ0 A;  1RAH B;  3E19 A;  1G83 A;  2CSI A;  5GAO r;  4JJD A;  2HDA A;  3OYB A;  3QPH A;  4IUV A;  4J7I A;  2J7I A;  1QCF A;  2QQS A;  4C5H A;  4DBF A;  1R0B G;  2R58 A;  2G6F X;  1KHC A;  2C06 A;  4R56 A;  4CC2 A;  1ZUK A;  3DB3 A;  4LXC A;  3C12 A;  5D6W A;  5ECA A;  2M9U A;  1WJQ A;  1BCO A;  5LJ5 d;  3OW2 A;  4A54 A;  1OU9 A;  3RES A;  4QQ6 A;  1YHQ Q;  3L1A A;  3CCM T;  1TH7 A;  2A08 A;  2H3E B;  2KDS A;  2OTL T;  2JS0 A;  1BK2 A;  2X35 A;  4F7U E;  2E3I A;  4KT0 E;  2CRE A;  2HEQ A;  2JXB A;  3N5B B;  4E47 A;  1N8R R;  1WXT A;  1VQK Q;  1R0C B;  4N0A A;  3CC4 T;  1U3O A;  1OPL A;  1PKS A;  4M77 F;  4X1V A;  2CUD A;  1M1K U;  2NUT B;  5EG2 A;  2OJ2 A;  3QDR B;  4RUG A;  2FG0 A;  5GAN 6;  1M30 A;  3JCM J;  1N8R C;  4OMP A;  4OF1 A;  3URG A;  1WHK A;  4FYY B;  2K79 A;  4C0D C;  3VS4 A;  2VYT A;  1ZSZ C;  3M0Q A;  4PJJ A;  1NEB A;  1KIK A;  1GBR A;  4M78 F;  2RB6 A;  3REA B;  4OP0 A;  3MP8 A;  2VUB A;  5HCK A;  1VQL A;  1M90 U;  2XKO C;  1YCY A;  2ROL A;  5J3B A;  1IGQ A;  4JRP A;  1MGQ A;  4MMK A;  1MMG A;  1BI2 A;  2PVO B;  1UDL A;  3WVD B;  2G3R A;  3I55 A;  1SHF A;  1QVP A;  3CCJ Q;  1TUG B;  5FRM A;  4C0D B;  5GMK m;  3S3N A;  2EVR A;  1OX9 A;  3OYI A;  2O2O A;  3QWX X;  1UFF A;  1OI1 A;  4M7A A;  2QQR A;  1M3C A;  3JCM W;  2YLB A;  2M02 A;  2JTM A;  1TUC A;  2EYZ A;  2GQI A;  1VQ9 A;  2AKK A;  3JB9 H;  1UGV A;  4PNO A;  1OPK A;  1G2B A;  4A4H A;  1WNL A;  2GGR A;  2K2V A;  4XTW A;  4M4Z A;  3JCM d;  2FL7 A;  3PNW C;  1W1F A;  4PJN A;  4WCI A;  4RG8 A;  3JCM h;  2DE0 X;  4A63 B;  3FLG A;  2ABL A;  2GFU A;  4HCK A;  5KYW A;  2EJG A;  5GMK e;  1YIT Q;  4Z88 A;  5GAO l;  3EG0 A;  4MZT A;  4LUD A;  2KYB A;  2RK1 A;  3QZ9 B;  5J39 A;  2OTL Q;  1CKA A;  5HK0 A;  4PJO E;  5CR2 A;  2XDB A;  2KXD A;  4A4F A;  4K11 A;  1UUE A;  2JVV A;  2L3Q A;  4EPC A;  2LNV A;  2RHZ A;  2NWM A;  2A36 A;  6AT1 B;  1H3Z A;  1PC0 A;  1YIT A;  3OYK A;  3D7S B;  1WIE A;  4DEX A;  2LC4 A;  4RTX A;  3A8G B;  2CP3 A;  1KG1 A;  3CCS A;  5FWB A;  1VQN Q;  3SDZ A;  1Z9Q A;  3JCM c;  2EJF A;  4PJO F;  2LQN A;  1QWF A;  3JAM E;  2E12 A;  4J9H A;  4PFO A;  2O88 A;  2O9S A;  4ZGJ B;  3PMI A;  2X4Y A;  3KUF A;  2RNA A;  1VIE A;  3EG1 A;  4XTY A;  4LDY A;  3MCA B;  1VQO A;  3Q1J A;  1Q86 U;  3FEO A;  3TSW A;  1OYX A;  4C8Q E;  3C0C A;  1RUW A;  2GTO A;  5CIU A;  4N4I A;  2YHT A;  1VIF A;  3INZ A;  3OS2 A;  2A7Y A;  2QTX A;  2FEI A;  4IUU A;  3E2U A;  2EQU A;  1TU0 B;  1NEG A;  4M7A G;  2DXU A;  2X4W A;  4M77 D;  2HL3 A;  2XU8 A;  4E7Z A;  5GAN 8;  2COW A;  2DL3 A;  1HSQ A;  4RTU A;  4M78 D;  1FMV A;  3CC4 Q;  3QO3 A;  1HK9 A;  1NBE B;  4PLI A;  1WGS A;  2F5T X;  2JM9 A;  2CH4 A;  2V8J A;  4FU6 A;  5D7U A;  1RAD B;  4BI8 B;  2IVW A;  4RG2 A;  2BIV A;  4M7A C;  1IRE B;  1PRL C;  1BIA A;  3P8D A;  2LMJ A;  1GL5 A;  1VQ5 T;  3OS5 A;  4AT1 B;  1VQK A;  2DA9 A;  4M75 G;  1JQQ A;  3QSU A;  1ZUY A;  1W6X A;  1M4Z A;  4ESR A;  3SFM A;  1QVG A;  2YUP A;  4M7D A;  4FYX B;  2DVJ A;  3HRU A;  3OYG A;  2D6F A;  8AT1 B;  3OY9 A;  2CKK A;  1Q82 C;  1GXI E;  2CP0 A;  3M59 A;  2KK4 A;  3EGX A;  2JMA A;  2WSF E;  2FB7 A;  4F17 A;  4AFU C;  2MI6 A;  2HD0 A;  1ZSG A;  2BZX A;  2WAC A;  1UB4 A;  2VKN A;  3SB2 A;  2YRC A;  2LRQ A;  5GAN 7;  4E7L A;  4BY6 C;  2RQV A;  1XOV A;  1VYU A;  1WQW A;  5GMK h;  1D09 B;  5L8R E;  3LGL A;  4LDV A;  3CME Q;  2E4H A;  1UG1 A;  2L5Q A;  1MMD A;  2FZC B;  3OMC A;  3JCM f;  1UJY A;  2OTJ A;  1NLO C;  1Z9Z A;  1D3B B;  4EMH A;  2DO3 A;  2PVG B;  1V76 A;  2CZ0 B;  3VUZ A;  2KMT A;  1P92 A;  1Q95 G;  1VUB A;  4M7A F;  1YIT T;  4JJB A;  1D0Y A;  4N4G A;  5KE2 A;  4J9C A;  4F7U B;  2LDM A;  5LJ3 f;  1VQO Q;  3M53 A;  1YJN Q;  2M0O A;  1WQ7 A;  4LE9 A;  1WLP B;  2DD4 A;  5CKH A;  1MMN A;  4C92 G;  1OZ3 A;  1I07 A;  2V8I A;  1RI0 A;  3DB4 A;  3NPF A;  3LWI A;  1HYO A;  4J9B A;  4FSX A;  3ULR B;  2DIQ A;  2KYM A;  4ELY C;  1PM3 A;  1QVG S;  1Q86 C;  1EIF A;  4Z02 A;  3M56 A;  3CMA T;  1VYV A;  4PFZ A;  2V8K A;  3CC4 A;  3CCL T;  2DYB A;  2RQU A;  1Y96 A;  3CXC A;  1KC8 C;  4ZTF A;  2L2P A;  1U06 A;  1I0C A;  2DX1 A;  1IHV A;  2YUQ A;  5HK3 A;  3WXM B;  4M78 B;  2VXF A;  1VQ9 T;  2EKO A;  2X3W D;  4FIB A;  2YUN A;  3VV0 A;  3H6Z A;  4BE2 A;  3HRS A;  2P84 A;  3CCM A;  3L2W A;  3JCM X;  2K57 A;  1Q81 R;  1VQ7 T;  5GAN 4;  4HT8 A;  3I56 A;  3V8J A;  1HD3 A;  4AMC A;  3GNF B;  4WTO B;  3J80 E;  4C92 A;  4QVD A;  1RI9 A;  3SWN C;  4XK8 E;  1IXD A;  4BDY A;  4IIM A;  2QQB A;  4DQ2 A;  1BIB A;  2RHY A;  1XTD A;  1VQ6 A;  1G5V A;  3L2Z A;  3RBB B;  1VQM Q;  2PUO B;  1UGS B;  4J8O A;  2PTK A;  2RI3 A;  2DFU A;  1G8X A;  4Y92 A;  3JCM e;  2AZV A;  5FU7 C;  4AFQ C;  4RTY A;  1FX7 A;  3OSV A;  3G1J A;  2MMP A;  2EPD A;  1GCP A;  1K73 U;  2E41 A;  1FWZ A;  4M75 A;  2M0Y A;  4J9D A;  4M75 E;  2KRO A;  2QA4 T;  4O6J A;  1J3T A;  2F1L A;  2LTO A;  4OMO A;  1X27 A;  2KAF A;  4FW2 A;  2JNG A;  1BI3 A;  1T3L A;  2BZY A;  4IKF A;  1WHM A;  1VQ5 Q;  1QW1 A;  2AZS A;  3E1S A;  2KRN A;  4C8Q C;  2XHC A;  4KGV B;  3CCR A;  3V7C A;  3P8H A;  5D6X A;  3QZ5 B;  3OYF A;  2K4Y A;  1AHJ B;  2D9T A;  2DJZ A;  5CKE A;  1BI0 A;  1S1N A;  1SSH A;  1WYX A;  3CC2 Q;  2KEA A;  1VQ8 A;  3JCM b;  4X9D A;  3MP1 A;  1WHH A;  2VXE A;  1VQP Q;  4A4K A;  2J6O A;  4M7D D;  3THK A;  1Y71 A;  4M7A D;  3G6E A;  2DEQ A;  3QWY A;  1K1Z A;  2GF7 A;  2M51 A;  5A0L A;  2KI7 A;  2XDD A;  4OMM A;  4C8Q F;  1LOJ A;  1LCK A;  1QVF P;  1YBY A;  2QAZ A;  2C0T A;  1VQ9 Q;  4EMK B;  3TU4 K;  3L42 A;  1D0Z A;  3CME T;  1WJR A;  3JCM g;  2EGA A;  1D3B A;  1N8R U;  2GFA A;  1VQ4 T;  1KC8 U;  2ZZD A;  2MPX C;  2JOY A;  4J83 A;  1DJ7 B;  5D6Y A;  4C5G A;  4A4G A;  3M0T A;  2GCX A;  1Y57 A;  1KD1 C;  1MUZ A;  5KH6 A;  4FM4 B;  1YHQ T;  4C0Z A;  1N9S A;  3NHN A;  3P8B B;  4Y91 A;  2DL5 A;  1D1C A;  1PNJ A;  2C0O A;  2OAW A;  3HFN A;  4FW1 A;  1AWW A;  2HNI A;  5GAN 3;  3PVQ A;  2SEM A;  2WSE E;  1B34 B;  4BD3 A;  2CYZ B;  1JJ2 P;  1YI2 A;  1ZA1 B;  2QA4 Q;  4JUV A;  1X75 C;  2CS7 A;  4LD6 A;  2A28 A;  4F04 B;  4JRQ A;  1TOV A;  1ZSZ B;  2E6N A;  2K5L A;  2DL8 A;  4C92 E;  4FYV B;  1KQS S;  3HKS A;  1X2K A;  3NFC A;  2V1R A;  2QXF A;  4ZN1 A;  3HFO A;  3GBQ A;  3G6E Q;  1JJ2 S;  2CZ1 B;  2QG9 B;  1KK7 A;  5GAN 5;  3CCL Q;  2LCC A;  1TXQ A;  2XI9 A;  2R5A A;  1VQ8 Q;  5KYY A;  1IB8 A;  4QQD A;  4LUE A;  2MWO A;  1MND A;  4M77 E;  2L89 A;  3CCQ T;  1K73 C;  4IIO A;  5A2Q E;  3SEM A;  3UPU A;  3NTH A;  1W2B A;  2P0K A;  2RH2 A;  1GFC A;  4M77 C;  3CCR Q;  5CKD A;  1M8M A;  2CUB A;  4GBQ A;  3H8Z A;  5CKB A;  3ASK A;  3JCM V;  2VWF A;  1NYF A;  1YCS B;  2J6F A;  5LJ3 e;  3FC3 A;  1HJD A;  3M9Q A;  4OB1 B;  3EFO B;  4KBM B;  1EFN A;  1V29 B;  3CPF A;  4P5N A;  3CC7 T;  2DL4 A;  1OOT A;  1VQM T;  5LJ3 j;  1M1G A;  2J06 A;  4Z8A A;  1ZHI A;  1SHG A;  2DKG A;  1JO8 A;  1Q82 R;  5CCA A;  2E1H A;  1VYT A;  2L0A A;  4M78 C;  1QP3 A;  1Q7Y U;  4PFP A;  2HBW A;  1X6B A;  4M7D C;  2QEX A;  5I11 A;  5I2S A;  2F2X A;  2QGG A;  2DPP B;  2C0I A;  2CT3 A;  5KYN A;  1ZX6 A;  1D0X A;  1ZBJ A;  3RR6 A;  2COZ A;  5GAN j;  1FYN A;  5GAO q;  4M7D G;  1SEM A;  5AT1 B;  2VC8 A;  4RCB A;  1YIJ Q;  1OUL A;  1VQ7 A;  1AEY A;  2DJQ A;  4QVZ A;  9ATC B;  1O75 A;  2D0Q B;  4C5I A;  1C0M A;  4E7S A;  5KYX A;  2ENM A;  1JB0 E;  2RF0 A;  4J6X A;  4Q5W A;  2DL7 A;  1D1B A;  2BE7 D;  2ROT A;  4J9E A;  3CCV A;  2FZK B;  1X2Q A;  2RD1 A;  2KVQ G;  3CCQ A;  4NL3 A;  3I5R A;  4D6W A;  5M9O A;  2FZG B;  3VS1 A;  1VOM A;  1IO6 A;  1RLP C;  3QJ6 A;  4PK4 A;  3CMA A;  3JB9 F;  3CPW A;  1Y7X A;  2JUF A;  3HHT B;  1MNE A;  4JRI A;  3BE3 A;  1VQP T;  3M54 A;  2KNB B;  4VUB A;  2A0F B;  2RQT A;  3OW2 P;  3DKM A;  1VQN T;  4OMF B;  1K8A U;  2DIG A;  4PJM A;  1YJ9 A;  3CD6 Q;  2XK0 A;  2W0Z A;  2A3L A;  2LQ8 A;  2VGN A;  3BDL A;  2D0N A;  3J7A F;  3QKJ A;  3FRN A;  5FU6 B;  3CCQ Q;  2HKN A;  1PSE A;  3NGP A;  1M2V B;  1FMK A;  1QKX A;  2EYX A;  3CPW P;  1QCN A;  1C6V X;  1MV0 B;  1VQ6 Q;  2DIL A;  3IQL A;  2EYW A;  2DD5 A;  5FRN A;  3CEY A;  4C8Q A;  4R55 A;  3RDV A;  4ZNX A;  1M8V A;  2YRD A;  2IPO B;  1WHG A;  1BCM A;  1JXM A;  2ZCF B;  3I56 Q;  2VAS A;  4JS5 A;  5KYW B;  2H3J A;  1SRL A;  1BB9 A;  4IUT A;  3VS6 A;  2E6Z A;  3CME A;  4ZGE B;  1XQH A;  2QEX T;  2HMA A;  1PRM C;  4CC4 B;  2ATC B;  4PJO B;  1AZE A;  3VKI A;  3CD6 A;  3SD4 A;  2DMO A;  5GAN 2;  3I9Q A;  3L2Q A;  3CC7 A;  3G6E T;  1UEB A;  2LX9 A;  4PJO C;  5GMK i;  2DTH A;  3HPW A;  1Y0M A;  1TTH B;  1SF9 A;  1AZG B;  3PIO A;  1VQ8 T;  4YTL A;  1AWX A;  1OZ2 A;  5I21 A;  4RTT A;  2EKH A;  2RA2 A;  1QVF S;  4C0F A;  5GAM g;  1IGU A;  2K9G A;  2OAU A;  3GF5 A;  4RTV A;  2DLP A;  5KCO A;  3G4S A;  2B8A A;  1WHL A;  2ZGW A;  3CCR T;  1YJN A;  2LZ6 B;  3CBM A;  2RJE A;  3CCL A;  3R6O A;  1I5L A;  4JDS A;  1QQJ A;  1RAE B;  4BE0 A;  5DM7 R;  1BBZ A;  4B9W A;  3NTK A;  5C0M A;  4JLG A;  2K3B A;  3LLR A;  4X9C A;  2EYQ A;  1PWT A;  5IAY A;  3NTI A;  3EFO A;  4XTV A;  3OYD A;  3EGX B;  1LPL A;  1I81 A;  2ZPF B;  2X9H A;  3V8L A;  5KYX B;  3EHR A;  4MDW A;  2RI2 A;  3I5S A;  1TSF A;  2RMO A;  1YI2 T;  4PJO A;  2MOX A;  1B7T A;  4JJN K;  1YJW A;  3M0U A;  3KXT A;  2X4X A;  1S72 A;  2OI3 A;  3PMT A;  1CSK A;  3BY7 A;  4PJO G;  3UT1 A;  3OBY A;  1N5Z A;  2P0Q A;  1WXU A;  4WF2 A;  3EH2 A;  2MYS A;  3A8M B;  5EC7 A;  2EQJ A;  3UAT A;  3I56 T;  5FWC A;  1U8R A;  1JEG A;  3H9N A;  2DEU A;  1M5Q 1;  1QKW A;  2YDL A;  2MCN A;  1QP2 A;  2MF2 A;  3LX7 A;  4J6W A;  2KRM A;  4NL2 A;  1K8A R;  1BI1 A;  2XG8 D;  5DLQ E;  4LDX A;  1KD1 U;  1QWE A;  5LJ5 g;  4GLM A;  1VQ4 A;  2HQH A;  2BKD N;  1QLY A;  2DVE A;  4NS5 A;  2GNC A;  2AKL A;  3OYN A;  1NLP C;  1YP5 A;  7AT1 B;  4C92 C;  2RHI A;  3A5Z B;  3MO8 A;  3L2U A;  2YT6 A;  4J9I A;  2JMC A;  3LH0 A;  4PLL A;  3CCS Q;  3OYH A;  4PKC C;  3GIB A;  1JBM A;  5CQY A;  2X3X D;  1UEC A;  2LT4 A;  4DOV A;  4IUQ A;  4M77 B;  1PD0 A;  3S3M A;  2JTE A;  3BFM A; 
#chains in the Genus database with same CATH homology
 1Y71 A;  4M7A D;  3G6E A;  4ZTJ A;  2DEQ A;  4OP0 A;  2DZC A;  3MP8 A;  2VUB A;  3VYG A;  4C8Q B;  4DOW A;  1VQL A;  2GF7 A;  3FIF A;  4XTX A;  2XKO C;  4EMK A;  5A0L A;  1B34 A;  1YCY A;  1M90 U;  2HAX A;  2M16 A;  2LT1 A;  2PU9 B;  5J3B A;  2XDD A;  3C95 A;  4JRP A;  4E7J A;  1LNX A;  1Q7Y C;  1VQ6 T;  4C8Q F;  1LOJ A;  3QUI A;  4TVR A;  2DZ9 A;  3OSS C;  1VQ5 A;  1H64 1;  1MGQ A;  3MEW A;  4MMK A;  3VYH B;  3CCJ T;  5A0G A;  1BI2 A;  1YBY A;  3C94 A;  2PVO B;  4EMK B;  3TU4 K;  4KUD K;  3WVD B;  1Q82 U;  3L42 A;  3CME T;  1WJR A;  3V8K A;  3JCM g;  2P0P A;  2PVD B;  3ZBD A;  1D3B A;  2G3R A;  4XQ3 A;  3I55 A;  1NPR A;  1K9M U;  1QVP A;  2E64 A;  1N8R U;  2GFA A;  1VQ4 T;  3QHS A;  2ZZD A;  4C5E A;  4C0D B;  1YHQ A;  1KC8 U;  4J6Y A;  2JOY A;  5GMK m;  5FRM A;  3S3N A;  4J83 A;  1DJ7 B;  5D6Y A;  3OYI A;  4C5G A;  4N0A C;  4A4G A;  5GAM e;  2GCX A;  4L5G A;  1OI1 A;  2CZ6 B;  4M7A A;  2VGM A;  2QQR A;  3JCM W;  4GLK A;  2QQA A;  1KD1 C;  3JB9 I;  2YLB A;  3OYA A;  2JTM A;  5KH6 A;  5CK9 A;  5GAN f;  4E7I A;  4BB7 A;  2DTI A;  4QW2 A;  1VQ9 A;  4MDX A;  4FM4 B;  3JB9 H;  2ZPI B;  4M7D E;  4C92 F;  5HY6 A;  4PNO A;  3GLX A;  1YHQ T;  4C0Z A;  1N9S A;  4ME7 A;  2DXC A;  3P8B B;  1WNL A;  1JRI A;  2K2V A;  2R5M A;  4XTW A;  4Y91 A;  4A4H A;  3JCM d;  2EQK A;  2FL7 A;  3PNW C;  3HFN A;  2HQE A;  3PTA A;  3OBW A;  3OW2 S;  2CGH A;  2HNI A;  4RG8 A;  3OMG A;  3JCM h;  4ZN3 A;  5GAN 3;  3S3O A;  4OVA A;  4EMG A;  3FLG A;  4JLI A;  3CCJ A;  2WSE E;  2GFU A;  1B34 B;  5KE3 A;  4BD3 A;  1M90 C;  4C8Q D;  4MML A;  1M1F A;  2DTO A;  4EMK C;  2CYZ B;  2EJG A;  5GMK e;  4O5V A;  5GAM d;  4XU0 A;  5LJ5 h;  5GAO l;  1YI2 A;  3L2R A;  4MZT A;  2BUD A;  1K8A C;  5GAN g;  2EWN A;  3ZEH A;  2KY9 A;  5GAM h;  4JUV A;  2RK1 A;  1X75 C;  2CS7 A;  4LD6 A;  4A4E A;  4M7A B;  4JRQ A;  3QZ9 B;  5J39 A;  4BAC A;  5CO7 A;  3SWN A;  5GAM f;  2E6N A;  2K5L A;  2K3X A;  4M78 F;  5LJ5 j;  4C92 E;  4M7D F;  1KQS S;  3HKS A;  3NFC A;  2ZPH B;  5HK0 A;  4KUL A;  2QXF A;  4J5Y A;  4M78 G;  4ZN1 A;  2RM4 A;  3HFO A;  5LJ5 f;  4PJO E;  1JJ2 S;  5CR2 A;  3LYI A;  2CZ1 B;  4DA4 A;  3SWN B;  2XDB A;  3V7R A;  5GAN 5;  4A4F A;  1UGQ B;  2RJC A;  1HXD A;  2LCC A;  2JVV A;  2LVM A;  4OB3 B;  3TEE A;  2XI9 A;  1VQP A;  4X34 A;  1PSF A;  3WVE B;  4EPC A;  2LNV A;  2RHZ A;  4E7K A;  1ZQ1 A;  2R5A A;  2DAQ A;  3CC2 A;  3G71 A;  1H3Z A;  4QQD A;  3VJP A;  2XID A;  1YIT A;  3RMS A;  2MWO A;  3QII A;  3OYK A;  4NOY A;  1K9M C;  2JZ2 A;  2LC4 A;  4JRK A;  1BYM A;  3TRE A;  1NE8 A;  2QI2 A;  3A8G B;  4XU2 A;  5GAN d;  1KG1 A;  2EFI A;  4M77 E;  3PIP A;  3CCS A;  2L89 A;  3CCQ T;  3CCV T;  1K73 C;  3S6W A;  5A0D A;  5A2Q E;  1W2B A;  3UPU A;  1R8O B;  3NTH A;  4M75 C;  1G3Y A;  2P0K A;  3A8O B;  3FDR A;  5GAN h;  1NJI U;  2RH2 A;  4M77 C;  3KBG A;  3JB9 G;  3SDZ A;  1M1K C;  5CKD A;  3JCM c;  2EJF A;  1MHN A;  4PJO F;  3OYJ A;  2RHU A;  2EQM A;  3JAM E;  3CCU T;  2E12 A;  4UC4 A;  3LWH A;  4M75 D;  3H8Z A;  2ZPB B;  3ASK A;  5CKB A;  3JCM V;  4F7U A;  4ZGJ B;  3PMI A;  2JN0 A;  2X4Y A;  3KUF A;  5GAM j;  4RKU E;  4QVC A;  5LJ3 e;  3FC3 A;  1VIE A;  4Y28 E;  3M9Q A;  4C92 D;  4XTY A;  4OB1 B;  5CKF A;  2K5F A;  3ER0 A;  4KBM B;  3MCA B;  4LDY A;  3QJY A;  1VQO A;  3Q1J A;  1Q86 U;  1V29 B;  2QDY B;  1RL2 A;  3CPF A;  3BW1 A;  4P5N A;  5DY9 A;  3FEO A;  3CC7 T;  3CPW S;  2HQX A;  1ZBX A;  5LJ3 j;  1VQM T;  1Q81 U;  1M1G A;  1I4K 1;  1ZHI A;  2DKG A;  1OYX A;  4C8Q E;  5CCA A;  2E1H A;  4V2S A;  2RI5 A;  4IUP A;  4LD9 K;  2QQ9 A;  4M78 C;  1QP3 A;  1Q7Y U;  5LJ3 h;  3M55 A;  5CIU A;  3OS1 A;  4N4I A;  4OB2 B;  4M7D C;  2YHT A;  1I8F A;  1VIF A;  3L2V A;  3INZ A;  2RK2 A;  2QEX A;  3RER A;  3J81 E;  3OS2 A;  1M9S A;  5I2S A;  1VQM A;  3OB9 A;  2A7Y A;  1X6O A;  2QTX A;  4IUU A;  2DPP B;  2XIC A;  4LDU A;  2EQU A;  4M77 G;  4M7A G;  5GAN j;  5AYF A;  5GAO p;  5GAO q;  4M7D G;  2DXU A;  2X4W A;  5KCH A;  4M77 D;  3OA6 A;  3RKW A;  2VC8 A;  3AHU A;  3CBO A;  4RCB A;  2E65 A;  4L6V 5;  4B9X A;  1VQ7 A;  2XU8 A;  3CCU A;  4QVZ A;  5GAN 8;  3O8V A;  1O75 A;  4M77 A;  2D0Q B;  4FT4 A;  4C5I A;  5LL6 S;  3GPL A;  4M78 D;  1JB0 E;  3EFS A;  4J6X A;  4Q5W A;  2F69 A;  3QO3 A;  1HK9 A;  5I2M A;  3OS0 A;  4JS4 A;  3CCV A;  4L59 A;  2RD1 A;  2KVQ G;  4PLI A;  3CCQ A;  1WGS A;  2F5T X;  3CCS T;  2O4X B;  2V8J A;  4NL3 A;  4FU6 A;  4D6W A;  5M9O A;  2PQW A;  2IVW A;  4BI8 B;  5J26 A;  4RG2 A;  3DLM A;  4GY5 A;  2BIV A;  4M7A C;  4II1 A;  1IRE B;  4M75 B;  1BIA A;  2K3Y A;  3P8D A;  3QJ6 A;  5LJ3 d;  3PFS A;  3CMA A;  3JB9 F;  3CPW A;  1WJS A;  1VQ5 T;  1Y7X A;  2JUF A;  3HHT B;  2RHX A;  3X26 B;  3OS5 A;  1VQK A;  4JRI A;  1N9R A;  4XTZ A;  4M75 G;  1VQP T;  4ATO A;  3M54 A;  3QYG B;  4VUB A;  3QSU A;  2XDP A;  2Y4Y A;  3LW5 E;  1NZ9 A;  2E5Q A;  1M4Z A;  4BY6 B;  3SFM A;  1QVG A;  3DKM A;  1VQN T;  4M7D A;  4OMF B;  1K8A U;  2ZPG B;  2DIG A;  3HP9 A;  3QYH B;  3HRU A;  3JCM Q;  3OYG A;  3JB9 D;  3GNG A;  2D6F A;  5CAI A;  2GQV A;  3M4Y A;  4HCB A;  1XNI A;  1YJ9 A;  4XTU A;  3OY9 A;  2XK0 A;  2CKK A;  4CI0 C;  1Q82 C;  1GXI E;  3PT9 A;  3M5A A;  2DXT A;  3M59 A;  2A3L A;  2LQ8 A;  2YLC A;  2KK4 A;  2VGN A;  3BDL A;  3J7A F;  4QQG A;  2I2L A;  1X01 A;  2KSS A;  2WSF E;  3FRN A;  3QKJ A;  5FU6 B;  1KQS A;  2FB7 A;  4PJO D;  3CD6 T;  2MI6 A;  1G3T A;  2IG0 A;  1JJ2 A;  1PSE A;  2HD0 A;  2L3R A;  2WAC A;  1UB4 A;  3E9F A;  5IN1 A;  1W4S A;  3SB2 A;  2LRQ A;  5GAN 7;  4E7L A;  4BY6 C;  3HL8 A;  1XOV A;  5LJ5 e;  1WQW A;  4XU3 A;  4M7A E;  5GMK h;  1N6A A;  2DD5 A;  2MAM A;  5FRN A;  2OTJ T;  1U1T A;  5L8R E;  1N27 A;  3LGL A;  3MEU A;  2RJD A;  1YIJ A;  2VV5 A;  4OGE A;  1IZ6 A;  3CEY A;  4LDV A;  4HCC A;  4LDW A;  3OYE A;  2Y90 A;  2KQW A;  4C8Q A;  4R55 A;  4MZM A;  1M8V A;  4EDU A;  4E7H A;  2L5Q A;  3VU3 C;  2LQK A;  2RO0 A;  2E70 A;  4M75 F;  4C8Q G;  5GMK l;  3OMC A;  2ZCF B;  4JS5 A;  3F70 A;  5FU7 B;  1KHI A;  2H3J A;  3JCM f;  1NPP A;  1LJO A;  2HBP A;  2O4X A;  3DLL A;  1YIJ T;  2OTJ A;  2FVU A;  3MHX A;  1D3B B;  3ME9 A;  4EMH A;  2DO3 A;  5HKC A;  3LGF A;  5C6S A;  3X25 B;  2PVG B;  3UDC A;  2XD0 A;  4FT2 A;  4IUT A;  2CZ0 B;  3VUZ A;  2E6Z A;  1YJN T;  1G3W A;  1P92 A;  1VUB A;  2KMT A;  3A8L B;  1XQH A;  4ZGE B;  5GAO m;  2QEX T;  3CME A;  3JCM P;  1YIT T;  4M7A F;  2FHD A;  1KQ1 A;  2L8D A;  3M4G A;  4N4G A;  4HT9 A;  2NLU A;  3RIR A;  5KE2 A;  3G71 T;  4PJO B;  1Y96 B;  1UGP B;  3VKI A;  3CD6 A;  3BDU A;  4F7U B;  2EIF A;  1SSF A;  3MET A;  2LDM A;  5LJ3 f;  3QBY A;  3SD4 A;  1G3S A;  2Y4X A;  3M53 A;  4BE1 A;  3MEA A;  2M0O A;  3UWN A;  5LJ3 g;  5GAN 2;  5DLO A;  1YJW T;  4J7F A;  3L2Q A;  1WQ7 A;  2WSC E;  1VQL T;  3CC7 A;  3QG1 A;  4CRI A;  2EJ9 A;  1UEB A;  2DD4 A;  5CKH A;  3G6E T;  2LX9 A;  3EAE A;  1O9S A;  4C92 G;  1WPY A;  1VQO T;  3T9N A;  4PL6 A;  4PJO C;  2ZPE B;  1OZ3 A;  4OGC A;  5FRO A;  2DTH A;  2V8I A;  3HPW A;  5GMK i;  1RI0 A;  4BI4 A;  4BUG A;  3CCE A;  3DB4 A;  3LWI A;  3PIO A;  1VQ8 T;  4YTL A;  1OZ2 A;  5I21 A;  4FSX A;  3X20 B;  4M78 E;  2RA2 A;  2PUK B;  4M78 A;  4C0F A;  1W2B S;  1QVF S;  2X4J A;  5GAM g;  2DIQ A;  4F7U G;  3RMQ A;  4ELY C;  3A8H B;  3X24 B;  1VQK T;  1QVG S;  2OAU A;  5CQX A;  4HKE A;  5FLX E;  3GF5 A;  3V7S A;  5KCO A;  4XAX B;  1Q86 C;  3G4S A;  2LCL A;  2B8A A;  3RKY A;  1EIF A;  3RKX A;  4Z02 A;  3M56 A;  3CMA T;  2CZ7 B;  1Y07 A;  5IT9 E;  2V8K A;  3X28 B;  3M57 A;  4KUI A;  1Q81 C;  3CC4 A;  2ZGW A;  2DK3 A;  4M7D B;  3CCR T;  3CCL T;  1YJN A;  3CBM A;  1U1S A;  1Y96 A;  3CXC A;  2RJE A;  1KC8 C;  3JRZ A;  4ZTF A;  3CCL A;  4XU1 A;  3MP6 A;  3R6O A;  3JB9 J;  1I5L A;  3OYY A;  2M1H A;  4JDS A;  4BDZ A;  5HK3 A;  4BI3 A;  3WXM B;  4M78 B;  2VXF A;  1VQ9 T;  2EKO A;  4BE0 A;  1UGR B;  5DM7 R;  4FIB A;  3G7Z A;  5CVI A;  3VV0 A;  4ELZ C;  4B9W A;  3GP8 A;  3OYM A;  3H6Z A;  4BE2 A;  3NTK A;  2OTL A;  3HRS A;  5C0M A;  3CCM A;  4JLG A;  3L2W A;  1QVF A;  3LLR A;  4RMO A;  4X9C A;  2EYQ A;  4IUR A;  5IAY A;  3NTI A;  3JCM X;  2QA4 A;  2K57 A;  5FU6 C;  4XTV A;  2F5K A;  4HA8 A;  2MWP A;  3OYD A;  3OYC A;  1VQ7 T;  5GAN 4;  3HSB A;  4HT8 A;  3OYL A;  3I56 A;  3V8J A;  2EAY A;  1NJI C;  1I81 A;  2ZPF B;  3GNF B;  4MZP A;  3E19 A;  3C4S A;  4N4H A;  3V8L A;  3J80 E;  4C92 A;  3I55 T;  3FB9 A;  4MDW A;  2RI2 A;  4QVD A;  5GAO r;  3M58 A;  2K5I A;  3SWN C;  1YI2 T;  4PJO A;  4XK8 E;  2E10 A;  1S72 T;  4JJN K;  2O01 E;  5GMK j;  4BDY A;  3OYB A;  1YJW A;  2QQB A;  3QPH A;  4IUV A;  4J7I A;  4OB0 B;  3PGG A;  2JTF A;  2R57 A;  4F7U F;  4C5H A;  2QQS A;  3JSC A;  4DQ2 A;  1BIB A;  2RHY A;  1XTD A;  3KXT A;  1VQ6 A;  2P4T A;  1G5V A;  2R58 A;  3L2Z A;  3FJP A;  1KHC A;  2X4X A;  2C06 A;  1S72 A;  4R56 A;  3PMT A;  3UT1 A;  3BY7 A;  2PUO B;  3OQ5 A;  3OBY A;  1UGS B;  4J8O A;  4PJO G;  2RI3 A;  3DB3 A;  3ZFJ A;  3C12 A;  2P0Q A;  5D6W A;  3VUB A;  1KQ2 A;  2M9U A;  1WJQ A;  4WF2 A;  5LJ5 d;  4C92 B;  3JCM e;  4RCC A;  5FU7 C;  3OW2 A;  3QXE B;  4A54 A;  3A8M B;  1FX7 A;  2EQJ A;  3OSV A;  3I56 T;  3CXC S;  3RES A;  2MMP A;  1BKB A;  1U8R A;  4FL6 A;  1VQN A;  1K73 U;  1M5Q 1;  4QQ6 A;  2E41 A;  1FWZ A;  1QP2 A;  4M75 A;  2MF2 A;  4M75 E;  3L1A A;  3LX7 A;  4J6W A;  4A53 A;  3CCM T;  1TH7 A;  2QA4 T;  4O6J A;  4NL2 A;  1BI1 A;  2KDS A;  2OTL T;  2LTO A;  2XG8 D;  2X35 A;  4F7U E;  5DLQ E;  3HRT A;  4LDX A;  2KAF A;  1KD1 U;  4KT0 E;  3GOX A;  2JNG A;  1BI3 A;  5LJ5 g;  1VQ4 A;  3N5B B;  4E47 A;  4IKF A;  1QW1 A;  2BKD N;  3E1S A;  2DVE A;  4NS5 A;  4N0A A;  2FYK A;  4C8Q C;  3CC4 T;  2AHJ B;  2DXB A;  2XHC A;  3TCJ A;  3OYN A;  3CCR A;  4M77 F;  1M1K U;  4C92 C;  2RHI A;  3EFR A;  3V7C A;  3A5Z B;  3P8H A;  2RJF A;  5D6X A;  3QZ5 B;  3MO8 A;  5EG2 A;  3L2U A;  3CC2 T;  3OYF A;  3G4S T;  2K4Y A;  3QDR B;  3LH0 A;  4PLL A;  1AHJ B;  3OYH A;  2D9T A;  4PKC C;  5GAN 6;  2DJZ A;  5GAO n;  3JCM J;  1N8R C;  3GIB A;  1JBM A;  5CQY A;  3E9G A;  4ZGD B;  3URG A;  4OF1 A;  5CKE A;  1BI0 A;  4HCZ A;  3CCE T;  1FXX A;  2LT4 A;  4C0D C;  1VQ8 A;  4DOV A;  3JCM b;  2VYT A;  1YJ9 T;  3CBP A;  4IUQ A;  4M77 B;  4X9D A;  4C0G A;  5GAN e;  3MP1 A;  2YRV A;  2VXE A;  4A4K A;  3S3M A;  3MEV A;  3RUX A;  4M7D D;  3BFM A;  2RB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...