3N5BB

The complex of pii and pipx from anabaena
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
b'SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3n5bB01
2XKOC 2XG8D 3N5BB
chains in the Genus database with same CATH superfamily
1E7OA 2HMAA 3OMCA 1ZSZB 4ME7A 1X01A 2MMPA 5IN1A 1HYOA 4RTTA 2RA2A 2M16A 4RMOA 1B34A 2BIVA 1ZSZC 2KE9A 2KVQG 2KAFA 5J26A 2OX7A 4L6V5 1K76A 2SRCA 5HK0A 2D1XA 4JUVA 1M90R 3I56T 3JCMV 2JM9A 5KYYA 2JOYA 3EH1A 2EFIA 5A0DA 4ZTJA 2CP0A 2ZAEA 2JS0A 1RLQC 2HSPA 3WVDB 3PGGA 1KC8U 3S3MA 2VB6A 1PSFA 3JB9I 3JSCA 3T9NA 1NLPC 2K5IA 3CCMA 1M2OA 1PG5B 3OMGA 4EMHA 3OW2A 1VQMA 1ABOA 4ZGDB 4HXJA 2GTOA 3SWNC 1ZSZA 2VASA 2RQUA 2LCLA 3DLMA 4M4ZA 2C06A 3AHUA 4XTWA 4KUIA 2XI9A 2O4XA 4NL3A 4J9BA 4II1A 3S3NA 2QDLA 5DLOA 2FZKB 2HKNA 5IXFA 2D6FA 4TVRA 3CCUT 4E7ZA 1HD3A 3RMSA 1K8AR 2MWPA 1M90U 1GXIE 5IAYA 2CREA 2ZPBB 1C1AA 2JTMA 3PVLA 1GRIA 1N9SA 3CCQA 3SWNA 3H0IA 1TU0B 4RTYA 1IHWA 2KSSA 1TUDA 2ROTA 3CCET 1OULA 4ZGEB 4RTWA 1YJ9Q 4HT8A 2HAXA 1NBEB 4D8KA 2QTVA 1RUWA 3L42A 3CMAQ 4ZN1A 2BTTA 2P4TA 1VYUA 2E6ZA 5CK9A 4MZMA 4OGCA 3F70A 4J83A 2R5MA 3HRUA 2X4XA 1NM7A 3BDUA 4JLIA 2YT6A 2GBQA 3QZ9B 2FO0A 2FG0A 2RQRA 3JCMh 4ANJA 5GAMe 3VKIA 1PNJA 3VYGA 1YITQ 4J6XA 1Q7YR 1RL2A 3KBGA 5KE2A 1VQKT 3M56A 3JCMW 2O88A 2A36A 1ZHIA 1HSQA 3N5BB 4AT1B 4E7KA 1VQOA 2RQWA 1X69A 3UDCA 2K4YA 1Y57A 4IIOA 3C0CA 1K8AU 2NUTB 1SF9A 3I55A 4CRIA 2A28A 5CKEA 2J6FA 1QP3A 1BCOA 4IUPA 1WHMA 2JUFA 5A0LA 1U3OA 3EGXB 2EWNA 2XHCA 1WXBA 3CPWA 3TVTA 3QBYA 1TUCA 4PJOG 1NYGA 2JMCA 1PC0A 4B9WA 3OYHA 4XK8E 2M02A 2HL5C 2LJ1A 1HJDA 2KT1A 3FJPA 4XTXA 3PNWC 3J80E 5GAN6 4N4IA 3M0TA 3H0FA 4J9EA 3CMEA 4QKUA 2HEQA 2K3XA 4LNPA 2COWA 2GF7A 4N0AC 4PLIA 4C92D 3UATA 5DLQE 2X4WA 5GMKi 3OBYA 2OTJT 3I56Q 2V8JA 2QQBA 1TWBA 5FU6B 2NUTA 3MKDA 4FYXB 4AFZC 2XD0A 1BYMA 3VS5A 1QVGS 5L23A 2EYXA 1G3SA 2K79A 2Y4XA 1J3TA 5FU6C 1VQNA 2X3XD 2X4JA 5GANh 4C5GA 3EFOB 1V1CA 3EGXA 2BKDN 3X26B 1SRMA 1X2KA 1NYFA 2IVWA 3M5AA 3AT1B 5CCAA 2DEUA 4KH1B 1NEGA 4OB0B 8ATCB 2VVKA 4L59A 3OYKA 2AT1B 2RHZA 4N0AA 5LJ5h 2CP6A 4E7HA 2JT4A 4ESRA 2DTIA 4FSXA 3GNFB 1E6GA 2IPOB 2D9TA 4BE0A 2BZ8A 3CCMT 5FRNA 4RTVA 4KGXB 5LJ3e 2CKKA 1UEBA 3M4YA 1D0YA 1S72A 2EIFA 3X28B 2M0OA 5A0GA 1QVFA 2BZXA 3KFVA 3CCUQ 1Q81R 1W70A 1WHGA 3SEMA 4AFSC 1YIJQ 1TUGB 3HFOA 1RACB 3EG1A 1WYXA 2P0PA 1R8OB 5LJ3h 1WJQA 4X34A 4KGVB 3SFMA 1IXDA 1I4K1 1D0XA 3H0HA 3EFOA 1W2BS 3L2WA 4IIMA 2J7IA 4BI3A 3RR6A 3CCJA 4LDVA 1ABQA 3CCEQ 1VQ8Q 2GNCA 2X4YA 4R0KA 3BW1A 4D6WA 1AOJA 4MMKA 2E4HA 2XKOC 2EJGA 1OX9A 1MUZA 2V1RA 3MEAA 5D6WA 5AYFA 5EG2A 3CBPA 2NUPB 1PRMC 1M1KC 4PJOB 2EQMA 4RTUA 3KXTA 2RQTA 2D0NA 4Y91A 1DJ7B 2RMOA 4R55A 3L2RA 1LNXA 4ZNXA 2D8HA 2K5LA 2RF0A 4PJMA 4QQ6A 1AD5A 2DXBA 1W4SA 2RHYA 5L8RE 3REAB 4X9DA 1OPKA 2YRVA 3MEVA 3PMTA 3RUXA 2CP7A 5GAN3 1VQ5A 3MJXA 4M77D 2VXFA 1ACMB 2K2MA 1OPLA 1G3WA 2DIGA 3GLXA 2EKHA 5CKDA 2K5FA 1JJ2A 2DJZA 4F04B 2CZ6B 1Y07A 2MF2A 1VQOT 1WXTA 1VQ9A 4C5HA 3NTKA 3L2QA 3LGFA 3INZA 1BU1A 1KIKA 2QTXA 2NUPA 2FZGB 1V29B 3P8BB 3EGUA 3HP9A 4F16A 2QASA 3DB4A 1MMAA 2K2VA 3QDFA 1RAAB 1YWPA 5I2SA 4P5NA 3CC4A 2KI7A 2LRQA 2KYBA 1BB9A 1OQKA 4OMOA 5KYXA 1YJNA 1B3QA 2RJEA 2XDDA 4XTYA 3MP1A 4A4FA 4CC4B 1PCXA 3CPWP 1M4ZA 2YUOA 3FEOA 1MMGA 2MIOA 5GAMd 1M2VB 4ORZA 4V2SA 1OOTA 3QJ6A 5HY6A 3CMET 2LQNA 2OTLQ 4FSSA 3G71A 4M7DD 4E47A 3MEUA 4BD3A 4KRTA 4LDUA 2EQIA 1Q82C 4X1VA 2GTJA 1GFCA 1XNIA 3CCVT 1NLOC 4QQGA 1Q86C 2J6OA 4JJCA 1KC8C 3TSWA 5I11A 1UGRB 2P84A 3CBOA 3RIRA 1VQNT 1NPPA 2XDBA 2ZCFB 4HVUA 3CCMQ 1VQ4A 4PJLA 3NHNA 1PRLC 4IKFA 1JQQA 1VQMQ 1MMNA 7AT1B 2K9GA 4FW2A 1VQPT 4A54A 1M1KR 5FW9A 4JZ3A 1BKBA 1M2VA 1EIFA 5D6XA 1WHJA 4JRQA 1SEMA 4CC3A 1WIEA 3EH2A 3V7CA 1V76A 2LTOA 5GANd 5HCKA 4M75D 1AWJA 1M27C 1X6OA 3A5ZB 2KEAA 1TSFA 2A37A 2YHTA 4JZ4A 3I5RA 4JRKA 2ENMA 1WJRA 3UF4A 4OB3B 3OB9A 3LH5A 1QVFP 5LJ5d 3CCQQ 3WXMB 3UA6A 3X25B 2Z0WA 4DBQA 2MK5A 2JW4A 3CCSA 3G4SQ 5I22A 2A08A 3OW2S 1IZ6A 2HBWA 2WACA 3VYHB 2YUNA 1KQ2A 1M8MA 3Q1JA 1I0CA 2R57A 2DYBA 3I35A 1M1KU 3QWYA 2RJCA 4D8DA 3P8HA 2CP2A 3GP8A 1UG1A 5LJ3d 5GAN2 1UJYA 1VQKA 4AFUC 2KXCA 4OP0A 2VKNA 1ZLMA 3JCMP 1KQSS 1UJ0A 3KUFA 3VJPA 4BE1A 3CXCP 1SHGA 4BY6B 2AIRB 1GCPA 3NPFA 1VQOQ 1VQ5T 1JB0E 4PKCC 1M3BA 1RAIB 2GFAA 1B34B 1MV3A 1BIAA 2DILA 3I55Q 4BY6C 1Q82R 4R56A 3M0UA 2E10A 1VOMA 2FHDA 1VQ9T 1Q86R 3TU4K 4LDWA 2RHUA 2LX9A 4FCYA 1YHQA 2FRWA 4KH0B 1KHCA 1JJ2P 2OJ2A 2PNIA 4JRIA 2E6NA 2F1LA 4PFZA 1FXXA 1VYTA 2WSCE 4QW2A 1I5LA 3EFRA 1S1NA 2DFUA 1Q7YC 2WSEE 5IHIA 2RK2A 3OYFA 2DF6A 2LVMA 3QYHB 2PU9B 3CC4T 2EPDA 3CMEQ 4BACA 5GAOr 2OTJA 2CZ1B 1YJNT 1YNZA 5GAN8 1MGQA 3GF5A 2EYZA 3M54A 3GNGA 1VQ7Q 3V8JA 1R0CB 1CKBA 4XQ3A 4BI8B 2O4XB 2HQXA 3ER0A 3UA7A 1MMDA 1JXOA 2M0YA 1M1GA 1H3HA 1UGSB 3G71T 1YI2T 3FDRA 2V8IA 4JLGA 3X20B 1VQNQ 5KE3A 1BI1A 1Q82U 2LZ6B 4M78D 1K4US 2LX7A 3QXEB 1I1JA 1RAGB 1Q86U 2CZ7B 2G6FX 1VQLT 2F2WA 3SWNB 4WF2A 2OI3A 2XMFA 3SHWA 1AVZC 2DL5A 4EMGA 1KK7A 4C8QD 1WQWA 1K0SA 2QEXQ 1WFWA 1VQ4T 2I2LA 5GMKe 2YLCA 4JJDA 2JXBA 1Y0MA 1UDLA 2HZYA 3GPLA 3RKXA 1S72Q 4LE9A 2P0QA 5FU7B 4EMKC 3JB9D 2EGCA 3V7SA 2HKQB 4HA8A 3PFSA 5IHNA 5GMKh 5FU7C 2JZ2A 2RNAA 3A8OB 2X9HA 2M1HA 4DBHA 2F5KA 2P4RA 4RCCA 4E2FB 2LP5A 3OS5A 4QVZA 3CCJQ 2L3PA 1LOJA 3NMZC 1X6GA 2CS7A 2E3HA 3J7AF 3TCJA 4J7FA 1W6XA 3EAEA 2OAUA 4NL2A 2HBPA 3H41A 4EMKA 2QQ9A 3JCMe 1I81A 1QCNA 1NEBA 3RDVA 3QIIA 3CCST 3OYMA 1JO8A 5GAN7 2L8DA 3O5ZA 1PM3A 3L2VA 1TOVA 3VS2A 1Q81C 2EGEA 2AKKA 3VS4A 1QCOA 3SB2A 2DVEA 3OYLA 4JS5A 3U23A 5GMKl 4GBQA 2E70A 3EGDB 2JJ9A 2PTKA 4FL6A 1M3CA 2ZPEB 1ZBXA 2QDYB 2F2VA 1WI7A 1D0ZA 3R6OA 2O9VA 1O75A 2DNUA 1I5OB 5KH6A 2FL7A 1K0XA 3M55A 3FLGA 3FB9A 4CI0C 2VGNA 4F7UF 3QDRB 4J9DA 1CKAA 1KD1R 2CYZB 2DXCA 1G2BA 2K3BA 1QVPA 3FRNA 1SG5A 3CD6Q 2RHIA 2KMTA 2KROA 2YRDA 2COYA 2CDTA 1SSFA 3LWHA 3DLLA 3JCMJ 2DXUA 5CAIA 3H9NA 3VS0A 3CC4Q 1YHQT 3OYDA 1D3BB 2DIQA 1YJNQ 4F7UE 2DZCA 1PD1A 2QGFB 3L2ZA 1SKUB 1Y7XA 2VXEA 2KNBB 4HKEA 3EGDA 4JJNK 4KBMB 4YTLA 1Q7YU 2AK5A 5GANe 4M78F 3G71Q 2M9UA 2V1QA 3TQ7P 1G8XA 2BE9B 3CCVA 2E5KA 3PE0A 4DBFA 2DPPB 2F5TX 3OS1A 3C95A 2QQAA 5D6YA 5LJ5e 3HHTB 3PMIA 2ED1A 4RKUE 3HKSA 4QQDA 1H92A 4BB7A 3A1PA 4A4HA 3THKA 4M78E 1VQ4Q 2RB6A 3JB9F 2KYMA 1K1ZA 1VQPA 4LD9K 1D3BA 3NTIA 3E2UA 1QCFA 5C0MA 2EQKA 3NGPA 1AEYA 1OEBA 3A8MB 4Y92A 4HT9A 3PTAA 4DEXA 1M5Q1 3NFCA 1BK2A 1ZA2B 4DOVA 3EHRA 1TG0A 2ECZA 2QA4T 4CC7A 2OAWA 4A4GA 5KCHA 3QUIA 2PUKB 2E5QA 2J6KA 1CSKA 3CC7T 2HQHA 4OMFB 5FLXE 1PHTA 2E64A 1WX6A 1RAFB 3CCSQ 5J3BA 3OS2A 5CO7A 3O8VA 2L3RA 4GLMA 2KGTA 1ARKA 1EX4A 3JCMc 3FJ5A 3CXCA 1PSEA 2DAQA 1Q95G 1UHFA 2EKOA 3HRTA 2DL3A 2H3JA 1U1TA 2JS2A 2ESWA 1VQKQ 1VQ6A 2CT3A 1RI9A 1VA7A 1SSHA 3GOXA 5KYXB 4RTXA 1Q81U 3MP8A 4EIKA 1G5VA 2A3LA 1T3LA 1RAEB 1IB8A 1X75C 1D09B 3VRZA 2EVRA 1QWEA 5DY9A 1TS9A 4FM4B 5M9OA 2L2PA 2RJFA 1U1SA 1T0JA 2HL3A 4E6RA 1ZUKA 5GAOl 1WHHA 3HFNA 4BI4A 2FRYA 2X35A 2DKGA 2YDLA 2B86A 5GMKm 1C0MA 1RI0A 4OMMA 2H8HA 3TSZA 4E7LA 4M78G 3QKJA 4N4HA 1M9SA 4DQ2A 1AZEA 1YHQQ 2FPEA 2DZ9A 3CC2A 3JCMd 2B8AA 5CR2A 1ZX6A 2PZ1A 4C92F 1QVGA 2ZPGB 3I5SA 3MCAB 5GAMg 3OS0A 5IT9E 1MNDA 3OYBA 1Z9ZA 3EFSA 1FYNA 3OYIA 2OTJQ 3BFMA 2M51A 3M0SA 2NUZA 2F69A 1ZQ1A 2ZGWA 5EC7A 3OSVA 3JB9G 1ZBJA 4JS4A 4C0FA 1W1FA 4BE2A 1YI2A 1NPRA 4C92E 2C0TA 4EDUA 2EAYA 2BUDA 3LYIA 4L5GA 2VC8A 1KFZA 3CCRT 4LDXA 2KT8A 2LDMA 3VUZA 2ZPFB 4Z02A 5GAMf 3VS7A 5GAN5 1VQLA 3UPUA 2ED0A 1AWWA 3ME9A 3OYYA 2K7AA 3LGLA 4HVWA 2XK0A 4BDYA 4FYYB 2D8JA 5GAN4 2O31A 1W2BA 4MZTA 4FT2A 3EG2A 3EG3A 2RO0A 4PJOD 2RHXA 4E7JA 2LMJA 1YCYA 2VWFA 2CUDA 3FC3A 4JDSA 3BDLA 1SRLA 2P0KA 2J05A 1WLPB 2CZ0B 2CSIA 1N27A 1N9RA 2DLPA 3M58A 1OYXA 3QG1A 4MMLA 4J5YA 2HNIA 1KQ1A 2YWWA 4IUVA 1QWFA 4XTVA 2K57A 5CKBA 2DL4A 1B07A 2BZYA 1LVKA 4M7AD 1FMVA 2HDAA 2EBPA 1PD0A 1LJOA 4OMQA 4UC4A 1GL5A 3JRZA 3G6EA 5FRMA 2RI3A 2KRNA 4QVDA 2LCCA 1UB4A 4M78B 2KBTA 1TTHB 4ZGJB 5LJ3g 5GAMj 8AT1B 4J8OA 4F7UA 1M30A 4M77F 5LJ5f 3S3OA 4HCZA 1U8RA 2MPXC 4PL6A 4EPCA 4DBRA 4M78C 2JTEA 2KDSA 4Z88A 2BE7D 3RERA 3CEYA 1N6AA 1NJIC 1X2QA 1VQ6T 2AZSA 2YUPA 1JU5C 2VYTA 2D0QB 1OZ2A 3OYAA 2PUOB 4C92G 1B7TA 3ZBDA 1M1FA 2DK3A 1GBRA 3L1AA 3BE3A 4M77E 2NYSA 4LUEA 5LJ3f 3CMAT 3HPWA 1BCMA 3M59A 1FX7A 1ZUYA 3META 3WVEB 4DOWA 4OF1A 2ZPHB 4C0ZA 3H6ZA 1RLPC 2QAZA 4M78A 1YITT 2GQVA 2XU8A 1OV3A 4LD6A 3LX7A 1F1BB 3P8DA 2ABLA 2EYYA 4N4GA 2IIMA 2O2OA 2KRMA 4C5IA 2LQKA 4BDZA 5FROA 3C94A 3HL8A 4LUDA 4E7IA 1IRXA 1AWXA 4QT7A 4XU2A 1IREB 5GANj 3CC2T 2MI6A 1XOVA 4M7DF 5I2MA 2KK4A 2GFUA 2VV5A 4PLLA 1UTIA 1KJWA 2CSQA 3MHXA 4AG2C 3M4GA 4ELZC 1O9SA 5LJ5j 1WJSA 2QXFA 1N8RC 1NG2A 4AG1C 1Z9QA 2XG8D 1YJWA 1QVGP 4XU0A 3CCVQ 4Z8AA 4C0DB 2DTHA 3JV3A 2XIDA 1KD1C 3PT9A 5GJVB 4M7DE 3IQLA 4XTZA 4C0DC 2VGMA 3VRYA 1D1CA 1H3ZA 2OTLA 5A2QE 3CPWS 4NS5A 4PJOF 5GJWB 1NE8A 3E19A 5LJ3j 2PVGB 2O9SA 1XTDA 1VQPQ 2H3EB 4EMKB 3L2UA 3CPFA 2PVOB 4M75F 1QLYA 4FIBA 5KYNA 2GGRA 1TH7A 1AWOA 2QA4A 1YWOA 2YXYA 4PJOE 2MWOA 4M7AF 1RABB 5IXBA 2LJ0A 5LL6S 3G1JA 1Y96B 1SPKA 3M0RA 1W2BP 3H8ZA 1YBYA 1NJIR 4M77G 2VUBA 1UUEA 2CP5A 4C92B 3CC7A 2GQIA 3OBWA 5HK3A 4M75E 3OYCA 4DA4A 3MEWA 3A8LB 4ATOA 5HKCA 4Y28E 1M3AA 4OMNA 4C92C 2L3SA 1IO6A 1KQSA 3OSSC 3ASKA 1UGVA 3HTRA 3C12A 4M7AE 4MDXA 3JCMQ 4DEYA 4C5EA 3LW5E 3HSBA 3G6ET 1YIJT 2PQWA 4HCBA 4VUBA 1UECA 2ROLA 2DEQA 2DD5A 4J9GA 2FYKA 4FYVB 3MP6A 1WQ7A 4ZN3A 2RJDA 2DERA 3JB9H 4A4EA 1QVFS 3CCLA 1VQ6Q 4OMPA 1QMCA 1AHJB 1VQ8T 3G4SA 1Y96A 2JTFA 4J9FA 1VQ5Q 4O5VA 1BBZA 3SDZA 3ZL7C 4C92A 2R58A 3ZEHA 2L89A 1IGQA 1NJIU 4RCBA 1N8RR 2DXTA 1WDXA 4M7DG 2EYWA 1VQ9Q 4OMLA 5GAOn 2V26A 3TREA 1IHVA 5CIUA 1NZ9A 2QYZA 4C0GA 4KT0E 4PJNA 4OGEA 1TXQA 2HCKA 2RM4A 2DO3A 3DKMA 3CC2Q 3CXCS 5GAMh 3OYNA 1XJWB 1K9MC 2RPNA 1WPYA 2FB7A 2ZZDA 1K73C 1D1BA 4AMCA 2A0FB 3LH0A 2DVJA 5I21A 1KG1A 2K3YA 3HRSA 4F14A 4WCIA 1X27A 1QKXA 1KSWA 2J06A 2NLUA 1GCQC 1YI2Q 1PWTA 1D1AA 2CUBA 5CKHA 2DRMA 4IUQA 3CCRA 1JJ2S 1UFFA 1N8RU 2JMAA 4MDWA 4M75G 4M77B 2LNVA 4JRPA 1YJWT 1ZA1B 3NTHA 2DL7A 3E1SA 4C8QF 4A53A 2QQSA 1VQLQ 2DETA 1JRIA 2QQRA 1KD1U 1VQ7A 2G3RA 2X3WD 1T0HA 4M77C 2CH4W 3PIOA 2NWMA 2LT1A 3PVQA 4M7AG 1UHCA 1X43A 2OTLT 4KULA 2ZPIB 5CKFA 4GY5A 2KY9A 2KR3A 2LQ8A 1WGSA 1WHKA 2AHJB 2XICA 1EFNA 1GCQA 2FPFA 4FW1A 1C6VX 1I8FA 2CGHA 1QP2A 3SD4A 4C8QE 4PNOA 2QG9B 4HVVA 4XTUA 1E6HA 3OY9A 2RH2A 2L5QA 4CC2A 2O01E 3E9FA 4A63B 2E1HA 2QEXA 4M77A 2DYIA 2FPDA 1VQMT 3D7SB 5AT1B 1G3TA 2V8KA 3DB3A 3X24B 4M7DB 2DBKA 5IH2A 1QQJA 2Y90A 3QYGB 3CBMA 1OZ3A 1Y71A 2GCXA 1ZUUA 3VS1A 3OYJA 4Z89A 3G6EQ 3OW2P 1RADB 1AZGB 3QHSA 5FWBA 4M7DC 2JVVA 1H8KA 1GFDA 3RMQA 1P92A 1HK9A 4RTZA 1WA7A 3VUBA 4J9IA 4JJBA 4F7UG 4MZPA 1K9MR 3E9GA 1OX8A 5ECAA 3M57A 1AT1B 3URGA 1K73R 1KQSP 3CCQT 1QKWA 4HCCA 2LT4A 3QPHA 3A8HB 2DMOA 3VV0A 1R77A 3CCLT 1YJ9A 1WHLA 2RI2A 2E12A 2QGGA 3G4ST 3LLRA 9ATCB 3CMAA 1U5SA 2W0ZA 1OU9A 4FU6A 4M7DA 3G7ZA 3M0PA 4PJOC 1PKSA 4LXCA 4E7SA 4M75B 3RBBB 6AT1B 2AKLA 2DL8A 3V8LA 3LWIA 3QSUA 1YITA 2COZA 2A7YA 3JCMg 3QJYA 3OA6A 2JM8A 4M75C 1T3SA 1VIFA 4M7AB 5KYWB 1VIEA 3CQTA 3GBQA 1K9AA 2YLBA 2E65A 2EYQA 2C0OA 3R6NA 3UWNA 2YUQA 3ULRB 2DRKA 4J9HA 3OYGA 1WNLA 4PJJA 3A8GB 4M7AC 4C8QG 2LCSA 2L0AA 1MHNA 1K9MU 3I55T 4O6JA 2RQVA 1GBQA 2SEMA 3CD6A 1K73U 4IUUA 4PJOA 1LCKA 3TEEA 2CH4A 3JCMf 3UT1A 3S6WA 3RKWA 1G3YA 1UGPB 1YJWQ 2IG0A 3QZ5B 2EJ9A 4J9CA 4M75A 2RN8A 3GIBA 4KUDK 2XDPA 1BI3A 2MCNA 1ZSGA 5KCOA 3OYEA 2QK0A 3BY7A 3QWXX 1G83A 4M7AA 4BUGA 5KYWA 2DM1A 4Q5WA 1OU8A 1BI0A 2W10A 3EHQA 5GMKj 2DE0X 2DBMA 3V7RA 3I56A 2EW3A 3RESA 2DA9A 1OI1A 4GLKA 2E41A 1VQ7T 4OB1B 4X9CA 2DTOA 4XU1A 1YP5A 2KQWA 2FZCB 1HXDA 1FMKA 2LC4A 1IGUA 2EGAA 4J6YA 1EZZB 5GAOq 1WZOA 3EG9B 4F7UB 2CP3A 5GANg 1PKTA 2C0IA 2QA4Q 5IHKA 1SHFA 3EG0A 5CQYA 3JCMX 4WTOB 3OQ5A 1H641 3JB9J 4LN2A 2ATCB 3A98A 1JEGA 1YFNA 2FEIA 2MYSA 2RD1A 5LJ5g 4PFPA 3M9QA 2HSEB 4JPBW 3CC7Q 3REBB 2E3IA 2JNGA 2R5AA 2LNHB 2YRCA 2QEXT 4B9XA 2Y4YA 2RI5A 2YSQA 4PK4A 4XAXB 3PIPA 3MPUB 3CCUA 1S72T 1BIBA 4F17A 5GANf 3MO8A 1U06A 2DJQA 4NOYA 1YIJA 2EJFA 1M90C 1M8VA 4XU3A 2MAMA 4J7IA 4HCKA 4OVAA 2EQJA 1MNEA 3QO3A 1UE9A 1KHIA 5FWCA 2JN0A 3EG9A 1LPLA 3V8KA 3M53A 3VS3A 2RK1A 3CCEA 1R0BG 5C6SA 1VQ8A 2KXDA 3CCJT 3CCLQ 3RKYA 2DX1A 4C8QB 2MOXA 4RG8A 1QW1A 4ZTFA 4IUTA 1WXUA 4QVCA 4LDYA 1YN8A 4FT4A 3I9QA 2K6DA 1I07A 4C8QC 2X51A 2LJ3A 3ZFJA 4IURA 4AFQC 4RG2A 5KYUB 4K11A 1YJ9T 2DD4A 2WSFE 5DM7R 4OB2B 4B6MA 2FVUA 3C4SA 3M0QA 2EQUA 2CT4A 1MV0B 4A4KA 5GAOp 1YCSB 1N5ZA 3J81E 4RUGA 5J39A 1K8AC 3JAME 5CQXA 2QI2A 1JBMA 3VU3C 5GAOm 4FYWB 5CVIA 4KGZB 1FMWA 1VYVA 2F2XA 3FIFA 1FWZA 1BI2A 4C8QA 1VUBA 1UGQB 2HD0A 4ELYC 1RAHB 2L3QA 5KYYB 2LQWA 1A0NB 1KC8R 4J6WA 1X6BA 5D7UA 1XQHA 3RNJA 5KYUA 3CD6T 3VS6A 3JCMb 4PFOA 2I0NA 1JXMA 2HQEA 2KRSA 3CCRQ 2AZVA 2PVDB
chains in the Genus database with same CATH topology
5GAOn 4IKFA 5J3BA 3TREA 3OS2A 5CO7A 3O8VA 2L3RA 5CIUA 1VQPT 3OMCA 4A54A 4ME7A 1NZ9A 1X01A 4C0GA 4KT0E 3JCMc 4OGEA 2MMPA 3CXCA 1PSEA 2RM4A 1BKBA 5IN1A 2DAQA 1EIFA 2DO3A 3DKMA 2RA2A 2EKOA 2M16A 3HRTA 5D6XA 3CXCS 4RMOA 4JRQA 2H3JA 5GAMh 3OYNA 1B34A 2BIVA 1U1TA 1K9MC 2KVQG 2KAFA 5J26A 4L6V5 1WPYA 3V7CA 5HK0A 1VQ6A 2FB7A 4JUVA 2LTOA 2ZZDA 5GANd 1K73C 4M75D 3I56T 3JCMV 3GOXA 1X6OA 3A5ZB 2JOYA 3MP8A 1Q81U 2EFIA 1G5VA 5A0DA 3LH0A 5I21A 2A3LA 1KG1A 4ZTJA 2K3YA 2YHTA 4JRKA 3HRSA 1X75C 3WVDB 5DY9A 3PGGA 4FM4B 1WJRA 4OB3B 5M9OA 2RJFA 1U1SA 3OB9A 1KC8U 3S3MA 5LJ5d 2NLUA 1PSFA 5GAOl 3HFNA 3JB9I 3JSCA 3WXMB 3T9NA 2K5IA 5CKHA 4BI4A 2X35A 4IUQA 3CCRA 3CCMA 2DKGA 3X25B 1JJ2S 1N8RU 3OMGA 4EMHA 3CCSA 3OW2A 1VQMA 4MDWA 4M75G 5GMKm 4M77B 4ZGDB 2LNVA 4JRPA 1YJWT 1RI0A 3SWNC 1IZ6A 3OW2S 3NTHA 3E1SA 2WACA 4C8QF 4E7LA 3VYHB 2QQSA 3QKJA 4M78G 4A53A 4N4HA 1M9SA 2LCLA 1JRIA 4DQ2A 2QQRA 3DLMA 1KQ2A 1KD1U 1VQ7A 2G3RA 2DZ9A 2C06A 4M77C 3Q1JA 3PIOA 3CC2A 3AHUA 4XTWA 4KUIA 3JCMd 2LT1A 2B8AA 2R57A 5CR2A 1M1KU 4M7AG 2XI9A 2O4XA 2RJCA 4NL3A 4C92F 1QVGA 3P8HA 2ZPGB 4II1A 3GP8A 5LJ3d 5GAN2 1VQKA 3S3NA 5DLOA 2OTLT 3QSUA 4KULA 2ZPIB 3MCAB 5CKFA 4GY5A 5GAMg 4OP0A 3OS0A 2KY9A 4TVRA 5IT9E 2LQ8A 1WGSA 3CCUT 2D6FA 3OYBA 3JCMP 2AHJB 2XICA 1KQSS 3EFSA 1I8FA 3KUFA 3RMSA 2CGHA 1QP2A 3BFMA 3VJPA 3OYIA 4BY6B 3SD4A 2MWPA 4BE1A 1M90U 1GXIE 5IAYA 2F69A 1ZQ1A 2ZGWA 4C8QE 1VQ5T 1JB0E 2ZPBB 4PNOA 3OSVA 3JB9G 2JTMA 4PKCC 4JS4A 4XTUA 1N9SA 4C0FA 2GFAA 4BE2A 3CCQA 1B34B 3SWNA 1BIAA 1YI2A 3OY9A 2RH2A 1NPRA 2L5QA 4BY6C 2O01E 3E9FA 4C92E 4EDUA 4R56A 2EAYA 2E10A 2KSSA 2E1HA 2BUDA 3LYIA 4L5GA 2VC8A 3CCET 2QEXA 4M77A 3CCRT 4LDXA 4ZGEB 2FHDA 3VUZA 2LDMA 1VQ9T 3TU4K 4LDWA 4HT8A 2HAXA 2ZPFB 4Z02A 1VQMT 5GAMf 5GAN5 1VQLA 3L42A 2RHUA 4ZN1A 1G3TA 2LX9A 2P4TA 2V8KA 3UPUA 1YHQA 3DB3A 2E6ZA 3ME9A 3OYYA 1KHCA 4MZMA 4OGCA 3X24B 5CK9A 3F70A 4M7DB 4J83A 2R5MA 3HRUA 2X4XA 3BDUA 2Y90A 3LGLA 3QYGB 3CBMA 4JLIA 2XK0A 1OZ3A 1Y71A 2E6NA 4JRIA 2GCXA 3QZ9B 4BDYA 1FXXA 3OYJA 2WSCE 3JCMh 5GAN4 4QW2A 1I5LA 3EFRA 5GAMe 3VKIA 3VYGA 4J6XA 1Q7YC 3QHSA 2WSEE 3OYFA 2RK2A 1W2BA 2JVVA 1RL2A 2LVMA 2PU9B 3KBGA 3QYHB 4MZTA 5KE2A 3CC4T 1VQKT 3M56A 3JCMW 3RMQA 1P92A 1ZHIA 4BACA 5GAOr 4FT2A 1HK9A 2OTJA 2CZ1B 3N5BB 1YJNT 5GAN8 2RO0A 1MGQA 3GF5A 4PJOD 2RHXA 3M54A 4E7JA 3GNGA 4E7KA 1VQOA 3V8JA 4XQ3A 3UDCA 1YCYA 3VUBA 2K4YA 3FC3A 4BI8B 4JDSA 3BDLA 4F7UG 1K8AU 2P0KA 4MZPA 2O4XB 2CZ0B 2HQXA 3E9GA 3ER0A 1N27A 3I55A 1N9RA 3M57A 1OYXA 3M58A 3QG1A 3URGA 4MMLA 5CKEA 4CRIA 1M1GA 3CCQT 1UGSB 4J5YA 3G71T 1YI2T 4HCCA 2LT4A 2V8IA 2HNIA 3FDRA 3QPHA 1KQ1A 3A8HB 4JLGA 1QP3A 3VV0A 4IUPA 3X20B 4IUVA 2JUFA 5A0LA 5KE3A 3CCLT 1BI1A 1YJ9A 1Q82U 4XTVA 2RI2A 2EWNA 2K57A 4M78D 2E12A 5CKBA 2XHCA 3G4ST 3CPWA 3QXEB 3LLRA 3QBYA 4PJOG 3CMAA 1Q86U 4B9WA 3OYHA 2CZ7B 4M7AD 1VQLT 4FU6A 4M7DA 3G7ZA 4XK8E 3SWNB 4WF2A 4PJOC 1LJOA 4M75B 4UC4A 4EMGA 3FJPA 3JRZA 4XTXA 3V8LA 4C8QD 3LWIA 3PNWC 3G6EA 2RI3A 3J80E 1YITA 5GAN6 5FRMA 1WQWA 4N4IA 4QVDA 2A7YA 2LCCA 1UB4A 4M78B 3JCMg 1VQ4T 2I2LA 5GMKe 3CMEA 3QJYA 2YLCA 4N0AC 4PLIA 2K3XA 3OA6A 2GF7A 4ZGJB 5LJ3g 4M75C 1VIFA 4C92D 5GAMj 3GPLA 4J8OA 3RKXA 4F7UA 5DLQE 4M7AB 4M77F 2X4WA 5LJ5f 2P0QA 4HCZA 1VIEA 5FU7B 4EMKC 5GMKi 3S3OA 3OBYA 3JB9D 4PL6A 2OTJT 2YLBA 4EPCA 2E65A 4M78C 2V8JA 2QQBA 5FU6B 2KDSA 2EYQA 3UWNA 3V7SA 4HA8A 3PFSA 3OYGA 2XD0A 1WNLA 1BYMA 3RERA 3CEYA 3A8GB 4M7AC 1N6AA 4C8QG 5FU7C 2JZ2A 5GMKh 3A8OB 1QVGS 1MHNA 1K9MU 2M1HA 3I55T 1G3SA 2F5KA 4RCCA 2Y4XA 4O6JA 5FU6C 1VQNA 1NJIC 2X4JA 5GANh 1VQ6T 4C5GA 3CD6A 3OS5A 1K73U 4IUUA 4PJOA 2BKDN 3X26B 4QVZA 2VYTA 2D0QB 3TEEA 1OZ2A 3OYAA 2PUOB 4C92G 2IVWA 3M5AA 3ZBDA 1M1FA 3JCMf 3UT1A 2DK3A 3S6WA 1LOJA 5CCAA 3L1AA 4OB0B 3RKWA 2CS7A 4M77E 1G3YA 1UGPB 4L59A 3OYKA 3J7AF 5LJ3f 3TCJA 4J7FA 3CMAT 2IG0A 3EAEA 3HPWA 2OAUA 2RHZA 3QZ5B 4N0AA 4NL2A 3M59A 2EJ9A 2HBPA 1FX7A 3META 3WVEB 4DOWA 5LJ5h 4M75A 4E7HA 4OF1A 3GIBA 2ZPHB 2DTIA 4FSXA 4EMKA 3GNFB 2QQ9A 4C0ZA 3JCMe 1I81A 2D9TA 3H6ZA 4KUDK 2XDPA 1BI3A 4BE0A 4M78A 5KCOA 3CCMT 5FRNA 3QIIA 3OYEA 1YITT 2GQVA 2XU8A 4LD6A 3CCST 5LJ3e 3OYMA 3BY7A 3LX7A 3P8DA 5GAN7 2CKKA 4N4GA 1UEBA 3M4YA 1S72A 2EIFA 3X28B 4M7AA 2M0OA 4BUGA 5A0GA 2L8DA 4C5IA 4Q5WA 1QVFA 2LQKA 1BI0A 5GMKj 3V7RA 5FROA 3I56A 3L2VA 4BDZA 3RESA 3C94A 1OI1A 3HL8A 4GLKA 4E7IA 1Q81C 2E41A 1VQ7T 4XU2A 1IREB 4OB1B 4X9CA 2DTOA 4XU1A 5GANj 3CC2T 2KQWA 2MI6A 1XOVA 3SB2A 2DVEA 3HFOA 5I2MA 3OYLA 2KK4A 4M7DF 4JS5A 1HXDA 2P0PA 2GFUA 1R8OB 2LC4A 2VV5A 1WJQA 4PLLA 4X34A 5LJ3h 3SFMA 5GMKl 1I4K1 2E70A 3MHXA 1W2BS 4J6YA 3L2WA 3M4GA 4FL6A 5GAOq 4BI3A 4ELZC 2ZPEB 1ZBXA 2QDYB 4F7UB 3CCJA 1O9SA 5GANg 5LJ5j 3R6OA 4LDVA 1WJSA 2QXFA 1N8RC 1O75A 5CQYA 2X4YA 2FL7A 2XG8D 3M55A 5KH6A 3FLGA 3BW1A 3FB9A 4D6WA 4CI0C 2VGNA 4MMKA 4XU0A 3JCMX 1YJWA 4F7UF 3OQ5A 1H641 2XKOC 4C0DB 2DTHA 2EJGA 3QDRB 3JB9J 2XIDA 2CYZB 2DXCA 3MEAA 5D6WA 1KD1C 3PT9A 5AYFA 4M7DE 5EG2A 2RD1A 1QVPA 5LJ5g 3M9QA 3CBPA 3FRNA 4XTZA 1M1KC 4PJOB 2JNGA 2RHIA 2KMTA 2EQMA 2R5AA 4C0DC 2VGMA 3KXTA 2QEXT 4Y91A 4B9XA 2Y4YA 1SSFA 2RI5A 3LWHA 1H3ZA 1DJ7B 4R55A 4XAXB 5A2QE 2OTLA 3CPWS 3L2RA 1LNXA 4M7DC 3DLLA 3JCMJ 2DXUA 5CAIA 3PIPA 4NS5A 4PJOF 1NE8A 3CCUA 2K5LA 3E19A 1S72T 5LJ3j 2PVGB 1XTDA 4QQ6A 1YHQT 3OYDA 2DXBA 1BIBA 1D3BB 1W4SA 2RHYA 3MO8A 5L8RE 5GANf 2DIQA 4X9DA 4NOYA 4F7UE 1YIJA 2DZCA 2YRVA 2EJFA 3MEVA 1M90C 3PMTA 4EMKB 4XU3A 3RUXA 1M8VA 2MAMA 4J7IA 3L2ZA 4M77D 5GAN3 3L2UA 1VQ5A 1Y7XA 2VXFA 4OVAA 3CPFA 2PVOB 2VXEA 2EQJA 4M75F 4HKEA 4JJNK 1G3WA 4KBMB 4YTLA 1Q7YU 2DIGA 3QO3A 3GLXA 1KHIA 2JN0A 5GANe 4FIBA 5CKDA 4M78F 3M53A 3V8KA 1TH7A 2K5FA 2M9UA 2RK1A 2QA4A 2DJZA 1JJ2A 3CCEA 2CZ6B 5C6SA 1VQ8A 1Y07A 2MF2A 3CCJT 1VQOT 3RKYA 4PJOE 4C8QB 2MWOA 3CCVA 1VQ9A 4RG8A 4C5HA 4M7AF 1QW1A 5LL6S 3NTKA 4ZTFA 2DPPB 4IUTA 1Y96B 4QVCA 4LDYA 3L2QA 3LGFA 2F5TX 3INZA 4FT4A 3H8ZA 3OS1A 3C95A 1YBYA 2QQAA 5D6YA 5LJ5e 3HHTB 4M77G 2VUBA 2QTXA 4C92B 3CC7A 1V29B 3PMIA 4RKUE 3P8BB 4C8QC 3OBWA 3HP9A 5HK3A 4M75E 3HKSA 4QQDA 3OYCA 3DB4A 3ZFJA 4IURA 4RG2A 4DA4A 1YJ9T 3MEWA 4BB7A 2DD4A 2WSFE 3A8LB 2K2VA 4ATOA 5DM7R 4A4HA 5HKCA 4M78E 4OB2B 5I2SA 4Y28E 2RB6A 4P5NA 4C92C 3CC4A 3JB9F 2LRQA 1VQPA 4LD9K 1D3BA 1KQSA 2FVUA 3C4SA 3NTIA 2EQUA 3ASKA 3OSSC 1YJNA 5C0MA 2EQKA 3C12A 2RJEA 4M7AE 4A4KA 2XDDA 4XTYA 4MDXA 5GAOp 3MP1A 3JCMQ 3J81E 4A4FA 4C5EA 3LW5E 5J39A 3HSBA 3G6ET 1YIJT 2PQWA 4HCBA 4VUBA 1K8AC 3A8MB 1M4ZA 3FEOA 3JAME 5CQXA 2QI2A 4HT9A 2DEQA 5GAMd 1JBMA 2DD5A 3PTAA 4V2SA 2FYKA 3QJ6A 5HY6A 3MP6A 1WQ7A 4ZN3A 3VU3C 1M5Q1 2RJDA 3NFCA 3CMET 5GAOm 3JB9H 3G71A 5CVIA 4M7DD 4DOVA 4A4EA 4E47A 3MEUA 3FIFA 4BD3A 1QVFS 1FWZA 1BI2A 4LDUA 3CCLA 4C8QA 1Q82C 1VUBA 2QA4T 1UGQB 1AHJB 2HD0A 4ELYC 1VQ8T 3G4SA 1Y96A 1XNIA 2JTFA 3CCVT 1U8RA 4O5VA 4QQGA 4A4GA 5KCHA 1Q86C 3QUIA 3SDZA 1KC8C 2PUKB 4J6WA 4C92A 2R58A 1UGRB 3ZEHA 3CBOA 2L89A 3RIRA 1VQNT 1XQHA 1NPPA 1NJIU 2E5QA 4RCBA 3CC7T 2XDBA 3CD6T 2DXTA 3JCMb 4OMFB 5FLXE 4M7DG 2HQEA 2E64A 2ZCFB 1VQ4A 2PVDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO C;  2XG8 D;  3N5B B; 
#chains in the Genus database with same CATH topology
 1E7O A;  2HMA A;  3OMC A;  1ZSZ B;  4ME7 A;  1X01 A;  2MMP A;  5IN1 A;  1HYO A;  4RTT A;  2RA2 A;  2M16 A;  4RMO A;  1B34 A;  2BIV A;  1ZSZ C;  2KE9 A;  2KVQ G;  2KAF A;  5J26 A;  2OX7 A;  4L6V 5;  1K76 A;  2SRC A;  5HK0 A;  2D1X A;  4JUV A;  1M90 R;  3I56 T;  3JCM V;  2JM9 A;  5KYY A;  2JOY A;  3EH1 A;  2EFI A;  5A0D A;  4ZTJ A;  2CP0 A;  2ZAE A;  2JS0 A;  1RLQ C;  2HSP A;  3WVD B;  3PGG A;  1KC8 U;  3S3M A;  2VB6 A;  1PSF A;  3JB9 I;  3JSC A;  3T9N A;  1NLP C;  2K5I A;  3CCM A;  1M2O A;  1PG5 B;  3OMG A;  4EMH A;  3OW2 A;  1VQM A;  1ABO A;  4ZGD B;  4HXJ A;  2GTO A;  3SWN C;  1ZSZ A;  2VAS A;  2RQU A;  2LCL A;  3DLM A;  4M4Z A;  2C06 A;  3AHU A;  4XTW A;  4KUI A;  2XI9 A;  2O4X A;  4NL3 A;  4J9B A;  4II1 A;  3S3N A;  2QDL A;  5DLO A;  2FZK B;  2HKN A;  5IXF A;  2D6F A;  4TVR A;  3CCU T;  4E7Z A;  1HD3 A;  3RMS A;  1K8A R;  2MWP A;  1M90 U;  1GXI E;  5IAY A;  2CRE A;  2ZPB B;  1C1A A;  2JTM A;  3PVL A;  1GRI A;  1N9S A;  3CCQ A;  3SWN A;  3H0I A;  1TU0 B;  4RTY A;  1IHW A;  2KSS A;  1TUD A;  2ROT A;  3CCE T;  1OUL A;  4ZGE B;  4RTW A;  1YJ9 Q;  4HT8 A;  2HAX A;  1NBE B;  4D8K A;  2QTV A;  1RUW A;  3L42 A;  3CMA Q;  4ZN1 A;  2BTT A;  2P4T A;  1VYU A;  2E6Z A;  5CK9 A;  4MZM A;  4OGC A;  3F70 A;  4J83 A;  2R5M A;  3HRU A;  2X4X A;  1NM7 A;  3BDU A;  4JLI A;  2YT6 A;  2GBQ A;  3QZ9 B;  2FO0 A;  2FG0 A;  2RQR A;  3JCM h;  4ANJ A;  5GAM e;  3VKI A;  1PNJ A;  3VYG A;  1YIT Q;  4J6X A;  1Q7Y R;  1RL2 A;  3KBG A;  5KE2 A;  1VQK T;  3M56 A;  3JCM W;  2O88 A;  2A36 A;  1ZHI A;  1HSQ A;  3N5B B;  4AT1 B;  4E7K A;  1VQO A;  2RQW A;  1X69 A;  3UDC A;  2K4Y A;  1Y57 A;  4IIO A;  3C0C A;  1K8A U;  2NUT B;  1SF9 A;  3I55 A;  4CRI A;  2A28 A;  5CKE A;  2J6F A;  1QP3 A;  1BCO A;  4IUP A;  1WHM A;  2JUF A;  5A0L A;  1U3O A;  3EGX B;  2EWN A;  2XHC A;  1WXB A;  3CPW A;  3TVT A;  3QBY A;  1TUC A;  4PJO G;  1NYG A;  2JMC A;  1PC0 A;  4B9W A;  3OYH A;  4XK8 E;  2M02 A;  2HL5 C;  2LJ1 A;  1HJD A;  2KT1 A;  3FJP A;  4XTX A;  3PNW C;  3J80 E;  5GAN 6;  4N4I A;  3M0T A;  3H0F A;  4J9E A;  3CME A;  4QKU A;  2HEQ A;  2K3X A;  4LNP A;  2COW A;  2GF7 A;  4N0A C;  4PLI A;  4C92 D;  3UAT A;  5DLQ E;  2X4W A;  5GMK i;  3OBY A;  2OTJ T;  3I56 Q;  2V8J A;  2QQB A;  1TWB A;  5FU6 B;  2NUT A;  3MKD A;  4FYX B;  4AFZ C;  2XD0 A;  1BYM A;  3VS5 A;  1QVG S;  5L23 A;  2EYX A;  1G3S A;  2K79 A;  2Y4X A;  1J3T A;  5FU6 C;  1VQN A;  2X3X D;  2X4J A;  5GAN h;  4C5G A;  3EFO B;  1V1C A;  3EGX A;  2BKD N;  3X26 B;  1SRM A;  1X2K A;  1NYF A;  2IVW A;  3M5A A;  3AT1 B;  5CCA A;  2DEU A;  4KH1 B;  1NEG A;  4OB0 B;  8ATC B;  2VVK A;  4L59 A;  3OYK A;  2AT1 B;  2RHZ A;  4N0A A;  5LJ5 h;  2CP6 A;  4E7H A;  2JT4 A;  4ESR A;  2DTI A;  4FSX A;  3GNF B;  1E6G A;  2IPO B;  2D9T A;  4BE0 A;  2BZ8 A;  3CCM T;  5FRN A;  4RTV A;  4KGX B;  5LJ3 e;  2CKK A;  1UEB A;  3M4Y A;  1D0Y A;  1S72 A;  2EIF A;  3X28 B;  2M0O A;  5A0G A;  1QVF A;  2BZX A;  3KFV A;  3CCU Q;  1Q81 R;  1W70 A;  1WHG A;  3SEM A;  4AFS C;  1YIJ Q;  1TUG B;  3HFO A;  1RAC B;  3EG1 A;  1WYX A;  2P0P A;  1R8O B;  5LJ3 h;  1WJQ A;  4X34 A;  4KGV B;  3SFM A;  1IXD A;  1I4K 1;  1D0X A;  3H0H A;  3EFO A;  1W2B S;  3L2W A;  4IIM A;  2J7I A;  4BI3 A;  3RR6 A;  3CCJ A;  4LDV A;  1ABQ A;  3CCE Q;  1VQ8 Q;  2GNC A;  2X4Y A;  4R0K A;  3BW1 A;  4D6W A;  1AOJ A;  4MMK A;  2E4H A;  2XKO C;  2EJG A;  1OX9 A;  1MUZ A;  2V1R A;  3MEA A;  5D6W A;  5AYF A;  5EG2 A;  3CBP A;  2NUP B;  1PRM C;  1M1K C;  4PJO B;  2EQM A;  4RTU A;  3KXT A;  2RQT A;  2D0N A;  4Y91 A;  1DJ7 B;  2RMO A;  4R55 A;  3L2R A;  1LNX A;  4ZNX A;  2D8H A;  2K5L A;  2RF0 A;  4PJM A;  4QQ6 A;  1AD5 A;  2DXB A;  1W4S A;  2RHY A;  5L8R E;  3REA B;  4X9D A;  1OPK A;  2YRV A;  3MEV A;  3PMT A;  3RUX A;  2CP7 A;  5GAN 3;  1VQ5 A;  3MJX A;  4M77 D;  2VXF A;  1ACM B;  2K2M A;  1OPL A;  1G3W A;  2DIG A;  3GLX A;  2EKH A;  5CKD A;  2K5F A;  1JJ2 A;  2DJZ A;  4F04 B;  2CZ6 B;  1Y07 A;  2MF2 A;  1VQO T;  1WXT A;  1VQ9 A;  4C5H A;  3NTK A;  3L2Q A;  3LGF A;  3INZ A;  1BU1 A;  1KIK A;  2QTX A;  2NUP A;  2FZG B;  1V29 B;  3P8B B;  3EGU A;  3HP9 A;  4F16 A;  2QAS A;  3DB4 A;  1MMA A;  2K2V A;  3QDF A;  1RAA B;  1YWP A;  5I2S A;  4P5N A;  3CC4 A;  2KI7 A;  2LRQ A;  2KYB A;  1BB9 A;  1OQK A;  4OMO A;  5KYX A;  1YJN A;  1B3Q A;  2RJE A;  2XDD A;  4XTY A;  3MP1 A;  4A4F A;  4CC4 B;  1PCX A;  3CPW P;  1M4Z A;  2YUO A;  3FEO A;  1MMG A;  2MIO A;  5GAM d;  1M2V B;  4ORZ A;  4V2S A;  1OOT A;  3QJ6 A;  5HY6 A;  3CME T;  2LQN A;  2OTL Q;  4FSS A;  3G71 A;  4M7D D;  4E47 A;  3MEU A;  4BD3 A;  4KRT A;  4LDU A;  2EQI A;  1Q82 C;  4X1V A;  2GTJ A;  1GFC A;  1XNI A;  3CCV T;  1NLO C;  4QQG A;  1Q86 C;  2J6O A;  4JJC A;  1KC8 C;  3TSW A;  5I11 A;  1UGR B;  2P84 A;  3CBO A;  3RIR A;  1VQN T;  1NPP A;  2XDB A;  2ZCF B;  4HVU A;  3CCM Q;  1VQ4 A;  4PJL A;  3NHN A;  1PRL C;  4IKF A;  1JQQ A;  1VQM Q;  1MMN A;  7AT1 B;  2K9G A;  4FW2 A;  1VQP T;  4A54 A;  1M1K R;  5FW9 A;  4JZ3 A;  1BKB A;  1M2V A;  1EIF A;  5D6X A;  1WHJ A;  4JRQ A;  1SEM A;  4CC3 A;  1WIE A;  3EH2 A;  3V7C A;  1V76 A;  2LTO A;  5GAN d;  5HCK A;  4M75 D;  1AWJ A;  1M27 C;  1X6O A;  3A5Z B;  2KEA A;  1TSF A;  2A37 A;  2YHT A;  4JZ4 A;  3I5R A;  4JRK A;  2ENM A;  1WJR A;  3UF4 A;  4OB3 B;  3OB9 A;  3LH5 A;  1QVF P;  5LJ5 d;  3CCQ Q;  3WXM B;  3UA6 A;  3X25 B;  2Z0W A;  4DBQ A;  2MK5 A;  2JW4 A;  3CCS A;  3G4S Q;  5I22 A;  2A08 A;  3OW2 S;  1IZ6 A;  2HBW A;  2WAC A;  3VYH B;  2YUN A;  1KQ2 A;  1M8M A;  3Q1J A;  1I0C A;  2R57 A;  2DYB A;  3I35 A;  1M1K U;  3QWY A;  2RJC A;  4D8D A;  3P8H A;  2CP2 A;  3GP8 A;  1UG1 A;  5LJ3 d;  5GAN 2;  1UJY A;  1VQK A;  4AFU C;  2KXC A;  4OP0 A;  2VKN A;  1ZLM A;  3JCM P;  1KQS S;  1UJ0 A;  3KUF A;  3VJP A;  4BE1 A;  3CXC P;  1SHG A;  4BY6 B;  2AIR B;  1GCP A;  3NPF A;  1VQO Q;  1VQ5 T;  1JB0 E;  4PKC C;  1M3B A;  1RAI B;  2GFA A;  1B34 B;  1MV3 A;  1BIA A;  2DIL A;  3I55 Q;  4BY6 C;  1Q82 R;  4R56 A;  3M0U A;  2E10 A;  1VOM A;  2FHD A;  1VQ9 T;  1Q86 R;  3TU4 K;  4LDW A;  2RHU A;  2LX9 A;  4FCY A;  1YHQ A;  2FRW A;  4KH0 B;  1KHC A;  1JJ2 P;  2OJ2 A;  2PNI A;  4JRI A;  2E6N A;  2F1L A;  4PFZ A;  1FXX A;  1VYT A;  2WSC E;  4QW2 A;  1I5L A;  3EFR A;  1S1N A;  2DFU A;  1Q7Y C;  2WSE E;  5IHI A;  2RK2 A;  3OYF A;  2DF6 A;  2LVM A;  3QYH B;  2PU9 B;  3CC4 T;  2EPD A;  3CME Q;  4BAC A;  5GAO r;  2OTJ A;  2CZ1 B;  1YJN T;  1YNZ A;  5GAN 8;  1MGQ A;  3GF5 A;  2EYZ A;  3M54 A;  3GNG A;  1VQ7 Q;  3V8J A;  1R0C B;  1CKB A;  4XQ3 A;  4BI8 B;  2O4X B;  2HQX A;  3ER0 A;  3UA7 A;  1MMD A;  1JXO A;  2M0Y A;  1M1G A;  1H3H A;  1UGS B;  3G71 T;  1YI2 T;  3FDR A;  2V8I A;  4JLG A;  3X20 B;  1VQN Q;  5KE3 A;  1BI1 A;  1Q82 U;  2LZ6 B;  4M78 D;  1K4U S;  2LX7 A;  3QXE B;  1I1J A;  1RAG B;  1Q86 U;  2CZ7 B;  2G6F X;  1VQL T;  2F2W A;  3SWN B;  4WF2 A;  2OI3 A;  2XMF A;  3SHW A;  1AVZ C;  2DL5 A;  4EMG A;  1KK7 A;  4C8Q D;  1WQW A;  1K0S A;  2QEX Q;  1WFW A;  1VQ4 T;  2I2L A;  5GMK e;  2YLC A;  4JJD A;  2JXB A;  1Y0M A;  1UDL A;  2HZY A;  3GPL A;  3RKX A;  1S72 Q;  4LE9 A;  2P0Q A;  5FU7 B;  4EMK C;  3JB9 D;  2EGC A;  3V7S A;  2HKQ B;  4HA8 A;  3PFS A;  5IHN A;  5GMK h;  5FU7 C;  2JZ2 A;  2RNA A;  3A8O B;  2X9H A;  2M1H A;  4DBH A;  2F5K A;  2P4R A;  4RCC A;  4E2F B;  2LP5 A;  3OS5 A;  4QVZ A;  3CCJ Q;  2L3P A;  1LOJ A;  3NMZ C;  1X6G A;  2CS7 A;  2E3H A;  3J7A F;  3TCJ A;  4J7F A;  1W6X A;  3EAE A;  2OAU A;  4NL2 A;  2HBP A;  3H41 A;  4EMK A;  2QQ9 A;  3JCM e;  1I81 A;  1QCN A;  1NEB A;  3RDV A;  3QII A;  3CCS T;  3OYM A;  1JO8 A;  5GAN 7;  2L8D A;  3O5Z A;  1PM3 A;  3L2V A;  1TOV A;  3VS2 A;  1Q81 C;  2EGE A;  2AKK A;  3VS4 A;  1QCO A;  3SB2 A;  2DVE A;  3OYL A;  4JS5 A;  3U23 A;  5GMK l;  4GBQ A;  2E70 A;  3EGD B;  2JJ9 A;  2PTK A;  4FL6 A;  1M3C A;  2ZPE B;  1ZBX A;  2QDY B;  2F2V A;  1WI7 A;  1D0Z A;  3R6O A;  2O9V A;  1O75 A;  2DNU A;  1I5O B;  5KH6 A;  2FL7 A;  1K0X A;  3M55 A;  3FLG A;  3FB9 A;  4CI0 C;  2VGN A;  4F7U F;  3QDR B;  4J9D A;  1CKA A;  1KD1 R;  2CYZ B;  2DXC A;  1G2B A;  2K3B A;  1QVP A;  3FRN A;  1SG5 A;  3CD6 Q;  2RHI A;  2KMT A;  2KRO A;  2YRD A;  2COY A;  2CDT A;  1SSF A;  3LWH A;  3DLL A;  3JCM J;  2DXU A;  5CAI A;  3H9N A;  3VS0 A;  3CC4 Q;  1YHQ T;  3OYD A;  1D3B B;  2DIQ A;  1YJN Q;  4F7U E;  2DZC A;  1PD1 A;  2QGF B;  3L2Z A;  1SKU B;  1Y7X A;  2VXE A;  2KNB B;  4HKE A;  3EGD A;  4JJN K;  4KBM B;  4YTL A;  1Q7Y U;  2AK5 A;  5GAN e;  4M78 F;  3G71 Q;  2M9U A;  2V1Q A;  3TQ7 P;  1G8X A;  2BE9 B;  3CCV A;  2E5K A;  3PE0 A;  4DBF A;  2DPP B;  2F5T X;  3OS1 A;  3C95 A;  2QQA A;  5D6Y A;  5LJ5 e;  3HHT B;  3PMI A;  2ED1 A;  4RKU E;  3HKS A;  4QQD A;  1H92 A;  4BB7 A;  3A1P A;  4A4H A;  3THK A;  4M78 E;  1VQ4 Q;  2RB6 A;  3JB9 F;  2KYM A;  1K1Z A;  1VQP A;  4LD9 K;  1D3B A;  3NTI A;  3E2U A;  1QCF A;  5C0M A;  2EQK A;  3NGP A;  1AEY A;  1OEB A;  3A8M B;  4Y92 A;  4HT9 A;  3PTA A;  4DEX A;  1M5Q 1;  3NFC A;  1BK2 A;  1ZA2 B;  4DOV A;  3EHR A;  1TG0 A;  2ECZ A;  2QA4 T;  4CC7 A;  2OAW A;  4A4G A;  5KCH A;  3QUI A;  2PUK B;  2E5Q A;  2J6K A;  1CSK A;  3CC7 T;  2HQH A;  4OMF B;  5FLX E;  1PHT A;  2E64 A;  1WX6 A;  1RAF B;  3CCS Q;  5J3B A;  3OS2 A;  5CO7 A;  3O8V A;  2L3R A;  4GLM A;  2KGT A;  1ARK A;  1EX4 A;  3JCM c;  3FJ5 A;  3CXC A;  1PSE A;  2DAQ A;  1Q95 G;  1UHF A;  2EKO A;  3HRT A;  2DL3 A;  2H3J A;  1U1T A;  2JS2 A;  2ESW A;  1VQK Q;  1VQ6 A;  2CT3 A;  1RI9 A;  1VA7 A;  1SSH A;  3GOX A;  5KYX B;  4RTX A;  1Q81 U;  3MP8 A;  4EIK A;  1G5V A;  2A3L A;  1T3L A;  1RAE B;  1IB8 A;  1X75 C;  1D09 B;  3VRZ A;  2EVR A;  1QWE A;  5DY9 A;  1TS9 A;  4FM4 B;  5M9O A;  2L2P A;  2RJF A;  1U1S A;  1T0J A;  2HL3 A;  4E6R A;  1ZUK A;  5GAO l;  1WHH A;  3HFN A;  4BI4 A;  2FRY A;  2X35 A;  2DKG A;  2YDL A;  2B86 A;  5GMK m;  1C0M A;  1RI0 A;  4OMM A;  2H8H A;  3TSZ A;  4E7L A;  4M78 G;  3QKJ A;  4N4H A;  1M9S A;  4DQ2 A;  1AZE A;  1YHQ Q;  2FPE A;  2DZ9 A;  3CC2 A;  3JCM d;  2B8A A;  5CR2 A;  1ZX6 A;  2PZ1 A;  4C92 F;  1QVG A;  2ZPG B;  3I5S A;  3MCA B;  5GAM g;  3OS0 A;  5IT9 E;  1MND A;  3OYB A;  1Z9Z A;  3EFS A;  1FYN A;  3OYI A;  2OTJ Q;  3BFM A;  2M51 A;  3M0S A;  2NUZ A;  2F69 A;  1ZQ1 A;  2ZGW A;  5EC7 A;  3OSV A;  3JB9 G;  1ZBJ A;  4JS4 A;  4C0F A;  1W1F A;  4BE2 A;  1YI2 A;  1NPR A;  4C92 E;  2C0T A;  4EDU A;  2EAY A;  2BUD A;  3LYI A;  4L5G A;  2VC8 A;  1KFZ A;  3CCR T;  4LDX A;  2KT8 A;  2LDM A;  3VUZ A;  2ZPF B;  4Z02 A;  5GAM f;  3VS7 A;  5GAN 5;  1VQL A;  3UPU A;  2ED0 A;  1AWW A;  3ME9 A;  3OYY A;  2K7A A;  3LGL A;  4HVW A;  2XK0 A;  4BDY A;  4FYY B;  2D8J A;  5GAN 4;  2O31 A;  1W2B A;  4MZT A;  4FT2 A;  3EG2 A;  3EG3 A;  2RO0 A;  4PJO D;  2RHX A;  4E7J A;  2LMJ A;  1YCY A;  2VWF A;  2CUD A;  3FC3 A;  4JDS A;  3BDL A;  1SRL A;  2P0K A;  2J05 A;  1WLP B;  2CZ0 B;  2CSI A;  1N27 A;  1N9R A;  2DLP A;  3M58 A;  1OYX A;  3QG1 A;  4MML A;  4J5Y A;  2HNI A;  1KQ1 A;  2YWW A;  4IUV A;  1QWF A;  4XTV A;  2K57 A;  5CKB A;  2DL4 A;  1B07 A;  2BZY A;  1LVK A;  4M7A D;  1FMV A;  2HDA A;  2EBP A;  1PD0 A;  1LJO A;  4OMQ A;  4UC4 A;  1GL5 A;  3JRZ A;  3G6E A;  5FRM A;  2RI3 A;  2KRN A;  4QVD A;  2LCC A;  1UB4 A;  4M78 B;  2KBT A;  1TTH B;  4ZGJ B;  5LJ3 g;  5GAM j;  8AT1 B;  4J8O A;  4F7U A;  1M30 A;  4M77 F;  5LJ5 f;  3S3O A;  4HCZ A;  1U8R A;  2MPX C;  4PL6 A;  4EPC A;  4DBR A;  4M78 C;  2JTE A;  2KDS A;  4Z88 A;  2BE7 D;  3RER A;  3CEY A;  1N6A A;  1NJI C;  1X2Q A;  1VQ6 T;  2AZS A;  2YUP A;  1JU5 C;  2VYT A;  2D0Q B;  1OZ2 A;  3OYA A;  2PUO B;  4C92 G;  1B7T A;  3ZBD A;  1M1F A;  2DK3 A;  1GBR A;  3L1A A;  3BE3 A;  4M77 E;  2NYS A;  4LUE A;  5LJ3 f;  3CMA T;  3HPW A;  1BCM A;  3M59 A;  1FX7 A;  1ZUY A;  3MET A;  3WVE B;  4DOW A;  4OF1 A;  2ZPH B;  4C0Z A;  3H6Z A;  1RLP C;  2QAZ A;  4M78 A;  1YIT T;  2GQV A;  2XU8 A;  1OV3 A;  4LD6 A;  3LX7 A;  1F1B B;  3P8D A;  2ABL A;  2EYY A;  4N4G A;  2IIM A;  2O2O A;  2KRM A;  4C5I A;  2LQK A;  4BDZ A;  5FRO A;  3C94 A;  3HL8 A;  4LUD A;  4E7I A;  1IRX A;  1AWX A;  4QT7 A;  4XU2 A;  1IRE B;  5GAN j;  3CC2 T;  2MI6 A;  1XOV A;  4M7D F;  5I2M A;  2KK4 A;  2GFU A;  2VV5 A;  4PLL A;  1UTI A;  1KJW A;  2CSQ A;  3MHX A;  4AG2 C;  3M4G A;  4ELZ C;  1O9S A;  5LJ5 j;  1WJS A;  2QXF A;  1N8R C;  1NG2 A;  4AG1 C;  1Z9Q A;  2XG8 D;  1YJW A;  1QVG P;  4XU0 A;  3CCV Q;  4Z8A A;  4C0D B;  2DTH A;  3JV3 A;  2XID A;  1KD1 C;  3PT9 A;  5GJV B;  4M7D E;  3IQL A;  4XTZ A;  4C0D C;  2VGM A;  3VRY A;  1D1C A;  1H3Z A;  2OTL A;  5A2Q E;  3CPW S;  4NS5 A;  4PJO F;  5GJW B;  1NE8 A;  3E19 A;  5LJ3 j;  2PVG B;  2O9S A;  1XTD A;  1VQP Q;  2H3E B;  4EMK B;  3L2U A;  3CPF A;  2PVO B;  4M75 F;  1QLY A;  4FIB A;  5KYN A;  2GGR A;  1TH7 A;  1AWO A;  2QA4 A;  1YWO A;  2YXY A;  4PJO E;  2MWO A;  4M7A F;  1RAB B;  5IXB A;  2LJ0 A;  5LL6 S;  3G1J A;  1Y96 B;  1SPK A;  3M0R A;  1W2B P;  3H8Z A;  1YBY A;  1NJI R;  4M77 G;  2VUB A;  1UUE A;  2CP5 A;  4C92 B;  3CC7 A;  2GQI A;  3OBW A;  5HK3 A;  4M75 E;  3OYC A;  4DA4 A;  3MEW A;  3A8L B;  4ATO A;  5HKC A;  4Y28 E;  1M3A A;  4OMN A;  4C92 C;  2L3S A;  1IO6 A;  1KQS A;  3OSS C;  3ASK A;  1UGV A;  3HTR A;  3C12 A;  4M7A E;  4MDX A;  3JCM Q;  4DEY A;  4C5E A;  3LW5 E;  3HSB A;  3G6E T;  1YIJ T;  2PQW A;  4HCB A;  4VUB A;  1UEC A;  2ROL A;  2DEQ A;  2DD5 A;  4J9G A;  2FYK A;  4FYV B;  3MP6 A;  1WQ7 A;  4ZN3 A;  2RJD A;  2DER A;  3JB9 H;  4A4E A;  1QVF S;  3CCL A;  1VQ6 Q;  4OMP A;  1QMC A;  1AHJ B;  1VQ8 T;  3G4S A;  1Y96 A;  2JTF A;  4J9F A;  1VQ5 Q;  4O5V A;  1BBZ A;  3SDZ A;  3ZL7 C;  4C92 A;  2R58 A;  3ZEH A;  2L89 A;  1IGQ A;  1NJI U;  4RCB A;  1N8R R;  2DXT A;  1WDX A;  4M7D G;  2EYW A;  1VQ9 Q;  4OML A;  5GAO n;  2V26 A;  3TRE A;  1IHV A;  5CIU A;  1NZ9 A;  2QYZ A;  4C0G A;  4KT0 E;  4PJN A;  4OGE A;  1TXQ A;  2HCK A;  2RM4 A;  2DO3 A;  3DKM A;  3CC2 Q;  3CXC S;  5GAM h;  3OYN A;  1XJW B;  1K9M C;  2RPN A;  1WPY A;  2FB7 A;  2ZZD A;  1K73 C;  1D1B A;  4AMC A;  2A0F B;  3LH0 A;  2DVJ A;  5I21 A;  1KG1 A;  2K3Y A;  3HRS A;  4F14 A;  4WCI A;  1X27 A;  1QKX A;  1KSW A;  2J06 A;  2NLU A;  1GCQ C;  1YI2 Q;  1PWT A;  1D1A A;  2CUB A;  5CKH A;  2DRM A;  4IUQ A;  3CCR A;  1JJ2 S;  1UFF A;  1N8R U;  2JMA A;  4MDW A;  4M75 G;  4M77 B;  2LNV A;  4JRP A;  1YJW T;  1ZA1 B;  3NTH A;  2DL7 A;  3E1S A;  4C8Q F;  4A53 A;  2QQS A;  1VQL Q;  2DET A;  1JRI A;  2QQR A;  1KD1 U;  1VQ7 A;  2G3R A;  2X3W D;  1T0H A;  4M77 C;  2CH4 W;  3PIO A;  2NWM A;  2LT1 A;  3PVQ A;  4M7A G;  1UHC A;  1X43 A;  2OTL T;  4KUL A;  2ZPI B;  5CKF A;  4GY5 A;  2KY9 A;  2KR3 A;  2LQ8 A;  1WGS A;  1WHK A;  2AHJ B;  2XIC A;  1EFN A;  1GCQ A;  2FPF A;  4FW1 A;  1C6V X;  1I8F A;  2CGH A;  1QP2 A;  3SD4 A;  4C8Q E;  4PNO A;  2QG9 B;  4HVV A;  4XTU A;  1E6H A;  3OY9 A;  2RH2 A;  2L5Q A;  4CC2 A;  2O01 E;  3E9F A;  4A63 B;  2E1H A;  2QEX A;  4M77 A;  2DYI A;  2FPD A;  1VQM T;  3D7S B;  5AT1 B;  1G3T A;  2V8K A;  3DB3 A;  3X24 B;  4M7D B;  2DBK A;  5IH2 A;  1QQJ A;  2Y90 A;  3QYG B;  3CBM A;  1OZ3 A;  1Y71 A;  2GCX A;  1ZUU A;  3VS1 A;  3OYJ A;  4Z89 A;  3G6E Q;  3OW2 P;  1RAD B;  1AZG B;  3QHS A;  5FWB A;  4M7D C;  2JVV A;  1H8K A;  1GFD A;  3RMQ A;  1P92 A;  1HK9 A;  4RTZ A;  1WA7 A;  3VUB A;  4J9I A;  4JJB A;  4F7U G;  4MZP A;  1K9M R;  3E9G A;  1OX8 A;  5ECA A;  3M57 A;  1AT1 B;  3URG A;  1K73 R;  1KQS P;  3CCQ T;  1QKW A;  4HCC A;  2LT4 A;  3QPH A;  3A8H B;  2DMO A;  3VV0 A;  1R77 A;  3CCL T;  1YJ9 A;  1WHL A;  2RI2 A;  2E12 A;  2QGG A;  3G4S T;  3LLR A;  9ATC B;  3CMA A;  1U5S A;  2W0Z A;  1OU9 A;  4FU6 A;  4M7D A;  3G7Z A;  3M0P A;  4PJO C;  1PKS A;  4LXC A;  4E7S A;  4M75 B;  3RBB B;  6AT1 B;  2AKL A;  2DL8 A;  3V8L A;  3LWI A;  3QSU A;  1YIT A;  2COZ A;  2A7Y A;  3JCM g;  3QJY A;  3OA6 A;  2JM8 A;  4M75 C;  1T3S A;  1VIF A;  4M7A B;  5KYW B;  1VIE A;  3CQT A;  3GBQ A;  1K9A A;  2YLB A;  2E65 A;  2EYQ A;  2C0O A;  3R6N A;  3UWN A;  2YUQ A;  3ULR B;  2DRK A;  4J9H A;  3OYG A;  1WNL A;  4PJJ A;  3A8G B;  4M7A C;  4C8Q G;  2LCS A;  2L0A A;  1MHN A;  1K9M U;  3I55 T;  4O6J A;  2RQV A;  1GBQ A;  2SEM A;  3CD6 A;  1K73 U;  4IUU A;  4PJO A;  1LCK A;  3TEE A;  2CH4 A;  3JCM f;  3UT1 A;  3S6W A;  3RKW A;  1G3Y A;  1UGP B;  1YJW Q;  2IG0 A;  3QZ5 B;  2EJ9 A;  4J9C A;  4M75 A;  2RN8 A;  3GIB A;  4KUD K;  2XDP A;  1BI3 A;  2MCN A;  1ZSG A;  5KCO A;  3OYE A;  2QK0 A;  3BY7 A;  3QWX X;  1G83 A;  4M7A A;  4BUG A;  5KYW A;  2DM1 A;  4Q5W A;  1OU8 A;  1BI0 A;  2W10 A;  3EHQ A;  5GMK j;  2DE0 X;  2DBM A;  3V7R A;  3I56 A;  2EW3 A;  3RES A;  2DA9 A;  1OI1 A;  4GLK A;  2E41 A;  1VQ7 T;  4OB1 B;  4X9C A;  2DTO A;  4XU1 A;  1YP5 A;  2KQW A;  2FZC B;  1HXD A;  1FMK A;  2LC4 A;  1IGU A;  2EGA A;  4J6Y A;  1EZZ B;  5GAO q;  1WZO A;  3EG9 B;  4F7U B;  2CP3 A;  5GAN g;  1PKT A;  2C0I A;  2QA4 Q;  5IHK A;  1SHF A;  3EG0 A;  5CQY A;  3JCM X;  4WTO B;  3OQ5 A;  1H64 1;  3JB9 J;  4LN2 A;  2ATC B;  3A98 A;  1JEG A;  1YFN A;  2FEI A;  2MYS A;  2RD1 A;  5LJ5 g;  4PFP A;  3M9Q A;  2HSE B;  4JPB W;  3CC7 Q;  3REB B;  2E3I A;  2JNG A;  2R5A A;  2LNH B;  2YRC A;  2QEX T;  4B9X A;  2Y4Y A;  2RI5 A;  2YSQ A;  4PK4 A;  4XAX B;  3PIP A;  3MPU B;  3CCU A;  1S72 T;  1BIB A;  4F17 A;  5GAN f;  3MO8 A;  1U06 A;  2DJQ A;  4NOY A;  1YIJ A;  2EJF A;  1M90 C;  1M8V A;  4XU3 A;  2MAM A;  4J7I A;  4HCK A;  4OVA A;  2EQJ A;  1MNE A;  3QO3 A;  1UE9 A;  1KHI A;  5FWC A;  2JN0 A;  3EG9 A;  1LPL A;  3V8K A;  3M53 A;  3VS3 A;  2RK1 A;  3CCE A;  1R0B G;  5C6S A;  1VQ8 A;  2KXD A;  3CCJ T;  3CCL Q;  3RKY A;  2DX1 A;  4C8Q B;  2MOX A;  4RG8 A;  1QW1 A;  4ZTF A;  4IUT A;  1WXU A;  4QVC A;  4LDY A;  1YN8 A;  4FT4 A;  3I9Q A;  2K6D A;  1I07 A;  4C8Q C;  2X51 A;  2LJ3 A;  3ZFJ A;  4IUR A;  4AFQ C;  4RG2 A;  5KYU B;  4K11 A;  1YJ9 T;  2DD4 A;  2WSF E;  5DM7 R;  4OB2 B;  4B6M A;  2FVU A;  3C4S A;  3M0Q A;  2EQU A;  2CT4 A;  1MV0 B;  4A4K A;  5GAO p;  1YCS B;  1N5Z A;  3J81 E;  4RUG A;  5J39 A;  1K8A C;  3JAM E;  5CQX A;  2QI2 A;  1JBM A;  3VU3 C;  5GAO m;  4FYW B;  5CVI A;  4KGZ B;  1FMW A;  1VYV A;  2F2X A;  3FIF A;  1FWZ A;  1BI2 A;  4C8Q A;  1VUB A;  1UGQ B;  2HD0 A;  4ELY C;  1RAH B;  2L3Q A;  5KYY B;  2LQW A;  1A0N B;  1KC8 R;  4J6W A;  1X6B A;  5D7U A;  1XQH A;  3RNJ A;  5KYU A;  3CD6 T;  3VS6 A;  3JCM b;  4PFO A;  2I0N A;  1JXM A;  2HQE A;  2KRS A;  3CCR Q;  2AZV A;  2PVD B; 
#chains in the Genus database with same CATH homology
 5GAO n;  4IKF A;  5J3B A;  3TRE A;  3OS2 A;  5CO7 A;  3O8V A;  2L3R A;  5CIU A;  1VQP T;  3OMC A;  4A54 A;  4ME7 A;  1NZ9 A;  1X01 A;  4C0G A;  4KT0 E;  3JCM c;  4OGE A;  2MMP A;  3CXC A;  1PSE A;  2RM4 A;  1BKB A;  5IN1 A;  2DAQ A;  1EIF A;  2DO3 A;  3DKM A;  2RA2 A;  2EKO A;  2M16 A;  3HRT A;  5D6X A;  3CXC S;  4RMO A;  4JRQ A;  2H3J A;  5GAM h;  3OYN A;  1B34 A;  2BIV A;  1U1T A;  1K9M C;  2KVQ G;  2KAF A;  5J26 A;  4L6V 5;  1WPY A;  3V7C A;  5HK0 A;  1VQ6 A;  2FB7 A;  4JUV A;  2LTO A;  2ZZD A;  5GAN d;  1K73 C;  4M75 D;  3I56 T;  3JCM V;  3GOX A;  1X6O A;  3A5Z B;  2JOY A;  3MP8 A;  1Q81 U;  2EFI A;  1G5V A;  5A0D A;  3LH0 A;  5I21 A;  2A3L A;  1KG1 A;  4ZTJ A;  2K3Y A;  2YHT A;  4JRK A;  3HRS A;  1X75 C;  3WVD B;  5DY9 A;  3PGG A;  4FM4 B;  1WJR A;  4OB3 B;  5M9O A;  2RJF A;  1U1S A;  3OB9 A;  1KC8 U;  3S3M A;  5LJ5 d;  2NLU A;  1PSF A;  5GAO l;  3HFN A;  3JB9 I;  3JSC A;  3WXM B;  3T9N A;  2K5I A;  5CKH A;  4BI4 A;  2X35 A;  4IUQ A;  3CCR A;  3CCM A;  2DKG A;  3X25 B;  1JJ2 S;  1N8R U;  3OMG A;  4EMH A;  3CCS A;  3OW2 A;  1VQM A;  4MDW A;  4M75 G;  5GMK m;  4M77 B;  4ZGD B;  2LNV A;  4JRP A;  1YJW T;  1RI0 A;  3SWN C;  1IZ6 A;  3OW2 S;  3NTH A;  3E1S A;  2WAC A;  4C8Q F;  4E7L A;  3VYH B;  2QQS A;  3QKJ A;  4M78 G;  4A53 A;  4N4H A;  1M9S A;  2LCL A;  1JRI A;  4DQ2 A;  2QQR A;  3DLM A;  1KQ2 A;  1KD1 U;  1VQ7 A;  2G3R A;  2DZ9 A;  2C06 A;  4M77 C;  3Q1J A;  3PIO A;  3CC2 A;  3AHU A;  4XTW A;  4KUI A;  3JCM d;  2LT1 A;  2B8A A;  2R57 A;  5CR2 A;  1M1K U;  4M7A G;  2XI9 A;  2O4X A;  2RJC A;  4NL3 A;  4C92 F;  1QVG A;  3P8H A;  2ZPG B;  4II1 A;  3GP8 A;  5LJ3 d;  5GAN 2;  1VQK A;  3S3N A;  5DLO A;  2OTL T;  3QSU A;  4KUL A;  2ZPI B;  3MCA B;  5CKF A;  4GY5 A;  5GAM g;  4OP0 A;  3OS0 A;  2KY9 A;  4TVR A;  5IT9 E;  2LQ8 A;  1WGS A;  3CCU T;  2D6F A;  3OYB A;  3JCM P;  2AHJ B;  2XIC A;  1KQS S;  3EFS A;  1I8F A;  3KUF A;  3RMS A;  2CGH A;  1QP2 A;  3BFM A;  3VJP A;  3OYI A;  4BY6 B;  3SD4 A;  2MWP A;  4BE1 A;  1M90 U;  1GXI E;  5IAY A;  2F69 A;  1ZQ1 A;  2ZGW A;  4C8Q E;  1VQ5 T;  1JB0 E;  2ZPB B;  4PNO A;  3OSV A;  3JB9 G;  2JTM A;  4PKC C;  4JS4 A;  4XTU A;  1N9S A;  4C0F A;  2GFA A;  4BE2 A;  3CCQ A;  1B34 B;  3SWN A;  1BIA A;  1YI2 A;  3OY9 A;  2RH2 A;  1NPR A;  2L5Q A;  4BY6 C;  2O01 E;  3E9F A;  4C92 E;  4EDU A;  4R56 A;  2EAY A;  2E10 A;  2KSS A;  2E1H A;  2BUD A;  3LYI A;  4L5G A;  2VC8 A;  3CCE T;  2QEX A;  4M77 A;  3CCR T;  4LDX A;  4ZGE B;  2FHD A;  3VUZ A;  2LDM A;  1VQ9 T;  3TU4 K;  4LDW A;  4HT8 A;  2HAX A;  2ZPF B;  4Z02 A;  1VQM T;  5GAM f;  5GAN 5;  1VQL A;  3L42 A;  2RHU A;  4ZN1 A;  1G3T A;  2LX9 A;  2P4T A;  2V8K A;  3UPU A;  1YHQ A;  3DB3 A;  2E6Z A;  3ME9 A;  3OYY A;  1KHC A;  4MZM A;  4OGC A;  3X24 B;  5CK9 A;  3F70 A;  4M7D B;  4J83 A;  2R5M A;  3HRU A;  2X4X A;  3BDU A;  2Y90 A;  3LGL A;  3QYG B;  3CBM A;  4JLI A;  2XK0 A;  1OZ3 A;  1Y71 A;  2E6N A;  4JRI A;  2GCX A;  3QZ9 B;  4BDY A;  1FXX A;  3OYJ A;  2WSC E;  3JCM h;  5GAN 4;  4QW2 A;  1I5L A;  3EFR A;  5GAM e;  3VKI A;  3VYG A;  4J6X A;  1Q7Y C;  3QHS A;  2WSE E;  3OYF A;  2RK2 A;  1W2B A;  2JVV A;  1RL2 A;  2LVM A;  2PU9 B;  3KBG A;  3QYH B;  4MZT A;  5KE2 A;  3CC4 T;  1VQK T;  3M56 A;  3JCM W;  3RMQ A;  1P92 A;  1ZHI A;  4BAC A;  5GAO r;  4FT2 A;  1HK9 A;  2OTJ A;  2CZ1 B;  3N5B B;  1YJN T;  5GAN 8;  2RO0 A;  1MGQ A;  3GF5 A;  4PJO D;  2RHX A;  3M54 A;  4E7J A;  3GNG A;  4E7K A;  1VQO A;  3V8J A;  4XQ3 A;  3UDC A;  1YCY A;  3VUB A;  2K4Y A;  3FC3 A;  4BI8 B;  4JDS A;  3BDL A;  4F7U G;  1K8A U;  2P0K A;  4MZP A;  2O4X B;  2CZ0 B;  2HQX A;  3E9G A;  3ER0 A;  1N27 A;  3I55 A;  1N9R A;  3M57 A;  1OYX A;  3M58 A;  3QG1 A;  3URG A;  4MML A;  5CKE A;  4CRI A;  1M1G A;  3CCQ T;  1UGS B;  4J5Y A;  3G71 T;  1YI2 T;  4HCC A;  2LT4 A;  2V8I A;  2HNI A;  3FDR A;  3QPH A;  1KQ1 A;  3A8H B;  4JLG A;  1QP3 A;  3VV0 A;  4IUP A;  3X20 B;  4IUV A;  2JUF A;  5A0L A;  5KE3 A;  3CCL T;  1BI1 A;  1YJ9 A;  1Q82 U;  4XTV A;  2RI2 A;  2EWN A;  2K57 A;  4M78 D;  2E12 A;  5CKB A;  2XHC A;  3G4S T;  3CPW A;  3QXE B;  3LLR A;  3QBY A;  4PJO G;  3CMA A;  1Q86 U;  4B9W A;  3OYH A;  2CZ7 B;  4M7A D;  1VQL T;  4FU6 A;  4M7D A;  3G7Z A;  4XK8 E;  3SWN B;  4WF2 A;  4PJO C;  1LJO A;  4M75 B;  4UC4 A;  4EMG A;  3FJP A;  3JRZ A;  4XTX A;  3V8L A;  4C8Q D;  3LWI A;  3PNW C;  3G6E A;  2RI3 A;  3J80 E;  1YIT A;  5GAN 6;  5FRM A;  1WQW A;  4N4I A;  4QVD A;  2A7Y A;  2LCC A;  1UB4 A;  4M78 B;  3JCM g;  1VQ4 T;  2I2L A;  5GMK e;  3CME A;  3QJY A;  2YLC A;  4N0A C;  4PLI A;  2K3X A;  3OA6 A;  2GF7 A;  4ZGJ B;  5LJ3 g;  4M75 C;  1VIF A;  4C92 D;  5GAM j;  3GPL A;  4J8O A;  3RKX A;  4F7U A;  5DLQ E;  4M7A B;  4M77 F;  2X4W A;  5LJ5 f;  2P0Q A;  4HCZ A;  1VIE A;  5FU7 B;  4EMK C;  5GMK i;  3S3O A;  3OBY A;  3JB9 D;  4PL6 A;  2OTJ T;  2YLB A;  4EPC A;  2E65 A;  4M78 C;  2V8J A;  2QQB A;  5FU6 B;  2KDS A;  2EYQ A;  3UWN A;  3V7S A;  4HA8 A;  3PFS A;  3OYG A;  2XD0 A;  1WNL A;  1BYM A;  3RER A;  3CEY A;  3A8G B;  4M7A C;  1N6A A;  4C8Q G;  5FU7 C;  2JZ2 A;  5GMK h;  3A8O B;  1QVG S;  1MHN A;  1K9M U;  2M1H A;  3I55 T;  1G3S A;  2F5K A;  4RCC A;  2Y4X A;  4O6J A;  5FU6 C;  1VQN A;  1NJI C;  2X4J A;  5GAN h;  1VQ6 T;  4C5G A;  3CD6 A;  3OS5 A;  1K73 U;  4IUU A;  4PJO A;  2BKD N;  3X26 B;  4QVZ A;  2VYT A;  2D0Q B;  3TEE A;  1OZ2 A;  3OYA A;  2PUO B;  4C92 G;  2IVW A;  3M5A A;  3ZBD A;  1M1F A;  3JCM f;  3UT1 A;  2DK3 A;  3S6W A;  1LOJ A;  5CCA A;  3L1A A;  4OB0 B;  3RKW A;  2CS7 A;  4M77 E;  1G3Y A;  1UGP B;  4L59 A;  3OYK A;  3J7A F;  5LJ3 f;  3TCJ A;  4J7F A;  3CMA T;  2IG0 A;  3EAE A;  3HPW A;  2OAU A;  2RHZ A;  3QZ5 B;  4N0A A;  4NL2 A;  3M59 A;  2EJ9 A;  2HBP A;  1FX7 A;  3MET A;  3WVE B;  4DOW A;  5LJ5 h;  4M75 A;  4E7H A;  4OF1 A;  3GIB A;  2ZPH B;  2DTI A;  4FSX A;  4EMK A;  3GNF B;  2QQ9 A;  4C0Z A;  3JCM e;  1I81 A;  2D9T A;  3H6Z A;  4KUD K;  2XDP A;  1BI3 A;  4BE0 A;  4M78 A;  5KCO A;  3CCM T;  5FRN A;  3QII A;  3OYE A;  1YIT T;  2GQV A;  2XU8 A;  4LD6 A;  3CCS T;  5LJ3 e;  3OYM A;  3BY7 A;  3LX7 A;  3P8D A;  5GAN 7;  2CKK A;  4N4G A;  1UEB A;  3M4Y A;  1S72 A;  2EIF A;  3X28 B;  4M7A A;  2M0O A;  4BUG A;  5A0G A;  2L8D A;  4C5I A;  4Q5W A;  1QVF A;  2LQK A;  1BI0 A;  5GMK j;  3V7R A;  5FRO A;  3I56 A;  3L2V A;  4BDZ A;  3RES A;  3C94 A;  1OI1 A;  3HL8 A;  4GLK A;  4E7I A;  1Q81 C;  2E41 A;  1VQ7 T;  4XU2 A;  1IRE B;  4OB1 B;  4X9C A;  2DTO A;  4XU1 A;  5GAN j;  3CC2 T;  2KQW A;  2MI6 A;  1XOV A;  3SB2 A;  2DVE A;  3HFO A;  5I2M A;  3OYL A;  2KK4 A;  4M7D F;  4JS5 A;  1HXD A;  2P0P A;  2GFU A;  1R8O B;  2LC4 A;  2VV5 A;  1WJQ A;  4PLL A;  4X34 A;  5LJ3 h;  3SFM A;  5GMK l;  1I4K 1;  2E70 A;  3MHX A;  1W2B S;  4J6Y A;  3L2W A;  3M4G A;  4FL6 A;  5GAO q;  4BI3 A;  4ELZ C;  2ZPE B;  1ZBX A;  2QDY B;  4F7U B;  3CCJ A;  1O9S A;  5GAN g;  5LJ5 j;  3R6O A;  4LDV A;  1WJS A;  2QXF A;  1N8R C;  1O75 A;  5CQY A;  2X4Y A;  2FL7 A;  2XG8 D;  3M55 A;  5KH6 A;  3FLG A;  3BW1 A;  3FB9 A;  4D6W A;  4CI0 C;  2VGN A;  4MMK A;  4XU0 A;  3JCM X;  1YJW A;  4F7U F;  3OQ5 A;  1H64 1;  2XKO C;  4C0D B;  2DTH A;  2EJG A;  3QDR B;  3JB9 J;  2XID A;  2CYZ B;  2DXC A;  3MEA A;  5D6W A;  1KD1 C;  3PT9 A;  5AYF A;  4M7D E;  5EG2 A;  2RD1 A;  1QVP A;  5LJ5 g;  3M9Q A;  3CBP A;  3FRN A;  4XTZ A;  1M1K C;  4PJO B;  2JNG A;  2RHI A;  2KMT A;  2EQM A;  2R5A A;  4C0D C;  2VGM A;  3KXT A;  2QEX T;  4Y91 A;  4B9X A;  2Y4Y A;  1SSF A;  2RI5 A;  3LWH A;  1H3Z A;  1DJ7 B;  4R55 A;  4XAX B;  5A2Q E;  2OTL A;  3CPW S;  3L2R A;  1LNX A;  4M7D C;  3DLL A;  3JCM J;  2DXU A;  5CAI A;  3PIP A;  4NS5 A;  4PJO F;  1NE8 A;  3CCU A;  2K5L A;  3E19 A;  1S72 T;  5LJ3 j;  2PVG B;  1XTD A;  4QQ6 A;  1YHQ T;  3OYD A;  2DXB A;  1BIB A;  1D3B B;  1W4S A;  2RHY A;  3MO8 A;  5L8R E;  5GAN f;  2DIQ A;  4X9D A;  4NOY A;  4F7U E;  1YIJ A;  2DZC A;  2YRV A;  2EJF A;  3MEV A;  1M90 C;  3PMT A;  4EMK B;  4XU3 A;  3RUX A;  1M8V A;  2MAM A;  4J7I A;  3L2Z A;  4M77 D;  5GAN 3;  3L2U A;  1VQ5 A;  1Y7X A;  2VXF A;  4OVA A;  3CPF A;  2PVO B;  2VXE A;  2EQJ A;  4M75 F;  4HKE A;  4JJN K;  1G3W A;  4KBM B;  4YTL A;  1Q7Y U;  2DIG A;  3QO3 A;  3GLX A;  1KHI A;  2JN0 A;  5GAN e;  4FIB A;  5CKD A;  4M78 F;  3M53 A;  3V8K A;  1TH7 A;  2K5F A;  2M9U A;  2RK1 A;  2QA4 A;  2DJZ A;  1JJ2 A;  3CCE A;  2CZ6 B;  5C6S A;  1VQ8 A;  1Y07 A;  2MF2 A;  3CCJ T;  1VQO T;  3RKY A;  4PJO E;  4C8Q B;  2MWO A;  3CCV A;  1VQ9 A;  4RG8 A;  4C5H A;  4M7A F;  1QW1 A;  5LL6 S;  3NTK A;  4ZTF A;  2DPP B;  4IUT A;  1Y96 B;  4QVC A;  4LDY A;  3L2Q A;  3LGF A;  2F5T X;  3INZ A;  4FT4 A;  3H8Z A;  3OS1 A;  3C95 A;  1YBY A;  2QQA A;  5D6Y A;  5LJ5 e;  3HHT B;  4M77 G;  2VUB A;  2QTX A;  4C92 B;  3CC7 A;  1V29 B;  3PMI A;  4RKU E;  3P8B B;  4C8Q C;  3OBW A;  3HP9 A;  5HK3 A;  4M75 E;  3HKS A;  4QQD A;  3OYC A;  3DB4 A;  3ZFJ A;  4IUR A;  4RG2 A;  4DA4 A;  1YJ9 T;  3MEW A;  4BB7 A;  2DD4 A;  2WSF E;  3A8L B;  2K2V A;  4ATO A;  5DM7 R;  4A4H A;  5HKC A;  4M78 E;  4OB2 B;  5I2S A;  4Y28 E;  2RB6 A;  4P5N A;  4C92 C;  3CC4 A;  3JB9 F;  2LRQ A;  1VQP A;  4LD9 K;  1D3B A;  1KQS A;  2FVU A;  3C4S A;  3NTI A;  2EQU A;  3ASK A;  3OSS C;  1YJN A;  5C0M A;  2EQK A;  3C12 A;  2RJE A;  4M7A E;  4A4K A;  2XDD A;  4XTY A;  4MDX A;  5GAO p;  3MP1 A;  3JCM Q;  3J81 E;  4A4F A;  4C5E A;  3LW5 E;  5J39 A;  3HSB A;  3G6E T;  1YIJ T;  2PQW A;  4HCB A;  4VUB A;  1K8A C;  3A8M B;  1M4Z A;  3FEO A;  3JAM E;  5CQX A;  2QI2 A;  4HT9 A;  2DEQ A;  5GAM d;  1JBM A;  2DD5 A;  3PTA A;  4V2S A;  2FYK A;  3QJ6 A;  5HY6 A;  3MP6 A;  1WQ7 A;  4ZN3 A;  3VU3 C;  1M5Q 1;  2RJD A;  3NFC A;  3CME T;  5GAO m;  3JB9 H;  3G71 A;  5CVI A;  4M7D D;  4DOV A;  4A4E A;  4E47 A;  3MEU A;  3FIF A;  4BD3 A;  1QVF S;  1FWZ A;  1BI2 A;  4LDU A;  3CCL A;  4C8Q A;  1Q82 C;  1VUB A;  2QA4 T;  1UGQ B;  1AHJ B;  2HD0 A;  4ELY C;  1VQ8 T;  3G4S A;  1Y96 A;  1XNI A;  2JTF A;  3CCV T;  1U8R A;  4O5V A;  4QQG A;  4A4G A;  5KCH A;  1Q86 C;  3QUI A;  3SDZ A;  1KC8 C;  2PUK B;  4J6W A;  4C92 A;  2R58 A;  1UGR B;  3ZEH A;  3CBO A;  2L89 A;  3RIR A;  1VQN T;  1XQH A;  1NPP A;  1NJI U;  2E5Q A;  4RCB A;  3CC7 T;  2XDB A;  3CD6 T;  2DXT A;  3JCM b;  4OMF B;  5FLX E;  4M7D G;  2HQE A;  2E64 A;  2ZCF B;  1VQ4 A;  2PVD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...