3N5BB

The complex of pii and pipx from anabaena
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
molecule tags Transcription regulator
molecule keywords Nitrogen regulatory protein P-II
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3n5bB01
2XG8D 3N5BB 2XKOC
chains in the Genus database with same CATH superfamily
1TOVA 1K9AA 1VQ4Q 3RKXA 1AVZC 4PJNA 1XOVA 2RA2A 1K8AR 2BKDN 4N4IA 1TUCA 2XK0A 4GLMA 4QT7A 1YI2T 3NGPA 3F70A 5HK3A 5GMKi 1VYUA 2P0QA 5CKDA 2GF7A 3G6ET 1GCPA 1VQ8T 1WXBA 4YTLA 4LDVA 2CZ7B 4QQDA 3JSCA 2DETA 2YSQA 4Q5WA 1Q7YU 2FB7A 1U1SA 4LUDA 2X4WA 2DTHA 1VQPA 3A8MB 2FEIA 4HVUA 1KD1R 5LL6S 3C12A 3V7CA 4C0DC 1UGVA 3VS4A 1SHFA 3CC4A 3MPUB 4X9DA 1UFFA 1V1CA 2PTKA 4RTZA 2E5QA 2LQNA 3VS1A 1MHNA 2B86A 2XG8D 4KH0B 3H9NA 2K5IA 1JQQA 2RHZA 2FRWA 4EMGA 3PVQA 4C0DB 3CCVA 4C92B 1KC8C 2L3SA 1IGUA 1WHMA 2YLCA 2MAMA 2R58A 3PTAA 5ECAA 2YT6A 2Z0WA 2K79A 3L2UA 3P8BB 1YHQA 3J81E 1VQ5T 4N4HA 1VQMT 2KMTA 2M0YA 1YITQ 4M7DD 2LCLA 2G6FX 1M8MA 2NUZA 2OTLQ 2J06A 3A8HB 2AZVA 2CP5A 1AWOA 2YUOA 4M78B 3VS6A 3RR6A 4E7IA 4AMCA 2QDLA 3CCQA 2DTIA 1B7TA 4BB7A 3N5BB 2RK2A 2QQAA 2CYZB 3CBPA 3GNGA 1SRMA 1G3TA 1EFNA 2O2OA 3SB2A 3X20B 4XTZA 1UECA 1WXTA 4M77D 5CR2A 4C92A 5LJ3e 3PMTA 4N0AA 5I21A 2P0PA 3O5ZA 3RERA 1HSQA 2MMPA 2QA4A 1LNXA 2YDLA 3S6WA 4BD3A 3CCQT 3FIFA 2KK4A 4ZGJB 5CQYA 1YWOA 2BZYA 1RAFB 3C94A 3NPFA 1QVFP 2YXYA 5GAN2 3CBOA 4AT1B 1NBEB 4LN2A 3CPWP 5KE3A 4UC4A 1UG1A 3I9QA 2ZCFB 3INZA 4JZ3A 4P5NA 4RTXA 1GXIE 1VQKT 3CPWS 5I22A 4BI4A 3EHRA 3CCLQ 2RK1A 3I56T 5FU6C 4DA4A 4HCKA 1V76A 1RI9A 1QCFA 2FZGB 1TUDA 3JCMe 4HVWA 1S72Q 2HBPA 2AHJB 2B8AA 3FJPA 4MZTA 1PKTA 1PSFA 1VQ5A 4WF2A 2KI7A 3LWIA 2K4YA 2VKNA 2D8HA 2EQKA 2EKOA 5IAYA 2HCKA 2D6FA 3G71A 3J80E 1KHCA 2ATCB 2ZGWA 1VIEA 4XTYA 5M9OA 2NUTA 1BCOA 2LJ1A 4AFSC 1N6AA 2DL3A 1VQNA 5CQXA 1N9SA 5GAMe 4OMFB 2ZPBB 1WNLA 3CCRT 1U06A 3Q1JA 3CCMQ 2KBTA 2PVDB 1NEGA 2CREA 2LMJA 4LDYA 1VQ7Q 3CD6Q 2K5LA 3JV3A 4QVZA 1AEYA 1UB4A 4F7UF 1TSFA 2DK3A 1D3BB 1R77A 4MDXA 4J9FA 2EPDA 3CCEQ 2IVWA 1X01A 4FCYA 2JJ9A 4F16A 4LDUA 3M9QA 4C0GA 5GANf 2E41A 3OW2A 2HAXA 1B3QA 3BFMA 2KVQG 1RABB 2JTEA 1KQSP 4HA8A 5FRMA 5I2MA 1OPKA 1WHJA 4AFQC 1PRLC 2RQTA 3OSVA 4KT0E 3WVEB 4M78A 2KRSA 4PFOA 1MGQA 5GAMg 3CCUQ 1X6BA 3GLXA 2YRVA 3L2RA 2JM8A 2AKKA 1VQ8A 3HRTA 5HKCA 4F14A 1QCOA 3L2QA 3L42A 3TCJA 2HKNA 2LX9A 4M78D 5D6YA 1NPRA 1Q86R 1M1KU 4A54A 2YRCA 2QGGA 4PNOA 4M77A 1BIBA 3R6OA 2QASA 4IURA 1W2BS 4KUIA 1D1AA 2GTJA 1NYFA 1Q7YC 1PNJA 4Z89A 1K1ZA 5D6XA 1VQ4A 3OYYA 4MDWA 3M0UA 4FT4A 3MKDA 1M3CA 1JBMA 2F5KA 2H8HA 2CDTA 1X6OA 1PRMC 2M16A 3QUIA 3OYIA 4OMOA 4JZ4A 3CCJA 3CCUT 2VC8A 3EFOB 1U5SA 4M75E 3CC2T 4ZTJA 2QG9B 3VU3C 4AG2C 5I11A 1WIEA 1YP5A 3JCMh 2WSEE 1KD1C 1IO6A 2MK5A 3V8JA 1X2KA 3MCAB 4J8OA 4FYWB 1VQPQ 3M53A 4BE2A 1HD3A 1X75C 3JCMc 2A28A 1YN8A 3C4SA 4LNPA 4KULA 4L6V5 3CC2Q 2F2WA 2GBQA 1WI7A 3M59A 3S3NA 2FVUA 5CKFA 1VQ7T 6AT1B 2WSFE 1K0SA 4J6YA 1KHIA 1U1TA 5C0MA 2DPPB 2NYSA 1UEBA 1OV3A 4C92F 4J5YA 1XTDA 2RQWA 3NTIA 1VQKA 2QQBA 1TUGB 4BUGA 2X3XD 4K11A 4KGZB 3H0FA 3JRZA 4IIMA 3RUXA 3M0SA 1SPKA 3I35A 1AT1B 2GCXA 3EGDB 2XICA 2PUOB 2DEUA 2AIRB 1A0NB 3LWHA 4JS5A 4M7AF 3RNJA 5LJ3j 1YITA 1SF9A 2C0TA 4KRTA 5FROA 3VUBA 5CIUA 4B6MA 4EMKA 5LJ3f 1VYTA 4PJOF 3QKJA 2FPDA 1PWTA 1M30A 3JCMb 2DJZA 3HL8A 1M27C 2DXBA 3C95A 4C92D 4IUPA 2HDAA 2YUQA 3FC3A 2D0QB 3CCET 1Q86C 1W6XA 2CZ0B 4XTXA 4V2SA 2LC4A 1B34A 1AZGB 4IUTA 3I5RA 5L23A 1YJWA 2RQUA 2VYTA 3OBYA 2CUDA 4LDXA 5KYXA 3OSSC 4OB3B 4QQ6A 1AWWA 5GAMh 1JJ2P 5GMKm 2HKQB 2JMAA 2CS7A 2CUBA 4M75G 2GGRA 4E47A 3HSBA 3BDLA 3E2UA 3T9NA 5KE2A 3BDUA 1Q95G 5CCAA 1QW1A 1YCYA 2DIQA 1Q82C 1W2BP 2DXTA 4PL6A 2ZZDA 3DKMA 5C6SA 1YJ9T 3PFSA 2K3BA 3MHXA 4F7UA 1MV3A 1S72T 5AYFA 2KYBA 2ED0A 5GAOp 3SD4A 2J05A 4XU2A 4IUQA 1VQMQ 1VQ5Q 4NL3A 1K76A 4O6JA 4C5GA 4C8QG 4M7AC 4M4ZA 3MJXA 5KYWB 1VQ9Q 4D6WA 2JS0A 4E7LA 1WFWA 2KSSA 2C0IA 2CZ6B 2EJGA 1RAGB 3QZ9B 1Y57A 1NLOC 1IHWA 3WXMB 4PLLA 1FXXA 2V8KA 1OI1A 2RQVA 1VQ6A 2MWPA 2J6KA 1Q7YR 4C92G 1Y7XA 1OU9A 4M77F 1OULA 2CH4W 4M75B 4ZTFA 4M7DA 3L1AA 2C0OA 3META 4RKUE 2RHYA 4RTUA 5CKEA 1Y96A 4JRKA 2Y4YA 3M54A 4LD6A 1M2VA 4OF1A 2KT8A 2EQIA 2QK0A 3E1SA 1BB9A 4E6RA 4PKCC 4KBMB 3OYGA 2QEXA 1VQ6T 4E2FB 1TTHB 1VQPT 3EFRA 5CAIA 1QLYA 1M5Q1 1LPLA 3UPUA 2COWA 3G6EQ 2PU9B 1X69A 2X4YA 3CPFA 3CCSA 3X28B 2ED1A 2JZ2A 1ZHIA 1K73C 2RPNA 1PHTA 2OTJT 4X1VA 1BI1A 3JB9G 2KT1A 3UWNA 4FU6A 3VRYA 1FMWA 4RCBA 1M2OA 5GMKj 3EHQA 1QVGA 1K9MR 2LDMA 3M4YA 2DYBA 2FL7A 5GMKl 1R0CB 1SSFA 3CCRQ 2DE0X 2E12A 1IREB 3CCVT 1GRIA 2LRQA 1Q81C 3LW5E 1MMAA 5DLQE 5HK0A 4HT9A 1PCXA 2CP7A 2DL7A 2EYZA 5I2SA 1FYNA 2F69A 3VRZA 3NTKA 1IZ6A 4BY6C 2JS2A 2LNHB 3EGXB 4X34A 4XU3A 4PK4A 4JS4A 4Y91A 1ACMB 1LJOA 2WSCE 2OAUA 4FM4B 4ZNXA 3A8GB 1WHKA 2LNVA 2BUDA 2XKOC 4M78G 4BY6B 1UHCA 3EFSA 2X9HA 5IXFA 4ME7A 2ECZA 1PD0A 1OOTA 3E9GA 1N5ZA 2CT4A 3EG3A 4PJLA 3LH5A 2EFIA 1YWPA 3OS1A 2ZPEB 1RL2A 1VYVA 1YHQT 1ZQ1A 1FX7A 4XQ3A 2MYSA 4EIKA 2X4JA 4IKFA 2QAZA 1M1FA 1K8AC 3I55A 4BE1A 2HMAA 4CC7A 2E70A 2JMCA 1OZ3A 3UT1A 4TVRA 1OYXA 4OMNA 2LCSA 2HSEB 1Y07A 1KIKA 5KCHA 5GANd 2HL5C 2RJFA 3X24B 3OYNA 2HSPA 1D0XA 2WACA 2NUPA 3UF4A 2Y90A 4PFPA 3PT9A 7AT1B 3CC7Q 4NS5A 3QJ6A 1OX8A 1ARKA 3L2WA 4J7FA 3REAB 4M7AD 1WZOA 3OS5A 5CO7A 4QKUA 4FYYB 2HL3A 2E65A 8ATCB 1RUWA 1G3WA 1T3SA 1JJ2S 2XIDA 1SG5A 2A0FB 5J26A 1YITT 3FLGA 2DL5A 1NM7A 2LVMA 2YHTA 3EGUA 1ZSZB 4PJOC 3PE0A 3CCLT 2DFUA 2RI5A 1QVGP 1JXMA 3TEEA 3JB9F 1FMVA 4BE0A 1GBRA 1BK2A 1WA7A 3M4GA 2EYXA 2KE9A 5LJ5h 1AWXA 5GANj 2DL4A 4R56A 3AT1B 3OA6A 1UGRB 5LJ3g 2PNIA 2JM9A 2KGTA 3RDVA 1K9MU 1QVFA 1RAIB 3SDZA 4C8QB 3CXCP 4CC2A 3JCMW 2EWNA 3RKWA 2OX7A 1D1BA 3CCQQ 3TVTA 1QWEA 1OQKA 1M4ZA 1GFCA 4X9CA 3M57A 2BE7D 1PM3A 3OYCA 2KXCA 4RMOA 4B9WA 3RESA 3CCST 4C92C 1NYGA 2QI2A 2DVJA 1Q81U 2MCNA 2CP0A 5IN1A 4JRPA 1UGPB 1TU0B 3URGA 4C5IA 2CP3A 2JXBA 1N8RR 2SEMA 3VKIA 2DO3A 2RQRA 1G3YA 3GP8A 1GCQC 2YUPA 1GCQA 1BCMA 4E7SA 2JT4A 1IB8A 3JCMg 1K73U 2VXEA 4J9EA 3OYEA 1TG0A 4KGXB 4CC3A 4C0ZA 2DD5A 3LGFA 4O5VA 2RO0A 1PKSA 2DX1A 2OTLA 1HXDA 1VQ4T 4A63B 3NHNA 1NJIR 1E7OA 1QQJA 4OB0B 2EJ9A 2RB6A 3WVDB 2LX7A 2DLPA 2L0AA 1TWBA 2J6OA 3QDRB 1S72A 3CMAQ 4JRQA 5DLOA 2JN0A 4PJOE 4ATOA 5KYUB 3D7SB 3S3MA 1YHQQ 1MMGA 4AG1C 3PNWC 4E7ZA 2QA4Q 2QEXQ 2H3EB 4M7AA 4PLIA 2XMFA 2CGHA 4AFUC 4F17A 2DKGA 4PJOA 2QTVA 2QEXT 3O8VA 1YJNA 3OW2S 1SKUB 3DB4A 4QW2A 2QA4T 1MNEA 2A3LA 4FL6A 4KH1B 1VQ7A 3GBQA 1P92A 1TH7A 3G7ZA 2EVRA 5GAN8 2MF2A 2V8JA 1JXOA 3CC7T 2VGMA 1G8XA 2EGAA 1Q82R 2R5AA 1JEGA 1H3ZA 1NLPC 2O88A 3KXTA 4F7UG 1W2BA 2HEQA 1TXQA 2K2VA 3AHUA 1FMKA 1VQOQ 1NPPA 3A8LB 4HCCA 2A37A 4A53A 4ANJA 4ESRA 2RH2A 1RI0A 4OB1B 2BZXA 3LLRA 4OGEA 2GFUA 2ESWA 3CCLA 2DF6A 4R55A 3OY9A 3SWNA 2IPOB 3A1PA 3OYHA 2XDPA 4DOVA 2E3HA 3G1JA 4FSSA 4D8DA 1KC8U 1KQ1A 1R0BG 4D8KA 3EH2A 3CD6A 2CP6A 1HK9A 1X27A 2K3YA 1PG5B 4RTWA 4GBQA 1I81A 2GQIA 2A08A 4EMHA 1YIJT 3CMEQ 2KY9A 1KQSS 1M8VA 3R6NA 4M75C 3EG9B 5KCOA 1RLPC 4DBQA 4FSXA 4C8QD 3QDFA 4OMLA 1K9MC 2GQVA 2D1XA 1CKAA 3VS0A 3OQ5A 3CCMA 1NJIU 3M56A 2DILA 4OMPA 3CC2A 2DZ9A 3VS7A 3CXCS 1O9SA 3CC7A 5GAN6 2RD1A 5GAOr 5FLXE 2FZCB 2EQJA 3FEOA 2O4XA 5FWBA 3CEYA 2L3QA 2OTJQ 5HY6A 1YBYA 4A4FA 2E1HA 1H641 1VOMA 4FW2A 1C1AA 2VGNA 2HQHA 1BYMA 2L5QA 2W10A 1YJ9Q 1D0ZA 3ZBDA 2O4XB 1YNZA 2V8IA 2E5KA 2K3XA 4N4GA 1Z9QA 5IHIA 4HCBA 3QJYA 3UDCA 3M0RA 2EYQA 1I1JA 3ZL7C 1I07A 3CCJQ 2MWOA 3OYFA 2BTTA 2E3IA 2XDBA 3EG1A 5DY9A 1X6GA 2DMOA 4RTVA 5LJ5g 1LOJA 5AT1B 2CSIA 3JCMJ 4JLGA 3OYLA 5GAN7 2RJCA 2RF0A 1U3OA 3MP1A 1T0JA 2A7YA 2O9SA 4A4HA 3QO3A 2P4TA 1G3SA 3EG9A 1SEMA 1K8AU 2RHXA 2EW3A 2PZ1A 1YI2A 1ZBJA 3VS3A 2R57A 5A0DA 4HKEA 3V7RA 3SHWA 5HCKA 5A2QE 1JRIA 4M77C 1WJRA 1RAHB 3JB9D 3UA6A 3JCMX 1I5LA 5KYYA 3E19A 1NJIC 5GAN3 2LQ8A 2L2PA 2W0ZA 2ZAEA 3DLLA 2EJFA 2EGCA 2GNCA 2K57A 3QYHB 1YJWQ 2VWFA 4LDWA 1UGSB 5GANh 4J6WA 1QCNA 4LXCA 1QWFA 3OYDA 4Z8AA 8AT1B 1M3AA 1WPYA 3H8ZA 4MMKA 4LD9K 3HTRA 2RHIA 3TQ7P 2L8DA 3H6ZA 3RMQA 5KYYB 2H3JA 3TSZA 3OB9A 3GPLA 3CC4Q 3M0TA 1VA7A 2FRYA 1M1KR 2LTOA 1EZZB 1JU5C 2PVOB 2HZYA 1QVPA 4JJBA 3CCVQ 3QPHA 1M3BA 2F5TX 2ABLA 1YIJA 3MO8A 2E10A 2D9TA 1Y0MA 2X51A 2VVKA 1WJSA 1OPLA 3M0QA 4JLIA 4NL2A 1ZA2B 2DRMA 4J7IA 2DNUA 3BY7A 3G4SA 4PJOD 4HXJA 2IG0A 4XTVA 4M7AB 1RACB 3H41A 1WHGA 5D6WA 2VUBA 4QVCA 1W1FA 1W70A 2VB6A 1VQ6Q 4F04B 1YJNQ 3GIBA 2FPEA 1CSKA 3JCMf 5CKHA 2O01E 1GBQA 5KYUA 1N9RA 4A4KA 1ZX6A 1S1NA 3A5ZB 4RTTA 1ZLMA 2EQUA 4OGCA 3PIOA 4HT8A 1YFNA 4DQ2A 2COYA 1EIFA 3M5AA 2PQWA 3QXEB 2EAYA 3PVLA 2EYYA 2HD0A 3QYGB 4J83A 2YWWA 2AT1B 2L3RA 5LJ5f 2DERA 3RBBB 4JJDA 1VQLQ 2JVVA 3V7SA 1KQ2A 2BE9B 3JCMd 1E6HA 5GAN4 1B07A 3RIRA 3V8KA 3P8HA 5CKBA 1VQ9T 2X4XA 3QWYA 3ZEHA 3VYGA 2ENMA 4Y92A 4F7UE 2MPXC 2E4HA 1RADB 3HFOA 3GF5A 2CKKA 4J9GA 2DA9A 1VUBA 3JCMV 3UATA 1K4US 2JUFA 4RUGA 1NZ9A 3CCRA 4EDUA 1BU1A 1T0HA 5GAOl 3PIPA 4C8QE 1F1BB 1KD1U 1UUEA 1UDLA 4XAXB 1M90R 2EIFA 3M0PA 3SWNB 3I55T 1N27A 3FRNA 3VJPA 2FZKB 1C0MA 3A98A 1KQSA 2P84A 5GAMj 2RJEA 1I0CA 1UE9A 3VS2A 1GL5A 4ZN1A 3GOXA 2G3RA 4C5HA 1ZSGA 3CMEA 4C8QA 1HJDA 3CCMT 4XTWA 1BI2A 5A0GA 4IUVA 4CRIA 1RLQC 3OMCA 5A0LA 2QQRA 1BI3A 2DYIA 4JJCA 2KR3A 4M78F 2LT1A 3CXCA 2AZSA 4II1A 4WTOB 3H0IA 5LJ3d 1SSHA 2XU8A 3KFVA 2VASA 1HYOA 2RHUA 4JJNK 1IRXA 2KRNA 2D8JA 2LZ6B 2AK5A 1XJWB 1BKBA 2DVEA 3HHTB 3OYMA 2DL8A 4FW1A 4RCCA 3G71Q 2CSQA 2F2VA 2LQKA 1M90C 1YJWT 5KH6A 3VV0A 3NTHA 1AOJA 3L2ZA 2M0OA 1UGQB 1SHGA 1QVFS 4M78C 3G71T 4J9BA 4PJOB 3I56A 1WJQA 1D1CA 1ZUUA 1BI0A 2I2LA 2JTFA 2K6DA 4J6XA 2FHDA 4DEYA 1OZ2A 2DTOA 3REBB 4VUBA 3THKA 1QMCA 3LX7A 2EGEA 3BW1A 1Q81R 4XK8E 4KUDK 1H3HA 3MP8A 4FYVB 3RKYA 3IQLA 2KXDA 3TREA 1PD1A 1VIFA 2YRDA 4C8QC 3EH1A 4DBHA 2ROTA 2RI2A 1R8OB 1BIAA 2D0NA 5EG2A 4M75D 2M51A 3FJ5A 4Y28E 1V29B 4ZGEB 2L3PA 2DXCA 5L8RE 5GAN5 1X2QA 4M7AE 2PUKB 4OVAA 2MOXA 2K2MA 3QG1A 5IH2A 5FU7C 2HQXA 3OMGA 3A8OB 4J9IA 2COZA 3CPWA 3U23A 2DEQA 3I55Q 2QGFB 3CC4T 1LCKA 1ZSZC 2K9GA 2LCCA 3DB3A 2LJ0A 3EAEA 4ZN3A 1KK7A 4JRIA 5IHNA 2HBWA 5D7UA 1ABQA 1C6VX 4CI0C 1WQ7A 3EGXA 1N8RU 5IT9E 1JB0E 2ROLA 1WHHA 4RTYA 3BE3A 1WHLA 1D0YA 2V26A 5LJ3h 1QKXA 1U8RA 4M77E 2XI9A 1IHVA 1CKBA 2JNGA 2X3WD 1OEBA 2EBPA 2DIGA 3X26B 1KFZA 4DOWA 2QQ9A 1W4SA 4C5EA 2O31A 4ZGDB 3M58A 1VQLT 2HNIA 2KROA 2FO0A 5KYNA 3PMIA 3CCUA 1I8FA 1YIJQ 2RI3A 1K73R 1EX4A 1MUZA 4QQGA 4M7DE 2Y4XA 3CQTA 2OJ2A 4RG8A 4ORZA 4A4EA 2JW4A 5IHKA 4N0AC 1TS9A 1D09B 2CH4A 2EQMA 4DBRA 3CBMA 1UJ0A 1G5VA 3FB9A 3J7AF 2QYZA 3RMSA 2AKLA 2GTOA 3M55A 1ZSZA 2XD0A 1KSWA 1I5OB 1M2VB 1ZUKA 4E7JA 2CT3A 4J9CA 1MMNA 4MMLA 5CK9A 2DM1A 2QDYB 4J9DA 4M7AG 3SFMA 4HVVA 1YCSB 3QHSA 1IXDA 1VQOT 3V8LA 1WGSA 1I4K1 3OS2A 2ZPIB 2XHCA 2DRKA 3JCMQ 1Q86U 5GAOm 5GAOq 1WQWA 3P8DA 1UHFA 1VQLA 4DBFA 2KDSA 2NUPB 3G4ST 3JB9J 4M7DC 3FDRA 3TSWA 1KG1A 4RG2A 5KYWA 2E64A 5GJWB 1XQHA 3OBWA 4AFZC 2KEAA 4NOYA 1M90U 3KUFA 2YUNA 2ZPFB 4R0KA 1QKWA 2DAQA 2QQSA 1ZBXA 2JOYA 5GANg 2YLBA 2CP2A 2FPFA 4BI8B 2J7IA 2OI3A 4LE9A 1NE8A 1OU8A 2NLUA 1H8KA 1LVKA 5CVIA 4MZMA 2KYMA 2CZ1B 1KC8R 1M1GA 1X43A 1WLPB 2P4RA 2FG0A 1RAEB 2M02A 3C0CA 1VQKQ 3CMAA 1YJNT 3ER0A 4M7DF 3HRUA 2VV5A 2RMOA 1VQOA 5FU6B 2DXUA 2F1LA 4J9HA 1M9SA 2BIVA 4IIOA 1VQ9A 3L2VA 4OB2B 1E6GA 3E9FA 4KGVB 5GJVB 1N8RC 1J3TA 4FT2A 1ZA1B 1NEBA 4DEXA 4C92E 4PJOG 3CD6T 4EPCA 3VUZA 4XU1A 3OW2P 1VQNT 4Z02A 2K5FA 1K0XA 2NWMA 4QVDA 2A36A 3H0HA 2ZPHB 2C06A 1XNIA 3QIIA 2LP5A 3EG2A 4OP0A 5EC7A 1Q82U 1KJWA 1WDXA 4XU0A 2OAWA 5FWCA 4PJMA 2RM4A 1QP3A 3ZFJA 3UA7A 2KAFA 1ZUYA 3I5SA 2E6NA 1MNDA 3VS5A 3VYHB 3JB9H 3MP6A 4E7KA 2JTMA 2KRMA 2BZ8A 1ABOA 5GMKe 3EG0A 2OTLT 2X35A 1NG2A 1PSEA 3EGDA 3CCSQ 2RNAA 4PJJA 2DBKA 3HFNA 3TU4K 3I56Q 3JAME 3OYAA 2MI6A 4FIBA 3HKSA 1FWZA 3MEWA 5GAMf 2VXFA 4JUVA 4GLKA 4EMKC 1SRLA 1Z9ZA 4XTUA 1Y96B 1RAAB 3QZ5B 4BDYA 3ULRB 2PVGB 3NMZC 4WCIA 2V1QA 1PC0A 4PFZA 3CMAT 4M7DB 4M75A 5LJ5e 1QP2A 4BACA 2DBMA 2QTXA 4BI3A 4E7HA 2IIMA 5FW9A 3S3OA 3G6EA 4CC4B 1VQMA 1OX9A 2XDDA 3OS0A 5J3BA 5FRNA 1JO8A 1BBZA 3LGLA 9ATCB 3OYKA 3NFCA 3LH0A 4B9XA 3OYBA 3CCJT 3ME9A 3HP9A 1GFDA 4ELZC 2SRCA 2M1HA 5LJ5d 1O75A 2ZPGB 5GANe 3GNFB 2EKHA 1WXUA 4HCZA 3JB9I 2M9UA 3EFOA 3OYJA 1AWJA 1UTIA 4GY5A 2L89A 2GFAA 1YI2Q 4BDZA 3SEMA 4ELYC 4LUEA 1MMDA 3ASKA 4F7UB 1AHJB 4C0FA 3MEAA 2QXFA 2R5MA 4M78E 2KNBB 2LJ3A 3KBGA 3HPWA 1WX6A 3JCMP 4C8QF 5J39A 5GAOn 2DJQA 4M7DG 2DD4A 1VQNQ 3X25B 2KQWA 1G83A 4M77B 1YJ9A 4M77G 1AZEA 4OMQA 5DM7R 3QWXX 5IXBA 5GAMd 2LQWA 1G2BA 2RJDA 1JJ2A 5KYXB 2E6ZA 2F2XA 3MEVA 2DZCA 3QBYA 1UJYA 2LT4A 1AD5A 2J6FA 4JDSA 3CMET 4M75F 3PGGA 5LJ5j 4OMMA 1B34B 3CCEA 2EYWA 3LYIA 3MEUA 4MZPA 2OTJA 2I0NA 2P0KA 5GMKh 2O9VA 2V1RA 1WYXA 4A4GA 1MV0B 1D3BA 4IUUA 2K7AA 3DLMA 1M1KC 2MIOA 1DJ7B 1VQ8Q 4Z88A 4JPBW 1QVGS 4EMKB 4L5GA 3SWNC 4L59A 1IGQA 1H92A 4FYXB 2FYKA 2HQEA 1Y71A 2RN8A 3HRSA 1T3LA 5FU7B 3G4SQ 2NUTB 3QSUA
chains in the Genus database with same CATH topology
3OBYA 4LDXA 1H3ZA 3RKXA 3OSSC 2RI2A 3KXTA 4OB3B 4QQ6A 4F7UG 1R8OB 1BIAA 1W2BA 5EG2A 4M75D 2K2VA 4Y28E 5GAMh 3AHUA 1XOVA 2RA2A 1V29B 4ZGEB 2DXCA 5L8RE 2BKDN 5GMKm 5GAN5 4N4IA 4M7AE 2CS7A 1NPPA 2PUKB 4M75G 3QG1A 4OVAA 3A8LB 4E47A 5FU7C 2HQXA 3HSBA 3OMGA 3BDLA 3A8OB 4HCCA 3T9NA 3CPWA 4A53A 5KE2A 2DEQA 3BDUA 3CC4T 2XK0A 5CCAA 1YI2T 1QW1A 1YCYA 2RH2A 3F70A 5HK3A 5GMKi 1RI0A 2DIQA 4OB1B 1Q82C 2P0QA 5CKDA 2LCCA 2GF7A 3G6ET 3LLRA 4OGEA 2DXTA 4PL6A 1VQ8T 2ZZDA 2GFUA 3DKMA 3DB3A 4YTLA 3PFSA 5C6SA 1YJ9T 4LDVA 2CZ7B 3MHXA 4QQDA 4R55A 4F7UA 3OY9A 3JSCA 3SWNA 3EAEA 4ZN3A 3OYHA 2XDPA 1S72T 4DOVA 4Q5WA 5AYFA 1Q7YU 4JRIA 2FB7A 1U1SA 5GAOp 2X4WA 2DTHA 1KC8U 1VQPA 3SD4A 1KQ1A 4XU2A 3A8MB 4IUQA 3CD6A 4CI0C 1WQ7A 1N8RU 1HK9A 5IT9E 1JB0E 5LL6S 2K3YA 4NL3A 4O6JA 4C5GA 3C12A 4C8QG 3V7CA 4C0DC 4M7AC 5LJ3h 1I81A 4D6WA 4EMHA 1YIJT 1U8RA 4M77E 2XI9A 4E7LA 3CC4A 2KY9A 1KQSS 1M8VA 2JNGA 4M75C 2KSSA 4X9DA 5KCOA 2CZ6B 2EJGA 2DIGA 3QZ9B 3X26B 2E5QA 1MHNA 4FSXA 2XG8D 2QQ9A 3WXMB 4C8QD 4DOWA 4PLLA 1FXXA 1W4SA 2V8KA 4C5EA 1OI1A 1K9MC 4ZGDB 2K5IA 2RHZA 1VQ6A 3M58A 2MWPA 2GQVA 2HNIA 4EMGA 1VQLT 4C0DB 3CCVA 4C92B 1KC8C 3PMIA 3OQ5A 4C92G 3CCUA 1Y7XA 1I8FA 4M77F 3CCMA 1NJIU 2YLCA 3M56A 2RI3A 4M75B 2MAMA 2R58A 3PTAA 4ZTFA 4M7DA 3L1AA 3CC2A 2DZ9A 4QQGA 4M7DE 2Y4XA 3CXCS 1O9SA 3CC7A 3L2UA 3P8BB 1YHQA 3META 5GAN6 2RD1A 3J81E 4RKUE 1VQ5T 2RHYA 4N4HA 4RG8A 5FLXE 5GAOr 5CKEA 1VQMT 4A4EA 2EQJA 2KMTA 3FEOA 1Y96A 4N0AC 2EQMA 2O4XA 2Y4YA 4JRKA 3M54A 3CBMA 4LD6A 3CEYA 1G5VA 4OF1A 3OYGA 2QEXA 2LCLA 3E1SA 1YJNT 4M7DD 4PKCC 3FB9A 4KBMB 5HY6A 1VQ6T 3J7AF 1YBYA 3A8HB 3RMSA 4A4FA 2E1HA 1H641 1VQPT 3EFRA 5CAIA 3M55A 2XD0A 2VGNA 4M78B 1BYMA 1M5Q1 2L5QA 3UPUA 4E7IA 3ZBDA 2O4XB 2PU9B 3CCQA 2DTIA 2V8IA 2K3XA 4N4GA 4BB7A 3N5BB 4E7JA 2X4YA 3CPFA 3CCSA 2RK2A 3QJYA 4HCBA 4MMLA 3UDCA 2QQAA 3X28B 5CK9A 2CYZB 2EYQA 2QDYB 3CBPA 3GNGA 2JZ2A 1ZHIA 1K73C 4M7AG 2OTJT 1G3TA 3SFMA 3SB2A 1BI1A 3X20B 4XTZA 3JB9G 3QHSA 3UWNA 2MWOA 1VQOT 4M77D 4FU6A 3V8LA 1WGSA 3OYFA 2XDBA 4RCBA 5CR2A 1I4K1 5GMKj 5DY9A 3OS2A 4C92A 2ZPIB 1QVGA 2LDMA 5LJ3e 3M4YA 3PMTA 2FL7A 4N0AA 1SSFA 1LOJA 2P0PA 5I21A 2XHCA 2E12A 5GMKl 5LJ5g 4JLGA 3JCMQ 3OYLA 1IREB 2MMPA 2RJCA 5GAN7 5GAOm 1LNXA 3CCVT 2QA4A 1Q86U 5GAOq 1WQWA 3MP1A 3P8DA 2A7YA 3S6WA 1VQLA 2LRQA 4BD3A 3CCQT 1Q81C 4A4HA 3FIFA 3LW5E 2KK4A 3QO3A 2KDSA 5DLQE 2P4TA 3G4ST 3JB9J 4M7DC 1G3SA 5CQYA 4ZGJB 3FDRA 5HK0A 4HT9A 1KG1A 3C94A 1K8AU 2RHXA 4RG2A 1YI2A 2E64A 5GAN2 5I2SA 2R57A 5A0DA 1XQHA 3OBWA 3CBOA 2F69A 4HKEA 4NOYA 1M90U 3KUFA 3NTKA 1IZ6A 2ZPFB 3V7RA 4BY6C 5KE3A 4UC4A 4X34A 4XU3A 1JRIA 5A2QE 4M77C 2DAQA 1WJRA 2QQSA 3JB9D 2ZCFB 3INZA 1ZBXA 2JOYA 4P5NA 5GANg 4JS4A 2YLBA 4BI8B 4Y91A 3JCMX 1I5LA 1GXIE 1VQKT 3E19A 1NE8A 1NJIC 5GAN3 3CPWS 2LQ8A 1LJOA 4BI4A 2RK1A 2WSCE 2OAUA 2NLUA 3I56T 5FU6C 3DLLA 3JCMJ 2EJFA 4FM4B 4DA4A 2K57A 3QYHB 3A8GB 5CVIA 2LNVA 2BUDA 2XKOC 4MZMA 2CZ1B 4LDWA 1UGSB 4M78G 4J6WA 5GANh 4BY6B 1M1GA 3EFSA 3JCMe 4ME7A 3OYDA 3CMAA 2HBPA 3ER0A 2AHJB 2B8AA 3E9GA 3FJPA 3HRUA 4M7DF 4MZTA 1PSFA 1WPYA 2VV5A 2EFIA 3H8ZA 4MMKA 4WF2A 3OS1A 1VQ5A 4LD9K 2ZPEB 1RL2A 1YHQT 3LWIA 2RHIA 1ZQ1A 2K4YA 1FX7A 2EQKA 2L8DA 4XQ3A 1VQOA 5FU6B 2DXUA 1K73U 1M9SA 2BIVA 2X4JA 3H6ZA 2EKOA 5IAYA 3RMQA 3L2VA 2H3JA 1VQ9A 4IKFA 4OB2B 1M1FA 3OB9A 3E9FA 3GPLA 2D6FA 1K8AC 3I55A 4BE1A 2LTOA 3G71A 1N8RC 4FT2A 3J80E 1KHCA 2E70A 1OZ3A 3UT1A 2ZGWA 1VIEA 4XTYA 4C92E 5M9OA 4PJOG 4TVRA 3CD6T 1OYXA 2PVOB 4EPCA 3VUZA 1N6AA 4XU1A 1VQNA 1QVPA 1Y07A 5CQXA 4Z02A 1N9SA 1VQNT 5KCHA 5GAMe 5GANd 2K5FA 4OMFB 3QPHA 4QVDA 2ZPBB 2F5TX 2RJFA 1WNLA 3CCRT 3X24B 2ZPHB 3OYNA 1XNIA 3QIIA 3Q1JA 2C06A 1YIJA 2WACA 4OP0A 2PVDB 3MO8A 2E10A 2Y90A 4LDYA 1Q82U 2D9TA 2K5LA 3PT9A 4QVZA 4XU0A 4NS5A 3QJ6A 1UB4A 2RM4A 1WJSA 4F7UF 4JLIA 1QP3A 3L2WA 4J7FA 2DK3A 3ZFJA 1D3BB 4NL2A 4M7AD 4MDXA 2IVWA 4J7IA 1X01A 2KAFA 3BY7A 3OS5A 4LDUA 5CO7A 3M9QA 4C0GA 3G4SA 2E6NA 4PJOD 5GANf 4XTVA 2IG0A 2E41A 3VYHB 3OW2A 3JB9H 3MP6A 4M7AB 3RERA 2E65A 5D6WA 2VUBA 2HAXA 4E7KA 2JTMA 2KVQG 3BFMA 4QVCA 5GMKe 1G3WA 4HA8A 5FRMA 5I2MA 1JJ2S 2OTLT 2X35A 1PSEA 2XIDA 5J26A 1YITT 3FLGA 3GIBA 3OSVA 4KT0E 3JCMf 5CKHA 4M78A 3WVEB 2O01E 5GAMg 1MGQA 2LVMA 2YHTA 1N9RA 3GLXA 3HFNA 2YRVA 4A4KA 3TU4K 3A5ZB 3JAME 3L2RA 4PJOC 3OYAA 3CCLT 2MI6A 4FIBA 3HKSA 1VQ8A 1FWZA 2EQUA 3HRTA 3MEWA 4OGCA 5GAMf 2VXFA 5HKCA 4JUVA 4GLKA 3L2QA 2RI5A 3PIOA 3L42A 3TCJA 4EMKC 4DQ2A 4HT8A 3TEEA 1EIFA 3M5AA 2PQWA 3QXEB 2LX9A 2EAYA 4XTUA 4M78D 1Y96B 4BE0A 3JB9F 2HD0A 1NPRA 5D6YA 3QYGB 4J83A 2L3RA 3QZ5B 1M1KU 4BDYA 3M4GA 4A54A 5LJ5f 2PVGB 5LJ5h 4PNOA 4M77A 5GANj 1BIBA 4R56A 2JVVA 3R6OA 3V7SA 3OA6A 1UGRB 1KQ2A 4IURA 5LJ3g 1W2BS 4KUIA 3CMAT 4M7DB 4M75A 5LJ5e 3JCMd 5GAN4 1QP2A 1Q7YC 1K9MU 1QVFA 4BACA 2QTXA 4BI3A 3SDZA 4C8QB 4E7HA 5D6XA 1VQ4A 3JCMW 3RIRA 3OYYA 2EWNA 4MDWA 3S3OA 3RKWA 3G6EA 3V8KA 4FT4A 1VQMA 3P8HA 5CKBA 1JBMA 1M4ZA 2F5KA 2XDDA 3OS0A 1VQ9T 5J3BA 2X4XA 3ZEHA 4X9CA 5FRNA 3VYGA 1X6OA 3M57A 3LGLA 3OYKA 3NFCA 2M16A 3LH0A 3QUIA 4B9XA 4F7UE 3OYBA 3OYCA 3OYIA 4RMOA 3HFOA 4B9WA 3CCJA 3GF5A 3CCJT 3ME9A 3CCUT 2VC8A 3HP9A 3RESA 2CKKA 3JCMV 4ELZC 1VUBA 3CCST 4C92C 2JUFA 2QI2A 2M1HA 1NZ9A 1Q81U 5LJ5d 1O75A 2ZPGB 4M75E 4EDUA 3CCRA 3CC2T 5IN1A 5GAOl 4ZTJA 3PIPA 5GANe 3VU3C 4JRPA 1UGPB 3GNFB 3URGA 4C8QE 4C5IA 3JCMh 4HCZA 2WSEE 1KD1U 1KD1C 3JB9I 2M9UA 2DO3A 3VKIA 1G3YA 3OYJA 3GP8A 4XAXB 3V8JA 4GY5A 2L89A 3MCAB 2GFAA 2EIFA 4J8OA 3M53A 4BDZA 4BE2A 3JCMc 1X75C 4ELYC 3C4SA 3SWNB 3I55T 4KULA 4L6V5 3JCMg 1N27A 3ASKA 4F7UB 3FRNA 3M59A 1AHJB 4C0FA 2VXEA 2QXFA 2R5MA 3MEAA 3VJPA 1KQSA 5GAMj 2RJEA 3S3NA 3OYEA 2FVUA 3CCLA 4M78E 4C0ZA 2DD5A 3LGFA 5CKFA 4ZN1A 2G3RA 4C5HA 3GOXA 1VQ7T 4O5VA 2RO0A 3KBGA 3CMEA 4C8QA 3CCMT 2WSFE 3HPWA 2OTLA 4J6YA 4XTWA 1BI2A 1HXDA 1KHIA 3JCMP 4C8QF 4IUVA 5A0GA 1VQ4T 5J39A 5GAOn 4CRIA 1U1TA 4M7DG 5C0MA 2DPPB 2DD4A 3OMCA 5A0LA 2QQRA 1BI3A 2KQWA 4OB0B 2EJ9A 4M77B 1UEBA 3X25B 2RB6A 3WVDB 1YJ9A 4M77G 5DM7R 4C92F 4J5YA 5GAMd 4M78F 2RJDA 1XTDA 2LT1A 1JJ2A 3CXCA 3QDRB 3NTIA 2E6ZA 4II1A 1S72A 1VQKA 2QQBA 4BUGA 4JRQA 5DLOA 2JN0A 5LJ3d 3JRZA 2XU8A 3MEVA 2DZCA 3QBYA 3RUXA 4PJOE 2RHUA 2LT4A 4ATOA 4JJNK 4JDSA 3CMET 4M75F 3PGGA 5LJ5j 3S3MA 2GCXA 1B34B 3CCEA 2XICA 2PUOB 3OYMA 1BKBA 2DVEA 3HHTB 3PNWC 4RCCA 3LWHA 4JS5A 4M7AF 3LYIA 5LJ3j 3MEUA 1YITA 4MZPA 2OTJA 5FROA 3VUBA 5CIUA 2P0KA 4EMKA 4M7AA 4PLIA 5LJ3f 4PJOF 2LQKA 3QKJA 5GMKh 1M90C 1YJWT 2CGHA 5KH6A 3VV0A 3NTHA 3L2ZA 2DKGA 2M0OA 1UGQB 4PJOA 2QEXT 3O8VA 1YJNA 4A4GA 3OW2S 1QVFS 3DB4A 2QA4T 1D3BA 4M78C 4IUUA 4QW2A 3JCMb 2A3LA 3G71T 4PJOB 3I56A 4FL6A 3DLMA 1M1KC 1WJQA 2DJZA 3HL8A 1DJ7B 1VQ7A 1BI0A 2DXBA 3C95A 4C92D 4IUPA 2I2LA 4EMKB 1QVGS 4L5GA 3SWNC 2JTFA 3FC3A 2D0QB 1P92A 1TH7A 3CCET 3G7ZA 4L59A 1Q86C 4J6XA 2CZ0B 2FHDA 5GAN8 2MF2A 4XTXA 1OZ2A 2DTOA 2V8JA 4V2SA 2LC4A 2FYKA 2HQEA 4VUBA 1B34A 3LX7A 4KUDK 3BW1A 4XK8E 1Y71A 3HRSA 4IUTA 2VGMA 3CC7T 3MP8A 3RKYA 3TREA 5FU7B 1YJWA 1VIFA 2R5AA 2VYTA 4C8QC 3QSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XG8 D;  3N5B B;  2XKO C; 
#chains in the Genus database with same CATH topology
 1TOV A;  1K9A A;  1VQ4 Q;  3RKX A;  1AVZ C;  4PJN A;  1XOV A;  2RA2 A;  1K8A R;  2BKD N;  4N4I A;  1TUC A;  2XK0 A;  4GLM A;  4QT7 A;  1YI2 T;  3NGP A;  3F70 A;  5HK3 A;  5GMK i;  1VYU A;  2P0Q A;  5CKD A;  2GF7 A;  3G6E T;  1GCP A;  1VQ8 T;  1WXB A;  4YTL A;  4LDV A;  2CZ7 B;  4QQD A;  3JSC A;  2DET A;  2YSQ A;  4Q5W A;  1Q7Y U;  2FB7 A;  1U1S A;  4LUD A;  2X4W A;  2DTH A;  1VQP A;  3A8M B;  2FEI A;  4HVU A;  1KD1 R;  5LL6 S;  3C12 A;  3V7C A;  4C0D C;  1UGV A;  3VS4 A;  1SHF A;  3CC4 A;  3MPU B;  4X9D A;  1UFF A;  1V1C A;  2PTK A;  4RTZ A;  2E5Q A;  2LQN A;  3VS1 A;  1MHN A;  2B86 A;  2XG8 D;  4KH0 B;  3H9N A;  2K5I A;  1JQQ A;  2RHZ A;  2FRW A;  4EMG A;  3PVQ A;  4C0D B;  3CCV A;  4C92 B;  1KC8 C;  2L3S A;  1IGU A;  1WHM A;  2YLC A;  2MAM A;  2R58 A;  3PTA A;  5ECA A;  2YT6 A;  2Z0W A;  2K79 A;  3L2U A;  3P8B B;  1YHQ A;  3J81 E;  1VQ5 T;  4N4H A;  1VQM T;  2KMT A;  2M0Y A;  1YIT Q;  4M7D D;  2LCL A;  2G6F X;  1M8M A;  2NUZ A;  2OTL Q;  2J06 A;  3A8H B;  2AZV A;  2CP5 A;  1AWO A;  2YUO A;  4M78 B;  3VS6 A;  3RR6 A;  4E7I A;  4AMC A;  2QDL A;  3CCQ A;  2DTI A;  1B7T A;  4BB7 A;  3N5B B;  2RK2 A;  2QQA A;  2CYZ B;  3CBP A;  3GNG A;  1SRM A;  1G3T A;  1EFN A;  2O2O A;  3SB2 A;  3X20 B;  4XTZ A;  1UEC A;  1WXT A;  4M77 D;  5CR2 A;  4C92 A;  5LJ3 e;  3PMT A;  4N0A A;  5I21 A;  2P0P A;  3O5Z A;  3RER A;  1HSQ A;  2MMP A;  2QA4 A;  1LNX A;  2YDL A;  3S6W A;  4BD3 A;  3CCQ T;  3FIF A;  2KK4 A;  4ZGJ B;  5CQY A;  1YWO A;  2BZY A;  1RAF B;  3C94 A;  3NPF A;  1QVF P;  2YXY A;  5GAN 2;  3CBO A;  4AT1 B;  1NBE B;  4LN2 A;  3CPW P;  5KE3 A;  4UC4 A;  1UG1 A;  3I9Q A;  2ZCF B;  3INZ A;  4JZ3 A;  4P5N A;  4RTX A;  1GXI E;  1VQK T;  3CPW S;  5I22 A;  4BI4 A;  3EHR A;  3CCL Q;  2RK1 A;  3I56 T;  5FU6 C;  4DA4 A;  4HCK A;  1V76 A;  1RI9 A;  1QCF A;  2FZG B;  1TUD A;  3JCM e;  4HVW A;  1S72 Q;  2HBP A;  2AHJ B;  2B8A A;  3FJP A;  4MZT A;  1PKT A;  1PSF A;  1VQ5 A;  4WF2 A;  2KI7 A;  3LWI A;  2K4Y A;  2VKN A;  2D8H A;  2EQK A;  2EKO A;  5IAY A;  2HCK A;  2D6F A;  3G71 A;  3J80 E;  1KHC A;  2ATC B;  2ZGW A;  1VIE A;  4XTY A;  5M9O A;  2NUT A;  1BCO A;  2LJ1 A;  4AFS C;  1N6A A;  2DL3 A;  1VQN A;  5CQX A;  1N9S A;  5GAM e;  4OMF B;  2ZPB B;  1WNL A;  3CCR T;  1U06 A;  3Q1J A;  3CCM Q;  2KBT A;  2PVD B;  1NEG A;  2CRE A;  2LMJ A;  4LDY A;  1VQ7 Q;  3CD6 Q;  2K5L A;  3JV3 A;  4QVZ A;  1AEY A;  1UB4 A;  4F7U F;  1TSF A;  2DK3 A;  1D3B B;  1R77 A;  4MDX A;  4J9F A;  2EPD A;  3CCE Q;  2IVW A;  1X01 A;  4FCY A;  2JJ9 A;  4F16 A;  4LDU A;  3M9Q A;  4C0G A;  5GAN f;  2E41 A;  3OW2 A;  2HAX A;  1B3Q A;  3BFM A;  2KVQ G;  1RAB B;  2JTE A;  1KQS P;  4HA8 A;  5FRM A;  5I2M A;  1OPK A;  1WHJ A;  4AFQ C;  1PRL C;  2RQT A;  3OSV A;  4KT0 E;  3WVE B;  4M78 A;  2KRS A;  4PFO A;  1MGQ A;  5GAM g;  3CCU Q;  1X6B A;  3GLX A;  2YRV A;  3L2R A;  2JM8 A;  2AKK A;  1VQ8 A;  3HRT A;  5HKC A;  4F14 A;  1QCO A;  3L2Q A;  3L42 A;  3TCJ A;  2HKN A;  2LX9 A;  4M78 D;  5D6Y A;  1NPR A;  1Q86 R;  1M1K U;  4A54 A;  2YRC A;  2QGG A;  4PNO A;  4M77 A;  1BIB A;  3R6O A;  2QAS A;  4IUR A;  1W2B S;  4KUI A;  1D1A A;  2GTJ A;  1NYF A;  1Q7Y C;  1PNJ A;  4Z89 A;  1K1Z A;  5D6X A;  1VQ4 A;  3OYY A;  4MDW A;  3M0U A;  4FT4 A;  3MKD A;  1M3C A;  1JBM A;  2F5K A;  2H8H A;  2CDT A;  1X6O A;  1PRM C;  2M16 A;  3QUI A;  3OYI A;  4OMO A;  4JZ4 A;  3CCJ A;  3CCU T;  2VC8 A;  3EFO B;  1U5S A;  4M75 E;  3CC2 T;  4ZTJ A;  2QG9 B;  3VU3 C;  4AG2 C;  5I11 A;  1WIE A;  1YP5 A;  3JCM h;  2WSE E;  1KD1 C;  1IO6 A;  2MK5 A;  3V8J A;  1X2K A;  3MCA B;  4J8O A;  4FYW B;  1VQP Q;  3M53 A;  4BE2 A;  1HD3 A;  1X75 C;  3JCM c;  2A28 A;  1YN8 A;  3C4S A;  4LNP A;  4KUL A;  4L6V 5;  3CC2 Q;  2F2W A;  2GBQ A;  1WI7 A;  3M59 A;  3S3N A;  2FVU A;  5CKF A;  1VQ7 T;  6AT1 B;  2WSF E;  1K0S A;  4J6Y A;  1KHI A;  1U1T A;  5C0M A;  2DPP B;  2NYS A;  1UEB A;  1OV3 A;  4C92 F;  4J5Y A;  1XTD A;  2RQW A;  3NTI A;  1VQK A;  2QQB A;  1TUG B;  4BUG A;  2X3X D;  4K11 A;  4KGZ B;  3H0F A;  3JRZ A;  4IIM A;  3RUX A;  3M0S A;  1SPK A;  3I35 A;  1AT1 B;  2GCX A;  3EGD B;  2XIC A;  2PUO B;  2DEU A;  2AIR B;  1A0N B;  3LWH A;  4JS5 A;  4M7A F;  3RNJ A;  5LJ3 j;  1YIT A;  1SF9 A;  2C0T A;  4KRT A;  5FRO A;  3VUB A;  5CIU A;  4B6M A;  4EMK A;  5LJ3 f;  1VYT A;  4PJO F;  3QKJ A;  2FPD A;  1PWT A;  1M30 A;  3JCM b;  2DJZ A;  3HL8 A;  1M27 C;  2DXB A;  3C95 A;  4C92 D;  4IUP A;  2HDA A;  2YUQ A;  3FC3 A;  2D0Q B;  3CCE T;  1Q86 C;  1W6X A;  2CZ0 B;  4XTX A;  4V2S A;  2LC4 A;  1B34 A;  1AZG B;  4IUT A;  3I5R A;  5L23 A;  1YJW A;  2RQU A;  2VYT A;  3OBY A;  2CUD A;  4LDX A;  5KYX A;  3OSS C;  4OB3 B;  4QQ6 A;  1AWW A;  5GAM h;  1JJ2 P;  5GMK m;  2HKQ B;  2JMA A;  2CS7 A;  2CUB A;  4M75 G;  2GGR A;  4E47 A;  3HSB A;  3BDL A;  3E2U A;  3T9N A;  5KE2 A;  3BDU A;  1Q95 G;  5CCA A;  1QW1 A;  1YCY A;  2DIQ A;  1Q82 C;  1W2B P;  2DXT A;  4PL6 A;  2ZZD A;  3DKM A;  5C6S A;  1YJ9 T;  3PFS A;  2K3B A;  3MHX A;  4F7U A;  1MV3 A;  1S72 T;  5AYF A;  2KYB A;  2ED0 A;  5GAO p;  3SD4 A;  2J05 A;  4XU2 A;  4IUQ A;  1VQM Q;  1VQ5 Q;  4NL3 A;  1K76 A;  4O6J A;  4C5G A;  4C8Q G;  4M7A C;  4M4Z A;  3MJX A;  5KYW B;  1VQ9 Q;  4D6W A;  2JS0 A;  4E7L A;  1WFW A;  2KSS A;  2C0I A;  2CZ6 B;  2EJG A;  1RAG B;  3QZ9 B;  1Y57 A;  1NLO C;  1IHW A;  3WXM B;  4PLL A;  1FXX A;  2V8K A;  1OI1 A;  2RQV A;  1VQ6 A;  2MWP A;  2J6K A;  1Q7Y R;  4C92 G;  1Y7X A;  1OU9 A;  4M77 F;  1OUL A;  2CH4 W;  4M75 B;  4ZTF A;  4M7D A;  3L1A A;  2C0O A;  3MET A;  4RKU E;  2RHY A;  4RTU A;  5CKE A;  1Y96 A;  4JRK A;  2Y4Y A;  3M54 A;  4LD6 A;  1M2V A;  4OF1 A;  2KT8 A;  2EQI A;  2QK0 A;  3E1S A;  1BB9 A;  4E6R A;  4PKC C;  4KBM B;  3OYG A;  2QEX A;  1VQ6 T;  4E2F B;  1TTH B;  1VQP T;  3EFR A;  5CAI A;  1QLY A;  1M5Q 1;  1LPL A;  3UPU A;  2COW A;  3G6E Q;  2PU9 B;  1X69 A;  2X4Y A;  3CPF A;  3CCS A;  3X28 B;  2ED1 A;  2JZ2 A;  1ZHI A;  1K73 C;  2RPN A;  1PHT A;  2OTJ T;  4X1V A;  1BI1 A;  3JB9 G;  2KT1 A;  3UWN A;  4FU6 A;  3VRY A;  1FMW A;  4RCB A;  1M2O A;  5GMK j;  3EHQ A;  1QVG A;  1K9M R;  2LDM A;  3M4Y A;  2DYB A;  2FL7 A;  5GMK l;  1R0C B;  1SSF A;  3CCR Q;  2DE0 X;  2E12 A;  1IRE B;  3CCV T;  1GRI A;  2LRQ A;  1Q81 C;  3LW5 E;  1MMA A;  5DLQ E;  5HK0 A;  4HT9 A;  1PCX A;  2CP7 A;  2DL7 A;  2EYZ A;  5I2S A;  1FYN A;  2F69 A;  3VRZ A;  3NTK A;  1IZ6 A;  4BY6 C;  2JS2 A;  2LNH B;  3EGX B;  4X34 A;  4XU3 A;  4PK4 A;  4JS4 A;  4Y91 A;  1ACM B;  1LJO A;  2WSC E;  2OAU A;  4FM4 B;  4ZNX A;  3A8G B;  1WHK A;  2LNV A;  2BUD A;  2XKO C;  4M78 G;  4BY6 B;  1UHC A;  3EFS A;  2X9H A;  5IXF A;  4ME7 A;  2ECZ A;  1PD0 A;  1OOT A;  3E9G A;  1N5Z A;  2CT4 A;  3EG3 A;  4PJL A;  3LH5 A;  2EFI A;  1YWP A;  3OS1 A;  2ZPE B;  1RL2 A;  1VYV A;  1YHQ T;  1ZQ1 A;  1FX7 A;  4XQ3 A;  2MYS A;  4EIK A;  2X4J A;  4IKF A;  2QAZ A;  1M1F A;  1K8A C;  3I55 A;  4BE1 A;  2HMA A;  4CC7 A;  2E70 A;  2JMC A;  1OZ3 A;  3UT1 A;  4TVR A;  1OYX A;  4OMN A;  2LCS A;  2HSE B;  1Y07 A;  1KIK A;  5KCH A;  5GAN d;  2HL5 C;  2RJF A;  3X24 B;  3OYN A;  2HSP A;  1D0X A;  2WAC A;  2NUP A;  3UF4 A;  2Y90 A;  4PFP A;  3PT9 A;  7AT1 B;  3CC7 Q;  4NS5 A;  3QJ6 A;  1OX8 A;  1ARK A;  3L2W A;  4J7F A;  3REA B;  4M7A D;  1WZO A;  3OS5 A;  5CO7 A;  4QKU A;  4FYY B;  2HL3 A;  2E65 A;  8ATC B;  1RUW A;  1G3W A;  1T3S A;  1JJ2 S;  2XID A;  1SG5 A;  2A0F B;  5J26 A;  1YIT T;  3FLG A;  2DL5 A;  1NM7 A;  2LVM A;  2YHT A;  3EGU A;  1ZSZ B;  4PJO C;  3PE0 A;  3CCL T;  2DFU A;  2RI5 A;  1QVG P;  1JXM A;  3TEE A;  3JB9 F;  1FMV A;  4BE0 A;  1GBR A;  1BK2 A;  1WA7 A;  3M4G A;  2EYX A;  2KE9 A;  5LJ5 h;  1AWX A;  5GAN j;  2DL4 A;  4R56 A;  3AT1 B;  3OA6 A;  1UGR B;  5LJ3 g;  2PNI A;  2JM9 A;  2KGT A;  3RDV A;  1K9M U;  1QVF A;  1RAI B;  3SDZ A;  4C8Q B;  3CXC P;  4CC2 A;  3JCM W;  2EWN A;  3RKW A;  2OX7 A;  1D1B A;  3CCQ Q;  3TVT A;  1QWE A;  1OQK A;  1M4Z A;  1GFC A;  4X9C A;  3M57 A;  2BE7 D;  1PM3 A;  3OYC A;  2KXC A;  4RMO A;  4B9W A;  3RES A;  3CCS T;  4C92 C;  1NYG A;  2QI2 A;  2DVJ A;  1Q81 U;  2MCN A;  2CP0 A;  5IN1 A;  4JRP A;  1UGP B;  1TU0 B;  3URG A;  4C5I A;  2CP3 A;  2JXB A;  1N8R R;  2SEM A;  3VKI A;  2DO3 A;  2RQR A;  1G3Y A;  3GP8 A;  1GCQ C;  2YUP A;  1GCQ A;  1BCM A;  4E7S A;  2JT4 A;  1IB8 A;  3JCM g;  1K73 U;  2VXE A;  4J9E A;  3OYE A;  1TG0 A;  4KGX B;  4CC3 A;  4C0Z A;  2DD5 A;  3LGF A;  4O5V A;  2RO0 A;  1PKS A;  2DX1 A;  2OTL A;  1HXD A;  1VQ4 T;  4A63 B;  3NHN A;  1NJI R;  1E7O A;  1QQJ A;  4OB0 B;  2EJ9 A;  2RB6 A;  3WVD B;  2LX7 A;  2DLP A;  2L0A A;  1TWB A;  2J6O A;  3QDR B;  1S72 A;  3CMA Q;  4JRQ A;  5DLO A;  2JN0 A;  4PJO E;  4ATO A;  5KYU B;  3D7S B;  3S3M A;  1YHQ Q;  1MMG A;  4AG1 C;  3PNW C;  4E7Z A;  2QA4 Q;  2QEX Q;  2H3E B;  4M7A A;  4PLI A;  2XMF A;  2CGH A;  4AFU C;  4F17 A;  2DKG A;  4PJO A;  2QTV A;  2QEX T;  3O8V A;  1YJN A;  3OW2 S;  1SKU B;  3DB4 A;  4QW2 A;  2QA4 T;  1MNE A;  2A3L A;  4FL6 A;  4KH1 B;  1VQ7 A;  3GBQ A;  1P92 A;  1TH7 A;  3G7Z A;  2EVR A;  5GAN 8;  2MF2 A;  2V8J A;  1JXO A;  3CC7 T;  2VGM A;  1G8X A;  2EGA A;  1Q82 R;  2R5A A;  1JEG A;  1H3Z A;  1NLP C;  2O88 A;  3KXT A;  4F7U G;  1W2B A;  2HEQ A;  1TXQ A;  2K2V A;  3AHU A;  1FMK A;  1VQO Q;  1NPP A;  3A8L B;  4HCC A;  2A37 A;  4A53 A;  4ANJ A;  4ESR A;  2RH2 A;  1RI0 A;  4OB1 B;  2BZX A;  3LLR A;  4OGE A;  2GFU A;  2ESW A;  3CCL A;  2DF6 A;  4R55 A;  3OY9 A;  3SWN A;  2IPO B;  3A1P A;  3OYH A;  2XDP A;  4DOV A;  2E3H A;  3G1J A;  4FSS A;  4D8D A;  1KC8 U;  1KQ1 A;  1R0B G;  4D8K A;  3EH2 A;  3CD6 A;  2CP6 A;  1HK9 A;  1X27 A;  2K3Y A;  1PG5 B;  4RTW A;  4GBQ A;  1I81 A;  2GQI A;  2A08 A;  4EMH A;  1YIJ T;  3CME Q;  2KY9 A;  1KQS S;  1M8V A;  3R6N A;  4M75 C;  3EG9 B;  5KCO A;  1RLP C;  4DBQ A;  4FSX A;  4C8Q D;  3QDF A;  4OML A;  1K9M C;  2GQV A;  2D1X A;  1CKA A;  3VS0 A;  3OQ5 A;  3CCM A;  1NJI U;  3M56 A;  2DIL A;  4OMP A;  3CC2 A;  2DZ9 A;  3VS7 A;  3CXC S;  1O9S A;  3CC7 A;  5GAN 6;  2RD1 A;  5GAO r;  5FLX E;  2FZC B;  2EQJ A;  3FEO A;  2O4X A;  5FWB A;  3CEY A;  2L3Q A;  2OTJ Q;  5HY6 A;  1YBY A;  4A4F A;  2E1H A;  1H64 1;  1VOM A;  4FW2 A;  1C1A A;  2VGN A;  2HQH A;  1BYM A;  2L5Q A;  2W10 A;  1YJ9 Q;  1D0Z A;  3ZBD A;  2O4X B;  1YNZ A;  2V8I A;  2E5K A;  2K3X A;  4N4G A;  1Z9Q A;  5IHI A;  4HCB A;  3QJY A;  3UDC A;  3M0R A;  2EYQ A;  1I1J A;  3ZL7 C;  1I07 A;  3CCJ Q;  2MWO A;  3OYF A;  2BTT A;  2E3I A;  2XDB A;  3EG1 A;  5DY9 A;  1X6G A;  2DMO A;  4RTV A;  5LJ5 g;  1LOJ A;  5AT1 B;  2CSI A;  3JCM J;  4JLG A;  3OYL A;  5GAN 7;  2RJC A;  2RF0 A;  1U3O A;  3MP1 A;  1T0J A;  2A7Y A;  2O9S A;  4A4H A;  3QO3 A;  2P4T A;  1G3S A;  3EG9 A;  1SEM A;  1K8A U;  2RHX A;  2EW3 A;  2PZ1 A;  1YI2 A;  1ZBJ A;  3VS3 A;  2R57 A;  5A0D A;  4HKE A;  3V7R A;  3SHW A;  5HCK A;  5A2Q E;  1JRI A;  4M77 C;  1WJR A;  1RAH B;  3JB9 D;  3UA6 A;  3JCM X;  1I5L A;  5KYY A;  3E19 A;  1NJI C;  5GAN 3;  2LQ8 A;  2L2P A;  2W0Z A;  2ZAE A;  3DLL A;  2EJF A;  2EGC A;  2GNC A;  2K57 A;  3QYH B;  1YJW Q;  2VWF A;  4LDW A;  1UGS B;  5GAN h;  4J6W A;  1QCN A;  4LXC A;  1QWF A;  3OYD A;  4Z8A A;  8AT1 B;  1M3A A;  1WPY A;  3H8Z A;  4MMK A;  4LD9 K;  3HTR A;  2RHI A;  3TQ7 P;  2L8D A;  3H6Z A;  3RMQ A;  5KYY B;  2H3J A;  3TSZ A;  3OB9 A;  3GPL A;  3CC4 Q;  3M0T A;  1VA7 A;  2FRY A;  1M1K R;  2LTO A;  1EZZ B;  1JU5 C;  2PVO B;  2HZY A;  1QVP A;  4JJB A;  3CCV Q;  3QPH A;  1M3B A;  2F5T X;  2ABL A;  1YIJ A;  3MO8 A;  2E10 A;  2D9T A;  1Y0M A;  2X51 A;  2VVK A;  1WJS A;  1OPL A;  3M0Q A;  4JLI A;  4NL2 A;  1ZA2 B;  2DRM A;  4J7I A;  2DNU A;  3BY7 A;  3G4S A;  4PJO D;  4HXJ A;  2IG0 A;  4XTV A;  4M7A B;  1RAC B;  3H41 A;  1WHG A;  5D6W A;  2VUB A;  4QVC A;  1W1F A;  1W70 A;  2VB6 A;  1VQ6 Q;  4F04 B;  1YJN Q;  3GIB A;  2FPE A;  1CSK A;  3JCM f;  5CKH A;  2O01 E;  1GBQ A;  5KYU A;  1N9R A;  4A4K A;  1ZX6 A;  1S1N A;  3A5Z B;  4RTT A;  1ZLM A;  2EQU A;  4OGC A;  3PIO A;  4HT8 A;  1YFN A;  4DQ2 A;  2COY A;  1EIF A;  3M5A A;  2PQW A;  3QXE B;  2EAY A;  3PVL A;  2EYY A;  2HD0 A;  3QYG B;  4J83 A;  2YWW A;  2AT1 B;  2L3R A;  5LJ5 f;  2DER A;  3RBB B;  4JJD A;  1VQL Q;  2JVV A;  3V7S A;  1KQ2 A;  2BE9 B;  3JCM d;  1E6H A;  5GAN 4;  1B07 A;  3RIR A;  3V8K A;  3P8H A;  5CKB A;  1VQ9 T;  2X4X A;  3QWY A;  3ZEH A;  3VYG A;  2ENM A;  4Y92 A;  4F7U E;  2MPX C;  2E4H A;  1RAD B;  3HFO A;  3GF5 A;  2CKK A;  4J9G A;  2DA9 A;  1VUB A;  3JCM V;  3UAT A;  1K4U S;  2JUF A;  4RUG A;  1NZ9 A;  3CCR A;  4EDU A;  1BU1 A;  1T0H A;  5GAO l;  3PIP A;  4C8Q E;  1F1B B;  1KD1 U;  1UUE A;  1UDL A;  4XAX B;  1M90 R;  2EIF A;  3M0P A;  3SWN B;  3I55 T;  1N27 A;  3FRN A;  3VJP A;  2FZK B;  1C0M A;  3A98 A;  1KQS A;  2P84 A;  5GAM j;  2RJE A;  1I0C A;  1UE9 A;  3VS2 A;  1GL5 A;  4ZN1 A;  3GOX A;  2G3R A;  4C5H A;  1ZSG A;  3CME A;  4C8Q A;  1HJD A;  3CCM T;  4XTW A;  1BI2 A;  5A0G A;  4IUV A;  4CRI A;  1RLQ C;  3OMC A;  5A0L A;  2QQR A;  1BI3 A;  2DYI A;  4JJC A;  2KR3 A;  4M78 F;  2LT1 A;  3CXC A;  2AZS A;  4II1 A;  4WTO B;  3H0I A;  5LJ3 d;  1SSH A;  2XU8 A;  3KFV A;  2VAS A;  1HYO A;  2RHU A;  4JJN K;  1IRX A;  2KRN A;  2D8J A;  2LZ6 B;  2AK5 A;  1XJW B;  1BKB A;  2DVE A;  3HHT B;  3OYM A;  2DL8 A;  4FW1 A;  4RCC A;  3G71 Q;  2CSQ A;  2F2V A;  2LQK A;  1M90 C;  1YJW T;  5KH6 A;  3VV0 A;  3NTH A;  1AOJ A;  3L2Z A;  2M0O A;  1UGQ B;  1SHG A;  1QVF S;  4M78 C;  3G71 T;  4J9B A;  4PJO B;  3I56 A;  1WJQ A;  1D1C A;  1ZUU A;  1BI0 A;  2I2L A;  2JTF A;  2K6D A;  4J6X A;  2FHD A;  4DEY A;  1OZ2 A;  2DTO A;  3REB B;  4VUB A;  3THK A;  1QMC A;  3LX7 A;  2EGE A;  3BW1 A;  1Q81 R;  4XK8 E;  4KUD K;  1H3H A;  3MP8 A;  4FYV B;  3RKY A;  3IQL A;  2KXD A;  3TRE A;  1PD1 A;  1VIF A;  2YRD A;  4C8Q C;  3EH1 A;  4DBH A;  2ROT A;  2RI2 A;  1R8O B;  1BIA A;  2D0N A;  5EG2 A;  4M75 D;  2M51 A;  3FJ5 A;  4Y28 E;  1V29 B;  4ZGE B;  2L3P A;  2DXC A;  5L8R E;  5GAN 5;  1X2Q A;  4M7A E;  2PUK B;  4OVA A;  2MOX A;  2K2M A;  3QG1 A;  5IH2 A;  5FU7 C;  2HQX A;  3OMG A;  3A8O B;  4J9I A;  2COZ A;  3CPW A;  3U23 A;  2DEQ A;  3I55 Q;  2QGF B;  3CC4 T;  1LCK A;  1ZSZ C;  2K9G A;  2LCC A;  3DB3 A;  2LJ0 A;  3EAE A;  4ZN3 A;  1KK7 A;  4JRI A;  5IHN A;  2HBW A;  5D7U A;  1ABQ A;  1C6V X;  4CI0 C;  1WQ7 A;  3EGX A;  1N8R U;  5IT9 E;  1JB0 E;  2ROL A;  1WHH A;  4RTY A;  3BE3 A;  1WHL A;  1D0Y A;  2V26 A;  5LJ3 h;  1QKX A;  1U8R A;  4M77 E;  2XI9 A;  1IHV A;  1CKB A;  2JNG A;  2X3W D;  1OEB A;  2EBP A;  2DIG A;  3X26 B;  1KFZ A;  4DOW A;  2QQ9 A;  1W4S A;  4C5E A;  2O31 A;  4ZGD B;  3M58 A;  1VQL T;  2HNI A;  2KRO A;  2FO0 A;  5KYN A;  3PMI A;  3CCU A;  1I8F A;  1YIJ Q;  2RI3 A;  1K73 R;  1EX4 A;  1MUZ A;  4QQG A;  4M7D E;  2Y4X A;  3CQT A;  2OJ2 A;  4RG8 A;  4ORZ A;  4A4E A;  2JW4 A;  5IHK A;  4N0A C;  1TS9 A;  1D09 B;  2CH4 A;  2EQM A;  4DBR A;  3CBM A;  1UJ0 A;  1G5V A;  3FB9 A;  3J7A F;  2QYZ A;  3RMS A;  2AKL A;  2GTO A;  3M55 A;  1ZSZ A;  2XD0 A;  1KSW A;  1I5O B;  1M2V B;  1ZUK A;  4E7J A;  2CT3 A;  4J9C A;  1MMN A;  4MML A;  5CK9 A;  2DM1 A;  2QDY B;  4J9D A;  4M7A G;  3SFM A;  4HVV A;  1YCS B;  3QHS A;  1IXD A;  1VQO T;  3V8L A;  1WGS A;  1I4K 1;  3OS2 A;  2ZPI B;  2XHC A;  2DRK A;  3JCM Q;  1Q86 U;  5GAO m;  5GAO q;  1WQW A;  3P8D A;  1UHF A;  1VQL A;  4DBF A;  2KDS A;  2NUP B;  3G4S T;  3JB9 J;  4M7D C;  3FDR A;  3TSW A;  1KG1 A;  4RG2 A;  5KYW A;  2E64 A;  5GJW B;  1XQH A;  3OBW A;  4AFZ C;  2KEA A;  4NOY A;  1M90 U;  3KUF A;  2YUN A;  2ZPF B;  4R0K A;  1QKW A;  2DAQ A;  2QQS A;  1ZBX A;  2JOY A;  5GAN g;  2YLB A;  2CP2 A;  2FPF A;  4BI8 B;  2J7I A;  2OI3 A;  4LE9 A;  1NE8 A;  1OU8 A;  2NLU A;  1H8K A;  1LVK A;  5CVI A;  4MZM A;  2KYM A;  2CZ1 B;  1KC8 R;  1M1G A;  1X43 A;  1WLP B;  2P4R A;  2FG0 A;  1RAE B;  2M02 A;  3C0C A;  1VQK Q;  3CMA A;  1YJN T;  3ER0 A;  4M7D F;  3HRU A;  2VV5 A;  2RMO A;  1VQO A;  5FU6 B;  2DXU A;  2F1L A;  4J9H A;  1M9S A;  2BIV A;  4IIO A;  1VQ9 A;  3L2V A;  4OB2 B;  1E6G A;  3E9F A;  4KGV B;  5GJV B;  1N8R C;  1J3T A;  4FT2 A;  1ZA1 B;  1NEB A;  4DEX A;  4C92 E;  4PJO G;  3CD6 T;  4EPC A;  3VUZ A;  4XU1 A;  3OW2 P;  1VQN T;  4Z02 A;  2K5F A;  1K0X A;  2NWM A;  4QVD A;  2A36 A;  3H0H A;  2ZPH B;  2C06 A;  1XNI A;  3QII A;  2LP5 A;  3EG2 A;  4OP0 A;  5EC7 A;  1Q82 U;  1KJW A;  1WDX A;  4XU0 A;  2OAW A;  5FWC A;  4PJM A;  2RM4 A;  1QP3 A;  3ZFJ A;  3UA7 A;  2KAF A;  1ZUY A;  3I5S A;  2E6N A;  1MND A;  3VS5 A;  3VYH B;  3JB9 H;  3MP6 A;  4E7K A;  2JTM A;  2KRM A;  2BZ8 A;  1ABO A;  5GMK e;  3EG0 A;  2OTL T;  2X35 A;  1NG2 A;  1PSE A;  3EGD A;  3CCS Q;  2RNA A;  4PJJ A;  2DBK A;  3HFN A;  3TU4 K;  3I56 Q;  3JAM E;  3OYA A;  2MI6 A;  4FIB A;  3HKS A;  1FWZ A;  3MEW A;  5GAM f;  2VXF A;  4JUV A;  4GLK A;  4EMK C;  1SRL A;  1Z9Z A;  4XTU A;  1Y96 B;  1RAA B;  3QZ5 B;  4BDY A;  3ULR B;  2PVG B;  3NMZ C;  4WCI A;  2V1Q A;  1PC0 A;  4PFZ A;  3CMA T;  4M7D B;  4M75 A;  5LJ5 e;  1QP2 A;  4BAC A;  2DBM A;  2QTX A;  4BI3 A;  4E7H A;  2IIM A;  5FW9 A;  3S3O A;  3G6E A;  4CC4 B;  1VQM A;  1OX9 A;  2XDD A;  3OS0 A;  5J3B A;  5FRN A;  1JO8 A;  1BBZ A;  3LGL A;  9ATC B;  3OYK A;  3NFC A;  3LH0 A;  4B9X A;  3OYB A;  3CCJ T;  3ME9 A;  3HP9 A;  1GFD A;  4ELZ C;  2SRC A;  2M1H A;  5LJ5 d;  1O75 A;  2ZPG B;  5GAN e;  3GNF B;  2EKH A;  1WXU A;  4HCZ A;  3JB9 I;  2M9U A;  3EFO A;  3OYJ A;  1AWJ A;  1UTI A;  4GY5 A;  2L89 A;  2GFA A;  1YI2 Q;  4BDZ A;  3SEM A;  4ELY C;  4LUE A;  1MMD A;  3ASK A;  4F7U B;  1AHJ B;  4C0F A;  3MEA A;  2QXF A;  2R5M A;  4M78 E;  2KNB B;  2LJ3 A;  3KBG A;  3HPW A;  1WX6 A;  3JCM P;  4C8Q F;  5J39 A;  5GAO n;  2DJQ A;  4M7D G;  2DD4 A;  1VQN Q;  3X25 B;  2KQW A;  1G83 A;  4M77 B;  1YJ9 A;  4M77 G;  1AZE A;  4OMQ A;  5DM7 R;  3QWX X;  5IXB A;  5GAM d;  2LQW A;  1G2B A;  2RJD A;  1JJ2 A;  5KYX B;  2E6Z A;  2F2X A;  3MEV A;  2DZC A;  3QBY A;  1UJY A;  2LT4 A;  1AD5 A;  2J6F A;  4JDS A;  3CME T;  4M75 F;  3PGG A;  5LJ5 j;  4OMM A;  1B34 B;  3CCE A;  2EYW A;  3LYI A;  3MEU A;  4MZP A;  2OTJ A;  2I0N A;  2P0K A;  5GMK h;  2O9V A;  2V1R A;  1WYX A;  4A4G A;  1MV0 B;  1D3B A;  4IUU A;  2K7A A;  3DLM A;  1M1K C;  2MIO A;  1DJ7 B;  1VQ8 Q;  4Z88 A;  4JPB W;  1QVG S;  4EMK B;  4L5G A;  3SWN C;  4L59 A;  1IGQ A;  1H92 A;  4FYX B;  2FYK A;  2HQE A;  1Y71 A;  2RN8 A;  3HRS A;  1T3L A;  5FU7 B;  3G4S Q;  2NUT B;  3QSU A; 
#chains in the Genus database with same CATH homology
 3OBY A;  4LDX A;  1H3Z A;  3RKX A;  3OSS C;  2RI2 A;  3KXT A;  4OB3 B;  4QQ6 A;  4F7U G;  1R8O B;  1BIA A;  1W2B A;  5EG2 A;  4M75 D;  2K2V A;  4Y28 E;  5GAM h;  3AHU A;  1XOV A;  2RA2 A;  1V29 B;  4ZGE B;  2DXC A;  5L8R E;  2BKD N;  5GMK m;  5GAN 5;  4N4I A;  4M7A E;  2CS7 A;  1NPP A;  2PUK B;  4M75 G;  3QG1 A;  4OVA A;  3A8L B;  4E47 A;  5FU7 C;  2HQX A;  3HSB A;  3OMG A;  3BDL A;  3A8O B;  4HCC A;  3T9N A;  3CPW A;  4A53 A;  5KE2 A;  2DEQ A;  3BDU A;  3CC4 T;  2XK0 A;  5CCA A;  1YI2 T;  1QW1 A;  1YCY A;  2RH2 A;  3F70 A;  5HK3 A;  5GMK i;  1RI0 A;  2DIQ A;  4OB1 B;  1Q82 C;  2P0Q A;  5CKD A;  2LCC A;  2GF7 A;  3G6E T;  3LLR A;  4OGE A;  2DXT A;  4PL6 A;  1VQ8 T;  2ZZD A;  2GFU A;  3DKM A;  3DB3 A;  4YTL A;  3PFS A;  5C6S A;  1YJ9 T;  4LDV A;  2CZ7 B;  3MHX A;  4QQD A;  4R55 A;  4F7U A;  3OY9 A;  3JSC A;  3SWN A;  3EAE A;  4ZN3 A;  3OYH A;  2XDP A;  1S72 T;  4DOV A;  4Q5W A;  5AYF A;  1Q7Y U;  4JRI A;  2FB7 A;  1U1S A;  5GAO p;  2X4W A;  2DTH A;  1KC8 U;  1VQP A;  3SD4 A;  1KQ1 A;  4XU2 A;  3A8M B;  4IUQ A;  3CD6 A;  4CI0 C;  1WQ7 A;  1N8R U;  1HK9 A;  5IT9 E;  1JB0 E;  5LL6 S;  2K3Y A;  4NL3 A;  4O6J A;  4C5G A;  3C12 A;  4C8Q G;  3V7C A;  4C0D C;  4M7A C;  5LJ3 h;  1I81 A;  4D6W A;  4EMH A;  1YIJ T;  1U8R A;  4M77 E;  2XI9 A;  4E7L A;  3CC4 A;  2KY9 A;  1KQS S;  1M8V A;  2JNG A;  4M75 C;  2KSS A;  4X9D A;  5KCO A;  2CZ6 B;  2EJG A;  2DIG A;  3QZ9 B;  3X26 B;  2E5Q A;  1MHN A;  4FSX A;  2XG8 D;  2QQ9 A;  3WXM B;  4C8Q D;  4DOW A;  4PLL A;  1FXX A;  1W4S A;  2V8K A;  4C5E A;  1OI1 A;  1K9M C;  4ZGD B;  2K5I A;  2RHZ A;  1VQ6 A;  3M58 A;  2MWP A;  2GQV A;  2HNI A;  4EMG A;  1VQL T;  4C0D B;  3CCV A;  4C92 B;  1KC8 C;  3PMI A;  3OQ5 A;  4C92 G;  3CCU A;  1Y7X A;  1I8F A;  4M77 F;  3CCM A;  1NJI U;  2YLC A;  3M56 A;  2RI3 A;  4M75 B;  2MAM A;  2R58 A;  3PTA A;  4ZTF A;  4M7D A;  3L1A A;  3CC2 A;  2DZ9 A;  4QQG A;  4M7D E;  2Y4X A;  3CXC S;  1O9S A;  3CC7 A;  3L2U A;  3P8B B;  1YHQ A;  3MET A;  5GAN 6;  2RD1 A;  3J81 E;  4RKU E;  1VQ5 T;  2RHY A;  4N4H A;  4RG8 A;  5FLX E;  5GAO r;  5CKE A;  1VQM T;  4A4E A;  2EQJ A;  2KMT A;  3FEO A;  1Y96 A;  4N0A C;  2EQM A;  2O4X A;  2Y4Y A;  4JRK A;  3M54 A;  3CBM A;  4LD6 A;  3CEY A;  1G5V A;  4OF1 A;  3OYG A;  2QEX A;  2LCL A;  3E1S A;  1YJN T;  4M7D D;  4PKC C;  3FB9 A;  4KBM B;  5HY6 A;  1VQ6 T;  3J7A F;  1YBY A;  3A8H B;  3RMS A;  4A4F A;  2E1H A;  1H64 1;  1VQP T;  3EFR A;  5CAI A;  3M55 A;  2XD0 A;  2VGN A;  4M78 B;  1BYM A;  1M5Q 1;  2L5Q A;  3UPU A;  4E7I A;  3ZBD A;  2O4X B;  2PU9 B;  3CCQ A;  2DTI A;  2V8I A;  2K3X A;  4N4G A;  4BB7 A;  3N5B B;  4E7J A;  2X4Y A;  3CPF A;  3CCS A;  2RK2 A;  3QJY A;  4HCB A;  4MML A;  3UDC A;  2QQA A;  3X28 B;  5CK9 A;  2CYZ B;  2EYQ A;  2QDY B;  3CBP A;  3GNG A;  2JZ2 A;  1ZHI A;  1K73 C;  4M7A G;  2OTJ T;  1G3T A;  3SFM A;  3SB2 A;  1BI1 A;  3X20 B;  4XTZ A;  3JB9 G;  3QHS A;  3UWN A;  2MWO A;  1VQO T;  4M77 D;  4FU6 A;  3V8L A;  1WGS A;  3OYF A;  2XDB A;  4RCB A;  5CR2 A;  1I4K 1;  5GMK j;  5DY9 A;  3OS2 A;  4C92 A;  2ZPI B;  1QVG A;  2LDM A;  5LJ3 e;  3M4Y A;  3PMT A;  2FL7 A;  4N0A A;  1SSF A;  1LOJ A;  2P0P A;  5I21 A;  2XHC A;  2E12 A;  5GMK l;  5LJ5 g;  4JLG A;  3JCM Q;  3OYL A;  1IRE B;  2MMP A;  2RJC A;  5GAN 7;  5GAO m;  1LNX A;  3CCV T;  2QA4 A;  1Q86 U;  5GAO q;  1WQW A;  3MP1 A;  3P8D A;  2A7Y A;  3S6W A;  1VQL A;  2LRQ A;  4BD3 A;  3CCQ T;  1Q81 C;  4A4H A;  3FIF A;  3LW5 E;  2KK4 A;  3QO3 A;  2KDS A;  5DLQ E;  2P4T A;  3G4S T;  3JB9 J;  4M7D C;  1G3S A;  5CQY A;  4ZGJ B;  3FDR A;  5HK0 A;  4HT9 A;  1KG1 A;  3C94 A;  1K8A U;  2RHX A;  4RG2 A;  1YI2 A;  2E64 A;  5GAN 2;  5I2S A;  2R57 A;  5A0D A;  1XQH A;  3OBW A;  3CBO A;  2F69 A;  4HKE A;  4NOY A;  1M90 U;  3KUF A;  3NTK A;  1IZ6 A;  2ZPF B;  3V7R A;  4BY6 C;  5KE3 A;  4UC4 A;  4X34 A;  4XU3 A;  1JRI A;  5A2Q E;  4M77 C;  2DAQ A;  1WJR A;  2QQS A;  3JB9 D;  2ZCF B;  3INZ A;  1ZBX A;  2JOY A;  4P5N A;  5GAN g;  4JS4 A;  2YLB A;  4BI8 B;  4Y91 A;  3JCM X;  1I5L A;  1GXI E;  1VQK T;  3E19 A;  1NE8 A;  1NJI C;  5GAN 3;  3CPW S;  2LQ8 A;  1LJO A;  4BI4 A;  2RK1 A;  2WSC E;  2OAU A;  2NLU A;  3I56 T;  5FU6 C;  3DLL A;  3JCM J;  2EJF A;  4FM4 B;  4DA4 A;  2K57 A;  3QYH B;  3A8G B;  5CVI A;  2LNV A;  2BUD A;  2XKO C;  4MZM A;  2CZ1 B;  4LDW A;  1UGS B;  4M78 G;  4J6W A;  5GAN h;  4BY6 B;  1M1G A;  3EFS A;  3JCM e;  4ME7 A;  3OYD A;  3CMA A;  2HBP A;  3ER0 A;  2AHJ B;  2B8A A;  3E9G A;  3FJP A;  3HRU A;  4M7D F;  4MZT A;  1PSF A;  1WPY A;  2VV5 A;  2EFI A;  3H8Z A;  4MMK A;  4WF2 A;  3OS1 A;  1VQ5 A;  4LD9 K;  2ZPE B;  1RL2 A;  1YHQ T;  3LWI A;  2RHI A;  1ZQ1 A;  2K4Y A;  1FX7 A;  2EQK A;  2L8D A;  4XQ3 A;  1VQO A;  5FU6 B;  2DXU A;  1K73 U;  1M9S A;  2BIV A;  2X4J A;  3H6Z A;  2EKO A;  5IAY A;  3RMQ A;  3L2V A;  2H3J A;  1VQ9 A;  4IKF A;  4OB2 B;  1M1F A;  3OB9 A;  3E9F A;  3GPL A;  2D6F A;  1K8A C;  3I55 A;  4BE1 A;  2LTO A;  3G71 A;  1N8R C;  4FT2 A;  3J80 E;  1KHC A;  2E70 A;  1OZ3 A;  3UT1 A;  2ZGW A;  1VIE A;  4XTY A;  4C92 E;  5M9O A;  4PJO G;  4TVR A;  3CD6 T;  1OYX A;  2PVO B;  4EPC A;  3VUZ A;  1N6A A;  4XU1 A;  1VQN A;  1QVP A;  1Y07 A;  5CQX A;  4Z02 A;  1N9S A;  1VQN T;  5KCH A;  5GAM e;  5GAN d;  2K5F A;  4OMF B;  3QPH A;  4QVD A;  2ZPB B;  2F5T X;  2RJF A;  1WNL A;  3CCR T;  3X24 B;  2ZPH B;  3OYN A;  1XNI A;  3QII A;  3Q1J A;  2C06 A;  1YIJ A;  2WAC A;  4OP0 A;  2PVD B;  3MO8 A;  2E10 A;  2Y90 A;  4LDY A;  1Q82 U;  2D9T A;  2K5L A;  3PT9 A;  4QVZ A;  4XU0 A;  4NS5 A;  3QJ6 A;  1UB4 A;  2RM4 A;  1WJS A;  4F7U F;  4JLI A;  1QP3 A;  3L2W A;  4J7F A;  2DK3 A;  3ZFJ A;  1D3B B;  4NL2 A;  4M7A D;  4MDX A;  2IVW A;  4J7I A;  1X01 A;  2KAF A;  3BY7 A;  3OS5 A;  4LDU A;  5CO7 A;  3M9Q A;  4C0G A;  3G4S A;  2E6N A;  4PJO D;  5GAN f;  4XTV A;  2IG0 A;  2E41 A;  3VYH B;  3OW2 A;  3JB9 H;  3MP6 A;  4M7A B;  3RER A;  2E65 A;  5D6W A;  2VUB A;  2HAX A;  4E7K A;  2JTM A;  2KVQ G;  3BFM A;  4QVC A;  5GMK e;  1G3W A;  4HA8 A;  5FRM A;  5I2M A;  1JJ2 S;  2OTL T;  2X35 A;  1PSE A;  2XID A;  5J26 A;  1YIT T;  3FLG A;  3GIB A;  3OSV A;  4KT0 E;  3JCM f;  5CKH A;  4M78 A;  3WVE B;  2O01 E;  5GAM g;  1MGQ A;  2LVM A;  2YHT A;  1N9R A;  3GLX A;  3HFN A;  2YRV A;  4A4K A;  3TU4 K;  3A5Z B;  3JAM E;  3L2R A;  4PJO C;  3OYA A;  3CCL T;  2MI6 A;  4FIB A;  3HKS A;  1VQ8 A;  1FWZ A;  2EQU A;  3HRT A;  3MEW A;  4OGC A;  5GAM f;  2VXF A;  5HKC A;  4JUV A;  4GLK A;  3L2Q A;  2RI5 A;  3PIO A;  3L42 A;  3TCJ A;  4EMK C;  4DQ2 A;  4HT8 A;  3TEE A;  1EIF A;  3M5A A;  2PQW A;  3QXE B;  2LX9 A;  2EAY A;  4XTU A;  4M78 D;  1Y96 B;  4BE0 A;  3JB9 F;  2HD0 A;  1NPR A;  5D6Y A;  3QYG B;  4J83 A;  2L3R A;  3QZ5 B;  1M1K U;  4BDY A;  3M4G A;  4A54 A;  5LJ5 f;  2PVG B;  5LJ5 h;  4PNO A;  4M77 A;  5GAN j;  1BIB A;  4R56 A;  2JVV A;  3R6O A;  3V7S A;  3OA6 A;  1UGR B;  1KQ2 A;  4IUR A;  5LJ3 g;  1W2B S;  4KUI A;  3CMA T;  4M7D B;  4M75 A;  5LJ5 e;  3JCM d;  5GAN 4;  1QP2 A;  1Q7Y C;  1K9M U;  1QVF A;  4BAC A;  2QTX A;  4BI3 A;  3SDZ A;  4C8Q B;  4E7H A;  5D6X A;  1VQ4 A;  3JCM W;  3RIR A;  3OYY A;  2EWN A;  4MDW A;  3S3O A;  3RKW A;  3G6E A;  3V8K A;  4FT4 A;  1VQM A;  3P8H A;  5CKB A;  1JBM A;  1M4Z A;  2F5K A;  2XDD A;  3OS0 A;  1VQ9 T;  5J3B A;  2X4X A;  3ZEH A;  4X9C A;  5FRN A;  3VYG A;  1X6O A;  3M57 A;  3LGL A;  3OYK A;  3NFC A;  2M16 A;  3LH0 A;  3QUI A;  4B9X A;  4F7U E;  3OYB A;  3OYC A;  3OYI A;  4RMO A;  3HFO A;  4B9W A;  3CCJ A;  3GF5 A;  3CCJ T;  3ME9 A;  3CCU T;  2VC8 A;  3HP9 A;  3RES A;  2CKK A;  3JCM V;  4ELZ C;  1VUB A;  3CCS T;  4C92 C;  2JUF A;  2QI2 A;  2M1H A;  1NZ9 A;  1Q81 U;  5LJ5 d;  1O75 A;  2ZPG B;  4M75 E;  4EDU A;  3CCR A;  3CC2 T;  5IN1 A;  5GAO l;  4ZTJ A;  3PIP A;  5GAN e;  3VU3 C;  4JRP A;  1UGP B;  3GNF B;  3URG A;  4C8Q E;  4C5I A;  3JCM h;  4HCZ A;  2WSE E;  1KD1 U;  1KD1 C;  3JB9 I;  2M9U A;  2DO3 A;  3VKI A;  1G3Y A;  3OYJ A;  3GP8 A;  4XAX B;  3V8J A;  4GY5 A;  2L89 A;  3MCA B;  2GFA A;  2EIF A;  4J8O A;  3M53 A;  4BDZ A;  4BE2 A;  3JCM c;  1X75 C;  4ELY C;  3C4S A;  3SWN B;  3I55 T;  4KUL A;  4L6V 5;  3JCM g;  1N27 A;  3ASK A;  4F7U B;  3FRN A;  3M59 A;  1AHJ B;  4C0F A;  2VXE A;  2QXF A;  2R5M A;  3MEA A;  3VJP A;  1KQS A;  5GAM j;  2RJE A;  3S3N A;  3OYE A;  2FVU A;  3CCL A;  4M78 E;  4C0Z A;  2DD5 A;  3LGF A;  5CKF A;  4ZN1 A;  2G3R A;  4C5H A;  3GOX A;  1VQ7 T;  4O5V A;  2RO0 A;  3KBG A;  3CME A;  4C8Q A;  3CCM T;  2WSF E;  3HPW A;  2OTL A;  4J6Y A;  4XTW A;  1BI2 A;  1HXD A;  1KHI A;  3JCM P;  4C8Q F;  4IUV A;  5A0G A;  1VQ4 T;  5J39 A;  5GAO n;  4CRI A;  1U1T A;  4M7D G;  5C0M A;  2DPP B;  2DD4 A;  3OMC A;  5A0L A;  2QQR A;  1BI3 A;  2KQW A;  4OB0 B;  2EJ9 A;  4M77 B;  1UEB A;  3X25 B;  2RB6 A;  3WVD B;  1YJ9 A;  4M77 G;  5DM7 R;  4C92 F;  4J5Y A;  5GAM d;  4M78 F;  2RJD A;  1XTD A;  2LT1 A;  1JJ2 A;  3CXC A;  3QDR B;  3NTI A;  2E6Z A;  4II1 A;  1S72 A;  1VQK A;  2QQB A;  4BUG A;  4JRQ A;  5DLO A;  2JN0 A;  5LJ3 d;  3JRZ A;  2XU8 A;  3MEV A;  2DZC A;  3QBY A;  3RUX A;  4PJO E;  2RHU A;  2LT4 A;  4ATO A;  4JJN K;  4JDS A;  3CME T;  4M75 F;  3PGG A;  5LJ5 j;  3S3M A;  2GCX A;  1B34 B;  3CCE A;  2XIC A;  2PUO B;  3OYM A;  1BKB A;  2DVE A;  3HHT B;  3PNW C;  4RCC A;  3LWH A;  4JS5 A;  4M7A F;  3LYI A;  5LJ3 j;  3MEU A;  1YIT A;  4MZP A;  2OTJ A;  5FRO A;  3VUB A;  5CIU A;  2P0K A;  4EMK A;  4M7A A;  4PLI A;  5LJ3 f;  4PJO F;  2LQK A;  3QKJ A;  5GMK h;  1M90 C;  1YJW T;  2CGH A;  5KH6 A;  3VV0 A;  3NTH A;  3L2Z A;  2DKG A;  2M0O A;  1UGQ B;  4PJO A;  2QEX T;  3O8V A;  1YJN A;  4A4G A;  3OW2 S;  1QVF S;  3DB4 A;  2QA4 T;  1D3B A;  4M78 C;  4IUU A;  4QW2 A;  3JCM b;  2A3L A;  3G71 T;  4PJO B;  3I56 A;  4FL6 A;  3DLM A;  1M1K C;  1WJQ A;  2DJZ A;  3HL8 A;  1DJ7 B;  1VQ7 A;  1BI0 A;  2DXB A;  3C95 A;  4C92 D;  4IUP A;  2I2L A;  4EMK B;  1QVG S;  4L5G A;  3SWN C;  2JTF A;  3FC3 A;  2D0Q B;  1P92 A;  1TH7 A;  3CCE T;  3G7Z A;  4L59 A;  1Q86 C;  4J6X A;  2CZ0 B;  2FHD A;  5GAN 8;  2MF2 A;  4XTX A;  1OZ2 A;  2DTO A;  2V8J A;  4V2S A;  2LC4 A;  2FYK A;  2HQE A;  4VUB A;  1B34 A;  3LX7 A;  4KUD K;  3BW1 A;  4XK8 E;  1Y71 A;  3HRS A;  4IUT A;  2VGM A;  3CC7 T;  3MP8 A;  3RKY A;  3TRE A;  5FU7 B;  1YJW A;  1VIF A;  2R5A A;  2VYT A;  4C8Q C;  3QSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...