3N5BB

The complex of pii and pipx from anabaena
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
86
structure length
86
Chain Sequence
SETYINHPTWGLLYRICMVDESQDLFTTLYAQRLFFLVGNDIKAIKFQPIGRTEARMLLENRLRNLRRNGQSQEYDQLQSVFQRTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Nitrogen regulatory protein P-II
publication title Crystal structure of the cyanobacterial signal transduction protein PII in complex with PipX.
pubmed doi rcsb
source organism Nostoc
total genus 24
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12058 DUF3539 Protein of unknown function (DUF3539)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.660 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3n5bB01
2XKOC 2XG8D 3N5BB
chains in the Genus database with same CATH superfamily
2AT1B 2R57A 4C0FA 1K1ZA 5CQXA 5IXFA 4A54A 1YI2T 1ZUKA 5FW9A 1RABB 3O5ZA 3H8ZA 2M0OA 2Z0WA 1OQKA 2MPXC 3I35A 4PNOA 3M56A 1Q81R 5KCHA 2HBPA 4C92C 3A5ZB 2BZXA 1N5ZA 5CVIA 4C0ZA 2CUDA 1I1JA 4ATOA 4J9HA 4MMLA 3D7SB 1VQ7T 2ESWA 2G3RA 3OMGA 2YXYA 4HVUA 3JCMX 4FM4B 2VB6A 1GCPA 2PUOB 3I55T 2A7YA 4C0GA 1WX6A 4M7AG 1E6GA 3CCJQ 4OB1B 1YITQ 2EJ9A 4Q5WA 2W10A 2ZPHB 3R6OA 3V8JA 4R55A 1VQNQ 3CC4Q 4PJMA 1E7OA 2O9SA 4LDXA 3OS0A 1JXOA 1I8FA 4M77F 1M30A 2HQHA 2COZA 1NLOC 1RACB 1RI0A 2I2LA 3OYKA 2NUTA 1YHQQ 1SG5A 5KE2A 3OBWA 6AT1B 2F69A 3BDUA 3CCUQ 1NBEB 5HCKA 5KCOA 2QG9B 5GAN2 4ESRA 1NEGA 3MEUA 4E6RA 3JSCA 3G6ET 2MAMA 4C8QB 2E70A 2QDLA 2DMOA 4BE1A 3JCMh 2L8DA 3JB9H 5DY9A 3EGXB 1LVKA 5LJ3g 3DB4A 4F7UB 1IXDA 2DKGA 2KNBB 3FLGA 2DPPB 2RQRA 1WI7A 3RBBB 2IG0A 1X27A 4EMGA 4HVWA 2DO3A 2LVMA 3LH5A 3ZFJA 1N27A 2K6DA 3MJXA 4BY6B 2MK5A 1D0ZA 1HD3A 3INZA 3RR6A 1VQLA 3JB9F 1QVGS 1UUEA 2OTJT 3PIOA 2DAQA 3C0CA 2K7AA 2QQRA 1ABQA 1KQSA 4M77E 1I5LA 1N9RA 1FWZA 1SHGA 1UGRB 4L6V5 4M78F 1B3QA 5LJ5g 4XTXA 1F1BB 4FW2A 2EPDA 3JCMe 3S3NA 4FW1A 2EBPA 3ULRB 5LJ5d 2OI3A 1OV3A 4CRIA 3CCVT 1G5VA 1K8AR 5KE3A 4PFOA 2L3RA 3JCMQ 3MKDA 2DTIA 4DA4A 2QA4T 1YCYA 2KGTA 1IZ6A 2DZCA 3I56A 4E7JA 4KRTA 5IHIA 1MNEA 4DQ2A 3VS3A 2MOXA 2M51A 1RI9A 3NTIA 4HT9A 2E64A 4CC3A 5CK9A 2QI2A 1RAAB 2PUKB 2O4XB 3M0TA 5FRNA 4RG8A 4QKUA 1EZZB 1WYXA 2O9VA 3M4GA 3ZBDA 3O8VA 1OZ2A 2EW3A 4NOYA 1GFCA 2CREA 1G3WA 4XAXB 4O5VA 2JW4A 2J05A 3OW2P 2Y4YA 3OB9A 4BI3A 2DBMA 2K5IA 2RK1A 4KULA 3A8MB 1YJNT 1ZSZA 3CCRA 2CH4A 4R0KA 4M78E 2LCLA 3VKIA 3OYFA 2RHZA 4XK8E 1KC8C 1SRMA 1WNLA 1VQKA 2AHJB 4FSXA 2IIMA 5I22A 4JS5A 1EFNA 3CXCS 1WHGA 4B9WA 1VQMT 1JEGA 4J7IA 4A4EA 1M5Q1 2P0PA 4E7ZA 1M3CA 3QZ9B 4RTVA 2EIFA 3LH0A 1NG2A 1VQOT 4RG2A 2XD0A 2VC8A 5GAOl 1WHLA 1NPPA 1WQWA 3M0UA 1X69A 5GMKj 3BDLA 4LE9A 1HSQA 3M0RA 2YRVA 1VQPT 2BTTA 1R0BG 3PMTA 4A4GA 2QEXT 3J81E 8ATCB 1IRXA 1BIBA 2EAYA 1OU8A 2HSPA 2I0NA 2X4XA 3NPFA 1ZSZC 2DTOA 1S1NA 1VQ6T 2GF7A 4A53A 2VUBA 3QO3A 4M7DG 1B34B 2VGMA 2BE7D 2LTOA 3L2QA 1WJQA 2MWOA 2K4YA 5GAN3 1UGVA 3I5RA 3CCMA 4TVRA 4HXJA 3OBYA 3SWNB 3JCMb 3VS4A 1VQLQ 1B7TA 4ZN1A 4ZTJA 2PNIA 4OP0A 3MO8A 3CC2T 3SFMA 3M53A 4FYXB 3EFSA 4C8QF 2D6FA 2YRCA 5GJVB 2EYWA 2VYTA 3NHNA 1ZUUA 2JTFA 1JBMA 2MIOA 4ORZA 4F7UF 2LQ8A 4Z89A 2V8IA 4PJOB 3CCQT 3M59A 2XHCA 1VQ5A 1EX4A 1WXUA 4C5GA 2LX7A 1AWXA 2AZSA 4KH1B 3P8DA 3EAEA 1OYXA 5J26A 4M4ZA 3CC7T 2JUFA 1YFNA 5L23A 3M0PA 2DXBA 1YIJQ 4F04B 2L2PA 3GF5A 3CCEA 3CEYA 2AIRB 2R5MA 2DLPA 2ZPEB 3I56Q 1PM3A 4FIBA 1S72A 3IQLA 4E2FB 2DL5A 2DNUA 1IHWA 3RMQA 3NGPA 2A37A 1YWPA 3UF4A 1GXIE 1YWOA 1BCMA 2WACA 1V29B 1WJRA 2QTVA 2X3XD 3EGXA 1ZA2B 4N0AA 5IN1A 1QMCA 1ZBJA 2KROA 2JOYA 1H3ZA 4OVAA 1JQQA 4D6WA 3META 2QK0A 2DRMA 1DJ7B 3MEVA 3WXMB 2V8KA 1WHKA 3FEOA 2CYZB 1MNDA 4L59A 3EG2A 2W0ZA 4QQ6A 1D1CA 1UB4A 1M1KU 3H0FA 3Q1JA 1VQ4A 9ATCB 4XU3A 1KIKA 1Q81C 1KC8R 3CXCA 1KSWA 3CPWS 2PTKA 2BIVA 4J83A 3SEMA 1JB0E 3X26B 3CBMA 4IUUA 5KYUA 3ZEHA 2CZ0B 4NS5A 4BUGA 2QGFB 4BDYA 5HY6A 1PRLC 4JLIA 1TS9A 3EGUA 2PVGB 3R6NA 2KDSA 4C92G 2DILA 1D0YA 4N0AC 5GAMd 4XTYA 2CP0A 3PTAA 1BCOA 1Z9QA 3S6WA 4P5NA 1G3YA 1QVFS 1LCKA 1UGPB 2GCXA 1G3SA 2J7IA 2XMFA 1W2BP 2JTMA 2BE9B 3CCJA 2QQ9A 4OMFB 5FLXE 1BU1A 1FMVA 3QJYA 2FPFA 3CCMQ 3QHSA 3VUBA 5KYYA 1VIFA 4JJDA 2CS7A 2WSFE 3CC4A 1KJWA 4EDUA 4M7AB 1SEMA 1M3BA 3HTRA 1OPLA 4AFUC 4M75E 2D8HA 1WFWA 4OF1A 2C0TA 1MUZA 1FYNA 4FL6A 3VRZA 4QW2A 2KI7A 3QIIA 2DJQA 3VS5A 3I5SA 2R58A 5GMKh 3TU4K 1PCXA 2YHTA 4E7KA 2LZ6B 1VQ5Q 2HKNA 2A36A 2LQKA 4GLKA 1HXDA 3JB9I 1I81A 2FB7A 1RLQC 4X34A 1KQSP 2BZYA 2LRQA 3OYBA 1KD1U 1AT1B 1H92A 3S3MA 3G6EA 1Q82U 3VRYA 3PNWC 1H641 1SRLA 1IGUA 2ED0A 3E19A 1AWJA 2KK4A 4A63B 1S72Q 2E41A 1N8RC 3JCMJ 1TWBA 4RTWA 1UG1A 3U23A 5FRMA 4KUDK 3EG1A 3LGFA 4Z88A 4JUVA 3QYHB 3EG9B 4LXCA 4PJOF 3ER0A 2EWNA 4KGVB 1BI3A 1QWFA 2DM1A 5GANd 2EQMA 4E47A 2ZPFB 3HP9A 1JJ2S 4BI4A 1RAFB 1QQJA 4MZMA 2L5QA 3GIBA 4LUEA 1BBZA 2KSSA 1TOVA 4IUPA 2JVVA 2COWA 2MI6A 3OQ5A 5M9OA 2DJZA 1VQ4Q 5CKFA 1JO8A 1HYOA 2FEIA 1U06A 3TQ7P 2FZCB 3HHTB 1X43A 2DYIA 1Y96B 2ENMA 3CPWA 3QBYA 1D1AA 2YWWA 1YI2Q 1OPKA 4JRQA 2RPNA 2X3WD 4MZPA 4HA8A 4PK4A 1J3TA 1EIFA 2PU9B 3JCMg 4KGZB 1YJ9A 1WLPB 2NUPA 2JJ9A 5CR2A 3CD6T 5HKCA 1ARKA 1D09B 2VXFA 1WXTA 3JCMd 2OAWA 2FYKA 2RI5A 2RJDA 4CC7A 1WHMA 3AHUA 5KYNA 3CMET 2RHYA 4PJOE 1QVFA 3QXEB 1U1TA 2EYXA 3H0IA 3HFNA 1M3AA 3GP8A 2ABLA 4PFPA 4QT7A 1GBQA 1MGQA 3HRUA 1ACMB 2LC4A 3EGDB 2XIDA 1PSEA 2FHDA 2JMAA 3WVDB 1YITT 1WHJA 1AVZC 2JS0A 1VQ8T 3NTKA 4RTXA 2HSEB 2E6ZA 1VQ9T 2P84A 1OZ3A 4EMKB 3A8LB 4QVDA 1CKBA 4DEYA 1PC0A 2DA9A 2M16A 3HSBA 2DRKA 2RMOA 2YDLA 4N4IA 2EFIA 4HKEA 1YHQT 5FU6C 5HK3A 3GLXA 1VQOA 2K5FA 1UHFA 2DZ9A 3CCUT 1NEBA 1M2VB 1PNJA 2L3PA 3J7AF 4LDWA 1SHFA 1VQPA 3G6EQ 5GAN8 4C0DB 1Y07A 5LJ3d 4M7AF 4M77A 3A8OB 1SSHA 2HZYA 4FYVB 4JS4A 5I2SA 3WVEB 1QP3A 2OTLA 2QTXA 4HCKA 2E5KA 1E6HA 1N8RR 1GBRA 3CCST 1FMWA 3JCMc 1VYVA 2E5QA 4M7DB 2RQVA 2G6FX 3FB9A 4O6JA 2DFUA 4LDYA 3E1SA 4DBFA 2V26A 5KH6A 4M77D 1UEBA 2P0KA 4JPBW 3CC2A 4FCYA 3TVTA 1TH7A 2FO0A 3OY9A 5I2MA 2ZPGB 1JJ2A 3RUXA 4BB7A 2ZPIB 1YJWT 1FX7A 5FU7B 1UECA 4AFQC 2RF0A 3OYIA 2YUPA 3H6ZA 3CCLA 3G4SA 1GCQA 1RAIB 2RQTA 1YIJA 3GNGA 3KBGA 3RERA 2NYSA 4M77C 2CKKA 3OYYA 2ZAEA 3M0QA 3QG1A 1KG1A 3CMAA 3QSUA 4M75B 2QQAA 4ELZC 4M7AE 1D3BB 2PVOB 1PWTA 1QVPA 1M1FA 3CBPA 1YJ9Q 2EGCA 2HQEA 4M78A 3KFVA 3CXCP 1SPKA 2DXTA 2DXCA 3J80E 5FROA 2QQBA 2IPOB 3OYMA 1OOTA 4C5IA 3G71T 2MYSA 3JB9D 3L2VA 2XU8A 3M55A 3KXTA 3OYAA 1AOJA 1VIEA 2HAXA 5KYXA 3OSVA 3RKXA 4J9IA 1PD0A 2F2VA 1WQ7A 1RLPC 3OMCA 1KD1C 3C95A 1T3SA 1GCQC 1UDLA 4JRIA 4M78D 1NJIC 3SDZA 1JRIA 2YT6A 2D0QB 4B6MA 4HCCA 2HL3A 5L8RE 3V8KA 3I9QA 2RN8A 3QDRB 2CUBA 4FT2A 4JJCA 1VQMQ 3JCMV 2LNHB 2DL3A 2RJFA 1QKXA 3X25B 3VV0A 1WXBA 3RKYA 2XDDA 1A0NB 3M0SA 4OMQA 2EYZA 4M78C 2KRSA 5GMKi 1VQOQ 1B07A 4F17A 2MF2A 3PFSA 3L2RA 4J6WA 3OW2S 4E7IA 3L2UA 4RCCA 5A2QE 2K3BA 4FYYB 1MV0B 4RKUE 4ZTFA 2X4YA 2DERA 1VQPQ 2FPDA 2MWPA 1CSKA 1N9SA 3QYGB 4C92B 4RCBA 2YUNA 3VS7A 1QWEA 4XTZA 1M90U 1RUWA 1R77A 2L3SA 1K0SA 3F70A 1ZA1B 1M1KR 4EIKA 1UJ0A 4ANJA 5KYWB 1M9SA 5LJ5e 5GAMj 4N4HA 2CDTA 3FJPA 2HQXA 2OTLQ 2YRDA 1PSFA 3OYDA 3LX7A 1KQ2A 2E12A 3E9GA 2F2XA 4R56A 2WSEE 1LJOA 2XKOC 1QVGA 1VQLT 1WZOA 5GAOq 5D6XA 3EFOB 2RHIA 2QASA 3MHXA 1K0XA 2D8JA 1V1CA 3CC2Q 4OMOA 3BW1A 3EGDA 1NE8A 1H8KA 3MPUB 1PHTA 2LCSA 1FXXA 1TTHB 2O31A 2X35A 2C0IA 3PT9A 4IIMA 3G4SQ 3CCLQ 2F5KA 2GNCA 3VS1A 3DLLA 2CP3A 1IO6A 2HKQB 2LQWA 4B9XA 2VVKA 4DBHA 3CC7Q 2EYYA 3CMAQ 2CT4A 2PQWA 4FSSA 2RH2A 4M7DF 3MP8A 1XQHA 2A3LA 4CC2A 2E3IA 1C1AA 2CZ7B 2CSQA 2LP5A 3I56T 4HCZA 4ZN3A 5C6SA 3LLRA 4C8QA 2B8AA 1M2VA 3JCMP 1M2OA 4KGXB 1UTIA 2JM9A 3DLMA 4XTVA 2LT1A 1K9AA 3AT1B 2OX7A 4F7UA 3CPWP 2VGNA 3OS2A 1LPLA 4ZNXA 2DX1A 3ASKA 2YLBA 1TSFA 1YCSB 2CP5A 2J6OA 1O75A 4GY5A 3JRZA 1R0CB 3CCRT 4C8QD 1OU9A 2AKKA 3NMZC 2RA2A 4M75F 1KD1R 2DL8A 3M54A 2R5AA 1VQKT 5GAOp 1NJIR 2E4HA 2RD1A 1Q82R 1IB8A 1AWOA 4X9DA 5DLQE 1YI2A 4NL2A 3MP1A 4C8QC 5GAOr 4E7HA 4M7DE 1T3LA 2LQNA 1RAHB 2JTEA 3TCJA 4MZTA 1Q7YU 1WHHA 1ZBXA 1UE9A 1I4K1 1AWWA 3VUZA 5CO7A 3C12A 4OGEA 1VQ7A 5GAN6 4XQ3A 2DL4A 2OJ2A 2NLUA 3RIRA 1OEBA 3VYHB 8AT1B 4M75A 3L2WA 4BY6C 4PL6A 3I55A 3TSZA 2F2WA 3QKJA 5J3BA 1D3BA 1QCNA 2HMAA 3HRSA 3HFOA 2XG8D 5ECAA 4LNPA 2Y4XA 1XNIA 3S3OA 4C5EA 1HK9A 2O4XA 1K73U 4J9FA 2LDMA 1NYGA 2XDPA 2D9TA 2JZ2A 1PD1A 2M9UA 2KY9A 1N6AA 4IUQA 3REAB 1I07A 2EYQA 4Z02A 1IREB 4DOVA 5DM7R 1VQ9A 4RTYA 2V1RA 4Y28E 2M1HA 4C92F 1QP2A 3LGLA 5CAIA 1W2BS 2LJ0A 1XJWB 4AG1C 4JLGA 4PFZA 2KYMA 3G7ZA 2V1QA 1QLYA 4JJBA 3H9NA 1KQ1A 3M5AA 3CCET 3DB3A 4KBMB 1Q86U 5GAMh 4J8OA 1SF9A 4XU0A 4A4HA 2CGHA 5I21A 4J9CA 2HL5C 2LNVA 1X6BA 2CP6A 2F1LA 3MEWA 1TUCA 1S72T 5FWCA 2YLCA 3L1AA 4DEXA 1M1GA 2EKOA 2XI9A 2JT4A 1ZSZB 1Y71A 5GAN4 2J06A 3UWNA 2X51A 5CKEA 4DOWA 2ECZA 1LNXA 3A8HB 1ZQ1A 3HKSA 4MDXA 3M57A 3CCSA 1QW1A 2FRYA 2OTJA 3EHQA 3OS5A 2LT4A 4BD3A 2FZKB 1B34A 3EG0A 2AK5A 4F16A 1MV3A 1KQSS 1AZGB 2QDYB 3GOXA 1NYFA 2E65A 3SWNA 1BI2A 4LDVA 4OB0B 5GAMe 5LJ5f 4C92E 4RTUA 1M90C 2A08A 1TXQA 3CCVA 3EH2A 2DBKA 3OA6A 1YJWA 3C94A 2A28A 2RO0A 1Q95G 2ZGWA 5LJ5j 3FC3A 3L2ZA 4M77G 2QA4A 4KUIA 3PE0A 1YBYA 4PJOA 1AEYA 4XU2A 2EKHA 2E1HA 3QJ6A 4J9GA 1NPRA 5GJWB 2GTJA 1VQ7Q 2DE0X 2EVRA 1TU0B 2RQWA 2SRCA 3M9QA 2P0QA 2DIQA 3GPLA 2FG0A 2DD5A 3CD6Q 2P4TA 3UDCA 4ZGEB 1U8RA 2HEQA 3SWNC 4PJOD 3CPFA 3I55Q 1K4US 2H3EB 3CCJT 3CMEQ 4JZ4A 1W1FA 4FYWB 4QVCA 5IT9E 3URGA 2ROTA 1IGQA 3G71A 1CKAA 1RAEB 1WIEA 3P8HA 1RADB 1YJNA 4C5HA 4IKFA 3BE3A 3THKA 3MCAB 3DKMA 4YTLA 5GANh 1VQNT 2L3QA 3CC4T 2E10A 2KQWA 2QAZA 2DIGA 2P4RA 3N5BB 1ZLMA 1VQMA 5DLOA 4PJOC 1VQ8Q 2JN0A 1G8XA 2RI2A 1AZEA 3JB9G 2RJCA 1VQ9Q 4OMMA 4QQGA 3FRNA 4ZGDB 3LYIA 1NZ9A 3JV3A 1O9SA 3LW5E 3NFCA 1Y0MA 2FL7A 4M78G 1K9MU 3OS1A 1W2BA 2BUDA 1QVGP 1MMDA 1OX9A 1BI0A 1TUDA 2JS2A 2XK0A 2QEXA 4XTUA 3H41A 5GAOm 2KXDA 4IURA 4AMCA 1M1KC 4E7SA 2AZVA 5GANe 2CP2A 3OYCA 1VQ6A 4PJLA 1TUGB 4EPCA 3UA6A 1X01A 5I11A 1XOVA 4Z8AA 2FRWA 5D7UA 3HPWA 1WPYA 4D8KA 1BKBA 1X2KA 5GMKl 1Q81U 2IVWA 2VWFA 3JB9J 4JRPA 3JAME 2K2VA 2D0NA 2DEQA 3KUFA 1Q7YC 1MMNA 3CCSQ 2O88A 2OTJQ 5HK0A 2GBQA 5IHNA 4MDWA 1VYTA 4X1VA 2PVDB 2JNGA 3RESA 2HD0A 5EC7A 3RNJA 4AFSC 4JJNK 1UHCA 4M7AA 2ED1A 1JU5C 3QUIA 4LDUA 4EMHA 4DBRA 5KYUB 2SEMA 2RK2A 2KT1A 3CCQA 4IIOA 3CCVQ 1WA7A 1MMGA 1YJWQ 2X4WA 1ZX6A 1M90R 3V7CA 3CC7A 1K73C 1C6VX 2H3JA 3CQTA 3C4SA 2ZCFB 4J9BA 2QA4Q 1UFFA 1IHVA 4BE2A 4BACA 1PRMC 2MCNA 1MHNA 4DBQA 5A0LA 5CKDA 2E3HA 4M7AD 2KYBA 1V76A 3SHWA 3REBB 4IUTA 5LJ3h 3QWYA 2ROLA 1X2QA 3CBOA 4D8DA 1BK2A 3TREA 3OYGA 2KRMA 2RB6A 1PKTA 1YJ9T 1T0JA 4FU6A 4JDSA 5KYYB 2H8HA 1VOMA 5A0DA 4OMLA 2VV5A 3QDFA 3X20B 2EJFA 3A8GB 2NUZA 2DVEA 4M7AC 1BYMA 4N4GA 3G71Q 2LJ1A 2FZGB 1Q82C 4PLIA 2VKNA 4Y91A 3VS2A 1YJNQ 1ABOA 1Q86C 1X75C 2EQUA 4BE0A 4L5GA 3EG9A 5CKHA 2GGRA 5FWBA 2GQVA 3VU3C 2L89A 2XDBA 2QXFA 5LJ5h 1C0MA 3JCMW 5D6YA 1RAGB 1GL5A 2EQKA 2M0YA 5LJ3e 3V7SA 2YUQA 1Z9ZA 3L42A 2ZZDA 3G1JA 1N8RU 1KK7A 4RMOA 3FDRA 4BI8B 1D0XA 3TEEA 4C8QG 2COYA 2RM4A 2LCCA 3TSWA 3MEAA 3SB2A 5C0MA 2KE9A 2RHXA 1LOJA 4J5YA 3P8BB 5A0GA 2HCKA 1PKSA 4F7UG 5GAMf 2QEXQ 2K3XA 1Y96A 1GRIA 4OB3B 3RDVA 2BZ8A 2WSCE 4II1A 2LX9A 5AT1B 2BKDN 2EQJA 3HRTA 3UPUA 4XTWA 2HNIA 1VQ6Q 2DK3A 4J9EA 5LL6S 1K8AU 3VYGA 2MMPA 3RMSA 1OX8A 3LWIA 4A4KA 2OTLT 2CSIA 2DL7A 2K9GA 4OGCA 1G2BA 5D6WA 3EG3A 2EGAA 1WGSA 3OYJA 1Q7YR 5EG2A 2A0FB 1OI1A 2HDAA 2YSQA 2GFUA 2VASA 4WTOB 1AD5A 5CCAA 1RL2A 1UGSB 2RHUA 3PIPA 4LUDA 2CZ1B 4J6YA 4F14A 3CCQQ 2KRNA 2ZPBB 3V8LA 3H0HA 2EGEA 1FMKA 1HJDA 3UATA 3CCLT 3G4ST 4EMKA 2HBWA 1YIJT 3OYNA 4J7FA 2DTHA 2XICA 4M75G 1X6GA 2C06A 3MP6A 2NUPB 3LWHA 4CI0C 3CMAT 1K73R 5FU6B 4AG2C 1UJYA 1YN8A 1KHIA 4ELYC 4KT0E 2AKLA 2QQSA 4HT8A 1I0CA 2EJGA 1X6OA 2KAFA 4HVVA 5GAOn 2X4JA 5GAN5 1VA7A 2L0AA 4OMNA 2KT8A 2DXUA 1K9MC 5CKBA 5AYFA 1SKUB 1QCOA 3OSSC 2KR3A 2DF6A 3M58A 2PZ1A 3E2UA 5IH2A 5IHKA 2JMCA 1OULA 4RUGA 5GANf 1D1BA 3OYEA 1M27C 2D1XA 1G83A 3VJPA 2NUTB 4EMKC 2JM8A 4XU1A 2C0OA 1GFDA 4M7DA 4JRKA 2FPEA 3PVLA 2GFAA 4GLMA 3CCRQ 4MMKA 4C8QE 1QVFP 4ZGJB 1Q86R 7AT1B 2B86A 2FVUA 5GANj 2RI3A 2LMJA 1T0HA 1VQKQ 2GQIA 4F7UE 2DYBA 5IAYA 3ZL7C 3FJ5A 4OMPA 1QCFA 2EQIA 4OB2B 3BY7A 3GNFB 4QVZA 4RTZA 2DVJA 4M7DD 2VXEA 4BDZA 4QQDA 2QYZA 4C0DC 4J9DA 4ME7A 4LD9K 3OW2A 1NM7A 4HCBA 2YUOA 3VS6A 1VUBA 4M77B 3PGGA 1ZHIA 2KVQG 1BIAA 5GAMg 1UGQB 3JCMf 3CD6A 2LJ3A 4PKCC 2ATCB 2KEAA 2KXCA 3CMEA 1QKWA 2OAUA 2KMTA 1G3TA 1SSFA 2K79A 3EFRA 4M7DC 4WF2A 2CH4W 1R8OB 2V8JA 1TG0A 3CCMT 5GAN7 4J6XA 2QGGA 1KFZA 2CP7A 1YNZA 1BB9A 3X28B 3OYLA 3E9FA 1YITA 1KHCA 4GBQA 2CZ6B 1P92A 2J6FA 3VS0A 4M75D 2J6KA 2K2MA 1VQ8A 2K57A 1H3HA 1VQNA 2CT3A 4IUVA 1PG5B 2DEUA 5FU7C 4LD6A 4JZ3A 4WCIA 4RTTA 4PJOG 1U1SA 1JXMA 5IXBA 3A98A 3NTHA 4KH0B 1I5OB 3FIFA 2RQUA 3QWXX 3X24B 1VQ5T 2O01E 5J39A 1YHQA 3BFMA 4VUBA 4E7LA 4M75C 1ZUYA 1W4SA 3CCUA 3SD4A 1YP5A 3UA7A 3GBQA 2Y90A 1W6XA 1M8MA 3RKWA 1Y57A 1JJ2P 4M78B 2M02A 4AT1B 3HL8A 4UC4A 4Y92A 2RNAA 5LJ3f 1AHJB 4PLLA 3CCEQ 4X9CA 2JXBA 4AFZC 4CC4B 1KC8U 5CIUA 1NJIU 4FT4A 4K11A 1Y7XA 1W70A 1U3OA 3OYHA 1VYUA 4NL3A 2O2OA 2GTOA 5KYXB 2DD4A 5LJ3j 4A4FA 3A1PA 4C92A 1WJSA 2K3YA 1NLPC 2DETA 3QPHA 1XTDA 3T9NA 4V2SA 5GMKe 4PJNA 1U5SA 1M8VA 3V7RA 4PJJA 2E6NA 5KYWA 1K9MR 2X9HA 3PMIA 1M4ZA 3EH1A 5GANg 1WDXA 2NWMA 1BI1A 5GMKm 1MMAA 2K5LA 3M4YA 5CQYA 3QZ5B 1VQ4T 3UT1A 4C92D 1K76A 2F5TX 3EFOA 1K8AC 3PVQA 3EHRA 1ZSGA 4LN2A 2RJEA 3ME9A 2KBTA
chains in the Genus database with same CATH topology
2PVDB 2JNGA 2R57A 3RESA 1M9SA 5LJ5e 5GAMj 4N4HA 5CQXA 4C0FA 2HD0A 4N0AC 3FJPA 2HQXA 5GAMd 4XTYA 1PSFA 4A54A 3PTAA 1YI2T 3OYDA 3S6WA 3LX7A 1KQ2A 2E12A 3E9GA 3H8ZA 4P5NA 1G3YA 4C92G 4JJNK 2M0OA 1QVFS 4PNOA 4R56A 2WSEE 4M7AA 1LJOA 3M56A 3QUIA 4LDUA 1UGPB 2GCXA 2XKOC 1G3SA 4EMHA 5KCHA 2HBPA 2RK2A 1QVGA 1VQLT 3CCQA 5GAOq 4C92C 3A5ZB 2JTMA 5D6XA 3CCJA 2RHIA 5CVIA 2QQ9A 3MHXA 2X4WA 4OMFB 5FLXE 4C0ZA 4ATOA 3V7CA 3QJYA 3CC7A 1K73C 2H3JA 4MMLA 3C4SA 3QHSA 1VQ7T 2ZCFB 3VUBA 3BW1A 1VIFA 2G3RA 1NE8A 2CS7A 2WSFE 3OMGA 3CC4A 3JCMX 4BACA 4BE2A 4FM4B 4EDUA 1MHNA 5A0LA 2PUOB 4M7AB 5CKDA 4M7AD 1FXXA 2X35A 3PT9A 3I55T 4M75E 2A7YA 4IUTA 2F5KA 4C0GA 3DLLA 5LJ3h 4OF1A 4M7AG 3CBOA 4OB1B 4FL6A 3TREA 3OYGA 4QW2A 2RB6A 1YJ9T 4B9XA 3QIIA 4FU6A 2R58A 4JDSA 2EJ9A 5GMKh 4Q5WA 2ZPHB 2PQWA 3R6OA 3TU4K 2RH2A 2YHTA 4M7DF 3V8JA 4R55A 3MP8A 1XQHA 2A3LA 4E7KA 5A0DA 2CZ7B 2LQKA 2VV5A 4GLKA 1HXDA 4LDXA 3I56T 3X20B 3OS0A 2EJFA 3A8GB 4HCZA 2DVEA 4M7AC 1I8FA 4M77F 1BYMA 4N4GA 3JB9I 1I81A 4ZN3A 5C6SA 1Q82C 3LLRA 4PLIA 4C8QA 2FB7A 4Y91A 2B8AA 4X34A 3JCMP 1RI0A 2I2LA 1Q86C 2LRQA 3OYBA 1KD1U 1X75C 2EQUA 3DLMA 4XTVA 3OYKA 4BE0A 2LT1A 4L5GA 3S3MA 5CKHA 4F7UA 3G6EA 1Q82U 3PNWC 2VGNA 5KE2A 2GQVA 3OS2A 3VU3C 2L89A 2XDBA 2QXFA 3OBWA 5LJ5h 1H641 2F69A 3JCMW 5D6YA 3BDUA 3E19A 3ASKA 2YLBA 2KK4A 2E41A 2EQKA 5KCOA 1N8RC 5GAN2 5LJ3e 3JCMJ 3MEUA 3V7SA 5FRMA 4KUDK 3JSCA 4GY5A 1O75A 3LGFA 2MAMA 3JRZA 4C8QB 3L42A 4C8QD 3G6ET 3CCRT 2E70A 2ZZDA 4JUVA 4BE1A 3JCMh 1N8RU 2L8DA 2RA2A 4M75F 3QYHB 4RMOA 3JB9H 3FDRA 5DY9A 4BI8B 3M54A 4PJOF 3TEEA 2R5AA 3DB4A 3ER0A 4C8QG 2EWNA 2RM4A 4F7UB 2LCCA 5LJ3g 5GAOp 1VQKT 2DKGA 1BI3A 3FLGA 2RD1A 2DPPB 3MEAA 3SB2A 5C0MA 2RHXA 1LOJA 4J5YA 4X9DA 3P8BB 5A0GA 4F7UG 5GAMf 5GANd 2EQMA 4E47A 2K3XA 2IG0A 1Y96A 2ZPFB 5DLQE 3HP9A 1JJ2S 4BI4A 1YI2A 4EMGA 2DO3A 2LVMA 3ZFJA 4NL2A 4MZMA 1N27A 2L5QA 2WSCE 4II1A 4OB3B 3GIBA 2LX9A 2BKDN 3MP1A 4C8QC 2EQJA 2KSSA 3HRTA 3UPUA 4BY6B 4E7HA 5GAOr 4M7DE 4IUPA 4XTWA 2HNIA 2JVVA 3INZA 1VQLA 2DK3A 3JB9F 2MI6A 3OQ5A 3TCJA 4MZTA 5LL6S 5M9OA 1Q7YU 2DJZA 1QVGS 1K8AU 1ZBXA 3PIOA 2OTJT 2DAQA 5CKFA 1I4K1 2QQRA 3VYGA 2MMPA 4M77E 1KQSA 3RMSA 3VUZA 1I5LA 1N9RA 3HHTB 5CO7A 3LWIA 1FWZA 3C12A 4A4KA 1UGRB 4OGEA 1VQ7A 2OTLT 4L6V5 1Y96B 5GAN6 4M78F 3CPWA 5LJ5g 3QBYA 4XTXA 3JCMe 4XQ3A 3S3NA 3RIRA 2NLUA 5LJ5d 4OGCA 3VYHB 4M75A 3L2WA 4BY6C 4JRQA 4PL6A 5D6WA 3I55A 4CRIA 4MZPA 4HA8A 3CCVT 3QKJA 1G5VA 5J3BA 1WGSA 1D3BA 3OYJA 4M7DB 3HRSA 3HFOA 1EIFA 2XG8D 5KE3A 2PU9B 2Y4XA 1XNIA 5EG2A 3JCMg 1OI1A 3S3OA 4C5EA 1HK9A 2GFUA 1YJ9A 2L3RA 2O4XA 3JCMQ 1K73U 3CD6T 2DTIA 5CR2A 5HKCA 2LDMA 5CCAA 2VXFA 3JCMd 4DA4A 2FYKA 2RI5A 1RL2A 1UGSB 2RJDA 2RHUA 1YCYA 2QA4T 3PIPA 2XDPA 2CZ1B 4J6YA 3AHUA 1IZ6A 2D9TA 2JZ2A 2RHYA 3CMET 2M9UA 2KY9A 1N6AA 4IUQA 2ZPBB 3QXEB 2DZCA 3V8LA 1QVFA 1U1TA 4PJOE 3HFNA 3I56A 4E7JA 2EYQA 3GP8A 4Z02A 3G4ST 3CCLT 4DQ2A 4EMKA 1IREB 1MGQA 3OYNA 4J7FA 2DTHA 3HRUA 1YIJT 3NTIA 2LC4A 4DOVA 4HT9A 2E64A 5DM7R 2XIDA 5CK9A 2XICA 1PSEA 4M75G 2QI2A 1VQ9A 2FHDA 3WVDB 1YITT 2C06A 3MP6A 2PUKB 2O4XB 3LWHA 4Y28E 5FRNA 4CI0C 3CMAT 4RG8A 2M1HA 5FU6B 4C92F 1QP2A 3LGLA 5CAIA 1KHIA 4ELYC 1W2BS 1VQ8T 3NTKA 4KT0E 3M4GA 2E6ZA 2QQSA 3ZBDA 3O8VA 1OZ2A 4HT8A 4NOYA 4JLGA 1VQ9T 1G3WA 4XAXB 4O5VA 2EJGA 1OZ3A 4EMKB 2Y4YA 3A8LB 3OB9A 3G7ZA 4BI3A 4QVDA 1X6OA 2KAFA 2K5IA 2RK1A 5GAOn 4KULA 2X4JA 3A8MB 1YJNT 1KQ1A 3CCRA 5GAN5 2M16A 3M5AA 3CCET 3DB3A 4M78E 2LCLA 3HSBA 4KBMB 1Q86U 3VKIA 3OYFA 5GAMh 4N4IA 2RHZA 2EFIA 4XK8E 4HKEA 1YHQT 4J8OA 2DXUA 4XU0A 1WNLA 5CKBA 2CGHA 4A4HA 1KC8C 5AYFA 5FU6C 2AHJB 4FSXA 5I21A 5HK3A 1VQKA 3GLXA 2LNVA 4JS5A 1VQOA 3OSSC 3CXCS 4B9WA 2K5FA 2DZ9A 1VQMT 3M58A 3CCUT 3MEWA 5GANf 1S72T 4J7IA 4A4EA 3OYEA 1M5Q1 2P0PA 2YLCA 3L1AA 3J7AF 3QZ9B 2EIFA 1M1GA 2EKOA 3VJPA 4EMKC 2XI9A 4XU1A 4LDWA 3LH0A 1Y71A 5GAN4 4JRKA 1VQPA 1VQOT 3UWNA 2GFAA 4M7DA 5GAN8 4RG2A 5CKEA 4DOWA 4C0DB 4MMKA 1Y07A 2XD0A 4C8QE 5LJ3d 1LNXA 2VC8A 1ZQ1A 3A8HB 3HKSA 4ZGJB 5GAOl 4M7AF 3M57A 4MDXA 2FVUA 3CCSA 5GANj 1NPPA 1QW1A 1WQWA 2RI3A 2OTJA 3OS5A 2LT4A 4BD3A 4M77A 1B34A 3A8OB 5GMKj 3BDLA 4F7UE 5IAYA 1KQSS 2QDYB 2YRVA 1VQPT 4A4GA 3PMTA 2QEXT 4JS4A 5I2SA 3GOXA 3J81E 3WVEB 1QP3A 2OTLA 2QTXA 1BIBA 2E65A 3SWNA 1BI2A 4OB2B 2EAYA 3CCST 3BY7A 3GNFB 2X4XA 4QVZA 3JCMc 4LDVA 2E5QA 4OB0B 5GAMe 5LJ5f 2VXEA 4C92E 4BDZA 2DTOA 4QQDA 1M90C 4M7DD 3FB9A 2GF7A 4A53A 4O6JA 1VQ6T 2VUBA 4C0DC 4ME7A 4LD9K 3CCVA 3QO3A 3OW2A 4HCBA 4LDYA 3OA6A 3E1SA 1YJWA 4M7DG 1VUBA 1K9MC 3C94A 5KH6A 4M77B 1B34B 2VGMA 4M77D 1UEBA 2P0KA 2LTOA 3PGGA 3CC2A 1ZHIA 3L2QA 1WJQA 1BIAA 2KVQG 5GAMg 2RO0A 2MWOA 1UGQB 2K4YA 5GAN3 1TH7A 2ZGWA 5LJ5j 3JCMf 4TVRA 3L2ZA 3FC3A 3CCMA 3CD6A 3OY9A 4PKCC 3OBYA 4M77G 5I2MA 2ZPGB 2QA4A 4KUIA 1JJ2A 3SWNB 1YBYA 3RUXA 4PJOA 4BB7A 2ZPIB 3JCMb 1YJWT 1FX7A 3CMEA 4XU2A 5FU7B 2OAUA 2KMTA 1G3TA 1SSFA 3EFRA 4ZN1A 4OP0A 4ZTJA 4WF2A 3MO8A 4M7DC 1R8OB 3CC2T 2V8JA 3H6ZA 3OYIA 3CCLA 2E1HA 3SFMA 3G4SA 3CCMT 3M53A 3QJ6A 5GAN7 4J6XA 1YIJA 1NPRA 3GNGA 3KBGA 1VQNT 3RERA 3EFSA 4M77C 3X28B 4C8QF 3OYLA 2D6FA 3E9FA 1YITA 2CKKA 3OYYA 3M9QA 1KHCA 2P0QA 2DIQA 3QG1A 1KG1A 3GPLA 3CMAA 3QSUA 2VYTA 1P92A 2CZ6B 2DD5A 2JTFA 2P4TA 4M75B 4M75D 1JBMA 2QQAA 3UDCA 4F7UF 2LQ8A 4ZGEB 1U8RA 1VQ8A 2V8IA 2K57A 4ELZC 3SWNC 3CCQT 4M7AE 3CPFA 3M59A 1VQNA 2XHCA 1VQ5A 4PJOD 1D3BB 2PVOB 4IUVA 3CCJT 5FU7C 4LD6A 1QVPA 4C5GA 4QVCA 5IT9E 3URGA 1M1FA 3P8DA 3EAEA 4PJOG 1OYXA 3CBPA 3G71A 5J26A 3CC7T 1U1SA 2JUFA 3P8HA 2HQEA 4M78A 1YJNA 4C5HA 2DXBA 3GF5A 3NTHA 2DXTA 3CCEA 4IKFA 2DXCA 3FIFA 3MCAB 3DKMA 4YTLA 3X24B 5GANh 3J80E 5FROA 2O01E 3CC4T 1VQ5T 2E10A 5J39A 2KQWA 2QQBA 3CEYA 2R5MA 1YHQA 3BFMA 2DIGA 4VUBA 2ZPEB 4E7LA 3OYMA 3N5BB 4M75C 4C5IA 3G71T 3JB9D 1W4SA 3L2VA 2XU8A 3M55A 1VQMA 5DLOA 3CCUA 3KXTA 4PJOC 3SD4A 2JN0A 4FIBA 3OYAA 1S72A 1VIEA 2HAXA 3OSVA 3RKXA 2RI2A 3RMQA 2Y90A 3JB9G 2RJCA 1WQ7A 3OMCA 1KD1C 3C95A 3RKWA 4M78B 4JRIA 4M78D 1NJIC 3HL8A 4QQGA 4UC4A 3SDZA 3FRNA 1JRIA 1GXIE 4ZGDB 3LYIA 5LJ3f 2D0QB 1NZ9A 1AHJB 1O9SA 2WACA 3LW5E 3NFCA 4PLLA 4X9CA 4HCCA 1V29B 1WJRA 5L8RE 2FL7A 3V8KA 4M78G 1KC8U 1K9MU 4N0AA 3OS1A 5CIUA 5IN1A 3QDRB 1NJIU 1W2BA 2BUDA 2JOYA 4FT2A 4FT4A 1Y7XA 1H3ZA 3OYHA 1BI0A 4OVAA 2XK0A 4NL3A 4D6WA 3META 2QEXA 4XTUA 2DD4A 5LJ3j 3JCMV 5GAOm 1DJ7B 3MEVA 4IURA 1M1KC 3WXMB 2RJFA 4A4FA 2V8KA 3X25B 3VV0A 3FEOA 2CYZB 3RKYA 1WJSA 4L59A 4C92A 2XDDA 2K3YA 5GANe 4M78C 3QPHA 5GMKi 1XTDA 4QQ6A 3T9NA 4V2SA 3OYCA 5GMKe 1VQ6A 1M8VA 1UB4A 1M1KU 3V7RA 2MF2A 3PFSA 3Q1JA 4EPCA 1VQ4A 3L2RA 4XU3A 2E6NA 4J6WA 3OW2S 1Q81C 1X01A 4E7IA 3L2UA 4RCCA 5A2QE 3CXCA 3PMIA 1XOVA 3CPWS 1M4ZA 5GANg 2BIVA 4J83A 4PJOB 4RKUE 3HPWA 1JB0E 4ZTFA 1WPYA 1BKBA 1BI1A 2X4YA 5GMKm 3X26B 2K5LA 5GMKl 2IVWA 3JB9J 1Q81U 3M4YA 5CQYA 3CBMA 4IUUA 3JAME 4JRPA 2MWPA 3QZ5B 2K2VA 1VQ4T 3ZEHA 2DEQA 1N9SA 2CZ0B 3KUFA 3QYGB 3UT1A 4C92D 4C92B 4NS5A 4RCBA 2F5TX 4BUGA 1Q7YC 1K8AC 4BDYA 5HY6A 4XTZA 5HK0A 1M90U 4JLIA 4MDWA 2RJEA 2PVGB 3ME9A 3F70A 2KDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKO C;  2XG8 D;  3N5B B; 
#chains in the Genus database with same CATH topology
 2AT1 B;  2R57 A;  4C0F A;  1K1Z A;  5CQX A;  5IXF A;  4A54 A;  1YI2 T;  1ZUK A;  5FW9 A;  1RAB B;  3O5Z A;  3H8Z A;  2M0O A;  2Z0W A;  1OQK A;  2MPX C;  3I35 A;  4PNO A;  3M56 A;  1Q81 R;  5KCH A;  2HBP A;  4C92 C;  3A5Z B;  2BZX A;  1N5Z A;  5CVI A;  4C0Z A;  2CUD A;  1I1J A;  4ATO A;  4J9H A;  4MML A;  3D7S B;  1VQ7 T;  2ESW A;  2G3R A;  3OMG A;  2YXY A;  4HVU A;  3JCM X;  4FM4 B;  2VB6 A;  1GCP A;  2PUO B;  3I55 T;  2A7Y A;  4C0G A;  1WX6 A;  4M7A G;  1E6G A;  3CCJ Q;  4OB1 B;  1YIT Q;  2EJ9 A;  4Q5W A;  2W10 A;  2ZPH B;  3R6O A;  3V8J A;  4R55 A;  1VQN Q;  3CC4 Q;  4PJM A;  1E7O A;  2O9S A;  4LDX A;  3OS0 A;  1JXO A;  1I8F A;  4M77 F;  1M30 A;  2HQH A;  2COZ A;  1NLO C;  1RAC B;  1RI0 A;  2I2L A;  3OYK A;  2NUT A;  1YHQ Q;  1SG5 A;  5KE2 A;  3OBW A;  6AT1 B;  2F69 A;  3BDU A;  3CCU Q;  1NBE B;  5HCK A;  5KCO A;  2QG9 B;  5GAN 2;  4ESR A;  1NEG A;  3MEU A;  4E6R A;  3JSC A;  3G6E T;  2MAM A;  4C8Q B;  2E70 A;  2QDL A;  2DMO A;  4BE1 A;  3JCM h;  2L8D A;  3JB9 H;  5DY9 A;  3EGX B;  1LVK A;  5LJ3 g;  3DB4 A;  4F7U B;  1IXD A;  2DKG A;  2KNB B;  3FLG A;  2DPP B;  2RQR A;  1WI7 A;  3RBB B;  2IG0 A;  1X27 A;  4EMG A;  4HVW A;  2DO3 A;  2LVM A;  3LH5 A;  3ZFJ A;  1N27 A;  2K6D A;  3MJX A;  4BY6 B;  2MK5 A;  1D0Z A;  1HD3 A;  3INZ A;  3RR6 A;  1VQL A;  3JB9 F;  1QVG S;  1UUE A;  2OTJ T;  3PIO A;  2DAQ A;  3C0C A;  2K7A A;  2QQR A;  1ABQ A;  1KQS A;  4M77 E;  1I5L A;  1N9R A;  1FWZ A;  1SHG A;  1UGR B;  4L6V 5;  4M78 F;  1B3Q A;  5LJ5 g;  4XTX A;  1F1B B;  4FW2 A;  2EPD A;  3JCM e;  3S3N A;  4FW1 A;  2EBP A;  3ULR B;  5LJ5 d;  2OI3 A;  1OV3 A;  4CRI A;  3CCV T;  1G5V A;  1K8A R;  5KE3 A;  4PFO A;  2L3R A;  3JCM Q;  3MKD A;  2DTI A;  4DA4 A;  2QA4 T;  1YCY A;  2KGT A;  1IZ6 A;  2DZC A;  3I56 A;  4E7J A;  4KRT A;  5IHI A;  1MNE A;  4DQ2 A;  3VS3 A;  2MOX A;  2M51 A;  1RI9 A;  3NTI A;  4HT9 A;  2E64 A;  4CC3 A;  5CK9 A;  2QI2 A;  1RAA B;  2PUK B;  2O4X B;  3M0T A;  5FRN A;  4RG8 A;  4QKU A;  1EZZ B;  1WYX A;  2O9V A;  3M4G A;  3ZBD A;  3O8V A;  1OZ2 A;  2EW3 A;  4NOY A;  1GFC A;  2CRE A;  1G3W A;  4XAX B;  4O5V A;  2JW4 A;  2J05 A;  3OW2 P;  2Y4Y A;  3OB9 A;  4BI3 A;  2DBM A;  2K5I A;  2RK1 A;  4KUL A;  3A8M B;  1YJN T;  1ZSZ A;  3CCR A;  2CH4 A;  4R0K A;  4M78 E;  2LCL A;  3VKI A;  3OYF A;  2RHZ A;  4XK8 E;  1KC8 C;  1SRM A;  1WNL A;  1VQK A;  2AHJ B;  4FSX A;  2IIM A;  5I22 A;  4JS5 A;  1EFN A;  3CXC S;  1WHG A;  4B9W A;  1VQM T;  1JEG A;  4J7I A;  4A4E A;  1M5Q 1;  2P0P A;  4E7Z A;  1M3C A;  3QZ9 B;  4RTV A;  2EIF A;  3LH0 A;  1NG2 A;  1VQO T;  4RG2 A;  2XD0 A;  2VC8 A;  5GAO l;  1WHL A;  1NPP A;  1WQW A;  3M0U A;  1X69 A;  5GMK j;  3BDL A;  4LE9 A;  1HSQ A;  3M0R A;  2YRV A;  1VQP T;  2BTT A;  1R0B G;  3PMT A;  4A4G A;  2QEX T;  3J81 E;  8ATC B;  1IRX A;  1BIB A;  2EAY A;  1OU8 A;  2HSP A;  2I0N A;  2X4X A;  3NPF A;  1ZSZ C;  2DTO A;  1S1N A;  1VQ6 T;  2GF7 A;  4A53 A;  2VUB A;  3QO3 A;  4M7D G;  1B34 B;  2VGM A;  2BE7 D;  2LTO A;  3L2Q A;  1WJQ A;  2MWO A;  2K4Y A;  5GAN 3;  1UGV A;  3I5R A;  3CCM A;  4TVR A;  4HXJ A;  3OBY A;  3SWN B;  3JCM b;  3VS4 A;  1VQL Q;  1B7T A;  4ZN1 A;  4ZTJ A;  2PNI A;  4OP0 A;  3MO8 A;  3CC2 T;  3SFM A;  3M53 A;  4FYX B;  3EFS A;  4C8Q F;  2D6F A;  2YRC A;  5GJV B;  2EYW A;  2VYT A;  3NHN A;  1ZUU A;  2JTF A;  1JBM A;  2MIO A;  4ORZ A;  4F7U F;  2LQ8 A;  4Z89 A;  2V8I A;  4PJO B;  3CCQ T;  3M59 A;  2XHC A;  1VQ5 A;  1EX4 A;  1WXU A;  4C5G A;  2LX7 A;  1AWX A;  2AZS A;  4KH1 B;  3P8D A;  3EAE A;  1OYX A;  5J26 A;  4M4Z A;  3CC7 T;  2JUF A;  1YFN A;  5L23 A;  3M0P A;  2DXB A;  1YIJ Q;  4F04 B;  2L2P A;  3GF5 A;  3CCE A;  3CEY A;  2AIR B;  2R5M A;  2DLP A;  2ZPE B;  3I56 Q;  1PM3 A;  4FIB A;  1S72 A;  3IQL A;  4E2F B;  2DL5 A;  2DNU A;  1IHW A;  3RMQ A;  3NGP A;  2A37 A;  1YWP A;  3UF4 A;  1GXI E;  1YWO A;  1BCM A;  2WAC A;  1V29 B;  1WJR A;  2QTV A;  2X3X D;  3EGX A;  1ZA2 B;  4N0A A;  5IN1 A;  1QMC A;  1ZBJ A;  2KRO A;  2JOY A;  1H3Z A;  4OVA A;  1JQQ A;  4D6W A;  3MET A;  2QK0 A;  2DRM A;  1DJ7 B;  3MEV A;  3WXM B;  2V8K A;  1WHK A;  3FEO A;  2CYZ B;  1MND A;  4L59 A;  3EG2 A;  2W0Z A;  4QQ6 A;  1D1C A;  1UB4 A;  1M1K U;  3H0F A;  3Q1J A;  1VQ4 A;  9ATC B;  4XU3 A;  1KIK A;  1Q81 C;  1KC8 R;  3CXC A;  1KSW A;  3CPW S;  2PTK A;  2BIV A;  4J83 A;  3SEM A;  1JB0 E;  3X26 B;  3CBM A;  4IUU A;  5KYU A;  3ZEH A;  2CZ0 B;  4NS5 A;  4BUG A;  2QGF B;  4BDY A;  5HY6 A;  1PRL C;  4JLI A;  1TS9 A;  3EGU A;  2PVG B;  3R6N A;  2KDS A;  4C92 G;  2DIL A;  1D0Y A;  4N0A C;  5GAM d;  4XTY A;  2CP0 A;  3PTA A;  1BCO A;  1Z9Q A;  3S6W A;  4P5N A;  1G3Y A;  1QVF S;  1LCK A;  1UGP B;  2GCX A;  1G3S A;  2J7I A;  2XMF A;  1W2B P;  2JTM A;  2BE9 B;  3CCJ A;  2QQ9 A;  4OMF B;  5FLX E;  1BU1 A;  1FMV A;  3QJY A;  2FPF A;  3CCM Q;  3QHS A;  3VUB A;  5KYY A;  1VIF A;  4JJD A;  2CS7 A;  2WSF E;  3CC4 A;  1KJW A;  4EDU A;  4M7A B;  1SEM A;  1M3B A;  3HTR A;  1OPL A;  4AFU C;  4M75 E;  2D8H A;  1WFW A;  4OF1 A;  2C0T A;  1MUZ A;  1FYN A;  4FL6 A;  3VRZ A;  4QW2 A;  2KI7 A;  3QII A;  2DJQ A;  3VS5 A;  3I5S A;  2R58 A;  5GMK h;  3TU4 K;  1PCX A;  2YHT A;  4E7K A;  2LZ6 B;  1VQ5 Q;  2HKN A;  2A36 A;  2LQK A;  4GLK A;  1HXD A;  3JB9 I;  1I81 A;  2FB7 A;  1RLQ C;  4X34 A;  1KQS P;  2BZY A;  2LRQ A;  3OYB A;  1KD1 U;  1AT1 B;  1H92 A;  3S3M A;  3G6E A;  1Q82 U;  3VRY A;  3PNW C;  1H64 1;  1SRL A;  1IGU A;  2ED0 A;  3E19 A;  1AWJ A;  2KK4 A;  4A63 B;  1S72 Q;  2E41 A;  1N8R C;  3JCM J;  1TWB A;  4RTW A;  1UG1 A;  3U23 A;  5FRM A;  4KUD K;  3EG1 A;  3LGF A;  4Z88 A;  4JUV A;  3QYH B;  3EG9 B;  4LXC A;  4PJO F;  3ER0 A;  2EWN A;  4KGV B;  1BI3 A;  1QWF A;  2DM1 A;  5GAN d;  2EQM A;  4E47 A;  2ZPF B;  3HP9 A;  1JJ2 S;  4BI4 A;  1RAF B;  1QQJ A;  4MZM A;  2L5Q A;  3GIB A;  4LUE A;  1BBZ A;  2KSS A;  1TOV A;  4IUP A;  2JVV A;  2COW A;  2MI6 A;  3OQ5 A;  5M9O A;  2DJZ A;  1VQ4 Q;  5CKF A;  1JO8 A;  1HYO A;  2FEI A;  1U06 A;  3TQ7 P;  2FZC B;  3HHT B;  1X43 A;  2DYI A;  1Y96 B;  2ENM A;  3CPW A;  3QBY A;  1D1A A;  2YWW A;  1YI2 Q;  1OPK A;  4JRQ A;  2RPN A;  2X3W D;  4MZP A;  4HA8 A;  4PK4 A;  1J3T A;  1EIF A;  2PU9 B;  3JCM g;  4KGZ B;  1YJ9 A;  1WLP B;  2NUP A;  2JJ9 A;  5CR2 A;  3CD6 T;  5HKC A;  1ARK A;  1D09 B;  2VXF A;  1WXT A;  3JCM d;  2OAW A;  2FYK A;  2RI5 A;  2RJD A;  4CC7 A;  1WHM A;  3AHU A;  5KYN A;  3CME T;  2RHY A;  4PJO E;  1QVF A;  3QXE B;  1U1T A;  2EYX A;  3H0I A;  3HFN A;  1M3A A;  3GP8 A;  2ABL A;  4PFP A;  4QT7 A;  1GBQ A;  1MGQ A;  3HRU A;  1ACM B;  2LC4 A;  3EGD B;  2XID A;  1PSE A;  2FHD A;  2JMA A;  3WVD B;  1YIT T;  1WHJ A;  1AVZ C;  2JS0 A;  1VQ8 T;  3NTK A;  4RTX A;  2HSE B;  2E6Z A;  1VQ9 T;  2P84 A;  1OZ3 A;  4EMK B;  3A8L B;  4QVD A;  1CKB A;  4DEY A;  1PC0 A;  2DA9 A;  2M16 A;  3HSB A;  2DRK A;  2RMO A;  2YDL A;  4N4I A;  2EFI A;  4HKE A;  1YHQ T;  5FU6 C;  5HK3 A;  3GLX A;  1VQO A;  2K5F A;  1UHF A;  2DZ9 A;  3CCU T;  1NEB A;  1M2V B;  1PNJ A;  2L3P A;  3J7A F;  4LDW A;  1SHF A;  1VQP A;  3G6E Q;  5GAN 8;  4C0D B;  1Y07 A;  5LJ3 d;  4M7A F;  4M77 A;  3A8O B;  1SSH A;  2HZY A;  4FYV B;  4JS4 A;  5I2S A;  3WVE B;  1QP3 A;  2OTL A;  2QTX A;  4HCK A;  2E5K A;  1E6H A;  1N8R R;  1GBR A;  3CCS T;  1FMW A;  3JCM c;  1VYV A;  2E5Q A;  4M7D B;  2RQV A;  2G6F X;  3FB9 A;  4O6J A;  2DFU A;  4LDY A;  3E1S A;  4DBF A;  2V26 A;  5KH6 A;  4M77 D;  1UEB A;  2P0K A;  4JPB W;  3CC2 A;  4FCY A;  3TVT A;  1TH7 A;  2FO0 A;  3OY9 A;  5I2M A;  2ZPG B;  1JJ2 A;  3RUX A;  4BB7 A;  2ZPI B;  1YJW T;  1FX7 A;  5FU7 B;  1UEC A;  4AFQ C;  2RF0 A;  3OYI A;  2YUP A;  3H6Z A;  3CCL A;  3G4S A;  1GCQ A;  1RAI B;  2RQT A;  1YIJ A;  3GNG A;  3KBG A;  3RER A;  2NYS A;  4M77 C;  2CKK A;  3OYY A;  2ZAE A;  3M0Q A;  3QG1 A;  1KG1 A;  3CMA A;  3QSU A;  4M75 B;  2QQA A;  4ELZ C;  4M7A E;  1D3B B;  2PVO B;  1PWT A;  1QVP A;  1M1F A;  3CBP A;  1YJ9 Q;  2EGC A;  2HQE A;  4M78 A;  3KFV A;  3CXC P;  1SPK A;  2DXT A;  2DXC A;  3J80 E;  5FRO A;  2QQB A;  2IPO B;  3OYM A;  1OOT A;  4C5I A;  3G71 T;  2MYS A;  3JB9 D;  3L2V A;  2XU8 A;  3M55 A;  3KXT A;  3OYA A;  1AOJ A;  1VIE A;  2HAX A;  5KYX A;  3OSV A;  3RKX A;  4J9I A;  1PD0 A;  2F2V A;  1WQ7 A;  1RLP C;  3OMC A;  1KD1 C;  3C95 A;  1T3S A;  1GCQ C;  1UDL A;  4JRI A;  4M78 D;  1NJI C;  3SDZ A;  1JRI A;  2YT6 A;  2D0Q B;  4B6M A;  4HCC A;  2HL3 A;  5L8R E;  3V8K A;  3I9Q A;  2RN8 A;  3QDR B;  2CUB A;  4FT2 A;  4JJC A;  1VQM Q;  3JCM V;  2LNH B;  2DL3 A;  2RJF A;  1QKX A;  3X25 B;  3VV0 A;  1WXB A;  3RKY A;  2XDD A;  1A0N B;  3M0S A;  4OMQ A;  2EYZ A;  4M78 C;  2KRS A;  5GMK i;  1VQO Q;  1B07 A;  4F17 A;  2MF2 A;  3PFS A;  3L2R A;  4J6W A;  3OW2 S;  4E7I A;  3L2U A;  4RCC A;  5A2Q E;  2K3B A;  4FYY B;  1MV0 B;  4RKU E;  4ZTF A;  2X4Y A;  2DER A;  1VQP Q;  2FPD A;  2MWP A;  1CSK A;  1N9S A;  3QYG B;  4C92 B;  4RCB A;  2YUN A;  3VS7 A;  1QWE A;  4XTZ A;  1M90 U;  1RUW A;  1R77 A;  2L3S A;  1K0S A;  3F70 A;  1ZA1 B;  1M1K R;  4EIK A;  1UJ0 A;  4ANJ A;  5KYW B;  1M9S A;  5LJ5 e;  5GAM j;  4N4H A;  2CDT A;  3FJP A;  2HQX A;  2OTL Q;  2YRD A;  1PSF A;  3OYD A;  3LX7 A;  1KQ2 A;  2E12 A;  3E9G A;  2F2X A;  4R56 A;  2WSE E;  1LJO A;  2XKO C;  1QVG A;  1VQL T;  1WZO A;  5GAO q;  5D6X A;  3EFO B;  2RHI A;  2QAS A;  3MHX A;  1K0X A;  2D8J A;  1V1C A;  3CC2 Q;  4OMO A;  3BW1 A;  3EGD A;  1NE8 A;  1H8K A;  3MPU B;  1PHT A;  2LCS A;  1FXX A;  1TTH B;  2O31 A;  2X35 A;  2C0I A;  3PT9 A;  4IIM A;  3G4S Q;  3CCL Q;  2F5K A;  2GNC A;  3VS1 A;  3DLL A;  2CP3 A;  1IO6 A;  2HKQ B;  2LQW A;  4B9X A;  2VVK A;  4DBH A;  3CC7 Q;  2EYY A;  3CMA Q;  2CT4 A;  2PQW A;  4FSS A;  2RH2 A;  4M7D F;  3MP8 A;  1XQH A;  2A3L A;  4CC2 A;  2E3I A;  1C1A A;  2CZ7 B;  2CSQ A;  2LP5 A;  3I56 T;  4HCZ A;  4ZN3 A;  5C6S A;  3LLR A;  4C8Q A;  2B8A A;  1M2V A;  3JCM P;  1M2O A;  4KGX B;  1UTI A;  2JM9 A;  3DLM A;  4XTV A;  2LT1 A;  1K9A A;  3AT1 B;  2OX7 A;  4F7U A;  3CPW P;  2VGN A;  3OS2 A;  1LPL A;  4ZNX A;  2DX1 A;  3ASK A;  2YLB A;  1TSF A;  1YCS B;  2CP5 A;  2J6O A;  1O75 A;  4GY5 A;  3JRZ A;  1R0C B;  3CCR T;  4C8Q D;  1OU9 A;  2AKK A;  3NMZ C;  2RA2 A;  4M75 F;  1KD1 R;  2DL8 A;  3M54 A;  2R5A A;  1VQK T;  5GAO p;  1NJI R;  2E4H A;  2RD1 A;  1Q82 R;  1IB8 A;  1AWO A;  4X9D A;  5DLQ E;  1YI2 A;  4NL2 A;  3MP1 A;  4C8Q C;  5GAO r;  4E7H A;  4M7D E;  1T3L A;  2LQN A;  1RAH B;  2JTE A;  3TCJ A;  4MZT A;  1Q7Y U;  1WHH A;  1ZBX A;  1UE9 A;  1I4K 1;  1AWW A;  3VUZ A;  5CO7 A;  3C12 A;  4OGE A;  1VQ7 A;  5GAN 6;  4XQ3 A;  2DL4 A;  2OJ2 A;  2NLU A;  3RIR A;  1OEB A;  3VYH B;  8AT1 B;  4M75 A;  3L2W A;  4BY6 C;  4PL6 A;  3I55 A;  3TSZ A;  2F2W A;  3QKJ A;  5J3B A;  1D3B A;  1QCN A;  2HMA A;  3HRS A;  3HFO A;  2XG8 D;  5ECA A;  4LNP A;  2Y4X A;  1XNI A;  3S3O A;  4C5E A;  1HK9 A;  2O4X A;  1K73 U;  4J9F A;  2LDM A;  1NYG A;  2XDP A;  2D9T A;  2JZ2 A;  1PD1 A;  2M9U A;  2KY9 A;  1N6A A;  4IUQ A;  3REA B;  1I07 A;  2EYQ A;  4Z02 A;  1IRE B;  4DOV A;  5DM7 R;  1VQ9 A;  4RTY A;  2V1R A;  4Y28 E;  2M1H A;  4C92 F;  1QP2 A;  3LGL A;  5CAI A;  1W2B S;  2LJ0 A;  1XJW B;  4AG1 C;  4JLG A;  4PFZ A;  2KYM A;  3G7Z A;  2V1Q A;  1QLY A;  4JJB A;  3H9N A;  1KQ1 A;  3M5A A;  3CCE T;  3DB3 A;  4KBM B;  1Q86 U;  5GAM h;  4J8O A;  1SF9 A;  4XU0 A;  4A4H A;  2CGH A;  5I21 A;  4J9C A;  2HL5 C;  2LNV A;  1X6B A;  2CP6 A;  2F1L A;  3MEW A;  1TUC A;  1S72 T;  5FWC A;  2YLC A;  3L1A A;  4DEX A;  1M1G A;  2EKO A;  2XI9 A;  2JT4 A;  1ZSZ B;  1Y71 A;  5GAN 4;  2J06 A;  3UWN A;  2X51 A;  5CKE A;  4DOW A;  2ECZ A;  1LNX A;  3A8H B;  1ZQ1 A;  3HKS A;  4MDX A;  3M57 A;  3CCS A;  1QW1 A;  2FRY A;  2OTJ A;  3EHQ A;  3OS5 A;  2LT4 A;  4BD3 A;  2FZK B;  1B34 A;  3EG0 A;  2AK5 A;  4F16 A;  1MV3 A;  1KQS S;  1AZG B;  2QDY B;  3GOX A;  1NYF A;  2E65 A;  3SWN A;  1BI2 A;  4LDV A;  4OB0 B;  5GAM e;  5LJ5 f;  4C92 E;  4RTU A;  1M90 C;  2A08 A;  1TXQ A;  3CCV A;  3EH2 A;  2DBK A;  3OA6 A;  1YJW A;  3C94 A;  2A28 A;  2RO0 A;  1Q95 G;  2ZGW A;  5LJ5 j;  3FC3 A;  3L2Z A;  4M77 G;  2QA4 A;  4KUI A;  3PE0 A;  1YBY A;  4PJO A;  1AEY A;  4XU2 A;  2EKH A;  2E1H A;  3QJ6 A;  4J9G A;  1NPR A;  5GJW B;  2GTJ A;  1VQ7 Q;  2DE0 X;  2EVR A;  1TU0 B;  2RQW A;  2SRC A;  3M9Q A;  2P0Q A;  2DIQ A;  3GPL A;  2FG0 A;  2DD5 A;  3CD6 Q;  2P4T A;  3UDC A;  4ZGE B;  1U8R A;  2HEQ A;  3SWN C;  4PJO D;  3CPF A;  3I55 Q;  1K4U S;  2H3E B;  3CCJ T;  3CME Q;  4JZ4 A;  1W1F A;  4FYW B;  4QVC A;  5IT9 E;  3URG A;  2ROT A;  1IGQ A;  3G71 A;  1CKA A;  1RAE B;  1WIE A;  3P8H A;  1RAD B;  1YJN A;  4C5H A;  4IKF A;  3BE3 A;  3THK A;  3MCA B;  3DKM A;  4YTL A;  5GAN h;  1VQN T;  2L3Q A;  3CC4 T;  2E10 A;  2KQW A;  2QAZ A;  2DIG A;  2P4R A;  3N5B B;  1ZLM A;  1VQM A;  5DLO A;  4PJO C;  1VQ8 Q;  2JN0 A;  1G8X A;  2RI2 A;  1AZE A;  3JB9 G;  2RJC A;  1VQ9 Q;  4OMM A;  4QQG A;  3FRN A;  4ZGD B;  3LYI A;  1NZ9 A;  3JV3 A;  1O9S A;  3LW5 E;  3NFC A;  1Y0M A;  2FL7 A;  4M78 G;  1K9M U;  3OS1 A;  1W2B A;  2BUD A;  1QVG P;  1MMD A;  1OX9 A;  1BI0 A;  1TUD A;  2JS2 A;  2XK0 A;  2QEX A;  4XTU A;  3H41 A;  5GAO m;  2KXD A;  4IUR A;  4AMC A;  1M1K C;  4E7S A;  2AZV A;  5GAN e;  2CP2 A;  3OYC A;  1VQ6 A;  4PJL A;  1TUG B;  4EPC A;  3UA6 A;  1X01 A;  5I11 A;  1XOV A;  4Z8A A;  2FRW A;  5D7U A;  3HPW A;  1WPY A;  4D8K A;  1BKB A;  1X2K A;  5GMK l;  1Q81 U;  2IVW A;  2VWF A;  3JB9 J;  4JRP A;  3JAM E;  2K2V A;  2D0N A;  2DEQ A;  3KUF A;  1Q7Y C;  1MMN A;  3CCS Q;  2O88 A;  2OTJ Q;  5HK0 A;  2GBQ A;  5IHN A;  4MDW A;  1VYT A;  4X1V A;  2PVD B;  2JNG A;  3RES A;  2HD0 A;  5EC7 A;  3RNJ A;  4AFS C;  4JJN K;  1UHC A;  4M7A A;  2ED1 A;  1JU5 C;  3QUI A;  4LDU A;  4EMH A;  4DBR A;  5KYU B;  2SEM A;  2RK2 A;  2KT1 A;  3CCQ A;  4IIO A;  3CCV Q;  1WA7 A;  1MMG A;  1YJW Q;  2X4W A;  1ZX6 A;  1M90 R;  3V7C A;  3CC7 A;  1K73 C;  1C6V X;  2H3J A;  3CQT A;  3C4S A;  2ZCF B;  4J9B A;  2QA4 Q;  1UFF A;  1IHV A;  4BE2 A;  4BAC A;  1PRM C;  2MCN A;  1MHN A;  4DBQ A;  5A0L A;  5CKD A;  2E3H A;  4M7A D;  2KYB A;  1V76 A;  3SHW A;  3REB B;  4IUT A;  5LJ3 h;  3QWY A;  2ROL A;  1X2Q A;  3CBO A;  4D8D A;  1BK2 A;  3TRE A;  3OYG A;  2KRM A;  2RB6 A;  1PKT A;  1YJ9 T;  1T0J A;  4FU6 A;  4JDS A;  5KYY B;  2H8H A;  1VOM A;  5A0D A;  4OML A;  2VV5 A;  3QDF A;  3X20 B;  2EJF A;  3A8G B;  2NUZ A;  2DVE A;  4M7A C;  1BYM A;  4N4G A;  3G71 Q;  2LJ1 A;  2FZG B;  1Q82 C;  4PLI A;  2VKN A;  4Y91 A;  3VS2 A;  1YJN Q;  1ABO A;  1Q86 C;  1X75 C;  2EQU A;  4BE0 A;  4L5G A;  3EG9 A;  5CKH A;  2GGR A;  5FWB A;  2GQV A;  3VU3 C;  2L89 A;  2XDB A;  2QXF A;  5LJ5 h;  1C0M A;  3JCM W;  5D6Y A;  1RAG B;  1GL5 A;  2EQK A;  2M0Y A;  5LJ3 e;  3V7S A;  2YUQ A;  1Z9Z A;  3L42 A;  2ZZD A;  3G1J A;  1N8R U;  1KK7 A;  4RMO A;  3FDR A;  4BI8 B;  1D0X A;  3TEE A;  4C8Q G;  2COY A;  2RM4 A;  2LCC A;  3TSW A;  3MEA A;  3SB2 A;  5C0M A;  2KE9 A;  2RHX A;  1LOJ A;  4J5Y A;  3P8B B;  5A0G A;  2HCK A;  1PKS A;  4F7U G;  5GAM f;  2QEX Q;  2K3X A;  1Y96 A;  1GRI A;  4OB3 B;  3RDV A;  2BZ8 A;  2WSC E;  4II1 A;  2LX9 A;  5AT1 B;  2BKD N;  2EQJ A;  3HRT A;  3UPU A;  4XTW A;  2HNI A;  1VQ6 Q;  2DK3 A;  4J9E A;  5LL6 S;  1K8A U;  3VYG A;  2MMP A;  3RMS A;  1OX8 A;  3LWI A;  4A4K A;  2OTL T;  2CSI A;  2DL7 A;  2K9G A;  4OGC A;  1G2B A;  5D6W A;  3EG3 A;  2EGA A;  1WGS A;  3OYJ A;  1Q7Y R;  5EG2 A;  2A0F B;  1OI1 A;  2HDA A;  2YSQ A;  2GFU A;  2VAS A;  4WTO B;  1AD5 A;  5CCA A;  1RL2 A;  1UGS B;  2RHU A;  3PIP A;  4LUD A;  2CZ1 B;  4J6Y A;  4F14 A;  3CCQ Q;  2KRN A;  2ZPB B;  3V8L A;  3H0H A;  2EGE A;  1FMK A;  1HJD A;  3UAT A;  3CCL T;  3G4S T;  4EMK A;  2HBW A;  1YIJ T;  3OYN A;  4J7F A;  2DTH A;  2XIC A;  4M75 G;  1X6G A;  2C06 A;  3MP6 A;  2NUP B;  3LWH A;  4CI0 C;  3CMA T;  1K73 R;  5FU6 B;  4AG2 C;  1UJY A;  1YN8 A;  1KHI A;  4ELY C;  4KT0 E;  2AKL A;  2QQS A;  4HT8 A;  1I0C A;  2EJG A;  1X6O A;  2KAF A;  4HVV A;  5GAO n;  2X4J A;  5GAN 5;  1VA7 A;  2L0A A;  4OMN A;  2KT8 A;  2DXU A;  1K9M C;  5CKB A;  5AYF A;  1SKU B;  1QCO A;  3OSS C;  2KR3 A;  2DF6 A;  3M58 A;  2PZ1 A;  3E2U A;  5IH2 A;  5IHK A;  2JMC A;  1OUL A;  4RUG A;  5GAN f;  1D1B A;  3OYE A;  1M27 C;  2D1X A;  1G83 A;  3VJP A;  2NUT B;  4EMK C;  2JM8 A;  4XU1 A;  2C0O A;  1GFD A;  4M7D A;  4JRK A;  2FPE A;  3PVL A;  2GFA A;  4GLM A;  3CCR Q;  4MMK A;  4C8Q E;  1QVF P;  4ZGJ B;  1Q86 R;  7AT1 B;  2B86 A;  2FVU A;  5GAN j;  2RI3 A;  2LMJ A;  1T0H A;  1VQK Q;  2GQI A;  4F7U E;  2DYB A;  5IAY A;  3ZL7 C;  3FJ5 A;  4OMP A;  1QCF A;  2EQI A;  4OB2 B;  3BY7 A;  3GNF B;  4QVZ A;  4RTZ A;  2DVJ A;  4M7D D;  2VXE A;  4BDZ A;  4QQD A;  2QYZ A;  4C0D C;  4J9D A;  4ME7 A;  4LD9 K;  3OW2 A;  1NM7 A;  4HCB A;  2YUO A;  3VS6 A;  1VUB A;  4M77 B;  3PGG A;  1ZHI A;  2KVQ G;  1BIA A;  5GAM g;  1UGQ B;  3JCM f;  3CD6 A;  2LJ3 A;  4PKC C;  2ATC B;  2KEA A;  2KXC A;  3CME A;  1QKW A;  2OAU A;  2KMT A;  1G3T A;  1SSF A;  2K79 A;  3EFR A;  4M7D C;  4WF2 A;  2CH4 W;  1R8O B;  2V8J A;  1TG0 A;  3CCM T;  5GAN 7;  4J6X A;  2QGG A;  1KFZ A;  2CP7 A;  1YNZ A;  1BB9 A;  3X28 B;  3OYL A;  3E9F A;  1YIT A;  1KHC A;  4GBQ A;  2CZ6 B;  1P92 A;  2J6F A;  3VS0 A;  4M75 D;  2J6K A;  2K2M A;  1VQ8 A;  2K57 A;  1H3H A;  1VQN A;  2CT3 A;  4IUV A;  1PG5 B;  2DEU A;  5FU7 C;  4LD6 A;  4JZ3 A;  4WCI A;  4RTT A;  4PJO G;  1U1S A;  1JXM A;  5IXB A;  3A98 A;  3NTH A;  4KH0 B;  1I5O B;  3FIF A;  2RQU A;  3QWX X;  3X24 B;  1VQ5 T;  2O01 E;  5J39 A;  1YHQ A;  3BFM A;  4VUB A;  4E7L A;  4M75 C;  1ZUY A;  1W4S A;  3CCU A;  3SD4 A;  1YP5 A;  3UA7 A;  3GBQ A;  2Y90 A;  1W6X A;  1M8M A;  3RKW A;  1Y57 A;  1JJ2 P;  4M78 B;  2M02 A;  4AT1 B;  3HL8 A;  4UC4 A;  4Y92 A;  2RNA A;  5LJ3 f;  1AHJ B;  4PLL A;  3CCE Q;  4X9C A;  2JXB A;  4AFZ C;  4CC4 B;  1KC8 U;  5CIU A;  1NJI U;  4FT4 A;  4K11 A;  1Y7X A;  1W70 A;  1U3O A;  3OYH A;  1VYU A;  4NL3 A;  2O2O A;  2GTO A;  5KYX B;  2DD4 A;  5LJ3 j;  4A4F A;  3A1P A;  4C92 A;  1WJS A;  2K3Y A;  1NLP C;  2DET A;  3QPH A;  1XTD A;  3T9N A;  4V2S A;  5GMK e;  4PJN A;  1U5S A;  1M8V A;  3V7R A;  4PJJ A;  2E6N A;  5KYW A;  1K9M R;  2X9H A;  3PMI A;  1M4Z A;  3EH1 A;  5GAN g;  1WDX A;  2NWM A;  1BI1 A;  5GMK m;  1MMA A;  2K5L A;  3M4Y A;  5CQY A;  3QZ5 B;  1VQ4 T;  3UT1 A;  4C92 D;  1K76 A;  2F5T X;  3EFO A;  1K8A C;  3PVQ A;  3EHR A;  1ZSG A;  4LN2 A;  2RJE A;  3ME9 A;  2KBT A; 
#chains in the Genus database with same CATH homology
 2PVD B;  2JNG A;  2R57 A;  3RES A;  1M9S A;  5LJ5 e;  5GAM j;  4N4H A;  5CQX A;  4C0F A;  2HD0 A;  4N0A C;  3FJP A;  2HQX A;  5GAM d;  4XTY A;  1PSF A;  4A54 A;  3PTA A;  1YI2 T;  3OYD A;  3S6W A;  3LX7 A;  1KQ2 A;  2E12 A;  3E9G A;  3H8Z A;  4P5N A;  1G3Y A;  4C92 G;  4JJN K;  2M0O A;  1QVF S;  4PNO A;  4R56 A;  2WSE E;  4M7A A;  1LJO A;  3M56 A;  3QUI A;  4LDU A;  1UGP B;  2GCX A;  2XKO C;  1G3S A;  4EMH A;  5KCH A;  2HBP A;  2RK2 A;  1QVG A;  1VQL T;  3CCQ A;  5GAO q;  4C92 C;  3A5Z B;  2JTM A;  5D6X A;  3CCJ A;  2RHI A;  5CVI A;  2QQ9 A;  3MHX A;  2X4W A;  4OMF B;  5FLX E;  4C0Z A;  4ATO A;  3V7C A;  3QJY A;  3CC7 A;  1K73 C;  2H3J A;  4MML A;  3C4S A;  3QHS A;  1VQ7 T;  2ZCF B;  3VUB A;  3BW1 A;  1VIF A;  2G3R A;  1NE8 A;  2CS7 A;  2WSF E;  3OMG A;  3CC4 A;  3JCM X;  4BAC A;  4BE2 A;  4FM4 B;  4EDU A;  1MHN A;  5A0L A;  2PUO B;  4M7A B;  5CKD A;  4M7A D;  1FXX A;  2X35 A;  3PT9 A;  3I55 T;  4M75 E;  2A7Y A;  4IUT A;  2F5K A;  4C0G A;  3DLL A;  5LJ3 h;  4OF1 A;  4M7A G;  3CBO A;  4OB1 B;  4FL6 A;  3TRE A;  3OYG A;  4QW2 A;  2RB6 A;  1YJ9 T;  4B9X A;  3QII A;  4FU6 A;  2R58 A;  4JDS A;  2EJ9 A;  5GMK h;  4Q5W A;  2ZPH B;  2PQW A;  3R6O A;  3TU4 K;  2RH2 A;  2YHT A;  4M7D F;  3V8J A;  4R55 A;  3MP8 A;  1XQH A;  2A3L A;  4E7K A;  5A0D A;  2CZ7 B;  2LQK A;  2VV5 A;  4GLK A;  1HXD A;  4LDX A;  3I56 T;  3X20 B;  3OS0 A;  2EJF A;  3A8G B;  4HCZ A;  2DVE A;  4M7A C;  1I8F A;  4M77 F;  1BYM A;  4N4G A;  3JB9 I;  1I81 A;  4ZN3 A;  5C6S A;  1Q82 C;  3LLR A;  4PLI A;  4C8Q A;  2FB7 A;  4Y91 A;  2B8A A;  4X34 A;  3JCM P;  1RI0 A;  2I2L A;  1Q86 C;  2LRQ A;  3OYB A;  1KD1 U;  1X75 C;  2EQU A;  3DLM A;  4XTV A;  3OYK A;  4BE0 A;  2LT1 A;  4L5G A;  3S3M A;  5CKH A;  4F7U A;  3G6E A;  1Q82 U;  3PNW C;  2VGN A;  5KE2 A;  2GQV A;  3OS2 A;  3VU3 C;  2L89 A;  2XDB A;  2QXF A;  3OBW A;  5LJ5 h;  1H64 1;  2F69 A;  3JCM W;  5D6Y A;  3BDU A;  3E19 A;  3ASK A;  2YLB A;  2KK4 A;  2E41 A;  2EQK A;  5KCO A;  1N8R C;  5GAN 2;  5LJ3 e;  3JCM J;  3MEU A;  3V7S A;  5FRM A;  4KUD K;  3JSC A;  4GY5 A;  1O75 A;  3LGF A;  2MAM A;  3JRZ A;  4C8Q B;  3L42 A;  4C8Q D;  3G6E T;  3CCR T;  2E70 A;  2ZZD A;  4JUV A;  4BE1 A;  3JCM h;  1N8R U;  2L8D A;  2RA2 A;  4M75 F;  3QYH B;  4RMO A;  3JB9 H;  3FDR A;  5DY9 A;  4BI8 B;  3M54 A;  4PJO F;  3TEE A;  2R5A A;  3DB4 A;  3ER0 A;  4C8Q G;  2EWN A;  2RM4 A;  4F7U B;  2LCC A;  5LJ3 g;  5GAO p;  1VQK T;  2DKG A;  1BI3 A;  3FLG A;  2RD1 A;  2DPP B;  3MEA A;  3SB2 A;  5C0M A;  2RHX A;  1LOJ A;  4J5Y A;  4X9D A;  3P8B B;  5A0G A;  4F7U G;  5GAM f;  5GAN d;  2EQM A;  4E47 A;  2K3X A;  2IG0 A;  1Y96 A;  2ZPF B;  5DLQ E;  3HP9 A;  1JJ2 S;  4BI4 A;  1YI2 A;  4EMG A;  2DO3 A;  2LVM A;  3ZFJ A;  4NL2 A;  4MZM A;  1N27 A;  2L5Q A;  2WSC E;  4II1 A;  4OB3 B;  3GIB A;  2LX9 A;  2BKD N;  3MP1 A;  4C8Q C;  2EQJ A;  2KSS A;  3HRT A;  3UPU A;  4BY6 B;  4E7H A;  5GAO r;  4M7D E;  4IUP A;  4XTW A;  2HNI A;  2JVV A;  3INZ A;  1VQL A;  2DK3 A;  3JB9 F;  2MI6 A;  3OQ5 A;  3TCJ A;  4MZT A;  5LL6 S;  5M9O A;  1Q7Y U;  2DJZ A;  1QVG S;  1K8A U;  1ZBX A;  3PIO A;  2OTJ T;  2DAQ A;  5CKF A;  1I4K 1;  2QQR A;  3VYG A;  2MMP A;  4M77 E;  1KQS A;  3RMS A;  3VUZ A;  1I5L A;  1N9R A;  3HHT B;  5CO7 A;  3LWI A;  1FWZ A;  3C12 A;  4A4K A;  1UGR B;  4OGE A;  1VQ7 A;  2OTL T;  4L6V 5;  1Y96 B;  5GAN 6;  4M78 F;  3CPW A;  5LJ5 g;  3QBY A;  4XTX A;  3JCM e;  4XQ3 A;  3S3N A;  3RIR A;  2NLU A;  5LJ5 d;  4OGC A;  3VYH B;  4M75 A;  3L2W A;  4BY6 C;  4JRQ A;  4PL6 A;  5D6W A;  3I55 A;  4CRI A;  4MZP A;  4HA8 A;  3CCV T;  3QKJ A;  1G5V A;  5J3B A;  1WGS A;  1D3B A;  3OYJ A;  4M7D B;  3HRS A;  3HFO A;  1EIF A;  2XG8 D;  5KE3 A;  2PU9 B;  2Y4X A;  1XNI A;  5EG2 A;  3JCM g;  1OI1 A;  3S3O A;  4C5E A;  1HK9 A;  2GFU A;  1YJ9 A;  2L3R A;  2O4X A;  3JCM Q;  1K73 U;  3CD6 T;  2DTI A;  5CR2 A;  5HKC A;  2LDM A;  5CCA A;  2VXF A;  3JCM d;  4DA4 A;  2FYK A;  2RI5 A;  1RL2 A;  1UGS B;  2RJD A;  2RHU A;  1YCY A;  2QA4 T;  3PIP A;  2XDP A;  2CZ1 B;  4J6Y A;  3AHU A;  1IZ6 A;  2D9T A;  2JZ2 A;  2RHY A;  3CME T;  2M9U A;  2KY9 A;  1N6A A;  4IUQ A;  2ZPB B;  3QXE B;  2DZC A;  3V8L A;  1QVF A;  1U1T A;  4PJO E;  3HFN A;  3I56 A;  4E7J A;  2EYQ A;  3GP8 A;  4Z02 A;  3G4S T;  3CCL T;  4DQ2 A;  4EMK A;  1IRE B;  1MGQ A;  3OYN A;  4J7F A;  2DTH A;  3HRU A;  1YIJ T;  3NTI A;  2LC4 A;  4DOV A;  4HT9 A;  2E64 A;  5DM7 R;  2XID A;  5CK9 A;  2XIC A;  1PSE A;  4M75 G;  2QI2 A;  1VQ9 A;  2FHD A;  3WVD B;  1YIT T;  2C06 A;  3MP6 A;  2PUK B;  2O4X B;  3LWH A;  4Y28 E;  5FRN A;  4CI0 C;  3CMA T;  4RG8 A;  2M1H A;  5FU6 B;  4C92 F;  1QP2 A;  3LGL A;  5CAI A;  1KHI A;  4ELY C;  1W2B S;  1VQ8 T;  3NTK A;  4KT0 E;  3M4G A;  2E6Z A;  2QQS A;  3ZBD A;  3O8V A;  1OZ2 A;  4HT8 A;  4NOY A;  4JLG A;  1VQ9 T;  1G3W A;  4XAX B;  4O5V A;  2EJG A;  1OZ3 A;  4EMK B;  2Y4Y A;  3A8L B;  3OB9 A;  3G7Z A;  4BI3 A;  4QVD A;  1X6O A;  2KAF A;  2K5I A;  2RK1 A;  5GAO n;  4KUL A;  2X4J A;  3A8M B;  1YJN T;  1KQ1 A;  3CCR A;  5GAN 5;  2M16 A;  3M5A A;  3CCE T;  3DB3 A;  4M78 E;  2LCL A;  3HSB A;  4KBM B;  1Q86 U;  3VKI A;  3OYF A;  5GAM h;  4N4I A;  2RHZ A;  2EFI A;  4XK8 E;  4HKE A;  1YHQ T;  4J8O A;  2DXU A;  4XU0 A;  1WNL A;  5CKB A;  2CGH A;  4A4H A;  1KC8 C;  5AYF A;  5FU6 C;  2AHJ B;  4FSX A;  5I21 A;  5HK3 A;  1VQK A;  3GLX A;  2LNV A;  4JS5 A;  1VQO A;  3OSS C;  3CXC S;  4B9W A;  2K5F A;  2DZ9 A;  1VQM T;  3M58 A;  3CCU T;  3MEW A;  5GAN f;  1S72 T;  4J7I A;  4A4E A;  3OYE A;  1M5Q 1;  2P0P A;  2YLC A;  3L1A A;  3J7A F;  3QZ9 B;  2EIF A;  1M1G A;  2EKO A;  3VJP A;  4EMK C;  2XI9 A;  4XU1 A;  4LDW A;  3LH0 A;  1Y71 A;  5GAN 4;  4JRK A;  1VQP A;  1VQO T;  3UWN A;  2GFA A;  4M7D A;  5GAN 8;  4RG2 A;  5CKE A;  4DOW A;  4C0D B;  4MMK A;  1Y07 A;  2XD0 A;  4C8Q E;  5LJ3 d;  1LNX A;  2VC8 A;  1ZQ1 A;  3A8H B;  3HKS A;  4ZGJ B;  5GAO l;  4M7A F;  3M57 A;  4MDX A;  2FVU A;  3CCS A;  5GAN j;  1NPP A;  1QW1 A;  1WQW A;  2RI3 A;  2OTJ A;  3OS5 A;  2LT4 A;  4BD3 A;  4M77 A;  1B34 A;  3A8O B;  5GMK j;  3BDL A;  4F7U E;  5IAY A;  1KQS S;  2QDY B;  2YRV A;  1VQP T;  4A4G A;  3PMT A;  2QEX T;  4JS4 A;  5I2S A;  3GOX A;  3J81 E;  3WVE B;  1QP3 A;  2OTL A;  2QTX A;  1BIB A;  2E65 A;  3SWN A;  1BI2 A;  4OB2 B;  2EAY A;  3CCS T;  3BY7 A;  3GNF B;  2X4X A;  4QVZ A;  3JCM c;  4LDV A;  2E5Q A;  4OB0 B;  5GAM e;  5LJ5 f;  2VXE A;  4C92 E;  4BDZ A;  2DTO A;  4QQD A;  1M90 C;  4M7D D;  3FB9 A;  2GF7 A;  4A53 A;  4O6J A;  1VQ6 T;  2VUB A;  4C0D C;  4ME7 A;  4LD9 K;  3CCV A;  3QO3 A;  3OW2 A;  4HCB A;  4LDY A;  3OA6 A;  3E1S A;  1YJW A;  4M7D G;  1VUB A;  1K9M C;  3C94 A;  5KH6 A;  4M77 B;  1B34 B;  2VGM A;  4M77 D;  1UEB A;  2P0K A;  2LTO A;  3PGG A;  3CC2 A;  1ZHI A;  3L2Q A;  1WJQ A;  1BIA A;  2KVQ G;  5GAM g;  2RO0 A;  2MWO A;  1UGQ B;  2K4Y A;  5GAN 3;  1TH7 A;  2ZGW A;  5LJ5 j;  3JCM f;  4TVR A;  3L2Z A;  3FC3 A;  3CCM A;  3CD6 A;  3OY9 A;  4PKC C;  3OBY A;  4M77 G;  5I2M A;  2ZPG B;  2QA4 A;  4KUI A;  1JJ2 A;  3SWN B;  1YBY A;  3RUX A;  4PJO A;  4BB7 A;  2ZPI B;  3JCM b;  1YJW T;  1FX7 A;  3CME A;  4XU2 A;  5FU7 B;  2OAU A;  2KMT A;  1G3T A;  1SSF A;  3EFR A;  4ZN1 A;  4OP0 A;  4ZTJ A;  4WF2 A;  3MO8 A;  4M7D C;  1R8O B;  3CC2 T;  2V8J A;  3H6Z A;  3OYI A;  3CCL A;  2E1H A;  3SFM A;  3G4S A;  3CCM T;  3M53 A;  3QJ6 A;  5GAN 7;  4J6X A;  1YIJ A;  1NPR A;  3GNG A;  3KBG A;  1VQN T;  3RER A;  3EFS A;  4M77 C;  3X28 B;  4C8Q F;  3OYL A;  2D6F A;  3E9F A;  1YIT A;  2CKK A;  3OYY A;  3M9Q A;  1KHC A;  2P0Q A;  2DIQ A;  3QG1 A;  1KG1 A;  3GPL A;  3CMA A;  3QSU A;  2VYT A;  1P92 A;  2CZ6 B;  2DD5 A;  2JTF A;  2P4T A;  4M75 B;  4M75 D;  1JBM A;  2QQA A;  3UDC A;  4F7U F;  2LQ8 A;  4ZGE B;  1U8R A;  1VQ8 A;  2V8I A;  2K57 A;  4ELZ C;  3SWN C;  3CCQ T;  4M7A E;  3CPF A;  3M59 A;  1VQN A;  2XHC A;  1VQ5 A;  4PJO D;  1D3B B;  2PVO B;  4IUV A;  3CCJ T;  5FU7 C;  4LD6 A;  1QVP A;  4C5G A;  4QVC A;  5IT9 E;  3URG A;  1M1F A;  3P8D A;  3EAE A;  4PJO G;  1OYX A;  3CBP A;  3G71 A;  5J26 A;  3CC7 T;  1U1S A;  2JUF A;  3P8H A;  2HQE A;  4M78 A;  1YJN A;  4C5H A;  2DXB A;  3GF5 A;  3NTH A;  2DXT A;  3CCE A;  4IKF A;  2DXC A;  3FIF A;  3MCA B;  3DKM A;  4YTL A;  3X24 B;  5GAN h;  3J80 E;  5FRO A;  2O01 E;  3CC4 T;  1VQ5 T;  2E10 A;  5J39 A;  2KQW A;  2QQB A;  3CEY A;  2R5M A;  1YHQ A;  3BFM A;  2DIG A;  4VUB A;  2ZPE B;  4E7L A;  3OYM A;  3N5B B;  4M75 C;  4C5I A;  3G71 T;  3JB9 D;  1W4S A;  3L2V A;  2XU8 A;  3M55 A;  1VQM A;  5DLO A;  3CCU A;  3KXT A;  4PJO C;  3SD4 A;  2JN0 A;  4FIB A;  3OYA A;  1S72 A;  1VIE A;  2HAX A;  3OSV A;  3RKX A;  2RI2 A;  3RMQ A;  2Y90 A;  3JB9 G;  2RJC A;  1WQ7 A;  3OMC A;  1KD1 C;  3C95 A;  3RKW A;  4M78 B;  4JRI A;  4M78 D;  1NJI C;  3HL8 A;  4QQG A;  4UC4 A;  3SDZ A;  3FRN A;  1JRI A;  1GXI E;  4ZGD B;  3LYI A;  5LJ3 f;  2D0Q B;  1NZ9 A;  1AHJ B;  1O9S A;  2WAC A;  3LW5 E;  3NFC A;  4PLL A;  4X9C A;  4HCC A;  1V29 B;  1WJR A;  5L8R E;  2FL7 A;  3V8K A;  4M78 G;  1KC8 U;  1K9M U;  4N0A A;  3OS1 A;  5CIU A;  5IN1 A;  3QDR B;  1NJI U;  1W2B A;  2BUD A;  2JOY A;  4FT2 A;  4FT4 A;  1Y7X A;  1H3Z A;  3OYH A;  1BI0 A;  4OVA A;  2XK0 A;  4NL3 A;  4D6W A;  3MET A;  2QEX A;  4XTU A;  2DD4 A;  5LJ3 j;  3JCM V;  5GAO m;  1DJ7 B;  3MEV A;  4IUR A;  1M1K C;  3WXM B;  2RJF A;  4A4F A;  2V8K A;  3X25 B;  3VV0 A;  3FEO A;  2CYZ B;  3RKY A;  1WJS A;  4L59 A;  4C92 A;  2XDD A;  2K3Y A;  5GAN e;  4M78 C;  3QPH A;  5GMK i;  1XTD A;  4QQ6 A;  3T9N A;  4V2S A;  3OYC A;  5GMK e;  1VQ6 A;  1M8V A;  1UB4 A;  1M1K U;  3V7R A;  2MF2 A;  3PFS A;  3Q1J A;  4EPC A;  1VQ4 A;  3L2R A;  4XU3 A;  2E6N A;  4J6W A;  3OW2 S;  1Q81 C;  1X01 A;  4E7I A;  3L2U A;  4RCC A;  5A2Q E;  3CXC A;  3PMI A;  1XOV A;  3CPW S;  1M4Z A;  5GAN g;  2BIV A;  4J83 A;  4PJO B;  4RKU E;  3HPW A;  1JB0 E;  4ZTF A;  1WPY A;  1BKB A;  1BI1 A;  2X4Y A;  5GMK m;  3X26 B;  2K5L A;  5GMK l;  2IVW A;  3JB9 J;  1Q81 U;  3M4Y A;  5CQY A;  3CBM A;  4IUU A;  3JAM E;  4JRP A;  2MWP A;  3QZ5 B;  2K2V A;  1VQ4 T;  3ZEH A;  2DEQ A;  1N9S A;  2CZ0 B;  3KUF A;  3QYG B;  3UT1 A;  4C92 D;  4C92 B;  4NS5 A;  4RCB A;  2F5T X;  4BUG A;  1Q7Y C;  1K8A C;  4BDY A;  5HY6 A;  4XTZ A;  5HK0 A;  1M90 U;  4JLI A;  4MDW A;  2RJE A;  2PVG B;  3ME9 A;  3F70 A;  2KDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...