3KUFA

The crystal structure of the tudor domains from fxr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
108
Chain Sequence
b'ELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPEISEGDEVEVYSRAEPCGWWLAKVRMMKGEFYVIEYATYNEIVTFERLRPVNQNKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation syndrome-related protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title Crystal structure of the Tudor domains from Fragile X mental retardation syndrome-related protein 1
rcsb
total genus 12
structure length 108
sequence length 119
ec nomenclature
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kufA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kufA01
1WGSA 4Q5WA 3DB3A 2DAQA 2L89A 3MP1A 4EDUA 5FRNA 4C5GA 3LX7A 3NTIA 4HCZA 5KE2A 3OYCA 4PLIA 1OI1A 3OY9A 2YRVA 2RI3A 3E9FA 3L2RA 4BE2A 5FRMA 2O4XB 5D6XA 4C5EA 2E6NA 2LCCA 4E7IA 2RHIA 3S3OA 3QIIA 2XDPA 2G3RA 3MEWA 2RHYA 4CRIA 5KCOA 4E7KA 4UC4A 4A4HA 2GF7A 3S6WA 5C6SA 3LGLA 2M0OA 3ZEHA 3PFSA 3O8VA 4BACA 1N27A 3MO8A 2EQUA 2R58A 4IKFA 2X4WA 2EKOA 3FLGA 3OYIA 2D9TA 2EFIA 5KE3A 4QQDA 4QVZA 5M9OA 3L42A 3LGFA 4B9WA 5IN1A 4A4FA 3LYIA 4II1A 4IURA 3S3MA 3FEOA 4L59A 2XK0A 4NS5A 2R57A 3MEVA 4GY5A 2P0KA 3H6ZA 4IUUA 4N4GA 3FC3A 3OYFA 3OYGA 2X4YA 1G5VA 4RG2A 3KUFA 4BDYA 4X34A 3PNWC 2RJEA 4PLLA 3H8ZA 2RI5A 3OYLA 3OYHA 3GOXA 2VYTA 5IAYA 1H3ZA 4IUTA 3C4SA 2RI2A 3L2QA 2NLUA 2K3XA 4BD3A 4B9XA 2R5AA 2LTOA 3P8DA 2RJFA 2DIQA 2R5MA 3FDRA 4Z02A 3S3NA 3L2VA 3MP8A 3PMIA 1XNIA 2M1HA 3OS0A 2B8AA 2RO0A 4C5IA 2BUDA 2IG0A 2L3RA 3ASKA 4IUVA 4LD6A 2JZ2A 4QW2A 5D6YA 4C5HA 4IUQA 3L2WA 2RHZA 2EQMA 2EQKA 1OZ3A 4E7LA 2RJDA 2BKDN 2LVMA 3P8HA 2FHDA 2GFUA 4E7HA 4A4GA 3OYNA 3Q1JA 2DIGA 5FROA 3M9QA 2QQRA 3OYEA 2X4XA 3UT1A 5KH6A 3OYAA 1OZ2A 3F70A 1WJSA 3QKJA 4FU6A 3OYKA 3QJ6A 3DLMA 3OMGA 5KCHA 3OYDA 3OYJA 1WJRA 3OYMA 3E9GA 4ZTFA 5C0MA 4N4IA 2LRQA 4PL6A 3SD4A 2X35A 3MEUA 3NTKA 4A4EA 2BIVA 2K3YA 2HQEA 3BDLA 2HQXA 5J26A 2QQSA 1SSFA 1RI0A 4QQGA 2GFAA 3NTHA 2E5QA 5J39A 3OA6A 3L2UA 3UWNA 3LLRA 3ME9A 5D6WA 2EQJA 2WACA 3MP6A 3OYBA 4ZTJA 3EAEA 3OS2A 1OYXA 2JTFA 4IUPA 2RHUA 4BDZA 2MWPA 4N4HA 3OB9A 2MWOA 3PMTA 1KHCA 4OVAA 4BE0A 3MEAA 4FL6A 3OQ5A 2RHXA 5CIUA 3LH0A 1WJQA 2L8DA 2LDMA 2M16A 2O4XA 3META 2CKKA 3DB4A 3QBYA 4QQ6A 3OS1A 4BE1A 4E7JA 2RJCA 3OMCA 2F5KA 3CEYA 2PQWA 1MHNA
chains in the Genus database with same CATH superfamily
3ZL7C 1PHTA 5FRNA 1VIFA 1Y96A 1BI2A 3OY9A 4PJLA 4JLGA 3HRUA 3QG1A 2OTLT 2A0FB 3CCQQ 2DVEA 4E7IA 4AFZC 3S3OA 1K4US 1R77A 3EH2A 2ZPHB 4OB0B 3SDZA 2PU9B 2F2XA 1UECA 3MEVA 5HKCA 5KYUB 3JAME 2EBPA 2FPEA 3P8BB 1BU1A 3QJYA 4FYXB 2ZPIB 3VS6A 2RI5A 1M9SA 3OYHA 2VYTA 3ULRB 3GOXA 4C92G 5GANg 2F1LA 1AHJB 1G3SA 3CCSA 1VQ8A 4DBRA 4M78D 4IUQA 4M78E 4XU0A 4CC2A 1YBYA 2DTOA 1KC8U 4KUIA 1X2KA 5A0GA 3OYKA 3DLMA 1RACB 4AG2C 4J7FA 1PKTA 2X35A 1PC0A 1SSFA 1TU0B 1SHGA 3RUXA 5LJ5f 1NE8A 3X20B 3HHTB 3OA6A 3L2UA 2HKQB 2DNUA 4OMNA 2DE0X 3OW2S 3EAEA 2W0ZA 3MPUB 2K5LA 1Z9ZA 1AEYA 2GGRA 2MOXA 4C92E 4LN2A 4BE0A 3MEAA 3I56T 1AD5A 3M0QA 5CIUA 1RLQC 1OQKA 4E7JA 2QGFB 4OGEA 1MHNA 2DAQA 3A1PA 1YHQA 3LX7A 1X6OA 4PJNA 1OI1A 3MHXA 4QT7A 3NFCA 2COZA 3ZFJA 5KYUA 4C5EA 1BK2A 1VQ5A 3C95A 9ATCB 3VS7A 4J6XA 5CO7A 2L5QA 2E6ZA 5GAOp 5GANh 2EQIA 2HD0A 2EQUA 4R56A 2OJ2A 3JCMV 2D9TA 2ZZDA 2ROTA 2FYKA 5I2MA 2K5IA 2M51A 2DF6A 4XK8E 2XK0A 2R57A 2ROLA 2JTMA 2V8IA 3BY7A 1IHWA 2KBTA 4WTOB 1UTIA 2RJEA 1RAFB 3H8ZA 4MDXA 4C0FA 4LD9K 4J5YA 2PUOB 5IAYA 3I55T 1YIJA 2KR3A 1K8AR 4JPBW 3CMAQ 1O75A 1RAHB 1TH7A 1K1ZA 3CCSQ 1Y07A 2L3RA 2FZCB 1Q82R 4PJMA 1Y7XA 4C0ZA 3CXCA 1JU5C 3X26B 5FROA 3M9QA 5LJ5e 3C94A 2PNIA 2WSCE 2JS0A 4ZGJB 5GAMh 1K8AU 1M3BA 3EH1A 4PNOA 3OYMA 2WSFE 4FYYB 2LRQA 2MMPA 3NTKA 1LJOA 3MCAB 2B86A 2EYYA 4VUBA 3HPWA 3U23A 3CCLQ 1I4K1 2P84A 1I5LA 2KEAA 3TCJA 1JJ2P 1O9SA 2QA4Q 2HAXA 4ELYC 1M8VA 1KK7A 1KHCA 2M02A 1U1SA 5GANe 3EGDB 5GAN7 4PJOE 2RJCA 3SB2A 1VYVA 3BFMA 1AVZC 1HYOA 5GAOl 1IGQA 3LW5E 4CC4B 4A53A 2A36A 1YI2A 2LC4A 2CYZB 4B6MA 3THKA 4PJOB 4E7KA 1OOTA 2JW4A 2DERA 2HBPA 1FMWA 4XU1A 3CCVA 2X4WA 2QEXA 1S72Q 1X27A 2QA4A 1M1GA 4FYVB 4ANJA 1UGSB 3VJPA 2E4HA 4M7AD 1XOVA 2AZSA 1Q7YU 3CCEA 2OAUA 1PG5B 2LNHB 3H41A 3I9QA 4M7AG 1D1AA 2ESWA 1K0XA 3G71T 3V8JA 2QQBA 1WQ7A 1W70A 1JEGA 1W1FA 1WYXA 4QW2A 3SWNB 5D6YA 2JZ2A 2I2LA 2RMOA 3VYHB 1K9MC 2KXCA 1I0CA 2QQRA 2EGAA 4JDSA 3CCRA 5CKHA 3HFOA 2FG0A 2KXDA 3QJ6A 4M77D 1OV3A 1YJWT 4EPCA 4OMPA 2DA9A 4N4IA 2O01E 2KT1A 2CZ1B 3G4ST 4M7DB 2BZ8A 4RTXA 3BDLA 1PD1A 2HQXA 1EZZB 2V1QA 3HL8A 4V2SA 2QASA 2CP2A 4IUPA 3CCJQ 1ABOA 3HRTA 4N4HA 3CBOA 1YJWA 4JZ3A 3X24B 1GCPA 2BZXA 4DBFA 3CC7A 4YTLA 2ED1A 1VQPA 2KRSA 4HCZA 2EAYA 4M7AA 3L2RA 4BE2A 2EYWA 2MCNA 1UB4A 2CZ6B 3PVQA 2CUDA 1Q86R 1K9AA 4HCCA 2M0OA 2EJ9A 3CC4A 4Y28E 2AT1B 5FU6B 1M27C 1MV0B 2CP7A 1WDXA 2DTHA 3CXCP 4IURA 1VQOQ 1C6VX 3FEOA 1M30A 2JMCA 4C92D 3REBB 2HQHA 4LE9A 1QCOA 1G5VA 3V8LA 4BY6C 2DXCA 3OYLA 2VC8A 3CXCS 2QEXQ 1RL2A 4J9GA 4LDWA 1S72A 3ZBDA 4FT4A 1BI0A 2RNAA 1RAEB 6AT1B 2DXBA 3CMAT 4RCBA 1VQ4Q 2B8AA 1ZSZC 1AWOA 1JJ2A 4GLKA 3LWHA 1UGPB 3X25B 3CCVT 2OTLA 1NPRA 1OZ2A 3RMSA 4F7UE 3OYAA 1VQ8Q 2M9UA 2HKNA 3OYJA 4QVCA 1QP2A 1NEGA 3VS1A 2CP3A 4LDYA 2HDAA 2LCLA 2BIVA 4RTTA 5GAMf 4ZGEB 5DM7R 4BY6B 1A0NB 3JRZA 5GAOq 2XD0A 2CP5A 2DVJA 1UE9A 2RHUA 3HP9A 3OSVA 2DD5A 1E7OA 2L8DA 2HMAA 2NUTB 4NL2A 1AWXA 1M90C 3M0TA 1WGSA 1VQ7A 4R0KA 3LH5A 4DOVA 4J83A 2YRVA 1SEMA 4C92C 1YNZA 2OI3A 2BZYA 1X69A 4OGCA 1V1CA 2CSIA 1U5SA 4EMKB 2R58A 1X75C 3FJPA 1AZEA 1UHCA 3J80E 2E3HA 1QWEA 3LYIA 4NL3A 5CKEA 4JJCA 2QGGA 3JCMX 4JRPA 1SF9A 3FB9A 2QI2A 4KH0B 2SRCA 4MMLA 3OBYA 1PNJA 1M3CA 4M77B 2RK2A 2LTOA 4EIKA 1Q86C 1XNIA 3M0UA 4M4ZA 1ZHIA 2MAMA 1FMVA 3CD6A 3CCEQ 4DBQA 4J6YA 3L2WA 2JJ9A 4DBHA 4C0DB 2QTXA 2MF2A 1P92A 1U06A 2ZPEB 2KY9A 4M78G 3QKJA 1VIEA 2RQUA 4CC7A 3J81E 3G71Q 1UGVA 3E9GA 5C0MA 1PCXA 3CD6T 2RQRA 5LL6S 4L6V5 1M1KC 5GMKh 3GNGA 3HKSA 1WIEA 2QQSA 1E6HA 2AK5A 2KRNA 1YJ9A 2QXFA 3CCLA 4KGVB 3INZA 3EG0A 2MK5A 2GBQA 1NJIR 1KQ1A 4BI4A 4D8KA 3M54A 1H641 1HJDA 2FEIA 3QYGB 1D3BB 4M78A 2LQKA 2LX7A 1ZSGA 3VS5A 2M16A 3META 2DX1A 4QQ6A 3HSBA 1NLPC 2L89A 4HT8A 5FWCA 2JT4A 1IZ6A 1N9SA 2MI6A 2GQVA 4D8DA 5CK9A 2NWMA 2LCCA 1VQKT 3L1AA 5GJVB 5GAOn 1QVFA 2DL3A 1SPKA 5CR2A 1I8FA 5KE3A 2EIFA 1QLYA 1RADB 3EGXB 1PRLC 2K57A 5AYFA 3JCMe 1MMGA 4LDXA 1VQKA 3M4GA 2OTJQ 3M55A 4J9HA 3N5BB 2JN0A 2ZPBB 1ZBXA 3OS5A 3VRYA 2HEQA 1M4ZA 2RD1A 4ZN3A 2DL5A 1T3LA 1VYTA 2BE7D 2YRDA 2BUDA 4F7UA 4IUVA 4C5HA 4A4KA 3UA6A 1ZBJA 2EGCA 5GAMe 2AIRB 2GNCA 3JB9D 2YLCA 3CCRQ 1NM7A 1ZSZA 2D0NA 5GMKi 1VQOT 5KCHA 4J9EA 2DLPA 4M7AC 4ELZC 2DZ9A 2ZAEA 2AKLA 2A37A 2VVKA 3JCMP 2MYSA 3G7ZA 1QVGA 3JCMJ 5GMKm 2QQ9A 1GBRA 1N8RU 1AT1B 1YHQT 4PJJA 4HVWA 2QA4T 4M7DD 2JTFA 2EPDA 2HBWA 2LDMA 2FRWA 3EG9A 2KYBA 4JRIA 3FIFA 1WX6A 2DL4A 3M57A 2K9GA 1K73C 3M0PA 3JCMc 2RI3A 3URGA 1U3OA 1VQ4T 5IT9E 2HCKA 3CCQT 3FJ5A 3QIIA 2G3RA 1QW1A 5KYYA 3CCUT 1TS9A 1EX4A 2YUPA 1KQSA 1N27A 3EFRA 3QYHB 4M75C 2CDTA 1GCQC 1UGRB 1JXOA 3L42A 2XDBA 4J6WA 4PJOA 5CQYA 2YUNA 4WF2A 1YITT 1UUEA 1ZX6A 1Q82C 4E6RA 4KRTA 1YWPA 2J6KA 2EGEA 2QK0A 3QPHA 1T0JA 5IXFA 1NYFA 1VYUA 1E6GA 2JS2A 5D7UA 4XU3A 3L2VA 2RO0A 3RR6A 4N0AA 2JM9A 1QWFA 1KIKA 3P8HA 1WQWA 4FW2A 3JB9I 1Y0MA 1M3AA 3A8GB 1Y96B 3GPLA 3VYGA 4FM4B 2XG8D 3OMGA 3OYDA 2KVQG 3A8LB 4PFPA 1TUCA 4XTUA 1DJ7B 3RIRA 2K3BA 4A4EA 4K11A 1PWTA 3OYYA 2FL7A 2VUBA 2VB6A 1BIAA 2GQIA 1RI0A 4QQGA 2VKNA 2GFAA 1VA7A 2E5QA 5IHIA 3UWNA 5IHNA 1W6XA 4F16A 2A08A 1CKAA 3A98A 4Y91A 5A0DA 1N9RA 4AMCA 4BUGA 1D3BA 2RQWA 3RNJA 4BE1A 4M75G 5LJ5d 2DEQA 1K76A 2KSSA 3O8VA 2L3PA 5EC7A 1FXXA 1YJNA 5KE2A 2QEXT 1M2OA 1QMCA 4PKCC 4M7DA 2O88A 4IIOA 3AT1B 3CC2A 2FRYA 1Q81R 2P0PA 2YUQA 3CMEA 5KCOA 1IO6A 3S6WA 2F5TX 5GAMj 1D1CA 3MO8A 1VQNA 1YJNT 1UEBA 3FLGA 5M9OA 3CC2T 2YRCA 1LCKA 2HZYA 1AZGB 4O6JA 2E5KA 1OU9A 1TG0A 1OPLA 3V8KA 3DKMA 2DFUA 4XTXA 4M7AE 4FW1A 1TOVA 5LJ3d 3TREA 2OX7A 2YSQA 2QDYB 3C4SA 4AT1B 2X4JA 1WZOA 3JCMQ 2YDLA 2R5AA 4F7UB 1OU8A 1KG1A 1VQLQ 2EQKA 2GCXA 2YT6A 2J06A 4E7LA 3CCVQ 4E7HA 4A4GA 2KMTA 2ECZA 2H3EB 2DD4A 3M4YA 3TQ7P 2PUKB 5GANj 4DA4A 4QVDA 1YI2Q 1IB8A 2KRMA 4OP0A 1VQKQ 2FO0A 1JQQA 3QDFA 4M75E 2DBKA 3HTRA 2BTTA 2HSPA 3ME9A 2CT3A 4FYWB 1BIBA 5FWBA 1ACMB 5KYYB 5I11A 2QYZA 5I21A 1VQMA 1KQSP 1WPYA 2DXUA 1WJQA 2O4XA 1ZA2B 4AG1C 4JRKA 3O5ZA 4MDWA 2PQWA 1QVPA 4Q5WA 4OMOA 3CCMA 3PT9A 5LJ3f 4XTZA 4C5GA 1XTDA 1YHQQ 3NPFA 1WXTA 3SEMA 3E9FA 3QUIA 3BW1A 1H92A 1K8AC 1Y57A 1D1BA 3EFOA 3MEWA 2CSQA 4DEYA 3PFSA 1VQ9Q 4RTYA 4BACA 1QCNA 4JJDA 2LQNA 2C0TA 1W4SA 3EG3A 2Y4XA 2XU8A 1MUZA 1MNDA 4B9WA 5GAN8 3JB9H 4GBQA 2DRMA 2ZGWA 3EG2A 2QG9B 1ABQA 3M0SA 3CMAA 4X9DA 3I56Q 2WSEE 5GAN5 1YJ9T 4QKUA 1V29B 2DBMA 4LUEA 4BDYA 2K6DA 2RM4A 2K2VA 2RI2A 2DO3A 3GF5A 3VS0A 3VKIA 2L2PA 3OS0A 4M78C 4LD6A 3M59A 3VU3C 1FWZA 2CZ7B 2RHZA 2NUTA 2LJ3A 1F1BB 1OPKA 2FHDA 3CBMA 2E64A 1YJNQ 4XAXB 1U1TA 2ZPFB 4Z88A 3CPWA 1KFZA 1ZQ1A 4LUDA 1WJRA 4EMKA 3I56A 4M77A 5GAN6 3QWXX 1Q7YR 4M78F 2D0QB 5KYWB 3VS2A 2EQJA 4J9CA 5GMKl 2MWPA 1NEBA 2MWOA 3ER0A 1VOMA 4M7DE 4FSXA 1QCFA 2NUPA 5CKBA 3MP1A 2DJZA 1C1AA 1IGUA 2VASA 3NTIA 2NUZA 3JCMh 2O9SA 1RI9A 5CVIA 3CCJT 2KYMA 4KUDK 1X6BA 3EG1A 4ESRA 3OSSC 1K73U 4HT9A 3TSZA 1OX8A 4ZNXA 3ZEHA 1C0MA 2P4RA 1I81A 2L3QA 4TVRA 2EKOA 3I55A 1Q81U 1AOJA 2F2VA 3LGFA 5IN1A 4A4FA 2JM8A 3T9NA 5IXBA 1Q95G 5LJ3e 5KYXB 4P5NA 4N4GA 2RQVA 2M0YA 3OYFA 1KQSS 2XI9A 5IH2A 3X28B 3PNWC 3G6ET 5GMKj 5I22A 1G3YA 2K79A 3G6EQ 4BD3A 4AFSC 2D8HA 4MMKA 3PE0A 2K4YA 5DY9A 4C5IA 2IG0A 5A0LA 4R55A 3LWIA 2PVDB 2EVRA 3CCLT 3TU4K 3C0CA 1LPLA 4IIMA 1OX9A 4PJOD 4FT2A 2HL5C 5J3BA 2SEMA 5KH6A 4OB1B 1HSQA 1VQ4A 1WHGA 3CCQA 1BBZA 2HSEB 3CMEQ 4ZN1A 2BE9B 4M77C 3CCUA 3CCUQ 3CC4T 1JB0E 4XTYA 5FU7C 1WHMA 1V76A 4MZTA 1I07A 1MMDA 2J6OA 5D6WA 3H0FA 4WCIA 1K0SA 4BDZA 2XICA 5LJ5g 2Y4YA 3CCST 3OQ5A 3PIOA 4OF1A 1VQ6Q 2KT8A 5GAN3 4C8QC 2DYBA 1H8KA 1WXUA 1S72T 1FX7A 4EDUA 5FLXE 1JXMA 7AT1B 8ATCB 4C8QF 2DETA 5DLQE 1I5OB 1EIFA 2O4XB 2RB6A 5LJ3h 5LJ5h 1QKXA 2RHYA 3CQTA 4EMGA 5CKFA 3LGLA 1YN8A 4C8QB 4X1VA 1VQPQ 1KSWA 4DQ2A 5GAN2 4J9DA 2J7IA 2CZ0B 1YP5A 2DL8A 1YITQ 1YI2T 2DKGA 4NS5A 2DXTA 3JB9G 1QVGS 1IHVA 2RN8A 1AWWA 3OYGA 3CPWP 1HD3A 4J9BA 5FU7B 4RG2A 2J05A 1VQ7Q 2JOYA 1CSKA 1UHFA 4PK4A 4C8QD 2RPNA 4HVUA 2D6FA 2D1XA 5GANf 1YCSB 3EGUA 5FW9A 2ABLA 4C8QG 3CCET 1R0BG 1YJ9Q 4M77E 4J9IA 3SWNA 2BKDN 1VQNQ 4LNPA 3UDCA 1UJYA 3VS3A 5GAOr 1W2BS 2HNIA 1IREB 3F70A 1WJSA 3G71A 2I0NA 4KGXB 4ZTFA 2X3WD 2EKHA 2K3YA 2NYSA 4JZ4A 1M2VB 1ZUUA 2LX9A 2DYIA 2X9HA 1KHIA 4M75D 4HCBA 2DZCA 3OYBA 3G6EA 1XJWB 1FYNA 4PFOA 2VV5A 3EFOB 1NZ9A 2VXFA 2DL7A 1YWOA 2LT4A 4C8QA 1WHKA 2E1HA 4ZGDB 4RTVA 3DB3A 2DK3A 2P0QA 4F14A 2XHCA 4J8OA 2KROA 4F7UG 3FRNA 2V8JA 2FVUA 4M75F 2F69A 5AT1B 4M7DF 2KK4A 4AFQC 4XQ3A 3A8MB 1N6AA 3JCMf 3G4SQ 1VQ5Q 1TTHB 1D09B 4UC4A 3CC7T 1D0YA 5KYXA 2KAFA 2AKKA 4GLMA 3R6NA 1SHFA 3I55Q 3PVLA 4JJBA 4QQDA 3OBWA 3UF4A 2FB7A 4II1A 1PKSA 2A28A 2G6FX 4OMMA 1TUGB 1UG1A 3JCMb 4XU2A 4AFUC 2PVOB 2IPOB 4N0AC 2JNGA 1M1KU 2VGMA 4M7DC 5CCAA 1H3HA 1T0HA 1RUWA 3WVEB 1D0XA 4EMHA 1YCYA 3FDRA 4F04B 3TVTA 2MIOA 1QVFP 3M58A 3CBPA 2OTJA 1ZLMA 1PM3A 4F17A 1I1JA 2EQMA 3CCMT 1R8OB 4KGZB 2LQ8A 4ATOA 2F2WA 3QZ5B 3SWNC 2LQWA 2DIGA 5ECAA 4ORZA 4M78B 1NPPA 1WLPB 1Q86U 3UT1A 4BB7A 5LJ3j 2FZGB 3JCMd 1G3WA 3I5RA 5L8RE 2KI7A 3E2UA 3SD4A 5KYWA 1N8RC 3RMQA 1D0ZA 1Z9QA 2HQEA 1U8RA 1YFNA 2X51A 1G2BA 3PGGA 3R6OA 4FCYA 1VQ9T 3NTHA 2E65A 1ZUKA 1VQ7T 3SFMA 1IRXA 3L2ZA 1KD1C 1OEBA 1B34B 1Q81C 2RHXA 4RG8A 4LDVA 3GLXA 2A3LA 3OMCA 3V7SA 1VQ9A 2RQTA 3WXMB 2KDSA 1VQNT 2IIMA 3PTAA 1FMKA 1JO8A 4M75A 1QVGP 1SRMA 3RKWA 2GTOA 2XIDA 2RHIA 3M53A 1B7TA 1G8XA 1PD0A 4PFZA 4A4HA 3GIBA 4XTVA 8AT1B 3HRSA 3CC4Q 1IXDA 4E2FB 1M90U 3NHNA 4IKFA 3QO3A 3WVDB 1VQOA 4GY5A 1WA7A 3VUZA 2W10A 1LNXA 1QQJA 2K5FA 3EGXA 4RTUA 3QWYA 4RUGA 3REAB 1B34A 1VQPT 4FSSA 3JB9J 4OMLA 2NLUA 5LJ3g 2FPFA 2RK1A 5GAN4 1TXQA 4MZMA 4Z02A 2LNVA 3PMIA 2J6FA 3V7RA 3CD6Q 4HCKA 5LJ5j 2DM1A 1WHHA 1RLPC 2DTIA 2V1RA 1N5ZA 3JCMg 4C92A 3CC7Q 1UDLA 2RJDA 1GRIA 4OMFB 3HFNA 4FIBA 1WFWA 3RKYA 5HY6A 3CCJA 3EHRA 2FPDA 4X9CA 1VQMT 2YHTA 1PSEA 3C12A 4PL6A 3MEUA 2LMJA 4M77F 5CKDA 2C0IA 1RABB 2JTEA 5J39A 3JCMW 1WXBA 2E12A 4O5VA 1RAGB 3A8OB 2H8HA 1X43A 2ZPGB 3OS2A 5A2QE 5GAMg 2K7AA 2E41A 1NLOC 1GXIE 3SHWA 4FL6A 1KD1R 1X6GA 3DB4A 2CP6A 4RCCA 2YWWA 2L3SA 3VRZA 3AHUA 3RERA 1MMNA 2Z0WA 4JRQA 1YIJT 2NUPB 2FZKB 1NYGA 1N8RR 2EW3A 4C92B 4NOYA 5FRMA 1LVKA 1GCQA 2E6NA 3PIPA 5GJWB 2ENMA 4CRIA 5KYNA 1PSFA 2E70A 2K2MA 1XQHA 4JJNK 1T3SA 3QZ9B 2ED0A 1KC8R 4M77G 2V26A 4HXJA 4QVZA 3E1SA 2CH4W 2ZCFB 1KJWA 1B3QA 3S3MA 1AWJA 2P0KA 3I5SA 1VUBA 1NJIU 2EYXA 1SRLA 1QVFS 2JMAA 2O9VA 5CQXA 2CUBA 1K9MR 1H3ZA 3MKDA 4Z8AA 3EFSA 4B9XA 4HKEA 2OTLQ 5IHKA 3ASKA 1VQ5T 1M1KR 2RH2A 4Z89A 1OZ3A 2LVMA 2GFUA 4LDUA 3TSWA 4JLIA 3Q1JA 1ZSZB 2EWNA 1B07A 3OYEA 4PJOF 3KXTA 3V7CA 2DILA 2XKOC 3MJXA 3CMET 1GFCA 2QTVA 3OW2P 1UFFA 2KGTA 3CCMQ 2AZVA 2KNBB 2JUFA 1ZUYA 4ZTJA 3UATA 3MP6A 5CAIA 2JXBA 3CCRT 3RESA 5L23A 1ZA1B 1TUDA 3H0IA 4OVAA 2A7YA 3G4SA 2RA2A 3I35A 1J3TA 4M75B 3QBYA 5FU6C 2CKKA 1VQ6T 5HK0A 3BE3A 4X34A 1X01A 4OB2B 3BDUA 4KH1B 4D6WA 3OYCA 4J9FA 3VV0A 4J7IA 4PLIA 2E10A 1HK9A 2PZ1A 1YITA 2DPPB 2XDPA 3D7SB 3GNFB 4PJOG 3UPUA 2VXEA 2GF7A 1RAIB 2CREA 1BCOA 1JRIA 5C6SA 2C06A 1NJIC 1TSFA 5GAOm 4HVVA 3H9NA 1W2BP 1MNEA 3OYIA 2EFIA 2EYQA 3QSUA 4BI3A 3VS4A 2MPXC 3H6ZA 4IUUA 1M90R 2EJFA 4M7AF 5HCKA 4A63B 4MZPA 3RDVA 1BYMA 1GFDA 1G3TA 2CS7A 3KUFA 2EJGA 2OAWA 2LT1A 2CT4A 1SSHA 4IUTA 3JB9F 3L2QA 2YUOA 4M7AB 2R5MA 4Y92A 3NGPA 1GBQA 2QAZA 2V8KA 1KC8C 2P4TA 3H0HA 2KQWA 1M5Q1 2LJ1A 2XDDA 2GTJA 4KT0E 1NBEB 4A54A 1SG5A 3OYNA 2COYA 1R0CB 4C0GA 4FU6A 1MMAA 4ME7A 1VQMQ 1S1NA 1RAAB 2D8JA 4CI0C 2ATCB 2AHJB 3UA7A 1Q82U 2CGHA 3M0RA 5GANd 1BKBA 2DJQA 1KQ2A 2L0AA 2WACA 1LOJA 1OULA 3A5ZB 4BI8B 1QKWA 4OB3B 5HK3A 3EGDA 3CC2Q 2PVGB 3PMTA 1K73R 3M56A 4JUVA 1VQLT 1BI3A 1YJWQ 3LH0A 1K9MU 3TEEA 3OS1A 1ARKA 2O31A 4DOWA 1WHJA 4CC3A 2EYZA 5DLOA 2CP0A 4PJOC 4KULA 3QXEB 3KBGA 4E7SA 2COWA 2E3IA 5I2SA 4JS5A 2LCSA 1VQ8T 1SKUB 3GBQA 5D6XA 1HXDA 1VQLA 2OTJT 3EHQA 2DRKA 4F7UF 1Q7YC 4M7DG 3EG9B 2HL3A 2LJ0A 2IVWA 1TWBA 1G83A 1JBMA 1M2VA 4C8QE 1GL5A 3JSCA 4L59A 3DLLA 1CKBA 5GMKe 2QQAA 3M5AA 3RKXA 4E7ZA 2RF0A 4KBMB 2LZ6B 1WI7A 3FC3A 1X2QA 1Y71A 2X4YA 3GP8A 5GAMd 1VQ6A 4RKUE 4HA8A 4PLLA 1BB9A 1UJ0A 2XMFA 3QDRB 3IQLA 1YIJQ 1MV3A 1BCMA 2PTKA 2K3XA 3OW2A 2Y90A 2LP5A 3P8DA 2RJFA 1NG2A 2O2OA 3S3NA 3MP8A 2M1HA 2DMOA 1M8MA 1BI1A 2KE9A 2VWFA 2VGNA 1WNLA 2X3XD 4C0DC 4JS4A 4E47A 1PRMC 3NMZC 2CH4A 2DEUA 4XTWA 3RBBB 3CPWS 2X4XA 4L5GA 4RTWA 3CPFA 4RMOA 1UGQB 1QP3A 1KD1U 4OMQA 4DEXA 3KFVA 3QHSA 2JVVA 3A8HB 1JJ2S 3E19A 1M1FA 3J7AF 5J26A 2YXYA 4LXCA 2C0OA 2QDLA 1WHLA 3JV3A 1MGQA 2YLBA 3LLRA 2H3JA 1OYXA 3VUBA 4RTZA 3OB9A 5EG2A 1W2BA 3G1JA 1EFNA 4C92F 4EMKC 2F5KA 3CEYA 2DIQA
chains in the Genus database with same CATH topology
1QVPA 1WGSA 4Q5WA 3PT9A 3WXMB 1VQ7A 2KDSA 1VQNT 5LJ3f 4XTZA 5FRNA 4C5GA 1VIFA 1Y96A 1XTDA 4DOVA 4J83A 1BI2A 3OY9A 2YRVA 3PTAA 4JLGA 3E9FA 3QUIA 3HRUA 3QG1A 3BW1A 2OTLT 1K8AC 4M75A 4C92C 2DVEA 3RKWA 2XIDA 4E7IA 2RHIA 3M53A 3S3OA 4PJOC 3MEWA 4OGCA 2ZPHB 4A4HA 3GIBA 4XTVA 3HRSA 3PFSA 1M90U 4BACA 4OB0B 4EMKB 1KC8C 2R58A 4IKFA 1X75C 3FJPA 3QO3A 3SDZA 3J80E 1W4SA 2Y4XA 2XU8A 3WVDB 2PU9B 5GAN8 4B9WA 1VQOA 3JB9H 3LYIA 4NL3A 5CKEA 2ZGWA 3MEVA 5HKCA 4GY5A 3VUZA 3JAME 3CMAA 4X9DA 1LNXA 3JCMX 4JRPA 2K5FA 2WSEE 3P8BB 5GAN5 1YJ9T 3FB9A 2QI2A 1V29B 3QJYA 4BDYA 1B34A 4MMLA 3OBYA 2ZPIB 2RI5A 1M9SA 4M77B 2VYTA 3OYHA 3GOXA 2RK2A 2RM4A 1VQPT 4C92G 2K2VA 2RI2A 5GANg 3JB9J 2NLUA 1AHJB 5LJ3g 2DO3A 2RK1A 2LTOA 5GAN4 1G3SA 3GF5A 4MZMA 4Z02A 3VKIA 3CCSA 2LNVA 1VQ8A 3PMIA 1Q86C 1XNIA 3OS0A 3V7RA 4M78C 4M78D 1ZHIA 2MAMA 5LJ5j 3CD6A 4LD6A 3M59A 2DTIA 3VU3C 4J6YA 4IUQA 1FWZA 2CZ7B 2RHZA 3L2WA 4M78E 3JCMg 4XU0A 4C92A 2RJDA 4C0DB 2QTXA 2FHDA 1P92A 1YBYA 2DTOA 2MF2A 2E64A 2ZPEB 3CBMA 3HFNA 4KUIA 1KC8U 4XAXB 2KY9A 4FIBA 4M78G 5A0GA 1U1TA 2ZPFB 5HY6A 3RKYA 3QKJA 3CCJA 3CPWA 1VIEA 3OYKA 3J81E 1ZQ1A 3DLMA 1WJRA 4X9CA 3E9GA 4EMKA 1VQMT 2YHTA 1PSEA 3C12A 5C0MA 3I56A 4M77A 4J7FA 4MDWA 4PL6A 2X35A 3MEUA 5GAN6 3CD6T 5LL6S 4L6V5 4M77F 1M1KC 5GMKh 3GNGA 3HKSA 5CKDA 2QQSA 4M78F 1SSFA 3RUXA 2D0QB 5LJ5f 1YJ9A 2QXFA 1NE8A 3CCLA 3INZA 3X20B 3HHTB 5J39A 3OA6A 3L2UA 3JCMW 1KQ1A 2E12A 2EQJA 4O5VA 4BI4A 3A8OB 3OW2S 3EAEA 2ZPGB 3OS2A 3M54A 1H641 5GAMg 5A2QE 2E41A 2K5LA 3QYGB 5GMKl 1D3BB 4M78A 2LQKA 2MWPA 4C92E 2MWOA 4BE0A 1GXIE 3ER0A 3MEAA 4FL6A 3I56T 4M7DE 5CIUA 2M16A 4OMFB 3META 3DB4A 4QQ6A 3HSBA 4FSXA 4E7JA 4OGEA 4RCCA 1MHNA 3AHUA 5CKBA 3RERA 2DAQA 2L89A 3MP1A 4HT8A 2DJZA 1YIJT 4JRQA 1YHQA 1IZ6A 3LX7A 1X6OA 3NTIA 1N9SA 1OI1A 3MHXA 3JCMh 3NFCA 4NOYA 4C92B 3ZFJA 2MI6A 2GQVA 5FRMA 5CVIA 3CCJT 4KUDK 5CK9A 4C5EA 2E6NA 2LCCA 3PIPA 1VQ5A 1VQKT 3L1AA 3OSSC 1K73U 4HT9A 4CRIA 3C95A 4J6XA 1PSFA 5CO7A 2L5QA 2E70A 2E6ZA 3ZEHA 5GAOp 5GAOn 5GANh 1XQHA 1QVFA 1I81A 2HD0A 4JJNK 2EQUA 4TVRA 3QZ9B 4R56A 2EKOA 5CR2A 3JCMV 2D9TA 1I8FA 2ZZDA 4M77G 5KE3A 3I55A 2EIFA 4QVZA 1Q81U 3E1SA 2FYKA 3LGFA 2K5IA 2ZCFB 5I2MA 5IN1A 4A4FA 3S3MA 4XK8E 2XK0A 2R57A 2K57A 5AYFA 3T9NA 3JCMe 4LDXA 2P0KA 1VQKA 3M4GA 5LJ3e 3M55A 4P5NA 1VUBA 2JTMA 4N4GA 1NJIU 2V8IA 3OYFA 3BY7A 3N5BB 1KQSS 2XI9A 1QVFS 2JN0A 2ZPBB 1ZBXA 3X28B 3PNWC 2RJEA 5CQXA 3OS5A 3H8ZA 3G6ET 4MDXA 4C0FA 4LD9K 5GMKj 4J5YA 2PUOB 5IAYA 1G3YA 3I55T 1H3ZA 1YIJA 1M4ZA 3EFSA 2RD1A 4BD3A 4B9XA 4ZN3A 4MMKA 1O75A 4HKEA 1TH7A 2K4YA 5DY9A 4C5IA 2BUDA 2IG0A 1Y07A 2L3RA 3ASKA 4IUVA 4F7UA 5A0LA 4R55A 2PVDB 3LWIA 4C5HA 2RH2A 1Y7XA 4A4KA 4C0ZA 1OZ3A 3CXCA 5GAMe 2LVMA 2GFUA 4LDUA 3CCLT 3TU4K 4JLIA 3X26B 2YLCA 3Q1JA 3JB9D 4PJOD 2EWNA 4FT2A 5FROA 3M9QA 3OYEA 5J3BA 4PJOF 3C94A 5LJ5e 5KH6A 4OB1B 2WSCE 4ZGJB 5GMKi 3KXTA 3V7CA 5GAMh 1VQOT 1VQ4A 5KCHA 1K8AU 4PNOA 2XKOC 3OYMA 3CCQA 2WSFE 4M7AC 4ELZC 3CMET 2DZ9A 2LRQA 2MMPA 3CCMA 3NTKA 4ZN1A 4M77C 3CCUA 3JCMP 1LJOA 3MCAB 3CC4T 1JB0E 3G7ZA 4XTYA 5FU7C 1QVGA 4VUBA 3HPWA 5GMKm 3JCMJ 1VQ9A 2QQ9A 2JUFA 1N8RU 1I4K1 4MZTA 1YHQT 4ZTJA 5D6WA 5CAIA 3MP6A 3CCRT 2QA4T 1I5LA 4M7DD 3RESA 2JTFA 3TCJA 2HAXA 1O9SA 4BDZA 4ELYC 2XICA 4OVAA 1M8VA 1KHCA 2Y4YA 5LJ5g 3CCST 1U1SA 2A7YA 3OQ5A 5GANe 3PIOA 3G4SA 5GAN7 2RA2A 4M75B 2LDMA 3QBYA 5FU6C 4OF1A 2CKKA 2OTLA 1VQ6T 4JRIA 3FIFA 5HK0A 2RJCA 4C8QC 5GAN3 3OYAA 4PJOE 3SB2A 4X34A 1X01A 4OB2B 3M57A 3BFMA 1S72T 1FX7A 4EDUA 1K73C 3BDUA 4D6WA 3OYCA 5FLXE 5GAOl 3JCMc 3VV0A 3LW5E 4J7IA 4PLIA 2E10A 1HK9A 2RI3A 4C8QF 3URGA 5DLQE 1EIFA 4A53A 2O4XB 2RB6A 5LJ3h 1YI2A 2LC4A 5LJ5h 1VQ4T 2CYZB 5IT9E 1YITA 3CCQT 2DPPB 3QIIA 2XDPA 1VQ5T 4PJOB 2G3RA 2RHYA 3GNFB 4PJOG 1QW1A 3UPUA 4E7KA 2VXEA 2GF7A 3CCUT 4EMGA 1JRIA 5CKFA 5C6SA 3LGLA 2HBPA 2C06A 4C8QB 1NJIC 4XU1A 3CCVA 5GAOm 1N27A 1KQSA 3EFRA 3QYHB 2X4WA 4M75C 2QEXA 4DQ2A 3OYIA 5GAN2 2EFIA 2EYQA 1UGRB 2CZ0B 3L42A 3QSUA 2QA4A 4J6WA 1M1GA 2XDBA 4PJOA 5CQYA 2DKGA 4BI3A 4NS5A 1YI2T 4WF2A 1YITT 3H6ZA 2DXTA 4IUUA 1UGSB 3VJPA 3JB9G 1QVGS 2EJFA 4M7AF 4M7AD 4MZPA 1XOVA 1BYMA 3OYGA 1G3TA 1Q7YU 3CCEA 1Q82C 2CS7A 2OAUA 5FU7B 4RG2A 3KUFA 2EJGA 3QPHA 2JOYA 2LT1A 4IUTA 3JB9F 3L2QA 4M7AG 4M7AB 4C8QD 3G71T 3V8JA 2R5MA 4XU3A 2QQBA 1WQ7A 2D6FA 3L2VA 5GANf 2RO0A 2V8KA 4N0AA 2JZ2A 4QW2A 2I2LA 5D6YA 3SWNB 2P4TA 4C8QG 2KQWA 1M5Q1 3VYHB 2XDDA 3CCET 4M77E 3SWNA 2BKDN 3P8HA 4KT0E 1K9MC 4A54A 1WQWA 3OYNA 3JB9I 3A8GB 3UDCA 1Y96B 2QQRA 4C0GA 3GPLA 5GAOr 1W2BS 2HNIA 4JDSA 3CCRA 1IREB 3HFOA 4FU6A 3F70A 1WJSA 5CKHA 3G71A 3VYGA 3QJ6A 2XG8D 3OMGA 4FM4B 4M77D 3OYDA 4ME7A 4ZTFA 2KVQG 1YJWT 3A8LB 4EPCA 4XTUA 4N4IA 2O01E 1DJ7B 3RIRA 4A4EA 2CZ1B 3G4ST 4M7DB 3OYYA 2FL7A 2K3YA 2VUBA 2HQXA 1BIAA 3BDLA 4CI0C 1RI0A 2LX9A 2AHJB 4QQGA 1Q82U 2GFAA 2CGHA 5GANd 1KHIA 1BKBA 2E5QA 4M75D 3UWNA 4HCBA 2DZCA 1KQ2A 3OYBA 3G6EA 2WACA 1LOJA 3HL8A 3A5ZB 4BI8B 4V2SA 4Y91A 4OB3B 5HK3A 4IUPA 2VV5A 2PVGB 5A0DA 3HRTA 4N4HA 1N9RA 3CBOA 3PMTA 4BUGA 1YJWA 1NZ9A 3M56A 4JUVA 1VQLT 1BI3A 1D3BA 2VXFA 3X24B 3LH0A 1K9MU 2LT4A 3TEEA 3OS1A 4M75G 4C8QA 5LJ5d 4BE1A 4DOWA 2DEQA 3CC7A 2E1HA 4YTLA 4ZGDB 2KSSA 3O8VA 1VQPA 3DB3A 2DK3A 2P0QA 1FXXA 5DLOA 2XHCA 4KULA 5KE2A 2QEXT 3QXEB 4HCZA 4J8OA 3KBGA 1YJNA 2EAYA 4PKCC 4F7UG 4M7DA 3FRNA 2V8JA 4M7AA 5I2SA 2FVUA 4M75F 2F69A 3L2RA 4JS5A 4BE2A 1VQ8T 3CC2A 4M7DF 2KK4A 5D6XA 1HXDA 2P0PA 1VQLA 2OTJT 1UB4A 2CZ6B 4XQ3A 3CMEA 3A8MB 1N6AA 3JCMf 5KCOA 4HCCA 4UC4A 3S6WA 3CC7T 4F7UF 1Q7YC 2F5TX 2M0OA 2EJ9A 2KAFA 4M7DG 5GAMj 3CC4A 4Y28E 2IVWA 3MO8A 1VQNA 5FU6B 1YJNT 1UEBA 3FLGA 1JBMA 4QQDA 5M9OA 3OBWA 2FB7A 4C8QE 3CC2T 2DTHA 4II1A 4IURA 3FEOA 3JSCA 4L59A 3DLLA 5GMKe 2QQAA 3M5AA 3RKXA 4O6JA 4KBMB 3JCMb 4C92D 3V8KA 3FC3A 3DKMA 1Y71A 4XU2A 2X4YA 3GP8A 1G5VA 4XTXA 3V8LA 4BY6C 5GAMd 2PVOB 1VQ6A 4M7AE 4RKUE 4HA8A 4PLLA 4N0AC 5LJ3d 3TREA 2DXCA 2JNGA 3OYLA 2VGMA 3QDRB 5CCAA 2VC8A 3CXCS 1M1KU 4M7DC 1S72A 1RL2A 2QDYB 3C4SA 4LDWA 2X4JA 3ZBDA 3WVEB 4FT4A 2K3XA 3JCMQ 3OW2A 2R5AA 1BI0A 2Y90A 3P8DA 4EMHA 2RJFA 1YCYA 2DXBA 3FDRA 3S3NA 4F7UB 1KG1A 3MP8A 2M1HA 3CMAT 3M58A 4RCBA 2B8AA 3CBPA 2OTJA 1BI1A 2VGNA 1WNLA 2EQMA 4C0DC 2EQKA 3CCMT 4JS4A 1R8OB 4E47A 1JJ2A 2GCXA 4GLKA 4E7LA 2LQ8A 4ATOA 3LWHA 4E7HA 3QZ5B 3SWNC 1UGPB 2KMTA 4A4GA 3X25B 3CCVT 2DIGA 4XTWA 3CPWS 4M78B 2X4XA 1NPPA 4L5GA 5GANj 1Q86U 3UT1A 3M4YA 2DD4A 4BB7A 1NPRA 1OZ2A 2PUKB 3RMSA 3CPFA 4F7UE 1UGQB 5LJ3j 3JCMd 1G3WA 2M9UA 1QP3A 4QVDA 4RMOA 4QVCA 3OYJA 4DA4A 1QP2A 1KD1U 4OP0A 5L8RE 3QHSA 4LDYA 2JVVA 3SD4A 2LCLA 3A8HB 1N8RC 1JJ2S 2BIVA 3E19A 3RMQA 5GAMf 1M1FA 3J7AF 4ZGEB 2HQEA 5J26A 4M75E 5DM7R 1U8RA 4BY6B 3PGGA 3R6OA 1VQ9T 3NTHA 2E65A 1MGQA 1VQ7T 3SFMA 3L2ZA 2YLBA 3LLRA 3ME9A 3JRZA 1KD1C 1BIBA 2H3JA 5GAOq 2XD0A 1OYXA 5I21A 2RHUA 3VUBA 1VQMA 3OB9A 1B34B 1WPYA 2DXUA 5EG2A 1W2BA 1Q81C 3HP9A 2RHXA 3OSVA 4RG8A 1WJQA 2DD5A 2L8DA 2O4XA 4LDVA 4C92F 4EMKC 3GLXA 2A3LA 4JRKA 4NL2A 1M90C 3OMCA 3V7SA 2F5KA 3CEYA 2PQWA 2DIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WGS A;  4Q5W A;  3DB3 A;  2DAQ A;  2L89 A;  3MP1 A;  4EDU A;  5FRN A;  4C5G A;  3LX7 A;  3NTI A;  4HCZ A;  5KE2 A;  3OYC A;  4PLI A;  1OI1 A;  3OY9 A;  2YRV A;  2RI3 A;  3E9F A;  3L2R A;  4BE2 A;  5FRM A;  2O4X B;  5D6X A;  4C5E A;  2E6N A;  2LCC A;  4E7I A;  2RHI A;  3S3O A;  3QII A;  2XDP A;  2G3R A;  3MEW A;  2RHY A;  4CRI A;  5KCO A;  4E7K A;  4UC4 A;  4A4H A;  2GF7 A;  3S6W A;  5C6S A;  3LGL A;  2M0O A;  3ZEH A;  3PFS A;  3O8V A;  4BAC A;  1N27 A;  3MO8 A;  2EQU A;  2R58 A;  4IKF A;  2X4W A;  2EKO A;  3FLG A;  3OYI A;  2D9T A;  2EFI A;  5KE3 A;  4QQD A;  4QVZ A;  5M9O A;  3L42 A;  3LGF A;  4B9W A;  5IN1 A;  4A4F A;  3LYI A;  4II1 A;  4IUR A;  3S3M A;  3FEO A;  4L59 A;  2XK0 A;  4NS5 A;  2R57 A;  3MEV A;  4GY5 A;  2P0K A;  3H6Z A;  4IUU A;  4N4G A;  3FC3 A;  3OYF A;  3OYG A;  2X4Y A;  1G5V A;  4RG2 A;  3KUF A;  4BDY A;  4X34 A;  3PNW C;  2RJE A;  4PLL A;  3H8Z A;  2RI5 A;  3OYL A;  3OYH A;  3GOX A;  2VYT A;  5IAY A;  1H3Z A;  4IUT A;  3C4S A;  2RI2 A;  3L2Q A;  2NLU A;  2K3X A;  4BD3 A;  4B9X A;  2R5A A;  2LTO A;  3P8D A;  2RJF A;  2DIQ A;  2R5M A;  3FDR A;  4Z02 A;  3S3N A;  3L2V A;  3MP8 A;  3PMI A;  1XNI A;  2M1H A;  3OS0 A;  2B8A A;  2RO0 A;  4C5I A;  2BUD A;  2IG0 A;  2L3R A;  3ASK A;  4IUV A;  4LD6 A;  2JZ2 A;  4QW2 A;  5D6Y A;  4C5H A;  4IUQ A;  3L2W A;  2RHZ A;  2EQM A;  2EQK A;  1OZ3 A;  4E7L A;  2RJD A;  2BKD N;  2LVM A;  3P8H A;  2FHD A;  2GFU A;  4E7H A;  4A4G A;  3OYN A;  3Q1J A;  2DIG A;  5FRO A;  3M9Q A;  2QQR A;  3OYE A;  2X4X A;  3UT1 A;  5KH6 A;  3OYA A;  1OZ2 A;  3F70 A;  1WJS A;  3QKJ A;  4FU6 A;  3OYK A;  3QJ6 A;  3DLM A;  3OMG A;  5KCH A;  3OYD A;  3OYJ A;  1WJR A;  3OYM A;  3E9G A;  4ZTF A;  5C0M A;  4N4I A;  2LRQ A;  4PL6 A;  3SD4 A;  2X35 A;  3MEU A;  3NTK A;  4A4E A;  2BIV A;  2K3Y A;  2HQE A;  3BDL A;  2HQX A;  5J26 A;  2QQS A;  1SSF A;  1RI0 A;  4QQG A;  2GFA A;  3NTH A;  2E5Q A;  5J39 A;  3OA6 A;  3L2U A;  3UWN A;  3LLR A;  3ME9 A;  5D6W A;  2EQJ A;  2WAC A;  3MP6 A;  3OYB A;  4ZTJ A;  3EAE A;  3OS2 A;  1OYX A;  2JTF A;  4IUP A;  2RHU A;  4BDZ A;  2MWP A;  4N4H A;  3OB9 A;  2MWO A;  3PMT A;  1KHC A;  4OVA A;  4BE0 A;  3MEA A;  4FL6 A;  3OQ5 A;  2RHX A;  5CIU A;  3LH0 A;  1WJQ A;  2L8D A;  2LDM A;  2M16 A;  2O4X A;  3MET A;  2CKK A;  3DB4 A;  3QBY A;  4QQ6 A;  3OS1 A;  4BE1 A;  4E7J A;  2RJC A;  3OMC A;  2F5K A;  3CEY A;  2PQW A;  1MHN A; 
#chains in the Genus database with same CATH topology
 3ZL7 C;  1PHT A;  5FRN A;  1VIF A;  1Y96 A;  1BI2 A;  3OY9 A;  4PJL A;  4JLG A;  3HRU A;  3QG1 A;  2OTL T;  2A0F B;  3CCQ Q;  2DVE A;  4E7I A;  4AFZ C;  3S3O A;  1K4U S;  1R77 A;  3EH2 A;  2ZPH B;  4OB0 B;  3SDZ A;  2PU9 B;  2F2X A;  1UEC A;  3MEV A;  5HKC A;  5KYU B;  3JAM E;  2EBP A;  2FPE A;  3P8B B;  1BU1 A;  3QJY A;  4FYX B;  2ZPI B;  3VS6 A;  2RI5 A;  1M9S A;  3OYH A;  2VYT A;  3ULR B;  3GOX A;  4C92 G;  5GAN g;  2F1L A;  1AHJ B;  1G3S A;  3CCS A;  1VQ8 A;  4DBR A;  4M78 D;  4IUQ A;  4M78 E;  4XU0 A;  4CC2 A;  1YBY A;  2DTO A;  1KC8 U;  4KUI A;  1X2K A;  5A0G A;  3OYK A;  3DLM A;  1RAC B;  4AG2 C;  4J7F A;  1PKT A;  2X35 A;  1PC0 A;  1SSF A;  1TU0 B;  1SHG A;  3RUX A;  5LJ5 f;  1NE8 A;  3X20 B;  3HHT B;  3OA6 A;  3L2U A;  2HKQ B;  2DNU A;  4OMN A;  2DE0 X;  3OW2 S;  3EAE A;  2W0Z A;  3MPU B;  2K5L A;  1Z9Z A;  1AEY A;  2GGR A;  2MOX A;  4C92 E;  4LN2 A;  4BE0 A;  3MEA A;  3I56 T;  1AD5 A;  3M0Q A;  5CIU A;  1RLQ C;  1OQK A;  4E7J A;  2QGF B;  4OGE A;  1MHN A;  2DAQ A;  3A1P A;  1YHQ A;  3LX7 A;  1X6O A;  4PJN A;  1OI1 A;  3MHX A;  4QT7 A;  3NFC A;  2COZ A;  3ZFJ A;  5KYU A;  4C5E A;  1BK2 A;  1VQ5 A;  3C95 A;  9ATC B;  3VS7 A;  4J6X A;  5CO7 A;  2L5Q A;  2E6Z A;  5GAO p;  5GAN h;  2EQI A;  2HD0 A;  2EQU A;  4R56 A;  2OJ2 A;  3JCM V;  2D9T A;  2ZZD A;  2ROT A;  2FYK A;  5I2M A;  2K5I A;  2M51 A;  2DF6 A;  4XK8 E;  2XK0 A;  2R57 A;  2ROL A;  2JTM A;  2V8I A;  3BY7 A;  1IHW A;  2KBT A;  4WTO B;  1UTI A;  2RJE A;  1RAF B;  3H8Z A;  4MDX A;  4C0F A;  4LD9 K;  4J5Y A;  2PUO B;  5IAY A;  3I55 T;  1YIJ A;  2KR3 A;  1K8A R;  4JPB W;  3CMA Q;  1O75 A;  1RAH B;  1TH7 A;  1K1Z A;  3CCS Q;  1Y07 A;  2L3R A;  2FZC B;  1Q82 R;  4PJM A;  1Y7X A;  4C0Z A;  3CXC A;  1JU5 C;  3X26 B;  5FRO A;  3M9Q A;  5LJ5 e;  3C94 A;  2PNI A;  2WSC E;  2JS0 A;  4ZGJ B;  5GAM h;  1K8A U;  1M3B A;  3EH1 A;  4PNO A;  3OYM A;  2WSF E;  4FYY B;  2LRQ A;  2MMP A;  3NTK A;  1LJO A;  3MCA B;  2B86 A;  2EYY A;  4VUB A;  3HPW A;  3U23 A;  3CCL Q;  1I4K 1;  2P84 A;  1I5L A;  2KEA A;  3TCJ A;  1JJ2 P;  1O9S A;  2QA4 Q;  2HAX A;  4ELY C;  1M8V A;  1KK7 A;  1KHC A;  2M02 A;  1U1S A;  5GAN e;  3EGD B;  5GAN 7;  4PJO E;  2RJC A;  3SB2 A;  1VYV A;  3BFM A;  1AVZ C;  1HYO A;  5GAO l;  1IGQ A;  3LW5 E;  4CC4 B;  4A53 A;  2A36 A;  1YI2 A;  2LC4 A;  2CYZ B;  4B6M A;  3THK A;  4PJO B;  4E7K A;  1OOT A;  2JW4 A;  2DER A;  2HBP A;  1FMW A;  4XU1 A;  3CCV A;  2X4W A;  2QEX A;  1S72 Q;  1X27 A;  2QA4 A;  1M1G A;  4FYV B;  4ANJ A;  1UGS B;  3VJP A;  2E4H A;  4M7A D;  1XOV A;  2AZS A;  1Q7Y U;  3CCE A;  2OAU A;  1PG5 B;  2LNH B;  3H41 A;  3I9Q A;  4M7A G;  1D1A A;  2ESW A;  1K0X A;  3G71 T;  3V8J A;  2QQB A;  1WQ7 A;  1W70 A;  1JEG A;  1W1F A;  1WYX A;  4QW2 A;  3SWN B;  5D6Y A;  2JZ2 A;  2I2L A;  2RMO A;  3VYH B;  1K9M C;  2KXC A;  1I0C A;  2QQR A;  2EGA A;  4JDS A;  3CCR A;  5CKH A;  3HFO A;  2FG0 A;  2KXD A;  3QJ6 A;  4M77 D;  1OV3 A;  1YJW T;  4EPC A;  4OMP A;  2DA9 A;  4N4I A;  2O01 E;  2KT1 A;  2CZ1 B;  3G4S T;  4M7D B;  2BZ8 A;  4RTX A;  3BDL A;  1PD1 A;  2HQX A;  1EZZ B;  2V1Q A;  3HL8 A;  4V2S A;  2QAS A;  2CP2 A;  4IUP A;  3CCJ Q;  1ABO A;  3HRT A;  4N4H A;  3CBO A;  1YJW A;  4JZ3 A;  3X24 B;  1GCP A;  2BZX A;  4DBF A;  3CC7 A;  4YTL A;  2ED1 A;  1VQP A;  2KRS A;  4HCZ A;  2EAY A;  4M7A A;  3L2R A;  4BE2 A;  2EYW A;  2MCN A;  1UB4 A;  2CZ6 B;  3PVQ A;  2CUD A;  1Q86 R;  1K9A A;  4HCC A;  2M0O A;  2EJ9 A;  3CC4 A;  4Y28 E;  2AT1 B;  5FU6 B;  1M27 C;  1MV0 B;  2CP7 A;  1WDX A;  2DTH A;  3CXC P;  4IUR A;  1VQO Q;  1C6V X;  3FEO A;  1M30 A;  2JMC A;  4C92 D;  3REB B;  2HQH A;  4LE9 A;  1QCO A;  1G5V A;  3V8L A;  4BY6 C;  2DXC A;  3OYL A;  2VC8 A;  3CXC S;  2QEX Q;  1RL2 A;  4J9G A;  4LDW A;  1S72 A;  3ZBD A;  4FT4 A;  1BI0 A;  2RNA A;  1RAE B;  6AT1 B;  2DXB A;  3CMA T;  4RCB A;  1VQ4 Q;  2B8A A;  1ZSZ C;  1AWO A;  1JJ2 A;  4GLK A;  3LWH A;  1UGP B;  3X25 B;  3CCV T;  2OTL A;  1NPR A;  1OZ2 A;  3RMS A;  4F7U E;  3OYA A;  1VQ8 Q;  2M9U A;  2HKN A;  3OYJ A;  4QVC A;  1QP2 A;  1NEG A;  3VS1 A;  2CP3 A;  4LDY A;  2HDA A;  2LCL A;  2BIV A;  4RTT A;  5GAM f;  4ZGE B;  5DM7 R;  4BY6 B;  1A0N B;  3JRZ A;  5GAO q;  2XD0 A;  2CP5 A;  2DVJ A;  1UE9 A;  2RHU A;  3HP9 A;  3OSV A;  2DD5 A;  1E7O A;  2L8D A;  2HMA A;  2NUT B;  4NL2 A;  1AWX A;  1M90 C;  3M0T A;  1WGS A;  1VQ7 A;  4R0K A;  3LH5 A;  4DOV A;  4J83 A;  2YRV A;  1SEM A;  4C92 C;  1YNZ A;  2OI3 A;  2BZY A;  1X69 A;  4OGC A;  1V1C A;  2CSI A;  1U5S A;  4EMK B;  2R58 A;  1X75 C;  3FJP A;  1AZE A;  1UHC A;  3J80 E;  2E3H A;  1QWE A;  3LYI A;  4NL3 A;  5CKE A;  4JJC A;  2QGG A;  3JCM X;  4JRP A;  1SF9 A;  3FB9 A;  2QI2 A;  4KH0 B;  2SRC A;  4MML A;  3OBY A;  1PNJ A;  1M3C A;  4M77 B;  2RK2 A;  2LTO A;  4EIK A;  1Q86 C;  1XNI A;  3M0U A;  4M4Z A;  1ZHI A;  2MAM A;  1FMV A;  3CD6 A;  3CCE Q;  4DBQ A;  4J6Y A;  3L2W A;  2JJ9 A;  4DBH A;  4C0D B;  2QTX A;  2MF2 A;  1P92 A;  1U06 A;  2ZPE B;  2KY9 A;  4M78 G;  3QKJ A;  1VIE A;  2RQU A;  4CC7 A;  3J81 E;  3G71 Q;  1UGV A;  3E9G A;  5C0M A;  1PCX A;  3CD6 T;  2RQR A;  5LL6 S;  4L6V 5;  1M1K C;  5GMK h;  3GNG A;  3HKS A;  1WIE A;  2QQS A;  1E6H A;  2AK5 A;  2KRN A;  1YJ9 A;  2QXF A;  3CCL A;  4KGV B;  3INZ A;  3EG0 A;  2MK5 A;  2GBQ A;  1NJI R;  1KQ1 A;  4BI4 A;  4D8K A;  3M54 A;  1H64 1;  1HJD A;  2FEI A;  3QYG B;  1D3B B;  4M78 A;  2LQK A;  2LX7 A;  1ZSG A;  3VS5 A;  2M16 A;  3MET A;  2DX1 A;  4QQ6 A;  3HSB A;  1NLP C;  2L89 A;  4HT8 A;  5FWC A;  2JT4 A;  1IZ6 A;  1N9S A;  2MI6 A;  2GQV A;  4D8D A;  5CK9 A;  2NWM A;  2LCC A;  1VQK T;  3L1A A;  5GJV B;  5GAO n;  1QVF A;  2DL3 A;  1SPK A;  5CR2 A;  1I8F A;  5KE3 A;  2EIF A;  1QLY A;  1RAD B;  3EGX B;  1PRL C;  2K57 A;  5AYF A;  3JCM e;  1MMG A;  4LDX A;  1VQK A;  3M4G A;  2OTJ Q;  3M55 A;  4J9H A;  3N5B B;  2JN0 A;  2ZPB B;  1ZBX A;  3OS5 A;  3VRY A;  2HEQ A;  1M4Z A;  2RD1 A;  4ZN3 A;  2DL5 A;  1T3L A;  1VYT A;  2BE7 D;  2YRD A;  2BUD A;  4F7U A;  4IUV A;  4C5H A;  4A4K A;  3UA6 A;  1ZBJ A;  2EGC A;  5GAM e;  2AIR B;  2GNC A;  3JB9 D;  2YLC A;  3CCR Q;  1NM7 A;  1ZSZ A;  2D0N A;  5GMK i;  1VQO T;  5KCH A;  4J9E A;  2DLP A;  4M7A C;  4ELZ C;  2DZ9 A;  2ZAE A;  2AKL A;  2A37 A;  2VVK A;  3JCM P;  2MYS A;  3G7Z A;  1QVG A;  3JCM J;  5GMK m;  2QQ9 A;  1GBR A;  1N8R U;  1AT1 B;  1YHQ T;  4PJJ A;  4HVW A;  2QA4 T;  4M7D D;  2JTF A;  2EPD A;  2HBW A;  2LDM A;  2FRW A;  3EG9 A;  2KYB A;  4JRI A;  3FIF A;  1WX6 A;  2DL4 A;  3M57 A;  2K9G A;  1K73 C;  3M0P A;  3JCM c;  2RI3 A;  3URG A;  1U3O A;  1VQ4 T;  5IT9 E;  2HCK A;  3CCQ T;  3FJ5 A;  3QII A;  2G3R A;  1QW1 A;  5KYY A;  3CCU T;  1TS9 A;  1EX4 A;  2YUP A;  1KQS A;  1N27 A;  3EFR A;  3QYH B;  4M75 C;  2CDT A;  1GCQ C;  1UGR B;  1JXO A;  3L42 A;  2XDB A;  4J6W A;  4PJO A;  5CQY A;  2YUN A;  4WF2 A;  1YIT T;  1UUE A;  1ZX6 A;  1Q82 C;  4E6R A;  4KRT A;  1YWP A;  2J6K A;  2EGE A;  2QK0 A;  3QPH A;  1T0J A;  5IXF A;  1NYF A;  1VYU A;  1E6G A;  2JS2 A;  5D7U A;  4XU3 A;  3L2V A;  2RO0 A;  3RR6 A;  4N0A A;  2JM9 A;  1QWF A;  1KIK A;  3P8H A;  1WQW A;  4FW2 A;  3JB9 I;  1Y0M A;  1M3A A;  3A8G B;  1Y96 B;  3GPL A;  3VYG A;  4FM4 B;  2XG8 D;  3OMG A;  3OYD A;  2KVQ G;  3A8L B;  4PFP A;  1TUC A;  4XTU A;  1DJ7 B;  3RIR A;  2K3B A;  4A4E A;  4K11 A;  1PWT A;  3OYY A;  2FL7 A;  2VUB A;  2VB6 A;  1BIA A;  2GQI A;  1RI0 A;  4QQG A;  2VKN A;  2GFA A;  1VA7 A;  2E5Q A;  5IHI A;  3UWN A;  5IHN A;  1W6X A;  4F16 A;  2A08 A;  1CKA A;  3A98 A;  4Y91 A;  5A0D A;  1N9R A;  4AMC A;  4BUG A;  1D3B A;  2RQW A;  3RNJ A;  4BE1 A;  4M75 G;  5LJ5 d;  2DEQ A;  1K76 A;  2KSS A;  3O8V A;  2L3P A;  5EC7 A;  1FXX A;  1YJN A;  5KE2 A;  2QEX T;  1M2O A;  1QMC A;  4PKC C;  4M7D A;  2O88 A;  4IIO A;  3AT1 B;  3CC2 A;  2FRY A;  1Q81 R;  2P0P A;  2YUQ A;  3CME A;  5KCO A;  1IO6 A;  3S6W A;  2F5T X;  5GAM j;  1D1C A;  3MO8 A;  1VQN A;  1YJN T;  1UEB A;  3FLG A;  5M9O A;  3CC2 T;  2YRC A;  1LCK A;  2HZY A;  1AZG B;  4O6J A;  2E5K A;  1OU9 A;  1TG0 A;  1OPL A;  3V8K A;  3DKM A;  2DFU A;  4XTX A;  4M7A E;  4FW1 A;  1TOV A;  5LJ3 d;  3TRE A;  2OX7 A;  2YSQ A;  2QDY B;  3C4S A;  4AT1 B;  2X4J A;  1WZO A;  3JCM Q;  2YDL A;  2R5A A;  4F7U B;  1OU8 A;  1KG1 A;  1VQL Q;  2EQK A;  2GCX A;  2YT6 A;  2J06 A;  4E7L A;  3CCV Q;  4E7H A;  4A4G A;  2KMT A;  2ECZ A;  2H3E B;  2DD4 A;  3M4Y A;  3TQ7 P;  2PUK B;  5GAN j;  4DA4 A;  4QVD A;  1YI2 Q;  1IB8 A;  2KRM A;  4OP0 A;  1VQK Q;  2FO0 A;  1JQQ A;  3QDF A;  4M75 E;  2DBK A;  3HTR A;  2BTT A;  2HSP A;  3ME9 A;  2CT3 A;  4FYW B;  1BIB A;  5FWB A;  1ACM B;  5KYY B;  5I11 A;  2QYZ A;  5I21 A;  1VQM A;  1KQS P;  1WPY A;  2DXU A;  1WJQ A;  2O4X A;  1ZA2 B;  4AG1 C;  4JRK A;  3O5Z A;  4MDW A;  2PQW A;  1QVP A;  4Q5W A;  4OMO A;  3CCM A;  3PT9 A;  5LJ3 f;  4XTZ A;  4C5G A;  1XTD A;  1YHQ Q;  3NPF A;  1WXT A;  3SEM A;  3E9F A;  3QUI A;  3BW1 A;  1H92 A;  1K8A C;  1Y57 A;  1D1B A;  3EFO A;  3MEW A;  2CSQ A;  4DEY A;  3PFS A;  1VQ9 Q;  4RTY A;  4BAC A;  1QCN A;  4JJD A;  2LQN A;  2C0T A;  1W4S A;  3EG3 A;  2Y4X A;  2XU8 A;  1MUZ A;  1MND A;  4B9W A;  5GAN 8;  3JB9 H;  4GBQ A;  2DRM A;  2ZGW A;  3EG2 A;  2QG9 B;  1ABQ A;  3M0S A;  3CMA A;  4X9D A;  3I56 Q;  2WSE E;  5GAN 5;  1YJ9 T;  4QKU A;  1V29 B;  2DBM A;  4LUE A;  4BDY A;  2K6D A;  2RM4 A;  2K2V A;  2RI2 A;  2DO3 A;  3GF5 A;  3VS0 A;  3VKI A;  2L2P A;  3OS0 A;  4M78 C;  4LD6 A;  3M59 A;  3VU3 C;  1FWZ A;  2CZ7 B;  2RHZ A;  2NUT A;  2LJ3 A;  1F1B B;  1OPK A;  2FHD A;  3CBM A;  2E64 A;  1YJN Q;  4XAX B;  1U1T A;  2ZPF B;  4Z88 A;  3CPW A;  1KFZ A;  1ZQ1 A;  4LUD A;  1WJR A;  4EMK A;  3I56 A;  4M77 A;  5GAN 6;  3QWX X;  1Q7Y R;  4M78 F;  2D0Q B;  5KYW B;  3VS2 A;  2EQJ A;  4J9C A;  5GMK l;  2MWP A;  1NEB A;  2MWO A;  3ER0 A;  1VOM A;  4M7D E;  4FSX A;  1QCF A;  2NUP A;  5CKB A;  3MP1 A;  2DJZ A;  1C1A A;  1IGU A;  2VAS A;  3NTI A;  2NUZ A;  3JCM h;  2O9S A;  1RI9 A;  5CVI A;  3CCJ T;  2KYM A;  4KUD K;  1X6B A;  3EG1 A;  4ESR A;  3OSS C;  1K73 U;  4HT9 A;  3TSZ A;  1OX8 A;  4ZNX A;  3ZEH A;  1C0M A;  2P4R A;  1I81 A;  2L3Q A;  4TVR A;  2EKO A;  3I55 A;  1Q81 U;  1AOJ A;  2F2V A;  3LGF A;  5IN1 A;  4A4F A;  2JM8 A;  3T9N A;  5IXB A;  1Q95 G;  5LJ3 e;  5KYX B;  4P5N A;  4N4G A;  2RQV A;  2M0Y A;  3OYF A;  1KQS S;  2XI9 A;  5IH2 A;  3X28 B;  3PNW C;  3G6E T;  5GMK j;  5I22 A;  1G3Y A;  2K79 A;  3G6E Q;  4BD3 A;  4AFS C;  2D8H A;  4MMK A;  3PE0 A;  2K4Y A;  5DY9 A;  4C5I A;  2IG0 A;  5A0L A;  4R55 A;  3LWI A;  2PVD B;  2EVR A;  3CCL T;  3TU4 K;  3C0C A;  1LPL A;  4IIM A;  1OX9 A;  4PJO D;  4FT2 A;  2HL5 C;  5J3B A;  2SEM A;  5KH6 A;  4OB1 B;  1HSQ A;  1VQ4 A;  1WHG A;  3CCQ A;  1BBZ A;  2HSE B;  3CME Q;  4ZN1 A;  2BE9 B;  4M77 C;  3CCU A;  3CCU Q;  3CC4 T;  1JB0 E;  4XTY A;  5FU7 C;  1WHM A;  1V76 A;  4MZT A;  1I07 A;  1MMD A;  2J6O A;  5D6W A;  3H0F A;  4WCI A;  1K0S A;  4BDZ A;  2XIC A;  5LJ5 g;  2Y4Y A;  3CCS T;  3OQ5 A;  3PIO A;  4OF1 A;  1VQ6 Q;  2KT8 A;  5GAN 3;  4C8Q C;  2DYB A;  1H8K A;  1WXU A;  1S72 T;  1FX7 A;  4EDU A;  5FLX E;  1JXM A;  7AT1 B;  8ATC B;  4C8Q F;  2DET A;  5DLQ E;  1I5O B;  1EIF A;  2O4X B;  2RB6 A;  5LJ3 h;  5LJ5 h;  1QKX A;  2RHY A;  3CQT A;  4EMG A;  5CKF A;  3LGL A;  1YN8 A;  4C8Q B;  4X1V A;  1VQP Q;  1KSW A;  4DQ2 A;  5GAN 2;  4J9D A;  2J7I A;  2CZ0 B;  1YP5 A;  2DL8 A;  1YIT Q;  1YI2 T;  2DKG A;  4NS5 A;  2DXT A;  3JB9 G;  1QVG S;  1IHV A;  2RN8 A;  1AWW A;  3OYG A;  3CPW P;  1HD3 A;  4J9B A;  5FU7 B;  4RG2 A;  2J05 A;  1VQ7 Q;  2JOY A;  1CSK A;  1UHF A;  4PK4 A;  4C8Q D;  2RPN A;  4HVU A;  2D6F A;  2D1X A;  5GAN f;  1YCS B;  3EGU A;  5FW9 A;  2ABL A;  4C8Q G;  3CCE T;  1R0B G;  1YJ9 Q;  4M77 E;  4J9I A;  3SWN A;  2BKD N;  1VQN Q;  4LNP A;  3UDC A;  1UJY A;  3VS3 A;  5GAO r;  1W2B S;  2HNI A;  1IRE B;  3F70 A;  1WJS A;  3G71 A;  2I0N A;  4KGX B;  4ZTF A;  2X3W D;  2EKH A;  2K3Y A;  2NYS A;  4JZ4 A;  1M2V B;  1ZUU A;  2LX9 A;  2DYI A;  2X9H A;  1KHI A;  4M75 D;  4HCB A;  2DZC A;  3OYB A;  3G6E A;  1XJW B;  1FYN A;  4PFO A;  2VV5 A;  3EFO B;  1NZ9 A;  2VXF A;  2DL7 A;  1YWO A;  2LT4 A;  4C8Q A;  1WHK A;  2E1H A;  4ZGD B;  4RTV A;  3DB3 A;  2DK3 A;  2P0Q A;  4F14 A;  2XHC A;  4J8O A;  2KRO A;  4F7U G;  3FRN A;  2V8J A;  2FVU A;  4M75 F;  2F69 A;  5AT1 B;  4M7D F;  2KK4 A;  4AFQ C;  4XQ3 A;  3A8M B;  1N6A A;  3JCM f;  3G4S Q;  1VQ5 Q;  1TTH B;  1D09 B;  4UC4 A;  3CC7 T;  1D0Y A;  5KYX A;  2KAF A;  2AKK A;  4GLM A;  3R6N A;  1SHF A;  3I55 Q;  3PVL A;  4JJB A;  4QQD A;  3OBW A;  3UF4 A;  2FB7 A;  4II1 A;  1PKS A;  2A28 A;  2G6F X;  4OMM A;  1TUG B;  1UG1 A;  3JCM b;  4XU2 A;  4AFU C;  2PVO B;  2IPO B;  4N0A C;  2JNG A;  1M1K U;  2VGM A;  4M7D C;  5CCA A;  1H3H A;  1T0H A;  1RUW A;  3WVE B;  1D0X A;  4EMH A;  1YCY A;  3FDR A;  4F04 B;  3TVT A;  2MIO A;  1QVF P;  3M58 A;  3CBP A;  2OTJ A;  1ZLM A;  1PM3 A;  4F17 A;  1I1J A;  2EQM A;  3CCM T;  1R8O B;  4KGZ B;  2LQ8 A;  4ATO A;  2F2W A;  3QZ5 B;  3SWN C;  2LQW A;  2DIG A;  5ECA A;  4ORZ A;  4M78 B;  1NPP A;  1WLP B;  1Q86 U;  3UT1 A;  4BB7 A;  5LJ3 j;  2FZG B;  3JCM d;  1G3W A;  3I5R A;  5L8R E;  2KI7 A;  3E2U A;  3SD4 A;  5KYW A;  1N8R C;  3RMQ A;  1D0Z A;  1Z9Q A;  2HQE A;  1U8R A;  1YFN A;  2X51 A;  1G2B A;  3PGG A;  3R6O A;  4FCY A;  1VQ9 T;  3NTH A;  2E65 A;  1ZUK A;  1VQ7 T;  3SFM A;  1IRX A;  3L2Z A;  1KD1 C;  1OEB A;  1B34 B;  1Q81 C;  2RHX A;  4RG8 A;  4LDV A;  3GLX A;  2A3L A;  3OMC A;  3V7S A;  1VQ9 A;  2RQT A;  3WXM B;  2KDS A;  1VQN T;  2IIM A;  3PTA A;  1FMK A;  1JO8 A;  4M75 A;  1QVG P;  1SRM A;  3RKW A;  2GTO A;  2XID A;  2RHI A;  3M53 A;  1B7T A;  1G8X A;  1PD0 A;  4PFZ A;  4A4H A;  3GIB A;  4XTV A;  8AT1 B;  3HRS A;  3CC4 Q;  1IXD A;  4E2F B;  1M90 U;  3NHN A;  4IKF A;  3QO3 A;  3WVD B;  1VQO A;  4GY5 A;  1WA7 A;  3VUZ A;  2W10 A;  1LNX A;  1QQJ A;  2K5F A;  3EGX A;  4RTU A;  3QWY A;  4RUG A;  3REA B;  1B34 A;  1VQP T;  4FSS A;  3JB9 J;  4OML A;  2NLU A;  5LJ3 g;  2FPF A;  2RK1 A;  5GAN 4;  1TXQ A;  4MZM A;  4Z02 A;  2LNV A;  3PMI A;  2J6F A;  3V7R A;  3CD6 Q;  4HCK A;  5LJ5 j;  2DM1 A;  1WHH A;  1RLP C;  2DTI A;  2V1R A;  1N5Z A;  3JCM g;  4C92 A;  3CC7 Q;  1UDL A;  2RJD A;  1GRI A;  4OMF B;  3HFN A;  4FIB A;  1WFW A;  3RKY A;  5HY6 A;  3CCJ A;  3EHR A;  2FPD A;  4X9C A;  1VQM T;  2YHT A;  1PSE A;  3C12 A;  4PL6 A;  3MEU A;  2LMJ A;  4M77 F;  5CKD A;  2C0I A;  1RAB B;  2JTE A;  5J39 A;  3JCM W;  1WXB A;  2E12 A;  4O5V A;  1RAG B;  3A8O B;  2H8H A;  1X43 A;  2ZPG B;  3OS2 A;  5A2Q E;  5GAM g;  2K7A A;  2E41 A;  1NLO C;  1GXI E;  3SHW A;  4FL6 A;  1KD1 R;  1X6G A;  3DB4 A;  2CP6 A;  4RCC A;  2YWW A;  2L3S A;  3VRZ A;  3AHU A;  3RER A;  1MMN A;  2Z0W A;  4JRQ A;  1YIJ T;  2NUP B;  2FZK B;  1NYG A;  1N8R R;  2EW3 A;  4C92 B;  4NOY A;  5FRM A;  1LVK A;  1GCQ A;  2E6N A;  3PIP A;  5GJW B;  2ENM A;  4CRI A;  5KYN A;  1PSF A;  2E70 A;  2K2M A;  1XQH A;  4JJN K;  1T3S A;  3QZ9 B;  2ED0 A;  1KC8 R;  4M77 G;  2V26 A;  4HXJ A;  4QVZ A;  3E1S A;  2CH4 W;  2ZCF B;  1KJW A;  1B3Q A;  3S3M A;  1AWJ A;  2P0K A;  3I5S A;  1VUB A;  1NJI U;  2EYX A;  1SRL A;  1QVF S;  2JMA A;  2O9V A;  5CQX A;  2CUB A;  1K9M R;  1H3Z A;  3MKD A;  4Z8A A;  3EFS A;  4B9X A;  4HKE A;  2OTL Q;  5IHK A;  3ASK A;  1VQ5 T;  1M1K R;  2RH2 A;  4Z89 A;  1OZ3 A;  2LVM A;  2GFU A;  4LDU A;  3TSW A;  4JLI A;  3Q1J A;  1ZSZ B;  2EWN A;  1B07 A;  3OYE A;  4PJO F;  3KXT A;  3V7C A;  2DIL A;  2XKO C;  3MJX A;  3CME T;  1GFC A;  2QTV A;  3OW2 P;  1UFF A;  2KGT A;  3CCM Q;  2AZV A;  2KNB B;  2JUF A;  1ZUY A;  4ZTJ A;  3UAT A;  3MP6 A;  5CAI A;  2JXB A;  3CCR T;  3RES A;  5L23 A;  1ZA1 B;  1TUD A;  3H0I A;  4OVA A;  2A7Y A;  3G4S A;  2RA2 A;  3I35 A;  1J3T A;  4M75 B;  3QBY A;  5FU6 C;  2CKK A;  1VQ6 T;  5HK0 A;  3BE3 A;  4X34 A;  1X01 A;  4OB2 B;  3BDU A;  4KH1 B;  4D6W A;  3OYC A;  4J9F A;  3VV0 A;  4J7I A;  4PLI A;  2E10 A;  1HK9 A;  2PZ1 A;  1YIT A;  2DPP B;  2XDP A;  3D7S B;  3GNF B;  4PJO G;  3UPU A;  2VXE A;  2GF7 A;  1RAI B;  2CRE A;  1BCO A;  1JRI A;  5C6S A;  2C06 A;  1NJI C;  1TSF A;  5GAO m;  4HVV A;  3H9N A;  1W2B P;  1MNE A;  3OYI A;  2EFI A;  2EYQ A;  3QSU A;  4BI3 A;  3VS4 A;  2MPX C;  3H6Z A;  4IUU A;  1M90 R;  2EJF A;  4M7A F;  5HCK A;  4A63 B;  4MZP A;  3RDV A;  1BYM A;  1GFD A;  1G3T A;  2CS7 A;  3KUF A;  2EJG A;  2OAW A;  2LT1 A;  2CT4 A;  1SSH A;  4IUT A;  3JB9 F;  3L2Q A;  2YUO A;  4M7A B;  2R5M A;  4Y92 A;  3NGP A;  1GBQ A;  2QAZ A;  2V8K A;  1KC8 C;  2P4T A;  3H0H A;  2KQW A;  1M5Q 1;  2LJ1 A;  2XDD A;  2GTJ A;  4KT0 E;  1NBE B;  4A54 A;  1SG5 A;  3OYN A;  2COY A;  1R0C B;  4C0G A;  4FU6 A;  1MMA A;  4ME7 A;  1VQM Q;  1S1N A;  1RAA B;  2D8J A;  4CI0 C;  2ATC B;  2AHJ B;  3UA7 A;  1Q82 U;  2CGH A;  3M0R A;  5GAN d;  1BKB A;  2DJQ A;  1KQ2 A;  2L0A A;  2WAC A;  1LOJ A;  1OUL A;  3A5Z B;  4BI8 B;  1QKW A;  4OB3 B;  5HK3 A;  3EGD A;  3CC2 Q;  2PVG B;  3PMT A;  1K73 R;  3M56 A;  4JUV A;  1VQL T;  1BI3 A;  1YJW Q;  3LH0 A;  1K9M U;  3TEE A;  3OS1 A;  1ARK A;  2O31 A;  4DOW A;  1WHJ A;  4CC3 A;  2EYZ A;  5DLO A;  2CP0 A;  4PJO C;  4KUL A;  3QXE B;  3KBG A;  4E7S A;  2COW A;  2E3I A;  5I2S A;  4JS5 A;  2LCS A;  1VQ8 T;  1SKU B;  3GBQ A;  5D6X A;  1HXD A;  1VQL A;  2OTJ T;  3EHQ A;  2DRK A;  4F7U F;  1Q7Y C;  4M7D G;  3EG9 B;  2HL3 A;  2LJ0 A;  2IVW A;  1TWB A;  1G83 A;  1JBM A;  1M2V A;  4C8Q E;  1GL5 A;  3JSC A;  4L59 A;  3DLL A;  1CKB A;  5GMK e;  2QQA A;  3M5A A;  3RKX A;  4E7Z A;  2RF0 A;  4KBM B;  2LZ6 B;  1WI7 A;  3FC3 A;  1X2Q A;  1Y71 A;  2X4Y A;  3GP8 A;  5GAM d;  1VQ6 A;  4RKU E;  4HA8 A;  4PLL A;  1BB9 A;  1UJ0 A;  2XMF A;  3QDR B;  3IQL A;  1YIJ Q;  1MV3 A;  1BCM A;  2PTK A;  2K3X A;  3OW2 A;  2Y90 A;  2LP5 A;  3P8D A;  2RJF A;  1NG2 A;  2O2O A;  3S3N A;  3MP8 A;  2M1H A;  2DMO A;  1M8M A;  1BI1 A;  2KE9 A;  2VWF A;  2VGN A;  1WNL A;  2X3X D;  4C0D C;  4JS4 A;  4E47 A;  1PRM C;  3NMZ C;  2CH4 A;  2DEU A;  4XTW A;  3RBB B;  3CPW S;  2X4X A;  4L5G A;  4RTW A;  3CPF A;  4RMO A;  1UGQ B;  1QP3 A;  1KD1 U;  4OMQ A;  4DEX A;  3KFV A;  3QHS A;  2JVV A;  3A8H B;  1JJ2 S;  3E19 A;  1M1F A;  3J7A F;  5J26 A;  2YXY A;  4LXC A;  2C0O A;  2QDL A;  1WHL A;  3JV3 A;  1MGQ A;  2YLB A;  3LLR A;  2H3J A;  1OYX A;  3VUB A;  4RTZ A;  3OB9 A;  5EG2 A;  1W2B A;  3G1J A;  1EFN A;  4C92 F;  4EMK C;  2F5K A;  3CEY A;  2DIQ A; 
#chains in the Genus database with same CATH homology
 1QVP A;  1WGS A;  4Q5W A;  3PT9 A;  3WXM B;  1VQ7 A;  2KDS A;  1VQN T;  5LJ3 f;  4XTZ A;  5FRN A;  4C5G A;  1VIF A;  1Y96 A;  1XTD A;  4DOV A;  4J83 A;  1BI2 A;  3OY9 A;  2YRV A;  3PTA A;  4JLG A;  3E9F A;  3QUI A;  3HRU A;  3QG1 A;  3BW1 A;  2OTL T;  1K8A C;  4M75 A;  4C92 C;  2DVE A;  3RKW A;  2XID A;  4E7I A;  2RHI A;  3M53 A;  3S3O A;  4PJO C;  3MEW A;  4OGC A;  2ZPH B;  4A4H A;  3GIB A;  4XTV A;  3HRS A;  3PFS A;  1M90 U;  4BAC A;  4OB0 B;  4EMK B;  1KC8 C;  2R58 A;  4IKF A;  1X75 C;  3FJP A;  3QO3 A;  3SDZ A;  3J80 E;  1W4S A;  2Y4X A;  2XU8 A;  3WVD B;  2PU9 B;  5GAN 8;  4B9W A;  1VQO A;  3JB9 H;  3LYI A;  4NL3 A;  5CKE A;  2ZGW A;  3MEV A;  5HKC A;  4GY5 A;  3VUZ A;  3JAM E;  3CMA A;  4X9D A;  1LNX A;  3JCM X;  4JRP A;  2K5F A;  2WSE E;  3P8B B;  5GAN 5;  1YJ9 T;  3FB9 A;  2QI2 A;  1V29 B;  3QJY A;  4BDY A;  1B34 A;  4MML A;  3OBY A;  2ZPI B;  2RI5 A;  1M9S A;  4M77 B;  2VYT A;  3OYH A;  3GOX A;  2RK2 A;  2RM4 A;  1VQP T;  4C92 G;  2K2V A;  2RI2 A;  5GAN g;  3JB9 J;  2NLU A;  1AHJ B;  5LJ3 g;  2DO3 A;  2RK1 A;  2LTO A;  5GAN 4;  1G3S A;  3GF5 A;  4MZM A;  4Z02 A;  3VKI A;  3CCS A;  2LNV A;  1VQ8 A;  3PMI A;  1Q86 C;  1XNI A;  3OS0 A;  3V7R A;  4M78 C;  4M78 D;  1ZHI A;  2MAM A;  5LJ5 j;  3CD6 A;  4LD6 A;  3M59 A;  2DTI A;  3VU3 C;  4J6Y A;  4IUQ A;  1FWZ A;  2CZ7 B;  2RHZ A;  3L2W A;  4M78 E;  3JCM g;  4XU0 A;  4C92 A;  2RJD A;  4C0D B;  2QTX A;  2FHD A;  1P92 A;  1YBY A;  2DTO A;  2MF2 A;  2E64 A;  2ZPE B;  3CBM A;  3HFN A;  4KUI A;  1KC8 U;  4XAX B;  2KY9 A;  4FIB A;  4M78 G;  5A0G A;  1U1T A;  2ZPF B;  5HY6 A;  3RKY A;  3QKJ A;  3CCJ A;  3CPW A;  1VIE A;  3OYK A;  3J81 E;  1ZQ1 A;  3DLM A;  1WJR A;  4X9C A;  3E9G A;  4EMK A;  1VQM T;  2YHT A;  1PSE A;  3C12 A;  5C0M A;  3I56 A;  4M77 A;  4J7F A;  4MDW A;  4PL6 A;  2X35 A;  3MEU A;  5GAN 6;  3CD6 T;  5LL6 S;  4L6V 5;  4M77 F;  1M1K C;  5GMK h;  3GNG A;  3HKS A;  5CKD A;  2QQS A;  4M78 F;  1SSF A;  3RUX A;  2D0Q B;  5LJ5 f;  1YJ9 A;  2QXF A;  1NE8 A;  3CCL A;  3INZ A;  3X20 B;  3HHT B;  5J39 A;  3OA6 A;  3L2U A;  3JCM W;  1KQ1 A;  2E12 A;  2EQJ A;  4O5V A;  4BI4 A;  3A8O B;  3OW2 S;  3EAE A;  2ZPG B;  3OS2 A;  3M54 A;  1H64 1;  5GAM g;  5A2Q E;  2E41 A;  2K5L A;  3QYG B;  5GMK l;  1D3B B;  4M78 A;  2LQK A;  2MWP A;  4C92 E;  2MWO A;  4BE0 A;  1GXI E;  3ER0 A;  3MEA A;  4FL6 A;  3I56 T;  4M7D E;  5CIU A;  2M16 A;  4OMF B;  3MET A;  3DB4 A;  4QQ6 A;  3HSB A;  4FSX A;  4E7J A;  4OGE A;  4RCC A;  1MHN A;  3AHU A;  5CKB A;  3RER A;  2DAQ A;  2L89 A;  3MP1 A;  4HT8 A;  2DJZ A;  1YIJ T;  4JRQ A;  1YHQ A;  1IZ6 A;  3LX7 A;  1X6O A;  3NTI A;  1N9S A;  1OI1 A;  3MHX A;  3JCM h;  3NFC A;  4NOY A;  4C92 B;  3ZFJ A;  2MI6 A;  2GQV A;  5FRM A;  5CVI A;  3CCJ T;  4KUD K;  5CK9 A;  4C5E A;  2E6N A;  2LCC A;  3PIP A;  1VQ5 A;  1VQK T;  3L1A A;  3OSS C;  1K73 U;  4HT9 A;  4CRI A;  3C95 A;  4J6X A;  1PSF A;  5CO7 A;  2L5Q A;  2E70 A;  2E6Z A;  3ZEH A;  5GAO p;  5GAO n;  5GAN h;  1XQH A;  1QVF A;  1I81 A;  2HD0 A;  4JJN K;  2EQU A;  4TVR A;  3QZ9 B;  4R56 A;  2EKO A;  5CR2 A;  3JCM V;  2D9T A;  1I8F A;  2ZZD A;  4M77 G;  5KE3 A;  3I55 A;  2EIF A;  4QVZ A;  1Q81 U;  3E1S A;  2FYK A;  3LGF A;  2K5I A;  2ZCF B;  5I2M A;  5IN1 A;  4A4F A;  3S3M A;  4XK8 E;  2XK0 A;  2R57 A;  2K57 A;  5AYF A;  3T9N A;  3JCM e;  4LDX A;  2P0K A;  1VQK A;  3M4G A;  5LJ3 e;  3M55 A;  4P5N A;  1VUB A;  2JTM A;  4N4G A;  1NJI U;  2V8I A;  3OYF A;  3BY7 A;  3N5B B;  1KQS S;  2XI9 A;  1QVF S;  2JN0 A;  2ZPB B;  1ZBX A;  3X28 B;  3PNW C;  2RJE A;  5CQX A;  3OS5 A;  3H8Z A;  3G6E T;  4MDX A;  4C0F A;  4LD9 K;  5GMK j;  4J5Y A;  2PUO B;  5IAY A;  1G3Y A;  3I55 T;  1H3Z A;  1YIJ A;  1M4Z A;  3EFS A;  2RD1 A;  4BD3 A;  4B9X A;  4ZN3 A;  4MMK A;  1O75 A;  4HKE A;  1TH7 A;  2K4Y A;  5DY9 A;  4C5I A;  2BUD A;  2IG0 A;  1Y07 A;  2L3R A;  3ASK A;  4IUV A;  4F7U A;  5A0L A;  4R55 A;  2PVD B;  3LWI A;  4C5H A;  2RH2 A;  1Y7X A;  4A4K A;  4C0Z A;  1OZ3 A;  3CXC A;  5GAM e;  2LVM A;  2GFU A;  4LDU A;  3CCL T;  3TU4 K;  4JLI A;  3X26 B;  2YLC A;  3Q1J A;  3JB9 D;  4PJO D;  2EWN A;  4FT2 A;  5FRO A;  3M9Q A;  3OYE A;  5J3B A;  4PJO F;  3C94 A;  5LJ5 e;  5KH6 A;  4OB1 B;  2WSC E;  4ZGJ B;  5GMK i;  3KXT A;  3V7C A;  5GAM h;  1VQO T;  1VQ4 A;  5KCH A;  1K8A U;  4PNO A;  2XKO C;  3OYM A;  3CCQ A;  2WSF E;  4M7A C;  4ELZ C;  3CME T;  2DZ9 A;  2LRQ A;  2MMP A;  3CCM A;  3NTK A;  4ZN1 A;  4M77 C;  3CCU A;  3JCM P;  1LJO A;  3MCA B;  3CC4 T;  1JB0 E;  3G7Z A;  4XTY A;  5FU7 C;  1QVG A;  4VUB A;  3HPW A;  5GMK m;  3JCM J;  1VQ9 A;  2QQ9 A;  2JUF A;  1N8R U;  1I4K 1;  4MZT A;  1YHQ T;  4ZTJ A;  5D6W A;  5CAI A;  3MP6 A;  3CCR T;  2QA4 T;  1I5L A;  4M7D D;  3RES A;  2JTF A;  3TCJ A;  2HAX A;  1O9S A;  4BDZ A;  4ELY C;  2XIC A;  4OVA A;  1M8V A;  1KHC A;  2Y4Y A;  5LJ5 g;  3CCS T;  1U1S A;  2A7Y A;  3OQ5 A;  5GAN e;  3PIO A;  3G4S A;  5GAN 7;  2RA2 A;  4M75 B;  2LDM A;  3QBY A;  5FU6 C;  4OF1 A;  2CKK A;  2OTL A;  1VQ6 T;  4JRI A;  3FIF A;  5HK0 A;  2RJC A;  4C8Q C;  5GAN 3;  3OYA A;  4PJO E;  3SB2 A;  4X34 A;  1X01 A;  4OB2 B;  3M57 A;  3BFM A;  1S72 T;  1FX7 A;  4EDU A;  1K73 C;  3BDU A;  4D6W A;  3OYC A;  5FLX E;  5GAO l;  3JCM c;  3VV0 A;  3LW5 E;  4J7I A;  4PLI A;  2E10 A;  1HK9 A;  2RI3 A;  4C8Q F;  3URG A;  5DLQ E;  1EIF A;  4A53 A;  2O4X B;  2RB6 A;  5LJ3 h;  1YI2 A;  2LC4 A;  5LJ5 h;  1VQ4 T;  2CYZ B;  5IT9 E;  1YIT A;  3CCQ T;  2DPP B;  3QII A;  2XDP A;  1VQ5 T;  4PJO B;  2G3R A;  2RHY A;  3GNF B;  4PJO G;  1QW1 A;  3UPU A;  4E7K A;  2VXE A;  2GF7 A;  3CCU T;  4EMG A;  1JRI A;  5CKF A;  5C6S A;  3LGL A;  2HBP A;  2C06 A;  4C8Q B;  1NJI C;  4XU1 A;  3CCV A;  5GAO m;  1N27 A;  1KQS A;  3EFR A;  3QYH B;  2X4W A;  4M75 C;  2QEX A;  4DQ2 A;  3OYI A;  5GAN 2;  2EFI A;  2EYQ A;  1UGR B;  2CZ0 B;  3L42 A;  3QSU A;  2QA4 A;  4J6W A;  1M1G A;  2XDB A;  4PJO A;  5CQY A;  2DKG A;  4BI3 A;  4NS5 A;  1YI2 T;  4WF2 A;  1YIT T;  3H6Z A;  2DXT A;  4IUU A;  1UGS B;  3VJP A;  3JB9 G;  1QVG S;  2EJF A;  4M7A F;  4M7A D;  4MZP A;  1XOV A;  1BYM A;  3OYG A;  1G3T A;  1Q7Y U;  3CCE A;  1Q82 C;  2CS7 A;  2OAU A;  5FU7 B;  4RG2 A;  3KUF A;  2EJG A;  3QPH A;  2JOY A;  2LT1 A;  4IUT A;  3JB9 F;  3L2Q A;  4M7A G;  4M7A B;  4C8Q D;  3G71 T;  3V8J A;  2R5M A;  4XU3 A;  2QQB A;  1WQ7 A;  2D6F A;  3L2V A;  5GAN f;  2RO0 A;  2V8K A;  4N0A A;  2JZ2 A;  4QW2 A;  2I2L A;  5D6Y A;  3SWN B;  2P4T A;  4C8Q G;  2KQW A;  1M5Q 1;  3VYH B;  2XDD A;  3CCE T;  4M77 E;  3SWN A;  2BKD N;  3P8H A;  4KT0 E;  1K9M C;  4A54 A;  1WQW A;  3OYN A;  3JB9 I;  3A8G B;  3UDC A;  1Y96 B;  2QQR A;  4C0G A;  3GPL A;  5GAO r;  1W2B S;  2HNI A;  4JDS A;  3CCR A;  1IRE B;  3HFO A;  4FU6 A;  3F70 A;  1WJS A;  5CKH A;  3G71 A;  3VYG A;  3QJ6 A;  2XG8 D;  3OMG A;  4FM4 B;  4M77 D;  3OYD A;  4ME7 A;  4ZTF A;  2KVQ G;  1YJW T;  3A8L B;  4EPC A;  4XTU A;  4N4I A;  2O01 E;  1DJ7 B;  3RIR A;  4A4E A;  2CZ1 B;  3G4S T;  4M7D B;  3OYY A;  2FL7 A;  2K3Y A;  2VUB A;  2HQX A;  1BIA A;  3BDL A;  4CI0 C;  1RI0 A;  2LX9 A;  2AHJ B;  4QQG A;  1Q82 U;  2GFA A;  2CGH A;  5GAN d;  1KHI A;  1BKB A;  2E5Q A;  4M75 D;  3UWN A;  4HCB A;  2DZC A;  1KQ2 A;  3OYB A;  3G6E A;  2WAC A;  1LOJ A;  3HL8 A;  3A5Z B;  4BI8 B;  4V2S A;  4Y91 A;  4OB3 B;  5HK3 A;  4IUP A;  2VV5 A;  2PVG B;  5A0D A;  3HRT A;  4N4H A;  1N9R A;  3CBO A;  3PMT A;  4BUG A;  1YJW A;  1NZ9 A;  3M56 A;  4JUV A;  1VQL T;  1BI3 A;  1D3B A;  2VXF A;  3X24 B;  3LH0 A;  1K9M U;  2LT4 A;  3TEE A;  3OS1 A;  4M75 G;  4C8Q A;  5LJ5 d;  4BE1 A;  4DOW A;  2DEQ A;  3CC7 A;  2E1H A;  4YTL A;  4ZGD B;  2KSS A;  3O8V A;  1VQP A;  3DB3 A;  2DK3 A;  2P0Q A;  1FXX A;  5DLO A;  2XHC A;  4KUL A;  5KE2 A;  2QEX T;  3QXE B;  4HCZ A;  4J8O A;  3KBG A;  1YJN A;  2EAY A;  4PKC C;  4F7U G;  4M7D A;  3FRN A;  2V8J A;  4M7A A;  5I2S A;  2FVU A;  4M75 F;  2F69 A;  3L2R A;  4JS5 A;  4BE2 A;  1VQ8 T;  3CC2 A;  4M7D F;  2KK4 A;  5D6X A;  1HXD A;  2P0P A;  1VQL A;  2OTJ T;  1UB4 A;  2CZ6 B;  4XQ3 A;  3CME A;  3A8M B;  1N6A A;  3JCM f;  5KCO A;  4HCC A;  4UC4 A;  3S6W A;  3CC7 T;  4F7U F;  1Q7Y C;  2F5T X;  2M0O A;  2EJ9 A;  2KAF A;  4M7D G;  5GAM j;  3CC4 A;  4Y28 E;  2IVW A;  3MO8 A;  1VQN A;  5FU6 B;  1YJN T;  1UEB A;  3FLG A;  1JBM A;  4QQD A;  5M9O A;  3OBW A;  2FB7 A;  4C8Q E;  3CC2 T;  2DTH A;  4II1 A;  4IUR A;  3FEO A;  3JSC A;  4L59 A;  3DLL A;  5GMK e;  2QQA A;  3M5A A;  3RKX A;  4O6J A;  4KBM B;  3JCM b;  4C92 D;  3V8K A;  3FC3 A;  3DKM A;  1Y71 A;  4XU2 A;  2X4Y A;  3GP8 A;  1G5V A;  4XTX A;  3V8L A;  4BY6 C;  5GAM d;  2PVO B;  1VQ6 A;  4M7A E;  4RKU E;  4HA8 A;  4PLL A;  4N0A C;  5LJ3 d;  3TRE A;  2DXC A;  2JNG A;  3OYL A;  2VGM A;  3QDR B;  5CCA A;  2VC8 A;  3CXC S;  1M1K U;  4M7D C;  1S72 A;  1RL2 A;  2QDY B;  3C4S A;  4LDW A;  2X4J A;  3ZBD A;  3WVE B;  4FT4 A;  2K3X A;  3JCM Q;  3OW2 A;  2R5A A;  1BI0 A;  2Y90 A;  3P8D A;  4EMH A;  2RJF A;  1YCY A;  2DXB A;  3FDR A;  3S3N A;  4F7U B;  1KG1 A;  3MP8 A;  2M1H A;  3CMA T;  3M58 A;  4RCB A;  2B8A A;  3CBP A;  2OTJ A;  1BI1 A;  2VGN A;  1WNL A;  2EQM A;  4C0D C;  2EQK A;  3CCM T;  4JS4 A;  1R8O B;  4E47 A;  1JJ2 A;  2GCX A;  4GLK A;  4E7L A;  2LQ8 A;  4ATO A;  3LWH A;  4E7H A;  3QZ5 B;  3SWN C;  1UGP B;  2KMT A;  4A4G A;  3X25 B;  3CCV T;  2DIG A;  4XTW A;  3CPW S;  4M78 B;  2X4X A;  1NPP A;  4L5G A;  5GAN j;  1Q86 U;  3UT1 A;  3M4Y A;  2DD4 A;  4BB7 A;  1NPR A;  1OZ2 A;  2PUK B;  3RMS A;  3CPF A;  4F7U E;  1UGQ B;  5LJ3 j;  3JCM d;  1G3W A;  2M9U A;  1QP3 A;  4QVD A;  4RMO A;  4QVC A;  3OYJ A;  4DA4 A;  1QP2 A;  1KD1 U;  4OP0 A;  5L8R E;  3QHS A;  4LDY A;  2JVV A;  3SD4 A;  2LCL A;  3A8H B;  1N8R C;  1JJ2 S;  2BIV A;  3E19 A;  3RMQ A;  5GAM f;  1M1F A;  3J7A F;  4ZGE B;  2HQE A;  5J26 A;  4M75 E;  5DM7 R;  1U8R A;  4BY6 B;  3PGG A;  3R6O A;  1VQ9 T;  3NTH A;  2E65 A;  1MGQ A;  1VQ7 T;  3SFM A;  3L2Z A;  2YLB A;  3LLR A;  3ME9 A;  3JRZ A;  1KD1 C;  1BIB A;  2H3J A;  5GAO q;  2XD0 A;  1OYX A;  5I21 A;  2RHU A;  3VUB A;  1VQM A;  3OB9 A;  1B34 B;  1WPY A;  2DXU A;  5EG2 A;  1W2B A;  1Q81 C;  3HP9 A;  2RHX A;  3OSV A;  4RG8 A;  1WJQ A;  2DD5 A;  2L8D A;  2O4X A;  4LDV A;  4C92 F;  4EMK C;  3GLX A;  2A3L A;  4JRK A;  4NL2 A;  1M90 C;  3OMC A;  3V7S A;  2F5K A;  3CEY A;  2PQW A;  2DIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...