3KUFA

The crystal structure of the tudor domains from fxr1
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
119
structure length
108
Chain Sequence
ELTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPEISEGDEVEVYSRAEPCGWWLAKVRMMKGEFYVIEYATYNEIVTFERLRPVNQNKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Fragile X mental retardation syndrome-related protein 1
publication title Crystal structure of the Tudor domains from Fragile X mental retardation syndrome-related protein 1
rcsb
source organism Homo sapiens
total genus 12
structure length 108
sequence length 119
ec nomenclature
pdb deposition date 2009-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kufA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3kufA01
2L89A 2RHYA 2YRVA 1WJRA 3QJ6A 3F70A 3LH0A 2EQUA 3OYAA 2LRQA 2R5AA 3NTIA 2RJEA 2PQWA 2LVMA 3BDLA 3PFSA 3ASKA 4IUVA 4QQDA 4E7HA 3ME9A 2LDMA 2F5KA 1OI1A 3OYIA 3OYFA 3L2QA 5D6YA 3CEYA 4C5GA 4EDUA 5FRNA 3OMGA 5KCOA 3OYBA 2MWPA 3OS2A 3DLMA 4QQ6A 4E7LA 3OS1A 1WJSA 1WGSA 4NS5A 3OYGA 2BIVA 3FC3A 3M9QA 4GY5A 1N27A 3ZEHA 4B9WA 3OY9A 4BE0A 4N4GA 2DIQA 3L2RA 2X4WA 2M16A 2RI3A 2XDPA 4IKFA 2R58A 3OYCA 4A4HA 3GOXA 3MEWA 4QVZA 3NTKA 4A4GA 4BDYA 5IN1A 2RHIA 4QW2A 3MEUA 3OYEA 3L42A 3LGFA 3P8DA 3QBYA 4HCZA 4Q5WA 2D9TA 3C4SA 2RO0A 3E9GA 4BACA 4II1A 5KH6A 3L2WA 1MHNA 3OYJA 2RHUA 3QKJA 3L2UA 3OYHA 3SD4A 3PMTA 2HQEA 4IUTA 4ZTFA 4PL6A 3S3OA 2NLUA 2QQRA 4C5EA 2RI5A 2X4XA 5KE3A 4E7KA 2R5MA 2LTOA 3FEOA 3S3MA 2GF7A 4N4HA 4PLIA 5KCHA 3OS0A 3META 3OYLA 3P8HA 3O8VA 4N4IA 2EKOA 2O4XB 4BE2A 4CRIA 2K3YA 3LX7A 4RG2A 4BDZA 4C5IA 5J26A 3OYDA 2RI2A 4FL6A 2RJCA 2QQSA 2WACA 3MEAA 4L59A 5KE2A 3S6WA 3OYNA 3UWNA 3OA6A 3MP6A 3UT1A 5J39A 5C6SA 2IG0A 2M0OA 5CIUA 4UC4A 5FRMA 5M9OA 3NTHA 3DB4A 3E9FA 3H8ZA 1XNIA 3EAEA 3FLGA 4IUUA 3OYMA 2RJDA 3KUFA 1OYXA 2XK0A 4IUQA 3QIIA 4FU6A 4OVAA 3MP8A 4C5HA 4IURA 2RJFA 3MP1A 3Q1JA 2B8AA 3OYKA 2EQJA 2O4XA 2DIGA 2HQXA 2X4YA 4ZTJA 3FDRA 4IUPA 2GFUA 4E7JA 5D6WA 2VYTA 1RI0A 2GFAA 2BUDA 1KHCA 3DB3A 2CKKA 3MEVA 3OB9A 1OZ3A 5C0MA 3LLRA 3S3NA 1SSFA 1OZ2A 2EQKA 2P0KA 1G5VA 5D6XA 2R57A 5FROA 2BKDN 4A4FA 4A4EA 2EFIA 4B9XA 3L2VA 2L8DA 3LGLA 3LYIA 1WJQA 2X35A 3H6ZA 2K3XA 2LCCA 2G3RA 3OMCA 4PLLA 2DAQA 2MWOA 2RHZA 4Z02A 2M1HA 2RHXA 3PMIA 2E5QA 4E7IA 4X34A 2JTFA 3PNWC 4BE1A 1H3ZA 3OQ5A 4BD3A 4QQGA 5IAYA 2JZ2A 2L3RA 3MO8A 2FHDA 2E6NA 4LD6A 2EQMA
chains in the Genus database with same CATH superfamily
2DBMA 2YRVA 2A7YA 2CZ1B 3LH0A 1NEGA 1K8AU 2LVMA 3J81E 1PNJA 4M7AB 1EIFA 5D6YA 5FRNA 1UJYA 1PD0A 4E7LA 1AWOA 2CZ6B 4M77D 1HXDA 3R6NA 1JJ2S 3RKWA 4D8KA 2XIDA 1YI2T 4BDYA 4XTUA 2BE7D 1YFNA 1YWOA 3CC4A 2OTLA 2F2WA 4M7DB 4PJOG 7AT1B 2Z0WA 2YLBA 1K73C 1YCSB 3UDCA 5I2SA 1GFDA 3X20B 1ZSZC 2RI5A 1YP5A 5CQYA 4QVCA 4RTUA 2EIFA 2FZGB 4XU0A 4QKUA 2K2MA 4M78G 3CCUQ 2YXYA 5LJ3j 3TREA 3NFCA 4XAXB 1NE8A 3TSWA 3S6WA 1M90R 2FVUA 2PNIA 1BI3A 3CMAA 3CCJT 1VOMA 2YDLA 1QVGS 2WSFE 4M75A 1K0XA 1FX7A 2PZ1A 4Y91A 2NUZA 1K73U 2HBPA 5LJ3d 1Z9ZA 4PJOC 1WHHA 1TH7A 5LL6S 2ED1A 5IXFA 1VQ4Q 5CCAA 1VQPT 1U1TA 4OP0A 1M3BA 4RG8A 4Z8AA 3SB2A 4JJBA 4R0KA 3CCLA 2NYSA 1QCOA 2RHZA 1OV3A 4DEXA 1YWPA 1ZSGA 1VQ7A 4M78C 1KD1R 4OMQA 1QMCA 3JV3A 1DJ7B 2HL5C 1M8MA 1ZSZB 3CCVT 2L3PA 4XTYA 1UGVA 4CI0C 2JNGA 2DZCA 4ZGEB 2DRMA 2F2XA 2K57A 4J5YA 3CC2Q 1KQ1A 3OS1A 4NS5A 1EZZB 3PT9A 2VB6A 2X4WA 3H9NA 1JEGA 3CD6A 2KXDA 1AOJA 1MMGA 3C94A 2KY9A 2RHIA 1OU9A 3OYEA 3QBYA 4Q5WA 2RQWA 3M0UA 2RQUA 3VUZA 2XMFA 5ECAA 4JLIA 4ZGDB 4EMKA 2K9GA 3QDFA 3UATA 5GAOq 3JCMg 4N4HA 4M77G 5KCHA 3JB9D 3N5BB 2QEXA 3EGDA 3JCMP 2E3IA 4E2FB 3FJPA 1ZLMA 1S72Q 4MMKA 4MDXA 2L3QA 4M78B 5GANf 4J8OA 3UA7A 1BIBA 3A8OB 2GCXA 3CC7A 2XU8A 3JCMh 1V1CA 3QJYA 2RJFA 2B8AA 2MPXC 2VYTA 2VV5A 4F7UF 1RI0A 3GF5A 3G71T 4ORZA 4RTYA 3DB3A 4RTVA 2QA4T 2QDLA 3M54A 3LW5E 3G6ET 4IIOA 1I0CA 2J7IA 3V7CA 4ZNXA 2DYIA 4M77C 2E5QA 5GJWB 1IHVA 3QPHA 4X34A 3WVEB 3EGXA 4FSSA 2L5QA 5GAOm 3GNFB 1YJWA 1NPPA 4Y28E 4NL2A 3THKA 3I56A 2SEMA 1AZEA 2LDMA 3EG0A 2NUPB 2PUOB 1OI1A 2DF6A 2GTOA 3BFMA 4C5GA 4QQ6A 1X2KA 3OYGA 3RIRA 2CH4W 2EAYA 2P0PA 1B34A 4PJOF 3CXCS 1OX8A 4ZN1A 4BACA 3CCMQ 3J80E 2WSEE 2EJGA 2MAMA 1JJ2P 1VQLT 2J6FA 2F1LA 3URGA 1NLOC 2DEUA 3TU4K 4C0FA 2MK5A 4J6WA 2RF0A 1MV3A 1UJ0A 5LJ3f 1N8RR 4M77B 5J26A 4PNOA 4X9DA 1ZHIA 4ESRA 5IT9E 5CKEA 3OYNA 1YI2A 2FPFA 2O2OA 4IUUA 4PFZA 2FEIA 1GXIE 4ATOA 1SHGA 3CCQT 2RK2A 3QIIA 1SPKA 3I9QA 1VQMQ 3JCMX 5LJ5j 3PTAA 2KXCA 2X4YA 2H8HA 1M4ZA 1KQ2A 1UDLA 2YUPA 1VQ5Q 1RUWA 1KHCA 3FJ5A 4J6YA 2EWNA 1UG1A 3OYYA 3OW2A 1BI0A 2LJ0A 3L2VA 2JXBA 1KG1A 4IIMA 1SRLA 1YJNQ 2JMAA 2CP5A 2K6DA 3X25B 4WCIA 5LJ5d 5HY6A 1NZ9A 2JTFA 1AEYA 2CP7A 3SWNA 4JRQA 4M7AD 4RTWA 3QJ6A 3F70A 3VU3C 1IB8A 2VUBA 1ABOA 2DJZA 2F5KA 1GCQC 3TCJA 2QQ9A 2MWPA 4JRPA 1M1GA 2YLCA 3EG2A 1VQPA 2KROA 4EMKB 1X27A 1UUEA 2M16A 1D0ZA 1WHMA 3JB9J 4N0AA 5IN1A 4HCZA 2DA9A 2X3XD 3C4SA 2KI7A 3E9GA 2OJ2A 1K76A 3L2WA 4P5NA 2QGFB 2EVRA 2K5FA 3PMTA 4C8QF 2Y90A 2E1HA 5GAMg 1E6HA 3CCVA 1VQ6T 4C5EA 3CCRQ 1RAIB 2KRMA 1HYOA 2QTVA 3OS0A 2QXFA 1TUCA 1VQ8T 4ELYC 1S1NA 3QWYA 5GAMe 3LX7A 4BDZA 2EJ9A 1H8KA 1UGPB 3OYDA 4FL6A 5DM7R 1Q95G 2COYA 3UT1A 2HEQA 2JMCA 2ZCFB 1D3BA 2K5IA 4EMGA 1UHCA 1MNEA 2DRKA 2HD0A 4DBHA 1QP3A 1K9AA 2ZGWA 4ZTJA 3LWHA 1Y71A 2QQBA 5D6WA 3ER0A 2K2VA 4RUGA 1YITT 2JTEA 2V1RA 4KGZB 4TVRA 2DLPA 2EYQA 2GBQA 4A4EA 4B9XA 2HCKA 1Z9QA 1WJQA 4EPCA 1RLPC 1AWXA 3QHSA 3OMCA 4C92F 1IGUA 5KYUA 2C0OA 3VUBA 1IRXA 2RQVA 2L3RA 1YHQT 2JTMA 1NM7A 4J9EA 1Q81R 3HSBA 1AVZC 1WDXA 2DX1A 1W1FA 3NTIA 1UE9A 1VQ9T 2PQWA 3G71A 3PFSA 3U23A 2MF2A 2EGAA 5GMKl 2QA4A 3JCMW 1LPLA 1M8VA 1J3TA 1VYVA 1G8XA 3G6EA 3VYGA 5J3BA 4LDWA 1E7OA 1BB9A 4N4GA 3RBBB 1NG2A 2DD4A 1WQ7A 3V8KA 4LXCA 2COWA 3JCMJ 3G4SQ 2J06A 2L2PA 4FCYA 4DA4A 3RERA 4M7AG 1UHFA 1OQKA 4M75E 1PWTA 2RNAA 5FU6C 4LNPA 3RMQA 4ZN3A 2K7AA 2QQRA 1NLPC 3CXCP 1F1BB 1I1JA 5A2QE 4LDUA 2GF7A 5I22A 2K4YA 4LDXA 1BCOA 2D8HA 1R77A 1I4K1 2NWMA 1QVGA 1VQKT 3A98A 5CKHA 1B07A 3VS1A 2I0NA 2WACA 4F7UA 4L59A 3QDRB 1OU8A 1ZUKA 4AT1B 1D1CA 1JRIA 1MMAA 2ZPBB 2XK0A 5LJ5f 3JB9F 5GMKe 2COZA 3QO3A 1Q82R 2BE9B 2CSQA 2W10A 1VQLA 1X43A 4E6RA 5FU7C 2WSCE 4Z88A 4M7AC 1GCPA 2NUTA 1ZA2B 2CKKA 4AMCA 3S3NA 1KD1C 2KRNA 1D1AA 1KHIA 1RAEB 3I5RA 1WX6A 2O9SA 1ZA1B 5GANg 5GAN8 4FYVB 5IHNA 1UTIA 1WXTA 4J9GA 1K0SA 2IVWA 3H0HA 3PNWC 2MI6A 4OB3B 1NYGA 4HA8A 3CCQA 2X51A 4C5HA 4QVDA 1BBZA 1JXMA 4KBMB 2FZCB 1T0HA 3I55Q 3CCSQ 5GJVB 1KC8R 2L0AA 3ME9A 1ZBXA 2EYWA 5GANh 1M2VA 4JJNK 2HKNA 2JW4A 1Y57A 3OY9A 4LE9A 3VYHB 3G4ST 2RI3A 2XDPA 1KQSA 2KEAA 3OSSC 2CT4A 3CMET 1NJIR 2V8JA 4QW2A 3LGFA 1OEBA 1K9MR 4FYYB 2LQKA 8ATCB 3QKJA 2LCLA 5FU7B 1PD1A 4PL6A 1MUZA 3CCET 2MMPA 2CP2A 4M75D 3OYLA 1D0YA 4J9FA 3INZA 1Q86U 2C06A 1Q7YR 4LDVA 1VQOQ 2G6FX 3UPUA 3TQ7P 2A08A 3M0SA 5M9OA 3H8ZA 3EH1A 5FW9A 1WHLA 3PIPA 4OVAA 1GBRA 3QZ9B 1VQ6A 1PRLC 3OBWA 4E7SA 2EQKA 5LJ3g 2P0KA 1G5VA 4L6V5 5D6XA 1VQ8A 4GLMA 2YUOA 1KK7A 3IQLA 4X1VA 1TUGB 5AYFA 2EQIA 4Z02A 2JVVA 2M1HA 1TTHB 3M58A 3HHTB 3QZ5B 2M9UA 1VIFA 2DFUA 1M1KR 4HVUA 4QQGA 4MZTA 2JZ2A 3M4YA 1X6GA 4J83A 2E6NA 2DZ9A 1IGQA 1W70A 5LJ3h 1VUBA 1U1SA 2LJ3A 2LRQA 3I55T 3CCST 3J7AF 1YITA 5GAOp 1H92A 4EDUA 3OMGA 4JPBW 4JZ4A 3G1JA 4JJCA 3EGUA 2CSIA 2QAZA 4C8QA 2J6OA 3C95A 1QWEA 4M7AF 2LP5A 2RQTA 1ABQA 3TSZA 4FT2A 2EPDA 2HZYA 1TSFA 2XICA 1YHQA 3OYJA 1XJWB 1K4US 2EYZA 4Y92A 1VQ9A 2R5MA 1B7TA 4M7DF 2KAFA 3UA6A 5EC7A 4XK8E 4BE2A 2LQNA 1ZX6A 3EG9A 2A37A 3ZBDA 2XI9A 4CRIA 2Y4XA 4AFUC 1VQOT 1WIEA 2CDTA 2ROLA 2DERA 2DVEA 3HP9A 5CIUA 1FMVA 5D7UA 1K8AR 4IUQA 4CC3A 3GPLA 1GL5A 4M75G 2EW3A 4C92A 4A53A 4BUGA 1WXUA 1OX9A 2YWWA 3CCUT 3OB9A 5C0MA 1YIJQ 1ZUYA 1Y96B 1RAAB 3RUXA 4PJMA 3JCMe 2L8DA 1VQKA 1I5OB 2LT4A 1RLQC 2HAXA 3AT1B 2RMOA 2LJ1A 4AG1C 3KXTA 2E64A 5GAN5 5IAYA 1NYFA 4LD6A 2EQMA 2HNIA 3JB9H 4FYXB 3OYAA 2E12A 1YJ9Q 3R6OA 1VQ4T 1JXOA 1E6GA 5I11A 3HRUA 2MYSA 3CEYA 4M75C 3JSCA 1LJOA 1BCMA 2CP6A 3FC3A 4BE0A 1KFZA 5IH2A 2VGMA 3EHRA 4IKFA 4OGEA 3MEWA 3NTKA 3QSUA 2EYYA 3RKYA 4HCBA 1QW1A 2LC4A 2LX9A 5GAN7 1UGRB 2JT4A 3VS7A 3CC2T 2X4XA 2VGNA 1HJDA 3V8LA 1U06A 4DBFA 2AIRB 1TS9A 2HQHA 4HVWA 4OB1B 2DE0X 4RG2A 1T3SA 1KIKA 2K5LA 2ROTA 4JJDA 2E4HA 3OSVA 4XU1A 3CMEA 1BI2A 1IZ6A 4C0GA 2L3SA 1OYXA 1YBYA 2VASA 4IURA 2ZPHB 4J7FA 4BI3A 3CC4Q 8AT1B 4M78F 2DJQA 4IUPA 3CCEA 2LX7A 1VYUA 4M75B 2OAWA 4XQ3A 1JO8A 1SSFA 2CT3A 1S72T 1Q81C 3WXMB 2KBTA 4GBQA 5KYYA 1ACMB 4EMKC 2LQWA 1MV0B 2AZSA 4C0DC 3MCAB 5LJ5g 1G3WA 4BE1A 2DTOA 2ENMA 3QYGB 2FRWA 1VIEA 4F14A 4L5GA 4QVZA 1HK9A 1YJ9T 2VC8A 1VQNQ 5DY9A 3CMAQ 1QP2A 3QYHB 4D6WA 2H3EB 1FXXA 3CQTA 3C0CA 5LJ5h 2FYKA 4F7UE 4B9WA 1N27A 3L2RA 2O01E 3GOXA 1RL2A 4A4HA 2XKOC 2KSSA 4A4GA 3CCJA 1SHFA 3M0PA 1PHTA 3P8DA 1O9SA 2MIOA 4CC4B 2VKNA 3CCLQ 2QI2A 3VKIA 4A54A 3SD4A 1BK2A 1M9SA 4J7IA 2CGHA 1VQ7Q 3CCSA 1G2BA 1GBQA 2CUBA 3A1PA 1I81A 2PVOB 3OS5A 4PLIA 2DL4A 5KYXA 3O8VA 2EKOA 2JS2A 4LUEA 1QQJA 2XG8D 4FW2A 5HKCA 2QASA 4RTZA 1Q82C 2DEQA 4C0DB 4FM4B 3CCMT 3EGDB 1D0XA 2RI2A 4OGCA 2M02A 4OF1A 1NBEB 2PU9B 3GLXA 3M56A 4M77F 3CD6Q 2XDBA 1FMWA 2A0FB 3Q1JA 3EFOA 3OYKA 2DIGA 4KRTA 3MHXA 4PJOE 5HCKA 1G83A 2QGGA 2DL7A 4E7JA 4J9HA 2BUDA 3MEVA 3QUIA 1XOVA 2KT1A 2R57A 5FROA 5GAN3 5DLOA 3LYIA 2X35A 1I5LA 1QVFP 4PJJA 2RA2A 4XU3A 3BDUA 1KC8C 1TU0B 4MMLA 2C0TA 1VQMT 4RTTA 1TG0A 1VQOA 5CKBA 5GAN4 2HMAA 2HSEB 1LCKA 2KQWA 1VQ5T 2EYXA 2GQVA 3RR6A 2ZPEB 2ABLA 3EGXB 1VQNT 2M0YA 2DETA 2I2LA 4ME7A 4M7AA 1Y0MA 1W2BP 3CC7Q 1NJIC 3BDLA 2FPDA 5GAMd 1IHWA 4JDSA 2KE9A 3CCUA 3C12A 3HTRA 1YJNT 1K9MC 4ANJA 3GBQA 3A8GB 4PJLA 1WJSA 3VS0A 2BIVA 2AKKA 1RACB 4OMNA 3X28B 2IPOB 2EGCA 2R58A 2HSPA 1AZGB 1D09B 1I8FA 4YTLA 1JJ2A 1BIAA 4M7DA 1NPRA 3L42A 1QVPA 3DLLA 4KUDK 1B34B 1AWWA 4OMFB 4DQ2A 1QCFA 4J6XA 1Q7YC 2C0IA 2XHCA 2KVQG 4OMPA 2JN0A 4PKCC 3S3OA 2AHJB 2EGEA 1GRIA 4DOVA 3SWNC 4V2SA 1VQ4A 3I56Q 1WPYA 1M3CA 3META 2OTJQ 2OX7A 1TWBA 4OB2B 3M57A 4XTVA 2K3YA 1SG5A 4DBRA 5GAN6 4XU2A 4VUBA 2QDYB 2RJCA 3D7SB 3MP6A 2HDAA 1JU5C 4UC4A 2H3JA 3NTHA 5KYWA 1QWFA 2QYZA 3PVLA 3CCRT 1PC0A 3MP1A 1M90C 3M0RA 4N0AC 2O4XA 2DXCA 2HQXA 2P0QA 3OW2S 1T3LA 3CC2A 4J9DA 1M1KC 1OZ3A 4HKEA 1OZ2A 1RI9A 2DKGA 2KYBA 2JM9A 4C8QE 3PIOA 5A0LA 3X24B 1FMKA 2DVJA 2V8IA 3CPWS 5AT1B 1AD5A 2YRCA 4OMMA 1ZUUA 5IHIA 1TXQA 3VJPA 2F5TX 3EG3A 2FZKB 1ZSZA 2DNUA 3MO8A 4KH1B 4J9BA 4R55A 1YI2Q 2RD1A 1KJWA 3SWNB 1M90U 4B6MA 2M51A 3VS5A 3A8MB 1JQQA 2E41A 3LWIA 2KK4A 5GMKm 5KCOA 3VS2A 1S72A 2ZPGB 1VYTA 2DBKA 4RKUE 3T9NA 2LZ6B 1LVKA 1AHJB 2VVKA 1PSFA 2Y4YA 4HCCA 2ATCB 2D8JA 5GANe 1IXDA 2W0ZA 3A8HB 2O31A 2J05A 4C92E 1PKTA 3PE0A 4JUVA 1U5SA 4KGXB 2P4TA 4PJOA 2ZPIB 2RB6A 3RDVA 1YJ9A 1SSHA 4AG2C 1X6BA 1KD1U 3FEOA 4XTWA 3S3MA 3JRZA 2OTJT 3M53A 4F16A 3H0FA 4F7UG 4M78A 2HKQB 4E47A 2QQSA 3MEAA 3SDZA 5CK9A 1VQPQ 1PSEA 5GANd 4R56A 2E5KA 2ZZDA 3M59A 1D3BB 1R8OB 3PVQA 4HVVA 2K79A 4HCKA 3KBGA 2DYBA 3CCVQ 3PGGA 4A4FA 5GAMf 3H6ZA 3GNGA 4BI4A 3QG1A 2DXTA 3CCMA 4OB0B 2P84A 4C8QD 1OULA 2BZ8A 5GAOr 1WQWA 3M4GA 2A3LA 1OOTA 3V7RA 5KYUB 3VS4A 4QT7A 1LOJA 4E7ZA 4CC7A 2NUPA 1C1AA 2V26A 2GNCA 2HBWA 2RK1A 2YHTA 5FLXE 6AT1B 3L2QA 1MNDA 2AK5A 1R0CB 2B86A 3EHQA 3NHNA 5LJ3e 2PUKB 3E19A 1VQMA 1MMDA 1ZQ1A 4OMOA 2FO0A 2D9TA 2EJFA 1VQ5A 4II1A 5KH6A 2YRDA 1MHNA 2SRCA 1FWZA 2MCNA 3RKXA 3L2UA 3CXCA 2HQEA 1VQNA 1PKSA 4WF2A 2QQAA 5KE3A 4GLKA 5I21A 1U3OA 4E7KA 4C92D 4JLGA 4MDWA 5KYWB 1WLPB 2FPEA 3DKMA 3E2UA 2DL5A 1PG5B 4M77A 2DTHA 1YJNA 3CBMA 1UECA 2O4XB 4PFPA 3G71Q 3G7ZA 2DMOA 3X26B 2QA4Q 4MZPA 2XD0A 3G6EQ 1N8RC 1BI1A 4RCCA 4NL3A 4XTXA 3I5SA 4RTXA 5C6SA 1YN8A 5CKFA 3DB4A 1WXBA 2EKHA 1XNIA 3E9FA 4F7UB 2RJDA 3KUFA 2E3HA 1JBMA 2E70A 1X01A 4PFOA 1G3TA 1X2QA 3FDRA 9ATCB 2GFUA 5A0GA 5GAOn 2BTTA 3BW1A 3VRZA 2O9VA 4MZMA 2NUTB 2BKDN 3CPFA 4F17A 2CH4A 3E1SA 4O5VA 3OW2P 2G3RA 2YSQA 1P92A 3A5ZB 1M27C 3PMIA 5GAOl 1N8RU 2LNHB 2LCSA 1YNZA 3FB9A 1Y07A 1QVFS 3A8LB 2KR3A 2FHDA 3CCRA 3CPWP 1X75C 1WFWA 3L1AA 2EQUA 2MOXA 5FWCA 2YT6A 4QQDA 1Q86R 1VQLQ 2DL3A 4PJOB 1KQSS 3CBPA 4C8QG 1WGSA 2V8KA 1W2BS 2JJ9A 1M2VB 4DBQA 2D0NA 3MJXA 2JS0A 3MEUA 2P4RA 2KYMA 4OMLA 1QKXA 1D1BA 2RHUA 3REBB 1A0NB 3OYHA 2CZ0B 2E10A 2DK3A 1FYNA 3CCQQ 1OPKA 2DM1A 3JCMd 2VWFA 1C0MA 3SEMA 1CKAA 5IHKA 1PCXA 2CUDA 4HT8A 4HXJA 1M1FA 1AT1B 4KT0E 2RH2A 3ZFJA 1TOVA 3HFOA 1K73R 2QK0A 4C0ZA 3EAEA 4C8QC 1O75A 1N5ZA 4FU6A 2VXFA 4M7AE 4FIBA 1GCQA 4JRIA 1UGQB 4C92G 1OPLA 2GQIA 2E6ZA 3TEEA 3RNJA 3GIBA 3JCMb 1M5Q1 2OTJA 1WYXA 3M5AA 1HD3A 1WHGA 3G4SA 3LGLA 2F69A 2LCCA 4FW1A 4M7DE 2DAQA 2MWOA 2CREA 2K3BA 2RHXA 4CC2A 4E7IA 4Z89A 5A0DA 3MPUB 4BD3A 2OTLQ 1X6OA 3HRSA 4DEYA 5FWBA 1PRMC 2L89A 2RHYA 1YIJT 2R5AA 2ZPFB 3MKDA 1YCYA 1WHJA 4IUVA 2DD5A 3SFMA 1V76A 3FRNA 3H0IA 3OYIA 1NEBA 4BB7A 4C92C 3EH2A 1VQ6Q 4HT9A 2FB7A 3NMZC 4PK4A 4AFZC 4KH0B 2RQRA 4EMHA 1VQ8Q 2D0QB 4C8QB 2JM8A 5L8RE 1Y7XA 3EG1A 2EBPA 2GGRA 3I35A 5LJ5e 2QTXA 4O6JA 5CO7A 3WVDB 3HKSA 2HL3A 4ZTFA 2FG0A 3UF4A 1UEBA 2NLUA 4RCBA 4WTOB 4X9CA 2VXEA 3VRYA 1Q81U 3JB9G 1EX4A 3BY7A 2AZVA 1K1ZA 4N4IA 5IXBA 1U8RA 1R0BG 1YITQ 2ECZA 4C5IA 3GP8A 1BYMA 2X9HA 1IREB 2AT1B 2BZYA 1QVGP 3EG9B 5KE2A 2ED0A 1H3HA 1GFCA 2BZXA 3O5ZA 2CZ7B 5HK3A 1G3SA 3FLGA 3SHWA 3I55A 1VA7A 2D1XA 4RMOA 3CPWA 1WI7A 2KT8A 4PJNA 1YHQQ 2GFAA 1BU1A 2X3WD 1RADB 2KDSA 2JUFA 4C92B 4LD9K 5EG2A 1QLYA 3M55A 1VQ9Q 4EIKA 4NOYA 4M75F 1WNLA 5GAN2 3AHUA 2YUQA 3CBOA 3JAME 4KGVB 3ULRB 3CC4T 2OTLT 4D8DA 4LDYA 1H3ZA 3OQ5A 4A63B 4M7DD 3JCMc 1SRMA 1WJRA 1M3AA 2FRYA 3KFVA 3QXEB 3NGPA 3ASKA 4E7HA 5CR2A 1CKBA 1AWJA 5CVIA 5GAMj 4J9CA 2D6FA 1Q82U 2YUNA 3JCMf 4M78E 3DLMA 2QEXQ 3M9QA 4GY5A 3FIFA 2FL7A 2DO3A 3ZEHA 2DIQA 3BE3A 3RESA 1N9RA 1BKBA 2GTJA 1VQKQ 4JS4A 1RAFB 2QG9B 5I2MA 1QCNA 1H641 2RO0A 1KQSP 3CMAT 2KRSA 2E65A 2PTKA 3H41A 1W6XA 4J9IA 5GAMh 1RAGB 4M4ZA 5L23A 4IUTA 1CSKA 1I07A 2CS7A 1JB0E 1V29B 1WZOA 2LTOA 1RABB 3OBYA 3P8HA 3HL8A 2ZAEA 2DXUA 4LUDA 2ESWA 2OI3A 1TUDA 2KGTA 2O88A 1KC8U 3CCLT 3V8JA 4KUIA 3UWNA 3OA6A 5FRMA 3HRTA 2JOYA 1QKWA 4FT4A 1VQ7T 1YJWQ 1UFFA 1RAHB 3JB9I 1MGQA 5HK0A 1NJIU 5KYNA 4FYWB 1K9MU 2LQ8A 2V1QA 3LLRA 2RPNA 2LMJA 3HFNA 3LH5A 5GMKi 4AFSC 1SEMA 2K3XA 2XDDA 3VV0A 4AFQC 5KYYB 3CD6T 4A4KA 1XTDA 3M0QA 4BY6C 2X4JA 4ZGJB 1T0JA 1Q7YU 1X69A 3EFRA 3CMEQ 1KSWA 1PM3A 3RMSA 4PJOD 1M30A 2RJEA 4M77E 3ZL7C 2IIMA 2KMTA 1UGSB 4F04B 3OYFA 3JCMV 3OYBA 2QEXT 3OS2A 3CCEQ 3QWXX 1HSQA 2F2VA 1IO6A 3HPWA 3NPFA 3OYCA 4M78D 2DTIA 4M7DG 5GMKj 3CC7T 4KULA 1XQHA 1M2OA 2DILA 1UB4A 2PVGB 3REAB 1N9SA 1G3YA 1YIJA 2A28A 4ELZC 2CYZB 3EFSA 1M1KU 1W4SA 2CP0A 1B3QA 5CQXA 3TVTA 2KNBB 2DXBA 4BI8B 3VS3A 1LNXA 5GMKh 3M0TA 3V7SA 4JS5A 5KYXB 2PVDB 2OAUA 2AKLA 1ARKA 4BY6B 1SKUB 1C6VX 5J39A 2DPPB 2LNVA 2IG0A 2M0OA 1N6AA 3OYMA 5GANj 1YJWT 3MP8A 2RN8A 4K11A 3I56T 3CCJQ 1EFNA 5CKDA 2EQJA 1K8AC 5FU6B 4FSXA 4M7DC 3VS6A 5DLQE 2J6KA 3EFOB 1MMNA 4DOWA 1Y96A 1ZBJA 2DL8A 1QVFA 1WHKA 1SF9A 2EFIA 4JRKA 3L2ZA 3JCMQ 4JZ3A 4PLLA 1Q86C 2RM4A 5CAIA 2LT1A 4XTZA 4LN2A 2A36A 3P8BB 1W2BA 1WA7A 2CP3A
chains in the Genus database with same CATH topology
1HK9A 1X75C 3HSBA 2YRVA 3L1AA 2A7YA 2CZ1B 3LH0A 2EQUA 2VC8A 1YJ9T 3NTIA 5DY9A 1VQ9T 1QP2A 1K8AU 2PQWA 2LVMA 3PFSA 3QYHB 4QQDA 3J81E 3G71A 2MF2A 4M7DA 5GMKl 4M7AB 2QA4A 4D6WA 3JCMW 1EIFA 5D6YA 1M8VA 5FRNA 1FXXA 4PJOB 3G6EA 4E7LA 1KQSS 3VYGA 5LJ5h 2CZ6B 2FYKA 1WGSA 2V8KA 3CBPA 4M77D 4C8QG 4F7UE 5J3BA 1HXDA 1W2BS 4B9WA 4LDWA 1N27A 1JJ2S 3RKWA 4N4GA 3L2RA 2DD4A 2O01E 1WQ7A 2XIDA 3V8KA 1RL2A 4A4HA 3GOXA 3JCMJ 2XKOC 2KSSA 1YI2T 4A4GA 4BDYA 3CCJA 4XTUA 4DA4A 3MEUA 3RERA 3CC4A 3P8DA 4M7AG 2OTLA 1O9SA 4M75E 2QI2A 4M7DB 4PJOG 3VKIA 5FU6C 4A54A 2RHUA 3OYHA 3SD4A 2YLBA 1M9SA 2CZ0B 3RMQA 2E10A 4J7IA 4ZN3A 2DK3A 1K73C 2CGHA 3UDCA 5I2SA 3CCSA 3X20B 2QQRA 2RI5A 3JCMd 5A2QE 4LDUA 5CQYA 1I81A 2PVOB 2GF7A 3OS5A 4QVCA 4PLIA 2EIFA 4XU0A 2K4YA 3O8VA 4LDXA 2EKOA 2XG8D 1Q82C 5HKCA 1I4K1 1QVGA 1VQKT 5CKHA 2DEQA 4M78G 4HT8A 1M1FA 4C0DB 4FM4B 5LJ3j 3TREA 3CCMT 3NFCA 2RI2A 4XAXB 1NE8A 4OGCA 4KT0E 2WACA 4F7UA 4L59A 2RH2A 3S6WA 3ZFJA 3HFOA 3QDRB 4OF1A 4C0ZA 1JRIA 3EAEA 4C8QC 2ZPBB 2FVUA 2PU9B 1BI3A 3GLXA 3M56A 2XK0A 1O75A 4M77F 5LJ5f 5GMKe 4FU6A 2VXFA 3CMAA 3CCJT 2XDBA 3JB9F 4M7AE 4FIBA 3QO3A 3Q1JA 4JRIA 1QVGS 2WSFE 1UGQB 1VQLA 3OYKA 2DIGA 4C92G 3MHXA 4M75A 3CC2T 4PJOE 2E6ZA 4E7JA 1FX7A 5FU7C 2WSCE 3TEEA 4M7AC 2BUDA 4Y91A 3GIBA 3JCMb 1K73U 2CKKA 2HBPA 3MEVA 1M5Q1 5LJ3d 3S3NA 1KD1C 2OTJA 4PJOC 3QUIA 1TH7A 3M5AA 1XOVA 5LL6S 2R57A 5FROA 5GAN3 3G4SA 1KHIA 5DLOA 3LGLA 3LYIA 5CCAA 2X35A 1VQPT 1U1TA 1I5LA 4OP0A 3SB2A 2F69A 2LCCA 2RA2A 3BDUA 4RG8A 4XU3A 4M7DE 5GANg 1KC8C 5GAN8 2DAQA 2MWOA 2RHZA 4MMLA 3CCLA 1VQMT 1VQOA 2RHXA 5CKBA 5GAN4 4E7IA 5A0DA 2IVWA 3PNWC 2MI6A 2KQWA 4BD3A 1VQ5T 4OB3B 1VQ7A 4M78C 1X6OA 2GQVA 3HRSA 4HA8A 3CCQA 2ZPEB 4C5HA 2L89A 2RHYA 1DJ7B 1YIJT 4QVDA 1VQNT 2I2LA 2R5AA 4ME7A 2ZPFB 3CCVT 4M7AA 1YCYA 4XTYA 4KBMB 1NJIC 4IUVA 2DD5A 3BDLA 3SFMA 4CI0C 5GAMd 3ME9A 2JNGA 2DZCA 1ZBXA 3FRNA 4JDSA 3CCUA 4ZGEB 3C12A 3OYIA 1YJNT 5GANh 1K9MC 4JJNK 3A8GB 4BB7A 4C92C 2K57A 4J5YA 1KQ1A 3OS1A 1WJSA 4NS5A 4HT9A 3PT9A 2FB7A 2BIVA 3OY9A 3VYHB 2X4WA 4EMHA 3G4ST 3X28B 2RI3A 2XDPA 2R58A 3CD6A 1KQSA 2D0QB 4C8QB 3OSSC 3C94A 2KY9A 1I8FA 3CMET 2V8JA 2RHIA 1BIAA 4QW2A 4YTLA 1NPRA 3L42A 1QVPA 3LGFA 3QBYA 1Y7XA 4Q5WA 3DLLA 4KUDK 1B34B 4OMFB 2LQKA 4DQ2A 5LJ5e 2QTXA 3QKJA 4J6XA 4O6JA 1Q7YC 2LCLA 5CO7A 3WVDB 5FU7B 3HKSA 2XHCA 2KVQG 4ZTFA 4PL6A 3VUZA 2JN0A 4PKCC 3S3OA 2AHJB 1UEBA 2NLUA 2MMPA 4JLIA 4RCBA 4EMKA 4ZGDB 4M75D 4X9CA 3CCET 4DOVA 3SWNC 4V2SA 1VQ4A 5GAOq 3JCMg 2VXEA 1WPYA 4N4HA 4M77G 5KCHA 3JB9D 1Q81U 3JB9G 3META 3OYLA 3BY7A 3N5BB 4N4IA 2QEXA 1U8RA 4OB2B 3M57A 4XTVA 2K3YA 3INZA 2D6FA 3JCMP 4C5IA 1Q86U 2C06A 3GP8A 1BYMA 5GAN6 4XU2A 4VUBA 1IREB 2QDYB 2RJCA 4M7DG 3FJPA 5KE2A 4LDVA 4MMKA 4MDXA 3MP6A 3UPUA 2CZ7B 4M78B 4UC4A 5GANf 5M9OA 2H3JA 3NTHA 4J8OA 3H8ZA 5HK3A 1JJ2A 1BIBA 1G3SA 3A8OB 3FLGA 2GCXA 3CC7A 3PIPA 3CCRT 4OVAA 3I55A 2XU8A 3JCMh 3QJYA 4RMOA 2RJFA 3MP1A 3CPWA 1M90C 2B8AA 4N0AC 2O4XA 2DXCA 2HQXA 2P0QA 3OW2S 2VYTA 2VV5A 4F7UF 1RI0A 3GF5A 3G71T 2GFAA 3QZ9B 5L8RE 3CC2A 1VQ6A 3DB3A 1M1KC 3OBWA 1OZ3A 2QA4T 4HKEA 4C92B 2KDSA 2JUFA 1OZ2A 2EQKA 5LJ3g 2DKGA 4LD9K 3M54A 2P0KA 3LW5E 5EG2A 4C8QE 4L6V5 3M55A 3G6ET 5D6XA 1VQ8A 1G5VA 3PIOA 5A0LA 3X24B 4NOYA 3V7CA 2V8IA 3CPWS 4M75F 1WNLA 5GAN2 3AHUA 3CBOA 5AYFA 4Z02A 4M77C 3JAME 2JVVA 2M1HA 3M58A 3VJPA 3HHTB 2E5QA 3QZ5B 3QPHA 4X34A 2M9UA 3CC4T 1VIFA 2OTLT 2F5TX 4LDYA 3WVEB 3OQ5A 1H3ZA 4MZTA 2L5QA 2JZ2A 3M4YA 4QQGA 5GAOm 3GNFB 3MO8A 3JCMc 1YJWA 1NPPA 4M7DD 4J83A 2E6NA 4Y28E 4R55A 4NL2A 2DZ9A 3I56A 5LJ3h 2RD1A 1WJRA 1VUBA 1U1SA 2LRQA 3I55T 3CCST 3SWNB 3QXEB 1M90U 3J7AF 3A8MB 3ASKA 4E7HA 5CR2A 1VQ6T 2LDMA 1YITA 2PUOB 1OI1A 5CVIA 5GAMj 2E41A 3BFMA 5GAOp 2KK4A 4C5GA 4EDUA 3LWIA 5GMKm 3OMGA 5KCOA 1Q82U 3JCMf 4M78E 1S72A 3DLMA 4QQ6A 2ZPGB 3T9NA 4RKUE 3OYGA 3RIRA 3M9QA 4GY5A 3FIFA 2FL7A 2DO3A 3ZEHA 3C95A 4C8QA 2DIQA 3RESA 4M7AF 1N9RA 1AHJB 1BKBA 1PSFA 2Y4YA 2EAYA 2P0PA 4HCCA 1B34A 4PJOF 3CXCS 4JS4A 4FT2A 5I2MA 4ZN1A 5GANe 1H641 2RO0A 4BACA 3CMAT 2E65A 3A8HB 2XICA 4C92E 3J80E 1YHQA 2WSEE 2EJGA 2MAMA 5GAMh 3OYJA 4JUVA 1VQLT 2P4TA 4PJOA 2ZPIB 2RB6A 4IUTA 1YJ9A 2CS7A 1JB0E 1VQ9A 3URGA 1KD1U 1V29B 2R5MA 2LTOA 3FEOA 4XTWA 3S3MA 3JRZA 3OBYA 4M7DF 2OTJT 2KAFA 3TU4K 3P8HA 3M53A 4C0FA 3HL8A 2DXUA 4J6WA 4XK8E 5LJ3f 4CRIA 4BE2A 3ZBDA 2XI9A 4M77B 1KC8U 5J26A 2Y4XA 4M78A 4PNOA 4X9DA 4F7UG 4E47A 3CCLT 1ZHIA 2QQSA 1VQOT 3MEAA 3SDZA 4KUIA 5CKEA 3V8JA 5IT9E 3OYNA 2DVEA 3UWNA 3OA6A 5FRMA 3HRTA 2JOYA 3HP9A 5CIUA 5CK9A 1YI2A 1PSEA 5GANd 4IUUA 4FT4A 4R56A 1GXIE 4ATOA 1VQ7T 3CCQT 2RK2A 4IUQA 3QIIA 3GPLA 3JCMX 2ZZDA 4M75G 3JB9I 5LJ5j 1MGQA 3M59A 3PTAA 1D3BB 5HK0A 1R8OB 2X4YA 1KQ2A 1M4ZA 1NJIU 4C92A 4A53A 4BUGA 1KHCA 3CCUT 1K9MU 3OB9A 2LQ8A 4J6YA 3LLRA 5C0MA 3KBGA 3HFNA 2EWNA 3OYYA 3OW2A 1BI0A 1Y96B 3PGGA 3RUXA 4A4FA 5GAMf 5GMKi 3L2VA 3JCMe 2L8DA 1KG1A 1VQKA 2LT4A 3H6ZA 2K3XA 2XDDA 3GNGA 3VV0A 2HAXA 4BI4A 3QG1A 2DXTA 3CCMA 4OB0B 3CD6T 4A4KA 4C8QD 3X25B 1WQWA 1XTDA 5LJ5d 5GAOr 3M4GA 2A3LA 5HY6A 3KXTA 2E64A 4BY6C 2X4JA 1NZ9A 2JTFA 4ZGJB 5GAN5 5IAYA 3V7RA 1Q7YU 3SWNA 4JRQA 1LOJA 4LD6A 3EFRA 2EQMA 2HNIA 4M7AD 3JB9H 3QJ6A 3F70A 3OYAA 3VU3C 2E12A 3RMSA 4PJOD 3R6OA 2RJEA 4M77E 2VUBA 1VQ4T 2RK1A 2YHTA 2DJZA 2F5KA 5FLXE 3TCJA 2KMTA 1UGSB 3HRUA 2QQ9A 3OYFA 3L2QA 3CEYA 4M75C 3JSCA 3JCMV 3OYBA 2QEXT 2MWPA 1LJOA 3OS2A 1M1GA 4JRPA 2YLCA 3FC3A 1VQPA 4EMKB 5LJ3e 4BE0A 2VGMA 2PUKB 2M16A 3HPWA 4IKFA 3E19A 3OYCA 4M78D 2DTIA 3MEWA 3NTKA 4OGEA 3JB9J 5GMKj 1ZQ1A 4N0AA 1VQMA 5IN1A 3QSUA 4HCZA 3CC7T 2D9TA 2EJFA 3C4SA 3E9GA 3RKYA 4KULA 1VQ5A 4II1A 5KH6A 1XQHA 3L2WA 4P5NA 1UB4A 1MHNA 1FWZA 2PVGB 2K5FA 3RKXA 3L2UA 1N9SA 3CXCA 1QW1A 3PMTA 4HCBA 4C8QF 1G3YA 2HQEA 2Y90A 2E1HA 5GAMg 3OYEA 2LC4A 1YIJA 1VQNA 4ELZC 2LX9A 4WF2A 2QQAA 2CYZB 5GAN7 1UGRB 3EFSA 3CCVA 1M1KU 4C5EA 1W4SA 2X4XA 4GLKA 2VGNA 5I21A 5CQXA 5KE3A 4E7KA 4C92D 4JLGA 4MDWA 3V8LA 3DKMA 2DXBA 3OS0A 4BI8B 2QXFA 4M77A 2DTHA 1YJNA 4ELYC 1VQ8T 1LNXA 3CBMA 5GMKh 2O4XB 4OB1B 3G7ZA 3V7SA 5GAMe 3LX7A 4RG2A 4JS5A 3X26B 2PVDB 4BDZA 2EJ9A 2K5LA 2OAUA 1UGPB 3OYDA 4MZPA 2XD0A 4FL6A 5DM7R 4BY6B 1N8RC 1BI1A 4RCCA 4NL3A 3OSVA 4XTXA 5J39A 3UT1A 2DPPB 2LNVA 2IG0A 2M0OA 4XU1A 5C6SA 1N6AA 5CKFA 3CMEA 3DB4A 1BI2A 3E9FA 1XNIA 4F7UB 1IZ6A 3OYMA 2ZCFB 4C0GA 2RJDA 1D3BA 2K5IA 3KUFA 1OYXA 4EMGA 5GANj 1YJWT 1YBYA 3MP8A 2HD0A 4IURA 1QP3A 3I56T 1JBMA 2E70A 1X01A 2ZPHB 5CKDA 2EQJA 4J7FA 4BI3A 1G3TA 2ZGWA 4FSXA 5FU6B 1K8AC 4M7DC 4ZTJA 4M78F 3FDRA 4IUPA 3LWHA 2GFUA 1Y71A 2QQBA 5D6WA 5DLQE 5A0GA 3CCEA 3ER0A 2K2VA 5GAOn 4DOWA 1Y96A 4M75B 1YITT 3BW1A 4XQ3A 1SSFA 1QVFA 4MZMA 4TVRA 2EYQA 1S72T 3WXMB 1Q81C 2BKDN 3CPFA 4A4EA 2EFIA 4B9XA 4EMKC 3E1SA 1WJQA 4JRKA 4EPCA 4O5VA 2G3RA 3L2ZA 3QHSA 3JCMQ 1P92A 3OMCA 4PLLA 4C92F 1Q86C 4C0DC 2RM4A 5CAIA 3A5ZB 3PMIA 3MCAB 5LJ5g 2LT1A 5GAOl 3VUBA 1N8RU 1G3WA 4BE1A 4XTZA 3FB9A 1Y07A 1QVFS 2DTOA 2L3RA 3A8LB 3P8BB 3QYGB 2FHDA 2JTMA 1YHQT 1W2BA 3CCRA 1VIEA 4L5GA 4QVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L89 A;  2RHY A;  2YRV A;  1WJR A;  3QJ6 A;  3F70 A;  3LH0 A;  2EQU A;  3OYA A;  2LRQ A;  2R5A A;  3NTI A;  2RJE A;  2PQW A;  2LVM A;  3BDL A;  3PFS A;  3ASK A;  4IUV A;  4QQD A;  4E7H A;  3ME9 A;  2LDM A;  2F5K A;  1OI1 A;  3OYI A;  3OYF A;  3L2Q A;  5D6Y A;  3CEY A;  4C5G A;  4EDU A;  5FRN A;  3OMG A;  5KCO A;  3OYB A;  2MWP A;  3OS2 A;  3DLM A;  4QQ6 A;  4E7L A;  3OS1 A;  1WJS A;  1WGS A;  4NS5 A;  3OYG A;  2BIV A;  3FC3 A;  3M9Q A;  4GY5 A;  1N27 A;  3ZEH A;  4B9W A;  3OY9 A;  4BE0 A;  4N4G A;  2DIQ A;  3L2R A;  2X4W A;  2M16 A;  2RI3 A;  2XDP A;  4IKF A;  2R58 A;  3OYC A;  4A4H A;  3GOX A;  3MEW A;  4QVZ A;  3NTK A;  4A4G A;  4BDY A;  5IN1 A;  2RHI A;  4QW2 A;  3MEU A;  3OYE A;  3L42 A;  3LGF A;  3P8D A;  3QBY A;  4HCZ A;  4Q5W A;  2D9T A;  3C4S A;  2RO0 A;  3E9G A;  4BAC A;  4II1 A;  5KH6 A;  3L2W A;  1MHN A;  3OYJ A;  2RHU A;  3QKJ A;  3L2U A;  3OYH A;  3SD4 A;  3PMT A;  2HQE A;  4IUT A;  4ZTF A;  4PL6 A;  3S3O A;  2NLU A;  2QQR A;  4C5E A;  2RI5 A;  2X4X A;  5KE3 A;  4E7K A;  2R5M A;  2LTO A;  3FEO A;  3S3M A;  2GF7 A;  4N4H A;  4PLI A;  5KCH A;  3OS0 A;  3MET A;  3OYL A;  3P8H A;  3O8V A;  4N4I A;  2EKO A;  2O4X B;  4BE2 A;  4CRI A;  2K3Y A;  3LX7 A;  4RG2 A;  4BDZ A;  4C5I A;  5J26 A;  3OYD A;  2RI2 A;  4FL6 A;  2RJC A;  2QQS A;  2WAC A;  3MEA A;  4L59 A;  5KE2 A;  3S6W A;  3OYN A;  3UWN A;  3OA6 A;  3MP6 A;  3UT1 A;  5J39 A;  5C6S A;  2IG0 A;  2M0O A;  5CIU A;  4UC4 A;  5FRM A;  5M9O A;  3NTH A;  3DB4 A;  3E9F A;  3H8Z A;  1XNI A;  3EAE A;  3FLG A;  4IUU A;  3OYM A;  2RJD A;  3KUF A;  1OYX A;  2XK0 A;  4IUQ A;  3QII A;  4FU6 A;  4OVA A;  3MP8 A;  4C5H A;  4IUR A;  2RJF A;  3MP1 A;  3Q1J A;  2B8A A;  3OYK A;  2EQJ A;  2O4X A;  2DIG A;  2HQX A;  2X4Y A;  4ZTJ A;  3FDR A;  4IUP A;  2GFU A;  4E7J A;  5D6W A;  2VYT A;  1RI0 A;  2GFA A;  2BUD A;  1KHC A;  3DB3 A;  2CKK A;  3MEV A;  3OB9 A;  1OZ3 A;  5C0M A;  3LLR A;  3S3N A;  1SSF A;  1OZ2 A;  2EQK A;  2P0K A;  1G5V A;  5D6X A;  2R57 A;  5FRO A;  2BKD N;  4A4F A;  4A4E A;  2EFI A;  4B9X A;  3L2V A;  2L8D A;  3LGL A;  3LYI A;  1WJQ A;  2X35 A;  3H6Z A;  2K3X A;  2LCC A;  2G3R A;  3OMC A;  4PLL A;  2DAQ A;  2MWO A;  2RHZ A;  4Z02 A;  2M1H A;  2RHX A;  3PMI A;  2E5Q A;  4E7I A;  4X34 A;  2JTF A;  3PNW C;  4BE1 A;  1H3Z A;  3OQ5 A;  4BD3 A;  4QQG A;  5IAY A;  2JZ2 A;  2L3R A;  3MO8 A;  2FHD A;  2E6N A;  4LD6 A;  2EQM A; 
#chains in the Genus database with same CATH topology
 2DBM A;  2YRV A;  2A7Y A;  2CZ1 B;  3LH0 A;  1NEG A;  1K8A U;  2LVM A;  3J81 E;  1PNJ A;  4M7A B;  1EIF A;  5D6Y A;  5FRN A;  1UJY A;  1PD0 A;  4E7L A;  1AWO A;  2CZ6 B;  4M77 D;  1HXD A;  3R6N A;  1JJ2 S;  3RKW A;  4D8K A;  2XID A;  1YI2 T;  4BDY A;  4XTU A;  2BE7 D;  1YFN A;  1YWO A;  3CC4 A;  2OTL A;  2F2W A;  4M7D B;  4PJO G;  7AT1 B;  2Z0W A;  2YLB A;  1K73 C;  1YCS B;  3UDC A;  5I2S A;  1GFD A;  3X20 B;  1ZSZ C;  2RI5 A;  1YP5 A;  5CQY A;  4QVC A;  4RTU A;  2EIF A;  2FZG B;  4XU0 A;  4QKU A;  2K2M A;  4M78 G;  3CCU Q;  2YXY A;  5LJ3 j;  3TRE A;  3NFC A;  4XAX B;  1NE8 A;  3TSW A;  3S6W A;  1M90 R;  2FVU A;  2PNI A;  1BI3 A;  3CMA A;  3CCJ T;  1VOM A;  2YDL A;  1QVG S;  2WSF E;  4M75 A;  1K0X A;  1FX7 A;  2PZ1 A;  4Y91 A;  2NUZ A;  1K73 U;  2HBP A;  5LJ3 d;  1Z9Z A;  4PJO C;  1WHH A;  1TH7 A;  5LL6 S;  2ED1 A;  5IXF A;  1VQ4 Q;  5CCA A;  1VQP T;  1U1T A;  4OP0 A;  1M3B A;  4RG8 A;  4Z8A A;  3SB2 A;  4JJB A;  4R0K A;  3CCL A;  2NYS A;  1QCO A;  2RHZ A;  1OV3 A;  4DEX A;  1YWP A;  1ZSG A;  1VQ7 A;  4M78 C;  1KD1 R;  4OMQ A;  1QMC A;  3JV3 A;  1DJ7 B;  2HL5 C;  1M8M A;  1ZSZ B;  3CCV T;  2L3P A;  4XTY A;  1UGV A;  4CI0 C;  2JNG A;  2DZC A;  4ZGE B;  2DRM A;  2F2X A;  2K57 A;  4J5Y A;  3CC2 Q;  1KQ1 A;  3OS1 A;  4NS5 A;  1EZZ B;  3PT9 A;  2VB6 A;  2X4W A;  3H9N A;  1JEG A;  3CD6 A;  2KXD A;  1AOJ A;  1MMG A;  3C94 A;  2KY9 A;  2RHI A;  1OU9 A;  3OYE A;  3QBY A;  4Q5W A;  2RQW A;  3M0U A;  2RQU A;  3VUZ A;  2XMF A;  5ECA A;  4JLI A;  4ZGD B;  4EMK A;  2K9G A;  3QDF A;  3UAT A;  5GAO q;  3JCM g;  4N4H A;  4M77 G;  5KCH A;  3JB9 D;  3N5B B;  2QEX A;  3EGD A;  3JCM P;  2E3I A;  4E2F B;  3FJP A;  1ZLM A;  1S72 Q;  4MMK A;  4MDX A;  2L3Q A;  4M78 B;  5GAN f;  4J8O A;  3UA7 A;  1BIB A;  3A8O B;  2GCX A;  3CC7 A;  2XU8 A;  3JCM h;  1V1C A;  3QJY A;  2RJF A;  2B8A A;  2MPX C;  2VYT A;  2VV5 A;  4F7U F;  1RI0 A;  3GF5 A;  3G71 T;  4ORZ A;  4RTY A;  3DB3 A;  4RTV A;  2QA4 T;  2QDL A;  3M54 A;  3LW5 E;  3G6E T;  4IIO A;  1I0C A;  2J7I A;  3V7C A;  4ZNX A;  2DYI A;  4M77 C;  2E5Q A;  5GJW B;  1IHV A;  3QPH A;  4X34 A;  3WVE B;  3EGX A;  4FSS A;  2L5Q A;  5GAO m;  3GNF B;  1YJW A;  1NPP A;  4Y28 E;  4NL2 A;  3THK A;  3I56 A;  2SEM A;  1AZE A;  2LDM A;  3EG0 A;  2NUP B;  2PUO B;  1OI1 A;  2DF6 A;  2GTO A;  3BFM A;  4C5G A;  4QQ6 A;  1X2K A;  3OYG A;  3RIR A;  2CH4 W;  2EAY A;  2P0P A;  1B34 A;  4PJO F;  3CXC S;  1OX8 A;  4ZN1 A;  4BAC A;  3CCM Q;  3J80 E;  2WSE E;  2EJG A;  2MAM A;  1JJ2 P;  1VQL T;  2J6F A;  2F1L A;  3URG A;  1NLO C;  2DEU A;  3TU4 K;  4C0F A;  2MK5 A;  4J6W A;  2RF0 A;  1MV3 A;  1UJ0 A;  5LJ3 f;  1N8R R;  4M77 B;  5J26 A;  4PNO A;  4X9D A;  1ZHI A;  4ESR A;  5IT9 E;  5CKE A;  3OYN A;  1YI2 A;  2FPF A;  2O2O A;  4IUU A;  4PFZ A;  2FEI A;  1GXI E;  4ATO A;  1SHG A;  3CCQ T;  2RK2 A;  3QII A;  1SPK A;  3I9Q A;  1VQM Q;  3JCM X;  5LJ5 j;  3PTA A;  2KXC A;  2X4Y A;  2H8H A;  1M4Z A;  1KQ2 A;  1UDL A;  2YUP A;  1VQ5 Q;  1RUW A;  1KHC A;  3FJ5 A;  4J6Y A;  2EWN A;  1UG1 A;  3OYY A;  3OW2 A;  1BI0 A;  2LJ0 A;  3L2V A;  2JXB A;  1KG1 A;  4IIM A;  1SRL A;  1YJN Q;  2JMA A;  2CP5 A;  2K6D A;  3X25 B;  4WCI A;  5LJ5 d;  5HY6 A;  1NZ9 A;  2JTF A;  1AEY A;  2CP7 A;  3SWN A;  4JRQ A;  4M7A D;  4RTW A;  3QJ6 A;  3F70 A;  3VU3 C;  1IB8 A;  2VUB A;  1ABO A;  2DJZ A;  2F5K A;  1GCQ C;  3TCJ A;  2QQ9 A;  2MWP A;  4JRP A;  1M1G A;  2YLC A;  3EG2 A;  1VQP A;  2KRO A;  4EMK B;  1X27 A;  1UUE A;  2M16 A;  1D0Z A;  1WHM A;  3JB9 J;  4N0A A;  5IN1 A;  4HCZ A;  2DA9 A;  2X3X D;  3C4S A;  2KI7 A;  3E9G A;  2OJ2 A;  1K76 A;  3L2W A;  4P5N A;  2QGF B;  2EVR A;  2K5F A;  3PMT A;  4C8Q F;  2Y90 A;  2E1H A;  5GAM g;  1E6H A;  3CCV A;  1VQ6 T;  4C5E A;  3CCR Q;  1RAI B;  2KRM A;  1HYO A;  2QTV A;  3OS0 A;  2QXF A;  1TUC A;  1VQ8 T;  4ELY C;  1S1N A;  3QWY A;  5GAM e;  3LX7 A;  4BDZ A;  2EJ9 A;  1H8K A;  1UGP B;  3OYD A;  4FL6 A;  5DM7 R;  1Q95 G;  2COY A;  3UT1 A;  2HEQ A;  2JMC A;  2ZCF B;  1D3B A;  2K5I A;  4EMG A;  1UHC A;  1MNE A;  2DRK A;  2HD0 A;  4DBH A;  1QP3 A;  1K9A A;  2ZGW A;  4ZTJ A;  3LWH A;  1Y71 A;  2QQB A;  5D6W A;  3ER0 A;  2K2V A;  4RUG A;  1YIT T;  2JTE A;  2V1R A;  4KGZ B;  4TVR A;  2DLP A;  2EYQ A;  2GBQ A;  4A4E A;  4B9X A;  2HCK A;  1Z9Q A;  1WJQ A;  4EPC A;  1RLP C;  1AWX A;  3QHS A;  3OMC A;  4C92 F;  1IGU A;  5KYU A;  2C0O A;  3VUB A;  1IRX A;  2RQV A;  2L3R A;  1YHQ T;  2JTM A;  1NM7 A;  4J9E A;  1Q81 R;  3HSB A;  1AVZ C;  1WDX A;  2DX1 A;  1W1F A;  3NTI A;  1UE9 A;  1VQ9 T;  2PQW A;  3G71 A;  3PFS A;  3U23 A;  2MF2 A;  2EGA A;  5GMK l;  2QA4 A;  3JCM W;  1LPL A;  1M8V A;  1J3T A;  1VYV A;  1G8X A;  3G6E A;  3VYG A;  5J3B A;  4LDW A;  1E7O A;  1BB9 A;  4N4G A;  3RBB B;  1NG2 A;  2DD4 A;  1WQ7 A;  3V8K A;  4LXC A;  2COW A;  3JCM J;  3G4S Q;  2J06 A;  2L2P A;  4FCY A;  4DA4 A;  3RER A;  4M7A G;  1UHF A;  1OQK A;  4M75 E;  1PWT A;  2RNA A;  5FU6 C;  4LNP A;  3RMQ A;  4ZN3 A;  2K7A A;  2QQR A;  1NLP C;  3CXC P;  1F1B B;  1I1J A;  5A2Q E;  4LDU A;  2GF7 A;  5I22 A;  2K4Y A;  4LDX A;  1BCO A;  2D8H A;  1R77 A;  1I4K 1;  2NWM A;  1QVG A;  1VQK T;  3A98 A;  5CKH A;  1B07 A;  3VS1 A;  2I0N A;  2WAC A;  4F7U A;  4L59 A;  3QDR B;  1OU8 A;  1ZUK A;  4AT1 B;  1D1C A;  1JRI A;  1MMA A;  2ZPB B;  2XK0 A;  5LJ5 f;  3JB9 F;  5GMK e;  2COZ A;  3QO3 A;  1Q82 R;  2BE9 B;  2CSQ A;  2W10 A;  1VQL A;  1X43 A;  4E6R A;  5FU7 C;  2WSC E;  4Z88 A;  4M7A C;  1GCP A;  2NUT A;  1ZA2 B;  2CKK A;  4AMC A;  3S3N A;  1KD1 C;  2KRN A;  1D1A A;  1KHI A;  1RAE B;  3I5R A;  1WX6 A;  2O9S A;  1ZA1 B;  5GAN g;  5GAN 8;  4FYV B;  5IHN A;  1UTI A;  1WXT A;  4J9G A;  1K0S A;  2IVW A;  3H0H A;  3PNW C;  2MI6 A;  4OB3 B;  1NYG A;  4HA8 A;  3CCQ A;  2X51 A;  4C5H A;  4QVD A;  1BBZ A;  1JXM A;  4KBM B;  2FZC B;  1T0H A;  3I55 Q;  3CCS Q;  5GJV B;  1KC8 R;  2L0A A;  3ME9 A;  1ZBX A;  2EYW A;  5GAN h;  1M2V A;  4JJN K;  2HKN A;  2JW4 A;  1Y57 A;  3OY9 A;  4LE9 A;  3VYH B;  3G4S T;  2RI3 A;  2XDP A;  1KQS A;  2KEA A;  3OSS C;  2CT4 A;  3CME T;  1NJI R;  2V8J A;  4QW2 A;  3LGF A;  1OEB A;  1K9M R;  4FYY B;  2LQK A;  8ATC B;  3QKJ A;  2LCL A;  5FU7 B;  1PD1 A;  4PL6 A;  1MUZ A;  3CCE T;  2MMP A;  2CP2 A;  4M75 D;  3OYL A;  1D0Y A;  4J9F A;  3INZ A;  1Q86 U;  2C06 A;  1Q7Y R;  4LDV A;  1VQO Q;  2G6F X;  3UPU A;  3TQ7 P;  2A08 A;  3M0S A;  5M9O A;  3H8Z A;  3EH1 A;  5FW9 A;  1WHL A;  3PIP A;  4OVA A;  1GBR A;  3QZ9 B;  1VQ6 A;  1PRL C;  3OBW A;  4E7S A;  2EQK A;  5LJ3 g;  2P0K A;  1G5V A;  4L6V 5;  5D6X A;  1VQ8 A;  4GLM A;  2YUO A;  1KK7 A;  3IQL A;  4X1V A;  1TUG B;  5AYF A;  2EQI A;  4Z02 A;  2JVV A;  2M1H A;  1TTH B;  3M58 A;  3HHT B;  3QZ5 B;  2M9U A;  1VIF A;  2DFU A;  1M1K R;  4HVU A;  4QQG A;  4MZT A;  2JZ2 A;  3M4Y A;  1X6G A;  4J83 A;  2E6N A;  2DZ9 A;  1IGQ A;  1W70 A;  5LJ3 h;  1VUB A;  1U1S A;  2LJ3 A;  2LRQ A;  3I55 T;  3CCS T;  3J7A F;  1YIT A;  5GAO p;  1H92 A;  4EDU A;  3OMG A;  4JPB W;  4JZ4 A;  3G1J A;  4JJC A;  3EGU A;  2CSI A;  2QAZ A;  4C8Q A;  2J6O A;  3C95 A;  1QWE A;  4M7A F;  2LP5 A;  2RQT A;  1ABQ A;  3TSZ A;  4FT2 A;  2EPD A;  2HZY A;  1TSF A;  2XIC A;  1YHQ A;  3OYJ A;  1XJW B;  1K4U S;  2EYZ A;  4Y92 A;  1VQ9 A;  2R5M A;  1B7T A;  4M7D F;  2KAF A;  3UA6 A;  5EC7 A;  4XK8 E;  4BE2 A;  2LQN A;  1ZX6 A;  3EG9 A;  2A37 A;  3ZBD A;  2XI9 A;  4CRI A;  2Y4X A;  4AFU C;  1VQO T;  1WIE A;  2CDT A;  2ROL A;  2DER A;  2DVE A;  3HP9 A;  5CIU A;  1FMV A;  5D7U A;  1K8A R;  4IUQ A;  4CC3 A;  3GPL A;  1GL5 A;  4M75 G;  2EW3 A;  4C92 A;  4A53 A;  4BUG A;  1WXU A;  1OX9 A;  2YWW A;  3CCU T;  3OB9 A;  5C0M A;  1YIJ Q;  1ZUY A;  1Y96 B;  1RAA B;  3RUX A;  4PJM A;  3JCM e;  2L8D A;  1VQK A;  1I5O B;  2LT4 A;  1RLQ C;  2HAX A;  3AT1 B;  2RMO A;  2LJ1 A;  4AG1 C;  3KXT A;  2E64 A;  5GAN 5;  5IAY A;  1NYF A;  4LD6 A;  2EQM A;  2HNI A;  3JB9 H;  4FYX B;  3OYA A;  2E12 A;  1YJ9 Q;  3R6O A;  1VQ4 T;  1JXO A;  1E6G A;  5I11 A;  3HRU A;  2MYS A;  3CEY A;  4M75 C;  3JSC A;  1LJO A;  1BCM A;  2CP6 A;  3FC3 A;  4BE0 A;  1KFZ A;  5IH2 A;  2VGM A;  3EHR A;  4IKF A;  4OGE A;  3MEW A;  3NTK A;  3QSU A;  2EYY A;  3RKY A;  4HCB A;  1QW1 A;  2LC4 A;  2LX9 A;  5GAN 7;  1UGR B;  2JT4 A;  3VS7 A;  3CC2 T;  2X4X A;  2VGN A;  1HJD A;  3V8L A;  1U06 A;  4DBF A;  2AIR B;  1TS9 A;  2HQH A;  4HVW A;  4OB1 B;  2DE0 X;  4RG2 A;  1T3S A;  1KIK A;  2K5L A;  2ROT A;  4JJD A;  2E4H A;  3OSV A;  4XU1 A;  3CME A;  1BI2 A;  1IZ6 A;  4C0G A;  2L3S A;  1OYX A;  1YBY A;  2VAS A;  4IUR A;  2ZPH B;  4J7F A;  4BI3 A;  3CC4 Q;  8AT1 B;  4M78 F;  2DJQ A;  4IUP A;  3CCE A;  2LX7 A;  1VYU A;  4M75 B;  2OAW A;  4XQ3 A;  1JO8 A;  1SSF A;  2CT3 A;  1S72 T;  1Q81 C;  3WXM B;  2KBT A;  4GBQ A;  5KYY A;  1ACM B;  4EMK C;  2LQW A;  1MV0 B;  2AZS A;  4C0D C;  3MCA B;  5LJ5 g;  1G3W A;  4BE1 A;  2DTO A;  2ENM A;  3QYG B;  2FRW A;  1VIE A;  4F14 A;  4L5G A;  4QVZ A;  1HK9 A;  1YJ9 T;  2VC8 A;  1VQN Q;  5DY9 A;  3CMA Q;  1QP2 A;  3QYH B;  4D6W A;  2H3E B;  1FXX A;  3CQT A;  3C0C A;  5LJ5 h;  2FYK A;  4F7U E;  4B9W A;  1N27 A;  3L2R A;  2O01 E;  3GOX A;  1RL2 A;  4A4H A;  2XKO C;  2KSS A;  4A4G A;  3CCJ A;  1SHF A;  3M0P A;  1PHT A;  3P8D A;  1O9S A;  2MIO A;  4CC4 B;  2VKN A;  3CCL Q;  2QI2 A;  3VKI A;  4A54 A;  3SD4 A;  1BK2 A;  1M9S A;  4J7I A;  2CGH A;  1VQ7 Q;  3CCS A;  1G2B A;  1GBQ A;  2CUB A;  3A1P A;  1I81 A;  2PVO B;  3OS5 A;  4PLI A;  2DL4 A;  5KYX A;  3O8V A;  2EKO A;  2JS2 A;  4LUE A;  1QQJ A;  2XG8 D;  4FW2 A;  5HKC A;  2QAS A;  4RTZ A;  1Q82 C;  2DEQ A;  4C0D B;  4FM4 B;  3CCM T;  3EGD B;  1D0X A;  2RI2 A;  4OGC A;  2M02 A;  4OF1 A;  1NBE B;  2PU9 B;  3GLX A;  3M56 A;  4M77 F;  3CD6 Q;  2XDB A;  1FMW A;  2A0F B;  3Q1J A;  3EFO A;  3OYK A;  2DIG A;  4KRT A;  3MHX A;  4PJO E;  5HCK A;  1G83 A;  2QGG A;  2DL7 A;  4E7J A;  4J9H A;  2BUD A;  3MEV A;  3QUI A;  1XOV A;  2KT1 A;  2R57 A;  5FRO A;  5GAN 3;  5DLO A;  3LYI A;  2X35 A;  1I5L A;  1QVF P;  4PJJ A;  2RA2 A;  4XU3 A;  3BDU A;  1KC8 C;  1TU0 B;  4MML A;  2C0T A;  1VQM T;  4RTT A;  1TG0 A;  1VQO A;  5CKB A;  5GAN 4;  2HMA A;  2HSE B;  1LCK A;  2KQW A;  1VQ5 T;  2EYX A;  2GQV A;  3RR6 A;  2ZPE B;  2ABL A;  3EGX B;  1VQN T;  2M0Y A;  2DET A;  2I2L A;  4ME7 A;  4M7A A;  1Y0M A;  1W2B P;  3CC7 Q;  1NJI C;  3BDL A;  2FPD A;  5GAM d;  1IHW A;  4JDS A;  2KE9 A;  3CCU A;  3C12 A;  3HTR A;  1YJN T;  1K9M C;  4ANJ A;  3GBQ A;  3A8G B;  4PJL A;  1WJS A;  3VS0 A;  2BIV A;  2AKK A;  1RAC B;  4OMN A;  3X28 B;  2IPO B;  2EGC A;  2R58 A;  2HSP A;  1AZG B;  1D09 B;  1I8F A;  4YTL A;  1JJ2 A;  1BIA A;  4M7D A;  1NPR A;  3L42 A;  1QVP A;  3DLL A;  4KUD K;  1B34 B;  1AWW A;  4OMF B;  4DQ2 A;  1QCF A;  4J6X A;  1Q7Y C;  2C0I A;  2XHC A;  2KVQ G;  4OMP A;  2JN0 A;  4PKC C;  3S3O A;  2AHJ B;  2EGE A;  1GRI A;  4DOV A;  3SWN C;  4V2S A;  1VQ4 A;  3I56 Q;  1WPY A;  1M3C A;  3MET A;  2OTJ Q;  2OX7 A;  1TWB A;  4OB2 B;  3M57 A;  4XTV A;  2K3Y A;  1SG5 A;  4DBR A;  5GAN 6;  4XU2 A;  4VUB A;  2QDY B;  2RJC A;  3D7S B;  3MP6 A;  2HDA A;  1JU5 C;  4UC4 A;  2H3J A;  3NTH A;  5KYW A;  1QWF A;  2QYZ A;  3PVL A;  3CCR T;  1PC0 A;  3MP1 A;  1M90 C;  3M0R A;  4N0A C;  2O4X A;  2DXC A;  2HQX A;  2P0Q A;  3OW2 S;  1T3L A;  3CC2 A;  4J9D A;  1M1K C;  1OZ3 A;  4HKE A;  1OZ2 A;  1RI9 A;  2DKG A;  2KYB A;  2JM9 A;  4C8Q E;  3PIO A;  5A0L A;  3X24 B;  1FMK A;  2DVJ A;  2V8I A;  3CPW S;  5AT1 B;  1AD5 A;  2YRC A;  4OMM A;  1ZUU A;  5IHI A;  1TXQ A;  3VJP A;  2F5T X;  3EG3 A;  2FZK B;  1ZSZ A;  2DNU A;  3MO8 A;  4KH1 B;  4J9B A;  4R55 A;  1YI2 Q;  2RD1 A;  1KJW A;  3SWN B;  1M90 U;  4B6M A;  2M51 A;  3VS5 A;  3A8M B;  1JQQ A;  2E41 A;  3LWI A;  2KK4 A;  5GMK m;  5KCO A;  3VS2 A;  1S72 A;  2ZPG B;  1VYT A;  2DBK A;  4RKU E;  3T9N A;  2LZ6 B;  1LVK A;  1AHJ B;  2VVK A;  1PSF A;  2Y4Y A;  4HCC A;  2ATC B;  2D8J A;  5GAN e;  1IXD A;  2W0Z A;  3A8H B;  2O31 A;  2J05 A;  4C92 E;  1PKT A;  3PE0 A;  4JUV A;  1U5S A;  4KGX B;  2P4T A;  4PJO A;  2ZPI B;  2RB6 A;  3RDV A;  1YJ9 A;  1SSH A;  4AG2 C;  1X6B A;  1KD1 U;  3FEO A;  4XTW A;  3S3M A;  3JRZ A;  2OTJ T;  3M53 A;  4F16 A;  3H0F A;  4F7U G;  4M78 A;  2HKQ B;  4E47 A;  2QQS A;  3MEA A;  3SDZ A;  5CK9 A;  1VQP Q;  1PSE A;  5GAN d;  4R56 A;  2E5K A;  2ZZD A;  3M59 A;  1D3B B;  1R8O B;  3PVQ A;  4HVV A;  2K79 A;  4HCK A;  3KBG A;  2DYB A;  3CCV Q;  3PGG A;  4A4F A;  5GAM f;  3H6Z A;  3GNG A;  4BI4 A;  3QG1 A;  2DXT A;  3CCM A;  4OB0 B;  2P84 A;  4C8Q D;  1OUL A;  2BZ8 A;  5GAO r;  1WQW A;  3M4G A;  2A3L A;  1OOT A;  3V7R A;  5KYU B;  3VS4 A;  4QT7 A;  1LOJ A;  4E7Z A;  4CC7 A;  2NUP A;  1C1A A;  2V26 A;  2GNC A;  2HBW A;  2RK1 A;  2YHT A;  5FLX E;  6AT1 B;  3L2Q A;  1MND A;  2AK5 A;  1R0C B;  2B86 A;  3EHQ A;  3NHN A;  5LJ3 e;  2PUK B;  3E19 A;  1VQM A;  1MMD A;  1ZQ1 A;  4OMO A;  2FO0 A;  2D9T A;  2EJF A;  1VQ5 A;  4II1 A;  5KH6 A;  2YRD A;  1MHN A;  2SRC A;  1FWZ A;  2MCN A;  3RKX A;  3L2U A;  3CXC A;  2HQE A;  1VQN A;  1PKS A;  4WF2 A;  2QQA A;  5KE3 A;  4GLK A;  5I21 A;  1U3O A;  4E7K A;  4C92 D;  4JLG A;  4MDW A;  5KYW B;  1WLP B;  2FPE A;  3DKM A;  3E2U A;  2DL5 A;  1PG5 B;  4M77 A;  2DTH A;  1YJN A;  3CBM A;  1UEC A;  2O4X B;  4PFP A;  3G71 Q;  3G7Z A;  2DMO A;  3X26 B;  2QA4 Q;  4MZP A;  2XD0 A;  3G6E Q;  1N8R C;  1BI1 A;  4RCC A;  4NL3 A;  4XTX A;  3I5S A;  4RTX A;  5C6S A;  1YN8 A;  5CKF A;  3DB4 A;  1WXB A;  2EKH A;  1XNI A;  3E9F A;  4F7U B;  2RJD A;  3KUF A;  2E3H A;  1JBM A;  2E70 A;  1X01 A;  4PFO A;  1G3T A;  1X2Q A;  3FDR A;  9ATC B;  2GFU A;  5A0G A;  5GAO n;  2BTT A;  3BW1 A;  3VRZ A;  2O9V A;  4MZM A;  2NUT B;  2BKD N;  3CPF A;  4F17 A;  2CH4 A;  3E1S A;  4O5V A;  3OW2 P;  2G3R A;  2YSQ A;  1P92 A;  3A5Z B;  1M27 C;  3PMI A;  5GAO l;  1N8R U;  2LNH B;  2LCS A;  1YNZ A;  3FB9 A;  1Y07 A;  1QVF S;  3A8L B;  2KR3 A;  2FHD A;  3CCR A;  3CPW P;  1X75 C;  1WFW A;  3L1A A;  2EQU A;  2MOX A;  5FWC A;  2YT6 A;  4QQD A;  1Q86 R;  1VQL Q;  2DL3 A;  4PJO B;  1KQS S;  3CBP A;  4C8Q G;  1WGS A;  2V8K A;  1W2B S;  2JJ9 A;  1M2V B;  4DBQ A;  2D0N A;  3MJX A;  2JS0 A;  3MEU A;  2P4R A;  2KYM A;  4OML A;  1QKX A;  1D1B A;  2RHU A;  3REB B;  1A0N B;  3OYH A;  2CZ0 B;  2E10 A;  2DK3 A;  1FYN A;  3CCQ Q;  1OPK A;  2DM1 A;  3JCM d;  2VWF A;  1C0M A;  3SEM A;  1CKA A;  5IHK A;  1PCX A;  2CUD A;  4HT8 A;  4HXJ A;  1M1F A;  1AT1 B;  4KT0 E;  2RH2 A;  3ZFJ A;  1TOV A;  3HFO A;  1K73 R;  2QK0 A;  4C0Z A;  3EAE A;  4C8Q C;  1O75 A;  1N5Z A;  4FU6 A;  2VXF A;  4M7A E;  4FIB A;  1GCQ A;  4JRI A;  1UGQ B;  4C92 G;  1OPL A;  2GQI A;  2E6Z A;  3TEE A;  3RNJ A;  3GIB A;  3JCM b;  1M5Q 1;  2OTJ A;  1WYX A;  3M5A A;  1HD3 A;  1WHG A;  3G4S A;  3LGL A;  2F69 A;  2LCC A;  4FW1 A;  4M7D E;  2DAQ A;  2MWO A;  2CRE A;  2K3B A;  2RHX A;  4CC2 A;  4E7I A;  4Z89 A;  5A0D A;  3MPU B;  4BD3 A;  2OTL Q;  1X6O A;  3HRS A;  4DEY A;  5FWB A;  1PRM C;  2L89 A;  2RHY A;  1YIJ T;  2R5A A;  2ZPF B;  3MKD A;  1YCY A;  1WHJ A;  4IUV A;  2DD5 A;  3SFM A;  1V76 A;  3FRN A;  3H0I A;  3OYI A;  1NEB A;  4BB7 A;  4C92 C;  3EH2 A;  1VQ6 Q;  4HT9 A;  2FB7 A;  3NMZ C;  4PK4 A;  4AFZ C;  4KH0 B;  2RQR A;  4EMH A;  1VQ8 Q;  2D0Q B;  4C8Q B;  2JM8 A;  5L8R E;  1Y7X A;  3EG1 A;  2EBP A;  2GGR A;  3I35 A;  5LJ5 e;  2QTX A;  4O6J A;  5CO7 A;  3WVD B;  3HKS A;  2HL3 A;  4ZTF A;  2FG0 A;  3UF4 A;  1UEB A;  2NLU A;  4RCB A;  4WTO B;  4X9C A;  2VXE A;  3VRY A;  1Q81 U;  3JB9 G;  1EX4 A;  3BY7 A;  2AZV A;  1K1Z A;  4N4I A;  5IXB A;  1U8R A;  1R0B G;  1YIT Q;  2ECZ A;  4C5I A;  3GP8 A;  1BYM A;  2X9H A;  1IRE B;  2AT1 B;  2BZY A;  1QVG P;  3EG9 B;  5KE2 A;  2ED0 A;  1H3H A;  1GFC A;  2BZX A;  3O5Z A;  2CZ7 B;  5HK3 A;  1G3S A;  3FLG A;  3SHW A;  3I55 A;  1VA7 A;  2D1X A;  4RMO A;  3CPW A;  1WI7 A;  2KT8 A;  4PJN A;  1YHQ Q;  2GFA A;  1BU1 A;  2X3W D;  1RAD B;  2KDS A;  2JUF A;  4C92 B;  4LD9 K;  5EG2 A;  1QLY A;  3M55 A;  1VQ9 Q;  4EIK A;  4NOY A;  4M75 F;  1WNL A;  5GAN 2;  3AHU A;  2YUQ A;  3CBO A;  3JAM E;  4KGV B;  3ULR B;  3CC4 T;  2OTL T;  4D8D A;  4LDY A;  1H3Z A;  3OQ5 A;  4A63 B;  4M7D D;  3JCM c;  1SRM A;  1WJR A;  1M3A A;  2FRY A;  3KFV A;  3QXE B;  3NGP A;  3ASK A;  4E7H A;  5CR2 A;  1CKB A;  1AWJ A;  5CVI A;  5GAM j;  4J9C A;  2D6F A;  1Q82 U;  2YUN A;  3JCM f;  4M78 E;  3DLM A;  2QEX Q;  3M9Q A;  4GY5 A;  3FIF A;  2FL7 A;  2DO3 A;  3ZEH A;  2DIQ A;  3BE3 A;  3RES A;  1N9R A;  1BKB A;  2GTJ A;  1VQK Q;  4JS4 A;  1RAF B;  2QG9 B;  5I2M A;  1QCN A;  1H64 1;  2RO0 A;  1KQS P;  3CMA T;  2KRS A;  2E65 A;  2PTK A;  3H41 A;  1W6X A;  4J9I A;  5GAM h;  1RAG B;  4M4Z A;  5L23 A;  4IUT A;  1CSK A;  1I07 A;  2CS7 A;  1JB0 E;  1V29 B;  1WZO A;  2LTO A;  1RAB B;  3OBY A;  3P8H A;  3HL8 A;  2ZAE A;  2DXU A;  4LUD A;  2ESW A;  2OI3 A;  1TUD A;  2KGT A;  2O88 A;  1KC8 U;  3CCL T;  3V8J A;  4KUI A;  3UWN A;  3OA6 A;  5FRM A;  3HRT A;  2JOY A;  1QKW A;  4FT4 A;  1VQ7 T;  1YJW Q;  1UFF A;  1RAH B;  3JB9 I;  1MGQ A;  5HK0 A;  1NJI U;  5KYN A;  4FYW B;  1K9M U;  2LQ8 A;  2V1Q A;  3LLR A;  2RPN A;  2LMJ A;  3HFN A;  3LH5 A;  5GMK i;  4AFS C;  1SEM A;  2K3X A;  2XDD A;  3VV0 A;  4AFQ C;  5KYY B;  3CD6 T;  4A4K A;  1XTD A;  3M0Q A;  4BY6 C;  2X4J A;  4ZGJ B;  1T0J A;  1Q7Y U;  1X69 A;  3EFR A;  3CME Q;  1KSW A;  1PM3 A;  3RMS A;  4PJO D;  1M30 A;  2RJE A;  4M77 E;  3ZL7 C;  2IIM A;  2KMT A;  1UGS B;  4F04 B;  3OYF A;  3JCM V;  3OYB A;  2QEX T;  3OS2 A;  3CCE Q;  3QWX X;  1HSQ A;  2F2V A;  1IO6 A;  3HPW A;  3NPF A;  3OYC A;  4M78 D;  2DTI A;  4M7D G;  5GMK j;  3CC7 T;  4KUL A;  1XQH A;  1M2O A;  2DIL A;  1UB4 A;  2PVG B;  3REA B;  1N9S A;  1G3Y A;  1YIJ A;  2A28 A;  4ELZ C;  2CYZ B;  3EFS A;  1M1K U;  1W4S A;  2CP0 A;  1B3Q A;  5CQX A;  3TVT A;  2KNB B;  2DXB A;  4BI8 B;  3VS3 A;  1LNX A;  5GMK h;  3M0T A;  3V7S A;  4JS5 A;  5KYX B;  2PVD B;  2OAU A;  2AKL A;  1ARK A;  4BY6 B;  1SKU B;  1C6V X;  5J39 A;  2DPP B;  2LNV A;  2IG0 A;  2M0O A;  1N6A A;  3OYM A;  5GAN j;  1YJW T;  3MP8 A;  2RN8 A;  4K11 A;  3I56 T;  3CCJ Q;  1EFN A;  5CKD A;  2EQJ A;  1K8A C;  5FU6 B;  4FSX A;  4M7D C;  3VS6 A;  5DLQ E;  2J6K A;  3EFO B;  1MMN A;  4DOW A;  1Y96 A;  1ZBJ A;  2DL8 A;  1QVF A;  1WHK A;  1SF9 A;  2EFI A;  4JRK A;  3L2Z A;  3JCM Q;  4JZ3 A;  4PLL A;  1Q86 C;  2RM4 A;  5CAI A;  2LT1 A;  4XTZ A;  4LN2 A;  2A36 A;  3P8B B;  1W2B A;  1WA7 A;  2CP3 A; 
#chains in the Genus database with same CATH homology
 1HK9 A;  1X75 C;  3HSB A;  2YRV A;  3L1A A;  2A7Y A;  2CZ1 B;  3LH0 A;  2EQU A;  2VC8 A;  1YJ9 T;  3NTI A;  5DY9 A;  1VQ9 T;  1QP2 A;  1K8A U;  2PQW A;  2LVM A;  3PFS A;  3QYH B;  4QQD A;  3J81 E;  3G71 A;  2MF2 A;  4M7D A;  5GMK l;  4M7A B;  2QA4 A;  4D6W A;  3JCM W;  1EIF A;  5D6Y A;  1M8V A;  5FRN A;  1FXX A;  4PJO B;  3G6E A;  4E7L A;  1KQS S;  3VYG A;  5LJ5 h;  2CZ6 B;  2FYK A;  1WGS A;  2V8K A;  3CBP A;  4M77 D;  4C8Q G;  4F7U E;  5J3B A;  1HXD A;  1W2B S;  4B9W A;  4LDW A;  1N27 A;  1JJ2 S;  3RKW A;  4N4G A;  3L2R A;  2DD4 A;  2O01 E;  1WQ7 A;  2XID A;  3V8K A;  1RL2 A;  4A4H A;  3GOX A;  3JCM J;  2XKO C;  2KSS A;  1YI2 T;  4A4G A;  4BDY A;  3CCJ A;  4XTU A;  4DA4 A;  3MEU A;  3RER A;  3CC4 A;  3P8D A;  4M7A G;  2OTL A;  1O9S A;  4M75 E;  2QI2 A;  4M7D B;  4PJO G;  3VKI A;  5FU6 C;  4A54 A;  2RHU A;  3OYH A;  3SD4 A;  2YLB A;  1M9S A;  2CZ0 B;  3RMQ A;  2E10 A;  4J7I A;  4ZN3 A;  2DK3 A;  1K73 C;  2CGH A;  3UDC A;  5I2S A;  3CCS A;  3X20 B;  2QQR A;  2RI5 A;  3JCM d;  5A2Q E;  4LDU A;  5CQY A;  1I81 A;  2PVO B;  2GF7 A;  3OS5 A;  4QVC A;  4PLI A;  2EIF A;  4XU0 A;  2K4Y A;  3O8V A;  4LDX A;  2EKO A;  2XG8 D;  1Q82 C;  5HKC A;  1I4K 1;  1QVG A;  1VQK T;  5CKH A;  2DEQ A;  4M78 G;  4HT8 A;  1M1F A;  4C0D B;  4FM4 B;  5LJ3 j;  3TRE A;  3CCM T;  3NFC A;  2RI2 A;  4XAX B;  1NE8 A;  4OGC A;  4KT0 E;  2WAC A;  4F7U A;  4L59 A;  2RH2 A;  3S6W A;  3ZFJ A;  3HFO A;  3QDR B;  4OF1 A;  4C0Z A;  1JRI A;  3EAE A;  4C8Q C;  2ZPB B;  2FVU A;  2PU9 B;  1BI3 A;  3GLX A;  3M56 A;  2XK0 A;  1O75 A;  4M77 F;  5LJ5 f;  5GMK e;  4FU6 A;  2VXF A;  3CMA A;  3CCJ T;  2XDB A;  3JB9 F;  4M7A E;  4FIB A;  3QO3 A;  3Q1J A;  4JRI A;  1QVG S;  2WSF E;  1UGQ B;  1VQL A;  3OYK A;  2DIG A;  4C92 G;  3MHX A;  4M75 A;  3CC2 T;  4PJO E;  2E6Z A;  4E7J A;  1FX7 A;  5FU7 C;  2WSC E;  3TEE A;  4M7A C;  2BUD A;  4Y91 A;  3GIB A;  3JCM b;  1K73 U;  2CKK A;  2HBP A;  3MEV A;  1M5Q 1;  5LJ3 d;  3S3N A;  1KD1 C;  2OTJ A;  4PJO C;  3QUI A;  1TH7 A;  3M5A A;  1XOV A;  5LL6 S;  2R57 A;  5FRO A;  5GAN 3;  3G4S A;  1KHI A;  5DLO A;  3LGL A;  3LYI A;  5CCA A;  2X35 A;  1VQP T;  1U1T A;  1I5L A;  4OP0 A;  3SB2 A;  2F69 A;  2LCC A;  2RA2 A;  3BDU A;  4RG8 A;  4XU3 A;  4M7D E;  5GAN g;  1KC8 C;  5GAN 8;  2DAQ A;  2MWO A;  2RHZ A;  4MML A;  3CCL A;  1VQM T;  1VQO A;  2RHX A;  5CKB A;  5GAN 4;  4E7I A;  5A0D A;  2IVW A;  3PNW C;  2MI6 A;  2KQW A;  4BD3 A;  1VQ5 T;  4OB3 B;  1VQ7 A;  4M78 C;  1X6O A;  2GQV A;  3HRS A;  4HA8 A;  3CCQ A;  2ZPE B;  4C5H A;  2L89 A;  2RHY A;  1DJ7 B;  1YIJ T;  4QVD A;  1VQN T;  2I2L A;  2R5A A;  4ME7 A;  2ZPF B;  3CCV T;  4M7A A;  1YCY A;  4XTY A;  4KBM B;  1NJI C;  4IUV A;  2DD5 A;  3BDL A;  3SFM A;  4CI0 C;  5GAM d;  3ME9 A;  2JNG A;  2DZC A;  1ZBX A;  3FRN A;  4JDS A;  3CCU A;  4ZGE B;  3C12 A;  3OYI A;  1YJN T;  5GAN h;  1K9M C;  4JJN K;  3A8G B;  4BB7 A;  4C92 C;  2K57 A;  4J5Y A;  1KQ1 A;  3OS1 A;  1WJS A;  4NS5 A;  4HT9 A;  3PT9 A;  2FB7 A;  2BIV A;  3OY9 A;  3VYH B;  2X4W A;  4EMH A;  3G4S T;  3X28 B;  2RI3 A;  2XDP A;  2R58 A;  3CD6 A;  1KQS A;  2D0Q B;  4C8Q B;  3OSS C;  3C94 A;  2KY9 A;  1I8F A;  3CME T;  2V8J A;  2RHI A;  1BIA A;  4QW2 A;  4YTL A;  1NPR A;  3L42 A;  1QVP A;  3LGF A;  3QBY A;  1Y7X A;  4Q5W A;  3DLL A;  4KUD K;  1B34 B;  4OMF B;  2LQK A;  4DQ2 A;  5LJ5 e;  2QTX A;  3QKJ A;  4J6X A;  4O6J A;  1Q7Y C;  2LCL A;  5CO7 A;  3WVD B;  5FU7 B;  3HKS A;  2XHC A;  2KVQ G;  4ZTF A;  4PL6 A;  3VUZ A;  2JN0 A;  4PKC C;  3S3O A;  2AHJ B;  1UEB A;  2NLU A;  2MMP A;  4JLI A;  4RCB A;  4EMK A;  4ZGD B;  4M75 D;  4X9C A;  3CCE T;  4DOV A;  3SWN C;  4V2S A;  1VQ4 A;  5GAO q;  3JCM g;  2VXE A;  1WPY A;  4N4H A;  4M77 G;  5KCH A;  3JB9 D;  1Q81 U;  3JB9 G;  3MET A;  3OYL A;  3BY7 A;  3N5B B;  4N4I A;  2QEX A;  1U8R A;  4OB2 B;  3M57 A;  4XTV A;  2K3Y A;  3INZ A;  2D6F A;  3JCM P;  4C5I A;  1Q86 U;  2C06 A;  3GP8 A;  1BYM A;  5GAN 6;  4XU2 A;  4VUB A;  1IRE B;  2QDY B;  2RJC A;  4M7D G;  3FJP A;  5KE2 A;  4LDV A;  4MMK A;  4MDX A;  3MP6 A;  3UPU A;  2CZ7 B;  4M78 B;  4UC4 A;  5GAN f;  5M9O A;  2H3J A;  3NTH A;  4J8O A;  3H8Z A;  5HK3 A;  1JJ2 A;  1BIB A;  1G3S A;  3A8O B;  3FLG A;  2GCX A;  3CC7 A;  3PIP A;  3CCR T;  4OVA A;  3I55 A;  2XU8 A;  3JCM h;  3QJY A;  4RMO A;  2RJF A;  3MP1 A;  3CPW A;  1M90 C;  2B8A A;  4N0A C;  2O4X A;  2DXC A;  2HQX A;  2P0Q A;  3OW2 S;  2VYT A;  2VV5 A;  4F7U F;  1RI0 A;  3GF5 A;  3G71 T;  2GFA A;  3QZ9 B;  5L8R E;  3CC2 A;  1VQ6 A;  3DB3 A;  1M1K C;  3OBW A;  1OZ3 A;  2QA4 T;  4HKE A;  4C92 B;  2KDS A;  2JUF A;  1OZ2 A;  2EQK A;  5LJ3 g;  2DKG A;  4LD9 K;  3M54 A;  2P0K A;  3LW5 E;  5EG2 A;  4C8Q E;  4L6V 5;  3M55 A;  3G6E T;  5D6X A;  1VQ8 A;  1G5V A;  3PIO A;  5A0L A;  3X24 B;  4NOY A;  3V7C A;  2V8I A;  3CPW S;  4M75 F;  1WNL A;  5GAN 2;  3AHU A;  3CBO A;  5AYF A;  4Z02 A;  4M77 C;  3JAM E;  2JVV A;  2M1H A;  3M58 A;  3VJP A;  3HHT B;  2E5Q A;  3QZ5 B;  3QPH A;  4X34 A;  2M9U A;  3CC4 T;  1VIF A;  2OTL T;  2F5T X;  4LDY A;  3WVE B;  3OQ5 A;  1H3Z A;  4MZT A;  2L5Q A;  2JZ2 A;  3M4Y A;  4QQG A;  5GAO m;  3GNF B;  3MO8 A;  3JCM c;  1YJW A;  1NPP A;  4M7D D;  4J83 A;  2E6N A;  4Y28 E;  4R55 A;  4NL2 A;  2DZ9 A;  3I56 A;  5LJ3 h;  2RD1 A;  1WJR A;  1VUB A;  1U1S A;  2LRQ A;  3I55 T;  3CCS T;  3SWN B;  3QXE B;  1M90 U;  3J7A F;  3A8M B;  3ASK A;  4E7H A;  5CR2 A;  1VQ6 T;  2LDM A;  1YIT A;  2PUO B;  1OI1 A;  5CVI A;  5GAM j;  2E41 A;  3BFM A;  5GAO p;  2KK4 A;  4C5G A;  4EDU A;  3LWI A;  5GMK m;  3OMG A;  5KCO A;  1Q82 U;  3JCM f;  4M78 E;  1S72 A;  3DLM A;  4QQ6 A;  2ZPG B;  3T9N A;  4RKU E;  3OYG A;  3RIR A;  3M9Q A;  4GY5 A;  3FIF A;  2FL7 A;  2DO3 A;  3ZEH A;  3C95 A;  4C8Q A;  2DIQ A;  3RES A;  4M7A F;  1N9R A;  1AHJ B;  1BKB A;  1PSF A;  2Y4Y A;  2EAY A;  2P0P A;  4HCC A;  1B34 A;  4PJO F;  3CXC S;  4JS4 A;  4FT2 A;  5I2M A;  4ZN1 A;  5GAN e;  1H64 1;  2RO0 A;  4BAC A;  3CMA T;  2E65 A;  3A8H B;  2XIC A;  4C92 E;  3J80 E;  1YHQ A;  2WSE E;  2EJG A;  2MAM A;  5GAM h;  3OYJ A;  4JUV A;  1VQL T;  2P4T A;  4PJO A;  2ZPI B;  2RB6 A;  4IUT A;  1YJ9 A;  2CS7 A;  1JB0 E;  1VQ9 A;  3URG A;  1KD1 U;  1V29 B;  2R5M A;  2LTO A;  3FEO A;  4XTW A;  3S3M A;  3JRZ A;  3OBY A;  4M7D F;  2OTJ T;  2KAF A;  3TU4 K;  3P8H A;  3M53 A;  4C0F A;  3HL8 A;  2DXU A;  4J6W A;  4XK8 E;  5LJ3 f;  4CRI A;  4BE2 A;  3ZBD A;  2XI9 A;  4M77 B;  1KC8 U;  5J26 A;  2Y4X A;  4M78 A;  4PNO A;  4X9D A;  4F7U G;  4E47 A;  3CCL T;  1ZHI A;  2QQS A;  1VQO T;  3MEA A;  3SDZ A;  4KUI A;  5CKE A;  3V8J A;  5IT9 E;  3OYN A;  2DVE A;  3UWN A;  3OA6 A;  5FRM A;  3HRT A;  2JOY A;  3HP9 A;  5CIU A;  5CK9 A;  1YI2 A;  1PSE A;  5GAN d;  4IUU A;  4FT4 A;  4R56 A;  1GXI E;  4ATO A;  1VQ7 T;  3CCQ T;  2RK2 A;  4IUQ A;  3QII A;  3GPL A;  3JCM X;  2ZZD A;  4M75 G;  3JB9 I;  5LJ5 j;  1MGQ A;  3M59 A;  3PTA A;  1D3B B;  5HK0 A;  1R8O B;  2X4Y A;  1KQ2 A;  1M4Z A;  1NJI U;  4C92 A;  4A53 A;  4BUG A;  1KHC A;  3CCU T;  1K9M U;  3OB9 A;  2LQ8 A;  4J6Y A;  3LLR A;  5C0M A;  3KBG A;  3HFN A;  2EWN A;  3OYY A;  3OW2 A;  1BI0 A;  1Y96 B;  3PGG A;  3RUX A;  4A4F A;  5GAM f;  5GMK i;  3L2V A;  3JCM e;  2L8D A;  1KG1 A;  1VQK A;  2LT4 A;  3H6Z A;  2K3X A;  2XDD A;  3GNG A;  3VV0 A;  2HAX A;  4BI4 A;  3QG1 A;  2DXT A;  3CCM A;  4OB0 B;  3CD6 T;  4A4K A;  4C8Q D;  3X25 B;  1WQW A;  1XTD A;  5LJ5 d;  5GAO r;  3M4G A;  2A3L A;  5HY6 A;  3KXT A;  2E64 A;  4BY6 C;  2X4J A;  1NZ9 A;  2JTF A;  4ZGJ B;  5GAN 5;  5IAY A;  3V7R A;  1Q7Y U;  3SWN A;  4JRQ A;  1LOJ A;  4LD6 A;  3EFR A;  2EQM A;  2HNI A;  4M7A D;  3JB9 H;  3QJ6 A;  3F70 A;  3OYA A;  3VU3 C;  2E12 A;  3RMS A;  4PJO D;  3R6O A;  2RJE A;  4M77 E;  2VUB A;  1VQ4 T;  2RK1 A;  2YHT A;  2DJZ A;  2F5K A;  5FLX E;  3TCJ A;  2KMT A;  1UGS B;  3HRU A;  2QQ9 A;  3OYF A;  3L2Q A;  3CEY A;  4M75 C;  3JSC A;  3JCM V;  3OYB A;  2QEX T;  2MWP A;  1LJO A;  3OS2 A;  1M1G A;  4JRP A;  2YLC A;  3FC3 A;  1VQP A;  4EMK B;  5LJ3 e;  4BE0 A;  2VGM A;  2PUK B;  2M16 A;  3HPW A;  4IKF A;  3E19 A;  3OYC A;  4M78 D;  2DTI A;  3MEW A;  3NTK A;  4OGE A;  3JB9 J;  5GMK j;  1ZQ1 A;  4N0A A;  1VQM A;  5IN1 A;  3QSU A;  4HCZ A;  3CC7 T;  2D9T A;  2EJF A;  3C4S A;  3E9G A;  3RKY A;  4KUL A;  1VQ5 A;  4II1 A;  5KH6 A;  1XQH A;  3L2W A;  4P5N A;  1UB4 A;  1MHN A;  1FWZ A;  2PVG B;  2K5F A;  3RKX A;  3L2U A;  1N9S A;  3CXC A;  1QW1 A;  3PMT A;  4HCB A;  4C8Q F;  1G3Y A;  2HQE A;  2Y90 A;  2E1H A;  5GAM g;  3OYE A;  2LC4 A;  1YIJ A;  1VQN A;  4ELZ C;  2LX9 A;  4WF2 A;  2QQA A;  2CYZ B;  5GAN 7;  1UGR B;  3EFS A;  3CCV A;  1M1K U;  4C5E A;  1W4S A;  2X4X A;  4GLK A;  2VGN A;  5I21 A;  5CQX A;  5KE3 A;  4E7K A;  4C92 D;  4JLG A;  4MDW A;  3V8L A;  3DKM A;  2DXB A;  3OS0 A;  4BI8 B;  2QXF A;  4M77 A;  2DTH A;  1YJN A;  4ELY C;  1VQ8 T;  1LNX A;  3CBM A;  5GMK h;  2O4X B;  4OB1 B;  3G7Z A;  3V7S A;  5GAM e;  3LX7 A;  4RG2 A;  4JS5 A;  3X26 B;  2PVD B;  4BDZ A;  2EJ9 A;  2K5L A;  2OAU A;  1UGP B;  3OYD A;  4MZP A;  2XD0 A;  4FL6 A;  5DM7 R;  4BY6 B;  1N8R C;  1BI1 A;  4RCC A;  4NL3 A;  3OSV A;  4XTX A;  5J39 A;  3UT1 A;  2DPP B;  2LNV A;  2IG0 A;  2M0O A;  4XU1 A;  5C6S A;  1N6A A;  5CKF A;  3CME A;  3DB4 A;  1BI2 A;  3E9F A;  1XNI A;  4F7U B;  1IZ6 A;  3OYM A;  2ZCF B;  4C0G A;  2RJD A;  1D3B A;  2K5I A;  3KUF A;  1OYX A;  4EMG A;  5GAN j;  1YJW T;  1YBY A;  3MP8 A;  2HD0 A;  4IUR A;  1QP3 A;  3I56 T;  1JBM A;  2E70 A;  1X01 A;  2ZPH B;  5CKD A;  2EQJ A;  4J7F A;  4BI3 A;  1G3T A;  2ZGW A;  4FSX A;  5FU6 B;  1K8A C;  4M7D C;  4ZTJ A;  4M78 F;  3FDR A;  4IUP A;  3LWH A;  2GFU A;  1Y71 A;  2QQB A;  5D6W A;  5DLQ E;  5A0G A;  3CCE A;  3ER0 A;  2K2V A;  5GAO n;  4DOW A;  1Y96 A;  4M75 B;  1YIT T;  3BW1 A;  4XQ3 A;  1SSF A;  1QVF A;  4MZM A;  4TVR A;  2EYQ A;  1S72 T;  3WXM B;  1Q81 C;  2BKD N;  3CPF A;  4A4E A;  2EFI A;  4B9X A;  4EMK C;  3E1S A;  1WJQ A;  4JRK A;  4EPC A;  4O5V A;  2G3R A;  3L2Z A;  3QHS A;  3JCM Q;  1P92 A;  3OMC A;  4PLL A;  4C92 F;  1Q86 C;  4C0D C;  2RM4 A;  5CAI A;  3A5Z B;  3PMI A;  3MCA B;  5LJ5 g;  2LT1 A;  5GAO l;  3VUB A;  1N8R U;  1G3W A;  4BE1 A;  4XTZ A;  3FB9 A;  1Y07 A;  1QVF S;  2DTO A;  2L3R A;  3A8L B;  3P8B B;  3QYG B;  2FHD A;  2JTM A;  1YHQ T;  1W2B A;  3CCR A;  1VIE A;  4L5G A;  4QVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...