1YHQQ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yhqQ00
3G4SQ 2QA4Q 1VQ8Q 1VQ7Q 2OTJQ 1W2BP 1VQOQ 3CC2Q 1KC8R 3CCLQ 3OW2P 3CCUQ 1Q7YR 1VQ9Q 3CCVQ 1VQNQ 3I56Q 2OTLQ 1YJNQ 1YITQ 3I55Q 1S72Q 1NJIR 3CMAQ 1JJ2P 3G71Q 1KQSP 3CC4Q 1Q82R 1YI2Q 1Q81R 3CCQQ 3CCJQ 1VQKQ 1M1KR 3G6EQ 3CCRQ 1YHQQ 3CMEQ 1M90R 3CCMQ 1KD1R 3CCEQ 1VQMQ 1N8RR 1VQPQ 1YJWQ 1VQ6Q 3CCSQ 3CD6Q 1K9MR 3CPWP 1VQ5Q 3CXCP 1VQLQ 3CC7Q 1QVFP 1K73R 1K8AR 1QVGP 2QEXQ 1YJ9Q 1Q86R 1YIJQ 1VQ4Q
chains in the Genus database with same CATH superfamily
2ZPBB 1M9SA 1GBRA 4C8QA 2O4XA 4JZ3A 3OW2P 1QVGS 1D09B 3GIBA 1YCYA 2V8JA 1SHGA 1VQMT 4OGCA 1AOJA 4DA4A 2F2XA 2RPNA 3JB9F 1BIAA 1NPPA 1M8MA 4OMLA 3CCEA 1QVPA 3M0TA 4QT7A 2K79A 3LLRA 1JB0E 4X34A 1ARKA 1UEBA 2MAMA 1AEYA 3JCMW 2FB7A 1VQPT 4MMLA 5CR2A 4EIKA 2LTOA 3S6WA 3MO8A 2OI3A 1VIEA 3A8GB 1WHJA 3CPWA 3RERA 2G6FX 4Q5WA 3BDLA 3FDRA 2JMAA 5CKEA 2ECZA 2DJQA 1WLPB 2RHXA 1Q7YR 1K8AU 3OY9A 1QP3A 1X6GA 5KYWA 4XQ3A 1AWXA 4NL2A 3MP1A 3MKDA 2P0PA 3EAEA 3MEUA 2LQKA 2X9HA 2BE9B 4E7LA 2I0NA 4HKEA 3CMEA 4IIMA 4C5IA 2RJCA 3EGXB 2O31A 2KAFA 2M16A 2AZSA 1BI3A 3PVQA 2KR3A 1G5VA 4L59A 3I56Q 2QG9B 1UUEA 3JCMg 1M90U 3INZA 4LDVA 3ME9A 2JNGA 1Q7YU 1ZBJA 2DYIA 3G71A 2DLPA 3EGDB 4LDYA 1MMDA 3VYGA 1Y0MA 1QP2A 2DMOA 3DKMA 3NGPA 4C92C 4LD9K 5J39A 2CUDA 4LUEA 2AZVA 2EYYA 2DAQA 3EG9B 2K3XA 2DPPB 3BY7A 2KK4A 4ANJA 3CCRT 2FZGB 2NUTA 4N4GA 1X75C 2X4JA 5GAOq 4KT0E 4B6MA 2K5FA 4ZGEB 1ZUUA 3OYEA 2QTVA 3OYIA 4II1A 3UA7A 2GF7A 1GCPA 1SRMA 3GF5A 4JJBA 2KDSA 2AKLA 3X26B 1EFNA 3M4YA 1VQ9A 2RQRA 4C8QF 2YSQA 4RG2A 3CC2A 4BUGA 4QQ6A 5CVIA 2MCNA 1YI2Q 1FMVA 2EBPA 2CUBA 3E2UA 1ZX6A 3CCRA 5CKDA 4FW2A 3VRYA 1JU5C 1E6HA 4J9CA 3VS4A 1OZ2A 3M57A 3OYMA 2QDYB 1ZQ1A 3CCVQ 3QSUA 2LX9A 1RLPC 3EG3A 1ZSGA 3MP6A 1IGQA 1OYXA 4M75D 2ZCFB 3WVDB 3OMGA 4M78G 2E64A 2KY9A 4OP0A 1YCSB 3CXCP 2JMCA 4M75G 1D0ZA 1LVKA 4DEXA 3CCJT 3GOXA 2LJ3A 2JM8A 3PMTA 3CC7T 3O8VA 4C8QB 1GRIA 2CSQA 4ZGJB 1D3BB 3UATA 1B3QA 2KGTA 2PUOB 4UC4A 5CQXA 1OU9A 5GAMd 1XJWB 3JAME 2MIOA 2YUQA 1YHQT 2HQEA 2LVMA 3HRTA 1M5Q1 2K6DA 1WQ7A 1PRMC 2XDBA 3ZBDA 2HKNA 3CQTA 3JCMX 1QMCA 3S3MA 2HEQA 4A53A 2CP7A 1UTIA 1UG1A 3L2ZA 2QEXT 2XKOC 1RAAB 3CBPA 3EGDA 3TREA 2DIGA 2D8JA 1K1ZA 2A36A 5J26A 3VS0A 5GAMg 4M77G 3CCUA 4OF1A 3I56T 1RAFB 2XDDA 3EFOA 1NZ9A 2C0TA 3RNJA 4HT9A 1PHTA 2QK0A 3LWHA 2OTLA 3UDCA 4VUBA 2NUZA 2LCLA 4RG8A 3M54A 2L8DA 4XTXA 3A98A 4C5EA 3X20B 3G7ZA 2DJZA 4A4FA 2M1HA 1TH7A 3OQ5A 3HTRA 2B8AA 1M1KR 5D6YA 4ELZC 2A28A 3VS3A 3G6EQ 1VQLT 2DZCA 1H3HA 1T0JA 2VWFA 3TCJA 4XTZA 1C1AA 3I56A 3A8OB 1TXQA 4CC4B 4HXJA 2JXBA 4K11A 2CP0A 4BE1A 1AVZC 1W70A 4OMNA 5KYNA 3LX7A 4QVDA 1KK7A 2DF6A 3HKSA 1VQ8T 1T3LA 3CCJA 3T9NA 1ZSZB 2L0AA 2KEAA 2GQIA 3EG0A 1IO6A 2WSEE 1M27C 2KRMA 2FZCB 1KC8U 1VQ8Q 4IIOA 1N8RU 4C5HA 1Y57A 1W2BS 1I1JA 5GAOr 1PD0A 1NJIR 2BZ8A 3N5BB 3DLMA 3LW5E 1K9AA 2VGNA 2E6NA 2CREA 4QQGA 3I55T 4J83A 3Q1JA 3QWYA 3CCLA 4M7AD 1T3SA 3JCMd 1KC8C 4PJOF 4M77F 2FZKB 1R8OB 1U06A 1YJWT 4KGVB 2K2MA 5HCKA 2DL4A 1WYXA 1W6XA 5C6SA 5FU7C 2L3RA 4JZ4A 3REAB 1IGUA 1UGPB 2HQHA 2YRCA 3CCLT 2LNVA 2NYSA 2ATCB 3NMZC 1UGRB 2QA4Q 1K0XA 3CCQT 1M1GA 3NTKA 2LCSA 3JCMc 2VVKA 5LJ5d 3JCMh 4AFSC 1UGVA 2K4YA 2QA4T 5LJ5h 1Q81R 2IIMA 1WHLA 5KYUA 4C8QC 3VJPA 1KHCA 4EMKB 1MMNA 3ASKA 1VQLQ 2CH4W 2KMTA 2RHIA 3VS6A 1QLYA 2XDPA 5LJ3g 2J6FA 2MK5A 1ZA2B 2RQUA 4C8QE 2BUDA 2DL7A 1UECA 2ABLA 3CCMA 3X28B 3J81E 1UHFA 2E65A 3KFVA 2PU9B 2RK1A 5IXBA 1NPRA 2CT3A 1G83A 4KBMB 1YJ9A 4PJOD 4OB2B 2LZ6B 1XOVA 2X4XA 5IHNA 3LH0A 1RACB 2YUOA 4PJOG 2DETA 1VQKQ 1D1BA 1BIBA 2V1QA 3CPWP 1NEBA 4A4EA 5CAIA 1PSEA 2G3RA 2DRKA 5GAOl 4EDUA 4D8DA 3QXEB 1SRLA 1QQJA 2DXTA 2OX7A 2GBQA 2CKKA 2EGCA 3C95A 4LE9A 2FEIA 1EX4A 2RHZA 1MUZA 1YWOA 2M9UA 2CZ1B 1HYOA 5GAOm 1M3BA 2EGAA 2WSCE 4JLGA 2OTLQ 1O75A 2GNCA 2W0ZA 2AHJB 1UGQB 2DBMA 1RUWA 1Q82U 3BE3A 1GCQA 5M9OA 5HK0A 3M58A 4N0AC 2OTJT 1G2BA 1UHCA 2ZPGB 5FWCA 3CCEQ 4RTXA 4C92D 3CCMQ 1SHFA 4OB1B 2QQBA 2MOXA 4ZNXA 2CSIA 1B07A 4XU3A 2QDLA 1B34A 2PUKB 2JW4A 3MEWA 1M2VA 1OULA 2YXYA 1Q86U 3JB9J 2XHCA 3M53A 1M8VA 2OAWA 1YITQ 2KE9A 4C8QD 4F16A 2SEMA 3CC4Q 1Z9ZA 2E1HA 3OMCA 4EPCA 4F7UB 2A7YA 2XU8A 1Y07A 2COYA 2R58A 5GAMe 1MV3A 1PG5B 3QKJA 1NLOC 1A0NB 1IHVA 4M77D 5GANj 2RJDA 2YT6A 3EG9A 2RK2A 4M78F 3TQ7P 5KE3A 2CP2A 2EKOA 2D0QB 5D6WA 2O4XB 4M75F 1W2BA 2XD0A 1OI1A 1WFWA 5CCAA 2W10A 3M0UA 3UT1A 4IUVA 4PJOC 1I8FA 3SWNA 4PK4A 4M7AC 5IXFA 4C0ZA 4PJNA 4FL6A 2RI2A 1ZBXA 2DBKA 4XTYA 5FLXE 1BCMA 3CMEQ 4JS4A 3H8ZA 3DB4A 4A4HA 2NUPB 1VQ6A 1ZUKA 1JJ2S 1Y96B 5GMKe 2X3XD 4HCBA 3J80E 1N9RA 3A5ZB 4BY6C 2EJFA 3JB9G 1D0XA 3C94A 4DBQA 3TU4K 2D9TA 2JOYA 1D1AA 3V7SA 3PTAA 1UE9A 3CCQA 1Y7XA 1TOVA 3JB9I 1KQSA 4EMGA 4HCCA 1AZGB 2QGFB 4DOWA 2RI3A 2E12A 3LWIA 5FRNA 2FHDA 3UA6A 4PL6A 2L3SA 2PQWA 2EYQA 2DKGA 3L2QA 2JTEA 4N0AA 3EHRA 1M3CA 3CPWS 4M7AE 2V26A 1SG5A 3FJPA 1UDLA 3P8DA 1WHKA 3H9NA 4ZGDB 3SFMA 4BE2A 3E1SA 1GFCA 3L2VA 2VV5A 2EAYA 2GCXA 3LGFA 3R6OA 2RNAA 1WQWA 4V2SA 1SKUB 2LNHB 4FYYB 1YJ9Q 4QVCA 4PJOE 2JJ9A 2KQWA 1X69A 4XTVA 5I21A 1V76A 3I9QA 3QBYA 1VQPA 3URGA 2XK0A 5GAN8 1Q82R 3QUIA 2LT1A 5FU6C 1WHMA 1VQ7T 3OYHA 2F5KA 4BI3A 3H0IA 3CXCS 1FYNA 2PVOB 1DJ7B 2H3EB 4J9FA 4DOVA 3ZFJA 5LJ3h 3H0HA 4PFZA 2Y4YA 3L42A 1VQMA 1VQ5T 3QWXX 4PJLA 1HD3A 1VQ4A 3JCMb 2D0NA 2DD4A 2GGRA 2YRVA 1M1KC 4Z88A 1VQMQ 2LDMA 1VQ9T 3HSBA 2DVEA 1WPYA 2AIRB 1R0CB 4R0KA 3META 2QQRA 4CRIA 2YWWA 3P8BB 5KYYB 1WXBA 3RKYA 3M55A 4M7DA 1X43A 1D1CA 4NL3A 1PSFA 3CBOA 1RAEB 3PNWC 4F7UF 2KRNA 1RI9A 3VV0A 2DK3A 3PT9A 2LJ0A 1KD1R 1IHWA 5GANe 1VQPQ 1K73U 3GBQA 3OYNA 4E7HA 1M1KU 2VC8A 4LDWA 1VQ7A 4N4HA 3X25B 3H41A 1SPKA 1YFNA 4C92B 4M78D 2CH4A 2KVQG 2P0KA 4E6RA 4Y28E 5A2QE 4XTUA 1BBZA 2A0FB 1VOMA 3CCVT 2E6ZA 1QVFA 1AZEA 3G1JA 5I2SA 1IB8A 2L3PA 4JDSA 4F7UE 1YJNA 2EQIA 1LNXA 1KC8R 4PNOA 3OA6A 4RKUE 5GJVB 2IPOB 2VASA 4OB0B 2OJ2A 3A8LB 3OW2S 4LDXA 4AFZC 3L2WA 4FYVB 2HMAA 2ZPFB 1KJWA 3J7AF 2KT1A 3CCVA 2H8HA 1M3AA 4J9GA 1U3OA 4M77A 2E3HA 1Q86R 3SB2A 1VYVA 1K8AC 4XK8E 3WXMB 2LMJA 3NFCA 4HA8A 2LT4A 4M7DE 3HL8A 4XU2A 1KQSS 2OTJA 3SHWA 3NTIA 2LX7A 2RQTA 4KGZB 3MHXA 1AT1B 3RESA 2VKNA 4FYWB 2DRMA 1YWPA 4LN2A 1X6BA 2C0OA 4Y92A 2EQMA 3EHQA 3O5ZA 1CSKA 2FRWA 1FX7A 1QKXA 3KBGA 2L89A 2XI9A 2ZPIB 5GAOp 2GFUA 3DLLA 2BZXA 3JCMV 2BTTA 4QVZA 4ESRA 2K7AA 5DY9A 2X4YA 2YUPA 1RI0A 2ZGWA 3VUZA 1TTHB 2EJ9A 1VUBA 1M1FA 3PMIA 4X1VA 1VQKT 4OMMA 1TWBA 2EFIA 3TSWA 1AWJA 1VQ9Q 3QO3A 2DVJA 3HP9A 4QQDA 4ZTFA 3QDRB 3PFSA 1I0CA 2QAZA 2BKDN 1YITT 1X27A 3CCUT 3FRNA 5DLOA 2XG8D 4PFPA 3JV3A 5HKCA 4JJCA 2V8IA 3HPWA 3OYYA 2RA2A 2RQVA 1PD1A 2A08A 2E5QA 3CCUQ 3ER0A 2EGEA 3NPFA 4C92G 3CCMT 4M77C 1Q82C 2LP5A 2LQWA 4O6JA 4X9DA 1MNEA 3OYAA 1MNDA 1WXUA 3QPHA 1N8RR 1LJOA 3ZL7C 2HSPA 4E2FB 4C0DB 4F04B 3CC2T 2DIQA 2LC4A 2MYSA 2BIVA 2KYMA 3OYJA 5A0LA 4XTWA 3BW1A 3OYDA 1ACMB 4FIBA 1R0BG 4E7ZA 3D7SB 1VA7A 4PJMA 2X3WD 1Y71A 2D8HA 2J6KA 2EIFA 1Q81C 1GXIE 3M0SA 2DILA 5DM7R 1PCXA 3OSVA 2DL3A 1K8AR 3MEVA 2GFAA 3P8HA 1N6AA 5FU7B 3U23A 1PM3A 2RHUA 3FIFA 1QWEA 4PJOA 2LRQA 3OS1A 2ED1A 3G71Q 3M0PA 2E70A 5CKHA 3BFMA 2DYBA 1EZZB 2E41A 2KSSA 4FW1A 4M7DD 3EH1A 4P5NA 3HFOA 4RTWA 4GLMA 1BI0A 3SEMA 4GY5A 4BDYA 3V8JA 3LGLA 1OQKA 2JZ2A 3NTHA 3CMET 1ZUYA 4J9DA 5C0MA 4D6WA 4B9XA 2ZPHB 4KRTA 1O9SA 3JCMQ 1VQNA 4RUGA 4KUIA 2DO3A 4FT4A 2MWPA 1SSHA 2OTJQ 3EGXA 1SF9A 2EQKA 1WA7A 4OMOA 2FPDA 3OYLA 1WIEA 3EFRA 2FO0A 1EIFA 4O5VA 1Q95G 2DXBA 4DQ2A 4MZPA 1HXDA 2RJEA 2PZ1A 1QWFA 1BU1A 4C92A 3GPLA 1VQ5Q 4N4IA 2FL7A 1V29B 2JTMA 1W2BP 1X2QA 2CT4A 1RADB 4B9WA 4PJOB 3RMSA 2DTHA 3OB9A 2EYWA 3LYIA 1H92A 1NYGA 2DTIA 4Z8AA 5LJ3j 2LQ8A 4LUDA 1Q7YC 1ABQA 3CC4A 3RR6A 1H641 4MDWA 5AYFA 4IUQA 1I81A 1GFDA 2GQVA 2DX1A 3SD4A 3CMAT 4PFOA 2KI7A 4KUDK 5FRMA 2A3LA 1VQ4T 1U8RA 4F14A 4C0FA 1ZLMA 3JB9H 1LCKA 1K0SA 4KULA 2YLCA 2LCCA 4OMFB 2DERA 2HZYA 4A4GA 2CS7A 4AG1C 1QVGP 4F17A 1MMGA 5GAMh 2HBPA 2X4WA 5FU6B 3L2RA 5LJ5g 4M7AA 4M77E 4DBRA 3TEEA 2K5LA 4J7IA 1LOJA 3FLGA 3VS2A 4A63B 5A0GA 5CKBA 5IAYA 3CCJQ 2EYZA 2BE7D 2DTOA 2ED0A 3REBB 2K3BA 5GMKj 1TS9A 1VYUA 2O01E 3JCMJ 5L23A 1IZ6A 3C4SA 1J3TA 1WX6A 3V8KA 2KXCA 3I55Q 1W4SA 4HVUA 4MDXA 2F2VA 2MWOA 2E4HA 2CP5A 2VB6A 1M2VB 2ESWA 2M0OA 3UPUA 3HRSA 4J9HA 1S1NA 3TSZA 1G3TA 3I35A 2KROA 2FPFA 3M56A 2EPDA 2YRDA 1WDXA 2DEQA 2E3IA 3GNGA 4HVWA 4CC2A 3GP8A 1VQOA 1YHQA 3PE0A 2O9VA 4RCCA 1YJ9T 5CO7A 4A54A 1BI1A 3CMAA 4AG2C 4FYXB 2DZ9A 1Y96A 1AWOA 2EWNA 4L6V5 1JO8A 5GANd 1N9SA 3FB9A 2X35A 3IQLA 5I22A 4ZN3A 2L5QA 1OPKA 3VUBA 3V7CA 1JXOA 3PVLA 1OZ3A 1QVFS 1PKTA 1MHNA 1M90R 3JB9D 3PIOA 3VS5A 2KBTA 4XAXB 1K9MR 1UJYA 2CZ7B 2GTOA 4AMCA 1OEBA 4KH1B 4C0GA 3AT1B 3EG2A 1F1BB 2QXFA 4M7DG 5KH6A 1M2OA 3MEAA 3A1PA 2QEXA 4JRIA 1AD5A 3BDUA 1G8XA 3ULRB 5GMKm 2EVRA 1IXDA 3EFOB 4MZMA 3JRZA 1NBEB 1K73C 5GAN3 3OS2A 1SEMA 1KD1C 2JUFA 1X2KA 1K9MU 4J5YA 2DXUA 3CCLQ 5LJ3e 3VU3C 4XU0A 2WACA 9ATCB 4DBFA 5D7UA 2K9GA 1VQLA 1FMKA 1WI7A 4RCBA 3OYKA 3RIRA 3FEOA 2CP6A 1KFZA 4E7JA 4EMKA 2QTXA 3QZ9B 2IG0A 4XU1A 2FYKA 5KYXA 4WF2A 5GAMj 4M75A 3ZEHA 1C6VX 1TU0B 4BI8B 1I5LA 1M4ZA 2DA9A 3LH5A 1JJ2A 2ROTA 3C12A 3M5AA 4M78A 3G4ST 4BE0A 1YI2A 2PTKA 5GANg 1B7TA 1OX8A 1NJIU 5LL6S 4E7IA 1VQOT 1E7OA 2HQXA 1QCOA 3NHNA 4DEYA 1VQNQ 1M90C 2I2LA 5LJ5f 2FG0A 1RLQC 1FXXA 2YUNA 1UGSB 3RMQA 2NLUA 5CKFA 3F70A 1WJSA 5A0DA 4D8KA 3AHUA 2Y4XA 2EKHA 3OBYA 5KE2A 4RTVA 2CDTA 1IREB 2D6FA 2FRYA 5GMKl 1ZHIA 4FM4B 5GMKi 1MMAA 4FSSA 3OYCA 2P0QA 4CI0C 4JPBW 2OTLT 5IHKA 5ECAA 2QGGA 2RJFA 4ELYC 5DLQE 8ATCB 4JRQA 4JUVA 5GAN7 5EG2A 4ZN1A 1VIFA 4M75C 2QQ9A 5IT9E 2ZAEA 3FJ5A 3HRUA 1VQ7Q 3A8HB 2GTJA 2WSFE 3RKWA 4M75B 1JQQA 4EMKC 1E6GA 2A37A 2EQJA 5FW9A 3VKIA 2CGHA 2MMPA 2RN8A 7AT1B 3M0QA 2ENMA 2PVDB 3OW2A 3I5SA 1AWWA 4MZTA 4RTUA 2COWA 3VS7A 1KQ1A 1N5ZA 2Y90A 1D0YA 3RUXA 2EJGA 3JCMe 1G3SA 1TUCA 5EC7A 1WZOA 1FMWA 2RH2A 4C8QG 3CD6Q 3MCAB 1JRIA 2JN0A 3CC7Q 3L1AA 2MPXC 1NE8A 2H3JA 2DE0X 4RTTA 2HBWA 2K2VA 1Q86C 4JS5A 1N8RC 1BKBA 4OMQA 4OB3B 5GJWB 4AFUC 1RAHB 2HNIA 2KYBA 2YHTA 5CQYA 3M9QA 3RKXA 3M59A 3G6ET 1X6OA 3CEYA 1I4K1 1YITA 1TSFA 5GMKh 4HCZA 2M51A 3R6NA 1AHJB 1OX9A 4MMKA 5HK3A 2HL3A 1YIJA 3G4SQ 4DBHA 5J3BA 2ZPEB 3C0CA 3E9FA 1KIKA 2B86A 2P4TA 4FSXA 3PGGA 1K4US 3QDFA 2JM9A 4M4ZA 2ZZDA 3QYHB 3CXCA 5LJ5j 4IKFA 2DEUA 3V7RA 1BI2A 4BACA 3CCSQ 1YJWA 3A8MB 2RQWA 5KCOA 5I11A 2NUTB 2DL8A 2LJ1A 1XQHA 2V8KA 4C92E 4QW2A 5KYXB 2J7IA 4JJNK 1K76A 5D6XA 3OSSC 4NOYA 1VQKA 2L3QA 2C06A 2HL5C 1NYFA 1P92A 4WCIA 1UB4A 3QHSA 4M7DC 1HJDA 2HDAA 3SWNC 1VQNT 1C0MA 4KH0B 1FWZA 1NLPC 1IRXA 2M0YA 4F7UG 5LJ3f 2QEXQ 2QA4A 1I07A 1N27A 3SWNB 2P84A 2C0IA 3WVEB 2O88A 4RMOA 1X01A 1V1CA 3CC4T 3CC7A 1RAGB 3EG1A 1YNZA 1JJ2P 2PNIA 4J9BA 4RTZA 3VS1A 5GAOn 3QYGB 1VQ8A 1QW1A 1WXTA 1U5SA 4OVAA 3CBMA 4ATOA 3GNFB 1T0HA 4BD3A 4E47A 1KD1U 2X51A 2DNUA 4R55A 2R5AA 3I5RA 3H6ZA 2L2PA 5GAN4 2K5IA 1YIJT 4LDUA 1S72A 2F2WA 4IUPA 4HCKA 3KXTA 4EMHA 2KXDA 2F5TX 2K3YA 1PNJA 1D3BA 1YIJQ 2JT4A 3HHTB 3EFSA 1WJRA 3CC2Q 2VXFA 3UF4A 1HK9A 1S72Q 4PLIA 4ORZA 2HAXA 2KNBB 2RI5A 1LPLA 1H8KA 2J05A 3UWNA 4L5GA 4OMPA 5GANh 3CCRQ 4PLLA 2F69A 2E10A 1WJQA 1Z9QA 1JXMA 5FROA 1OV3A 1HSQA 1PC0A 3THKA 4Z02A 2O2OA 3QG1A 2JS0A 4J6YA 2MF2A 1I5OB 4M7DB 2KT8A 1ZSZA 3QJYA 4ME7A 1KQSP 3JCMP 2P4RA 3TVTA 1MV0B 5KCHA 1MGQA 4CC7A 2FVUA 1W1FA 2VXEA 1YHQQ 2DM1A 3G71T 2K57A 5KYUB 1UJ0A 4TVRA 6AT1B 1QVGA 2DFUA 2QI2A 2HSEB 2J06A 3JSCA 1KG1A 2AK5A 2EYXA 1WNLA 1QKWA 3QZ5B 4JJDA 3X24B 5AT1B 3PIPA 3G6EA 4X9CA 4IUUA 1QCNA 3M0RA 1JBMA 3H0FA 3SDZA 1VQOQ 4RTYA 4BDZA 2RO0A 3CCSA 4C5GA 3CCET 2RF0A 3OYFA 2RHYA 4AFQC 4IUTA 8AT1B 4JRKA 3QJ6A 3S3OA 2IVWA 3EGUA 3OBWA 1CKAA 3CCQQ 2DL5A 1BYMA 4BY6B 1WHHA 4E7KA 2QQSA 3E9GA 2VYTA 3HFNA 3DB3A 2M02A 4J9IA 4Z89A 1K73R 4HT8A 3G4SA 1YI2T 1PKSA 1QCFA 4HVVA 4FCYA 1KSWA 1WGSA 5FWBA 2F1LA 2AT1B 1VQ6T 4CC3A 4J6WA 4J7FA 1XTDA 5GANf 1VQ5A 5LJ3d 5LJ5e 4E7SA 4J9EA 4WTOB 1CKBA 5GAN6 1S72T 3RDVA 2QYZA 1YJWQ 4C92F 1YN8A 3E19A 5KYYA 1JEGA 3QIIA 1RABB 1BCOA 2QASA 5IN1A 3MP8A 1KQ2A 4GLKA 2BZYA 1KHIA 2E5KA 2FPEA 3GLXA 5KYWB 1RL2A 4M78C 3CD6A 1GCQC 1TUDA 5CK9A 1UFFA 2MI6A 5IH2A 2R57A 1ZA1B 4PKCC 4KGXB 1BK2A 1NJIC 2LQNA 1OU8A 4M78B 1OPLA 3VYHB 2AKKA 4Y91A 5I2MA 2D1XA 2JS2A 4M7AB 1OOTA 4M78E 2O9SA 4R56A 1NG2A 3OS0A 3VRZA 2RD1A 1ABOA 1M30A 4NS5A 4J6XA 4M75E 3I55A 2Z0WA 4M7AG 2CZ6B 3S3NA 1BB9A 1SSFA 2YLBA 3CD6T 2VGMA 2CP3A 2CZ0B 1GBQA 4A4KA 1PWTA 4FU6A 4YTLA 5GAN5 4PJJA 2HCKA 1VQ6Q 3MPUB 3MJXA 4IURA 3OS5A 2ROLA 5GAN2 2NWMA 3FC3A 1G3YA 2KRSA 1K9MC 2PVGB 2JTFA 2DXCA 3OYBA 5L8RE 4LXCA 4LD6A 1YJNQ 2JVVA 3CMAQ 2XMFA 3KUFA 3JCMf 2V1RA 4QKUA 4M77B 2VUBA 5HY6A 1QVFP 2HD0A 5IHIA 1ZSZC 1B34B 2DD5A 4OGEA 4JRPA 5GAMf 4C0DC 1WHGA 2QQAA 3CCST 3V8LA 3OYGA 2SRCA 2EW3A 2OAUA 2CYZB 2EQUA 4AT1B 1G3WA 2J6OA 4LNPA 1TUGB 1PRLC 1H3ZA 1Q81U 4M7AF 1U1TA 1R77A 2COZA 4M7DF 1XNIA 2NUPA 4ZTJA 1RAIB 1VQ4Q 1YJNT 1GL5A 2YDLA 1NEGA 3M4GA 2RMOA 1YBYA 2HKQB 4FT2A 1VYTA 2RB6A 4F7UA 3L2UA 3CPFA 1TG0A 2RM4A 2XICA 1YP5A 2XIDA 3RBBB 3EH2A 4J8OA 4BI4A 1U1SA 4GBQA 5CIUA 2R5MA 1NM7A 4BB7A 4JLIA
chains in the Genus database with same CATH topology
3G4SQ 2QA4Q 1VQ8Q 1VQ7Q 2OTJQ 1W2BP 1VQOQ 3CC2Q 1KC8R 3CCLQ 3OW2P 3CCUQ 1Q7YR 1VQ9Q 3CCVQ 1VQNQ 3I56Q 2OTLQ 1YJNQ 1YITQ 3I55Q 1S72Q 1NJIR 3CMAQ 1JJ2P 3G71Q 1KQSP 3CC4Q 1Q82R 1YI2Q 1Q81R 3CCQQ 3CCJQ 1VQKQ 1M1KR 3G6EQ 3CCRQ 1YHQQ 3CMEQ 1M90R 3CCMQ 1KD1R 3CCEQ 1VQMQ 1N8RR 1VQPQ 1YJWQ 1VQ6Q 3CCSQ 3CD6Q 1K9MR 3CPWP 1VQ5Q 3CXCP 1VQLQ 3CC7Q 1QVFP 1K73R 1K8AR 1QVGP 2QEXQ 1YJ9Q 1Q86R 1YIJQ 1VQ4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G4S Q;  2QA4 Q;  1VQ8 Q;  1VQ7 Q;  2OTJ Q;  1W2B P;  1VQO Q;  3CC2 Q;  1KC8 R;  3CCL Q;  3OW2 P;  3CCU Q;  1Q7Y R;  1VQ9 Q;  3CCV Q;  1VQN Q;  3I56 Q;  2OTL Q;  1YJN Q;  1YIT Q;  3I55 Q;  1S72 Q;  1NJI R;  3CMA Q;  1JJ2 P;  3G71 Q;  1KQS P;  3CC4 Q;  1Q82 R;  1YI2 Q;  1Q81 R;  3CCQ Q;  3CCJ Q;  1VQK Q;  1M1K R;  3G6E Q;  3CCR Q;  1YHQ Q;  3CME Q;  1M90 R;  3CCM Q;  1KD1 R;  3CCE Q;  1VQM Q;  1N8R R;  1VQP Q;  1YJW Q;  1VQ6 Q;  3CCS Q;  3CD6 Q;  1K9M R;  3CPW P;  1VQ5 Q;  3CXC P;  1VQL Q;  3CC7 Q;  1QVF P;  1K73 R;  1K8A R;  1QVG P;  2QEX Q;  1YJ9 Q;  1Q86 R;  1YIJ Q;  1VQ4 Q; 
#chains in the Genus database with same CATH topology
 2ZPB B;  1M9S A;  1GBR A;  4C8Q A;  2O4X A;  4JZ3 A;  3OW2 P;  1QVG S;  1D09 B;  3GIB A;  1YCY A;  2V8J A;  1SHG A;  1VQM T;  4OGC A;  1AOJ A;  4DA4 A;  2F2X A;  2RPN A;  3JB9 F;  1BIA A;  1NPP A;  1M8M A;  4OML A;  3CCE A;  1QVP A;  3M0T A;  4QT7 A;  2K79 A;  3LLR A;  1JB0 E;  4X34 A;  1ARK A;  1UEB A;  2MAM A;  1AEY A;  3JCM W;  2FB7 A;  1VQP T;  4MML A;  5CR2 A;  4EIK A;  2LTO A;  3S6W A;  3MO8 A;  2OI3 A;  1VIE A;  3A8G B;  1WHJ A;  3CPW A;  3RER A;  2G6F X;  4Q5W A;  3BDL A;  3FDR A;  2JMA A;  5CKE A;  2ECZ A;  2DJQ A;  1WLP B;  2RHX A;  1Q7Y R;  1K8A U;  3OY9 A;  1QP3 A;  1X6G A;  5KYW A;  4XQ3 A;  1AWX A;  4NL2 A;  3MP1 A;  3MKD A;  2P0P A;  3EAE A;  3MEU A;  2LQK A;  2X9H A;  2BE9 B;  4E7L A;  2I0N A;  4HKE A;  3CME A;  4IIM A;  4C5I A;  2RJC A;  3EGX B;  2O31 A;  2KAF A;  2M16 A;  2AZS A;  1BI3 A;  3PVQ A;  2KR3 A;  1G5V A;  4L59 A;  3I56 Q;  2QG9 B;  1UUE A;  3JCM g;  1M90 U;  3INZ A;  4LDV A;  3ME9 A;  2JNG A;  1Q7Y U;  1ZBJ A;  2DYI A;  3G71 A;  2DLP A;  3EGD B;  4LDY A;  1MMD A;  3VYG A;  1Y0M A;  1QP2 A;  2DMO A;  3DKM A;  3NGP A;  4C92 C;  4LD9 K;  5J39 A;  2CUD A;  4LUE A;  2AZV A;  2EYY A;  2DAQ A;  3EG9 B;  2K3X A;  2DPP B;  3BY7 A;  2KK4 A;  4ANJ A;  3CCR T;  2FZG B;  2NUT A;  4N4G A;  1X75 C;  2X4J A;  5GAO q;  4KT0 E;  4B6M A;  2K5F A;  4ZGE B;  1ZUU A;  3OYE A;  2QTV A;  3OYI A;  4II1 A;  3UA7 A;  2GF7 A;  1GCP A;  1SRM A;  3GF5 A;  4JJB A;  2KDS A;  2AKL A;  3X26 B;  1EFN A;  3M4Y A;  1VQ9 A;  2RQR A;  4C8Q F;  2YSQ A;  4RG2 A;  3CC2 A;  4BUG A;  4QQ6 A;  5CVI A;  2MCN A;  1YI2 Q;  1FMV A;  2EBP A;  2CUB A;  3E2U A;  1ZX6 A;  3CCR A;  5CKD A;  4FW2 A;  3VRY A;  1JU5 C;  1E6H A;  4J9C A;  3VS4 A;  1OZ2 A;  3M57 A;  3OYM A;  2QDY B;  1ZQ1 A;  3CCV Q;  3QSU A;  2LX9 A;  1RLP C;  3EG3 A;  1ZSG A;  3MP6 A;  1IGQ A;  1OYX A;  4M75 D;  2ZCF B;  3WVD B;  3OMG A;  4M78 G;  2E64 A;  2KY9 A;  4OP0 A;  1YCS B;  3CXC P;  2JMC A;  4M75 G;  1D0Z A;  1LVK A;  4DEX A;  3CCJ T;  3GOX A;  2LJ3 A;  2JM8 A;  3PMT A;  3CC7 T;  3O8V A;  4C8Q B;  1GRI A;  2CSQ A;  4ZGJ B;  1D3B B;  3UAT A;  1B3Q A;  2KGT A;  2PUO B;  4UC4 A;  5CQX A;  1OU9 A;  5GAM d;  1XJW B;  3JAM E;  2MIO A;  2YUQ A;  1YHQ T;  2HQE A;  2LVM A;  3HRT A;  1M5Q 1;  2K6D A;  1WQ7 A;  1PRM C;  2XDB A;  3ZBD A;  2HKN A;  3CQT A;  3JCM X;  1QMC A;  3S3M A;  2HEQ A;  4A53 A;  2CP7 A;  1UTI A;  1UG1 A;  3L2Z A;  2QEX T;  2XKO C;  1RAA B;  3CBP A;  3EGD A;  3TRE A;  2DIG A;  2D8J A;  1K1Z A;  2A36 A;  5J26 A;  3VS0 A;  5GAM g;  4M77 G;  3CCU A;  4OF1 A;  3I56 T;  1RAF B;  2XDD A;  3EFO A;  1NZ9 A;  2C0T A;  3RNJ A;  4HT9 A;  1PHT A;  2QK0 A;  3LWH A;  2OTL A;  3UDC A;  4VUB A;  2NUZ A;  2LCL A;  4RG8 A;  3M54 A;  2L8D A;  4XTX A;  3A98 A;  4C5E A;  3X20 B;  3G7Z A;  2DJZ A;  4A4F A;  2M1H A;  1TH7 A;  3OQ5 A;  3HTR A;  2B8A A;  1M1K R;  5D6Y A;  4ELZ C;  2A28 A;  3VS3 A;  3G6E Q;  1VQL T;  2DZC A;  1H3H A;  1T0J A;  2VWF A;  3TCJ A;  4XTZ A;  1C1A A;  3I56 A;  3A8O B;  1TXQ A;  4CC4 B;  4HXJ A;  2JXB A;  4K11 A;  2CP0 A;  4BE1 A;  1AVZ C;  1W70 A;  4OMN A;  5KYN A;  3LX7 A;  4QVD A;  1KK7 A;  2DF6 A;  3HKS A;  1VQ8 T;  1T3L A;  3CCJ A;  3T9N A;  1ZSZ B;  2L0A A;  2KEA A;  2GQI A;  3EG0 A;  1IO6 A;  2WSE E;  1M27 C;  2KRM A;  2FZC B;  1KC8 U;  1VQ8 Q;  4IIO A;  1N8R U;  4C5H A;  1Y57 A;  1W2B S;  1I1J A;  5GAO r;  1PD0 A;  1NJI R;  2BZ8 A;  3N5B B;  3DLM A;  3LW5 E;  1K9A A;  2VGN A;  2E6N A;  2CRE A;  4QQG A;  3I55 T;  4J83 A;  3Q1J A;  3QWY A;  3CCL A;  4M7A D;  1T3S A;  3JCM d;  1KC8 C;  4PJO F;  4M77 F;  2FZK B;  1R8O B;  1U06 A;  1YJW T;  4KGV B;  2K2M A;  5HCK A;  2DL4 A;  1WYX A;  1W6X A;  5C6S A;  5FU7 C;  2L3R A;  4JZ4 A;  3REA B;  1IGU A;  1UGP B;  2HQH A;  2YRC A;  3CCL T;  2LNV A;  2NYS A;  2ATC B;  3NMZ C;  1UGR B;  2QA4 Q;  1K0X A;  3CCQ T;  1M1G A;  3NTK A;  2LCS A;  3JCM c;  2VVK A;  5LJ5 d;  3JCM h;  4AFS C;  1UGV A;  2K4Y A;  2QA4 T;  5LJ5 h;  1Q81 R;  2IIM A;  1WHL A;  5KYU A;  4C8Q C;  3VJP A;  1KHC A;  4EMK B;  1MMN A;  3ASK A;  1VQL Q;  2CH4 W;  2KMT A;  2RHI A;  3VS6 A;  1QLY A;  2XDP A;  5LJ3 g;  2J6F A;  2MK5 A;  1ZA2 B;  2RQU A;  4C8Q E;  2BUD A;  2DL7 A;  1UEC A;  2ABL A;  3CCM A;  3X28 B;  3J81 E;  1UHF A;  2E65 A;  3KFV A;  2PU9 B;  2RK1 A;  5IXB A;  1NPR A;  2CT3 A;  1G83 A;  4KBM B;  1YJ9 A;  4PJO D;  4OB2 B;  2LZ6 B;  1XOV A;  2X4X A;  5IHN A;  3LH0 A;  1RAC B;  2YUO A;  4PJO G;  2DET A;  1VQK Q;  1D1B A;  1BIB A;  2V1Q A;  3CPW P;  1NEB A;  4A4E A;  5CAI A;  1PSE A;  2G3R A;  2DRK A;  5GAO l;  4EDU A;  4D8D A;  3QXE B;  1SRL A;  1QQJ A;  2DXT A;  2OX7 A;  2GBQ A;  2CKK A;  2EGC A;  3C95 A;  4LE9 A;  2FEI A;  1EX4 A;  2RHZ A;  1MUZ A;  1YWO A;  2M9U A;  2CZ1 B;  1HYO A;  5GAO m;  1M3B A;  2EGA A;  2WSC E;  4JLG A;  2OTL Q;  1O75 A;  2GNC A;  2W0Z A;  2AHJ B;  1UGQ B;  2DBM A;  1RUW A;  1Q82 U;  3BE3 A;  1GCQ A;  5M9O A;  5HK0 A;  3M58 A;  4N0A C;  2OTJ T;  1G2B A;  1UHC A;  2ZPG B;  5FWC A;  3CCE Q;  4RTX A;  4C92 D;  3CCM Q;  1SHF A;  4OB1 B;  2QQB A;  2MOX A;  4ZNX A;  2CSI A;  1B07 A;  4XU3 A;  2QDL A;  1B34 A;  2PUK B;  2JW4 A;  3MEW A;  1M2V A;  1OUL A;  2YXY A;  1Q86 U;  3JB9 J;  2XHC A;  3M53 A;  1M8V A;  2OAW A;  1YIT Q;  2KE9 A;  4C8Q D;  4F16 A;  2SEM A;  3CC4 Q;  1Z9Z A;  2E1H A;  3OMC A;  4EPC A;  4F7U B;  2A7Y A;  2XU8 A;  1Y07 A;  2COY A;  2R58 A;  5GAM e;  1MV3 A;  1PG5 B;  3QKJ A;  1NLO C;  1A0N B;  1IHV A;  4M77 D;  5GAN j;  2RJD A;  2YT6 A;  3EG9 A;  2RK2 A;  4M78 F;  3TQ7 P;  5KE3 A;  2CP2 A;  2EKO A;  2D0Q B;  5D6W A;  2O4X B;  4M75 F;  1W2B A;  2XD0 A;  1OI1 A;  1WFW A;  5CCA A;  2W10 A;  3M0U A;  3UT1 A;  4IUV A;  4PJO C;  1I8F A;  3SWN A;  4PK4 A;  4M7A C;  5IXF A;  4C0Z A;  4PJN A;  4FL6 A;  2RI2 A;  1ZBX A;  2DBK A;  4XTY A;  5FLX E;  1BCM A;  3CME Q;  4JS4 A;  3H8Z A;  3DB4 A;  4A4H A;  2NUP B;  1VQ6 A;  1ZUK A;  1JJ2 S;  1Y96 B;  5GMK e;  2X3X D;  4HCB A;  3J80 E;  1N9R A;  3A5Z B;  4BY6 C;  2EJF A;  3JB9 G;  1D0X A;  3C94 A;  4DBQ A;  3TU4 K;  2D9T A;  2JOY A;  1D1A A;  3V7S A;  3PTA A;  1UE9 A;  3CCQ A;  1Y7X A;  1TOV A;  3JB9 I;  1KQS A;  4EMG A;  4HCC A;  1AZG B;  2QGF B;  4DOW A;  2RI3 A;  2E12 A;  3LWI A;  5FRN A;  2FHD A;  3UA6 A;  4PL6 A;  2L3S A;  2PQW A;  2EYQ A;  2DKG A;  3L2Q A;  2JTE A;  4N0A A;  3EHR A;  1M3C A;  3CPW S;  4M7A E;  2V26 A;  1SG5 A;  3FJP A;  1UDL A;  3P8D A;  1WHK A;  3H9N A;  4ZGD B;  3SFM A;  4BE2 A;  3E1S A;  1GFC A;  3L2V A;  2VV5 A;  2EAY A;  2GCX A;  3LGF A;  3R6O A;  2RNA A;  1WQW A;  4V2S A;  1SKU B;  2LNH B;  4FYY B;  1YJ9 Q;  4QVC A;  4PJO E;  2JJ9 A;  2KQW A;  1X69 A;  4XTV A;  5I21 A;  1V76 A;  3I9Q A;  3QBY A;  1VQP A;  3URG A;  2XK0 A;  5GAN 8;  1Q82 R;  3QUI A;  2LT1 A;  5FU6 C;  1WHM A;  1VQ7 T;  3OYH A;  2F5K A;  4BI3 A;  3H0I A;  3CXC S;  1FYN A;  2PVO B;  1DJ7 B;  2H3E B;  4J9F A;  4DOV A;  3ZFJ A;  5LJ3 h;  3H0H A;  4PFZ A;  2Y4Y A;  3L42 A;  1VQM A;  1VQ5 T;  3QWX X;  4PJL A;  1HD3 A;  1VQ4 A;  3JCM b;  2D0N A;  2DD4 A;  2GGR A;  2YRV A;  1M1K C;  4Z88 A;  1VQM Q;  2LDM A;  1VQ9 T;  3HSB A;  2DVE A;  1WPY A;  2AIR B;  1R0C B;  4R0K A;  3MET A;  2QQR A;  4CRI A;  2YWW A;  3P8B B;  5KYY B;  1WXB A;  3RKY A;  3M55 A;  4M7D A;  1X43 A;  1D1C A;  4NL3 A;  1PSF A;  3CBO A;  1RAE B;  3PNW C;  4F7U F;  2KRN A;  1RI9 A;  3VV0 A;  2DK3 A;  3PT9 A;  2LJ0 A;  1KD1 R;  1IHW A;  5GAN e;  1VQP Q;  1K73 U;  3GBQ A;  3OYN A;  4E7H A;  1M1K U;  2VC8 A;  4LDW A;  1VQ7 A;  4N4H A;  3X25 B;  3H41 A;  1SPK A;  1YFN A;  4C92 B;  4M78 D;  2CH4 A;  2KVQ G;  2P0K A;  4E6R A;  4Y28 E;  5A2Q E;  4XTU A;  1BBZ A;  2A0F B;  1VOM A;  3CCV T;  2E6Z A;  1QVF A;  1AZE A;  3G1J A;  5I2S A;  1IB8 A;  2L3P A;  4JDS A;  4F7U E;  1YJN A;  2EQI A;  1LNX A;  1KC8 R;  4PNO A;  3OA6 A;  4RKU E;  5GJV B;  2IPO B;  2VAS A;  4OB0 B;  2OJ2 A;  3A8L B;  3OW2 S;  4LDX A;  4AFZ C;  3L2W A;  4FYV B;  2HMA A;  2ZPF B;  1KJW A;  3J7A F;  2KT1 A;  3CCV A;  2H8H A;  1M3A A;  4J9G A;  1U3O A;  4M77 A;  2E3H A;  1Q86 R;  3SB2 A;  1VYV A;  1K8A C;  4XK8 E;  3WXM B;  2LMJ A;  3NFC A;  4HA8 A;  2LT4 A;  4M7D E;  3HL8 A;  4XU2 A;  1KQS S;  2OTJ A;  3SHW A;  3NTI A;  2LX7 A;  2RQT A;  4KGZ B;  3MHX A;  1AT1 B;  3RES A;  2VKN A;  4FYW B;  2DRM A;  1YWP A;  4LN2 A;  1X6B A;  2C0O A;  4Y92 A;  2EQM A;  3EHQ A;  3O5Z A;  1CSK A;  2FRW A;  1FX7 A;  1QKX A;  3KBG A;  2L89 A;  2XI9 A;  2ZPI B;  5GAO p;  2GFU A;  3DLL A;  2BZX A;  3JCM V;  2BTT A;  4QVZ A;  4ESR A;  2K7A A;  5DY9 A;  2X4Y A;  2YUP A;  1RI0 A;  2ZGW A;  3VUZ A;  1TTH B;  2EJ9 A;  1VUB A;  1M1F A;  3PMI A;  4X1V A;  1VQK T;  4OMM A;  1TWB A;  2EFI A;  3TSW A;  1AWJ A;  1VQ9 Q;  3QO3 A;  2DVJ A;  3HP9 A;  4QQD A;  4ZTF A;  3QDR B;  3PFS A;  1I0C A;  2QAZ A;  2BKD N;  1YIT T;  1X27 A;  3CCU T;  3FRN A;  5DLO A;  2XG8 D;  4PFP A;  3JV3 A;  5HKC A;  4JJC A;  2V8I A;  3HPW A;  3OYY A;  2RA2 A;  2RQV A;  1PD1 A;  2A08 A;  2E5Q A;  3CCU Q;  3ER0 A;  2EGE A;  3NPF A;  4C92 G;  3CCM T;  4M77 C;  1Q82 C;  2LP5 A;  2LQW A;  4O6J A;  4X9D A;  1MNE A;  3OYA A;  1MND A;  1WXU A;  3QPH A;  1N8R R;  1LJO A;  3ZL7 C;  2HSP A;  4E2F B;  4C0D B;  4F04 B;  3CC2 T;  2DIQ A;  2LC4 A;  2MYS A;  2BIV A;  2KYM A;  3OYJ A;  5A0L A;  4XTW A;  3BW1 A;  3OYD A;  1ACM B;  4FIB A;  1R0B G;  4E7Z A;  3D7S B;  1VA7 A;  4PJM A;  2X3W D;  1Y71 A;  2D8H A;  2J6K A;  2EIF A;  1Q81 C;  1GXI E;  3M0S A;  2DIL A;  5DM7 R;  1PCX A;  3OSV A;  2DL3 A;  1K8A R;  3MEV A;  2GFA A;  3P8H A;  1N6A A;  5FU7 B;  3U23 A;  1PM3 A;  2RHU A;  3FIF A;  1QWE A;  4PJO A;  2LRQ A;  3OS1 A;  2ED1 A;  3G71 Q;  3M0P A;  2E70 A;  5CKH A;  3BFM A;  2DYB A;  1EZZ B;  2E41 A;  2KSS A;  4FW1 A;  4M7D D;  3EH1 A;  4P5N A;  3HFO A;  4RTW A;  4GLM A;  1BI0 A;  3SEM A;  4GY5 A;  4BDY A;  3V8J A;  3LGL A;  1OQK A;  2JZ2 A;  3NTH A;  3CME T;  1ZUY A;  4J9D A;  5C0M A;  4D6W A;  4B9X A;  2ZPH B;  4KRT A;  1O9S A;  3JCM Q;  1VQN A;  4RUG A;  4KUI A;  2DO3 A;  4FT4 A;  2MWP A;  1SSH A;  2OTJ Q;  3EGX A;  1SF9 A;  2EQK A;  1WA7 A;  4OMO A;  2FPD A;  3OYL A;  1WIE A;  3EFR A;  2FO0 A;  1EIF A;  4O5V A;  1Q95 G;  2DXB A;  4DQ2 A;  4MZP A;  1HXD A;  2RJE A;  2PZ1 A;  1QWF A;  1BU1 A;  4C92 A;  3GPL A;  1VQ5 Q;  4N4I A;  2FL7 A;  1V29 B;  2JTM A;  1W2B P;  1X2Q A;  2CT4 A;  1RAD B;  4B9W A;  4PJO B;  3RMS A;  2DTH A;  3OB9 A;  2EYW A;  3LYI A;  1H92 A;  1NYG A;  2DTI A;  4Z8A A;  5LJ3 j;  2LQ8 A;  4LUD A;  1Q7Y C;  1ABQ A;  3CC4 A;  3RR6 A;  1H64 1;  4MDW A;  5AYF A;  4IUQ A;  1I81 A;  1GFD A;  2GQV A;  2DX1 A;  3SD4 A;  3CMA T;  4PFO A;  2KI7 A;  4KUD K;  5FRM A;  2A3L A;  1VQ4 T;  1U8R A;  4F14 A;  4C0F A;  1ZLM A;  3JB9 H;  1LCK A;  1K0S A;  4KUL A;  2YLC A;  2LCC A;  4OMF B;  2DER A;  2HZY A;  4A4G A;  2CS7 A;  4AG1 C;  1QVG P;  4F17 A;  1MMG A;  5GAM h;  2HBP A;  2X4W A;  5FU6 B;  3L2R A;  5LJ5 g;  4M7A A;  4M77 E;  4DBR A;  3TEE A;  2K5L A;  4J7I A;  1LOJ A;  3FLG A;  3VS2 A;  4A63 B;  5A0G A;  5CKB A;  5IAY A;  3CCJ Q;  2EYZ A;  2BE7 D;  2DTO A;  2ED0 A;  3REB B;  2K3B A;  5GMK j;  1TS9 A;  1VYU A;  2O01 E;  3JCM J;  5L23 A;  1IZ6 A;  3C4S A;  1J3T A;  1WX6 A;  3V8K A;  2KXC A;  3I55 Q;  1W4S A;  4HVU A;  4MDX A;  2F2V A;  2MWO A;  2E4H A;  2CP5 A;  2VB6 A;  1M2V B;  2ESW A;  2M0O A;  3UPU A;  3HRS A;  4J9H A;  1S1N A;  3TSZ A;  1G3T A;  3I35 A;  2KRO A;  2FPF A;  3M56 A;  2EPD A;  2YRD A;  1WDX A;  2DEQ A;  2E3I A;  3GNG A;  4HVW A;  4CC2 A;  3GP8 A;  1VQO A;  1YHQ A;  3PE0 A;  2O9V A;  4RCC A;  1YJ9 T;  5CO7 A;  4A54 A;  1BI1 A;  3CMA A;  4AG2 C;  4FYX B;  2DZ9 A;  1Y96 A;  1AWO A;  2EWN A;  4L6V 5;  1JO8 A;  5GAN d;  1N9S A;  3FB9 A;  2X35 A;  3IQL A;  5I22 A;  4ZN3 A;  2L5Q A;  1OPK A;  3VUB A;  3V7C A;  1JXO A;  3PVL A;  1OZ3 A;  1QVF S;  1PKT A;  1MHN A;  1M90 R;  3JB9 D;  3PIO A;  3VS5 A;  2KBT A;  4XAX B;  1K9M R;  1UJY A;  2CZ7 B;  2GTO A;  4AMC A;  1OEB A;  4KH1 B;  4C0G A;  3AT1 B;  3EG2 A;  1F1B B;  2QXF A;  4M7D G;  5KH6 A;  1M2O A;  3MEA A;  3A1P A;  2QEX A;  4JRI A;  1AD5 A;  3BDU A;  1G8X A;  3ULR B;  5GMK m;  2EVR A;  1IXD A;  3EFO B;  4MZM A;  3JRZ A;  1NBE B;  1K73 C;  5GAN 3;  3OS2 A;  1SEM A;  1KD1 C;  2JUF A;  1X2K A;  1K9M U;  4J5Y A;  2DXU A;  3CCL Q;  5LJ3 e;  3VU3 C;  4XU0 A;  2WAC A;  9ATC B;  4DBF A;  5D7U A;  2K9G A;  1VQL A;  1FMK A;  1WI7 A;  4RCB A;  3OYK A;  3RIR A;  3FEO A;  2CP6 A;  1KFZ A;  4E7J A;  4EMK A;  2QTX A;  3QZ9 B;  2IG0 A;  4XU1 A;  2FYK A;  5KYX A;  4WF2 A;  5GAM j;  4M75 A;  3ZEH A;  1C6V X;  1TU0 B;  4BI8 B;  1I5L A;  1M4Z A;  2DA9 A;  3LH5 A;  1JJ2 A;  2ROT A;  3C12 A;  3M5A A;  4M78 A;  3G4S T;  4BE0 A;  1YI2 A;  2PTK A;  5GAN g;  1B7T A;  1OX8 A;  1NJI U;  5LL6 S;  4E7I A;  1VQO T;  1E7O A;  2HQX A;  1QCO A;  3NHN A;  4DEY A;  1VQN Q;  1M90 C;  2I2L A;  5LJ5 f;  2FG0 A;  1RLQ C;  1FXX A;  2YUN A;  1UGS B;  3RMQ A;  2NLU A;  5CKF A;  3F70 A;  1WJS A;  5A0D A;  4D8K A;  3AHU A;  2Y4X A;  2EKH A;  3OBY A;  5KE2 A;  4RTV A;  2CDT A;  1IRE B;  2D6F A;  2FRY A;  5GMK l;  1ZHI A;  4FM4 B;  5GMK i;  1MMA A;  4FSS A;  3OYC A;  2P0Q A;  4CI0 C;  4JPB W;  2OTL T;  5IHK A;  5ECA A;  2QGG A;  2RJF A;  4ELY C;  5DLQ E;  8ATC B;  4JRQ A;  4JUV A;  5GAN 7;  5EG2 A;  4ZN1 A;  1VIF A;  4M75 C;  2QQ9 A;  5IT9 E;  2ZAE A;  3FJ5 A;  3HRU A;  1VQ7 Q;  3A8H B;  2GTJ A;  2WSF E;  3RKW A;  4M75 B;  1JQQ A;  4EMK C;  1E6G A;  2A37 A;  2EQJ A;  5FW9 A;  3VKI A;  2CGH A;  2MMP A;  2RN8 A;  7AT1 B;  3M0Q A;  2ENM A;  2PVD B;  3OW2 A;  3I5S A;  1AWW A;  4MZT A;  4RTU A;  2COW A;  3VS7 A;  1KQ1 A;  1N5Z A;  2Y90 A;  1D0Y A;  3RUX A;  2EJG A;  3JCM e;  1G3S A;  1TUC A;  5EC7 A;  1WZO A;  1FMW A;  2RH2 A;  4C8Q G;  3CD6 Q;  3MCA B;  1JRI A;  2JN0 A;  3CC7 Q;  3L1A A;  2MPX C;  1NE8 A;  2H3J A;  2DE0 X;  4RTT A;  2HBW A;  2K2V A;  1Q86 C;  4JS5 A;  1N8R C;  1BKB A;  4OMQ A;  4OB3 B;  5GJW B;  4AFU C;  1RAH B;  2HNI A;  2KYB A;  2YHT A;  5CQY A;  3M9Q A;  3RKX A;  3M59 A;  3G6E T;  1X6O A;  3CEY A;  1I4K 1;  1YIT A;  1TSF A;  5GMK h;  4HCZ A;  2M51 A;  3R6N A;  1AHJ B;  1OX9 A;  4MMK A;  5HK3 A;  2HL3 A;  1YIJ A;  3G4S Q;  4DBH A;  5J3B A;  2ZPE B;  3C0C A;  3E9F A;  1KIK A;  2B86 A;  2P4T A;  4FSX A;  3PGG A;  1K4U S;  3QDF A;  2JM9 A;  4M4Z A;  2ZZD A;  3QYH B;  3CXC A;  5LJ5 j;  4IKF A;  2DEU A;  3V7R A;  1BI2 A;  4BAC A;  3CCS Q;  1YJW A;  3A8M B;  2RQW A;  5KCO A;  5I11 A;  2NUT B;  2DL8 A;  2LJ1 A;  1XQH A;  2V8K A;  4C92 E;  4QW2 A;  5KYX B;  2J7I A;  4JJN K;  1K76 A;  5D6X A;  3OSS C;  4NOY A;  1VQK A;  2L3Q A;  2C06 A;  2HL5 C;  1NYF A;  1P92 A;  4WCI A;  1UB4 A;  3QHS A;  4M7D C;  1HJD A;  2HDA A;  3SWN C;  1VQN T;  1C0M A;  4KH0 B;  1FWZ A;  1NLP C;  1IRX A;  2M0Y A;  4F7U G;  5LJ3 f;  2QEX Q;  2QA4 A;  1I07 A;  1N27 A;  3SWN B;  2P84 A;  2C0I A;  3WVE B;  2O88 A;  4RMO A;  1X01 A;  1V1C A;  3CC4 T;  3CC7 A;  1RAG B;  3EG1 A;  1YNZ A;  1JJ2 P;  2PNI A;  4J9B A;  4RTZ A;  3VS1 A;  5GAO n;  3QYG B;  1VQ8 A;  1QW1 A;  1WXT A;  1U5S A;  4OVA A;  3CBM A;  4ATO A;  3GNF B;  1T0H A;  4BD3 A;  4E47 A;  1KD1 U;  2X51 A;  2DNU A;  4R55 A;  2R5A A;  3I5R A;  3H6Z A;  2L2P A;  5GAN 4;  2K5I A;  1YIJ T;  4LDU A;  1S72 A;  2F2W A;  4IUP A;  4HCK A;  3KXT A;  4EMH A;  2KXD A;  2F5T X;  2K3Y A;  1PNJ A;  1D3B A;  1YIJ Q;  2JT4 A;  3HHT B;  3EFS A;  1WJR A;  3CC2 Q;  2VXF A;  3UF4 A;  1HK9 A;  1S72 Q;  4PLI A;  4ORZ A;  2HAX A;  2KNB B;  2RI5 A;  1LPL A;  1H8K A;  2J05 A;  3UWN A;  4L5G A;  4OMP A;  5GAN h;  3CCR Q;  4PLL A;  2F69 A;  2E10 A;  1WJQ A;  1Z9Q A;  1JXM A;  5FRO A;  1OV3 A;  1HSQ A;  1PC0 A;  3THK A;  4Z02 A;  2O2O A;  3QG1 A;  2JS0 A;  4J6Y A;  2MF2 A;  1I5O B;  4M7D B;  2KT8 A;  1ZSZ A;  3QJY A;  4ME7 A;  1KQS P;  3JCM P;  2P4R A;  3TVT A;  1MV0 B;  5KCH A;  1MGQ A;  4CC7 A;  2FVU A;  1W1F A;  2VXE A;  1YHQ Q;  2DM1 A;  3G71 T;  2K57 A;  5KYU B;  1UJ0 A;  4TVR A;  6AT1 B;  1QVG A;  2DFU A;  2QI2 A;  2HSE B;  2J06 A;  3JSC A;  1KG1 A;  2AK5 A;  2EYX A;  1WNL A;  1QKW A;  3QZ5 B;  4JJD A;  3X24 B;  5AT1 B;  3PIP A;  3G6E A;  4X9C A;  4IUU A;  1QCN A;  3M0R A;  1JBM A;  3H0F A;  3SDZ A;  1VQO Q;  4RTY A;  4BDZ A;  2RO0 A;  3CCS A;  4C5G A;  3CCE T;  2RF0 A;  3OYF A;  2RHY A;  4AFQ C;  4IUT A;  8AT1 B;  4JRK A;  3QJ6 A;  3S3O A;  2IVW A;  3EGU A;  3OBW A;  1CKA A;  3CCQ Q;  2DL5 A;  1BYM A;  4BY6 B;  1WHH A;  4E7K A;  2QQS A;  3E9G A;  2VYT A;  3HFN A;  3DB3 A;  2M02 A;  4J9I A;  4Z89 A;  1K73 R;  4HT8 A;  3G4S A;  1YI2 T;  1PKS A;  1QCF A;  4HVV A;  4FCY A;  1KSW A;  1WGS A;  5FWB A;  2F1L A;  2AT1 B;  1VQ6 T;  4CC3 A;  4J6W A;  4J7F A;  1XTD A;  5GAN f;  1VQ5 A;  5LJ3 d;  5LJ5 e;  4E7S A;  4J9E A;  4WTO B;  1CKB A;  5GAN 6;  1S72 T;  3RDV A;  2QYZ A;  1YJW Q;  4C92 F;  1YN8 A;  3E19 A;  5KYY A;  1JEG A;  3QII A;  1RAB B;  1BCO A;  2QAS A;  5IN1 A;  3MP8 A;  1KQ2 A;  4GLK A;  2BZY A;  1KHI A;  2E5K A;  2FPE A;  3GLX A;  5KYW B;  1RL2 A;  4M78 C;  3CD6 A;  1GCQ C;  1TUD A;  5CK9 A;  1UFF A;  2MI6 A;  5IH2 A;  2R57 A;  1ZA1 B;  4PKC C;  4KGX B;  1BK2 A;  1NJI C;  2LQN A;  1OU8 A;  4M78 B;  1OPL A;  3VYH B;  2AKK A;  4Y91 A;  5I2M A;  2D1X A;  2JS2 A;  4M7A B;  1OOT A;  4M78 E;  2O9S A;  4R56 A;  1NG2 A;  3OS0 A;  3VRZ A;  2RD1 A;  1ABO A;  1M30 A;  4NS5 A;  4J6X A;  4M75 E;  3I55 A;  2Z0W A;  4M7A G;  2CZ6 B;  3S3N A;  1BB9 A;  1SSF A;  2YLB A;  3CD6 T;  2VGM A;  2CP3 A;  2CZ0 B;  1GBQ A;  4A4K A;  1PWT A;  4FU6 A;  4YTL A;  5GAN 5;  4PJJ A;  2HCK A;  1VQ6 Q;  3MPU B;  3MJX A;  4IUR A;  3OS5 A;  2ROL A;  5GAN 2;  2NWM A;  3FC3 A;  1G3Y A;  2KRS A;  1K9M C;  2PVG B;  2JTF A;  2DXC A;  3OYB A;  5L8R E;  4LXC A;  4LD6 A;  1YJN Q;  2JVV A;  3CMA Q;  2XMF A;  3KUF A;  3JCM f;  2V1R A;  4QKU A;  4M77 B;  2VUB A;  5HY6 A;  1QVF P;  2HD0 A;  5IHI A;  1ZSZ C;  1B34 B;  2DD5 A;  4OGE A;  4JRP A;  5GAM f;  4C0D C;  1WHG A;  2QQA A;  3CCS T;  3V8L A;  3OYG A;  2SRC A;  2EW3 A;  2OAU A;  2CYZ B;  2EQU A;  4AT1 B;  1G3W A;  2J6O A;  4LNP A;  1TUG B;  1PRL C;  1H3Z A;  1Q81 U;  4M7A F;  1U1T A;  1R77 A;  2COZ A;  4M7D F;  1XNI A;  2NUP A;  4ZTJ A;  1RAI B;  1VQ4 Q;  1YJN T;  1GL5 A;  2YDL A;  1NEG A;  3M4G A;  2RMO A;  1YBY A;  2HKQ B;  4FT2 A;  1VYT A;  2RB6 A;  4F7U A;  3L2U A;  3CPF A;  1TG0 A;  2RM4 A;  2XIC A;  1YP5 A;  2XID A;  3RBB B;  3EH2 A;  4J8O A;  4BI4 A;  1U1S A;  4GBQ A;  5CIU A;  2R5M A;  1NM7 A;  4BB7 A;  4JLI A; 
#chains in the Genus database with same CATH homology
 3G4S Q;  2QA4 Q;  1VQ8 Q;  1VQ7 Q;  2OTJ Q;  1W2B P;  1VQO Q;  3CC2 Q;  1KC8 R;  3CCL Q;  3OW2 P;  3CCU Q;  1Q7Y R;  1VQ9 Q;  3CCV Q;  1VQN Q;  3I56 Q;  2OTL Q;  1YJN Q;  1YIT Q;  3I55 Q;  1S72 Q;  1NJI R;  3CMA Q;  1JJ2 P;  3G71 Q;  1KQS P;  3CC4 Q;  1Q82 R;  1YI2 Q;  1Q81 R;  3CCQ Q;  3CCJ Q;  1VQK Q;  1M1K R;  3G6E Q;  3CCR Q;  1YHQ Q;  3CME Q;  1M90 R;  3CCM Q;  1KD1 R;  3CCE Q;  1VQM Q;  1N8R R;  1VQP Q;  1YJW Q;  1VQ6 Q;  3CCS Q;  3CD6 Q;  1K9M R;  3CPW P;  1VQ5 Q;  3CXC P;  1VQL Q;  3CC7 Q;  1QVF P;  1K73 R;  1K8A R;  1QVG P;  2QEX Q;  1YJ9 Q;  1Q86 R;  1YIJ Q;  1VQ4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...