1YHQQ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yhqQ00
1QVGP 1QVFP 1VQ4Q 1VQPQ 1W2BP 1NJIR 1M1KR 1VQ7Q 2OTLQ 2OTJQ 3CC2Q 3CMAQ 3I56Q 3CC4Q 1JJ2P 1VQMQ 1VQNQ 1YJWQ 1VQ8Q 1K9MR 3CMEQ 1K73R 3CCJQ 1KQSP 3CCUQ 3CCMQ 3CXCP 3CCSQ 3CCRQ 3OW2P 1YITQ 3I55Q 1YJNQ 1KD1R 1VQKQ 1N8RR 1YI2Q 1VQOQ 1VQLQ 1Q86R 3G4SQ 1YIJQ 1Q81R 1VQ5Q 3CD6Q 3G6EQ 1Q82R 3CCLQ 1S72Q 3CC7Q 3CPWP 1KC8R 1YJ9Q 1Q7YR 1M90R 1VQ9Q 1VQ6Q 2QEXQ 3CCVQ 3G71Q 3CCEQ 1YHQQ 3CCQQ 1K8AR 2QA4Q
chains in the Genus database with same CATH superfamily
3OYMA 1K9MC 2ED1A 2K3YA 2LNVA 1GCQC 1N8RC 1JBMA 2IVWA 3GBQA 4PFZA 4FSXA 4RTZA 2G6FX 1KC8U 1KSWA 2FZCB 2CSIA 4PJOC 3G4SQ 2RA2A 4CC3A 3CMAT 2KRNA 2KK4A 3JB9F 3CPFA 3GP8A 2LX9A 2SEMA 4LN2A 2L0AA 3QJYA 4C8QE 5LJ5f 1S1NA 2E70A 1TSFA 1NJIC 2QGGA 3OMGA 4C92F 4PJOD 2DAQA 4JJNK 2DL4A 1JO8A 2M9UA 4M78G 1NEGA 2R57A 5A0GA 3I56Q 2L3RA 1SEMA 3G7ZA 3N5BB 1JRIA 4XAXB 4WCIA 5GAN3 4JPBW 2DKGA 3EGUA 2DYIA 4EMGA 2NUZA 1MNDA 1B34A 1NEBA 2PVOB 3G71Q 4XU1A 3X28B 2DBMA 1KD1U 1EX4A 2YUOA 1VQ7Q 5KYWB 3M4GA 1SHFA 1ZSZC 3QZ9B 2MI6A 1H92A 1YJNQ 1M4ZA 1OYXA 1U1TA 2F5TX 4FL6A 5GAMh 5FWBA 4II1A 1X6GA 1H641 3VYHB 3PGGA 3SEMA 3BW1A 2QA4Q 1TG0A 3V7CA 2E6ZA 3NMZC 3CC2Q 4PJJA 4PJMA 3V7RA 1N5ZA 2NYSA 1T3SA 4AFSC 3CCMQ 4QVZA 1YITQ 1UFFA 4OB0B 2J6OA 1IO6A 2QASA 5FRMA 2RO0A 3DLLA 5I21A 3AHUA 3H8ZA 1Q7YR 3META 1LJOA 2KT8A 5LJ3g 2K9GA 4HA8A 5DLQE 1WI7A 5FW9A 2HNIA 3CMEQ 1WLPB 1OQKA 1ABQA 1XTDA 4FYYB 2A28A 2BE9B 1LPLA 3QBYA 4BI8B 4EDUA 3SWNA 2DF6A 1BYMA 1H3ZA 3CCQA 2CREA 1M1KU 2XDBA 2EQUA 2FRYA 2K79A 5IAYA 2NWMA 3G4ST 3REBB 1U5SA 3DLMA 4IUUA 4C0FA 2O88A 3J7AF 4X9DA 2FZGB 1LNXA 2E6NA 1JJ2A 1UB4A 3JCMQ 2RM4A 2DRMA 2KAFA 1GCPA 1WXUA 1MHNA 1T0HA 1IREB 4C92C 4ZTFA 2OI3A 3NFCA 2DM1A 3M53A 3JB9D 3PFSA 1QCNA 4JS5A 1AZGB 4C92D 1K9MR 1HK9A 3G6EA 3G71T 3V7SA 4J7FA 1AWOA 1VQ7T 1Y96A 2JUFA 4FIBA 2DRKA 1Q82R 4LXCA 1QVGS 4Z8AA 2XICA 4HKEA 4IUVA 2OAWA 1YJNT 2LT4A 3C94A 2DZ9A 3FIFA 2KY9A 4LDVA 1OI1A 5LJ3h 1NJIR 2X9HA 1RAIB 3HKSA 4OP0A 3CD6A 4O5VA 4M78B 2JNGA 4HCZA 1M3CA 2ATCB 2OJ2A 2EJGA 3MEVA 2DL7A 4A53A 3CC2T 1VIFA 2YUNA 3CCMT 3REAB 1V76A 1YITT 1WHKA 4EMKC 1WNLA 4RTYA 1X01A 5AYFA 3PVQA 5GMKl 2JMAA 2B8AA 2EQKA 1VQOA 1K73R 3HPWA 3EHQA 1VIEA 2P0KA 4OMPA 1PSFA 4B9XA 1M8MA 1ZUKA 3JAME 5C6SA 3CMET 2RB6A 2J05A 3SD4A 2CP7A 2OTJA 3NTIA 1W2BP 1NYFA 2E3IA 5LJ3f 2NLUA 4M77G 4HT9A 1CKBA 3JCMX 1AWJA 4F7UG 3PMTA 1QLYA 2CYZB 4IKFA 2BKDN 4JS4A 1T0JA 5FROA 2NUPA 3LGFA 3UT1A 3CCQQ 2J6FA 5GAMj 4LDYA 2FL7A 1EIFA 4ELZC 1C0MA 4M77A 4KGVB 3FRNA 1S72A 2X4WA 4CC2A 4Z89A 5I11A 2QTXA 4GLMA 1GCQA 2EGEA 5HY6A 1YN8A 1WHJA 3PT9A 1ZX6A 4RTXA 1VQ8A 2K5IA 1UGPB 4JLIA 2CP3A 1WHHA 4ZGJB 2KE9A 2RPNA 3EG9A 4ZNXA 1QVPA 3MPUB 3M0QA 3EFRA 2EJFA 3ZBDA 1BB9A 4D8DA 1Q81C 5GAOm 1FMKA 3CPWS 1QWFA 3G6EQ 3TSZA 2QK0A 2QDLA 4RTVA 2M51A 3JCMc 1AHJB 3H0IA 3H9NA 2VV5A 3OYIA 1BIBA 1LOJA 2YT6A 5FU7B 4C0DB 1BIAA 4FYVB 1YNZA 4M78E 1TUDA 3X20B 2X51A 3OS5A 2HSPA 2AIRB 2XDPA 3CD6Q 2KROA 5DM7R 1X27A 1J3TA 1OX8A 5I22A 2RK2A 4ZGDB 2HZYA 4ORZA 4KH1B 4BACA 4PJNA 3CC4Q 2E5QA 1XNIA 1RAFB 2M16A 2EW3A 2VWFA 4Y92A 3M0PA 2E65A 3LLRA 1X2KA 4XU0A 2XDDA 1NE8A 4QKUA 1M30A 3CBMA 2O4XA 3M5AA 4OMNA 2CP0A 4PLLA 2OTJQ 1JEGA 4AG1C 2FPDA 2P0PA 3WVDB 1N6AA 4OB1B 3CCQT 2RQRA 2C0TA 3CC7A 2OX7A 2V8IA 1Q7YU 4E7HA 1JU5C 2OAUA 1ZBXA 3OYYA 4J5YA 2LCSA 4DBHA 1GL5A 3M4YA 1Y57A 1RAEB 1YJ9Q 3F70A 2YWWA 2RHIA 3CCVQ 1VQMA 1OU8A 1VQPQ 3RKYA 5J3BA 4IUQA 3LX7A 4KULA 3VS5A 3PIPA 4JRPA 4A4HA 1TH7A 1VQKQ 1FX7A 2AHJB 1M90U 1M9SA 1E6GA 1YHQA 2DIGA 2X3XD 1NZ9A 2DXTA 4F7UB 4B6MA 1VQ8Q 3G6ET 2KXCA 2RQUA 4C92A 2ZPFB 1QVGA 1RI9A 1G3WA 2BZXA 1HXDA 3RERA 3V8KA 2FYKA 1M1FA 1D0YA 2RK1A 1Q86R 3EG2A 1M2VA 3RMQA 1I5LA 4PJOF 4LD6A 2FO0A 2KQWA 4ZN3A 4BY6B 1T3LA 3MEWA 3I56A 2K2VA 3JV3A 4C8QB 4FU6A 2LJ1A 2R5AA 3CD6T 3OBYA 4E7ZA 2RJCA 1JXMA 2DZCA 2COYA 5CKFA 4LNPA 2DD4A 1SSFA 4A4FA 3EFSA 5FLXE 1Q82U 1UHFA 4WTOB 2M02A 5CO7A 3O5ZA 1IGQA 1Q81R 3CC4T 3NGPA 2J7IA 3HTRA 3G71A 3I5RA 3T9NA 1D1AA 5D7UA 2NUTB 3MP1A 1QP3A 4HVWA 1VQOT 3OY9A 1ACMB 3KXTA 5FU7C 1W1FA 3RIRA 4C0DC 2KR3A 4C8QF 2EBPA 1BKBA 1U1SA 5KYUB 4M7DG 4EMKA 1U8RA 1D09B 2DE0X 4C5HA 2EAYA 3A8HB 3PVLA 1AT1B 2OTJT 2V8KA 1P92A 4M75G 3JCMh 1SF9A 2KRSA 3RMSA 4BE0A 4IUPA 3QHSA 2QA4A 2DX1A 4RG8A 1K8AC 1I81A 2VC8A 3FJPA 3UA7A 5FRNA 2KMTA 1K73U 1ARKA 1BCMA 1QMCA 1UDLA 2LQWA 4IIMA 1DJ7B 4M7DA 1HD3A 2B86A 4HVVA 2CP2A 4DEYA 3VUZA 1CSKA 3VV0A 2E5KA 3R6NA 1YBYA 1IB8A 3FC3A 4C5IA 3THKA 2HSEB 1MMNA 4PNOA 2PVDB 3M0UA 5GANe 2FEIA 3L2QA 4BI3A 1S72T 5KE3A 2D1XA 3C4SA 3OB9A 2O2OA 4Z02A 4E6RA 3CXCP 2L2PA 1VQ8T 3LH5A 2VXFA 5CKBA 4NOYA 1JXOA 2SRCA 4M77E 1ZA1B 3EGDA 2FB7A 4F7UE 3JCMf 3GNGA 3A1PA 4E47A 4LDWA 1YHQQ 1WQ7A 2K3BA 2ENMA 3CPWA 1QVFP 5GAOl 3EGXB 1PD1A 2EFIA 1QWEA 2BZYA 3X24B 1PRMC 2CH4A 3P8HA 5L23A 4ZN1A 5C0MA 3OYKA 1MGQA 3JRZA 1ZUYA 3VRYA 5GAN5 2GFAA 3QKJA 2FPFA 5GAN7 3G1JA 2ABLA 1NLOC 4OB2B 1G2BA 2DVJA 4J9EA 2E64A 3BDUA 1B7TA 1M2OA 2LNHB 3TEEA 2CGHA 4B9WA 1VQLA 1Z9QA 1OPLA 3MHXA 2MOXA 3UF4A 2XMFA 2DBKA 2QEXA 2YLBA 3JCMW 5I2MA 2CH4W 1QQJA 4BY6C 2DJZA 5IH2A 4C8QC 2WSFE 1VOMA 3SDZA 1YJWQ 4M7AG 4BB7A 2WACA 2F2XA 4JJDA 4XU3A 2XIDA 4BE2A 4C8QD 1ZLMA 2GCXA 1O9SA 5CKDA 1ZA2B 5GAN8 2M0OA 4HCKA 1PM3A 3ZL7C 3VS2A 4RCCA 3EFOA 1KFZA 4M7AA 4WF2A 3CC7T 2AKKA 5GANg 2AKLA 2BUDA 4RKUE 1WFWA 1UGSB 2Z0WA 3QJ6A 3E1SA 5IXFA 2DEQA 1VQMT 3LW5E 1UGRB 3OSSC 1YFNA 3V8JA 2HQXA 3EH1A 4M75B 1MUZA 3VS0A 3OYHA 4FM4B 3I55A 1NPRA 1UGVA 2M1HA 3GNFB 4FT4A 3OS2A 2PUKB 5D6XA 3UDCA 1HYOA 1YHQT 4A4GA 4BE1A 2FPEA 2L3PA 4MMLA 2COWA 4KUIA 2XK0A 3PMIA 1HJDA 4QQDA 4OMOA 2RI3A 1D1CA 5KE2A 2EKHA 4JRQA 1Y71A 4ELYC 5KYYB 3L2UA 1Y07A 1Y7XA 1PKSA 1WJSA 3I35A 2RN8A 2DMOA 3A8LB 1FYNA 2I2LA 3HHTB 1OOTA 1TU0B 2O9VA 2E41A 4QQGA 1KC8C 2H3EB 3I56T 4DQ2A 3KBGA 1UGQB 4J9GA 4RTTA 1NYGA 2LZ6B 4LUDA 4FT2A 3E19A 2RJFA 2K5LA 2C0OA 2MMPA 1RL2A 5LJ5j 2IG0A 1X6OA 1Q86U 2A36A 3O8VA 5GANh 1N9SA 1N8RR 4RTWA 1VQLQ 1JQQA 2R58A 1M3AA 2JS0A 3VKIA 4J9BA 2DPPB 1GBRA 4LD9K 5GMKj 3ZEHA 1VQNA 2QEXQ 3UPUA 2RQVA 1GBQA 3CCRA 3LGLA 3CBOA 1AD5A 2DXBA 2IPOB 1WYXA 2JTMA 1KD1C 1JJ2P 4AT1B 1U06A 1B34B 2P84A 5EG2A 2ZCFB 2KNBB 5KYNA 3QPHA 2QA4T 2HAXA 1G3TA 3CCEA 5GJWB 3CCLQ 1G83A 4J9HA 3HRUA 3CC4A 2YSQA 1WXTA 2EVRA 3I9QA 4HVUA 1VYUA 2DVEA 3V8LA 2KRMA 3HRSA 2F1LA 4M7DE 4N0AA 3CQTA 5GANf 4M78F 1PWTA 5KCHA 2GNCA 2X4XA 4M75E 2KEAA 3VJPA 5J39A 2ESWA 2LX7A 3CCUA 3OW2S 2ROLA 2BZ8A 1M8VA 3WXMB 3EG0A 1YCSB 3VU3C 4DOVA 3M0TA 3I55Q 5GAN2 3TCJA 2GGRA 4OF1A 3VS7A 2Y4XA 1YJ9A 1VUBA 2ZGWA 3FDRA 1ZUUA 5CCAA 3CCVA 2X4YA 1M1GA 2PQWA 1VQPA 3QSUA 1IHWA 2HD0A 2FHDA 1M1KC 3SB2A 3CXCS 1ZSGA 3SWNB 4N4HA 4PJOG 3J81E 4PK4A 1VQKA 4J9DA 2EGCA 2RNAA 2QDYB 1PKTA 4C5EA 4D8KA 3OYJA 4DBRA 4Y28E 2MIOA 3LWIA 4J9IA 1VQLT 4PJOA 1PC0A 3SHWA 1KQ1A 3RR6A 2D8JA 1X6BA 4DBQA 5LJ5d 4XTVA 5HK3A 2JT4A 2QEXT 4P5NA 3D7SB 3OYGA 5I2SA 3PNWC 4AMCA 2HQEA 2O9SA 2FRWA 1KC8R 4GLKA 4L5GA 1U3OA 2XG8D 1VQ9Q 2LVMA 4IUTA 1Y96B 4ATOA 3ZFJA 1WPYA 3MJXA 9ATCB 1VQNQ 3VS3A 2RJDA 2C0IA 1UTIA 1RLPC 3CCRQ 3BY7A 2X4JA 2PNIA 1YIJQ 5A0DA 1ZSZA 4BDZA 2HKQB 1G5VA 2AZVA 2V8JA 5M9OA 2ZPIB 4BUGA 2QGFB 3CCEQ 3RNJA 4A54A 2X3WD 1PCXA 1RAHB 4PLIA 1MMDA 4KGZB 4HXJA 4M7AE 4J9CA 2MAMA 4M78C 1E7OA 1LVKA 2ROTA 2E1HA 2XU8A 3I55T 4E2FB 4M78D 2A7YA 3INZA 1X75C 1IZ6A 5ECAA 4ZGEB 2DXCA 4J8OA 1A0NB 3CCUQ 1XOVA 1GFDA 4TVRA 2ZPGB 2CP5A 1K0SA 5LJ3j 1VYTA 1WA7A 3VYGA 4NL2A 4ANJA 1RABB 2D0NA 4RTUA 5CKEA 2L3QA 2F2WA 3P8DA 3JB9G 5GAMd 3PTAA 1MV3A 1WGSA 2GBQA 2E4HA 4C92G 2NUPB 3L2RA 5KYXA 4MMKA 2DEUA 1W6XA 4BDYA 2RHYA 1QP2A 3M59A 3JB9I 2MYSA 1QKXA 4M77B 5GAOp 2VVKA 1AZEA 2CDTA 1VA7A 1M1KR 1D3BA 5GJVB 1WXBA 3CBPA 3EG9B 5CR2A 4E7LA 2ZZDA 1VQ6A 1M5Q1 1UJ0A 1VQNT 3UA6A 2DXUA 3S3NA 1KHCA 3EH2A 3CCRT 2K4YA 2HMAA 1K9MU 5HK0A 4M77F 2K6DA 3CCSA 1VQ4Q 3FLGA 4K11A 1GRIA 4F7UF 4DOWA 1N8RU 3L1AA 4MDWA 5GAMe 2P0QA 1GXIE 1HSQA 1KQSP 2LDMA 2MF2A 5GAN4 3CCET 1O75A 1D0ZA 2BE7D 2RQWA 4VUBA 1V29B 2YDLA 3HP9A 2DFUA 1R77A 4L6V5 1K76A 4QVDA 2JTEA 2JXBA 1NJIU 2RH2A 4MDXA 3L42A 1NLPC 3QIIA 1YJWA 2CUDA 2H8HA 1QVGP 4J83A 1WQWA 1VYVA 2EYXA 4A4EA 1ABOA 1PNJA 5IHKA 2QTVA 3OBWA 4Z88A 3QDRB 2QQSA 2L3SA 2COZA 2HCKA 3E2UA 4GY5A 3OW2A 1RI0A 4O6JA 3OS0A 5KYWA 2LTOA 3CEYA 2DL3A 3CCUT 2EIFA 4LUEA 1NBEB 2KGTA 2PZ1A 4V2SA 2RMOA 1XJWB 1I07A 2PVGB 1UEBA 1YJ9T 2DL8A 2R5MA 3CCVT 2O4XB 1G3YA 3CXCA 3M56A 1VQPT 4Y91A 3P8BB 5LJ3d 1K4US 2K7AA 5D6YA 3H0HA 1W2BS 1N9RA 3IQLA 3M58A 4D6WA 3OYBA 1OX9A 2LRQA 4JUVA 2ECZA 1VQKT 2H3JA 4JJBA 1YWPA 3JCMb 5CVIA 4LDXA 1QVFA 3GLXA 1WHLA 2E12A 3LYIA 2D0QB 1M90C 1Z9ZA 5GAOq 1LCKA 2MPXC 1PG5B 2EJ9A 2L8DA 4HCBA 4AFQC 1RAAB 3NTKA 1NM7A 1AEYA 1M27C 1UJYA 1QCOA 4OMQA 5GAMg 1TXQA 3QZ5B 1SRLA 2FZKB 5GAOr 1MNEA 1E6HA 1ZHIA 4C92B 3SFMA 1IXDA 2D8HA 3OS1A 2QQRA 1C1AA 1EZZB 4KGXB 4M77C 1VQ6Q 4AFZC 4C5GA 2GQIA 1M2VB 2EYZA 3MCAB 2HL5C 1IGUA 1RAGB 2EGAA 1G3SA 1VQ5A 4M77D 4MZTA 3VS6A 3CCSQ 3PE0A 1Q82C 2YRCA 2MK5A 3S3MA 3OA6A 4C0ZA 4XTZA 1D1BA 3CPWP 1YWOA 3DB4A 1I8FA 4EMHA 1BCOA 2M0YA 3JCMP 2VASA 2JM8A 1TUGB 3UATA 3M0RA 2EQMA 2VXEA 4MZMA 1WHMA 1MMAA 3CCLA 1YI2Q 2CS7A 1BBZA 5IXBA 2YLCA 4RMOA 4EMKB 4X34A 3FJ5A 4CC4B 1PD0A 2HL3A 4M78A 4M4ZA 1OEBA 1K73C 2DJQA 4DA4A 2EYQA 5GAN6 4ZTJA 2VUBA 5CQXA 4PFPA 3L2VA 1BI0A 1XQHA 5CK9A 2LJ0A 4E7KA 1H3HA 2DTOA 4M7DB 2LP5A 4E7IA 3GPLA 4F17A 1R0BG 3QWXX 1V1CA 2JOYA 2LQNA 4A4KA 3DB3A 2K3XA 4JDSA 2PU9B 2DLPA 2K5FA 1K8AR 4OMFB 3VUBA 3S6WA 2CT3A 3M0SA 1UUEA 4FCYA 1N27A 4CC7A 3HFOA 3NTHA 4FYXB 1FXXA 5IN1A 4YTLA 2LMJA 4A63B 3C0CA 5IT9E 1AVZC 1KK7A 3QDFA 4M7DF 2LQKA 3X25B 1X43A 2QI2A 3GOXA 2PTKA 2JZ2A 2CZ7B 3EGDB 4M75F 1KJWA 4AG2C 4EIKA 1MMGA 2EYYA 4R55A 2O01E 1I0CA 1VQ6T 1WDXA 1WIEA 5LL6S 2DD5A 4C92E 2RJEA 3MO8A 1ZQ1A 2DO3A 5GAMf 5L8RE 3CCST 2D9TA 1OPKA 3EG3A 1M90R 5A0LA 3OYFA 8ATCB 5FU6B 1RLQC 5CKHA 2VKNA 2LT1A 1SKUB 3ER0A 3HL8A 5IHNA 2A3LA 2L89A 5HCKA 2FG0A 1SG5A 2HEQA 4X1VA 4XTXA 2KT1A 2K2MA 1VQ5Q 1VQ9A 4C0GA 1YJWT 1W4SA 3MEUA 2V1QA 1M3BA 2GTOA 1YI2T 1KQSS 1WJQA 4E7SA 2JTFA 2BTTA 2CZ1B 2ZPBB 3QWYA 2VYTA 1Q81U 3PIOA 2LCLA 2KSSA 1YIJA 3H41A 3DKMA 2KXDA 2ZPHB 3OQ5A 1Q95G 4JZ3A 4R56A 5GAOn 4OB3B 2OTLA 3OMCA 3AT1B 2DA9A 3VS4A 5CQYA 2KI7A 2PUOB 4XK8E 4JRKA 1W2BA 5GMKi 2EYWA 3RESA 1MV0B 4MZPA 1UG1A 3EFOB 4NS5A 4M7AB 2DIQA 4EPCA 4XTWA 3M9QA 2J06A 3L2WA 2X35A 4BI4A 1WJRA 2DILA 1PRLC 3RDVA 3QXEB 4J9FA 1FMVA 3E9GA 4XTUA 4AFUC 4ESRA 3LH0A 1CKAA 3BE3A 1BK2A 3MP6A 4M7DC 4LE9A 2WSEE 4FW2A 4DBFA 2L5QA 3Q1JA 4M7AF 2Y90A 2CZ6B 3TQ7P 2LCCA 3FEOA 1BI2A 4M75C 4M7DD 1QW1A 1RUWA 3JCMd 2AT1B 3C12A 3M55A 5HKCA 2MWPA 2ED0A 4M75D 2GQVA 2AZSA 3MP8A 2DERA 3OYAA 2JMCA 1QVFS 3NHNA 1AOJA 2DYBA 4PJLA 4FSSA 2CZ0B 5AT1B 1ZBJA 1K9AA 2FVUA 4QQ6A 3CCJA 4HT8A 2MWOA 3OYCA 2CT4A 1VQ5T 1H8KA 2D6FA 3RBBB 1Q86C 3LWHA 4F7UA 3A8GB 2DTHA 2ZAEA 1I4K1 2QQBA 2EWNA 2RD1A 4C8QG 1KHIA 1VQ4A 4GBQA 4XTYA 3QUIA 4RUGA 4HCCA 5CIUA 1D0XA 3QG1A 3UWNA 2YXYA 3CCLT 5FU6C 1SRMA 3JCMe 2W0ZA 4PFOA 4E7JA 4JRIA 5FWCA 3VS1A 3OYLA 2RI5A 2KVQG 1K1ZA 4C8QA 2A08A 2WSCE 3H0FA 3L2ZA 1YP5A 3KFVA 2XI9A 2RI2A 4RCBA 1OZ3A 3CMAA 2P4RA 2XHCA 3EG1A 1WZOA 5CAIA 1IRXA 1WHGA 2OTLQ 1G8XA 2I0NA 3S3OA 3TREA 1C6VX 1EFNA 2QYZA 5J26A 5LJ5e 1KD1R 4F04B 4Q5WA 2NUTA 3WVEB 3JB9J 1B3QA 4IIOA 1KG1A 1FMWA 2RHXA 1NPPA 3HRTA 2F5KA 3E9FA 4BD3A 1AWXA 5KYUA 2QXFA 2V1RA 4IURA 2DTIA 2DNUA 2MCNA 2IIMA 2JN0A 5GANj 5GMKe 1BI1A 2DK3A 1K0XA 3OYDA 3R6OA 1TWBA 3NPFA 1NG2A 4FYWB 3ULRB 1QKWA 4KH0B 1BI3A 1KQ2A 1VQOQ 3QYGB 2QAZA 3A98A 2YUPA 3FB9A 1RACB 1K8AU 2KYBA 4KRTA 3URGA 4M7AC 4R0KA 1OV3A 2CKKA 2XD0A 2A0FB 3A8MB 2QG9B 5D6WA 4XQ3A 4M7AD 1YCYA 2E3HA 4QVCA 4PL6A 1IHVA 1W70A 2QQAA 3QYHB 3I5SA 3X26B 2EKOA 3MEAA 7AT1B 1AWWA 2RHZA 2ZPEB 2DETA 5DY9A 2HKNA 4N4IA 4F16A 2KYMA 5A2QE 1JB0E 1RADB 2BIVA 2CSQA 3SWNC 2HDAA 3RKXA 3CCJQ 1VQ9T 3A8OB 3ASKA 3JCMg 1PSEA 3U23A 4PJOB 1KQSA 1Y0MA 2AK5A 3EGXA 2EQJA 1X2QA 1S72Q 2JM9A 3J80E 4JZ4A 2G3RA 2KDSA 3M57A 3OYEA 2VGMA 4QT7A 2GFUA 3M54A 1YIJT 2JVVA 1UHCA 3G4SA 3OYNA 5KCOA 2EQIA 2YRVA 4J6WA 1PHTA 4KUDK 2KBTA 2HQHA 5LJ5g 2OTLT 3ME9A 1R0CB 2VGNA 3GF5A 3BDLA 4NL3A 1JJ2S 1SPKA 2CUBA 3EHRA 5KH6A 4JLGA 2P4TA 1FWZA 2W10A 1ZSZB 2F69A 3CMAQ 1YI2A 1UECA 3JCMV 2A37A 4X9CA 1X69A 2O31A 1GFCA 6AT1B 2GF7A 1SHGA 3JCMJ 1VQ7A 4UC4A 3A5ZB 4ME7A 3KUFA 2LJ3A 4N4GA 4XU2A 5GANd 3OSVA 3QO3A 4J6YA 1YJNA 2EPDA 1TOVA 3GIBA 1TS9A 1F1BB 8AT1B 2F2VA 2RHUA 2RQTA 4OMLA 4QW2A 3JB9H 3EAEA 3H6ZA 2HBWA 2JJ9A 2JS2A 3TU4K 3HFNA 1Q7YC 4J7IA 4PKCC 4RG2A 1R8OB 1B07A 2DL5A 2J6KA 5IHIA 2V26A 3CC2A 2JW4A 1I5OB 3TVTA 2YHTA 4CI0C 4N0AC 3CCMA 2E10A 4F14A 2C06A 1YITA 2LC4A 3C95A 2XKOC 2CP6A 5DLOA 1OZ2A 3OW2P 3VRZA 1OU9A 1TTHB 5GMKm 1UE9A 4M75A 3RKWA 4J6XA 4L59A 3TSWA 4OGCA 5LJ5h 1BU1A 3JSCA 4KT0E 2VB6A 3CCJT 1OULA 2GTJA 3CC7Q 4FW1A 2HBPA 3RUXA 5KYXB 3CMEA 1QCFA 3HSBA 4LDUA 1VQMQ 1KIKA 2YRDA 2QQ9A 3MKDA 5GMKh 3BFMA 4PJOE 4OGEA 1I1JA 2LQ8A 1WX6A 4OMMA 2RF0A 5KYYA 1VQ4T 2YUQA 1D3BB 4CRIA 2Y4YA 1SSHA 4DEXA 5LJ3e 4OVAA 5EC7A 1TUCA 4JJCA 4KBMB 2K57A
chains in the Genus database with same CATH topology
1QVGP 1QVFP 1VQ4Q 1VQPQ 1W2BP 1NJIR 1M1KR 1VQ7Q 2OTLQ 2OTJQ 3CC2Q 3CMAQ 3I56Q 3CC4Q 1JJ2P 1VQMQ 1VQNQ 1YJWQ 1VQ8Q 1K9MR 3CMEQ 1K73R 3CCJQ 1KQSP 3CCUQ 3CCMQ 3CXCP 3CCSQ 3CCRQ 3OW2P 1YITQ 3I55Q 1YJNQ 1KD1R 1VQKQ 1N8RR 1YI2Q 1VQOQ 1VQLQ 1Q86R 3G4SQ 1YIJQ 1Q81R 1VQ5Q 3CD6Q 3G6EQ 1Q82R 3CCLQ 1S72Q 3CC7Q 3CPWP 1KC8R 1YJ9Q 1Q7YR 1M90R 1VQ9Q 1VQ6Q 2QEXQ 3CCVQ 3G71Q 3CCEQ 1YHQQ 3CCQQ 1K8AR 2QA4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QVG P;  1QVF P;  1VQ4 Q;  1VQP Q;  1W2B P;  1NJI R;  1M1K R;  1VQ7 Q;  2OTL Q;  2OTJ Q;  3CC2 Q;  3CMA Q;  3I56 Q;  3CC4 Q;  1JJ2 P;  1VQM Q;  1VQN Q;  1YJW Q;  1VQ8 Q;  1K9M R;  3CME Q;  1K73 R;  3CCJ Q;  1KQS P;  3CCU Q;  3CCM Q;  3CXC P;  3CCS Q;  3CCR Q;  3OW2 P;  1YIT Q;  3I55 Q;  1YJN Q;  1KD1 R;  1VQK Q;  1N8R R;  1YI2 Q;  1VQO Q;  1VQL Q;  1Q86 R;  3G4S Q;  1YIJ Q;  1Q81 R;  1VQ5 Q;  3CD6 Q;  3G6E Q;  1Q82 R;  3CCL Q;  1S72 Q;  3CC7 Q;  3CPW P;  1KC8 R;  1YJ9 Q;  1Q7Y R;  1M90 R;  1VQ9 Q;  1VQ6 Q;  2QEX Q;  3CCV Q;  3G71 Q;  3CCE Q;  1YHQ Q;  3CCQ Q;  1K8A R;  2QA4 Q; 
#chains in the Genus database with same CATH topology
 3OYM A;  1K9M C;  2ED1 A;  2K3Y A;  2LNV A;  1GCQ C;  1N8R C;  1JBM A;  2IVW A;  3GBQ A;  4PFZ A;  4FSX A;  4RTZ A;  2G6F X;  1KC8 U;  1KSW A;  2FZC B;  2CSI A;  4PJO C;  3G4S Q;  2RA2 A;  4CC3 A;  3CMA T;  2KRN A;  2KK4 A;  3JB9 F;  3CPF A;  3GP8 A;  2LX9 A;  2SEM A;  4LN2 A;  2L0A A;  3QJY A;  4C8Q E;  5LJ5 f;  1S1N A;  2E70 A;  1TSF A;  1NJI C;  2QGG A;  3OMG A;  4C92 F;  4PJO D;  2DAQ A;  4JJN K;  2DL4 A;  1JO8 A;  2M9U A;  4M78 G;  1NEG A;  2R57 A;  5A0G A;  3I56 Q;  2L3R A;  1SEM A;  3G7Z A;  3N5B B;  1JRI A;  4XAX B;  4WCI A;  5GAN 3;  4JPB W;  2DKG A;  3EGU A;  2DYI A;  4EMG A;  2NUZ A;  1MND A;  1B34 A;  1NEB A;  2PVO B;  3G71 Q;  4XU1 A;  3X28 B;  2DBM A;  1KD1 U;  1EX4 A;  2YUO A;  1VQ7 Q;  5KYW B;  3M4G A;  1SHF A;  1ZSZ C;  3QZ9 B;  2MI6 A;  1H92 A;  1YJN Q;  1M4Z A;  1OYX A;  1U1T A;  2F5T X;  4FL6 A;  5GAM h;  5FWB A;  4II1 A;  1X6G A;  1H64 1;  3VYH B;  3PGG A;  3SEM A;  3BW1 A;  2QA4 Q;  1TG0 A;  3V7C A;  2E6Z A;  3NMZ C;  3CC2 Q;  4PJJ A;  4PJM A;  3V7R A;  1N5Z A;  2NYS A;  1T3S A;  4AFS C;  3CCM Q;  4QVZ A;  1YIT Q;  1UFF A;  4OB0 B;  2J6O A;  1IO6 A;  2QAS A;  5FRM A;  2RO0 A;  3DLL A;  5I21 A;  3AHU A;  3H8Z A;  1Q7Y R;  3MET A;  1LJO A;  2KT8 A;  5LJ3 g;  2K9G A;  4HA8 A;  5DLQ E;  1WI7 A;  5FW9 A;  2HNI A;  3CME Q;  1WLP B;  1OQK A;  1ABQ A;  1XTD A;  4FYY B;  2A28 A;  2BE9 B;  1LPL A;  3QBY A;  4BI8 B;  4EDU A;  3SWN A;  2DF6 A;  1BYM A;  1H3Z A;  3CCQ A;  2CRE A;  1M1K U;  2XDB A;  2EQU A;  2FRY A;  2K79 A;  5IAY A;  2NWM A;  3G4S T;  3REB B;  1U5S A;  3DLM A;  4IUU A;  4C0F A;  2O88 A;  3J7A F;  4X9D A;  2FZG B;  1LNX A;  2E6N A;  1JJ2 A;  1UB4 A;  3JCM Q;  2RM4 A;  2DRM A;  2KAF A;  1GCP A;  1WXU A;  1MHN A;  1T0H A;  1IRE B;  4C92 C;  4ZTF A;  2OI3 A;  3NFC A;  2DM1 A;  3M53 A;  3JB9 D;  3PFS A;  1QCN A;  4JS5 A;  1AZG B;  4C92 D;  1K9M R;  1HK9 A;  3G6E A;  3G71 T;  3V7S A;  4J7F A;  1AWO A;  1VQ7 T;  1Y96 A;  2JUF A;  4FIB A;  2DRK A;  1Q82 R;  4LXC A;  1QVG S;  4Z8A A;  2XIC A;  4HKE A;  4IUV A;  2OAW A;  1YJN T;  2LT4 A;  3C94 A;  2DZ9 A;  3FIF A;  2KY9 A;  4LDV A;  1OI1 A;  5LJ3 h;  1NJI R;  2X9H A;  1RAI B;  3HKS A;  4OP0 A;  3CD6 A;  4O5V A;  4M78 B;  2JNG A;  4HCZ A;  1M3C A;  2ATC B;  2OJ2 A;  2EJG A;  3MEV A;  2DL7 A;  4A53 A;  3CC2 T;  1VIF A;  2YUN A;  3CCM T;  3REA B;  1V76 A;  1YIT T;  1WHK A;  4EMK C;  1WNL A;  4RTY A;  1X01 A;  5AYF A;  3PVQ A;  5GMK l;  2JMA A;  2B8A A;  2EQK A;  1VQO A;  1K73 R;  3HPW A;  3EHQ A;  1VIE A;  2P0K A;  4OMP A;  1PSF A;  4B9X A;  1M8M A;  1ZUK A;  3JAM E;  5C6S A;  3CME T;  2RB6 A;  2J05 A;  3SD4 A;  2CP7 A;  2OTJ A;  3NTI A;  1W2B P;  1NYF A;  2E3I A;  5LJ3 f;  2NLU A;  4M77 G;  4HT9 A;  1CKB A;  3JCM X;  1AWJ A;  4F7U G;  3PMT A;  1QLY A;  2CYZ B;  4IKF A;  2BKD N;  4JS4 A;  1T0J A;  5FRO A;  2NUP A;  3LGF A;  3UT1 A;  3CCQ Q;  2J6F A;  5GAM j;  4LDY A;  2FL7 A;  1EIF A;  4ELZ C;  1C0M A;  4M77 A;  4KGV B;  3FRN A;  1S72 A;  2X4W A;  4CC2 A;  4Z89 A;  5I11 A;  2QTX A;  4GLM A;  1GCQ A;  2EGE A;  5HY6 A;  1YN8 A;  1WHJ A;  3PT9 A;  1ZX6 A;  4RTX A;  1VQ8 A;  2K5I A;  1UGP B;  4JLI A;  2CP3 A;  1WHH A;  4ZGJ B;  2KE9 A;  2RPN A;  3EG9 A;  4ZNX A;  1QVP A;  3MPU B;  3M0Q A;  3EFR A;  2EJF A;  3ZBD A;  1BB9 A;  4D8D A;  1Q81 C;  5GAO m;  1FMK A;  3CPW S;  1QWF A;  3G6E Q;  3TSZ A;  2QK0 A;  2QDL A;  4RTV A;  2M51 A;  3JCM c;  1AHJ B;  3H0I A;  3H9N A;  2VV5 A;  3OYI A;  1BIB A;  1LOJ A;  2YT6 A;  5FU7 B;  4C0D B;  1BIA A;  4FYV B;  1YNZ A;  4M78 E;  1TUD A;  3X20 B;  2X51 A;  3OS5 A;  2HSP A;  2AIR B;  2XDP A;  3CD6 Q;  2KRO A;  5DM7 R;  1X27 A;  1J3T A;  1OX8 A;  5I22 A;  2RK2 A;  4ZGD B;  2HZY A;  4ORZ A;  4KH1 B;  4BAC A;  4PJN A;  3CC4 Q;  2E5Q A;  1XNI A;  1RAF B;  2M16 A;  2EW3 A;  2VWF A;  4Y92 A;  3M0P A;  2E65 A;  3LLR A;  1X2K A;  4XU0 A;  2XDD A;  1NE8 A;  4QKU A;  1M30 A;  3CBM A;  2O4X A;  3M5A A;  4OMN A;  2CP0 A;  4PLL A;  2OTJ Q;  1JEG A;  4AG1 C;  2FPD A;  2P0P A;  3WVD B;  1N6A A;  4OB1 B;  3CCQ T;  2RQR A;  2C0T A;  3CC7 A;  2OX7 A;  2V8I A;  1Q7Y U;  4E7H A;  1JU5 C;  2OAU A;  1ZBX A;  3OYY A;  4J5Y A;  2LCS A;  4DBH A;  1GL5 A;  3M4Y A;  1Y57 A;  1RAE B;  1YJ9 Q;  3F70 A;  2YWW A;  2RHI A;  3CCV Q;  1VQM A;  1OU8 A;  1VQP Q;  3RKY A;  5J3B A;  4IUQ A;  3LX7 A;  4KUL A;  3VS5 A;  3PIP A;  4JRP A;  4A4H A;  1TH7 A;  1VQK Q;  1FX7 A;  2AHJ B;  1M90 U;  1M9S A;  1E6G A;  1YHQ A;  2DIG A;  2X3X D;  1NZ9 A;  2DXT A;  4F7U B;  4B6M A;  1VQ8 Q;  3G6E T;  2KXC A;  2RQU A;  4C92 A;  2ZPF B;  1QVG A;  1RI9 A;  1G3W A;  2BZX A;  1HXD A;  3RER A;  3V8K A;  2FYK A;  1M1F A;  1D0Y A;  2RK1 A;  1Q86 R;  3EG2 A;  1M2V A;  3RMQ A;  1I5L A;  4PJO F;  4LD6 A;  2FO0 A;  2KQW A;  4ZN3 A;  4BY6 B;  1T3L A;  3MEW A;  3I56 A;  2K2V A;  3JV3 A;  4C8Q B;  4FU6 A;  2LJ1 A;  2R5A A;  3CD6 T;  3OBY A;  4E7Z A;  2RJC A;  1JXM A;  2DZC A;  2COY A;  5CKF A;  4LNP A;  2DD4 A;  1SSF A;  4A4F A;  3EFS A;  5FLX E;  1Q82 U;  1UHF A;  4WTO B;  2M02 A;  5CO7 A;  3O5Z A;  1IGQ A;  1Q81 R;  3CC4 T;  3NGP A;  2J7I A;  3HTR A;  3G71 A;  3I5R A;  3T9N A;  1D1A A;  5D7U A;  2NUT B;  3MP1 A;  1QP3 A;  4HVW A;  1VQO T;  3OY9 A;  1ACM B;  3KXT A;  5FU7 C;  1W1F A;  3RIR A;  4C0D C;  2KR3 A;  4C8Q F;  2EBP A;  1BKB A;  1U1S A;  5KYU B;  4M7D G;  4EMK A;  1U8R A;  1D09 B;  2DE0 X;  4C5H A;  2EAY A;  3A8H B;  3PVL A;  1AT1 B;  2OTJ T;  2V8K A;  1P92 A;  4M75 G;  3JCM h;  1SF9 A;  2KRS A;  3RMS A;  4BE0 A;  4IUP A;  3QHS A;  2QA4 A;  2DX1 A;  4RG8 A;  1K8A C;  1I81 A;  2VC8 A;  3FJP A;  3UA7 A;  5FRN A;  2KMT A;  1K73 U;  1ARK A;  1BCM A;  1QMC A;  1UDL A;  2LQW A;  4IIM A;  1DJ7 B;  4M7D A;  1HD3 A;  2B86 A;  4HVV A;  2CP2 A;  4DEY A;  3VUZ A;  1CSK A;  3VV0 A;  2E5K A;  3R6N A;  1YBY A;  1IB8 A;  3FC3 A;  4C5I A;  3THK A;  2HSE B;  1MMN A;  4PNO A;  2PVD B;  3M0U A;  5GAN e;  2FEI A;  3L2Q A;  4BI3 A;  1S72 T;  5KE3 A;  2D1X A;  3C4S A;  3OB9 A;  2O2O A;  4Z02 A;  4E6R A;  3CXC P;  2L2P A;  1VQ8 T;  3LH5 A;  2VXF A;  5CKB A;  4NOY A;  1JXO A;  2SRC A;  4M77 E;  1ZA1 B;  3EGD A;  2FB7 A;  4F7U E;  3JCM f;  3GNG A;  3A1P A;  4E47 A;  4LDW A;  1YHQ Q;  1WQ7 A;  2K3B A;  2ENM A;  3CPW A;  1QVF P;  5GAO l;  3EGX B;  1PD1 A;  2EFI A;  1QWE A;  2BZY A;  3X24 B;  1PRM C;  2CH4 A;  3P8H A;  5L23 A;  4ZN1 A;  5C0M A;  3OYK A;  1MGQ A;  3JRZ A;  1ZUY A;  3VRY A;  5GAN 5;  2GFA A;  3QKJ A;  2FPF A;  5GAN 7;  3G1J A;  2ABL A;  1NLO C;  4OB2 B;  1G2B A;  2DVJ A;  4J9E A;  2E64 A;  3BDU A;  1B7T A;  1M2O A;  2LNH B;  3TEE A;  2CGH A;  4B9W A;  1VQL A;  1Z9Q A;  1OPL A;  3MHX A;  2MOX A;  3UF4 A;  2XMF A;  2DBK A;  2QEX A;  2YLB A;  3JCM W;  5I2M A;  2CH4 W;  1QQJ A;  4BY6 C;  2DJZ A;  5IH2 A;  4C8Q C;  2WSF E;  1VOM A;  3SDZ A;  1YJW Q;  4M7A G;  4BB7 A;  2WAC A;  2F2X A;  4JJD A;  4XU3 A;  2XID A;  4BE2 A;  4C8Q D;  1ZLM A;  2GCX A;  1O9S A;  5CKD A;  1ZA2 B;  5GAN 8;  2M0O A;  4HCK A;  1PM3 A;  3ZL7 C;  3VS2 A;  4RCC A;  3EFO A;  1KFZ A;  4M7A A;  4WF2 A;  3CC7 T;  2AKK A;  5GAN g;  2AKL A;  2BUD A;  4RKU E;  1WFW A;  1UGS B;  2Z0W A;  3QJ6 A;  3E1S A;  5IXF A;  2DEQ A;  1VQM T;  3LW5 E;  1UGR B;  3OSS C;  1YFN A;  3V8J A;  2HQX A;  3EH1 A;  4M75 B;  1MUZ A;  3VS0 A;  3OYH A;  4FM4 B;  3I55 A;  1NPR A;  1UGV A;  2M1H A;  3GNF B;  4FT4 A;  3OS2 A;  2PUK B;  5D6X A;  3UDC A;  1HYO A;  1YHQ T;  4A4G A;  4BE1 A;  2FPE A;  2L3P A;  4MML A;  2COW A;  4KUI A;  2XK0 A;  3PMI A;  1HJD A;  4QQD A;  4OMO A;  2RI3 A;  1D1C A;  5KE2 A;  2EKH A;  4JRQ A;  1Y71 A;  4ELY C;  5KYY B;  3L2U A;  1Y07 A;  1Y7X A;  1PKS A;  1WJS A;  3I35 A;  2RN8 A;  2DMO A;  3A8L B;  1FYN A;  2I2L A;  3HHT B;  1OOT A;  1TU0 B;  2O9V A;  2E41 A;  4QQG A;  1KC8 C;  2H3E B;  3I56 T;  4DQ2 A;  3KBG A;  1UGQ B;  4J9G A;  4RTT A;  1NYG A;  2LZ6 B;  4LUD A;  4FT2 A;  3E19 A;  2RJF A;  2K5L A;  2C0O A;  2MMP A;  1RL2 A;  5LJ5 j;  2IG0 A;  1X6O A;  1Q86 U;  2A36 A;  3O8V A;  5GAN h;  1N9S A;  1N8R R;  4RTW A;  1VQL Q;  1JQQ A;  2R58 A;  1M3A A;  2JS0 A;  3VKI A;  4J9B A;  2DPP B;  1GBR A;  4LD9 K;  5GMK j;  3ZEH A;  1VQN A;  2QEX Q;  3UPU A;  2RQV A;  1GBQ A;  3CCR A;  3LGL A;  3CBO A;  1AD5 A;  2DXB A;  2IPO B;  1WYX A;  2JTM A;  1KD1 C;  1JJ2 P;  4AT1 B;  1U06 A;  1B34 B;  2P84 A;  5EG2 A;  2ZCF B;  2KNB B;  5KYN A;  3QPH A;  2QA4 T;  2HAX A;  1G3T A;  3CCE A;  5GJW B;  3CCL Q;  1G83 A;  4J9H A;  3HRU A;  3CC4 A;  2YSQ A;  1WXT A;  2EVR A;  3I9Q A;  4HVU A;  1VYU A;  2DVE A;  3V8L A;  2KRM A;  3HRS A;  2F1L A;  4M7D E;  4N0A A;  3CQT A;  5GAN f;  4M78 F;  1PWT A;  5KCH A;  2GNC A;  2X4X A;  4M75 E;  2KEA A;  3VJP A;  5J39 A;  2ESW A;  2LX7 A;  3CCU A;  3OW2 S;  2ROL A;  2BZ8 A;  1M8V A;  3WXM B;  3EG0 A;  1YCS B;  3VU3 C;  4DOV A;  3M0T A;  3I55 Q;  5GAN 2;  3TCJ A;  2GGR A;  4OF1 A;  3VS7 A;  2Y4X A;  1YJ9 A;  1VUB A;  2ZGW A;  3FDR A;  1ZUU A;  5CCA A;  3CCV A;  2X4Y A;  1M1G A;  2PQW A;  1VQP A;  3QSU A;  1IHW A;  2HD0 A;  2FHD A;  1M1K C;  3SB2 A;  3CXC S;  1ZSG A;  3SWN B;  4N4H A;  4PJO G;  3J81 E;  4PK4 A;  1VQK A;  4J9D A;  2EGC A;  2RNA A;  2QDY B;  1PKT A;  4C5E A;  4D8K A;  3OYJ A;  4DBR A;  4Y28 E;  2MIO A;  3LWI A;  4J9I A;  1VQL T;  4PJO A;  1PC0 A;  3SHW A;  1KQ1 A;  3RR6 A;  2D8J A;  1X6B A;  4DBQ A;  5LJ5 d;  4XTV A;  5HK3 A;  2JT4 A;  2QEX T;  4P5N A;  3D7S B;  3OYG A;  5I2S A;  3PNW C;  4AMC A;  2HQE A;  2O9S A;  2FRW A;  1KC8 R;  4GLK A;  4L5G A;  1U3O A;  2XG8 D;  1VQ9 Q;  2LVM A;  4IUT A;  1Y96 B;  4ATO A;  3ZFJ A;  1WPY A;  3MJX A;  9ATC B;  1VQN Q;  3VS3 A;  2RJD A;  2C0I A;  1UTI A;  1RLP C;  3CCR Q;  3BY7 A;  2X4J A;  2PNI A;  1YIJ Q;  5A0D A;  1ZSZ A;  4BDZ A;  2HKQ B;  1G5V A;  2AZV A;  2V8J A;  5M9O A;  2ZPI B;  4BUG A;  2QGF B;  3CCE Q;  3RNJ A;  4A54 A;  2X3W D;  1PCX A;  1RAH B;  4PLI A;  1MMD A;  4KGZ B;  4HXJ A;  4M7A E;  4J9C A;  2MAM A;  4M78 C;  1E7O A;  1LVK A;  2ROT A;  2E1H A;  2XU8 A;  3I55 T;  4E2F B;  4M78 D;  2A7Y A;  3INZ A;  1X75 C;  1IZ6 A;  5ECA A;  4ZGE B;  2DXC A;  4J8O A;  1A0N B;  3CCU Q;  1XOV A;  1GFD A;  4TVR A;  2ZPG B;  2CP5 A;  1K0S A;  5LJ3 j;  1VYT A;  1WA7 A;  3VYG A;  4NL2 A;  4ANJ A;  1RAB B;  2D0N A;  4RTU A;  5CKE A;  2L3Q A;  2F2W A;  3P8D A;  3JB9 G;  5GAM d;  3PTA A;  1MV3 A;  1WGS A;  2GBQ A;  2E4H A;  4C92 G;  2NUP B;  3L2R A;  5KYX A;  4MMK A;  2DEU A;  1W6X A;  4BDY A;  2RHY A;  1QP2 A;  3M59 A;  3JB9 I;  2MYS A;  1QKX A;  4M77 B;  5GAO p;  2VVK A;  1AZE A;  2CDT A;  1VA7 A;  1M1K R;  1D3B A;  5GJV B;  1WXB A;  3CBP A;  3EG9 B;  5CR2 A;  4E7L A;  2ZZD A;  1VQ6 A;  1M5Q 1;  1UJ0 A;  1VQN T;  3UA6 A;  2DXU A;  3S3N A;  1KHC A;  3EH2 A;  3CCR T;  2K4Y A;  2HMA A;  1K9M U;  5HK0 A;  4M77 F;  2K6D A;  3CCS A;  1VQ4 Q;  3FLG A;  4K11 A;  1GRI A;  4F7U F;  4DOW A;  1N8R U;  3L1A A;  4MDW A;  5GAM e;  2P0Q A;  1GXI E;  1HSQ A;  1KQS P;  2LDM A;  2MF2 A;  5GAN 4;  3CCE T;  1O75 A;  1D0Z A;  2BE7 D;  2RQW A;  4VUB A;  1V29 B;  2YDL A;  3HP9 A;  2DFU A;  1R77 A;  4L6V 5;  1K76 A;  4QVD A;  2JTE A;  2JXB A;  1NJI U;  2RH2 A;  4MDX A;  3L42 A;  1NLP C;  3QII A;  1YJW A;  2CUD A;  2H8H A;  1QVG P;  4J83 A;  1WQW A;  1VYV A;  2EYX A;  4A4E A;  1ABO A;  1PNJ A;  5IHK A;  2QTV A;  3OBW A;  4Z88 A;  3QDR B;  2QQS A;  2L3S A;  2COZ A;  2HCK A;  3E2U A;  4GY5 A;  3OW2 A;  1RI0 A;  4O6J A;  3OS0 A;  5KYW A;  2LTO A;  3CEY A;  2DL3 A;  3CCU T;  2EIF A;  4LUE A;  1NBE B;  2KGT A;  2PZ1 A;  4V2S A;  2RMO A;  1XJW B;  1I07 A;  2PVG B;  1UEB A;  1YJ9 T;  2DL8 A;  2R5M A;  3CCV T;  2O4X B;  1G3Y A;  3CXC A;  3M56 A;  1VQP T;  4Y91 A;  3P8B B;  5LJ3 d;  1K4U S;  2K7A A;  5D6Y A;  3H0H A;  1W2B S;  1N9R A;  3IQL A;  3M58 A;  4D6W A;  3OYB A;  1OX9 A;  2LRQ A;  4JUV A;  2ECZ A;  1VQK T;  2H3J A;  4JJB A;  1YWP A;  3JCM b;  5CVI A;  4LDX A;  1QVF A;  3GLX A;  1WHL A;  2E12 A;  3LYI A;  2D0Q B;  1M90 C;  1Z9Z A;  5GAO q;  1LCK A;  2MPX C;  1PG5 B;  2EJ9 A;  2L8D A;  4HCB A;  4AFQ C;  1RAA B;  3NTK A;  1NM7 A;  1AEY A;  1M27 C;  1UJY A;  1QCO A;  4OMQ A;  5GAM g;  1TXQ A;  3QZ5 B;  1SRL A;  2FZK B;  5GAO r;  1MNE A;  1E6H A;  1ZHI A;  4C92 B;  3SFM A;  1IXD A;  2D8H A;  3OS1 A;  2QQR A;  1C1A A;  1EZZ B;  4KGX B;  4M77 C;  1VQ6 Q;  4AFZ C;  4C5G A;  2GQI A;  1M2V B;  2EYZ A;  3MCA B;  2HL5 C;  1IGU A;  1RAG B;  2EGA A;  1G3S A;  1VQ5 A;  4M77 D;  4MZT A;  3VS6 A;  3CCS Q;  3PE0 A;  1Q82 C;  2YRC A;  2MK5 A;  3S3M A;  3OA6 A;  4C0Z A;  4XTZ A;  1D1B A;  3CPW P;  1YWO A;  3DB4 A;  1I8F A;  4EMH A;  1BCO A;  2M0Y A;  3JCM P;  2VAS A;  2JM8 A;  1TUG B;  3UAT A;  3M0R A;  2EQM A;  2VXE A;  4MZM A;  1WHM A;  1MMA A;  3CCL A;  1YI2 Q;  2CS7 A;  1BBZ A;  5IXB A;  2YLC A;  4RMO A;  4EMK B;  4X34 A;  3FJ5 A;  4CC4 B;  1PD0 A;  2HL3 A;  4M78 A;  4M4Z A;  1OEB A;  1K73 C;  2DJQ A;  4DA4 A;  2EYQ A;  5GAN 6;  4ZTJ A;  2VUB A;  5CQX A;  4PFP A;  3L2V A;  1BI0 A;  1XQH A;  5CK9 A;  2LJ0 A;  4E7K A;  1H3H A;  2DTO A;  4M7D B;  2LP5 A;  4E7I A;  3GPL A;  4F17 A;  1R0B G;  3QWX X;  1V1C A;  2JOY A;  2LQN A;  4A4K A;  3DB3 A;  2K3X A;  4JDS A;  2PU9 B;  2DLP A;  2K5F A;  1K8A R;  4OMF B;  3VUB A;  3S6W A;  2CT3 A;  3M0S A;  1UUE A;  4FCY A;  1N27 A;  4CC7 A;  3HFO A;  3NTH A;  4FYX B;  1FXX A;  5IN1 A;  4YTL A;  2LMJ A;  4A63 B;  3C0C A;  5IT9 E;  1AVZ C;  1KK7 A;  3QDF A;  4M7D F;  2LQK A;  3X25 B;  1X43 A;  2QI2 A;  3GOX A;  2PTK A;  2JZ2 A;  2CZ7 B;  3EGD B;  4M75 F;  1KJW A;  4AG2 C;  4EIK A;  1MMG A;  2EYY A;  4R55 A;  2O01 E;  1I0C A;  1VQ6 T;  1WDX A;  1WIE A;  5LL6 S;  2DD5 A;  4C92 E;  2RJE A;  3MO8 A;  1ZQ1 A;  2DO3 A;  5GAM f;  5L8R E;  3CCS T;  2D9T A;  1OPK A;  3EG3 A;  1M90 R;  5A0L A;  3OYF A;  8ATC B;  5FU6 B;  1RLQ C;  5CKH A;  2VKN A;  2LT1 A;  1SKU B;  3ER0 A;  3HL8 A;  5IHN A;  2A3L A;  2L89 A;  5HCK A;  2FG0 A;  1SG5 A;  2HEQ A;  4X1V A;  4XTX A;  2KT1 A;  2K2M A;  1VQ5 Q;  1VQ9 A;  4C0G A;  1YJW T;  1W4S A;  3MEU A;  2V1Q A;  1M3B A;  2GTO A;  1YI2 T;  1KQS S;  1WJQ A;  4E7S A;  2JTF A;  2BTT A;  2CZ1 B;  2ZPB B;  3QWY A;  2VYT A;  1Q81 U;  3PIO A;  2LCL A;  2KSS A;  1YIJ A;  3H41 A;  3DKM A;  2KXD A;  2ZPH B;  3OQ5 A;  1Q95 G;  4JZ3 A;  4R56 A;  5GAO n;  4OB3 B;  2OTL A;  3OMC A;  3AT1 B;  2DA9 A;  3VS4 A;  5CQY A;  2KI7 A;  2PUO B;  4XK8 E;  4JRK A;  1W2B A;  5GMK i;  2EYW A;  3RES A;  1MV0 B;  4MZP A;  1UG1 A;  3EFO B;  4NS5 A;  4M7A B;  2DIQ A;  4EPC A;  4XTW A;  3M9Q A;  2J06 A;  3L2W A;  2X35 A;  4BI4 A;  1WJR A;  2DIL A;  1PRL C;  3RDV A;  3QXE B;  4J9F A;  1FMV A;  3E9G A;  4XTU A;  4AFU C;  4ESR A;  3LH0 A;  1CKA A;  3BE3 A;  1BK2 A;  3MP6 A;  4M7D C;  4LE9 A;  2WSE E;  4FW2 A;  4DBF A;  2L5Q A;  3Q1J A;  4M7A F;  2Y90 A;  2CZ6 B;  3TQ7 P;  2LCC A;  3FEO A;  1BI2 A;  4M75 C;  4M7D D;  1QW1 A;  1RUW A;  3JCM d;  2AT1 B;  3C12 A;  3M55 A;  5HKC A;  2MWP A;  2ED0 A;  4M75 D;  2GQV A;  2AZS A;  3MP8 A;  2DER A;  3OYA A;  2JMC A;  1QVF S;  3NHN A;  1AOJ A;  2DYB A;  4PJL A;  4FSS A;  2CZ0 B;  5AT1 B;  1ZBJ A;  1K9A A;  2FVU A;  4QQ6 A;  3CCJ A;  4HT8 A;  2MWO A;  3OYC A;  2CT4 A;  1VQ5 T;  1H8K A;  2D6F A;  3RBB B;  1Q86 C;  3LWH A;  4F7U A;  3A8G B;  2DTH A;  2ZAE A;  1I4K 1;  2QQB A;  2EWN A;  2RD1 A;  4C8Q G;  1KHI A;  1VQ4 A;  4GBQ A;  4XTY A;  3QUI A;  4RUG A;  4HCC A;  5CIU A;  1D0X A;  3QG1 A;  3UWN A;  2YXY A;  3CCL T;  5FU6 C;  1SRM A;  3JCM e;  2W0Z A;  4PFO A;  4E7J A;  4JRI A;  5FWC A;  3VS1 A;  3OYL A;  2RI5 A;  2KVQ G;  1K1Z A;  4C8Q A;  2A08 A;  2WSC E;  3H0F A;  3L2Z A;  1YP5 A;  3KFV A;  2XI9 A;  2RI2 A;  4RCB A;  1OZ3 A;  3CMA A;  2P4R A;  2XHC A;  3EG1 A;  1WZO A;  5CAI A;  1IRX A;  1WHG A;  2OTL Q;  1G8X A;  2I0N A;  3S3O A;  3TRE A;  1C6V X;  1EFN A;  2QYZ A;  5J26 A;  5LJ5 e;  1KD1 R;  4F04 B;  4Q5W A;  2NUT A;  3WVE B;  3JB9 J;  1B3Q A;  4IIO A;  1KG1 A;  1FMW A;  2RHX A;  1NPP A;  3HRT A;  2F5K A;  3E9F A;  4BD3 A;  1AWX A;  5KYU A;  2QXF A;  2V1R A;  4IUR A;  2DTI A;  2DNU A;  2MCN A;  2IIM A;  2JN0 A;  5GAN j;  5GMK e;  1BI1 A;  2DK3 A;  1K0X A;  3OYD A;  3R6O A;  1TWB A;  3NPF A;  1NG2 A;  4FYW B;  3ULR B;  1QKW A;  4KH0 B;  1BI3 A;  1KQ2 A;  1VQO Q;  3QYG B;  2QAZ A;  3A98 A;  2YUP A;  3FB9 A;  1RAC B;  1K8A U;  2KYB A;  4KRT A;  3URG A;  4M7A C;  4R0K A;  1OV3 A;  2CKK A;  2XD0 A;  2A0F B;  3A8M B;  2QG9 B;  5D6W A;  4XQ3 A;  4M7A D;  1YCY A;  2E3H A;  4QVC A;  4PL6 A;  1IHV A;  1W70 A;  2QQA A;  3QYH B;  3I5S A;  3X26 B;  2EKO A;  3MEA A;  7AT1 B;  1AWW A;  2RHZ A;  2ZPE B;  2DET A;  5DY9 A;  2HKN A;  4N4I A;  4F16 A;  2KYM A;  5A2Q E;  1JB0 E;  1RAD B;  2BIV A;  2CSQ A;  3SWN C;  2HDA A;  3RKX A;  3CCJ Q;  1VQ9 T;  3A8O B;  3ASK A;  3JCM g;  1PSE A;  3U23 A;  4PJO B;  1KQS A;  1Y0M A;  2AK5 A;  3EGX A;  2EQJ A;  1X2Q A;  1S72 Q;  2JM9 A;  3J80 E;  4JZ4 A;  2G3R A;  2KDS A;  3M57 A;  3OYE A;  2VGM A;  4QT7 A;  2GFU A;  3M54 A;  1YIJ T;  2JVV A;  1UHC A;  3G4S A;  3OYN A;  5KCO A;  2EQI A;  2YRV A;  4J6W A;  1PHT A;  4KUD K;  2KBT A;  2HQH A;  5LJ5 g;  2OTL T;  3ME9 A;  1R0C B;  2VGN A;  3GF5 A;  3BDL A;  4NL3 A;  1JJ2 S;  1SPK A;  2CUB A;  3EHR A;  5KH6 A;  4JLG A;  2P4T A;  1FWZ A;  2W10 A;  1ZSZ B;  2F69 A;  3CMA Q;  1YI2 A;  1UEC A;  3JCM V;  2A37 A;  4X9C A;  1X69 A;  2O31 A;  1GFC A;  6AT1 B;  2GF7 A;  1SHG A;  3JCM J;  1VQ7 A;  4UC4 A;  3A5Z B;  4ME7 A;  3KUF A;  2LJ3 A;  4N4G A;  4XU2 A;  5GAN d;  3OSV A;  3QO3 A;  4J6Y A;  1YJN A;  2EPD A;  1TOV A;  3GIB A;  1TS9 A;  1F1B B;  8AT1 B;  2F2V A;  2RHU A;  2RQT A;  4OML A;  4QW2 A;  3JB9 H;  3EAE A;  3H6Z A;  2HBW A;  2JJ9 A;  2JS2 A;  3TU4 K;  3HFN A;  1Q7Y C;  4J7I A;  4PKC C;  4RG2 A;  1R8O B;  1B07 A;  2DL5 A;  2J6K A;  5IHI A;  2V26 A;  3CC2 A;  2JW4 A;  1I5O B;  3TVT A;  2YHT A;  4CI0 C;  4N0A C;  3CCM A;  2E10 A;  4F14 A;  2C06 A;  1YIT A;  2LC4 A;  3C95 A;  2XKO C;  2CP6 A;  5DLO A;  1OZ2 A;  3OW2 P;  3VRZ A;  1OU9 A;  1TTH B;  5GMK m;  1UE9 A;  4M75 A;  3RKW A;  4J6X A;  4L59 A;  3TSW A;  4OGC A;  5LJ5 h;  1BU1 A;  3JSC A;  4KT0 E;  2VB6 A;  3CCJ T;  1OUL A;  2GTJ A;  3CC7 Q;  4FW1 A;  2HBP A;  3RUX A;  5KYX B;  3CME A;  1QCF A;  3HSB A;  4LDU A;  1VQM Q;  1KIK A;  2YRD A;  2QQ9 A;  3MKD A;  5GMK h;  3BFM A;  4PJO E;  4OGE A;  1I1J A;  2LQ8 A;  1WX6 A;  4OMM A;  2RF0 A;  5KYY A;  1VQ4 T;  2YUQ A;  1D3B B;  4CRI A;  2Y4Y A;  1SSH A;  4DEX A;  5LJ3 e;  4OVA A;  5EC7 A;  1TUC A;  4JJC A;  4KBM B;  2K57 A; 
#chains in the Genus database with same CATH homology
 1QVG P;  1QVF P;  1VQ4 Q;  1VQP Q;  1W2B P;  1NJI R;  1M1K R;  1VQ7 Q;  2OTL Q;  2OTJ Q;  3CC2 Q;  3CMA Q;  3I56 Q;  3CC4 Q;  1JJ2 P;  1VQM Q;  1VQN Q;  1YJW Q;  1VQ8 Q;  1K9M R;  3CME Q;  1K73 R;  3CCJ Q;  1KQS P;  3CCU Q;  3CCM Q;  3CXC P;  3CCS Q;  3CCR Q;  3OW2 P;  1YIT Q;  3I55 Q;  1YJN Q;  1KD1 R;  1VQK Q;  1N8R R;  1YI2 Q;  1VQO Q;  1VQL Q;  1Q86 R;  3G4S Q;  1YIJ Q;  1Q81 R;  1VQ5 Q;  3CD6 Q;  3G6E Q;  1Q82 R;  3CCL Q;  1S72 Q;  3CC7 Q;  3CPW P;  1KC8 R;  1YJ9 Q;  1Q7Y R;  1M90 R;  1VQ9 Q;  1VQ6 Q;  2QEX Q;  3CCV Q;  3G71 Q;  3CCE Q;  1YHQ Q;  3CCQ Q;  1K8A R;  2QA4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...