1YHQQ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yhqQ00
1KC8R 3I56Q 3CCVQ 1VQMQ 1QVGP 1VQOQ 1KD1R 1VQ5Q 3CC4Q 3CCRQ 1Q82R 1JJ2P 1VQKQ 3CD6Q 3G71Q 1K73R 3CXCP 1YJ9Q 3CCMQ 1W2BP 1VQ8Q 1YI2Q 1K8AR 1VQ6Q 1YHQQ 3CC7Q 3OW2P 1K9MR 1YJWQ 2QA4Q 3CCUQ 1M90R 1VQ7Q 1VQPQ 3CMAQ 1Q7YR 1S72Q 1VQ4Q 3CC2Q 3CCEQ 1QVFP 3CCSQ 3CCJQ 1YITQ 3CMEQ 1N8RR 1YIJQ 3I55Q 1Q86R 1M1KR 1VQLQ 1YJNQ 1VQNQ 2QEXQ 3G6EQ 3G4SQ 1NJIR 3CPWP 3CCLQ 3CCQQ 1KQSP 1Q81R 1VQ9Q 2OTLQ 2OTJQ
chains in the Genus database with same CATH superfamily
1AZGB 2AZSA 5CCAA 1VYVA 3WVDB 1K0SA 2KGTA 4PKCC 3G4SA 5DM7R 5GAN6 1YJ9Q 4YTLA 2EQUA 1X43A 1UGVA 2PZ1A 2M1HA 2QTVA 4LDYA 2JW4A 1W2BS 3GIBA 3UPUA 4QW2A 4FSSA 4DBRA 3CMEQ 3I35A 3OBWA 4EMKB 3ER0A 4HCCA 1Q81R 1W1FA 1M30A 3OBYA 1YIJA 4JPBW 4J83A 4PL6A 4RG8A 4D6WA 2KRNA 4VUBA 1M4ZA 1I5OB 1KSWA 4Q5WA 5C0MA 4NL3A 3TSWA 4FYXB 4N4GA 5GAN8 1YI2T 1YHQT 2EW3A 2HMAA 4ZTFA 3G4SQ 2RJCA 3G1JA 3VS7A 3UATA 4Y91A 3CCJT 4R56A 3E19A 4M78B 3M5AA 5AYFA 1BU1A 4LXCA 5KE2A 2Y4YA 1NLOC 1K73C 1TSFA 1YIJQ 3CC7T 2NYSA 2YHTA 1AHJB 2OTJQ 1C6VX 1TUDA 2M16A 4OB2B 3JB9F 1NYFA 1Y71A 2A7YA 4M77E 2HBPA 2HKNA 1GBQA 2NWMA 2RD1A 1YNZA 4R55A 4PJOE 4QVCA 2GFUA 2JT4A 4AT1B 1LPLA 1OI1A 2EPDA 1JJ2A 1WPYA 3C12A 4J9HA 2MCNA 1UG1A 3OQ5A 4CC3A 1IXDA 2E3HA 1R0BG 4BUGA 5L8RE 3OYHA 4J9GA 2K5LA 2DD4A 4C92F 2DJZA 2K5IA 3GPLA 5GAOp 3CC4T 1AWXA 4M75C 2OAUA 4LD9K 1V1CA 2K9GA 3RR6A 2IVWA 1ZUUA 2FZGB 1NPRA 3E9FA 1AD5A 3SWNB 4OP0A 2HQEA 3VRZA 5AT1B 2CT3A 3GNFB 5GMKi 1AWWA 1ZQ1A 1BIBA 3KUFA 2JM8A 1MNDA 1ZUYA 4ZNXA 3H9NA 5GANd 2PVGB 1RL2A 1R77A 1SKUB 2EYXA 2VYTA 3OYAA 2PUKB 2JS2A 4DEXA 4J9EA 4RTVA 3CCST 2QG9B 2COZA 1RI9A 2JVVA 1G83A 1IHVA 2GBQA 1QP3A 1D1CA 1PCXA 1QVGA 1YHQA 2KMTA 5IAYA 2GGRA 1FXXA 3QYHB 2A28A 2J05A 2DZ9A 3CCJA 3CCUT 3EG3A 2QI2A 3SWNA 4DBQA 1U5SA 5A0LA 1EX4A 1RUWA 5I22A 2DRKA 5FU7C 3OA6A 2KSSA 3I56T 3OYFA 1Q82U 2J7IA 3CC7A 4JRPA 8AT1B 1MV3A 1AVZC 2FO0A 2KEAA 4M78F 3EFOA 1IGQA 3ZBDA 5HK0A 4NOYA 4LN2A 5GAMe 1C1AA 4PK4A 2RQWA 1Q86U 5HK3A 1VQLT 1K9AA 1N9SA 2DMOA 4CC7A 1YI2Q 1X27A 1Y7XA 3S3MA 1YHQQ 4J9CA 4A4GA 4P5NA 5KYYB 4XU3A 3PVLA 2ZPHB 1QVFP 3FLGA 3CCJQ 3HRTA 3H8ZA 5KCOA 4FT2A 5IH2A 3E9GA 2YRDA 1H3HA 1KQSP 4J9DA 4M77D 2R57A 1Q7YU 4WF2A 4IIOA 1PC0A 5HY6A 4ZTJA 4BACA 2P84A 5CAIA 5GANh 4PJOD 1B07A 1IRXA 3VS0A 3JCMQ 7AT1B 1HSQA 3CC7Q 1M9SA 3X20B 4DEYA 4PLIA 1M1FA 1ACMB 2PUOB 2CP6A 1SRLA 4A54A 1E6HA 3BE3A 4F16A 4LDUA 2QQSA 1M8MA 3LLRA 4M7DG 4C8QG 5CVIA 3CCET 2Y4XA 3I9QA 2DXBA 2X4JA 4OVAA 4AMCA 3LWIA 1VQNT 4N0AC 2VVKA 4XTYA 2W10A 4LUDA 4M75E 1RLPC 3RIRA 4J6WA 1U1SA 1KD1U 3JB9H 3CCRT 2KXDA 1YWPA 4F04B 4KUDK 2LX7A 2LMJA 1N8RR 1M2OA 3OYKA 4QVZA 3QZ9B 2XI9A 3CCSA 2X4WA 1WNLA 3RKYA 4M4ZA 2E1HA 4J8OA 2JJ9A 5GAOl 3CC4Q 1ZBXA 5L23A 2ZZDA 1FYNA 2QXFA 2LDMA 3A8LB 4BDYA 2CREA 1XTDA 4M7AG 3CCUA 4J6YA 1QCNA 2RO0A 3G7ZA 1QCFA 4BY6C 3VUZA 3MCAB 3MEUA 4AFZC 1JQQA 1JEGA 3I56A 1NM7A 2DL5A 2AKKA 2XK0A 6AT1B 4EMGA 2JTFA 4RKUE 2BE7D 4EMHA 3NPFA 1WI7A 2GCXA 1M5Q1 2LTOA 3URGA 2CP3A 3CCSQ 4AG1C 1K9MU 2KQWA 1UDLA 4RTWA 3X25B 1IHWA 1VQ7T 1O9SA 2NUZA 3HFNA 4LD6A 2C0IA 4M7DB 2F5TX 2COWA 4BD3A 4J7FA 5CIUA 5GAN5 1N5ZA 4GLKA 4KULA 3CCUQ 1Q95G 3EFSA 3RERA 1BIAA 3QHSA 3VU3C 1YCSB 3GOXA 4D8KA 3PVQA 3QDRB 1UHFA 3CMAT 3I56Q 2COYA 1G8XA 3L2WA 3EG0A 2E5QA 1VIFA 4X1VA 3CCLT 3OYJA 1R8OB 2SRCA 3FC3A 2EAYA 2QQ9A 1PM3A 2KT8A 1ABQA 2KT1A 4OB1B 4JRQA 1VQLQ 2BUDA 3NGPA 2FB7A 1MMGA 1RAHB 1WFWA 5D6YA 3CCEA 4M7AB 5CQXA 3OW2A 1VQNA 4IUPA 3MP8A 1M3BA 4XAXB 2DPPB 2DNUA 3OSVA 1QMCA 1TUCA 2CZ6B 3JCMe 1NPPA 1BBZA 3OW2S 1QLYA 2L2PA 4JRIA 2VWFA 4KBMB 2DYIA 2PNIA 3O8VA 3I55T 2YT6A 2RF0A 4M75D 3CPWS 1W2BP 4DOWA 3DLLA 2AIRB 1VQ9T 4PJMA 4QVDA 4ORZA 2P0QA 3CCEQ 1K8AU 4O5VA 4XTZA 2EQJA 1VQNQ 1XOVA 3NMZC 2JOYA 2GQIA 1GL5A 2MYSA 4ELYC 2SEMA 3CCRQ 4XTWA 2F69A 1YITT 2QASA 5GANj 4IKFA 3RUXA 2A36A 1VA7A 3FIFA 4AFSC 4A4HA 1RAEB 1JO8A 3RMQA 2AT1B 2IG0A 4ESRA 1NG2A 4E7LA 3CXCA 2EKOA 2YUNA 5KH6A 3REAB 2O9SA 1BI1A 2LVMA 1ARKA 4JJCA 2OI3A 3CQTA 1EFNA 1Y57A 1KD1R 1M1KU 3QWYA 4F14A 3QIIA 3VYGA 1NJIU 1UGPB 2LQWA 1KC8U 2GQVA 2E12A 1WHLA 1OPKA 4XTXA 3CXCS 3GBQA 1WA7A 2Z0WA 1KK7A 4C8QF 3FJ5A 3CMAA 1M2VB 2D0NA 1NLPC 1CKBA 3A1PA 1I81A 2CP7A 3CCLA 4IUVA 3OS0A 3MEVA 4F7UA 4HT8A 1UGSB 4RTZA 2X3XD 3P8BB 2VV5A 1YWOA 2BZXA 1VQ7Q 4BE2A 4DBHA 1VQKT 2CZ0B 2A37A 4C92B 5J39A 1VQ4A 1Z9QA 4ZGDB 2C0TA 4JZ3A 3T9NA 1W70A 3V7SA 3JCMJ 2XHCA 3TVTA 2FRYA 2MWPA 5I2SA 4E47A 3H0IA 2DTIA 1WGSA 2LCLA 2QYZA 5GAMf 1C0MA 4E6RA 4XTVA 1RI0A 2QK0A 3CMAQ 3F70A 1SEMA 4A4FA 2HNIA 2MI6A 3UT1A 3DB3A 2PVOB 3PNWC 3CCLQ 4HXJA 2P0KA 4PJOG 1OX9A 4ZN1A 5GMKh 1U1TA 4L5GA 1VQ9A 5KE3A 2LNHB 2O2OA 2YWWA 3QJYA 2E3IA 2IPOB 2R58A 2KAFA 4BI3A 4ZGEB 2L8DA 3CBOA 1K73U 3S3OA 4C92A 1MGQA 5FROA 1QWFA 2LJ3A 1MUZA 1X2KA 3HSBA 4FT4A 3WVEB 4QT7A 4JUVA 2P4RA 1YJWT 2BZYA 1YITA 1PD0A 1TUGB 2OTLA 1JBMA 4JLGA 4FW1A 2HQHA 1KHCA 2EYQA 2DIGA 2K57A 4Y28E 1VQ8T 2J6OA 4IUUA 3I55Q 5FU6B 1VQ9Q 5DLOA 2E6NA 5A0GA 2QEXA 1D1BA 3CPFA 3JSCA 2RHIA 2W0ZA 1QQJA 2KRMA 1D0YA 4RMOA 2KYBA 1M8VA 5LJ5e 2ZCFB 4JJBA 3SHWA 4EMKA 5J3BA 5KYUB 1YITQ 2ESWA 3JAME 2LRQA 1OQKA 1WXTA 3JCMP 1LNXA 5HCKA 2L5QA 1AZEA 1GRIA 1UB4A 2OAWA 2O4XB 1ZA2B 4PJOB 1UECA 1K1ZA 2LZ6B 1VQKA 4KGZB 2QQBA 1VQ5T 1R0CB 5CR2A 1G2BA 2CUDA 1I8FA 3MJXA 3JCMW 1Y0MA 2YRVA 5IN1A 4B6MA 2V8JA 3L1AA 4XTUA 2CT4A 1W6XA 3V8LA 4C5GA 2RMOA 2I0NA 2XDBA 2GTOA 5D7UA 2EGEA 4M78A 3VS4A 5LL6S 4ELZC 1RAAB 3J81E 4BE1A 1VIEA 1JJ2S 2GTJA 5KYUA 3EGDB 3MEWA 1RAFB 2V1QA 2HCKA 2M0YA 1BI3A 4FL6A 3RKWA 2O4XA 3M0TA 1BI0A 4MDWA 4BI8B 1VQKQ 1H92A 4CI0C 2ED1A 1GXIE 3HPWA 4C0DC 1JXMA 4XQ3A 5D6XA 4CC4B 2FZCB 1YJWA 2L0AA 2DETA 4B9XA 2RQRA 5GAOr 2V8KA 4CC2A 2CP5A 2BZ8A 2X35A 3OYGA 4PLLA 2JS0A 2E70A 1TS9A 1PSFA 5LJ3e 1N8RC 1T0JA 4ZGJB 3FJPA 3KBGA 3SB2A 1VQ8A 1OU8A 2DTOA 5GAMd 3ZFJA 4X34A 4MMKA 2M51A 3VS1A 4M7AD 2YXYA 2JTEA 3PFSA 1UTIA 5CQYA 1FMKA 2KXCA 1UGRB 3H41A 4M75G 4IUQA 2H3EB 3EH2A 3VS6A 2DVJA 4HT9A 3CBMA 4OMNA 3M0QA 2EBPA 1QVGS 3OYDA 3GP8A 3MHXA 1YJWQ 4JJDA 5IT9E 3OYMA 1ZX6A 1B34B 4AG2C 3HL8A 3P8HA 4FW2A 1MHNA 2LQKA 4Z89A 5GMKj 5CKBA 3INZA 2EIFA 3FB9A 5GANe 3HFOA 1VQ8Q 2CUBA 4JS5A 5M9OA 1VQ5A 2DYBA 2VC8A 3X28B 4UC4A 4C5IA 4M77F 2XIDA 3S3NA 1X2QA 1D1AA 2L3PA 2VB6A 4J7IA 2EYYA 3M59A 2K2MA 1PNJA 4PJOF 3EHQA 3OYNA 3U23A 2ED0A 2EYZA 3UA6A 5GMKl 4NS5A 3H0FA 3M4YA 3OS2A 2BIVA 2DBMA 1M1GA 4C0ZA 1PKTA 9ATCB 2A3LA 5IXFA 1TU0B 2FYKA 2PTKA 1UFFA 5EG2A 4O6JA 3QUIA 2F2VA 5KYXB 2VXEA 1U8RA 1PHTA 1VYTA 2CS7A 4KUIA 3SDZA 2CKKA 1SSHA 4RTUA 3REBB 3VKIA 2DEUA 3NTKA 1N6AA 4FYYB 5GAMh 4F17A 4AFUC 1U3OA 1M3AA 1VQ5Q 4FU6A 2GF7A 3OYIA 2JM9A 1VQMA 2M02A 5CKFA 2O88A 5KYYA 3OW2P 2XMFA 3MKDA 3EG1A 1ZUKA 2DE0X 3EGXB 2BE9B 3CD6T 2QDYB 2YDLA 2DXTA 2GFAA 1SPKA 3CPWP 4OMQA 3HRUA 2K3BA 4BE0A 1U06A 2ZGWA 4PNOA 1WJSA 2V1RA 4J6XA 1SF9A 4J9BA 3V7RA 2L3SA 1G3YA 4Z8AA 3AT1B 3G6ET 2ZAEA 3KXTA 3MP1A 4RCCA 3ZL7C 1KFZA 4OMLA 2M9UA 5LJ3g 1J3TA 3CCMT 2JUFA 3OMCA 1GCQA 3M9QA 2EJFA 3PE0A 4JJNK 1SHGA 4KGVB 2KE9A 3N5BB 1VQMQ 3OY9A 1FWZA 2F2WA 3QWXX 1WHMA 4X9DA 2LQ8A 1UHCA 1AT1B 2DL7A 2EJ9A 5GAOn 2F5KA 1M90U 2DF6A 1OV3A 2VUBA 1WLPB 4HCZA 2YUPA 3M4GA 1RLQC 1YCYA 3CXCP 2AZVA 4X9CA 4C8QB 3L2VA 1QCOA 4HCKA 3HP9A 5ECAA 5GAMg 5FWBA 1IGUA 4OGEA 1KD1C 1I0CA 3CC2A 1IB8A 3UF4A 3JCMd 3HKSA 2KROA 2RN8A 1QVFA 5KCHA 1KQSA 1D3BB 2J06A 3M58A 3M54A 1K0XA 3M0PA 3VS3A 1BK2A 3FEOA 4BB7A 2MOXA 4TVRA 1PSEA 5LJ5f 1S72T 1VQ4T 4C92C 4M7DA 3RDVA 4C8QA 1Q82R 1T0HA 2QTXA 2FG0A 3JCMX 2NUTB 1Q81U 3VS2A 3CD6A 2OJ2A 4QQGA 1WXBA 4ANJA 2RJDA 3R6NA 2BKDN 4OB0B 1Q86R 4KGXB 3EH1A 4M75F 3OS5A 2RB6A 1K9MC 5D6WA 1I1JA 4J5YA 4AFQC 3G6EA 3E1SA 1M27C 5CKEA 1VUBA 1D3BA 3ASKA 2CZ7B 3JCMV 3CCMA 4PFPA 4E7SA 5CKDA 1Q7YR 1ABOA 1QWEA 4JRKA 2JXBA 2J6KA 2MF2A 3M57A 4M7AA 2GNCA 1WHJA 2KI7A 1YBYA 2MWOA 3QBYA 2LNVA 4EMKC 3CD6Q 2XDPA 1GCPA 2OTLT 4KRTA 2RM4A 3EG2A 4PFOA 4A4EA 3HRSA 2X4XA 1OYXA 2ATCB 1JB0E 1OU9A 3G6EQ 1NBEB 3L2RA 5GAMj 3MO8A 2HKQB 2VASA 4Z88A 4RCBA 4LE9A 3JCMc 1SSFA 1PRLC 1TXQA 4MMLA 3CCMQ 2FZKB 3BY7A 2QEXT 2RI3A 3UA7A 4F7UE 5LJ3f 1QKXA 1TH7A 1GFDA 2C0OA 1X6GA 1I4K1 2OX7A 4M78C 3DB4A 1XNIA 2DL4A 1P92A 2J6FA 2D0QB 2EGCA 4PFZA 2ZPBB 1B7TA 3QPHA 4OB3B 5A0DA 1MV0B 3TREA 2CYZB 4RG2A 2JN0A 1X69A 1TG0A 2EQKA 2NLUA 5GAOq 2ZPFB 2EQMA 1S72A 1BCMA 4B9WA 4MZPA 1YN8A 1HJDA 2CZ1B 1EZZB 2PQWA 2QQRA 4FIBA 1JJ2P 2XU8A 1UEBA 2D8JA 2HBWA 2C06A 1ZSZB 3PMIA 3SD4A 1YJ9A 3DKMA 1K9MR 2DIQA 1QKWA 2D9TA 3JRZA 4DA4A 1M2VA 4M77G 2DZCA 2E4HA 2QQAA 4C92E 1S1NA 3L2QA 4EPCA 3JCMg 4L59A 1BCOA 3EAEA 1PWTA 1LCKA 2MPXC 1M1KC 3TEEA 5J26A 4A53A 1IZ6A 2F2XA 3V7CA 2A0FB 2D1XA 3GLXA 1FX7A 3PTAA 1EIFA 1KC8C 2DM1A 1B3QA 2CGHA 3SWNC 3OYBA 1WQ7A 1S72Q 1RAIB 5GAOm 1VQ4Q 1ZBJA 1RADB 1W2BA 2KDSA 3OYYA 1RAGB 3QO3A 2FRWA 2K3YA 5GAN4 2DJQA 3BFMA 5LJ5d 2O9VA 2DXUA 2E5KA 1ZSZA 3HTRA 2RK2A 1X6BA 1MMDA 4IUTA 2CSQA 3TSZA 3A8HB 2DKGA 2LCSA 4A63B 1K76A 5FRMA 3PIOA 2JMCA 3VRYA 1WHKA 2JZ2A 2KR3A 2WACA 5KYWB 2KBTA 1D0ZA 1QVGP 2CH4A 4FSXA 3PIPA 1PG5B 3QKJA 3LWHA 1E6GA 2OTJA 2FHDA 3I5SA 1WJQA 1WHHA 1CSKA 4DOVA 3EFRA 1ZHIA 2QGFB 1G3TA 1VQOT 2WSCE 1LJOA 1OPLA 2AKLA 4KT0E 3NTIA 4XU0A 3FRNA 1Y96B 1GBRA 4PJLA 4ME7A 2FPDA 4PJNA 4C0FA 4N4HA 4F7UF 3R6OA 2LP5A 2OTLQ 4NL2A 2K79A 1VQPT 4M77B 2K3XA 1T3LA 3A8OB 2RQUA 2CP0A 1D0XA 1JU5C 3H0HA 2NUPB 1K8AR 4FM4B 2RHYA 2E65A 4M78E 2RH2A 2DBKA 2RQVA 4N4IA 2M0OA 2ROTA 3VV0A 3J7AF 2AHJB 1WQWA 5KYWA 2QEXQ 2HSPA 4E7ZA 4ATOA 2P4TA 2WSFE 5A2QE 1N8RU 4J9FA 2HEQA 4RTXA 2FEIA 4HVWA 1X01A 3JB9D 5LJ5h 2HQXA 1Y96A 2RI2A 2DA9A 5LJ3d 3A8MB 1M3CA 1M1KR 3L42A 3M55A 4M77A 1NJIR 1BB9A 5I11A 2DK3A 1KC8R 3ZEHA 2O01E 2NUPA 3EG9B 4XU1A 2DL3A 4PJOA 4JDSA 1GCQC 3PMTA 2DO3A 2ABLA 2HD0A 3V8JA 2EFIA 1VQMT 1IREB 3TU4K 4QQ6A 2D8HA 4C92D 4CRIA 4DQ2A 4L6V5 4IIMA 4WCIA 3VJPA 4E7KA 1TTHB 4R0KA 2YUOA 3D7SB 4E2FB 5CK9A 4FCYA 4RUGA 3OSSC 4LDXA 2LJ1A 3DLMA 3JB9I 3VUBA 2RJFA 3VS5A 2EYWA 2VGNA 2X51A 1XQHA 2JTMA 3EGDA 2E64A 3L2UA 1WXUA 3QYGB 1X6OA 2A08A 3S6WA 3JCMf 2XKOC 5GAN2 1VYUA 3EG9A 3EFOB 2H3JA 4QQDA 4HCBA 3BDUA 2KYMA 3H6ZA 4LNPA 1VQOA 1K4US 1OZ3A 3EGUA 2DVEA 4II1A 1YI2A 1UUEA 2MK5A 1VQPA 4IURA 3META 1IO6A 3NHNA 5DY9A 2QA4T 2RI5A 2RHUA 5LJ5g 5LJ3h 4JZ4A 1K73R 4V2SA 1UJ0A 4KH0B 1KG1A 3RESA 1WJRA 4WTOB 4M7DC 4C8QC 1H8KA 4HVUA 2RQTA 1NYGA 2ROLA 2K4YA 2L3RA 1UGQB 2HZYA 1SHFA 3A8GB 2FPFA 2JNGA 1VQOQ 3CC2T 1VOMA 2KVQG 1G3WA 1GFCA 2K6DA 5C6SA 1KQ2A 4Y92A 4M78D 3CCQT 1I07A 2RHZA 3QG1A 3PT9A 3GNGA 1HD3A 1VQPQ 3O5ZA 1B34A 4BDZA 2JMAA 1SG5A 4E7JA 2QAZA 2VXFA 5EC7A 2E41A 3LW5E 1AWOA 4D8DA 1YJNT 1BI2A 2ZPEB 3CC4A 4M75B 1F1BB 4M7AC 4RTTA 1TOVA 1NEBA 3RNJA 2R5MA 1DJ7B 3OYCA 2DFUA 3OYEA 3JCMb 3ME9A 4EDUA 4FYWB 1Q82C 1G5VA 4FYVB 2WSEE 4MZMA 1NEGA 2YUQA 2HL3A 5FLXE 4XK8E 3OMGA 2G3RA 2RK1A 4HKEA 2E6ZA 4C0DB 1HK9A 2ZPGB 1V29B 1WIEA 5GJVB 2FL7A 1Q86C 1MMAA 2FPEA 4LDWA 2G6FX 3M0SA 1D09B 5KYXA 2DRMA 1O75A 2DEQA 1VQ6T 2LC4A 3BW1A 3JB9J 1QP2A 2I2LA 2CP2A 3J80E 1TWBA 2YRCA 1WZOA 1Q7YC 4M75A 3BDLA 1PD1A 1V76A 2B8AA 5LJ5j 2LX9A 3EGXA 2MMPA 4C0GA 2K2VA 4JS4A 1BYMA 1OZ2A 3OS1A 3RBBB 3ULRB 2QA4A 3LX7A 3QZ5B 4C5EA 8ATCB 3M53A 5FU7B 4A4KA 5FRNA 2RJEA 1OEBA 2K5FA 2YLCA 2XICA 3C0CA 4E7HA 3JV3A 2H8HA 1FMWA 2X3WD 2DLPA 4C5HA 2HAXA 5GANg 3OYLA 5CO7A 2LT4A 2LCCA 3MEAA 2EWNA 3CBPA 1VQLA 4QKUA 3CCQA 2HDAA 2MAMA 3QDFA 3THKA 2RHXA 3LGLA 4M7DE 4C8QE 2XDDA 3CCVT 1OULA 2QA4Q 2RPNA 3G71T 1I5LA 3OB9A 2EGAA 2CDTA 5GAN7 4LUEA 2DX1A 2EVRA 2EQIA 4LDVA 3X26B 1QVFS 4F7UG 1YJNA 1LOJA 1MNEA 1KHIA 2QDLA 2V8IA 5HKCA 1KQSS 2RNAA 3LGFA 3NTHA 1LVKA 3CEYA 3RKXA 1JRIA 1ZSZC 3CC2Q 1YJ9T 2F1LA 3LH0A 2XD0A 1PRMC 3CCQQ 2PVDB 2IIMA 2KY9A 2X4YA 1SRMA 2VGMA 1M90C 5LJ3j 2R5AA 3A5ZB 3IQLA 4M7AE 1XJWB 3CMET 3JB9G 2EKHA 2XG8D 1QW1A 2E10A 3TQ7P 1WX6A 1H3ZA 2EJGA 3CCRA 3M0UA 2HL5C 3CPWA 3C94A 2DTHA 3QJ6A 4EIKA 4DBFA 1WYXA 1VQ6A 3E2UA 2QGGA 4K11A 3QSUA 1N27A 3PGGA 2CSIA 2DD5A 3P8DA 3AHUA 1YJNQ 1H641 2HSEB 2DAQA 3LH5A 4GBQA 4OMPA 5IHNA 5IHKA 2NUTA 1WDXA 4J9IA 1KJWA 3MPUB 3G4ST 1QVPA 3C95A 2YSQA 4GLMA 4C92G 1AOJA 3JCMh 3FDRA 1WHGA 2AK5A 3LYIA 4RTYA 2DL8A 3I5RA 2K7AA 2L89A 4BY6B 3MP6A 1Y07A 4N0AA 3L2ZA 1W4SA 1OOTA 1ZLMA 1CKAA 1AWJA 1YP5A 5KYNA 1NZ9A 1UE9A 4OMMA 3X24B 1YIJT 4OGCA 5FU6C 1X75C 1AEYA 4F7UB 4ZN3A 3UDCA 2VKNA 1FMVA 3V8KA 1G3SA 1VQ6Q 1Q81C 5I2MA 2OTJT 2O31A 1RABB 2RA2A 3GF5A 5GAN3 4XU2A 5FWCA 1VQ7A 2X9HA 4JLIA 3A98A 2KK4A 4HVVA 2FVUA 2P0PA 4GY5A 4PJJA 2CH4W 2KRSA 2LJ0A 2DERA 1OX8A 4BI4A 3CCVA 1KQ1A 4M77C 3QXEB 3HHTB 2LQNA 3C4SA 3G71A 5GMKm 3RMSA 5IXBA 4OMFB 3TCJA 4PJOC 4M7DF 3UWNA 1T3SA 1K8AC 1UJYA 1BKBA 1E7OA 4MZTA 5FW9A 5GMKe 5DLQE 4M7DD 4KH1B 4C8QD 1ZA1B 2PU9B 5I21A 2D6FA 1M90R 2B86A 1A0NB 1JXOA 3VYHB 1RACB 3SEMA 5GANf 2ENMA 1MMNA 3KFVA 4E7IA 1YFNA 2V26A 1NE8A 3M56A 1N9RA 3CMEA 3CCVQ 4M78G 3Q1JA 4MDXA 3M0RA 2Y90A 3G71Q 4OF1A 2ECZA 2BTTA 5CKHA 1HXDA 4OMOA 3SFMA 1NJIC 1KIKA 3WXMB 4M7AF 3EHRA 1HYOA 2ZPIB 2LT1A 4Z02A 2DILA 4HA8A 1Z9ZA 1PKSA 3NFCA 2KNBB 2YLBA 2MIOA 5GJWB 1ZSGA 2DXCA 3I55A 5IHIA 2L3QA
chains in the Genus database with same CATH topology
1KC8R 3I56Q 3CCVQ 1VQMQ 1QVGP 1VQOQ 1KD1R 1VQ5Q 3CC4Q 3CCRQ 1Q82R 1JJ2P 1VQKQ 3CD6Q 3G71Q 1K73R 3CXCP 1YJ9Q 3CCMQ 1W2BP 1VQ8Q 1YI2Q 1K8AR 1VQ6Q 1YHQQ 3CC7Q 3OW2P 1K9MR 1YJWQ 2QA4Q 3CCUQ 1M90R 1VQ7Q 1VQPQ 3CMAQ 1Q7YR 1S72Q 1VQ4Q 3CC2Q 3CCEQ 1QVFP 3CCSQ 3CCJQ 1YITQ 3CMEQ 1N8RR 1YIJQ 3I55Q 1Q86R 1M1KR 1VQLQ 1YJNQ 1VQNQ 2QEXQ 3G6EQ 3G4SQ 1NJIR 3CPWP 3CCLQ 3CCQQ 1KQSP 1Q81R 1VQ9Q 2OTLQ 2OTJQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KC8 R;  3I56 Q;  3CCV Q;  1VQM Q;  1QVG P;  1VQO Q;  1KD1 R;  1VQ5 Q;  3CC4 Q;  3CCR Q;  1Q82 R;  1JJ2 P;  1VQK Q;  3CD6 Q;  3G71 Q;  1K73 R;  3CXC P;  1YJ9 Q;  3CCM Q;  1W2B P;  1VQ8 Q;  1YI2 Q;  1K8A R;  1VQ6 Q;  1YHQ Q;  3CC7 Q;  3OW2 P;  1K9M R;  1YJW Q;  2QA4 Q;  3CCU Q;  1M90 R;  1VQ7 Q;  1VQP Q;  3CMA Q;  1Q7Y R;  1S72 Q;  1VQ4 Q;  3CC2 Q;  3CCE Q;  1QVF P;  3CCS Q;  3CCJ Q;  1YIT Q;  3CME Q;  1N8R R;  1YIJ Q;  3I55 Q;  1Q86 R;  1M1K R;  1VQL Q;  1YJN Q;  1VQN Q;  2QEX Q;  3G6E Q;  3G4S Q;  1NJI R;  3CPW P;  3CCL Q;  3CCQ Q;  1KQS P;  1Q81 R;  1VQ9 Q;  2OTL Q;  2OTJ Q; 
#chains in the Genus database with same CATH topology
 1AZG B;  2AZS A;  5CCA A;  1VYV A;  3WVD B;  1K0S A;  2KGT A;  4PKC C;  3G4S A;  5DM7 R;  5GAN 6;  1YJ9 Q;  4YTL A;  2EQU A;  1X43 A;  1UGV A;  2PZ1 A;  2M1H A;  2QTV A;  4LDY A;  2JW4 A;  1W2B S;  3GIB A;  3UPU A;  4QW2 A;  4FSS A;  4DBR A;  3CME Q;  3I35 A;  3OBW A;  4EMK B;  3ER0 A;  4HCC A;  1Q81 R;  1W1F A;  1M30 A;  3OBY A;  1YIJ A;  4JPB W;  4J83 A;  4PL6 A;  4RG8 A;  4D6W A;  2KRN A;  4VUB A;  1M4Z A;  1I5O B;  1KSW A;  4Q5W A;  5C0M A;  4NL3 A;  3TSW A;  4FYX B;  4N4G A;  5GAN 8;  1YI2 T;  1YHQ T;  2EW3 A;  2HMA A;  4ZTF A;  3G4S Q;  2RJC A;  3G1J A;  3VS7 A;  3UAT A;  4Y91 A;  3CCJ T;  4R56 A;  3E19 A;  4M78 B;  3M5A A;  5AYF A;  1BU1 A;  4LXC A;  5KE2 A;  2Y4Y A;  1NLO C;  1K73 C;  1TSF A;  1YIJ Q;  3CC7 T;  2NYS A;  2YHT A;  1AHJ B;  2OTJ Q;  1C6V X;  1TUD A;  2M16 A;  4OB2 B;  3JB9 F;  1NYF A;  1Y71 A;  2A7Y A;  4M77 E;  2HBP A;  2HKN A;  1GBQ A;  2NWM A;  2RD1 A;  1YNZ A;  4R55 A;  4PJO E;  4QVC A;  2GFU A;  2JT4 A;  4AT1 B;  1LPL A;  1OI1 A;  2EPD A;  1JJ2 A;  1WPY A;  3C12 A;  4J9H A;  2MCN A;  1UG1 A;  3OQ5 A;  4CC3 A;  1IXD A;  2E3H A;  1R0B G;  4BUG A;  5L8R E;  3OYH A;  4J9G A;  2K5L A;  2DD4 A;  4C92 F;  2DJZ A;  2K5I A;  3GPL A;  5GAO p;  3CC4 T;  1AWX A;  4M75 C;  2OAU A;  4LD9 K;  1V1C A;  2K9G A;  3RR6 A;  2IVW A;  1ZUU A;  2FZG B;  1NPR A;  3E9F A;  1AD5 A;  3SWN B;  4OP0 A;  2HQE A;  3VRZ A;  5AT1 B;  2CT3 A;  3GNF B;  5GMK i;  1AWW A;  1ZQ1 A;  1BIB A;  3KUF A;  2JM8 A;  1MND A;  1ZUY A;  4ZNX A;  3H9N A;  5GAN d;  2PVG B;  1RL2 A;  1R77 A;  1SKU B;  2EYX A;  2VYT A;  3OYA A;  2PUK B;  2JS2 A;  4DEX A;  4J9E A;  4RTV A;  3CCS T;  2QG9 B;  2COZ A;  1RI9 A;  2JVV A;  1G83 A;  1IHV A;  2GBQ A;  1QP3 A;  1D1C A;  1PCX A;  1QVG A;  1YHQ A;  2KMT A;  5IAY A;  2GGR A;  1FXX A;  3QYH B;  2A28 A;  2J05 A;  2DZ9 A;  3CCJ A;  3CCU T;  3EG3 A;  2QI2 A;  3SWN A;  4DBQ A;  1U5S A;  5A0L A;  1EX4 A;  1RUW A;  5I22 A;  2DRK A;  5FU7 C;  3OA6 A;  2KSS A;  3I56 T;  3OYF A;  1Q82 U;  2J7I A;  3CC7 A;  4JRP A;  8AT1 B;  1MV3 A;  1AVZ C;  2FO0 A;  2KEA A;  4M78 F;  3EFO A;  1IGQ A;  3ZBD A;  5HK0 A;  4NOY A;  4LN2 A;  5GAM e;  1C1A A;  4PK4 A;  2RQW A;  1Q86 U;  5HK3 A;  1VQL T;  1K9A A;  1N9S A;  2DMO A;  4CC7 A;  1YI2 Q;  1X27 A;  1Y7X A;  3S3M A;  1YHQ Q;  4J9C A;  4A4G A;  4P5N A;  5KYY B;  4XU3 A;  3PVL A;  2ZPH B;  1QVF P;  3FLG A;  3CCJ Q;  3HRT A;  3H8Z A;  5KCO A;  4FT2 A;  5IH2 A;  3E9G A;  2YRD A;  1H3H A;  1KQS P;  4J9D A;  4M77 D;  2R57 A;  1Q7Y U;  4WF2 A;  4IIO A;  1PC0 A;  5HY6 A;  4ZTJ A;  4BAC A;  2P84 A;  5CAI A;  5GAN h;  4PJO D;  1B07 A;  1IRX A;  3VS0 A;  3JCM Q;  7AT1 B;  1HSQ A;  3CC7 Q;  1M9S A;  3X20 B;  4DEY A;  4PLI A;  1M1F A;  1ACM B;  2PUO B;  2CP6 A;  1SRL A;  4A54 A;  1E6H A;  3BE3 A;  4F16 A;  4LDU A;  2QQS A;  1M8M A;  3LLR A;  4M7D G;  4C8Q G;  5CVI A;  3CCE T;  2Y4X A;  3I9Q A;  2DXB A;  2X4J A;  4OVA A;  4AMC A;  3LWI A;  1VQN T;  4N0A C;  2VVK A;  4XTY A;  2W10 A;  4LUD A;  4M75 E;  1RLP C;  3RIR A;  4J6W A;  1U1S A;  1KD1 U;  3JB9 H;  3CCR T;  2KXD A;  1YWP A;  4F04 B;  4KUD K;  2LX7 A;  2LMJ A;  1N8R R;  1M2O A;  3OYK A;  4QVZ A;  3QZ9 B;  2XI9 A;  3CCS A;  2X4W A;  1WNL A;  3RKY A;  4M4Z A;  2E1H A;  4J8O A;  2JJ9 A;  5GAO l;  3CC4 Q;  1ZBX A;  5L23 A;  2ZZD A;  1FYN A;  2QXF A;  2LDM A;  3A8L B;  4BDY A;  2CRE A;  1XTD A;  4M7A G;  3CCU A;  4J6Y A;  1QCN A;  2RO0 A;  3G7Z A;  1QCF A;  4BY6 C;  3VUZ A;  3MCA B;  3MEU A;  4AFZ C;  1JQQ A;  1JEG A;  3I56 A;  1NM7 A;  2DL5 A;  2AKK A;  2XK0 A;  6AT1 B;  4EMG A;  2JTF A;  4RKU E;  2BE7 D;  4EMH A;  3NPF A;  1WI7 A;  2GCX A;  1M5Q 1;  2LTO A;  3URG A;  2CP3 A;  3CCS Q;  4AG1 C;  1K9M U;  2KQW A;  1UDL A;  4RTW A;  3X25 B;  1IHW A;  1VQ7 T;  1O9S A;  2NUZ A;  3HFN A;  4LD6 A;  2C0I A;  4M7D B;  2F5T X;  2COW A;  4BD3 A;  4J7F A;  5CIU A;  5GAN 5;  1N5Z A;  4GLK A;  4KUL A;  3CCU Q;  1Q95 G;  3EFS A;  3RER A;  1BIA A;  3QHS A;  3VU3 C;  1YCS B;  3GOX A;  4D8K A;  3PVQ A;  3QDR B;  1UHF A;  3CMA T;  3I56 Q;  2COY A;  1G8X A;  3L2W A;  3EG0 A;  2E5Q A;  1VIF A;  4X1V A;  3CCL T;  3OYJ A;  1R8O B;  2SRC A;  3FC3 A;  2EAY A;  2QQ9 A;  1PM3 A;  2KT8 A;  1ABQ A;  2KT1 A;  4OB1 B;  4JRQ A;  1VQL Q;  2BUD A;  3NGP A;  2FB7 A;  1MMG A;  1RAH B;  1WFW A;  5D6Y A;  3CCE A;  4M7A B;  5CQX A;  3OW2 A;  1VQN A;  4IUP A;  3MP8 A;  1M3B A;  4XAX B;  2DPP B;  2DNU A;  3OSV A;  1QMC A;  1TUC A;  2CZ6 B;  3JCM e;  1NPP A;  1BBZ A;  3OW2 S;  1QLY A;  2L2P A;  4JRI A;  2VWF A;  4KBM B;  2DYI A;  2PNI A;  3O8V A;  3I55 T;  2YT6 A;  2RF0 A;  4M75 D;  3CPW S;  1W2B P;  4DOW A;  3DLL A;  2AIR B;  1VQ9 T;  4PJM A;  4QVD A;  4ORZ A;  2P0Q A;  3CCE Q;  1K8A U;  4O5V A;  4XTZ A;  2EQJ A;  1VQN Q;  1XOV A;  3NMZ C;  2JOY A;  2GQI A;  1GL5 A;  2MYS A;  4ELY C;  2SEM A;  3CCR Q;  4XTW A;  2F69 A;  1YIT T;  2QAS A;  5GAN j;  4IKF A;  3RUX A;  2A36 A;  1VA7 A;  3FIF A;  4AFS C;  4A4H A;  1RAE B;  1JO8 A;  3RMQ A;  2AT1 B;  2IG0 A;  4ESR A;  1NG2 A;  4E7L A;  3CXC A;  2EKO A;  2YUN A;  5KH6 A;  3REA B;  2O9S A;  1BI1 A;  2LVM A;  1ARK A;  4JJC A;  2OI3 A;  3CQT A;  1EFN A;  1Y57 A;  1KD1 R;  1M1K U;  3QWY A;  4F14 A;  3QII A;  3VYG A;  1NJI U;  1UGP B;  2LQW A;  1KC8 U;  2GQV A;  2E12 A;  1WHL A;  1OPK A;  4XTX A;  3CXC S;  3GBQ A;  1WA7 A;  2Z0W A;  1KK7 A;  4C8Q F;  3FJ5 A;  3CMA A;  1M2V B;  2D0N A;  1NLP C;  1CKB A;  3A1P A;  1I81 A;  2CP7 A;  3CCL A;  4IUV A;  3OS0 A;  3MEV A;  4F7U A;  4HT8 A;  1UGS B;  4RTZ A;  2X3X D;  3P8B B;  2VV5 A;  1YWO A;  2BZX A;  1VQ7 Q;  4BE2 A;  4DBH A;  1VQK T;  2CZ0 B;  2A37 A;  4C92 B;  5J39 A;  1VQ4 A;  1Z9Q A;  4ZGD B;  2C0T A;  4JZ3 A;  3T9N A;  1W70 A;  3V7S A;  3JCM J;  2XHC A;  3TVT A;  2FRY A;  2MWP A;  5I2S A;  4E47 A;  3H0I A;  2DTI A;  1WGS A;  2LCL A;  2QYZ A;  5GAM f;  1C0M A;  4E6R A;  4XTV A;  1RI0 A;  2QK0 A;  3CMA Q;  3F70 A;  1SEM A;  4A4F A;  2HNI A;  2MI6 A;  3UT1 A;  3DB3 A;  2PVO B;  3PNW C;  3CCL Q;  4HXJ A;  2P0K A;  4PJO G;  1OX9 A;  4ZN1 A;  5GMK h;  1U1T A;  4L5G A;  1VQ9 A;  5KE3 A;  2LNH B;  2O2O A;  2YWW A;  3QJY A;  2E3I A;  2IPO B;  2R58 A;  2KAF A;  4BI3 A;  4ZGE B;  2L8D A;  3CBO A;  1K73 U;  3S3O A;  4C92 A;  1MGQ A;  5FRO A;  1QWF A;  2LJ3 A;  1MUZ A;  1X2K A;  3HSB A;  4FT4 A;  3WVE B;  4QT7 A;  4JUV A;  2P4R A;  1YJW T;  2BZY A;  1YIT A;  1PD0 A;  1TUG B;  2OTL A;  1JBM A;  4JLG A;  4FW1 A;  2HQH A;  1KHC A;  2EYQ A;  2DIG A;  2K57 A;  4Y28 E;  1VQ8 T;  2J6O A;  4IUU A;  3I55 Q;  5FU6 B;  1VQ9 Q;  5DLO A;  2E6N A;  5A0G A;  2QEX A;  1D1B A;  3CPF A;  3JSC A;  2RHI A;  2W0Z A;  1QQJ A;  2KRM A;  1D0Y A;  4RMO A;  2KYB A;  1M8V A;  5LJ5 e;  2ZCF B;  4JJB A;  3SHW A;  4EMK A;  5J3B A;  5KYU B;  1YIT Q;  2ESW A;  3JAM E;  2LRQ A;  1OQK A;  1WXT A;  3JCM P;  1LNX A;  5HCK A;  2L5Q A;  1AZE A;  1GRI A;  1UB4 A;  2OAW A;  2O4X B;  1ZA2 B;  4PJO B;  1UEC A;  1K1Z A;  2LZ6 B;  1VQK A;  4KGZ B;  2QQB A;  1VQ5 T;  1R0C B;  5CR2 A;  1G2B A;  2CUD A;  1I8F A;  3MJX A;  3JCM W;  1Y0M A;  2YRV A;  5IN1 A;  4B6M A;  2V8J A;  3L1A A;  4XTU A;  2CT4 A;  1W6X A;  3V8L A;  4C5G A;  2RMO A;  2I0N A;  2XDB A;  2GTO A;  5D7U A;  2EGE A;  4M78 A;  3VS4 A;  5LL6 S;  4ELZ C;  1RAA B;  3J81 E;  4BE1 A;  1VIE A;  1JJ2 S;  2GTJ A;  5KYU A;  3EGD B;  3MEW A;  1RAF B;  2V1Q A;  2HCK A;  2M0Y A;  1BI3 A;  4FL6 A;  3RKW A;  2O4X A;  3M0T A;  1BI0 A;  4MDW A;  4BI8 B;  1VQK Q;  1H92 A;  4CI0 C;  2ED1 A;  1GXI E;  3HPW A;  4C0D C;  1JXM A;  4XQ3 A;  5D6X A;  4CC4 B;  2FZC B;  1YJW A;  2L0A A;  2DET A;  4B9X A;  2RQR A;  5GAO r;  2V8K A;  4CC2 A;  2CP5 A;  2BZ8 A;  2X35 A;  3OYG A;  4PLL A;  2JS0 A;  2E70 A;  1TS9 A;  1PSF A;  5LJ3 e;  1N8R C;  1T0J A;  4ZGJ B;  3FJP A;  3KBG A;  3SB2 A;  1VQ8 A;  1OU8 A;  2DTO A;  5GAM d;  3ZFJ A;  4X34 A;  4MMK A;  2M51 A;  3VS1 A;  4M7A D;  2YXY A;  2JTE A;  3PFS A;  1UTI A;  5CQY A;  1FMK A;  2KXC A;  1UGR B;  3H41 A;  4M75 G;  4IUQ A;  2H3E B;  3EH2 A;  3VS6 A;  2DVJ A;  4HT9 A;  3CBM A;  4OMN A;  3M0Q A;  2EBP A;  1QVG S;  3OYD A;  3GP8 A;  3MHX A;  1YJW Q;  4JJD A;  5IT9 E;  3OYM A;  1ZX6 A;  1B34 B;  4AG2 C;  3HL8 A;  3P8H A;  4FW2 A;  1MHN A;  2LQK A;  4Z89 A;  5GMK j;  5CKB A;  3INZ A;  2EIF A;  3FB9 A;  5GAN e;  3HFO A;  1VQ8 Q;  2CUB A;  4JS5 A;  5M9O A;  1VQ5 A;  2DYB A;  2VC8 A;  3X28 B;  4UC4 A;  4C5I A;  4M77 F;  2XID A;  3S3N A;  1X2Q A;  1D1A A;  2L3P A;  2VB6 A;  4J7I A;  2EYY A;  3M59 A;  2K2M A;  1PNJ A;  4PJO F;  3EHQ A;  3OYN A;  3U23 A;  2ED0 A;  2EYZ A;  3UA6 A;  5GMK l;  4NS5 A;  3H0F A;  3M4Y A;  3OS2 A;  2BIV A;  2DBM A;  1M1G A;  4C0Z A;  1PKT A;  9ATC B;  2A3L A;  5IXF A;  1TU0 B;  2FYK A;  2PTK A;  1UFF A;  5EG2 A;  4O6J A;  3QUI A;  2F2V A;  5KYX B;  2VXE A;  1U8R A;  1PHT A;  1VYT A;  2CS7 A;  4KUI A;  3SDZ A;  2CKK A;  1SSH A;  4RTU A;  3REB B;  3VKI A;  2DEU A;  3NTK A;  1N6A A;  4FYY B;  5GAM h;  4F17 A;  4AFU C;  1U3O A;  1M3A A;  1VQ5 Q;  4FU6 A;  2GF7 A;  3OYI A;  2JM9 A;  1VQM A;  2M02 A;  5CKF A;  2O88 A;  5KYY A;  3OW2 P;  2XMF A;  3MKD A;  3EG1 A;  1ZUK A;  2DE0 X;  3EGX B;  2BE9 B;  3CD6 T;  2QDY B;  2YDL A;  2DXT A;  2GFA A;  1SPK A;  3CPW P;  4OMQ A;  3HRU A;  2K3B A;  4BE0 A;  1U06 A;  2ZGW A;  4PNO A;  1WJS A;  2V1R A;  4J6X A;  1SF9 A;  4J9B A;  3V7R A;  2L3S A;  1G3Y A;  4Z8A A;  3AT1 B;  3G6E T;  2ZAE A;  3KXT A;  3MP1 A;  4RCC A;  3ZL7 C;  1KFZ A;  4OML A;  2M9U A;  5LJ3 g;  1J3T A;  3CCM T;  2JUF A;  3OMC A;  1GCQ A;  3M9Q A;  2EJF A;  3PE0 A;  4JJN K;  1SHG A;  4KGV B;  2KE9 A;  3N5B B;  1VQM Q;  3OY9 A;  1FWZ A;  2F2W A;  3QWX X;  1WHM A;  4X9D A;  2LQ8 A;  1UHC A;  1AT1 B;  2DL7 A;  2EJ9 A;  5GAO n;  2F5K A;  1M90 U;  2DF6 A;  1OV3 A;  2VUB A;  1WLP B;  4HCZ A;  2YUP A;  3M4G A;  1RLQ C;  1YCY A;  3CXC P;  2AZV A;  4X9C A;  4C8Q B;  3L2V A;  1QCO A;  4HCK A;  3HP9 A;  5ECA A;  5GAM g;  5FWB A;  1IGU A;  4OGE A;  1KD1 C;  1I0C A;  3CC2 A;  1IB8 A;  3UF4 A;  3JCM d;  3HKS A;  2KRO A;  2RN8 A;  1QVF A;  5KCH A;  1KQS A;  1D3B B;  2J06 A;  3M58 A;  3M54 A;  1K0X A;  3M0P A;  3VS3 A;  1BK2 A;  3FEO A;  4BB7 A;  2MOX A;  4TVR A;  1PSE A;  5LJ5 f;  1S72 T;  1VQ4 T;  4C92 C;  4M7D A;  3RDV A;  4C8Q A;  1Q82 R;  1T0H A;  2QTX A;  2FG0 A;  3JCM X;  2NUT B;  1Q81 U;  3VS2 A;  3CD6 A;  2OJ2 A;  4QQG A;  1WXB A;  4ANJ A;  2RJD A;  3R6N A;  2BKD N;  4OB0 B;  1Q86 R;  4KGX B;  3EH1 A;  4M75 F;  3OS5 A;  2RB6 A;  1K9M C;  5D6W A;  1I1J A;  4J5Y A;  4AFQ C;  3G6E A;  3E1S A;  1M27 C;  5CKE A;  1VUB A;  1D3B A;  3ASK A;  2CZ7 B;  3JCM V;  3CCM A;  4PFP A;  4E7S A;  5CKD A;  1Q7Y R;  1ABO A;  1QWE A;  4JRK A;  2JXB A;  2J6K A;  2MF2 A;  3M57 A;  4M7A A;  2GNC A;  1WHJ A;  2KI7 A;  1YBY A;  2MWO A;  3QBY A;  2LNV A;  4EMK C;  3CD6 Q;  2XDP A;  1GCP A;  2OTL T;  4KRT A;  2RM4 A;  3EG2 A;  4PFO A;  4A4E A;  3HRS A;  2X4X A;  1OYX A;  2ATC B;  1JB0 E;  1OU9 A;  3G6E Q;  1NBE B;  3L2R A;  5GAM j;  3MO8 A;  2HKQ B;  2VAS A;  4Z88 A;  4RCB A;  4LE9 A;  3JCM c;  1SSF A;  1PRL C;  1TXQ A;  4MML A;  3CCM Q;  2FZK B;  3BY7 A;  2QEX T;  2RI3 A;  3UA7 A;  4F7U E;  5LJ3 f;  1QKX A;  1TH7 A;  1GFD A;  2C0O A;  1X6G A;  1I4K 1;  2OX7 A;  4M78 C;  3DB4 A;  1XNI A;  2DL4 A;  1P92 A;  2J6F A;  2D0Q B;  2EGC A;  4PFZ A;  2ZPB B;  1B7T A;  3QPH A;  4OB3 B;  5A0D A;  1MV0 B;  3TRE A;  2CYZ B;  4RG2 A;  2JN0 A;  1X69 A;  1TG0 A;  2EQK A;  2NLU A;  5GAO q;  2ZPF B;  2EQM A;  1S72 A;  1BCM A;  4B9W A;  4MZP A;  1YN8 A;  1HJD A;  2CZ1 B;  1EZZ B;  2PQW A;  2QQR A;  4FIB A;  1JJ2 P;  2XU8 A;  1UEB A;  2D8J A;  2HBW A;  2C06 A;  1ZSZ B;  3PMI A;  3SD4 A;  1YJ9 A;  3DKM A;  1K9M R;  2DIQ A;  1QKW A;  2D9T A;  3JRZ A;  4DA4 A;  1M2V A;  4M77 G;  2DZC A;  2E4H A;  2QQA A;  4C92 E;  1S1N A;  3L2Q A;  4EPC A;  3JCM g;  4L59 A;  1BCO A;  3EAE A;  1PWT A;  1LCK A;  2MPX C;  1M1K C;  3TEE A;  5J26 A;  4A53 A;  1IZ6 A;  2F2X A;  3V7C A;  2A0F B;  2D1X A;  3GLX A;  1FX7 A;  3PTA A;  1EIF A;  1KC8 C;  2DM1 A;  1B3Q A;  2CGH A;  3SWN C;  3OYB A;  1WQ7 A;  1S72 Q;  1RAI B;  5GAO m;  1VQ4 Q;  1ZBJ A;  1RAD B;  1W2B A;  2KDS A;  3OYY A;  1RAG B;  3QO3 A;  2FRW A;  2K3Y A;  5GAN 4;  2DJQ A;  3BFM A;  5LJ5 d;  2O9V A;  2DXU A;  2E5K A;  1ZSZ A;  3HTR A;  2RK2 A;  1X6B A;  1MMD A;  4IUT A;  2CSQ A;  3TSZ A;  3A8H B;  2DKG A;  2LCS A;  4A63 B;  1K76 A;  5FRM A;  3PIO A;  2JMC A;  3VRY A;  1WHK A;  2JZ2 A;  2KR3 A;  2WAC A;  5KYW B;  2KBT A;  1D0Z A;  1QVG P;  2CH4 A;  4FSX A;  3PIP A;  1PG5 B;  3QKJ A;  3LWH A;  1E6G A;  2OTJ A;  2FHD A;  3I5S A;  1WJQ A;  1WHH A;  1CSK A;  4DOV A;  3EFR A;  1ZHI A;  2QGF B;  1G3T A;  1VQO T;  2WSC E;  1LJO A;  1OPL A;  2AKL A;  4KT0 E;  3NTI A;  4XU0 A;  3FRN A;  1Y96 B;  1GBR A;  4PJL A;  4ME7 A;  2FPD A;  4PJN A;  4C0F A;  4N4H A;  4F7U F;  3R6O A;  2LP5 A;  2OTL Q;  4NL2 A;  2K79 A;  1VQP T;  4M77 B;  2K3X A;  1T3L A;  3A8O B;  2RQU A;  2CP0 A;  1D0X A;  1JU5 C;  3H0H A;  2NUP B;  1K8A R;  4FM4 B;  2RHY A;  2E65 A;  4M78 E;  2RH2 A;  2DBK A;  2RQV A;  4N4I A;  2M0O A;  2ROT A;  3VV0 A;  3J7A F;  2AHJ B;  1WQW A;  5KYW A;  2QEX Q;  2HSP A;  4E7Z A;  4ATO A;  2P4T A;  2WSF E;  5A2Q E;  1N8R U;  4J9F A;  2HEQ A;  4RTX A;  2FEI A;  4HVW A;  1X01 A;  3JB9 D;  5LJ5 h;  2HQX A;  1Y96 A;  2RI2 A;  2DA9 A;  5LJ3 d;  3A8M B;  1M3C A;  1M1K R;  3L42 A;  3M55 A;  4M77 A;  1NJI R;  1BB9 A;  5I11 A;  2DK3 A;  1KC8 R;  3ZEH A;  2O01 E;  2NUP A;  3EG9 B;  4XU1 A;  2DL3 A;  4PJO A;  4JDS A;  1GCQ C;  3PMT A;  2DO3 A;  2ABL A;  2HD0 A;  3V8J A;  2EFI A;  1VQM T;  1IRE B;  3TU4 K;  4QQ6 A;  2D8H A;  4C92 D;  4CRI A;  4DQ2 A;  4L6V 5;  4IIM A;  4WCI A;  3VJP A;  4E7K A;  1TTH B;  4R0K A;  2YUO A;  3D7S B;  4E2F B;  5CK9 A;  4FCY A;  4RUG A;  3OSS C;  4LDX A;  2LJ1 A;  3DLM A;  3JB9 I;  3VUB A;  2RJF A;  3VS5 A;  2EYW A;  2VGN A;  2X51 A;  1XQH A;  2JTM A;  3EGD A;  2E64 A;  3L2U A;  1WXU A;  3QYG B;  1X6O A;  2A08 A;  3S6W A;  3JCM f;  2XKO C;  5GAN 2;  1VYU A;  3EG9 A;  3EFO B;  2H3J A;  4QQD A;  4HCB A;  3BDU A;  2KYM A;  3H6Z A;  4LNP A;  1VQO A;  1K4U S;  1OZ3 A;  3EGU A;  2DVE A;  4II1 A;  1YI2 A;  1UUE A;  2MK5 A;  1VQP A;  4IUR A;  3MET A;  1IO6 A;  3NHN A;  5DY9 A;  2QA4 T;  2RI5 A;  2RHU A;  5LJ5 g;  5LJ3 h;  4JZ4 A;  1K73 R;  4V2S A;  1UJ0 A;  4KH0 B;  1KG1 A;  3RES A;  1WJR A;  4WTO B;  4M7D C;  4C8Q C;  1H8K A;  4HVU A;  2RQT A;  1NYG A;  2ROL A;  2K4Y A;  2L3R A;  1UGQ B;  2HZY A;  1SHF A;  3A8G B;  2FPF A;  2JNG A;  1VQO Q;  3CC2 T;  1VOM A;  2KVQ G;  1G3W A;  1GFC A;  2K6D A;  5C6S A;  1KQ2 A;  4Y92 A;  4M78 D;  3CCQ T;  1I07 A;  2RHZ A;  3QG1 A;  3PT9 A;  3GNG A;  1HD3 A;  1VQP Q;  3O5Z A;  1B34 A;  4BDZ A;  2JMA A;  1SG5 A;  4E7J A;  2QAZ A;  2VXF A;  5EC7 A;  2E41 A;  3LW5 E;  1AWO A;  4D8D A;  1YJN T;  1BI2 A;  2ZPE B;  3CC4 A;  4M75 B;  1F1B B;  4M7A C;  4RTT A;  1TOV A;  1NEB A;  3RNJ A;  2R5M A;  1DJ7 B;  3OYC A;  2DFU A;  3OYE A;  3JCM b;  3ME9 A;  4EDU A;  4FYW B;  1Q82 C;  1G5V A;  4FYV B;  2WSE E;  4MZM A;  1NEG A;  2YUQ A;  2HL3 A;  5FLX E;  4XK8 E;  3OMG A;  2G3R A;  2RK1 A;  4HKE A;  2E6Z A;  4C0D B;  1HK9 A;  2ZPG B;  1V29 B;  1WIE A;  5GJV B;  2FL7 A;  1Q86 C;  1MMA A;  2FPE A;  4LDW A;  2G6F X;  3M0S A;  1D09 B;  5KYX A;  2DRM A;  1O75 A;  2DEQ A;  1VQ6 T;  2LC4 A;  3BW1 A;  3JB9 J;  1QP2 A;  2I2L A;  2CP2 A;  3J80 E;  1TWB A;  2YRC A;  1WZO A;  1Q7Y C;  4M75 A;  3BDL A;  1PD1 A;  1V76 A;  2B8A A;  5LJ5 j;  2LX9 A;  3EGX A;  2MMP A;  4C0G A;  2K2V A;  4JS4 A;  1BYM A;  1OZ2 A;  3OS1 A;  3RBB B;  3ULR B;  2QA4 A;  3LX7 A;  3QZ5 B;  4C5E A;  8ATC B;  3M53 A;  5FU7 B;  4A4K A;  5FRN A;  2RJE A;  1OEB A;  2K5F A;  2YLC A;  2XIC A;  3C0C A;  4E7H A;  3JV3 A;  2H8H A;  1FMW A;  2X3W D;  2DLP A;  4C5H A;  2HAX A;  5GAN g;  3OYL A;  5CO7 A;  2LT4 A;  2LCC A;  3MEA A;  2EWN A;  3CBP A;  1VQL A;  4QKU A;  3CCQ A;  2HDA A;  2MAM A;  3QDF A;  3THK A;  2RHX A;  3LGL A;  4M7D E;  4C8Q E;  2XDD A;  3CCV T;  1OUL A;  2QA4 Q;  2RPN A;  3G71 T;  1I5L A;  3OB9 A;  2EGA A;  2CDT A;  5GAN 7;  4LUE A;  2DX1 A;  2EVR A;  2EQI A;  4LDV A;  3X26 B;  1QVF S;  4F7U G;  1YJN A;  1LOJ A;  1MNE A;  1KHI A;  2QDL A;  2V8I A;  5HKC A;  1KQS S;  2RNA A;  3LGF A;  3NTH A;  1LVK A;  3CEY A;  3RKX A;  1JRI A;  1ZSZ C;  3CC2 Q;  1YJ9 T;  2F1L A;  3LH0 A;  2XD0 A;  1PRM C;  3CCQ Q;  2PVD B;  2IIM A;  2KY9 A;  2X4Y A;  1SRM A;  2VGM A;  1M90 C;  5LJ3 j;  2R5A A;  3A5Z B;  3IQL A;  4M7A E;  1XJW B;  3CME T;  3JB9 G;  2EKH A;  2XG8 D;  1QW1 A;  2E10 A;  3TQ7 P;  1WX6 A;  1H3Z A;  2EJG A;  3CCR A;  3M0U A;  2HL5 C;  3CPW A;  3C94 A;  2DTH A;  3QJ6 A;  4EIK A;  4DBF A;  1WYX A;  1VQ6 A;  3E2U A;  2QGG A;  4K11 A;  3QSU A;  1N27 A;  3PGG A;  2CSI A;  2DD5 A;  3P8D A;  3AHU A;  1YJN Q;  1H64 1;  2HSE B;  2DAQ A;  3LH5 A;  4GBQ A;  4OMP A;  5IHN A;  5IHK A;  2NUT A;  1WDX A;  4J9I A;  1KJW A;  3MPU B;  3G4S T;  1QVP A;  3C95 A;  2YSQ A;  4GLM A;  4C92 G;  1AOJ A;  3JCM h;  3FDR A;  1WHG A;  2AK5 A;  3LYI A;  4RTY A;  2DL8 A;  3I5R A;  2K7A A;  2L89 A;  4BY6 B;  3MP6 A;  1Y07 A;  4N0A A;  3L2Z A;  1W4S A;  1OOT A;  1ZLM A;  1CKA A;  1AWJ A;  1YP5 A;  5KYN A;  1NZ9 A;  1UE9 A;  4OMM A;  3X24 B;  1YIJ T;  4OGC A;  5FU6 C;  1X75 C;  1AEY A;  4F7U B;  4ZN3 A;  3UDC A;  2VKN A;  1FMV A;  3V8K A;  1G3S A;  1VQ6 Q;  1Q81 C;  5I2M A;  2OTJ T;  2O31 A;  1RAB B;  2RA2 A;  3GF5 A;  5GAN 3;  4XU2 A;  5FWC A;  1VQ7 A;  2X9H A;  4JLI A;  3A98 A;  2KK4 A;  4HVV A;  2FVU A;  2P0P A;  4GY5 A;  4PJJ A;  2CH4 W;  2KRS A;  2LJ0 A;  2DER A;  1OX8 A;  4BI4 A;  3CCV A;  1KQ1 A;  4M77 C;  3QXE B;  3HHT B;  2LQN A;  3C4S A;  3G71 A;  5GMK m;  3RMS A;  5IXB A;  4OMF B;  3TCJ A;  4PJO C;  4M7D F;  3UWN A;  1T3S A;  1K8A C;  1UJY A;  1BKB A;  1E7O A;  4MZT A;  5FW9 A;  5GMK e;  5DLQ E;  4M7D D;  4KH1 B;  4C8Q D;  1ZA1 B;  2PU9 B;  5I21 A;  2D6F A;  1M90 R;  2B86 A;  1A0N B;  1JXO A;  3VYH B;  1RAC B;  3SEM A;  5GAN f;  2ENM A;  1MMN A;  3KFV A;  4E7I A;  1YFN A;  2V26 A;  1NE8 A;  3M56 A;  1N9R A;  3CME A;  3CCV Q;  4M78 G;  3Q1J A;  4MDX A;  3M0R A;  2Y90 A;  3G71 Q;  4OF1 A;  2ECZ A;  2BTT A;  5CKH A;  1HXD A;  4OMO A;  3SFM A;  1NJI C;  1KIK A;  3WXM B;  4M7A F;  3EHR A;  1HYO A;  2ZPI B;  2LT1 A;  4Z02 A;  2DIL A;  4HA8 A;  1Z9Z A;  1PKS A;  3NFC A;  2KNB B;  2YLB A;  2MIO A;  5GJW B;  1ZSG A;  2DXC A;  3I55 A;  5IHI A;  2L3Q A; 
#chains in the Genus database with same CATH homology
 1KC8 R;  3I56 Q;  3CCV Q;  1VQM Q;  1QVG P;  1VQO Q;  1KD1 R;  1VQ5 Q;  3CC4 Q;  3CCR Q;  1Q82 R;  1JJ2 P;  1VQK Q;  3CD6 Q;  3G71 Q;  1K73 R;  3CXC P;  1YJ9 Q;  3CCM Q;  1W2B P;  1VQ8 Q;  1YI2 Q;  1K8A R;  1VQ6 Q;  1YHQ Q;  3CC7 Q;  3OW2 P;  1K9M R;  1YJW Q;  2QA4 Q;  3CCU Q;  1M90 R;  1VQ7 Q;  1VQP Q;  3CMA Q;  1Q7Y R;  1S72 Q;  1VQ4 Q;  3CC2 Q;  3CCE Q;  1QVF P;  3CCS Q;  3CCJ Q;  1YIT Q;  3CME Q;  1N8R R;  1YIJ Q;  3I55 Q;  1Q86 R;  1M1K R;  1VQL Q;  1YJN Q;  1VQN Q;  2QEX Q;  3G6E Q;  3G4S Q;  1NJI R;  3CPW P;  3CCL Q;  3CCQ Q;  1KQS P;  1Q81 R;  1VQ9 Q;  2OTL Q;  2OTJ Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...