1YHQQ

Crystal structure of azithromycin bound to the g2099a mutant 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S Ribosomal RNA
publication title Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1yhqQ00
3CC7Q 1M90R 1VQMQ 1VQ4Q 1VQ5Q 2OTJQ 3CCRQ 1Q86R 3I55Q 3CCQQ 3CCJQ 1KC8R 3CCMQ 3G4SQ 1K9MR 3I56Q 1YJ9Q 1QVGP 3CCVQ 3CCUQ 1YI2Q 3G71Q 1Q81R 1Q7YR 1VQNQ 1VQ6Q 1K8AR 1VQ8Q 3CCSQ 2QA4Q 1VQLQ 2OTLQ 1YITQ 3CD6Q 3CCEQ 3CXCP 1YJWQ 1VQPQ 3CMEQ 1NJIR 1JJ2P 3CC2Q 1W2BP 1QVFP 1KD1R 3OW2P 1YHQQ 1YJNQ 3G6EQ 1S72Q 1M1KR 1VQOQ 1N8RR 3CPWP 1YIJQ 1Q82R 2QEXQ 1VQKQ 3CMAQ 1K73R 1KQSP 1VQ9Q 3CCLQ 3CC4Q 1VQ7Q
chains in the Genus database with same CATH superfamily
1JB0E 2YRDA 4XTXA 1KIKA 2HSPA 3CCMQ 2LT1A 3M0RA 1AHJB 4PFOA 2MOXA 3VUBA 2KAFA 4MDWA 2QGFB 2KYBA 1K9AA 3CCQA 4O5VA 3CPWP 2QTXA 2KEAA 2BZYA 2KQWA 1H3ZA 1SSFA 1XOVA 1ZUKA 2KR3A 3H6ZA 1KC8R 2RQWA 4XAXB 3M0TA 1YJ9Q 3F70A 4LDUA 3CC2T 4TVRA 3L2VA 2FVUA 5FROA 1OV3A 3OY9A 4PK4A 1Q82C 1YBYA 3EH2A 3EH1A 2QQRA 2OI3A 5KE3A 1Q81U 1PG5B 2HL3A 1VQNA 2L3RA 3CC4Q 1D3BB 2DFUA 4M78D 2DMOA 2J7IA 2QK0A 1EX4A 2Y4XA 1WZOA 3I5SA 2KBTA 5HKCA 1JU5C 2ROLA 2A37A 3MKDA 4QVCA 1ZSZB 3HRSA 3SFMA 5FU7B 2FB7A 2NUPB 3CD6Q 4M7AB 4PNOA 2X3WD 4EMKB 3URGA 3OA6A 1BI0A 1UGVA 4B9WA 3DLMA 3UPUA 2BKDN 2HNIA 3DB4A 4ZN3A 3FEOA 2E65A 3EG9A 5GMKi 5FW9A 3G71Q 1WHGA 4HT9A 2EQMA 1R0BG 2K57A 1G3YA 1VIFA 3GBQA 4NOYA 1MMNA 2F1LA 2K5IA 4Z8AA 1TH7A 5L23A 3FDRA 2DXBA 2VWFA 3RKYA 1JJ2S 1N9SA 4IKFA 1SSHA 1WPYA 5LJ5h 1G2BA 5I2SA 1VQLT 3H0HA 5GANj 1OI1A 2DL5A 1T3LA 2AZVA 3PGGA 3GPLA 2RPNA 2RK1A 3A1PA 4FT4A 1M8MA 1YJWQ 1K73C 3OYAA 2LCCA 2CYZB 4CI0C 1M3BA 1XNIA 1UEBA 4MMKA 3HRUA 3QBYA 3JCMh 5HY6A 2E10A 2KRNA 1CKBA 1PD0A 1YIJA 4OMFB 1T0JA 4N0AA 1M9SA 1YITQ 3SB2A 1ZSGA 4A63B 1X6BA 1VOMA 4Z89A 4M77C 3CXCS 3RMSA 5GAMj 2HMAA 3G71T 1SG5A 4PJOF 1G8XA 3C12A 3FB9A 3P8BB 4L59A 1VQKA 4L6V5 2NYSA 1M3AA 3CCEQ 1OX8A 4JLIA 4OB0B 1D0ZA 4M78G 2XMFA 1N8RR 2FG0A 2GQIA 2MK5A 2ECZA 4KT0E 1Z9ZA 1OU9A 1K0SA 4M7DA 1H92A 1M2OA 1GCQC 1NE8A 1HYOA 2EJ9A 1QVFA 2A28A 2LNHB 1YJWT 4LDXA 2DTHA 4J8OA 1WHHA 4P5NA 5GAOq 4PJOA 2RB6A 3V8LA 1T3SA 1I81A 2PZ1A 2RF0A 2W0ZA 5C0MA 5KYXB 1XTDA 1KFZA 5A2QE 1VQ9Q 1FWZA 5GANg 2X35A 2E6NA 3WVEB 4JUVA 5HK0A 2L3QA 3G4SQ 3LGLA 2CDTA 1Y0MA 1I5OB 2RH2A 4F7UF 3L2WA 3AHUA 3LGFA 2H8HA 1LNXA 1VQ6Q 4M77A 4GY5A 5KCOA 2QA4Q 4J83A 2EIFA 4ANJA 1FYNA 3L42A 2XD0A 2EKOA 4CRIA 2DD4A 1Q81C 1OYXA 2JS0A 2JZ2A 2ZAEA 4Q5WA 1K9MR 4ZGJB 3CCET 3ZL7C 2DKGA 4LE9A 1MUZA 4A4FA 1JO8A 3WXMB 5IHIA 4FYXB 1BKBA 1FMWA 4DBQA 3UDCA 5KYUB 2HDAA 3LYIA 2ZPEB 1AZEA 1EFNA 5GAMg 1QMCA 5ECAA 4C5EA 2ED1A 2AZSA 3EGXA 2B86A 3CMAQ 3JB9H 1QKXA 2M0YA 2PVDB 4WTOB 4M77B 1U5SA 2L0AA 4PLIA 2VXFA 4QQDA 1WXTA 3J81E 3CCST 4M78E 4DBHA 3OYDA 8AT1B 3HPWA 2OTJA 1VQ9T 2CP6A 3VRYA 4J9BA 1KD1R 1SHFA 4ELZC 1TUDA 2QQAA 1YCSB 4C5IA 1U1SA 5GMKe 1TS9A 4JZ3A 2RJCA 5LL6S 3RKXA 4F14A 2A0FB 4FW2A 1Q7YC 2LQKA 2QA4T 1MV3A 2DXTA 4JS5A 1AT1B 1OZ2A 2KYMA 5I21A 2RO0A 2X51A 1K8AR 4C8QE 3WVDB 4HCKA 2QQBA 2GFAA 1WQ7A 1U06A 4QVZA 3EGDA 2VC8A 2QQSA 1D0YA 3L2UA 2SRCA 3CCRT 4C92C 4FYYB 3META 2M0OA 2YUNA 3NTKA 3FRNA 2FPEA 3M59A 3JB9F 2EFIA 2LQWA 4M75D 4KH1B 3CCLA 1QKWA 1AD5A 1OEBA 2F5KA 1BB9A 2EYZA 3CMAT 3CMEQ 2VGNA 3GNFB 1WJRA 2R5MA 2RQTA 3M57A 2WACA 3C95A 5GAOr 4Y92A 2FYKA 2JXBA 3M4YA 2QEXA 3BW1A 4IUTA 2GTJA 3JCMV 2PUOB 1YJNT 4JJBA 3GP8A 1M90U 3VRZA 1Q86U 1D1CA 3CC7T 3TVTA 1SRLA 2J6OA 1RAIB 3Q1JA 5A0DA 4QQGA 1G83A 2D0QB 3I55Q 1UFFA 4BI8B 1JRIA 2MMPA 1ABQA 4C92A 1YHQT 1WI7A 4J6WA 4KGVB 4LN2A 2CH4W 3JB9J 1GCPA 4A4EA 2ZGWA 1JXOA 1W6XA 3QKJA 3HRTA 2DF6A 4MZPA 1WX6A 2DD5A 4OMPA 4JJCA 1Y96B 3OBWA 2MWPA 4JJNK 3UT1A 3VJPA 3JB9D 4EIKA 2GF7A 1B07A 1WXBA 1R0CB 1LPLA 4M4ZA 3OW2P 1RAFB 2CT3A 2XU8A 4LD6A 4C5GA 5LJ3j 4IUQA 4BD3A 1VQ8Q 2V8IA 2DEUA 5C6SA 5LJ5j 2WSCE 2RD1A 1NZ9A 1XQHA 2K3XA 4FYWB 4F7UG 4RKUE 1MMDA 4KRTA 3QXEB 3M54A 2D8HA 2F2VA 2J6KA 2PQWA 5GMKh 2DIQA 4QQ6A 3I55T 2R5AA 1QVFS 2V1QA 1VQLA 2X4WA 4F16A 1VQ4Q 5CVIA 1LOJA 1OU8A 4M75G 1IB8A 1NPPA 1Y7XA 1SEMA 3JB9I 1FMVA 4J9GA 4OMLA 1NLOC 2JJ9A 2I2LA 4PJOE 4FL6A 4HVUA 3I5RA 5KCHA 3M9QA 1X01A 3G1JA 1QCFA 2KVQG 2ZCFB 2XICA 1BCOA 3HFOA 2X9HA 3REAB 2KRSA 4V2SA 3LH0A 1QP2A 4BDYA 4XTVA 3DLLA 1VQ8T 3X26B 3JCMX 2GQVA 1B7TA 3PVLA 4E7IA 4Y28E 2EQJA 5DLOA 4B9XA 1WHMA 1C6VX 2O4XA 1GL5A 2NWMA 2QXFA 1KQSS 1ZSZC 4JS4A 3TEEA 1IO6A 4JLGA 2KI7A 4AFSC 3PMTA 4M78C 5GAN5 2YWWA 2OAWA 1O9SA 1MGQA 4OMOA 3PT9A 1MNDA 1VQ4T 1BI2A 2CT4A 2DVEA 1VQOQ 3JRZA 5LJ5g 4F7UE 2EVRA 2RA2A 4XU1A 2DYBA 1U8RA 1QVGP 3JB9G 2RI2A 3ZEHA 4J9IA 4RTTA 4X34A 2K6DA 2RHZA 2CREA 4C8QC 1N8RC 1ARKA 1UDLA 4J9HA 2HL5C 1WJSA 2YXYA 3M56A 2JVVA 1S72Q 1M90C 1Q86C 2COWA 4XK8E 2DPPB 3A8GB 4NL2A 2CSIA 3RKWA 4PL6A 3JCMg 2H3JA 2H3EB 1YNZA 3M58A 3HHTB 4EMHA 3U23A 2Y90A 4HT8A 1KK7A 1D3BA 1VQ7A 2VGMA 2DETA 2KK4A 4MZMA 1M5Q1 1QLYA 2DZCA 3CQTA 2RNAA 4J6YA 1ZSZA 1M30A 3H8ZA 2M1HA 1KQ2A 2YUOA 2NUPA 5DM7R 4M7AA 1VQMQ 4EMKA 3CCJQ 2C06A 3BE3A 3SHWA 2A7YA 2CGHA 1ZA2B 1BYMA 1VQOT 4OGCA 4DEXA 3FC3A 5AYFA 3BFMA 1X2QA 2FEIA 5KH6A 4IUVA 1A0NB 4JRIA 5FU6B 1BI3A 3CCSA 1VQ5Q 3OYEA 3CBMA 1K76A 1IHVA 3NTHA 2MIOA 2QYZA 4BACA 2OTLQ 2RMOA 3C4SA 4M78B 1IHWA 2C0OA 2JN0A 1WHKA 2YRVA 1YI2A 1C0MA 3HSBA 3CCMT 2QAZA 3KFVA 4C8QD 3S6WA 2DZ9A 1DJ7B 3V7CA 2RN8A 3KBGA 5D7UA 2KROA 3EFOB 5GANd 3CCRA 1JBMA 2BZXA 4C8QB 1GRIA 4OMQA 3OYIA 2XKOC 5J3BA 1Q7YU 1YJ9T 4D8KA 3LWIA 2HSEB 2QI2A 2EYXA 1VQPA 2ROTA 3JAME 1B3QA 2D8JA 1UE9A 2O9SA 2DLPA 3NGPA 3M5AA 4JRPA 4BB7A 1ZUYA 3HKSA 4PJJA 3CC4T 1VQ5T 4ME7A 3RR6A 1S1NA 3EG1A 4JDSA 3SD4A 1SPKA 1G3WA 5GAMd 2OTLT 1M1KU 1YJNA 2AKLA 3CD6T 1UECA 3CCUQ 3CEYA 5GAN8 2XI9A 2K5LA 1IREB 3CC7A 4C0FA 1W2BP 3QJYA 3MEVA 1WA7A 4M7DF 3C94A 4R55A 3TSZA 2YUQA 5GAMf 2KRMA 4IURA 4OP0A 1CSKA 4HCZA 4RG2A 2FZGB 2EGAA 1YHQA 5KYXA 3I56Q 3VS2A 1B34A 1QCOA 2E4HA 1I07A 2ESWA 3A8LB 3UA6A 2DVJA 2RHIA 3ASKA 3HP9A 1M2VB 2C0IA 3E19A 2RM4A 2C0TA 1U3OA 3QYHB 3MHXA 4M77F 3QO3A 3CCQQ 3LW5E 1F1BB 1WHLA 3THKA 2VXEA 3CPWA 4LNPA 5CKHA 3JCMc 4B6MA 2YDLA 5CKEA 3A8OB 5J26A 1FMKA 1KC8U 3VKIA 2AT1B 5GAN6 1RAAB 4AFQC 3MPUB 2LTOA 4OB1B 5EC7A 1D0XA 4C8QG 1B34B 3OYGA 5KYUA 3CCUT 4GLMA 1X69A 4FSXA 2FPFA 3OYHA 5DY9A 4E7HA 1PSFA 2SEMA 4FSSA 1AZGB 1YITT 5GANe 1E7OA 4OVAA 2YUPA 1PRMC 1VQNQ 2KXDA 1ZBXA 4XTYA 2KXCA 3R6OA 1MHNA 5KYNA 2LMJA 5CKDA 3H0IA 3OBYA 4M75C 2VV5A 2DILA 4ZTJA 2RJFA 2LCSA 4M7DD 2JOYA 3I56T 1AWJA 2NUTB 2I0NA 4J5YA 1SF9A 2CP3A 3JSCA 3GLXA 5FLXE 1WJQA 3L2ZA 3OYMA 1OULA 1QVPA 3CCVQ 2RQVA 2Y4YA 4PJOD 2IG0A 4OB2B 5IT9E 4ORZA 3A98A 2CP7A 3M53A 2DL7A 4AFUC 1I5LA 1JJ2P 2VKNA 1GCQA 2JT4A 3EG0A 2HQHA 1Q82R 1PC0A 3CCQT 2VASA 4N4GA 2ENMA 3CBOA 5GAMe 2KMTA 4XTWA 4OB3B 1H3HA 1H641 1P92A 2ZPHB 3VS7A 4IIMA 2EAYA 2FO0A 1X6OA 2DJQA 4J9DA 2OJ2A 1GBQA 1PD1A 1M4ZA 2CKKA 4HA8A 4DEYA 2XHCA 4EPCA 5GAN7 4RTXA 2VB6A 2HBPA 2LC4A 3M0PA 3G4ST 4LDWA 2P4RA 2Z0WA 2FL7A 1VQNT 1JXMA 1HD3A 1X27A 1VQ6T 2MAMA 1AWXA 5KE2A 4DQ2A 1NJIC 2PVGB 2B8AA 1LCKA 4M75A 2DXUA 3CXCP 1N27A 2ZPBB 3SWNB 4Z88A 1TXQA 2O2OA 1YIJQ 3FJ5A 4E7ZA 3CCVT 5CO7A 2L5QA 8ATCB 1G3TA 1W4SA 1NYGA 1W2BA 4F7UB 5EG2A 1I0CA 2L2PA 2LQ8A 3VS5A 5CQXA 1H8KA 1M1KC 1FX7A 5CCAA 3DB3A 3L2RA 1ZBJA 4KGXB 2OAUA 5IN1A 3GF5A 3EG3A 2LJ0A 1VA7A 1XJWB 3BDLA 5CKBA 3ULRB 1X2KA 1VQKQ 1PNJA 1K73R 5CQYA 3D7SB 4CC3A 2L8DA 2PUKB 4M75B 2L3SA 1ZQ1A 4C92F 2DIGA 1BIAA 4RTYA 5CKFA 2DTOA 1N8RU 1R8OB 2DYIA 5AT1B 4BE0A 3NHNA 1Y96A 1PRLC 5GAN3 4FW1A 4ESRA 4M7DG 4XQ3A 1V1CA 1YCYA 2DBMA 2DAQA 3HTRA 4PJOG 3CC2A 4RCBA 2MYSA 3PNWC 5KYWB 4AG2C 1VYUA 1YIJT 1OPKA 4R0KA 3ME9A 1M1FA 2DL3A 2M51A 2JM8A 2VYTA 1YWPA 4HVVA 4K11A 2COYA 3QWXX 1M1GA 2LT4A 4E2FB 2GFUA 3H41A 1KC8C 2F2WA 2DL8A 3EFRA 2DM1A 2AHJB 4XU3A 1QWEA 3QYGB 5LJ3d 1SHGA 5L8RE 1Q95G 3V7RA 1BBZA 3CMET 1NEGA 5LJ5d 4LDVA 3T9NA 4AMCA 4X9CA 1K9MU 3CCMA 5GAMh 2CS7A 5LJ3f 1KSWA 5D6YA 2CZ1B 4WCIA 5J39A 4GLKA 2V26A 4ZGDB 3UWNA 2DTIA 4O6JA 3OYBA 2DX1A 4DBFA 9ATCB 4DBRA 4MZTA 3JCMd 4QT7A 1I1JA 1YJ9A 1RABB 4CC7A 3RBBB 2F2XA 2FZCB 3RNJA 1OX9A 2GTOA 1AEYA 2HZYA 2KE9A 2OTJQ 4IUPA 3CPWS 1D1AA 2EJGA 1KD1U 2DJZA 5KYYA 1Q81R 2PU9B 4M7DE 3CPFA 2FZKB 3CC4A 5DLQE 3MCAB 4YTLA 1X75C 5GAOn 4FU6A 1NG2A 2KY9A 2AKKA 2K2MA 4PKCC 2YSQA 4PJLA 2E64A 3S3NA 3PVQA 2CUDA 3L1AA 2CUBA 1ZHIA 2A36A 2EJFA 2JMCA 3CXCA 3CD6A 2LX7A 2JM9A 1MMAA 1YN8A 1PCXA 3OYKA 3V8JA 4MDXA 3NMZC 3EGUA 4J7FA 1UGRB 3JCMW 2MPXC 2DA9A 4X1VA 4M77E 2DEQA 5FU6C 3L2QA 3G71A 1GFDA 5GJVB 2LRQA 5KYYB 4RTUA 2DRMA 1C1AA 3RIRA 1N9RA 3J7AF 1Q7YR 1BI1A 3QZ5B 1NBEB 2EKHA 1UTIA 1WQWA 4FM4B 2EYYA 5GAOp 6AT1B 2LJ3A 4R56A 2QDLA 2OTJT 2O31A 2QEXQ 2MF2A 1WFWA 2HCKA 2OX7A 3RESA 3G7ZA 3QDRB 5LJ3e 2ATCB 1KJWA 1YJWA 5LJ5e 4X9DA 2V8KA 2RJDA 1TTHB 4FT2A 1OPLA 1ZUUA 2EQIA 3OMCA 4BDZA 4M7AF 2RHXA 3CCUA 1NPRA 3GIBA 5FRNA 4XTZA 1UG1A 2HQXA 1PM3A 5HCKA 3UATA 1YITA 1V76A 4OF1A 1YWOA 3S3MA 3M55A 3PE0A 4BUGA 3JCMe 2M16A 4BE1A 4F04B 1QQJA 1ABOA 1D1BA 4E7JA 1UJ0A 2CZ6B 1W1FA 2NLUA 2BIVA 1Y07A 2KGTA 3VUZA 3FJPA 4FCYA 3CCEA 4M78A 3V8KA 1UUEA 1X6GA 3AT1B 3REBB 7AT1B 3OW2A 2CP2A 2FRYA 3OYJA 3KUFA 2E5QA 3X20B 1WYXA 4LDYA 2LJ1A 2QEXT 1QVFP 2P84A 2X4YA 1RLPC 4F17A 1IGQA 1KQ1A 1J3TA 3EFOA 3CBPA 1K9MC 4FYVB 3M4GA 2G3RA 3EHQA 1MNEA 5HK3A 4C8QA 4JPBW 2D6FA 1VQ9A 4JRKA 1RL2A 1VQLQ 1S72T 2JNGA 3BDUA 3G4SA 3GNGA 3TCJA 4M7AD 2K79A 1VQ6A 2XG8D 2E70A 2QA4A 2HKNA 2A3LA 4C0DC 3JCMb 1QCNA 3VS6A 2YT6A 3OB9A 3OS1A 2HKQB 4Z02A 2AK5A 4GBQA 1PSEA 1KD1C 3UF4A 1JEGA 4AG1C 3JCMJ 2QTVA 2L3PA 2P0KA 4KUDK 2ED0A 1MMGA 2RQRA 2HAXA 2R57A 2LDMA 4C92E 3G6EQ 3OS2A 3CCVA 3M0UA 1VQMT 4N0AC 2DRKA 3PTAA 1N6AA 1GBRA 1KQSP 3CCJT 2GCXA 4Y91A 3NFCA 1NJIU 4A4HA 2RHUA 1K8AC 1RADB 3VU3C 2CP5A 1TOVA 5CK9A 4IIOA 2XIDA 5GJWB 5GANf 1TUCA 3CMAA 5IAYA 3J80E 5GMKm 2HQEA 1SRMA 4E7SA 1IGUA 5LJ3h 2D9TA 2EYQA 2QQ9A 5I22A 1WIEA 2M9UA 2L89A 2X4XA 1QP3A 5D6XA 4PFPA 2F69A 2KDSA 2PTKA 2BTTA 2DBKA 1M2VA 1OZ3A 3TSWA 5GAN2 2RK2A 3UA7A 4M7DC 3E2UA 3X25B 3OYLA 4N4IA 3QJ6A 2P4TA 3QHSA 4RTWA 1ZLMA 3EG9B 4N4HA 2EGEA 4PJOC 1QVGA 1UGSB 5GAOl 4ZNXA 1Y57A 3M0QA 2YRCA 4D8DA 1K0XA 3A8MB 2RQUA 1KHCA 2KNBB 1HJDA 1YP5A 1RUWA 1M3CA 2CSQA 2ABLA 3G6ET 2YHTA 3QSUA 3QIIA 3OYYA 1Z9QA 1ACMB 1ZA1B 2G6FX 2RJEA 3VS0A 4PJNA 1VQ7Q 2JTMA 3CMEA 2ZPFB 3VS1A 4C0DB 3SEMA 1IZ6A 3V7SA 4E7KA 3RUXA 2LZ6B 3FLGA 2NUTA 3OYNA 3QDFA 3SWNC 5I11A 2YLCA 2JTFA 4M7AG 5I2MA 4BI3A 2CP0A 3ZBDA 1IRXA 1NEBA 5GMKj 1K4US 1IXDA 3MJXA 1BU1A 1M90R 4J7IA 1OOTA 3OS5A 3O5ZA 1Q86R 3MEUA 1VIEA 3M0SA 4PFZA 2EWNA 3H9NA 1WNLA 2J06A 3TQ7P 3CCSQ 5IXBA 3I55A 2BZ8A 4WF2A 3E9GA 2QASA 3JCMQ 2WSEE 3I9QA 2COZA 1PKTA 3QG1A 2BE9B 3FIFA 3LLRA 4D6WA 3X24B 3RDVA 1RI9A 2HBWA 4OGEA 1YI2Q 4RMOA 1G3SA 3LH5A 3PMIA 1GFCA 3S3OA 4M7DB 2FRWA 1VQ7T 3QUIA 2LQNA 2MI6A 2HD0A 1G5VA 2RI3A 4PJOB 3CCRQ 4M75F 3SWNA 2K3YA 4A4KA 3MP1A 4JZ4A 4M77D 2IVWA 4RUGA 1KQSA 1UHCA 1LJOA 1VQ8A 2LNVA 4F7UA 1VQPQ 2DNUA 2D0NA 3OSVA 2LP5A 1I4K1 4MMLA 2KT8A 4OMMA 3OW2S 3QWYA 4XU2A 1EZZB 2IPOB 4ATOA 2K4YA 3IQLA 1RACB 3R6NA 4M7AE 2FPDA 3EHRA 5IHNA 4VUBA 1E6GA 1WLPB 2E12A 1VQ4A 4E47A 3O8VA 1Y71A 2E3IA 2PVOB 5A0LA 2RI5A 2XK0A 3KXTA 1YJNQ 2F5TX 4KUIA 4ZGEB 5FWCA 1FXXA 3PIPA 4EDUA 2ZZDA 1YI2T 3CC7Q 5D6WA 4QVDA 1ZX6A 4RG8A 3EGXB 1UJYA 2XDDA 2W10A 4HCCA 1UHFA 1WHJA 1YFNA 1N5ZA 2EGCA 1WXUA 2LX9A 3MO8A 4HXJA 1YHQQ 2QDYB 2P0PA 1M8VA 1U1TA 3PFSA 5KYWA 2K2VA 1QWFA 4LUEA 1V29B 4J9FA 4DOVA 2GBQA 2VUBA 4A4GA 4E6RA 1VQPT 3OQ5A 4UC4A 3OYCA 2CZ0B 4JRQA 2X4JA 4RCCA 3I35A 5GMKl 1RAEB 1MV0B 1T0HA 2E41A 4J9CA 4QKUA 5IHKA 4PJMA 2O9VA 4KH0B 1E6HA 3C0CA 2EQKA 1W70A 2VVKA 5IH2A 2MCNA 5GANh 2O01E 3ZFJA 4KULA 2E3HA 3OYFA 2JUFA 3EGDB 4J9EA 1VQOA 3VYGA 2XDPA 4A53A 4ZN1A 2EW3A 2GNCA 4LXCA 4PLLA 4AFZC 3NPFA 4E7LA 1NM7A 2E5KA 5M9OA 5IXFA 1TWBA 1TUGB 4BI4A 2KT1A 1WDXA 2JW4A 4NS5A 4NL3A 3QZ9B 2KSSA 3X28B 4M77G 3EG2A 2R58A 1TSFA 1S72A 3HL8A 4LD9K 1RLQC 1QVGS 3P8DA 1VQKT 4RTZA 2FHDA 1O75A 1AWWA 5CIUA 3HFNA 3JV3A 1TG0A 2E1HA 4LUDA 2DO3A 4EMGA 4IUUA 1VUBA 2J05A 2EYWA 1KG1A 4CC2A 3SDZA 1JJ2A 5LJ5f 2EQUA 4C0ZA 1X43A 1Q82U 3VS3A 2YLBA 3TREA 4C92D 2K9GA 5CAIA 3E9FA 1TU0B 1VQMA 4KGZB 1LVKA 2DE0X 4BY6C 3CCJA 1I8FA 3MP8A 2JMAA 2JS2A 4FIBA 4DA4A 1HSQA 4JJDA 4C92B 1NYFA 2PNIA 1AVZC 2LVMA 4OMNA 3QPHA 2DK3A 3LX7A 1R77A 4ZTFA 2LCLA 3VV0A 2A08A 3EFSA 2RHYA 2J6FA 3JCMf 1RI0A 2M02A 4BE2A 1KHIA 3OS0A 3VYHB 2K3BA 1VQ5A 2X3XD 3JCMP 2GGRA 5GAOm 1BK2A 1K8AU 2OTLA 1EIFA 4CC4B 1CKAA 3A5ZB 3VS4A 4XU0A 2WSFE 4QW2A 1D09B 3N5BB 2V1RA 2ZPIB 1PHTA 1BIBA 4L5GA 3E1SA 4DOWA 1RAHB 2IIMA 1UGPB 3NTIA 4A54A 3H0FA 2V8JA 1NLPC 1PWTA 3CCLQ 3TU4K 3PIOA 1JQQA 1OQKA 1VYTA 4HCBA 2QG9B 2ZPGB 2DERA 2EPDA 2K5FA 2JTEA 3RMQA 3RERA 3G6EA 2K7AA 1QW1A 1PKSA 4C0GA 5GAN4 1K73U 3ER0A 4J6XA 3BY7A 2XDBA 1NJIR 4RTVA 2HEQA 1K1ZA 2MWOA 4ELYC 1BCMA 4II1A 1SKUB 1AWOA 3MEWA 3MP6A 3P8HA 1AOJA 3EAEA 1M27C 3MEAA 1WGSA 2E6ZA 1UB4A 3OMGA 3LWHA 4KBMB 2D1XA 5FRMA 5FU7C 4M7AC 4EMKC 1GXIE 2CZ7B 2CH4A 5A0GA 4HKEA 2P0QA 5LJ3g 5CR2A 3GOXA 3CC2Q 2DL4A 1M1KR 2EBPA 2DXCA 4M78F 2BUDA 4BY6B 2BE7D 3OSSC 4XTUA 1HXDA 2NUZA 3INZA 4C92G 2AIRB 4HVWA 2O88A 3A8HB 5FWBA 1VYVA 2O4XB 1HK9A 3DKMA 4C5HA 3CCLT 2QGGA 1UGQB 4M75E 3I56A 4AT1B 4C8QF 1W2BS 1RAGB
chains in the Genus database with same CATH topology
3CC7Q 1M90R 1VQMQ 1VQ4Q 1VQ5Q 2OTJQ 3CCRQ 1Q86R 3I55Q 3CCQQ 3CCJQ 1KC8R 3CCMQ 3G4SQ 1K9MR 3I56Q 1YJ9Q 1QVGP 3CCVQ 3CCUQ 1YI2Q 3G71Q 1Q81R 1Q7YR 1VQNQ 1VQ6Q 1K8AR 1VQ8Q 3CCSQ 2QA4Q 1VQLQ 2OTLQ 1YITQ 3CD6Q 3CCEQ 3CXCP 1YJWQ 1VQPQ 3CMEQ 1NJIR 1JJ2P 3CC2Q 1W2BP 1QVFP 1KD1R 3OW2P 1YHQQ 1YJNQ 3G6EQ 1S72Q 1M1KR 1VQOQ 1N8RR 3CPWP 1YIJQ 1Q82R 2QEXQ 1VQKQ 3CMAQ 1K73R 1KQSP 1VQ9Q 3CCLQ 3CC4Q 1VQ7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CC7 Q;  1M90 R;  1VQM Q;  1VQ4 Q;  1VQ5 Q;  2OTJ Q;  3CCR Q;  1Q86 R;  3I55 Q;  3CCQ Q;  3CCJ Q;  1KC8 R;  3CCM Q;  3G4S Q;  1K9M R;  3I56 Q;  1YJ9 Q;  1QVG P;  3CCV Q;  3CCU Q;  1YI2 Q;  3G71 Q;  1Q81 R;  1Q7Y R;  1VQN Q;  1VQ6 Q;  1K8A R;  1VQ8 Q;  3CCS Q;  2QA4 Q;  1VQL Q;  2OTL Q;  1YIT Q;  3CD6 Q;  3CCE Q;  3CXC P;  1YJW Q;  1VQP Q;  3CME Q;  1NJI R;  1JJ2 P;  3CC2 Q;  1W2B P;  1QVF P;  1KD1 R;  3OW2 P;  1YHQ Q;  1YJN Q;  3G6E Q;  1S72 Q;  1M1K R;  1VQO Q;  1N8R R;  3CPW P;  1YIJ Q;  1Q82 R;  2QEX Q;  1VQK Q;  3CMA Q;  1K73 R;  1KQS P;  1VQ9 Q;  3CCL Q;  3CC4 Q;  1VQ7 Q; 
#chains in the Genus database with same CATH topology
 1JB0 E;  2YRD A;  4XTX A;  1KIK A;  2HSP A;  3CCM Q;  2LT1 A;  3M0R A;  1AHJ B;  4PFO A;  2MOX A;  3VUB A;  2KAF A;  4MDW A;  2QGF B;  2KYB A;  1K9A A;  3CCQ A;  4O5V A;  3CPW P;  2QTX A;  2KEA A;  2BZY A;  2KQW A;  1H3Z A;  1SSF A;  1XOV A;  1ZUK A;  2KR3 A;  3H6Z A;  1KC8 R;  2RQW A;  4XAX B;  3M0T A;  1YJ9 Q;  3F70 A;  4LDU A;  3CC2 T;  4TVR A;  3L2V A;  2FVU A;  5FRO A;  1OV3 A;  3OY9 A;  4PK4 A;  1Q82 C;  1YBY A;  3EH2 A;  3EH1 A;  2QQR A;  2OI3 A;  5KE3 A;  1Q81 U;  1PG5 B;  2HL3 A;  1VQN A;  2L3R A;  3CC4 Q;  1D3B B;  2DFU A;  4M78 D;  2DMO A;  2J7I A;  2QK0 A;  1EX4 A;  2Y4X A;  1WZO A;  3I5S A;  2KBT A;  5HKC A;  1JU5 C;  2ROL A;  2A37 A;  3MKD A;  4QVC A;  1ZSZ B;  3HRS A;  3SFM A;  5FU7 B;  2FB7 A;  2NUP B;  3CD6 Q;  4M7A B;  4PNO A;  2X3W D;  4EMK B;  3URG A;  3OA6 A;  1BI0 A;  1UGV A;  4B9W A;  3DLM A;  3UPU A;  2BKD N;  2HNI A;  3DB4 A;  4ZN3 A;  3FEO A;  2E65 A;  3EG9 A;  5GMK i;  5FW9 A;  3G71 Q;  1WHG A;  4HT9 A;  2EQM A;  1R0B G;  2K57 A;  1G3Y A;  1VIF A;  3GBQ A;  4NOY A;  1MMN A;  2F1L A;  2K5I A;  4Z8A A;  1TH7 A;  5L23 A;  3FDR A;  2DXB A;  2VWF A;  3RKY A;  1JJ2 S;  1N9S A;  4IKF A;  1SSH A;  1WPY A;  5LJ5 h;  1G2B A;  5I2S A;  1VQL T;  3H0H A;  5GAN j;  1OI1 A;  2DL5 A;  1T3L A;  2AZV A;  3PGG A;  3GPL A;  2RPN A;  2RK1 A;  3A1P A;  4FT4 A;  1M8M A;  1YJW Q;  1K73 C;  3OYA A;  2LCC A;  2CYZ B;  4CI0 C;  1M3B A;  1XNI A;  1UEB A;  4MMK A;  3HRU A;  3QBY A;  3JCM h;  5HY6 A;  2E10 A;  2KRN A;  1CKB A;  1PD0 A;  1YIJ A;  4OMF B;  1T0J A;  4N0A A;  1M9S A;  1YIT Q;  3SB2 A;  1ZSG A;  4A63 B;  1X6B A;  1VOM A;  4Z89 A;  4M77 C;  3CXC S;  3RMS A;  5GAM j;  2HMA A;  3G71 T;  1SG5 A;  4PJO F;  1G8X A;  3C12 A;  3FB9 A;  3P8B B;  4L59 A;  1VQK A;  4L6V 5;  2NYS A;  1M3A A;  3CCE Q;  1OX8 A;  4JLI A;  4OB0 B;  1D0Z A;  4M78 G;  2XMF A;  1N8R R;  2FG0 A;  2GQI A;  2MK5 A;  2ECZ A;  4KT0 E;  1Z9Z A;  1OU9 A;  1K0S A;  4M7D A;  1H92 A;  1M2O A;  1GCQ C;  1NE8 A;  1HYO A;  2EJ9 A;  1QVF A;  2A28 A;  2LNH B;  1YJW T;  4LDX A;  2DTH A;  4J8O A;  1WHH A;  4P5N A;  5GAO q;  4PJO A;  2RB6 A;  3V8L A;  1T3S A;  1I81 A;  2PZ1 A;  2RF0 A;  2W0Z A;  5C0M A;  5KYX B;  1XTD A;  1KFZ A;  5A2Q E;  1VQ9 Q;  1FWZ A;  5GAN g;  2X35 A;  2E6N A;  3WVE B;  4JUV A;  5HK0 A;  2L3Q A;  3G4S Q;  3LGL A;  2CDT A;  1Y0M A;  1I5O B;  2RH2 A;  4F7U F;  3L2W A;  3AHU A;  3LGF A;  2H8H A;  1LNX A;  1VQ6 Q;  4M77 A;  4GY5 A;  5KCO A;  2QA4 Q;  4J83 A;  2EIF A;  4ANJ A;  1FYN A;  3L42 A;  2XD0 A;  2EKO A;  4CRI A;  2DD4 A;  1Q81 C;  1OYX A;  2JS0 A;  2JZ2 A;  2ZAE A;  4Q5W A;  1K9M R;  4ZGJ B;  3CCE T;  3ZL7 C;  2DKG A;  4LE9 A;  1MUZ A;  4A4F A;  1JO8 A;  3WXM B;  5IHI A;  4FYX B;  1BKB A;  1FMW A;  4DBQ A;  3UDC A;  5KYU B;  2HDA A;  3LYI A;  2ZPE B;  1AZE A;  1EFN A;  5GAM g;  1QMC A;  5ECA A;  4C5E A;  2ED1 A;  2AZS A;  3EGX A;  2B86 A;  3CMA Q;  3JB9 H;  1QKX A;  2M0Y A;  2PVD B;  4WTO B;  4M77 B;  1U5S A;  2L0A A;  4PLI A;  2VXF A;  4QQD A;  1WXT A;  3J81 E;  3CCS T;  4M78 E;  4DBH A;  3OYD A;  8AT1 B;  3HPW A;  2OTJ A;  1VQ9 T;  2CP6 A;  3VRY A;  4J9B A;  1KD1 R;  1SHF A;  4ELZ C;  1TUD A;  2QQA A;  1YCS B;  4C5I A;  1U1S A;  5GMK e;  1TS9 A;  4JZ3 A;  2RJC A;  5LL6 S;  3RKX A;  4F14 A;  2A0F B;  4FW2 A;  1Q7Y C;  2LQK A;  2QA4 T;  1MV3 A;  2DXT A;  4JS5 A;  1AT1 B;  1OZ2 A;  2KYM A;  5I21 A;  2RO0 A;  2X51 A;  1K8A R;  4C8Q E;  3WVD B;  4HCK A;  2QQB A;  2GFA A;  1WQ7 A;  1U06 A;  4QVZ A;  3EGD A;  2VC8 A;  2QQS A;  1D0Y A;  3L2U A;  2SRC A;  3CCR T;  4C92 C;  4FYY B;  3MET A;  2M0O A;  2YUN A;  3NTK A;  3FRN A;  2FPE A;  3M59 A;  3JB9 F;  2EFI A;  2LQW A;  4M75 D;  4KH1 B;  3CCL A;  1QKW A;  1AD5 A;  1OEB A;  2F5K A;  1BB9 A;  2EYZ A;  3CMA T;  3CME Q;  2VGN A;  3GNF B;  1WJR A;  2R5M A;  2RQT A;  3M57 A;  2WAC A;  3C95 A;  5GAO r;  4Y92 A;  2FYK A;  2JXB A;  3M4Y A;  2QEX A;  3BW1 A;  4IUT A;  2GTJ A;  3JCM V;  2PUO B;  1YJN T;  4JJB A;  3GP8 A;  1M90 U;  3VRZ A;  1Q86 U;  1D1C A;  3CC7 T;  3TVT A;  1SRL A;  2J6O A;  1RAI B;  3Q1J A;  5A0D A;  4QQG A;  1G83 A;  2D0Q B;  3I55 Q;  1UFF A;  4BI8 B;  1JRI A;  2MMP A;  1ABQ A;  4C92 A;  1YHQ T;  1WI7 A;  4J6W A;  4KGV B;  4LN2 A;  2CH4 W;  3JB9 J;  1GCP A;  4A4E A;  2ZGW A;  1JXO A;  1W6X A;  3QKJ A;  3HRT A;  2DF6 A;  4MZP A;  1WX6 A;  2DD5 A;  4OMP A;  4JJC A;  1Y96 B;  3OBW A;  2MWP A;  4JJN K;  3UT1 A;  3VJP A;  3JB9 D;  4EIK A;  2GF7 A;  1B07 A;  1WXB A;  1R0C B;  1LPL A;  4M4Z A;  3OW2 P;  1RAF B;  2CT3 A;  2XU8 A;  4LD6 A;  4C5G A;  5LJ3 j;  4IUQ A;  4BD3 A;  1VQ8 Q;  2V8I A;  2DEU A;  5C6S A;  5LJ5 j;  2WSC E;  2RD1 A;  1NZ9 A;  1XQH A;  2K3X A;  4FYW B;  4F7U G;  4RKU E;  1MMD A;  4KRT A;  3QXE B;  3M54 A;  2D8H A;  2F2V A;  2J6K A;  2PQW A;  5GMK h;  2DIQ A;  4QQ6 A;  3I55 T;  2R5A A;  1QVF S;  2V1Q A;  1VQL A;  2X4W A;  4F16 A;  1VQ4 Q;  5CVI A;  1LOJ A;  1OU8 A;  4M75 G;  1IB8 A;  1NPP A;  1Y7X A;  1SEM A;  3JB9 I;  1FMV A;  4J9G A;  4OML A;  1NLO C;  2JJ9 A;  2I2L A;  4PJO E;  4FL6 A;  4HVU A;  3I5R A;  5KCH A;  3M9Q A;  1X01 A;  3G1J A;  1QCF A;  2KVQ G;  2ZCF B;  2XIC A;  1BCO A;  3HFO A;  2X9H A;  3REA B;  2KRS A;  4V2S A;  3LH0 A;  1QP2 A;  4BDY A;  4XTV A;  3DLL A;  1VQ8 T;  3X26 B;  3JCM X;  2GQV A;  1B7T A;  3PVL A;  4E7I A;  4Y28 E;  2EQJ A;  5DLO A;  4B9X A;  1WHM A;  1C6V X;  2O4X A;  1GL5 A;  2NWM A;  2QXF A;  1KQS S;  1ZSZ C;  4JS4 A;  3TEE A;  1IO6 A;  4JLG A;  2KI7 A;  4AFS C;  3PMT A;  4M78 C;  5GAN 5;  2YWW A;  2OAW A;  1O9S A;  1MGQ A;  4OMO A;  3PT9 A;  1MND A;  1VQ4 T;  1BI2 A;  2CT4 A;  2DVE A;  1VQO Q;  3JRZ A;  5LJ5 g;  4F7U E;  2EVR A;  2RA2 A;  4XU1 A;  2DYB A;  1U8R A;  1QVG P;  3JB9 G;  2RI2 A;  3ZEH A;  4J9I A;  4RTT A;  4X34 A;  2K6D A;  2RHZ A;  2CRE A;  4C8Q C;  1N8R C;  1ARK A;  1UDL A;  4J9H A;  2HL5 C;  1WJS A;  2YXY A;  3M56 A;  2JVV A;  1S72 Q;  1M90 C;  1Q86 C;  2COW A;  4XK8 E;  2DPP B;  3A8G B;  4NL2 A;  2CSI A;  3RKW A;  4PL6 A;  3JCM g;  2H3J A;  2H3E B;  1YNZ A;  3M58 A;  3HHT B;  4EMH A;  3U23 A;  2Y90 A;  4HT8 A;  1KK7 A;  1D3B A;  1VQ7 A;  2VGM A;  2DET A;  2KK4 A;  4MZM A;  1M5Q 1;  1QLY A;  2DZC A;  3CQT A;  2RNA A;  4J6Y A;  1ZSZ A;  1M30 A;  3H8Z A;  2M1H A;  1KQ2 A;  2YUO A;  2NUP A;  5DM7 R;  4M7A A;  1VQM Q;  4EMK A;  3CCJ Q;  2C06 A;  3BE3 A;  3SHW A;  2A7Y A;  2CGH A;  1ZA2 B;  1BYM A;  1VQO T;  4OGC A;  4DEX A;  3FC3 A;  5AYF A;  3BFM A;  1X2Q A;  2FEI A;  5KH6 A;  4IUV A;  1A0N B;  4JRI A;  5FU6 B;  1BI3 A;  3CCS A;  1VQ5 Q;  3OYE A;  3CBM A;  1K76 A;  1IHV A;  3NTH A;  2MIO A;  2QYZ A;  4BAC A;  2OTL Q;  2RMO A;  3C4S A;  4M78 B;  1IHW A;  2C0O A;  2JN0 A;  1WHK A;  2YRV A;  1YI2 A;  1C0M A;  3HSB A;  3CCM T;  2QAZ A;  3KFV A;  4C8Q D;  3S6W A;  2DZ9 A;  1DJ7 B;  3V7C A;  2RN8 A;  3KBG A;  5D7U A;  2KRO A;  3EFO B;  5GAN d;  3CCR A;  1JBM A;  2BZX A;  4C8Q B;  1GRI A;  4OMQ A;  3OYI A;  2XKO C;  5J3B A;  1Q7Y U;  1YJ9 T;  4D8K A;  3LWI A;  2HSE B;  2QI2 A;  2EYX A;  1VQP A;  2ROT A;  3JAM E;  1B3Q A;  2D8J A;  1UE9 A;  2O9S A;  2DLP A;  3NGP A;  3M5A A;  4JRP A;  4BB7 A;  1ZUY A;  3HKS A;  4PJJ A;  3CC4 T;  1VQ5 T;  4ME7 A;  3RR6 A;  1S1N A;  3EG1 A;  4JDS A;  3SD4 A;  1SPK A;  1G3W A;  5GAM d;  2OTL T;  1M1K U;  1YJN A;  2AKL A;  3CD6 T;  1UEC A;  3CCU Q;  3CEY A;  5GAN 8;  2XI9 A;  2K5L A;  1IRE B;  3CC7 A;  4C0F A;  1W2B P;  3QJY A;  3MEV A;  1WA7 A;  4M7D F;  3C94 A;  4R55 A;  3TSZ A;  2YUQ A;  5GAM f;  2KRM A;  4IUR A;  4OP0 A;  1CSK A;  4HCZ A;  4RG2 A;  2FZG B;  2EGA A;  1YHQ A;  5KYX A;  3I56 Q;  3VS2 A;  1B34 A;  1QCO A;  2E4H A;  1I07 A;  2ESW A;  3A8L B;  3UA6 A;  2DVJ A;  2RHI A;  3ASK A;  3HP9 A;  1M2V B;  2C0I A;  3E19 A;  2RM4 A;  2C0T A;  1U3O A;  3QYH B;  3MHX A;  4M77 F;  3QO3 A;  3CCQ Q;  3LW5 E;  1F1B B;  1WHL A;  3THK A;  2VXE A;  3CPW A;  4LNP A;  5CKH A;  3JCM c;  4B6M A;  2YDL A;  5CKE A;  3A8O B;  5J26 A;  1FMK A;  1KC8 U;  3VKI A;  2AT1 B;  5GAN 6;  1RAA B;  4AFQ C;  3MPU B;  2LTO A;  4OB1 B;  5EC7 A;  1D0X A;  4C8Q G;  1B34 B;  3OYG A;  5KYU A;  3CCU T;  4GLM A;  1X69 A;  4FSX A;  2FPF A;  3OYH A;  5DY9 A;  4E7H A;  1PSF A;  2SEM A;  4FSS A;  1AZG B;  1YIT T;  5GAN e;  1E7O A;  4OVA A;  2YUP A;  1PRM C;  1VQN Q;  2KXD A;  1ZBX A;  4XTY A;  2KXC A;  3R6O A;  1MHN A;  5KYN A;  2LMJ A;  5CKD A;  3H0I A;  3OBY A;  4M75 C;  2VV5 A;  2DIL A;  4ZTJ A;  2RJF A;  2LCS A;  4M7D D;  2JOY A;  3I56 T;  1AWJ A;  2NUT B;  2I0N A;  4J5Y A;  1SF9 A;  2CP3 A;  3JSC A;  3GLX A;  5FLX E;  1WJQ A;  3L2Z A;  3OYM A;  1OUL A;  1QVP A;  3CCV Q;  2RQV A;  2Y4Y A;  4PJO D;  2IG0 A;  4OB2 B;  5IT9 E;  4ORZ A;  3A98 A;  2CP7 A;  3M53 A;  2DL7 A;  4AFU C;  1I5L A;  1JJ2 P;  2VKN A;  1GCQ A;  2JT4 A;  3EG0 A;  2HQH A;  1Q82 R;  1PC0 A;  3CCQ T;  2VAS A;  4N4G A;  2ENM A;  3CBO A;  5GAM e;  2KMT A;  4XTW A;  4OB3 B;  1H3H A;  1H64 1;  1P92 A;  2ZPH B;  3VS7 A;  4IIM A;  2EAY A;  2FO0 A;  1X6O A;  2DJQ A;  4J9D A;  2OJ2 A;  1GBQ A;  1PD1 A;  1M4Z A;  2CKK A;  4HA8 A;  4DEY A;  2XHC A;  4EPC A;  5GAN 7;  4RTX A;  2VB6 A;  2HBP A;  2LC4 A;  3M0P A;  3G4S T;  4LDW A;  2P4R A;  2Z0W A;  2FL7 A;  1VQN T;  1JXM A;  1HD3 A;  1X27 A;  1VQ6 T;  2MAM A;  1AWX A;  5KE2 A;  4DQ2 A;  1NJI C;  2PVG B;  2B8A A;  1LCK A;  4M75 A;  2DXU A;  3CXC P;  1N27 A;  2ZPB B;  3SWN B;  4Z88 A;  1TXQ A;  2O2O A;  1YIJ Q;  3FJ5 A;  4E7Z A;  3CCV T;  5CO7 A;  2L5Q A;  8ATC B;  1G3T A;  1W4S A;  1NYG A;  1W2B A;  4F7U B;  5EG2 A;  1I0C A;  2L2P A;  2LQ8 A;  3VS5 A;  5CQX A;  1H8K A;  1M1K C;  1FX7 A;  5CCA A;  3DB3 A;  3L2R A;  1ZBJ A;  4KGX B;  2OAU A;  5IN1 A;  3GF5 A;  3EG3 A;  2LJ0 A;  1VA7 A;  1XJW B;  3BDL A;  5CKB A;  3ULR B;  1X2K A;  1VQK Q;  1PNJ A;  1K73 R;  5CQY A;  3D7S B;  4CC3 A;  2L8D A;  2PUK B;  4M75 B;  2L3S A;  1ZQ1 A;  4C92 F;  2DIG A;  1BIA A;  4RTY A;  5CKF A;  2DTO A;  1N8R U;  1R8O B;  2DYI A;  5AT1 B;  4BE0 A;  3NHN A;  1Y96 A;  1PRL C;  5GAN 3;  4FW1 A;  4ESR A;  4M7D G;  4XQ3 A;  1V1C A;  1YCY A;  2DBM A;  2DAQ A;  3HTR A;  4PJO G;  3CC2 A;  4RCB A;  2MYS A;  3PNW C;  5KYW B;  4AG2 C;  1VYU A;  1YIJ T;  1OPK A;  4R0K A;  3ME9 A;  1M1F A;  2DL3 A;  2M51 A;  2JM8 A;  2VYT A;  1YWP A;  4HVV A;  4K11 A;  2COY A;  3QWX X;  1M1G A;  2LT4 A;  4E2F B;  2GFU A;  3H41 A;  1KC8 C;  2F2W A;  2DL8 A;  3EFR A;  2DM1 A;  2AHJ B;  4XU3 A;  1QWE A;  3QYG B;  5LJ3 d;  1SHG A;  5L8R E;  1Q95 G;  3V7R A;  1BBZ A;  3CME T;  1NEG A;  5LJ5 d;  4LDV A;  3T9N A;  4AMC A;  4X9C A;  1K9M U;  3CCM A;  5GAM h;  2CS7 A;  5LJ3 f;  1KSW A;  5D6Y A;  2CZ1 B;  4WCI A;  5J39 A;  4GLK A;  2V26 A;  4ZGD B;  3UWN A;  2DTI A;  4O6J A;  3OYB A;  2DX1 A;  4DBF A;  9ATC B;  4DBR A;  4MZT A;  3JCM d;  4QT7 A;  1I1J A;  1YJ9 A;  1RAB B;  4CC7 A;  3RBB B;  2F2X A;  2FZC B;  3RNJ A;  1OX9 A;  2GTO A;  1AEY A;  2HZY A;  2KE9 A;  2OTJ Q;  4IUP A;  3CPW S;  1D1A A;  2EJG A;  1KD1 U;  2DJZ A;  5KYY A;  1Q81 R;  2PU9 B;  4M7D E;  3CPF A;  2FZK B;  3CC4 A;  5DLQ E;  3MCA B;  4YTL A;  1X75 C;  5GAO n;  4FU6 A;  1NG2 A;  2KY9 A;  2AKK A;  2K2M A;  4PKC C;  2YSQ A;  4PJL A;  2E64 A;  3S3N A;  3PVQ A;  2CUD A;  3L1A A;  2CUB A;  1ZHI A;  2A36 A;  2EJF A;  2JMC A;  3CXC A;  3CD6 A;  2LX7 A;  2JM9 A;  1MMA A;  1YN8 A;  1PCX A;  3OYK A;  3V8J A;  4MDX A;  3NMZ C;  3EGU A;  4J7F A;  1UGR B;  3JCM W;  2MPX C;  2DA9 A;  4X1V A;  4M77 E;  2DEQ A;  5FU6 C;  3L2Q A;  3G71 A;  1GFD A;  5GJV B;  2LRQ A;  5KYY B;  4RTU A;  2DRM A;  1C1A A;  3RIR A;  1N9R A;  3J7A F;  1Q7Y R;  1BI1 A;  3QZ5 B;  1NBE B;  2EKH A;  1UTI A;  1WQW A;  4FM4 B;  2EYY A;  5GAO p;  6AT1 B;  2LJ3 A;  4R56 A;  2QDL A;  2OTJ T;  2O31 A;  2QEX Q;  2MF2 A;  1WFW A;  2HCK A;  2OX7 A;  3RES A;  3G7Z A;  3QDR B;  5LJ3 e;  2ATC B;  1KJW A;  1YJW A;  5LJ5 e;  4X9D A;  2V8K A;  2RJD A;  1TTH B;  4FT2 A;  1OPL A;  1ZUU A;  2EQI A;  3OMC A;  4BDZ A;  4M7A F;  2RHX A;  3CCU A;  1NPR A;  3GIB A;  5FRN A;  4XTZ A;  1UG1 A;  2HQX A;  1PM3 A;  5HCK A;  3UAT A;  1YIT A;  1V76 A;  4OF1 A;  1YWO A;  3S3M A;  3M55 A;  3PE0 A;  4BUG A;  3JCM e;  2M16 A;  4BE1 A;  4F04 B;  1QQJ A;  1ABO A;  1D1B A;  4E7J A;  1UJ0 A;  2CZ6 B;  1W1F A;  2NLU A;  2BIV A;  1Y07 A;  2KGT A;  3VUZ A;  3FJP A;  4FCY A;  3CCE A;  4M78 A;  3V8K A;  1UUE A;  1X6G A;  3AT1 B;  3REB B;  7AT1 B;  3OW2 A;  2CP2 A;  2FRY A;  3OYJ A;  3KUF A;  2E5Q A;  3X20 B;  1WYX A;  4LDY A;  2LJ1 A;  2QEX T;  1QVF P;  2P84 A;  2X4Y A;  1RLP C;  4F17 A;  1IGQ A;  1KQ1 A;  1J3T A;  3EFO A;  3CBP A;  1K9M C;  4FYV B;  3M4G A;  2G3R A;  3EHQ A;  1MNE A;  5HK3 A;  4C8Q A;  4JPB W;  2D6F A;  1VQ9 A;  4JRK A;  1RL2 A;  1VQL Q;  1S72 T;  2JNG A;  3BDU A;  3G4S A;  3GNG A;  3TCJ A;  4M7A D;  2K79 A;  1VQ6 A;  2XG8 D;  2E70 A;  2QA4 A;  2HKN A;  2A3L A;  4C0D C;  3JCM b;  1QCN A;  3VS6 A;  2YT6 A;  3OB9 A;  3OS1 A;  2HKQ B;  4Z02 A;  2AK5 A;  4GBQ A;  1PSE A;  1KD1 C;  3UF4 A;  1JEG A;  4AG1 C;  3JCM J;  2QTV A;  2L3P A;  2P0K A;  4KUD K;  2ED0 A;  1MMG A;  2RQR A;  2HAX A;  2R57 A;  2LDM A;  4C92 E;  3G6E Q;  3OS2 A;  3CCV A;  3M0U A;  1VQM T;  4N0A C;  2DRK A;  3PTA A;  1N6A A;  1GBR A;  1KQS P;  3CCJ T;  2GCX A;  4Y91 A;  3NFC A;  1NJI U;  4A4H A;  2RHU A;  1K8A C;  1RAD B;  3VU3 C;  2CP5 A;  1TOV A;  5CK9 A;  4IIO A;  2XID A;  5GJW B;  5GAN f;  1TUC A;  3CMA A;  5IAY A;  3J80 E;  5GMK m;  2HQE A;  1SRM A;  4E7S A;  1IGU A;  5LJ3 h;  2D9T A;  2EYQ A;  2QQ9 A;  5I22 A;  1WIE A;  2M9U A;  2L89 A;  2X4X A;  1QP3 A;  5D6X A;  4PFP A;  2F69 A;  2KDS A;  2PTK A;  2BTT A;  2DBK A;  1M2V A;  1OZ3 A;  3TSW A;  5GAN 2;  2RK2 A;  3UA7 A;  4M7D C;  3E2U A;  3X25 B;  3OYL A;  4N4I A;  3QJ6 A;  2P4T A;  3QHS A;  4RTW A;  1ZLM A;  3EG9 B;  4N4H A;  2EGE A;  4PJO C;  1QVG A;  1UGS B;  5GAO l;  4ZNX A;  1Y57 A;  3M0Q A;  2YRC A;  4D8D A;  1K0X A;  3A8M B;  2RQU A;  1KHC A;  2KNB B;  1HJD A;  1YP5 A;  1RUW A;  1M3C A;  2CSQ A;  2ABL A;  3G6E T;  2YHT A;  3QSU A;  3QII A;  3OYY A;  1Z9Q A;  1ACM B;  1ZA1 B;  2G6F X;  2RJE A;  3VS0 A;  4PJN A;  1VQ7 Q;  2JTM A;  3CME A;  2ZPF B;  3VS1 A;  4C0D B;  3SEM A;  1IZ6 A;  3V7S A;  4E7K A;  3RUX A;  2LZ6 B;  3FLG A;  2NUT A;  3OYN A;  3QDF A;  3SWN C;  5I11 A;  2YLC A;  2JTF A;  4M7A G;  5I2M A;  4BI3 A;  2CP0 A;  3ZBD A;  1IRX A;  1NEB A;  5GMK j;  1K4U S;  1IXD A;  3MJX A;  1BU1 A;  1M90 R;  4J7I A;  1OOT A;  3OS5 A;  3O5Z A;  1Q86 R;  3MEU A;  1VIE A;  3M0S A;  4PFZ A;  2EWN A;  3H9N A;  1WNL A;  2J06 A;  3TQ7 P;  3CCS Q;  5IXB A;  3I55 A;  2BZ8 A;  4WF2 A;  3E9G A;  2QAS A;  3JCM Q;  2WSE E;  3I9Q A;  2COZ A;  1PKT A;  3QG1 A;  2BE9 B;  3FIF A;  3LLR A;  4D6W A;  3X24 B;  3RDV A;  1RI9 A;  2HBW A;  4OGE A;  1YI2 Q;  4RMO A;  1G3S A;  3LH5 A;  3PMI A;  1GFC A;  3S3O A;  4M7D B;  2FRW A;  1VQ7 T;  3QUI A;  2LQN A;  2MI6 A;  2HD0 A;  1G5V A;  2RI3 A;  4PJO B;  3CCR Q;  4M75 F;  3SWN A;  2K3Y A;  4A4K A;  3MP1 A;  4JZ4 A;  4M77 D;  2IVW A;  4RUG A;  1KQS A;  1UHC A;  1LJO A;  1VQ8 A;  2LNV A;  4F7U A;  1VQP Q;  2DNU A;  2D0N A;  3OSV A;  2LP5 A;  1I4K 1;  4MML A;  2KT8 A;  4OMM A;  3OW2 S;  3QWY A;  4XU2 A;  1EZZ B;  2IPO B;  4ATO A;  2K4Y A;  3IQL A;  1RAC B;  3R6N A;  4M7A E;  2FPD A;  3EHR A;  5IHN A;  4VUB A;  1E6G A;  1WLP B;  2E12 A;  1VQ4 A;  4E47 A;  3O8V A;  1Y71 A;  2E3I A;  2PVO B;  5A0L A;  2RI5 A;  2XK0 A;  3KXT A;  1YJN Q;  2F5T X;  4KUI A;  4ZGE B;  5FWC A;  1FXX A;  3PIP A;  4EDU A;  2ZZD A;  1YI2 T;  3CC7 Q;  5D6W A;  4QVD A;  1ZX6 A;  4RG8 A;  3EGX B;  1UJY A;  2XDD A;  2W10 A;  4HCC A;  1UHF A;  1WHJ A;  1YFN A;  1N5Z A;  2EGC A;  1WXU A;  2LX9 A;  3MO8 A;  4HXJ A;  1YHQ Q;  2QDY B;  2P0P A;  1M8V A;  1U1T A;  3PFS A;  5KYW A;  2K2V A;  1QWF A;  4LUE A;  1V29 B;  4J9F A;  4DOV A;  2GBQ A;  2VUB A;  4A4G A;  4E6R A;  1VQP T;  3OQ5 A;  4UC4 A;  3OYC A;  2CZ0 B;  4JRQ A;  2X4J A;  4RCC A;  3I35 A;  5GMK l;  1RAE B;  1MV0 B;  1T0H A;  2E41 A;  4J9C A;  4QKU A;  5IHK A;  4PJM A;  2O9V A;  4KH0 B;  1E6H A;  3C0C A;  2EQK A;  1W70 A;  2VVK A;  5IH2 A;  2MCN A;  5GAN h;  2O01 E;  3ZFJ A;  4KUL A;  2E3H A;  3OYF A;  2JUF A;  3EGD B;  4J9E A;  1VQO A;  3VYG A;  2XDP A;  4A53 A;  4ZN1 A;  2EW3 A;  2GNC A;  4LXC A;  4PLL A;  4AFZ C;  3NPF A;  4E7L A;  1NM7 A;  2E5K A;  5M9O A;  5IXF A;  1TWB A;  1TUG B;  4BI4 A;  2KT1 A;  1WDX A;  2JW4 A;  4NS5 A;  4NL3 A;  3QZ9 B;  2KSS A;  3X28 B;  4M77 G;  3EG2 A;  2R58 A;  1TSF A;  1S72 A;  3HL8 A;  4LD9 K;  1RLQ C;  1QVG S;  3P8D A;  1VQK T;  4RTZ A;  2FHD A;  1O75 A;  1AWW A;  5CIU A;  3HFN A;  3JV3 A;  1TG0 A;  2E1H A;  4LUD A;  2DO3 A;  4EMG A;  4IUU A;  1VUB A;  2J05 A;  2EYW A;  1KG1 A;  4CC2 A;  3SDZ A;  1JJ2 A;  5LJ5 f;  2EQU A;  4C0Z A;  1X43 A;  1Q82 U;  3VS3 A;  2YLB A;  3TRE A;  4C92 D;  2K9G A;  5CAI A;  3E9F A;  1TU0 B;  1VQM A;  4KGZ B;  1LVK A;  2DE0 X;  4BY6 C;  3CCJ A;  1I8F A;  3MP8 A;  2JMA A;  2JS2 A;  4FIB A;  4DA4 A;  1HSQ A;  4JJD A;  4C92 B;  1NYF A;  2PNI A;  1AVZ C;  2LVM A;  4OMN A;  3QPH A;  2DK3 A;  3LX7 A;  1R77 A;  4ZTF A;  2LCL A;  3VV0 A;  2A08 A;  3EFS A;  2RHY A;  2J6F A;  3JCM f;  1RI0 A;  2M02 A;  4BE2 A;  1KHI A;  3OS0 A;  3VYH B;  2K3B A;  1VQ5 A;  2X3X D;  3JCM P;  2GGR A;  5GAO m;  1BK2 A;  1K8A U;  2OTL A;  1EIF A;  4CC4 B;  1CKA A;  3A5Z B;  3VS4 A;  4XU0 A;  2WSF E;  4QW2 A;  1D09 B;  3N5B B;  2V1R A;  2ZPI B;  1PHT A;  1BIB A;  4L5G A;  3E1S A;  4DOW A;  1RAH B;  2IIM A;  1UGP B;  3NTI A;  4A54 A;  3H0F A;  2V8J A;  1NLP C;  1PWT A;  3CCL Q;  3TU4 K;  3PIO A;  1JQQ A;  1OQK A;  1VYT A;  4HCB A;  2QG9 B;  2ZPG B;  2DER A;  2EPD A;  2K5F A;  2JTE A;  3RMQ A;  3RER A;  3G6E A;  2K7A A;  1QW1 A;  1PKS A;  4C0G A;  5GAN 4;  1K73 U;  3ER0 A;  4J6X A;  3BY7 A;  2XDB A;  1NJI R;  4RTV A;  2HEQ A;  1K1Z A;  2MWO A;  4ELY C;  1BCM A;  4II1 A;  1SKU B;  1AWO A;  3MEW A;  3MP6 A;  3P8H A;  1AOJ A;  3EAE A;  1M27 C;  3MEA A;  1WGS A;  2E6Z A;  1UB4 A;  3OMG A;  3LWH A;  4KBM B;  2D1X A;  5FRM A;  5FU7 C;  4M7A C;  4EMK C;  1GXI E;  2CZ7 B;  2CH4 A;  5A0G A;  4HKE A;  2P0Q A;  5LJ3 g;  5CR2 A;  3GOX A;  3CC2 Q;  2DL4 A;  1M1K R;  2EBP A;  2DXC A;  4M78 F;  2BUD A;  4BY6 B;  2BE7 D;  3OSS C;  4XTU A;  1HXD A;  2NUZ A;  3INZ A;  4C92 G;  2AIR B;  4HVW A;  2O88 A;  3A8H B;  5FWB A;  1VYV A;  2O4X B;  1HK9 A;  3DKM A;  4C5H A;  3CCL T;  2QGG A;  1UGQ B;  4M75 E;  3I56 A;  4AT1 B;  4C8Q F;  1W2B S;  1RAG B; 
#chains in the Genus database with same CATH homology
 3CC7 Q;  1M90 R;  1VQM Q;  1VQ4 Q;  1VQ5 Q;  2OTJ Q;  3CCR Q;  1Q86 R;  3I55 Q;  3CCQ Q;  3CCJ Q;  1KC8 R;  3CCM Q;  3G4S Q;  1K9M R;  3I56 Q;  1YJ9 Q;  1QVG P;  3CCV Q;  3CCU Q;  1YI2 Q;  3G71 Q;  1Q81 R;  1Q7Y R;  1VQN Q;  1VQ6 Q;  1K8A R;  1VQ8 Q;  3CCS Q;  2QA4 Q;  1VQL Q;  2OTL Q;  1YIT Q;  3CD6 Q;  3CCE Q;  3CXC P;  1YJW Q;  1VQP Q;  3CME Q;  1NJI R;  1JJ2 P;  3CC2 Q;  1W2B P;  1QVF P;  1KD1 R;  3OW2 P;  1YHQ Q;  1YJN Q;  3G6E Q;  1S72 Q;  1M1K R;  1VQO Q;  1N8R R;  3CPW P;  1YIJ Q;  1Q82 R;  2QEX Q;  1VQK Q;  3CMA Q;  1K73 R;  1KQS P;  1VQ9 Q;  3CCL Q;  3CC4 Q;  1VQ7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...