2DLPA

Solution structure of the sh3 domain of human kiaa1783 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
85
structure length
85
Chain Sequence
GSSGSSGSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human KIAA1783 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords KIAA1783 protein
total genus 6
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dlpA00
3NPFA 1WIEA 3NMZC 2F2WA 1KIKA 1B07A 3EHRA 4HVVA 3O5ZA 2DMOA 3I9QA 2EYYA 3EG2A 3VS4A 4KRTA 2JS2A 2O31A 2DL3A 1ZUYA 2VKNA 2C0IA 2FG0A 2DVJA 2L3QA 3M0SA 2CT4A 2EW3A 1I07A 2CREA 3I5RA 2KBTA 1G83A 3M0TA 1VYVA 2BTTA 1ABQA 2GTOA 3VRYA 2KEAA 5IH2A 2EBPA 2X3XD 2O9SA 1X2KA 2J05A 1YCSB 4OMPA 4CC2A 1OPKA 5IHKA 2EVRA 5FW9A 1S1NA 2PNIA 4FSSA 1U06A 1EFNA 1PKTA 2JMCA 1G2BA 1RLQC 1X2QA 4F14A 1ZUKA 2P4RA 4RTZA 5HCKA 2FRWA 2YUPA 1GBQA 2DM1A 5GJVB 1J3TA 2M51A 2L3PA 2X3WD 1WXBA 3TSWA 1SHGA 1SSHA 2RQVA 5L23A 2GGRA 4ESRA 2DE0X 1ZBJA 4Z88A 2LJ1A 4GBQA 2EGEA 2YUNA 2CT3A 2F2XA 1JXMA 2D8HA 1W1FA 1AWWA 2MIOA 4JZ3A 2LQWA 4D8KA 2YUOA 1HJDA 1PKSA 2E5KA 4HVWA 2DBMA 1M27C 2EYZA 1UHCA 2CUDA 4M4ZA 2JT4A 2KE9A 4A63B 5IXBA 3H0FA 1TUDA 1AWOA 2KYBA 1WI7A 1HD3A 1QKXA 1WFWA 2K9GA 1YWOA 1JXOA 1X6GA 2F2VA 3SHWA 2HCKA 1ZUUA 1U5SA 1NG2A 4HXJA 2JTEA 2KRSA 3LH5A 1WXTA 1I1JA 2VWFA 4ZNXA 1U3OA 1GFCA 1NEBA 5FWBA 1N5ZA 4J9IA 2KROA 2NUZA 1OOTA 3NGPA 2HSPA 4J9DA 4RTVA 2DA9A 2JMAA 2OI3A 4J9GA 4RTTA 4LN2A 2DRKA 2GQIA 1GCQA 5GJWB 1PRLC 4AFQC 1W70A 2DF6A 2I0NA 1JU5C 2ECZA 3REBB 4AG1C 1AZEA 1XOVA 3EHQA 2KRMA 3QWYA 3M0RA 2XMFA 4J9CA 1NM7A 1PNJA 2KR3A 1CKAA 5EC7A 3NHNA 2AZVA 2LJ3A 1Z9ZA 2DILA 4JJBA 2DRMA 2KNBB 4K11A 1UDLA 1UGVA 1YWPA 1WXUA 2LZ6B 4F17A 3TVTA 2BZXA 1TUCA 2ENMA 3I5SA 2AK5A 2FPEA 2SRCA 3THKA 2HEQA 1X43A 3EG0A 2J6OA 3FJ5A 3RNJA 1NYGA 1M8MA 2RQRA 4AG2C 1PRMC 2W10A 2FEIA 2IIMA 3R6NA 2YDLA 1GFDA 4RTUA 1K0SA 5ECAA 2D0NA 3VS1A 3JV3A 2JXBA 3VS7A 4JZ4A 1ZX6A 1I0CA 4OMNA 1WX6A 2DBKA 2KT8A 1M30A 2EYWA 1UTIA 1PHTA 3EGUA 4AFZC 3H0IA 4R0KA 1ZLMA 4DEXA 1T3SA 2K3BA 1AEYA 3M0UA 2A37A 2DL8A 1H92A 2H8HA 1FMKA 2SEMA 1JEGA 1M3CA 5FWCA 2VVKA 2CSQA 3VS3A 1KJWA 2KT1A 4LUEA 2K2MA 3EG1A 2HDAA 4JJCA 2C0TA 1JO8A 2DNUA 2RF0A 4EIKA 4CC3A 1K1ZA 3UA7A 1X69A 2LNHB 1NLOC 2G6FX 1VYTA 2W0ZA 3VS0A 2YSQA 3VRZA 1SRLA 5IHIA 2KXCA 1RLPC 2LQNA 1BK2A 3H0HA 1E6HA 2J06A 1MV3A 2LCSA 1VA7A 4Z89A 1UG1A 2M0YA 1BBZA 1T0JA 5I22A 3CQTA 2RQUA 2ROTA 3H41A 1FYNA 1HSQA 4X1VA 3U23A 3ULRB 3UA6A 4J9HA 1B3QA 4IIMA 2C0OA 1WYXA 2HBWA 2O9VA 4CC4B 1X6BA 2RPNA 1QCFA 2CH4W 4AFSC 3ZL7C 2L0AA 1GCQC 2YUQA 1YP5A 2GNCA 1K76A 3UATA 2J6KA 2EGCA 4QT7A 2RQTA 2NWMA 3KFVA 2A28A 2EQIA 2OAWA 4J9EA 2JM9A 2AZSA 2CDTA 1AWJA 2ABLA 1YNZA 2PTKA 3PVQA 1AWXA 1QKWA 3EG3A 4OMOA 1IO6A 1QWFA 2DYBA 3I35A 2OJ2A 3M0PA 1OV3A 1Z9QA 1SPKA 1GBRA 1Y0MA 3VS2A 2K7AA 2RNAA 3VS5A 1GRIA 4OMLA 1UHFA 2JW4A 1K4US 2V1QA 3PVLA 2LJ0A 2JM8A 2MCNA 1UJ0A 2FPFA 3SEMA 2BZ8A 2B86A 3UF4A 4RTXA 4E6RA 1H8KA 4LUDA 2LMJA 2FPDA 4J9FA 1K9AA 1OEBA 1UJYA 1NEGA 2KYMA 1CKBA 2GBQA 4JPBW 4RTWA 1UECA 1K0XA 2DX1A 1T0HA 2KRNA 1WA7A 3REAB 5I11A 1NYFA 1GL5A 1T3LA 1V1CA 4IIOA 2LP5A 4DEYA 1AZGB 2D1XA 4D8DA 1M3BA 2K6DA 4LE9A 2PZ1A 4CC7A 2ED0A 2MOXA 2QDLA 3QWXX 3RBBB 1ARKA 2EGAA 1AD5A 1WLPB 4Z8AA 2L3SA 1PWTA 2ESWA 1AVZC 1SRMA 2JS0A 4OMMA 5IXFA 2DL5A 3TSZA 1QWEA 2CH4A 3C0CA 2FRYA 1M3AA 1MV0B 1CSKA 1SHFA 1NLPC 1BB9A 1GCPA 1OPLA 1VYUA 1KFZA 2RMOA 2V1RA 2KGTA 2A08A 1A0NB 2O2OA 2DLPA 2LX7A 4HCKA 4LNPA 2RN8A 1AOJA 3VS6A 2ROLA 1UE9A 3M0QA 1WDXA 2DL4A 2RQWA 1TG0A 1QLYA 2D8JA 4F16A 1JQQA 3A98A 1ABOA 1YN8A 2DL7A 5IHNA 4AFUC 2AKKA 2K79A 2J6FA 2YT6A 4Y92A 2BZYA 2KXDA 1MUZA 1KSWA 2EYXA 2FO0A 4RUGA 4J9BA 1X27A 2CSIA 1W6XA 4OMQA 1E7OA 1UFFA 4GLMA 2CUBA 4JJDA 1Y57A 2DJQA 1RI9A 4HVUA 3GBQA 1RUWA 1SEMA 2ED1A 3PE0A 2L2PA 4WCIA 2AKLA 1E6GA 2GTJA 2O88A 2EPDA 2A36A 1ZSGA 2EKHA 1LCKA 4RTYA 1H3HA 1UUEA 4ORZA 3IQLA 2J7IA 1BU1A
chains in the Genus database with same CATH superfamily
1BI3A 3NMZC 3SWNB 1B07A 5GAN6 3EHRA 4N0AC 4BDYA 2M0OA 3DB3A 1ZSZC 3O5ZA 4FYXB 2E65A 3VS4A 5LJ3f 2DL3A 1ZUYA 2VKNA 2DVJA 1KHCA 2LRQA 2KBTA 2CP7A 3INZA 5KE3A 2E10A 3GNFB 2E64A 2O9SA 4LDXA 1YCSB 1QVFS 4CC2A 2FB7A 1BI0A 1OPKA 3OMCA 5CAIA 4WTOB 1S1NA 3META 4FSSA 1VQ5T 4LDUA 1Q7YU 4KH0B 1G2BA 4RCBA 4F7UG 3QYHB 1PD0A 1Q81U 5HCKA 5KCHA 2RJCA 1GBQA 4LDWA 3VKIA 4HCCA 4FU6A 2X35A 1J3TA 2M51A 5KCOA 1OYXA 1OX8A 1W4SA 2QG9B 4M7AF 3NTKA 1IXDA 4Y28E 1VQ4A 3URGA 2F2XA 2ZCFB 2COZA 4F7UE 4N0AA 1W1FA 1AWWA 3QJ6A 4JZ3A 4WF2A 3JCMQ 2YRCA 1S72A 4HVWA 2DBMA 1O75A 1D0YA 3X28B 3OB9A 3QJYA 5HKCA 2X9HA 4PJNA 1WI7A 2D0QB 4C92G 1YWOA 3SD4A 1K9MR 1ZA2B 3SHWA 1VQ7Q 3A8MB 2KRSA 3FDRA 1WXTA 2CGHA 3DLLA 1YJ9A 1HK9A 1I8FA 1U3OA 1RAIB 4EMGA 4ZTJA 3A1PA 3SB2A 5I2SA 4M75D 3NGPA 4J9DA 5KYXA 3JCMP 3CMAQ 1M90U 2QTVA 1QP2A 2DA9A 4J9GA 4RTTA 3LH0A 2DRKA 1YITQ 2YLBA 5GJWB 4JS4A 2XDPA 2I0NA 4AG1C 1AZEA 1XJWB 3CCVA 2HQXA 4J6YA 5EG2A 4XQ3A 2DRMA 4K11A 5KYXB 1WXUA 4FL6A 4IUUA 4ZN1A 3JAME 1M8VA 3RMSA 2F1LA 1YJWA 4GY5A 4MZTA 1VQ5Q 5DM7R 3FJ5A 1UEBA 4DOVA 1YHQA 1YIJA 2E3IA 3OMGA 4KULA 3I56Q 1YJ9Q 2JVVA 3OS1A 2FVUA 2KAFA 2RHXA 1ZQ1A 4X9CA 3OYCA 1K0SA 3EAEA 1MNEA 1VQ5A 3HSBA 1YJWQ 4JZ4A 1ZX6A 3UPUA 1O9SA 2JNGA 1D0XA 4M78F 1RADB 3FB9A 2DBKA 4PKCC 2DIGA 4BE0A 1M30A 2XIDA 1B7TA 3H0IA 4R0KA 1ZLMA 4DEXA 3RIRA 2G3RA 2XHCA 3CD6A 1M1FA 1FMWA 5CR2A 3M54A 2OTLA 1WNLA 1QVGP 1JEGA 1UGRB 3VS3A 1YITA 1KJWA 2KT1A 1VQMT 2K2MA 4NL2A 2ZPGB 2RI5A 1D3BA 2RF0A 4QKUA 4CC3A 2LNHB 4KBMB 1VYTA 1H641 3PIOA 4OGCA 1UGSB 3EFOA 2KXCA 4JRIA 1RLPC 4FW2A 1BI1A 1BK2A 2JN0A 2LCSA 3OYIA 4Z89A 1M1KR 1BBZA 1T0JA 1UGPB 3QSUA 2GQVA 5I22A 1FYNA 4M7AG 1M4ZA 4PFZA 3UA6A 4LD9K 2EJGA 1G5VA 1B3QA 3EFRA 3MP8A 3NTIA 1WYXA 2LX9A 2MWPA 4HA8A 1IRXA 2HQHA 2ZGWA 1QCFA 2O4XB 4N4GA 1S72Q 3CCJQ 2YUQA 1YP5A 4A4GA 4F7UA 3X25B 3L2RA 2J6KA 2EGCA 2V8JA 2MI6A 8AT1B 3CCVT 2R58A 2O01E 4QQGA 4C0DC 5GAOm 1AWXA 1QKWA 3JCMg 5GANd 2MK5A 2DYBA 3VUBA 5KYYB 1SPKA 2EAYA 3VS2A 2CZ0B 5M9OA 1GRIA 3GP8A 2CYZB 2JW4A 1K4US 2V1QA 3PVLA 4FYYB 2MCNA 1UJ0A 4DBQA 1KQ1A 3HTRA 2P0PA 5GAMf 3JCMb 3UF4A 2DJZA 2K5LA 4RCCA 5L8RE 1OEBA 2GBQA 4JPBW 1UECA 4M7DE 5D6YA 3L1AA 2I2LA 2VGNA 3OYMA 4X34A 4ANJA 5LJ5g 1NYFA 1T3LA 2JTMA 5GAMd 2LP5A 3MP6A 2FL7A 2JJ9A 5CQXA 1QQJA 2HQEA 3EFOB 1RABB 4NOYA 4F7UF 1TTHB 3QIIA 3RBBB 4BB7A 1KD1U 1WLPB 2L3SA 4HKEA 1KHIA 1PWTA 3OYYA 2ESWA 2V8KA 3SFMA 1C0MA 3MPUB 1TU0B 1M2VB 1QWEA 3GIBA 4IKFA 2DD4A 5D6XA 4M7DA 4M77A 2PQWA 3HFOA 2CH4A 4XU0A 1SG5A 4M77F 2QA4A 4PJOG 3HPWA 3OQ5A 3JRZA 1OPLA 3LGFA 3CCQQ 3CEYA 3QYGB 3OW2A 2V1RA 4B9XA 1NZ9A 2YLCA 4ZGDB 4CRIA 4C92D 4XTUA 2DLPA 1R0BG 4XTXA 3PMIA 4O6JA 2FZGB 3JB9G 4N4HA 2DL4A 4XU2A 1RAGB 3ER0A 2D8JA 1JRIA 2D6FA 3A98A 3CBMA 1RAAB 1Y7XA 1K9MU 3JCMc 2J6FA 3TCJA 1XQHA 1MHNA 2KY9A 5HK3A 2KXDA 1MUZA 4E47A 2LVMA 1QW1A 2EWNA 2AHJB 2EYXA 4RUGA 2MWOA 2ZPHB 1X27A 3MO8A 1JJ2A 4OMQA 3JCMW 1KQSP 4JJDA 4HVUA 1YJNQ 4FYWB 5IT9E 4C92C 1VQNT 4OVAA 1RUWA 3PE0A 4LXCA 4WCIA 2AKLA 1VQ8A 3FC3A 3LW5E 4M75A 4E2FB 4P5NA 3PFSA 5CQYA 2DPPB 4ORZA 3OYEA 1ACMB 2J7IA 1R77A 1VIFA 1KIKA 4L5GA 3KBGA 4PJOB 3OYKA 1K73R 4BUGA 3DB4A 2DMOA 2DXUA 3I9QA 3JCMf 1X75C 2JS2A 1TWBA 4M78E 2C0IA 2YRVA 3M0SA 2MYSA 2CT4A 2DO3A 3VJPA 5CIUA 4A4HA 2EQMA 2GFUA 2BTTA 4M75B 2KEAA 1M90R 5IH2A 3FIFA 4C8QC 1X2KA 5CKFA 3CMAT 1C1AA 4OMPA 1MMDA 2EVRA 5GAOl 1N8RC 1VQ6Q 1EFNA 1VQPQ 3EG9B 2P4RA 1R0CB 2QEXA 2L3PA 1SHGA 1NJIU 2RQVA 4C5GA 3OS2A 4J6XA 1ZBJA 4GBQA 2EGEA 1VQOT 2CT3A 4R56A 3OYNA 2L5QA 4DBHA 2VB6A 3GNGA 1JXMA 4Z02A 4J5YA 3CD6Q 3I55A 1G3YA 3CCJA 2E5KA 2EYZA 3NFCA 3ZFJA 2KE9A 5LJ5d 3D7SB 3L2WA 3HHTB 1WFWA 2K9GA 4C8QA 3OS0A 2X4WA 5KYNA 1QP3A 1X6GA 3OYDA 2K2VA 4HXJA 2NUTB 1OX9A 4BACA 2RM4A 2VWFA 1VQPT 1BCMA 4C0FA 4M7AD 1GFCA 1NEBA 2CP0A 3QDRB 4M7DC 2LCCA 1X6OA 1N6AA 3HL8A 4M7DF 1VQLQ 5KH6A 5CKDA 1QVPA 4MMKA 3FJPA 3CC7Q 3M59A 1B34B 2GQIA 1GCQA 2L89A 3VUZA 2HNIA 1PRLC 1QCNA 2VUBA 2E1HA 2ECZA 3REBB 1VQMQ 3JCMV 1R8OB 3M4YA 2XMFA 4XU3A 2PUOB 1OQKA 1NM7A 1VQ4T 5LJ5e 2KSSA 2AZVA 2LJ3A 5KYUB 1Z9ZA 2NLUA 2P0QA 4JJBA 5LJ3h 4M7AC 4TVRA 5DLOA 2DEUA 4F17A 2HMAA 2VC8A 2FPEA 2WACA 2V8IA 1D0ZA 3THKA 1PC0A 4C8QE 3EG0A 3HRSA 1VQKQ 2ZZDA 2JTFA 3RNJA 3CMET 3CCRA 3EGDB 3I56A 1YIJQ 2ZPEB 3MEWA 3CCRQ 4ZGEB 3R6NA 1QVGA 2YDLA 1GFDA 4RTUA 4OB0B 4ATOA 2BIVA 3QPHA 1QMCA 5LL6S 5C0MA 1MNDA 1WX6A 1YBYA 1KC8C 2QXFA 2EYWA 1PHTA 4DBRA 4FYVB 2DYIA 1T3SA 1AEYA 2QI2A 2HL3A 2A37A 1Y96A 3KXTA 4OB3B 5FWCA 2VVKA 1Q95G 3ZBDA 1NBEB 3CCJT 4LUEA 3CC7A 4OP0A 2XI9A 5GAMg 4FM4B 4JJCA 1G8XA 2HAXA 3G7ZA 3JB9J 1VQLA 2DXBA 4D6WA 1NLOC 5CKHA 2QAZA 5GANe 4LDVA 4PJOD 1ZHIA 1VQ6A 4EMKC 1E6HA 1RL2A 3M58A 3CC7T 2P0KA 1VA7A 4EMKA 1UG1A 2M0YA 2QGGA 5A2QE 2NUTA 1WQ7A 2K3YA 1HSQA 4X1VA 4JLGA 1VQ9Q 2QQ9A 4C5EA 3V7SA 1Y71A 2C0OA 2HBWA 3QG1A 1YJNT 1D3BB 3OYHA 5IN1A 1JJ2S 5GANh 2QQRA 3S3MA 2L0AA 1D1AA 1GCQC 5LJ3j 4PLLA 4OF1A 3PIPA 3OYFA 5GAN4 4J8OA 4M78B 4MZPA 2OAWA 2AZSA 1AWJA 3CD6T 4PJOC 2PVOB 1YNZA 3TQ7P 4M78C 5GMKe 1QWFA 2QGFB 2EQKA 2OJ2A 3CCSA 2K7AA 3QKJA 2NYSA 1PSFA 1YITT 4OMFB 1Q82C 2CZ1B 2HKNA 3SDZA 3SEMA 1MMGA 3JCMd 4RTXA 5GANg 3PNWC 4LUDA 2LMJA 2ZPFB 3M56A 2OTJQ 2FPDA 5FRNA 2IG0A 2K5FA 4XTZA 1NEGA 2KYMA 1M1KC 1LJOA 4A4KA 1VQ9T 3REAB 4XAXB 4Q5WA 2K4YA 2MAMA 5I11A 1GL5A 1V1CA 1GXIE 2ZPIB 4DEYA 3QO3A 2D1XA 4D8DA 2K6DA 3CPFA 4ZGJB 3EH1A 4KGXB 1Q86C 2ED0A 2CP3A 2QDLA 3CC4Q 3OYBA 1M2VA 2XG8D 2QQSA 2P84A 5GAMh 4NS5A 1VQ8Q 2VASA 1RI0A 3CCLT 1SRMA 5CVIA 1U1TA 1W2BS 4NL3A 3X26B 5IXFA 3TSZA 1WJQA 2QA4Q 2P4TA 1BYMA 2RJFA 3C0CA 5AT1B 1X01A 1M3AA 1MV0B 4N4IA 4RG8A 4BI8B 4EMHA 1SHFA 1BB9A 1NLPC 5GAOr 3JCMX 1XNIA 2PU9B 2XDDA 3KUFA 4PLIA 1VYUA 2RMOA 2NUPB 4VUBA 5GMKj 1VQKT 2X51A 2IVWA 1BCOA 1VQ6T 2HD0A 1OI1A 2LNVA 3CCEA 2Z0WA 2O2OA 2DEQA 3G4SA 4IUTA 3V8JA 2RQWA 3O8VA 4HT9A 1QLYA 2A0FB 2WSCE 1WGSA 3VV0A 1ABOA 3BW1A 1XTDA 2RK2A 4IUPA 5IHNA 2AKKA 2JOYA 4RMOA 3H6ZA 3P8BB 2VV5A 4M7AB 3CCLQ 5GAOq 2FO0A 1YI2A 3OBWA 4J9BA 3R6OA 3CBPA 1WQWA 3S6WA 1E7OA 1UFFA 4GLMA 2CP5A 1YJWT 2PVDB 5CKBA 3EH2A 3CCSQ 4GLKA 3FEOA 1KQSS 2GCXA 4JLIA 3CCST 2O88A 2EPDA 4C92E 2A36A 4F7UB 1H3HA 4J7FA 2DD5A 5KYUA 3OW2S 2RHUA 3NPFA 5GAN3 1WIEA 4V2SA 2XKOC 1HXDA 2YRDA 4HVVA 1BI2A 1HYOA 2X4YA 4M77B 5IAYA 2EYYA 4JRPA 2O31A 3G1JA 3JSCA 1VQ9A 4M77D 1TUGB 3PGGA 3G71T 4C5IA 5LJ3e 2E4HA 1I07A 1Q81R 2CREA 3I5RA 2LC4A 4M75C 1LVKA 1WHKA 3M0TA 2GTOA 3VRYA 1KQSA 2X3XD 3EGXA 2OTJA 1Y07A 1N8RR 1D09B 2EJ9A 5IHKA 5FW9A 1PKTA 1RLQC 1X2QA 3G71A 1ZUKA 4RTZA 3LYIA 2FRWA 3SWNC 4KUDK 2DM1A 3MHXA 1LPLA 3DLMA 2X3WD 1WXBA 1SSHA 2GGRA 4ESRA 4XU1A 3V7RA 2FHDA 3F70A 2DE0X 1N8RU 5GAOp 2LT1A 2VYTA 2RHIA 2LCLA 6AT1B 2LJ1A 4M7DD 2YUNA 4XTVA 3CXCA 1MGQA 4EDUA 4O5VA 2M16A 3P8HA 3L2ZA 2M9UA 1KD1C 3OYJA 2RHYA 1PKSA 1HJDA 1WHJA 1EIFA 1UHCA 2CUDA 4IUQA 5I2MA 3G6EA 4ELYC 3CCUQ 3RESA 4A63B 3WVEB 1FXXA 1VQNA 1AT1B 3J7AF 1TUDA 1AWOA 1HD3A 4KGZB 4M77E 2ATCB 1BIAA 2CZ7B 3VU3C 2HCKA 3BFMA 3OA6A 1NG2A 2JTEA 3LH5A 3EGDA 4AMCA 3S3NA 1BKBA 1I1JA 3TEEA 2FZCB 3RKXA 2DAQA 4J9IA 3AHUA 2NUZA 1OOTA 1WHHA 1VQ8T 1QCOA 4RTVA 2JMAA 2OI3A 5D7UA 4LN2A 5A0LA 3WXMB 4QVZA 4C8QF 3S3OA 5GAMe 3QXEB 3CPWS 4C92B 1I5LA 1XOVA 2KRMA 3QWYA 3M0RA 4J9CA 5GAOn 4Y91A 3CCVQ 1WHLA 4BY6C 1VQOA 3A8LB 1PNJA 2KR3A 3NHNA 3OYGA 1K73U 2BKDN 1JBMA 2XDBA 3CCMA 5GANj 1Q86U 3CPWP 2KNBB 2E3HA 1UGVA 1YWPA 2LZ6B 3TVTA 3HKSA 3CMAA 2BZXA 1TUCA 3I5SA 4M7AE 3ZEHA 2HEQA 1X43A 1V76A 2QYZA 3J81E 1MMNA 4OB2B 3UT1A 4KH1B 1NYGA 1M8MA 3LLRA 3X24B 5LJ3d 4BI4A 2DKGA 1PRMC 5J39A 1YHQQ 2IIMA 3LGLA 1N27A 1KC8U 2RJDA 2VXFA 5KYYA 1VQ7A 5ECAA 4PNOA 2RD1A 2KK4A 3VS1A 3JV3A 3A8HB 3C94A 5FU7C 2JXBA 3BE3A 4M75G 3OW2P 1F1BB 3CPWA 2XU8A 4OMNA 1WHGA 2DZCA 2KT8A 3I55T 3CCUA 4PJJA 1D1CA 4FW1A 4M75E 3P8DA 3EGUA 2CS7A 4AFZC 3E9FA 1LNXA 3I55Q 2K3BA 5KE2A 2DL8A 3AT1B 1H92A 2V26A 2H8HA 1FMKA 1I4K1 1M3CA 2L3RA 4C0DB 2D9TA 3RKWA 2EKOA 2EQUA 2MMPA 2HDAA 2YHTA 1K8AR 2C0TA 1JO8A 2DNUA 2QEXQ 3CCQT 2DTHA 5KYWA 1K1ZA 3UA7A 1X69A 3G71Q 4ZTFA 2LTOA 2W0ZA 4C92A 3VRZA 1SRLA 2B8AA 5IHIA 3MJXA 4PJOF 1N9SA 3V8LA 2LQNA 1Q7YR 2J06A 1MV3A 1G3WA 3JB9D 3I56T 2BUDA 2RQUA 3HP9A 2XICA 1FX7A 3FLGA 1W2BP 4IIMA 3A8OB 1X6BA 4RG2A 2RPNA 1KG1A 1M1KU 1JB0E 1K8AC 2CH4W 4AFSC 3ZL7C 4KGVB 1OULA 3Q1JA 3QBYA 4HCZA 2Y90A 2RQTA 4EPCA 3KFVA 2A28A 5FU7B 4J9EA 2JM9A 2IPOB 1EX4A 2PTKA 3PVQA 3EG3A 4OMOA 1IO6A 4BY6B 5GMKm 3M0PA 5AYFA 3CCMT 1OV3A 5C6SA 1M90C 2RNAA 1OZ2A 5GAN5 2FZKB 4QQ6A 1PCXA 2LJ0A 2JM8A 1YJ9T 4M75F 1IB8A 3E2UA 3CC4T 2B86A 4E6RA 8ATCB 1H8KA 3CCLA 4C0GA 4PJMA 4J9FA 3V7CA 4ME7A 1CKBA 2DXTA 4C0ZA 3PTAA 2RA2A 1TH7A 2F5TX 4E7KA 4DA4A 1T0HA 2PUKB 1KD1R 4QQDA 4E7ZA 5GAMj 1M3BA 4HT8A 1Q7YC 3T9NA 4LE9A 3LWIA 3L2QA 3EGXB 3ME9A 5GANf 2HZYA 3QWXX 4FT2A 1ARKA 2EGAA 1G3TA 1AD5A 4Z8AA 1M9SA 3LWHA 3OYAA 3M53A 1AVZC 1OU8A 2DK3A 3QUIA 1Q82U 1VQLT 2M1HA 1WPYA 2H3JA 5GMKh 4E7LA 2DETA 3RKYA 2DVEA 2CP6A 4PL6A 1YJNA 5KYWB 4E7HA 3OS5A 1GCPA 2VGMA 2YWWA 3A8GB 1Q82R 2WSEE 4BI3A 1PSEA 4MMLA 5LJ3g 4M7DG 4FCYA 1M1GA 2X4XA 5HY6A 4MZMA 3DKMA 4J6WA 2KGTA 2A08A 2QQBA 1A0NB 3M9QA 4C8QD 2LX7A 4HCKA 4LNPA 5LJ5j 1AOJA 3VS6A 4QVCA 1UE9A 1WDXA 7AT1B 1U8RA 1TG0A 1FMVA 3LX7A 1M5Q1 1S72T 3QHSA 4F16A 2HSEB 3L2VA 1YN8A 2GFAA 4AFUC 4M7AA 3PT9A 2EIFA 4E7JA 1KK7A 4FIBA 2YT6A 4Y92A 2BZYA 5LJ5f 1KSWA 1RAHB 1NPPA 3CMEA 3CCRT 2LDMA 4M77C 2CSIA 1W6XA 2EFIA 2CUBA 2E12A 3BY7A 1K8AU 3CC2T 1SSFA 3MKDA 5J26A 1NJIC 1SEMA 3N5BB 2ED1A 2L2PA 4MDXA 3M5AA 3H9NA 3OYLA 1NE8A 4YTLA 3CXCP 3QDFA 1VIEA 2EKHA 1LCKA 2DZ9A 3E1SA 2C06A 3IQLA 2O4XA 5GAN2 3EG9A 1U06A 3CC4A 2F69A 2F2WA 1K9MC 3CXCS 2X4JA 1PG5B 5D6WA 4IURA 3EG2A 4KRTA 2K3XA 3GOXA 3SWNA 2FG0A 4PFPA 2L3QA 4PK4A 4QVDA 2EW3A 3MP1A 3A5ZB 4E7IA 1G83A 2RHZA 1VYVA 1ABQA 2KI7A 2EBPA 3RMQA 2J05A 4CI0C 1SKUB 2E70A 2PNIA 2RH2A 2JMCA 1Y96B 4F14A 1P92A 2AIRB 4KUIA 2YUPA 3VYGA 1YIJT 5GJVB 4JDSA 3TSWA 5L23A 2QDYB 3M57A 4Z88A 4FT4A 3ASKA 3HFNA 5LJ5h 2JZ2A 4A54A 3CCET 3E19A 3WVDB 2D8HA 2KVQG 3C12A 4C8QG 2MIOA 4XTYA 2LQWA 4D8KA 2YUOA 1M27C 1BIBA 1UGQB 2EJFA 2LQ8A 4M4ZA 2E6ZA 2JT4A 5IXBA 2ZPBB 4ZN3A 1V29B 3H0FA 2CP2A 1PD1A 2BE9B 2KYBA 1QKXA 4L6V5 1KC8R 2RI3A 1YHQT 1Q81C 1JXOA 5FU6B 1YI2T 2F2VA 1ZUUA 4FSXA 5GMKl 1U5SA 4JS5A 2QA4T 2NUPA 2GF7A 4J7IA 1IGQA 4ZNXA 2ZAEA 5FWBA 3M55A 3C95A 1N5ZA 5CO7A 4AT1B 2KROA 2OTJT 4B9WA 2KDSA 1N9RA 3RR6A 2HSPA 1U1SA 4DOWA 1B34A 1ZA1B 2Y4XA 5CKEA 3MEUA 2E41A 3CCMQ 2A3LA 1QVFP 2RI2A 2MF2A 4AFQC 5GAN7 1W70A 2DF6A 1D1BA 2OTLQ 1JU5C 3EHQA 1VQOQ 1C6VX 3JB9H 1CKAA 5EC7A 1VQMA 2HL5C 3EFSA 5FROA 2DILA 2KMTA 1H3ZA 5A0DA 1UDLA 4KT0E 4A53A 5FRMA 4M78D 2ENMA 2AK5A 4C8QB 2LQKA 2SRCA 1YCYA 2J6OA 5DLQE 2RJEA 4M77G 4C5HA 2RQRA 3PMTA 4AG2C 2W10A 2FEIA 1ZSZA 4OGEA 1VQKA 3FRNA 2D0NA 2EYQA 4A4FA 1LOJA 3VS7A 4OB1B 3NTHA 1PM3A 4BD3A 3G4ST 2XK0A 1I0CA 1VQNQ 1W2BA 2Y4YA 1I81A 1YFNA 4JJNK 5GMKi 1UTIA 2K5IA 3TREA 2DXCA 3L42A 1KQ2A 3G6ET 4X9DA 4JRQA 3M0UA 2CZ6B 2SEMA 3BDUA 1VQ4Q 3OSVA 2CSQA 2E5QA 3EG1A 2LT4A 1WJRA 1MMAA 3UDCA 2XD0A 3X20B 5J3BA 4EMKB 3RDVA 4EIKA 4M78G 4R55A 1IHVA 2G6FX 4A4EA 5FU6C 3VS0A 3VYHB 2YSQA 1Q86R 3HRTA 3H0HA 3JB9I 4DBFA 3GLXA 3MEAA 4LD6A 3CQTA 2ROTA 3H8ZA 2CKKA 3H41A 4BDZA 3U23A 2OTLT 3ULRB 3QZ5B 4LDYA 4J9HA 1VQ7T 1WZOA 2O9VA 3L2UA 1QVFA 4CC4B 5A0GA 3G6EQ 2OX7A 2WSFE 2GNCA 4PJOE 3OBYA 1K76A 3UATA 1G3SA 1RAFB 4DQ2A 4E7SA 1ZBXA 4QT7A 3RERA 2NWMA 2EQIA 2CDTA 2QTXA 1TOVA 5HK0A 2ABLA 2DIQA 3JCMh 2E6NA 3V8KA 1NPRA 4XTWA 3I35A 2BE7D 1Z9QA 1GBRA 1Y0MA 2DTIA 4M78A 2RK1A 3HRUA 3VS5A 5I21A 2QQAA 1UHFA 4OMLA 1AHJB 1OZ3A 1VQPA 4J83A 1WJSA 2FPFA 2A7YA 2PVGB 2BZ8A 1K9AA 1UJYA 3OY9A 4BE1A 1ZSZB 4RTWA 1K0XA 2DX1A 4MDWA 3CCUT 2K57A 2KRNA 3GF5A 1WA7A 4ELZC 1RAEB 3UWNA 3BDLA 4QW2A 2H3EB 4IIOA 3QZ9B 4RKUE 1AZGB 2F5KA 1IZ6A 1IGUA 3RUXA 4C92F 5DY9A 2PZ1A 4CC7A 1IREB 2MOXA 3CC2Q 2DTOA 4PJOA 2EQJA 1WHMA 4HCBA 1FWZA 2R5MA 1VUBA 3MEVA 1SF9A 4JUVA 2L8DA 4XK8E 2AT1B 3CCQA 2COWA 2JS0A 4OMMA 3JCMe 1VOMA 2DL5A 4M7DB 2M02A 4L59A 1IHWA 2FRYA 3TU4K 1TXQA 1NJIR 1CSKA 1JJ2P 5CK9A 1QVGS 2HBPA 1KFZA 2HKQB 5FLXE 1YI2Q 3CMEQ 2R5AA 9ATCB 3J80E 1M2OA 3JCMJ 2QK0A 1UB4A 1K73C 3GPLA 3CC2A 4BE2A 2MPXC 1I5OB 2RN8A 2ROLA 3C4SA 3M0QA 4PJLA 2QEXT 1JQQA 3G4SQ 2DFUA 2JUFA 2DL7A 3CCEQ 5GAN8 2K79A 2QASA 2VXEA 1OU9A 4F04B 4IUVA 3OSSC 4PFOA 3E9GA 2R57A 1RACB 2COYA 5CCAA 2FYKA 1DJ7B 4JRKA 3M4GA 1Y57A 4UC4A 3MCAB 2DJQA 1EZZB 1RI9A 1TSFA 3GBQA 3JB9F 1TS9A 2YXYA 1E6GA 2GTJA 2OAUA 1ZSGA 4RTYA 2RO0A 2RB6A 2DERA 4II1A 1UUEA 4B6MA 1BU1A 3CBOA 2KQWA
chains in the Genus database with same CATH topology
3NPFA 1WIEA 3NMZC 2F2WA 1KIKA 1B07A 3EHRA 4HVVA 3O5ZA 2DMOA 3I9QA 2EYYA 3EG2A 3VS4A 4KRTA 2JS2A 2O31A 2DL3A 1ZUYA 2VKNA 2C0IA 2FG0A 2DVJA 2L3QA 3M0SA 2CT4A 2EW3A 1I07A 2CREA 3I5RA 2KBTA 1G83A 3M0TA 1VYVA 2BTTA 1ABQA 2GTOA 3VRYA 2KEAA 5IH2A 2EBPA 2X3XD 2O9SA 1X2KA 2J05A 1YCSB 4OMPA 4CC2A 1OPKA 5IHKA 2EVRA 5FW9A 1S1NA 2PNIA 4FSSA 1U06A 1EFNA 1PKTA 2JMCA 1G2BA 1RLQC 1X2QA 4F14A 1ZUKA 2P4RA 4RTZA 5HCKA 2FRWA 2YUPA 1GBQA 2DM1A 5GJVB 1J3TA 2M51A 2L3PA 2X3WD 1WXBA 3TSWA 1SHGA 1SSHA 2RQVA 5L23A 2GGRA 4ESRA 2DE0X 1ZBJA 4Z88A 2LJ1A 4GBQA 2EGEA 2YUNA 2CT3A 2F2XA 1JXMA 2D8HA 1W1FA 1AWWA 2MIOA 4JZ3A 2LQWA 4D8KA 2YUOA 1HJDA 1PKSA 2E5KA 4HVWA 2DBMA 1M27C 2EYZA 1UHCA 2CUDA 4M4ZA 2JT4A 2KE9A 4A63B 5IXBA 3H0FA 1TUDA 1AWOA 2KYBA 1WI7A 1HD3A 1QKXA 1WFWA 2K9GA 1YWOA 1JXOA 1X6GA 2F2VA 3SHWA 2HCKA 1ZUUA 1U5SA 1NG2A 4HXJA 2JTEA 2KRSA 3LH5A 1WXTA 1I1JA 2VWFA 4ZNXA 1U3OA 1GFCA 1NEBA 5FWBA 1N5ZA 4J9IA 2KROA 2NUZA 1OOTA 3NGPA 2HSPA 4J9DA 4RTVA 2DA9A 2JMAA 2OI3A 4J9GA 4RTTA 4LN2A 2DRKA 2GQIA 1GCQA 5GJWB 1PRLC 4AFQC 1W70A 2DF6A 2I0NA 1JU5C 2ECZA 3REBB 4AG1C 1AZEA 1XOVA 3EHQA 2KRMA 3QWYA 3M0RA 2XMFA 4J9CA 1NM7A 1PNJA 2KR3A 1CKAA 5EC7A 3NHNA 2AZVA 2LJ3A 1Z9ZA 2DILA 4JJBA 2DRMA 2KNBB 4K11A 1UDLA 1UGVA 1YWPA 1WXUA 2LZ6B 4F17A 3TVTA 2BZXA 1TUCA 2ENMA 3I5SA 2AK5A 2FPEA 2SRCA 3THKA 2HEQA 1X43A 3EG0A 2J6OA 3FJ5A 3RNJA 1NYGA 1M8MA 2RQRA 4AG2C 1PRMC 2W10A 2FEIA 2IIMA 3R6NA 2YDLA 1GFDA 4RTUA 1K0SA 5ECAA 2D0NA 3VS1A 3JV3A 2JXBA 3VS7A 4JZ4A 1ZX6A 1I0CA 4OMNA 1WX6A 2DBKA 2KT8A 1M30A 2EYWA 1UTIA 1PHTA 3EGUA 4AFZC 3H0IA 4R0KA 1ZLMA 4DEXA 1T3SA 2K3BA 1AEYA 3M0UA 2A37A 2DL8A 1H92A 2H8HA 1FMKA 2SEMA 1JEGA 1M3CA 5FWCA 2VVKA 2CSQA 3VS3A 1KJWA 2KT1A 4LUEA 2K2MA 3EG1A 2HDAA 4JJCA 2C0TA 1JO8A 2DNUA 2RF0A 4EIKA 4CC3A 1K1ZA 3UA7A 1X69A 2LNHB 1NLOC 2G6FX 1VYTA 2W0ZA 3VS0A 2YSQA 3VRZA 1SRLA 5IHIA 2KXCA 1RLPC 2LQNA 1BK2A 3H0HA 1E6HA 2J06A 1MV3A 2LCSA 1VA7A 4Z89A 1UG1A 2M0YA 1BBZA 1T0JA 5I22A 3CQTA 2RQUA 2ROTA 3H41A 1FYNA 1HSQA 4X1VA 3U23A 3ULRB 3UA6A 4J9HA 1B3QA 4IIMA 2C0OA 1WYXA 2HBWA 2O9VA 4CC4B 1X6BA 2RPNA 1QCFA 2CH4W 4AFSC 3ZL7C 2L0AA 1GCQC 2YUQA 1YP5A 2GNCA 1K76A 3UATA 2J6KA 2EGCA 4QT7A 2RQTA 2NWMA 3KFVA 2A28A 2EQIA 2OAWA 4J9EA 2JM9A 2AZSA 2CDTA 1AWJA 2ABLA 1YNZA 2PTKA 3PVQA 1AWXA 1QKWA 3EG3A 4OMOA 1IO6A 1QWFA 2DYBA 3I35A 2OJ2A 3M0PA 1OV3A 1Z9QA 1SPKA 1GBRA 1Y0MA 3VS2A 2K7AA 2RNAA 3VS5A 1GRIA 4OMLA 1UHFA 2JW4A 1K4US 2V1QA 3PVLA 2LJ0A 2JM8A 2MCNA 1UJ0A 2FPFA 3SEMA 2BZ8A 2B86A 3UF4A 4RTXA 4E6RA 1H8KA 4LUDA 2LMJA 2FPDA 4J9FA 1K9AA 1OEBA 1UJYA 1NEGA 2KYMA 1CKBA 2GBQA 4JPBW 4RTWA 1UECA 1K0XA 2DX1A 1T0HA 2KRNA 1WA7A 3REAB 5I11A 1NYFA 1GL5A 1T3LA 1V1CA 4IIOA 2LP5A 4DEYA 1AZGB 2D1XA 4D8DA 1M3BA 2K6DA 4LE9A 2PZ1A 4CC7A 2ED0A 2MOXA 2QDLA 3QWXX 3RBBB 1ARKA 2EGAA 1AD5A 1WLPB 4Z8AA 2L3SA 1PWTA 2ESWA 1AVZC 1SRMA 2JS0A 4OMMA 5IXFA 2DL5A 3TSZA 1QWEA 2CH4A 3C0CA 2FRYA 1M3AA 1MV0B 1CSKA 1SHFA 1NLPC 1BB9A 1GCPA 1OPLA 1VYUA 1KFZA 2RMOA 2V1RA 2KGTA 2A08A 1A0NB 2O2OA 2DLPA 2LX7A 4HCKA 4LNPA 2RN8A 1AOJA 3VS6A 2ROLA 1UE9A 3M0QA 1WDXA 2DL4A 2RQWA 1TG0A 1QLYA 2D8JA 4F16A 1JQQA 3A98A 1ABOA 1YN8A 2DL7A 5IHNA 4AFUC 2AKKA 2K79A 2J6FA 2YT6A 4Y92A 2BZYA 2KXDA 1MUZA 1KSWA 2EYXA 2FO0A 4RUGA 4J9BA 1X27A 2CSIA 1W6XA 4OMQA 1E7OA 1UFFA 4GLMA 2CUBA 4JJDA 1Y57A 2DJQA 1RI9A 4HVUA 3GBQA 1RUWA 1SEMA 2ED1A 3PE0A 2L2PA 4WCIA 2AKLA 1E6GA 2GTJA 2O88A 2EPDA 2A36A 1ZSGA 2EKHA 1LCKA 4RTYA 1H3HA 1UUEA 4ORZA 3IQLA 2J7IA 1BU1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NPF A;  1WIE A;  3NMZ C;  2F2W A;  1KIK A;  1B07 A;  3EHR A;  4HVV A;  3O5Z A;  2DMO A;  3I9Q A;  2EYY A;  3EG2 A;  3VS4 A;  4KRT A;  2JS2 A;  2O31 A;  2DL3 A;  1ZUY A;  2VKN A;  2C0I A;  2FG0 A;  2DVJ A;  2L3Q A;  3M0S A;  2CT4 A;  2EW3 A;  1I07 A;  2CRE A;  3I5R A;  2KBT A;  1G83 A;  3M0T A;  1VYV A;  2BTT A;  1ABQ A;  2GTO A;  3VRY A;  2KEA A;  5IH2 A;  2EBP A;  2X3X D;  2O9S A;  1X2K A;  2J05 A;  1YCS B;  4OMP A;  4CC2 A;  1OPK A;  5IHK A;  2EVR A;  5FW9 A;  1S1N A;  2PNI A;  4FSS A;  1U06 A;  1EFN A;  1PKT A;  2JMC A;  1G2B A;  1RLQ C;  1X2Q A;  4F14 A;  1ZUK A;  2P4R A;  4RTZ A;  5HCK A;  2FRW A;  2YUP A;  1GBQ A;  2DM1 A;  5GJV B;  1J3T A;  2M51 A;  2L3P A;  2X3W D;  1WXB A;  3TSW A;  1SHG A;  1SSH A;  2RQV A;  5L23 A;  2GGR A;  4ESR A;  2DE0 X;  1ZBJ A;  4Z88 A;  2LJ1 A;  4GBQ A;  2EGE A;  2YUN A;  2CT3 A;  2F2X A;  1JXM A;  2D8H A;  1W1F A;  1AWW A;  2MIO A;  4JZ3 A;  2LQW A;  4D8K A;  2YUO A;  1HJD A;  1PKS A;  2E5K A;  4HVW A;  2DBM A;  1M27 C;  2EYZ A;  1UHC A;  2CUD A;  4M4Z A;  2JT4 A;  2KE9 A;  4A63 B;  5IXB A;  3H0F A;  1TUD A;  1AWO A;  2KYB A;  1WI7 A;  1HD3 A;  1QKX A;  1WFW A;  2K9G A;  1YWO A;  1JXO A;  1X6G A;  2F2V A;  3SHW A;  2HCK A;  1ZUU A;  1U5S A;  1NG2 A;  4HXJ A;  2JTE A;  2KRS A;  3LH5 A;  1WXT A;  1I1J A;  2VWF A;  4ZNX A;  1U3O A;  1GFC A;  1NEB A;  5FWB A;  1N5Z A;  4J9I A;  2KRO A;  2NUZ A;  1OOT A;  3NGP A;  2HSP A;  4J9D A;  4RTV A;  2DA9 A;  2JMA A;  2OI3 A;  4J9G A;  4RTT A;  4LN2 A;  2DRK A;  2GQI A;  1GCQ A;  5GJW B;  1PRL C;  4AFQ C;  1W70 A;  2DF6 A;  2I0N A;  1JU5 C;  2ECZ A;  3REB B;  4AG1 C;  1AZE A;  1XOV A;  3EHQ A;  2KRM A;  3QWY A;  3M0R A;  2XMF A;  4J9C A;  1NM7 A;  1PNJ A;  2KR3 A;  1CKA A;  5EC7 A;  3NHN A;  2AZV A;  2LJ3 A;  1Z9Z A;  2DIL A;  4JJB A;  2DRM A;  2KNB B;  4K11 A;  1UDL A;  1UGV A;  1YWP A;  1WXU A;  2LZ6 B;  4F17 A;  3TVT A;  2BZX A;  1TUC A;  2ENM A;  3I5S A;  2AK5 A;  2FPE A;  2SRC A;  3THK A;  2HEQ A;  1X43 A;  3EG0 A;  2J6O A;  3FJ5 A;  3RNJ A;  1NYG A;  1M8M A;  2RQR A;  4AG2 C;  1PRM C;  2W10 A;  2FEI A;  2IIM A;  3R6N A;  2YDL A;  1GFD A;  4RTU A;  1K0S A;  5ECA A;  2D0N A;  3VS1 A;  3JV3 A;  2JXB A;  3VS7 A;  4JZ4 A;  1ZX6 A;  1I0C A;  4OMN A;  1WX6 A;  2DBK A;  2KT8 A;  1M30 A;  2EYW A;  1UTI A;  1PHT A;  3EGU A;  4AFZ C;  3H0I A;  4R0K A;  1ZLM A;  4DEX A;  1T3S A;  2K3B A;  1AEY A;  3M0U A;  2A37 A;  2DL8 A;  1H92 A;  2H8H A;  1FMK A;  2SEM A;  1JEG A;  1M3C A;  5FWC A;  2VVK A;  2CSQ A;  3VS3 A;  1KJW A;  2KT1 A;  4LUE A;  2K2M A;  3EG1 A;  2HDA A;  4JJC A;  2C0T A;  1JO8 A;  2DNU A;  2RF0 A;  4EIK A;  4CC3 A;  1K1Z A;  3UA7 A;  1X69 A;  2LNH B;  1NLO C;  2G6F X;  1VYT A;  2W0Z A;  3VS0 A;  2YSQ A;  3VRZ A;  1SRL A;  5IHI A;  2KXC A;  1RLP C;  2LQN A;  1BK2 A;  3H0H A;  1E6H A;  2J06 A;  1MV3 A;  2LCS A;  1VA7 A;  4Z89 A;  1UG1 A;  2M0Y A;  1BBZ A;  1T0J A;  5I22 A;  3CQT A;  2RQU A;  2ROT A;  3H41 A;  1FYN A;  1HSQ A;  4X1V A;  3U23 A;  3ULR B;  3UA6 A;  4J9H A;  1B3Q A;  4IIM A;  2C0O A;  1WYX A;  2HBW A;  2O9V A;  4CC4 B;  1X6B A;  2RPN A;  1QCF A;  2CH4 W;  4AFS C;  3ZL7 C;  2L0A A;  1GCQ C;  2YUQ A;  1YP5 A;  2GNC A;  1K76 A;  3UAT A;  2J6K A;  2EGC A;  4QT7 A;  2RQT A;  2NWM A;  3KFV A;  2A28 A;  2EQI A;  2OAW A;  4J9E A;  2JM9 A;  2AZS A;  2CDT A;  1AWJ A;  2ABL A;  1YNZ A;  2PTK A;  3PVQ A;  1AWX A;  1QKW A;  3EG3 A;  4OMO A;  1IO6 A;  1QWF A;  2DYB A;  3I35 A;  2OJ2 A;  3M0P A;  1OV3 A;  1Z9Q A;  1SPK A;  1GBR A;  1Y0M A;  3VS2 A;  2K7A A;  2RNA A;  3VS5 A;  1GRI A;  4OML A;  1UHF A;  2JW4 A;  1K4U S;  2V1Q A;  3PVL A;  2LJ0 A;  2JM8 A;  2MCN A;  1UJ0 A;  2FPF A;  3SEM A;  2BZ8 A;  2B86 A;  3UF4 A;  4RTX A;  4E6R A;  1H8K A;  4LUD A;  2LMJ A;  2FPD A;  4J9F A;  1K9A A;  1OEB A;  1UJY A;  1NEG A;  2KYM A;  1CKB A;  2GBQ A;  4JPB W;  4RTW A;  1UEC A;  1K0X A;  2DX1 A;  1T0H A;  2KRN A;  1WA7 A;  3REA B;  5I11 A;  1NYF A;  1GL5 A;  1T3L A;  1V1C A;  4IIO A;  2LP5 A;  4DEY A;  1AZG B;  2D1X A;  4D8D A;  1M3B A;  2K6D A;  4LE9 A;  2PZ1 A;  4CC7 A;  2ED0 A;  2MOX A;  2QDL A;  3QWX X;  3RBB B;  1ARK A;  2EGA A;  1AD5 A;  1WLP B;  4Z8A A;  2L3S A;  1PWT A;  2ESW A;  1AVZ C;  1SRM A;  2JS0 A;  4OMM A;  5IXF A;  2DL5 A;  3TSZ A;  1QWE A;  2CH4 A;  3C0C A;  2FRY A;  1M3A A;  1MV0 B;  1CSK A;  1SHF A;  1NLP C;  1BB9 A;  1GCP A;  1OPL A;  1VYU A;  1KFZ A;  2RMO A;  2V1R A;  2KGT A;  2A08 A;  1A0N B;  2O2O A;  2DLP A;  2LX7 A;  4HCK A;  4LNP A;  2RN8 A;  1AOJ A;  3VS6 A;  2ROL A;  1UE9 A;  3M0Q A;  1WDX A;  2DL4 A;  2RQW A;  1TG0 A;  1QLY A;  2D8J A;  4F16 A;  1JQQ A;  3A98 A;  1ABO A;  1YN8 A;  2DL7 A;  5IHN A;  4AFU C;  2AKK A;  2K79 A;  2J6F A;  2YT6 A;  4Y92 A;  2BZY A;  2KXD A;  1MUZ A;  1KSW A;  2EYX A;  2FO0 A;  4RUG A;  4J9B A;  1X27 A;  2CSI A;  1W6X A;  4OMQ A;  1E7O A;  1UFF A;  4GLM A;  2CUB A;  4JJD A;  1Y57 A;  2DJQ A;  1RI9 A;  4HVU A;  3GBQ A;  1RUW A;  1SEM A;  2ED1 A;  3PE0 A;  2L2P A;  4WCI A;  2AKL A;  1E6G A;  2GTJ A;  2O88 A;  2EPD A;  2A36 A;  1ZSG A;  2EKH A;  1LCK A;  4RTY A;  1H3H A;  1UUE A;  4ORZ A;  3IQL A;  2J7I A;  1BU1 A; 
#chains in the Genus database with same CATH topology
 1BI3 A;  3NMZ C;  3SWN B;  1B07 A;  5GAN 6;  3EHR A;  4N0A C;  4BDY A;  2M0O A;  3DB3 A;  1ZSZ C;  3O5Z A;  4FYX B;  2E65 A;  3VS4 A;  5LJ3 f;  2DL3 A;  1ZUY A;  2VKN A;  2DVJ A;  1KHC A;  2LRQ A;  2KBT A;  2CP7 A;  3INZ A;  5KE3 A;  2E10 A;  3GNF B;  2E64 A;  2O9S A;  4LDX A;  1YCS B;  1QVF S;  4CC2 A;  2FB7 A;  1BI0 A;  1OPK A;  3OMC A;  5CAI A;  4WTO B;  1S1N A;  3MET A;  4FSS A;  1VQ5 T;  4LDU A;  1Q7Y U;  4KH0 B;  1G2B A;  4RCB A;  4F7U G;  3QYH B;  1PD0 A;  1Q81 U;  5HCK A;  5KCH A;  2RJC A;  1GBQ A;  4LDW A;  3VKI A;  4HCC A;  4FU6 A;  2X35 A;  1J3T A;  2M51 A;  5KCO A;  1OYX A;  1OX8 A;  1W4S A;  2QG9 B;  4M7A F;  3NTK A;  1IXD A;  4Y28 E;  1VQ4 A;  3URG A;  2F2X A;  2ZCF B;  2COZ A;  4F7U E;  4N0A A;  1W1F A;  1AWW A;  3QJ6 A;  4JZ3 A;  4WF2 A;  3JCM Q;  2YRC A;  1S72 A;  4HVW A;  2DBM A;  1O75 A;  1D0Y A;  3X28 B;  3OB9 A;  3QJY A;  5HKC A;  2X9H A;  4PJN A;  1WI7 A;  2D0Q B;  4C92 G;  1YWO A;  3SD4 A;  1K9M R;  1ZA2 B;  3SHW A;  1VQ7 Q;  3A8M B;  2KRS A;  3FDR A;  1WXT A;  2CGH A;  3DLL A;  1YJ9 A;  1HK9 A;  1I8F A;  1U3O A;  1RAI B;  4EMG A;  4ZTJ A;  3A1P A;  3SB2 A;  5I2S A;  4M75 D;  3NGP A;  4J9D A;  5KYX A;  3JCM P;  3CMA Q;  1M90 U;  2QTV A;  1QP2 A;  2DA9 A;  4J9G A;  4RTT A;  3LH0 A;  2DRK A;  1YIT Q;  2YLB A;  5GJW B;  4JS4 A;  2XDP A;  2I0N A;  4AG1 C;  1AZE A;  1XJW B;  3CCV A;  2HQX A;  4J6Y A;  5EG2 A;  4XQ3 A;  2DRM A;  4K11 A;  5KYX B;  1WXU A;  4FL6 A;  4IUU A;  4ZN1 A;  3JAM E;  1M8V A;  3RMS A;  2F1L A;  1YJW A;  4GY5 A;  4MZT A;  1VQ5 Q;  5DM7 R;  3FJ5 A;  1UEB A;  4DOV A;  1YHQ A;  1YIJ A;  2E3I A;  3OMG A;  4KUL A;  3I56 Q;  1YJ9 Q;  2JVV A;  3OS1 A;  2FVU A;  2KAF A;  2RHX A;  1ZQ1 A;  4X9C A;  3OYC A;  1K0S A;  3EAE A;  1MNE A;  1VQ5 A;  3HSB A;  1YJW Q;  4JZ4 A;  1ZX6 A;  3UPU A;  1O9S A;  2JNG A;  1D0X A;  4M78 F;  1RAD B;  3FB9 A;  2DBK A;  4PKC C;  2DIG A;  4BE0 A;  1M30 A;  2XID A;  1B7T A;  3H0I A;  4R0K A;  1ZLM A;  4DEX A;  3RIR A;  2G3R A;  2XHC A;  3CD6 A;  1M1F A;  1FMW A;  5CR2 A;  3M54 A;  2OTL A;  1WNL A;  1QVG P;  1JEG A;  1UGR B;  3VS3 A;  1YIT A;  1KJW A;  2KT1 A;  1VQM T;  2K2M A;  4NL2 A;  2ZPG B;  2RI5 A;  1D3B A;  2RF0 A;  4QKU A;  4CC3 A;  2LNH B;  4KBM B;  1VYT A;  1H64 1;  3PIO A;  4OGC A;  1UGS B;  3EFO A;  2KXC A;  4JRI A;  1RLP C;  4FW2 A;  1BI1 A;  1BK2 A;  2JN0 A;  2LCS A;  3OYI A;  4Z89 A;  1M1K R;  1BBZ A;  1T0J A;  1UGP B;  3QSU A;  2GQV A;  5I22 A;  1FYN A;  4M7A G;  1M4Z A;  4PFZ A;  3UA6 A;  4LD9 K;  2EJG A;  1G5V A;  1B3Q A;  3EFR A;  3MP8 A;  3NTI A;  1WYX A;  2LX9 A;  2MWP A;  4HA8 A;  1IRX A;  2HQH A;  2ZGW A;  1QCF A;  2O4X B;  4N4G A;  1S72 Q;  3CCJ Q;  2YUQ A;  1YP5 A;  4A4G A;  4F7U A;  3X25 B;  3L2R A;  2J6K A;  2EGC A;  2V8J A;  2MI6 A;  8AT1 B;  3CCV T;  2R58 A;  2O01 E;  4QQG A;  4C0D C;  5GAO m;  1AWX A;  1QKW A;  3JCM g;  5GAN d;  2MK5 A;  2DYB A;  3VUB A;  5KYY B;  1SPK A;  2EAY A;  3VS2 A;  2CZ0 B;  5M9O A;  1GRI A;  3GP8 A;  2CYZ B;  2JW4 A;  1K4U S;  2V1Q A;  3PVL A;  4FYY B;  2MCN A;  1UJ0 A;  4DBQ A;  1KQ1 A;  3HTR A;  2P0P A;  5GAM f;  3JCM b;  3UF4 A;  2DJZ A;  2K5L A;  4RCC A;  5L8R E;  1OEB A;  2GBQ A;  4JPB W;  1UEC A;  4M7D E;  5D6Y A;  3L1A A;  2I2L A;  2VGN A;  3OYM A;  4X34 A;  4ANJ A;  5LJ5 g;  1NYF A;  1T3L A;  2JTM A;  5GAM d;  2LP5 A;  3MP6 A;  2FL7 A;  2JJ9 A;  5CQX A;  1QQJ A;  2HQE A;  3EFO B;  1RAB B;  4NOY A;  4F7U F;  1TTH B;  3QII A;  3RBB B;  4BB7 A;  1KD1 U;  1WLP B;  2L3S A;  4HKE A;  1KHI A;  1PWT A;  3OYY A;  2ESW A;  2V8K A;  3SFM A;  1C0M A;  3MPU B;  1TU0 B;  1M2V B;  1QWE A;  3GIB A;  4IKF A;  2DD4 A;  5D6X A;  4M7D A;  4M77 A;  2PQW A;  3HFO A;  2CH4 A;  4XU0 A;  1SG5 A;  4M77 F;  2QA4 A;  4PJO G;  3HPW A;  3OQ5 A;  3JRZ A;  1OPL A;  3LGF A;  3CCQ Q;  3CEY A;  3QYG B;  3OW2 A;  2V1R A;  4B9X A;  1NZ9 A;  2YLC A;  4ZGD B;  4CRI A;  4C92 D;  4XTU A;  2DLP A;  1R0B G;  4XTX A;  3PMI A;  4O6J A;  2FZG B;  3JB9 G;  4N4H A;  2DL4 A;  4XU2 A;  1RAG B;  3ER0 A;  2D8J A;  1JRI A;  2D6F A;  3A98 A;  3CBM A;  1RAA B;  1Y7X A;  1K9M U;  3JCM c;  2J6F A;  3TCJ A;  1XQH A;  1MHN A;  2KY9 A;  5HK3 A;  2KXD A;  1MUZ A;  4E47 A;  2LVM A;  1QW1 A;  2EWN A;  2AHJ B;  2EYX A;  4RUG A;  2MWO A;  2ZPH B;  1X27 A;  3MO8 A;  1JJ2 A;  4OMQ A;  3JCM W;  1KQS P;  4JJD A;  4HVU A;  1YJN Q;  4FYW B;  5IT9 E;  4C92 C;  1VQN T;  4OVA A;  1RUW A;  3PE0 A;  4LXC A;  4WCI A;  2AKL A;  1VQ8 A;  3FC3 A;  3LW5 E;  4M75 A;  4E2F B;  4P5N A;  3PFS A;  5CQY A;  2DPP B;  4ORZ A;  3OYE A;  1ACM B;  2J7I A;  1R77 A;  1VIF A;  1KIK A;  4L5G A;  3KBG A;  4PJO B;  3OYK A;  1K73 R;  4BUG A;  3DB4 A;  2DMO A;  2DXU A;  3I9Q A;  3JCM f;  1X75 C;  2JS2 A;  1TWB A;  4M78 E;  2C0I A;  2YRV A;  3M0S A;  2MYS A;  2CT4 A;  2DO3 A;  3VJP A;  5CIU A;  4A4H A;  2EQM A;  2GFU A;  2BTT A;  4M75 B;  2KEA A;  1M90 R;  5IH2 A;  3FIF A;  4C8Q C;  1X2K A;  5CKF A;  3CMA T;  1C1A A;  4OMP A;  1MMD A;  2EVR A;  5GAO l;  1N8R C;  1VQ6 Q;  1EFN A;  1VQP Q;  3EG9 B;  2P4R A;  1R0C B;  2QEX A;  2L3P A;  1SHG A;  1NJI U;  2RQV A;  4C5G A;  3OS2 A;  4J6X A;  1ZBJ A;  4GBQ A;  2EGE A;  1VQO T;  2CT3 A;  4R56 A;  3OYN A;  2L5Q A;  4DBH A;  2VB6 A;  3GNG A;  1JXM A;  4Z02 A;  4J5Y A;  3CD6 Q;  3I55 A;  1G3Y A;  3CCJ A;  2E5K A;  2EYZ A;  3NFC A;  3ZFJ A;  2KE9 A;  5LJ5 d;  3D7S B;  3L2W A;  3HHT B;  1WFW A;  2K9G A;  4C8Q A;  3OS0 A;  2X4W A;  5KYN A;  1QP3 A;  1X6G A;  3OYD A;  2K2V A;  4HXJ A;  2NUT B;  1OX9 A;  4BAC A;  2RM4 A;  2VWF A;  1VQP T;  1BCM A;  4C0F A;  4M7A D;  1GFC A;  1NEB A;  2CP0 A;  3QDR B;  4M7D C;  2LCC A;  1X6O A;  1N6A A;  3HL8 A;  4M7D F;  1VQL Q;  5KH6 A;  5CKD A;  1QVP A;  4MMK A;  3FJP A;  3CC7 Q;  3M59 A;  1B34 B;  2GQI A;  1GCQ A;  2L89 A;  3VUZ A;  2HNI A;  1PRL C;  1QCN A;  2VUB A;  2E1H A;  2ECZ A;  3REB B;  1VQM Q;  3JCM V;  1R8O B;  3M4Y A;  2XMF A;  4XU3 A;  2PUO B;  1OQK A;  1NM7 A;  1VQ4 T;  5LJ5 e;  2KSS A;  2AZV A;  2LJ3 A;  5KYU B;  1Z9Z A;  2NLU A;  2P0Q A;  4JJB A;  5LJ3 h;  4M7A C;  4TVR A;  5DLO A;  2DEU A;  4F17 A;  2HMA A;  2VC8 A;  2FPE A;  2WAC A;  2V8I A;  1D0Z A;  3THK A;  1PC0 A;  4C8Q E;  3EG0 A;  3HRS A;  1VQK Q;  2ZZD A;  2JTF A;  3RNJ A;  3CME T;  3CCR A;  3EGD B;  3I56 A;  1YIJ Q;  2ZPE B;  3MEW A;  3CCR Q;  4ZGE B;  3R6N A;  1QVG A;  2YDL A;  1GFD A;  4RTU A;  4OB0 B;  4ATO A;  2BIV A;  3QPH A;  1QMC A;  5LL6 S;  5C0M A;  1MND A;  1WX6 A;  1YBY A;  1KC8 C;  2QXF A;  2EYW A;  1PHT A;  4DBR A;  4FYV B;  2DYI A;  1T3S A;  1AEY A;  2QI2 A;  2HL3 A;  2A37 A;  1Y96 A;  3KXT A;  4OB3 B;  5FWC A;  2VVK A;  1Q95 G;  3ZBD A;  1NBE B;  3CCJ T;  4LUE A;  3CC7 A;  4OP0 A;  2XI9 A;  5GAM g;  4FM4 B;  4JJC A;  1G8X A;  2HAX A;  3G7Z A;  3JB9 J;  1VQL A;  2DXB A;  4D6W A;  1NLO C;  5CKH A;  2QAZ A;  5GAN e;  4LDV A;  4PJO D;  1ZHI A;  1VQ6 A;  4EMK C;  1E6H A;  1RL2 A;  3M58 A;  3CC7 T;  2P0K A;  1VA7 A;  4EMK A;  1UG1 A;  2M0Y A;  2QGG A;  5A2Q E;  2NUT A;  1WQ7 A;  2K3Y A;  1HSQ A;  4X1V A;  4JLG A;  1VQ9 Q;  2QQ9 A;  4C5E A;  3V7S A;  1Y71 A;  2C0O A;  2HBW A;  3QG1 A;  1YJN T;  1D3B B;  3OYH A;  5IN1 A;  1JJ2 S;  5GAN h;  2QQR A;  3S3M A;  2L0A A;  1D1A A;  1GCQ C;  5LJ3 j;  4PLL A;  4OF1 A;  3PIP A;  3OYF A;  5GAN 4;  4J8O A;  4M78 B;  4MZP A;  2OAW A;  2AZS A;  1AWJ A;  3CD6 T;  4PJO C;  2PVO B;  1YNZ A;  3TQ7 P;  4M78 C;  5GMK e;  1QWF A;  2QGF B;  2EQK A;  2OJ2 A;  3CCS A;  2K7A A;  3QKJ A;  2NYS A;  1PSF A;  1YIT T;  4OMF B;  1Q82 C;  2CZ1 B;  2HKN A;  3SDZ A;  3SEM A;  1MMG A;  3JCM d;  4RTX A;  5GAN g;  3PNW C;  4LUD A;  2LMJ A;  2ZPF B;  3M56 A;  2OTJ Q;  2FPD A;  5FRN A;  2IG0 A;  2K5F A;  4XTZ A;  1NEG A;  2KYM A;  1M1K C;  1LJO A;  4A4K A;  1VQ9 T;  3REA B;  4XAX B;  4Q5W A;  2K4Y A;  2MAM A;  5I11 A;  1GL5 A;  1V1C A;  1GXI E;  2ZPI B;  4DEY A;  3QO3 A;  2D1X A;  4D8D A;  2K6D A;  3CPF A;  4ZGJ B;  3EH1 A;  4KGX B;  1Q86 C;  2ED0 A;  2CP3 A;  2QDL A;  3CC4 Q;  3OYB A;  1M2V A;  2XG8 D;  2QQS A;  2P84 A;  5GAM h;  4NS5 A;  1VQ8 Q;  2VAS A;  1RI0 A;  3CCL T;  1SRM A;  5CVI A;  1U1T A;  1W2B S;  4NL3 A;  3X26 B;  5IXF A;  3TSZ A;  1WJQ A;  2QA4 Q;  2P4T A;  1BYM A;  2RJF A;  3C0C A;  5AT1 B;  1X01 A;  1M3A A;  1MV0 B;  4N4I A;  4RG8 A;  4BI8 B;  4EMH A;  1SHF A;  1BB9 A;  1NLP C;  5GAO r;  3JCM X;  1XNI A;  2PU9 B;  2XDD A;  3KUF A;  4PLI A;  1VYU A;  2RMO A;  2NUP B;  4VUB A;  5GMK j;  1VQK T;  2X51 A;  2IVW A;  1BCO A;  1VQ6 T;  2HD0 A;  1OI1 A;  2LNV A;  3CCE A;  2Z0W A;  2O2O A;  2DEQ A;  3G4S A;  4IUT A;  3V8J A;  2RQW A;  3O8V A;  4HT9 A;  1QLY A;  2A0F B;  2WSC E;  1WGS A;  3VV0 A;  1ABO A;  3BW1 A;  1XTD A;  2RK2 A;  4IUP A;  5IHN A;  2AKK A;  2JOY A;  4RMO A;  3H6Z A;  3P8B B;  2VV5 A;  4M7A B;  3CCL Q;  5GAO q;  2FO0 A;  1YI2 A;  3OBW A;  4J9B A;  3R6O A;  3CBP A;  1WQW A;  3S6W A;  1E7O A;  1UFF A;  4GLM A;  2CP5 A;  1YJW T;  2PVD B;  5CKB A;  3EH2 A;  3CCS Q;  4GLK A;  3FEO A;  1KQS S;  2GCX A;  4JLI A;  3CCS T;  2O88 A;  2EPD A;  4C92 E;  2A36 A;  4F7U B;  1H3H A;  4J7F A;  2DD5 A;  5KYU A;  3OW2 S;  2RHU A;  3NPF A;  5GAN 3;  1WIE A;  4V2S A;  2XKO C;  1HXD A;  2YRD A;  4HVV A;  1BI2 A;  1HYO A;  2X4Y A;  4M77 B;  5IAY A;  2EYY A;  4JRP A;  2O31 A;  3G1J A;  3JSC A;  1VQ9 A;  4M77 D;  1TUG B;  3PGG A;  3G71 T;  4C5I A;  5LJ3 e;  2E4H A;  1I07 A;  1Q81 R;  2CRE A;  3I5R A;  2LC4 A;  4M75 C;  1LVK A;  1WHK A;  3M0T A;  2GTO A;  3VRY A;  1KQS A;  2X3X D;  3EGX A;  2OTJ A;  1Y07 A;  1N8R R;  1D09 B;  2EJ9 A;  5IHK A;  5FW9 A;  1PKT A;  1RLQ C;  1X2Q A;  3G71 A;  1ZUK A;  4RTZ A;  3LYI A;  2FRW A;  3SWN C;  4KUD K;  2DM1 A;  3MHX A;  1LPL A;  3DLM A;  2X3W D;  1WXB A;  1SSH A;  2GGR A;  4ESR A;  4XU1 A;  3V7R A;  2FHD A;  3F70 A;  2DE0 X;  1N8R U;  5GAO p;  2LT1 A;  2VYT A;  2RHI A;  2LCL A;  6AT1 B;  2LJ1 A;  4M7D D;  2YUN A;  4XTV A;  3CXC A;  1MGQ A;  4EDU A;  4O5V A;  2M16 A;  3P8H A;  3L2Z A;  2M9U A;  1KD1 C;  3OYJ A;  2RHY A;  1PKS A;  1HJD A;  1WHJ A;  1EIF A;  1UHC A;  2CUD A;  4IUQ A;  5I2M A;  3G6E A;  4ELY C;  3CCU Q;  3RES A;  4A63 B;  3WVE B;  1FXX A;  1VQN A;  1AT1 B;  3J7A F;  1TUD A;  1AWO A;  1HD3 A;  4KGZ B;  4M77 E;  2ATC B;  1BIA A;  2CZ7 B;  3VU3 C;  2HCK A;  3BFM A;  3OA6 A;  1NG2 A;  2JTE A;  3LH5 A;  3EGD A;  4AMC A;  3S3N A;  1BKB A;  1I1J A;  3TEE A;  2FZC B;  3RKX A;  2DAQ A;  4J9I A;  3AHU A;  2NUZ A;  1OOT A;  1WHH A;  1VQ8 T;  1QCO A;  4RTV A;  2JMA A;  2OI3 A;  5D7U A;  4LN2 A;  5A0L A;  3WXM B;  4QVZ A;  4C8Q F;  3S3O A;  5GAM e;  3QXE B;  3CPW S;  4C92 B;  1I5L A;  1XOV A;  2KRM A;  3QWY A;  3M0R A;  4J9C A;  5GAO n;  4Y91 A;  3CCV Q;  1WHL A;  4BY6 C;  1VQO A;  3A8L B;  1PNJ A;  2KR3 A;  3NHN A;  3OYG A;  1K73 U;  2BKD N;  1JBM A;  2XDB A;  3CCM A;  5GAN j;  1Q86 U;  3CPW P;  2KNB B;  2E3H A;  1UGV A;  1YWP A;  2LZ6 B;  3TVT A;  3HKS A;  3CMA A;  2BZX A;  1TUC A;  3I5S A;  4M7A E;  3ZEH A;  2HEQ A;  1X43 A;  1V76 A;  2QYZ A;  3J81 E;  1MMN A;  4OB2 B;  3UT1 A;  4KH1 B;  1NYG A;  1M8M A;  3LLR A;  3X24 B;  5LJ3 d;  4BI4 A;  2DKG A;  1PRM C;  5J39 A;  1YHQ Q;  2IIM A;  3LGL A;  1N27 A;  1KC8 U;  2RJD A;  2VXF A;  5KYY A;  1VQ7 A;  5ECA A;  4PNO A;  2RD1 A;  2KK4 A;  3VS1 A;  3JV3 A;  3A8H B;  3C94 A;  5FU7 C;  2JXB A;  3BE3 A;  4M75 G;  3OW2 P;  1F1B B;  3CPW A;  2XU8 A;  4OMN A;  1WHG A;  2DZC A;  2KT8 A;  3I55 T;  3CCU A;  4PJJ A;  1D1C A;  4FW1 A;  4M75 E;  3P8D A;  3EGU A;  2CS7 A;  4AFZ C;  3E9F A;  1LNX A;  3I55 Q;  2K3B A;  5KE2 A;  2DL8 A;  3AT1 B;  1H92 A;  2V26 A;  2H8H A;  1FMK A;  1I4K 1;  1M3C A;  2L3R A;  4C0D B;  2D9T A;  3RKW A;  2EKO A;  2EQU A;  2MMP A;  2HDA A;  2YHT A;  1K8A R;  2C0T A;  1JO8 A;  2DNU A;  2QEX Q;  3CCQ T;  2DTH A;  5KYW A;  1K1Z A;  3UA7 A;  1X69 A;  3G71 Q;  4ZTF A;  2LTO A;  2W0Z A;  4C92 A;  3VRZ A;  1SRL A;  2B8A A;  5IHI A;  3MJX A;  4PJO F;  1N9S A;  3V8L A;  2LQN A;  1Q7Y R;  2J06 A;  1MV3 A;  1G3W A;  3JB9 D;  3I56 T;  2BUD A;  2RQU A;  3HP9 A;  2XIC A;  1FX7 A;  3FLG A;  1W2B P;  4IIM A;  3A8O B;  1X6B A;  4RG2 A;  2RPN A;  1KG1 A;  1M1K U;  1JB0 E;  1K8A C;  2CH4 W;  4AFS C;  3ZL7 C;  4KGV B;  1OUL A;  3Q1J A;  3QBY A;  4HCZ A;  2Y90 A;  2RQT A;  4EPC A;  3KFV A;  2A28 A;  5FU7 B;  4J9E A;  2JM9 A;  2IPO B;  1EX4 A;  2PTK A;  3PVQ A;  3EG3 A;  4OMO A;  1IO6 A;  4BY6 B;  5GMK m;  3M0P A;  5AYF A;  3CCM T;  1OV3 A;  5C6S A;  1M90 C;  2RNA A;  1OZ2 A;  5GAN 5;  2FZK B;  4QQ6 A;  1PCX A;  2LJ0 A;  2JM8 A;  1YJ9 T;  4M75 F;  1IB8 A;  3E2U A;  3CC4 T;  2B86 A;  4E6R A;  8ATC B;  1H8K A;  3CCL A;  4C0G A;  4PJM A;  4J9F A;  3V7C A;  4ME7 A;  1CKB A;  2DXT A;  4C0Z A;  3PTA A;  2RA2 A;  1TH7 A;  2F5T X;  4E7K A;  4DA4 A;  1T0H A;  2PUK B;  1KD1 R;  4QQD A;  4E7Z A;  5GAM j;  1M3B A;  4HT8 A;  1Q7Y C;  3T9N A;  4LE9 A;  3LWI A;  3L2Q A;  3EGX B;  3ME9 A;  5GAN f;  2HZY A;  3QWX X;  4FT2 A;  1ARK A;  2EGA A;  1G3T A;  1AD5 A;  4Z8A A;  1M9S A;  3LWH A;  3OYA A;  3M53 A;  1AVZ C;  1OU8 A;  2DK3 A;  3QUI A;  1Q82 U;  1VQL T;  2M1H A;  1WPY A;  2H3J A;  5GMK h;  4E7L A;  2DET A;  3RKY A;  2DVE A;  2CP6 A;  4PL6 A;  1YJN A;  5KYW B;  4E7H A;  3OS5 A;  1GCP A;  2VGM A;  2YWW A;  3A8G B;  1Q82 R;  2WSE E;  4BI3 A;  1PSE A;  4MML A;  5LJ3 g;  4M7D G;  4FCY A;  1M1G A;  2X4X A;  5HY6 A;  4MZM A;  3DKM A;  4J6W A;  2KGT A;  2A08 A;  2QQB A;  1A0N B;  3M9Q A;  4C8Q D;  2LX7 A;  4HCK A;  4LNP A;  5LJ5 j;  1AOJ A;  3VS6 A;  4QVC A;  1UE9 A;  1WDX A;  7AT1 B;  1U8R A;  1TG0 A;  1FMV A;  3LX7 A;  1M5Q 1;  1S72 T;  3QHS A;  4F16 A;  2HSE B;  3L2V A;  1YN8 A;  2GFA A;  4AFU C;  4M7A A;  3PT9 A;  2EIF A;  4E7J A;  1KK7 A;  4FIB A;  2YT6 A;  4Y92 A;  2BZY A;  5LJ5 f;  1KSW A;  1RAH B;  1NPP A;  3CME A;  3CCR T;  2LDM A;  4M77 C;  2CSI A;  1W6X A;  2EFI A;  2CUB A;  2E12 A;  3BY7 A;  1K8A U;  3CC2 T;  1SSF A;  3MKD A;  5J26 A;  1NJI C;  1SEM A;  3N5B B;  2ED1 A;  2L2P A;  4MDX A;  3M5A A;  3H9N A;  3OYL A;  1NE8 A;  4YTL A;  3CXC P;  3QDF A;  1VIE A;  2EKH A;  1LCK A;  2DZ9 A;  3E1S A;  2C06 A;  3IQL A;  2O4X A;  5GAN 2;  3EG9 A;  1U06 A;  3CC4 A;  2F69 A;  2F2W A;  1K9M C;  3CXC S;  2X4J A;  1PG5 B;  5D6W A;  4IUR A;  3EG2 A;  4KRT A;  2K3X A;  3GOX A;  3SWN A;  2FG0 A;  4PFP A;  2L3Q A;  4PK4 A;  4QVD A;  2EW3 A;  3MP1 A;  3A5Z B;  4E7I A;  1G83 A;  2RHZ A;  1VYV A;  1ABQ A;  2KI7 A;  2EBP A;  3RMQ A;  2J05 A;  4CI0 C;  1SKU B;  2E70 A;  2PNI A;  2RH2 A;  2JMC A;  1Y96 B;  4F14 A;  1P92 A;  2AIR B;  4KUI A;  2YUP A;  3VYG A;  1YIJ T;  5GJV B;  4JDS A;  3TSW A;  5L23 A;  2QDY B;  3M57 A;  4Z88 A;  4FT4 A;  3ASK A;  3HFN A;  5LJ5 h;  2JZ2 A;  4A54 A;  3CCE T;  3E19 A;  3WVD B;  2D8H A;  2KVQ G;  3C12 A;  4C8Q G;  2MIO A;  4XTY A;  2LQW A;  4D8K A;  2YUO A;  1M27 C;  1BIB A;  1UGQ B;  2EJF A;  2LQ8 A;  4M4Z A;  2E6Z A;  2JT4 A;  5IXB A;  2ZPB B;  4ZN3 A;  1V29 B;  3H0F A;  2CP2 A;  1PD1 A;  2BE9 B;  2KYB A;  1QKX A;  4L6V 5;  1KC8 R;  2RI3 A;  1YHQ T;  1Q81 C;  1JXO A;  5FU6 B;  1YI2 T;  2F2V A;  1ZUU A;  4FSX A;  5GMK l;  1U5S A;  4JS5 A;  2QA4 T;  2NUP A;  2GF7 A;  4J7I A;  1IGQ A;  4ZNX A;  2ZAE A;  5FWB A;  3M55 A;  3C95 A;  1N5Z A;  5CO7 A;  4AT1 B;  2KRO A;  2OTJ T;  4B9W A;  2KDS A;  1N9R A;  3RR6 A;  2HSP A;  1U1S A;  4DOW A;  1B34 A;  1ZA1 B;  2Y4X A;  5CKE A;  3MEU A;  2E41 A;  3CCM Q;  2A3L A;  1QVF P;  2RI2 A;  2MF2 A;  4AFQ C;  5GAN 7;  1W70 A;  2DF6 A;  1D1B A;  2OTL Q;  1JU5 C;  3EHQ A;  1VQO Q;  1C6V X;  3JB9 H;  1CKA A;  5EC7 A;  1VQM A;  2HL5 C;  3EFS A;  5FRO A;  2DIL A;  2KMT A;  1H3Z A;  5A0D A;  1UDL A;  4KT0 E;  4A53 A;  5FRM A;  4M78 D;  2ENM A;  2AK5 A;  4C8Q B;  2LQK A;  2SRC A;  1YCY A;  2J6O A;  5DLQ E;  2RJE A;  4M77 G;  4C5H A;  2RQR A;  3PMT A;  4AG2 C;  2W10 A;  2FEI A;  1ZSZ A;  4OGE A;  1VQK A;  3FRN A;  2D0N A;  2EYQ A;  4A4F A;  1LOJ A;  3VS7 A;  4OB1 B;  3NTH A;  1PM3 A;  4BD3 A;  3G4S T;  2XK0 A;  1I0C A;  1VQN Q;  1W2B A;  2Y4Y A;  1I81 A;  1YFN A;  4JJN K;  5GMK i;  1UTI A;  2K5I A;  3TRE A;  2DXC A;  3L42 A;  1KQ2 A;  3G6E T;  4X9D A;  4JRQ A;  3M0U A;  2CZ6 B;  2SEM A;  3BDU A;  1VQ4 Q;  3OSV A;  2CSQ A;  2E5Q A;  3EG1 A;  2LT4 A;  1WJR A;  1MMA A;  3UDC A;  2XD0 A;  3X20 B;  5J3B A;  4EMK B;  3RDV A;  4EIK A;  4M78 G;  4R55 A;  1IHV A;  2G6F X;  4A4E A;  5FU6 C;  3VS0 A;  3VYH B;  2YSQ A;  1Q86 R;  3HRT A;  3H0H A;  3JB9 I;  4DBF A;  3GLX A;  3MEA A;  4LD6 A;  3CQT A;  2ROT A;  3H8Z A;  2CKK A;  3H41 A;  4BDZ A;  3U23 A;  2OTL T;  3ULR B;  3QZ5 B;  4LDY A;  4J9H A;  1VQ7 T;  1WZO A;  2O9V A;  3L2U A;  1QVF A;  4CC4 B;  5A0G A;  3G6E Q;  2OX7 A;  2WSF E;  2GNC A;  4PJO E;  3OBY A;  1K76 A;  3UAT A;  1G3S A;  1RAF B;  4DQ2 A;  4E7S A;  1ZBX A;  4QT7 A;  3RER A;  2NWM A;  2EQI A;  2CDT A;  2QTX A;  1TOV A;  5HK0 A;  2ABL A;  2DIQ A;  3JCM h;  2E6N A;  3V8K A;  1NPR A;  4XTW A;  3I35 A;  2BE7 D;  1Z9Q A;  1GBR A;  1Y0M A;  2DTI A;  4M78 A;  2RK1 A;  3HRU A;  3VS5 A;  5I21 A;  2QQA A;  1UHF A;  4OML A;  1AHJ B;  1OZ3 A;  1VQP A;  4J83 A;  1WJS A;  2FPF A;  2A7Y A;  2PVG B;  2BZ8 A;  1K9A A;  1UJY A;  3OY9 A;  4BE1 A;  1ZSZ B;  4RTW A;  1K0X A;  2DX1 A;  4MDW A;  3CCU T;  2K57 A;  2KRN A;  3GF5 A;  1WA7 A;  4ELZ C;  1RAE B;  3UWN A;  3BDL A;  4QW2 A;  2H3E B;  4IIO A;  3QZ9 B;  4RKU E;  1AZG B;  2F5K A;  1IZ6 A;  1IGU A;  3RUX A;  4C92 F;  5DY9 A;  2PZ1 A;  4CC7 A;  1IRE B;  2MOX A;  3CC2 Q;  2DTO A;  4PJO A;  2EQJ A;  1WHM A;  4HCB A;  1FWZ A;  2R5M A;  1VUB A;  3MEV A;  1SF9 A;  4JUV A;  2L8D A;  4XK8 E;  2AT1 B;  3CCQ A;  2COW A;  2JS0 A;  4OMM A;  3JCM e;  1VOM A;  2DL5 A;  4M7D B;  2M02 A;  4L59 A;  1IHW A;  2FRY A;  3TU4 K;  1TXQ A;  1NJI R;  1CSK A;  1JJ2 P;  5CK9 A;  1QVG S;  2HBP A;  1KFZ A;  2HKQ B;  5FLX E;  1YI2 Q;  3CME Q;  2R5A A;  9ATC B;  3J80 E;  1M2O A;  3JCM J;  2QK0 A;  1UB4 A;  1K73 C;  3GPL A;  3CC2 A;  4BE2 A;  2MPX C;  1I5O B;  2RN8 A;  2ROL A;  3C4S A;  3M0Q A;  4PJL A;  2QEX T;  1JQQ A;  3G4S Q;  2DFU A;  2JUF A;  2DL7 A;  3CCE Q;  5GAN 8;  2K79 A;  2QAS A;  2VXE A;  1OU9 A;  4F04 B;  4IUV A;  3OSS C;  4PFO A;  3E9G A;  2R57 A;  1RAC B;  2COY A;  5CCA A;  2FYK A;  1DJ7 B;  4JRK A;  3M4G A;  1Y57 A;  4UC4 A;  3MCA B;  2DJQ A;  1EZZ B;  1RI9 A;  1TSF A;  3GBQ A;  3JB9 F;  1TS9 A;  2YXY A;  1E6G A;  2GTJ A;  2OAU A;  1ZSG A;  4RTY A;  2RO0 A;  2RB6 A;  2DER A;  4II1 A;  1UUE A;  4B6M A;  1BU1 A;  3CBO A;  2KQW A; 
#chains in the Genus database with same CATH homology
 3NPF A;  1WIE A;  3NMZ C;  2F2W A;  1KIK A;  1B07 A;  3EHR A;  4HVV A;  3O5Z A;  2DMO A;  3I9Q A;  2EYY A;  3EG2 A;  3VS4 A;  4KRT A;  2JS2 A;  2O31 A;  2DL3 A;  1ZUY A;  2VKN A;  2C0I A;  2FG0 A;  2DVJ A;  2L3Q A;  3M0S A;  2CT4 A;  2EW3 A;  1I07 A;  2CRE A;  3I5R A;  2KBT A;  1G83 A;  3M0T A;  1VYV A;  2BTT A;  1ABQ A;  2GTO A;  3VRY A;  2KEA A;  5IH2 A;  2EBP A;  2X3X D;  2O9S A;  1X2K A;  2J05 A;  1YCS B;  4OMP A;  4CC2 A;  1OPK A;  5IHK A;  2EVR A;  5FW9 A;  1S1N A;  2PNI A;  4FSS A;  1U06 A;  1EFN A;  1PKT A;  2JMC A;  1G2B A;  1RLQ C;  1X2Q A;  4F14 A;  1ZUK A;  2P4R A;  4RTZ A;  5HCK A;  2FRW A;  2YUP A;  1GBQ A;  2DM1 A;  5GJV B;  1J3T A;  2M51 A;  2L3P A;  2X3W D;  1WXB A;  3TSW A;  1SHG A;  1SSH A;  2RQV A;  5L23 A;  2GGR A;  4ESR A;  2DE0 X;  1ZBJ A;  4Z88 A;  2LJ1 A;  4GBQ A;  2EGE A;  2YUN A;  2CT3 A;  2F2X A;  1JXM A;  2D8H A;  1W1F A;  1AWW A;  2MIO A;  4JZ3 A;  2LQW A;  4D8K A;  2YUO A;  1HJD A;  1PKS A;  2E5K A;  4HVW A;  2DBM A;  1M27 C;  2EYZ A;  1UHC A;  2CUD A;  4M4Z A;  2JT4 A;  2KE9 A;  4A63 B;  5IXB A;  3H0F A;  1TUD A;  1AWO A;  2KYB A;  1WI7 A;  1HD3 A;  1QKX A;  1WFW A;  2K9G A;  1YWO A;  1JXO A;  1X6G A;  2F2V A;  3SHW A;  2HCK A;  1ZUU A;  1U5S A;  1NG2 A;  4HXJ A;  2JTE A;  2KRS A;  3LH5 A;  1WXT A;  1I1J A;  2VWF A;  4ZNX A;  1U3O A;  1GFC A;  1NEB A;  5FWB A;  1N5Z A;  4J9I A;  2KRO A;  2NUZ A;  1OOT A;  3NGP A;  2HSP A;  4J9D A;  4RTV A;  2DA9 A;  2JMA A;  2OI3 A;  4J9G A;  4RTT A;  4LN2 A;  2DRK A;  2GQI A;  1GCQ A;  5GJW B;  1PRL C;  4AFQ C;  1W70 A;  2DF6 A;  2I0N A;  1JU5 C;  2ECZ A;  3REB B;  4AG1 C;  1AZE A;  1XOV A;  3EHQ A;  2KRM A;  3QWY A;  3M0R A;  2XMF A;  4J9C A;  1NM7 A;  1PNJ A;  2KR3 A;  1CKA A;  5EC7 A;  3NHN A;  2AZV A;  2LJ3 A;  1Z9Z A;  2DIL A;  4JJB A;  2DRM A;  2KNB B;  4K11 A;  1UDL A;  1UGV A;  1YWP A;  1WXU A;  2LZ6 B;  4F17 A;  3TVT A;  2BZX A;  1TUC A;  2ENM A;  3I5S A;  2AK5 A;  2FPE A;  2SRC A;  3THK A;  2HEQ A;  1X43 A;  3EG0 A;  2J6O A;  3FJ5 A;  3RNJ A;  1NYG A;  1M8M A;  2RQR A;  4AG2 C;  1PRM C;  2W10 A;  2FEI A;  2IIM A;  3R6N A;  2YDL A;  1GFD A;  4RTU A;  1K0S A;  5ECA A;  2D0N A;  3VS1 A;  3JV3 A;  2JXB A;  3VS7 A;  4JZ4 A;  1ZX6 A;  1I0C A;  4OMN A;  1WX6 A;  2DBK A;  2KT8 A;  1M30 A;  2EYW A;  1UTI A;  1PHT A;  3EGU A;  4AFZ C;  3H0I A;  4R0K A;  1ZLM A;  4DEX A;  1T3S A;  2K3B A;  1AEY A;  3M0U A;  2A37 A;  2DL8 A;  1H92 A;  2H8H A;  1FMK A;  2SEM A;  1JEG A;  1M3C A;  5FWC A;  2VVK A;  2CSQ A;  3VS3 A;  1KJW A;  2KT1 A;  4LUE A;  2K2M A;  3EG1 A;  2HDA A;  4JJC A;  2C0T A;  1JO8 A;  2DNU A;  2RF0 A;  4EIK A;  4CC3 A;  1K1Z A;  3UA7 A;  1X69 A;  2LNH B;  1NLO C;  2G6F X;  1VYT A;  2W0Z A;  3VS0 A;  2YSQ A;  3VRZ A;  1SRL A;  5IHI A;  2KXC A;  1RLP C;  2LQN A;  1BK2 A;  3H0H A;  1E6H A;  2J06 A;  1MV3 A;  2LCS A;  1VA7 A;  4Z89 A;  1UG1 A;  2M0Y A;  1BBZ A;  1T0J A;  5I22 A;  3CQT A;  2RQU A;  2ROT A;  3H41 A;  1FYN A;  1HSQ A;  4X1V A;  3U23 A;  3ULR B;  3UA6 A;  4J9H A;  1B3Q A;  4IIM A;  2C0O A;  1WYX A;  2HBW A;  2O9V A;  4CC4 B;  1X6B A;  2RPN A;  1QCF A;  2CH4 W;  4AFS C;  3ZL7 C;  2L0A A;  1GCQ C;  2YUQ A;  1YP5 A;  2GNC A;  1K76 A;  3UAT A;  2J6K A;  2EGC A;  4QT7 A;  2RQT A;  2NWM A;  3KFV A;  2A28 A;  2EQI A;  2OAW A;  4J9E A;  2JM9 A;  2AZS A;  2CDT A;  1AWJ A;  2ABL A;  1YNZ A;  2PTK A;  3PVQ A;  1AWX A;  1QKW A;  3EG3 A;  4OMO A;  1IO6 A;  1QWF A;  2DYB A;  3I35 A;  2OJ2 A;  3M0P A;  1OV3 A;  1Z9Q A;  1SPK A;  1GBR A;  1Y0M A;  3VS2 A;  2K7A A;  2RNA A;  3VS5 A;  1GRI A;  4OML A;  1UHF A;  2JW4 A;  1K4U S;  2V1Q A;  3PVL A;  2LJ0 A;  2JM8 A;  2MCN A;  1UJ0 A;  2FPF A;  3SEM A;  2BZ8 A;  2B86 A;  3UF4 A;  4RTX A;  4E6R A;  1H8K A;  4LUD A;  2LMJ A;  2FPD A;  4J9F A;  1K9A A;  1OEB A;  1UJY A;  1NEG A;  2KYM A;  1CKB A;  2GBQ A;  4JPB W;  4RTW A;  1UEC A;  1K0X A;  2DX1 A;  1T0H A;  2KRN A;  1WA7 A;  3REA B;  5I11 A;  1NYF A;  1GL5 A;  1T3L A;  1V1C A;  4IIO A;  2LP5 A;  4DEY A;  1AZG B;  2D1X A;  4D8D A;  1M3B A;  2K6D A;  4LE9 A;  2PZ1 A;  4CC7 A;  2ED0 A;  2MOX A;  2QDL A;  3QWX X;  3RBB B;  1ARK A;  2EGA A;  1AD5 A;  1WLP B;  4Z8A A;  2L3S A;  1PWT A;  2ESW A;  1AVZ C;  1SRM A;  2JS0 A;  4OMM A;  5IXF A;  2DL5 A;  3TSZ A;  1QWE A;  2CH4 A;  3C0C A;  2FRY A;  1M3A A;  1MV0 B;  1CSK A;  1SHF A;  1NLP C;  1BB9 A;  1GCP A;  1OPL A;  1VYU A;  1KFZ A;  2RMO A;  2V1R A;  2KGT A;  2A08 A;  1A0N B;  2O2O A;  2DLP A;  2LX7 A;  4HCK A;  4LNP A;  2RN8 A;  1AOJ A;  3VS6 A;  2ROL A;  1UE9 A;  3M0Q A;  1WDX A;  2DL4 A;  2RQW A;  1TG0 A;  1QLY A;  2D8J A;  4F16 A;  1JQQ A;  3A98 A;  1ABO A;  1YN8 A;  2DL7 A;  5IHN A;  4AFU C;  2AKK A;  2K79 A;  2J6F A;  2YT6 A;  4Y92 A;  2BZY A;  2KXD A;  1MUZ A;  1KSW A;  2EYX A;  2FO0 A;  4RUG A;  4J9B A;  1X27 A;  2CSI A;  1W6X A;  4OMQ A;  1E7O A;  1UFF A;  4GLM A;  2CUB A;  4JJD A;  1Y57 A;  2DJQ A;  1RI9 A;  4HVU A;  3GBQ A;  1RUW A;  1SEM A;  2ED1 A;  3PE0 A;  2L2P A;  4WCI A;  2AKL A;  1E6G A;  2GTJ A;  2O88 A;  2EPD A;  2A36 A;  1ZSG A;  2EKH A;  1LCK A;  4RTY A;  1H3H A;  1UUE A;  4ORZ A;  3IQL A;  2J7I A;  1BU1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...