2DLPA

Solution structure of the sh3 domain of human kiaa1783 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
85
structure length
85
Chain Sequence
GSSGSSGSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1783 protein
publication title Solution structure of the SH3 domain of human KIAA1783 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dlpA00
1QWFA 2CSQA 1ABOA 2LMJA 4J9BA 2DL8A 2YUNA 1RLPC 4AG1C 3ZL7C 2EGAA 4IIMA 2EGCA 4GBQA 2SEMA 4RTTA 4F17A 1T3SA 2NWMA 1SSHA 1ZSGA 2DJQA 1RI9A 2GTOA 1W1FA 1AVZC 2OJ2A 4KRTA 2DBKA 4F14A 1K9AA 1KFZA 4LUDA 2P4RA 4FSSA 3UF4A 3C0CA 2KEAA 1U3OA 3SEMA 1JQQA 3THKA 4OMQA 4X1VA 4CC2A 1NYFA 1A0NB 1Z9QA 4CC4B 1JO8A 2ROTA 2EBPA 1UFFA 5IHKA 1SRMA 2DILA 2AZSA 3M0TA 5FWBA 2ENMA 2FG0A 1UGVA 3REAB 2KE9A 3I5RA 2RMOA 2CSIA 2SRCA 1QKWA 3QWXX 4Z88A 1TUDA 2LZ6B 3UATA 2C0IA 3JV3A 1K76A 2RQUA 1Y57A 3LH5A 1JEGA 2J06A 2CT3A 4JPBW 1GBQA 1QCFA 3EG1A 2EGEA 2EYWA 2ROLA 2MCNA 2GQIA 4ORZA 2X3XD 2H8HA 4LUEA 2FRWA 2J6OA 2JW4A 3UA7A 1UJYA 4D8KA 4RTYA 2HDAA 2F2VA 1WA7A 1PKSA 1X2QA 4OMPA 1UDLA 4D8DA 2AZVA 1AWJA 1AWOA 4OMLA 3M0SA 2AKLA 1AZGB 1IO6A 1UE9A 1HSQA 3EHQA 2QDLA 2VWFA 2EVRA 2X3WD 2KRNA 2DRKA 2DVJA 2DLPA 3VS0A 1UECA 2K79A 2YUQA 1AWWA 1YWOA 2K3BA 1SRLA 2BZ8A 2EYYA 4AFUC 1MV3A 2VVKA 1K0SA 2V1QA 1UJ0A 1MUZA 2CUBA 2KT8A 2K7AA 5GJWB 2O31A 4RUGA 1I07A 1TG0A 4J9CA 2L0AA 1M27C 2KXCA 1SHGA 2BTTA 2JMCA 1UG1A 3VS5A 1HJDA 1M3AA 2GTJA 2JM8A 1XOVA 1OOTA 5IH2A 2DYBA 2LQWA 4RTZA 1ZLMA 3KFVA 2FRYA 3H0HA 5IXFA 4E6RA 3UA6A 3RBBB 2F2XA 3VS7A 1AZEA 1VYTA 1WDXA 2A08A 1BK2A 3PVQA 1BBZA 4J9IA 1UHCA 1UUEA 1X27A 2GBQA 3SHWA 1PWTA 2CREA 2KYMA 2DM1A 1U06A 1CKBA 4RTUA 2AK5A 1AD5A 2RN8A 1PRMC 1BU1A 1X2KA 3A98A 1CSKA 1T0HA 4GLMA 2B86A 2D1XA 2K2MA 4LE9A 1RLQC 4AFSC 1K4US 1X6GA 2RQRA 3PE0A 2KRSA 2LJ0A 1B3QA 3NMZC 1Y0MA 2DL7A 5GJVB 1GCPA 1WLPB 2DL4A 2LCSA 4HVUA 3RNJA 3R6NA 2LQNA 2J6FA 1GRIA 5I11A 1X43A 3ULRB 1NLOC 2A36A 1UHFA 2IIMA 3I5SA 4OMNA 4J9EA 2C0TA 4JJDA 5EC7A 3EG0A 1KIKA 2LJ3A 4F16A 3VRZA 2DE0X 1WXBA 2EQIA 3I9QA 2JM9A 3VS2A 2DL3A 1NLPC 1V1CA 1WYXA 4RTXA 2OAWA 5IXBA 2LP5A 2O9SA 2HSPA 3M0UA 2GGRA 1W70A 4JJCA 1WX6A 2CT4A 2O88A 3H0IA 1M3CA 1G2BA 4HXJA 4CC7A 1VYVA 1NM7A 2PNIA 4RTWA 1E6HA 5ECAA 2JS2A 3H0FA 2DF6A 1ZUYA 5HCKA 4LN2A 1AWXA 2K9GA 4J9HA 2E5KA 1T3LA 4AG2C 2CDTA 2YDLA 2G6FX 4AFQC 2HEQA 2KYBA 2PTKA 2YSQA 2ED1A 2JS0A 5IHIA 1TUCA 2CUDA 1N5ZA 2HCKA 2NUZA 2RPNA 1G83A 4A63B 3REBB 3TVTA 1I0CA 1VYUA 2FEIA 2RF0A 2YUPA 1H8KA 1UTIA 1KSWA 1YN8A 2VKNA 4R0KA 4DEXA 2BZXA 1PKTA 2K6DA 2EW3A 2LNHB 1WFWA 1U5SA 2EKHA 2DNUA 1AEYA 3U23A 2DMOA 2DA9A 4EIKA 4Y92A 1H92A 4HCKA 1OPKA 3NGPA 4JJBA 1CKAA 1GCQA 1YP5A 1ABQA 2W0ZA 2I0NA 1ZBJA 2JTEA 2V1RA 2DX1A 3GBQA 1H3HA 1FYNA 1RUWA 2ABLA 4J9DA 3EG2A 2L3PA 1PRLC 1GL5A 4ZNXA 4QT7A 1VA7A 1ZUKA 3TSZA 3M0QA 3M0RA 2FO0A 2JXBA 2FPEA 3I35A 1JU5C 3M0PA 1LCKA 1M30A 2EPDA 3H41A 2KNBB 4RTVA 2RQTA 1E7OA 2MOXA 4IIOA 2YT6A 4DEYA 1EFNA 1GBRA 2D0NA 4Z8AA 1Z9ZA 3EHRA 2KBTA 2FPFA 4ESRA 1QWEA 1NG2A 1WI7A 3NHNA 3VS1A 3FJ5A 1OV3A 5FWCA 2O2OA 4Z89A 1YCSB 2ECZA 4M4ZA 2D8HA 2AKKA 3VS4A 2GNCA 2RQWA 2ESWA 1GFCA 1S1NA 4K11A 2DL5A 2KR3A 2KXDA 1E6GA 3CQTA 4WCIA 1SEMA 5I22A 1ZX6A 2KROA 2KRMA 2ED0A 5L23A 3VS3A 2M0YA 4OMOA 2JT4A 1HD3A 2CH4A 2YUOA 2PZ1A 4J9GA 1JXOA 1T0JA 1WIEA 2L2PA 4LNPA 2LJ1A 3PVLA 1ARKA 1FMKA 2J6KA 4OMMA 1GFDA 2MIOA 3QWYA 2HBWA 4HVVA 1PHTA 2OI3A 1M3BA 4AFZC 2M51A 1QKXA 3NPFA 5IHNA 1WXTA 1GCQC 2L3QA 1YNZA 1NYGA 1NEGA 1K0XA 2L3SA 3VRYA 1B07A 1MV0B 1WXUA 1PNJA 2O9VA 2A37A 4JZ3A 1NEBA 1QLYA 3O5ZA 2C0OA 1J3TA 1SPKA 2EYZA 4HVWA 2F2WA 2RQVA 1YWPA 2DRMA 4CC3A 1SHFA 4J9FA 3EG3A 2A28A 1OPLA 1M8MA 5FW9A 2KT1A 1JXMA 1KJWA 2JMAA 2DBMA 2FPDA 1I1JA 2J7IA 1BB9A 4JZ4A 2LX7A 3IQLA 2J05A 2CH4W 3VS6A 1AOJA 2KGTA 2XMFA 1W6XA 2EYXA 1X6BA 3TSWA 1K1ZA 3EGUA 1OEBA 1X69A 1ZUUA 2W10A 2BZYA 2D8JA 2RNAA
chains in the Genus database with same CATH superfamily
3CCRT 3M55A 3FB9A 4RTTA 4F17A 1T3SA 5CK9A 1SSHA 2WSEE 4ZTFA 2P0KA 3OS2A 1W1FA 3G6EQ 2DBKA 2LX9A 5C0MA 3X25B 2OTJQ 1OU8A 3G4ST 4KGZB 4BI4A 2E10A 2YXYA 4KH0B 3SWNA 4J83A 4CC2A 2Z0WA 4UC4A 5GMKi 3LX7A 4CC4B 5KE3A 2L89A 4J8OA 3CCVT 3QDFA 5GAMh 4MMLA 4M78A 2I2LA 3TQ7P 8ATCB 5DLQE 1UGVA 3REAB 3VJPA 2YRVA 3I5RA 1QKWA 3OW2P 3JCMJ 4A4HA 2LZ6B 3UATA 1RI0A 2C0IA 3JV3A 3OYCA 2AIRB 1ACMB 1K76A 4PJOG 2J06A 4C8QG 1VQNA 2QK0A 1UGRB 2ROLA 3KXTA 2FYKA 2E4HA 4QVZA 4LUEA 2VC8A 2FRWA 2JNGA 4XU3A 1BIBA 4JUVA 2E3IA 4AMCA 2VGNA 5GAMj 1YJ9Q 1KC8R 3HP9A 2QTXA 3MCAB 2ZPBB 3PFSA 4JRIA 2DO3A 3CCRQ 3X28B 1QVGP 1VQNQ 2EWNA 4OMPA 3PIPA 4D8DA 4BY6B 4OMLA 1BI0A 3HFOA 1VQKQ 2BE9B 4DBRA 1UGSB 4BDZA 4ZN3A 3SWNC 2MPXC 2XK0A 4MDWA 3EHQA 3G4SQ 2E6NA 4NOYA 2VWFA 2F5TX 2KRNA 2DRKA 2DVJA 2CP7A 1UECA 2RB6A 4M7DD 4M78C 2EQJA 2K3BA 3PGGA 2EYYA 4A54A 1G5VA 1M1KC 1MUZA 1TOVA 2O31A 3BDUA 4JJNK 2L0AA 2X4JA 1MMGA 3MEWA 2BTTA 1UG1A 3EGDA 3M4GA 4ZGDB 1M3AA 1YJWA 1Q81U 3JCMh 2DYBA 3OY9A 4XTYA 1Q7YU 1HK9A 3CCQT 4E6RA 5CIUA 1B34A 5HY6A 3LGFA 3RBBB 5GMKe 2F2XA 4C92B 2HKQB 3OYJA 1X27A 2GBQA 1PWTA 1IGQA 3OYBA 4BACA 1FWZA 1WHLA 1YJWQ 4GY5A 2RN8A 2YHTA 3E1SA 1X2KA 3A98A 3JB9F 4O5VA 1VQ5Q 2B86A 2D1XA 4XAXB 3CMAT 2ZCFB 1YIJT 5GAOq 2LCSA 4FL6A 3S6WA 2DXBA 2EYQA 4BI3A 3CC4Q 3JRZA 2LQNA 2LVMA 2EJFA 3CXCA 3OMGA 1P92A 1FX7A 1YI2A 1S72A 1NLOC 3QKJA 1MGQA 4MDXA 1KHCA 4HA8A 4OMNA 1VQOA 3FRNA 1VQPQ 1Q82R 2RH2A 3EG0A 8AT1B 1I4K1 2LJ3A 2VB6A 2LTOA 4FW2A 2EQIA 1IZ6A 3VS2A 4XU1A 3FDRA 3M5AA 2JVVA 1NLPC 1XJWB 1TUGB 4ELZC 1D0ZA 2HSPA 4FW1A 1VQLT 1M1GA 5LJ3f 1W70A 5KYUB 3H0IA 1G2BA 1VYVA 1TH7A 2QXFA 2RO0A 2DIQA 2DF6A 3A8HB 4LDYA 4J6WA 1KQSA 1QMCA 3CCSQ 2E5KA 1T3LA 5FU7C 4N4IA 2CDTA 3WVDB 5IT9E 2YSQA 5I2SA 2ED1A 4M77E 4XTUA 4F7UE 2RA2A 3ER0A 3G71A 1N5ZA 3DKMA 3REBB 1I0CA 4FYXB 1IXDA 1UTIA 1KSWA 3DB4A 2VKNA 5M9OA 5FROA 2WSFE 1YIJQ 2EIFA 2K6DA 1U5SA 4EIKA 1H92A 2K3XA 4E47A 5GMKl 3NGPA 3RDVA 5CKHA 2ZGWA 5FLXE 1GCQA 2W0ZA 2CP2A 1XQHA 1ZA1B 1FYNA 4LDXA 1RUWA 3CC2T 4J9DA 5GAMe 4M7AA 3EG2A 4ZNXA 4IUQA 1YFNA 5GAN2 1ZUKA 3M0RA 5AT1B 5GANd 4JRQA 1XNIA 2FO0A 5GAOr 1JU5C 2EFIA 4M78E 3H41A 3OQ5A 4X9DA 4QVCA 3SFMA 1K9MU 1Q7YC 4Z8AA 3EHRA 3A1PA 1LVKA 1WZOA 4ESRA 3RIRA 2XG8D 4JLGA 3FJ5A 1VQMA 2QA4A 3NFCA 3A8LB 2ZPFB 2FVUA 5CKEA 2QDYB 4Z02A 3OYKA 5CQXA 4Y28E 3S3NA 3JCMg 1K8AR 1YITA 2ESWA 1GFCA 2KR3A 3VYGA 5LJ5h 2KROA 1UGPB 2KMTA 2RK1A 1BIAA 2HL3A 3MJXA 3I56T 4J9GA 4BI8B 4M75A 5HK0A 3PVLA 2JJ9A 1ARKA 3OW2A 2MIOA 2HBWA 2KSSA 3CC7A 1PHTA 3VU3C 5IAYA 1SG5A 5IHNA 1GCQC 3N5BB 4LD9K 2R5AA 1K0XA 1R77A 1RAGB 4PLLA 3CMET 2L3SA 3VRYA 4M78G 1PG5B 1PD1A 1PNJA 2A37A 4JZ3A 2DTHA 4EMKB 5I2MA 1IHWA 2K5IA 1TXQA 1RAEB 3JCMX 1SHFA 4J9FA 3EG3A 3RKWA 5GAN6 4FCYA 3MP6A 2A28A 2MWPA 2RD1A 4BE2A 2DBMA 3VV0A 3JCMe 3RKYA 1Q82U 2ZZDA 3IQLA 4ZTJA 3VYHB 5GAOn 3JB9J 5KYXA 5CKFA 2OTLT 5LJ3d 2XDBA 3LGLA 1PSFA 4OF1A 1XTDA 5KYWB 1G3TA 1D1BA 4PJOB 3I55A 2D8JA 5FU6B 4DBHA 3TU4K 2CSQA 4J9BA 2EGAA 1M5Q1 1QP2A 3QPHA 4IIMA 4XU2A 4C5IA 3LH0A 4M75C 2GFAA 3I56Q 4A4EA 1YBYA 2VYTA 2DJQA 2XDDA 4KRTA 2VASA 4F14A 2L3RA 1K9AA 2IVWA 2QASA 4FSSA 2QAZA 4QVDA 3M58A 5EG2A 4ZGEB 4X1VA 2LCLA 2DD5A 4LDVA 1A0NB 1Z9QA 4LDUA 4DBFA 3HFNA 2ROTA 2QG9B 2ZPEB 3CPWP 1UFFA 2K4YA 1SRMA 2DILA 3RR6A 3M0TA 1K9MC 2ENMA 2M1HA 3EAEA 2KE9A 4EPCA 4C5GA 2QGGA 2RMOA 1D09B 4QW2A 2SRCA 3OYYA 4Z88A 3OB9A 4C0DB 1IRXA 3JB9I 1QP3A 2Y4YA 1NZ9A 3MEVA 1Y57A 2OTJT 1TSFA 2CT3A 1VQ7A 1M8VA 2EGEA 2P84A 3RMQA 2GQIA 4ORZA 3MEAA 4JRPA 1VQ8Q 1WJSA 1UJYA 4D8KA 1Q95G 1KD1U 1YCYA 1Q81R 2LC4A 1X2QA 2ZPIB 1SSFA 2D0QB 3S3OA 3VUBA 3OMCA 1UDLA 2AZVA 3CXCS 2HBPA 3NTIA 4ZN1A 5LJ5g 3CCMA 3M0SA 1BI3A 2XI9A 1VOMA 1UE9A 1HSQA 3H6ZA 2EVRA 2X3WD 1M4ZA 2DLPA 3VS0A 2K79A 2YUQA 4C8QD 4ATOA 1AWWA 4ANJA 1YWOA 2KAFA 4M7AD 2HKNA 2YLBA 3T9NA 4LXCA 4AFUC 2MMPA 1D3BB 4C92F 2VVKA 4M77A 4RCBA 3PTAA 1K0SA 1W2BA 4M7DB 1YJ9T 1VQ9A 1I07A 4DOWA 4R55A 4J9CA 1Q82C 4RMOA 3M53A 1VQNT 2M02A 3VS5A 3ZFJA 3QBYA 1QVFS 1WHKA 2PUKB 2LQWA 2RHXA 1YHQA 1KQSS 1VQKT 3OBWA 2D6FA 3J81E 2H3JA 5DM7R 3R6OA 1WDXA 4J9IA 2K2VA 1V76A 4J7IA 3SHWA 2CKKA 4J6YA 2DM1A 2E64A 2AK5A 3PIOA 1I5OB 3L2RA 1PRMC 1BU1A 1VQ4A 2E12A 2DIGA 3CCEA 1CSKA 2CYZB 5LJ3h 4JS4A 3MPUB 3GF5A 1M2OA 2K2MA 1RLQC 4AFSC 1K4US 2RQRA 3PE0A 2KRSA 3QZ5B 4M75E 3FIFA 2DL4A 4FYWB 3M9QA 3R6NA 5GAOm 2IG0A 3BDLA 2J6FA 1X43A 3QSUA 3LYIA 1G3WA 3ULRB 3V8LA 3CCEQ 1AT1B 4E7HA 4BY6C 3LW5E 2A36A 3S3MA 4M7AG 1UHFA 1N27A 4J9EA 4M77C 4IKFA 4OP0A 3INZA 4JJDA 3JCMW 2DETA 3X26B 4QQGA 4F16A 3X24B 3VRZA 1YJWT 5D6XA 2H3EB 2JM9A 3QDRB 1VQ6A 4NS5A 1V1CA 4RTXA 3L1AA 3A8OB 2BUDA 4IUTA 1VQ5T 3TCJA 4CI0C 2M9UA 1WHMA 3OYLA 3EH2A 2WSCE 2GGRA 3L2QA 1WX6A 2CT4A 1RACB 2EJGA 3C94A 3EGXB 4XTXA 1NM7A 4XK8E 5ECAA 3H0FA 3CC4T 2JN0A 2NUTB 1ZUYA 1M2VB 2LNVA 3A5ZB 5GANf 1VQ6Q 3E2UA 4AG2C 2G6FX 3EH1A 1K9MR 4AFQC 2HEQA 4OGCA 5KYUA 3QZ9B 1VQPT 4WTOB 3CCVA 2JS0A 5IHIA 2DZCA 2L5QA 1LPLA 3EFOB 1K8AC 3PT9A 4A63B 2NUPB 5A0DA 4M75G 2YUPA 1H8KA 1YN8A 3CEYA 1O9SA 3CCUA 2GF7A 2RJDA 2BZXA 1PKTA 1S72T 2EW3A 3G1JA 2DNUA 1AEYA 3U23A 2ZAEA 2X4XA 2HMAA 4HCKA 4JJBA 1CKAA 1ZSZA 2GQVA 1YP5A 1ABQA 4PJLA 1H3HA 1WJQA 2X9HA 1NBEB 2L3PA 4PFPA 1PRLC 3CCST 2QTVA 4EMHA 2X51A 4MZPA 3JCMb 3I35A 2COZA 4BUGA 4FT2A 2R58A 2RQTA 1E7OA 2MOXA 4IIOA 2YT6A 4DEYA 1YJNA 1EFNA 1GBRA 3OSSC 2KBTA 3OS1A 3V8JA 4HT8A 2FPFA 4F04B 3A8GB 4KBMB 2IPOB 3GNGA 1C1AA 3D7SB 4Z89A 4A4FA 2NLUA 2FHDA 3SDZA 3G71T 2HZYA 3OA6A 2K5LA 2RQWA 1OZ3A 1WPYA 1KG1A 4QKUA 3DLMA 4WF2A 4K11A 5KYYB 2KXDA 5HK3A 2EJ9A 1SEMA 5I22A 5GAN8 2KRMA 2ED0A 2M0YA 4MZTA 1OZ2A 2RK2A 1M90U 2X4YA 2L2PA 5IN1A 2F69A 2LJ1A 3HKSA 1FMKA 2DTOA 3P8HA 1MHNA 2O4XB 4E7ZA 1YI2Q 1S72Q 1SF9A 3QUIA 3RMSA 3ZBDA 2YWWA 5LJ3g 1ZSZC 1WXTA 1NYGA 2XKOC 1VQOQ 3CPFA 1NEGA 2BE7D 1WQ7A 1LJOA 3CCQA 2ATCB 1B07A 5GAMf 1WXUA 2DAQA 2YLCA 3HRUA 3GPLA 1QLYA 4M77D 4PJOF 1JJ2A 2RHIA 1J3TA 2EYZA 4C8QF 1YWPA 2XIDA 5L8RE 4B9WA 4OB0B 1VQMT 2QA4T 4N4HA 1JXMA 2KT1A 4JZ4A 3CMAA 2F5KA 3RUXA 2J05A 2K3YA 2LRQA 1NJIU 4ZGJB 1G3YA 3OS5A 2HL5C 3EGDB 3GNFB 1BCOA 1EX4A 1MNEA 3G71Q 1BI2A 2BZYA 3E9GA 1QWFA 2DL8A 2YUNA 1RLPC 5C6SA 4AG1C 2PVOB 3ZL7C 3G7ZA 4GBQA 2SEMA 2RHUA 4M78D 4YTLA 2RM4A 4Q5WA 5FU7B 1AVZC 2OJ2A 5DLOA 1Q81C 1ZBXA 2LT4A 6AT1B 5HKCA 3OYAA 2CGHA 4C92E 5CKDA 4LUDA 2P4RA 3V7SA 1VQLA 2D9TA 3LWIA 2KEAA 4KT0E 1KD1R 2CP0A 2E5QA 1JQQA 4RCCA 4C5EA 1W2BS 1NYFA 1IHVA 2ZPGB 2PVGB 1K73U 2EBPA 3BE3A 3P8BB 4M77G 4F7UG 2DFUA 1W4SA 4XTWA 5FWBA 2FG0A 1C6VX 3BY7A 1M1FA 2ZPHB 4BD3A 1OU9A 2CSIA 3L2VA 1MNDA 3QWXX 4PL6A 3BFMA 1VQMQ 2QA4Q 1TUDA 4DA4A 2RQUA 3META 3QXEB 3LH5A 4KGXB 4L59A 1VUBA 1JEGA 4O6JA 1Y96B 1WQWA 4JPBW 3I55T 1YITQ 3EG1A 1N9RA 5CCAA 3CCJA 2EYWA 2DD4A 5FRNA 2DVEA 2K57A 3GP8A 2MCNA 2H8HA 3MO8A 2J6OA 2JW4A 3CD6A 1MMNA 3FLGA 1UEBA 4RTYA 1OX8A 2HDAA 3CC2A 1WA7A 4KH1B 2COYA 3X20B 2EAYA 4NL3A 2LQ8A 3TREA 3CCJQ 3CC7Q 4D6WA 4BE1A 4M7DF 1ZQ1A 5LJ5j 4OMFB 1AWJA 5FU6C 1D0XA 4BB7A 2AKLA 1QVGA 1IO6A 1Q86U 4JS5A 2X4WA 4LD6A 1QQJA 1VIEA 2MF2A 3OYEA 2NYSA 3NTHA 3E9FA 1VQ8T 3P8DA 2VXFA 1MV3A 2KK4A 2COWA 4NL2A 4HCZA 3QIIA 2CUBA 4C8QB 5GJWB 1D1CA 4RUGA 4B6MA 2VUBA 3E19A 4M7AB 3URGA 2VGMA 2KXCA 5GAMd 3EG9A 3WXMB 3MHXA 5GAOp 1D3BA 2DEUA 1ZLMA 4V2SA 3KUFA 2FRYA 4M7DA 5I21A 3I55Q 2P0QA 2R57A 4J7FA 3VS7A 3BW1A 4C0DC 1AZEA 2A08A 3PVQA 1BK2A 1UHCA 1LOJA 3M57A 3CMEA 1RL2A 1WHGA 3A8MB 2KYMA 1CKBA 4RTUA 1AD5A 1OX9A 3CBPA 3CCMT 2DTIA 2PU9B 4JLIA 3JCMQ 1T0HA 2AT1B 4GLMA 3OYGA 4PNOA 4XU0A 4HCCA 4LE9A 1B3QA 3NMZC 1Y0MA 2DL7A 3CXCP 1WLPB 2RI5A 1N9SA 2FB7A 3RNJA 1JBMA 2R5MA 4A4KA 5I11A 5GMKh 3WVEB 5GANh 4A4GA 2XU8A 2C06A 1AHJB 4AT1B 5A0GA 2OTLA 2P4TA 2OX7A 3H9NA 3I5SA 3CBMA 5EC7A 3J80E 1HYOA 1NPRA 1BYMA 1WXBA 3I9QA 2DL3A 2HQEA 3VUZA 2EQUA 4C0ZA 1WYXA 2OAWA 2EKOA 5IXBA 1Y71A 1VQ7Q 2QYZA 3M0UA 1QVFP 4M7DC 4HXJA 3FC3A 3GIBA 2DKGA 2JOYA 3ME9A 4C0FA 1KQSP 2JS2A 1TTHB 4RKUE 3JSCA 4PJNA 4LN2A 4P5NA 2K9GA 4J9HA 1VQ4T 4N0AA 2FZGB 3JCMd 3CCET 2QQSA 5D6WA 2QEXA 2G3RA 5KYNA 4DOVA 1N8RU 2KYBA 2PTKA 2DK3A 1RABB 4KGVB 2CUDA 1GXIE 2NUZA 2RPNA 1WHHA 1PD0A 3CCMQ 1WJRA 2NUTA 3OYMA 2RF0A 1M2VA 4PLIA 2JTMA 2E1HA 5CAIA 2E65A 1BI1A 5FRMA 4M78F 1WFWA 4ELYC 3L2UA 1X6OA 2CZ7B 2HSEB 2DA9A 3DLLA 3OYDA 4OB3B 4PJOE 3QHSA 3G6EA 3JB9G 3UPUA 2MYSA 1QCNA 3M54A 3DB3A 2CP6A 2KVQG 2NUPA 2I0NA 1ZBJA 1JJ2S 2JTEA 3CBOA 3GBQA 1TU0B 1M90R 2HD0A 1U1SA 1U1TA 1VQ6T 1VQ9Q 5A0LA 4QT7A 4E7IA 2QQBA 3M0QA 3TSZA 2JXBA 2FPEA 3M0PA 1LCKA 3SB2A 1M30A 2DXTA 5LJ5e 4IUVA 4RTVA 3CCLA 1H641 1YHQQ 2KY9A 3QJYA 4BDYA 4PK4A 1Z9ZA 4M75D 4C92A 1QWEA 1NG2A 1WI7A 3NHNA 4XQ3A 3VS1A 1OV3A 9ATCB 1PC0A 2O2OA 4M4ZA 2AHJB 4N0AC 3ZEHA 4E7LA 4OVAA 2RI2A 1X01A 2PVDB 3CCLQ 1VQ4Q 4MZMA 3RKXA 2DL5A 3RESA 3KBGA 3CCUT 2V8KA 5L23A 1HD3A 2X35A 2QGFB 1NJIR 1YJ9A 4J6XA 5GAOl 4LNPA 2YRDA 1M9SA 1EIFA 3CCRA 2JZ2A 1MMDA 4FU6A 4HVVA 5KYYA 5LJ3j 2OI3A 2V8JA 1UB4A 1FMWA 4JDSA 4OB1B 1VQKA 3AHUA 1QVPA 3G4SA 1I8FA 1MV0B 1KD1C 1UGQB 3L2WA 2O4XA 5GANg 1YJNT 5AYFA 3O5ZA 1SPKA 2RQVA 2MAMA 4X9CA 4RG2A 3OW2S 2YRCA 1IREB 4N4GA 4FSXA 1V29B 1TS9A 4M77B 1M8MA 1KJWA 4F7UB 3HRTA 4C92C 3OYFA 2FPDA 1I1JA 3OYIA 1BB9A 1F1BB 3Q1JA 2DXCA 1K73R 3JB9H 2CH4W 1YI2T 3VS6A 1PM3A 1N8RC 1VQOT 5GAN4 1W6XA 4M7DE 1R0CB 3CCVQ 4FIBA 2EYXA 1X6BA 2MK5A 4E7KA 1K1ZA 3EGUA 1OEBA 2W10A 3OYHA 2RJCA 1ABOA 2LMJA 3HSBA 1LNXA 3SWNB 3CCUQ 1QVGS 2EGCA 3JCMP 2NWMA 1KQ2A 1RAIB 1WGSA 2OAUA 1ZSGA 4KUDK 1RI9A 2GTOA 4E2FB 1BCMA 2XICA 5LJ5d 4M78B 1KFZA 1VQ5A 2A0FB 1PCXA 3UF4A 3C0CA 1VIFA 5GANe 1U3OA 4MMKA 3SEMA 1I5LA 3THKA 4OMQA 3V7CA 5KH6A 1BKBA 4KUIA 4XTVA 3CC4A 1JO8A 4R56A 2DERA 4FM4B 5IHKA 2CP3A 2QQAA 2XD0A 2AZSA 3NTKA 3GLXA 1U8RA 4II1A 1YJNQ 3CPWA 1Q86R 1VQPA 3HTRA 2GFUA 1IGUA 3C4SA 3QG1A 4EDUA 3UT1A 2DYIA 4PKCC 5KE2A 2DZ9A 4M7DG 1GBQA 1QCFA 1N6AA 3LWHA 4BE0A 2X3XD 4HKEA 3UA7A 3M4YA 1JRIA 1QW1A 3UWNA 2F2VA 3C95A 4GLKA 4IURA 3V7RA 3CCSA 1Y96A 5GAMg 4Y91A 1R8OB 1PKSA 4A53A 2HNIA 2HAXA 2CS7A 4LDWA 2A3LA 3EFSA 3JAME 2P0PA 1AWOA 4M7AF 2Y90A 4IUUA 1AZGB 2MWOA 3O8VA 3CCQQ 1QVFA 2QDLA 3HL8A 1YIJA 1NE8A 1WNLA 1YITT 4EMKA 4TVRA 3V8KA 2EQKA 2RJEA 1W2BP 5GMKm 5J3BA 2KQWA 1SRLA 2BZ8A 3J7AF 1ZSZB 2V1QA 1UJ0A 2E6ZA 2KT8A 2K7AA 1I81A 4RG8A 1B34B 5CO7A 1TG0A 2LQKA 1M27C 3CMAQ 2VXEA 1SHGA 2DPPB 3LLRA 2JMCA 3CCJT 3CC7T 5LJ3e 1EZZB 1HJDA 2GTJA 5KCOA 2JM8A 1KC8U 1XOVA 1OOTA 5IH2A 4RTZA 4PFOA 4C92D 4C5HA 2JUFA 5KYWA 3KFVA 3CD6T 4C0GA 4XTZA 4PJOA 3H0HA 5CQYA 5IXFA 4C8QA 3UA6A 2CP5A 4M75F 2QI2A 1VYTA 1BBZA 3HPWA 1UUEA 3FEOA 4ME7A 2CREA 2BKDN 2QQRA 4VUBA 1U06A 3MP1A 5GAN3 3EFRA 5CVIA 4EMGA 2VV5A 2L8DA 3MP8A 2LDMA 1VQLQ 1X6GA 2LJ0A 5GJVB 1GCPA 5CR2A 3L42A 5LL6S 4HVUA 2CZ1B 2HQHA 3AT1B 3L2ZA 4B9XA 5A2QE 1N8RR 1GRIA 3JCMf 4EMKC 2KI7A 4OB2B 3JCMV 1M1KR 1X75C 5GAN7 3UDCA 2RJFA 1RAAB 2E41A 2IIMA 1KHIA 4QQ6A 3PMIA 1G3SA 2C0TA 1Y7XA 2M16A 1D1AA 4JRKA 3MEUA 4L6V5 1ZA2B 1OQKA 1KIKA 2EQMA 1D0YA 2DE0X 1M90C 2WACA 3OYNA 4KULA 3QO3A 3OS0A 3SD4A 1SKUB 2LP5A 2O9SA 4C92G 4JJCA 3VKIA 2O88A 4PJOC 1M3CA 4CC7A 4C8QC 2FZKB 2PNIA 4RTWA 1E6HA 1KK7A 4M7AC 3CD6Q 2RHYA 5HCKA 1DJ7B 3CC2Q 1AWXA 2A7YA 4X34A 1HXDA 2YDLA 2Y4XA 3HHTB 4QQDA 4PFZA 1RAHB 1TUCA 2HCKA 1G83A 4DBQA 1O75A 3TVTA 1VYUA 2FEIA 2RI3A 3TEEA 4R0KA 2JTFA 4DEXA 1VQ7T 1IB8A 1OYXA 2LNHB 2EKHA 2GCXA 2DMOA 2XDPA 3H8ZA 3OSVA 4Y92A 3I56A 1NJIC 1OPKA 2DEQA 3QYGB 2V1RA 2DX1A 2ABLA 2B8AA 1GL5A 1VA7A 4CRIA 4FYVB 3RERA 5CKBA 3C12A 1RADB 2EPDA 1KC8C 4J5YA 2KNBB 1FXXA 2LCCA 2RHZA 5D7UA 4PJJA 5J26A 2D0NA 5KCHA 1B7TA 1G8XA 2XHCA 3QYHB 3F70A 4FT4A 2HQXA 4L5GA 2DJZA 2QEXT 5FWCA 1YCSB 2ECZA 2KDSA 2D8HA 2AKKA 3CMEQ 3VS4A 4M75B 2GNCA 2DXUA 1K73C 2MI6A 3JB9D 2E3HA 1S1NA 1Y07A 1E6GA 3CQTA 4WCIA 1VQ9T 1OULA 1VQ8A 1ZX6A 1NPPA 1H3ZA 2F1LA 3VS3A 4OMOA 2JT4A 1PSEA 2YUOA 2CH4A 3MKDA 2BIVA 2PZ1A 3FJPA 1JXOA 1FMVA 1T0JA 1WIEA 1KQ1A 3G6ET 1JB0E 1YHQT 1RAFB 3JCMc 4OMMA 2J6KA 2K5FA 2O01E 1GFDA 4PJMA 3QWYA 1C0MA 5DY9A 3HRSA 1M3BA 2FL7A 4AFZC 4M77F 2M51A 4DQ2A 4E7JA 1QKXA 3NPFA 4F7UF 5J39A 2OTLQ 2L3QA 1YNZA 1QCOA 1R0BG 2PQWA 3ASKA 2CZ6B 2PUOB 3QJ6A 3CPWS 2M0OA 1JJ2P 3GOXA 5GMKj 3OBYA 5GANj 3CCLT 2O9VA 1NEBA 1Q7YR 4E7SA 5KYXB 1ZHIA 2C0OA 4HVWA 3PNWC 4IUPA 1OI1A 2F2WA 2QQ9A 2DRMA 3EGXA 4CC3A 1K8AU 1WHJA 2LT1A 5LJ5f 3PMTA 1M1KU 1OPLA 5FW9A 2JMAA 2J7IA 7AT1B 1Q86C 3M56A 1MMAA 2LX7A 4FYYB 1TWBA 3M59A 3EG9B 2CZ0B 4PJOD 1AOJA 4OGEA 2KGTA 2QEXQ 2XMFA 2V8IA 2V26A 4C8QE 5GAN5 3EFOA 2E70A 2OTJA 3TSWA 4M7AE 4HCBA 4F7UA 1X69A 2FZCB 4HT9A 5D6YA 1ZUUA 2RNAA
chains in the Genus database with same CATH topology
1QWFA 2CSQA 1ABOA 2LMJA 4J9BA 2DL8A 2YUNA 1RLPC 4AG1C 3ZL7C 2EGAA 4IIMA 2EGCA 4GBQA 2SEMA 4RTTA 4F17A 1T3SA 2NWMA 1SSHA 1ZSGA 2DJQA 1RI9A 2GTOA 1W1FA 1AVZC 2OJ2A 4KRTA 2DBKA 4F14A 1K9AA 1KFZA 4LUDA 2P4RA 4FSSA 3UF4A 3C0CA 2KEAA 1U3OA 3SEMA 1JQQA 3THKA 4OMQA 4X1VA 4CC2A 1NYFA 1A0NB 1Z9QA 4CC4B 1JO8A 2ROTA 2EBPA 1UFFA 5IHKA 1SRMA 2DILA 2AZSA 3M0TA 5FWBA 2ENMA 2FG0A 1UGVA 3REAB 2KE9A 3I5RA 2RMOA 2CSIA 2SRCA 1QKWA 3QWXX 4Z88A 1TUDA 2LZ6B 3UATA 2C0IA 3JV3A 1K76A 2RQUA 1Y57A 3LH5A 1JEGA 2J06A 2CT3A 4JPBW 1GBQA 1QCFA 3EG1A 2EGEA 2EYWA 2ROLA 2MCNA 2GQIA 4ORZA 2X3XD 2H8HA 4LUEA 2FRWA 2J6OA 2JW4A 3UA7A 1UJYA 4D8KA 4RTYA 2HDAA 2F2VA 1WA7A 1PKSA 1X2QA 4OMPA 1UDLA 4D8DA 2AZVA 1AWJA 1AWOA 4OMLA 3M0SA 2AKLA 1AZGB 1IO6A 1UE9A 1HSQA 3EHQA 2QDLA 2VWFA 2EVRA 2X3WD 2KRNA 2DRKA 2DVJA 2DLPA 3VS0A 1UECA 2K79A 2YUQA 1AWWA 1YWOA 2K3BA 1SRLA 2BZ8A 2EYYA 4AFUC 1MV3A 2VVKA 1K0SA 2V1QA 1UJ0A 1MUZA 2CUBA 2KT8A 2K7AA 5GJWB 2O31A 4RUGA 1I07A 1TG0A 4J9CA 2L0AA 1M27C 2KXCA 1SHGA 2BTTA 2JMCA 1UG1A 3VS5A 1HJDA 1M3AA 2GTJA 2JM8A 1XOVA 1OOTA 5IH2A 2DYBA 2LQWA 4RTZA 1ZLMA 3KFVA 2FRYA 3H0HA 5IXFA 4E6RA 3UA6A 3RBBB 2F2XA 3VS7A 1AZEA 1VYTA 1WDXA 2A08A 1BK2A 3PVQA 1BBZA 4J9IA 1UHCA 1UUEA 1X27A 2GBQA 3SHWA 1PWTA 2CREA 2KYMA 2DM1A 1U06A 1CKBA 4RTUA 2AK5A 1AD5A 2RN8A 1PRMC 1BU1A 1X2KA 3A98A 1CSKA 1T0HA 4GLMA 2B86A 2D1XA 2K2MA 4LE9A 1RLQC 4AFSC 1K4US 1X6GA 2RQRA 3PE0A 2KRSA 2LJ0A 1B3QA 3NMZC 1Y0MA 2DL7A 5GJVB 1GCPA 1WLPB 2DL4A 2LCSA 4HVUA 3RNJA 3R6NA 2LQNA 2J6FA 1GRIA 5I11A 1X43A 3ULRB 1NLOC 2A36A 1UHFA 2IIMA 3I5SA 4OMNA 4J9EA 2C0TA 4JJDA 5EC7A 3EG0A 1KIKA 2LJ3A 4F16A 3VRZA 2DE0X 1WXBA 2EQIA 3I9QA 2JM9A 3VS2A 2DL3A 1NLPC 1V1CA 1WYXA 4RTXA 2OAWA 5IXBA 2LP5A 2O9SA 2HSPA 3M0UA 2GGRA 1W70A 4JJCA 1WX6A 2CT4A 2O88A 3H0IA 1M3CA 1G2BA 4HXJA 4CC7A 1VYVA 1NM7A 2PNIA 4RTWA 1E6HA 5ECAA 2JS2A 3H0FA 2DF6A 1ZUYA 5HCKA 4LN2A 1AWXA 2K9GA 4J9HA 2E5KA 1T3LA 4AG2C 2CDTA 2YDLA 2G6FX 4AFQC 2HEQA 2KYBA 2PTKA 2YSQA 2ED1A 2JS0A 5IHIA 1TUCA 2CUDA 1N5ZA 2HCKA 2NUZA 2RPNA 1G83A 4A63B 3REBB 3TVTA 1I0CA 1VYUA 2FEIA 2RF0A 2YUPA 1H8KA 1UTIA 1KSWA 1YN8A 2VKNA 4R0KA 4DEXA 2BZXA 1PKTA 2K6DA 2EW3A 2LNHB 1WFWA 1U5SA 2EKHA 2DNUA 1AEYA 3U23A 2DMOA 2DA9A 4EIKA 4Y92A 1H92A 4HCKA 1OPKA 3NGPA 4JJBA 1CKAA 1GCQA 1YP5A 1ABQA 2W0ZA 2I0NA 1ZBJA 2JTEA 2V1RA 2DX1A 3GBQA 1H3HA 1FYNA 1RUWA 2ABLA 4J9DA 3EG2A 2L3PA 1PRLC 1GL5A 4ZNXA 4QT7A 1VA7A 1ZUKA 3TSZA 3M0QA 3M0RA 2FO0A 2JXBA 2FPEA 3I35A 1JU5C 3M0PA 1LCKA 1M30A 2EPDA 3H41A 2KNBB 4RTVA 2RQTA 1E7OA 2MOXA 4IIOA 2YT6A 4DEYA 1EFNA 1GBRA 2D0NA 4Z8AA 1Z9ZA 3EHRA 2KBTA 2FPFA 4ESRA 1QWEA 1NG2A 1WI7A 3NHNA 3VS1A 3FJ5A 1OV3A 5FWCA 2O2OA 4Z89A 1YCSB 2ECZA 4M4ZA 2D8HA 2AKKA 3VS4A 2GNCA 2RQWA 2ESWA 1GFCA 1S1NA 4K11A 2DL5A 2KR3A 2KXDA 1E6GA 3CQTA 4WCIA 1SEMA 5I22A 1ZX6A 2KROA 2KRMA 2ED0A 5L23A 3VS3A 2M0YA 4OMOA 2JT4A 1HD3A 2CH4A 2YUOA 2PZ1A 4J9GA 1JXOA 1T0JA 1WIEA 2L2PA 4LNPA 2LJ1A 3PVLA 1ARKA 1FMKA 2J6KA 4OMMA 1GFDA 2MIOA 3QWYA 2HBWA 4HVVA 1PHTA 2OI3A 1M3BA 4AFZC 2M51A 1QKXA 3NPFA 5IHNA 1WXTA 1GCQC 2L3QA 1YNZA 1NYGA 1NEGA 1K0XA 2L3SA 3VRYA 1B07A 1MV0B 1WXUA 1PNJA 2O9VA 2A37A 4JZ3A 1NEBA 1QLYA 3O5ZA 2C0OA 1J3TA 1SPKA 2EYZA 4HVWA 2F2WA 2RQVA 1YWPA 2DRMA 4CC3A 1SHFA 4J9FA 3EG3A 2A28A 1OPLA 1M8MA 5FW9A 2KT1A 1JXMA 1KJWA 2JMAA 2DBMA 2FPDA 1I1JA 2J7IA 1BB9A 4JZ4A 2LX7A 3IQLA 2J05A 2CH4W 3VS6A 1AOJA 2KGTA 2XMFA 1W6XA 2EYXA 1X6BA 3TSWA 1K1ZA 3EGUA 1OEBA 1X69A 1ZUUA 2W10A 2BZYA 2D8JA 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QWF A;  2CSQ A;  1ABO A;  2LMJ A;  4J9B A;  2DL8 A;  2YUN A;  1RLP C;  4AG1 C;  3ZL7 C;  2EGA A;  4IIM A;  2EGC A;  4GBQ A;  2SEM A;  4RTT A;  4F17 A;  1T3S A;  2NWM A;  1SSH A;  1ZSG A;  2DJQ A;  1RI9 A;  2GTO A;  1W1F A;  1AVZ C;  2OJ2 A;  4KRT A;  2DBK A;  4F14 A;  1K9A A;  1KFZ A;  4LUD A;  2P4R A;  4FSS A;  3UF4 A;  3C0C A;  2KEA A;  1U3O A;  3SEM A;  1JQQ A;  3THK A;  4OMQ A;  4X1V A;  4CC2 A;  1NYF A;  1A0N B;  1Z9Q A;  4CC4 B;  1JO8 A;  2ROT A;  2EBP A;  1UFF A;  5IHK A;  1SRM A;  2DIL A;  2AZS A;  3M0T A;  5FWB A;  2ENM A;  2FG0 A;  1UGV A;  3REA B;  2KE9 A;  3I5R A;  2RMO A;  2CSI A;  2SRC A;  1QKW A;  3QWX X;  4Z88 A;  1TUD A;  2LZ6 B;  3UAT A;  2C0I A;  3JV3 A;  1K76 A;  2RQU A;  1Y57 A;  3LH5 A;  1JEG A;  2J06 A;  2CT3 A;  4JPB W;  1GBQ A;  1QCF A;  3EG1 A;  2EGE A;  2EYW A;  2ROL A;  2MCN A;  2GQI A;  4ORZ A;  2X3X D;  2H8H A;  4LUE A;  2FRW A;  2J6O A;  2JW4 A;  3UA7 A;  1UJY A;  4D8K A;  4RTY A;  2HDA A;  2F2V A;  1WA7 A;  1PKS A;  1X2Q A;  4OMP A;  1UDL A;  4D8D A;  2AZV A;  1AWJ A;  1AWO A;  4OML A;  3M0S A;  2AKL A;  1AZG B;  1IO6 A;  1UE9 A;  1HSQ A;  3EHQ A;  2QDL A;  2VWF A;  2EVR A;  2X3W D;  2KRN A;  2DRK A;  2DVJ A;  2DLP A;  3VS0 A;  1UEC A;  2K79 A;  2YUQ A;  1AWW A;  1YWO A;  2K3B A;  1SRL A;  2BZ8 A;  2EYY A;  4AFU C;  1MV3 A;  2VVK A;  1K0S A;  2V1Q A;  1UJ0 A;  1MUZ A;  2CUB A;  2KT8 A;  2K7A A;  5GJW B;  2O31 A;  4RUG A;  1I07 A;  1TG0 A;  4J9C A;  2L0A A;  1M27 C;  2KXC A;  1SHG A;  2BTT A;  2JMC A;  1UG1 A;  3VS5 A;  1HJD A;  1M3A A;  2GTJ A;  2JM8 A;  1XOV A;  1OOT A;  5IH2 A;  2DYB A;  2LQW A;  4RTZ A;  1ZLM A;  3KFV A;  2FRY A;  3H0H A;  5IXF A;  4E6R A;  3UA6 A;  3RBB B;  2F2X A;  3VS7 A;  1AZE A;  1VYT A;  1WDX A;  2A08 A;  1BK2 A;  3PVQ A;  1BBZ A;  4J9I A;  1UHC A;  1UUE A;  1X27 A;  2GBQ A;  3SHW A;  1PWT A;  2CRE A;  2KYM A;  2DM1 A;  1U06 A;  1CKB A;  4RTU A;  2AK5 A;  1AD5 A;  2RN8 A;  1PRM C;  1BU1 A;  1X2K A;  3A98 A;  1CSK A;  1T0H A;  4GLM A;  2B86 A;  2D1X A;  2K2M A;  4LE9 A;  1RLQ C;  4AFS C;  1K4U S;  1X6G A;  2RQR A;  3PE0 A;  2KRS A;  2LJ0 A;  1B3Q A;  3NMZ C;  1Y0M A;  2DL7 A;  5GJV B;  1GCP A;  1WLP B;  2DL4 A;  2LCS A;  4HVU A;  3RNJ A;  3R6N A;  2LQN A;  2J6F A;  1GRI A;  5I11 A;  1X43 A;  3ULR B;  1NLO C;  2A36 A;  1UHF A;  2IIM A;  3I5S A;  4OMN A;  4J9E A;  2C0T A;  4JJD A;  5EC7 A;  3EG0 A;  1KIK A;  2LJ3 A;  4F16 A;  3VRZ A;  2DE0 X;  1WXB A;  2EQI A;  3I9Q A;  2JM9 A;  3VS2 A;  2DL3 A;  1NLP C;  1V1C A;  1WYX A;  4RTX A;  2OAW A;  5IXB A;  2LP5 A;  2O9S A;  2HSP A;  3M0U A;  2GGR A;  1W70 A;  4JJC A;  1WX6 A;  2CT4 A;  2O88 A;  3H0I A;  1M3C A;  1G2B A;  4HXJ A;  4CC7 A;  1VYV A;  1NM7 A;  2PNI A;  4RTW A;  1E6H A;  5ECA A;  2JS2 A;  3H0F A;  2DF6 A;  1ZUY A;  5HCK A;  4LN2 A;  1AWX A;  2K9G A;  4J9H A;  2E5K A;  1T3L A;  4AG2 C;  2CDT A;  2YDL A;  2G6F X;  4AFQ C;  2HEQ A;  2KYB A;  2PTK A;  2YSQ A;  2ED1 A;  2JS0 A;  5IHI A;  1TUC A;  2CUD A;  1N5Z A;  2HCK A;  2NUZ A;  2RPN A;  1G83 A;  4A63 B;  3REB B;  3TVT A;  1I0C A;  1VYU A;  2FEI A;  2RF0 A;  2YUP A;  1H8K A;  1UTI A;  1KSW A;  1YN8 A;  2VKN A;  4R0K A;  4DEX A;  2BZX A;  1PKT A;  2K6D A;  2EW3 A;  2LNH B;  1WFW A;  1U5S A;  2EKH A;  2DNU A;  1AEY A;  3U23 A;  2DMO A;  2DA9 A;  4EIK A;  4Y92 A;  1H92 A;  4HCK A;  1OPK A;  3NGP A;  4JJB A;  1CKA A;  1GCQ A;  1YP5 A;  1ABQ A;  2W0Z A;  2I0N A;  1ZBJ A;  2JTE A;  2V1R A;  2DX1 A;  3GBQ A;  1H3H A;  1FYN A;  1RUW A;  2ABL A;  4J9D A;  3EG2 A;  2L3P A;  1PRL C;  1GL5 A;  4ZNX A;  4QT7 A;  1VA7 A;  1ZUK A;  3TSZ A;  3M0Q A;  3M0R A;  2FO0 A;  2JXB A;  2FPE A;  3I35 A;  1JU5 C;  3M0P A;  1LCK A;  1M30 A;  2EPD A;  3H41 A;  2KNB B;  4RTV A;  2RQT A;  1E7O A;  2MOX A;  4IIO A;  2YT6 A;  4DEY A;  1EFN A;  1GBR A;  2D0N A;  4Z8A A;  1Z9Z A;  3EHR A;  2KBT A;  2FPF A;  4ESR A;  1QWE A;  1NG2 A;  1WI7 A;  3NHN A;  3VS1 A;  3FJ5 A;  1OV3 A;  5FWC A;  2O2O A;  4Z89 A;  1YCS B;  2ECZ A;  4M4Z A;  2D8H A;  2AKK A;  3VS4 A;  2GNC A;  2RQW A;  2ESW A;  1GFC A;  1S1N A;  4K11 A;  2DL5 A;  2KR3 A;  2KXD A;  1E6G A;  3CQT A;  4WCI A;  1SEM A;  5I22 A;  1ZX6 A;  2KRO A;  2KRM A;  2ED0 A;  5L23 A;  3VS3 A;  2M0Y A;  4OMO A;  2JT4 A;  1HD3 A;  2CH4 A;  2YUO A;  2PZ1 A;  4J9G A;  1JXO A;  1T0J A;  1WIE A;  2L2P A;  4LNP A;  2LJ1 A;  3PVL A;  1ARK A;  1FMK A;  2J6K A;  4OMM A;  1GFD A;  2MIO A;  3QWY A;  2HBW A;  4HVV A;  1PHT A;  2OI3 A;  1M3B A;  4AFZ C;  2M51 A;  1QKX A;  3NPF A;  5IHN A;  1WXT A;  1GCQ C;  2L3Q A;  1YNZ A;  1NYG A;  1NEG A;  1K0X A;  2L3S A;  3VRY A;  1B07 A;  1MV0 B;  1WXU A;  1PNJ A;  2O9V A;  2A37 A;  4JZ3 A;  1NEB A;  1QLY A;  3O5Z A;  2C0O A;  1J3T A;  1SPK A;  2EYZ A;  4HVW A;  2F2W A;  2RQV A;  1YWP A;  2DRM A;  4CC3 A;  1SHF A;  4J9F A;  3EG3 A;  2A28 A;  1OPL A;  1M8M A;  5FW9 A;  2KT1 A;  1JXM A;  1KJW A;  2JMA A;  2DBM A;  2FPD A;  1I1J A;  2J7I A;  1BB9 A;  4JZ4 A;  2LX7 A;  3IQL A;  2J05 A;  2CH4 W;  3VS6 A;  1AOJ A;  2KGT A;  2XMF A;  1W6X A;  2EYX A;  1X6B A;  3TSW A;  1K1Z A;  3EGU A;  1OEB A;  1X69 A;  1ZUU A;  2W10 A;  2BZY A;  2D8J A;  2RNA A; 
#chains in the Genus database with same CATH topology
 3CCR T;  3M55 A;  3FB9 A;  4RTT A;  4F17 A;  1T3S A;  5CK9 A;  1SSH A;  2WSE E;  4ZTF A;  2P0K A;  3OS2 A;  1W1F A;  3G6E Q;  2DBK A;  2LX9 A;  5C0M A;  3X25 B;  2OTJ Q;  1OU8 A;  3G4S T;  4KGZ B;  4BI4 A;  2E10 A;  2YXY A;  4KH0 B;  3SWN A;  4J83 A;  4CC2 A;  2Z0W A;  4UC4 A;  5GMK i;  3LX7 A;  4CC4 B;  5KE3 A;  2L89 A;  4J8O A;  3CCV T;  3QDF A;  5GAM h;  4MML A;  4M78 A;  2I2L A;  3TQ7 P;  8ATC B;  5DLQ E;  1UGV A;  3REA B;  3VJP A;  2YRV A;  3I5R A;  1QKW A;  3OW2 P;  3JCM J;  4A4H A;  2LZ6 B;  3UAT A;  1RI0 A;  2C0I A;  3JV3 A;  3OYC A;  2AIR B;  1ACM B;  1K76 A;  4PJO G;  2J06 A;  4C8Q G;  1VQN A;  2QK0 A;  1UGR B;  2ROL A;  3KXT A;  2FYK A;  2E4H A;  4QVZ A;  4LUE A;  2VC8 A;  2FRW A;  2JNG A;  4XU3 A;  1BIB A;  4JUV A;  2E3I A;  4AMC A;  2VGN A;  5GAM j;  1YJ9 Q;  1KC8 R;  3HP9 A;  2QTX A;  3MCA B;  2ZPB B;  3PFS A;  4JRI A;  2DO3 A;  3CCR Q;  3X28 B;  1QVG P;  1VQN Q;  2EWN A;  4OMP A;  3PIP A;  4D8D A;  4BY6 B;  4OML A;  1BI0 A;  3HFO A;  1VQK Q;  2BE9 B;  4DBR A;  1UGS B;  4BDZ A;  4ZN3 A;  3SWN C;  2MPX C;  2XK0 A;  4MDW A;  3EHQ A;  3G4S Q;  2E6N A;  4NOY A;  2VWF A;  2F5T X;  2KRN A;  2DRK A;  2DVJ A;  2CP7 A;  1UEC A;  2RB6 A;  4M7D D;  4M78 C;  2EQJ A;  2K3B A;  3PGG A;  2EYY A;  4A54 A;  1G5V A;  1M1K C;  1MUZ A;  1TOV A;  2O31 A;  3BDU A;  4JJN K;  2L0A A;  2X4J A;  1MMG A;  3MEW A;  2BTT A;  1UG1 A;  3EGD A;  3M4G A;  4ZGD B;  1M3A A;  1YJW A;  1Q81 U;  3JCM h;  2DYB A;  3OY9 A;  4XTY A;  1Q7Y U;  1HK9 A;  3CCQ T;  4E6R A;  5CIU A;  1B34 A;  5HY6 A;  3LGF A;  3RBB B;  5GMK e;  2F2X A;  4C92 B;  2HKQ B;  3OYJ A;  1X27 A;  2GBQ A;  1PWT A;  1IGQ A;  3OYB A;  4BAC A;  1FWZ A;  1WHL A;  1YJW Q;  4GY5 A;  2RN8 A;  2YHT A;  3E1S A;  1X2K A;  3A98 A;  3JB9 F;  4O5V A;  1VQ5 Q;  2B86 A;  2D1X A;  4XAX B;  3CMA T;  2ZCF B;  1YIJ T;  5GAO q;  2LCS A;  4FL6 A;  3S6W A;  2DXB A;  2EYQ A;  4BI3 A;  3CC4 Q;  3JRZ A;  2LQN A;  2LVM A;  2EJF A;  3CXC A;  3OMG A;  1P92 A;  1FX7 A;  1YI2 A;  1S72 A;  1NLO C;  3QKJ A;  1MGQ A;  4MDX A;  1KHC A;  4HA8 A;  4OMN A;  1VQO A;  3FRN A;  1VQP Q;  1Q82 R;  2RH2 A;  3EG0 A;  8AT1 B;  1I4K 1;  2LJ3 A;  2VB6 A;  2LTO A;  4FW2 A;  2EQI A;  1IZ6 A;  3VS2 A;  4XU1 A;  3FDR A;  3M5A A;  2JVV A;  1NLP C;  1XJW B;  1TUG B;  4ELZ C;  1D0Z A;  2HSP A;  4FW1 A;  1VQL T;  1M1G A;  5LJ3 f;  1W70 A;  5KYU B;  3H0I A;  1G2B A;  1VYV A;  1TH7 A;  2QXF A;  2RO0 A;  2DIQ A;  2DF6 A;  3A8H B;  4LDY A;  4J6W A;  1KQS A;  1QMC A;  3CCS Q;  2E5K A;  1T3L A;  5FU7 C;  4N4I A;  2CDT A;  3WVD B;  5IT9 E;  2YSQ A;  5I2S A;  2ED1 A;  4M77 E;  4XTU A;  4F7U E;  2RA2 A;  3ER0 A;  3G71 A;  1N5Z A;  3DKM A;  3REB B;  1I0C A;  4FYX B;  1IXD A;  1UTI A;  1KSW A;  3DB4 A;  2VKN A;  5M9O A;  5FRO A;  2WSF E;  1YIJ Q;  2EIF A;  2K6D A;  1U5S A;  4EIK A;  1H92 A;  2K3X A;  4E47 A;  5GMK l;  3NGP A;  3RDV A;  5CKH A;  2ZGW A;  5FLX E;  1GCQ A;  2W0Z A;  2CP2 A;  1XQH A;  1ZA1 B;  1FYN A;  4LDX A;  1RUW A;  3CC2 T;  4J9D A;  5GAM e;  4M7A A;  3EG2 A;  4ZNX A;  4IUQ A;  1YFN A;  5GAN 2;  1ZUK A;  3M0R A;  5AT1 B;  5GAN d;  4JRQ A;  1XNI A;  2FO0 A;  5GAO r;  1JU5 C;  2EFI A;  4M78 E;  3H41 A;  3OQ5 A;  4X9D A;  4QVC A;  3SFM A;  1K9M U;  1Q7Y C;  4Z8A A;  3EHR A;  3A1P A;  1LVK A;  1WZO A;  4ESR A;  3RIR A;  2XG8 D;  4JLG A;  3FJ5 A;  1VQM A;  2QA4 A;  3NFC A;  3A8L B;  2ZPF B;  2FVU A;  5CKE A;  2QDY B;  4Z02 A;  3OYK A;  5CQX A;  4Y28 E;  3S3N A;  3JCM g;  1K8A R;  1YIT A;  2ESW A;  1GFC A;  2KR3 A;  3VYG A;  5LJ5 h;  2KRO A;  1UGP B;  2KMT A;  2RK1 A;  1BIA A;  2HL3 A;  3MJX A;  3I56 T;  4J9G A;  4BI8 B;  4M75 A;  5HK0 A;  3PVL A;  2JJ9 A;  1ARK A;  3OW2 A;  2MIO A;  2HBW A;  2KSS A;  3CC7 A;  1PHT A;  3VU3 C;  5IAY A;  1SG5 A;  5IHN A;  1GCQ C;  3N5B B;  4LD9 K;  2R5A A;  1K0X A;  1R77 A;  1RAG B;  4PLL A;  3CME T;  2L3S A;  3VRY A;  4M78 G;  1PG5 B;  1PD1 A;  1PNJ A;  2A37 A;  4JZ3 A;  2DTH A;  4EMK B;  5I2M A;  1IHW A;  2K5I A;  1TXQ A;  1RAE B;  3JCM X;  1SHF A;  4J9F A;  3EG3 A;  3RKW A;  5GAN 6;  4FCY A;  3MP6 A;  2A28 A;  2MWP A;  2RD1 A;  4BE2 A;  2DBM A;  3VV0 A;  3JCM e;  3RKY A;  1Q82 U;  2ZZD A;  3IQL A;  4ZTJ A;  3VYH B;  5GAO n;  3JB9 J;  5KYX A;  5CKF A;  2OTL T;  5LJ3 d;  2XDB A;  3LGL A;  1PSF A;  4OF1 A;  1XTD A;  5KYW B;  1G3T A;  1D1B A;  4PJO B;  3I55 A;  2D8J A;  5FU6 B;  4DBH A;  3TU4 K;  2CSQ A;  4J9B A;  2EGA A;  1M5Q 1;  1QP2 A;  3QPH A;  4IIM A;  4XU2 A;  4C5I A;  3LH0 A;  4M75 C;  2GFA A;  3I56 Q;  4A4E A;  1YBY A;  2VYT A;  2DJQ A;  2XDD A;  4KRT A;  2VAS A;  4F14 A;  2L3R A;  1K9A A;  2IVW A;  2QAS A;  4FSS A;  2QAZ A;  4QVD A;  3M58 A;  5EG2 A;  4ZGE B;  4X1V A;  2LCL A;  2DD5 A;  4LDV A;  1A0N B;  1Z9Q A;  4LDU A;  4DBF A;  3HFN A;  2ROT A;  2QG9 B;  2ZPE B;  3CPW P;  1UFF A;  2K4Y A;  1SRM A;  2DIL A;  3RR6 A;  3M0T A;  1K9M C;  2ENM A;  2M1H A;  3EAE A;  2KE9 A;  4EPC A;  4C5G A;  2QGG A;  2RMO A;  1D09 B;  4QW2 A;  2SRC A;  3OYY A;  4Z88 A;  3OB9 A;  4C0D B;  1IRX A;  3JB9 I;  1QP3 A;  2Y4Y A;  1NZ9 A;  3MEV A;  1Y57 A;  2OTJ T;  1TSF A;  2CT3 A;  1VQ7 A;  1M8V A;  2EGE A;  2P84 A;  3RMQ A;  2GQI A;  4ORZ A;  3MEA A;  4JRP A;  1VQ8 Q;  1WJS A;  1UJY A;  4D8K A;  1Q95 G;  1KD1 U;  1YCY A;  1Q81 R;  2LC4 A;  1X2Q A;  2ZPI B;  1SSF A;  2D0Q B;  3S3O A;  3VUB A;  3OMC A;  1UDL A;  2AZV A;  3CXC S;  2HBP A;  3NTI A;  4ZN1 A;  5LJ5 g;  3CCM A;  3M0S A;  1BI3 A;  2XI9 A;  1VOM A;  1UE9 A;  1HSQ A;  3H6Z A;  2EVR A;  2X3W D;  1M4Z A;  2DLP A;  3VS0 A;  2K79 A;  2YUQ A;  4C8Q D;  4ATO A;  1AWW A;  4ANJ A;  1YWO A;  2KAF A;  4M7A D;  2HKN A;  2YLB A;  3T9N A;  4LXC A;  4AFU C;  2MMP A;  1D3B B;  4C92 F;  2VVK A;  4M77 A;  4RCB A;  3PTA A;  1K0S A;  1W2B A;  4M7D B;  1YJ9 T;  1VQ9 A;  1I07 A;  4DOW A;  4R55 A;  4J9C A;  1Q82 C;  4RMO A;  3M53 A;  1VQN T;  2M02 A;  3VS5 A;  3ZFJ A;  3QBY A;  1QVF S;  1WHK A;  2PUK B;  2LQW A;  2RHX A;  1YHQ A;  1KQS S;  1VQK T;  3OBW A;  2D6F A;  3J81 E;  2H3J A;  5DM7 R;  3R6O A;  1WDX A;  4J9I A;  2K2V A;  1V76 A;  4J7I A;  3SHW A;  2CKK A;  4J6Y A;  2DM1 A;  2E64 A;  2AK5 A;  3PIO A;  1I5O B;  3L2R A;  1PRM C;  1BU1 A;  1VQ4 A;  2E12 A;  2DIG A;  3CCE A;  1CSK A;  2CYZ B;  5LJ3 h;  4JS4 A;  3MPU B;  3GF5 A;  1M2O A;  2K2M A;  1RLQ C;  4AFS C;  1K4U S;  2RQR A;  3PE0 A;  2KRS A;  3QZ5 B;  4M75 E;  3FIF A;  2DL4 A;  4FYW B;  3M9Q A;  3R6N A;  5GAO m;  2IG0 A;  3BDL A;  2J6F A;  1X43 A;  3QSU A;  3LYI A;  1G3W A;  3ULR B;  3V8L A;  3CCE Q;  1AT1 B;  4E7H A;  4BY6 C;  3LW5 E;  2A36 A;  3S3M A;  4M7A G;  1UHF A;  1N27 A;  4J9E A;  4M77 C;  4IKF A;  4OP0 A;  3INZ A;  4JJD A;  3JCM W;  2DET A;  3X26 B;  4QQG A;  4F16 A;  3X24 B;  3VRZ A;  1YJW T;  5D6X A;  2H3E B;  2JM9 A;  3QDR B;  1VQ6 A;  4NS5 A;  1V1C A;  4RTX A;  3L1A A;  3A8O B;  2BUD A;  4IUT A;  1VQ5 T;  3TCJ A;  4CI0 C;  2M9U A;  1WHM A;  3OYL A;  3EH2 A;  2WSC E;  2GGR A;  3L2Q A;  1WX6 A;  2CT4 A;  1RAC B;  2EJG A;  3C94 A;  3EGX B;  4XTX A;  1NM7 A;  4XK8 E;  5ECA A;  3H0F A;  3CC4 T;  2JN0 A;  2NUT B;  1ZUY A;  1M2V B;  2LNV A;  3A5Z B;  5GAN f;  1VQ6 Q;  3E2U A;  4AG2 C;  2G6F X;  3EH1 A;  1K9M R;  4AFQ C;  2HEQ A;  4OGC A;  5KYU A;  3QZ9 B;  1VQP T;  4WTO B;  3CCV A;  2JS0 A;  5IHI A;  2DZC A;  2L5Q A;  1LPL A;  3EFO B;  1K8A C;  3PT9 A;  4A63 B;  2NUP B;  5A0D A;  4M75 G;  2YUP A;  1H8K A;  1YN8 A;  3CEY A;  1O9S A;  3CCU A;  2GF7 A;  2RJD A;  2BZX A;  1PKT A;  1S72 T;  2EW3 A;  3G1J A;  2DNU A;  1AEY A;  3U23 A;  2ZAE A;  2X4X A;  2HMA A;  4HCK A;  4JJB A;  1CKA A;  1ZSZ A;  2GQV A;  1YP5 A;  1ABQ A;  4PJL A;  1H3H A;  1WJQ A;  2X9H A;  1NBE B;  2L3P A;  4PFP A;  1PRL C;  3CCS T;  2QTV A;  4EMH A;  2X51 A;  4MZP A;  3JCM b;  3I35 A;  2COZ A;  4BUG A;  4FT2 A;  2R58 A;  2RQT A;  1E7O A;  2MOX A;  4IIO A;  2YT6 A;  4DEY A;  1YJN A;  1EFN A;  1GBR A;  3OSS C;  2KBT A;  3OS1 A;  3V8J A;  4HT8 A;  2FPF A;  4F04 B;  3A8G B;  4KBM B;  2IPO B;  3GNG A;  1C1A A;  3D7S B;  4Z89 A;  4A4F A;  2NLU A;  2FHD A;  3SDZ A;  3G71 T;  2HZY A;  3OA6 A;  2K5L A;  2RQW A;  1OZ3 A;  1WPY A;  1KG1 A;  4QKU A;  3DLM A;  4WF2 A;  4K11 A;  5KYY B;  2KXD A;  5HK3 A;  2EJ9 A;  1SEM A;  5I22 A;  5GAN 8;  2KRM A;  2ED0 A;  2M0Y A;  4MZT A;  1OZ2 A;  2RK2 A;  1M90 U;  2X4Y A;  2L2P A;  5IN1 A;  2F69 A;  2LJ1 A;  3HKS A;  1FMK A;  2DTO A;  3P8H A;  1MHN A;  2O4X B;  4E7Z A;  1YI2 Q;  1S72 Q;  1SF9 A;  3QUI A;  3RMS A;  3ZBD A;  2YWW A;  5LJ3 g;  1ZSZ C;  1WXT A;  1NYG A;  2XKO C;  1VQO Q;  3CPF A;  1NEG A;  2BE7 D;  1WQ7 A;  1LJO A;  3CCQ A;  2ATC B;  1B07 A;  5GAM f;  1WXU A;  2DAQ A;  2YLC A;  3HRU A;  3GPL A;  1QLY A;  4M77 D;  4PJO F;  1JJ2 A;  2RHI A;  1J3T A;  2EYZ A;  4C8Q F;  1YWP A;  2XID A;  5L8R E;  4B9W A;  4OB0 B;  1VQM T;  2QA4 T;  4N4H A;  1JXM A;  2KT1 A;  4JZ4 A;  3CMA A;  2F5K A;  3RUX A;  2J05 A;  2K3Y A;  2LRQ A;  1NJI U;  4ZGJ B;  1G3Y A;  3OS5 A;  2HL5 C;  3EGD B;  3GNF B;  1BCO A;  1EX4 A;  1MNE A;  3G71 Q;  1BI2 A;  2BZY A;  3E9G A;  1QWF A;  2DL8 A;  2YUN A;  1RLP C;  5C6S A;  4AG1 C;  2PVO B;  3ZL7 C;  3G7Z A;  4GBQ A;  2SEM A;  2RHU A;  4M78 D;  4YTL A;  2RM4 A;  4Q5W A;  5FU7 B;  1AVZ C;  2OJ2 A;  5DLO A;  1Q81 C;  1ZBX A;  2LT4 A;  6AT1 B;  5HKC A;  3OYA A;  2CGH A;  4C92 E;  5CKD A;  4LUD A;  2P4R A;  3V7S A;  1VQL A;  2D9T A;  3LWI A;  2KEA A;  4KT0 E;  1KD1 R;  2CP0 A;  2E5Q A;  1JQQ A;  4RCC A;  4C5E A;  1W2B S;  1NYF A;  1IHV A;  2ZPG B;  2PVG B;  1K73 U;  2EBP A;  3BE3 A;  3P8B B;  4M77 G;  4F7U G;  2DFU A;  1W4S A;  4XTW A;  5FWB A;  2FG0 A;  1C6V X;  3BY7 A;  1M1F A;  2ZPH B;  4BD3 A;  1OU9 A;  2CSI A;  3L2V A;  1MND A;  3QWX X;  4PL6 A;  3BFM A;  1VQM Q;  2QA4 Q;  1TUD A;  4DA4 A;  2RQU A;  3MET A;  3QXE B;  3LH5 A;  4KGX B;  4L59 A;  1VUB A;  1JEG A;  4O6J A;  1Y96 B;  1WQW A;  4JPB W;  3I55 T;  1YIT Q;  3EG1 A;  1N9R A;  5CCA A;  3CCJ A;  2EYW A;  2DD4 A;  5FRN A;  2DVE A;  2K57 A;  3GP8 A;  2MCN A;  2H8H A;  3MO8 A;  2J6O A;  2JW4 A;  3CD6 A;  1MMN A;  3FLG A;  1UEB A;  4RTY A;  1OX8 A;  2HDA A;  3CC2 A;  1WA7 A;  4KH1 B;  2COY A;  3X20 B;  2EAY A;  4NL3 A;  2LQ8 A;  3TRE A;  3CCJ Q;  3CC7 Q;  4D6W A;  4BE1 A;  4M7D F;  1ZQ1 A;  5LJ5 j;  4OMF B;  1AWJ A;  5FU6 C;  1D0X A;  4BB7 A;  2AKL A;  1QVG A;  1IO6 A;  1Q86 U;  4JS5 A;  2X4W A;  4LD6 A;  1QQJ A;  1VIE A;  2MF2 A;  3OYE A;  2NYS A;  3NTH A;  3E9F A;  1VQ8 T;  3P8D A;  2VXF A;  1MV3 A;  2KK4 A;  2COW A;  4NL2 A;  4HCZ A;  3QII A;  2CUB A;  4C8Q B;  5GJW B;  1D1C A;  4RUG A;  4B6M A;  2VUB A;  3E19 A;  4M7A B;  3URG A;  2VGM A;  2KXC A;  5GAM d;  3EG9 A;  3WXM B;  3MHX A;  5GAO p;  1D3B A;  2DEU A;  1ZLM A;  4V2S A;  3KUF A;  2FRY A;  4M7D A;  5I21 A;  3I55 Q;  2P0Q A;  2R57 A;  4J7F A;  3VS7 A;  3BW1 A;  4C0D C;  1AZE A;  2A08 A;  3PVQ A;  1BK2 A;  1UHC A;  1LOJ A;  3M57 A;  3CME A;  1RL2 A;  1WHG A;  3A8M B;  2KYM A;  1CKB A;  4RTU A;  1AD5 A;  1OX9 A;  3CBP A;  3CCM T;  2DTI A;  2PU9 B;  4JLI A;  3JCM Q;  1T0H A;  2AT1 B;  4GLM A;  3OYG A;  4PNO A;  4XU0 A;  4HCC A;  4LE9 A;  1B3Q A;  3NMZ C;  1Y0M A;  2DL7 A;  3CXC P;  1WLP B;  2RI5 A;  1N9S A;  2FB7 A;  3RNJ A;  1JBM A;  2R5M A;  4A4K A;  5I11 A;  5GMK h;  3WVE B;  5GAN h;  4A4G A;  2XU8 A;  2C06 A;  1AHJ B;  4AT1 B;  5A0G A;  2OTL A;  2P4T A;  2OX7 A;  3H9N A;  3I5S A;  3CBM A;  5EC7 A;  3J80 E;  1HYO A;  1NPR A;  1BYM A;  1WXB A;  3I9Q A;  2DL3 A;  2HQE A;  3VUZ A;  2EQU A;  4C0Z A;  1WYX A;  2OAW A;  2EKO A;  5IXB A;  1Y71 A;  1VQ7 Q;  2QYZ A;  3M0U A;  1QVF P;  4M7D C;  4HXJ A;  3FC3 A;  3GIB A;  2DKG A;  2JOY A;  3ME9 A;  4C0F A;  1KQS P;  2JS2 A;  1TTH B;  4RKU E;  3JSC A;  4PJN A;  4LN2 A;  4P5N A;  2K9G A;  4J9H A;  1VQ4 T;  4N0A A;  2FZG B;  3JCM d;  3CCE T;  2QQS A;  5D6W A;  2QEX A;  2G3R A;  5KYN A;  4DOV A;  1N8R U;  2KYB A;  2PTK A;  2DK3 A;  1RAB B;  4KGV B;  2CUD A;  1GXI E;  2NUZ A;  2RPN A;  1WHH A;  1PD0 A;  3CCM Q;  1WJR A;  2NUT A;  3OYM A;  2RF0 A;  1M2V A;  4PLI A;  2JTM A;  2E1H A;  5CAI A;  2E65 A;  1BI1 A;  5FRM A;  4M78 F;  1WFW A;  4ELY C;  3L2U A;  1X6O A;  2CZ7 B;  2HSE B;  2DA9 A;  3DLL A;  3OYD A;  4OB3 B;  4PJO E;  3QHS A;  3G6E A;  3JB9 G;  3UPU A;  2MYS A;  1QCN A;  3M54 A;  3DB3 A;  2CP6 A;  2KVQ G;  2NUP A;  2I0N A;  1ZBJ A;  1JJ2 S;  2JTE A;  3CBO A;  3GBQ A;  1TU0 B;  1M90 R;  2HD0 A;  1U1S A;  1U1T A;  1VQ6 T;  1VQ9 Q;  5A0L A;  4QT7 A;  4E7I A;  2QQB A;  3M0Q A;  3TSZ A;  2JXB A;  2FPE A;  3M0P A;  1LCK A;  3SB2 A;  1M30 A;  2DXT A;  5LJ5 e;  4IUV A;  4RTV A;  3CCL A;  1H64 1;  1YHQ Q;  2KY9 A;  3QJY A;  4BDY A;  4PK4 A;  1Z9Z A;  4M75 D;  4C92 A;  1QWE A;  1NG2 A;  1WI7 A;  3NHN A;  4XQ3 A;  3VS1 A;  1OV3 A;  9ATC B;  1PC0 A;  2O2O A;  4M4Z A;  2AHJ B;  4N0A C;  3ZEH A;  4E7L A;  4OVA A;  2RI2 A;  1X01 A;  2PVD B;  3CCL Q;  1VQ4 Q;  4MZM A;  3RKX A;  2DL5 A;  3RES A;  3KBG A;  3CCU T;  2V8K A;  5L23 A;  1HD3 A;  2X35 A;  2QGF B;  1NJI R;  1YJ9 A;  4J6X A;  5GAO l;  4LNP A;  2YRD A;  1M9S A;  1EIF A;  3CCR A;  2JZ2 A;  1MMD A;  4FU6 A;  4HVV A;  5KYY A;  5LJ3 j;  2OI3 A;  2V8J A;  1UB4 A;  1FMW A;  4JDS A;  4OB1 B;  1VQK A;  3AHU A;  1QVP A;  3G4S A;  1I8F A;  1MV0 B;  1KD1 C;  1UGQ B;  3L2W A;  2O4X A;  5GAN g;  1YJN T;  5AYF A;  3O5Z A;  1SPK A;  2RQV A;  2MAM A;  4X9C A;  4RG2 A;  3OW2 S;  2YRC A;  1IRE B;  4N4G A;  4FSX A;  1V29 B;  1TS9 A;  4M77 B;  1M8M A;  1KJW A;  4F7U B;  3HRT A;  4C92 C;  3OYF A;  2FPD A;  1I1J A;  3OYI A;  1BB9 A;  1F1B B;  3Q1J A;  2DXC A;  1K73 R;  3JB9 H;  2CH4 W;  1YI2 T;  3VS6 A;  1PM3 A;  1N8R C;  1VQO T;  5GAN 4;  1W6X A;  4M7D E;  1R0C B;  3CCV Q;  4FIB A;  2EYX A;  1X6B A;  2MK5 A;  4E7K A;  1K1Z A;  3EGU A;  1OEB A;  2W10 A;  3OYH A;  2RJC A;  1ABO A;  2LMJ A;  3HSB A;  1LNX A;  3SWN B;  3CCU Q;  1QVG S;  2EGC A;  3JCM P;  2NWM A;  1KQ2 A;  1RAI B;  1WGS A;  2OAU A;  1ZSG A;  4KUD K;  1RI9 A;  2GTO A;  4E2F B;  1BCM A;  2XIC A;  5LJ5 d;  4M78 B;  1KFZ A;  1VQ5 A;  2A0F B;  1PCX A;  3UF4 A;  3C0C A;  1VIF A;  5GAN e;  1U3O A;  4MMK A;  3SEM A;  1I5L A;  3THK A;  4OMQ A;  3V7C A;  5KH6 A;  1BKB A;  4KUI A;  4XTV A;  3CC4 A;  1JO8 A;  4R56 A;  2DER A;  4FM4 B;  5IHK A;  2CP3 A;  2QQA A;  2XD0 A;  2AZS A;  3NTK A;  3GLX A;  1U8R A;  4II1 A;  1YJN Q;  3CPW A;  1Q86 R;  1VQP A;  3HTR A;  2GFU A;  1IGU A;  3C4S A;  3QG1 A;  4EDU A;  3UT1 A;  2DYI A;  4PKC C;  5KE2 A;  2DZ9 A;  4M7D G;  1GBQ A;  1QCF A;  1N6A A;  3LWH A;  4BE0 A;  2X3X D;  4HKE A;  3UA7 A;  3M4Y A;  1JRI A;  1QW1 A;  3UWN A;  2F2V A;  3C95 A;  4GLK A;  4IUR A;  3V7R A;  3CCS A;  1Y96 A;  5GAM g;  4Y91 A;  1R8O B;  1PKS A;  4A53 A;  2HNI A;  2HAX A;  2CS7 A;  4LDW A;  2A3L A;  3EFS A;  3JAM E;  2P0P A;  1AWO A;  4M7A F;  2Y90 A;  4IUU A;  1AZG B;  2MWO A;  3O8V A;  3CCQ Q;  1QVF A;  2QDL A;  3HL8 A;  1YIJ A;  1NE8 A;  1WNL A;  1YIT T;  4EMK A;  4TVR A;  3V8K A;  2EQK A;  2RJE A;  1W2B P;  5GMK m;  5J3B A;  2KQW A;  1SRL A;  2BZ8 A;  3J7A F;  1ZSZ B;  2V1Q A;  1UJ0 A;  2E6Z A;  2KT8 A;  2K7A A;  1I81 A;  4RG8 A;  1B34 B;  5CO7 A;  1TG0 A;  2LQK A;  1M27 C;  3CMA Q;  2VXE A;  1SHG A;  2DPP B;  3LLR A;  2JMC A;  3CCJ T;  3CC7 T;  5LJ3 e;  1EZZ B;  1HJD A;  2GTJ A;  5KCO A;  2JM8 A;  1KC8 U;  1XOV A;  1OOT A;  5IH2 A;  4RTZ A;  4PFO A;  4C92 D;  4C5H A;  2JUF A;  5KYW A;  3KFV A;  3CD6 T;  4C0G A;  4XTZ A;  4PJO A;  3H0H A;  5CQY A;  5IXF A;  4C8Q A;  3UA6 A;  2CP5 A;  4M75 F;  2QI2 A;  1VYT A;  1BBZ A;  3HPW A;  1UUE A;  3FEO A;  4ME7 A;  2CRE A;  2BKD N;  2QQR A;  4VUB A;  1U06 A;  3MP1 A;  5GAN 3;  3EFR A;  5CVI A;  4EMG A;  2VV5 A;  2L8D A;  3MP8 A;  2LDM A;  1VQL Q;  1X6G A;  2LJ0 A;  5GJV B;  1GCP A;  5CR2 A;  3L42 A;  5LL6 S;  4HVU A;  2CZ1 B;  2HQH A;  3AT1 B;  3L2Z A;  4B9X A;  5A2Q E;  1N8R R;  1GRI A;  3JCM f;  4EMK C;  2KI7 A;  4OB2 B;  3JCM V;  1M1K R;  1X75 C;  5GAN 7;  3UDC A;  2RJF A;  1RAA B;  2E41 A;  2IIM A;  1KHI A;  4QQ6 A;  3PMI A;  1G3S A;  2C0T A;  1Y7X A;  2M16 A;  1D1A A;  4JRK A;  3MEU A;  4L6V 5;  1ZA2 B;  1OQK A;  1KIK A;  2EQM A;  1D0Y A;  2DE0 X;  1M90 C;  2WAC A;  3OYN A;  4KUL A;  3QO3 A;  3OS0 A;  3SD4 A;  1SKU B;  2LP5 A;  2O9S A;  4C92 G;  4JJC A;  3VKI A;  2O88 A;  4PJO C;  1M3C A;  4CC7 A;  4C8Q C;  2FZK B;  2PNI A;  4RTW A;  1E6H A;  1KK7 A;  4M7A C;  3CD6 Q;  2RHY A;  5HCK A;  1DJ7 B;  3CC2 Q;  1AWX A;  2A7Y A;  4X34 A;  1HXD A;  2YDL A;  2Y4X A;  3HHT B;  4QQD A;  4PFZ A;  1RAH B;  1TUC A;  2HCK A;  1G83 A;  4DBQ A;  1O75 A;  3TVT A;  1VYU A;  2FEI A;  2RI3 A;  3TEE A;  4R0K A;  2JTF A;  4DEX A;  1VQ7 T;  1IB8 A;  1OYX A;  2LNH B;  2EKH A;  2GCX A;  2DMO A;  2XDP A;  3H8Z A;  3OSV A;  4Y92 A;  3I56 A;  1NJI C;  1OPK A;  2DEQ A;  3QYG B;  2V1R A;  2DX1 A;  2ABL A;  2B8A A;  1GL5 A;  1VA7 A;  4CRI A;  4FYV B;  3RER A;  5CKB A;  3C12 A;  1RAD B;  2EPD A;  1KC8 C;  4J5Y A;  2KNB B;  1FXX A;  2LCC A;  2RHZ A;  5D7U A;  4PJJ A;  5J26 A;  2D0N A;  5KCH A;  1B7T A;  1G8X A;  2XHC A;  3QYH B;  3F70 A;  4FT4 A;  2HQX A;  4L5G A;  2DJZ A;  2QEX T;  5FWC A;  1YCS B;  2ECZ A;  2KDS A;  2D8H A;  2AKK A;  3CME Q;  3VS4 A;  4M75 B;  2GNC A;  2DXU A;  1K73 C;  2MI6 A;  3JB9 D;  2E3H A;  1S1N A;  1Y07 A;  1E6G A;  3CQT A;  4WCI A;  1VQ9 T;  1OUL A;  1VQ8 A;  1ZX6 A;  1NPP A;  1H3Z A;  2F1L A;  3VS3 A;  4OMO A;  2JT4 A;  1PSE A;  2YUO A;  2CH4 A;  3MKD A;  2BIV A;  2PZ1 A;  3FJP A;  1JXO A;  1FMV A;  1T0J A;  1WIE A;  1KQ1 A;  3G6E T;  1JB0 E;  1YHQ T;  1RAF B;  3JCM c;  4OMM A;  2J6K A;  2K5F A;  2O01 E;  1GFD A;  4PJM A;  3QWY A;  1C0M A;  5DY9 A;  3HRS A;  1M3B A;  2FL7 A;  4AFZ C;  4M77 F;  2M51 A;  4DQ2 A;  4E7J A;  1QKX A;  3NPF A;  4F7U F;  5J39 A;  2OTL Q;  2L3Q A;  1YNZ A;  1QCO A;  1R0B G;  2PQW A;  3ASK A;  2CZ6 B;  2PUO B;  3QJ6 A;  3CPW S;  2M0O A;  1JJ2 P;  3GOX A;  5GMK j;  3OBY A;  5GAN j;  3CCL T;  2O9V A;  1NEB A;  1Q7Y R;  4E7S A;  5KYX B;  1ZHI A;  2C0O A;  4HVW A;  3PNW C;  4IUP A;  1OI1 A;  2F2W A;  2QQ9 A;  2DRM A;  3EGX A;  4CC3 A;  1K8A U;  1WHJ A;  2LT1 A;  5LJ5 f;  3PMT A;  1M1K U;  1OPL A;  5FW9 A;  2JMA A;  2J7I A;  7AT1 B;  1Q86 C;  3M56 A;  1MMA A;  2LX7 A;  4FYY B;  1TWB A;  3M59 A;  3EG9 B;  2CZ0 B;  4PJO D;  1AOJ A;  4OGE A;  2KGT A;  2QEX Q;  2XMF A;  2V8I A;  2V26 A;  4C8Q E;  5GAN 5;  3EFO A;  2E70 A;  2OTJ A;  3TSW A;  4M7A E;  4HCB A;  4F7U A;  1X69 A;  2FZC B;  4HT9 A;  5D6Y A;  1ZUU A;  2RNA A; 
#chains in the Genus database with same CATH homology
 1QWF A;  2CSQ A;  1ABO A;  2LMJ A;  4J9B A;  2DL8 A;  2YUN A;  1RLP C;  4AG1 C;  3ZL7 C;  2EGA A;  4IIM A;  2EGC A;  4GBQ A;  2SEM A;  4RTT A;  4F17 A;  1T3S A;  2NWM A;  1SSH A;  1ZSG A;  2DJQ A;  1RI9 A;  2GTO A;  1W1F A;  1AVZ C;  2OJ2 A;  4KRT A;  2DBK A;  4F14 A;  1K9A A;  1KFZ A;  4LUD A;  2P4R A;  4FSS A;  3UF4 A;  3C0C A;  2KEA A;  1U3O A;  3SEM A;  1JQQ A;  3THK A;  4OMQ A;  4X1V A;  4CC2 A;  1NYF A;  1A0N B;  1Z9Q A;  4CC4 B;  1JO8 A;  2ROT A;  2EBP A;  1UFF A;  5IHK A;  1SRM A;  2DIL A;  2AZS A;  3M0T A;  5FWB A;  2ENM A;  2FG0 A;  1UGV A;  3REA B;  2KE9 A;  3I5R A;  2RMO A;  2CSI A;  2SRC A;  1QKW A;  3QWX X;  4Z88 A;  1TUD A;  2LZ6 B;  3UAT A;  2C0I A;  3JV3 A;  1K76 A;  2RQU A;  1Y57 A;  3LH5 A;  1JEG A;  2J06 A;  2CT3 A;  4JPB W;  1GBQ A;  1QCF A;  3EG1 A;  2EGE A;  2EYW A;  2ROL A;  2MCN A;  2GQI A;  4ORZ A;  2X3X D;  2H8H A;  4LUE A;  2FRW A;  2J6O A;  2JW4 A;  3UA7 A;  1UJY A;  4D8K A;  4RTY A;  2HDA A;  2F2V A;  1WA7 A;  1PKS A;  1X2Q A;  4OMP A;  1UDL A;  4D8D A;  2AZV A;  1AWJ A;  1AWO A;  4OML A;  3M0S A;  2AKL A;  1AZG B;  1IO6 A;  1UE9 A;  1HSQ A;  3EHQ A;  2QDL A;  2VWF A;  2EVR A;  2X3W D;  2KRN A;  2DRK A;  2DVJ A;  2DLP A;  3VS0 A;  1UEC A;  2K79 A;  2YUQ A;  1AWW A;  1YWO A;  2K3B A;  1SRL A;  2BZ8 A;  2EYY A;  4AFU C;  1MV3 A;  2VVK A;  1K0S A;  2V1Q A;  1UJ0 A;  1MUZ A;  2CUB A;  2KT8 A;  2K7A A;  5GJW B;  2O31 A;  4RUG A;  1I07 A;  1TG0 A;  4J9C A;  2L0A A;  1M27 C;  2KXC A;  1SHG A;  2BTT A;  2JMC A;  1UG1 A;  3VS5 A;  1HJD A;  1M3A A;  2GTJ A;  2JM8 A;  1XOV A;  1OOT A;  5IH2 A;  2DYB A;  2LQW A;  4RTZ A;  1ZLM A;  3KFV A;  2FRY A;  3H0H A;  5IXF A;  4E6R A;  3UA6 A;  3RBB B;  2F2X A;  3VS7 A;  1AZE A;  1VYT A;  1WDX A;  2A08 A;  1BK2 A;  3PVQ A;  1BBZ A;  4J9I A;  1UHC A;  1UUE A;  1X27 A;  2GBQ A;  3SHW A;  1PWT A;  2CRE A;  2KYM A;  2DM1 A;  1U06 A;  1CKB A;  4RTU A;  2AK5 A;  1AD5 A;  2RN8 A;  1PRM C;  1BU1 A;  1X2K A;  3A98 A;  1CSK A;  1T0H A;  4GLM A;  2B86 A;  2D1X A;  2K2M A;  4LE9 A;  1RLQ C;  4AFS C;  1K4U S;  1X6G A;  2RQR A;  3PE0 A;  2KRS A;  2LJ0 A;  1B3Q A;  3NMZ C;  1Y0M A;  2DL7 A;  5GJV B;  1GCP A;  1WLP B;  2DL4 A;  2LCS A;  4HVU A;  3RNJ A;  3R6N A;  2LQN A;  2J6F A;  1GRI A;  5I11 A;  1X43 A;  3ULR B;  1NLO C;  2A36 A;  1UHF A;  2IIM A;  3I5S A;  4OMN A;  4J9E A;  2C0T A;  4JJD A;  5EC7 A;  3EG0 A;  1KIK A;  2LJ3 A;  4F16 A;  3VRZ A;  2DE0 X;  1WXB A;  2EQI A;  3I9Q A;  2JM9 A;  3VS2 A;  2DL3 A;  1NLP C;  1V1C A;  1WYX A;  4RTX A;  2OAW A;  5IXB A;  2LP5 A;  2O9S A;  2HSP A;  3M0U A;  2GGR A;  1W70 A;  4JJC A;  1WX6 A;  2CT4 A;  2O88 A;  3H0I A;  1M3C A;  1G2B A;  4HXJ A;  4CC7 A;  1VYV A;  1NM7 A;  2PNI A;  4RTW A;  1E6H A;  5ECA A;  2JS2 A;  3H0F A;  2DF6 A;  1ZUY A;  5HCK A;  4LN2 A;  1AWX A;  2K9G A;  4J9H A;  2E5K A;  1T3L A;  4AG2 C;  2CDT A;  2YDL A;  2G6F X;  4AFQ C;  2HEQ A;  2KYB A;  2PTK A;  2YSQ A;  2ED1 A;  2JS0 A;  5IHI A;  1TUC A;  2CUD A;  1N5Z A;  2HCK A;  2NUZ A;  2RPN A;  1G83 A;  4A63 B;  3REB B;  3TVT A;  1I0C A;  1VYU A;  2FEI A;  2RF0 A;  2YUP A;  1H8K A;  1UTI A;  1KSW A;  1YN8 A;  2VKN A;  4R0K A;  4DEX A;  2BZX A;  1PKT A;  2K6D A;  2EW3 A;  2LNH B;  1WFW A;  1U5S A;  2EKH A;  2DNU A;  1AEY A;  3U23 A;  2DMO A;  2DA9 A;  4EIK A;  4Y92 A;  1H92 A;  4HCK A;  1OPK A;  3NGP A;  4JJB A;  1CKA A;  1GCQ A;  1YP5 A;  1ABQ A;  2W0Z A;  2I0N A;  1ZBJ A;  2JTE A;  2V1R A;  2DX1 A;  3GBQ A;  1H3H A;  1FYN A;  1RUW A;  2ABL A;  4J9D A;  3EG2 A;  2L3P A;  1PRL C;  1GL5 A;  4ZNX A;  4QT7 A;  1VA7 A;  1ZUK A;  3TSZ A;  3M0Q A;  3M0R A;  2FO0 A;  2JXB A;  2FPE A;  3I35 A;  1JU5 C;  3M0P A;  1LCK A;  1M30 A;  2EPD A;  3H41 A;  2KNB B;  4RTV A;  2RQT A;  1E7O A;  2MOX A;  4IIO A;  2YT6 A;  4DEY A;  1EFN A;  1GBR A;  2D0N A;  4Z8A A;  1Z9Z A;  3EHR A;  2KBT A;  2FPF A;  4ESR A;  1QWE A;  1NG2 A;  1WI7 A;  3NHN A;  3VS1 A;  3FJ5 A;  1OV3 A;  5FWC A;  2O2O A;  4Z89 A;  1YCS B;  2ECZ A;  4M4Z A;  2D8H A;  2AKK A;  3VS4 A;  2GNC A;  2RQW A;  2ESW A;  1GFC A;  1S1N A;  4K11 A;  2DL5 A;  2KR3 A;  2KXD A;  1E6G A;  3CQT A;  4WCI A;  1SEM A;  5I22 A;  1ZX6 A;  2KRO A;  2KRM A;  2ED0 A;  5L23 A;  3VS3 A;  2M0Y A;  4OMO A;  2JT4 A;  1HD3 A;  2CH4 A;  2YUO A;  2PZ1 A;  4J9G A;  1JXO A;  1T0J A;  1WIE A;  2L2P A;  4LNP A;  2LJ1 A;  3PVL A;  1ARK A;  1FMK A;  2J6K A;  4OMM A;  1GFD A;  2MIO A;  3QWY A;  2HBW A;  4HVV A;  1PHT A;  2OI3 A;  1M3B A;  4AFZ C;  2M51 A;  1QKX A;  3NPF A;  5IHN A;  1WXT A;  1GCQ C;  2L3Q A;  1YNZ A;  1NYG A;  1NEG A;  1K0X A;  2L3S A;  3VRY A;  1B07 A;  1MV0 B;  1WXU A;  1PNJ A;  2O9V A;  2A37 A;  4JZ3 A;  1NEB A;  1QLY A;  3O5Z A;  2C0O A;  1J3T A;  1SPK A;  2EYZ A;  4HVW A;  2F2W A;  2RQV A;  1YWP A;  2DRM A;  4CC3 A;  1SHF A;  4J9F A;  3EG3 A;  2A28 A;  1OPL A;  1M8M A;  5FW9 A;  2KT1 A;  1JXM A;  1KJW A;  2JMA A;  2DBM A;  2FPD A;  1I1J A;  2J7I A;  1BB9 A;  4JZ4 A;  2LX7 A;  3IQL A;  2J05 A;  2CH4 W;  3VS6 A;  1AOJ A;  2KGT A;  2XMF A;  1W6X A;  2EYX A;  1X6B A;  3TSW A;  1K1Z A;  3EGU A;  1OEB A;  1X69 A;  1ZUU A;  2W10 A;  2BZY A;  2D8J A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...