2DLPA

Solution structure of the sh3 domain of human kiaa1783 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
85
structure length
85
Chain Sequence
GSSGSSGSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SH3 domain of human KIAA1783 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords KIAA1783 protein
total genus 6
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dlpA00
3I35A 4RTXA 1IO6A 3M0SA 4OMNA 4QT7A 1GL5A 1QLYA 3I5RA 1T0JA 1M3BA 1KFZA 2YUPA 2EPDA 2PNIA 3LH5A 2ROLA 1ABQA 2O2OA 2BZXA 2YUNA 4AFSC 1VYVA 2A28A 2FRWA 2A37A 2YUOA 4J9BA 2GTOA 1WI7A 3VS3A 2CSQA 2D8HA 3EG1A 1SHGA 2AZSA 2J6KA 2K2MA 3VS5A 1ZSGA 2DYBA 1ZUUA 3M0RA 2RPNA 3EHRA 1ABOA 2NUZA 2DA9A 2C0OA 2DL7A 4IIOA 2KROA 2LP5A 2RF0A 1RLPC 1ZUKA 2FO0A 1K9AA 3M0PA 1SHFA 4OMMA 2D0NA 4DEYA 2E5KA 2KEAA 1NLOC 3GBQA 2I0NA 2J06A 5L23A 1NM7A 2CH4W 4AG1C 4ESRA 2HBWA 2LQNA 2JXBA 2YDLA 1KSWA 2F2XA 2LMJA 2AZVA 2DLPA 1VYUA 2DBMA 2DVJA 4E6RA 2D1XA 2L0AA 2P4RA 1OEBA 1PKSA 1B3QA 3H41A 4CC3A 2LJ3A 1NEBA 2AKLA 5EC7A 1GCQC 3PVQA 2B86A 2XMFA 3M0TA 2JTEA 2OJ2A 3VS1A 3NPFA 3ZL7C 1K76A 2EKHA 1HSQA 1YNZA 2LJ1A 1GCPA 2ROTA 1WXUA 3RBBB 3VS0A 2KRSA 1X6BA 1BK2A 1MV0B 2C0IA 2KYBA 1AZGB 1WLPB 1NYFA 1UE9A 2EYWA 4HCKA 5FWBA 4DEXA 2GNCA 4RUGA 2KGTA 1OV3A 1U06A 3VS2A 1UHCA 1J3TA 1YWOA 1X2QA 1LCKA 1FYNA 2L3PA 3M0UA 1K0XA 1OPLA 3UA7A 4HXJA 2JW4A 2KRNA 2GQIA 2M51A 3UATA 1GBRA 2LX7A 3O5ZA 2CUDA 1M27C 3VS7A 4LNPA 2MIOA 1GFDA 3ULRB 1WIEA 2HEQA 3CQTA 2ENMA 4OMPA 5I22A 1M30A 1JXOA 1NLPC 4RTTA 1SRLA 4HVVA 1BU1A 2L2PA 1ZUYA 2BTTA 1RLQC 3EG0A 5GJWB 3REAB 1WXTA 2FPFA 3TSZA 4CC7A 1T3LA 4RTZA 4J9CA 1PRMC 1CKBA 2HDAA 2JMCA 1X69A 2O31A 1JU5C 2RQVA 3EG2A 1W6XA 2KR3A 2JMAA 2K7AA 2EYZA 1K4US 3KFVA 4OMOA 5IHIA 4HVWA 1GBQA 1KJWA 1Y57A 2EVRA 1M3AA 1UHFA 1SPKA 2RNAA 1U3OA 1JXMA 2ED1A 4ORZA 2KXCA 2VVKA 4Z88A 3FJ5A 2A08A 2KXDA 2OI3A 4F14A 1B07A 1GFCA 1PRLC 2EGEA 2RQRA 2SRCA 1CKAA 3VRYA 1UFFA 3NHNA 1NYGA 1T0HA 1H8KA 3VS6A 2EBPA 2A36A 1FMKA 1GRIA 5IXBA 1MUZA 2O88A 1AWWA 2RQWA 4FSSA 3I9QA 1RUWA 2FG0A 1VYTA 2V1QA 4JJDA 2K3BA 2RN8A 2PTKA 2G6FX 2O9SA 1X43A 2X3WD 2JM8A 4EIKA 3R6NA 1ZBJA 2CDTA 1AWJA 2VKNA 3UA6A 1I1JA 2K6DA 4Z8AA 3QWXX 1YCSB 1EFNA 2KT8A 3REBB 4D8KA 2LCSA 1Y0MA 1Z9ZA 4LUEA 2JS2A 1UG1A 2KE9A 2RQTA 1M8MA 2DL4A 2DRMA 1NEGA 1U5SA 1ZX6A 4R0KA 2JS0A 2OAWA 1GCQA 2VWFA 3UF4A 2J05A 2K9GA 1UDLA 4JJBA 2EYYA 2NWMA 4JPBW 3M0QA 2CSIA 2DM1A 2LNHB 4Y92A 1HJDA 2JM9A 2GBQA 4RTYA 4A63B 1AEYA 2LZ6B 3H0HA 4F17A 1AVZC 1X2KA 4ZNXA 1TUDA 1VA7A 4JZ3A 2KYMA 1QCFA 2KBTA 2ECZA 1XOVA 1JQQA 1K0SA 3I5SA 2AKKA 1WYXA 4LUDA 1G83A 2HSPA 1ARKA 2GGRA 1PWTA 4RTUA 3EG3A 2YT6A 3THKA 1MV3A 1WDXA 1WFWA 2BZ8A 1QKXA 1WX6A 2IIMA 1UTIA 1AWXA 2RQUA 3QWYA 2J6OA 2KT1A 4GLMA 4J9FA 1WA7A 2W10A 1QWFA 2KRMA 2DL5A 1UJYA 2DX1A 4OMLA 2DRKA 2HCKA 2L3SA 2RMOA 1K1ZA 4LE9A 1ZLMA 1AZEA 2O9VA 2W0ZA 2J6FA 3VS4A 1H3HA 4GBQA 3RNJA 4M4ZA 1UUEA 1PKTA 2EW3A 1QWEA 2DJQA 4JZ4A 1BBZA 2H8HA 2MOXA 4WCIA 5ECAA 2FEIA 1W1FA 2GTJA 2CT3A 1UECA 1W70A 1X27A 4JJCA 1JEGA 2CT4A 1AOJA 2CREA 2LQWA 1Z9QA 4J9HA 2V1RA 3H0FA 4IIMA 2DMOA 2F2VA 4AFZC 1A0NB 1E6HA 1KIKA 3U23A 3VRZA 1AD5A 2FRYA 2J7IA 1M3CA 1PNJA 1BB9A 1WXBA 3IQLA 1T3SA 4F16A 2DILA 2DBKA 1H92A 2K79A 4RTWA 1JO8A 4CC2A 2AK5A 2FPEA 2FPDA 3EHQA 2EGCA 3TVTA 5IHKA 2DNUA 5I11A 2CH4A 1E6GA 1YN8A 3NGPA 4D8DA 2M0YA 2ESWA 2EQIA 1TUCA 2CUBA 1RI9A 2KNBB 3TSWA 3SEMA 1X6GA 3NMZC 5GJVB 1AWOA 2LJ0A 1SRMA 2C0TA 4AFUC 1UJ0A 2EGAA 4K11A 4J9EA 1SEMA 2DL8A 2DF6A 2SEMA 1YP5A 1E7OA 1QKWA 1NG2A 1V1CA 1CSKA 2X3XD 2PZ1A 3EGUA 4CC4B 1TG0A 1HD3A 5IH2A 2MCNA 4LN2A 4KRTA 1I0CA 1YWPA 2YUQA 4Z89A 1SSHA 2BZYA 2F2WA 1N5ZA 1UGVA 5HCKA 2YSQA 4AG2C 2DE0X 5IXFA 2DL3A 4HVUA 2EYXA 5FW9A 3H0IA 1OOTA 3C0CA 4X1VA 3PE0A 1S1NA 4J9GA 3PVLA 3SHWA 2QDLA 1G2BA 1I07A 1PHTA 4AFQC 2ED0A 1OPKA 5IHNA 5FWCA 4J9IA 2ABLA 2D8JA 2L3QA 3A98A 4J9DA 2JT4A 3JV3A 4OMQA 4RTVA
chains in the Genus database with same CATH superfamily
4OMNA 1N9SA 3H8ZA 1IRXA 5LJ5e 1JB0E 1XTDA 2MAMA 1M3BA 3M57A 2DXTA 1ABQA 1IHVA 2O2OA 4C0GA 4M7DG 2QK0A 1NPPA 1ZBXA 2CGHA 1NZ9A 1QVFP 1VQ4T 2RM4A 4M7AG 3SFMA 3JRZA 1JJ2P 3EG1A 1ZA2B 4PLLA 3CXCP 2WSEE 3TREA 3JCMd 1MNDA 2NUZA 2DA9A 3CMAA 2DL7A 3FDRA 2KROA 1VQ5T 4Q5WA 2XU8A 2FO0A 2PVDB 1UEBA 4M75D 2J06A 5L23A 1YJNQ 1RAHB 1M1KC 3M59A 1I5LA 1HXDA 2CP5A 1D0YA 2FVUA 1N8RC 2AZVA 1VYUA 3G6EA 2LQ8A 1YJWT 3H6ZA 3H41A 2QEXA 2AKLA 3PVQA 2B86A 3ZBDA 3P8BB 5GANg 2E10A 1QW1A 5EG2A 5FU6B 2VC8A 2KK4A 4Y91A 3X28B 1YNZA 5D6WA 4IUTA 1YJNT 2EJ9A 3TQ7P 1X6BA 1BK2A 2KYBA 2EKOA 2RO0A 2MK5A 4HCKA 5FWBA 2GNCA 4RUGA 3RKXA 1YITT 4M7AE 1OV3A 2DVEA 3VS2A 1J3TA 3E9FA 3EGXB 2R57A 1K0XA 2CZ6B 1QVGP 1GBRA 2CUDA 5GAOq 2MIOA 2MMPA 3G6ET 3ULRB 4FW2A 2HEQA 3CQTA 1KC8C 2ENMA 1VQ8T 1VQKA 2P0KA 1QMCA 5A2QE 2E6ZA 3EG9A 1BI3A 3BDLA 4RTTA 2K3YA 1VQ7Q 2X4JA 4M77E 1SRLA 2EQMA 5A0LA 1PSFA 3CC7Q 1ZUYA 2BTTA 3EFOB 4M75C 3TSZA 3L2RA 3EFSA 1T3LA 1TUGB 3VKIA 4N4HA 2CP0A 1CKBA 3UPUA 2K5IA 5D6XA 5J39A 2VGMA 1V76A 2KR3A 2EQKA 1VQ7A 1OZ3A 1YI2A 3OSSC 2X4WA 2MWPA 4FU6A 3GOXA 4BDZA 2CZ0B 5IHIA 3CCEQ 4HVWA 2EWNA 2E5QA 2QDYB 5LJ3h 5KYXA 2F69A 4ORZA 4CRIA 2OTJQ 4NOYA 3FJ5A 2A08A 2QA4A 1GFCA 1Y96A 2YRDA 2RQRA 2Y4XA 3VRYA 2XD0A 4QW2A 2R58A 2QGGA 3BFMA 3M4YA 3NHNA 1T0HA 3VS6A 1WHMA 1MUZA 3I9QA 4QKUA 3JB9G 1VYTA 2K3BA 2RN8A 5GAMe 4R55A 5CAIA 2JM8A 2CDTA 1AWJA 1I1JA 3G71Q 4C8QD 5GAOn 1YCSB 2KT8A 2EFIA 3PIPA 1VQ7T 1Y0MA 3GNFB 2R5AA 4XAXB 4JLGA 3M5AA 3EGXA 2JS2A 1UG1A 1NBEB 2AHJB 1Q81R 1VQLQ 1K9MU 2DRMA 2QG9B 4YTLA 1UB4A 3OS1A 1U5SA 3HSBA 4F7UE 2VWFA 3PIOA 1MHNA 3JB9I 1U1TA 5L8RE 1UDLA 4JJBA 3OYJA 2QTVA 2DM1A 3QYGB 1PSEA 3OSVA 2RH2A 4Y92A 3GF5A 2GBQA 1D0XA 4F7UF 2MWOA 2LZ6B 3CMAQ 1AVZC 3CC2A 4ZNXA 4C92D 5FRNA 1G3YA 2KBTA 4M7DD 3FB9A 3QXEB 1K0SA 3I5SA 4PK4A 2KI7A 3N5BB 1YITA 4RTUA 4E2FB 1OZ2A 4X34A 3S6WA 1WDXA 4PL6A 1M9SA 4XK8E 2IIMA 3A8HB 4GLMA 2KT1A 4NL2A 1D1AA 4J9FA 1WA7A 3EGDA 1KD1C 1VQ9Q 2QQRA 5I21A 4OMLA 4OMFB 3T9NA 4A54A 3E19A 4LE9A 1ZLMA 5CCAA 3CXCA 1VQMT 2O9VA 2ZZDA 2J6FA 1H3HA 3RNJA 1UUEA 2DJQA 4JZ4A 1BBZA 1D3BB 4WCIA 5CR2A 2FEIA 3CCQQ 3C94A 3PTAA 4JJCA 1JEGA 4M7DF 2LQWA 4RCBA 1WHJA 3M55A 1D0ZA 3WVEB 4AFZC 1B34A 2JVVA 4D6WA 3CCRT 1YIJA 1E6HA 3U23A 1VQMA 1AD5A 2H3EB 1VQ5A 3IQLA 3OS0A 5FU6C 4F16A 2DILA 4RTWA 2QTXA 1IHWA 5LJ3j 3A8GB 5CKFA 5I2MA 1QVFS 5IHKA 1MMNA 2E64A 2PVOB 3M9QA 3CC2Q 3FEOA 4J7IA 5LJ3f 1E6GA 3VU3C 2X4XA 4D8DA 2DFUA 4II1A 5LJ3g 2CUBA 5AT1B 4RCCA 4JRQA 3NMZC 4M7DC 5DM7R 4AFUC 2EGAA 4J9EA 2KMTA 2DL8A 3M53A 2DERA 2E1HA 3PFSA 3DLMA 1NG2A 1HD3A 1RADB 1QVPA 2YUQA 3GLXA 4Z89A 4OB1B 3CCSA 3CCMT 1GXIE 1UGVA 2O4XB 5GAN5 3QYHB 3RR6A 3CCLQ 4AG2C 2DE0X 1I8FA 2HQXA 3HKSA 1RABB 3I56T 3CCQT 1D09B 5KYYA 2BE7D 1VQKQ 2CKKA 2K3XA 1G2BA 1M2VB 1PHTA 1Q82R 1KQ2A 3FC3A 3CC4Q 1YJ9Q 3VYHB 4C5HA 5IHNA 4FYXB 4ELZC 5GAN3 2K4YA 5GAN6 1M2OA 2D8JA 1FWZA 5KYXB 2K5FA 3CMET 3M58A 1NE8A 1VQOA 2V26A 2MF2A 4RTVA 2OTLT 2DZ9A 1IO6A 3M0SA 1Q82C 4QT7A 1YIJT 2QQBA 5I2SA 1T0JA 1ZHIA 2EPDA 2PNIA 4N4GA 8AT1B 1VQNA 2YUNA 1WQWA 2FRWA 2HD0A 3A1PA 2QQAA 1BCOA 3X24B 3VS3A 2ZCFB 1SHGA 3RIRA 2AZSA 4FYYB 5GANd 4ZTJA 4TVRA 2DYBA 1ZUUA 3M0RA 2RPNA 3EHRA 2ATCB 2VXEA 1ABOA 4NS5A 1LNXA 3RDVA 2C0OA 3HPWA 2XG8D 4IIOA 2RF0A 1TOVA 2M02A 4EMKA 2Y90A 3MPUB 1K9AA 1SHFA 1Q86C 4C92B 4EMKC 4PFZA 3L2VA 2D6FA 3LW5E 3CC4A 2I0NA 2O01E 3RKWA 1YJNA 1PC0A 1Q81C 4ESRA 1SF9A 2L5QA 4ZTFA 1KSWA 2NUPB 4FYVB 4E47A 5GAN2 4M75B 1OQKA 2L8DA 4PNOA 1S72A 5C0MA 1G3WA 4J6YA 4E6RA 3OYDA 4HA8A 1PKSA 2VUBA 1B3QA 2QEXT 4HT8A 4KGZB 1NEBA 1GCQC 4ZGDB 2GQVA 2AIRB 3M0TA 1KQSP 2EQUA 2OJ2A 3RUXA 3OYNA 3VS1A 1W2BP 2Y4YA 3FJPA 4E7KA 3JCMX 1K76A 4JRPA 5KYYB 2EKHA 1HSQA 4M77F 2LJ1A 1ZA1B 1WXUA 2CP6A 2JTFA 3VS0A 2KRSA 4M7AB 4C8QC 3OYAA 4OF1A 3VUZA 2DD5A 3EG9B 3JCMg 1OU8A 2JTMA 2K57A 2C0IA 3G4SQ 1UE9A 2RI2A 1LPLA 1UHCA 1YWOA 1BIAA 1LCKA 4ZN1A 1XNIA 3G4SA 4M7AA 4L6V5 1TU0B 2M51A 2E6NA 3O5ZA 2YLCA 3WVDB 4HT9A 3G71T 3V8LA 3Q1JA 1M30A 1U8RA 1JXOA 3EGDB 4VUBA 3EH1A 1B34B 1FX7A 5KYUA 4HVVA 2L2PA 5GJWB 2FPFA 5CIUA 1PRMC 2HKQB 3JSCA 4FM4B 4F7UG 5LJ5g 4IUUA 4FYWB 1QCOA 4PJOE 2OX7A 3KFVA 1YHQQ 3S3OA 2A3LA 4X9DA 3JCMP 5GAOp 3QJYA 2OAUA 5CVIA 1SPKA 1UGSB 2BKDN 2RNAA 5FU7B 4KUDK 4BI3A 4L5GA 3MKDA 4JJNK 2KXDA 2OI3A 4F14A 4KGVB 2FZGB 1VQ4A 2RJEA 1PRLC 2EGEA 2R5MA 1YHQA 2EJFA 4PJOD 2EBPA 4BDYA 4RMOA 2KSSA 5DLQE 2ZPIB 2A36A 3OBWA 1GRIA 5IXBA 1EX4A 2JOYA 2RQWA 3CCMQ 1NPRA 1RUWA 2FG0A 4PJJA 2V1QA 2RB6A 1C6VX 1RL2A 2PTKA 4MMKA 2G6FX 2O9SA 4OB2B 3MHXA 4MZMA 4WF2A 2X3WD 4EIKA 3R6NA 4C8QE 1F1BB 2LCCA 4HKEA 1IGQA 1VQOQ 3REBB 2LCSA 4LDXA 1UGPB 3OYCA 5GMKi 2KE9A 2RQTA 2OTLQ 4PJMA 1H641 2DL4A 2DD4A 3TEEA 1NJIC 3OYGA 2LVMA 5HY6A 2GFAA 2ZAEA 3OS2A 3QDFA 2NUPA 1WJRA 2O4XA 4M77D 2JS0A 3QO3A 1WHGA 3UF4A 1VQPQ 1KG1A 3LLRA 4AT1B 4E7IA 2K9GA 5J26A 3M0QA 2JM9A 1RAFB 4RTYA 4DBFA 1IZ6A 4KBMB 3L2ZA 3MCAB 1X2KA 4LDVA 1EZZB 2KYMA 4DBHA 4PLIA 3C95A 1N9RA 1G83A 1ARKA 2XDDA 3CCUA 4A53A 4M7AD 1OULA 3EG3A 3QIIA 1M5Q1 1Q86U 1WFWA 1QQJA 4EMHA 2BZ8A 1QKXA 1WX6A 2HAXA 4J6XA 2OTJA 1K8AU 4DOWA 2QQ9A 1KC8R 1UTIA 1AWXA 3PMIA 3R6OA 3KUFA 3QHSA 4L59A 2KQWA 2CP2A 2KRMA 1UJYA 2DX1A 4C92C 4EMKB 4IURA 4O6JA 2CZ1B 3NFCA 3AHUA 2QAZA 1R77A 1YI2Q 2W0ZA 3FLGA 2QEXQ 4A4HA 4QQ6A 3LGFA 3CCLA 1PKTA 2HL3A 4XQ3A 1QWEA 1FMVA 4M78D 3CC7T 2X35A 3S3MA 1I81A 4M78A 1W1FA 2CT3A 5J3BA 5LJ3e 2HSEB 4J5YA 2YWWA 3LYIA 4MMLA 4A4GA 5GAOl 4JDSA 9ATCB 4XU3A 3SDZA 2E41A 4JRIA 2C06A 1A0NB 2CP7A 1KIKA 1I4K1 3RMQA 1PD0A 4BY6C 1D1CA 4C92F 1WXBA 5LJ5j 1T3SA 2RHUA 1H92A 2K79A 1O9SA 2BUDA 2RA2A 5C6SA 1IB8A 4KH0B 4J83A 2FPEA 2EGCA 3HRTA 1VQ9A 5I11A 4XTVA 2DTHA 2PVGB 5GANh 5D7UA 1VIFA 1M4ZA 2A7YA 3MEUA 3CCRA 2PQWA 3EFRA 3SEMA 3OMCA 4PFPA 5GAN4 3V8KA 4K11A 3ME9A 1HK9A 2OTJT 1YFNA 2DF6A 2SEMA 3PT9A 1V1CA 1CSKA 5LJ5d 2X3XD 2PZ1A 4C8QA 2QI2A 1QVGS 2MCNA 4LN2A 4KRTA 4FCYA 3JCMV 2BZYA 1MGQA 2F2WA 4E7SA 2YSQA 4N0AC 3ZFJA 1Q81U 2LDMA 5GAN7 2KDSA 4PFOA 5FW9A 3H0IA 1OOTA 3C0CA 4V2SA 3UWNA 1BI2A 3PE0A 2E70A 3JB9H 1Y71A 3SHWA 2QDLA 4AFQC 4C5IA 5CKHA 2VXFA 2DZCA 2ED0A 4BI4A 2FZCB 1VQLA 4JS5A 1W2BS 3QSUA 2VB6A 3V7RA 4J9IA 3QPHA 2XK0A 3JB9J 1WHKA 2L3QA 5CKEA 3MO8A 4FW1A 4BUGA 3URGA 3A8OB 3LH0A 3L2WA 3CPFA 3HP9A 1TWBA 3G71A 3I35A 3X26B 2WACA 2JJ9A 4DQ2A 5HK0A 3RESA 1GL5A 2RI5A 1QLYA 3I5RA 4M75E 1EIFA 3E1SA 5GAOr 3I55A 1KFZA 2YUPA 4QVZA 3JCMf 3G4ST 5HKCA 2BZXA 4AFSC 2QYZA 1VYVA 2A28A 4XTUA 4PJOG 2LT4A 2GTOA 4R56A 1Q82U 3CD6Q 2CSQA 1YITQ 1YJWQ 2Z0WA 3P8HA 4XU0A 3SWNC 3OBYA 3VS5A 3JB9D 3GNGA 1WZOA 2DEUA 3JCMQ 1OU9A 2DTOA 3MJXA 1B7TA 2B8AA 1KD1R 4GLKA 3J7AF 2X9HA 2HNIA 2EAYA 1RLPC 1W4SA 4PJOF 1K73U 3CXCS 4OMMA 1JJ2S 2DIGA 3AT1B 1OI1A 2LT1A 2CS7A 1NJIR 2E5KA 1NLOC 2NLUA 2VV5A 2CH4W 4PJLA 1QP2A 2HBWA 3BW1A 2YRVA 1OYXA 2LQNA 2JXBA 1S72T 2LMJA 2FYKA 4ZGJB 2LX9A 2DLPA 2DBMA 2DVJA 2L0AA 1O75A 3LGLA 1OEBA 3CBPA 2COZA 2LJ3A 5EC7A 3MEWA 4ANJA 2NUTA 3L42A 1RAIB 2YLBA 2QA4T 4J8OA 2LRQA 3CCJA 4QVCA 1PD1A 4IUVA 3X20B 5A0GA 2MI6A 6AT1B 1BKBA 3QKJA 1RAAB 4LDYA 4P5NA 4Z02A 2CP3A 1WLPB 1JBMA 4DEXA 3OYYA 2KGTA 1MMDA 2QA4Q 2EQJA 3OA6A 1R0BG 1OPLA 1RAGB 3UA7A 2JW4A 1RI0A 3UATA 1KC8U 1N6AA 2M9UA 5D6YA 3VUBA 4F7UB 1R8OB 2M16A 3NTHA 4KGXB 3CMAT 2LTOA 3CMEA 4OMPA 4KH1B 3ZEHA 3V8JA 1NLPC 4CI0C 2ZPGB 1I5OB 4M78G 2BIVA 1BU1A 3JCMe 3HRSA 1RLQC 3I56Q 1ZSZA 3EG0A 1WXTA 2VGNA 4RTZA 3UDCA 4J9CA 1VQ8Q 4JRKA 2HDAA 2O31A 1X69A 1JU5C 2RQVA 4LD6A 4Y28E 3EH2A 1C1AA 3OMGA 1M8VA 2JMAA 1K4US 1D1BA 1MMAA 2LC4A 4OB0B 2KVQG 4FL6A 1SSFA 4PJOC 3TCJA 2XDPA 4E7JA 3OYLA 1KJWA 4EMGA 2F1LA 1Y57A 1UHFA 4F04B 3H9NA 1BI0A 1Q7YR 1JXMA 2ED1A 2KXCA 1ACMB 4Z88A 3CC4T 3QZ9B 2A0FB 5GAOm 3CCJQ 1ZQ1A 4EDUA 3DKMA 3LWHA 1BYMA 1CKAA 2PUKB 5IN1A 3HFOA 1FMKA 5KE2A 2O88A 1SKUB 2DK3A 2CYZB 5IT9E 2RHXA 2VYTA 4E7HA 4JJDA 4EPCA 1K73C 1VQLT 1SG5A 1X43A 2YHTA 4M7DA 2V8KA 1TH7A 1ZBJA 1R0CB 3OYMA 2VKNA 1XQHA 1BIBA 4Z8AA 3QWXX 2VASA 1VQNT 4BB7A 1K9MC 4D8KA 2DO3A 4GY5A 1Z9ZA 2P84A 4M75G 4LUEA 2EJGA 2IG0A 1YHQT 3E2UA 2XKOC 5FROA 3HTRA 2QASA 3OYBA 3L2QA 2OTLA 4DBRA 2EIFA 3A5ZB 2QGFB 2DXCA 8ATCB 3C12A 3CCUT 4PKCC 4R0KA 3X25B 1ZSZC 3PMTA 1K73R 2J05A 4HCBA 3JCMc 2EYYA 2NWMA 2EYQA 4A63B 5GAMd 2NUTB 5KCOA 4OB3B 3H0HA 2RHZA 3QG1A 4F17A 1N8RR 3MP6A 1TUDA 7AT1B 1M90R 1DJ7B 4JZ3A 4B9XA 1JQQA 5GANj 2D9TA 4LUDA 5KE3A 3JB9F 1AT1B 1VQ4Q 2V8IA 2COYA 4OGCA 3THKA 4MDWA 1MV3A 5HK3A 5A0DA 5CKDA 2RQUA 1WNLA 5LJ5h 4C8QF 2HQHA 2W10A 3QUIA 1QWFA 3JCMh 2DL5A 3M56A 4IUQA 3RMSA 2HCKA 4M75F 2DKGA 2L3SA 2F5TX 4M7AF 1AZEA 4J6WA 2PUOB 3CD6T 4F7UA 3VS4A 1X01A 4QQDA 2EW3A 4FIBA 1G3TA 5GMKl 2E65A 3CCLT 2MOXA 3QZ5B 2HBPA 4B6MA 1S72Q 1VQ6Q 1KHCA 1OX9A 2P4TA 2JNGA 2GTJA 2DTIA 1UECA 1W70A 1X27A 3QJ6A 4C92A 3DB3A 4ZGEB 1WGSA 1Z9QA 4JS4A 4OGEA 2V1RA 1TXQA 3CD6A 2DXUA 2F2VA 3DB4A 1VOMA 4QVDA 1WQ7A 3FRNA 2KY9A 2FB7A 4BE1A 2E3IA 1Y96B 4M75A 1PNJA 3PGGA 5KYWB 2E4HA 2DBKA 4CC2A 3L1AA 3ASKA 3OY9A 3EHQA 3TVTA 2DNUA 1TSFA 3S3NA 1YN8A 3INZA 1YBYA 3HL8A 2M0YA 2EQIA 4XU1A 5KYWA 1TUCA 2DAQA 1RI9A 2KNBB 3TSWA 3G7ZA 2JZ2A 1KQSA 3CCUQ 2RHIA 1UJ0A 1UGQB 5LJ3d 4LXCA 1E7OA 1QKWA 2GFUA 4ZN3A 1AHJB 1TG0A 4C92E 3META 4C8QG 4MZTA 1FXXA 1N5ZA 4BE2A 3JCMb 2BE9B 3WXMB 3I56A 1K8AC 5IXFA 2RJFA 5GMKj 4HVUA 3CC2T 3J81E 5CO7A 3G1JA 4X1VA 2RI3A 1S1NA 4J9GA 1I07A 2CZ7B 4BI8B 1QVGA 1PM3A 3A8MB 5FWCA 3OW2P 4M78F 5KYUB 1V29B 2XHCA 3CCRQ 2ABLA 2XDBA 4N0AA 2LCLA 3VYGA 4J9DA 3V7CA 2MPXC 2JT4A 4OMQA 3CCET 4OP0A 2V8JA 2E12A 4RTXA 4HCCA 4LDUA 1QCNA 4M78C 1VUBA 3HFNA 4C92G 5GANf 4AMCA 2RJDA 3LH5A 2ROLA 2A37A 2QXFA 4XTYA 3OYEA 2YUOA 4N4IA 4J9BA 1G8XA 3CCEA 1G5VA 1WI7A 2XICA 2D8HA 4C0DB 1MMGA 2DXBA 2J6KA 2K2MA 2HL5C 1ZSGA 4C0ZA 1HYOA 1PCXA 4HCZA 3JCMW 2LP5A 3C4SA 1ZUKA 4O5VA 2RHYA 3O8VA 3M0PA 2D0NA 1YIJQ 2NYSA 2XIDA 4DEYA 2LNVA 2KEAA 3GBQA 2G3RA 1VQPA 1NM7A 4XTXA 4AG1C 4DBQA 4C8QB 3HHTB 5GAMh 2YDLA 3CCJT 3JAME 2F2XA 1QP3A 4A4EA 3L2UA 3CCVA 2D1XA 1YJ9T 2P4RA 3EAEA 2F5KA 5CQYA 3M54A 1Q86R 5CK9A 4CC3A 5GANe 3MP1A 2XMFA 2JTEA 2L89A 4NL3A 3OYHA 5KCHA 3LX7A 2DYIA 3NPFA 3ZL7C 1NJIU 2AT1B 1VQOT 4BY6B 3HRUA 3GP8A 1GCPA 4KULA 2ROTA 3RBBB 4RG2A 4XU2A 1MV0B 1UGRB 3OB9A 4C5GA 3I55Q 1M1KR 1AZGB 1LOJA 1KK7A 3OYFA 1NYFA 2EYWA 4ME7A 5LL6S 2DPPB 1U06A 4RKUE 1X2QA 2FL7A 1FYNA 3NTKA 2L3PA 3M0UA 1Q7YC 4DA4A 1VQPT 4HXJA 4E7LA 4BE0A 2KRNA 2GQIA 2LX7A 3VS7A 1M27C 3VV0A 3E9GA 4LNPA 5GAMg 1GFDA 3V7SA 3OYIA 2HKNA 1VQMQ 1WIEA 3CBOA 5GAN8 5I22A 2K5LA 3CBMA 5CKBA 3GPLA 2DJZA 2JUFA 4UC4A 3RKYA 2XI9A 1Q95G 3I55T 3REAB 4CC7A 2JMCA 3CCVQ 2HZYA 2YXYA 3JCMJ 5AYFA 3EG2A 1W6XA 1N8RU 3ER0A 4C5EA 2K7AA 2EYZA 2ZGWA 1YJWA 2E3HA 4OMOA 5GMKm 1M1KU 1GBQA 2EVRA 1M3AA 1W2BA 5FRMA 1U3OA 4M77C 2VVKA 1KQSS 5IAYA 4QQGA 1B07A 2MYSA 2SRCA 4M7DB 1WPYA 3PNWC 1UFFA 2IPOB 4IKFA 4WTOB 1IXDA 1K9MR 1NYGA 1H8KA 2RK2A 2P0QA 4C0DC 1AWWA 4FSSA 1WHLA 4XTZA 4M7AC 1FMWA 5GMKe 1WJQA 1LJOA 1XJWB 2COWA 4FT2A 3MEAA 2GCXA 3UA6A 2K6DA 1BI1A 2WSFE 4M78B 1EFNA 3BE3A 2FZKB 3J80E 4PJOA 1Y07A 3CEYA 1VQ9T 1VQ6T 3CPWA 4B9WA 3CCST 1M8MA 1YJ9A 2DIQA 3A8LB 5GAMj 3CCVT 1JJ2A 1VQ8A 1VQKT 3TU4K 3CPWP 1M1GA 5KH6A 4MZPA 2PU9B 1WJSA 1WHHA 1NEGA 2RJCA 4JUVA 1ZX6A 2X4YA 4BD3A 4ELYC 2OAWA 1GCQA 4FT4A 2JN0A 3KBGA 5FLXE 2WSCE 4X9CA 4JPBW 4RG8A 3CMEQ 2CSIA 2QQSA 2LNHB 1HJDA 5FU7C 4M78E 3QDRB 4LD9K 1KD1U 1AEYA 1YI2T 1ZSZB 1RACB 1VA7A 5CQXA 1QCFA 3CPWS 2ECZA 1XOVA 1TTHB 2AKKA 2ZPBB 3P8DA 1WYXA 2HSPA 2GGRA 4C0FA 2LQKA 1PWTA 2YT6A 5GAMf 1N27A 1K8AR 2HMAA 5DY9A 3QWYA 2K2VA 2GF7A 2J6OA 3QBYA 2FHDA 2KAFA 4MDXA 2YRCA 2ZPEB 1C0MA 2DRKA 1M2VA 2RMOA 1K1ZA 3D7SB 1Y7XA 4KUIA 1X6OA 4GBQA 4E7ZA 4LDWA 4M4ZA 2X51A 2L3RA 3M4GA 1OX8A 4PJNA 3CCSQ 2H8HA 3RERA 3G6EQ 5ECAA 1VIEA 3DLLA 3CC7A 2M0OA 3VJPA 4M77B 3EFOA 2CT4A 1AOJA 2CREA 4DOVA 3FIFA 4J9HA 2I2LA 5M9OA 1QVFA 1VQ6A 1JRIA 3H0FA 4IIMA 2DMOA 3MP8A 3SD4A 3VRZA 4PJOB 2FRYA 1MNEA 1PG5B 1Q7YU 2J7IA 1M3CA 3MEVA 4M77A 3SWNB 1RAEB 1BB9A 1VQNQ 2RD1A 4OVAA 2IVWA 4ATOA 4FSXA 1JO8A 4J7FA 1D3BA 2AK5A 4IUPA 1H3ZA 2FPDA 1KHIA 2D0QB 2CH4A 3OQ5A 5GMKh 2ZPFB 3NGPA 3SWNA 2DETA 2ESWA 3NTIA 5LJ5f 1M90U 3KXTA 2HQEA 1YCYA 3BDUA 3OW2A 5DLOA 2DEQA 1X6GA 2P0PA 1BCMA 5GJVB 1AWOA 4BACA 2LJ0A 1SRMA 2C0TA 3BY7A 4M7DE 1SEMA 5KYNA 3GIBA 1YP5A 1LVKA 4JLIA 1X75C 1G3SA 1VQ5Q 3LWIA 1U1SA 1IREB 3EGUA 4CC4B 1TS9A 5IH2A 1I0CA 1YWPA 1SSHA 3F70A 5HCKA 1P92A 4A4KA 2DL3A 3OS5A 2EYXA 2H3JA 2ZPHB 3OYKA 3PVLA 3CCQA 3UT1A 3OW2S 1M90C 2M1HA 1OPKA 2RK1A 3SB2A 4A4FA 1M1FA 4M77G 3CCMA 4KT0E 3A98A 1KQ1A 1IGUA 4XTWA 3JV3A
chains in the Genus database with same CATH topology
3I35A 4RTXA 1IO6A 3M0SA 4OMNA 4QT7A 1GL5A 1QLYA 3I5RA 1T0JA 1M3BA 1KFZA 2YUPA 2EPDA 2PNIA 3LH5A 2ROLA 1ABQA 2O2OA 2BZXA 2YUNA 4AFSC 1VYVA 2A28A 2FRWA 2A37A 2YUOA 4J9BA 2GTOA 1WI7A 3VS3A 2CSQA 2D8HA 3EG1A 1SHGA 2AZSA 2J6KA 2K2MA 3VS5A 1ZSGA 2DYBA 1ZUUA 3M0RA 2RPNA 3EHRA 1ABOA 2NUZA 2DA9A 2C0OA 2DL7A 4IIOA 2KROA 2LP5A 2RF0A 1RLPC 1ZUKA 2FO0A 1K9AA 3M0PA 1SHFA 4OMMA 2D0NA 4DEYA 2E5KA 2KEAA 1NLOC 3GBQA 2I0NA 2J06A 5L23A 1NM7A 2CH4W 4AG1C 4ESRA 2HBWA 2LQNA 2JXBA 2YDLA 1KSWA 2F2XA 2LMJA 2AZVA 2DLPA 1VYUA 2DBMA 2DVJA 4E6RA 2D1XA 2L0AA 2P4RA 1OEBA 1PKSA 1B3QA 3H41A 4CC3A 2LJ3A 1NEBA 2AKLA 5EC7A 1GCQC 3PVQA 2B86A 2XMFA 3M0TA 2JTEA 2OJ2A 3VS1A 3NPFA 3ZL7C 1K76A 2EKHA 1HSQA 1YNZA 2LJ1A 1GCPA 2ROTA 1WXUA 3RBBB 3VS0A 2KRSA 1X6BA 1BK2A 1MV0B 2C0IA 2KYBA 1AZGB 1WLPB 1NYFA 1UE9A 2EYWA 4HCKA 5FWBA 4DEXA 2GNCA 4RUGA 2KGTA 1OV3A 1U06A 3VS2A 1UHCA 1J3TA 1YWOA 1X2QA 1LCKA 1FYNA 2L3PA 3M0UA 1K0XA 1OPLA 3UA7A 4HXJA 2JW4A 2KRNA 2GQIA 2M51A 3UATA 1GBRA 2LX7A 3O5ZA 2CUDA 1M27C 3VS7A 4LNPA 2MIOA 1GFDA 3ULRB 1WIEA 2HEQA 3CQTA 2ENMA 4OMPA 5I22A 1M30A 1JXOA 1NLPC 4RTTA 1SRLA 4HVVA 1BU1A 2L2PA 1ZUYA 2BTTA 1RLQC 3EG0A 5GJWB 3REAB 1WXTA 2FPFA 3TSZA 4CC7A 1T3LA 4RTZA 4J9CA 1PRMC 1CKBA 2HDAA 2JMCA 1X69A 2O31A 1JU5C 2RQVA 3EG2A 1W6XA 2KR3A 2JMAA 2K7AA 2EYZA 1K4US 3KFVA 4OMOA 5IHIA 4HVWA 1GBQA 1KJWA 1Y57A 2EVRA 1M3AA 1UHFA 1SPKA 2RNAA 1U3OA 1JXMA 2ED1A 4ORZA 2KXCA 2VVKA 4Z88A 3FJ5A 2A08A 2KXDA 2OI3A 4F14A 1B07A 1GFCA 1PRLC 2EGEA 2RQRA 2SRCA 1CKAA 3VRYA 1UFFA 3NHNA 1NYGA 1T0HA 1H8KA 3VS6A 2EBPA 2A36A 1FMKA 1GRIA 5IXBA 1MUZA 2O88A 1AWWA 2RQWA 4FSSA 3I9QA 1RUWA 2FG0A 1VYTA 2V1QA 4JJDA 2K3BA 2RN8A 2PTKA 2G6FX 2O9SA 1X43A 2X3WD 2JM8A 4EIKA 3R6NA 1ZBJA 2CDTA 1AWJA 2VKNA 3UA6A 1I1JA 2K6DA 4Z8AA 3QWXX 1YCSB 1EFNA 2KT8A 3REBB 4D8KA 2LCSA 1Y0MA 1Z9ZA 4LUEA 2JS2A 1UG1A 2KE9A 2RQTA 1M8MA 2DL4A 2DRMA 1NEGA 1U5SA 1ZX6A 4R0KA 2JS0A 2OAWA 1GCQA 2VWFA 3UF4A 2J05A 2K9GA 1UDLA 4JJBA 2EYYA 2NWMA 4JPBW 3M0QA 2CSIA 2DM1A 2LNHB 4Y92A 1HJDA 2JM9A 2GBQA 4RTYA 4A63B 1AEYA 2LZ6B 3H0HA 4F17A 1AVZC 1X2KA 4ZNXA 1TUDA 1VA7A 4JZ3A 2KYMA 1QCFA 2KBTA 2ECZA 1XOVA 1JQQA 1K0SA 3I5SA 2AKKA 1WYXA 4LUDA 1G83A 2HSPA 1ARKA 2GGRA 1PWTA 4RTUA 3EG3A 2YT6A 3THKA 1MV3A 1WDXA 1WFWA 2BZ8A 1QKXA 1WX6A 2IIMA 1UTIA 1AWXA 2RQUA 3QWYA 2J6OA 2KT1A 4GLMA 4J9FA 1WA7A 2W10A 1QWFA 2KRMA 2DL5A 1UJYA 2DX1A 4OMLA 2DRKA 2HCKA 2L3SA 2RMOA 1K1ZA 4LE9A 1ZLMA 1AZEA 2O9VA 2W0ZA 2J6FA 3VS4A 1H3HA 4GBQA 3RNJA 4M4ZA 1UUEA 1PKTA 2EW3A 1QWEA 2DJQA 4JZ4A 1BBZA 2H8HA 2MOXA 4WCIA 5ECAA 2FEIA 1W1FA 2GTJA 2CT3A 1UECA 1W70A 1X27A 4JJCA 1JEGA 2CT4A 1AOJA 2CREA 2LQWA 1Z9QA 4J9HA 2V1RA 3H0FA 4IIMA 2DMOA 2F2VA 4AFZC 1A0NB 1E6HA 1KIKA 3U23A 3VRZA 1AD5A 2FRYA 2J7IA 1M3CA 1PNJA 1BB9A 1WXBA 3IQLA 1T3SA 4F16A 2DILA 2DBKA 1H92A 2K79A 4RTWA 1JO8A 4CC2A 2AK5A 2FPEA 2FPDA 3EHQA 2EGCA 3TVTA 5IHKA 2DNUA 5I11A 2CH4A 1E6GA 1YN8A 3NGPA 4D8DA 2M0YA 2ESWA 2EQIA 1TUCA 2CUBA 1RI9A 2KNBB 3TSWA 3SEMA 1X6GA 3NMZC 5GJVB 1AWOA 2LJ0A 1SRMA 2C0TA 4AFUC 1UJ0A 2EGAA 4K11A 4J9EA 1SEMA 2DL8A 2DF6A 2SEMA 1YP5A 1E7OA 1QKWA 1NG2A 1V1CA 1CSKA 2X3XD 2PZ1A 3EGUA 4CC4B 1TG0A 1HD3A 5IH2A 2MCNA 4LN2A 4KRTA 1I0CA 1YWPA 2YUQA 4Z89A 1SSHA 2BZYA 2F2WA 1N5ZA 1UGVA 5HCKA 2YSQA 4AG2C 2DE0X 5IXFA 2DL3A 4HVUA 2EYXA 5FW9A 3H0IA 1OOTA 3C0CA 4X1VA 3PE0A 1S1NA 4J9GA 3PVLA 3SHWA 2QDLA 1G2BA 1I07A 1PHTA 4AFQC 2ED0A 1OPKA 5IHNA 5FWCA 4J9IA 2ABLA 2D8JA 2L3QA 3A98A 4J9DA 2JT4A 3JV3A 4OMQA 4RTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I35 A;  4RTX A;  1IO6 A;  3M0S A;  4OMN A;  4QT7 A;  1GL5 A;  1QLY A;  3I5R A;  1T0J A;  1M3B A;  1KFZ A;  2YUP A;  2EPD A;  2PNI A;  3LH5 A;  2ROL A;  1ABQ A;  2O2O A;  2BZX A;  2YUN A;  4AFS C;  1VYV A;  2A28 A;  2FRW A;  2A37 A;  2YUO A;  4J9B A;  2GTO A;  1WI7 A;  3VS3 A;  2CSQ A;  2D8H A;  3EG1 A;  1SHG A;  2AZS A;  2J6K A;  2K2M A;  3VS5 A;  1ZSG A;  2DYB A;  1ZUU A;  3M0R A;  2RPN A;  3EHR A;  1ABO A;  2NUZ A;  2DA9 A;  2C0O A;  2DL7 A;  4IIO A;  2KRO A;  2LP5 A;  2RF0 A;  1RLP C;  1ZUK A;  2FO0 A;  1K9A A;  3M0P A;  1SHF A;  4OMM A;  2D0N A;  4DEY A;  2E5K A;  2KEA A;  1NLO C;  3GBQ A;  2I0N A;  2J06 A;  5L23 A;  1NM7 A;  2CH4 W;  4AG1 C;  4ESR A;  2HBW A;  2LQN A;  2JXB A;  2YDL A;  1KSW A;  2F2X A;  2LMJ A;  2AZV A;  2DLP A;  1VYU A;  2DBM A;  2DVJ A;  4E6R A;  2D1X A;  2L0A A;  2P4R A;  1OEB A;  1PKS A;  1B3Q A;  3H41 A;  4CC3 A;  2LJ3 A;  1NEB A;  2AKL A;  5EC7 A;  1GCQ C;  3PVQ A;  2B86 A;  2XMF A;  3M0T A;  2JTE A;  2OJ2 A;  3VS1 A;  3NPF A;  3ZL7 C;  1K76 A;  2EKH A;  1HSQ A;  1YNZ A;  2LJ1 A;  1GCP A;  2ROT A;  1WXU A;  3RBB B;  3VS0 A;  2KRS A;  1X6B A;  1BK2 A;  1MV0 B;  2C0I A;  2KYB A;  1AZG B;  1WLP B;  1NYF A;  1UE9 A;  2EYW A;  4HCK A;  5FWB A;  4DEX A;  2GNC A;  4RUG A;  2KGT A;  1OV3 A;  1U06 A;  3VS2 A;  1UHC A;  1J3T A;  1YWO A;  1X2Q A;  1LCK A;  1FYN A;  2L3P A;  3M0U A;  1K0X A;  1OPL A;  3UA7 A;  4HXJ A;  2JW4 A;  2KRN A;  2GQI A;  2M51 A;  3UAT A;  1GBR A;  2LX7 A;  3O5Z A;  2CUD A;  1M27 C;  3VS7 A;  4LNP A;  2MIO A;  1GFD A;  3ULR B;  1WIE A;  2HEQ A;  3CQT A;  2ENM A;  4OMP A;  5I22 A;  1M30 A;  1JXO A;  1NLP C;  4RTT A;  1SRL A;  4HVV A;  1BU1 A;  2L2P A;  1ZUY A;  2BTT A;  1RLQ C;  3EG0 A;  5GJW B;  3REA B;  1WXT A;  2FPF A;  3TSZ A;  4CC7 A;  1T3L A;  4RTZ A;  4J9C A;  1PRM C;  1CKB A;  2HDA A;  2JMC A;  1X69 A;  2O31 A;  1JU5 C;  2RQV A;  3EG2 A;  1W6X A;  2KR3 A;  2JMA A;  2K7A A;  2EYZ A;  1K4U S;  3KFV A;  4OMO A;  5IHI A;  4HVW A;  1GBQ A;  1KJW A;  1Y57 A;  2EVR A;  1M3A A;  1UHF A;  1SPK A;  2RNA A;  1U3O A;  1JXM A;  2ED1 A;  4ORZ A;  2KXC A;  2VVK A;  4Z88 A;  3FJ5 A;  2A08 A;  2KXD A;  2OI3 A;  4F14 A;  1B07 A;  1GFC A;  1PRL C;  2EGE A;  2RQR A;  2SRC A;  1CKA A;  3VRY A;  1UFF A;  3NHN A;  1NYG A;  1T0H A;  1H8K A;  3VS6 A;  2EBP A;  2A36 A;  1FMK A;  1GRI A;  5IXB A;  1MUZ A;  2O88 A;  1AWW A;  2RQW A;  4FSS A;  3I9Q A;  1RUW A;  2FG0 A;  1VYT A;  2V1Q A;  4JJD A;  2K3B A;  2RN8 A;  2PTK A;  2G6F X;  2O9S A;  1X43 A;  2X3W D;  2JM8 A;  4EIK A;  3R6N A;  1ZBJ A;  2CDT A;  1AWJ A;  2VKN A;  3UA6 A;  1I1J A;  2K6D A;  4Z8A A;  3QWX X;  1YCS B;  1EFN A;  2KT8 A;  3REB B;  4D8K A;  2LCS A;  1Y0M A;  1Z9Z A;  4LUE A;  2JS2 A;  1UG1 A;  2KE9 A;  2RQT A;  1M8M A;  2DL4 A;  2DRM A;  1NEG A;  1U5S A;  1ZX6 A;  4R0K A;  2JS0 A;  2OAW A;  1GCQ A;  2VWF A;  3UF4 A;  2J05 A;  2K9G A;  1UDL A;  4JJB A;  2EYY A;  2NWM A;  4JPB W;  3M0Q A;  2CSI A;  2DM1 A;  2LNH B;  4Y92 A;  1HJD A;  2JM9 A;  2GBQ A;  4RTY A;  4A63 B;  1AEY A;  2LZ6 B;  3H0H A;  4F17 A;  1AVZ C;  1X2K A;  4ZNX A;  1TUD A;  1VA7 A;  4JZ3 A;  2KYM A;  1QCF A;  2KBT A;  2ECZ A;  1XOV A;  1JQQ A;  1K0S A;  3I5S A;  2AKK A;  1WYX A;  4LUD A;  1G83 A;  2HSP A;  1ARK A;  2GGR A;  1PWT A;  4RTU A;  3EG3 A;  2YT6 A;  3THK A;  1MV3 A;  1WDX A;  1WFW A;  2BZ8 A;  1QKX A;  1WX6 A;  2IIM A;  1UTI A;  1AWX A;  2RQU A;  3QWY A;  2J6O A;  2KT1 A;  4GLM A;  4J9F A;  1WA7 A;  2W10 A;  1QWF A;  2KRM A;  2DL5 A;  1UJY A;  2DX1 A;  4OML A;  2DRK A;  2HCK A;  2L3S A;  2RMO A;  1K1Z A;  4LE9 A;  1ZLM A;  1AZE A;  2O9V A;  2W0Z A;  2J6F A;  3VS4 A;  1H3H A;  4GBQ A;  3RNJ A;  4M4Z A;  1UUE A;  1PKT A;  2EW3 A;  1QWE A;  2DJQ A;  4JZ4 A;  1BBZ A;  2H8H A;  2MOX A;  4WCI A;  5ECA A;  2FEI A;  1W1F A;  2GTJ A;  2CT3 A;  1UEC A;  1W70 A;  1X27 A;  4JJC A;  1JEG A;  2CT4 A;  1AOJ A;  2CRE A;  2LQW A;  1Z9Q A;  4J9H A;  2V1R A;  3H0F A;  4IIM A;  2DMO A;  2F2V A;  4AFZ C;  1A0N B;  1E6H A;  1KIK A;  3U23 A;  3VRZ A;  1AD5 A;  2FRY A;  2J7I A;  1M3C A;  1PNJ A;  1BB9 A;  1WXB A;  3IQL A;  1T3S A;  4F16 A;  2DIL A;  2DBK A;  1H92 A;  2K79 A;  4RTW A;  1JO8 A;  4CC2 A;  2AK5 A;  2FPE A;  2FPD A;  3EHQ A;  2EGC A;  3TVT A;  5IHK A;  2DNU A;  5I11 A;  2CH4 A;  1E6G A;  1YN8 A;  3NGP A;  4D8D A;  2M0Y A;  2ESW A;  2EQI A;  1TUC A;  2CUB A;  1RI9 A;  2KNB B;  3TSW A;  3SEM A;  1X6G A;  3NMZ C;  5GJV B;  1AWO A;  2LJ0 A;  1SRM A;  2C0T A;  4AFU C;  1UJ0 A;  2EGA A;  4K11 A;  4J9E A;  1SEM A;  2DL8 A;  2DF6 A;  2SEM A;  1YP5 A;  1E7O A;  1QKW A;  1NG2 A;  1V1C A;  1CSK A;  2X3X D;  2PZ1 A;  3EGU A;  4CC4 B;  1TG0 A;  1HD3 A;  5IH2 A;  2MCN A;  4LN2 A;  4KRT A;  1I0C A;  1YWP A;  2YUQ A;  4Z89 A;  1SSH A;  2BZY A;  2F2W A;  1N5Z A;  1UGV A;  5HCK A;  2YSQ A;  4AG2 C;  2DE0 X;  5IXF A;  2DL3 A;  4HVU A;  2EYX A;  5FW9 A;  3H0I A;  1OOT A;  3C0C A;  4X1V A;  3PE0 A;  1S1N A;  4J9G A;  3PVL A;  3SHW A;  2QDL A;  1G2B A;  1I07 A;  1PHT A;  4AFQ C;  2ED0 A;  1OPK A;  5IHN A;  5FWC A;  4J9I A;  2ABL A;  2D8J A;  2L3Q A;  3A98 A;  4J9D A;  2JT4 A;  3JV3 A;  4OMQ A;  4RTV A; 
#chains in the Genus database with same CATH topology
 4OMN A;  1N9S A;  3H8Z A;  1IRX A;  5LJ5 e;  1JB0 E;  1XTD A;  2MAM A;  1M3B A;  3M57 A;  2DXT A;  1ABQ A;  1IHV A;  2O2O A;  4C0G A;  4M7D G;  2QK0 A;  1NPP A;  1ZBX A;  2CGH A;  1NZ9 A;  1QVF P;  1VQ4 T;  2RM4 A;  4M7A G;  3SFM A;  3JRZ A;  1JJ2 P;  3EG1 A;  1ZA2 B;  4PLL A;  3CXC P;  2WSE E;  3TRE A;  3JCM d;  1MND A;  2NUZ A;  2DA9 A;  3CMA A;  2DL7 A;  3FDR A;  2KRO A;  1VQ5 T;  4Q5W A;  2XU8 A;  2FO0 A;  2PVD B;  1UEB A;  4M75 D;  2J06 A;  5L23 A;  1YJN Q;  1RAH B;  1M1K C;  3M59 A;  1I5L A;  1HXD A;  2CP5 A;  1D0Y A;  2FVU A;  1N8R C;  2AZV A;  1VYU A;  3G6E A;  2LQ8 A;  1YJW T;  3H6Z A;  3H41 A;  2QEX A;  2AKL A;  3PVQ A;  2B86 A;  3ZBD A;  3P8B B;  5GAN g;  2E10 A;  1QW1 A;  5EG2 A;  5FU6 B;  2VC8 A;  2KK4 A;  4Y91 A;  3X28 B;  1YNZ A;  5D6W A;  4IUT A;  1YJN T;  2EJ9 A;  3TQ7 P;  1X6B A;  1BK2 A;  2KYB A;  2EKO A;  2RO0 A;  2MK5 A;  4HCK A;  5FWB A;  2GNC A;  4RUG A;  3RKX A;  1YIT T;  4M7A E;  1OV3 A;  2DVE A;  3VS2 A;  1J3T A;  3E9F A;  3EGX B;  2R57 A;  1K0X A;  2CZ6 B;  1QVG P;  1GBR A;  2CUD A;  5GAO q;  2MIO A;  2MMP A;  3G6E T;  3ULR B;  4FW2 A;  2HEQ A;  3CQT A;  1KC8 C;  2ENM A;  1VQ8 T;  1VQK A;  2P0K A;  1QMC A;  5A2Q E;  2E6Z A;  3EG9 A;  1BI3 A;  3BDL A;  4RTT A;  2K3Y A;  1VQ7 Q;  2X4J A;  4M77 E;  1SRL A;  2EQM A;  5A0L A;  1PSF A;  3CC7 Q;  1ZUY A;  2BTT A;  3EFO B;  4M75 C;  3TSZ A;  3L2R A;  3EFS A;  1T3L A;  1TUG B;  3VKI A;  4N4H A;  2CP0 A;  1CKB A;  3UPU A;  2K5I A;  5D6X A;  5J39 A;  2VGM A;  1V76 A;  2KR3 A;  2EQK A;  1VQ7 A;  1OZ3 A;  1YI2 A;  3OSS C;  2X4W A;  2MWP A;  4FU6 A;  3GOX A;  4BDZ A;  2CZ0 B;  5IHI A;  3CCE Q;  4HVW A;  2EWN A;  2E5Q A;  2QDY B;  5LJ3 h;  5KYX A;  2F69 A;  4ORZ A;  4CRI A;  2OTJ Q;  4NOY A;  3FJ5 A;  2A08 A;  2QA4 A;  1GFC A;  1Y96 A;  2YRD A;  2RQR A;  2Y4X A;  3VRY A;  2XD0 A;  4QW2 A;  2R58 A;  2QGG A;  3BFM A;  3M4Y A;  3NHN A;  1T0H A;  3VS6 A;  1WHM A;  1MUZ A;  3I9Q A;  4QKU A;  3JB9 G;  1VYT A;  2K3B A;  2RN8 A;  5GAM e;  4R55 A;  5CAI A;  2JM8 A;  2CDT A;  1AWJ A;  1I1J A;  3G71 Q;  4C8Q D;  5GAO n;  1YCS B;  2KT8 A;  2EFI A;  3PIP A;  1VQ7 T;  1Y0M A;  3GNF B;  2R5A A;  4XAX B;  4JLG A;  3M5A A;  3EGX A;  2JS2 A;  1UG1 A;  1NBE B;  2AHJ B;  1Q81 R;  1VQL Q;  1K9M U;  2DRM A;  2QG9 B;  4YTL A;  1UB4 A;  3OS1 A;  1U5S A;  3HSB A;  4F7U E;  2VWF A;  3PIO A;  1MHN A;  3JB9 I;  1U1T A;  5L8R E;  1UDL A;  4JJB A;  3OYJ A;  2QTV A;  2DM1 A;  3QYG B;  1PSE A;  3OSV A;  2RH2 A;  4Y92 A;  3GF5 A;  2GBQ A;  1D0X A;  4F7U F;  2MWO A;  2LZ6 B;  3CMA Q;  1AVZ C;  3CC2 A;  4ZNX A;  4C92 D;  5FRN A;  1G3Y A;  2KBT A;  4M7D D;  3FB9 A;  3QXE B;  1K0S A;  3I5S A;  4PK4 A;  2KI7 A;  3N5B B;  1YIT A;  4RTU A;  4E2F B;  1OZ2 A;  4X34 A;  3S6W A;  1WDX A;  4PL6 A;  1M9S A;  4XK8 E;  2IIM A;  3A8H B;  4GLM A;  2KT1 A;  4NL2 A;  1D1A A;  4J9F A;  1WA7 A;  3EGD A;  1KD1 C;  1VQ9 Q;  2QQR A;  5I21 A;  4OML A;  4OMF B;  3T9N A;  4A54 A;  3E19 A;  4LE9 A;  1ZLM A;  5CCA A;  3CXC A;  1VQM T;  2O9V A;  2ZZD A;  2J6F A;  1H3H A;  3RNJ A;  1UUE A;  2DJQ A;  4JZ4 A;  1BBZ A;  1D3B B;  4WCI A;  5CR2 A;  2FEI A;  3CCQ Q;  3C94 A;  3PTA A;  4JJC A;  1JEG A;  4M7D F;  2LQW A;  4RCB A;  1WHJ A;  3M55 A;  1D0Z A;  3WVE B;  4AFZ C;  1B34 A;  2JVV A;  4D6W A;  3CCR T;  1YIJ A;  1E6H A;  3U23 A;  1VQM A;  1AD5 A;  2H3E B;  1VQ5 A;  3IQL A;  3OS0 A;  5FU6 C;  4F16 A;  2DIL A;  4RTW A;  2QTX A;  1IHW A;  5LJ3 j;  3A8G B;  5CKF A;  5I2M A;  1QVF S;  5IHK A;  1MMN A;  2E64 A;  2PVO B;  3M9Q A;  3CC2 Q;  3FEO A;  4J7I A;  5LJ3 f;  1E6G A;  3VU3 C;  2X4X A;  4D8D A;  2DFU A;  4II1 A;  5LJ3 g;  2CUB A;  5AT1 B;  4RCC A;  4JRQ A;  3NMZ C;  4M7D C;  5DM7 R;  4AFU C;  2EGA A;  4J9E A;  2KMT A;  2DL8 A;  3M53 A;  2DER A;  2E1H A;  3PFS A;  3DLM A;  1NG2 A;  1HD3 A;  1RAD B;  1QVP A;  2YUQ A;  3GLX A;  4Z89 A;  4OB1 B;  3CCS A;  3CCM T;  1GXI E;  1UGV A;  2O4X B;  5GAN 5;  3QYH B;  3RR6 A;  3CCL Q;  4AG2 C;  2DE0 X;  1I8F A;  2HQX A;  3HKS A;  1RAB B;  3I56 T;  3CCQ T;  1D09 B;  5KYY A;  2BE7 D;  1VQK Q;  2CKK A;  2K3X A;  1G2B A;  1M2V B;  1PHT A;  1Q82 R;  1KQ2 A;  3FC3 A;  3CC4 Q;  1YJ9 Q;  3VYH B;  4C5H A;  5IHN A;  4FYX B;  4ELZ C;  5GAN 3;  2K4Y A;  5GAN 6;  1M2O A;  2D8J A;  1FWZ A;  5KYX B;  2K5F A;  3CME T;  3M58 A;  1NE8 A;  1VQO A;  2V26 A;  2MF2 A;  4RTV A;  2OTL T;  2DZ9 A;  1IO6 A;  3M0S A;  1Q82 C;  4QT7 A;  1YIJ T;  2QQB A;  5I2S A;  1T0J A;  1ZHI A;  2EPD A;  2PNI A;  4N4G A;  8AT1 B;  1VQN A;  2YUN A;  1WQW A;  2FRW A;  2HD0 A;  3A1P A;  2QQA A;  1BCO A;  3X24 B;  3VS3 A;  2ZCF B;  1SHG A;  3RIR A;  2AZS A;  4FYY B;  5GAN d;  4ZTJ A;  4TVR A;  2DYB A;  1ZUU A;  3M0R A;  2RPN A;  3EHR A;  2ATC B;  2VXE A;  1ABO A;  4NS5 A;  1LNX A;  3RDV A;  2C0O A;  3HPW A;  2XG8 D;  4IIO A;  2RF0 A;  1TOV A;  2M02 A;  4EMK A;  2Y90 A;  3MPU B;  1K9A A;  1SHF A;  1Q86 C;  4C92 B;  4EMK C;  4PFZ A;  3L2V A;  2D6F A;  3LW5 E;  3CC4 A;  2I0N A;  2O01 E;  3RKW A;  1YJN A;  1PC0 A;  1Q81 C;  4ESR A;  1SF9 A;  2L5Q A;  4ZTF A;  1KSW A;  2NUP B;  4FYV B;  4E47 A;  5GAN 2;  4M75 B;  1OQK A;  2L8D A;  4PNO A;  1S72 A;  5C0M A;  1G3W A;  4J6Y A;  4E6R A;  3OYD A;  4HA8 A;  1PKS A;  2VUB A;  1B3Q A;  2QEX T;  4HT8 A;  4KGZ B;  1NEB A;  1GCQ C;  4ZGD B;  2GQV A;  2AIR B;  3M0T A;  1KQS P;  2EQU A;  2OJ2 A;  3RUX A;  3OYN A;  3VS1 A;  1W2B P;  2Y4Y A;  3FJP A;  4E7K A;  3JCM X;  1K76 A;  4JRP A;  5KYY B;  2EKH A;  1HSQ A;  4M77 F;  2LJ1 A;  1ZA1 B;  1WXU A;  2CP6 A;  2JTF A;  3VS0 A;  2KRS A;  4M7A B;  4C8Q C;  3OYA A;  4OF1 A;  3VUZ A;  2DD5 A;  3EG9 B;  3JCM g;  1OU8 A;  2JTM A;  2K57 A;  2C0I A;  3G4S Q;  1UE9 A;  2RI2 A;  1LPL A;  1UHC A;  1YWO A;  1BIA A;  1LCK A;  4ZN1 A;  1XNI A;  3G4S A;  4M7A A;  4L6V 5;  1TU0 B;  2M51 A;  2E6N A;  3O5Z A;  2YLC A;  3WVD B;  4HT9 A;  3G71 T;  3V8L A;  3Q1J A;  1M30 A;  1U8R A;  1JXO A;  3EGD B;  4VUB A;  3EH1 A;  1B34 B;  1FX7 A;  5KYU A;  4HVV A;  2L2P A;  5GJW B;  2FPF A;  5CIU A;  1PRM C;  2HKQ B;  3JSC A;  4FM4 B;  4F7U G;  5LJ5 g;  4IUU A;  4FYW B;  1QCO A;  4PJO E;  2OX7 A;  3KFV A;  1YHQ Q;  3S3O A;  2A3L A;  4X9D A;  3JCM P;  5GAO p;  3QJY A;  2OAU A;  5CVI A;  1SPK A;  1UGS B;  2BKD N;  2RNA A;  5FU7 B;  4KUD K;  4BI3 A;  4L5G A;  3MKD A;  4JJN K;  2KXD A;  2OI3 A;  4F14 A;  4KGV B;  2FZG B;  1VQ4 A;  2RJE A;  1PRL C;  2EGE A;  2R5M A;  1YHQ A;  2EJF A;  4PJO D;  2EBP A;  4BDY A;  4RMO A;  2KSS A;  5DLQ E;  2ZPI B;  2A36 A;  3OBW A;  1GRI A;  5IXB A;  1EX4 A;  2JOY A;  2RQW A;  3CCM Q;  1NPR A;  1RUW A;  2FG0 A;  4PJJ A;  2V1Q A;  2RB6 A;  1C6V X;  1RL2 A;  2PTK A;  4MMK A;  2G6F X;  2O9S A;  4OB2 B;  3MHX A;  4MZM A;  4WF2 A;  2X3W D;  4EIK A;  3R6N A;  4C8Q E;  1F1B B;  2LCC A;  4HKE A;  1IGQ A;  1VQO Q;  3REB B;  2LCS A;  4LDX A;  1UGP B;  3OYC A;  5GMK i;  2KE9 A;  2RQT A;  2OTL Q;  4PJM A;  1H64 1;  2DL4 A;  2DD4 A;  3TEE A;  1NJI C;  3OYG A;  2LVM A;  5HY6 A;  2GFA A;  2ZAE A;  3OS2 A;  3QDF A;  2NUP A;  1WJR A;  2O4X A;  4M77 D;  2JS0 A;  3QO3 A;  1WHG A;  3UF4 A;  1VQP Q;  1KG1 A;  3LLR A;  4AT1 B;  4E7I A;  2K9G A;  5J26 A;  3M0Q A;  2JM9 A;  1RAF B;  4RTY A;  4DBF A;  1IZ6 A;  4KBM B;  3L2Z A;  3MCA B;  1X2K A;  4LDV A;  1EZZ B;  2KYM A;  4DBH A;  4PLI A;  3C95 A;  1N9R A;  1G83 A;  1ARK A;  2XDD A;  3CCU A;  4A53 A;  4M7A D;  1OUL A;  3EG3 A;  3QII A;  1M5Q 1;  1Q86 U;  1WFW A;  1QQJ A;  4EMH A;  2BZ8 A;  1QKX A;  1WX6 A;  2HAX A;  4J6X A;  2OTJ A;  1K8A U;  4DOW A;  2QQ9 A;  1KC8 R;  1UTI A;  1AWX A;  3PMI A;  3R6O A;  3KUF A;  3QHS A;  4L59 A;  2KQW A;  2CP2 A;  2KRM A;  1UJY A;  2DX1 A;  4C92 C;  4EMK B;  4IUR A;  4O6J A;  2CZ1 B;  3NFC A;  3AHU A;  2QAZ A;  1R77 A;  1YI2 Q;  2W0Z A;  3FLG A;  2QEX Q;  4A4H A;  4QQ6 A;  3LGF A;  3CCL A;  1PKT A;  2HL3 A;  4XQ3 A;  1QWE A;  1FMV A;  4M78 D;  3CC7 T;  2X35 A;  3S3M A;  1I81 A;  4M78 A;  1W1F A;  2CT3 A;  5J3B A;  5LJ3 e;  2HSE B;  4J5Y A;  2YWW A;  3LYI A;  4MML A;  4A4G A;  5GAO l;  4JDS A;  9ATC B;  4XU3 A;  3SDZ A;  2E41 A;  4JRI A;  2C06 A;  1A0N B;  2CP7 A;  1KIK A;  1I4K 1;  3RMQ A;  1PD0 A;  4BY6 C;  1D1C A;  4C92 F;  1WXB A;  5LJ5 j;  1T3S A;  2RHU A;  1H92 A;  2K79 A;  1O9S A;  2BUD A;  2RA2 A;  5C6S A;  1IB8 A;  4KH0 B;  4J83 A;  2FPE A;  2EGC A;  3HRT A;  1VQ9 A;  5I11 A;  4XTV A;  2DTH A;  2PVG B;  5GAN h;  5D7U A;  1VIF A;  1M4Z A;  2A7Y A;  3MEU A;  3CCR A;  2PQW A;  3EFR A;  3SEM A;  3OMC A;  4PFP A;  5GAN 4;  3V8K A;  4K11 A;  3ME9 A;  1HK9 A;  2OTJ T;  1YFN A;  2DF6 A;  2SEM A;  3PT9 A;  1V1C A;  1CSK A;  5LJ5 d;  2X3X D;  2PZ1 A;  4C8Q A;  2QI2 A;  1QVG S;  2MCN A;  4LN2 A;  4KRT A;  4FCY A;  3JCM V;  2BZY A;  1MGQ A;  2F2W A;  4E7S A;  2YSQ A;  4N0A C;  3ZFJ A;  1Q81 U;  2LDM A;  5GAN 7;  2KDS A;  4PFO A;  5FW9 A;  3H0I A;  1OOT A;  3C0C A;  4V2S A;  3UWN A;  1BI2 A;  3PE0 A;  2E70 A;  3JB9 H;  1Y71 A;  3SHW A;  2QDL A;  4AFQ C;  4C5I A;  5CKH A;  2VXF A;  2DZC A;  2ED0 A;  4BI4 A;  2FZC B;  1VQL A;  4JS5 A;  1W2B S;  3QSU A;  2VB6 A;  3V7R A;  4J9I A;  3QPH A;  2XK0 A;  3JB9 J;  1WHK A;  2L3Q A;  5CKE A;  3MO8 A;  4FW1 A;  4BUG A;  3URG A;  3A8O B;  3LH0 A;  3L2W A;  3CPF A;  3HP9 A;  1TWB A;  3G71 A;  3I35 A;  3X26 B;  2WAC A;  2JJ9 A;  4DQ2 A;  5HK0 A;  3RES A;  1GL5 A;  2RI5 A;  1QLY A;  3I5R A;  4M75 E;  1EIF A;  3E1S A;  5GAO r;  3I55 A;  1KFZ A;  2YUP A;  4QVZ A;  3JCM f;  3G4S T;  5HKC A;  2BZX A;  4AFS C;  2QYZ A;  1VYV A;  2A28 A;  4XTU A;  4PJO G;  2LT4 A;  2GTO A;  4R56 A;  1Q82 U;  3CD6 Q;  2CSQ A;  1YIT Q;  1YJW Q;  2Z0W A;  3P8H A;  4XU0 A;  3SWN C;  3OBY A;  3VS5 A;  3JB9 D;  3GNG A;  1WZO A;  2DEU A;  3JCM Q;  1OU9 A;  2DTO A;  3MJX A;  1B7T A;  2B8A A;  1KD1 R;  4GLK A;  3J7A F;  2X9H A;  2HNI A;  2EAY A;  1RLP C;  1W4S A;  4PJO F;  1K73 U;  3CXC S;  4OMM A;  1JJ2 S;  2DIG A;  3AT1 B;  1OI1 A;  2LT1 A;  2CS7 A;  1NJI R;  2E5K A;  1NLO C;  2NLU A;  2VV5 A;  2CH4 W;  4PJL A;  1QP2 A;  2HBW A;  3BW1 A;  2YRV A;  1OYX A;  2LQN A;  2JXB A;  1S72 T;  2LMJ A;  2FYK A;  4ZGJ B;  2LX9 A;  2DLP A;  2DBM A;  2DVJ A;  2L0A A;  1O75 A;  3LGL A;  1OEB A;  3CBP A;  2COZ A;  2LJ3 A;  5EC7 A;  3MEW A;  4ANJ A;  2NUT A;  3L42 A;  1RAI B;  2YLB A;  2QA4 T;  4J8O A;  2LRQ A;  3CCJ A;  4QVC A;  1PD1 A;  4IUV A;  3X20 B;  5A0G A;  2MI6 A;  6AT1 B;  1BKB A;  3QKJ A;  1RAA B;  4LDY A;  4P5N A;  4Z02 A;  2CP3 A;  1WLP B;  1JBM A;  4DEX A;  3OYY A;  2KGT A;  1MMD A;  2QA4 Q;  2EQJ A;  3OA6 A;  1R0B G;  1OPL A;  1RAG B;  3UA7 A;  2JW4 A;  1RI0 A;  3UAT A;  1KC8 U;  1N6A A;  2M9U A;  5D6Y A;  3VUB A;  4F7U B;  1R8O B;  2M16 A;  3NTH A;  4KGX B;  3CMA T;  2LTO A;  3CME A;  4OMP A;  4KH1 B;  3ZEH A;  3V8J A;  1NLP C;  4CI0 C;  2ZPG B;  1I5O B;  4M78 G;  2BIV A;  1BU1 A;  3JCM e;  3HRS A;  1RLQ C;  3I56 Q;  1ZSZ A;  3EG0 A;  1WXT A;  2VGN A;  4RTZ A;  3UDC A;  4J9C A;  1VQ8 Q;  4JRK A;  2HDA A;  2O31 A;  1X69 A;  1JU5 C;  2RQV A;  4LD6 A;  4Y28 E;  3EH2 A;  1C1A A;  3OMG A;  1M8V A;  2JMA A;  1K4U S;  1D1B A;  1MMA A;  2LC4 A;  4OB0 B;  2KVQ G;  4FL6 A;  1SSF A;  4PJO C;  3TCJ A;  2XDP A;  4E7J A;  3OYL A;  1KJW A;  4EMG A;  2F1L A;  1Y57 A;  1UHF A;  4F04 B;  3H9N A;  1BI0 A;  1Q7Y R;  1JXM A;  2ED1 A;  2KXC A;  1ACM B;  4Z88 A;  3CC4 T;  3QZ9 B;  2A0F B;  5GAO m;  3CCJ Q;  1ZQ1 A;  4EDU A;  3DKM A;  3LWH A;  1BYM A;  1CKA A;  2PUK B;  5IN1 A;  3HFO A;  1FMK A;  5KE2 A;  2O88 A;  1SKU B;  2DK3 A;  2CYZ B;  5IT9 E;  2RHX A;  2VYT A;  4E7H A;  4JJD A;  4EPC A;  1K73 C;  1VQL T;  1SG5 A;  1X43 A;  2YHT A;  4M7D A;  2V8K A;  1TH7 A;  1ZBJ A;  1R0C B;  3OYM A;  2VKN A;  1XQH A;  1BIB A;  4Z8A A;  3QWX X;  2VAS A;  1VQN T;  4BB7 A;  1K9M C;  4D8K A;  2DO3 A;  4GY5 A;  1Z9Z A;  2P84 A;  4M75 G;  4LUE A;  2EJG A;  2IG0 A;  1YHQ T;  3E2U A;  2XKO C;  5FRO A;  3HTR A;  2QAS A;  3OYB A;  3L2Q A;  2OTL A;  4DBR A;  2EIF A;  3A5Z B;  2QGF B;  2DXC A;  8ATC B;  3C12 A;  3CCU T;  4PKC C;  4R0K A;  3X25 B;  1ZSZ C;  3PMT A;  1K73 R;  2J05 A;  4HCB A;  3JCM c;  2EYY A;  2NWM A;  2EYQ A;  4A63 B;  5GAM d;  2NUT B;  5KCO A;  4OB3 B;  3H0H A;  2RHZ A;  3QG1 A;  4F17 A;  1N8R R;  3MP6 A;  1TUD A;  7AT1 B;  1M90 R;  1DJ7 B;  4JZ3 A;  4B9X A;  1JQQ A;  5GAN j;  2D9T A;  4LUD A;  5KE3 A;  3JB9 F;  1AT1 B;  1VQ4 Q;  2V8I A;  2COY A;  4OGC A;  3THK A;  4MDW A;  1MV3 A;  5HK3 A;  5A0D A;  5CKD A;  2RQU A;  1WNL A;  5LJ5 h;  4C8Q F;  2HQH A;  2W10 A;  3QUI A;  1QWF A;  3JCM h;  2DL5 A;  3M56 A;  4IUQ A;  3RMS A;  2HCK A;  4M75 F;  2DKG A;  2L3S A;  2F5T X;  4M7A F;  1AZE A;  4J6W A;  2PUO B;  3CD6 T;  4F7U A;  3VS4 A;  1X01 A;  4QQD A;  2EW3 A;  4FIB A;  1G3T A;  5GMK l;  2E65 A;  3CCL T;  2MOX A;  3QZ5 B;  2HBP A;  4B6M A;  1S72 Q;  1VQ6 Q;  1KHC A;  1OX9 A;  2P4T A;  2JNG A;  2GTJ A;  2DTI A;  1UEC A;  1W70 A;  1X27 A;  3QJ6 A;  4C92 A;  3DB3 A;  4ZGE B;  1WGS A;  1Z9Q A;  4JS4 A;  4OGE A;  2V1R A;  1TXQ A;  3CD6 A;  2DXU A;  2F2V A;  3DB4 A;  1VOM A;  4QVD A;  1WQ7 A;  3FRN A;  2KY9 A;  2FB7 A;  4BE1 A;  2E3I A;  1Y96 B;  4M75 A;  1PNJ A;  3PGG A;  5KYW B;  2E4H A;  2DBK A;  4CC2 A;  3L1A A;  3ASK A;  3OY9 A;  3EHQ A;  3TVT A;  2DNU A;  1TSF A;  3S3N A;  1YN8 A;  3INZ A;  1YBY A;  3HL8 A;  2M0Y A;  2EQI A;  4XU1 A;  5KYW A;  1TUC A;  2DAQ A;  1RI9 A;  2KNB B;  3TSW A;  3G7Z A;  2JZ2 A;  1KQS A;  3CCU Q;  2RHI A;  1UJ0 A;  1UGQ B;  5LJ3 d;  4LXC A;  1E7O A;  1QKW A;  2GFU A;  4ZN3 A;  1AHJ B;  1TG0 A;  4C92 E;  3MET A;  4C8Q G;  4MZT A;  1FXX A;  1N5Z A;  4BE2 A;  3JCM b;  2BE9 B;  3WXM B;  3I56 A;  1K8A C;  5IXF A;  2RJF A;  5GMK j;  4HVU A;  3CC2 T;  3J81 E;  5CO7 A;  3G1J A;  4X1V A;  2RI3 A;  1S1N A;  4J9G A;  1I07 A;  2CZ7 B;  4BI8 B;  1QVG A;  1PM3 A;  3A8M B;  5FWC A;  3OW2 P;  4M78 F;  5KYU B;  1V29 B;  2XHC A;  3CCR Q;  2ABL A;  2XDB A;  4N0A A;  2LCL A;  3VYG A;  4J9D A;  3V7C A;  2MPX C;  2JT4 A;  4OMQ A;  3CCE T;  4OP0 A;  2V8J A;  2E12 A;  4RTX A;  4HCC A;  4LDU A;  1QCN A;  4M78 C;  1VUB A;  3HFN A;  4C92 G;  5GAN f;  4AMC A;  2RJD A;  3LH5 A;  2ROL A;  2A37 A;  2QXF A;  4XTY A;  3OYE A;  2YUO A;  4N4I A;  4J9B A;  1G8X A;  3CCE A;  1G5V A;  1WI7 A;  2XIC A;  2D8H A;  4C0D B;  1MMG A;  2DXB A;  2J6K A;  2K2M A;  2HL5 C;  1ZSG A;  4C0Z A;  1HYO A;  1PCX A;  4HCZ A;  3JCM W;  2LP5 A;  3C4S A;  1ZUK A;  4O5V A;  2RHY A;  3O8V A;  3M0P A;  2D0N A;  1YIJ Q;  2NYS A;  2XID A;  4DEY A;  2LNV A;  2KEA A;  3GBQ A;  2G3R A;  1VQP A;  1NM7 A;  4XTX A;  4AG1 C;  4DBQ A;  4C8Q B;  3HHT B;  5GAM h;  2YDL A;  3CCJ T;  3JAM E;  2F2X A;  1QP3 A;  4A4E A;  3L2U A;  3CCV A;  2D1X A;  1YJ9 T;  2P4R A;  3EAE A;  2F5K A;  5CQY A;  3M54 A;  1Q86 R;  5CK9 A;  4CC3 A;  5GAN e;  3MP1 A;  2XMF A;  2JTE A;  2L89 A;  4NL3 A;  3OYH A;  5KCH A;  3LX7 A;  2DYI A;  3NPF A;  3ZL7 C;  1NJI U;  2AT1 B;  1VQO T;  4BY6 B;  3HRU A;  3GP8 A;  1GCP A;  4KUL A;  2ROT A;  3RBB B;  4RG2 A;  4XU2 A;  1MV0 B;  1UGR B;  3OB9 A;  4C5G A;  3I55 Q;  1M1K R;  1AZG B;  1LOJ A;  1KK7 A;  3OYF A;  1NYF A;  2EYW A;  4ME7 A;  5LL6 S;  2DPP B;  1U06 A;  4RKU E;  1X2Q A;  2FL7 A;  1FYN A;  3NTK A;  2L3P A;  3M0U A;  1Q7Y C;  4DA4 A;  1VQP T;  4HXJ A;  4E7L A;  4BE0 A;  2KRN A;  2GQI A;  2LX7 A;  3VS7 A;  1M27 C;  3VV0 A;  3E9G A;  4LNP A;  5GAM g;  1GFD A;  3V7S A;  3OYI A;  2HKN A;  1VQM Q;  1WIE A;  3CBO A;  5GAN 8;  5I22 A;  2K5L A;  3CBM A;  5CKB A;  3GPL A;  2DJZ A;  2JUF A;  4UC4 A;  3RKY A;  2XI9 A;  1Q95 G;  3I55 T;  3REA B;  4CC7 A;  2JMC A;  3CCV Q;  2HZY A;  2YXY A;  3JCM J;  5AYF A;  3EG2 A;  1W6X A;  1N8R U;  3ER0 A;  4C5E A;  2K7A A;  2EYZ A;  2ZGW A;  1YJW A;  2E3H A;  4OMO A;  5GMK m;  1M1K U;  1GBQ A;  2EVR A;  1M3A A;  1W2B A;  5FRM A;  1U3O A;  4M77 C;  2VVK A;  1KQS S;  5IAY A;  4QQG A;  1B07 A;  2MYS A;  2SRC A;  4M7D B;  1WPY A;  3PNW C;  1UFF A;  2IPO B;  4IKF A;  4WTO B;  1IXD A;  1K9M R;  1NYG A;  1H8K A;  2RK2 A;  2P0Q A;  4C0D C;  1AWW A;  4FSS A;  1WHL A;  4XTZ A;  4M7A C;  1FMW A;  5GMK e;  1WJQ A;  1LJO A;  1XJW B;  2COW A;  4FT2 A;  3MEA A;  2GCX A;  3UA6 A;  2K6D A;  1BI1 A;  2WSF E;  4M78 B;  1EFN A;  3BE3 A;  2FZK B;  3J80 E;  4PJO A;  1Y07 A;  3CEY A;  1VQ9 T;  1VQ6 T;  3CPW A;  4B9W A;  3CCS T;  1M8M A;  1YJ9 A;  2DIQ A;  3A8L B;  5GAM j;  3CCV T;  1JJ2 A;  1VQ8 A;  1VQK T;  3TU4 K;  3CPW P;  1M1G A;  5KH6 A;  4MZP A;  2PU9 B;  1WJS A;  1WHH A;  1NEG A;  2RJC A;  4JUV A;  1ZX6 A;  2X4Y A;  4BD3 A;  4ELY C;  2OAW A;  1GCQ A;  4FT4 A;  2JN0 A;  3KBG A;  5FLX E;  2WSC E;  4X9C A;  4JPB W;  4RG8 A;  3CME Q;  2CSI A;  2QQS A;  2LNH B;  1HJD A;  5FU7 C;  4M78 E;  3QDR B;  4LD9 K;  1KD1 U;  1AEY A;  1YI2 T;  1ZSZ B;  1RAC B;  1VA7 A;  5CQX A;  1QCF A;  3CPW S;  2ECZ A;  1XOV A;  1TTH B;  2AKK A;  2ZPB B;  3P8D A;  1WYX A;  2HSP A;  2GGR A;  4C0F A;  2LQK A;  1PWT A;  2YT6 A;  5GAM f;  1N27 A;  1K8A R;  2HMA A;  5DY9 A;  3QWY A;  2K2V A;  2GF7 A;  2J6O A;  3QBY A;  2FHD A;  2KAF A;  4MDX A;  2YRC A;  2ZPE B;  1C0M A;  2DRK A;  1M2V A;  2RMO A;  1K1Z A;  3D7S B;  1Y7X A;  4KUI A;  1X6O A;  4GBQ A;  4E7Z A;  4LDW A;  4M4Z A;  2X51 A;  2L3R A;  3M4G A;  1OX8 A;  4PJN A;  3CCS Q;  2H8H A;  3RER A;  3G6E Q;  5ECA A;  1VIE A;  3DLL A;  3CC7 A;  2M0O A;  3VJP A;  4M77 B;  3EFO A;  2CT4 A;  1AOJ A;  2CRE A;  4DOV A;  3FIF A;  4J9H A;  2I2L A;  5M9O A;  1QVF A;  1VQ6 A;  1JRI A;  3H0F A;  4IIM A;  2DMO A;  3MP8 A;  3SD4 A;  3VRZ A;  4PJO B;  2FRY A;  1MNE A;  1PG5 B;  1Q7Y U;  2J7I A;  1M3C A;  3MEV A;  4M77 A;  3SWN B;  1RAE B;  1BB9 A;  1VQN Q;  2RD1 A;  4OVA A;  2IVW A;  4ATO A;  4FSX A;  1JO8 A;  4J7F A;  1D3B A;  2AK5 A;  4IUP A;  1H3Z A;  2FPD A;  1KHI A;  2D0Q B;  2CH4 A;  3OQ5 A;  5GMK h;  2ZPF B;  3NGP A;  3SWN A;  2DET A;  2ESW A;  3NTI A;  5LJ5 f;  1M90 U;  3KXT A;  2HQE A;  1YCY A;  3BDU A;  3OW2 A;  5DLO A;  2DEQ A;  1X6G A;  2P0P A;  1BCM A;  5GJV B;  1AWO A;  4BAC A;  2LJ0 A;  1SRM A;  2C0T A;  3BY7 A;  4M7D E;  1SEM A;  5KYN A;  3GIB A;  1YP5 A;  1LVK A;  4JLI A;  1X75 C;  1G3S A;  1VQ5 Q;  3LWI A;  1U1S A;  1IRE B;  3EGU A;  4CC4 B;  1TS9 A;  5IH2 A;  1I0C A;  1YWP A;  1SSH A;  3F70 A;  5HCK A;  1P92 A;  4A4K A;  2DL3 A;  3OS5 A;  2EYX A;  2H3J A;  2ZPH B;  3OYK A;  3PVL A;  3CCQ A;  3UT1 A;  3OW2 S;  1M90 C;  2M1H A;  1OPK A;  2RK1 A;  3SB2 A;  4A4F A;  1M1F A;  4M77 G;  3CCM A;  4KT0 E;  3A98 A;  1KQ1 A;  1IGU A;  4XTW A;  3JV3 A; 
#chains in the Genus database with same CATH homology
 3I35 A;  4RTX A;  1IO6 A;  3M0S A;  4OMN A;  4QT7 A;  1GL5 A;  1QLY A;  3I5R A;  1T0J A;  1M3B A;  1KFZ A;  2YUP A;  2EPD A;  2PNI A;  3LH5 A;  2ROL A;  1ABQ A;  2O2O A;  2BZX A;  2YUN A;  4AFS C;  1VYV A;  2A28 A;  2FRW A;  2A37 A;  2YUO A;  4J9B A;  2GTO A;  1WI7 A;  3VS3 A;  2CSQ A;  2D8H A;  3EG1 A;  1SHG A;  2AZS A;  2J6K A;  2K2M A;  3VS5 A;  1ZSG A;  2DYB A;  1ZUU A;  3M0R A;  2RPN A;  3EHR A;  1ABO A;  2NUZ A;  2DA9 A;  2C0O A;  2DL7 A;  4IIO A;  2KRO A;  2LP5 A;  2RF0 A;  1RLP C;  1ZUK A;  2FO0 A;  1K9A A;  3M0P A;  1SHF A;  4OMM A;  2D0N A;  4DEY A;  2E5K A;  2KEA A;  1NLO C;  3GBQ A;  2I0N A;  2J06 A;  5L23 A;  1NM7 A;  2CH4 W;  4AG1 C;  4ESR A;  2HBW A;  2LQN A;  2JXB A;  2YDL A;  1KSW A;  2F2X A;  2LMJ A;  2AZV A;  2DLP A;  1VYU A;  2DBM A;  2DVJ A;  4E6R A;  2D1X A;  2L0A A;  2P4R A;  1OEB A;  1PKS A;  1B3Q A;  3H41 A;  4CC3 A;  2LJ3 A;  1NEB A;  2AKL A;  5EC7 A;  1GCQ C;  3PVQ A;  2B86 A;  2XMF A;  3M0T A;  2JTE A;  2OJ2 A;  3VS1 A;  3NPF A;  3ZL7 C;  1K76 A;  2EKH A;  1HSQ A;  1YNZ A;  2LJ1 A;  1GCP A;  2ROT A;  1WXU A;  3RBB B;  3VS0 A;  2KRS A;  1X6B A;  1BK2 A;  1MV0 B;  2C0I A;  2KYB A;  1AZG B;  1WLP B;  1NYF A;  1UE9 A;  2EYW A;  4HCK A;  5FWB A;  4DEX A;  2GNC A;  4RUG A;  2KGT A;  1OV3 A;  1U06 A;  3VS2 A;  1UHC A;  1J3T A;  1YWO A;  1X2Q A;  1LCK A;  1FYN A;  2L3P A;  3M0U A;  1K0X A;  1OPL A;  3UA7 A;  4HXJ A;  2JW4 A;  2KRN A;  2GQI A;  2M51 A;  3UAT A;  1GBR A;  2LX7 A;  3O5Z A;  2CUD A;  1M27 C;  3VS7 A;  4LNP A;  2MIO A;  1GFD A;  3ULR B;  1WIE A;  2HEQ A;  3CQT A;  2ENM A;  4OMP A;  5I22 A;  1M30 A;  1JXO A;  1NLP C;  4RTT A;  1SRL A;  4HVV A;  1BU1 A;  2L2P A;  1ZUY A;  2BTT A;  1RLQ C;  3EG0 A;  5GJW B;  3REA B;  1WXT A;  2FPF A;  3TSZ A;  4CC7 A;  1T3L A;  4RTZ A;  4J9C A;  1PRM C;  1CKB A;  2HDA A;  2JMC A;  1X69 A;  2O31 A;  1JU5 C;  2RQV A;  3EG2 A;  1W6X A;  2KR3 A;  2JMA A;  2K7A A;  2EYZ A;  1K4U S;  3KFV A;  4OMO A;  5IHI A;  4HVW A;  1GBQ A;  1KJW A;  1Y57 A;  2EVR A;  1M3A A;  1UHF A;  1SPK A;  2RNA A;  1U3O A;  1JXM A;  2ED1 A;  4ORZ A;  2KXC A;  2VVK A;  4Z88 A;  3FJ5 A;  2A08 A;  2KXD A;  2OI3 A;  4F14 A;  1B07 A;  1GFC A;  1PRL C;  2EGE A;  2RQR A;  2SRC A;  1CKA A;  3VRY A;  1UFF A;  3NHN A;  1NYG A;  1T0H A;  1H8K A;  3VS6 A;  2EBP A;  2A36 A;  1FMK A;  1GRI A;  5IXB A;  1MUZ A;  2O88 A;  1AWW A;  2RQW A;  4FSS A;  3I9Q A;  1RUW A;  2FG0 A;  1VYT A;  2V1Q A;  4JJD A;  2K3B A;  2RN8 A;  2PTK A;  2G6F X;  2O9S A;  1X43 A;  2X3W D;  2JM8 A;  4EIK A;  3R6N A;  1ZBJ A;  2CDT A;  1AWJ A;  2VKN A;  3UA6 A;  1I1J A;  2K6D A;  4Z8A A;  3QWX X;  1YCS B;  1EFN A;  2KT8 A;  3REB B;  4D8K A;  2LCS A;  1Y0M A;  1Z9Z A;  4LUE A;  2JS2 A;  1UG1 A;  2KE9 A;  2RQT A;  1M8M A;  2DL4 A;  2DRM A;  1NEG A;  1U5S A;  1ZX6 A;  4R0K A;  2JS0 A;  2OAW A;  1GCQ A;  2VWF A;  3UF4 A;  2J05 A;  2K9G A;  1UDL A;  4JJB A;  2EYY A;  2NWM A;  4JPB W;  3M0Q A;  2CSI A;  2DM1 A;  2LNH B;  4Y92 A;  1HJD A;  2JM9 A;  2GBQ A;  4RTY A;  4A63 B;  1AEY A;  2LZ6 B;  3H0H A;  4F17 A;  1AVZ C;  1X2K A;  4ZNX A;  1TUD A;  1VA7 A;  4JZ3 A;  2KYM A;  1QCF A;  2KBT A;  2ECZ A;  1XOV A;  1JQQ A;  1K0S A;  3I5S A;  2AKK A;  1WYX A;  4LUD A;  1G83 A;  2HSP A;  1ARK A;  2GGR A;  1PWT A;  4RTU A;  3EG3 A;  2YT6 A;  3THK A;  1MV3 A;  1WDX A;  1WFW A;  2BZ8 A;  1QKX A;  1WX6 A;  2IIM A;  1UTI A;  1AWX A;  2RQU A;  3QWY A;  2J6O A;  2KT1 A;  4GLM A;  4J9F A;  1WA7 A;  2W10 A;  1QWF A;  2KRM A;  2DL5 A;  1UJY A;  2DX1 A;  4OML A;  2DRK A;  2HCK A;  2L3S A;  2RMO A;  1K1Z A;  4LE9 A;  1ZLM A;  1AZE A;  2O9V A;  2W0Z A;  2J6F A;  3VS4 A;  1H3H A;  4GBQ A;  3RNJ A;  4M4Z A;  1UUE A;  1PKT A;  2EW3 A;  1QWE A;  2DJQ A;  4JZ4 A;  1BBZ A;  2H8H A;  2MOX A;  4WCI A;  5ECA A;  2FEI A;  1W1F A;  2GTJ A;  2CT3 A;  1UEC A;  1W70 A;  1X27 A;  4JJC A;  1JEG A;  2CT4 A;  1AOJ A;  2CRE A;  2LQW A;  1Z9Q A;  4J9H A;  2V1R A;  3H0F A;  4IIM A;  2DMO A;  2F2V A;  4AFZ C;  1A0N B;  1E6H A;  1KIK A;  3U23 A;  3VRZ A;  1AD5 A;  2FRY A;  2J7I A;  1M3C A;  1PNJ A;  1BB9 A;  1WXB A;  3IQL A;  1T3S A;  4F16 A;  2DIL A;  2DBK A;  1H92 A;  2K79 A;  4RTW A;  1JO8 A;  4CC2 A;  2AK5 A;  2FPE A;  2FPD A;  3EHQ A;  2EGC A;  3TVT A;  5IHK A;  2DNU A;  5I11 A;  2CH4 A;  1E6G A;  1YN8 A;  3NGP A;  4D8D A;  2M0Y A;  2ESW A;  2EQI A;  1TUC A;  2CUB A;  1RI9 A;  2KNB B;  3TSW A;  3SEM A;  1X6G A;  3NMZ C;  5GJV B;  1AWO A;  2LJ0 A;  1SRM A;  2C0T A;  4AFU C;  1UJ0 A;  2EGA A;  4K11 A;  4J9E A;  1SEM A;  2DL8 A;  2DF6 A;  2SEM A;  1YP5 A;  1E7O A;  1QKW A;  1NG2 A;  1V1C A;  1CSK A;  2X3X D;  2PZ1 A;  3EGU A;  4CC4 B;  1TG0 A;  1HD3 A;  5IH2 A;  2MCN A;  4LN2 A;  4KRT A;  1I0C A;  1YWP A;  2YUQ A;  4Z89 A;  1SSH A;  2BZY A;  2F2W A;  1N5Z A;  1UGV A;  5HCK A;  2YSQ A;  4AG2 C;  2DE0 X;  5IXF A;  2DL3 A;  4HVU A;  2EYX A;  5FW9 A;  3H0I A;  1OOT A;  3C0C A;  4X1V A;  3PE0 A;  1S1N A;  4J9G A;  3PVL A;  3SHW A;  2QDL A;  1G2B A;  1I07 A;  1PHT A;  4AFQ C;  2ED0 A;  1OPK A;  5IHN A;  5FWC A;  4J9I A;  2ABL A;  2D8J A;  2L3Q A;  3A98 A;  4J9D A;  2JT4 A;  3JV3 A;  4OMQ A;  4RTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...