2DLPA

Solution structure of the sh3 domain of human kiaa1783 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
85
structure length
85
Chain Sequence
GSSGSSGSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords KIAA1783 protein
publication title Solution structure of the SH3 domain of human KIAA1783 protein
rcsb
source organism Homo sapiens
total genus 6
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dlpA00
2D8JA 2FO0A 1WDXA 2JW4A 4CC7A 4D8KA 1WXBA 1SSHA 2LCSA 3EG0A 1M27C 4RTVA 1M8MA 2KRSA 2LP5A 1YP5A 3RNJA 3NHNA 2O9VA 1GBQA 4ESRA 2EPDA 3UATA 2DF6A 1PHTA 2L3SA 2PTKA 4AFSC 1I07A 3C0CA 3I9QA 3PVQA 1TUDA 4GLMA 2JT4A 2CDTA 2HBWA 2F2VA 3SEMA 3VS2A 1JEGA 1NYFA 2FEIA 1ZUYA 1OPKA 1EFNA 1SHGA 1UG1A 1UDLA 2FPEA 1AZEA 3R6NA 1UHFA 3EG2A 1X43A 3M0SA 2GNCA 4CC2A 2ESWA 2JS0A 1KJWA 1BK2A 4ORZA 2OJ2A 2YUNA 2DNUA 2DX1A 1X69A 2I0NA 1YN8A 1YWOA 1H8KA 3I35A 2DL8A 3PVLA 2JM8A 2ROLA 2EYYA 1GBRA 3ZL7C 3H0FA 2MCNA 3TVTA 2O9SA 2GBQA 4HVUA 2J6FA 2OAWA 2ABLA 4KRTA 2ED0A 3VRZA 2KE9A 1GFCA 1AZGB 2JXBA 1KIKA 3O5ZA 1W70A 4AG1C 2KYBA 1GFDA 2C0OA 4JZ3A 4LE9A 3REAB 4A63B 2EGCA 1MV0B 2K2MA 2LMJA 4F16A 1ZLMA 2CH4W 4D8DA 5FW9A 2DVJA 4J9CA 4J9EA 4JJDA 3U23A 3UA6A 2HDAA 3M0RA 5IHKA 4Y92A 2FPFA 2K6DA 1W6XA 2W10A 4AFUC 1U06A 2AZSA 4J9FA 2HSPA 2DL5A 2JMAA 1OEBA 1SRLA 2VVKA 4F14A 4OMLA 1FMKA 1Z9QA 2CT4A 4RTXA 2JS2A 1SPKA 2L0AA 1WYXA 1WLPB 2A08A 2EQIA 1OPLA 1HD3A 1ARKA 4J9IA 2J06A 4Z8AA 1JQQA 1WA7A 1WX6A 3H41A 4DEYA 5L23A 5GJVB 1A0NB 2BZYA 1QKXA 4HXJA 3VS5A 2RN8A 1RLPC 2KT8A 3EG3A 2AZVA 3VS3A 2A36A 1QLYA 1PRLC 4Z88A 1TG0A 1YWPA 4DEXA 2ED1A 2GQIA 1JU5C 4J9DA 4X1VA 1LCKA 2ENMA 4JJBA 2DRMA 2BZXA 1GRIA 3M0TA 2G6FX 2LJ1A 4OMQA 1KFZA 1E7OA 1VA7A 1Y0MA 2FRWA 3GBQA 3UA7A 1H3HA 3QWYA 4J9HA 2KEAA 2JTEA 1X2KA 2LX7A 4EIKA 2K9GA 4OMOA 4RTUA 1QWEA 1WI7A 4LUEA 2PNIA 4OMPA 1G2BA 2YSQA 4ZNXA 4J9GA 3EG1A 3I5RA 1WXTA 2LJ3A 2KRNA 5FWCA 2CREA 5IHNA 1V1CA 1UECA 2RQWA 1AWJA 2J6OA 2DLPA 1NYGA 3CQTA 3EGUA 2KXDA 2QDLA 1S1NA 4RTYA 1VYTA 5IH2A 2BTTA 1GCQC 2RPNA 1WXUA 3M0UA 2JMCA 4LUDA 1N5ZA 1T0JA 1RUWA 4GBQA 1RI9A 1QWFA 2YUQA 2V1RA 4J9BA 5I22A 4HVWA 2DL7A 2MOXA 3H0IA 4RTTA 5I11A 3THKA 2B86A 2L3QA 1PWTA 2SEMA 1UFFA 3I5SA 2HEQA 1B07A 1AOJA 4Z89A 2YUOA 3TSZA 1G83A 5FWBA 1H92A 5EC7A 1J3TA 3H0HA 3VRYA 2EW3A 1T3SA 3SHWA 1QCFA 1AWOA 2BZ8A 1ZBJA 2NUZA 2EGAA 2RMOA 2AKLA 3QWXX 2A37A 3A98A 1E6HA 5ECAA 1PRMC 2X3WD 4OMMA 1GL5A 1UJ0A 1AVZC 2DA9A 4LN2A 3VS4A 4CC3A 2KBTA 1AWWA 3UF4A 2PZ1A 1FYNA 1M30A 1AEYA 2M0YA 3NPFA 1UE9A 3VS1A 1JXOA 1BB9A 2E5KA 2OI3A 4F17A 1NEGA 1BBZA 4HVVA 1X6BA 5IXFA 5HCKA 2LNHB 1Y57A 2DE0X 4CC4B 4AFQC 1MV3A 2SRCA 1RLQC 1ZUKA 1U5SA 2EYZA 2O2OA 2F2XA 2EGEA 2A28A 4JJCA 3NMZC 1OV3A 2CUDA 2KNBB 2YDLA 1U3OA 2YT6A 2L2PA 2L3PA 2DJQA 2DYBA 2IIMA 2K79A 2M51A 2J6KA 2VKNA 2DM1A 2D1XA 1SRMA 2RQTA 2JM9A 1Z9ZA 3PE0A 2J7IA 1K0XA 2DRKA 4LNPA 1CSKA 2GGRA 1YNZA 4RTWA 2CSIA 2J05A 3M0PA 2EVRA 1SEMA 2MIOA 2X3XD 2DBKA 2GTJA 3FJ5A 1CKBA 1K76A 2CH4A 4K11A 1B3QA 2LZ6B 3IQLA 2FRYA 1AWXA 4E6RA 4IIMA 1NLPC 1T0HA 1NEBA 2GTOA 4RUGA 5IXBA 2XMFA 1K1ZA 2KRMA 3REBB 2EYWA 2O31A 4HCKA 2LQNA 1K4US 1GCQA 1QKWA 1WFWA 5GJWB 1AD5A 1UTIA 1VYUA 2EBPA 2RQRA 1GCPA 1UJYA 1JO8A 1PKTA 2KYMA 4AFZC 1NM7A 1IO6A 2V1QA 1XOVA 1OOTA 1NLOC 1PNJA 3JV3A 1CKAA 2KROA 3NGPA 3KFVA 1E6GA 1BU1A 2KGTA 1WIEA 4IIOA 4AG2C 2K3BA 1X6GA 1X27A 1PKSA 2F2WA 1MUZA 2ECZA 2RQUA 2HCKA 3ULRB 2RF0A 3VS0A 3RBBB 1ZUUA 2AKKA 1K0SA 3VS7A 2LQWA 1W1FA 2DILA 4FSSA 3EHQA 2O88A 1KSWA 1ZSGA 2D0NA 3EHRA 2VWFA 1NG2A 2D8HA 2FPDA 4RTZA 1HSQA 2FG0A 1K9AA 2H8HA 2CUBA 2YUPA 2CSQA 1TUCA 2DL3A 4OMNA 2EYXA 2C0TA 1VYVA 2DMOA 2KT1A 2KR3A 2RQVA 2ROTA 2EKHA 3TSWA 2W0ZA 1SHFA 3VS6A 1ABQA 2CT3A 1I1JA 1M3AA 4WCIA 2DBMA 4M4ZA 2C0IA 2LJ0A 1YCSB 3LH5A 2RNAA 1X2QA 1ZX6A 1JXMA 2DL4A 4JZ4A 1ABOA 1I0CA 1UGVA 1M3BA 4R0KA 4QT7A 2AK5A 4JPBW 1T3LA 2P4RA 1HJDA 1M3CA 5IHIA 1UUEA 2KXCA 2NWMA 1UHCA 3M0QA 2K7AA
chains in the Genus database with same CATH superfamily
2QQBA 3JB9J 5D6WA 3E1SA 4CC7A 3M58A 3HP9A 1IZ6A 2KRSA 4M7DF 3CMEA 1QVPA 2ZPBB 1WPYA 3EG9A 3S6WA 1G3WA 3I55A 2JOYA 4ESRA 2EPDA 2QQSA 1PHTA 4ANJA 4JRPA 2PUOB 3CXCA 2JT4A 2F2VA 3CCEA 2ZGWA 1S72T 1LPLA 3UDCA 1YJ9T 1EFNA 1N9RA 4FT2A 1Q82R 4LDUA 2XKOC 3PMTA 4C92G 3CMEQ 4DBRA 3CCMA 4M77F 1VQ6A 1VQKA 3BW1A 1KQSA 2DNUA 4M7AA 4A4KA 1UGRB 1YN8A 1YWOA 3CCEQ 1NPPA 1FX7A 4II1A 3J81E 2JM8A 1QCNA 3S3OA 2EYYA 5KE2A 4KUDK 3X25B 5LJ5d 2PVGB 2QXFA 2GBQA 2OAWA 4M77D 2VXFA 4LXCA 1KIKA 3O5ZA 1W70A 2QEXT 1OI1A 2KYBA 2COYA 1VQKQ 2G3RA 1D3BA 4A63B 5FU6C 2K4YA 2IVWA 3G7ZA 3U23A 1VQ4A 1D1BA 2CP7A 1NJIC 3OS0A 2OTLQ 2FPFA 4JRIA 3JCMJ 1W6XA 2HAXA 4BACA 2EAYA 1ZA1B 2AZSA 2LNVA 4J9FA 1KQ2A 3JCMP 1OEBA 2FZKB 4M7DC 1SRLA 4J8OA 2KVQG 1Z9QA 4OMLA 4JRKA 2DETA 1R8OB 5CCAA 1RAAB 3AT1B 2A08A 4IUQA 1OPLA 5GAN7 2J06A 3I56A 1WX6A 4DEYA 3JRZA 5L23A 1ZSZB 3MP6A 4HCBA 5CKFA 3JCMV 4M7DE 2FZCB 2A36A 2P4TA 4ME7A 1K73R 1TG0A 1TUGB 4C0FA 2ED1A 3PNWC 1MMDA 4M78C 4CI0C 4XQ3A 4X1VA 1LCKA 4BDZA 2DRMA 1M1GA 2DERA 4OMQA 4XTYA 4E7SA 1VQNT 3A1PA 2LDMA 3PGGA 1VA7A 1WHJA 4FYVB 3CC4A 5C0MA 1H3HA 4J9HA 5GMKh 4MDXA 4EIKA 2K9GA 2XDBA 2E64A 2LCLA 2PNIA 1N8RU 2YLBA 3INZA 1G2BA 4F7UF 1AHJB 2YSQA 3CCLA 5DM7R 5KYXB 1M2VB 4M78E 4PNOA 2KAFA 1WXTA 2EJ9A 5CIUA 5IHNA 2RI5A 1V1CA 1AWJA 2FHDA 2J6OA 1Q82C 3ZEHA 1VQOT 2Y4XA 1NYGA 2DEUA 3EGUA 3CC4Q 5CK9A 3EFOA 2QG9B 3OYEA 2NUTA 4C8QF 2LQKA 4ZGEB 4YTLA 4M75F 3CMAT 1GCQC 3GNGA 1Q95G 2RPNA 3WVDB 3M0UA 2EQJA 2Y4YA 1Y96A 5GAOp 1RI9A 1QWFA 1NJIU 5I22A 1WJSA 3H0IA 2OX7A 2RH2A 5D6XA 2RHUA 2HMAA 4M75D 3THKA 5GAN2 2L3QA 3LWIA 3I5SA 4FW1A 3JB9D 4BE1A 2QYZA 3OYYA 3CD6A 5GAOl 1B34A 5FRMA 1X75C 3G71T 4AT1B 4PJNA 2EGAA 4FYXB 2M0OA 1QMCA 1TTHB 4C0DC 1E6HA 5GAOn 2CZ0B 3L42A 4XTUA 1C1AA 1UJ0A 4C92F 1O75A 3VS4A 2PVOB 1OZ3A 2ZZDA 1QP2A 2PZ1A 3HTRA 3VS1A 1H641 2X9HA 4HT8A 1RAHB 4C5EA 4F17A 1NEGA 1BBZA 4HVVA 4QQGA 2DIGA 3CD6Q 2DO3A 2K5LA 4JLIA 2DXBA 3QJYA 3CPWS 1RI0A 2FL7A 1Y57A 2DE0X 4AFQC 3CC2T 2SRCA 1IGUA 1RLQC 1ZUKA 3CCVQ 5FU7C 2O2OA 3CMAA 3OW2P 4OB2B 2CUDA 3M4GA 2YDLA 4PJOB 1U3OA 4Y91A 2MAMA 2YT6A 5GMKj 2L2PA 4M78B 4C8QC 2DJQA 2DYBA 2CP0A 1BI0A 1KD1R 1WJQA 1VQ9T 4DOVA 2LRQA 1Q82U 3PE0A 4JS5A 3C94A 2DRKA 2X51A 4F04B 1PM3A 2DBKA 1XNIA 1K76A 2CH4A 4JS4A 1YCYA 1SF9A 2YHTA 3IQLA 4C8QE 4FYYB 1AWXA 4E6RA 3NTHA 5GAOq 3EG9B 1H3ZA 3TU4K 4MZPA 2KRMA 3REBB 2EYWA 1RACB 3GF5A 2LQNA 1VQLT 1WFWA 4IUVA 1N6AA 3CBMA 3OYGA 1VQ8A 2QAZA 2X35A 5KYUA 1JO8A 4XU1A 4J7FA 1OU8A 3SD4A 4AFZC 4C0GA 1PNJA 2KROA 1VQ7A 3L1AA 1E6GA 4IIOA 3S3MA 5GAOm 1WHKA 3ASKA 2HL3A 1MUZA 2ECZA 5GANf 4M7AB 5J3BA 1ZUUA 4QQDA 1U1SA 1YITQ 2R58A 1ZSGA 2D0NA 1UEBA 3EHRA 1V29B 3BDUA 1U1TA 2PUKB 2FPDA 4OB0B 2CKKA 2FG0A 2CUBA 2LCCA 1TUCA 2QTVA 2DFUA 1YJWQ 1KC8R 3MPUB 2F5TX 1YHQQ 1I5OB 2EYXA 3LW5E 3VJPA 3OYDA 2C0TA 3FEOA 1YBYA 5LJ3d 5HKCA 2KR3A 1D3BB 3GPLA 2ROTA 2EKHA 3NTIA 2W0ZA 3EFSA 3D7SB 4JJNK 4E2FB 2JTMA 2RJEA 3MP1A 2DYIA 1M1FA 1NZ9A 2M16A 1X2QA 1HXDA 1JXMA 1ZX6A 4PJOG 2ZPHB 2C06A 2M02A 2F69A 1I0CA 3OB9A 5CKBA 4M78G 3G1JA 3UT1A 2K2VA 1RAFB 3OYFA 2XDPA 4NOYA 5D7UA 2D8JA 2FO0A 3G6EA 4RCCA 1WXBA 2O4XA 4X9DA 1N27A 3EG0A 3F70A 1M8MA 1OZ2A 3L2RA 2XU8A 2LP5A 3OS2A 3RNJA 3JCMg 1R0BG 4A4EA 1M90C 2IG0A 3OS5A 3QDRB 2PTKA 2L3SA 3CCSA 3CCUQ 3PVQA 2DD5A 4DOWA 2DK3A 2DKGA 3JSCA 2HBWA 4A4FA 1JEGA 1I8FA 5LJ5f 1UG1A 3A8GB 1SHGA 3CPWA 1RADB 2FPEA 1AZEA 1P92A 1YI2Q 4PJLA 1UGQB 2RJDA 1KHIA 1X43A 4KUIA 3TREA 4EMKA 1QP3A 4LD9K 4CC2A 1TSFA 4M7AG 2KK4A 4Q5WA 3LGFA 4X34A 2QGFB 2R5MA 2EJFA 1X69A 2I0NA 3HRTA 2DTHA 4PFZA 1H8KA 3PVLA 3EFOB 3Q1JA 2DTIA 2NUTB 3ZL7C 5KH6A 3OMCA 2MCNA 1X6OA 2O9SA 4HVUA 2ED0A 2AHJB 3G4ST 1AZGB 1DJ7B 2JXBA 1VIFA 3C4SA 2K3XA 1Y96B 1W2BP 3LX7A 3CCQA 1RAIB 1GFDA 2M1HA 4LE9A 2KY9A 1TOVA 2EGCA 1C0MA 1NE8A 4QVCA 1N9SA 5A0DA 2LMJA 1YJNT 1VQPA 1BI1A 1NJIR 2CH4W 4N4HA 5A0LA 1KK7A 4D8DA 4CRIA 3QPHA 5FW9A 2DVJA 4J9EA 3UA6A 1YIJQ 2ZPGB 1QVFP 5IHKA 2EKOA 2K6DA 2W10A 4AFUC 3EH2A 3JCMe 4OP0A 2WSFE 2MPXC 4E7HA 2JMAA 5GMKe 3ER0A 2VVKA 1B34B 4F14A 1FMKA 4O5VA 3RERA 4KGZB 1KD1U 2RJFA 4GY5A 3A8OB 3URGA 2L0AA 4BE0A 2K57A 1WJRA 1ZSZC 1JQQA 4ZTFA 1WHLA 3EAEA 1K9MC 2QI2A 5GJVB 1A0NB 1QKXA 4XU3A 1SKUB 2DXTA 2AIRB 2AZVA 4M77A 1QLYA 1PRLC 1YWPA 4MMLA 2GQIA 3HPWA 4L59A 2QA4Q 1JU5C 4J9DA 3CCJA 1BI2A 3CC7A 5CVIA 3SDZA 2OTLT 3M54A 5KYWA 2BZXA 3A8LB 1M4ZA 4L6V5 1E7OA 1TU0B 1Y0MA 2DAQA 3N5BB 2FRWA 1TS9A 4J5YA 4FCYA 3EFRA 1JRIA 2GCXA 3HFNA 3CCRA 3QHSA 4N0AC 2DZCA 1XJWB 2E6NA 2VYTA 4OMOA 1MMAA 1QWEA 2D6FA 3QXEB 3KXTA 2JUFA 4XTWA 4M7DD 2QQRA 4J9GA 3EG1A 5FWCA 2CREA 2VV5A 2MF2A 2RI3A 3I55Q 2VUBA 4RMOA 3OS1A 4M78F 5FROA 1QQJA 4BY6C 4E7LA 1S1NA 1VQ5A 3CCRQ 3HKSA 2QTXA 4ELYC 4KT0E 1WXUA 2JN0A 4LUDA 1KC8U 3J7AF 5DLQE 3CCMQ 2V1RA 4J9BA 2H3JA 3X20B 4EMKC 5KYUB 4FW2A 2XICA 1VQ6Q 2BKDN 4RTTA 4C5IA 3DB3A 1VQ5Q 1PWTA 1IGQA 3X28B 1EX4A 3OYKA 2DXCA 1B07A 2CYZB 3OBWA 4Z89A 1I4K1 2JZ2A 2MMPA 1G83A 2D0QB 1H92A 1BCOA 1FWZA 3SFMA 3J80E 1QCFA 2KI7A 1AWOA 4RG8A 2BZ8A 1ZBJA 4QQ6A 2RMOA 3QWXX 2A37A 3MHXA 2F1LA 2RJCA 3JCMX 1WHHA 1GL5A 1S72A 1YJ9A 4MZMA 1AWWA 5IN1A 1FYNA 1M30A 2M0YA 4M7AF 1VQ4Q 3HL8A 3E2UA 4PL6A 1Q7YC 5GMKi 3PIOA 2LNHB 3BDLA 4FU6A 4FYWB 3FDRA 2EYZA 4BI8B 3WXMB 4PJOC 3QBYA 5IT9E 1S72Q 2CS7A 2R57A 3GNFB 4PK4A 3KBGA 3NMZC 2LTOA 3HSBA 2KNBB 4BE2A 1YJ9Q 4M75A 3META 2RO0A 2K79A 2M51A 3P8DA 3I56Q 4KH1B 2QEXA 3JCMh 2P0QA 2D1XA 2J7IA 2X4YA 1K0XA 4LNPA 3PTAA 2GGRA 1BCMA 1YNZA 5KYNA 1WHMA 1G3TA 4PJOE 2O4XB 1JJ2P 3V8LA 3FJ5A 4K11A 1CKBA 1B3QA 3BE3A 5KCOA 5HK3A 4ATOA 2WSEE 4JRQA 2V8JA 2V8KA 2QQAA 2O01E 3CCVT 2GTOA 5GAN4 4DQ2A 1K1ZA 1R77A 3CBPA 4PFPA 5CKDA 3SWNA 4BY6B 5GJWB 1VYUA 2VXEA 2HSEB 5CO7A 3CCLQ 1UJYA 3QYHB 1PKTA 1MMGA 2NYSA 4XTZA 4PLLA 2RK2A 1IO6A 2V1QA 3JV3A 4ZGJB 3NGPA 5A0GA 5GAN3 1MNEA 2KGTA 4C8QD 3CBOA 1V76A 1X6GA 4EMKB 5LJ3f 4M7AC 2RF0A 1RL2A 3RR6A 5GAMh 1K0SA 2ZCFB 3VS7A 4EMGA 1C6VX 1W1FA 4FSSA 3EHQA 2L5QA 1VOMA 2MK5A 4C0ZA 3OW2S 1VQNA 2CZ1B 1NG2A 2D8HA 3M56A 3JB9I 4DBQA 4RTZA 3FRNA 4IKFA 1FXXA 4OMNA 1Y07A 4M7AE 3HFOA 4ZN1A 4DA4A 1YFNA 2DVEA 2RQVA 1D0YA 3JCMc 1IREB 2CZ6B 4FIBA 3NFCA 5GMKl 4IUUA 3VS6A 2CT3A 3QO3A 4AMCA 4M4ZA 3RUXA 2C0IA 2LJ0A 4LDYA 1YCSB 2YRDA 2EYQA 1VQOA 1IRXA 4JZ4A 5CQXA 3A8MB 4C92D 1M3BA 4E47A 4R0KA 1BI3A 1WQ7A 7AT1B 1YITT 1M2OA 1WNLA 4BI3A 3GOXA 5IHIA 1EIFA 2NUPA 3JCMb 1BKBA 1YJWT 4QVDA 1YHQT 2GF7A 2FZGB 1WDXA 2JW4A 4D8KA 2CP3A 4HKEA 1XTDA 1SSHA 4J6XA 2ZPIB 2LCSA 1IXDA 1M27C 4RTVA 4OGEA 4ELZC 3DLMA 1M90R 2XD0A 3CMAQ 4M77B 1HYOA 1PCXA 1PD1A 2DF6A 3QIIA 4AFSC 5KYWB 4QVZA 3C0CA 3I9QA 2ZPFB 1Q81C 4GLMA 3G71A 2CDTA 3OMGA 3SEMA 2DTOA 3VS2A 5AT1B 4IURA 2FEIA 1ZUYA 4J7IA 4KGXB 3PIPA 3VU3C 2EQKA 3CEYA 1UDLA 4B9XA 2L89A 2NLUA 3OYJA 1QVGP 2WSCE 3V7RA 4V2SA 2E6ZA 2RHYA 2JS0A 2HZYA 1KJWA 1BK2A 5GAMj 2OJ2A 1U8RA 2YUNA 1VQMT 2DX1A 4J83A 4ZTJA 5I21A 1UGSB 1FMVA 3CC2A 2ROLA 1KG1A 2RHZA 3TVTA 1VQ8Q 3CCUT 3VRZA 3QJ6A 3P8BB 1PG5B 2HL5C 2ZAEA 4AG1C 2QQ9A 1VQ7Q 4JZ3A 1VQ9A 4L5GA 3REAB 2E3HA 1MV0B 4EPCA 3ZFJA 2K2MA 4F16A 1YI2T 1ZLMA 4WTOB 3QZ5B 4J9CA 4JJDA 5LJ5h 3M0RA 4A54A 1OX9A 4MZTA 4Y92A 1QW1A 2E10A 5DLOA 1U06A 2XK0A 2CT4A 1FMWA 2OTJT 1ZA2B 3QZ9B 3OQ5A 3OSVA 1I81A 1VQLA 4WF2A 2KDSA 1G8XA 2H3EB 1K9MR 1WLPB 1HD3A 2K3YA 3H41A 3JCMd 2BZYA 4HXJA 3VS5A 2Y90A 2RN8A 1M8VA 2KT8A 4M77G 1K8AR 3OW2A 2LVMA 5M9OA 4DEXA 3QYGB 4MMKA 1YIJT 4P5NA 3FLGA 1EZZB 1VQLQ 4O6JA 2EJGA 2ENMA 2XG8D 4RCBA 4JJBA 1RAEB 3M0TA 2LJ1A 1KFZA 3JAME 3X24B 3P8HA 4M75B 3UA7A 2A7YA 2KEAA 2JTEA 3L2QA 4IUPA 4LUEA 3G6EQ 1W2BS 4OMPA 3CXCP 1B7TA 4BD3A 3M55A 2HQHA 3I5RA 4Z02A 3JCMW 3QKJA 3H9NA 2LJ3A 1PSEA 2RHXA 1D0ZA 1UECA 1WZOA 4DBHA 2D9TA 4LDWA 2DLPA 3E19A 1KHCA 3H6ZA 3CCSQ 2KXDA 1QVFS 2YRVA 2QA4T 3AHUA 5GAMd 1KQSP 3RMQA 4LD6A 2BIVA 8ATCB 2DXUA 3SWNB 3MEVA 1N5ZA 4GBQA 3M9QA 3OA6A 3FIFA 3MO8A 2DL7A 1MGQA 2DJZA 3L2VA 3BY7A 5GAMg 2B86A 2SEMA 1LJOA 2LT4A 5LJ5j 2HEQA 3HHTB 5EG2A 2CP5A 4A4HA 3EH1A 1JB0E 2DEQA 3DB4A 5IAYA 3CMET 2YUOA 3RKYA 1MNDA 3I55T 3VRYA 4R56A 2EW3A 1T3SA 4XU2A 4BI4A 4M7DA 2ATCB 3CCET 3CCQQ 3A98A 2E65A 5ECAA 1PRMC 2X3WD 3QDFA 4LN2A 4CC3A 1VQPQ 3DLLA 3UF4A 3CCMT 2XDDA 2YLCA 1Q7YR 1TH7A 3NPFA 1UE9A 3EGDA 1JXOA 1VQ6T 1VQKT 4ZGDB 2KMTA 2L3RA 3OYHA 1M90U 3FB9A 5HCKA 4CC4B 3MCAB 1MV3A 5C6SA 2OAUA 1U5SA 4E7KA 5GANg 1KQ1A 2XIDA 1K8AC 3LLRA 2EGEA 4M75G 4XK8E 2A28A 3TQ7P 4JJCA 3L2ZA 2DPPB 2K5FA 4IUTA 2L3PA 1SSFA 1LVKA 3G4SA 3JB9G 3E9GA 2DZ9A 3M5AA 2DM1A 2B8AA 1SRMA 2LX9A 1Z9ZA 2NUPB 2BUDA 1CSKA 2RI2A 5GAMe 1YJNA 2YXYA 1VQ4T 3HRSA 3CCJQ 1VUBA 6AT1B 4X9CA 3CC7Q 4JUVA 3V8KA 3PMIA 2EIFA 2JTFA 4PJOF 1IHWA 3G4SQ 1NLPC 1T0HA 1NEBA 3TEEA 3MKDA 3OYIA 2V26A 2E5QA 3MEUA 5J26A 5KCHA 2O31A 4HCKA 3M4YA 1K4US 1GCQA 4QKUA 1G3SA 2COZA 1OULA 2RHIA 2GQVA 1AD5A 1UTIA 1YJNQ 2A3LA 4FM4B 3I56T 2KYMA 4A4GA 4PJOD 1NPRA 1NM7A 1XOVA 1OOTA 1NLOC 4FT4A 1CKAA 4M78D 1LNXA 2FVUA 3KFVA 1BU1A 1WGSA 1WIEA 2MWPA 4AG2C 1N8RC 1X27A 4XU0A 2HQXA 3M53A 3VUBA 1M9SA 1MMNA 4FL6A 1OYXA 4OGCA 3V8JA 2HNIA 3VS0A 1PC0A 4C5GA 1D1CA 2AKKA 4RG2A 1F1BB 1OU9A 5GANe 2RK1A 2DILA 2OTLA 1IB8A 1W2BA 2O88A 1KSWA 2YWWA 3CC4T 2E3IA 2VGMA 2VWFA 3BFMA 1D09B 1K9MU 1HSQA 1K9AA 2H8HA 4N4IA 2CSQA 2DL3A 1D0XA 5GAN8 3PT9A 5LJ5g 3CCLT 2DMOA 2HBPA 4BUGA 1QVFA 3TSWA 1K8AU 1SHFA 2DD4A 1ABQA 2BE7D 2RA2A 1HK9A 4F7UA 1JJ2S 2DBMA 3LH5A 3PFSA 4KH0B 2X4JA 2DL4A 3OBYA 3RIRA 2X4WA 1UGVA 2LQ8A 2E41A 4JPBW 1T3LA 4M7AD 5LJ3h 2IPOB 2P4RA 4C8QA 1M3CA 4GLKA 2EQUA 1UUEA 2BE9B 2KXCA 1UHCA 5KYYA 2P0PA 2EWNA 3ZBDA 3C95A 1ZBXA 4OB1B 2DIQA 1GXIE 1JBMA 4M77C 4XTVA 4JLGA 4HA8A 1YP5A 2KQWA 4XTXA 3NHNA 2O9VA 3CD6T 4C5HA 1Q81R 1GBQA 3OY9A 3UATA 2L8DA 1Q86R 2JVVA 5I2MA 1I07A 4OVAA 1TUDA 2QEXQ 2HQEA 2RM4A 1NYFA 3O8VA 4M77E 4HT9A 1OPKA 3NTKA 3R6NA 1UHFA 5LJ5e 3EG2A 5GAOr 5L8RE 3M0SA 2GNCA 3RDVA 4C92A 2ESWA 2X4XA 3MJXA 4ORZA 3RKXA 4EDUA 1NBEB 2FB7A 3I35A 3ME9A 2DL8A 1GBRA 3H0FA 5LL6S 3JB9F 3T9NA 2J6FA 2HKNA 2ABLA 4KRTA 2KE9A 1GFCA 2C0OA 1RAGB 3A8HB 1Q7YU 4KGVB 4OMFB 3EGXA 2CP2A 3X26B 4PJJA 5FU6B 4RKUE 3JCMf 2MWOA 2VC8A 2JNGA 5FLXE 2HDAA 5AYFA 1RABB 1ZHIA 2QASA 3OYBA 2WACA 1VQNQ 2HSPA 2A0FB 3L2UA 2R5AA 2DL5A 4PJMA 3CCVA 5LJ3j 3WVEB 5I2SA 1G5VA 4RTXA 2JS2A 4M7DB 1VQ8T 3C12A 3M57A 1SPKA 1WYXA 2EQIA 3VV0A 4ZN3A 1ZQ1A 5KE3A 1ARKA 3LWHA 4J9IA 4Z8AA 4E7JA 1WA7A 5GANh 1VQ7T 4LDXA 1I5LA 3OYAA 2CP6A 3JCMQ 3EGDB 1RLPC 1QVGS 3EG3A 5CR2A 4QW2A 1VQOQ 3VS3A 1PSFA 1LOJA 4Z88A 2LC4A 3OYNA 3R6OA 4FSXA 3QSUA 4NS5A 1K73C 2AT1B 1GRIA 4UC4A 2G6FX 4M75C 3GBQA 3HRUA 4F7UE 3RESA 3QWYA 5GAMf 1OQKA 2LT1A 1M1KR 1X2KA 2LX7A 4RTUA 1Q86C 1WI7A 9ATCB 3GP8A 1JJ2A 3MEAA 4ZNXA 1UGPB 2M9UA 3CPWP 2KRNA 4R55A 1BIAA 2RQWA 3DKMA 1SG5A 2K5IA 2P0KA 2EFIA 4M75E 4NL2A 3CQTA 2QDLA 3S3NA 4RTYA 5CQYA 3G71Q 1VYTA 5IH2A 2BTTA 3SWNC 3LH0A 3RMSA 1BYMA 1YITA 3E9FA 1X01A 2JMCA 1T0JA 1RUWA 3LYIA 2YUQA 5J39A 2YRCA 4LDVA 4C92C 3KUFA 4HVWA 2MOXA 5GMKm 3OSSC 3G6ET 5I11A 1YJWA 4HCZA 1YHQA 3V7CA 1UFFA 4JDSA 5GAN6 4E7IA 5CAIA 2P84A 1AOJA 3CC2Q 2QDYB 3TSZA 1ACMB 2RD1A 4KBMB 3OYCA 5FWBA 5EC7A 4B6MA 1J3TA 3H0HA 4PLIA 3TCJA 3SHWA 2CZ7B 3CCST 4M7DG 1WHGA 4C92E 2NUZA 1MHNA 2CGHA 3VYGA 2E1HA 2AKLA 1VQ9Q 3OYLA 1XQHA 1IHVA 4OMMA 5GANj 4HCCA 4E7ZA 2I2LA 1AVZC 4C0DB 2DA9A 2JJ9A 2KBTA 1ZSZA 1AEYA 3LGLA 2MYSA 8AT1B 3CXCS 1K73U 1BB9A 2E5KA 2OI3A 1Y71A 4PFOA 1X6BA 5CKEA 5IXFA 3UPUA 2E12A 4F7UB 5HK0A 1VQMA 3MP8A 5LJ3g 1Q81U 3QG1A 2GFAA 1Q86U 2F2XA 1OV3A 5FU7B 1KQSS 1QCOA 2VASA 3H8ZA 4KULA 1O9SA 2IIMA 3CCUA 3CCQT 3M59A 2J6KA 4C8QB 1M5Q1 2VKNA 2XI9A 2MI6A 1Y7XA 4N0AA 3VYHB 2RQTA 2JM9A 5KYYB 4B9WA 1R0CB 5KYXA 1KD1C 3MEWA 1VQPT 1M2VA 3OYMA 1VQMQ 4RTWA 5HY6A 2CSIA 1M1KC 2J05A 1YI2A 3M0PA 2EVRA 1SEMA 2COWA 3CPFA 2MIOA 2X3XD 2GTJA 4BB7A 2HKQB 2LZ6B 2PQWA 4A53A 2FRYA 2GFUA 4XAXB 4IIMA 3GIBA 1WQWA 3JB9H 4RUGA 4TVRA 5IXBA 2XMFA 1QKWA 2E4HA 2EQMA 2OTJA 2Z0WA 2EBPA 1QVGA 2F5KA 2RQRA 1GCPA 2ZPEB 3FC3A 3L2WA 1W4SA 3SB2A 2V8IA 1VIEA 1N8RR 1OX8A 4OF1A 2RB6A 2VB6A 2K3BA 4C92B 4BDYA 2QK0A 2KSSA 5A2QE 1PKSA 3A5ZB 2F2WA 4DBFA 2PU9B 2RQUA 4OB3B 2HCKA 3ULRB 3CCJT 3RBBB 3CC7T 3VKIA 2VGNA 2OTJQ 5LJ3e 5CKHA 1YIJA 2HD0A 2LQWA 2XHCA 1TXQA 3V7SA 1G3YA 1AT1B 3CCRT 3QUIA 3VUZA 2YUPA 2FYKA 4Y28E 1BIBA 4EMHA 4MDWA 3GLXA 1VYVA 2PVDB 2KT1A 1KC8C 1PD0A 1D1AA 5GANd 2QGGA 3EGXB 4F7UG 4J6YA 3UWNA 1I1JA 1M3AA 4D6WA 4WCIA 1UB4A 1VQ5T 4N4GA 2RNAA 3FJPA 1ABOA 4PKCC 4NL3A 1TWBA 5D6YA 4PJOA 2QA4A 4J6WA 5GAN5 4M78A 4C8QG 4QT7A 4VUBA 2AK5A 2E70A 1M1KU 1HJDA 5DY9A 2NWMA 3RKWA 3M0QA 5FRNA 2K7AA
chains in the Genus database with same CATH topology
2D8JA 2FO0A 1WDXA 2JW4A 4CC7A 4D8KA 1WXBA 1SSHA 2LCSA 3EG0A 1M27C 4RTVA 1M8MA 2KRSA 2LP5A 1YP5A 3RNJA 3NHNA 2O9VA 1GBQA 4ESRA 2EPDA 3UATA 2DF6A 1PHTA 2L3SA 2PTKA 4AFSC 1I07A 3C0CA 3I9QA 3PVQA 1TUDA 4GLMA 2JT4A 2CDTA 2HBWA 2F2VA 3SEMA 3VS2A 1JEGA 1NYFA 2FEIA 1ZUYA 1OPKA 1EFNA 1SHGA 1UG1A 1UDLA 2FPEA 1AZEA 3R6NA 1UHFA 3EG2A 1X43A 3M0SA 2GNCA 4CC2A 2ESWA 2JS0A 1KJWA 1BK2A 4ORZA 2OJ2A 2YUNA 2DNUA 2DX1A 1X69A 2I0NA 1YN8A 1YWOA 1H8KA 3I35A 2DL8A 3PVLA 2JM8A 2ROLA 2EYYA 1GBRA 3ZL7C 3H0FA 2MCNA 3TVTA 2O9SA 2GBQA 4HVUA 2J6FA 2OAWA 2ABLA 4KRTA 2ED0A 3VRZA 2KE9A 1GFCA 1AZGB 2JXBA 1KIKA 3O5ZA 1W70A 4AG1C 2KYBA 1GFDA 2C0OA 4JZ3A 4LE9A 3REAB 4A63B 2EGCA 1MV0B 2K2MA 2LMJA 4F16A 1ZLMA 2CH4W 4D8DA 5FW9A 2DVJA 4J9CA 4J9EA 4JJDA 3U23A 3UA6A 2HDAA 3M0RA 5IHKA 4Y92A 2FPFA 2K6DA 1W6XA 2W10A 4AFUC 1U06A 2AZSA 4J9FA 2HSPA 2DL5A 2JMAA 1OEBA 1SRLA 2VVKA 4F14A 4OMLA 1FMKA 1Z9QA 2CT4A 4RTXA 2JS2A 1SPKA 2L0AA 1WYXA 1WLPB 2A08A 2EQIA 1OPLA 1HD3A 1ARKA 4J9IA 2J06A 4Z8AA 1JQQA 1WA7A 1WX6A 3H41A 4DEYA 5L23A 5GJVB 1A0NB 2BZYA 1QKXA 4HXJA 3VS5A 2RN8A 1RLPC 2KT8A 3EG3A 2AZVA 3VS3A 2A36A 1QLYA 1PRLC 4Z88A 1TG0A 1YWPA 4DEXA 2ED1A 2GQIA 1JU5C 4J9DA 4X1VA 1LCKA 2ENMA 4JJBA 2DRMA 2BZXA 1GRIA 3M0TA 2G6FX 2LJ1A 4OMQA 1KFZA 1E7OA 1VA7A 1Y0MA 2FRWA 3GBQA 3UA7A 1H3HA 3QWYA 4J9HA 2KEAA 2JTEA 1X2KA 2LX7A 4EIKA 2K9GA 4OMOA 4RTUA 1QWEA 1WI7A 4LUEA 2PNIA 4OMPA 1G2BA 2YSQA 4ZNXA 4J9GA 3EG1A 3I5RA 1WXTA 2LJ3A 2KRNA 5FWCA 2CREA 5IHNA 1V1CA 1UECA 2RQWA 1AWJA 2J6OA 2DLPA 1NYGA 3CQTA 3EGUA 2KXDA 2QDLA 1S1NA 4RTYA 1VYTA 5IH2A 2BTTA 1GCQC 2RPNA 1WXUA 3M0UA 2JMCA 4LUDA 1N5ZA 1T0JA 1RUWA 4GBQA 1RI9A 1QWFA 2YUQA 2V1RA 4J9BA 5I22A 4HVWA 2DL7A 2MOXA 3H0IA 4RTTA 5I11A 3THKA 2B86A 2L3QA 1PWTA 2SEMA 1UFFA 3I5SA 2HEQA 1B07A 1AOJA 4Z89A 2YUOA 3TSZA 1G83A 5FWBA 1H92A 5EC7A 1J3TA 3H0HA 3VRYA 2EW3A 1T3SA 3SHWA 1QCFA 1AWOA 2BZ8A 1ZBJA 2NUZA 2EGAA 2RMOA 2AKLA 3QWXX 2A37A 3A98A 1E6HA 5ECAA 1PRMC 2X3WD 4OMMA 1GL5A 1UJ0A 1AVZC 2DA9A 4LN2A 3VS4A 4CC3A 2KBTA 1AWWA 3UF4A 2PZ1A 1FYNA 1M30A 1AEYA 2M0YA 3NPFA 1UE9A 3VS1A 1JXOA 1BB9A 2E5KA 2OI3A 4F17A 1NEGA 1BBZA 4HVVA 1X6BA 5IXFA 5HCKA 2LNHB 1Y57A 2DE0X 4CC4B 4AFQC 1MV3A 2SRCA 1RLQC 1ZUKA 1U5SA 2EYZA 2O2OA 2F2XA 2EGEA 2A28A 4JJCA 3NMZC 1OV3A 2CUDA 2KNBB 2YDLA 1U3OA 2YT6A 2L2PA 2L3PA 2DJQA 2DYBA 2IIMA 2K79A 2M51A 2J6KA 2VKNA 2DM1A 2D1XA 1SRMA 2RQTA 2JM9A 1Z9ZA 3PE0A 2J7IA 1K0XA 2DRKA 4LNPA 1CSKA 2GGRA 1YNZA 4RTWA 2CSIA 2J05A 3M0PA 2EVRA 1SEMA 2MIOA 2X3XD 2DBKA 2GTJA 3FJ5A 1CKBA 1K76A 2CH4A 4K11A 1B3QA 2LZ6B 3IQLA 2FRYA 1AWXA 4E6RA 4IIMA 1NLPC 1T0HA 1NEBA 2GTOA 4RUGA 5IXBA 2XMFA 1K1ZA 2KRMA 3REBB 2EYWA 2O31A 4HCKA 2LQNA 1K4US 1GCQA 1QKWA 1WFWA 5GJWB 1AD5A 1UTIA 1VYUA 2EBPA 2RQRA 1GCPA 1UJYA 1JO8A 1PKTA 2KYMA 4AFZC 1NM7A 1IO6A 2V1QA 1XOVA 1OOTA 1NLOC 1PNJA 3JV3A 1CKAA 2KROA 3NGPA 3KFVA 1E6GA 1BU1A 2KGTA 1WIEA 4IIOA 4AG2C 2K3BA 1X6GA 1X27A 1PKSA 2F2WA 1MUZA 2ECZA 2RQUA 2HCKA 3ULRB 2RF0A 3VS0A 3RBBB 1ZUUA 2AKKA 1K0SA 3VS7A 2LQWA 1W1FA 2DILA 4FSSA 3EHQA 2O88A 1KSWA 1ZSGA 2D0NA 3EHRA 2VWFA 1NG2A 2D8HA 2FPDA 4RTZA 1HSQA 2FG0A 1K9AA 2H8HA 2CUBA 2YUPA 2CSQA 1TUCA 2DL3A 4OMNA 2EYXA 2C0TA 1VYVA 2DMOA 2KT1A 2KR3A 2RQVA 2ROTA 2EKHA 3TSWA 2W0ZA 1SHFA 3VS6A 1ABQA 2CT3A 1I1JA 1M3AA 4WCIA 2DBMA 4M4ZA 2C0IA 2LJ0A 1YCSB 3LH5A 2RNAA 1X2QA 1ZX6A 1JXMA 2DL4A 4JZ4A 1ABOA 1I0CA 1UGVA 1M3BA 4R0KA 4QT7A 2AK5A 4JPBW 1T3LA 2P4RA 1HJDA 1M3CA 5IHIA 1UUEA 2KXCA 2NWMA 1UHCA 3M0QA 2K7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8J A;  2FO0 A;  1WDX A;  2JW4 A;  4CC7 A;  4D8K A;  1WXB A;  1SSH A;  2LCS A;  3EG0 A;  1M27 C;  4RTV A;  1M8M A;  2KRS A;  2LP5 A;  1YP5 A;  3RNJ A;  3NHN A;  2O9V A;  1GBQ A;  4ESR A;  2EPD A;  3UAT A;  2DF6 A;  1PHT A;  2L3S A;  2PTK A;  4AFS C;  1I07 A;  3C0C A;  3I9Q A;  3PVQ A;  1TUD A;  4GLM A;  2JT4 A;  2CDT A;  2HBW A;  2F2V A;  3SEM A;  3VS2 A;  1JEG A;  1NYF A;  2FEI A;  1ZUY A;  1OPK A;  1EFN A;  1SHG A;  1UG1 A;  1UDL A;  2FPE A;  1AZE A;  3R6N A;  1UHF A;  3EG2 A;  1X43 A;  3M0S A;  2GNC A;  4CC2 A;  2ESW A;  2JS0 A;  1KJW A;  1BK2 A;  4ORZ A;  2OJ2 A;  2YUN A;  2DNU A;  2DX1 A;  1X69 A;  2I0N A;  1YN8 A;  1YWO A;  1H8K A;  3I35 A;  2DL8 A;  3PVL A;  2JM8 A;  2ROL A;  2EYY A;  1GBR A;  3ZL7 C;  3H0F A;  2MCN A;  3TVT A;  2O9S A;  2GBQ A;  4HVU A;  2J6F A;  2OAW A;  2ABL A;  4KRT A;  2ED0 A;  3VRZ A;  2KE9 A;  1GFC A;  1AZG B;  2JXB A;  1KIK A;  3O5Z A;  1W70 A;  4AG1 C;  2KYB A;  1GFD A;  2C0O A;  4JZ3 A;  4LE9 A;  3REA B;  4A63 B;  2EGC A;  1MV0 B;  2K2M A;  2LMJ A;  4F16 A;  1ZLM A;  2CH4 W;  4D8D A;  5FW9 A;  2DVJ A;  4J9C A;  4J9E A;  4JJD A;  3U23 A;  3UA6 A;  2HDA A;  3M0R A;  5IHK A;  4Y92 A;  2FPF A;  2K6D A;  1W6X A;  2W10 A;  4AFU C;  1U06 A;  2AZS A;  4J9F A;  2HSP A;  2DL5 A;  2JMA A;  1OEB A;  1SRL A;  2VVK A;  4F14 A;  4OML A;  1FMK A;  1Z9Q A;  2CT4 A;  4RTX A;  2JS2 A;  1SPK A;  2L0A A;  1WYX A;  1WLP B;  2A08 A;  2EQI A;  1OPL A;  1HD3 A;  1ARK A;  4J9I A;  2J06 A;  4Z8A A;  1JQQ A;  1WA7 A;  1WX6 A;  3H41 A;  4DEY A;  5L23 A;  5GJV B;  1A0N B;  2BZY A;  1QKX A;  4HXJ A;  3VS5 A;  2RN8 A;  1RLP C;  2KT8 A;  3EG3 A;  2AZV A;  3VS3 A;  2A36 A;  1QLY A;  1PRL C;  4Z88 A;  1TG0 A;  1YWP A;  4DEX A;  2ED1 A;  2GQI A;  1JU5 C;  4J9D A;  4X1V A;  1LCK A;  2ENM A;  4JJB A;  2DRM A;  2BZX A;  1GRI A;  3M0T A;  2G6F X;  2LJ1 A;  4OMQ A;  1KFZ A;  1E7O A;  1VA7 A;  1Y0M A;  2FRW A;  3GBQ A;  3UA7 A;  1H3H A;  3QWY A;  4J9H A;  2KEA A;  2JTE A;  1X2K A;  2LX7 A;  4EIK A;  2K9G A;  4OMO A;  4RTU A;  1QWE A;  1WI7 A;  4LUE A;  2PNI A;  4OMP A;  1G2B A;  2YSQ A;  4ZNX A;  4J9G A;  3EG1 A;  3I5R A;  1WXT A;  2LJ3 A;  2KRN A;  5FWC A;  2CRE A;  5IHN A;  1V1C A;  1UEC A;  2RQW A;  1AWJ A;  2J6O A;  2DLP A;  1NYG A;  3CQT A;  3EGU A;  2KXD A;  2QDL A;  1S1N A;  4RTY A;  1VYT A;  5IH2 A;  2BTT A;  1GCQ C;  2RPN A;  1WXU A;  3M0U A;  2JMC A;  4LUD A;  1N5Z A;  1T0J A;  1RUW A;  4GBQ A;  1RI9 A;  1QWF A;  2YUQ A;  2V1R A;  4J9B A;  5I22 A;  4HVW A;  2DL7 A;  2MOX A;  3H0I A;  4RTT A;  5I11 A;  3THK A;  2B86 A;  2L3Q A;  1PWT A;  2SEM A;  1UFF A;  3I5S A;  2HEQ A;  1B07 A;  1AOJ A;  4Z89 A;  2YUO A;  3TSZ A;  1G83 A;  5FWB A;  1H92 A;  5EC7 A;  1J3T A;  3H0H A;  3VRY A;  2EW3 A;  1T3S A;  3SHW A;  1QCF A;  1AWO A;  2BZ8 A;  1ZBJ A;  2NUZ A;  2EGA A;  2RMO A;  2AKL A;  3QWX X;  2A37 A;  3A98 A;  1E6H A;  5ECA A;  1PRM C;  2X3W D;  4OMM A;  1GL5 A;  1UJ0 A;  1AVZ C;  2DA9 A;  4LN2 A;  3VS4 A;  4CC3 A;  2KBT A;  1AWW A;  3UF4 A;  2PZ1 A;  1FYN A;  1M30 A;  1AEY A;  2M0Y A;  3NPF A;  1UE9 A;  3VS1 A;  1JXO A;  1BB9 A;  2E5K A;  2OI3 A;  4F17 A;  1NEG A;  1BBZ A;  4HVV A;  1X6B A;  5IXF A;  5HCK A;  2LNH B;  1Y57 A;  2DE0 X;  4CC4 B;  4AFQ C;  1MV3 A;  2SRC A;  1RLQ C;  1ZUK A;  1U5S A;  2EYZ A;  2O2O A;  2F2X A;  2EGE A;  2A28 A;  4JJC A;  3NMZ C;  1OV3 A;  2CUD A;  2KNB B;  2YDL A;  1U3O A;  2YT6 A;  2L2P A;  2L3P A;  2DJQ A;  2DYB A;  2IIM A;  2K79 A;  2M51 A;  2J6K A;  2VKN A;  2DM1 A;  2D1X A;  1SRM A;  2RQT A;  2JM9 A;  1Z9Z A;  3PE0 A;  2J7I A;  1K0X A;  2DRK A;  4LNP A;  1CSK A;  2GGR A;  1YNZ A;  4RTW A;  2CSI A;  2J05 A;  3M0P A;  2EVR A;  1SEM A;  2MIO A;  2X3X D;  2DBK A;  2GTJ A;  3FJ5 A;  1CKB A;  1K76 A;  2CH4 A;  4K11 A;  1B3Q A;  2LZ6 B;  3IQL A;  2FRY A;  1AWX A;  4E6R A;  4IIM A;  1NLP C;  1T0H A;  1NEB A;  2GTO A;  4RUG A;  5IXB A;  2XMF A;  1K1Z A;  2KRM A;  3REB B;  2EYW A;  2O31 A;  4HCK A;  2LQN A;  1K4U S;  1GCQ A;  1QKW A;  1WFW A;  5GJW B;  1AD5 A;  1UTI A;  1VYU A;  2EBP A;  2RQR A;  1GCP A;  1UJY A;  1JO8 A;  1PKT A;  2KYM A;  4AFZ C;  1NM7 A;  1IO6 A;  2V1Q A;  1XOV A;  1OOT A;  1NLO C;  1PNJ A;  3JV3 A;  1CKA A;  2KRO A;  3NGP A;  3KFV A;  1E6G A;  1BU1 A;  2KGT A;  1WIE A;  4IIO A;  4AG2 C;  2K3B A;  1X6G A;  1X27 A;  1PKS A;  2F2W A;  1MUZ A;  2ECZ A;  2RQU A;  2HCK A;  3ULR B;  2RF0 A;  3VS0 A;  3RBB B;  1ZUU A;  2AKK A;  1K0S A;  3VS7 A;  2LQW A;  1W1F A;  2DIL A;  4FSS A;  3EHQ A;  2O88 A;  1KSW A;  1ZSG A;  2D0N A;  3EHR A;  2VWF A;  1NG2 A;  2D8H A;  2FPD A;  4RTZ A;  1HSQ A;  2FG0 A;  1K9A A;  2H8H A;  2CUB A;  2YUP A;  2CSQ A;  1TUC A;  2DL3 A;  4OMN A;  2EYX A;  2C0T A;  1VYV A;  2DMO A;  2KT1 A;  2KR3 A;  2RQV A;  2ROT A;  2EKH A;  3TSW A;  2W0Z A;  1SHF A;  3VS6 A;  1ABQ A;  2CT3 A;  1I1J A;  1M3A A;  4WCI A;  2DBM A;  4M4Z A;  2C0I A;  2LJ0 A;  1YCS B;  3LH5 A;  2RNA A;  1X2Q A;  1ZX6 A;  1JXM A;  2DL4 A;  4JZ4 A;  1ABO A;  1I0C A;  1UGV A;  1M3B A;  4R0K A;  4QT7 A;  2AK5 A;  4JPB W;  1T3L A;  2P4R A;  1HJD A;  1M3C A;  5IHI A;  1UUE A;  2KXC A;  2NWM A;  1UHC A;  3M0Q A;  2K7A A; 
#chains in the Genus database with same CATH topology
 2QQB A;  3JB9 J;  5D6W A;  3E1S A;  4CC7 A;  3M58 A;  3HP9 A;  1IZ6 A;  2KRS A;  4M7D F;  3CME A;  1QVP A;  2ZPB B;  1WPY A;  3EG9 A;  3S6W A;  1G3W A;  3I55 A;  2JOY A;  4ESR A;  2EPD A;  2QQS A;  1PHT A;  4ANJ A;  4JRP A;  2PUO B;  3CXC A;  2JT4 A;  2F2V A;  3CCE A;  2ZGW A;  1S72 T;  1LPL A;  3UDC A;  1YJ9 T;  1EFN A;  1N9R A;  4FT2 A;  1Q82 R;  4LDU A;  2XKO C;  3PMT A;  4C92 G;  3CME Q;  4DBR A;  3CCM A;  4M77 F;  1VQ6 A;  1VQK A;  3BW1 A;  1KQS A;  2DNU A;  4M7A A;  4A4K A;  1UGR B;  1YN8 A;  1YWO A;  3CCE Q;  1NPP A;  1FX7 A;  4II1 A;  3J81 E;  2JM8 A;  1QCN A;  3S3O A;  2EYY A;  5KE2 A;  4KUD K;  3X25 B;  5LJ5 d;  2PVG B;  2QXF A;  2GBQ A;  2OAW A;  4M77 D;  2VXF A;  4LXC A;  1KIK A;  3O5Z A;  1W70 A;  2QEX T;  1OI1 A;  2KYB A;  2COY A;  1VQK Q;  2G3R A;  1D3B A;  4A63 B;  5FU6 C;  2K4Y A;  2IVW A;  3G7Z A;  3U23 A;  1VQ4 A;  1D1B A;  2CP7 A;  1NJI C;  3OS0 A;  2OTL Q;  2FPF A;  4JRI A;  3JCM J;  1W6X A;  2HAX A;  4BAC A;  2EAY A;  1ZA1 B;  2AZS A;  2LNV A;  4J9F A;  1KQ2 A;  3JCM P;  1OEB A;  2FZK B;  4M7D C;  1SRL A;  4J8O A;  2KVQ G;  1Z9Q A;  4OML A;  4JRK A;  2DET A;  1R8O B;  5CCA A;  1RAA B;  3AT1 B;  2A08 A;  4IUQ A;  1OPL A;  5GAN 7;  2J06 A;  3I56 A;  1WX6 A;  4DEY A;  3JRZ A;  5L23 A;  1ZSZ B;  3MP6 A;  4HCB A;  5CKF A;  3JCM V;  4M7D E;  2FZC B;  2A36 A;  2P4T A;  4ME7 A;  1K73 R;  1TG0 A;  1TUG B;  4C0F A;  2ED1 A;  3PNW C;  1MMD A;  4M78 C;  4CI0 C;  4XQ3 A;  4X1V A;  1LCK A;  4BDZ A;  2DRM A;  1M1G A;  2DER A;  4OMQ A;  4XTY A;  4E7S A;  1VQN T;  3A1P A;  2LDM A;  3PGG A;  1VA7 A;  1WHJ A;  4FYV B;  3CC4 A;  5C0M A;  1H3H A;  4J9H A;  5GMK h;  4MDX A;  4EIK A;  2K9G A;  2XDB A;  2E64 A;  2LCL A;  2PNI A;  1N8R U;  2YLB A;  3INZ A;  1G2B A;  4F7U F;  1AHJ B;  2YSQ A;  3CCL A;  5DM7 R;  5KYX B;  1M2V B;  4M78 E;  4PNO A;  2KAF A;  1WXT A;  2EJ9 A;  5CIU A;  5IHN A;  2RI5 A;  1V1C A;  1AWJ A;  2FHD A;  2J6O A;  1Q82 C;  3ZEH A;  1VQO T;  2Y4X A;  1NYG A;  2DEU A;  3EGU A;  3CC4 Q;  5CK9 A;  3EFO A;  2QG9 B;  3OYE A;  2NUT A;  4C8Q F;  2LQK A;  4ZGE B;  4YTL A;  4M75 F;  3CMA T;  1GCQ C;  3GNG A;  1Q95 G;  2RPN A;  3WVD B;  3M0U A;  2EQJ A;  2Y4Y A;  1Y96 A;  5GAO p;  1RI9 A;  1QWF A;  1NJI U;  5I22 A;  1WJS A;  3H0I A;  2OX7 A;  2RH2 A;  5D6X A;  2RHU A;  2HMA A;  4M75 D;  3THK A;  5GAN 2;  2L3Q A;  3LWI A;  3I5S A;  4FW1 A;  3JB9 D;  4BE1 A;  2QYZ A;  3OYY A;  3CD6 A;  5GAO l;  1B34 A;  5FRM A;  1X75 C;  3G71 T;  4AT1 B;  4PJN A;  2EGA A;  4FYX B;  2M0O A;  1QMC A;  1TTH B;  4C0D C;  1E6H A;  5GAO n;  2CZ0 B;  3L42 A;  4XTU A;  1C1A A;  1UJ0 A;  4C92 F;  1O75 A;  3VS4 A;  2PVO B;  1OZ3 A;  2ZZD A;  1QP2 A;  2PZ1 A;  3HTR A;  3VS1 A;  1H64 1;  2X9H A;  4HT8 A;  1RAH B;  4C5E A;  4F17 A;  1NEG A;  1BBZ A;  4HVV A;  4QQG A;  2DIG A;  3CD6 Q;  2DO3 A;  2K5L A;  4JLI A;  2DXB A;  3QJY A;  3CPW S;  1RI0 A;  2FL7 A;  1Y57 A;  2DE0 X;  4AFQ C;  3CC2 T;  2SRC A;  1IGU A;  1RLQ C;  1ZUK A;  3CCV Q;  5FU7 C;  2O2O A;  3CMA A;  3OW2 P;  4OB2 B;  2CUD A;  3M4G A;  2YDL A;  4PJO B;  1U3O A;  4Y91 A;  2MAM A;  2YT6 A;  5GMK j;  2L2P A;  4M78 B;  4C8Q C;  2DJQ A;  2DYB A;  2CP0 A;  1BI0 A;  1KD1 R;  1WJQ A;  1VQ9 T;  4DOV A;  2LRQ A;  1Q82 U;  3PE0 A;  4JS5 A;  3C94 A;  2DRK A;  2X51 A;  4F04 B;  1PM3 A;  2DBK A;  1XNI A;  1K76 A;  2CH4 A;  4JS4 A;  1YCY A;  1SF9 A;  2YHT A;  3IQL A;  4C8Q E;  4FYY B;  1AWX A;  4E6R A;  3NTH A;  5GAO q;  3EG9 B;  1H3Z A;  3TU4 K;  4MZP A;  2KRM A;  3REB B;  2EYW A;  1RAC B;  3GF5 A;  2LQN A;  1VQL T;  1WFW A;  4IUV A;  1N6A A;  3CBM A;  3OYG A;  1VQ8 A;  2QAZ A;  2X35 A;  5KYU A;  1JO8 A;  4XU1 A;  4J7F A;  1OU8 A;  3SD4 A;  4AFZ C;  4C0G A;  1PNJ A;  2KRO A;  1VQ7 A;  3L1A A;  1E6G A;  4IIO A;  3S3M A;  5GAO m;  1WHK A;  3ASK A;  2HL3 A;  1MUZ A;  2ECZ A;  5GAN f;  4M7A B;  5J3B A;  1ZUU A;  4QQD A;  1U1S A;  1YIT Q;  2R58 A;  1ZSG A;  2D0N A;  1UEB A;  3EHR A;  1V29 B;  3BDU A;  1U1T A;  2PUK B;  2FPD A;  4OB0 B;  2CKK A;  2FG0 A;  2CUB A;  2LCC A;  1TUC A;  2QTV A;  2DFU A;  1YJW Q;  1KC8 R;  3MPU B;  2F5T X;  1YHQ Q;  1I5O B;  2EYX A;  3LW5 E;  3VJP A;  3OYD A;  2C0T A;  3FEO A;  1YBY A;  5LJ3 d;  5HKC A;  2KR3 A;  1D3B B;  3GPL A;  2ROT A;  2EKH A;  3NTI A;  2W0Z A;  3EFS A;  3D7S B;  4JJN K;  4E2F B;  2JTM A;  2RJE A;  3MP1 A;  2DYI A;  1M1F A;  1NZ9 A;  2M16 A;  1X2Q A;  1HXD A;  1JXM A;  1ZX6 A;  4PJO G;  2ZPH B;  2C06 A;  2M02 A;  2F69 A;  1I0C A;  3OB9 A;  5CKB A;  4M78 G;  3G1J A;  3UT1 A;  2K2V A;  1RAF B;  3OYF A;  2XDP A;  4NOY A;  5D7U A;  2D8J A;  2FO0 A;  3G6E A;  4RCC A;  1WXB A;  2O4X A;  4X9D A;  1N27 A;  3EG0 A;  3F70 A;  1M8M A;  1OZ2 A;  3L2R A;  2XU8 A;  2LP5 A;  3OS2 A;  3RNJ A;  3JCM g;  1R0B G;  4A4E A;  1M90 C;  2IG0 A;  3OS5 A;  3QDR B;  2PTK A;  2L3S A;  3CCS A;  3CCU Q;  3PVQ A;  2DD5 A;  4DOW A;  2DK3 A;  2DKG A;  3JSC A;  2HBW A;  4A4F A;  1JEG A;  1I8F A;  5LJ5 f;  1UG1 A;  3A8G B;  1SHG A;  3CPW A;  1RAD B;  2FPE A;  1AZE A;  1P92 A;  1YI2 Q;  4PJL A;  1UGQ B;  2RJD A;  1KHI A;  1X43 A;  4KUI A;  3TRE A;  4EMK A;  1QP3 A;  4LD9 K;  4CC2 A;  1TSF A;  4M7A G;  2KK4 A;  4Q5W A;  3LGF A;  4X34 A;  2QGF B;  2R5M A;  2EJF A;  1X69 A;  2I0N A;  3HRT A;  2DTH A;  4PFZ A;  1H8K A;  3PVL A;  3EFO B;  3Q1J A;  2DTI A;  2NUT B;  3ZL7 C;  5KH6 A;  3OMC A;  2MCN A;  1X6O A;  2O9S A;  4HVU A;  2ED0 A;  2AHJ B;  3G4S T;  1AZG B;  1DJ7 B;  2JXB A;  1VIF A;  3C4S A;  2K3X A;  1Y96 B;  1W2B P;  3LX7 A;  3CCQ A;  1RAI B;  1GFD A;  2M1H A;  4LE9 A;  2KY9 A;  1TOV A;  2EGC A;  1C0M A;  1NE8 A;  4QVC A;  1N9S A;  5A0D A;  2LMJ A;  1YJN T;  1VQP A;  1BI1 A;  1NJI R;  2CH4 W;  4N4H A;  5A0L A;  1KK7 A;  4D8D A;  4CRI A;  3QPH A;  5FW9 A;  2DVJ A;  4J9E A;  3UA6 A;  1YIJ Q;  2ZPG B;  1QVF P;  5IHK A;  2EKO A;  2K6D A;  2W10 A;  4AFU C;  3EH2 A;  3JCM e;  4OP0 A;  2WSF E;  2MPX C;  4E7H A;  2JMA A;  5GMK e;  3ER0 A;  2VVK A;  1B34 B;  4F14 A;  1FMK A;  4O5V A;  3RER A;  4KGZ B;  1KD1 U;  2RJF A;  4GY5 A;  3A8O B;  3URG A;  2L0A A;  4BE0 A;  2K57 A;  1WJR A;  1ZSZ C;  1JQQ A;  4ZTF A;  1WHL A;  3EAE A;  1K9M C;  2QI2 A;  5GJV B;  1A0N B;  1QKX A;  4XU3 A;  1SKU B;  2DXT A;  2AIR B;  2AZV A;  4M77 A;  1QLY A;  1PRL C;  1YWP A;  4MML A;  2GQI A;  3HPW A;  4L59 A;  2QA4 Q;  1JU5 C;  4J9D A;  3CCJ A;  1BI2 A;  3CC7 A;  5CVI A;  3SDZ A;  2OTL T;  3M54 A;  5KYW A;  2BZX A;  3A8L B;  1M4Z A;  4L6V 5;  1E7O A;  1TU0 B;  1Y0M A;  2DAQ A;  3N5B B;  2FRW A;  1TS9 A;  4J5Y A;  4FCY A;  3EFR A;  1JRI A;  2GCX A;  3HFN A;  3CCR A;  3QHS A;  4N0A C;  2DZC A;  1XJW B;  2E6N A;  2VYT A;  4OMO A;  1MMA A;  1QWE A;  2D6F A;  3QXE B;  3KXT A;  2JUF A;  4XTW A;  4M7D D;  2QQR A;  4J9G A;  3EG1 A;  5FWC A;  2CRE A;  2VV5 A;  2MF2 A;  2RI3 A;  3I55 Q;  2VUB A;  4RMO A;  3OS1 A;  4M78 F;  5FRO A;  1QQJ A;  4BY6 C;  4E7L A;  1S1N A;  1VQ5 A;  3CCR Q;  3HKS A;  2QTX A;  4ELY C;  4KT0 E;  1WXU A;  2JN0 A;  4LUD A;  1KC8 U;  3J7A F;  5DLQ E;  3CCM Q;  2V1R A;  4J9B A;  2H3J A;  3X20 B;  4EMK C;  5KYU B;  4FW2 A;  2XIC A;  1VQ6 Q;  2BKD N;  4RTT A;  4C5I A;  3DB3 A;  1VQ5 Q;  1PWT A;  1IGQ A;  3X28 B;  1EX4 A;  3OYK A;  2DXC A;  1B07 A;  2CYZ B;  3OBW A;  4Z89 A;  1I4K 1;  2JZ2 A;  2MMP A;  1G83 A;  2D0Q B;  1H92 A;  1BCO A;  1FWZ A;  3SFM A;  3J80 E;  1QCF A;  2KI7 A;  1AWO A;  4RG8 A;  2BZ8 A;  1ZBJ A;  4QQ6 A;  2RMO A;  3QWX X;  2A37 A;  3MHX A;  2F1L A;  2RJC A;  3JCM X;  1WHH A;  1GL5 A;  1S72 A;  1YJ9 A;  4MZM A;  1AWW A;  5IN1 A;  1FYN A;  1M30 A;  2M0Y A;  4M7A F;  1VQ4 Q;  3HL8 A;  3E2U A;  4PL6 A;  1Q7Y C;  5GMK i;  3PIO A;  2LNH B;  3BDL A;  4FU6 A;  4FYW B;  3FDR A;  2EYZ A;  4BI8 B;  3WXM B;  4PJO C;  3QBY A;  5IT9 E;  1S72 Q;  2CS7 A;  2R57 A;  3GNF B;  4PK4 A;  3KBG A;  3NMZ C;  2LTO A;  3HSB A;  2KNB B;  4BE2 A;  1YJ9 Q;  4M75 A;  3MET A;  2RO0 A;  2K79 A;  2M51 A;  3P8D A;  3I56 Q;  4KH1 B;  2QEX A;  3JCM h;  2P0Q A;  2D1X A;  2J7I A;  2X4Y A;  1K0X A;  4LNP A;  3PTA A;  2GGR A;  1BCM A;  1YNZ A;  5KYN A;  1WHM A;  1G3T A;  4PJO E;  2O4X B;  1JJ2 P;  3V8L A;  3FJ5 A;  4K11 A;  1CKB A;  1B3Q A;  3BE3 A;  5KCO A;  5HK3 A;  4ATO A;  2WSE E;  4JRQ A;  2V8J A;  2V8K A;  2QQA A;  2O01 E;  3CCV T;  2GTO A;  5GAN 4;  4DQ2 A;  1K1Z A;  1R77 A;  3CBP A;  4PFP A;  5CKD A;  3SWN A;  4BY6 B;  5GJW B;  1VYU A;  2VXE A;  2HSE B;  5CO7 A;  3CCL Q;  1UJY A;  3QYH B;  1PKT A;  1MMG A;  2NYS A;  4XTZ A;  4PLL A;  2RK2 A;  1IO6 A;  2V1Q A;  3JV3 A;  4ZGJ B;  3NGP A;  5A0G A;  5GAN 3;  1MNE A;  2KGT A;  4C8Q D;  3CBO A;  1V76 A;  1X6G A;  4EMK B;  5LJ3 f;  4M7A C;  2RF0 A;  1RL2 A;  3RR6 A;  5GAM h;  1K0S A;  2ZCF B;  3VS7 A;  4EMG A;  1C6V X;  1W1F A;  4FSS A;  3EHQ A;  2L5Q A;  1VOM A;  2MK5 A;  4C0Z A;  3OW2 S;  1VQN A;  2CZ1 B;  1NG2 A;  2D8H A;  3M56 A;  3JB9 I;  4DBQ A;  4RTZ A;  3FRN A;  4IKF A;  1FXX A;  4OMN A;  1Y07 A;  4M7A E;  3HFO A;  4ZN1 A;  4DA4 A;  1YFN A;  2DVE A;  2RQV A;  1D0Y A;  3JCM c;  1IRE B;  2CZ6 B;  4FIB A;  3NFC A;  5GMK l;  4IUU A;  3VS6 A;  2CT3 A;  3QO3 A;  4AMC A;  4M4Z A;  3RUX A;  2C0I A;  2LJ0 A;  4LDY A;  1YCS B;  2YRD A;  2EYQ A;  1VQO A;  1IRX A;  4JZ4 A;  5CQX A;  3A8M B;  4C92 D;  1M3B A;  4E47 A;  4R0K A;  1BI3 A;  1WQ7 A;  7AT1 B;  1YIT T;  1M2O A;  1WNL A;  4BI3 A;  3GOX A;  5IHI A;  1EIF A;  2NUP A;  3JCM b;  1BKB A;  1YJW T;  4QVD A;  1YHQ T;  2GF7 A;  2FZG B;  1WDX A;  2JW4 A;  4D8K A;  2CP3 A;  4HKE A;  1XTD A;  1SSH A;  4J6X A;  2ZPI B;  2LCS A;  1IXD A;  1M27 C;  4RTV A;  4OGE A;  4ELZ C;  3DLM A;  1M90 R;  2XD0 A;  3CMA Q;  4M77 B;  1HYO A;  1PCX A;  1PD1 A;  2DF6 A;  3QII A;  4AFS C;  5KYW B;  4QVZ A;  3C0C A;  3I9Q A;  2ZPF B;  1Q81 C;  4GLM A;  3G71 A;  2CDT A;  3OMG A;  3SEM A;  2DTO A;  3VS2 A;  5AT1 B;  4IUR A;  2FEI A;  1ZUY A;  4J7I A;  4KGX B;  3PIP A;  3VU3 C;  2EQK A;  3CEY A;  1UDL A;  4B9X A;  2L89 A;  2NLU A;  3OYJ A;  1QVG P;  2WSC E;  3V7R A;  4V2S A;  2E6Z A;  2RHY A;  2JS0 A;  2HZY A;  1KJW A;  1BK2 A;  5GAM j;  2OJ2 A;  1U8R A;  2YUN A;  1VQM T;  2DX1 A;  4J83 A;  4ZTJ A;  5I21 A;  1UGS B;  1FMV A;  3CC2 A;  2ROL A;  1KG1 A;  2RHZ A;  3TVT A;  1VQ8 Q;  3CCU T;  3VRZ A;  3QJ6 A;  3P8B B;  1PG5 B;  2HL5 C;  2ZAE A;  4AG1 C;  2QQ9 A;  1VQ7 Q;  4JZ3 A;  1VQ9 A;  4L5G A;  3REA B;  2E3H A;  1MV0 B;  4EPC A;  3ZFJ A;  2K2M A;  4F16 A;  1YI2 T;  1ZLM A;  4WTO B;  3QZ5 B;  4J9C A;  4JJD A;  5LJ5 h;  3M0R A;  4A54 A;  1OX9 A;  4MZT A;  4Y92 A;  1QW1 A;  2E10 A;  5DLO A;  1U06 A;  2XK0 A;  2CT4 A;  1FMW A;  2OTJ T;  1ZA2 B;  3QZ9 B;  3OQ5 A;  3OSV A;  1I81 A;  1VQL A;  4WF2 A;  2KDS A;  1G8X A;  2H3E B;  1K9M R;  1WLP B;  1HD3 A;  2K3Y A;  3H41 A;  3JCM d;  2BZY A;  4HXJ A;  3VS5 A;  2Y90 A;  2RN8 A;  1M8V A;  2KT8 A;  4M77 G;  1K8A R;  3OW2 A;  2LVM A;  5M9O A;  4DEX A;  3QYG B;  4MMK A;  1YIJ T;  4P5N A;  3FLG A;  1EZZ B;  1VQL Q;  4O6J A;  2EJG A;  2ENM A;  2XG8 D;  4RCB A;  4JJB A;  1RAE B;  3M0T A;  2LJ1 A;  1KFZ A;  3JAM E;  3X24 B;  3P8H A;  4M75 B;  3UA7 A;  2A7Y A;  2KEA A;  2JTE A;  3L2Q A;  4IUP A;  4LUE A;  3G6E Q;  1W2B S;  4OMP A;  3CXC P;  1B7T A;  4BD3 A;  3M55 A;  2HQH A;  3I5R A;  4Z02 A;  3JCM W;  3QKJ A;  3H9N A;  2LJ3 A;  1PSE A;  2RHX A;  1D0Z A;  1UEC A;  1WZO A;  4DBH A;  2D9T A;  4LDW A;  2DLP A;  3E19 A;  1KHC A;  3H6Z A;  3CCS Q;  2KXD A;  1QVF S;  2YRV A;  2QA4 T;  3AHU A;  5GAM d;  1KQS P;  3RMQ A;  4LD6 A;  2BIV A;  8ATC B;  2DXU A;  3SWN B;  3MEV A;  1N5Z A;  4GBQ A;  3M9Q A;  3OA6 A;  3FIF A;  3MO8 A;  2DL7 A;  1MGQ A;  2DJZ A;  3L2V A;  3BY7 A;  5GAM g;  2B86 A;  2SEM A;  1LJO A;  2LT4 A;  5LJ5 j;  2HEQ A;  3HHT B;  5EG2 A;  2CP5 A;  4A4H A;  3EH1 A;  1JB0 E;  2DEQ A;  3DB4 A;  5IAY A;  3CME T;  2YUO A;  3RKY A;  1MND A;  3I55 T;  3VRY A;  4R56 A;  2EW3 A;  1T3S A;  4XU2 A;  4BI4 A;  4M7D A;  2ATC B;  3CCE T;  3CCQ Q;  3A98 A;  2E65 A;  5ECA A;  1PRM C;  2X3W D;  3QDF A;  4LN2 A;  4CC3 A;  1VQP Q;  3DLL A;  3UF4 A;  3CCM T;  2XDD A;  2YLC A;  1Q7Y R;  1TH7 A;  3NPF A;  1UE9 A;  3EGD A;  1JXO A;  1VQ6 T;  1VQK T;  4ZGD B;  2KMT A;  2L3R A;  3OYH A;  1M90 U;  3FB9 A;  5HCK A;  4CC4 B;  3MCA B;  1MV3 A;  5C6S A;  2OAU A;  1U5S A;  4E7K A;  5GAN g;  1KQ1 A;  2XID A;  1K8A C;  3LLR A;  2EGE A;  4M75 G;  4XK8 E;  2A28 A;  3TQ7 P;  4JJC A;  3L2Z A;  2DPP B;  2K5F A;  4IUT A;  2L3P A;  1SSF A;  1LVK A;  3G4S A;  3JB9 G;  3E9G A;  2DZ9 A;  3M5A A;  2DM1 A;  2B8A A;  1SRM A;  2LX9 A;  1Z9Z A;  2NUP B;  2BUD A;  1CSK A;  2RI2 A;  5GAM e;  1YJN A;  2YXY A;  1VQ4 T;  3HRS A;  3CCJ Q;  1VUB A;  6AT1 B;  4X9C A;  3CC7 Q;  4JUV A;  3V8K A;  3PMI A;  2EIF A;  2JTF A;  4PJO F;  1IHW A;  3G4S Q;  1NLP C;  1T0H A;  1NEB A;  3TEE A;  3MKD A;  3OYI A;  2V26 A;  2E5Q A;  3MEU A;  5J26 A;  5KCH A;  2O31 A;  4HCK A;  3M4Y A;  1K4U S;  1GCQ A;  4QKU A;  1G3S A;  2COZ A;  1OUL A;  2RHI A;  2GQV A;  1AD5 A;  1UTI A;  1YJN Q;  2A3L A;  4FM4 B;  3I56 T;  2KYM A;  4A4G A;  4PJO D;  1NPR A;  1NM7 A;  1XOV A;  1OOT A;  1NLO C;  4FT4 A;  1CKA A;  4M78 D;  1LNX A;  2FVU A;  3KFV A;  1BU1 A;  1WGS A;  1WIE A;  2MWP A;  4AG2 C;  1N8R C;  1X27 A;  4XU0 A;  2HQX A;  3M53 A;  3VUB A;  1M9S A;  1MMN A;  4FL6 A;  1OYX A;  4OGC A;  3V8J A;  2HNI A;  3VS0 A;  1PC0 A;  4C5G A;  1D1C A;  2AKK A;  4RG2 A;  1F1B B;  1OU9 A;  5GAN e;  2RK1 A;  2DIL A;  2OTL A;  1IB8 A;  1W2B A;  2O88 A;  1KSW A;  2YWW A;  3CC4 T;  2E3I A;  2VGM A;  2VWF A;  3BFM A;  1D09 B;  1K9M U;  1HSQ A;  1K9A A;  2H8H A;  4N4I A;  2CSQ A;  2DL3 A;  1D0X A;  5GAN 8;  3PT9 A;  5LJ5 g;  3CCL T;  2DMO A;  2HBP A;  4BUG A;  1QVF A;  3TSW A;  1K8A U;  1SHF A;  2DD4 A;  1ABQ A;  2BE7 D;  2RA2 A;  1HK9 A;  4F7U A;  1JJ2 S;  2DBM A;  3LH5 A;  3PFS A;  4KH0 B;  2X4J A;  2DL4 A;  3OBY A;  3RIR A;  2X4W A;  1UGV A;  2LQ8 A;  2E41 A;  4JPB W;  1T3L A;  4M7A D;  5LJ3 h;  2IPO B;  2P4R A;  4C8Q A;  1M3C A;  4GLK A;  2EQU A;  1UUE A;  2BE9 B;  2KXC A;  1UHC A;  5KYY A;  2P0P A;  2EWN A;  3ZBD A;  3C95 A;  1ZBX A;  4OB1 B;  2DIQ A;  1GXI E;  1JBM A;  4M77 C;  4XTV A;  4JLG A;  4HA8 A;  1YP5 A;  2KQW A;  4XTX A;  3NHN A;  2O9V A;  3CD6 T;  4C5H A;  1Q81 R;  1GBQ A;  3OY9 A;  3UAT A;  2L8D A;  1Q86 R;  2JVV A;  5I2M A;  1I07 A;  4OVA A;  1TUD A;  2QEX Q;  2HQE A;  2RM4 A;  1NYF A;  3O8V A;  4M77 E;  4HT9 A;  1OPK A;  3NTK A;  3R6N A;  1UHF A;  5LJ5 e;  3EG2 A;  5GAO r;  5L8R E;  3M0S A;  2GNC A;  3RDV A;  4C92 A;  2ESW A;  2X4X A;  3MJX A;  4ORZ A;  3RKX A;  4EDU A;  1NBE B;  2FB7 A;  3I35 A;  3ME9 A;  2DL8 A;  1GBR A;  3H0F A;  5LL6 S;  3JB9 F;  3T9N A;  2J6F A;  2HKN A;  2ABL A;  4KRT A;  2KE9 A;  1GFC A;  2C0O A;  1RAG B;  3A8H B;  1Q7Y U;  4KGV B;  4OMF B;  3EGX A;  2CP2 A;  3X26 B;  4PJJ A;  5FU6 B;  4RKU E;  3JCM f;  2MWO A;  2VC8 A;  2JNG A;  5FLX E;  2HDA A;  5AYF A;  1RAB B;  1ZHI A;  2QAS A;  3OYB A;  2WAC A;  1VQN Q;  2HSP A;  2A0F B;  3L2U A;  2R5A A;  2DL5 A;  4PJM A;  3CCV A;  5LJ3 j;  3WVE B;  5I2S A;  1G5V A;  4RTX A;  2JS2 A;  4M7D B;  1VQ8 T;  3C12 A;  3M57 A;  1SPK A;  1WYX A;  2EQI A;  3VV0 A;  4ZN3 A;  1ZQ1 A;  5KE3 A;  1ARK A;  3LWH A;  4J9I A;  4Z8A A;  4E7J A;  1WA7 A;  5GAN h;  1VQ7 T;  4LDX A;  1I5L A;  3OYA A;  2CP6 A;  3JCM Q;  3EGD B;  1RLP C;  1QVG S;  3EG3 A;  5CR2 A;  4QW2 A;  1VQO Q;  3VS3 A;  1PSF A;  1LOJ A;  4Z88 A;  2LC4 A;  3OYN A;  3R6O A;  4FSX A;  3QSU A;  4NS5 A;  1K73 C;  2AT1 B;  1GRI A;  4UC4 A;  2G6F X;  4M75 C;  3GBQ A;  3HRU A;  4F7U E;  3RES A;  3QWY A;  5GAM f;  1OQK A;  2LT1 A;  1M1K R;  1X2K A;  2LX7 A;  4RTU A;  1Q86 C;  1WI7 A;  9ATC B;  3GP8 A;  1JJ2 A;  3MEA A;  4ZNX A;  1UGP B;  2M9U A;  3CPW P;  2KRN A;  4R55 A;  1BIA A;  2RQW A;  3DKM A;  1SG5 A;  2K5I A;  2P0K A;  2EFI A;  4M75 E;  4NL2 A;  3CQT A;  2QDL A;  3S3N A;  4RTY A;  5CQY A;  3G71 Q;  1VYT A;  5IH2 A;  2BTT A;  3SWN C;  3LH0 A;  3RMS A;  1BYM A;  1YIT A;  3E9F A;  1X01 A;  2JMC A;  1T0J A;  1RUW A;  3LYI A;  2YUQ A;  5J39 A;  2YRC A;  4LDV A;  4C92 C;  3KUF A;  4HVW A;  2MOX A;  5GMK m;  3OSS C;  3G6E T;  5I11 A;  1YJW A;  4HCZ A;  1YHQ A;  3V7C A;  1UFF A;  4JDS A;  5GAN 6;  4E7I A;  5CAI A;  2P84 A;  1AOJ A;  3CC2 Q;  2QDY B;  3TSZ A;  1ACM B;  2RD1 A;  4KBM B;  3OYC A;  5FWB A;  5EC7 A;  4B6M A;  1J3T A;  3H0H A;  4PLI A;  3TCJ A;  3SHW A;  2CZ7 B;  3CCS T;  4M7D G;  1WHG A;  4C92 E;  2NUZ A;  1MHN A;  2CGH A;  3VYG A;  2E1H A;  2AKL A;  1VQ9 Q;  3OYL A;  1XQH A;  1IHV A;  4OMM A;  5GAN j;  4HCC A;  4E7Z A;  2I2L A;  1AVZ C;  4C0D B;  2DA9 A;  2JJ9 A;  2KBT A;  1ZSZ A;  1AEY A;  3LGL A;  2MYS A;  8AT1 B;  3CXC S;  1K73 U;  1BB9 A;  2E5K A;  2OI3 A;  1Y71 A;  4PFO A;  1X6B A;  5CKE A;  5IXF A;  3UPU A;  2E12 A;  4F7U B;  5HK0 A;  1VQM A;  3MP8 A;  5LJ3 g;  1Q81 U;  3QG1 A;  2GFA A;  1Q86 U;  2F2X A;  1OV3 A;  5FU7 B;  1KQS S;  1QCO A;  2VAS A;  3H8Z A;  4KUL A;  1O9S A;  2IIM A;  3CCU A;  3CCQ T;  3M59 A;  2J6K A;  4C8Q B;  1M5Q 1;  2VKN A;  2XI9 A;  2MI6 A;  1Y7X A;  4N0A A;  3VYH B;  2RQT A;  2JM9 A;  5KYY B;  4B9W A;  1R0C B;  5KYX A;  1KD1 C;  3MEW A;  1VQP T;  1M2V A;  3OYM A;  1VQM Q;  4RTW A;  5HY6 A;  2CSI A;  1M1K C;  2J05 A;  1YI2 A;  3M0P A;  2EVR A;  1SEM A;  2COW A;  3CPF A;  2MIO A;  2X3X D;  2GTJ A;  4BB7 A;  2HKQ B;  2LZ6 B;  2PQW A;  4A53 A;  2FRY A;  2GFU A;  4XAX B;  4IIM A;  3GIB A;  1WQW A;  3JB9 H;  4RUG A;  4TVR A;  5IXB A;  2XMF A;  1QKW A;  2E4H A;  2EQM A;  2OTJ A;  2Z0W A;  2EBP A;  1QVG A;  2F5K A;  2RQR A;  1GCP A;  2ZPE B;  3FC3 A;  3L2W A;  1W4S A;  3SB2 A;  2V8I A;  1VIE A;  1N8R R;  1OX8 A;  4OF1 A;  2RB6 A;  2VB6 A;  2K3B A;  4C92 B;  4BDY A;  2QK0 A;  2KSS A;  5A2Q E;  1PKS A;  3A5Z B;  2F2W A;  4DBF A;  2PU9 B;  2RQU A;  4OB3 B;  2HCK A;  3ULR B;  3CCJ T;  3RBB B;  3CC7 T;  3VKI A;  2VGN A;  2OTJ Q;  5LJ3 e;  5CKH A;  1YIJ A;  2HD0 A;  2LQW A;  2XHC A;  1TXQ A;  3V7S A;  1G3Y A;  1AT1 B;  3CCR T;  3QUI A;  3VUZ A;  2YUP A;  2FYK A;  4Y28 E;  1BIB A;  4EMH A;  4MDW A;  3GLX A;  1VYV A;  2PVD B;  2KT1 A;  1KC8 C;  1PD0 A;  1D1A A;  5GAN d;  2QGG A;  3EGX B;  4F7U G;  4J6Y A;  3UWN A;  1I1J A;  1M3A A;  4D6W A;  4WCI A;  1UB4 A;  1VQ5 T;  4N4G A;  2RNA A;  3FJP A;  1ABO A;  4PKC C;  4NL3 A;  1TWB A;  5D6Y A;  4PJO A;  2QA4 A;  4J6W A;  5GAN 5;  4M78 A;  4C8Q G;  4QT7 A;  4VUB A;  2AK5 A;  2E70 A;  1M1K U;  1HJD A;  5DY9 A;  2NWM A;  3RKW A;  3M0Q A;  5FRN A;  2K7A A; 
#chains in the Genus database with same CATH homology
 2D8J A;  2FO0 A;  1WDX A;  2JW4 A;  4CC7 A;  4D8K A;  1WXB A;  1SSH A;  2LCS A;  3EG0 A;  1M27 C;  4RTV A;  1M8M A;  2KRS A;  2LP5 A;  1YP5 A;  3RNJ A;  3NHN A;  2O9V A;  1GBQ A;  4ESR A;  2EPD A;  3UAT A;  2DF6 A;  1PHT A;  2L3S A;  2PTK A;  4AFS C;  1I07 A;  3C0C A;  3I9Q A;  3PVQ A;  1TUD A;  4GLM A;  2JT4 A;  2CDT A;  2HBW A;  2F2V A;  3SEM A;  3VS2 A;  1JEG A;  1NYF A;  2FEI A;  1ZUY A;  1OPK A;  1EFN A;  1SHG A;  1UG1 A;  1UDL A;  2FPE A;  1AZE A;  3R6N A;  1UHF A;  3EG2 A;  1X43 A;  3M0S A;  2GNC A;  4CC2 A;  2ESW A;  2JS0 A;  1KJW A;  1BK2 A;  4ORZ A;  2OJ2 A;  2YUN A;  2DNU A;  2DX1 A;  1X69 A;  2I0N A;  1YN8 A;  1YWO A;  1H8K A;  3I35 A;  2DL8 A;  3PVL A;  2JM8 A;  2ROL A;  2EYY A;  1GBR A;  3ZL7 C;  3H0F A;  2MCN A;  3TVT A;  2O9S A;  2GBQ A;  4HVU A;  2J6F A;  2OAW A;  2ABL A;  4KRT A;  2ED0 A;  3VRZ A;  2KE9 A;  1GFC A;  1AZG B;  2JXB A;  1KIK A;  3O5Z A;  1W70 A;  4AG1 C;  2KYB A;  1GFD A;  2C0O A;  4JZ3 A;  4LE9 A;  3REA B;  4A63 B;  2EGC A;  1MV0 B;  2K2M A;  2LMJ A;  4F16 A;  1ZLM A;  2CH4 W;  4D8D A;  5FW9 A;  2DVJ A;  4J9C A;  4J9E A;  4JJD A;  3U23 A;  3UA6 A;  2HDA A;  3M0R A;  5IHK A;  4Y92 A;  2FPF A;  2K6D A;  1W6X A;  2W10 A;  4AFU C;  1U06 A;  2AZS A;  4J9F A;  2HSP A;  2DL5 A;  2JMA A;  1OEB A;  1SRL A;  2VVK A;  4F14 A;  4OML A;  1FMK A;  1Z9Q A;  2CT4 A;  4RTX A;  2JS2 A;  1SPK A;  2L0A A;  1WYX A;  1WLP B;  2A08 A;  2EQI A;  1OPL A;  1HD3 A;  1ARK A;  4J9I A;  2J06 A;  4Z8A A;  1JQQ A;  1WA7 A;  1WX6 A;  3H41 A;  4DEY A;  5L23 A;  5GJV B;  1A0N B;  2BZY A;  1QKX A;  4HXJ A;  3VS5 A;  2RN8 A;  1RLP C;  2KT8 A;  3EG3 A;  2AZV A;  3VS3 A;  2A36 A;  1QLY A;  1PRL C;  4Z88 A;  1TG0 A;  1YWP A;  4DEX A;  2ED1 A;  2GQI A;  1JU5 C;  4J9D A;  4X1V A;  1LCK A;  2ENM A;  4JJB A;  2DRM A;  2BZX A;  1GRI A;  3M0T A;  2G6F X;  2LJ1 A;  4OMQ A;  1KFZ A;  1E7O A;  1VA7 A;  1Y0M A;  2FRW A;  3GBQ A;  3UA7 A;  1H3H A;  3QWY A;  4J9H A;  2KEA A;  2JTE A;  1X2K A;  2LX7 A;  4EIK A;  2K9G A;  4OMO A;  4RTU A;  1QWE A;  1WI7 A;  4LUE A;  2PNI A;  4OMP A;  1G2B A;  2YSQ A;  4ZNX A;  4J9G A;  3EG1 A;  3I5R A;  1WXT A;  2LJ3 A;  2KRN A;  5FWC A;  2CRE A;  5IHN A;  1V1C A;  1UEC A;  2RQW A;  1AWJ A;  2J6O A;  2DLP A;  1NYG A;  3CQT A;  3EGU A;  2KXD A;  2QDL A;  1S1N A;  4RTY A;  1VYT A;  5IH2 A;  2BTT A;  1GCQ C;  2RPN A;  1WXU A;  3M0U A;  2JMC A;  4LUD A;  1N5Z A;  1T0J A;  1RUW A;  4GBQ A;  1RI9 A;  1QWF A;  2YUQ A;  2V1R A;  4J9B A;  5I22 A;  4HVW A;  2DL7 A;  2MOX A;  3H0I A;  4RTT A;  5I11 A;  3THK A;  2B86 A;  2L3Q A;  1PWT A;  2SEM A;  1UFF A;  3I5S A;  2HEQ A;  1B07 A;  1AOJ A;  4Z89 A;  2YUO A;  3TSZ A;  1G83 A;  5FWB A;  1H92 A;  5EC7 A;  1J3T A;  3H0H A;  3VRY A;  2EW3 A;  1T3S A;  3SHW A;  1QCF A;  1AWO A;  2BZ8 A;  1ZBJ A;  2NUZ A;  2EGA A;  2RMO A;  2AKL A;  3QWX X;  2A37 A;  3A98 A;  1E6H A;  5ECA A;  1PRM C;  2X3W D;  4OMM A;  1GL5 A;  1UJ0 A;  1AVZ C;  2DA9 A;  4LN2 A;  3VS4 A;  4CC3 A;  2KBT A;  1AWW A;  3UF4 A;  2PZ1 A;  1FYN A;  1M30 A;  1AEY A;  2M0Y A;  3NPF A;  1UE9 A;  3VS1 A;  1JXO A;  1BB9 A;  2E5K A;  2OI3 A;  4F17 A;  1NEG A;  1BBZ A;  4HVV A;  1X6B A;  5IXF A;  5HCK A;  2LNH B;  1Y57 A;  2DE0 X;  4CC4 B;  4AFQ C;  1MV3 A;  2SRC A;  1RLQ C;  1ZUK A;  1U5S A;  2EYZ A;  2O2O A;  2F2X A;  2EGE A;  2A28 A;  4JJC A;  3NMZ C;  1OV3 A;  2CUD A;  2KNB B;  2YDL A;  1U3O A;  2YT6 A;  2L2P A;  2L3P A;  2DJQ A;  2DYB A;  2IIM A;  2K79 A;  2M51 A;  2J6K A;  2VKN A;  2DM1 A;  2D1X A;  1SRM A;  2RQT A;  2JM9 A;  1Z9Z A;  3PE0 A;  2J7I A;  1K0X A;  2DRK A;  4LNP A;  1CSK A;  2GGR A;  1YNZ A;  4RTW A;  2CSI A;  2J05 A;  3M0P A;  2EVR A;  1SEM A;  2MIO A;  2X3X D;  2DBK A;  2GTJ A;  3FJ5 A;  1CKB A;  1K76 A;  2CH4 A;  4K11 A;  1B3Q A;  2LZ6 B;  3IQL A;  2FRY A;  1AWX A;  4E6R A;  4IIM A;  1NLP C;  1T0H A;  1NEB A;  2GTO A;  4RUG A;  5IXB A;  2XMF A;  1K1Z A;  2KRM A;  3REB B;  2EYW A;  2O31 A;  4HCK A;  2LQN A;  1K4U S;  1GCQ A;  1QKW A;  1WFW A;  5GJW B;  1AD5 A;  1UTI A;  1VYU A;  2EBP A;  2RQR A;  1GCP A;  1UJY A;  1JO8 A;  1PKT A;  2KYM A;  4AFZ C;  1NM7 A;  1IO6 A;  2V1Q A;  1XOV A;  1OOT A;  1NLO C;  1PNJ A;  3JV3 A;  1CKA A;  2KRO A;  3NGP A;  3KFV A;  1E6G A;  1BU1 A;  2KGT A;  1WIE A;  4IIO A;  4AG2 C;  2K3B A;  1X6G A;  1X27 A;  1PKS A;  2F2W A;  1MUZ A;  2ECZ A;  2RQU A;  2HCK A;  3ULR B;  2RF0 A;  3VS0 A;  3RBB B;  1ZUU A;  2AKK A;  1K0S A;  3VS7 A;  2LQW A;  1W1F A;  2DIL A;  4FSS A;  3EHQ A;  2O88 A;  1KSW A;  1ZSG A;  2D0N A;  3EHR A;  2VWF A;  1NG2 A;  2D8H A;  2FPD A;  4RTZ A;  1HSQ A;  2FG0 A;  1K9A A;  2H8H A;  2CUB A;  2YUP A;  2CSQ A;  1TUC A;  2DL3 A;  4OMN A;  2EYX A;  2C0T A;  1VYV A;  2DMO A;  2KT1 A;  2KR3 A;  2RQV A;  2ROT A;  2EKH A;  3TSW A;  2W0Z A;  1SHF A;  3VS6 A;  1ABQ A;  2CT3 A;  1I1J A;  1M3A A;  4WCI A;  2DBM A;  4M4Z A;  2C0I A;  2LJ0 A;  1YCS B;  3LH5 A;  2RNA A;  1X2Q A;  1ZX6 A;  1JXM A;  2DL4 A;  4JZ4 A;  1ABO A;  1I0C A;  1UGV A;  1M3B A;  4R0K A;  4QT7 A;  2AK5 A;  4JPB W;  1T3L A;  2P4R A;  1HJD A;  1M3C A;  5IHI A;  1UUE A;  2KXC A;  2NWM A;  1UHC A;  3M0Q A;  2K7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...