2DLPA

Solution structure of the sh3 domain of human kiaa1783 protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
85
structure length
85
Chain Sequence
GSSGSSGSGYVIALRSYITDNCSLLSFHRGDLIKLLPVATLEPGWQFGSAGGRSGLFPADIVQPAAAPDFSFSKEQRSGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA1783 protein
publication title Solution structure of the SH3 domain of human KIAA1783 protein
rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 6
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07653 SH3_2 Variant SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dlpA00
1AWOA 1WX6A 2EPDA 1UTIA 4OMQA 1QWFA 3VS1A 1ZSGA 1JU5C 1T3LA 1V1CA 1K0XA 2ED1A 2DMOA 1QKXA 2KT1A 2JS2A 2KXDA 2O88A 4AFZC 1Y0MA 4LUEA 1E7OA 5IHKA 2KR3A 1ZX6A 4J9GA 2DL4A 2RF0A 2DA9A 4DEXA 2BZYA 2LX7A 2J7IA 1SSHA 2VKNA 2ESWA 4R0KA 1OPLA 2JM8A 2KXCA 4OMPA 3H0HA 1SHFA 1GCQA 1UGVA 2O9SA 3LH5A 1Z9ZA 1H8KA 2YSQA 1WXBA 3EHQA 1T0JA 4OMLA 2O2OA 1PWTA 2DL7A 2OJ2A 1Z9QA 3UA7A 1WFWA 2B86A 4GBQA 2AKKA 1CKBA 2DM1A 5GJVB 1X2QA 3TSZA 1VYTA 2DYBA 1YN8A 2RQTA 2DRMA 2EBPA 2FRWA 1SPKA 3FJ5A 1G2BA 1UJ0A 4JZ4A 1OEBA 2GGRA 4FSSA 4F14A 2CT4A 2J6FA 2IIMA 2LJ1A 2X3WD 1SRMA 1FYNA 1OPKA 2ENMA 4ZNXA 1JEGA 2DNUA 4LN2A 1UHFA 2J06A 1RLQC 1GRIA 2CT3A 4HVUA 1K1ZA 1HD3A 2K79A 1BB9A 3VS3A 2J6KA 1PRMC 1AOJA 4CC3A 1LCKA 1WXUA 2DL5A 2LCSA 2PTKA 5I22A 1SHGA 2DRKA 1N5ZA 5ECAA 2MIOA 3H0FA 1HJDA 1FMKA 1UHCA 2EVRA 3RBBB 3H41A 3UF4A 1WXTA 2VVKA 2YT6A 1AWJA 4AFSC 1GCQC 2FRYA 1AWWA 1NLPC 1WDXA 2KRSA 2RNAA 2D8JA 4DEYA 2KROA 3M0TA 1S1NA 5L23A 4HVWA 2KEAA 1MV3A 1H3HA 1AEYA 1X69A 1OOTA 2BZXA 5IHNA 4AFQC 2V1RA 1NYFA 1KIKA 2AZVA 1J3TA 2PZ1A 2ECZA 1WYXA 2SEMA 1KJWA 3EG1A 2XMFA 3QWXX 2O9VA 2JT4A 3M0QA 4J9CA 1NLOC 5HCKA 1ARKA 1YNZA 3VS5A 3ULRB 1X43A 1PNJA 2YUNA 5IXFA 1JXMA 2EGAA 4RUGA 4AG1C 4RTYA 2A36A 2A28A 2FPDA 3RNJA 3UA6A 4OMNA 2J6OA 1UFFA 2CREA 2KYBA 3EGUA 3NGPA 1X27A 1SRLA 1A0NB 3M0RA 2DLPA 2O31A 2M0YA 2LQWA 3SEMA 2JS0A 3ZL7C 1BK2A 2KRMA 4J9DA 1ZUUA 2AKLA 2M51A 3VRZA 2HSPA 2EYZA 3TSWA 1M3AA 1QKWA 1T3SA 2EYXA 2JXBA 3QWYA 2H8HA 1KFZA 3A98A 2CUDA 2RMOA 4J9EA 2F2VA 4D8KA 2D1XA 2C0OA 1K9AA 2P4RA 4JJCA 2JTEA 1UECA 2EKHA 2FEIA 1UE9A 1B07A 5GJWB 1JO8A 3REBB 1U3OA 2A08A 1WIEA 1GBQA 2L3PA 3EG3A 2HBWA 2EQIA 2LQNA 2GTJA 1CSKA 2EW3A 1W70A 1AD5A 1PKSA 1RLPC 1UDLA 2QDLA 3PE0A 3REAB 1H92A 2KE9A 1AZGB 2LJ3A 2CH4W 3VS6A 1M27C 1NEBA 2JMCA 3NMZC 1PRLC 4CC7A 2EGCA 2CDTA 3SHWA 1GFCA 3UATA 2AZSA 4LE9A 4RTXA 1GCPA 2LJ0A 2YUPA 2AK5A 4RTVA 3VS0A 2OAWA 1M3CA 2A37A 2CSIA 4E6RA 4LNPA 2RQVA 1GFDA 1E6GA 4OMOA 1YWPA 1U5SA 1PHTA 2G6FX 2KRNA 3JV3A 2MCNA 4RTUA 2W0ZA 2RQUA 5FW9A 2DBMA 4HVVA 1BBZA 1G83A 2ROLA 3R6NA 2LZ6B 2VWFA 4ESRA 1NM7A 1YP5A 2RN8A 4F17A 2DJQA 2KGTA 3VS2A 2HDAA 2ED0A 4M4ZA 4X1VA 2CSQA 1VA7A 3TVTA 4RTZA 1AWXA 4JJBA 2RPNA 1JQQA 1IO6A 2HCKA 1ZLMA 4ORZA 1YCSB 4JJDA 2CH4A 2GNCA 1NYGA 1AZEA 3PVQA 3VS7A 2K7AA 1YWOA 1B3QA 2MOXA 2L2PA 1Y57A 4F16A 2LP5A 2NWMA 2K6DA 2DILA 1K4US 1WA7A 4QT7A 1SEMA 1GBRA 3C0CA 2W10A 1OV3A 2DVJA 3IQLA 4OMMA 1I1JA 4D8DA 1HSQA 1QWEA 1XOVA 2K2MA 1EFNA 1ABOA 1M30A 2GQIA 2D0NA 1ZUKA 5IHIA 4HXJA 2DL3A 1GL5A 4AG2C 2DBKA 1UJYA 2DX1A 4IIMA 1T0HA 4JPBW 3I5SA 1KSWA 4K11A 5I11A 1NG2A 1NEGA 1QLYA 5IXBA 4AFUC 2JW4A 1E6HA 1TUDA 1M8MA 1PKTA 2L3SA 1UUEA 2CUBA 2SRCA 2EGEA 2BTTA 1K76A 3EHRA 2FPFA 1W1FA 1BU1A 3GBQA 2GTOA 2FO0A 2EYWA 2HEQA 5EC7A 2DF6A 2YUOA 2EYYA 4J9IA 1MUZA 1TUCA 2JM9A 4A63B 3VS4A 2V1QA 2F2WA 1QCFA 4LUDA 1ABQA 1VYUA 1ZUYA 3NHNA 1UG1A 2I0NA 3EG2A 2C0TA 2PNIA 2K9GA 1X2KA 4KRTA 3NPFA 2ROTA 2YUQA 2GBQA 2L0AA 3KFVA 4RTWA 1WI7A 3THKA 1W6XA 4GLMA 3M0UA 2LMJA 2OI3A 3VRYA 2FPEA 4Z88A 1JXOA 2ABLA 2DL8A 5FWBA 2KBTA 1ZBJA 2K3BA 3U23A 1I0CA 1WLPB 2BZ8A 1AVZC 4EIKA 3H0IA 2DE0X 3I9QA 1X6GA 5FWCA 2RQRA 4HCKA 4Z8AA 3I5RA 3PVLA 2F2XA 2KYMA 1RUWA 2FG0A 3I35A 5IH2A 1X6BA 3CQTA 2X3XD 1RI9A 1CKAA 1MV0B 2C0IA 3O5ZA 4Y92A 1K0SA 2KNBB 2RQWA 4JZ3A 4CC2A 2JMAA 2J05A 1U06A 1TG0A 2E5KA 2LNHB 3M0PA 2KT8A 1M3BA 4Z89A 4RTTA 4CC4B 4J9HA 4J9BA 2L3QA 3EG0A 2D8HA 3M0SA 1VYVA 2NUZA 4WCIA 2YDLA 4IIOA 1I07A 4J9FA
chains in the Genus database with same CATH superfamily
1AWOA 1WX6A 1D0YA 4IUPA 5GAOr 1UTIA 2RJCA 1QWFA 2VC8A 3CCMA 2KDSA 3I55Q 1VQ9Q 4M75F 2ED1A 1FMVA 4PFOA 4J6YA 2COWA 4A4KA 1YI2Q 3VJPA 2KXDA 2DIQA 2LVMA 1VQ7Q 2HBPA 4JDSA 4AFZC 1Y0MA 4FT4A 4MMLA 2QA4Q 3OYMA 2DL4A 3OYKA 4R0KA 3V8LA 2DIGA 2JM8A 2KXCA 4OMPA 1UGVA 1GCQA 2NLUA 4LDVA 3X25B 1H641 2COZA 1YJWT 2YSQA 5GAOq 1YITA 1VQ5A 1PWTA 3VKIA 5DLQE 4TVRA 1Q82C 3JCMc 5GJVB 1VYTA 4EMKB 1KC8C 4BE2A 3DKMA 2RQTA 3G7ZA 3CCQA 2FRWA 1K73R 3FJ5A 2EWNA 1UJ0A 4JLGA 2DYIA 3E9GA 2J6FA 2CP7A 1UEBA 4J8OA 1TWBA 1WHKA 3OS5A 3MEVA 2J06A 1RLQC 1PSFA 5IAYA 4HVUA 1N9RA 3JB9H 1B7TA 1ACMB 4N0AA 1D1CA 4KGXB 3T9NA 1YJNT 2DO3A 1WXUA 2QDYB 3EG9B 4L6V5 4HA8A 4XTYA 1N5ZA 4NS5A 2CGHA 2O4XB 3SWNB 1FMKA 2ZPGB 3H41A 3I55A 1VQ9A 3V8KA 1WXTA 2RHYA 4UC4A 2RJDA 2GQVA 3E19A 3CC7A 1YI2A 4C92F 3A8MB 4PJOA 1VQ7A 1NLPC 3OW2S 1RAGB 1P92A 2D8JA 3RERA 1Q95G 3UT1A 2QA4A 4HVWA 3TU4K 1MV3A 1H3HA 3JCMV 2RJFA 2YRCA 1OOTA 3PIPA 3JCMf 3OBWA 4AFQC 1VQMQ 2V1RA 1NYFA 3QHSA 5AT1B 5GAN7 1K9MU 1WYXA 3ZEHA 3J7AF 2FZCB 1VQOQ 1TXQA 3TQ7P 4C92D 2JT4A 1VOMA 2GFUA 1ARKA 3OYDA 1PNJA 5GAN8 5IXFA 3LYIA 3C12A 3GF5A 3META 5LJ5f 1WHGA 4C8QC 2FPDA 2PUOB 2CREA 2KYBA 3OS0A 4L59A 1X27A 5KCHA 3WVEB 3QO3A 2DLPA 1QP2A 5KYWA 2M0YA 3JB9F 3OYLA 1ZUUA 2QYZA 1LJOA 2M51A 3VRZA 2HSPA 2EYZA 3TSWA 2GCXA 2AT1B 4M7AC 1HK9A 3CD6T 2VGNA 3CCLQ 2C0OA 4KUIA 1K9AA 5LJ3d 3V7SA 2XDDA 1VQNQ 1UECA 4X9CA 1R77A 4M7DA 2V26A 2EKHA 5LJ5h 5GJWB 1N8RR 3REBB 4E7IA 1VQKT 3TCJA 5GAN2 2EQJA 2A08A 4L5GA 1QVGP 4C5EA 4OB1B 2L89A 2LQNA 2GTJA 3R6OA 1CSKA 2EW3A 1W70A 1PKSA 1UDLA 5GAMg 2KVQG 2XD0A 2CH4W 1IGQA 1TTHB 1KQSP 4CC7A 3JCMJ 3CXCS 2XHCA 4M75C 4RG2A 1HXDA 2QAZA 2LJ0A 3TEEA 2AK5A 4RTVA 3VS0A 1K8AC 1M3CA 1TSFA 1VQMA 3G6ET 4J83A 3S3NA 1RAEB 1WPYA 1X01A 2EKOA 2K3YA 2RHIA 2DXCA 1RAFB 2F1LA 1MGQA 2DETA 3LWHA 2QASA 3LH0A 4EMKA 4OVAA 2MCNA 5FU7C 2W0ZA 3OY9A 2OTLQ 2RQUA 3HL8A 3L2RA 1KHCA 4FYVB 2HQXA 2COYA 4HVVA 5GMKl 2ROLA 1Y7XA 1YJ9Q 3KUFA 2HQHA 3QXEB 5CR2A 1Q81C 2E1HA 2CSQA 1VA7A 3A8GB 4FT2A 4RTZA 3SD4A 3F70A 2K5IA 1D09B 3EG9A 2HCKA 3MEUA 1H3ZA 1AZEA 2GNCA 3CCLA 3PVQA 1SG5A 1U1TA 2O4XA 3SWNA 1VQNA 2M0OA 5M9OA 1Y57A 2LP5A 4XU3A 3JCMd 2NWMA 4QT7A 1SEMA 1Q86R 4ELYC 1ZA1B 2DVJA 3RKYA 4OMMA 1NJIU 4JRQA 4LDWA 2OTJA 2LT4A 2JUFA 2D0NA 4M78E 2AHJB 2DL3A 2G3RA 3M58A 3QJYA 3OS2A 1GL5A 4RMOA 2D6FA 1OZ3A 5CIUA 1WHHA 4P5NA 1NG2A 2JN0A 2DD5A 2PVDB 4C92C 4FW1A 2L3SA 4DBHA 1IZ6A 4GLKA 1V29B 3JCMX 2EGEA 5C6SA 3RUXA 4FU6A 1QCNA 1YITT 1VQ5T 1W1FA 1BU1A 2HEQA 4MMKA 2OTLA 2PVGB 4E7ZA 1PSEA 3VYHB 2EQMA 1YJ9A 2JM9A 4XU0A 4Q5WA 4BI4A 2V1QA 4LUDA 4XQ3A 3NHNA 2I0NA 1OU9A 3EG2A 2PNIA 2YLBA 2K9GA 3M4YA 4LDYA 4PFPA 1R8OB 2YUQA 2L0AA 4FIBA 3L42A 3KFVA 4RTWA 2P84A 4BB7A 3KXTA 1Q7YR 3H6ZA 3QIIA 2HSEB 3M0UA 4FL6A 2LMJA 3PFSA 3QSUA 1JXOA 2ZPIB 3U23A 3MKDA 5LL6S 3H8ZA 1M90R 4XK8E 2XICA 1AVZC 2RHUA 3RMSA 4DA4A 3H0IA 1VQKQ 2DD4A 1WHMA 3I55T 3G71A 1VQ9T 2BE7D 4GY5A 1PG5B 3PVLA 1YI2T 3CC7T 1ZA2B 1VQ7T 2X3XD 1CKAA 1MV0B 2H3EB 2YXYA 3OBYA 2QA4T 2C0IA 3O5ZA 4C0DC 4CC2A 1SKUB 1MMGA 2H3JA 2K5LA 2JMAA 3L2QA 5CQYA 2LNHB 1QVFS 1X6OA 3M0PA 4PJOF 4DBFA 3PMTA 2M1HA 1UGPB 4OMFB 4FSXA 4BACA 2CZ7B 1VQLQ 2D8HA 2JJ9A 2JTMA 2HKNA 5AYFA 2NUZA 2QQSA 4F7UE 4WCIA 4F04B 4IIOA 2KY9A 3V7CA 3OSSC 2GF7A 3KBGA 5HK0A 4OP0A 3GLXA 2MPXC 4PNOA 3CPFA 2CP3A 3VS1A 5LJ3j 5LJ5g 3E1SA 4BD3A 1JB0E 2LX9A 1C6VX 3URGA 1VQ4Q 4DQ2A 4JS5A 3CMEQ 2JS2A 1Q82R 1AT1B 2O88A 2MK5A 6AT1B 1KC8R 3VUZA 1ZX6A 1G5VA 2RF0A 2DA9A 4QQGA 1YCYA 2LX7A 4B6MA 2E6NA 4E7SA 5DM7R 1SSHA 2VKNA 2QEXQ 4HKEA 5GAOp 4QQ6A 3I56Q 1OPLA 1WZOA 3H0HA 1SHFA 1WGSA 2HD0A 3E2UA 1Z9ZA 1H8KA 3V8JA 2O2OA 4BUGA 5CAIA 2R57A 4GBQA 2ATCB 2AKKA 2ZPFB 4M7DF 1IHWA 1BKBA 1X2QA 3V7RA 2DRMA 2BE9B 3CCVT 4JZ4A 5HY6A 5GANe 3NTIA 1OEBA 3JCMP 2GGRA 4F14A 2IIMA 2X3WD 1M8VA 1SRMA 2RM4A 1FYNA 1VQMT 1QMCA 2K3XA 3DLLA 2E70A 2CT3A 4OB0B 3CC4A 3VS3A 1VQLA 2D0QB 3S3MA 2J6KA 5GMKm 2CZ1B 3FDRA 2BKDN 3OYGA 1MNEA 1M1KR 2PTKA 1SHGA 1PC0A 4M77E 4JLIA 4E7JA 3PNWC 3MEWA 3A8LB 2MIOA 3H0FA 1UHCA 2V8IA 2X9HA 1VQ4A 2VVKA 2VYTA 2X4JA 3CMEA 1GCQC 2FYKA 1WDXA 1SF9A 2KRSA 4PJNA 4X9DA 4DEYA 2KROA 9ATCB 5L23A 2KEAA 3CCRQ 1RAIB 2B8AA 1X69A 1UGSB 3CCLT 4OGEA 2QEXA 1XJWB 3SDZA 2DPPB 1KIKA 2AZVA 3I56A 1J3TA 1QCOA 2PZ1A 2ECZA 1IB8A 1RAHB 3EG1A 2M9UA 3QWXX 4J9CA 1NLOC 3M5AA 4PJMA 1YNZA 3C4SA 3PTAA 5IN1A 1X43A 3OW2A 3OQ5A 2OTJT 4M78B 4RUGA 2E3HA 3CC7Q 2A28A 3RNJA 4OMNA 4ATOA 3M55A 1M5Q1 2R5AA 3NGPA 5LJ3f 2JZ2A 4XTVA 1SRLA 2JVVA 2LQWA 3SEMA 1RAAB 2JS0A 2KRMA 4J9DA 1I5OB 1KK7A 2RJEA 3OB9A 5FU6B 3HFOA 1Y96B 2MWOA 4QVDA 2DEUA 5CKHA 1T3SA 3QWYA 2H8HA 3NFCA 3JCMb 2RMOA 2F2VA 3C95A 4D8KA 2D1XA 3CCEQ 5GMKh 1K8AR 2P4RA 3JAME 4PJOC 3FIFA 2OTLT 4FYXB 3BFMA 2RA2A 5GANj 3JRZA 1LNXA 1B07A 4KT0E 1LOJA 1IHVA 1G3WA 1YJ9T 1WIEA 3BDLA 1DJ7B 4Z02A 2HBWA 5LJ3h 1AD5A 3MHXA 3RDVA 2IPOB 4JRPA 2A3LA 3PE0A 3REAB 2KE9A 1NEBA 2DTOA 2JMCA 3JCMW 1IREB 3OYCA 3J80E 3CCRA 2AZSA 2P0QA 1QVPA 3AHUA 4EDUA 4CI0C 3OYHA 1BI2A 2OAWA 2VASA 2DTIA 4IKFA 1Q81R 2CSIA 3G4SQ 2RQVA 4KH1B 1QW1A 5KH6A 2WSEE 1U5SA 3QKJA 3S6WA 2HNIA 5GAMd 2V8JA 2DXTA 3QJ6A 2EJ9A 3G71T 5KE3A 2WSCE 3CCJQ 1EIFA 3CXCA 1BBZA 1G83A 2X4WA 2LZ6B 1KQ1A 3CCVQ 1YP5A 2CS7A 2EQUA 4F17A 2DJQA 3FJPA 2X4YA 1VQ8Q 2HDAA 4M75B 4M7DC 3UDCA 2DAQA 4RCCA 2R5MA 3EGDB 1D1BA 1IO6A 2DFUA 4IUTA 4F7UB 2CZ6B 4JJDA 1NYGA 3LX7A 3CCEA 2EQKA 2E12A 5I2SA 3DB4A 4O5VA 4C5IA 2EAYA 3X26B 3BW1A 2L2PA 4M78G 1NPPA 2FVUA 1KQ2A 1Y07A 1K4US 1GBRA 3RESA 1YHQA 4Y91A 1D0XA 3QZ5B 4D8DA 3L1AA 1QWEA 1MMAA 5D6WA 1ABOA 1IXDA 3MP6A 1M30A 2GQIA 2A7YA 2QQBA 3GOXA 3JCMh 2WSFE 5A0GA 4BY6B 4EMKC 4OGCA 4IIMA 1T0HA 4JPBW 4K11A 5I11A 1NEGA 1VIEA 1I8FA 5IXBA 3JCMQ 3G4SA 2E41A 4WTOB 4A4EA 4KGZB 1UUEA 2E4HA 2CUBA 4M78A 1N8RU 1JJ2S 2MAMA 2HAXA 2RK2A 2GTOA 3ER0A 5GAN4 3MCAB 5EC7A 1XQHA 3GIBA 1D1AA 3CPWS 2DF6A 4N4GA 2IVWA 1MMNA 3CCJA 3AT1B 2OTJQ 2EYYA 8ATCB 3OYJA 2K4YA 5GANf 3L2UA 3CCUQ 3CBPA 2HL3A 4PK4A 4A63B 3CCVA 1Y96A 3EFRA 1QCFA 1GXIE 1I81A 1VYUA 1ZUYA 1VQ8A 3SWNC 5FLXE 4JRIA 1UG1A 3M53A 5GAOn 2M16A 2E5QA 4E2FB 3NPFA 5GAMe 3OW2P 3CC4T 5KYXB 2XI9A 1VQLT 2KK4A 4ZGEB 3OYNA 1W6XA 2OI3A 3VRYA 4M77B 4Z88A 1UB4A 3QBYA 1OX9A 1ZBJA 1VIFA 2L8DA 2K3BA 2KI7A 3OYEA 1N6AA 2QQRA 1WLPB 2BZ8A 1V76A 3JB9I 2FL7A 3QUIA 1VQ4T 2CZ0B 1PM3A 4C5HA 2PU9B 2RHZA 2F2XA 2KYMA 3CMET 2RI3A 3FC3A 1RUWA 4M75G 5IH2A 3CQTA 4B9WA 3D7SB 4QVZA 1M9SA 2RQWA 4JZ3A 3HTRA 4F7UG 2X4XA 2KAFA 2P4TA 7AT1B 2QEXT 4FW2A 3I56T 4X34A 3JSCA 3CBOA 2FB7A 3PGGA 4J9BA 1Q86U 2E3IA 3HSBA 1WHLA 2E64A 1C1AA 2XDBA 2CP5A 3G71Q 4C5GA 1I07A 4BI3A 3UPUA 2EPDA 5CKDA 3GPLA 3RKXA 3CCUA 1QVFA 2K57A 4M75A 3RMQA 1JU5C 1T3LA 1V1CA 3A8OB 5C0MA 2X51A 1BYMA 2ZZDA 3EGDA 2DMOA 2KT1A 1TUGB 3M56A 4O6JA 5LJ3g 4F7UA 3RKWA 5IHKA 1M1GA 2ZGWA 2KR3A 4XU2A 4J9GA 4ME7A 4QW2A 2LC4A 3M57A 2VB6A 2J7IA 1IGUA 3CXCP 2QGFB 1K9MC 1G3YA 5J26A 3J81E 1KD1U 1VQPQ 3FRNA 1WXBA 4ANJA 1YFNA 3UA7A 3LLRA 1JBMA 4KUDK 1YIJA 4C8QE 4BI8B 1CKBA 5GAMj 3G1JA 2LQKA 4OB3B 1YN8A 3BE3A 1G2BA 2EIFA 3CCRT 4ZTJA 4FSSA 2LJ1A 1OPKA 5GANd 4RCBA 2ENMA 4ZNXA 2DNUA 2YLCA 2F69A 2L5QA 4LN2A 4M77G 4M7AE 2LTOA 4CRIA 1M90U 1NZ9A 3WVDB 2DL5A 2P0PA 5CO7A 2LCSA 1FMWA 3C94A 1N8RC 3ME9A 2MWPA 5ECAA 3JB9J 3L2ZA 1HJDA 4ELZC 1XTDA 2EVRA 2LCCA 2QTXA 3UF4A 1MHNA 1BI1A 2JOYA 2YT6A 1AWJA 4AFSC 4HCBA 4NOYA 5KYXA 1C0MA 1TH7A 2D9TA 5HK3A 2R58A 4M75E 4R56A 3JCMg 3JB9G 1S72T 4M77A 2DVEA 1YBYA 3CC2T 5IHNA 3CC4Q 3CCET 5GAN3 4C0ZA 1W2BS 1EZZB 1KJWA 1VQPA 3M0QA 5HCKA 5J39A 1N9SA 1YHQT 2VXFA 2EGAA 4MDXA 1Q82U 1UFFA 2VV5A 1M1FA 3VUBA 3OYBA 4HCZA 1VQ6Q 1A0NB 3MO8A 3M0RA 2O31A 4XTWA 1BK2A 2IG0A 5LJ5e 3G4ST 2AKLA 4J7IA 2DJZA 5CVIA 3OYIA 2EYXA 1ZSZC 2JXBA 2LNVA 3DLMA 2CUDA 4J9EA 1M2VB 3M9QA 4JJCA 2JTEA 3INZA 2PQWA 3CCJT 3M54A 2EYQA 4XTXA 1Q86C 3GP8A 4M78F 5DLOA 5D6XA 2BIVA 1GBQA 1NJIC 2L3PA 5I2MA 2NUPB 4PJJA 2KMTA 4JRKA 1VQ8T 3EFSA 1FXXA 1RLPC 1X75C 2QDLA 4JS4A 1H92A 2LJ3A 2QTVA 5GAMf 3VS6A 1M27C 1OX8A 2PUKB 1PD0A 1PRLC 3SHWA 3CEYA 3MP1A 1RACB 3UATA 4LE9A 4RTXA 1GCPA 4M78D 4C92E 4E6RA 4LNPA 1GFDA 1M1KU 3PMIA 1UGRB 4OMOA 4HCCA 1QVFP 4PJOB 3MJXA 3CMAA 1YWPA 5KYUB 5HKCA 3SFMA 2M02A 1RI0A 3DB3A 3PIOA 3OSVA 2KRNA 3JV3A 5CKEA 1PCXA 1KD1C 5J3BA 2DBMA 4EMGA 3SB2A 1UGQB 2RH2A 1BI3A 2VWFA 2RN8A 1VQ6A 1I4K1 2DTHA 2QXFA 4M4ZA 1LVKA 3L2WA 4X1VA 2HL5C 3EGXB 3TVTA 2L3RA 4N4HA 3EH1A 4JJBA 2RPNA 3LWIA 2RI5A 3P8BB 1WJQA 4EPCA 1OYXA 1ZLMA 1YCSB 4VUBA 5A0LA 4LDXA 2FZKB 3X20B 2K7AA 3QG1A 1YWOA 1B3QA 3HP9A 5KYNA 5KYYB 1M90C 4C0FA 3HKSA 2K6DA 3FLGA 2DILA 3CCUT 3TREA 3C0CA 4N0AC 5LJ5j 5GAOm 4DOVA 2W10A 3IQLA 1I1JA 2K2MA 1EFNA 1ZUKA 5CQXA 4A4HA 4M7DB 4HT9A 4E47A 1QQJA 1TU0B 2F5TX 1UJYA 4XTZA 1S72Q 1KG1A 3CCST 4A53A 1QLYA 1K8AU 4QQDA 3CC2Q 4AMCA 2LRQA 4F7UF 3QYHB 1TUDA 1M8MA 1PKTA 1MNDA 2SRCA 2BTTA 1K76A 4MZMA 3EHRA 3ASKA 3HFNA 4M75D 1K73U 1YHQQ 4C8QB 4R55A 2EYWA 1WQWA 1YIJT 4DBQA 3PT9A 2LT1A 2DZ9A 4J9IA 2E65A 4EMHA 4E7LA 2CP6A 2DEQA 2FZGB 1WJRA 2F2WA 1Q81U 4M7AB 1JJ2A 2VGMA 2C0TA 1M2VA 3FEOA 1G3SA 1X2KA 1NE8A 4KRTA 4PJOG 2ROTA 1OQKA 4QKUA 3CPWA 1WI7A 3LW5E 2E6ZA 3THKA 4J5YA 4AT1B 2ZAEA 1TS9A 2DL8A 5FWBA 1F1BB 4ZGDB 1M4ZA 2KBTA 1LPLA 2QQ9A 2Z0WA 3HRSA 1QVGS 1I0CA 2NUPA 4C0GA 1NBEB 4JJNK 4J6XA 4EIKA 2DE0X 2RI2A 3I9QA 4A54A 1ZBXA 5FWCA 4JUVA 4HCKA 1B34B 4XTUA 4Z8AA 3I5RA 1KQSS 2FG0A 1RI9A 4M78C 3QYGB 2XDPA 2O01E 4LXCA 1S72A 3ZBDA 3OS1A 4ZN3A 1U06A 1TG0A 2E5KA 2OAUA 5KYUA 2RK1A 3CC2A 4WF2A 2KT8A 3HRTA 4OF1A 5FU7B 4M77F 1VQPT 2AIRB 3H9NA 5FU6C 3EG0A 4ZN1A 3M0SA 1M2OA 1VYVA 1M1KC 5DY9A 4IUUA 1RL2A 2YDLA 3OYFA 1K9MR 4PKCC 5D7UA 4J9FA 2LDMA 2ZPEB 3VV0A 3OYAA 4OMQA 8AT1B 1ZSGA 2CKKA 4M7DG 1K0XA 1QP3A 3EGXA 4MZPA 4M77D 1QKXA 3O8VA 4ZTFA 2WACA 4FM4B 2HZYA 1E7OA 4LUEA 3EAEA 4DEXA 5CKBA 2BZYA 4KBMB 3QDRB 4BDYA 2I2LA 5KYYA 4FYYB 2ESWA 4C8QG 1FX7A 5KCOA 2O9SA 3LH5A 3LGFA 3EHQA 1T0JA 1WNLA 4OMLA 2Y90A 2ZCFB 2DL7A 5A2QE 2OJ2A 1Z9QA 4ZGJB 4KULA 1WFWA 1Y71A 2LCLA 4Y28E 2B86A 3JB9D 3GNFB 1WHJA 2DM1A 2XKOC 2MYSA 3TSZA 2DYBA 4A4GA 3HRUA 2XIDA 2OX7A 4M7AG 3GNGA 2EBPA 1SPKA 1I5LA 1RABB 2MF2A 4C92B 2CT4A 3CCSQ 4IUQA 2RB6A 1N27A 1JEGA 5KE2A 2K2VA 3X28B 4RG8A 1UHFA 1GRIA 4C8QA 1U8RA 1K1ZA 1HD3A 3Q1JA 3OA6A 4DBRA 3CMAT 5CKFA 2K79A 1BB9A 2YWWA 1XNIA 3QPHA 4PJOE 1PRMC 1AOJA 4CC3A 1LCKA 2KSSA 1OI1A 5GANh 2RHXA 3NTKA 5I22A 1VQOA 2DRKA 1MMDA 1YIJQ 1YJWQ 2QG9B 1KHIA 1K73C 4IUVA 4NL2A 3ZFJA 4E7KA 4M7AA 3RBBB 2DZCA 4LDUA 5FROA 3S3OA 2XK0A 1VQ6T 3NTHA 2Y4YA 2FRYA 4RKUE 1AWWA 2RNAA 2BUDA 3M0TA 2RD1A 1S1NA 4KH0B 2E10A 4YTLA 5IT9E 1AEYA 1O9SA 4E7HA 1BIBA 2BZXA 2Y4XA 1R0BG 2CP2A 4BY6C 1FWZA 2SEMA 2XMFA 2O9VA 1B34A 3VS5A 2XU8A 5GMKi 2YRDA 5CCAA 1YJNQ 3ULRB 2EJGA 2YUNA 1JJ2P 4LD9K 1JXMA 4AG1C 2P0KA 4RTYA 4C0DB 2A36A 3LGLA 3CCMT 3UA6A 2J6OA 5GAOl 3CPWP 1WQ7A 2HMAA 3EGUA 5GMKe 2YHTA 1W2BA 1NJIR 3OYYA 4M7DE 3CCSA 3ZL7C 1D3BB 2ZPHB 2LQ8A 4BE1A 1WJSA 5FRMA 5LJ5d 1M3AA 2VUBA 1QKWA 5GAN6 4PFZA 1KFZA 3A98A 5LJ3e 3RIRA 1U1SA 4IURA 3QZ9B 2ZPBB 1R0CB 2XG8D 2FEIA 1YJWA 1UE9A 4PLIA 3HPWA 4M77C 4N4IA 1JO8A 1U3OA 4C92G 3EG3A 2EQIA 1O75A 1KD1R 3L2VA 1Q7YU 3M59A 3CCQT 1AZGB 2NUTB 3NMZC 1BCMA 4MZTA 2EGCA 2CDTA 2EFIA 1GFCA 2VXEA 3P8DA 2YUPA 1ZSZB 1JRIA 4XAXB 1BIAA 4DOWA 2A37A 2MI6A 1BI0A 1E6GA 4V2SA 3CD6Q 4BDZA 3VU3C 1PHTA 1BCOA 2GFAA 2G6FX 1YJNA 1EX4A 4RTUA 2DK3A 4MDWA 2QGGA 4J6WA 1VUBA 3OMGA 5FW9A 4C92A 2QI2A 5L8RE 3R6NA 5A0DA 3EFOB 4ESRA 1NM7A 2KGTA 1NPRA 3VS2A 3BDUA 1G3TA 3MPUB 4D6WA 2ED0A 2QQAA 4LD6A 4PL6A 2CYZB 3E9FA 1AWXA 2X35A 3X24B 1JQQA 4ORZA 4B9XA 3CMAQ 2YRVA 2CH4A 1OU8A 3MEAA 3G6EQ 3VS7A 3JCMe 5GMKj 2NYSA 2MOXA 1RADB 2A0FB 3A1PA 2F5KA 4FYWB 4F16A 1WA7A 1KC8U 2MMPA 2PVOB 4BE0A 1OV3A 1HSQA 1XOVA 4J7FA 4PJOD 4XU1A 3P8HA 2V8KA 5IHIA 4HXJA 5D6YA 4AG2C 2DBKA 4PLLA 2DX1A 3RR6A 3I5SA 2HKQB 1KSWA 1G8XA 3M4GA 1ZHIA 4AFUC 5CK9A 2JW4A 1E6HA 2JTFA 4KGVB 3A8HB 3CD6A 2FPFA 3FB9A 1TOVA 2KQWA 3GBQA 2FO0A 2DXUA 4FCYA 2JNGA 1W4SA 5GANg 2YUOA 5EG2A 1MUZA 3CCMQ 1TUCA 1VQKA 1D3BA 3MP8A 3N5BB 2EJFA 3VS4A 2C06A 1ABQA 2FHDA 2DERA 1AHJB 2CP0A 3VYGA 1D0ZA 3HHTB 2GBQA 3OMCA 1PD1A 1OZ2A 4GLMA 3G6EA 1SSFA 2FPEA 2ABLA 4M7DD 1ZQ1A 1VQOT 4C8QF 3BY7A 1W2BP 1HYOA 4NL3A 5FRNA 1VQ5Q 1YITQ 4II1A 4PJLA 4QVCA 5GAMh 3WXMB 2NUTA 1X6GA 2RQRA 2K5FA 2DXBA 3I35A 5GAN5 5I21A 1X6BA 1ZSZA 3CCQQ 4Y92A 3UWNA 4M7AF 1K0SA 2KNBB 4C8QD 4HT8A 3QDFA 3A5ZB 1Q7YC 2J05A 1QVGA 4A4FA 1M3BA 3CBMA 5KYWB 4Z89A 4RTTA 2HQEA 4CC4B 4J9HA 1IRXA 2L3QA 2QK0A 1KQSA 2RO0A 3EH2A 4M7AD 1VQNT 1OULA 2DKGA 4OB2B 3EFOA
chains in the Genus database with same CATH topology
1AWOA 1WX6A 2EPDA 1UTIA 4OMQA 1QWFA 3VS1A 1ZSGA 1JU5C 1T3LA 1V1CA 1K0XA 2ED1A 2DMOA 1QKXA 2KT1A 2JS2A 2KXDA 2O88A 4AFZC 1Y0MA 4LUEA 1E7OA 5IHKA 2KR3A 1ZX6A 4J9GA 2DL4A 2RF0A 2DA9A 4DEXA 2BZYA 2LX7A 2J7IA 1SSHA 2VKNA 2ESWA 4R0KA 1OPLA 2JM8A 2KXCA 4OMPA 3H0HA 1SHFA 1GCQA 1UGVA 2O9SA 3LH5A 1Z9ZA 1H8KA 2YSQA 1WXBA 3EHQA 1T0JA 4OMLA 2O2OA 1PWTA 2DL7A 2OJ2A 1Z9QA 3UA7A 1WFWA 2B86A 4GBQA 2AKKA 1CKBA 2DM1A 5GJVB 1X2QA 3TSZA 1VYTA 2DYBA 1YN8A 2RQTA 2DRMA 2EBPA 2FRWA 1SPKA 3FJ5A 1G2BA 1UJ0A 4JZ4A 1OEBA 2GGRA 4FSSA 4F14A 2CT4A 2J6FA 2IIMA 2LJ1A 2X3WD 1SRMA 1FYNA 1OPKA 2ENMA 4ZNXA 1JEGA 2DNUA 4LN2A 1UHFA 2J06A 1RLQC 1GRIA 2CT3A 4HVUA 1K1ZA 1HD3A 2K79A 1BB9A 3VS3A 2J6KA 1PRMC 1AOJA 4CC3A 1LCKA 1WXUA 2DL5A 2LCSA 2PTKA 5I22A 1SHGA 2DRKA 1N5ZA 5ECAA 2MIOA 3H0FA 1HJDA 1FMKA 1UHCA 2EVRA 3RBBB 3H41A 3UF4A 1WXTA 2VVKA 2YT6A 1AWJA 4AFSC 1GCQC 2FRYA 1AWWA 1NLPC 1WDXA 2KRSA 2RNAA 2D8JA 4DEYA 2KROA 3M0TA 1S1NA 5L23A 4HVWA 2KEAA 1MV3A 1H3HA 1AEYA 1X69A 1OOTA 2BZXA 5IHNA 4AFQC 2V1RA 1NYFA 1KIKA 2AZVA 1J3TA 2PZ1A 2ECZA 1WYXA 2SEMA 1KJWA 3EG1A 2XMFA 3QWXX 2O9VA 2JT4A 3M0QA 4J9CA 1NLOC 5HCKA 1ARKA 1YNZA 3VS5A 3ULRB 1X43A 1PNJA 2YUNA 5IXFA 1JXMA 2EGAA 4RUGA 4AG1C 4RTYA 2A36A 2A28A 2FPDA 3RNJA 3UA6A 4OMNA 2J6OA 1UFFA 2CREA 2KYBA 3EGUA 3NGPA 1X27A 1SRLA 1A0NB 3M0RA 2DLPA 2O31A 2M0YA 2LQWA 3SEMA 2JS0A 3ZL7C 1BK2A 2KRMA 4J9DA 1ZUUA 2AKLA 2M51A 3VRZA 2HSPA 2EYZA 3TSWA 1M3AA 1QKWA 1T3SA 2EYXA 2JXBA 3QWYA 2H8HA 1KFZA 3A98A 2CUDA 2RMOA 4J9EA 2F2VA 4D8KA 2D1XA 2C0OA 1K9AA 2P4RA 4JJCA 2JTEA 1UECA 2EKHA 2FEIA 1UE9A 1B07A 5GJWB 1JO8A 3REBB 1U3OA 2A08A 1WIEA 1GBQA 2L3PA 3EG3A 2HBWA 2EQIA 2LQNA 2GTJA 1CSKA 2EW3A 1W70A 1AD5A 1PKSA 1RLPC 1UDLA 2QDLA 3PE0A 3REAB 1H92A 2KE9A 1AZGB 2LJ3A 2CH4W 3VS6A 1M27C 1NEBA 2JMCA 3NMZC 1PRLC 4CC7A 2EGCA 2CDTA 3SHWA 1GFCA 3UATA 2AZSA 4LE9A 4RTXA 1GCPA 2LJ0A 2YUPA 2AK5A 4RTVA 3VS0A 2OAWA 1M3CA 2A37A 2CSIA 4E6RA 4LNPA 2RQVA 1GFDA 1E6GA 4OMOA 1YWPA 1U5SA 1PHTA 2G6FX 2KRNA 3JV3A 2MCNA 4RTUA 2W0ZA 2RQUA 5FW9A 2DBMA 4HVVA 1BBZA 1G83A 2ROLA 3R6NA 2LZ6B 2VWFA 4ESRA 1NM7A 1YP5A 2RN8A 4F17A 2DJQA 2KGTA 3VS2A 2HDAA 2ED0A 4M4ZA 4X1VA 2CSQA 1VA7A 3TVTA 4RTZA 1AWXA 4JJBA 2RPNA 1JQQA 1IO6A 2HCKA 1ZLMA 4ORZA 1YCSB 4JJDA 2CH4A 2GNCA 1NYGA 1AZEA 3PVQA 3VS7A 2K7AA 1YWOA 1B3QA 2MOXA 2L2PA 1Y57A 4F16A 2LP5A 2NWMA 2K6DA 2DILA 1K4US 1WA7A 4QT7A 1SEMA 1GBRA 3C0CA 2W10A 1OV3A 2DVJA 3IQLA 4OMMA 1I1JA 4D8DA 1HSQA 1QWEA 1XOVA 2K2MA 1EFNA 1ABOA 1M30A 2GQIA 2D0NA 1ZUKA 5IHIA 4HXJA 2DL3A 1GL5A 4AG2C 2DBKA 1UJYA 2DX1A 4IIMA 1T0HA 4JPBW 3I5SA 1KSWA 4K11A 5I11A 1NG2A 1NEGA 1QLYA 5IXBA 4AFUC 2JW4A 1E6HA 1TUDA 1M8MA 1PKTA 2L3SA 1UUEA 2CUBA 2SRCA 2EGEA 2BTTA 1K76A 3EHRA 2FPFA 1W1FA 1BU1A 3GBQA 2GTOA 2FO0A 2EYWA 2HEQA 5EC7A 2DF6A 2YUOA 2EYYA 4J9IA 1MUZA 1TUCA 2JM9A 4A63B 3VS4A 2V1QA 2F2WA 1QCFA 4LUDA 1ABQA 1VYUA 1ZUYA 3NHNA 1UG1A 2I0NA 3EG2A 2C0TA 2PNIA 2K9GA 1X2KA 4KRTA 3NPFA 2ROTA 2YUQA 2GBQA 2L0AA 3KFVA 4RTWA 1WI7A 3THKA 1W6XA 4GLMA 3M0UA 2LMJA 2OI3A 3VRYA 2FPEA 4Z88A 1JXOA 2ABLA 2DL8A 5FWBA 2KBTA 1ZBJA 2K3BA 3U23A 1I0CA 1WLPB 2BZ8A 1AVZC 4EIKA 3H0IA 2DE0X 3I9QA 1X6GA 5FWCA 2RQRA 4HCKA 4Z8AA 3I5RA 3PVLA 2F2XA 2KYMA 1RUWA 2FG0A 3I35A 5IH2A 1X6BA 3CQTA 2X3XD 1RI9A 1CKAA 1MV0B 2C0IA 3O5ZA 4Y92A 1K0SA 2KNBB 2RQWA 4JZ3A 4CC2A 2JMAA 2J05A 1U06A 1TG0A 2E5KA 2LNHB 3M0PA 2KT8A 1M3BA 4Z89A 4RTTA 4CC4B 4J9HA 4J9BA 2L3QA 3EG0A 2D8HA 3M0SA 1VYVA 2NUZA 4WCIA 2YDLA 4IIOA 1I07A 4J9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWO A;  1WX6 A;  2EPD A;  1UTI A;  4OMQ A;  1QWF A;  3VS1 A;  1ZSG A;  1JU5 C;  1T3L A;  1V1C A;  1K0X A;  2ED1 A;  2DMO A;  1QKX A;  2KT1 A;  2JS2 A;  2KXD A;  2O88 A;  4AFZ C;  1Y0M A;  4LUE A;  1E7O A;  5IHK A;  2KR3 A;  1ZX6 A;  4J9G A;  2DL4 A;  2RF0 A;  2DA9 A;  4DEX A;  2BZY A;  2LX7 A;  2J7I A;  1SSH A;  2VKN A;  2ESW A;  4R0K A;  1OPL A;  2JM8 A;  2KXC A;  4OMP A;  3H0H A;  1SHF A;  1GCQ A;  1UGV A;  2O9S A;  3LH5 A;  1Z9Z A;  1H8K A;  2YSQ A;  1WXB A;  3EHQ A;  1T0J A;  4OML A;  2O2O A;  1PWT A;  2DL7 A;  2OJ2 A;  1Z9Q A;  3UA7 A;  1WFW A;  2B86 A;  4GBQ A;  2AKK A;  1CKB A;  2DM1 A;  5GJV B;  1X2Q A;  3TSZ A;  1VYT A;  2DYB A;  1YN8 A;  2RQT A;  2DRM A;  2EBP A;  2FRW A;  1SPK A;  3FJ5 A;  1G2B A;  1UJ0 A;  4JZ4 A;  1OEB A;  2GGR A;  4FSS A;  4F14 A;  2CT4 A;  2J6F A;  2IIM A;  2LJ1 A;  2X3W D;  1SRM A;  1FYN A;  1OPK A;  2ENM A;  4ZNX A;  1JEG A;  2DNU A;  4LN2 A;  1UHF A;  2J06 A;  1RLQ C;  1GRI A;  2CT3 A;  4HVU A;  1K1Z A;  1HD3 A;  2K79 A;  1BB9 A;  3VS3 A;  2J6K A;  1PRM C;  1AOJ A;  4CC3 A;  1LCK A;  1WXU A;  2DL5 A;  2LCS A;  2PTK A;  5I22 A;  1SHG A;  2DRK A;  1N5Z A;  5ECA A;  2MIO A;  3H0F A;  1HJD A;  1FMK A;  1UHC A;  2EVR A;  3RBB B;  3H41 A;  3UF4 A;  1WXT A;  2VVK A;  2YT6 A;  1AWJ A;  4AFS C;  1GCQ C;  2FRY A;  1AWW A;  1NLP C;  1WDX A;  2KRS A;  2RNA A;  2D8J A;  4DEY A;  2KRO A;  3M0T A;  1S1N A;  5L23 A;  4HVW A;  2KEA A;  1MV3 A;  1H3H A;  1AEY A;  1X69 A;  1OOT A;  2BZX A;  5IHN A;  4AFQ C;  2V1R A;  1NYF A;  1KIK A;  2AZV A;  1J3T A;  2PZ1 A;  2ECZ A;  1WYX A;  2SEM A;  1KJW A;  3EG1 A;  2XMF A;  3QWX X;  2O9V A;  2JT4 A;  3M0Q A;  4J9C A;  1NLO C;  5HCK A;  1ARK A;  1YNZ A;  3VS5 A;  3ULR B;  1X43 A;  1PNJ A;  2YUN A;  5IXF A;  1JXM A;  2EGA A;  4RUG A;  4AG1 C;  4RTY A;  2A36 A;  2A28 A;  2FPD A;  3RNJ A;  3UA6 A;  4OMN A;  2J6O A;  1UFF A;  2CRE A;  2KYB A;  3EGU A;  3NGP A;  1X27 A;  1SRL A;  1A0N B;  3M0R A;  2DLP A;  2O31 A;  2M0Y A;  2LQW A;  3SEM A;  2JS0 A;  3ZL7 C;  1BK2 A;  2KRM A;  4J9D A;  1ZUU A;  2AKL A;  2M51 A;  3VRZ A;  2HSP A;  2EYZ A;  3TSW A;  1M3A A;  1QKW A;  1T3S A;  2EYX A;  2JXB A;  3QWY A;  2H8H A;  1KFZ A;  3A98 A;  2CUD A;  2RMO A;  4J9E A;  2F2V A;  4D8K A;  2D1X A;  2C0O A;  1K9A A;  2P4R A;  4JJC A;  2JTE A;  1UEC A;  2EKH A;  2FEI A;  1UE9 A;  1B07 A;  5GJW B;  1JO8 A;  3REB B;  1U3O A;  2A08 A;  1WIE A;  1GBQ A;  2L3P A;  3EG3 A;  2HBW A;  2EQI A;  2LQN A;  2GTJ A;  1CSK A;  2EW3 A;  1W70 A;  1AD5 A;  1PKS A;  1RLP C;  1UDL A;  2QDL A;  3PE0 A;  3REA B;  1H92 A;  2KE9 A;  1AZG B;  2LJ3 A;  2CH4 W;  3VS6 A;  1M27 C;  1NEB A;  2JMC A;  3NMZ C;  1PRL C;  4CC7 A;  2EGC A;  2CDT A;  3SHW A;  1GFC A;  3UAT A;  2AZS A;  4LE9 A;  4RTX A;  1GCP A;  2LJ0 A;  2YUP A;  2AK5 A;  4RTV A;  3VS0 A;  2OAW A;  1M3C A;  2A37 A;  2CSI A;  4E6R A;  4LNP A;  2RQV A;  1GFD A;  1E6G A;  4OMO A;  1YWP A;  1U5S A;  1PHT A;  2G6F X;  2KRN A;  3JV3 A;  2MCN A;  4RTU A;  2W0Z A;  2RQU A;  5FW9 A;  2DBM A;  4HVV A;  1BBZ A;  1G83 A;  2ROL A;  3R6N A;  2LZ6 B;  2VWF A;  4ESR A;  1NM7 A;  1YP5 A;  2RN8 A;  4F17 A;  2DJQ A;  2KGT A;  3VS2 A;  2HDA A;  2ED0 A;  4M4Z A;  4X1V A;  2CSQ A;  1VA7 A;  3TVT A;  4RTZ A;  1AWX A;  4JJB A;  2RPN A;  1JQQ A;  1IO6 A;  2HCK A;  1ZLM A;  4ORZ A;  1YCS B;  4JJD A;  2CH4 A;  2GNC A;  1NYG A;  1AZE A;  3PVQ A;  3VS7 A;  2K7A A;  1YWO A;  1B3Q A;  2MOX A;  2L2P A;  1Y57 A;  4F16 A;  2LP5 A;  2NWM A;  2K6D A;  2DIL A;  1K4U S;  1WA7 A;  4QT7 A;  1SEM A;  1GBR A;  3C0C A;  2W10 A;  1OV3 A;  2DVJ A;  3IQL A;  4OMM A;  1I1J A;  4D8D A;  1HSQ A;  1QWE A;  1XOV A;  2K2M A;  1EFN A;  1ABO A;  1M30 A;  2GQI A;  2D0N A;  1ZUK A;  5IHI A;  4HXJ A;  2DL3 A;  1GL5 A;  4AG2 C;  2DBK A;  1UJY A;  2DX1 A;  4IIM A;  1T0H A;  4JPB W;  3I5S A;  1KSW A;  4K11 A;  5I11 A;  1NG2 A;  1NEG A;  1QLY A;  5IXB A;  4AFU C;  2JW4 A;  1E6H A;  1TUD A;  1M8M A;  1PKT A;  2L3S A;  1UUE A;  2CUB A;  2SRC A;  2EGE A;  2BTT A;  1K76 A;  3EHR A;  2FPF A;  1W1F A;  1BU1 A;  3GBQ A;  2GTO A;  2FO0 A;  2EYW A;  2HEQ A;  5EC7 A;  2DF6 A;  2YUO A;  2EYY A;  4J9I A;  1MUZ A;  1TUC A;  2JM9 A;  4A63 B;  3VS4 A;  2V1Q A;  2F2W A;  1QCF A;  4LUD A;  1ABQ A;  1VYU A;  1ZUY A;  3NHN A;  1UG1 A;  2I0N A;  3EG2 A;  2C0T A;  2PNI A;  2K9G A;  1X2K A;  4KRT A;  3NPF A;  2ROT A;  2YUQ A;  2GBQ A;  2L0A A;  3KFV A;  4RTW A;  1WI7 A;  3THK A;  1W6X A;  4GLM A;  3M0U A;  2LMJ A;  2OI3 A;  3VRY A;  2FPE A;  4Z88 A;  1JXO A;  2ABL A;  2DL8 A;  5FWB A;  2KBT A;  1ZBJ A;  2K3B A;  3U23 A;  1I0C A;  1WLP B;  2BZ8 A;  1AVZ C;  4EIK A;  3H0I A;  2DE0 X;  3I9Q A;  1X6G A;  5FWC A;  2RQR A;  4HCK A;  4Z8A A;  3I5R A;  3PVL A;  2F2X A;  2KYM A;  1RUW A;  2FG0 A;  3I35 A;  5IH2 A;  1X6B A;  3CQT A;  2X3X D;  1RI9 A;  1CKA A;  1MV0 B;  2C0I A;  3O5Z A;  4Y92 A;  1K0S A;  2KNB B;  2RQW A;  4JZ3 A;  4CC2 A;  2JMA A;  2J05 A;  1U06 A;  1TG0 A;  2E5K A;  2LNH B;  3M0P A;  2KT8 A;  1M3B A;  4Z89 A;  4RTT A;  4CC4 B;  4J9H A;  4J9B A;  2L3Q A;  3EG0 A;  2D8H A;  3M0S A;  1VYV A;  2NUZ A;  4WCI A;  2YDL A;  4IIO A;  1I07 A;  4J9F A; 
#chains in the Genus database with same CATH topology
 1AWO A;  1WX6 A;  1D0Y A;  4IUP A;  5GAO r;  1UTI A;  2RJC A;  1QWF A;  2VC8 A;  3CCM A;  2KDS A;  3I55 Q;  1VQ9 Q;  4M75 F;  2ED1 A;  1FMV A;  4PFO A;  4J6Y A;  2COW A;  4A4K A;  1YI2 Q;  3VJP A;  2KXD A;  2DIQ A;  2LVM A;  1VQ7 Q;  2HBP A;  4JDS A;  4AFZ C;  1Y0M A;  4FT4 A;  4MML A;  2QA4 Q;  3OYM A;  2DL4 A;  3OYK A;  4R0K A;  3V8L A;  2DIG A;  2JM8 A;  2KXC A;  4OMP A;  1UGV A;  1GCQ A;  2NLU A;  4LDV A;  3X25 B;  1H64 1;  2COZ A;  1YJW T;  2YSQ A;  5GAO q;  1YIT A;  1VQ5 A;  1PWT A;  3VKI A;  5DLQ E;  4TVR A;  1Q82 C;  3JCM c;  5GJV B;  1VYT A;  4EMK B;  1KC8 C;  4BE2 A;  3DKM A;  2RQT A;  3G7Z A;  3CCQ A;  2FRW A;  1K73 R;  3FJ5 A;  2EWN A;  1UJ0 A;  4JLG A;  2DYI A;  3E9G A;  2J6F A;  2CP7 A;  1UEB A;  4J8O A;  1TWB A;  1WHK A;  3OS5 A;  3MEV A;  2J06 A;  1RLQ C;  1PSF A;  5IAY A;  4HVU A;  1N9R A;  3JB9 H;  1B7T A;  1ACM B;  4N0A A;  1D1C A;  4KGX B;  3T9N A;  1YJN T;  2DO3 A;  1WXU A;  2QDY B;  3EG9 B;  4L6V 5;  4HA8 A;  4XTY A;  1N5Z A;  4NS5 A;  2CGH A;  2O4X B;  3SWN B;  1FMK A;  2ZPG B;  3H41 A;  3I55 A;  1VQ9 A;  3V8K A;  1WXT A;  2RHY A;  4UC4 A;  2RJD A;  2GQV A;  3E19 A;  3CC7 A;  1YI2 A;  4C92 F;  3A8M B;  4PJO A;  1VQ7 A;  1NLP C;  3OW2 S;  1RAG B;  1P92 A;  2D8J A;  3RER A;  1Q95 G;  3UT1 A;  2QA4 A;  4HVW A;  3TU4 K;  1MV3 A;  1H3H A;  3JCM V;  2RJF A;  2YRC A;  1OOT A;  3PIP A;  3JCM f;  3OBW A;  4AFQ C;  1VQM Q;  2V1R A;  1NYF A;  3QHS A;  5AT1 B;  5GAN 7;  1K9M U;  1WYX A;  3ZEH A;  3J7A F;  2FZC B;  1VQO Q;  1TXQ A;  3TQ7 P;  4C92 D;  2JT4 A;  1VOM A;  2GFU A;  1ARK A;  3OYD A;  1PNJ A;  5GAN 8;  5IXF A;  3LYI A;  3C12 A;  3GF5 A;  3MET A;  5LJ5 f;  1WHG A;  4C8Q C;  2FPD A;  2PUO B;  2CRE A;  2KYB A;  3OS0 A;  4L59 A;  1X27 A;  5KCH A;  3WVE B;  3QO3 A;  2DLP A;  1QP2 A;  5KYW A;  2M0Y A;  3JB9 F;  3OYL A;  1ZUU A;  2QYZ A;  1LJO A;  2M51 A;  3VRZ A;  2HSP A;  2EYZ A;  3TSW A;  2GCX A;  2AT1 B;  4M7A C;  1HK9 A;  3CD6 T;  2VGN A;  3CCL Q;  2C0O A;  4KUI A;  1K9A A;  5LJ3 d;  3V7S A;  2XDD A;  1VQN Q;  1UEC A;  4X9C A;  1R77 A;  4M7D A;  2V26 A;  2EKH A;  5LJ5 h;  5GJW B;  1N8R R;  3REB B;  4E7I A;  1VQK T;  3TCJ A;  5GAN 2;  2EQJ A;  2A08 A;  4L5G A;  1QVG P;  4C5E A;  4OB1 B;  2L89 A;  2LQN A;  2GTJ A;  3R6O A;  1CSK A;  2EW3 A;  1W70 A;  1PKS A;  1UDL A;  5GAM g;  2KVQ G;  2XD0 A;  2CH4 W;  1IGQ A;  1TTH B;  1KQS P;  4CC7 A;  3JCM J;  3CXC S;  2XHC A;  4M75 C;  4RG2 A;  1HXD A;  2QAZ A;  2LJ0 A;  3TEE A;  2AK5 A;  4RTV A;  3VS0 A;  1K8A C;  1M3C A;  1TSF A;  1VQM A;  3G6E T;  4J83 A;  3S3N A;  1RAE B;  1WPY A;  1X01 A;  2EKO A;  2K3Y A;  2RHI A;  2DXC A;  1RAF B;  2F1L A;  1MGQ A;  2DET A;  3LWH A;  2QAS A;  3LH0 A;  4EMK A;  4OVA A;  2MCN A;  5FU7 C;  2W0Z A;  3OY9 A;  2OTL Q;  2RQU A;  3HL8 A;  3L2R A;  1KHC A;  4FYV B;  2HQX A;  2COY A;  4HVV A;  5GMK l;  2ROL A;  1Y7X A;  1YJ9 Q;  3KUF A;  2HQH A;  3QXE B;  5CR2 A;  1Q81 C;  2E1H A;  2CSQ A;  1VA7 A;  3A8G B;  4FT2 A;  4RTZ A;  3SD4 A;  3F70 A;  2K5I A;  1D09 B;  3EG9 A;  2HCK A;  3MEU A;  1H3Z A;  1AZE A;  2GNC A;  3CCL A;  3PVQ A;  1SG5 A;  1U1T A;  2O4X A;  3SWN A;  1VQN A;  2M0O A;  5M9O A;  1Y57 A;  2LP5 A;  4XU3 A;  3JCM d;  2NWM A;  4QT7 A;  1SEM A;  1Q86 R;  4ELY C;  1ZA1 B;  2DVJ A;  3RKY A;  4OMM A;  1NJI U;  4JRQ A;  4LDW A;  2OTJ A;  2LT4 A;  2JUF A;  2D0N A;  4M78 E;  2AHJ B;  2DL3 A;  2G3R A;  3M58 A;  3QJY A;  3OS2 A;  1GL5 A;  4RMO A;  2D6F A;  1OZ3 A;  5CIU A;  1WHH A;  4P5N A;  1NG2 A;  2JN0 A;  2DD5 A;  2PVD B;  4C92 C;  4FW1 A;  2L3S A;  4DBH A;  1IZ6 A;  4GLK A;  1V29 B;  3JCM X;  2EGE A;  5C6S A;  3RUX A;  4FU6 A;  1QCN A;  1YIT T;  1VQ5 T;  1W1F A;  1BU1 A;  2HEQ A;  4MMK A;  2OTL A;  2PVG B;  4E7Z A;  1PSE A;  3VYH B;  2EQM A;  1YJ9 A;  2JM9 A;  4XU0 A;  4Q5W A;  4BI4 A;  2V1Q A;  4LUD A;  4XQ3 A;  3NHN A;  2I0N A;  1OU9 A;  3EG2 A;  2PNI A;  2YLB A;  2K9G A;  3M4Y A;  4LDY A;  4PFP A;  1R8O B;  2YUQ A;  2L0A A;  4FIB A;  3L42 A;  3KFV A;  4RTW A;  2P84 A;  4BB7 A;  3KXT A;  1Q7Y R;  3H6Z A;  3QII A;  2HSE B;  3M0U A;  4FL6 A;  2LMJ A;  3PFS A;  3QSU A;  1JXO A;  2ZPI B;  3U23 A;  3MKD A;  5LL6 S;  3H8Z A;  1M90 R;  4XK8 E;  2XIC A;  1AVZ C;  2RHU A;  3RMS A;  4DA4 A;  3H0I A;  1VQK Q;  2DD4 A;  1WHM A;  3I55 T;  3G71 A;  1VQ9 T;  2BE7 D;  4GY5 A;  1PG5 B;  3PVL A;  1YI2 T;  3CC7 T;  1ZA2 B;  1VQ7 T;  2X3X D;  1CKA A;  1MV0 B;  2H3E B;  2YXY A;  3OBY A;  2QA4 T;  2C0I A;  3O5Z A;  4C0D C;  4CC2 A;  1SKU B;  1MMG A;  2H3J A;  2K5L A;  2JMA A;  3L2Q A;  5CQY A;  2LNH B;  1QVF S;  1X6O A;  3M0P A;  4PJO F;  4DBF A;  3PMT A;  2M1H A;  1UGP B;  4OMF B;  4FSX A;  4BAC A;  2CZ7 B;  1VQL Q;  2D8H A;  2JJ9 A;  2JTM A;  2HKN A;  5AYF A;  2NUZ A;  2QQS A;  4F7U E;  4WCI A;  4F04 B;  4IIO A;  2KY9 A;  3V7C A;  3OSS C;  2GF7 A;  3KBG A;  5HK0 A;  4OP0 A;  3GLX A;  2MPX C;  4PNO A;  3CPF A;  2CP3 A;  3VS1 A;  5LJ3 j;  5LJ5 g;  3E1S A;  4BD3 A;  1JB0 E;  2LX9 A;  1C6V X;  3URG A;  1VQ4 Q;  4DQ2 A;  4JS5 A;  3CME Q;  2JS2 A;  1Q82 R;  1AT1 B;  2O88 A;  2MK5 A;  6AT1 B;  1KC8 R;  3VUZ A;  1ZX6 A;  1G5V A;  2RF0 A;  2DA9 A;  4QQG A;  1YCY A;  2LX7 A;  4B6M A;  2E6N A;  4E7S A;  5DM7 R;  1SSH A;  2VKN A;  2QEX Q;  4HKE A;  5GAO p;  4QQ6 A;  3I56 Q;  1OPL A;  1WZO A;  3H0H A;  1SHF A;  1WGS A;  2HD0 A;  3E2U A;  1Z9Z A;  1H8K A;  3V8J A;  2O2O A;  4BUG A;  5CAI A;  2R57 A;  4GBQ A;  2ATC B;  2AKK A;  2ZPF B;  4M7D F;  1IHW A;  1BKB A;  1X2Q A;  3V7R A;  2DRM A;  2BE9 B;  3CCV T;  4JZ4 A;  5HY6 A;  5GAN e;  3NTI A;  1OEB A;  3JCM P;  2GGR A;  4F14 A;  2IIM A;  2X3W D;  1M8V A;  1SRM A;  2RM4 A;  1FYN A;  1VQM T;  1QMC A;  2K3X A;  3DLL A;  2E70 A;  2CT3 A;  4OB0 B;  3CC4 A;  3VS3 A;  1VQL A;  2D0Q B;  3S3M A;  2J6K A;  5GMK m;  2CZ1 B;  3FDR A;  2BKD N;  3OYG A;  1MNE A;  1M1K R;  2PTK A;  1SHG A;  1PC0 A;  4M77 E;  4JLI A;  4E7J A;  3PNW C;  3MEW A;  3A8L B;  2MIO A;  3H0F A;  1UHC A;  2V8I A;  2X9H A;  1VQ4 A;  2VVK A;  2VYT A;  2X4J A;  3CME A;  1GCQ C;  2FYK A;  1WDX A;  1SF9 A;  2KRS A;  4PJN A;  4X9D A;  4DEY A;  2KRO A;  9ATC B;  5L23 A;  2KEA A;  3CCR Q;  1RAI B;  2B8A A;  1X69 A;  1UGS B;  3CCL T;  4OGE A;  2QEX A;  1XJW B;  3SDZ A;  2DPP B;  1KIK A;  2AZV A;  3I56 A;  1J3T A;  1QCO A;  2PZ1 A;  2ECZ A;  1IB8 A;  1RAH B;  3EG1 A;  2M9U A;  3QWX X;  4J9C A;  1NLO C;  3M5A A;  4PJM A;  1YNZ A;  3C4S A;  3PTA A;  5IN1 A;  1X43 A;  3OW2 A;  3OQ5 A;  2OTJ T;  4M78 B;  4RUG A;  2E3H A;  3CC7 Q;  2A28 A;  3RNJ A;  4OMN A;  4ATO A;  3M55 A;  1M5Q 1;  2R5A A;  3NGP A;  5LJ3 f;  2JZ2 A;  4XTV A;  1SRL A;  2JVV A;  2LQW A;  3SEM A;  1RAA B;  2JS0 A;  2KRM A;  4J9D A;  1I5O B;  1KK7 A;  2RJE A;  3OB9 A;  5FU6 B;  3HFO A;  1Y96 B;  2MWO A;  4QVD A;  2DEU A;  5CKH A;  1T3S A;  3QWY A;  2H8H A;  3NFC A;  3JCM b;  2RMO A;  2F2V A;  3C95 A;  4D8K A;  2D1X A;  3CCE Q;  5GMK h;  1K8A R;  2P4R A;  3JAM E;  4PJO C;  3FIF A;  2OTL T;  4FYX B;  3BFM A;  2RA2 A;  5GAN j;  3JRZ A;  1LNX A;  1B07 A;  4KT0 E;  1LOJ A;  1IHV A;  1G3W A;  1YJ9 T;  1WIE A;  3BDL A;  1DJ7 B;  4Z02 A;  2HBW A;  5LJ3 h;  1AD5 A;  3MHX A;  3RDV A;  2IPO B;  4JRP A;  2A3L A;  3PE0 A;  3REA B;  2KE9 A;  1NEB A;  2DTO A;  2JMC A;  3JCM W;  1IRE B;  3OYC A;  3J80 E;  3CCR A;  2AZS A;  2P0Q A;  1QVP A;  3AHU A;  4EDU A;  4CI0 C;  3OYH A;  1BI2 A;  2OAW A;  2VAS A;  2DTI A;  4IKF A;  1Q81 R;  2CSI A;  3G4S Q;  2RQV A;  4KH1 B;  1QW1 A;  5KH6 A;  2WSE E;  1U5S A;  3QKJ A;  3S6W A;  2HNI A;  5GAM d;  2V8J A;  2DXT A;  3QJ6 A;  2EJ9 A;  3G71 T;  5KE3 A;  2WSC E;  3CCJ Q;  1EIF A;  3CXC A;  1BBZ A;  1G83 A;  2X4W A;  2LZ6 B;  1KQ1 A;  3CCV Q;  1YP5 A;  2CS7 A;  2EQU A;  4F17 A;  2DJQ A;  3FJP A;  2X4Y A;  1VQ8 Q;  2HDA A;  4M75 B;  4M7D C;  3UDC A;  2DAQ A;  4RCC A;  2R5M A;  3EGD B;  1D1B A;  1IO6 A;  2DFU A;  4IUT A;  4F7U B;  2CZ6 B;  4JJD A;  1NYG A;  3LX7 A;  3CCE A;  2EQK A;  2E12 A;  5I2S A;  3DB4 A;  4O5V A;  4C5I A;  2EAY A;  3X26 B;  3BW1 A;  2L2P A;  4M78 G;  1NPP A;  2FVU A;  1KQ2 A;  1Y07 A;  1K4U S;  1GBR A;  3RES A;  1YHQ A;  4Y91 A;  1D0X A;  3QZ5 B;  4D8D A;  3L1A A;  1QWE A;  1MMA A;  5D6W A;  1ABO A;  1IXD A;  3MP6 A;  1M30 A;  2GQI A;  2A7Y A;  2QQB A;  3GOX A;  3JCM h;  2WSF E;  5A0G A;  4BY6 B;  4EMK C;  4OGC A;  4IIM A;  1T0H A;  4JPB W;  4K11 A;  5I11 A;  1NEG A;  1VIE A;  1I8F A;  5IXB A;  3JCM Q;  3G4S A;  2E41 A;  4WTO B;  4A4E A;  4KGZ B;  1UUE A;  2E4H A;  2CUB A;  4M78 A;  1N8R U;  1JJ2 S;  2MAM A;  2HAX A;  2RK2 A;  2GTO A;  3ER0 A;  5GAN 4;  3MCA B;  5EC7 A;  1XQH A;  3GIB A;  1D1A A;  3CPW S;  2DF6 A;  4N4G A;  2IVW A;  1MMN A;  3CCJ A;  3AT1 B;  2OTJ Q;  2EYY A;  8ATC B;  3OYJ A;  2K4Y A;  5GAN f;  3L2U A;  3CCU Q;  3CBP A;  2HL3 A;  4PK4 A;  4A63 B;  3CCV A;  1Y96 A;  3EFR A;  1QCF A;  1GXI E;  1I81 A;  1VYU A;  1ZUY A;  1VQ8 A;  3SWN C;  5FLX E;  4JRI A;  1UG1 A;  3M53 A;  5GAO n;  2M16 A;  2E5Q A;  4E2F B;  3NPF A;  5GAM e;  3OW2 P;  3CC4 T;  5KYX B;  2XI9 A;  1VQL T;  2KK4 A;  4ZGE B;  3OYN A;  1W6X A;  2OI3 A;  3VRY A;  4M77 B;  4Z88 A;  1UB4 A;  3QBY A;  1OX9 A;  1ZBJ A;  1VIF A;  2L8D A;  2K3B A;  2KI7 A;  3OYE A;  1N6A A;  2QQR A;  1WLP B;  2BZ8 A;  1V76 A;  3JB9 I;  2FL7 A;  3QUI A;  1VQ4 T;  2CZ0 B;  1PM3 A;  4C5H A;  2PU9 B;  2RHZ A;  2F2X A;  2KYM A;  3CME T;  2RI3 A;  3FC3 A;  1RUW A;  4M75 G;  5IH2 A;  3CQT A;  4B9W A;  3D7S B;  4QVZ A;  1M9S A;  2RQW A;  4JZ3 A;  3HTR A;  4F7U G;  2X4X A;  2KAF A;  2P4T A;  7AT1 B;  2QEX T;  4FW2 A;  3I56 T;  4X34 A;  3JSC A;  3CBO A;  2FB7 A;  3PGG A;  4J9B A;  1Q86 U;  2E3I A;  3HSB A;  1WHL A;  2E64 A;  1C1A A;  2XDB A;  2CP5 A;  3G71 Q;  4C5G A;  1I07 A;  4BI3 A;  3UPU A;  2EPD A;  5CKD A;  3GPL A;  3RKX A;  3CCU A;  1QVF A;  2K57 A;  4M75 A;  3RMQ A;  1JU5 C;  1T3L A;  1V1C A;  3A8O B;  5C0M A;  2X51 A;  1BYM A;  2ZZD A;  3EGD A;  2DMO A;  2KT1 A;  1TUG B;  3M56 A;  4O6J A;  5LJ3 g;  4F7U A;  3RKW A;  5IHK A;  1M1G A;  2ZGW A;  2KR3 A;  4XU2 A;  4J9G A;  4ME7 A;  4QW2 A;  2LC4 A;  3M57 A;  2VB6 A;  2J7I A;  1IGU A;  3CXC P;  2QGF B;  1K9M C;  1G3Y A;  5J26 A;  3J81 E;  1KD1 U;  1VQP Q;  3FRN A;  1WXB A;  4ANJ A;  1YFN A;  3UA7 A;  3LLR A;  1JBM A;  4KUD K;  1YIJ A;  4C8Q E;  4BI8 B;  1CKB A;  5GAM j;  3G1J A;  2LQK A;  4OB3 B;  1YN8 A;  3BE3 A;  1G2B A;  2EIF A;  3CCR T;  4ZTJ A;  4FSS A;  2LJ1 A;  1OPK A;  5GAN d;  4RCB A;  2ENM A;  4ZNX A;  2DNU A;  2YLC A;  2F69 A;  2L5Q A;  4LN2 A;  4M77 G;  4M7A E;  2LTO A;  4CRI A;  1M90 U;  1NZ9 A;  3WVD B;  2DL5 A;  2P0P A;  5CO7 A;  2LCS A;  1FMW A;  3C94 A;  1N8R C;  3ME9 A;  2MWP A;  5ECA A;  3JB9 J;  3L2Z A;  1HJD A;  4ELZ C;  1XTD A;  2EVR A;  2LCC A;  2QTX A;  3UF4 A;  1MHN A;  1BI1 A;  2JOY A;  2YT6 A;  1AWJ A;  4AFS C;  4HCB A;  4NOY A;  5KYX A;  1C0M A;  1TH7 A;  2D9T A;  5HK3 A;  2R58 A;  4M75 E;  4R56 A;  3JCM g;  3JB9 G;  1S72 T;  4M77 A;  2DVE A;  1YBY A;  3CC2 T;  5IHN A;  3CC4 Q;  3CCE T;  5GAN 3;  4C0Z A;  1W2B S;  1EZZ B;  1KJW A;  1VQP A;  3M0Q A;  5HCK A;  5J39 A;  1N9S A;  1YHQ T;  2VXF A;  2EGA A;  4MDX A;  1Q82 U;  1UFF A;  2VV5 A;  1M1F A;  3VUB A;  3OYB A;  4HCZ A;  1VQ6 Q;  1A0N B;  3MO8 A;  3M0R A;  2O31 A;  4XTW A;  1BK2 A;  2IG0 A;  5LJ5 e;  3G4S T;  2AKL A;  4J7I A;  2DJZ A;  5CVI A;  3OYI A;  2EYX A;  1ZSZ C;  2JXB A;  2LNV A;  3DLM A;  2CUD A;  4J9E A;  1M2V B;  3M9Q A;  4JJC A;  2JTE A;  3INZ A;  2PQW A;  3CCJ T;  3M54 A;  2EYQ A;  4XTX A;  1Q86 C;  3GP8 A;  4M78 F;  5DLO A;  5D6X A;  2BIV A;  1GBQ A;  1NJI C;  2L3P A;  5I2M A;  2NUP B;  4PJJ A;  2KMT A;  4JRK A;  1VQ8 T;  3EFS A;  1FXX A;  1RLP C;  1X75 C;  2QDL A;  4JS4 A;  1H92 A;  2LJ3 A;  2QTV A;  5GAM f;  3VS6 A;  1M27 C;  1OX8 A;  2PUK B;  1PD0 A;  1PRL C;  3SHW A;  3CEY A;  3MP1 A;  1RAC B;  3UAT A;  4LE9 A;  4RTX A;  1GCP A;  4M78 D;  4C92 E;  4E6R A;  4LNP A;  1GFD A;  1M1K U;  3PMI A;  1UGR B;  4OMO A;  4HCC A;  1QVF P;  4PJO B;  3MJX A;  3CMA A;  1YWP A;  5KYU B;  5HKC A;  3SFM A;  2M02 A;  1RI0 A;  3DB3 A;  3PIO A;  3OSV A;  2KRN A;  3JV3 A;  5CKE A;  1PCX A;  1KD1 C;  5J3B A;  2DBM A;  4EMG A;  3SB2 A;  1UGQ B;  2RH2 A;  1BI3 A;  2VWF A;  2RN8 A;  1VQ6 A;  1I4K 1;  2DTH A;  2QXF A;  4M4Z A;  1LVK A;  3L2W A;  4X1V A;  2HL5 C;  3EGX B;  3TVT A;  2L3R A;  4N4H A;  3EH1 A;  4JJB A;  2RPN A;  3LWI A;  2RI5 A;  3P8B B;  1WJQ A;  4EPC A;  1OYX A;  1ZLM A;  1YCS B;  4VUB A;  5A0L A;  4LDX A;  2FZK B;  3X20 B;  2K7A A;  3QG1 A;  1YWO A;  1B3Q A;  3HP9 A;  5KYN A;  5KYY B;  1M90 C;  4C0F A;  3HKS A;  2K6D A;  3FLG A;  2DIL A;  3CCU T;  3TRE A;  3C0C A;  4N0A C;  5LJ5 j;  5GAO m;  4DOV A;  2W10 A;  3IQL A;  1I1J A;  2K2M A;  1EFN A;  1ZUK A;  5CQX A;  4A4H A;  4M7D B;  4HT9 A;  4E47 A;  1QQJ A;  1TU0 B;  2F5T X;  1UJY A;  4XTZ A;  1S72 Q;  1KG1 A;  3CCS T;  4A53 A;  1QLY A;  1K8A U;  4QQD A;  3CC2 Q;  4AMC A;  2LRQ A;  4F7U F;  3QYH B;  1TUD A;  1M8M A;  1PKT A;  1MND A;  2SRC A;  2BTT A;  1K76 A;  4MZM A;  3EHR A;  3ASK A;  3HFN A;  4M75 D;  1K73 U;  1YHQ Q;  4C8Q B;  4R55 A;  2EYW A;  1WQW A;  1YIJ T;  4DBQ A;  3PT9 A;  2LT1 A;  2DZ9 A;  4J9I A;  2E65 A;  4EMH A;  4E7L A;  2CP6 A;  2DEQ A;  2FZG B;  1WJR A;  2F2W A;  1Q81 U;  4M7A B;  1JJ2 A;  2VGM A;  2C0T A;  1M2V A;  3FEO A;  1G3S A;  1X2K A;  1NE8 A;  4KRT A;  4PJO G;  2ROT A;  1OQK A;  4QKU A;  3CPW A;  1WI7 A;  3LW5 E;  2E6Z A;  3THK A;  4J5Y A;  4AT1 B;  2ZAE A;  1TS9 A;  2DL8 A;  5FWB A;  1F1B B;  4ZGD B;  1M4Z A;  2KBT A;  1LPL A;  2QQ9 A;  2Z0W A;  3HRS A;  1QVG S;  1I0C A;  2NUP A;  4C0G A;  1NBE B;  4JJN K;  4J6X A;  4EIK A;  2DE0 X;  2RI2 A;  3I9Q A;  4A54 A;  1ZBX A;  5FWC A;  4JUV A;  4HCK A;  1B34 B;  4XTU A;  4Z8A A;  3I5R A;  1KQS S;  2FG0 A;  1RI9 A;  4M78 C;  3QYG B;  2XDP A;  2O01 E;  4LXC A;  1S72 A;  3ZBD A;  3OS1 A;  4ZN3 A;  1U06 A;  1TG0 A;  2E5K A;  2OAU A;  5KYU A;  2RK1 A;  3CC2 A;  4WF2 A;  2KT8 A;  3HRT A;  4OF1 A;  5FU7 B;  4M77 F;  1VQP T;  2AIR B;  3H9N A;  5FU6 C;  3EG0 A;  4ZN1 A;  3M0S A;  1M2O A;  1VYV A;  1M1K C;  5DY9 A;  4IUU A;  1RL2 A;  2YDL A;  3OYF A;  1K9M R;  4PKC C;  5D7U A;  4J9F A;  2LDM A;  2ZPE B;  3VV0 A;  3OYA A;  4OMQ A;  8AT1 B;  1ZSG A;  2CKK A;  4M7D G;  1K0X A;  1QP3 A;  3EGX A;  4MZP A;  4M77 D;  1QKX A;  3O8V A;  4ZTF A;  2WAC A;  4FM4 B;  2HZY A;  1E7O A;  4LUE A;  3EAE A;  4DEX A;  5CKB A;  2BZY A;  4KBM B;  3QDR B;  4BDY A;  2I2L A;  5KYY A;  4FYY B;  2ESW A;  4C8Q G;  1FX7 A;  5KCO A;  2O9S A;  3LH5 A;  3LGF A;  3EHQ A;  1T0J A;  1WNL A;  4OML A;  2Y90 A;  2ZCF B;  2DL7 A;  5A2Q E;  2OJ2 A;  1Z9Q A;  4ZGJ B;  4KUL A;  1WFW A;  1Y71 A;  2LCL A;  4Y28 E;  2B86 A;  3JB9 D;  3GNF B;  1WHJ A;  2DM1 A;  2XKO C;  2MYS A;  3TSZ A;  2DYB A;  4A4G A;  3HRU A;  2XID A;  2OX7 A;  4M7A G;  3GNG A;  2EBP A;  1SPK A;  1I5L A;  1RAB B;  2MF2 A;  4C92 B;  2CT4 A;  3CCS Q;  4IUQ A;  2RB6 A;  1N27 A;  1JEG A;  5KE2 A;  2K2V A;  3X28 B;  4RG8 A;  1UHF A;  1GRI A;  4C8Q A;  1U8R A;  1K1Z A;  1HD3 A;  3Q1J A;  3OA6 A;  4DBR A;  3CMA T;  5CKF A;  2K79 A;  1BB9 A;  2YWW A;  1XNI A;  3QPH A;  4PJO E;  1PRM C;  1AOJ A;  4CC3 A;  1LCK A;  2KSS A;  1OI1 A;  5GAN h;  2RHX A;  3NTK A;  5I22 A;  1VQO A;  2DRK A;  1MMD A;  1YIJ Q;  1YJW Q;  2QG9 B;  1KHI A;  1K73 C;  4IUV A;  4NL2 A;  3ZFJ A;  4E7K A;  4M7A A;  3RBB B;  2DZC A;  4LDU A;  5FRO A;  3S3O A;  2XK0 A;  1VQ6 T;  3NTH A;  2Y4Y A;  2FRY A;  4RKU E;  1AWW A;  2RNA A;  2BUD A;  3M0T A;  2RD1 A;  1S1N A;  4KH0 B;  2E10 A;  4YTL A;  5IT9 E;  1AEY A;  1O9S A;  4E7H A;  1BIB A;  2BZX A;  2Y4X A;  1R0B G;  2CP2 A;  4BY6 C;  1FWZ A;  2SEM A;  2XMF A;  2O9V A;  1B34 A;  3VS5 A;  2XU8 A;  5GMK i;  2YRD A;  5CCA A;  1YJN Q;  3ULR B;  2EJG A;  2YUN A;  1JJ2 P;  4LD9 K;  1JXM A;  4AG1 C;  2P0K A;  4RTY A;  4C0D B;  2A36 A;  3LGL A;  3CCM T;  3UA6 A;  2J6O A;  5GAO l;  3CPW P;  1WQ7 A;  2HMA A;  3EGU A;  5GMK e;  2YHT A;  1W2B A;  1NJI R;  3OYY A;  4M7D E;  3CCS A;  3ZL7 C;  1D3B B;  2ZPH B;  2LQ8 A;  4BE1 A;  1WJS A;  5FRM A;  5LJ5 d;  1M3A A;  2VUB A;  1QKW A;  5GAN 6;  4PFZ A;  1KFZ A;  3A98 A;  5LJ3 e;  3RIR A;  1U1S A;  4IUR A;  3QZ9 B;  2ZPB B;  1R0C B;  2XG8 D;  2FEI A;  1YJW A;  1UE9 A;  4PLI A;  3HPW A;  4M77 C;  4N4I A;  1JO8 A;  1U3O A;  4C92 G;  3EG3 A;  2EQI A;  1O75 A;  1KD1 R;  3L2V A;  1Q7Y U;  3M59 A;  3CCQ T;  1AZG B;  2NUT B;  3NMZ C;  1BCM A;  4MZT A;  2EGC A;  2CDT A;  2EFI A;  1GFC A;  2VXE A;  3P8D A;  2YUP A;  1ZSZ B;  1JRI A;  4XAX B;  1BIA A;  4DOW A;  2A37 A;  2MI6 A;  1BI0 A;  1E6G A;  4V2S A;  3CD6 Q;  4BDZ A;  3VU3 C;  1PHT A;  1BCO A;  2GFA A;  2G6F X;  1YJN A;  1EX4 A;  4RTU A;  2DK3 A;  4MDW A;  2QGG A;  4J6W A;  1VUB A;  3OMG A;  5FW9 A;  4C92 A;  2QI2 A;  5L8R E;  3R6N A;  5A0D A;  3EFO B;  4ESR A;  1NM7 A;  2KGT A;  1NPR A;  3VS2 A;  3BDU A;  1G3T A;  3MPU B;  4D6W A;  2ED0 A;  2QQA A;  4LD6 A;  4PL6 A;  2CYZ B;  3E9F A;  1AWX A;  2X35 A;  3X24 B;  1JQQ A;  4ORZ A;  4B9X A;  3CMA Q;  2YRV A;  2CH4 A;  1OU8 A;  3MEA A;  3G6E Q;  3VS7 A;  3JCM e;  5GMK j;  2NYS A;  2MOX A;  1RAD B;  2A0F B;  3A1P A;  2F5K A;  4FYW B;  4F16 A;  1WA7 A;  1KC8 U;  2MMP A;  2PVO B;  4BE0 A;  1OV3 A;  1HSQ A;  1XOV A;  4J7F A;  4PJO D;  4XU1 A;  3P8H A;  2V8K A;  5IHI A;  4HXJ A;  5D6Y A;  4AG2 C;  2DBK A;  4PLL A;  2DX1 A;  3RR6 A;  3I5S A;  2HKQ B;  1KSW A;  1G8X A;  3M4G A;  1ZHI A;  4AFU C;  5CK9 A;  2JW4 A;  1E6H A;  2JTF A;  4KGV B;  3A8H B;  3CD6 A;  2FPF A;  3FB9 A;  1TOV A;  2KQW A;  3GBQ A;  2FO0 A;  2DXU A;  4FCY A;  2JNG A;  1W4S A;  5GAN g;  2YUO A;  5EG2 A;  1MUZ A;  3CCM Q;  1TUC A;  1VQK A;  1D3B A;  3MP8 A;  3N5B B;  2EJF A;  3VS4 A;  2C06 A;  1ABQ A;  2FHD A;  2DER A;  1AHJ B;  2CP0 A;  3VYG A;  1D0Z A;  3HHT B;  2GBQ A;  3OMC A;  1PD1 A;  1OZ2 A;  4GLM A;  3G6E A;  1SSF A;  2FPE A;  2ABL A;  4M7D D;  1ZQ1 A;  1VQO T;  4C8Q F;  3BY7 A;  1W2B P;  1HYO A;  4NL3 A;  5FRN A;  1VQ5 Q;  1YIT Q;  4II1 A;  4PJL A;  4QVC A;  5GAM h;  3WXM B;  2NUT A;  1X6G A;  2RQR A;  2K5F A;  2DXB A;  3I35 A;  5GAN 5;  5I21 A;  1X6B A;  1ZSZ A;  3CCQ Q;  4Y92 A;  3UWN A;  4M7A F;  1K0S A;  2KNB B;  4C8Q D;  4HT8 A;  3QDF A;  3A5Z B;  1Q7Y C;  2J05 A;  1QVG A;  4A4F A;  1M3B A;  3CBM A;  5KYW B;  4Z89 A;  4RTT A;  2HQE A;  4CC4 B;  4J9H A;  1IRX A;  2L3Q A;  2QK0 A;  1KQS A;  2RO0 A;  3EH2 A;  4M7A D;  1VQN T;  1OUL A;  2DKG A;  4OB2 B;  3EFO A; 
#chains in the Genus database with same CATH homology
 1AWO A;  1WX6 A;  2EPD A;  1UTI A;  4OMQ A;  1QWF A;  3VS1 A;  1ZSG A;  1JU5 C;  1T3L A;  1V1C A;  1K0X A;  2ED1 A;  2DMO A;  1QKX A;  2KT1 A;  2JS2 A;  2KXD A;  2O88 A;  4AFZ C;  1Y0M A;  4LUE A;  1E7O A;  5IHK A;  2KR3 A;  1ZX6 A;  4J9G A;  2DL4 A;  2RF0 A;  2DA9 A;  4DEX A;  2BZY A;  2LX7 A;  2J7I A;  1SSH A;  2VKN A;  2ESW A;  4R0K A;  1OPL A;  2JM8 A;  2KXC A;  4OMP A;  3H0H A;  1SHF A;  1GCQ A;  1UGV A;  2O9S A;  3LH5 A;  1Z9Z A;  1H8K A;  2YSQ A;  1WXB A;  3EHQ A;  1T0J A;  4OML A;  2O2O A;  1PWT A;  2DL7 A;  2OJ2 A;  1Z9Q A;  3UA7 A;  1WFW A;  2B86 A;  4GBQ A;  2AKK A;  1CKB A;  2DM1 A;  5GJV B;  1X2Q A;  3TSZ A;  1VYT A;  2DYB A;  1YN8 A;  2RQT A;  2DRM A;  2EBP A;  2FRW A;  1SPK A;  3FJ5 A;  1G2B A;  1UJ0 A;  4JZ4 A;  1OEB A;  2GGR A;  4FSS A;  4F14 A;  2CT4 A;  2J6F A;  2IIM A;  2LJ1 A;  2X3W D;  1SRM A;  1FYN A;  1OPK A;  2ENM A;  4ZNX A;  1JEG A;  2DNU A;  4LN2 A;  1UHF A;  2J06 A;  1RLQ C;  1GRI A;  2CT3 A;  4HVU A;  1K1Z A;  1HD3 A;  2K79 A;  1BB9 A;  3VS3 A;  2J6K A;  1PRM C;  1AOJ A;  4CC3 A;  1LCK A;  1WXU A;  2DL5 A;  2LCS A;  2PTK A;  5I22 A;  1SHG A;  2DRK A;  1N5Z A;  5ECA A;  2MIO A;  3H0F A;  1HJD A;  1FMK A;  1UHC A;  2EVR A;  3RBB B;  3H41 A;  3UF4 A;  1WXT A;  2VVK A;  2YT6 A;  1AWJ A;  4AFS C;  1GCQ C;  2FRY A;  1AWW A;  1NLP C;  1WDX A;  2KRS A;  2RNA A;  2D8J A;  4DEY A;  2KRO A;  3M0T A;  1S1N A;  5L23 A;  4HVW A;  2KEA A;  1MV3 A;  1H3H A;  1AEY A;  1X69 A;  1OOT A;  2BZX A;  5IHN A;  4AFQ C;  2V1R A;  1NYF A;  1KIK A;  2AZV A;  1J3T A;  2PZ1 A;  2ECZ A;  1WYX A;  2SEM A;  1KJW A;  3EG1 A;  2XMF A;  3QWX X;  2O9V A;  2JT4 A;  3M0Q A;  4J9C A;  1NLO C;  5HCK A;  1ARK A;  1YNZ A;  3VS5 A;  3ULR B;  1X43 A;  1PNJ A;  2YUN A;  5IXF A;  1JXM A;  2EGA A;  4RUG A;  4AG1 C;  4RTY A;  2A36 A;  2A28 A;  2FPD A;  3RNJ A;  3UA6 A;  4OMN A;  2J6O A;  1UFF A;  2CRE A;  2KYB A;  3EGU A;  3NGP A;  1X27 A;  1SRL A;  1A0N B;  3M0R A;  2DLP A;  2O31 A;  2M0Y A;  2LQW A;  3SEM A;  2JS0 A;  3ZL7 C;  1BK2 A;  2KRM A;  4J9D A;  1ZUU A;  2AKL A;  2M51 A;  3VRZ A;  2HSP A;  2EYZ A;  3TSW A;  1M3A A;  1QKW A;  1T3S A;  2EYX A;  2JXB A;  3QWY A;  2H8H A;  1KFZ A;  3A98 A;  2CUD A;  2RMO A;  4J9E A;  2F2V A;  4D8K A;  2D1X A;  2C0O A;  1K9A A;  2P4R A;  4JJC A;  2JTE A;  1UEC A;  2EKH A;  2FEI A;  1UE9 A;  1B07 A;  5GJW B;  1JO8 A;  3REB B;  1U3O A;  2A08 A;  1WIE A;  1GBQ A;  2L3P A;  3EG3 A;  2HBW A;  2EQI A;  2LQN A;  2GTJ A;  1CSK A;  2EW3 A;  1W70 A;  1AD5 A;  1PKS A;  1RLP C;  1UDL A;  2QDL A;  3PE0 A;  3REA B;  1H92 A;  2KE9 A;  1AZG B;  2LJ3 A;  2CH4 W;  3VS6 A;  1M27 C;  1NEB A;  2JMC A;  3NMZ C;  1PRL C;  4CC7 A;  2EGC A;  2CDT A;  3SHW A;  1GFC A;  3UAT A;  2AZS A;  4LE9 A;  4RTX A;  1GCP A;  2LJ0 A;  2YUP A;  2AK5 A;  4RTV A;  3VS0 A;  2OAW A;  1M3C A;  2A37 A;  2CSI A;  4E6R A;  4LNP A;  2RQV A;  1GFD A;  1E6G A;  4OMO A;  1YWP A;  1U5S A;  1PHT A;  2G6F X;  2KRN A;  3JV3 A;  2MCN A;  4RTU A;  2W0Z A;  2RQU A;  5FW9 A;  2DBM A;  4HVV A;  1BBZ A;  1G83 A;  2ROL A;  3R6N A;  2LZ6 B;  2VWF A;  4ESR A;  1NM7 A;  1YP5 A;  2RN8 A;  4F17 A;  2DJQ A;  2KGT A;  3VS2 A;  2HDA A;  2ED0 A;  4M4Z A;  4X1V A;  2CSQ A;  1VA7 A;  3TVT A;  4RTZ A;  1AWX A;  4JJB A;  2RPN A;  1JQQ A;  1IO6 A;  2HCK A;  1ZLM A;  4ORZ A;  1YCS B;  4JJD A;  2CH4 A;  2GNC A;  1NYG A;  1AZE A;  3PVQ A;  3VS7 A;  2K7A A;  1YWO A;  1B3Q A;  2MOX A;  2L2P A;  1Y57 A;  4F16 A;  2LP5 A;  2NWM A;  2K6D A;  2DIL A;  1K4U S;  1WA7 A;  4QT7 A;  1SEM A;  1GBR A;  3C0C A;  2W10 A;  1OV3 A;  2DVJ A;  3IQL A;  4OMM A;  1I1J A;  4D8D A;  1HSQ A;  1QWE A;  1XOV A;  2K2M A;  1EFN A;  1ABO A;  1M30 A;  2GQI A;  2D0N A;  1ZUK A;  5IHI A;  4HXJ A;  2DL3 A;  1GL5 A;  4AG2 C;  2DBK A;  1UJY A;  2DX1 A;  4IIM A;  1T0H A;  4JPB W;  3I5S A;  1KSW A;  4K11 A;  5I11 A;  1NG2 A;  1NEG A;  1QLY A;  5IXB A;  4AFU C;  2JW4 A;  1E6H A;  1TUD A;  1M8M A;  1PKT A;  2L3S A;  1UUE A;  2CUB A;  2SRC A;  2EGE A;  2BTT A;  1K76 A;  3EHR A;  2FPF A;  1W1F A;  1BU1 A;  3GBQ A;  2GTO A;  2FO0 A;  2EYW A;  2HEQ A;  5EC7 A;  2DF6 A;  2YUO A;  2EYY A;  4J9I A;  1MUZ A;  1TUC A;  2JM9 A;  4A63 B;  3VS4 A;  2V1Q A;  2F2W A;  1QCF A;  4LUD A;  1ABQ A;  1VYU A;  1ZUY A;  3NHN A;  1UG1 A;  2I0N A;  3EG2 A;  2C0T A;  2PNI A;  2K9G A;  1X2K A;  4KRT A;  3NPF A;  2ROT A;  2YUQ A;  2GBQ A;  2L0A A;  3KFV A;  4RTW A;  1WI7 A;  3THK A;  1W6X A;  4GLM A;  3M0U A;  2LMJ A;  2OI3 A;  3VRY A;  2FPE A;  4Z88 A;  1JXO A;  2ABL A;  2DL8 A;  5FWB A;  2KBT A;  1ZBJ A;  2K3B A;  3U23 A;  1I0C A;  1WLP B;  2BZ8 A;  1AVZ C;  4EIK A;  3H0I A;  2DE0 X;  3I9Q A;  1X6G A;  5FWC A;  2RQR A;  4HCK A;  4Z8A A;  3I5R A;  3PVL A;  2F2X A;  2KYM A;  1RUW A;  2FG0 A;  3I35 A;  5IH2 A;  1X6B A;  3CQT A;  2X3X D;  1RI9 A;  1CKA A;  1MV0 B;  2C0I A;  3O5Z A;  4Y92 A;  1K0S A;  2KNB B;  2RQW A;  4JZ3 A;  4CC2 A;  2JMA A;  2J05 A;  1U06 A;  1TG0 A;  2E5K A;  2LNH B;  3M0P A;  2KT8 A;  1M3B A;  4Z89 A;  4RTT A;  4CC4 B;  4J9H A;  4J9B A;  2L3Q A;  3EG0 A;  2D8H A;  3M0S A;  1VYV A;  2NUZ A;  4WCI A;  2YDL A;  4IIO A;  1I07 A;  4J9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...