2B86A

Solution structure of the first src homology 3 domain of nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Solution structure of the first SRC homology 3 domain of human nck2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2b86A00
3M0QA 4HVWA 1T0JA 1ZLMA 2KYMA 2YDLA 1AWWA 2DILA 3VS1A 2D8HA 2DE0X 3EHQA 1U3OA 2LJ3A 1N5ZA 1K76A 4RTVA 4JZ4A 3M0RA 1ZSGA 2RQWA 3VS2A 3SEMA 2K7AA 2LMJA 1UJ0A 2ENMA 2A37A 2I0NA 1E6HA 2OJ2A 4HVUA 1SRLA 2DBKA 1MV3A 2HSPA 1WXTA 2DBMA 3VS3A 2O9SA 1PHTA 2J6FA 4LE9A 2K79A 3JV3A 1XOVA 2DMOA 5IH2A 2KXCA 4LN2A 1QWEA 2X3WD 2K3BA 1K0SA 5IHIA 2KR3A 1HJDA 4M4ZA 1JEGA 4OMQA 2YT6A 1RLQC 2LJ0A 2CUBA 2KXDA 1B3QA 2J05A 5L23A 2EYZA 4D8DA 2GQIA 3ULRB 5IHNA 4CC4B 2LNHB 2CREA 4HCKA 5IXBA 1U5SA 4J9BA 2VWFA 1YP5A 3H41A 4Z89A 2GTOA 1PKSA 5GJWB 2RF0A 2ECZA 1OOTA 1WI7A 2H8HA 1CSKA 4OMLA 1SEMA 3A98A 1I07A 2GTJA 3QWXX 4RTWA 1FMKA 1AWOA 2D8JA 2EYXA 1ZX6A 2YUQA 1OV3A 1W6XA 1G83A 2LX7A 1KSWA 1JQQA 1X69A 1Y0MA 4GLMA 4D8KA 1PRLC 2B86A 2JS2A 2FPEA 1NYFA 1GRIA 2KT8A 2KRSA 1GCQC 2K2MA 3M0UA 4AFUC 4CC2A 4F14A 1JXMA 2BZXA 4AG2C 1W70A 1UECA 2QDLA 2LP5A 4ORZA 2K9GA 5GJVB 2FG0A 1K0XA 1V1CA 2AKKA 2AKLA 4J9GA 1PNJA 4DEXA 3NHNA 1E7OA 2CH4W 3VS7A 1RLPC 2SRCA 4LUEA 4R0KA 1K4US 1X6GA 1FYNA 4A63B 1M30A 1NG2A 2EBPA 3M0TA 1H3HA 2V1QA 2L3SA 1YN8A 2FO0A 4RTXA 2AK5A 2CSQA 2BZYA 2DF6A 3IQLA 1YCSB 4J9EA 2JXBA 1UE9A 4JJCA 3THKA 5IHKA 2LCSA 2DL8A 2L3QA 4JJDA 2RQTA 3H0HA 3VS0A 4RUGA 3NMZC 1UFFA 2KRMA 3CQTA 2X3XD 3R6NA 2DL7A 1ABOA 1WLPB 2KYBA 2LQNA 2LQWA 2ROTA 4J9DA 4K11A 4RTYA 2VVKA 1H92A 4ZNXA 1BB9A 4LUDA 3I35A 2JMAA 2KBTA 2J06A 3RBBB 2DM1A 3EG2A 1HD3A 2RQUA 4Z88A 4J9HA 1Y57A 2EKHA 2P4RA 2DL3A 4KRTA 1WFWA 2EQIA 2BZ8A 3O5ZA 1GBQA 1UTIA 1SSHA 1ABQA 2XMFA 2O88A 1VYVA 4JPBW 2E5KA 1M8MA 1BK2A 4AFZC 1YWOA 1M3BA 4RTTA 2PNIA 3U23A 1M27C 2JS0A 4AFQC 1AWJA 1OPKA 2C0OA 2DJQA 1HSQA 1ZUUA 2RQVA 3EG1A 3I5SA 2DRMA 5I22A 4JJBA 3QWYA 1TUDA 1SHGA 1X2QA 2YUOA 1QCFA 1B07A 2ESWA 2HCKA 4OMPA 4LNPA 1X6BA 3VRZA 4GBQA 2DLPA 1WX6A 2DL5A 2RPNA 5EC7A 2W0ZA 3PVLA 2CH4A 4J9FA 2M0YA 1EFNA 2L2PA 2FRYA 3EHRA 1CKBA 1WXUA 4J9CA 3TSWA 4Z8AA 1BBZA 2O31A 2GGRA 1AVZC 2YSQA 5I11A 1PKTA 3I5RA 1YNZA 1I0CA 1AZGB 4Y92A 2RN8A 1GFCA 3M0PA 1K1ZA 2LZ6B 2W10A 2J6KA 5HCKA 1CKAA 1AZEA 1I1JA 1GBRA 2KT1A 1JO8A 1QKWA 1MV0B 2CT3A 4AG1C 2KEAA 1SPKA 1GFDA 1M3AA 1U06A 2EW3A 3I9QA 5FWCA 2JT4A 4JZ3A 2ED1A 3FJ5A 3TVTA 2HDAA 2IIMA 3C0CA 4RTUA 4IIMA 3UF4A 2JMCA 2EVRA 4FSSA 1OPLA 2O9VA 2JM8A 2J7IA 4DEYA 1JXOA 5ECAA 2CSIA 2EYWA 1UUEA 4OMOA 2D0NA 2FEIA 3H0FA 2KE9A 1T3LA 1KJWA 2CT4A 1SHFA 1NLPC 3EG3A 4OMMA 1BU1A 1TUCA 3KFVA 3EGUA 4WCIA 2PZ1A 2EGAA 2NWMA 1RUWA 1H8KA 2DL4A 1Z9QA 3VS6A 4X1VA 2JW4A 2FRWA 2YUPA 3RNJA 1M3CA 2EPDA 3VS5A 2F2XA 4J9IA 3UA6A 2FPDA 2BTTA 3ZL7C 4OMNA 2GBQA 1PWTA 4ESRA 2G6FX 2KGTA 1VYTA 2M51A 1VA7A 1ZUYA 2KROA 2V1RA 1IO6A 5FWBA 2OI3A 2O2OA 1TG0A 1GL5A 1AOJA 2EGCA 3H0IA 3VS4A 2F2VA 1JU5C 1VYUA 1X2KA 2C0IA 3PE0A 1UJYA 2CUDA 2RQRA 2CDTA 1OEBA 1NLOC 4AFSC 2D1XA 1ARKA 1WIEA 3NGPA 1ZUKA 4QT7A 1A0NB 1AD5A 1RI9A 2JTEA 1E6GA 2DA9A 1AEYA 1T3SA 2SEMA 2LJ1A 2ABLA 3SHWA 4CC7A 2F2WA 1WXBA 2C0TA 1AWXA 1LCKA 2KRNA 1UGVA 2FPFA 1QKXA 3NPFA 2DRKA 1Z9ZA 1YWPA 2L3PA 1J3TA 1WYXA 2PTKA 1NYGA 4HXJA 3GBQA 5IXFA 1QLYA 2GNCA 2KNBB 2J6OA 1SRMA 2AZVA 2MOXA 1PRMC 1QWFA 1NM7A 1UHCA 4F16A 4E6RA 2DX1A 3VRYA 1KIKA 4F17A 2ROLA 2EGEA 2A36A 2RMOA 3REAB 2A28A 1MUZA 2NUZA 3M0SA 1UDLA 4HVVA 2DYBA 4EIKA 1G2BA 1GCQA 2L0AA 3UATA 2HEQA 4RTZA 5FW9A 1NEGA 2ED0A 3PVQA 2EYYA 1WA7A 2HBWA 3TSZA 2A08A 2RNAA 3LH5A 2DNUA 2MCNA 1ZBJA 1NEBA 2AZSA 1X27A 1KFZA 1GCPA 2OAWA 2VKNA 1WDXA 1K9AA 4IIOA 2YUNA 1W1FA 3UA7A 2K6DA 1UG1A 1T0HA 4CC3A 1UHFA 2DVJA 2JM9A 1X43A 2MIOA 3EG0A 3REBB 1S1NA
chains in the Genus database with same CATH superfamily
1PSEA 4HVWA 4M78A 1M1KC 2CP5A 1H641 2YDLA 3M5AA 3JB9D 3P8DA 2PQWA 3JCMd 2D8HA 4ZGDB 4RMOA 1U3OA 1WQ7A 2VV5A 1WHMA 5FROA 2DYIA 1B7TA 4JZ4A 3R6OA 3JCMP 2YXYA 2K7AA 2QGFB 3JCMV 3G1JA 4MZTA 2RM4A 2VGMA 1VQ8A 2CP3A 4RCBA 2EQKA 3CCSQ 2J6FA 4LE9A 3JV3A 1XOVA 2BUDA 2F5TX 1VQ8T 3M56A 5DLQE 4PK4A 2COZA 3RIRA 3SWNA 4PJOB 1WZOA 4OMQA 1WHLA 3PFSA 4AMCA 1B3QA 3QKJA 5L23A 2MI6A 2XD0A 4X34A 5CCAA 3CD6Q 2QEXQ 1K9MC 3BE3A 3URGA 3ZFJA 4HCCA 4J83A 1YP5A 3TEEA 2GTOA 1VQPA 4M7DG 2ZPFB 5KYWA 2L3RA 2ECZA 5HKCA 4PLIA 3RKXA 3ER0A 3VKIA 3EG9B 1VQPT 4M7AB 3QWXX 1AWOA 1ZX6A 7AT1B 4FL6A 4NOYA 4XQ3A 3X24B 4BUGA 1KSWA 3OSVA 3HFOA 4D8KA 4L59A 3EH2A 2FPEA 4PLLA 2DXBA 4EMKC 3PMTA 5LJ3d 1M1KR 4QVDA 4V2SA 2QDLA 2K9GA 3GNGA 3OYEA 2ZPEB 3WVDB 1V1CA 5A0DA 4DEXA 1Y07A 3VS7A 1RLPC 2SRCA 1OI1A 1M2VB 4IUPA 1M30A 5IT9E 1H3HA 3M0TA 4RKUE 4DOVA 1YN8A 3LYIA 5GAMe 2AK5A 3RKWA 1TH7A 3BDUA 4KT0E 4J9EA 3THKA 2OTLA 4BACA 3CCJA 3E2UA 4D6WA 4FYYB 4JJDA 3H0HA 4N4HA 2WACA 4IURA 4IUTA 4KULA 4QW2A 2CZ7B 2RO0A 3NMZC 3OBYA 2OTLT 1QVFA 5LJ3j 4PJNA 3CCJT 2LC4A 1ABOA 3L42A 4HCBA 5GAOq 4XTUA 2NUPA 4J9DA 1K9MR 2VVKA 2LT1A 2QG9B 3BW1A 3META 1FX7A 1BB9A 4LUDA 3H6ZA 1HD3A 2RQUA 3OW2P 5J3BA 5CKDA 2P4RA 1LOJA 2BZ8A 4QQGA 4C8QG 3CPWA 2HBPA 1VYVA 1LJOA 1G3SA 5GAMf 1BK2A 1EX4A 4RTTA 4M78B 4DBFA 4ZGJB 2K3XA 2FZKB 4F04B 4AFQC 3CC7A 1ZSZC 4C92A 2RQVA 3E1SA 4C8QA 2DRMA 2RHYA 4BE2A 5KE3A 5I22A 4JJBA 3CC7T 1WHHA 1QCFA 1SKUB 4HCZA 3CEYA 2HCKA 4LNPA 1X6BA 3VRZA 4C0DB 5HK3A 3MEUA 1VQLQ 4FYXB 1PM3A 3G6EA 1W2BP 5LJ5d 2CH4A 4A4FA 5A0GA 2LTOA 2NUTA 1G8XA 1CKBA 1WJSA 3G6ET 5IAYA 1BBZA 3T9NA 2YSQA 1YCYA 1OU8A 1R0CB 2MMPA 2VYTA 3SWNB 3O8VA 1MNEA 1YBYA 1VQ7Q 2W10A 1VUBA 5HCKA 2K2VA 1AZEA 1D1AA 2QXFA 2DD4A 3JCMQ 4FT2A 3RESA 4XK8E 1M3AA 1NPPA 4M77G 4IUVA 2EJFA 2P0PA 5KYWB 1PG5B 4PNOA 3OMCA 2DETA 2HDAA 3CCRQ 5LJ5j 1NPRA 5KCOA 4LDUA 4M77A 4NL3A 1LNXA 1YITT 3H0FA 1RABB 2CT4A 4F7UE 3HP9A 1NLPC 4Y28E 4WTOB 3EG3A 2JN0A 2D6FA 2EGAA 2NWMA 8AT1B 4BDZA 5GMKi 1Z9QA 3CCSA 3LWHA 5A0LA 2GFAA 3RNJA 1VIFA 2F2XA 5GMKj 3ZL7C 1ZQ1A 2EJGA 4ESRA 3RMQA 3JCMh 2KGTA 5CO7A 2DAQA 2KROA 3CCST 2V1RA 5FWBA 3SDZA 2V8JA 5I2MA 4M75G 4C0GA 3CD6A 3RERA 3QO3A 3G71Q 4J6YA 1JU5C 2A3LA 5FU6C 2QEXA 1YHQQ 2X4WA 3CCUQ 3JCMb 2CDTA 3EFOB 3CD6T 4LDWA 4M75A 1ARKA 2QEXT 1WIEA 2LRQA 1ZUKA 3G4SQ 1N9SA 2WSEE 5GANe 1RI9A 2O01E 2NLUA 2M0OA 3FEOA 1AEYA 2NUPB 3RR6A 2SEMA 4PFPA 1Q86U 1H3ZA 2C0TA 3SB2A 1AWXA 4FU6A 2FPFA 2LCLA 1G3YA 1DJ7B 1R77A 1M5Q1 4JRQA 2E4HA 5KYYA 1N9RA 1NBEB 2RK1A 4ME7A 2PTKA 4M7DC 1Q7YU 2ZPGB 1M90U 4IUUA 3KBGA 3JSCA 4M7DE 2XDDA 1ZHIA 2D0QB 3VRYA 4FIBA 4GY5A 4F17A 4C8QB 4J7FA 2ROLA 1EZZB 2A28A 2Y4XA 1MUZA 3HL8A 1KC8U 4C5HA 5GANf 4JLIA 4PJMA 1ZA2B 5LJ3h 2HEQA 4PJOF 3FJPA 2KAFA 1WA7A 2HBWA 3TSZA 2NUTB 5IN1A 4XU1A 2VKNA 4IIOA 1M2OA 3UA7A 3CC4Q 1QVFS 1UHFA 2DVJA 1Q81R 2PUOB 2E6ZA 1S1NA 3M0QA 2BE9B 4BY6B 1ZLMA 4KUDK 2KYMA 2DILA 1PSFA 3ZEHA 1C6VX 4KH0B 4RTVA 1D3BA 1ZSGA 2MF2A 4ATOA 5A2QE 2YRDA 1RADB 2A37A 3QZ5B 5FU7B 5GAOr 5KCHA 4HVUA 2DJZA 5GAN4 3A1PA 1MV3A 2YLBA 3JCMe 2LX9A 2DBMA 3L2ZA 3VS3A 1PHTA 4M77B 2K79A 2DMOA 5GAOl 4LN2A 3BDLA 2K3BA 1GXIE 4MZPA 5IHIA 1TWBA 2KR3A 2PVDB 4M4ZA 2A7YA 4JDSA 1F1BB 2CUBA 2KXDA 2DXTA 1WPYA 3MO8A 4JUVA 2M02A 5AT1B 1NJIC 4CC4B 1VQLA 2LNHB 3L2UA 1WHKA 2XI9A 2RI2A 4FYWB 3H41A 1JJ2A 1PKSA 4FW1A 1VQLT 4C8QE 1RAFB 4KH1B 2OTJQ 3OYMA 4FYVB 3GIBA 1MNDA 2FZCB 1VQ7A 4BD3A 4RTWA 2YLCA 2X51A 2E64A 1TXQA 4LDYA 1OZ3A 1OV3A 1IRXA 3JCMf 2P0KA 3E9FA 2MAMA 1VQ7T 4E7IA 5LJ5h 1X69A 1Y0MA 2QI2A 2XG8D 2E6NA 4M75B 3FIFA 3JCMc 2KRSA 1GCQC 2K2MA 3CCRA 4CC2A 4AG2C 4L6V5 4F7UF 3GLXA 1K0XA 4J9GA 2DTOA 3CCRT 1PNJA 3LX7A 1E7OA 2CH4W 4A4EA 3FC3A 2E3HA 2DTHA 4R0KA 4Z02A 1YIJQ 1RL2A 1NG2A 2EBPA 2V1QA 4QQ6A 4M78F 5LJ3e 1BKBA 4RTXA 1XQHA 5KYYB 5GAOp 5GMKh 2E5QA 3QUIA 4Y91A 3BY7A 3HTRA 2DL8A 3QHSA 3MHXA 2AIRB 4RUGA 1YFNA 2F1LA 3I55Q 2KRMA 2HKNA 2QYZA 3WXMB 1W4SA 1WLPB 2XDPA 2KYBA 2E12A 5CQYA 2LQNA 2V26A 2IPOB 3QG1A 4C0ZA 4E7LA 3FDRA 1HK9A 2KY9A 3LH0A 4BDYA 3G71A 1H92A 1V29B 5D6YA 3DLLA 1YJNQ 1YHQA 1N6AA 3CXCP 3OB9A 2JMAA 3HSBA 3CCUA 2OX7A 2I2LA 3CCMQ 2RHXA 2KMTA 6AT1B 3G71T 2NYSA 1OZ2A 1Y71A 2EKHA 5FRMA 3DLMA 1YHQT 4KRTA 1NJIU 1WFWA 3G4SA 3CCUT 5LL6S 1SSHA 1QP3A 1M8MA 3EFSA 5D6XA 3OYKA 4B6MA 1BCMA 2PNIA 2CP7A 4NS5A 3G4ST 1M9SA 3U23A 2JS0A 2C0OA 2DJQA 1HSQA 1ZUUA 2DPPB 3I5SA 3VYGA 1C0MA 3QWYA 1TUDA 1D3BB 1X2QA 4DBHA 4M7DF 2ESWA 2EFIA 2EQUA 3QXEB 4C5IA 4OMPA 2PVOB 4PJOD 2QQBA 4FM4B 5GAN5 2RPNA 2P4TA 2M0YA 2DXCA 3OYCA 3OYYA 1EFNA 4J9CA 3RDVA 2Y4YA 1KQSP 1BI1A 2GGRA 1UGRB 3QYHB 1PC0A 1PKTA 3I5RA 4E7SA 1VQNQ 4PFZA 2JTMA 3M0PA 1I5OB 4YTLA 5LJ5e 1WNLA 4AT1B 1QCOA 3OW2A 1GBRA 1JO8A 1WJRA 1D0YA 2CT3A 4AG1C 4N4GA 1VQMQ 1GFDA 4B9XA 1UEBA 4JZ3A 2Y90A 3TVTA 2COWA 2XDBA 2IIMA 3C0CA 4RTUA 4E7ZA 2JMCA 2EVRA 4FSSA 3OYNA 2O9VA 2JM8A 2J7IA 3L2WA 2QK0A 4HKEA 1JXOA 4RG8A 4DEYA 5ECAA 3OYFA 2CSIA 3CC4T 2EYWA 1KD1U 2KDSA 4PJOC 1MGQA 2R58A 1T3LA 5GMKe 3M4YA 2JOYA 3NTKA 1SHFA 3QYGB 1S72Q 4OMMA 1TUCA 4PJOE 4N0AC 3S6WA 4WCIA 2PZ1A 1W2BA 5L8RE 1RUWA 1H8KA 3DKMA 3VS6A 1LVKA 2JW4A 2FRWA 2YUPA 3OYAA 3VS5A 2PVGB 1Q95G 5LJ5f 3CBPA 2GBQA 3HPWA 2KI7A 2M51A 1BI3A 4XAXB 2Z0WA 4M7AC 1UGSB 2K5LA 4IUQA 2O2OA 3NFCA 4ZTFA 2RJFA 1TG0A 4C92G 4M7AE 2EGCA 1JBMA 5GAN7 1IGQA 4OGEA 4C8QF 1NE8A 1X2KA 2VGNA 1KK7A 2C0IA 3PE0A 5KYUA 1UJYA 1IHWA 2RQRA 2COYA 3C94A 5J26A 1NLOC 4AFSC 2BKDN 1JJ2S 3CPFA 3QDRB 1A0NB 3ME9A 3UT1A 2VB6A 3N5BB 2OTJT 3EGDA 2ABLA 3OYLA 1OX9A 3SHWA 2RB6A 1X75C 1PCXA 4N4IA 1WQWA 3MP1A 3CMEQ 3PIOA 1IB8A 1Q86C 4KUIA 1WYXA 1NYGA 4HXJA 3GBQA 2DVEA 5IXFA 4EMGA 4OB1B 3CCEQ 2AZVA 1PRMC 3MCAB 1UHCA 1Q7YC 5DLOA 4E6RA 1M90C 4XTWA 2LVMA 5HK0A 2RI5A 5GAMg 1YIJA 3JCMJ 3PGGA 4M77F 1YITA 3OSSC 4EIKA 1GCQA 1Y7XA 2L0AA 1YIJT 4CRIA 3UATA 4EMHA 3MEWA 1KC8C 2LCCA 2RNAA 3JCMW 3LH5A 3I55A 5CKBA 2WSCE 1WDXA 3QJ6A 2RHIA 2YUNA 2RD1A 2XKOC 4CC3A 4M78C 1X43A 3I55T 2EJ9A 5FRNA 1T0JA 2QDYB 2ZAEA 5GAOm 5EG2A 1YJNA 4M78E 1KQ2A 5C6SA 3A8HB 2DE0X 4MZMA 4JS4A 1YJ9Q 3EHQA 2RJEA 5D6WA 3CMAQ 1MMGA 1K8AC 1N5ZA 1Q82U 2XU8A 4M7DD 1TUGB 1HYOA 4OF1A 2RHZA 3M0RA 3VS2A 1YJNT 2DO3A 5M9OA 4C0DC 3A5ZB 3C95A 2MWOA 4GLKA 8ATCB 3CCMT 1E6HA 1RAEB 4OGCA 3OYBA 2LT4A 2KVQG 2ZZDA 4M75F 4JLGA 1N27A 4VUBA 5IH2A 2KXCA 3MEAA 5GAN6 3CBOA 3SWNC 1NZ9A 4ELZC 4E2FB 1KHIA 3MP8A 1BI2A 1Q86R 4OB2B 1JEGA 2ZPBB 4EPCA 3MJXA 4PJJA 2J05A 3OS0A 4D8DA 2GQIA 4XTVA 5IHNA 1Y96A 2YRVA 3JB9G 1WHJA 3LW5E 2EWNA 1VQ5Q 1M1FA 3AT1B 1Q7YR 1U5SA 2VWFA 3H8ZA 3X20B 3DB3A 1KHCA 1M90R 5CAIA 5GJWB 3EFRA 3V8KA 1CSKA 5GAN8 1SEMA 1VQNA 1I07A 2GTJA 3FLGA 1TOVA 3KXTA 1FMKA 2VUBA 4DOWA 4A4GA 3X25B 1VQNT 1G83A 2LX7A 1KC8R 5KYUB 4RCCA 5KYXA 3OW2S 1VQMA 1JQQA 4C92B 4BE1A 4GLMA 1PRLC 5CKHA 2JS2A 1D0ZA 2CP2A 2DIQA 2BE7D 1I8FA 1RAIB 4ANJA 1GRIA 2KT8A 4X9CA 1VQMT 4F14A 1JXMA 2BZXA 1W70A 1YI2Q 2YHTA 4EMKA 5GJVB 3S3OA 2K57A 2M9UA 2HQXA 2GQVA 2FG0A 2AKKA 3D7SB 4JJNK 4QVZA 2EQMA 2RH2A 1XNIA 4MMLA 4R56A 4LUEA 1X6GA 2HL3A 2HNIA 1S72A 2KSSA 2BZYA 2DF6A 3JRZA 4HA8A 4C8QD 3IQLA 1VIEA 4JJCA 3NTHA 5IHKA 2HL5C 2LCSA 1K8AU 2JTFA 2DERA 1S72T 2XICA 2L3QA 1B34A 1W2BS 1SF9A 2CZ6B 4J7IA 1UFFA 2R5AA 4M7AF 2X3XD 3QSUA 2DL7A 4TVRA 3HHTB 2E70A 2LQWA 3V8LA 2ROTA 3SFMA 2MWPA 4K11A 2DFUA 1MMNA 3E9GA 3I35A 2KBTA 2J06A 3RBBB 3EG2A 2L5QA 4A4HA 1D1BA 4J9HA 3OYDA 1Y57A 4FT4A 4KGVB 3PMIA 2VXEA 5GANg 2DL3A 2EQIA 2X35A 3O5ZA 2JNGA 2RJCA 1G3WA 2PU9B 2O88A 4JPBW 1N8RU 1RAGB 4AFZC 1VQ9Q 1FXXA 2QA4Q 4C8QC 1M27C 2C06A 1OPKA 3EG1A 3M55A 2F5KA 1MHNA 1QVGP 2CZ1B 3S3MA 4M77D 4C92E 4QVCA 1ZSZA 3CCVQ 4A54A 2EQJA 2YUOA 1B07A 1R8OB 4OP0A 4BI3A 3OA6A 3CMET 3TCJA 3OYJA 4GBQA 2DLPA 2E10A 1WX6A 3VUBA 2A0FB 2K3YA 3LGLA 5EC7A 5KH6A 3PVLA 1M2VA 4J8OA 3NTIA 3M54A 2CYZB 2FRYA 3UWNA 3EHRA 3TSWA 2X4XA 2LDMA 3CCET 2O31A 3ZBDA 1AVZC 2G3RA 4C5GA 5I11A 3A8LB 1G3TA 4BY6C 4ZGEB 5GAN3 1YNZA 3LLRA 3QZ9B 4Y92A 2RN8A 1GFCA 3PTAA 1K1ZA 1FWZA 2LZ6B 3CXCA 2ZGWA 2J6KA 1Y96B 3GF5A 3HFNA 1U06A 3MPUB 2EW3A 3I9QA 5FU7C 5FWCA 4J6XA 2ED1A 3FJ5A 3EGXA 4O6JA 1I81A 4F7UG 1IHVA 2VASA 2GCXA 4IKFA 4IIMA 4M77C 4A4KA 3DB4A 5I21A 2K5FA 4M75D 1OPLA 2CP0A 2FVUA 2FZGB 4OVAA 4RG2A 2EIFA 2L8DA 4DBRA 4M77E 4F7UA 4OMOA 2FEIA 4O5VA 1YJ9A 2EKOA 3OY9A 1OYXA 1KJWA 5KYXB 2MYSA 2VC8A 2WSFE 4UC4A 3CMAA 2ATCB 3CCLQ 2QQSA 2FL7A 1KD1C 1YJ9T 3JCMg 3KFVA 3CMAT 2QASA 3QIIA 3SD4A 1ZBXA 1NJIR 3V7RA 1QVPA 4EMKB 1M3CA 4BI4A 1SSFA 4J9IA 4QQDA 1KQSA 4OMNA 1YJWQ 3FB9A 2G6FX 1ZUYA 2RJDA 3UPUA 3Q1JA 3VU3C 1IO6A 2OI3A 4X9DA 1M4ZA 3VYHB 2DZCA 4XTYA 4ZTJA 5LJ3f 3H0IA 3PIPA 4LDVA 2F2VA 3GP8A 1K73C 5CR2A 4MMKA 3TU4K 1VQ5A 1B34B 2CUDA 3JAME 4M75C 5I2SA 5C0MA 1XTDA 3I56Q 3EH1A 3MP6A 1VQOQ 4CI0C 2ZPHB 3NGPA 3M57A 2QTXA 4QT7A 1VQ5T 4M75E 1VQKQ 3MKDA 2JTEA 4WF2A 3BFMA 1ACMB 1E6GA 4A53A 2HKQB 3RMSA 4ELYC 2LJ1A 2CS7A 2GF7A 2RA2A 4CC7A 2CKKA 4BB7A 3J7AF 1QKXA 3QPHA 1G5VA 2DRKA 1Z9ZA 2ZCFB 3RKYA 1YWPA 2L3PA 5DY9A 2EYQA 3OS1A 3OQ5A 3J81E 3M53A 3A8GB 3L2QA 3EAEA 3JCMX 3JB9J 2GNCA 1YI2A 4M7DA 1P92A 2KNBB 2J6OA 1SRMA 2QAZA 1QWFA 1NM7A 4M7AD 1OQKA 3VV0A 1V76A 4XTXA 2DD5A 2DX1A 2B8AA 4Q5WA 1YI2T 5LJ3g 3F70A 1QMCA 2LQKA 2RMOA 2YRCA 1ZSZB 1KD1R 3REAB 4PFOA 1PD0A 3INZA 2NUZA 3CC4A 2KQWA 1LPLA 3G7ZA 4HVVA 1G2BA 1OULA 4LDXA 1BI0A 5FW9A 3AHUA 1NEGA 2EYYA 1BIBA 3CCQQ 1QVGS 4LD6A 1NEBA 1WJQA 2AZSA 1X27A 2X9HA 1M1KU 1KFZA 2OAWA 1K9AA 1AHJB 1W1FA 2DXUA 2K6DA 1UG1A 2CP6A 2MIOA 2FB7A 3EG0A 3GNFB 1VOMA 3REBB 2QTVA 1QP2A 1K73R 3OYHA 1AWWA 3VS1A 4OB0B 3EFOA 3P8BB 2OAUA 2LJ3A 1K76A 1VQ6Q 2HQHA 2RQWA 3SEMA 1IREB 2LMJA 1UJ0A 2ENMA 1K73U 3EGXB 2I0NA 2P84A 2PUKB 3TQ7P 2OJ2A 1SRLA 2DBKA 1Q82C 1VQ9A 2HSPA 3QDFA 1WXTA 4C92F 3V7CA 2O9SA 3HRUA 2QA4A 5CKEA 3CC2Q 5KE2A 1QWEA 2X3WD 4F7UB 1VQ9T 1K0SA 2JJ9A 1QW1A 1HJDA 3CCVA 2QA4T 1K9MU 2OTJA 2YT6A 1RLQC 2LJ0A 2RK2A 3KUFA 3M9QA 2EYZA 3ULRB 1M8VA 3CCVT 5CQXA 3L2RA 5GANh 2YWWA 2CREA 4HCKA 5IXBA 4J9BA 4Z89A 5FLXE 2IVWA 2RF0A 4M78D 3JB9H 1OOTA 1WI7A 2E1HA 2H8HA 4OMLA 4FCYA 3A98A 5DM7R 1QVFP 5LJ5g 2MPXC 4FW2A 1D1CA 2HD0A 2D8JA 5GAN2 2EYXA 2YUQA 4XU0A 1RI0A 4XTZA 1W6XA 2FHDA 5GMKm 3CXCS 4XU3A 5FU6B 1FMWA 5AYFA 2B86A 2O4XA 1NYFA 2RHUA 3PT9A 4KBMB 3P8HA 4II1A 2E3IA 1IXDA 3M0UA 1OU9A 4AFUC 1UECA 2M1HA 1QCNA 5GAMd 2LP5A 2EAYA 4ORZA 1UGQB 1X6OA 1JRIA 3CPWP 2V8IA 2AKLA 5CK9A 3NHNA 4PKCC 3PNWC 1K4US 3OBWA 1FYNA 3QJYA 3CCLA 2HQEA 3WVEB 4A63B 2L3SA 2HSEB 2FO0A 1SG5A 3MEVA 2CSQA 1O75A 1YCSB 1VQ4Q 1Q82R 2JXBA 1UE9A 1HXDA 3M58A 3RUXA 4OMFB 3CCLT 4M7DB 1TTHB 1R0BG 2RQTA 1JB0E 3VS0A 1YJWA 3CCMA 3V7SA 3CQTA 2GFUA 4JRIA 3R6NA 5GAMj 1KQSS 2QQRA 4E7KA 5D7UA 1YJWT 1D0XA 5KYNA 1U1TA 4RTYA 2V8KA 4ZNXA 2DKGA 3L1AA 2DM1A 5CKFA 3I56A 4Z88A 4JRKA 1VQOA 1OX8A 3A8OB 1BYMA 1UGPB 1QQJA 2QQAA 1VQKA 4LD9K 1GBQA 1UTIA 3I56T 1Q81C 2XMFA 1ABQA 1VQ8Q 4R55A 2E5KA 1VQOT 1YWOA 1M3BA 1WGSA 5HY6A 4PL6A 1I5LA 1EIFA 1VQKT 1RAAB 1AWJA 1TSFA 1N8RC 3JB9F 9ATCB 3OYIA 1SHGA 4P5NA 1AT1B 2DZ9A 2HMAA 1PD1A 4XU2A 4NL2A 3L2VA 2IG0A 2DL5A 1X01A 2W0ZA 2X4JA 2HZYA 4KGXB 2DEUA 3QBYA 4J9FA 3LWIA 3OS5A 1VQPQ 2L2PA 1WXUA 4HT8A 4QKUA 4EDUA 3CBMA 4Z8AA 1BIAA 3GOXA 1BCOA 1I0CA 1AZGB 2JUFA 2QQ9A 4J6WA 3LGFA 3VUZA 2AT1B 4MDWA 1CKAA 1I1JA 4E7JA 2KT1A 3J80E 1UB4A 3GPLA 2JVVA 1QKWA 3EGDB 5J39A 1MV0B 2KEAA 1O9SA 1SPKA 3CCQA 1K8AR 5GMKl 1TS9A 4DQ2A 2JT4A 1C1AA 5GAOn 5CIUA 4PJLA 2MK5A 3UF4A 4C92D 4JS5A 3CCQT 1FMVA 4PJOG 4HT9A 1QVGA 1RACB 1UUEA 2D0NA 3TREA 1MMAA 2KE9A 3HRSA 2D9TA 2XIDA 1VQ6A 4PJOA 3H9NA 2O4XB 3OMGA 1BU1A 3EGUA 3OYGA 2L89A 1D09B 1VQ6T 2OTLQ 2DL4A 4DBQA 3UDCA 2E65A 2H3JA 4LXCA 4N0AA 4BE0A 1IGUA 3CCJQ 4FSXA 4X1VA 4M7AG 2DEQA 2EPDA 2XK0A 4B9WA 3CC2A 3UA6A 2FPDA 2BTTA 1N8RR 1PWTA 1TU0B 1Q81U 1VYTA 1VA7A 3M59A 2X4YA 2H3EB 3CC2T 3EG9A 4M7AA 1RAHB 2E41A 1GL5A 1AOJA 1KG1A 5GANd 3VS4A 3CPWS 1VYUA 4JRPA 4C92C 2DIGA 2ZPIB 1MMDA 4OB3B 1WHGA 3V8JA 1OEBA 4BI8B 4C0FA 3CMEA 2D1XA 2P0QA 2KK4A 4ZN3A 1AD5A 3ASKA 2R57A 4KGZB 2AHJB 2DA9A 3FRNA 3M4GA 3OS2A 3E19A 1T3SA 3X26B 4E47A 5CVIA 2HAXA 4MDXA 4J5YA 2VXFA 4DA4A 2F2WA 2CGHA 3CCEA 1WXBA 3CC7Q 2DK3A 4L5GA 2JZ2A 1LCKA 2KRNA 1UGVA 3NPFA 2XHCA 5GANj 3C12A 1M1GA 1U1SA 2BIVA 1J3TA 1I4K1 1KQ1A 4E7HA 1IZ6A 2LQ8A 2DTIA 2FYKA 2RI3A 1XJWB 3G6EQ 3S3NA 2K5IA 2MOXA 3X28B 4F16A 1ZA1B 1KIKA 2EGEA 2A36A 3HRTA 2M16A 2F69A 3M0SA 1UDLA 2CZ0B 2LNVA 1VQ4A 2DYBA 3VJPA 5GAMh 4RTZA 3HKSA 1U8RA 3A8MB 2QGGA 2ED0A 2R5MA 3PVQA 1VQ4T 2A08A 2MCNA 2DNUA 1ZBJA 2K4YA 4M78G 4ZN1A 1GCPA 3JB9I 1JJ2P 3C4SA 1T0HA 2JM9A 4C5EA 1YITQ 1QLYA
chains in the Genus database with same CATH topology
3M0QA 4HVWA 1T0JA 1ZLMA 2KYMA 2YDLA 1AWWA 2DILA 3VS1A 2D8HA 2DE0X 3EHQA 1U3OA 2LJ3A 1N5ZA 1K76A 4RTVA 4JZ4A 3M0RA 1ZSGA 2RQWA 3VS2A 3SEMA 2K7AA 2LMJA 1UJ0A 2ENMA 2A37A 2I0NA 1E6HA 2OJ2A 4HVUA 1SRLA 2DBKA 1MV3A 2HSPA 1WXTA 2DBMA 3VS3A 2O9SA 1PHTA 2J6FA 4LE9A 2K79A 3JV3A 1XOVA 2DMOA 5IH2A 2KXCA 4LN2A 1QWEA 2X3WD 2K3BA 1K0SA 5IHIA 2KR3A 1HJDA 4M4ZA 1JEGA 4OMQA 2YT6A 1RLQC 2LJ0A 2CUBA 2KXDA 1B3QA 2J05A 5L23A 2EYZA 4D8DA 2GQIA 3ULRB 5IHNA 4CC4B 2LNHB 2CREA 4HCKA 5IXBA 1U5SA 4J9BA 2VWFA 1YP5A 3H41A 4Z89A 2GTOA 1PKSA 5GJWB 2RF0A 2ECZA 1OOTA 1WI7A 2H8HA 1CSKA 4OMLA 1SEMA 3A98A 1I07A 2GTJA 3QWXX 4RTWA 1FMKA 1AWOA 2D8JA 2EYXA 1ZX6A 2YUQA 1OV3A 1W6XA 1G83A 2LX7A 1KSWA 1JQQA 1X69A 1Y0MA 4GLMA 4D8KA 1PRLC 2B86A 2JS2A 2FPEA 1NYFA 1GRIA 2KT8A 2KRSA 1GCQC 2K2MA 3M0UA 4AFUC 4CC2A 4F14A 1JXMA 2BZXA 4AG2C 1W70A 1UECA 2QDLA 2LP5A 4ORZA 2K9GA 5GJVB 2FG0A 1K0XA 1V1CA 2AKKA 2AKLA 4J9GA 1PNJA 4DEXA 3NHNA 1E7OA 2CH4W 3VS7A 1RLPC 2SRCA 4LUEA 4R0KA 1K4US 1X6GA 1FYNA 4A63B 1M30A 1NG2A 2EBPA 3M0TA 1H3HA 2V1QA 2L3SA 1YN8A 2FO0A 4RTXA 2AK5A 2CSQA 2BZYA 2DF6A 3IQLA 1YCSB 4J9EA 2JXBA 1UE9A 4JJCA 3THKA 5IHKA 2LCSA 2DL8A 2L3QA 4JJDA 2RQTA 3H0HA 3VS0A 4RUGA 3NMZC 1UFFA 2KRMA 3CQTA 2X3XD 3R6NA 2DL7A 1ABOA 1WLPB 2KYBA 2LQNA 2LQWA 2ROTA 4J9DA 4K11A 4RTYA 2VVKA 1H92A 4ZNXA 1BB9A 4LUDA 3I35A 2JMAA 2KBTA 2J06A 3RBBB 2DM1A 3EG2A 1HD3A 2RQUA 4Z88A 4J9HA 1Y57A 2EKHA 2P4RA 2DL3A 4KRTA 1WFWA 2EQIA 2BZ8A 3O5ZA 1GBQA 1UTIA 1SSHA 1ABQA 2XMFA 2O88A 1VYVA 4JPBW 2E5KA 1M8MA 1BK2A 4AFZC 1YWOA 1M3BA 4RTTA 2PNIA 3U23A 1M27C 2JS0A 4AFQC 1AWJA 1OPKA 2C0OA 2DJQA 1HSQA 1ZUUA 2RQVA 3EG1A 3I5SA 2DRMA 5I22A 4JJBA 3QWYA 1TUDA 1SHGA 1X2QA 2YUOA 1QCFA 1B07A 2ESWA 2HCKA 4OMPA 4LNPA 1X6BA 3VRZA 4GBQA 2DLPA 1WX6A 2DL5A 2RPNA 5EC7A 2W0ZA 3PVLA 2CH4A 4J9FA 2M0YA 1EFNA 2L2PA 2FRYA 3EHRA 1CKBA 1WXUA 4J9CA 3TSWA 4Z8AA 1BBZA 2O31A 2GGRA 1AVZC 2YSQA 5I11A 1PKTA 3I5RA 1YNZA 1I0CA 1AZGB 4Y92A 2RN8A 1GFCA 3M0PA 1K1ZA 2LZ6B 2W10A 2J6KA 5HCKA 1CKAA 1AZEA 1I1JA 1GBRA 2KT1A 1JO8A 1QKWA 1MV0B 2CT3A 4AG1C 2KEAA 1SPKA 1GFDA 1M3AA 1U06A 2EW3A 3I9QA 5FWCA 2JT4A 4JZ3A 2ED1A 3FJ5A 3TVTA 2HDAA 2IIMA 3C0CA 4RTUA 4IIMA 3UF4A 2JMCA 2EVRA 4FSSA 1OPLA 2O9VA 2JM8A 2J7IA 4DEYA 1JXOA 5ECAA 2CSIA 2EYWA 1UUEA 4OMOA 2D0NA 2FEIA 3H0FA 2KE9A 1T3LA 1KJWA 2CT4A 1SHFA 1NLPC 3EG3A 4OMMA 1BU1A 1TUCA 3KFVA 3EGUA 4WCIA 2PZ1A 2EGAA 2NWMA 1RUWA 1H8KA 2DL4A 1Z9QA 3VS6A 4X1VA 2JW4A 2FRWA 2YUPA 3RNJA 1M3CA 2EPDA 3VS5A 2F2XA 4J9IA 3UA6A 2FPDA 2BTTA 3ZL7C 4OMNA 2GBQA 1PWTA 4ESRA 2G6FX 2KGTA 1VYTA 2M51A 1VA7A 1ZUYA 2KROA 2V1RA 1IO6A 5FWBA 2OI3A 2O2OA 1TG0A 1GL5A 1AOJA 2EGCA 3H0IA 3VS4A 2F2VA 1JU5C 1VYUA 1X2KA 2C0IA 3PE0A 1UJYA 2CUDA 2RQRA 2CDTA 1OEBA 1NLOC 4AFSC 2D1XA 1ARKA 1WIEA 3NGPA 1ZUKA 4QT7A 1A0NB 1AD5A 1RI9A 2JTEA 1E6GA 2DA9A 1AEYA 1T3SA 2SEMA 2LJ1A 2ABLA 3SHWA 4CC7A 2F2WA 1WXBA 2C0TA 1AWXA 1LCKA 2KRNA 1UGVA 2FPFA 1QKXA 3NPFA 2DRKA 1Z9ZA 1YWPA 2L3PA 1J3TA 1WYXA 2PTKA 1NYGA 4HXJA 3GBQA 5IXFA 1QLYA 2GNCA 2KNBB 2J6OA 1SRMA 2AZVA 2MOXA 1PRMC 1QWFA 1NM7A 1UHCA 4F16A 4E6RA 2DX1A 3VRYA 1KIKA 4F17A 2ROLA 2EGEA 2A36A 2RMOA 3REAB 2A28A 1MUZA 2NUZA 3M0SA 1UDLA 4HVVA 2DYBA 4EIKA 1G2BA 1GCQA 2L0AA 3UATA 2HEQA 4RTZA 5FW9A 1NEGA 2ED0A 3PVQA 2EYYA 1WA7A 2HBWA 3TSZA 2A08A 2RNAA 3LH5A 2DNUA 2MCNA 1ZBJA 1NEBA 2AZSA 1X27A 1KFZA 1GCPA 2OAWA 2VKNA 1WDXA 1K9AA 4IIOA 2YUNA 1W1FA 3UA7A 2K6DA 1UG1A 1T0HA 4CC3A 1UHFA 2DVJA 2JM9A 1X43A 2MIOA 3EG0A 3REBB 1S1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0Q A;  4HVW A;  1T0J A;  1ZLM A;  2KYM A;  2YDL A;  1AWW A;  2DIL A;  3VS1 A;  2D8H A;  2DE0 X;  3EHQ A;  1U3O A;  2LJ3 A;  1N5Z A;  1K76 A;  4RTV A;  4JZ4 A;  3M0R A;  1ZSG A;  2RQW A;  3VS2 A;  3SEM A;  2K7A A;  2LMJ A;  1UJ0 A;  2ENM A;  2A37 A;  2I0N A;  1E6H A;  2OJ2 A;  4HVU A;  1SRL A;  2DBK A;  1MV3 A;  2HSP A;  1WXT A;  2DBM A;  3VS3 A;  2O9S A;  1PHT A;  2J6F A;  4LE9 A;  2K79 A;  3JV3 A;  1XOV A;  2DMO A;  5IH2 A;  2KXC A;  4LN2 A;  1QWE A;  2X3W D;  2K3B A;  1K0S A;  5IHI A;  2KR3 A;  1HJD A;  4M4Z A;  1JEG A;  4OMQ A;  2YT6 A;  1RLQ C;  2LJ0 A;  2CUB A;  2KXD A;  1B3Q A;  2J05 A;  5L23 A;  2EYZ A;  4D8D A;  2GQI A;  3ULR B;  5IHN A;  4CC4 B;  2LNH B;  2CRE A;  4HCK A;  5IXB A;  1U5S A;  4J9B A;  2VWF A;  1YP5 A;  3H41 A;  4Z89 A;  2GTO A;  1PKS A;  5GJW B;  2RF0 A;  2ECZ A;  1OOT A;  1WI7 A;  2H8H A;  1CSK A;  4OML A;  1SEM A;  3A98 A;  1I07 A;  2GTJ A;  3QWX X;  4RTW A;  1FMK A;  1AWO A;  2D8J A;  2EYX A;  1ZX6 A;  2YUQ A;  1OV3 A;  1W6X A;  1G83 A;  2LX7 A;  1KSW A;  1JQQ A;  1X69 A;  1Y0M A;  4GLM A;  4D8K A;  1PRL C;  2B86 A;  2JS2 A;  2FPE A;  1NYF A;  1GRI A;  2KT8 A;  2KRS A;  1GCQ C;  2K2M A;  3M0U A;  4AFU C;  4CC2 A;  4F14 A;  1JXM A;  2BZX A;  4AG2 C;  1W70 A;  1UEC A;  2QDL A;  2LP5 A;  4ORZ A;  2K9G A;  5GJV B;  2FG0 A;  1K0X A;  1V1C A;  2AKK A;  2AKL A;  4J9G A;  1PNJ A;  4DEX A;  3NHN A;  1E7O A;  2CH4 W;  3VS7 A;  1RLP C;  2SRC A;  4LUE A;  4R0K A;  1K4U S;  1X6G A;  1FYN A;  4A63 B;  1M30 A;  1NG2 A;  2EBP A;  3M0T A;  1H3H A;  2V1Q A;  2L3S A;  1YN8 A;  2FO0 A;  4RTX A;  2AK5 A;  2CSQ A;  2BZY A;  2DF6 A;  3IQL A;  1YCS B;  4J9E A;  2JXB A;  1UE9 A;  4JJC A;  3THK A;  5IHK A;  2LCS A;  2DL8 A;  2L3Q A;  4JJD A;  2RQT A;  3H0H A;  3VS0 A;  4RUG A;  3NMZ C;  1UFF A;  2KRM A;  3CQT A;  2X3X D;  3R6N A;  2DL7 A;  1ABO A;  1WLP B;  2KYB A;  2LQN A;  2LQW A;  2ROT A;  4J9D A;  4K11 A;  4RTY A;  2VVK A;  1H92 A;  4ZNX A;  1BB9 A;  4LUD A;  3I35 A;  2JMA A;  2KBT A;  2J06 A;  3RBB B;  2DM1 A;  3EG2 A;  1HD3 A;  2RQU A;  4Z88 A;  4J9H A;  1Y57 A;  2EKH A;  2P4R A;  2DL3 A;  4KRT A;  1WFW A;  2EQI A;  2BZ8 A;  3O5Z A;  1GBQ A;  1UTI A;  1SSH A;  1ABQ A;  2XMF A;  2O88 A;  1VYV A;  4JPB W;  2E5K A;  1M8M A;  1BK2 A;  4AFZ C;  1YWO A;  1M3B A;  4RTT A;  2PNI A;  3U23 A;  1M27 C;  2JS0 A;  4AFQ C;  1AWJ A;  1OPK A;  2C0O A;  2DJQ A;  1HSQ A;  1ZUU A;  2RQV A;  3EG1 A;  3I5S A;  2DRM A;  5I22 A;  4JJB A;  3QWY A;  1TUD A;  1SHG A;  1X2Q A;  2YUO A;  1QCF A;  1B07 A;  2ESW A;  2HCK A;  4OMP A;  4LNP A;  1X6B A;  3VRZ A;  4GBQ A;  2DLP A;  1WX6 A;  2DL5 A;  2RPN A;  5EC7 A;  2W0Z A;  3PVL A;  2CH4 A;  4J9F A;  2M0Y A;  1EFN A;  2L2P A;  2FRY A;  3EHR A;  1CKB A;  1WXU A;  4J9C A;  3TSW A;  4Z8A A;  1BBZ A;  2O31 A;  2GGR A;  1AVZ C;  2YSQ A;  5I11 A;  1PKT A;  3I5R A;  1YNZ A;  1I0C A;  1AZG B;  4Y92 A;  2RN8 A;  1GFC A;  3M0P A;  1K1Z A;  2LZ6 B;  2W10 A;  2J6K A;  5HCK A;  1CKA A;  1AZE A;  1I1J A;  1GBR A;  2KT1 A;  1JO8 A;  1QKW A;  1MV0 B;  2CT3 A;  4AG1 C;  2KEA A;  1SPK A;  1GFD A;  1M3A A;  1U06 A;  2EW3 A;  3I9Q A;  5FWC A;  2JT4 A;  4JZ3 A;  2ED1 A;  3FJ5 A;  3TVT A;  2HDA A;  2IIM A;  3C0C A;  4RTU A;  4IIM A;  3UF4 A;  2JMC A;  2EVR A;  4FSS A;  1OPL A;  2O9V A;  2JM8 A;  2J7I A;  4DEY A;  1JXO A;  5ECA A;  2CSI A;  2EYW A;  1UUE A;  4OMO A;  2D0N A;  2FEI A;  3H0F A;  2KE9 A;  1T3L A;  1KJW A;  2CT4 A;  1SHF A;  1NLP C;  3EG3 A;  4OMM A;  1BU1 A;  1TUC A;  3KFV A;  3EGU A;  4WCI A;  2PZ1 A;  2EGA A;  2NWM A;  1RUW A;  1H8K A;  2DL4 A;  1Z9Q A;  3VS6 A;  4X1V A;  2JW4 A;  2FRW A;  2YUP A;  3RNJ A;  1M3C A;  2EPD A;  3VS5 A;  2F2X A;  4J9I A;  3UA6 A;  2FPD A;  2BTT A;  3ZL7 C;  4OMN A;  2GBQ A;  1PWT A;  4ESR A;  2G6F X;  2KGT A;  1VYT A;  2M51 A;  1VA7 A;  1ZUY A;  2KRO A;  2V1R A;  1IO6 A;  5FWB A;  2OI3 A;  2O2O A;  1TG0 A;  1GL5 A;  1AOJ A;  2EGC A;  3H0I A;  3VS4 A;  2F2V A;  1JU5 C;  1VYU A;  1X2K A;  2C0I A;  3PE0 A;  1UJY A;  2CUD A;  2RQR A;  2CDT A;  1OEB A;  1NLO C;  4AFS C;  2D1X A;  1ARK A;  1WIE A;  3NGP A;  1ZUK A;  4QT7 A;  1A0N B;  1AD5 A;  1RI9 A;  2JTE A;  1E6G A;  2DA9 A;  1AEY A;  1T3S A;  2SEM A;  2LJ1 A;  2ABL A;  3SHW A;  4CC7 A;  2F2W A;  1WXB A;  2C0T A;  1AWX A;  1LCK A;  2KRN A;  1UGV A;  2FPF A;  1QKX A;  3NPF A;  2DRK A;  1Z9Z A;  1YWP A;  2L3P A;  1J3T A;  1WYX A;  2PTK A;  1NYG A;  4HXJ A;  3GBQ A;  5IXF A;  1QLY A;  2GNC A;  2KNB B;  2J6O A;  1SRM A;  2AZV A;  2MOX A;  1PRM C;  1QWF A;  1NM7 A;  1UHC A;  4F16 A;  4E6R A;  2DX1 A;  3VRY A;  1KIK A;  4F17 A;  2ROL A;  2EGE A;  2A36 A;  2RMO A;  3REA B;  2A28 A;  1MUZ A;  2NUZ A;  3M0S A;  1UDL A;  4HVV A;  2DYB A;  4EIK A;  1G2B A;  1GCQ A;  2L0A A;  3UAT A;  2HEQ A;  4RTZ A;  5FW9 A;  1NEG A;  2ED0 A;  3PVQ A;  2EYY A;  1WA7 A;  2HBW A;  3TSZ A;  2A08 A;  2RNA A;  3LH5 A;  2DNU A;  2MCN A;  1ZBJ A;  1NEB A;  2AZS A;  1X27 A;  1KFZ A;  1GCP A;  2OAW A;  2VKN A;  1WDX A;  1K9A A;  4IIO A;  2YUN A;  1W1F A;  3UA7 A;  2K6D A;  1UG1 A;  1T0H A;  4CC3 A;  1UHF A;  2DVJ A;  2JM9 A;  1X43 A;  2MIO A;  3EG0 A;  3REB B;  1S1N A; 
#chains in the Genus database with same CATH topology
 1PSE A;  4HVW A;  4M78 A;  1M1K C;  2CP5 A;  1H64 1;  2YDL A;  3M5A A;  3JB9 D;  3P8D A;  2PQW A;  3JCM d;  2D8H A;  4ZGD B;  4RMO A;  1U3O A;  1WQ7 A;  2VV5 A;  1WHM A;  5FRO A;  2DYI A;  1B7T A;  4JZ4 A;  3R6O A;  3JCM P;  2YXY A;  2K7A A;  2QGF B;  3JCM V;  3G1J A;  4MZT A;  2RM4 A;  2VGM A;  1VQ8 A;  2CP3 A;  4RCB A;  2EQK A;  3CCS Q;  2J6F A;  4LE9 A;  3JV3 A;  1XOV A;  2BUD A;  2F5T X;  1VQ8 T;  3M56 A;  5DLQ E;  4PK4 A;  2COZ A;  3RIR A;  3SWN A;  4PJO B;  1WZO A;  4OMQ A;  1WHL A;  3PFS A;  4AMC A;  1B3Q A;  3QKJ A;  5L23 A;  2MI6 A;  2XD0 A;  4X34 A;  5CCA A;  3CD6 Q;  2QEX Q;  1K9M C;  3BE3 A;  3URG A;  3ZFJ A;  4HCC A;  4J83 A;  1YP5 A;  3TEE A;  2GTO A;  1VQP A;  4M7D G;  2ZPF B;  5KYW A;  2L3R A;  2ECZ A;  5HKC A;  4PLI A;  3RKX A;  3ER0 A;  3VKI A;  3EG9 B;  1VQP T;  4M7A B;  3QWX X;  1AWO A;  1ZX6 A;  7AT1 B;  4FL6 A;  4NOY A;  4XQ3 A;  3X24 B;  4BUG A;  1KSW A;  3OSV A;  3HFO A;  4D8K A;  4L59 A;  3EH2 A;  2FPE A;  4PLL A;  2DXB A;  4EMK C;  3PMT A;  5LJ3 d;  1M1K R;  4QVD A;  4V2S A;  2QDL A;  2K9G A;  3GNG A;  3OYE A;  2ZPE B;  3WVD B;  1V1C A;  5A0D A;  4DEX A;  1Y07 A;  3VS7 A;  1RLP C;  2SRC A;  1OI1 A;  1M2V B;  4IUP A;  1M30 A;  5IT9 E;  1H3H A;  3M0T A;  4RKU E;  4DOV A;  1YN8 A;  3LYI A;  5GAM e;  2AK5 A;  3RKW A;  1TH7 A;  3BDU A;  4KT0 E;  4J9E A;  3THK A;  2OTL A;  4BAC A;  3CCJ A;  3E2U A;  4D6W A;  4FYY B;  4JJD A;  3H0H A;  4N4H A;  2WAC A;  4IUR A;  4IUT A;  4KUL A;  4QW2 A;  2CZ7 B;  2RO0 A;  3NMZ C;  3OBY A;  2OTL T;  1QVF A;  5LJ3 j;  4PJN A;  3CCJ T;  2LC4 A;  1ABO A;  3L42 A;  4HCB A;  5GAO q;  4XTU A;  2NUP A;  4J9D A;  1K9M R;  2VVK A;  2LT1 A;  2QG9 B;  3BW1 A;  3MET A;  1FX7 A;  1BB9 A;  4LUD A;  3H6Z A;  1HD3 A;  2RQU A;  3OW2 P;  5J3B A;  5CKD A;  2P4R A;  1LOJ A;  2BZ8 A;  4QQG A;  4C8Q G;  3CPW A;  2HBP A;  1VYV A;  1LJO A;  1G3S A;  5GAM f;  1BK2 A;  1EX4 A;  4RTT A;  4M78 B;  4DBF A;  4ZGJ B;  2K3X A;  2FZK B;  4F04 B;  4AFQ C;  3CC7 A;  1ZSZ C;  4C92 A;  2RQV A;  3E1S A;  4C8Q A;  2DRM A;  2RHY A;  4BE2 A;  5KE3 A;  5I22 A;  4JJB A;  3CC7 T;  1WHH A;  1QCF A;  1SKU B;  4HCZ A;  3CEY A;  2HCK A;  4LNP A;  1X6B A;  3VRZ A;  4C0D B;  5HK3 A;  3MEU A;  1VQL Q;  4FYX B;  1PM3 A;  3G6E A;  1W2B P;  5LJ5 d;  2CH4 A;  4A4F A;  5A0G A;  2LTO A;  2NUT A;  1G8X A;  1CKB A;  1WJS A;  3G6E T;  5IAY A;  1BBZ A;  3T9N A;  2YSQ A;  1YCY A;  1OU8 A;  1R0C B;  2MMP A;  2VYT A;  3SWN B;  3O8V A;  1MNE A;  1YBY A;  1VQ7 Q;  2W10 A;  1VUB A;  5HCK A;  2K2V A;  1AZE A;  1D1A A;  2QXF A;  2DD4 A;  3JCM Q;  4FT2 A;  3RES A;  4XK8 E;  1M3A A;  1NPP A;  4M77 G;  4IUV A;  2EJF A;  2P0P A;  5KYW B;  1PG5 B;  4PNO A;  3OMC A;  2DET A;  2HDA A;  3CCR Q;  5LJ5 j;  1NPR A;  5KCO A;  4LDU A;  4M77 A;  4NL3 A;  1LNX A;  1YIT T;  3H0F A;  1RAB B;  2CT4 A;  4F7U E;  3HP9 A;  1NLP C;  4Y28 E;  4WTO B;  3EG3 A;  2JN0 A;  2D6F A;  2EGA A;  2NWM A;  8AT1 B;  4BDZ A;  5GMK i;  1Z9Q A;  3CCS A;  3LWH A;  5A0L A;  2GFA A;  3RNJ A;  1VIF A;  2F2X A;  5GMK j;  3ZL7 C;  1ZQ1 A;  2EJG A;  4ESR A;  3RMQ A;  3JCM h;  2KGT A;  5CO7 A;  2DAQ A;  2KRO A;  3CCS T;  2V1R A;  5FWB A;  3SDZ A;  2V8J A;  5I2M A;  4M75 G;  4C0G A;  3CD6 A;  3RER A;  3QO3 A;  3G71 Q;  4J6Y A;  1JU5 C;  2A3L A;  5FU6 C;  2QEX A;  1YHQ Q;  2X4W A;  3CCU Q;  3JCM b;  2CDT A;  3EFO B;  3CD6 T;  4LDW A;  4M75 A;  1ARK A;  2QEX T;  1WIE A;  2LRQ A;  1ZUK A;  3G4S Q;  1N9S A;  2WSE E;  5GAN e;  1RI9 A;  2O01 E;  2NLU A;  2M0O A;  3FEO A;  1AEY A;  2NUP B;  3RR6 A;  2SEM A;  4PFP A;  1Q86 U;  1H3Z A;  2C0T A;  3SB2 A;  1AWX A;  4FU6 A;  2FPF A;  2LCL A;  1G3Y A;  1DJ7 B;  1R77 A;  1M5Q 1;  4JRQ A;  2E4H A;  5KYY A;  1N9R A;  1NBE B;  2RK1 A;  4ME7 A;  2PTK A;  4M7D C;  1Q7Y U;  2ZPG B;  1M90 U;  4IUU A;  3KBG A;  3JSC A;  4M7D E;  2XDD A;  1ZHI A;  2D0Q B;  3VRY A;  4FIB A;  4GY5 A;  4F17 A;  4C8Q B;  4J7F A;  2ROL A;  1EZZ B;  2A28 A;  2Y4X A;  1MUZ A;  3HL8 A;  1KC8 U;  4C5H A;  5GAN f;  4JLI A;  4PJM A;  1ZA2 B;  5LJ3 h;  2HEQ A;  4PJO F;  3FJP A;  2KAF A;  1WA7 A;  2HBW A;  3TSZ A;  2NUT B;  5IN1 A;  4XU1 A;  2VKN A;  4IIO A;  1M2O A;  3UA7 A;  3CC4 Q;  1QVF S;  1UHF A;  2DVJ A;  1Q81 R;  2PUO B;  2E6Z A;  1S1N A;  3M0Q A;  2BE9 B;  4BY6 B;  1ZLM A;  4KUD K;  2KYM A;  2DIL A;  1PSF A;  3ZEH A;  1C6V X;  4KH0 B;  4RTV A;  1D3B A;  1ZSG A;  2MF2 A;  4ATO A;  5A2Q E;  2YRD A;  1RAD B;  2A37 A;  3QZ5 B;  5FU7 B;  5GAO r;  5KCH A;  4HVU A;  2DJZ A;  5GAN 4;  3A1P A;  1MV3 A;  2YLB A;  3JCM e;  2LX9 A;  2DBM A;  3L2Z A;  3VS3 A;  1PHT A;  4M77 B;  2K79 A;  2DMO A;  5GAO l;  4LN2 A;  3BDL A;  2K3B A;  1GXI E;  4MZP A;  5IHI A;  1TWB A;  2KR3 A;  2PVD B;  4M4Z A;  2A7Y A;  4JDS A;  1F1B B;  2CUB A;  2KXD A;  2DXT A;  1WPY A;  3MO8 A;  4JUV A;  2M02 A;  5AT1 B;  1NJI C;  4CC4 B;  1VQL A;  2LNH B;  3L2U A;  1WHK A;  2XI9 A;  2RI2 A;  4FYW B;  3H41 A;  1JJ2 A;  1PKS A;  4FW1 A;  1VQL T;  4C8Q E;  1RAF B;  4KH1 B;  2OTJ Q;  3OYM A;  4FYV B;  3GIB A;  1MND A;  2FZC B;  1VQ7 A;  4BD3 A;  4RTW A;  2YLC A;  2X51 A;  2E64 A;  1TXQ A;  4LDY A;  1OZ3 A;  1OV3 A;  1IRX A;  3JCM f;  2P0K A;  3E9F A;  2MAM A;  1VQ7 T;  4E7I A;  5LJ5 h;  1X69 A;  1Y0M A;  2QI2 A;  2XG8 D;  2E6N A;  4M75 B;  3FIF A;  3JCM c;  2KRS A;  1GCQ C;  2K2M A;  3CCR A;  4CC2 A;  4AG2 C;  4L6V 5;  4F7U F;  3GLX A;  1K0X A;  4J9G A;  2DTO A;  3CCR T;  1PNJ A;  3LX7 A;  1E7O A;  2CH4 W;  4A4E A;  3FC3 A;  2E3H A;  2DTH A;  4R0K A;  4Z02 A;  1YIJ Q;  1RL2 A;  1NG2 A;  2EBP A;  2V1Q A;  4QQ6 A;  4M78 F;  5LJ3 e;  1BKB A;  4RTX A;  1XQH A;  5KYY B;  5GAO p;  5GMK h;  2E5Q A;  3QUI A;  4Y91 A;  3BY7 A;  3HTR A;  2DL8 A;  3QHS A;  3MHX A;  2AIR B;  4RUG A;  1YFN A;  2F1L A;  3I55 Q;  2KRM A;  2HKN A;  2QYZ A;  3WXM B;  1W4S A;  1WLP B;  2XDP A;  2KYB A;  2E12 A;  5CQY A;  2LQN A;  2V26 A;  2IPO B;  3QG1 A;  4C0Z A;  4E7L A;  3FDR A;  1HK9 A;  2KY9 A;  3LH0 A;  4BDY A;  3G71 A;  1H92 A;  1V29 B;  5D6Y A;  3DLL A;  1YJN Q;  1YHQ A;  1N6A A;  3CXC P;  3OB9 A;  2JMA A;  3HSB A;  3CCU A;  2OX7 A;  2I2L A;  3CCM Q;  2RHX A;  2KMT A;  6AT1 B;  3G71 T;  2NYS A;  1OZ2 A;  1Y71 A;  2EKH A;  5FRM A;  3DLM A;  1YHQ T;  4KRT A;  1NJI U;  1WFW A;  3G4S A;  3CCU T;  5LL6 S;  1SSH A;  1QP3 A;  1M8M A;  3EFS A;  5D6X A;  3OYK A;  4B6M A;  1BCM A;  2PNI A;  2CP7 A;  4NS5 A;  3G4S T;  1M9S A;  3U23 A;  2JS0 A;  2C0O A;  2DJQ A;  1HSQ A;  1ZUU A;  2DPP B;  3I5S A;  3VYG A;  1C0M A;  3QWY A;  1TUD A;  1D3B B;  1X2Q A;  4DBH A;  4M7D F;  2ESW A;  2EFI A;  2EQU A;  3QXE B;  4C5I A;  4OMP A;  2PVO B;  4PJO D;  2QQB A;  4FM4 B;  5GAN 5;  2RPN A;  2P4T A;  2M0Y A;  2DXC A;  3OYC A;  3OYY A;  1EFN A;  4J9C A;  3RDV A;  2Y4Y A;  1KQS P;  1BI1 A;  2GGR A;  1UGR B;  3QYH B;  1PC0 A;  1PKT A;  3I5R A;  4E7S A;  1VQN Q;  4PFZ A;  2JTM A;  3M0P A;  1I5O B;  4YTL A;  5LJ5 e;  1WNL A;  4AT1 B;  1QCO A;  3OW2 A;  1GBR A;  1JO8 A;  1WJR A;  1D0Y A;  2CT3 A;  4AG1 C;  4N4G A;  1VQM Q;  1GFD A;  4B9X A;  1UEB A;  4JZ3 A;  2Y90 A;  3TVT A;  2COW A;  2XDB A;  2IIM A;  3C0C A;  4RTU A;  4E7Z A;  2JMC A;  2EVR A;  4FSS A;  3OYN A;  2O9V A;  2JM8 A;  2J7I A;  3L2W A;  2QK0 A;  4HKE A;  1JXO A;  4RG8 A;  4DEY A;  5ECA A;  3OYF A;  2CSI A;  3CC4 T;  2EYW A;  1KD1 U;  2KDS A;  4PJO C;  1MGQ A;  2R58 A;  1T3L A;  5GMK e;  3M4Y A;  2JOY A;  3NTK A;  1SHF A;  3QYG B;  1S72 Q;  4OMM A;  1TUC A;  4PJO E;  4N0A C;  3S6W A;  4WCI A;  2PZ1 A;  1W2B A;  5L8R E;  1RUW A;  1H8K A;  3DKM A;  3VS6 A;  1LVK A;  2JW4 A;  2FRW A;  2YUP A;  3OYA A;  3VS5 A;  2PVG B;  1Q95 G;  5LJ5 f;  3CBP A;  2GBQ A;  3HPW A;  2KI7 A;  2M51 A;  1BI3 A;  4XAX B;  2Z0W A;  4M7A C;  1UGS B;  2K5L A;  4IUQ A;  2O2O A;  3NFC A;  4ZTF A;  2RJF A;  1TG0 A;  4C92 G;  4M7A E;  2EGC A;  1JBM A;  5GAN 7;  1IGQ A;  4OGE A;  4C8Q F;  1NE8 A;  1X2K A;  2VGN A;  1KK7 A;  2C0I A;  3PE0 A;  5KYU A;  1UJY A;  1IHW A;  2RQR A;  2COY A;  3C94 A;  5J26 A;  1NLO C;  4AFS C;  2BKD N;  1JJ2 S;  3CPF A;  3QDR B;  1A0N B;  3ME9 A;  3UT1 A;  2VB6 A;  3N5B B;  2OTJ T;  3EGD A;  2ABL A;  3OYL A;  1OX9 A;  3SHW A;  2RB6 A;  1X75 C;  1PCX A;  4N4I A;  1WQW A;  3MP1 A;  3CME Q;  3PIO A;  1IB8 A;  1Q86 C;  4KUI A;  1WYX A;  1NYG A;  4HXJ A;  3GBQ A;  2DVE A;  5IXF A;  4EMG A;  4OB1 B;  3CCE Q;  2AZV A;  1PRM C;  3MCA B;  1UHC A;  1Q7Y C;  5DLO A;  4E6R A;  1M90 C;  4XTW A;  2LVM A;  5HK0 A;  2RI5 A;  5GAM g;  1YIJ A;  3JCM J;  3PGG A;  4M77 F;  1YIT A;  3OSS C;  4EIK A;  1GCQ A;  1Y7X A;  2L0A A;  1YIJ T;  4CRI A;  3UAT A;  4EMH A;  3MEW A;  1KC8 C;  2LCC A;  2RNA A;  3JCM W;  3LH5 A;  3I55 A;  5CKB A;  2WSC E;  1WDX A;  3QJ6 A;  2RHI A;  2YUN A;  2RD1 A;  2XKO C;  4CC3 A;  4M78 C;  1X43 A;  3I55 T;  2EJ9 A;  5FRN A;  1T0J A;  2QDY B;  2ZAE A;  5GAO m;  5EG2 A;  1YJN A;  4M78 E;  1KQ2 A;  5C6S A;  3A8H B;  2DE0 X;  4MZM A;  4JS4 A;  1YJ9 Q;  3EHQ A;  2RJE A;  5D6W A;  3CMA Q;  1MMG A;  1K8A C;  1N5Z A;  1Q82 U;  2XU8 A;  4M7D D;  1TUG B;  1HYO A;  4OF1 A;  2RHZ A;  3M0R A;  3VS2 A;  1YJN T;  2DO3 A;  5M9O A;  4C0D C;  3A5Z B;  3C95 A;  2MWO A;  4GLK A;  8ATC B;  3CCM T;  1E6H A;  1RAE B;  4OGC A;  3OYB A;  2LT4 A;  2KVQ G;  2ZZD A;  4M75 F;  4JLG A;  1N27 A;  4VUB A;  5IH2 A;  2KXC A;  3MEA A;  5GAN 6;  3CBO A;  3SWN C;  1NZ9 A;  4ELZ C;  4E2F B;  1KHI A;  3MP8 A;  1BI2 A;  1Q86 R;  4OB2 B;  1JEG A;  2ZPB B;  4EPC A;  3MJX A;  4PJJ A;  2J05 A;  3OS0 A;  4D8D A;  2GQI A;  4XTV A;  5IHN A;  1Y96 A;  2YRV A;  3JB9 G;  1WHJ A;  3LW5 E;  2EWN A;  1VQ5 Q;  1M1F A;  3AT1 B;  1Q7Y R;  1U5S A;  2VWF A;  3H8Z A;  3X20 B;  3DB3 A;  1KHC A;  1M90 R;  5CAI A;  5GJW B;  3EFR A;  3V8K A;  1CSK A;  5GAN 8;  1SEM A;  1VQN A;  1I07 A;  2GTJ A;  3FLG A;  1TOV A;  3KXT A;  1FMK A;  2VUB A;  4DOW A;  4A4G A;  3X25 B;  1VQN T;  1G83 A;  2LX7 A;  1KC8 R;  5KYU B;  4RCC A;  5KYX A;  3OW2 S;  1VQM A;  1JQQ A;  4C92 B;  4BE1 A;  4GLM A;  1PRL C;  5CKH A;  2JS2 A;  1D0Z A;  2CP2 A;  2DIQ A;  2BE7 D;  1I8F A;  1RAI B;  4ANJ A;  1GRI A;  2KT8 A;  4X9C A;  1VQM T;  4F14 A;  1JXM A;  2BZX A;  1W70 A;  1YI2 Q;  2YHT A;  4EMK A;  5GJV B;  3S3O A;  2K57 A;  2M9U A;  2HQX A;  2GQV A;  2FG0 A;  2AKK A;  3D7S B;  4JJN K;  4QVZ A;  2EQM A;  2RH2 A;  1XNI A;  4MML A;  4R56 A;  4LUE A;  1X6G A;  2HL3 A;  2HNI A;  1S72 A;  2KSS A;  2BZY A;  2DF6 A;  3JRZ A;  4HA8 A;  4C8Q D;  3IQL A;  1VIE A;  4JJC A;  3NTH A;  5IHK A;  2HL5 C;  2LCS A;  1K8A U;  2JTF A;  2DER A;  1S72 T;  2XIC A;  2L3Q A;  1B34 A;  1W2B S;  1SF9 A;  2CZ6 B;  4J7I A;  1UFF A;  2R5A A;  4M7A F;  2X3X D;  3QSU A;  2DL7 A;  4TVR A;  3HHT B;  2E70 A;  2LQW A;  3V8L A;  2ROT A;  3SFM A;  2MWP A;  4K11 A;  2DFU A;  1MMN A;  3E9G A;  3I35 A;  2KBT A;  2J06 A;  3RBB B;  3EG2 A;  2L5Q A;  4A4H A;  1D1B A;  4J9H A;  3OYD A;  1Y57 A;  4FT4 A;  4KGV B;  3PMI A;  2VXE A;  5GAN g;  2DL3 A;  2EQI A;  2X35 A;  3O5Z A;  2JNG A;  2RJC A;  1G3W A;  2PU9 B;  2O88 A;  4JPB W;  1N8R U;  1RAG B;  4AFZ C;  1VQ9 Q;  1FXX A;  2QA4 Q;  4C8Q C;  1M27 C;  2C06 A;  1OPK A;  3EG1 A;  3M55 A;  2F5K A;  1MHN A;  1QVG P;  2CZ1 B;  3S3M A;  4M77 D;  4C92 E;  4QVC A;  1ZSZ A;  3CCV Q;  4A54 A;  2EQJ A;  2YUO A;  1B07 A;  1R8O B;  4OP0 A;  4BI3 A;  3OA6 A;  3CME T;  3TCJ A;  3OYJ A;  4GBQ A;  2DLP A;  2E10 A;  1WX6 A;  3VUB A;  2A0F B;  2K3Y A;  3LGL A;  5EC7 A;  5KH6 A;  3PVL A;  1M2V A;  4J8O A;  3NTI A;  3M54 A;  2CYZ B;  2FRY A;  3UWN A;  3EHR A;  3TSW A;  2X4X A;  2LDM A;  3CCE T;  2O31 A;  3ZBD A;  1AVZ C;  2G3R A;  4C5G A;  5I11 A;  3A8L B;  1G3T A;  4BY6 C;  4ZGE B;  5GAN 3;  1YNZ A;  3LLR A;  3QZ9 B;  4Y92 A;  2RN8 A;  1GFC A;  3PTA A;  1K1Z A;  1FWZ A;  2LZ6 B;  3CXC A;  2ZGW A;  2J6K A;  1Y96 B;  3GF5 A;  3HFN A;  1U06 A;  3MPU B;  2EW3 A;  3I9Q A;  5FU7 C;  5FWC A;  4J6X A;  2ED1 A;  3FJ5 A;  3EGX A;  4O6J A;  1I81 A;  4F7U G;  1IHV A;  2VAS A;  2GCX A;  4IKF A;  4IIM A;  4M77 C;  4A4K A;  3DB4 A;  5I21 A;  2K5F A;  4M75 D;  1OPL A;  2CP0 A;  2FVU A;  2FZG B;  4OVA A;  4RG2 A;  2EIF A;  2L8D A;  4DBR A;  4M77 E;  4F7U A;  4OMO A;  2FEI A;  4O5V A;  1YJ9 A;  2EKO A;  3OY9 A;  1OYX A;  1KJW A;  5KYX B;  2MYS A;  2VC8 A;  2WSF E;  4UC4 A;  3CMA A;  2ATC B;  3CCL Q;  2QQS A;  2FL7 A;  1KD1 C;  1YJ9 T;  3JCM g;  3KFV A;  3CMA T;  2QAS A;  3QII A;  3SD4 A;  1ZBX A;  1NJI R;  3V7R A;  1QVP A;  4EMK B;  1M3C A;  4BI4 A;  1SSF A;  4J9I A;  4QQD A;  1KQS A;  4OMN A;  1YJW Q;  3FB9 A;  2G6F X;  1ZUY A;  2RJD A;  3UPU A;  3Q1J A;  3VU3 C;  1IO6 A;  2OI3 A;  4X9D A;  1M4Z A;  3VYH B;  2DZC A;  4XTY A;  4ZTJ A;  5LJ3 f;  3H0I A;  3PIP A;  4LDV A;  2F2V A;  3GP8 A;  1K73 C;  5CR2 A;  4MMK A;  3TU4 K;  1VQ5 A;  1B34 B;  2CUD A;  3JAM E;  4M75 C;  5I2S A;  5C0M A;  1XTD A;  3I56 Q;  3EH1 A;  3MP6 A;  1VQO Q;  4CI0 C;  2ZPH B;  3NGP A;  3M57 A;  2QTX A;  4QT7 A;  1VQ5 T;  4M75 E;  1VQK Q;  3MKD A;  2JTE A;  4WF2 A;  3BFM A;  1ACM B;  1E6G A;  4A53 A;  2HKQ B;  3RMS A;  4ELY C;  2LJ1 A;  2CS7 A;  2GF7 A;  2RA2 A;  4CC7 A;  2CKK A;  4BB7 A;  3J7A F;  1QKX A;  3QPH A;  1G5V A;  2DRK A;  1Z9Z A;  2ZCF B;  3RKY A;  1YWP A;  2L3P A;  5DY9 A;  2EYQ A;  3OS1 A;  3OQ5 A;  3J81 E;  3M53 A;  3A8G B;  3L2Q A;  3EAE A;  3JCM X;  3JB9 J;  2GNC A;  1YI2 A;  4M7D A;  1P92 A;  2KNB B;  2J6O A;  1SRM A;  2QAZ A;  1QWF A;  1NM7 A;  4M7A D;  1OQK A;  3VV0 A;  1V76 A;  4XTX A;  2DD5 A;  2DX1 A;  2B8A A;  4Q5W A;  1YI2 T;  5LJ3 g;  3F70 A;  1QMC A;  2LQK A;  2RMO A;  2YRC A;  1ZSZ B;  1KD1 R;  3REA B;  4PFO A;  1PD0 A;  3INZ A;  2NUZ A;  3CC4 A;  2KQW A;  1LPL A;  3G7Z A;  4HVV A;  1G2B A;  1OUL A;  4LDX A;  1BI0 A;  5FW9 A;  3AHU A;  1NEG A;  2EYY A;  1BIB A;  3CCQ Q;  1QVG S;  4LD6 A;  1NEB A;  1WJQ A;  2AZS A;  1X27 A;  2X9H A;  1M1K U;  1KFZ A;  2OAW A;  1K9A A;  1AHJ B;  1W1F A;  2DXU A;  2K6D A;  1UG1 A;  2CP6 A;  2MIO A;  2FB7 A;  3EG0 A;  3GNF B;  1VOM A;  3REB B;  2QTV A;  1QP2 A;  1K73 R;  3OYH A;  1AWW A;  3VS1 A;  4OB0 B;  3EFO A;  3P8B B;  2OAU A;  2LJ3 A;  1K76 A;  1VQ6 Q;  2HQH A;  2RQW A;  3SEM A;  1IRE B;  2LMJ A;  1UJ0 A;  2ENM A;  1K73 U;  3EGX B;  2I0N A;  2P84 A;  2PUK B;  3TQ7 P;  2OJ2 A;  1SRL A;  2DBK A;  1Q82 C;  1VQ9 A;  2HSP A;  3QDF A;  1WXT A;  4C92 F;  3V7C A;  2O9S A;  3HRU A;  2QA4 A;  5CKE A;  3CC2 Q;  5KE2 A;  1QWE A;  2X3W D;  4F7U B;  1VQ9 T;  1K0S A;  2JJ9 A;  1QW1 A;  1HJD A;  3CCV A;  2QA4 T;  1K9M U;  2OTJ A;  2YT6 A;  1RLQ C;  2LJ0 A;  2RK2 A;  3KUF A;  3M9Q A;  2EYZ A;  3ULR B;  1M8V A;  3CCV T;  5CQX A;  3L2R A;  5GAN h;  2YWW A;  2CRE A;  4HCK A;  5IXB A;  4J9B A;  4Z89 A;  5FLX E;  2IVW A;  2RF0 A;  4M78 D;  3JB9 H;  1OOT A;  1WI7 A;  2E1H A;  2H8H A;  4OML A;  4FCY A;  3A98 A;  5DM7 R;  1QVF P;  5LJ5 g;  2MPX C;  4FW2 A;  1D1C A;  2HD0 A;  2D8J A;  5GAN 2;  2EYX A;  2YUQ A;  4XU0 A;  1RI0 A;  4XTZ A;  1W6X A;  2FHD A;  5GMK m;  3CXC S;  4XU3 A;  5FU6 B;  1FMW A;  5AYF A;  2B86 A;  2O4X A;  1NYF A;  2RHU A;  3PT9 A;  4KBM B;  3P8H A;  4II1 A;  2E3I A;  1IXD A;  3M0U A;  1OU9 A;  4AFU C;  1UEC A;  2M1H A;  1QCN A;  5GAM d;  2LP5 A;  2EAY A;  4ORZ A;  1UGQ B;  1X6O A;  1JRI A;  3CPW P;  2V8I A;  2AKL A;  5CK9 A;  3NHN A;  4PKC C;  3PNW C;  1K4U S;  3OBW A;  1FYN A;  3QJY A;  3CCL A;  2HQE A;  3WVE B;  4A63 B;  2L3S A;  2HSE B;  2FO0 A;  1SG5 A;  3MEV A;  2CSQ A;  1O75 A;  1YCS B;  1VQ4 Q;  1Q82 R;  2JXB A;  1UE9 A;  1HXD A;  3M58 A;  3RUX A;  4OMF B;  3CCL T;  4M7D B;  1TTH B;  1R0B G;  2RQT A;  1JB0 E;  3VS0 A;  1YJW A;  3CCM A;  3V7S A;  3CQT A;  2GFU A;  4JRI A;  3R6N A;  5GAM j;  1KQS S;  2QQR A;  4E7K A;  5D7U A;  1YJW T;  1D0X A;  5KYN A;  1U1T A;  4RTY A;  2V8K A;  4ZNX A;  2DKG A;  3L1A A;  2DM1 A;  5CKF A;  3I56 A;  4Z88 A;  4JRK A;  1VQO A;  1OX8 A;  3A8O B;  1BYM A;  1UGP B;  1QQJ A;  2QQA A;  1VQK A;  4LD9 K;  1GBQ A;  1UTI A;  3I56 T;  1Q81 C;  2XMF A;  1ABQ A;  1VQ8 Q;  4R55 A;  2E5K A;  1VQO T;  1YWO A;  1M3B A;  1WGS A;  5HY6 A;  4PL6 A;  1I5L A;  1EIF A;  1VQK T;  1RAA B;  1AWJ A;  1TSF A;  1N8R C;  3JB9 F;  9ATC B;  3OYI A;  1SHG A;  4P5N A;  1AT1 B;  2DZ9 A;  2HMA A;  1PD1 A;  4XU2 A;  4NL2 A;  3L2V A;  2IG0 A;  2DL5 A;  1X01 A;  2W0Z A;  2X4J A;  2HZY A;  4KGX B;  2DEU A;  3QBY A;  4J9F A;  3LWI A;  3OS5 A;  1VQP Q;  2L2P A;  1WXU A;  4HT8 A;  4QKU A;  4EDU A;  3CBM A;  4Z8A A;  1BIA A;  3GOX A;  1BCO A;  1I0C A;  1AZG B;  2JUF A;  2QQ9 A;  4J6W A;  3LGF A;  3VUZ A;  2AT1 B;  4MDW A;  1CKA A;  1I1J A;  4E7J A;  2KT1 A;  3J80 E;  1UB4 A;  3GPL A;  2JVV A;  1QKW A;  3EGD B;  5J39 A;  1MV0 B;  2KEA A;  1O9S A;  1SPK A;  3CCQ A;  1K8A R;  5GMK l;  1TS9 A;  4DQ2 A;  2JT4 A;  1C1A A;  5GAO n;  5CIU A;  4PJL A;  2MK5 A;  3UF4 A;  4C92 D;  4JS5 A;  3CCQ T;  1FMV A;  4PJO G;  4HT9 A;  1QVG A;  1RAC B;  1UUE A;  2D0N A;  3TRE A;  1MMA A;  2KE9 A;  3HRS A;  2D9T A;  2XID A;  1VQ6 A;  4PJO A;  3H9N A;  2O4X B;  3OMG A;  1BU1 A;  3EGU A;  3OYG A;  2L89 A;  1D09 B;  1VQ6 T;  2OTL Q;  2DL4 A;  4DBQ A;  3UDC A;  2E65 A;  2H3J A;  4LXC A;  4N0A A;  4BE0 A;  1IGU A;  3CCJ Q;  4FSX A;  4X1V A;  4M7A G;  2DEQ A;  2EPD A;  2XK0 A;  4B9W A;  3CC2 A;  3UA6 A;  2FPD A;  2BTT A;  1N8R R;  1PWT A;  1TU0 B;  1Q81 U;  1VYT A;  1VA7 A;  3M59 A;  2X4Y A;  2H3E B;  3CC2 T;  3EG9 A;  4M7A A;  1RAH B;  2E41 A;  1GL5 A;  1AOJ A;  1KG1 A;  5GAN d;  3VS4 A;  3CPW S;  1VYU A;  4JRP A;  4C92 C;  2DIG A;  2ZPI B;  1MMD A;  4OB3 B;  1WHG A;  3V8J A;  1OEB A;  4BI8 B;  4C0F A;  3CME A;  2D1X A;  2P0Q A;  2KK4 A;  4ZN3 A;  1AD5 A;  3ASK A;  2R57 A;  4KGZ B;  2AHJ B;  2DA9 A;  3FRN A;  3M4G A;  3OS2 A;  3E19 A;  1T3S A;  3X26 B;  4E47 A;  5CVI A;  2HAX A;  4MDX A;  4J5Y A;  2VXF A;  4DA4 A;  2F2W A;  2CGH A;  3CCE A;  1WXB A;  3CC7 Q;  2DK3 A;  4L5G A;  2JZ2 A;  1LCK A;  2KRN A;  1UGV A;  3NPF A;  2XHC A;  5GAN j;  3C12 A;  1M1G A;  1U1S A;  2BIV A;  1J3T A;  1I4K 1;  1KQ1 A;  4E7H A;  1IZ6 A;  2LQ8 A;  2DTI A;  2FYK A;  2RI3 A;  1XJW B;  3G6E Q;  3S3N A;  2K5I A;  2MOX A;  3X28 B;  4F16 A;  1ZA1 B;  1KIK A;  2EGE A;  2A36 A;  3HRT A;  2M16 A;  2F69 A;  3M0S A;  1UDL A;  2CZ0 B;  2LNV A;  1VQ4 A;  2DYB A;  3VJP A;  5GAM h;  4RTZ A;  3HKS A;  1U8R A;  3A8M B;  2QGG A;  2ED0 A;  2R5M A;  3PVQ A;  1VQ4 T;  2A08 A;  2MCN A;  2DNU A;  1ZBJ A;  2K4Y A;  4M78 G;  4ZN1 A;  1GCP A;  3JB9 I;  1JJ2 P;  3C4S A;  1T0H A;  2JM9 A;  4C5E A;  1YIT Q;  1QLY A; 
#chains in the Genus database with same CATH homology
 3M0Q A;  4HVW A;  1T0J A;  1ZLM A;  2KYM A;  2YDL A;  1AWW A;  2DIL A;  3VS1 A;  2D8H A;  2DE0 X;  3EHQ A;  1U3O A;  2LJ3 A;  1N5Z A;  1K76 A;  4RTV A;  4JZ4 A;  3M0R A;  1ZSG A;  2RQW A;  3VS2 A;  3SEM A;  2K7A A;  2LMJ A;  1UJ0 A;  2ENM A;  2A37 A;  2I0N A;  1E6H A;  2OJ2 A;  4HVU A;  1SRL A;  2DBK A;  1MV3 A;  2HSP A;  1WXT A;  2DBM A;  3VS3 A;  2O9S A;  1PHT A;  2J6F A;  4LE9 A;  2K79 A;  3JV3 A;  1XOV A;  2DMO A;  5IH2 A;  2KXC A;  4LN2 A;  1QWE A;  2X3W D;  2K3B A;  1K0S A;  5IHI A;  2KR3 A;  1HJD A;  4M4Z A;  1JEG A;  4OMQ A;  2YT6 A;  1RLQ C;  2LJ0 A;  2CUB A;  2KXD A;  1B3Q A;  2J05 A;  5L23 A;  2EYZ A;  4D8D A;  2GQI A;  3ULR B;  5IHN A;  4CC4 B;  2LNH B;  2CRE A;  4HCK A;  5IXB A;  1U5S A;  4J9B A;  2VWF A;  1YP5 A;  3H41 A;  4Z89 A;  2GTO A;  1PKS A;  5GJW B;  2RF0 A;  2ECZ A;  1OOT A;  1WI7 A;  2H8H A;  1CSK A;  4OML A;  1SEM A;  3A98 A;  1I07 A;  2GTJ A;  3QWX X;  4RTW A;  1FMK A;  1AWO A;  2D8J A;  2EYX A;  1ZX6 A;  2YUQ A;  1OV3 A;  1W6X A;  1G83 A;  2LX7 A;  1KSW A;  1JQQ A;  1X69 A;  1Y0M A;  4GLM A;  4D8K A;  1PRL C;  2B86 A;  2JS2 A;  2FPE A;  1NYF A;  1GRI A;  2KT8 A;  2KRS A;  1GCQ C;  2K2M A;  3M0U A;  4AFU C;  4CC2 A;  4F14 A;  1JXM A;  2BZX A;  4AG2 C;  1W70 A;  1UEC A;  2QDL A;  2LP5 A;  4ORZ A;  2K9G A;  5GJV B;  2FG0 A;  1K0X A;  1V1C A;  2AKK A;  2AKL A;  4J9G A;  1PNJ A;  4DEX A;  3NHN A;  1E7O A;  2CH4 W;  3VS7 A;  1RLP C;  2SRC A;  4LUE A;  4R0K A;  1K4U S;  1X6G A;  1FYN A;  4A63 B;  1M30 A;  1NG2 A;  2EBP A;  3M0T A;  1H3H A;  2V1Q A;  2L3S A;  1YN8 A;  2FO0 A;  4RTX A;  2AK5 A;  2CSQ A;  2BZY A;  2DF6 A;  3IQL A;  1YCS B;  4J9E A;  2JXB A;  1UE9 A;  4JJC A;  3THK A;  5IHK A;  2LCS A;  2DL8 A;  2L3Q A;  4JJD A;  2RQT A;  3H0H A;  3VS0 A;  4RUG A;  3NMZ C;  1UFF A;  2KRM A;  3CQT A;  2X3X D;  3R6N A;  2DL7 A;  1ABO A;  1WLP B;  2KYB A;  2LQN A;  2LQW A;  2ROT A;  4J9D A;  4K11 A;  4RTY A;  2VVK A;  1H92 A;  4ZNX A;  1BB9 A;  4LUD A;  3I35 A;  2JMA A;  2KBT A;  2J06 A;  3RBB B;  2DM1 A;  3EG2 A;  1HD3 A;  2RQU A;  4Z88 A;  4J9H A;  1Y57 A;  2EKH A;  2P4R A;  2DL3 A;  4KRT A;  1WFW A;  2EQI A;  2BZ8 A;  3O5Z A;  1GBQ A;  1UTI A;  1SSH A;  1ABQ A;  2XMF A;  2O88 A;  1VYV A;  4JPB W;  2E5K A;  1M8M A;  1BK2 A;  4AFZ C;  1YWO A;  1M3B A;  4RTT A;  2PNI A;  3U23 A;  1M27 C;  2JS0 A;  4AFQ C;  1AWJ A;  1OPK A;  2C0O A;  2DJQ A;  1HSQ A;  1ZUU A;  2RQV A;  3EG1 A;  3I5S A;  2DRM A;  5I22 A;  4JJB A;  3QWY A;  1TUD A;  1SHG A;  1X2Q A;  2YUO A;  1QCF A;  1B07 A;  2ESW A;  2HCK A;  4OMP A;  4LNP A;  1X6B A;  3VRZ A;  4GBQ A;  2DLP A;  1WX6 A;  2DL5 A;  2RPN A;  5EC7 A;  2W0Z A;  3PVL A;  2CH4 A;  4J9F A;  2M0Y A;  1EFN A;  2L2P A;  2FRY A;  3EHR A;  1CKB A;  1WXU A;  4J9C A;  3TSW A;  4Z8A A;  1BBZ A;  2O31 A;  2GGR A;  1AVZ C;  2YSQ A;  5I11 A;  1PKT A;  3I5R A;  1YNZ A;  1I0C A;  1AZG B;  4Y92 A;  2RN8 A;  1GFC A;  3M0P A;  1K1Z A;  2LZ6 B;  2W10 A;  2J6K A;  5HCK A;  1CKA A;  1AZE A;  1I1J A;  1GBR A;  2KT1 A;  1JO8 A;  1QKW A;  1MV0 B;  2CT3 A;  4AG1 C;  2KEA A;  1SPK A;  1GFD A;  1M3A A;  1U06 A;  2EW3 A;  3I9Q A;  5FWC A;  2JT4 A;  4JZ3 A;  2ED1 A;  3FJ5 A;  3TVT A;  2HDA A;  2IIM A;  3C0C A;  4RTU A;  4IIM A;  3UF4 A;  2JMC A;  2EVR A;  4FSS A;  1OPL A;  2O9V A;  2JM8 A;  2J7I A;  4DEY A;  1JXO A;  5ECA A;  2CSI A;  2EYW A;  1UUE A;  4OMO A;  2D0N A;  2FEI A;  3H0F A;  2KE9 A;  1T3L A;  1KJW A;  2CT4 A;  1SHF A;  1NLP C;  3EG3 A;  4OMM A;  1BU1 A;  1TUC A;  3KFV A;  3EGU A;  4WCI A;  2PZ1 A;  2EGA A;  2NWM A;  1RUW A;  1H8K A;  2DL4 A;  1Z9Q A;  3VS6 A;  4X1V A;  2JW4 A;  2FRW A;  2YUP A;  3RNJ A;  1M3C A;  2EPD A;  3VS5 A;  2F2X A;  4J9I A;  3UA6 A;  2FPD A;  2BTT A;  3ZL7 C;  4OMN A;  2GBQ A;  1PWT A;  4ESR A;  2G6F X;  2KGT A;  1VYT A;  2M51 A;  1VA7 A;  1ZUY A;  2KRO A;  2V1R A;  1IO6 A;  5FWB A;  2OI3 A;  2O2O A;  1TG0 A;  1GL5 A;  1AOJ A;  2EGC A;  3H0I A;  3VS4 A;  2F2V A;  1JU5 C;  1VYU A;  1X2K A;  2C0I A;  3PE0 A;  1UJY A;  2CUD A;  2RQR A;  2CDT A;  1OEB A;  1NLO C;  4AFS C;  2D1X A;  1ARK A;  1WIE A;  3NGP A;  1ZUK A;  4QT7 A;  1A0N B;  1AD5 A;  1RI9 A;  2JTE A;  1E6G A;  2DA9 A;  1AEY A;  1T3S A;  2SEM A;  2LJ1 A;  2ABL A;  3SHW A;  4CC7 A;  2F2W A;  1WXB A;  2C0T A;  1AWX A;  1LCK A;  2KRN A;  1UGV A;  2FPF A;  1QKX A;  3NPF A;  2DRK A;  1Z9Z A;  1YWP A;  2L3P A;  1J3T A;  1WYX A;  2PTK A;  1NYG A;  4HXJ A;  3GBQ A;  5IXF A;  1QLY A;  2GNC A;  2KNB B;  2J6O A;  1SRM A;  2AZV A;  2MOX A;  1PRM C;  1QWF A;  1NM7 A;  1UHC A;  4F16 A;  4E6R A;  2DX1 A;  3VRY A;  1KIK A;  4F17 A;  2ROL A;  2EGE A;  2A36 A;  2RMO A;  3REA B;  2A28 A;  1MUZ A;  2NUZ A;  3M0S A;  1UDL A;  4HVV A;  2DYB A;  4EIK A;  1G2B A;  1GCQ A;  2L0A A;  3UAT A;  2HEQ A;  4RTZ A;  5FW9 A;  1NEG A;  2ED0 A;  3PVQ A;  2EYY A;  1WA7 A;  2HBW A;  3TSZ A;  2A08 A;  2RNA A;  3LH5 A;  2DNU A;  2MCN A;  1ZBJ A;  1NEB A;  2AZS A;  1X27 A;  1KFZ A;  1GCP A;  2OAW A;  2VKN A;  1WDX A;  1K9A A;  4IIO A;  2YUN A;  1W1F A;  3UA7 A;  2K6D A;  1UG1 A;  1T0H A;  4CC3 A;  1UHF A;  2DVJ A;  2JM9 A;  1X43 A;  2MIO A;  3EG0 A;  3REB B;  1S1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...