2B86A

Solution structure of the first src homology 3 domain of nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
b'MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Solution structure of the first SRC homology 3 domain of human nck2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2b86A00
2HBWA 4RTXA 2V1RA 2YDLA 1UTIA 5ECAA 4F17A 1NLPC 1HD3A 2EPDA 1UG1A 4J9DA 1VYVA 1T3LA 3NMZC 1GFDA 2MCNA 1H92A 1UECA 1TG0A 2AK5A 1X69A 3ULRB 3UATA 1ARKA 1KIKA 2DBMA 4JJDA 1X6GA 1UDLA 1WFWA 1E6HA 4QT7A 1W6XA 1QLYA 3VS3A 2ABLA 2DVJA 1UFFA 1ZLMA 1RLPC 1SRMA 3SHWA 1RUWA 2J6KA 5FWCA 1VA7A 1YCSB 2KBTA 4IIOA 3EG3A 1JXOA 3TSWA 2L3SA 4R0KA 1WYXA 2RN8A 2LZ6B 4JZ3A 2YUQA 4J9CA 4JZ4A 1H3HA 1JXMA 2LQNA 3I5RA 2RQVA 1M3AA 2EGEA 1CKAA 1NEGA 1K0SA 2ROLA 2M51A 1AWOA 4F14A 1G83A 1WLPB 2O31A 1NG2A 1MUZA 1PHTA 1NM7A 4AFUC 1YWOA 2EYXA 2D8JA 1GRIA 2I0NA 4JPBW 4ESRA 2YUNA 3VS0A 4ORZA 3REAB 4DEXA 1VYUA 1AD5A 2HCKA 1QCFA 2JTEA 2J7IA 1I0CA 2HDAA 1AZGB 2X3WD 4WCIA 2KR3A 1Z9QA 1GCQC 4GLMA 2KRNA 2A37A 2C0OA 3M0UA 2KT8A 1YP5A 1ABOA 3TSZA 2G6FX 1ZUYA 3H0IA 4OMPA 3EG2A 2D1XA 1ZBJA 1QWFA 2H8HA 2GBQA 4K11A 4CC7A 4J9BA 3M0SA 5HCKA 3ZL7C 1JU5C 2LJ0A 3M0TA 1FMKA 1OEBA 2CT3A 2JM9A 4CC3A 2JMCA 4OMOA 4E6RA 3REBB 2RQUA 2NUZA 2EGAA 4FSSA 1JEGA 5FWBA 1OOTA 4HCKA 2ECZA 4ZNXA 1N5ZA 1T3SA 4J9GA 1TUDA 1OV3A 2JT4A 2DRKA 1I1JA 1T0JA 3I5SA 2O2OA 1BBZA 2RF0A 1U3OA 1X27A 1K1ZA 2JMAA 1W1FA 2L3QA 4RTZA 1K4US 2RQTA 4D8KA 1AOJA 1ZUKA 3PVLA 2JS2A 3JV3A 2E5KA 2DM1A 5I22A 2J05A 2LJ3A 2JM8A 2KEAA 3PE0A 2JS0A 2BZ8A 3QWYA 2C0IA 2DX1A 1UHCA 4GBQA 1M3CA 2BTTA 2KRSA 1QWEA 4M4ZA 4HVUA 1NEBA 2J06A 1SHGA 4Y92A 2NWMA 1SRLA 2D0NA 3VS5A 4JJBA 2ENMA 1TUCA 3GBQA 2FPDA 2SEMA 1GFCA 1AEYA 2J6OA 1VYTA 1CKBA 2C0TA 1WA7A 3EG1A 4J9IA 1M30A 2L2PA 4RTTA 1YWPA 3THKA 4J9EA 1M27C 3UF4A 1MV0B 1JO8A 2FO0A 3O5ZA 2KROA 3M0RA 4HVVA 1SEMA 2DLPA 1WX6A 4CC4B 1QKWA 2EKHA 1NLOC 2CUDA 1BB9A 2CT4A 2PZ1A 2KRMA 4Z8AA 2OAWA 3EHRA 4RTYA 4JJCA 1Y0MA 4EIKA 1W70A 4OMMA 3R6NA 3A98A 5IHNA 1B07A 2CDTA 2DJQA 2LQWA 1BK2A 3EGUA 1GCPA 1YNZA 4HXJA 2L0AA 5L23A 3LH5A 4KRTA 4Z88A 1HSQA 1WXUA 2HSPA 1GCQA 2RQWA 4A63B 2L3PA 2LP5A 2YSQA 1CSKA 1HJDA 1UJ0A 5IH2A 1RLQC 3VS2A 1UUEA 1UE9A 2P4RA 3UA7A 2CUBA 1QKXA 3VS4A 1PNJA 1OPLA 2EQIA 4RTWA 2DL5A 2KGTA 1RI9A 1GL5A 3PVQA 2CSIA 2AKLA 1AWWA 2EYZA 2HEQA 1NYFA 2OJ2A 3KFVA 2DL7A 2X3XD 2MOXA 3VRYA 5I11A 2KXCA 2GTOA 4CC2A 2VWFA 4AFZC 3IQLA 3SEMA 1M3BA 1KFZA 2PNIA 1PRLC 1M8MA 3H41A 4J9HA 2CSQA 2ED1A 2LMJA 2DRMA 4LUDA 5IHKA 2FPFA 2O9VA 1G2BA 2KNBB 3I9QA 3C0CA 2AZSA 1EFNA 4RTVA 1B3QA 2K9GA 1WXTA 3UA6A 1OPKA 2F2XA 2CH4A 5IHIA 1H8KA 2K3BA 2RPNA 2GTJA 2RMOA 2EW3A 3I35A 2EGCA 2OI3A 1E7OA 1AWXA 4LE9A 4AG2C 1ZSGA 2O9SA 1KSWA 1PWTA 4Z89A 4LNPA 1UHFA 1AZEA 4IIMA 2BZXA 2GNCA 2MIOA 1X2QA 2ESWA 2LX7A 1PKTA 2ED0A 2KYBA 3QWXX 2FEIA 2PTKA 4RUGA 1I07A 4AFQC 2VKNA 4AFSC 1JQQA 1S1NA 1XOVA 2CH4W 1WI7A 1WIEA 2K6DA 2XMFA 4RTUA 1GBRA 1PRMC 3U23A 3CQTA 2DNUA 2F2VA 5EC7A 4LUEA 2W10A 2FPEA 1FYNA 2RNAA 2DE0X 3RNJA 1Z9ZA 2A08A 3M0PA 4J9FA 2M0YA 3NGPA 2IIMA 2DBKA 1PKSA 1K76A 2EYWA 4F16A 4OMNA 1X43A 2A36A 2DF6A 2AZVA 2FRWA 2YUOA 2JXBA 1X6BA 2K2MA 2RQRA 1LCKA 2DL4A 2K7AA 1SHFA 2B86A 2J6FA 2DMOA 1MV3A 3M0QA 2ROTA 4OMQA 4DEYA 3VS7A 2EYYA 2VVKA 2KXDA 1BU1A 3RBBB 2BZYA 2GQIA 2DL3A 1U5SA 3TVTA 1NYGA 2FG0A 3VS6A 1ZX6A 1WXBA 1T0HA 4LN2A 2KYMA 2EVRA 2GGRA 2YT6A 3H0FA 1E6GA 3NHNA 4X1VA 1AVZC 4HVWA 2LCSA 1AWJA 3VS1A 2LJ1A 2F2WA 1YN8A 1UJYA 2D8HA 2K79A 1U06A 1V1CA 2DL8A 2O88A 2CREA 5FW9A 1J3TA 3EHQA 1X2KA 2YUPA 4D8DA 3FJ5A 2A28A 3NPFA 1ABQA 2KE9A 2AKKA 1K9AA 2V1QA 2DILA 5GJWB 1KJWA 2EBPA 2KT1A 1UGVA 5IXBA 1IO6A 1ZUUA 2JW4A 1GBQA 1A0NB 2QDLA 3EG0A 3H0HA 2SRCA 1SSHA 1WDXA 4OMLA 2W0ZA 4AG1C 1SPKA 3VRZA 1Y57A 2FRYA 5GJVB 2DA9A 5IXFA 2DYBA 1K0XA 2LNHB
chains in the Genus database with same CATH superfamily
4RTXA 4Y28E 1UTIA 5ECAA 4F17A 2EPDA 1MMNA 3NMZC 1Q95G 1UECA 1D0XA 3ULRB 5I2SA 3EAEA 1KC8C 1VQ7A 3JCMg 3H8ZA 4MZTA 4PFPA 4UC4A 4QQGA 2ABLA 2DERA 1ZLMA 3VV0A 3CC4A 4M77E 4M77A 3H9NA 3SHWA 2J6KA 4A54A 3RIRA 2QGFB 1Y96A 3VYHB 4PJMA 4F7UG 2RN8A 4M77B 5CKHA 3FLGA 3M9QA 4J9CA 4DA4A 2D9TA 2EGEA 2JUFA 3WXMB 5KYUA 2ROLA 4M7DE 4M7DA 1IRXA 1Y96B 2CS7A 2M51A 2RHIA 1G3YA 4FYYB 4C0ZA 2O31A 1NG2A 1PHTA 3I55Q 1M1KC 3LW5E 4AFUC 1YWOA 3HPWA 5KYUB 3QYHB 4M7DB 1VQLA 3HRTA 2P0PA 5DM7R 3VS0A 4ORZA 3BDUA 1QCFA 4WCIA 4KH0B 5KYYA 1N6AA 5J26A 2RI2A 2KT8A 5LJ3e 1YP5A 1ZUYA 2D1XA 1M90U 5KYYB 4JRQA 4K11A 1ACMB 3M0SA 3FEOA 2LJ0A 3G4SA 3OSVA 3T9NA 2Y90A 3CMAQ 2EGAA 2KI7A 2MWPA 3HFNA 4ZNXA 1N5ZA 2E12A 1OV3A 3TU4K 2DRKA 3HRUA 1I1JA 1T0JA 3I5SA 2RF0A 2M16A 1OZ3A 1K1ZA 4HT8A 1K4US 3UT1A 3PVLA 4D6WA 3L2QA 2E5KA 1M8VA 3M5AA 1RAFB 5DLQE 2XI9A 5C0MA 2ZZDA 3CCRT 2FHDA 1ZA1B 2JS0A 1VOMA 4RG2A 1MGQA 3QWYA 2X51A 3CD6Q 4XAXB 4GBQA 1M3CA 4L6V5 4LDUA 1WQWA 2DYBA 4M4ZA 1R8OB 4M78E 1SHGA 2FB7A 4M78A 2O4XA 2NWMA 1SRLA 1VQ4Q 2FPDA 1RABB 2LNVA 3G71A 2OTLA 4FL6A 1VYTA 1CKBA 4M78B 3CEYA 5GAN8 2O4XB 2L2PA 3THKA 4F7UF 5GMKh 3JCMP 2CGHA 2KK4A 2DPPB 4M7AE 4M7AA 3V7SA 1KQSP 1WX6A 2DD5A 2EKHA 1MMAA 2QXFA 4M7AB 3JCMb 1UGPB 2CUDA 5DLOA 5DY9A 2IPOB 2RHZA 4J7IA 4C5GA 1VQ6A 2WSFE 3PT9A 5IHNA 2DJQA 3EGUA 1BK2A 3CCVQ 1GCPA 3FDRA 1Q82C 1YIJA 4BD3A 3LH5A 1VQNT 4C92G 1ZSZC 4XK8E 3CPWP 3PTAA 1K73U 1NZ9A 3META 3CCST 1GCQA 3MEAA 2L3PA 2LP5A 1KQSA 1BIBA 3A1PA 3I56A 2VXFA 1YJ9Q 1UJ0A 2ZCFB 1UE9A 2P4RA 3UA7A 1UGRB 3JCMQ 3FB9A 1YCYA 2XK0A 1VIEA 2AHJB 2JNGA 3PVQA 1O9SA 2CSIA 5KE2A 3QXEB 4PK4A 3RERA 4ELYC 2PUKB 2QA4Q 4LDVA 2EYZA 1VQ9A 3MP8A 1NYFA 2OJ2A 4IUVA 5LJ3f 3HTRA 4C8QD 4MDWA 3JCMh 1H641 3C4SA 3CCUT 1C6VX 2X3XD 2MOXA 1VQ5A 3M57A 1UEBA 4XTZA 2YLCA 2QEXQ 4AFZC 3IQLA 3SEMA 5GAN3 1M3BA 5LJ5j 3H41A 3INZA 5KCOA 3VUZA 5LJ5d 3JB9J 5GAMe 2QQSA 4C0DB 1YJNT 4IKFA 3LH0A 3C0CA 2XICA 2K9GA 3UA6A 1RACB 1H8KA 2RPNA 2EGCA 1E7OA 1AWXA 1TXQA 1C0MA 1S72Q 2O9SA 2NLUA 2FZKB 4LNPA 5IT9E 1Q86R 1UHFA 1MHNA 3CPFA 3LGLA 4OB1B 1Q7YR 2QGGA 5GAN2 3OS2A 3QYGB 1PC0A 2GNCA 1EZZB 5A2QE 2XDDA 1P92A 3EH1A 4BE2A 1PKTA 4ELZC 4OGEA 1OYXA 1QVGP 2KYBA 3QWXX 3E2UA 2P4TA 1FXXA 4AFQC 4BE1A 3X20B 4QW2A 3CCMT 4KGXB 1WI7A 4HKEA 1M1KU 1VQPA 4RTUA 4RCCA 2PVGB 1WJSA 1YITA 2DIQA 4LUEA 3P8HA 4J5YA 2DE0X 1YI2A 1G3WA 2VC8A 2CP7A 3CC7A 2A08A 3NGPA 2IIMA 3FJPA 4C92F 2KMTA 4GLKA 4KT0E 4JRIA 4BE0A 2DF6A 1RAEB 2KVQG 4N0AA 4BACA 3SWNC 2JJ9A 2XU8A 3E9GA 5GAMj 1MV3A 2X4XA 3A5ZB 4OMQA 5CCAA 2EYYA 2VVKA 1WZOA 3A8GB 4WF2A 5GAMd 3CCQT 3V8KA 2BZYA 3L2RA 1JJ2P 3TVTA 1VQOA 1NYGA 2FL7A 4M77D 2FG0A 4XTWA 1VQMA 1M90C 2ZPGB 1JRIA 2COYA 4FT4A 2KYMA 2EVRA 5LJ5g 1TUGB 2GGRA 3EH2A 4LDWA 1DJ7B 2CZ1B 1AVZC 4A4EA 2F2WA 1V1CA 2K79A 4E7KA 4M7DD 2DL8A 2O88A 5FW9A 2YLBA 1X2KA 3JCMe 4D8DA 2DEUA 1ABQA 2D6FA 4ATOA 2V1QA 2DILA 4LD9K 2KT1A 4PJJA 3HP9A 4OB0B 3BW1A 1ZUUA 1TOVA 3EG0A 4J7FA 4OMLA 2DKGA 2QASA 2W0ZA 1QMCA 2BUDA 2R5AA 2FRYA 3OYHA 2KQWA 1QVFP 2OTLT 3X25B 1K0XA 1U1TA 2HBWA 3FIFA 3MCAB 2YDLA 2LRQA 3HKSA 5GAOn 5GMKl 2A7YA 3CC2T 2RK2A 3C12A 1T3LA 4IUTA 4OGCA 2AK5A 4VUBA 1OX9A 4L59A 1YHQT 4JJDA 1UDLA 2QAZA 1WFWA 1QLYA 3VS3A 1WHMA 1PCXA 1VQ8A 4V2SA 4IUUA 1RLPC 1SRMA 2RK1A 3SDZA 1QVFA 2COWA 5GAMg 1KD1R 5AT1B 3RKWA 4JZ3A 4PNOA 1JXMA 1H3HA 2LQNA 1K8AU 1CKAA 1YIJT 1K0SA 1I4K1 4PJLA 4X9DA 2CYZB 3CCRQ 1BI0A 3JB9D 4F14A 1WLPB 2E65A 1NM7A 2CZ6B 3L1AA 1ZHIA 2R58A 9ATCB 4M75G 2NUTA 3OYIA 2L89A 2YUNA 3REAB 4KULA 1AD5A 1OU8A 4M78D 3V7CA 2DETA 2JTEA 2COZA 2J7IA 3RKYA 4EMKC 2X3WD 2NUTB 2KR3A 4GLMA 3C94A 1EX4A 4Y91A 2C0OA 3CCLT 4OF1A 1K73C 3H0IA 1NPRA 2X4JA 1QWFA 2GBQA 4J9BA 3OYJA 2P84A 4M7AD 2ZAEA 3M0TA 1OEBA 2CT3A 5CO7A 3LYIA 2HL5C 2L8DA 2EYQA 3H6ZA 4HCKA 3L2VA 1T3SA 5GAN6 1K9MR 4J83A 4J9GA 1TUDA 4X34A 3A8LB 2OTJT 4PJOE 4PJOA 3LWHA 2O2OA 4XU0A 3RMQA 2JMAA 1N8RR 1QW1A 1WJQA 2KDSA 4RTZA 4C5HA 3GOXA 3ZFJA 2RQTA 2F5KA 4PJOB 1AOJA 2K5FA 4ME7A 3DKMA 3JV3A 1OI1A 3M56A 2DM1A 2HBPA 1VQNQ 2A0FB 2J05A 2E3HA 1RAIB 4OVAA 3CCSQ 2RJDA 5GAOl 2VV5A 2EIFA 3PE0A 3KXTA 3JCMf 2DX1A 1UHCA 3P8BB 3E1SA 2CP2A 1QWEA 5FLXE 2MK5A 3CXCP 4HVUA 2HZYA 3RMSA 4KGZB 3VS5A 4JLIA 2MYSA 4XTUA 2RB6A 1GFCA 3OS5A 2GF7A 4JJNK 5CK9A 5I21A 2C0TA 1WA7A 1X75C 1M30A 3I55A 1D0YA 3L2ZA 3PFSA 4J9EA 4FYWB 1YJWT 1W2BP 3UF4A 1MV0B 3CCUQ 2FO0A 3OYDA 1MMGA 1BCOA 2CZ0B 3M59A 1LNXA 4BDZA 4PFZA 3E19A 3TEEA 2E3IA 2DLPA 1QKWA 3HHTB 1R77A 1Q81C 4M75F 5LJ5h 2QYZA 4JDSA 1X6OA 2PZ1A 1IREB 2OAWA 1YFNA 3EHRA 4RTYA 2HKQB 1YJNQ 1TTHB 2EQJA 4JRKA 5EG2A 2EJFA 5J39A 1B07A 2CDTA 4R55A 1LOJA 3PGGA 4EMHA 4A4HA 1Y07A 4LD6A 1W2BA 4BUGA 3OS0A 3CMAA 4HXJA 2L0AA 3EGDA 5L23A 2LTOA 1OU9A 2YRVA 2YSQA 3S3MA 3EGDB 2K57A 1RLQC 3CMET 3UWNA 5HY6A 1OPLA 1SF9A 2EQIA 5CVIA 2DL5A 2KGTA 4TVRA 4FU6A 3M58A 5D6WA 3CCMQ 2DO3A 4N4IA 3PIOA 2FZGB 3ZEHA 4BB7A 5KYNA 2R5MA 3QIIA 3OYCA 1NJIR 1I5LA 5IN1A 4M75C 3CCJT 3CD6A 1B7TA 1VIFA 4A4GA 1W2BS 4HA8A 2GFUA 3HRSA 1W4SA 1PSFA 2RA2A 1KFZA 3JCMV 1M8MA 3PMIA 1KK7A 5C6SA 2LMJA 1WGSA 4LUDA 5CKDA 5GAMh 3OMGA 3CCQQ 1V29B 1KC8R 3M4YA 3I9QA 1VQKT 3X26B 1EFNA 2K3YA 2F2XA 4DOVA 2JTFA 2NUPA 4PKCC 2K4YA 2GTJA 2RMOA 2EW3A 1N9RA 4E7ZA 2DXTA 4LE9A 4AG2C 1ZSGA 1Y71A 3FC3A 3Q1JA 2RI3A 4Z89A 1FX7A 2QQAA 3G1JA 2FYKA 2NUPB 3JB9H 4IIMA 4NS5A 2BZXA 2BKDN 2QI2A 4IURA 1OQKA 2DEQA 3O8VA 5I2MA 3OBYA 3VU3C 2V8IA 2K5IA 3M54A 4PJNA 1PD1A 2CP0A 2FEIA 2PTKA 3TQ7P 4HCZA 4HT9A 2YWWA 1I07A 1M1FA 3CCVA 4AFSC 1M1KR 4DBFA 2XMFA 2K3XA 5LJ5e 4BDYA 3CQTA 3JB9I 2XG8D 1K8AC 2IVWA 2W10A 2FPEA 4QVZA 1FYNA 2QQBA 2OTLQ 2YHTA 3RNJA 2BE7D 4J9FA 4C0GA 1YJ9A 5GAOq 2VUBA 3CC2Q 1K76A 1WHJA 2ZPEB 3OYKA 1X43A 2A36A 5GAN5 2ZPFB 2K5LA 2FRWA 4ZN3A 3R6OA 3CCET 2K2MA 4II1A 3QJYA 1LCKA 1YHQQ 3OYNA 1NPPA 1D1CA 2QA4A 1ZSZA 3VS7A 2YXYA 4E7HA 3OW2P 1QP2A 1YBYA 3RBBB 3G6ET 2DL3A 2JVVA 5LL6S 3ME9A 2JTMA 3VKIA 1Y7XA 1IGUA 4KUIA 1ZSZB 3MEVA 3GPLA 4N4HA 4F7UE 4F7UA 2YT6A 1HYOA 4J6YA 4X1VA 2FVUA 1UJYA 4E7SA 3PMTA 2F69A 1OX8A 4F7UB 4BI8B 1YIJQ 2IG0A 3CPWA 3NTIA 3NPFA 2AKKA 1IO6A 1IHVA 4C0FA 2JW4A 1KQSS 4J8OA 2DAQA 3GNFB 3QZ9B 1VQ7T 3OYGA 1XTDA 5GAN7 2RJCA 4E7LA 5GANj 2E4HA 1S72A 4QVCA 4C0DC 3VYGA 1SPKA 3VRZA 5GANd 3CCLQ 2XHCA 3V7RA 1SG5A 2LNHB 2QTXA 3CC4T 2JN0A 4C8QG 1M4ZA 4J9DA 1VYVA 1GFDA 1KHCA 2MCNA 4MMKA 2BIVA 1X69A 1M1GA 3UATA 1IXDA 1ARKA 3CPWS 3OY9A 4PJOD 2OTJQ 1XNIA 4KH1B 1UFFA 2RHXA 1VQLT 1RUWA 5FWCA 3V8LA 2CP5A 1Q81U 5GMKi 4R0KA 3QSUA 2HQEA 1D0ZA 3J81E 2LZ6B 3ASKA 1OULA 2E1HA 3AHUA 3I5RA 3ZBDA 3EFRA 1NEGA 2ZGWA 2JOYA 2DTIA 1IHWA 4JLGA 1FWZA 1V76A 3JAME 1Q82R 2JZ2A 1PSEA 2DZCA 3JCMJ 3MO8A 3G4ST 3OS1A 1QVGA 2RO0A 5CQXA 1QCOA 1UB4A 2RHUA 2HDAA 1AZGB 2QDYB 4N0AC 4ZGJB 2LCLA 1FMWA 1Z9QA 1X01A 2HKNA 3SWNA 4IUPA 2KRNA 2A37A 5FU6C 5LJ5f 3M0UA 2KSSA 3A8OB 4ZGDB 1ABOA 3TSZA 4OMPA 4R56A 1RAHB 4XU1A 1ZBJA 3SWNB 2H8HA 1QP3A 3S3NA 1YJWQ 4CC7A 5GANg 3F70A 5HCKA 3ZL7C 1JU5C 5FROA 4HCCA 1FMKA 3QKJA 2JM9A 4CC3A 3BFMA 4RG8A 3M53A 2VASA 3SFMA 8AT1B 1N9SA 4B9WA 1OOTA 1B34A 2AT1B 2OX7A 4O6JA 1QVGS 1U3OA 2M1HA 5HK0A 1JBMA 1JJ2A 4M77G 1BI3A 3HFOA 4BI4A 2L3QA 1B34B 3QUIA 4P5NA 2LCCA 2RJFA 4D8KA 3JCMX 5GAN4 1ZUKA 4X9CA 3J7AF 5A0DA 3G71T 4C92E 4C92A 3OYMA 4C8QF 4DBRA 3FRNA 1PM3A 2LJ3A 4ANJA 4M7DG 2LT4A 4C5EA 4C92B 2C0IA 2XKOC 1F1BB 4FM4B 1WPYA 2BTTA 2KRSA 3CMEQ 3M55A 2E10A 1WHLA 2J06A 2KAFA 3RDVA 1KG1A 4Y92A 2QG9B 3MEUA 1D1AA 2ENMA 3GBQA 3NTHA 1AEYA 4FIBA 2J6OA 2MAMA 5GAMf 2EFIA 4XTYA 1JJ2S 1UGQB 4XTXA 1I81A 1M27C 3CCJQ 1JO8A 1Q7YU 1VQ6T 2MWOA 4ZN1A 2DJZA 3M0RA 4LDXA 2Y4YA 1D1BA 1NLOC 3UPUA 4JRPA 3LLRA 2VGMA 2PVOB 4C8QC 3I56T 1G3TA 2LC4A 4FYVB 4AT1B 4JJCA 1Y0MA 5FU7B 4FW2A 2XDPA 1W70A 1VQKQ 1NBEB 3G7ZA 1U8RA 5GAOm 2Y4XA 1M2VA 2KY9A 4BY6B 5D6YA 4XU3A 4KRTA 4EMKA 1M90R 4Z88A 1M2VB 2HQXA 1VQ9T 1QVFS 1WXUA 4A63B 2RQWA 2CP6A 2HSEB 5D7UA 1O75A 1QVPA 1GXIE 1CSKA 2MF2A 4DBHA 3JB9G 4EMKB 1HJDA 1VQ5T 3MJXA 1MNEA 1UUEA 1D3BA 1HXDA 2CUBA 1OZ2A 3KUFA 3WVDB 2E5QA 3VS4A 2GCXA 4M78G 1RI9A 1GL5A 1M5Q1 3QJ6A 1D3BB 5L8RE 4J6WA 4M77F 1VQNA 1QQJA 5CKFA 2HEQA 3OYFA 3M4GA 3EG9A 3CCSA 3MP6A 4E7JA 2DL7A 1MNDA 1C1AA 5I11A 3QPHA 3EG9B 3LWIA 2KXCA 4YTLA 2GTOA 2EWNA 4NOYA 5GAOr 4MMLA 4CC2A 4M7DF 5KH6A 2HNIA 4M7AG 2RH2A 5J3BA 4JS5A 3CCEQ 1PRLC 4J9HA 3GLXA 2ED1A 5IHKA 2O9VA 3OBWA 1MMDA 2X9HA 2LVMA 3G6EQ 1RI0A 4RTVA 3CCUA 5KCHA 1OPKA 4CRIA 1WHKA 3GP8A 2OI3A 2WSEE 1VQPT 3OMCA 2O01E 5FRMA 3GIBA 1KSWA 1LJOA 1PWTA 3URGA 1YITT 4ZGEB 2GFAA 2HAXA 1YI2T 4M77C 3CC7T 1X2QA 2LX7A 1YJNA 3SB2A 3QDRB 1IZ6A 2ED0A 4E7IA 1G5VA 4Z02A 4CI0C 1BI2A 2MPXC 1JQQA 3CXCA 2CH4W 1VQ7Q 1WIEA 4M7DC 1GBRA 2CP3A 3RKXA 1KD1U 2DNUA 5GANh 2RNAA 1VQOT 3CC4Q 1VQMT 1Z9ZA 1TS9A 3OB9A 2M0YA 2DBKA 1PKSA 3QZ5B 2EYWA 4F16A 3WVEB 4O5VA 3JCMc 4PLLA 1K73R 1X6BA 3CCMA 3QDFA 2RQRA 3JB9F 2EQMA 2B8AA 2K7AA 1SHFA 2B86A 2J6FA 3M0QA 2ROTA 2ZPHB 4ZTJA 2KXDA 1BU1A 2Z0WA 4M78F 2C06A 3MHXA 1ZX6A 8ATCB 1VQLQ 3CXCS 1KQ1A 1T0HA 2VB6A 4LN2A 4JUVA 1BIAA 2HMAA 2VXEA 3NHNA 1BKBA 4HVWA 2LCSA 2LJ1A 1YN8A 4LXCA 1U06A 3MEWA 2CREA 2DXBA 3PNWC 3EHQA 2H3JA 1AHJB 2EQUA 2A28A 4M7AF 3CCQA 1K9MU 5GJWB 1KJWA 4M75E 4M75A 5IXBA 1BI1A 3AT1B 5KYXA 3G4SQ 4IUQA 1VQ4A 1GBQA 4Q5WA 2QDLA 3TCJA 1N8RU 4DOWA 2FZCB 4M75B 1BCMA 1WDXA 5KYXB 5GJVB 3DLMA 1VQ8T 5CAIA 2PVDB 2V1RA 5KE3A 1NLPC 3PIPA 3OYAA 1HD3A 1LPLA 2DIGA 1UG1A 1U1SA 1AT1B 5M9OA 1H92A 4M78C 3MP1A 1TG0A 4JS4A 2WACA 3LGFA 4KGVB 3A8HB 5CKEA 2EQKA 2QQ9A 1M9SA 1KIKA 2DBMA 1X6GA 2VYTA 1XQHA 5LJ3j 1E6HA 4QT7A 1W6XA 4FSXA 2M0OA 3JSCA 2DVJA 5GAOp 5LJ3d 3L2UA 4MDXA 1VA7A 2PUOB 1Q86C 1YCSB 2KBTA 4IIOA 3CC2A 4C5IA 4M7AC 2CKKA 3DB3A 3EG3A 1JXOA 1Q7YC 1Q81R 3TSWA 2L3SA 1WYXA 5CQYA 2YUQA 5GANe 4ZTFA 1ZBXA 2RQVA 4C92D 2HL3A 1M3AA 3G71Q 1YHQA 1RAGB 2E41A 3VUBA 2G3RA 1I5OB 2M02A 2HQHA 4FCYA 1AWOA 1G83A 1MUZA 5CR2A 5AYFA 2EYXA 3SD4A 2D8JA 4E47A 1GRIA 2I0NA 4JPBW 4ESRA 4NL2A 4QKUA 3C95A 4MZMA 4DEXA 1VYUA 4E2FB 2HCKA 4FYXB 1XJWB 1I0CA 3JRZA 3OA6A 1GCQC 2XDBA 4PLIA 2G6FX 2EKOA 4A53A 3EG2A 1R0CB 2QEXA 4NL3A 2M9UA 1VQ6Q 2JMCA 4OMOA 4E6RA 3REBB 2RQUA 3BDLA 1JB0E 2NUZA 4FSSA 2D0QB 1JEGA 5FWBA 3CBOA 3EFOA 4QQDA 2ECZA 4QVDA 3CCLA 2JT4A 1TSFA 2L5QA 2RM4A 3I56Q 2H3EB 1BBZA 3EFOB 3OW2A 1X27A 1BYMA 4F04B 3RESA 1NJIU 1H3ZA 1W1FA 3EGXA 1R0BG 1WHHA 2RHYA 2A3LA 3E9FA 5LJ3g 2JS2A 3QBYA 3ER0A 3J80E 3EGXB 5I22A 2JM8A 3CBPA 4KUDK 2DXUA 1VQ9Q 2RD1A 1HK9A 2KEAA 3I55T 2DVEA 2E6ZA 4EDUA 2OTJA 2BZ8A 2DK3A 2CZ7B 1N27A 1VQ5Q 3VJPA 4OB2B 1KC8U 2XD0A 3X28B 1NEBA 4PL6A 4OB3B 2D0NA 2NYSA 4JJBA 1TUCA 2SEMA 3OYBA 2YRDA 1ZQ1A 3CBMA 5CIUA 3OW2S 2LDMA 2HD0A 4A4FA 1WNLA 2EAYA 4PFOA 3EG1A 4J9IA 4RTTA 1YWPA 4N4GA 2V8KA 2L3RA 5GMKe 4FW1A 3DB4A 1WHGA 3O5ZA 1IGQA 1WQ7A 1K8AR 3GF5A 2KROA 3CMAT 4HVVA 1SEMA 4CC4B 5KYWA 2VGNA 2QK0A 1KQ2A 1KD1C 2I2LA 1PD0A 1BB9A 2CT4A 2KRMA 4Z8AA 5KYWB 4PJOG 2E64A 4EIKA 4DBQA 2X4WA 1KHIA 3LX7A 1YJWA 1D09B 5GMKm 4OMMA 3R6NA 7AT1B 3A98A 2LQWA 1IB8A 1YNZA 2PQWA 1ZA2B 4RMOA 1VQPQ 2EJ9A 5IAYA 5GANf 1HSQA 1YITQ 2DTHA 2DZ9A 2HSPA 1RAAB 3QO3A 3BE3A 2GQVA 1YI2Q 2K2VA 3CD6T 3CC7Q 4RKUE 1RL2A 2LT1A 5IH2A 3HL8A 3VS2A 4QQ6A 5FU6B 3L2WA 1QKXA 3UDCA 1PNJA 4RTWA 1SKUB 1VQ4T 3JCMW 2AKLA 5GMKj 1AWWA 4XQ3A 4EPCA 3KFVA 1VQOQ 3TREA 1VQMQ 4XU2A 3VRYA 1K9MC 3CMEA 2YRCA 3V8JA 2EJGA 2VWFA 4RCBA 1N8RC 2PNIA 2CSQA 4C92C 1VUBA 2DRMA 3KBGA 4BI3A 4L5GA 2FPFA 2DD4A 2X4YA 1G2BA 2E6NA 1RADB 2X35A 2KNBB 1TU0B 1I8FA 2AZSA 3OSSC 3CCJA 1B3QA 3X24B 1WXTA 4AMCA 2CH4A 5IHIA 3CCVT 2K3BA 3N5BB 3I35A 4B6MA 4J6XA 4XTVA 5FRNA 3CCRA 2MI6A 3RR6A 3OYYA 3MKDA 5D6XA 1Q86U 1AZEA 2ZPIB 2DYIA 1PG5B 2E70A 3QHSA 2F5TX 2MIOA 1YJ9T 1M2OA 2ESWA 4M75D 1VQKA 2AIRB 4RUGA 2LQKA 3GNGA 2P0QA 2P0KA 3RUXA 2VKNA 4MZPA 2ATCB 1S1NA 1XOVA 3MPUB 4B9XA 4PJOF 2LQ8A 2K6DA 3A8MB 4FT2A 2DFUA 1PRMC 2QA4T 2WSCE 3U23A 2F2VA 5FU7C 5EC7A 2RJEA 4KBMB 1VQ8Q 5A0GA 4C8QE 4C8QA 3M0PA 3JCMd 2BE9B 1TWBA 4BY6C 1Q82U 3NTKA 2OAUA 4OMNA 2QEXT 4A4KA 1G8XA 2QQRA 2AZVA 2YUOA 1TH7A 2JXBA 4C8QB 3S3OA 4EMGA 5A0LA 1UGSB 2DL4A 1FMVA 2PU9B 3S6WA 2DMOA 2R57A 4DEYA 3D7SB 2DXCA 2ZPBB 2MMPA 2XIDA 2GQIA 1U5SA 3QG1A 5LJ3h 3EFSA 3P8DA 3VS6A 3BY7A 1WXBA 2F1LA 1WJRA 3NFCA 3H0FA 1E6GA 4LDYA 5CKBA 4OP0A 1S72T 6AT1B 1AWJA 3VS1A 3CCEA 2D8HA 4WTOB 2DTOA 2V26A 1J3TA 4PJOC 2RI5A 2YUPA 2LX9A 1G3SA 3FJ5A 3OYLA 2KE9A 3HSBA 1K9AA 5HKCA 3G6EA 2EBPA 1QCNA 1UGVA 4GY5A 1EIFA 3DLLA 1NJIC 1A0NB 3H0HA 4OMFB 4DQ2A 2SRCA 1SSHA 3OYEA 3OQ5A 1SSFA 4HCBA 4AG1C 3L42A 2QTVA 1LVKA 1NE8A 1Y57A 2DA9A 5IXFA 4JZ4A 2V8JA 5HK3A
chains in the Genus database with same CATH topology
2HBWA 4RTXA 2V1RA 2YDLA 1UTIA 5ECAA 4F17A 1NLPC 1HD3A 2EPDA 1UG1A 4J9DA 1VYVA 1T3LA 3NMZC 1GFDA 2MCNA 1H92A 1UECA 1TG0A 2AK5A 1X69A 3ULRB 3UATA 1ARKA 1KIKA 2DBMA 4JJDA 1X6GA 1UDLA 1WFWA 1E6HA 4QT7A 1W6XA 1QLYA 3VS3A 2ABLA 2DVJA 1UFFA 1ZLMA 1RLPC 1SRMA 3SHWA 1RUWA 2J6KA 5FWCA 1VA7A 1YCSB 2KBTA 4IIOA 3EG3A 1JXOA 3TSWA 2L3SA 4R0KA 1WYXA 2RN8A 2LZ6B 4JZ3A 2YUQA 4J9CA 4JZ4A 1H3HA 1JXMA 2LQNA 3I5RA 2RQVA 1M3AA 2EGEA 1CKAA 1NEGA 1K0SA 2ROLA 2M51A 1AWOA 4F14A 1G83A 1WLPB 2O31A 1NG2A 1MUZA 1PHTA 1NM7A 4AFUC 1YWOA 2EYXA 2D8JA 1GRIA 2I0NA 4JPBW 4ESRA 2YUNA 3VS0A 4ORZA 3REAB 4DEXA 1VYUA 1AD5A 2HCKA 1QCFA 2JTEA 2J7IA 1I0CA 2HDAA 1AZGB 2X3WD 4WCIA 2KR3A 1Z9QA 1GCQC 4GLMA 2KRNA 2A37A 2C0OA 3M0UA 2KT8A 1YP5A 1ABOA 3TSZA 2G6FX 1ZUYA 3H0IA 4OMPA 3EG2A 2D1XA 1ZBJA 1QWFA 2H8HA 2GBQA 4K11A 4CC7A 4J9BA 3M0SA 5HCKA 3ZL7C 1JU5C 2LJ0A 3M0TA 1FMKA 1OEBA 2CT3A 2JM9A 4CC3A 2JMCA 4OMOA 4E6RA 3REBB 2RQUA 2NUZA 2EGAA 4FSSA 1JEGA 5FWBA 1OOTA 4HCKA 2ECZA 4ZNXA 1N5ZA 1T3SA 4J9GA 1TUDA 1OV3A 2JT4A 2DRKA 1I1JA 1T0JA 3I5SA 2O2OA 1BBZA 2RF0A 1U3OA 1X27A 1K1ZA 2JMAA 1W1FA 2L3QA 4RTZA 1K4US 2RQTA 4D8KA 1AOJA 1ZUKA 3PVLA 2JS2A 3JV3A 2E5KA 2DM1A 5I22A 2J05A 2LJ3A 2JM8A 2KEAA 3PE0A 2JS0A 2BZ8A 3QWYA 2C0IA 2DX1A 1UHCA 4GBQA 1M3CA 2BTTA 2KRSA 1QWEA 4M4ZA 4HVUA 1NEBA 2J06A 1SHGA 4Y92A 2NWMA 1SRLA 2D0NA 3VS5A 4JJBA 2ENMA 1TUCA 3GBQA 2FPDA 2SEMA 1GFCA 1AEYA 2J6OA 1VYTA 1CKBA 2C0TA 1WA7A 3EG1A 4J9IA 1M30A 2L2PA 4RTTA 1YWPA 3THKA 4J9EA 1M27C 3UF4A 1MV0B 1JO8A 2FO0A 3O5ZA 2KROA 3M0RA 4HVVA 1SEMA 2DLPA 1WX6A 4CC4B 1QKWA 2EKHA 1NLOC 2CUDA 1BB9A 2CT4A 2PZ1A 2KRMA 4Z8AA 2OAWA 3EHRA 4RTYA 4JJCA 1Y0MA 4EIKA 1W70A 4OMMA 3R6NA 3A98A 5IHNA 1B07A 2CDTA 2DJQA 2LQWA 1BK2A 3EGUA 1GCPA 1YNZA 4HXJA 2L0AA 5L23A 3LH5A 4KRTA 4Z88A 1HSQA 1WXUA 2HSPA 1GCQA 2RQWA 4A63B 2L3PA 2LP5A 2YSQA 1CSKA 1HJDA 1UJ0A 5IH2A 1RLQC 3VS2A 1UUEA 1UE9A 2P4RA 3UA7A 2CUBA 1QKXA 3VS4A 1PNJA 1OPLA 2EQIA 4RTWA 2DL5A 2KGTA 1RI9A 1GL5A 3PVQA 2CSIA 2AKLA 1AWWA 2EYZA 2HEQA 1NYFA 2OJ2A 3KFVA 2DL7A 2X3XD 2MOXA 3VRYA 5I11A 2KXCA 2GTOA 4CC2A 2VWFA 4AFZC 3IQLA 3SEMA 1M3BA 1KFZA 2PNIA 1PRLC 1M8MA 3H41A 4J9HA 2CSQA 2ED1A 2LMJA 2DRMA 4LUDA 5IHKA 2FPFA 2O9VA 1G2BA 2KNBB 3I9QA 3C0CA 2AZSA 1EFNA 4RTVA 1B3QA 2K9GA 1WXTA 3UA6A 1OPKA 2F2XA 2CH4A 5IHIA 1H8KA 2K3BA 2RPNA 2GTJA 2RMOA 2EW3A 3I35A 2EGCA 2OI3A 1E7OA 1AWXA 4LE9A 4AG2C 1ZSGA 2O9SA 1KSWA 1PWTA 4Z89A 4LNPA 1UHFA 1AZEA 4IIMA 2BZXA 2GNCA 2MIOA 1X2QA 2ESWA 2LX7A 1PKTA 2ED0A 2KYBA 3QWXX 2FEIA 2PTKA 4RUGA 1I07A 4AFQC 2VKNA 4AFSC 1JQQA 1S1NA 1XOVA 2CH4W 1WI7A 1WIEA 2K6DA 2XMFA 4RTUA 1GBRA 1PRMC 3U23A 3CQTA 2DNUA 2F2VA 5EC7A 4LUEA 2W10A 2FPEA 1FYNA 2RNAA 2DE0X 3RNJA 1Z9ZA 2A08A 3M0PA 4J9FA 2M0YA 3NGPA 2IIMA 2DBKA 1PKSA 1K76A 2EYWA 4F16A 4OMNA 1X43A 2A36A 2DF6A 2AZVA 2FRWA 2YUOA 2JXBA 1X6BA 2K2MA 2RQRA 1LCKA 2DL4A 2K7AA 1SHFA 2B86A 2J6FA 2DMOA 1MV3A 3M0QA 2ROTA 4OMQA 4DEYA 3VS7A 2EYYA 2VVKA 2KXDA 1BU1A 3RBBB 2BZYA 2GQIA 2DL3A 1U5SA 3TVTA 1NYGA 2FG0A 3VS6A 1ZX6A 1WXBA 1T0HA 4LN2A 2KYMA 2EVRA 2GGRA 2YT6A 3H0FA 1E6GA 3NHNA 4X1VA 1AVZC 4HVWA 2LCSA 1AWJA 3VS1A 2LJ1A 2F2WA 1YN8A 1UJYA 2D8HA 2K79A 1U06A 1V1CA 2DL8A 2O88A 2CREA 5FW9A 1J3TA 3EHQA 1X2KA 2YUPA 4D8DA 3FJ5A 2A28A 3NPFA 1ABQA 2KE9A 2AKKA 1K9AA 2V1QA 2DILA 5GJWB 1KJWA 2EBPA 2KT1A 1UGVA 5IXBA 1IO6A 1ZUUA 2JW4A 1GBQA 1A0NB 2QDLA 3EG0A 3H0HA 2SRCA 1SSHA 1WDXA 4OMLA 2W0ZA 4AG1C 1SPKA 3VRZA 1Y57A 2FRYA 5GJVB 2DA9A 5IXFA 2DYBA 1K0XA 2LNHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HBW A;  4RTX A;  2V1R A;  2YDL A;  1UTI A;  5ECA A;  4F17 A;  1NLP C;  1HD3 A;  2EPD A;  1UG1 A;  4J9D A;  1VYV A;  1T3L A;  3NMZ C;  1GFD A;  2MCN A;  1H92 A;  1UEC A;  1TG0 A;  2AK5 A;  1X69 A;  3ULR B;  3UAT A;  1ARK A;  1KIK A;  2DBM A;  4JJD A;  1X6G A;  1UDL A;  1WFW A;  1E6H A;  4QT7 A;  1W6X A;  1QLY A;  3VS3 A;  2ABL A;  2DVJ A;  1UFF A;  1ZLM A;  1RLP C;  1SRM A;  3SHW A;  1RUW A;  2J6K A;  5FWC A;  1VA7 A;  1YCS B;  2KBT A;  4IIO A;  3EG3 A;  1JXO A;  3TSW A;  2L3S A;  4R0K A;  1WYX A;  2RN8 A;  2LZ6 B;  4JZ3 A;  2YUQ A;  4J9C A;  4JZ4 A;  1H3H A;  1JXM A;  2LQN A;  3I5R A;  2RQV A;  1M3A A;  2EGE A;  1CKA A;  1NEG A;  1K0S A;  2ROL A;  2M51 A;  1AWO A;  4F14 A;  1G83 A;  1WLP B;  2O31 A;  1NG2 A;  1MUZ A;  1PHT A;  1NM7 A;  4AFU C;  1YWO A;  2EYX A;  2D8J A;  1GRI A;  2I0N A;  4JPB W;  4ESR A;  2YUN A;  3VS0 A;  4ORZ A;  3REA B;  4DEX A;  1VYU A;  1AD5 A;  2HCK A;  1QCF A;  2JTE A;  2J7I A;  1I0C A;  2HDA A;  1AZG B;  2X3W D;  4WCI A;  2KR3 A;  1Z9Q A;  1GCQ C;  4GLM A;  2KRN A;  2A37 A;  2C0O A;  3M0U A;  2KT8 A;  1YP5 A;  1ABO A;  3TSZ A;  2G6F X;  1ZUY A;  3H0I A;  4OMP A;  3EG2 A;  2D1X A;  1ZBJ A;  1QWF A;  2H8H A;  2GBQ A;  4K11 A;  4CC7 A;  4J9B A;  3M0S A;  5HCK A;  3ZL7 C;  1JU5 C;  2LJ0 A;  3M0T A;  1FMK A;  1OEB A;  2CT3 A;  2JM9 A;  4CC3 A;  2JMC A;  4OMO A;  4E6R A;  3REB B;  2RQU A;  2NUZ A;  2EGA A;  4FSS A;  1JEG A;  5FWB A;  1OOT A;  4HCK A;  2ECZ A;  4ZNX A;  1N5Z A;  1T3S A;  4J9G A;  1TUD A;  1OV3 A;  2JT4 A;  2DRK A;  1I1J A;  1T0J A;  3I5S A;  2O2O A;  1BBZ A;  2RF0 A;  1U3O A;  1X27 A;  1K1Z A;  2JMA A;  1W1F A;  2L3Q A;  4RTZ A;  1K4U S;  2RQT A;  4D8K A;  1AOJ A;  1ZUK A;  3PVL A;  2JS2 A;  3JV3 A;  2E5K A;  2DM1 A;  5I22 A;  2J05 A;  2LJ3 A;  2JM8 A;  2KEA A;  3PE0 A;  2JS0 A;  2BZ8 A;  3QWY A;  2C0I A;  2DX1 A;  1UHC A;  4GBQ A;  1M3C A;  2BTT A;  2KRS A;  1QWE A;  4M4Z A;  4HVU A;  1NEB A;  2J06 A;  1SHG A;  4Y92 A;  2NWM A;  1SRL A;  2D0N A;  3VS5 A;  4JJB A;  2ENM A;  1TUC A;  3GBQ A;  2FPD A;  2SEM A;  1GFC A;  1AEY A;  2J6O A;  1VYT A;  1CKB A;  2C0T A;  1WA7 A;  3EG1 A;  4J9I A;  1M30 A;  2L2P A;  4RTT A;  1YWP A;  3THK A;  4J9E A;  1M27 C;  3UF4 A;  1MV0 B;  1JO8 A;  2FO0 A;  3O5Z A;  2KRO A;  3M0R A;  4HVV A;  1SEM A;  2DLP A;  1WX6 A;  4CC4 B;  1QKW A;  2EKH A;  1NLO C;  2CUD A;  1BB9 A;  2CT4 A;  2PZ1 A;  2KRM A;  4Z8A A;  2OAW A;  3EHR A;  4RTY A;  4JJC A;  1Y0M A;  4EIK A;  1W70 A;  4OMM A;  3R6N A;  3A98 A;  5IHN A;  1B07 A;  2CDT A;  2DJQ A;  2LQW A;  1BK2 A;  3EGU A;  1GCP A;  1YNZ A;  4HXJ A;  2L0A A;  5L23 A;  3LH5 A;  4KRT A;  4Z88 A;  1HSQ A;  1WXU A;  2HSP A;  1GCQ A;  2RQW A;  4A63 B;  2L3P A;  2LP5 A;  2YSQ A;  1CSK A;  1HJD A;  1UJ0 A;  5IH2 A;  1RLQ C;  3VS2 A;  1UUE A;  1UE9 A;  2P4R A;  3UA7 A;  2CUB A;  1QKX A;  3VS4 A;  1PNJ A;  1OPL A;  2EQI A;  4RTW A;  2DL5 A;  2KGT A;  1RI9 A;  1GL5 A;  3PVQ A;  2CSI A;  2AKL A;  1AWW A;  2EYZ A;  2HEQ A;  1NYF A;  2OJ2 A;  3KFV A;  2DL7 A;  2X3X D;  2MOX A;  3VRY A;  5I11 A;  2KXC A;  2GTO A;  4CC2 A;  2VWF A;  4AFZ C;  3IQL A;  3SEM A;  1M3B A;  1KFZ A;  2PNI A;  1PRL C;  1M8M A;  3H41 A;  4J9H A;  2CSQ A;  2ED1 A;  2LMJ A;  2DRM A;  4LUD A;  5IHK A;  2FPF A;  2O9V A;  1G2B A;  2KNB B;  3I9Q A;  3C0C A;  2AZS A;  1EFN A;  4RTV A;  1B3Q A;  2K9G A;  1WXT A;  3UA6 A;  1OPK A;  2F2X A;  2CH4 A;  5IHI A;  1H8K A;  2K3B A;  2RPN A;  2GTJ A;  2RMO A;  2EW3 A;  3I35 A;  2EGC A;  2OI3 A;  1E7O A;  1AWX A;  4LE9 A;  4AG2 C;  1ZSG A;  2O9S A;  1KSW A;  1PWT A;  4Z89 A;  4LNP A;  1UHF A;  1AZE A;  4IIM A;  2BZX A;  2GNC A;  2MIO A;  1X2Q A;  2ESW A;  2LX7 A;  1PKT A;  2ED0 A;  2KYB A;  3QWX X;  2FEI A;  2PTK A;  4RUG A;  1I07 A;  4AFQ C;  2VKN A;  4AFS C;  1JQQ A;  1S1N A;  1XOV A;  2CH4 W;  1WI7 A;  1WIE A;  2K6D A;  2XMF A;  4RTU A;  1GBR A;  1PRM C;  3U23 A;  3CQT A;  2DNU A;  2F2V A;  5EC7 A;  4LUE A;  2W10 A;  2FPE A;  1FYN A;  2RNA A;  2DE0 X;  3RNJ A;  1Z9Z A;  2A08 A;  3M0P A;  4J9F A;  2M0Y A;  3NGP A;  2IIM A;  2DBK A;  1PKS A;  1K76 A;  2EYW A;  4F16 A;  4OMN A;  1X43 A;  2A36 A;  2DF6 A;  2AZV A;  2FRW A;  2YUO A;  2JXB A;  1X6B A;  2K2M A;  2RQR A;  1LCK A;  2DL4 A;  2K7A A;  1SHF A;  2B86 A;  2J6F A;  2DMO A;  1MV3 A;  3M0Q A;  2ROT A;  4OMQ A;  4DEY A;  3VS7 A;  2EYY A;  2VVK A;  2KXD A;  1BU1 A;  3RBB B;  2BZY A;  2GQI A;  2DL3 A;  1U5S A;  3TVT A;  1NYG A;  2FG0 A;  3VS6 A;  1ZX6 A;  1WXB A;  1T0H A;  4LN2 A;  2KYM A;  2EVR A;  2GGR A;  2YT6 A;  3H0F A;  1E6G A;  3NHN A;  4X1V A;  1AVZ C;  4HVW A;  2LCS A;  1AWJ A;  3VS1 A;  2LJ1 A;  2F2W A;  1YN8 A;  1UJY A;  2D8H A;  2K79 A;  1U06 A;  1V1C A;  2DL8 A;  2O88 A;  2CRE A;  5FW9 A;  1J3T A;  3EHQ A;  1X2K A;  2YUP A;  4D8D A;  3FJ5 A;  2A28 A;  3NPF A;  1ABQ A;  2KE9 A;  2AKK A;  1K9A A;  2V1Q A;  2DIL A;  5GJW B;  1KJW A;  2EBP A;  2KT1 A;  1UGV A;  5IXB A;  1IO6 A;  1ZUU A;  2JW4 A;  1GBQ A;  1A0N B;  2QDL A;  3EG0 A;  3H0H A;  2SRC A;  1SSH A;  1WDX A;  4OML A;  2W0Z A;  4AG1 C;  1SPK A;  3VRZ A;  1Y57 A;  2FRY A;  5GJV B;  2DA9 A;  5IXF A;  2DYB A;  1K0X A;  2LNH B; 
#chains in the Genus database with same CATH topology
 4RTX A;  4Y28 E;  1UTI A;  5ECA A;  4F17 A;  2EPD A;  1MMN A;  3NMZ C;  1Q95 G;  1UEC A;  1D0X A;  3ULR B;  5I2S A;  3EAE A;  1KC8 C;  1VQ7 A;  3JCM g;  3H8Z A;  4MZT A;  4PFP A;  4UC4 A;  4QQG A;  2ABL A;  2DER A;  1ZLM A;  3VV0 A;  3CC4 A;  4M77 E;  4M77 A;  3H9N A;  3SHW A;  2J6K A;  4A54 A;  3RIR A;  2QGF B;  1Y96 A;  3VYH B;  4PJM A;  4F7U G;  2RN8 A;  4M77 B;  5CKH A;  3FLG A;  3M9Q A;  4J9C A;  4DA4 A;  2D9T A;  2EGE A;  2JUF A;  3WXM B;  5KYU A;  2ROL A;  4M7D E;  4M7D A;  1IRX A;  1Y96 B;  2CS7 A;  2M51 A;  2RHI A;  1G3Y A;  4FYY B;  4C0Z A;  2O31 A;  1NG2 A;  1PHT A;  3I55 Q;  1M1K C;  3LW5 E;  4AFU C;  1YWO A;  3HPW A;  5KYU B;  3QYH B;  4M7D B;  1VQL A;  3HRT A;  2P0P A;  5DM7 R;  3VS0 A;  4ORZ A;  3BDU A;  1QCF A;  4WCI A;  4KH0 B;  5KYY A;  1N6A A;  5J26 A;  2RI2 A;  2KT8 A;  5LJ3 e;  1YP5 A;  1ZUY A;  2D1X A;  1M90 U;  5KYY B;  4JRQ A;  4K11 A;  1ACM B;  3M0S A;  3FEO A;  2LJ0 A;  3G4S A;  3OSV A;  3T9N A;  2Y90 A;  3CMA Q;  2EGA A;  2KI7 A;  2MWP A;  3HFN A;  4ZNX A;  1N5Z A;  2E12 A;  1OV3 A;  3TU4 K;  2DRK A;  3HRU A;  1I1J A;  1T0J A;  3I5S A;  2RF0 A;  2M16 A;  1OZ3 A;  1K1Z A;  4HT8 A;  1K4U S;  3UT1 A;  3PVL A;  4D6W A;  3L2Q A;  2E5K A;  1M8V A;  3M5A A;  1RAF B;  5DLQ E;  2XI9 A;  5C0M A;  2ZZD A;  3CCR T;  2FHD A;  1ZA1 B;  2JS0 A;  1VOM A;  4RG2 A;  1MGQ A;  3QWY A;  2X51 A;  3CD6 Q;  4XAX B;  4GBQ A;  1M3C A;  4L6V 5;  4LDU A;  1WQW A;  2DYB A;  4M4Z A;  1R8O B;  4M78 E;  1SHG A;  2FB7 A;  4M78 A;  2O4X A;  2NWM A;  1SRL A;  1VQ4 Q;  2FPD A;  1RAB B;  2LNV A;  3G71 A;  2OTL A;  4FL6 A;  1VYT A;  1CKB A;  4M78 B;  3CEY A;  5GAN 8;  2O4X B;  2L2P A;  3THK A;  4F7U F;  5GMK h;  3JCM P;  2CGH A;  2KK4 A;  2DPP B;  4M7A E;  4M7A A;  3V7S A;  1KQS P;  1WX6 A;  2DD5 A;  2EKH A;  1MMA A;  2QXF A;  4M7A B;  3JCM b;  1UGP B;  2CUD A;  5DLO A;  5DY9 A;  2IPO B;  2RHZ A;  4J7I A;  4C5G A;  1VQ6 A;  2WSF E;  3PT9 A;  5IHN A;  2DJQ A;  3EGU A;  1BK2 A;  3CCV Q;  1GCP A;  3FDR A;  1Q82 C;  1YIJ A;  4BD3 A;  3LH5 A;  1VQN T;  4C92 G;  1ZSZ C;  4XK8 E;  3CPW P;  3PTA A;  1K73 U;  1NZ9 A;  3MET A;  3CCS T;  1GCQ A;  3MEA A;  2L3P A;  2LP5 A;  1KQS A;  1BIB A;  3A1P A;  3I56 A;  2VXF A;  1YJ9 Q;  1UJ0 A;  2ZCF B;  1UE9 A;  2P4R A;  3UA7 A;  1UGR B;  3JCM Q;  3FB9 A;  1YCY A;  2XK0 A;  1VIE A;  2AHJ B;  2JNG A;  3PVQ A;  1O9S A;  2CSI A;  5KE2 A;  3QXE B;  4PK4 A;  3RER A;  4ELY C;  2PUK B;  2QA4 Q;  4LDV A;  2EYZ A;  1VQ9 A;  3MP8 A;  1NYF A;  2OJ2 A;  4IUV A;  5LJ3 f;  3HTR A;  4C8Q D;  4MDW A;  3JCM h;  1H64 1;  3C4S A;  3CCU T;  1C6V X;  2X3X D;  2MOX A;  1VQ5 A;  3M57 A;  1UEB A;  4XTZ A;  2YLC A;  2QEX Q;  4AFZ C;  3IQL A;  3SEM A;  5GAN 3;  1M3B A;  5LJ5 j;  3H41 A;  3INZ A;  5KCO A;  3VUZ A;  5LJ5 d;  3JB9 J;  5GAM e;  2QQS A;  4C0D B;  1YJN T;  4IKF A;  3LH0 A;  3C0C A;  2XIC A;  2K9G A;  3UA6 A;  1RAC B;  1H8K A;  2RPN A;  2EGC A;  1E7O A;  1AWX A;  1TXQ A;  1C0M A;  1S72 Q;  2O9S A;  2NLU A;  2FZK B;  4LNP A;  5IT9 E;  1Q86 R;  1UHF A;  1MHN A;  3CPF A;  3LGL A;  4OB1 B;  1Q7Y R;  2QGG A;  5GAN 2;  3OS2 A;  3QYG B;  1PC0 A;  2GNC A;  1EZZ B;  5A2Q E;  2XDD A;  1P92 A;  3EH1 A;  4BE2 A;  1PKT A;  4ELZ C;  4OGE A;  1OYX A;  1QVG P;  2KYB A;  3QWX X;  3E2U A;  2P4T A;  1FXX A;  4AFQ C;  4BE1 A;  3X20 B;  4QW2 A;  3CCM T;  4KGX B;  1WI7 A;  4HKE A;  1M1K U;  1VQP A;  4RTU A;  4RCC A;  2PVG B;  1WJS A;  1YIT A;  2DIQ A;  4LUE A;  3P8H A;  4J5Y A;  2DE0 X;  1YI2 A;  1G3W A;  2VC8 A;  2CP7 A;  3CC7 A;  2A08 A;  3NGP A;  2IIM A;  3FJP A;  4C92 F;  2KMT A;  4GLK A;  4KT0 E;  4JRI A;  4BE0 A;  2DF6 A;  1RAE B;  2KVQ G;  4N0A A;  4BAC A;  3SWN C;  2JJ9 A;  2XU8 A;  3E9G A;  5GAM j;  1MV3 A;  2X4X A;  3A5Z B;  4OMQ A;  5CCA A;  2EYY A;  2VVK A;  1WZO A;  3A8G B;  4WF2 A;  5GAM d;  3CCQ T;  3V8K A;  2BZY A;  3L2R A;  1JJ2 P;  3TVT A;  1VQO A;  1NYG A;  2FL7 A;  4M77 D;  2FG0 A;  4XTW A;  1VQM A;  1M90 C;  2ZPG B;  1JRI A;  2COY A;  4FT4 A;  2KYM A;  2EVR A;  5LJ5 g;  1TUG B;  2GGR A;  3EH2 A;  4LDW A;  1DJ7 B;  2CZ1 B;  1AVZ C;  4A4E A;  2F2W A;  1V1C A;  2K79 A;  4E7K A;  4M7D D;  2DL8 A;  2O88 A;  5FW9 A;  2YLB A;  1X2K A;  3JCM e;  4D8D A;  2DEU A;  1ABQ A;  2D6F A;  4ATO A;  2V1Q A;  2DIL A;  4LD9 K;  2KT1 A;  4PJJ A;  3HP9 A;  4OB0 B;  3BW1 A;  1ZUU A;  1TOV A;  3EG0 A;  4J7F A;  4OML A;  2DKG A;  2QAS A;  2W0Z A;  1QMC A;  2BUD A;  2R5A A;  2FRY A;  3OYH A;  2KQW A;  1QVF P;  2OTL T;  3X25 B;  1K0X A;  1U1T A;  2HBW A;  3FIF A;  3MCA B;  2YDL A;  2LRQ A;  3HKS A;  5GAO n;  5GMK l;  2A7Y A;  3CC2 T;  2RK2 A;  3C12 A;  1T3L A;  4IUT A;  4OGC A;  2AK5 A;  4VUB A;  1OX9 A;  4L59 A;  1YHQ T;  4JJD A;  1UDL A;  2QAZ A;  1WFW A;  1QLY A;  3VS3 A;  1WHM A;  1PCX A;  1VQ8 A;  4V2S A;  4IUU A;  1RLP C;  1SRM A;  2RK1 A;  3SDZ A;  1QVF A;  2COW A;  5GAM g;  1KD1 R;  5AT1 B;  3RKW A;  4JZ3 A;  4PNO A;  1JXM A;  1H3H A;  2LQN A;  1K8A U;  1CKA A;  1YIJ T;  1K0S A;  1I4K 1;  4PJL A;  4X9D A;  2CYZ B;  3CCR Q;  1BI0 A;  3JB9 D;  4F14 A;  1WLP B;  2E65 A;  1NM7 A;  2CZ6 B;  3L1A A;  1ZHI A;  2R58 A;  9ATC B;  4M75 G;  2NUT A;  3OYI A;  2L89 A;  2YUN A;  3REA B;  4KUL A;  1AD5 A;  1OU8 A;  4M78 D;  3V7C A;  2DET A;  2JTE A;  2COZ A;  2J7I A;  3RKY A;  4EMK C;  2X3W D;  2NUT B;  2KR3 A;  4GLM A;  3C94 A;  1EX4 A;  4Y91 A;  2C0O A;  3CCL T;  4OF1 A;  1K73 C;  3H0I A;  1NPR A;  2X4J A;  1QWF A;  2GBQ A;  4J9B A;  3OYJ A;  2P84 A;  4M7A D;  2ZAE A;  3M0T A;  1OEB A;  2CT3 A;  5CO7 A;  3LYI A;  2HL5 C;  2L8D A;  2EYQ A;  3H6Z A;  4HCK A;  3L2V A;  1T3S A;  5GAN 6;  1K9M R;  4J83 A;  4J9G A;  1TUD A;  4X34 A;  3A8L B;  2OTJ T;  4PJO E;  4PJO A;  3LWH A;  2O2O A;  4XU0 A;  3RMQ A;  2JMA A;  1N8R R;  1QW1 A;  1WJQ A;  2KDS A;  4RTZ A;  4C5H A;  3GOX A;  3ZFJ A;  2RQT A;  2F5K A;  4PJO B;  1AOJ A;  2K5F A;  4ME7 A;  3DKM A;  3JV3 A;  1OI1 A;  3M56 A;  2DM1 A;  2HBP A;  1VQN Q;  2A0F B;  2J05 A;  2E3H A;  1RAI B;  4OVA A;  3CCS Q;  2RJD A;  5GAO l;  2VV5 A;  2EIF A;  3PE0 A;  3KXT A;  3JCM f;  2DX1 A;  1UHC A;  3P8B B;  3E1S A;  2CP2 A;  1QWE A;  5FLX E;  2MK5 A;  3CXC P;  4HVU A;  2HZY A;  3RMS A;  4KGZ B;  3VS5 A;  4JLI A;  2MYS A;  4XTU A;  2RB6 A;  1GFC A;  3OS5 A;  2GF7 A;  4JJN K;  5CK9 A;  5I21 A;  2C0T A;  1WA7 A;  1X75 C;  1M30 A;  3I55 A;  1D0Y A;  3L2Z A;  3PFS A;  4J9E A;  4FYW B;  1YJW T;  1W2B P;  3UF4 A;  1MV0 B;  3CCU Q;  2FO0 A;  3OYD A;  1MMG A;  1BCO A;  2CZ0 B;  3M59 A;  1LNX A;  4BDZ A;  4PFZ A;  3E19 A;  3TEE A;  2E3I A;  2DLP A;  1QKW A;  3HHT B;  1R77 A;  1Q81 C;  4M75 F;  5LJ5 h;  2QYZ A;  4JDS A;  1X6O A;  2PZ1 A;  1IRE B;  2OAW A;  1YFN A;  3EHR A;  4RTY A;  2HKQ B;  1YJN Q;  1TTH B;  2EQJ A;  4JRK A;  5EG2 A;  2EJF A;  5J39 A;  1B07 A;  2CDT A;  4R55 A;  1LOJ A;  3PGG A;  4EMH A;  4A4H A;  1Y07 A;  4LD6 A;  1W2B A;  4BUG A;  3OS0 A;  3CMA A;  4HXJ A;  2L0A A;  3EGD A;  5L23 A;  2LTO A;  1OU9 A;  2YRV A;  2YSQ A;  3S3M A;  3EGD B;  2K57 A;  1RLQ C;  3CME T;  3UWN A;  5HY6 A;  1OPL A;  1SF9 A;  2EQI A;  5CVI A;  2DL5 A;  2KGT A;  4TVR A;  4FU6 A;  3M58 A;  5D6W A;  3CCM Q;  2DO3 A;  4N4I A;  3PIO A;  2FZG B;  3ZEH A;  4BB7 A;  5KYN A;  2R5M A;  3QII A;  3OYC A;  1NJI R;  1I5L A;  5IN1 A;  4M75 C;  3CCJ T;  3CD6 A;  1B7T A;  1VIF A;  4A4G A;  1W2B S;  4HA8 A;  2GFU A;  3HRS A;  1W4S A;  1PSF A;  2RA2 A;  1KFZ A;  3JCM V;  1M8M A;  3PMI A;  1KK7 A;  5C6S A;  2LMJ A;  1WGS A;  4LUD A;  5CKD A;  5GAM h;  3OMG A;  3CCQ Q;  1V29 B;  1KC8 R;  3M4Y A;  3I9Q A;  1VQK T;  3X26 B;  1EFN A;  2K3Y A;  2F2X A;  4DOV A;  2JTF A;  2NUP A;  4PKC C;  2K4Y A;  2GTJ A;  2RMO A;  2EW3 A;  1N9R A;  4E7Z A;  2DXT A;  4LE9 A;  4AG2 C;  1ZSG A;  1Y71 A;  3FC3 A;  3Q1J A;  2RI3 A;  4Z89 A;  1FX7 A;  2QQA A;  3G1J A;  2FYK A;  2NUP B;  3JB9 H;  4IIM A;  4NS5 A;  2BZX A;  2BKD N;  2QI2 A;  4IUR A;  1OQK A;  2DEQ A;  3O8V A;  5I2M A;  3OBY A;  3VU3 C;  2V8I A;  2K5I A;  3M54 A;  4PJN A;  1PD1 A;  2CP0 A;  2FEI A;  2PTK A;  3TQ7 P;  4HCZ A;  4HT9 A;  2YWW A;  1I07 A;  1M1F A;  3CCV A;  4AFS C;  1M1K R;  4DBF A;  2XMF A;  2K3X A;  5LJ5 e;  4BDY A;  3CQT A;  3JB9 I;  2XG8 D;  1K8A C;  2IVW A;  2W10 A;  2FPE A;  4QVZ A;  1FYN A;  2QQB A;  2OTL Q;  2YHT A;  3RNJ A;  2BE7 D;  4J9F A;  4C0G A;  1YJ9 A;  5GAO q;  2VUB A;  3CC2 Q;  1K76 A;  1WHJ A;  2ZPE B;  3OYK A;  1X43 A;  2A36 A;  5GAN 5;  2ZPF B;  2K5L A;  2FRW A;  4ZN3 A;  3R6O A;  3CCE T;  2K2M A;  4II1 A;  3QJY A;  1LCK A;  1YHQ Q;  3OYN A;  1NPP A;  1D1C A;  2QA4 A;  1ZSZ A;  3VS7 A;  2YXY A;  4E7H A;  3OW2 P;  1QP2 A;  1YBY A;  3RBB B;  3G6E T;  2DL3 A;  2JVV A;  5LL6 S;  3ME9 A;  2JTM A;  3VKI A;  1Y7X A;  1IGU A;  4KUI A;  1ZSZ B;  3MEV A;  3GPL A;  4N4H A;  4F7U E;  4F7U A;  2YT6 A;  1HYO A;  4J6Y A;  4X1V A;  2FVU A;  1UJY A;  4E7S A;  3PMT A;  2F69 A;  1OX8 A;  4F7U B;  4BI8 B;  1YIJ Q;  2IG0 A;  3CPW A;  3NTI A;  3NPF A;  2AKK A;  1IO6 A;  1IHV A;  4C0F A;  2JW4 A;  1KQS S;  4J8O A;  2DAQ A;  3GNF B;  3QZ9 B;  1VQ7 T;  3OYG A;  1XTD A;  5GAN 7;  2RJC A;  4E7L A;  5GAN j;  2E4H A;  1S72 A;  4QVC A;  4C0D C;  3VYG A;  1SPK A;  3VRZ A;  5GAN d;  3CCL Q;  2XHC A;  3V7R A;  1SG5 A;  2LNH B;  2QTX A;  3CC4 T;  2JN0 A;  4C8Q G;  1M4Z A;  4J9D A;  1VYV A;  1GFD A;  1KHC A;  2MCN A;  4MMK A;  2BIV A;  1X69 A;  1M1G A;  3UAT A;  1IXD A;  1ARK A;  3CPW S;  3OY9 A;  4PJO D;  2OTJ Q;  1XNI A;  4KH1 B;  1UFF A;  2RHX A;  1VQL T;  1RUW A;  5FWC A;  3V8L A;  2CP5 A;  1Q81 U;  5GMK i;  4R0K A;  3QSU A;  2HQE A;  1D0Z A;  3J81 E;  2LZ6 B;  3ASK A;  1OUL A;  2E1H A;  3AHU A;  3I5R A;  3ZBD A;  3EFR A;  1NEG A;  2ZGW A;  2JOY A;  2DTI A;  1IHW A;  4JLG A;  1FWZ A;  1V76 A;  3JAM E;  1Q82 R;  2JZ2 A;  1PSE A;  2DZC A;  3JCM J;  3MO8 A;  3G4S T;  3OS1 A;  1QVG A;  2RO0 A;  5CQX A;  1QCO A;  1UB4 A;  2RHU A;  2HDA A;  1AZG B;  2QDY B;  4N0A C;  4ZGJ B;  2LCL A;  1FMW A;  1Z9Q A;  1X01 A;  2HKN A;  3SWN A;  4IUP A;  2KRN A;  2A37 A;  5FU6 C;  5LJ5 f;  3M0U A;  2KSS A;  3A8O B;  4ZGD B;  1ABO A;  3TSZ A;  4OMP A;  4R56 A;  1RAH B;  4XU1 A;  1ZBJ A;  3SWN B;  2H8H A;  1QP3 A;  3S3N A;  1YJW Q;  4CC7 A;  5GAN g;  3F70 A;  5HCK A;  3ZL7 C;  1JU5 C;  5FRO A;  4HCC A;  1FMK A;  3QKJ A;  2JM9 A;  4CC3 A;  3BFM A;  4RG8 A;  3M53 A;  2VAS A;  3SFM A;  8AT1 B;  1N9S A;  4B9W A;  1OOT A;  1B34 A;  2AT1 B;  2OX7 A;  4O6J A;  1QVG S;  1U3O A;  2M1H A;  5HK0 A;  1JBM A;  1JJ2 A;  4M77 G;  1BI3 A;  3HFO A;  4BI4 A;  2L3Q A;  1B34 B;  3QUI A;  4P5N A;  2LCC A;  2RJF A;  4D8K A;  3JCM X;  5GAN 4;  1ZUK A;  4X9C A;  3J7A F;  5A0D A;  3G71 T;  4C92 E;  4C92 A;  3OYM A;  4C8Q F;  4DBR A;  3FRN A;  1PM3 A;  2LJ3 A;  4ANJ A;  4M7D G;  2LT4 A;  4C5E A;  4C92 B;  2C0I A;  2XKO C;  1F1B B;  4FM4 B;  1WPY A;  2BTT A;  2KRS A;  3CME Q;  3M55 A;  2E10 A;  1WHL A;  2J06 A;  2KAF A;  3RDV A;  1KG1 A;  4Y92 A;  2QG9 B;  3MEU A;  1D1A A;  2ENM A;  3GBQ A;  3NTH A;  1AEY A;  4FIB A;  2J6O A;  2MAM A;  5GAM f;  2EFI A;  4XTY A;  1JJ2 S;  1UGQ B;  4XTX A;  1I81 A;  1M27 C;  3CCJ Q;  1JO8 A;  1Q7Y U;  1VQ6 T;  2MWO A;  4ZN1 A;  2DJZ A;  3M0R A;  4LDX A;  2Y4Y A;  1D1B A;  1NLO C;  3UPU A;  4JRP A;  3LLR A;  2VGM A;  2PVO B;  4C8Q C;  3I56 T;  1G3T A;  2LC4 A;  4FYV B;  4AT1 B;  4JJC A;  1Y0M A;  5FU7 B;  4FW2 A;  2XDP A;  1W70 A;  1VQK Q;  1NBE B;  3G7Z A;  1U8R A;  5GAO m;  2Y4X A;  1M2V A;  2KY9 A;  4BY6 B;  5D6Y A;  4XU3 A;  4KRT A;  4EMK A;  1M90 R;  4Z88 A;  1M2V B;  2HQX A;  1VQ9 T;  1QVF S;  1WXU A;  4A63 B;  2RQW A;  2CP6 A;  2HSE B;  5D7U A;  1O75 A;  1QVP A;  1GXI E;  1CSK A;  2MF2 A;  4DBH A;  3JB9 G;  4EMK B;  1HJD A;  1VQ5 T;  3MJX A;  1MNE A;  1UUE A;  1D3B A;  1HXD A;  2CUB A;  1OZ2 A;  3KUF A;  3WVD B;  2E5Q A;  3VS4 A;  2GCX A;  4M78 G;  1RI9 A;  1GL5 A;  1M5Q 1;  3QJ6 A;  1D3B B;  5L8R E;  4J6W A;  4M77 F;  1VQN A;  1QQJ A;  5CKF A;  2HEQ A;  3OYF A;  3M4G A;  3EG9 A;  3CCS A;  3MP6 A;  4E7J A;  2DL7 A;  1MND A;  1C1A A;  5I11 A;  3QPH A;  3EG9 B;  3LWI A;  2KXC A;  4YTL A;  2GTO A;  2EWN A;  4NOY A;  5GAO r;  4MML A;  4CC2 A;  4M7D F;  5KH6 A;  2HNI A;  4M7A G;  2RH2 A;  5J3B A;  4JS5 A;  3CCE Q;  1PRL C;  4J9H A;  3GLX A;  2ED1 A;  5IHK A;  2O9V A;  3OBW A;  1MMD A;  2X9H A;  2LVM A;  3G6E Q;  1RI0 A;  4RTV A;  3CCU A;  5KCH A;  1OPK A;  4CRI A;  1WHK A;  3GP8 A;  2OI3 A;  2WSE E;  1VQP T;  3OMC A;  2O01 E;  5FRM A;  3GIB A;  1KSW A;  1LJO A;  1PWT A;  3URG A;  1YIT T;  4ZGE B;  2GFA A;  2HAX A;  1YI2 T;  4M77 C;  3CC7 T;  1X2Q A;  2LX7 A;  1YJN A;  3SB2 A;  3QDR B;  1IZ6 A;  2ED0 A;  4E7I A;  1G5V A;  4Z02 A;  4CI0 C;  1BI2 A;  2MPX C;  1JQQ A;  3CXC A;  2CH4 W;  1VQ7 Q;  1WIE A;  4M7D C;  1GBR A;  2CP3 A;  3RKX A;  1KD1 U;  2DNU A;  5GAN h;  2RNA A;  1VQO T;  3CC4 Q;  1VQM T;  1Z9Z A;  1TS9 A;  3OB9 A;  2M0Y A;  2DBK A;  1PKS A;  3QZ5 B;  2EYW A;  4F16 A;  3WVE B;  4O5V A;  3JCM c;  4PLL A;  1K73 R;  1X6B A;  3CCM A;  3QDF A;  2RQR A;  3JB9 F;  2EQM A;  2B8A A;  2K7A A;  1SHF A;  2B86 A;  2J6F A;  3M0Q A;  2ROT A;  2ZPH B;  4ZTJ A;  2KXD A;  1BU1 A;  2Z0W A;  4M78 F;  2C06 A;  3MHX A;  1ZX6 A;  8ATC B;  1VQL Q;  3CXC S;  1KQ1 A;  1T0H A;  2VB6 A;  4LN2 A;  4JUV A;  1BIA A;  2HMA A;  2VXE A;  3NHN A;  1BKB A;  4HVW A;  2LCS A;  2LJ1 A;  1YN8 A;  4LXC A;  1U06 A;  3MEW A;  2CRE A;  2DXB A;  3PNW C;  3EHQ A;  2H3J A;  1AHJ B;  2EQU A;  2A28 A;  4M7A F;  3CCQ A;  1K9M U;  5GJW B;  1KJW A;  4M75 E;  4M75 A;  5IXB A;  1BI1 A;  3AT1 B;  5KYX A;  3G4S Q;  4IUQ A;  1VQ4 A;  1GBQ A;  4Q5W A;  2QDL A;  3TCJ A;  1N8R U;  4DOW A;  2FZC B;  4M75 B;  1BCM A;  1WDX A;  5KYX B;  5GJV B;  3DLM A;  1VQ8 T;  5CAI A;  2PVD B;  2V1R A;  5KE3 A;  1NLP C;  3PIP A;  3OYA A;  1HD3 A;  1LPL A;  2DIG A;  1UG1 A;  1U1S A;  1AT1 B;  5M9O A;  1H92 A;  4M78 C;  3MP1 A;  1TG0 A;  4JS4 A;  2WAC A;  3LGF A;  4KGV B;  3A8H B;  5CKE A;  2EQK A;  2QQ9 A;  1M9S A;  1KIK A;  2DBM A;  1X6G A;  2VYT A;  1XQH A;  5LJ3 j;  1E6H A;  4QT7 A;  1W6X A;  4FSX A;  2M0O A;  3JSC A;  2DVJ A;  5GAO p;  5LJ3 d;  3L2U A;  4MDX A;  1VA7 A;  2PUO B;  1Q86 C;  1YCS B;  2KBT A;  4IIO A;  3CC2 A;  4C5I A;  4M7A C;  2CKK A;  3DB3 A;  3EG3 A;  1JXO A;  1Q7Y C;  1Q81 R;  3TSW A;  2L3S A;  1WYX A;  5CQY A;  2YUQ A;  5GAN e;  4ZTF A;  1ZBX A;  2RQV A;  4C92 D;  2HL3 A;  1M3A A;  3G71 Q;  1YHQ A;  1RAG B;  2E41 A;  3VUB A;  2G3R A;  1I5O B;  2M02 A;  2HQH A;  4FCY A;  1AWO A;  1G83 A;  1MUZ A;  5CR2 A;  5AYF A;  2EYX A;  3SD4 A;  2D8J A;  4E47 A;  1GRI A;  2I0N A;  4JPB W;  4ESR A;  4NL2 A;  4QKU A;  3C95 A;  4MZM A;  4DEX A;  1VYU A;  4E2F B;  2HCK A;  4FYX B;  1XJW B;  1I0C A;  3JRZ A;  3OA6 A;  1GCQ C;  2XDB A;  4PLI A;  2G6F X;  2EKO A;  4A53 A;  3EG2 A;  1R0C B;  2QEX A;  4NL3 A;  2M9U A;  1VQ6 Q;  2JMC A;  4OMO A;  4E6R A;  3REB B;  2RQU A;  3BDL A;  1JB0 E;  2NUZ A;  4FSS A;  2D0Q B;  1JEG A;  5FWB A;  3CBO A;  3EFO A;  4QQD A;  2ECZ A;  4QVD A;  3CCL A;  2JT4 A;  1TSF A;  2L5Q A;  2RM4 A;  3I56 Q;  2H3E B;  1BBZ A;  3EFO B;  3OW2 A;  1X27 A;  1BYM A;  4F04 B;  3RES A;  1NJI U;  1H3Z A;  1W1F A;  3EGX A;  1R0B G;  1WHH A;  2RHY A;  2A3L A;  3E9F A;  5LJ3 g;  2JS2 A;  3QBY A;  3ER0 A;  3J80 E;  3EGX B;  5I22 A;  2JM8 A;  3CBP A;  4KUD K;  2DXU A;  1VQ9 Q;  2RD1 A;  1HK9 A;  2KEA A;  3I55 T;  2DVE A;  2E6Z A;  4EDU A;  2OTJ A;  2BZ8 A;  2DK3 A;  2CZ7 B;  1N27 A;  1VQ5 Q;  3VJP A;  4OB2 B;  1KC8 U;  2XD0 A;  3X28 B;  1NEB A;  4PL6 A;  4OB3 B;  2D0N A;  2NYS A;  4JJB A;  1TUC A;  2SEM A;  3OYB A;  2YRD A;  1ZQ1 A;  3CBM A;  5CIU A;  3OW2 S;  2LDM A;  2HD0 A;  4A4F A;  1WNL A;  2EAY A;  4PFO A;  3EG1 A;  4J9I A;  4RTT A;  1YWP A;  4N4G A;  2V8K A;  2L3R A;  5GMK e;  4FW1 A;  3DB4 A;  1WHG A;  3O5Z A;  1IGQ A;  1WQ7 A;  1K8A R;  3GF5 A;  2KRO A;  3CMA T;  4HVV A;  1SEM A;  4CC4 B;  5KYW A;  2VGN A;  2QK0 A;  1KQ2 A;  1KD1 C;  2I2L A;  1PD0 A;  1BB9 A;  2CT4 A;  2KRM A;  4Z8A A;  5KYW B;  4PJO G;  2E64 A;  4EIK A;  4DBQ A;  2X4W A;  1KHI A;  3LX7 A;  1YJW A;  1D09 B;  5GMK m;  4OMM A;  3R6N A;  7AT1 B;  3A98 A;  2LQW A;  1IB8 A;  1YNZ A;  2PQW A;  1ZA2 B;  4RMO A;  1VQP Q;  2EJ9 A;  5IAY A;  5GAN f;  1HSQ A;  1YIT Q;  2DTH A;  2DZ9 A;  2HSP A;  1RAA B;  3QO3 A;  3BE3 A;  2GQV A;  1YI2 Q;  2K2V A;  3CD6 T;  3CC7 Q;  4RKU E;  1RL2 A;  2LT1 A;  5IH2 A;  3HL8 A;  3VS2 A;  4QQ6 A;  5FU6 B;  3L2W A;  1QKX A;  3UDC A;  1PNJ A;  4RTW A;  1SKU B;  1VQ4 T;  3JCM W;  2AKL A;  5GMK j;  1AWW A;  4XQ3 A;  4EPC A;  3KFV A;  1VQO Q;  3TRE A;  1VQM Q;  4XU2 A;  3VRY A;  1K9M C;  3CME A;  2YRC A;  3V8J A;  2EJG A;  2VWF A;  4RCB A;  1N8R C;  2PNI A;  2CSQ A;  4C92 C;  1VUB A;  2DRM A;  3KBG A;  4BI3 A;  4L5G A;  2FPF A;  2DD4 A;  2X4Y A;  1G2B A;  2E6N A;  1RAD B;  2X35 A;  2KNB B;  1TU0 B;  1I8F A;  2AZS A;  3OSS C;  3CCJ A;  1B3Q A;  3X24 B;  1WXT A;  4AMC A;  2CH4 A;  5IHI A;  3CCV T;  2K3B A;  3N5B B;  3I35 A;  4B6M A;  4J6X A;  4XTV A;  5FRN A;  3CCR A;  2MI6 A;  3RR6 A;  3OYY A;  3MKD A;  5D6X A;  1Q86 U;  1AZE A;  2ZPI B;  2DYI A;  1PG5 B;  2E70 A;  3QHS A;  2F5T X;  2MIO A;  1YJ9 T;  1M2O A;  2ESW A;  4M75 D;  1VQK A;  2AIR B;  4RUG A;  2LQK A;  3GNG A;  2P0Q A;  2P0K A;  3RUX A;  2VKN A;  4MZP A;  2ATC B;  1S1N A;  1XOV A;  3MPU B;  4B9X A;  4PJO F;  2LQ8 A;  2K6D A;  3A8M B;  4FT2 A;  2DFU A;  1PRM C;  2QA4 T;  2WSC E;  3U23 A;  2F2V A;  5FU7 C;  5EC7 A;  2RJE A;  4KBM B;  1VQ8 Q;  5A0G A;  4C8Q E;  4C8Q A;  3M0P A;  3JCM d;  2BE9 B;  1TWB A;  4BY6 C;  1Q82 U;  3NTK A;  2OAU A;  4OMN A;  2QEX T;  4A4K A;  1G8X A;  2QQR A;  2AZV A;  2YUO A;  1TH7 A;  2JXB A;  4C8Q B;  3S3O A;  4EMG A;  5A0L A;  1UGS B;  2DL4 A;  1FMV A;  2PU9 B;  3S6W A;  2DMO A;  2R57 A;  4DEY A;  3D7S B;  2DXC A;  2ZPB B;  2MMP A;  2XID A;  2GQI A;  1U5S A;  3QG1 A;  5LJ3 h;  3EFS A;  3P8D A;  3VS6 A;  3BY7 A;  1WXB A;  2F1L A;  1WJR A;  3NFC A;  3H0F A;  1E6G A;  4LDY A;  5CKB A;  4OP0 A;  1S72 T;  6AT1 B;  1AWJ A;  3VS1 A;  3CCE A;  2D8H A;  4WTO B;  2DTO A;  2V26 A;  1J3T A;  4PJO C;  2RI5 A;  2YUP A;  2LX9 A;  1G3S A;  3FJ5 A;  3OYL A;  2KE9 A;  3HSB A;  1K9A A;  5HKC A;  3G6E A;  2EBP A;  1QCN A;  1UGV A;  4GY5 A;  1EIF A;  3DLL A;  1NJI C;  1A0N B;  3H0H A;  4OMF B;  4DQ2 A;  2SRC A;  1SSH A;  3OYE A;  3OQ5 A;  1SSF A;  4HCB A;  4AG1 C;  3L42 A;  2QTV A;  1LVK A;  1NE8 A;  1Y57 A;  2DA9 A;  5IXF A;  4JZ4 A;  2V8J A;  5HK3 A; 
#chains in the Genus database with same CATH homology
 2HBW A;  4RTX A;  2V1R A;  2YDL A;  1UTI A;  5ECA A;  4F17 A;  1NLP C;  1HD3 A;  2EPD A;  1UG1 A;  4J9D A;  1VYV A;  1T3L A;  3NMZ C;  1GFD A;  2MCN A;  1H92 A;  1UEC A;  1TG0 A;  2AK5 A;  1X69 A;  3ULR B;  3UAT A;  1ARK A;  1KIK A;  2DBM A;  4JJD A;  1X6G A;  1UDL A;  1WFW A;  1E6H A;  4QT7 A;  1W6X A;  1QLY A;  3VS3 A;  2ABL A;  2DVJ A;  1UFF A;  1ZLM A;  1RLP C;  1SRM A;  3SHW A;  1RUW A;  2J6K A;  5FWC A;  1VA7 A;  1YCS B;  2KBT A;  4IIO A;  3EG3 A;  1JXO A;  3TSW A;  2L3S A;  4R0K A;  1WYX A;  2RN8 A;  2LZ6 B;  4JZ3 A;  2YUQ A;  4J9C A;  4JZ4 A;  1H3H A;  1JXM A;  2LQN A;  3I5R A;  2RQV A;  1M3A A;  2EGE A;  1CKA A;  1NEG A;  1K0S A;  2ROL A;  2M51 A;  1AWO A;  4F14 A;  1G83 A;  1WLP B;  2O31 A;  1NG2 A;  1MUZ A;  1PHT A;  1NM7 A;  4AFU C;  1YWO A;  2EYX A;  2D8J A;  1GRI A;  2I0N A;  4JPB W;  4ESR A;  2YUN A;  3VS0 A;  4ORZ A;  3REA B;  4DEX A;  1VYU A;  1AD5 A;  2HCK A;  1QCF A;  2JTE A;  2J7I A;  1I0C A;  2HDA A;  1AZG B;  2X3W D;  4WCI A;  2KR3 A;  1Z9Q A;  1GCQ C;  4GLM A;  2KRN A;  2A37 A;  2C0O A;  3M0U A;  2KT8 A;  1YP5 A;  1ABO A;  3TSZ A;  2G6F X;  1ZUY A;  3H0I A;  4OMP A;  3EG2 A;  2D1X A;  1ZBJ A;  1QWF A;  2H8H A;  2GBQ A;  4K11 A;  4CC7 A;  4J9B A;  3M0S A;  5HCK A;  3ZL7 C;  1JU5 C;  2LJ0 A;  3M0T A;  1FMK A;  1OEB A;  2CT3 A;  2JM9 A;  4CC3 A;  2JMC A;  4OMO A;  4E6R A;  3REB B;  2RQU A;  2NUZ A;  2EGA A;  4FSS A;  1JEG A;  5FWB A;  1OOT A;  4HCK A;  2ECZ A;  4ZNX A;  1N5Z A;  1T3S A;  4J9G A;  1TUD A;  1OV3 A;  2JT4 A;  2DRK A;  1I1J A;  1T0J A;  3I5S A;  2O2O A;  1BBZ A;  2RF0 A;  1U3O A;  1X27 A;  1K1Z A;  2JMA A;  1W1F A;  2L3Q A;  4RTZ A;  1K4U S;  2RQT A;  4D8K A;  1AOJ A;  1ZUK A;  3PVL A;  2JS2 A;  3JV3 A;  2E5K A;  2DM1 A;  5I22 A;  2J05 A;  2LJ3 A;  2JM8 A;  2KEA A;  3PE0 A;  2JS0 A;  2BZ8 A;  3QWY A;  2C0I A;  2DX1 A;  1UHC A;  4GBQ A;  1M3C A;  2BTT A;  2KRS A;  1QWE A;  4M4Z A;  4HVU A;  1NEB A;  2J06 A;  1SHG A;  4Y92 A;  2NWM A;  1SRL A;  2D0N A;  3VS5 A;  4JJB A;  2ENM A;  1TUC A;  3GBQ A;  2FPD A;  2SEM A;  1GFC A;  1AEY A;  2J6O A;  1VYT A;  1CKB A;  2C0T A;  1WA7 A;  3EG1 A;  4J9I A;  1M30 A;  2L2P A;  4RTT A;  1YWP A;  3THK A;  4J9E A;  1M27 C;  3UF4 A;  1MV0 B;  1JO8 A;  2FO0 A;  3O5Z A;  2KRO A;  3M0R A;  4HVV A;  1SEM A;  2DLP A;  1WX6 A;  4CC4 B;  1QKW A;  2EKH A;  1NLO C;  2CUD A;  1BB9 A;  2CT4 A;  2PZ1 A;  2KRM A;  4Z8A A;  2OAW A;  3EHR A;  4RTY A;  4JJC A;  1Y0M A;  4EIK A;  1W70 A;  4OMM A;  3R6N A;  3A98 A;  5IHN A;  1B07 A;  2CDT A;  2DJQ A;  2LQW A;  1BK2 A;  3EGU A;  1GCP A;  1YNZ A;  4HXJ A;  2L0A A;  5L23 A;  3LH5 A;  4KRT A;  4Z88 A;  1HSQ A;  1WXU A;  2HSP A;  1GCQ A;  2RQW A;  4A63 B;  2L3P A;  2LP5 A;  2YSQ A;  1CSK A;  1HJD A;  1UJ0 A;  5IH2 A;  1RLQ C;  3VS2 A;  1UUE A;  1UE9 A;  2P4R A;  3UA7 A;  2CUB A;  1QKX A;  3VS4 A;  1PNJ A;  1OPL A;  2EQI A;  4RTW A;  2DL5 A;  2KGT A;  1RI9 A;  1GL5 A;  3PVQ A;  2CSI A;  2AKL A;  1AWW A;  2EYZ A;  2HEQ A;  1NYF A;  2OJ2 A;  3KFV A;  2DL7 A;  2X3X D;  2MOX A;  3VRY A;  5I11 A;  2KXC A;  2GTO A;  4CC2 A;  2VWF A;  4AFZ C;  3IQL A;  3SEM A;  1M3B A;  1KFZ A;  2PNI A;  1PRL C;  1M8M A;  3H41 A;  4J9H A;  2CSQ A;  2ED1 A;  2LMJ A;  2DRM A;  4LUD A;  5IHK A;  2FPF A;  2O9V A;  1G2B A;  2KNB B;  3I9Q A;  3C0C A;  2AZS A;  1EFN A;  4RTV A;  1B3Q A;  2K9G A;  1WXT A;  3UA6 A;  1OPK A;  2F2X A;  2CH4 A;  5IHI A;  1H8K A;  2K3B A;  2RPN A;  2GTJ A;  2RMO A;  2EW3 A;  3I35 A;  2EGC A;  2OI3 A;  1E7O A;  1AWX A;  4LE9 A;  4AG2 C;  1ZSG A;  2O9S A;  1KSW A;  1PWT A;  4Z89 A;  4LNP A;  1UHF A;  1AZE A;  4IIM A;  2BZX A;  2GNC A;  2MIO A;  1X2Q A;  2ESW A;  2LX7 A;  1PKT A;  2ED0 A;  2KYB A;  3QWX X;  2FEI A;  2PTK A;  4RUG A;  1I07 A;  4AFQ C;  2VKN A;  4AFS C;  1JQQ A;  1S1N A;  1XOV A;  2CH4 W;  1WI7 A;  1WIE A;  2K6D A;  2XMF A;  4RTU A;  1GBR A;  1PRM C;  3U23 A;  3CQT A;  2DNU A;  2F2V A;  5EC7 A;  4LUE A;  2W10 A;  2FPE A;  1FYN A;  2RNA A;  2DE0 X;  3RNJ A;  1Z9Z A;  2A08 A;  3M0P A;  4J9F A;  2M0Y A;  3NGP A;  2IIM A;  2DBK A;  1PKS A;  1K76 A;  2EYW A;  4F16 A;  4OMN A;  1X43 A;  2A36 A;  2DF6 A;  2AZV A;  2FRW A;  2YUO A;  2JXB A;  1X6B A;  2K2M A;  2RQR A;  1LCK A;  2DL4 A;  2K7A A;  1SHF A;  2B86 A;  2J6F A;  2DMO A;  1MV3 A;  3M0Q A;  2ROT A;  4OMQ A;  4DEY A;  3VS7 A;  2EYY A;  2VVK A;  2KXD A;  1BU1 A;  3RBB B;  2BZY A;  2GQI A;  2DL3 A;  1U5S A;  3TVT A;  1NYG A;  2FG0 A;  3VS6 A;  1ZX6 A;  1WXB A;  1T0H A;  4LN2 A;  2KYM A;  2EVR A;  2GGR A;  2YT6 A;  3H0F A;  1E6G A;  3NHN A;  4X1V A;  1AVZ C;  4HVW A;  2LCS A;  1AWJ A;  3VS1 A;  2LJ1 A;  2F2W A;  1YN8 A;  1UJY A;  2D8H A;  2K79 A;  1U06 A;  1V1C A;  2DL8 A;  2O88 A;  2CRE A;  5FW9 A;  1J3T A;  3EHQ A;  1X2K A;  2YUP A;  4D8D A;  3FJ5 A;  2A28 A;  3NPF A;  1ABQ A;  2KE9 A;  2AKK A;  1K9A A;  2V1Q A;  2DIL A;  5GJW B;  1KJW A;  2EBP A;  2KT1 A;  1UGV A;  5IXB A;  1IO6 A;  1ZUU A;  2JW4 A;  1GBQ A;  1A0N B;  2QDL A;  3EG0 A;  3H0H A;  2SRC A;  1SSH A;  1WDX A;  4OML A;  2W0Z A;  4AG1 C;  1SPK A;  3VRZ A;  1Y57 A;  2FRY A;  5GJV B;  2DA9 A;  5IXF A;  2DYB A;  1K0X A;  2LNH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...