2B86A

Solution structure of the first src homology 3 domain of nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK2
publication title Solution structure of the first SRC homology 3 domain of human nck2
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2b86A00
1G2BA 2RNAA 4A63B 4DEXA 2A08A 4HVWA 2FPEA 1OOTA 3FJ5A 1HD3A 2KRMA 3EG1A 1EFNA 1YN8A 1WI7A 4J9CA 2OI3A 2KT8A 1BU1A 3QWYA 1FYNA 1UJ0A 1W1FA 1PHTA 3QWXX 4OMOA 2J7IA 2D8JA 2O9VA 2RMOA 1JXMA 2C0OA 1UUEA 2X3XD 1PRLC 4ORZA 2JS2A 2OJ2A 2IIMA 2A36A 2DM1A 2AKLA 3U23A 1MUZA 1B07A 1WA7A 2XMFA 1UHCA 1M27C 2HDAA 4J9BA 3TSZA 5EC7A 4AG2C 1YP5A 3R6NA 3M0PA 2GQIA 2DL4A 3PVQA 2JM8A 1AEYA 2FRYA 2D0NA 4J9FA 2L3QA 3M0UA 3EG0A 2M51A 1WXUA 2EVRA 1KFZA 3PE0A 4AFSC 2C0TA 3RNJA 2ROTA 3LH5A 1HJDA 4OMMA 3H0HA 1TUDA 1GCQA 3M0SA 2VWFA 1HSQA 3VS3A 2LX7A 4LUDA 1K1ZA 5IHKA 1RLPC 2K7AA 1X6BA 2O31A 1NLPC 1K0XA 3TSWA 2BZYA 5IXBA 2YT6A 4CC7A 1CKBA 2JMAA 2GGRA 1NG2A 4J9HA 2ABLA 1AWOA 2FG0A 3EG3A 4GBQA 1ARKA 3ZL7C 3NPFA 4JJBA 3VS1A 1VYTA 5I11A 3GBQA 2J6KA 1X43A 3JV3A 1Y57A 3M0QA 2W10A 2L3SA 1A0NB 2YUPA 3KFVA 2EW3A 4HCKA 1X27A 1SSHA 2LMJA 1BK2A 2RQUA 2P4RA 2L0AA 2QDLA 4Y92A 2LQWA 1QWEA 2A37A 1M8MA 1OPKA 2PZ1A 1RUWA 4D8DA 2DMOA 2LJ3A 2ROLA 1UTIA 3PVLA 2SRCA 4J9EA 1AOJA 2DL8A 4K11A 1ABOA 1UJYA 1FMKA 1NM7A 2DBKA 1GFDA 2GTOA 4AFZC 3M0RA 1SHGA 1WXTA 3NGPA 5HCKA 1GFCA 2V1QA 1JQQA 1JU5C 5I22A 1SRMA 1YWOA 2F2VA 1WDXA 1JXOA 2O88A 2JMCA 2HCKA 2CREA 4E6RA 3H0IA 3A98A 2O9SA 1T0HA 2LJ0A 1Y0MA 1WIEA 4D8KA 2LQNA 4OMNA 4Z88A 3M0TA 4LE9A 2AZVA 3H41A 2CSIA 1AWJA 1AWXA 1ZSGA 1YCSB 4RTUA 1U5SA 2DA9A 2J6OA 2ED0A 2EYXA 4J9GA 1I1JA 1X69A 4RUGA 1ZUKA 2O2OA 4RTTA 4CC3A 1SRLA 3O5ZA 2DRMA 2JM9A 1G83A 3EHQA 2CH4W 1AWWA 3VRYA 1ZUUA 1H92A 2L3PA 2FRWA 3IQLA 4JZ4A 1AD5A 2EGEA 2MIOA 2CT3A 2J6FA 4OMQA 2KROA 1KJWA 2JS0A 2L2PA 2KR3A 2YSQA 1W6XA 3C0CA 3THKA 1N5ZA 2DX1A 1QLYA 3REAB 2NUZA 3TVTA 2DL7A 1X2KA 2CDTA 2MCNA 2PTKA 1H3HA 2EYYA 4Z8AA 2RN8A 1PRMC 2J06A 2YUNA 2JXBA 1WFWA 4LN2A 2DE0X 2HSPA 2KEAA 1M30A 1XOVA 2J05A 4CC2A 2DILA 4F16A 2EYWA 1K4US 2FPDA 2EKHA 4WCIA 3VS2A 2K3BA 4IIOA 2D8HA 1PKSA 1VYVA 2K9GA 1T3SA 2K2MA 3H0FA 1GRIA 4M4ZA 1I07A 1B3QA 3RBBB 1WLPB 1K76A 2YDLA 5GJVB 3VS4A 5FWBA 1JO8A 5FWCA 4RTWA 1LCKA 2EYZA 2HEQA 2JTEA 1M3CA 1UFFA 1U06A 2AZSA 4QT7A 1E6HA 2MOXA 1NYFA 1WX6A 2DRKA 3EGUA 1V1CA 2YUQA 4J9DA 3VRZA 4ESRA 1Z9QA 2EGCA 1QWFA 5L23A 1VYUA 2BZXA 1TG0A 2DYBA 5GJWB 1KIKA 3UA7A 5IXFA 2PNIA 1ZBJA 4AG1C 3EHRA 1MV3A 2LJ1A 3SEMA 2KYMA 1SPKA 4AFQC 2GBQA 1ZX6A 2CH4A 2KXCA 2KRSA 3VS7A 1TUCA 4JJCA 3I9QA 2NWMA 1AVZC 4JZ3A 1AZEA 4JJDA 4KRTA 4DEYA 1UHFA 4X1VA 2D1XA 1WXBA 2LNHB 4F17A 2AKKA 1YNZA 4Z89A 2BZ8A 1QKXA 2DF6A 4HVVA 2HBWA 3I5SA 1QKWA 3VS0A 2SEMA 2VVKA 1CSKA 2ED1A 3VS5A 4J9IA 1RLQC 3I35A 2KNBB 4GLMA 2LCSA 1MV0B 1PKTA 4ZNXA 4IIMA 1YWPA 2RF0A 1X6GA 2DL5A 1E7OA 2RQWA 1SHFA 4JPBW 2EPDA 1VA7A 1NEGA 1IO6A 2B86A 2K6DA 2BTTA 1NYGA 2ENMA 2H8HA 2GTJA 2KBTA 5IHIA 2FPFA 1ZUYA 1H8KA 3UATA 2CUBA 4R0KA 1PNJA 2LZ6B 3NHNA 1K9AA 1CKAA 4LNPA 2CSQA 1BBZA 3UF4A 1QCFA 1GBQA 1X2QA 1K0SA 1ZLMA 4FSSA 3CQTA 1UDLA 2KT1A 5ECAA 2KRNA 1AZGB 2YUOA 2X3WD 2DL3A 1J3TA 2CT4A 2LP5A 2KE9A 1T0JA 2ESWA 1NLOC 2F2WA 4EIKA 1UGVA 2JW4A 2A28A 2OAWA 3EG2A 2DBMA 2K79A 1GBRA 3VS6A 1E6GA 2RQRA 3ULRB 2F2XA 2GNCA 5IH2A 1I0CA 2RQTA 1Z9ZA 2KGTA 1UG1A 1T3LA 2DJQA 4RTVA 1OPLA 4HXJA 1U3OA 1W70A 2M0YA 2JT4A 4AFUC 2RPNA 1OEBA 4RTYA 2CUDA 4RTZA 2RQVA 2VKNA 1S1NA 4RTXA 4LUEA 2DVJA 1ABQA 1SEMA 1RI9A 2DNUA 2KXDA 3UA6A 2ECZA 2G6FX 5IHNA 3NMZC 2DLPA 2W0ZA 4OMLA 2KYBA 2EBPA 2I0NA 4F14A 4HVUA 1BB9A 1GCPA 3I5RA 3SHWA 1GL5A 1JEGA 1PWTA 2AK5A 1M3AA 4OMPA 2EQIA 1UE9A 1M3BA 1WYXA 2FO0A 5FW9A 2EGAA 3REBB 1UECA 1OV3A 2C0IA 2E5KA 1KSWA 1GCQC 2V1RA 1NEBA 2FEIA 4CC4B
chains in the Genus database with same CATH superfamily
4F7UA 4C5IA 1N8RR 2YRVA 1OYXA 2ZPGB 3CMAT 2LQKA 2FPEA 4J8OA 3FJ5A 1KC8R 3CCUQ 2VASA 4C92F 3LW5E 1EFNA 3TQ7P 3QO3A 1BU1A 1WHLA 4XTZA 3OW2A 4PFZA 1RAAB 1JJ2A 2C0OA 1UUEA 1VQNA 2HQHA 2XICA 3G71A 2IIMA 2A36A 2DM1A 2GF7A 3SB2A 3EAEA 3P8HA 4FSXA 3U23A 1ZHIA 1B07A 4HCZA 4MZTA 4ZGJB 4NOYA 2IG0A 1I8FA 1KQ2A 4C8QB 4ATOA 1N27A 3JCMc 1Q86R 1QVFS 2JM8A 1AEYA 3JAME 4BY6C 2BIVA 4A54A 2FRYA 3EG0A 1YJWA 1PC0A 1KFZA 2RJDA 1VUBA 3SWNC 5GAN2 4C92A 5CKEA 3CC7T 2DD4A 2YWWA 3QZ5B 1HJDA 1O9SA 3CD6Q 1IGUA 1GCQA 3M0SA 2HQEA 1HSQA 3VS3A 2LX7A 2QA4Q 2OX7A 1C1AA 2DEUA 3A8MB 1H3ZA 3CCVA 2GFUA 2MAMA 1X6BA 5GAN8 2O31A 1MMAA 2EQMA 1NPPA 5GAOm 2X35A 4CC7A 4XK8E 5CKHA 1VQ7Q 5FRNA 2JNGA 1P92A 3RKYA 2CP5A 4BD3A 1HYOA 1UGPB 3EG3A 1ARKA 4KH1B 1NJIU 3GIBA 1OZ3A 3QIIA 4PNOA 4B6MA 3JV3A 5GAMe 4E7KA 3FJPA 5FU7C 5A0DA 1VQ9Q 2MMPA 2QTVA 3MJXA 1RAFB 3SFMA 3DB4A 1Q82U 1X27A 4KGVB 3CCUT 3A8GB 2LX9A 3E2UA 2L0AA 1QVFP 1N9SA 1DJ7B 4QW2A 1QWEA 2RHIA 5LJ3j 5FRMA 1M8MA 1NPRA 1M90U 2E65A 1RUWA 2QQRA 3CCMQ 5FROA 1UTIA 1U8RA 3PVLA 5CVIA 5GAOr 1AOJA 2DL8A 3CPWS 2X4WA 2HMAA 1WQWA 1VQPA 1ABOA 2ZPFB 3BFMA 3F70A 1MMNA 3FB9A 2ZAEA 4EMHA 3OYCA 2CYZB 1GFCA 2G3RA 5IN1A 3S3NA 1SRMA 1WDXA 4C0DB 2JMCA 3A8LB 1VQ4A 5DY9A 3A98A 2ZPHB 1Y0MA 4BI3A 4D8KA 4OMNA 3CEYA 2DK3A 4Y28E 5LJ5d 1YIJT 4M7AG 3CCSA 3I55A 3LX7A 2DA9A 5D6XA 1TH7A 2O01E 2CP2A 1OQKA 4M75B 4RUGA 4QVDA 1VQ6T 2JM9A 3V8LA 4C0FA 1ZUUA 1H92A 5GMKm 5GAOq 1N6AA 3QDFA 3IQLA 4JZ4A 5C0MA 1YITQ 2DXCA 3ER0A 2QXFA 1R8OB 2KROA 1VQ7T 2EJFA 4M78F 4E7LA 3C0CA 3THKA 1N5ZA 2DX1A 2NUZA 2RI2A 5CQXA 1PSEA 5M9OA 4OB1B 2V8JA 3BW1A 2J06A 3URGA 4XTVA 2DE0X 2HSPA 3FC3A 1VQ9T 4N4GA 1XOVA 4Z02A 3OBYA 1K73C 2VGMA 4DBHA 2MWOA 3C94A 1YJNQ 3QXEB 3CPWA 1EIFA 3CCLA 3M56A 1F1BB 3RBBB 1K76A 3CC7A 2YDLA 1LCKA 2EYZA 3CCMT 3S3OA 3VYGA 1KQSA 2AZSA 1UFFA 4QT7A 1TUGB 4EMKC 2MOXA 4A4EA 1WX6A 1Q95G 4PJJA 3BDUA 3PT9A 4UC4A 1M5Q1 4M78A 4NS5A 2DZCA 1TG0A 4FYYB 1KIKA 5IXFA 4BB7A 2EKOA 5KYUA 1MV3A 2LJ1A 1JRIA 4XTUA 5FU6C 4A4FA 4C8QG 5CIUA 4JRKA 1K73R 1ZX6A 5J26A 4F7UB 3OY9A 5D6YA 2CP0A 1WJQA 4JRQA 4JJCA 5GAMf 1MMDA 4KRTA 2YLBA 1UHFA 1WXBA 3QUIA 2HBWA 2FYKA 2X9HA 3VS0A 4C0ZA 2Y90A 3O8VA 3VS5A 1RI0A 2VV5A 3I35A 4GLMA 2LCSA 3FRNA 2DJZA 1YWPA 4Y91A 2K3YA 2Z0WA 4C5EA 3CCQQ 5KYYA 4DBFA 1LVKA 3E1SA 1NEGA 3P8BB 1AT1B 1UB4A 2KY9A 3X26B 4BI8B 1FXXA 3M9QA 2FPFA 1WQ7A 2DVEA 1PNJA 2LZ6B 1VQMQ 4LNPA 3WXMB 3OYFA 1BBZA 3UF4A 1QCFA 2VXEA 1K0SA 2DZ9A 2QAZA 2KRNA 2YUOA 1UGSB 2KI7A 5HK0A 1YJNT 2ESWA 2A3LA 3L2WA 3PIPA 4XTYA 3VS6A 2EQKA 2PU9B 3CD6A 2F2XA 1WHHA 5IH2A 1I0CA 1VQKQ 1VQOQ 2RQTA 2XIDA 2QA4A 2RI3A 3M53A 3VUZA 2E4HA 4M75D 2ZZDA 2QEXT 2JT4A 2E6NA 4ELYC 4RTYA 2CUDA 1GXIE 2CGHA 1KD1C 1M1GA 1VQ7A 2VGNA 3OSVA 4FM4B 4RCBA 2DAQA 2KXDA 2DXUA 1BYMA 2A7YA 3NMZC 3FLGA 3NFCA 4HA8A 1VQ9A 2HD0A 1BCOA 2EAYA 1RAHB 4HCCA 2FO0A 2YXYA 1K9MU 4QKUA 3H6ZA 8ATCB 4N0AA 1WHKA 2V1RA 1BCMA 1TS9A 5L8RE 4M75G 1ZSZA 2RNAA 4M7AE 4DEXA 2A08A 2ZPBB 4HVWA 4GLKA 1KD1R 1HD3A 4DQ2A 5C6SA 3PMIA 1MNDA 5IAYA 4OF1A 5GAN5 2FVUA 5LJ5e 3KUFA 3QWXX 3CXCS 4IUPA 2E6ZA 4OB0B 4JS5A 4HT9A 1JXMA 4N4HA 2BE9B 3L2QA 1PG5B 2K4YA 3MEVA 2M1HA 1Y7XA 2WSEE 4ME7A 1G8XA 1B34A 1BI2A 1MUZA 2XMFA 1W2BS 2HDAA 3TSZA 5EC7A 4AG2C 4KUDK 3C95A 1YP5A 3R6NA 3M0PA 4LD9K 2XK0A 3PVQA 4B9XA 5GANd 5GAOp 3JCMf 2D0NA 1VQ8T 2L3QA 4A53A 1LNXA 1WXUA 2MK5A 1I5OB 1YITA 1U1SA 4ZTJA 2C0TA 4LD6A 3G6ET 3H0HA 1TUDA 1OULA 2BE7D 3OS0A 5KYXA 1K1ZA 4XU0A 3L42A 1M2OA 2FZCB 2FZGB 3M4GA 1K0XA 2YT6A 1KHIA 2E3IA 4F7UG 2JMAA 1RABB 2KQWA 3CXCP 1V29B 1AWOA 3QKJA 2DEQA 4GBQA 2X4JA 4JJBA 4C8QC 3VS1A 1VYTA 5I11A 2RB6A 4C8QE 3G4SQ 3BE3A 1V76A 2LDMA 1AHJB 1YHQA 1IGQA 1K8AC 3KFVA 4HCKA 3QDRB 4Q5WA 3RIRA 2RQUA 2P4RA 4M78B 1VQ5A 5CO7A 3QSUA 3M59A 2NLUA 4FW2A 4CI0C 2OAUA 2XDBA 2LQ8A 2O4XA 5KYUB 2MPXC 1W2BA 2E1HA 3BY7A 3HRUA 3HFNA 4M77D 2SRCA 1M2VA 1UJYA 3HPWA 2CS7A 1FMKA 1XJWB 2DBKA 2GTOA 4ANJA 1UEBA 2COYA 3M0RA 2ZPEB 2BKDN 3NGPA 2F5KA 4J7FA 1JU5C 1YWOA 1PSFA 1JXOA 3JCMd 2K5FA 2MF2A 4M7DF 1K8AR 2CREA 2O9SA 1T0HA 2LJ0A 2JVVA 3JSCA 2FL7A 2P0PA 2F69A 1WIEA 2LQNA 5DLOA 2HKNA 1WJRA 2JTMA 1EZZB 5KYYB 3EFOA 3CCET 2K5IA 3BDLA 2DO3A 4WTOB 3CCQA 1AWXA 1YCSB 2LC4A 3MEAA 4FYWB 1UGRB 3V7RA 2DTOA 2EYXA 4J9GA 1WHJA 3J81E 2NYSA 3OB9A 2O2OA 2A0FB 2FHDA 2COZA 4M77G 2DRMA 4MZMA 1VQMA 4E2FB 2YRCA 3UDCA 3VRYA 1YIJQ 2ZPIB 1MGQA 1TU0B 2V26A 3QG1A 2FRWA 4L6V5 5LJ5f 1TTHB 2CT3A 4OMQA 3RKXA 2JS0A 4JUVA 1Q81U 4LDVA 4PL6A 3TCJA 5EG2A 1QLYA 3TVTA 3OYKA 2DL7A 4JJNK 1VQ6Q 2MCNA 1G3YA 2RHZA 1H3HA 3G4ST 2E41A 1Q7YU 1PRMC 2YUNA 1LJOA 4LN2A 2KEAA 4F04B 4M7DA 5CAIA 4BE1A 4LXCA 2J05A 4HCBA 2DILA 1VQKA 1VQOA 2EYWA 2FPDA 2EKHA 4IIOA 4E7SA 2D8HA 1VYVA 3EH1A 2K2MA 5LJ5h 4FL6A 4CRIA 4FCYA 1FX7A 1GRIA 4X9DA 1I07A 3GNFB 4M75C 3KXTA 1D1BA 2DERA 4M75E 5GJVB 3CC4T 3VS4A 1OX8A 4RTWA 2HEQA 4RKUE 2FZKB 1D1AA 1M3CA 5KYWA 1MMGA 3OS5A 4XU3A 2DIGA 1X01A 3OYAA 3LLRA 4MDWA 2EJGA 4M7AD 3FDRA 3G1JA 1S72Q 1D0ZA 4ELZC 3OQ5A 4LDWA 4ESRA 1Z9QA 2EGCA 1QWFA 4ZTFA 1VYUA 5GJWB 2R5AA 3NTHA 4N4IA 5GAMg 1ZBJA 2QASA 4AG1C 2RO0A 1Y96A 2LCCA 2MI6A 3SEMA 4JRIA 3VKIA 1QVFA 4AFQC 1ZSZB 3JB9D 3MKDA 4VUBA 1M1KC 4IKFA 3E9FA 3GPLA 2F5TX 2HQXA 2NWMA 1AZEA 1EX4A 4X1VA 4F17A 1NBEB 2LNHB 5I2MA 5KE2A 4OP0A 4Z89A 2R58A 1QKXA 4HVVA 3S6WA 2CZ7B 2SEMA 4IUVA 1CSKA 2KNBB 3M57A 1MV0B 4ZNXA 1TSFA 1X6GA 2DL5A 2YHTA 1E7OA 3CMAA 4EMGA 5IT9E 2OTLQ 2E10A 2H3EB 4EDUA 4XAXB 4JPBW 1VA7A 3RUXA 1IO6A 1RAEB 3RR6A 1B34B 2K6DA 1U1TA 5GANe 1NYGA 2H8HA 2KBTA 2D6FA 4TVRA 4AT1B 2HSEB 1XQHA 1IHVA 2L3RA 4DOVA 1I5LA 1RACB 3EGDA 2E5QA 4QVCA 4PLLA 3JB9G 2CZ1B 1M1KR 1ZBXA 2JTFA 1FMWA 4QVZA 2E64A 1UDLA 4F7UE 5ECAA 1AZGB 2DTIA 4LDUA 2X3WD 2LP5A 1T0JA 5GANg 2F2WA 3TU4K 4J83A 1D09B 2YRDA 3OYDA 4PKCC 2IVWA 2HZYA 2CP6A 4M78G 2KAFA 1SSFA 4BUGA 5KYXB 4C8QD 2AT1B 1Z9ZA 2KGTA 1T3LA 4HXJA 4MMLA 2M0YA 1YI2T 2RPNA 2ZCFB 1S72T 1OEBA 4RTZA 1YJ9Q 1S1NA 2XG8D 4LUEA 1ABQA 3UA6A 2ECZA 4E7HA 4LDXA 3HFOA 3G4SA 4FT4A 2QEXQ 1KQ1A 4C5GA 2EBPA 4KULA 4F14A 1BB9A 3RMQA 3I5RA 1GL5A 5I21A 2QGFB 2AK5A 3CCJQ 1M3AA 2PUKB 2RJCA 5FW9A 2EGAA 4PJOF 5GAOn 2E5KA 4XU2A 1M4ZA 1MNEA 4D6WA 2O4XB 1GCQC 3EFSA 2FEIA 4MDXA 2JJ9A 4II1A 1N8RU 1JBMA 4A63B 2OTLT 1N9RA 2H3JA 3JCMe 1M2VB 1VQLQ 3CCUA 1KC8U 4E7ZA 1BI1A 2KRMA 3H9NA 5KCOA 1R0BG 3CMET 1YN8A 4M77C 1WI7A 4M77E 2OI3A 1FYNA 1UJ0A 1W1FA 5CR2A 1PHTA 2J7IA 2D8JA 2M16A 2M02A 3HRSA 1I4K1 1QVGP 3JCMQ 5A0LA 4ORZA 2JS2A 2OJ2A 1BKBA 3EFOB 2CZ6B 5GAMh 1YBYA 3JCMg 2X4YA 1ZA1B 2DIQA 1WA7A 1UHCA 4PFPA 2P0QA 4PJOA 1Q86U 3E9GA 5CK9A 3QPHA 1NJIC 1NE8A 2K2VA 1RAGB 1XTDA 1TWBA 4OMFB 4J9FA 5J3BA 3UWNA 4C92B 2XD0A 2X51A 3EH2A 3RERA 1YIJA 3FEOA 3PE0A 1Q82C 3OYBA 4AFSC 1YJ9T 3CBMA 2ROTA 3ASKA 3LH5A 3T9NA 2PVOB 2RHYA 1VQ6A 1VQ8Q 5GANf 4M7DB 1M90C 1RLPC 2K7AA 2V8KA 4EPCA 1WHGA 5LL6S 1YCYA 2NUTA 3TSWA 2BZYA 5IXBA 2WSCE 3CCJT 3G6EQ 2OTJQ 3C12A 2RK1A 2GGRA 4FYVB 4DOWA 1NG2A 4J9HA 2ABLA 2HBPA 5D6WA 5DM7R 3I56T 1NJIR 1JB0E 2QI2A 4E7JA 2J6KA 2RA2A 5GAN3 1RADB 1Y57A 2W10A 5KE3A 2XHCA 1LOJA 1G5VA 3L2ZA 2COWA 5KYWB 1BIBA 1A0NB 4BI4A 1M1FA 2YUPA 5GANh 2F1LA 1Q82R 1VQLT 1M9SA 5A2QE 1OU9A 3GNGA 4J7IA 3JB9H 2LQWA 2QQSA 3QZ9B 3OYNA 1KK7A 4FW1A 4M7AC 1Y96B 1M90R 4D8DA 3CCMA 1IHWA 1VIFA 2DMOA 2LJ3A 4J9EA 4K11A 2R57A 4NL2A 4X34A 3SWNA 1GFDA 2AIRB 4AFZC 5GMKe 3X24B 1SHGA 3L2UA 1WHMA 1WXTA 5LJ3f 3LH0A 2M0OA 3GF5A 5I22A 2F2VA 4C0GA 3DLMA 2RD1A 3JCMX 2ATCB 2HCKA 1VQ4Q 2DYIA 4J6YA 4Z88A 2LNVA 3M0TA 4LE9A 1YJWT 3H41A 2OTLA 2CZ0B 1AWJA 4WF2A 1G3TA 3I55Q 1HK9A 2J6OA 3L2VA 4M78C 3A5ZB 3ME9A 4M78E 5LJ5g 2X4XA 1I1JA 1ZUKA 3EGDB 1SRLA 3O5ZA 3EFRA 1QCNA 1G83A 3CCEQ 2CH4W 3CCVT 3JRZA 4DA4A 1AWWA 1WGSA 2EWNA 2EGEA 4JDSA 3OS2A 2OTJT 3META 1KJWA 3JB9I 1W6XA 3JCMb 1RAIB 3REAB 1X2KA 3OBWA 2CDTA 2VC8A 3OYYA 4KGZB 3GOXA 4IUTA 2EYYA 1ACMB 1WFWA 2KMTA 2P4TA 1KHCA 3JCMh 5GAN7 4F16A 1K4US 4WCIA 1WNLA 3JCMW 2K3BA 3M4YA 1YJNA 2DFUA 2K57A 4XU1A 4C92D 4RCCA 3PTAA 2RK2A 3PMTA 5FWBA 5FWCA 3CXCA 5AT1B 1WZOA 2B8AA 2JTEA 2PVGB 1U06A 1R77A 2RH2A 1E6HA 1NYFA 4P5NA 2QEXA 4MZPA 2DRKA 1VQPT 2R5MA 5LJ3d 4J9DA 2D9TA 5GAMj 5L23A 1PD0A 3QJYA 4PJNA 4M7DD 3CCJA 3CC4Q 2EFIA 3OYMA 1ZA2B 2PNIA 2QDYB 3S3MA 3H8ZA 3PFSA 4PFOA 3EHRA 2PUOB 6AT1B 3CCRQ 3RMSA 1SPKA 2QQ9A 3PIOA 1IB8A 1K73U 1VQ4T 2GBQA 2CH4A 1OZ2A 2L89A 3D7SB 4QQ6A 1KG1A 4J5YA 1TUCA 3ZBDA 1AVZC 4JZ3A 3CCST 3OW2P 3I55T 2YLCA 4DEYA 1JJ2P 1VQLA 4C92G 2AKKA 1YNZA 3JCMP 2DF6A 2QTXA 4BE2A 4B9WA 1WPYA 2QG9B 4J9IA 1RLQC 1SKUB 2DTHA 2HKQB 2RF0A 1YFNA 1TXQA 1D3BA 1SHFA 3HKSA 4M7DG 2B86A 2BTTA 3NTKA 2ENMA 3HHTB 3QYHB 4RG8A 3Q1JA 4DBRA 4R56A 2GTJA 1H8KA 4PJOB 4R0KA 4ZGDB 5CKBA 4N0AC 4M77F 3A8HB 3HTRA 3MP6A 1CKAA 3VUBA 4L5GA 2CSQA 4R55A 4EMKA 3M5AA 4FSSA 3CQTA 1ZSZC 3ZFJA 3OYHA 5GANj 5CQYA 4KH0B 4XTWA 5GMKi 3CCLT 4YTLA 4C0DC 2DBMA 1TOVA 1K9MC 4KT0E 2GNCA 1UG1A 2DJQA 1VQ8A 1OPLA 1U3OA 2NUTB 1W70A 5GMKh 2L8DA 3MO8A 5GAOl 4AFUC 3MPUB 2M9UA 2VKNA 1PD1A 4PK4A 3CBOA 3G6EA 2OTJA 4FIBA 4RTXA 9ATCB 3X20B 3EGXA 4M77A 4RG2A 3A1PA 3CCRT 3E19A 2CP7A 5GAN6 3HRTA 2DLPA 2W0ZA 1YI2Q 8AT1B 7AT1B 1PWTA 3WVDB 4ZN1A 4BDYA 4OMPA 3RDVA 3J80E 1UE9A 1M3BA 1NZ9A 1K9MR 3REBB 1OV3A 4LDYA 1KSWA 4BY6B 1G2BA 2RJFA 4PJMA 2CKKA 4AMCA 4BDZA 3HP9A 4OB3B 1OOTA 1KD1U 3SWNB 4X9CA 2EJ9A 3EG9A 3M55A 5CKFA 3EG1A 3GLXA 4KUIA 1D0YA 3OYGA 2VYTA 4J9CA 3PNWC 2MWPA 3M54A 3G7ZA 2KT8A 1HXDA 3QWYA 4M78D 5CCAA 1WJSA 4OMOA 1IREB 3LWHA 3MCAB 1KQSS 4OB2B 2O9VA 2RMOA 4M7AF 3MEUA 2X3XD 1PRLC 2P0KA 4E7IA 2WACA 3A8OB 4FT2A 2LCLA 3CMEQ 2JUFA 2AKLA 3V7CA 1SG5A 2ZGWA 2QQBA 1XNIA 3UT1A 1M27C 4J9BA 3FIFA 3OA6A 4QQDA 1PM3A 4PLIA 3TREA 3JB9F 2GQIA 2DL4A 5FU7B 2V8IA 4BE0A 3CD6T 5DLQE 5FLXE 2P84A 2QA4T 4QQGA 2Y4XA 2RJEA 3X28B 2NUPA 3LWIA 3M0UA 3DKMA 5GMKl 3CCEA 3L2RA 2EYQA 2M51A 4MMKA 3RKWA 2EVRA 4JRPA 2C06A 1O75A 3RNJA 3V8JA 2MYSA 4OMMA 4DBQA 3CC2Q 2VWFA 4LUDA 3HL8A 1D0XA 1ZQ1A 5IHKA 4M7AA 4HKEA 3CPWP 2DXTA 3OYLA 1QVGS 2RHUA 4PJOD 1NLPC 2JZ2A 3PGGA 3QBYA 4OGCA 1CKBA 3JCMJ 2FG0A 3LGLA 1KQSP 3ZEHA 3ZL7C 3NPFA 3V7SA 1B7TA 3GBQA 5LJ3e 1MHNA 3C4SA 1X43A 3LGFA 3M0QA 2L3SA 1YHQQ 1IRXA 3RESA 2EW3A 4C92C 2DXBA 4C92E 1SSHA 3QYGB 2LMJA 3I56Q 1PCXA 1BK2A 2QDLA 4Y92A 1VQ5Q 4C8QF 5HK3A 5HY6A 1FWZA 2A37A 4XQ3A 3CC4A 3OYIA 2QYZA 1OPKA 2PZ1A 3QHSA 4PJOG 5LJ3g 2GFAA 2ROLA 4M7DC 2EQUA 3CCRA 4M7DE 3HSBA 4C5HA 5KCHA 3MEWA 2GCXA 1NM7A 4JS4A 3DLLA 5HCKA 2V1QA 5KH6A 1Q81C 2K5LA 4ZGEB 1JQQA 2LVMA 3MP8A 4IUQA 1VQNQ 2JN0A 3P8DA 2O88A 1SF9A 1M8VA 2KK4A 1K8AU 4E6RA 1G3WA 3H0IA 5CKDA 3G71Q 1Q7YC 1I81A 2E3HA 2JOYA 1D3BB 2XKOC 4OVAA 3SDZA 2AZVA 2CSIA 4FU6A 5LJ5j 5GMKj 3OMGA 1YITT 1QVGA 1ZSGA 4RTUA 1U5SA 2ED0A 3OS1A 4C8QA 1IXDA 3CC2T 2XDDA 3R6OA 1X69A 3V8KA 4RTTA 2PVDB 4CC3A 4L59A 2RI5A 3EHQA 4J6XA 1YJWQ 4EMKB 3TEEA 3J7AF 5KYNA 2BUDA 2L3PA 2IPOB 4O5VA 1AD5A 2DPPB 2MIOA 2J6FA 1QW1A 4A4KA 2EIFA 2L2PA 1Q81R 2KR3A 2YSQA 2HNIA 2LT4A 2QGGA 3OYEA 3AHUA 2PTKA 3WVEB 5D7UA 5FU6B 3CCVQ 4Z8AA 2RN8A 1Q7YR 2JXBA 1OI1A 2LRQA 5A0GA 1M30A 1OX9A 4CC2A 1YHQT 2AHJB 2XI9A 3VS2A 1G3SA 1PKSA 2K9GA 1T3SA 2RM4A 3H0FA 1VQ5T 1QQJA 4M4ZA 1B3QA 4V2SA 1QP3A 1WLPB 4JLIA 3EGXB 1H641 4M77B 1R0CB 1LPLA 3NTIA 1JO8A 2LT1A 2HL3A 2XDPA 2I2LA 5AYFA 4ZN3A 3OYJA 3GP8A 1BI3A 1IZ6A 1YI2A 1OU8A 1S72A 3EGUA 1V1CA 2YUQA 3MHXA 3JCMV 1Y07A 5GAMd 3VRZA 1UGQB 2BZXA 2DYBA 2VB6A 5GAN4 2RHXA 3QJ6A 4M75F 3UA7A 2QQAA 2HAXA 2KDSA 4XTXA 1X75C 4RMOA 1VQNT 2KYMA 2E12A 3G71T 1VQPQ 2KXCA 2EQJA 2KRSA 3VS7A 3X25B 3CBPA 3I9QA 4JJDA 3EG9B 4A4GA 3CCQT 2D1XA 2QK0A 2BZ8A 3I5SA 1QKWA 2K3XA 4NL3A 2KVQG 2VVKA 2ED1A 4BACA 1W4SA 2GQVA 1PKTA 1QP2A 1VQMT 4IIMA 3JB9J 1QVPA 1BI0A 3AT1B 2D0QB 3CCSQ 2RQWA 3CMAQ 1X6OA 2EPDA 1QCOA 4HT8A 4O6JA 4IURA 2DKGA 3M58A 3VJPA 5IHIA 3CMEA 5LJ3h 1ZUYA 3UATA 2CUBA 4M75A 3KBGA 3NHNA 2HL5C 1K9AA 2VUBA 2XU8A 2DETA 4OGEA 3N5BB 4PJLA 4A4HA 4FYXB 1M1KU 1D1CA 1GBQA 1X2QA 3OMCA 1ZLMA 2NUPB 3DB3A 2KT1A 1C0MA 1VQOT 2L5QA 1VQKT 2DL3A 4IUUA 2CT4A 5J39A 1J3TA 2KE9A 2Y4YA 1Y71A 3OW2S 1NLOC 4EIKA 1UGVA 2JW4A 2WSFE 2A28A 1JJ2S 2OAWA 3EG2A 1FMVA 3VYHB 2K79A 1GBRA 1C6VX 4E47A 1E6GA 2RQRA 3ULRB 3VU3C 3CC2A 1VIEA 4M7AB 4F7UF 2PQWA 2VXFA 4RTVA 1RL2A 3OSSC 1QMCA 5I2SA 1N8RC 3CCLQ 2LTOA 1YJ9A 2RQVA 1KC8C 3CC7Q 3L1AA 2DVJA 3INZA 1SEMA 1RI9A 4PJOC 2DNUA 4PJOE 3MP1A 2CP3A 3SD4A 2G6FX 5IHNA 4JLGA 3VV0A 4GY5A 4OMLA 2KYBA 1BIAA 2I0NA 4HVUA 2KSSA 1GCPA 3SHWA 1JEGA 1W2BP 3UPUA 5HKCA 2FB7A 2EQIA 1WYXA 4KBMB 3CPFA 3LYIA 3I56A 1VOMA 2DD5A 1UECA 2C0IA 4J6WA 2E70A 1NEBA 4KGXB 1Q86C 4CC4B
chains in the Genus database with same CATH topology
1G2BA 2RNAA 4A63B 4DEXA 2A08A 4HVWA 2FPEA 1OOTA 3FJ5A 1HD3A 2KRMA 3EG1A 1EFNA 1YN8A 1WI7A 4J9CA 2OI3A 2KT8A 1BU1A 3QWYA 1FYNA 1UJ0A 1W1FA 1PHTA 3QWXX 4OMOA 2J7IA 2D8JA 2O9VA 2RMOA 1JXMA 2C0OA 1UUEA 2X3XD 1PRLC 4ORZA 2JS2A 2OJ2A 2IIMA 2A36A 2DM1A 2AKLA 3U23A 1MUZA 1B07A 1WA7A 2XMFA 1UHCA 1M27C 2HDAA 4J9BA 3TSZA 5EC7A 4AG2C 1YP5A 3R6NA 3M0PA 2GQIA 2DL4A 3PVQA 2JM8A 1AEYA 2FRYA 2D0NA 4J9FA 2L3QA 3M0UA 3EG0A 2M51A 1WXUA 2EVRA 1KFZA 3PE0A 4AFSC 2C0TA 3RNJA 2ROTA 3LH5A 1HJDA 4OMMA 3H0HA 1TUDA 1GCQA 3M0SA 2VWFA 1HSQA 3VS3A 2LX7A 4LUDA 1K1ZA 5IHKA 1RLPC 2K7AA 1X6BA 2O31A 1NLPC 1K0XA 3TSWA 2BZYA 5IXBA 2YT6A 4CC7A 1CKBA 2JMAA 2GGRA 1NG2A 4J9HA 2ABLA 1AWOA 2FG0A 3EG3A 4GBQA 1ARKA 3ZL7C 3NPFA 4JJBA 3VS1A 1VYTA 5I11A 3GBQA 2J6KA 1X43A 3JV3A 1Y57A 3M0QA 2W10A 2L3SA 1A0NB 2YUPA 3KFVA 2EW3A 4HCKA 1X27A 1SSHA 2LMJA 1BK2A 2RQUA 2P4RA 2L0AA 2QDLA 4Y92A 2LQWA 1QWEA 2A37A 1M8MA 1OPKA 2PZ1A 1RUWA 4D8DA 2DMOA 2LJ3A 2ROLA 1UTIA 3PVLA 2SRCA 4J9EA 1AOJA 2DL8A 4K11A 1ABOA 1UJYA 1FMKA 1NM7A 2DBKA 1GFDA 2GTOA 4AFZC 3M0RA 1SHGA 1WXTA 3NGPA 5HCKA 1GFCA 2V1QA 1JQQA 1JU5C 5I22A 1SRMA 1YWOA 2F2VA 1WDXA 1JXOA 2O88A 2JMCA 2HCKA 2CREA 4E6RA 3H0IA 3A98A 2O9SA 1T0HA 2LJ0A 1Y0MA 1WIEA 4D8KA 2LQNA 4OMNA 4Z88A 3M0TA 4LE9A 2AZVA 3H41A 2CSIA 1AWJA 1AWXA 1ZSGA 1YCSB 4RTUA 1U5SA 2DA9A 2J6OA 2ED0A 2EYXA 4J9GA 1I1JA 1X69A 4RUGA 1ZUKA 2O2OA 4RTTA 4CC3A 1SRLA 3O5ZA 2DRMA 2JM9A 1G83A 3EHQA 2CH4W 1AWWA 3VRYA 1ZUUA 1H92A 2L3PA 2FRWA 3IQLA 4JZ4A 1AD5A 2EGEA 2MIOA 2CT3A 2J6FA 4OMQA 2KROA 1KJWA 2JS0A 2L2PA 2KR3A 2YSQA 1W6XA 3C0CA 3THKA 1N5ZA 2DX1A 1QLYA 3REAB 2NUZA 3TVTA 2DL7A 1X2KA 2CDTA 2MCNA 2PTKA 1H3HA 2EYYA 4Z8AA 2RN8A 1PRMC 2J06A 2YUNA 2JXBA 1WFWA 4LN2A 2DE0X 2HSPA 2KEAA 1M30A 1XOVA 2J05A 4CC2A 2DILA 4F16A 2EYWA 1K4US 2FPDA 2EKHA 4WCIA 3VS2A 2K3BA 4IIOA 2D8HA 1PKSA 1VYVA 2K9GA 1T3SA 2K2MA 3H0FA 1GRIA 4M4ZA 1I07A 1B3QA 3RBBB 1WLPB 1K76A 2YDLA 5GJVB 3VS4A 5FWBA 1JO8A 5FWCA 4RTWA 1LCKA 2EYZA 2HEQA 2JTEA 1M3CA 1UFFA 1U06A 2AZSA 4QT7A 1E6HA 2MOXA 1NYFA 1WX6A 2DRKA 3EGUA 1V1CA 2YUQA 4J9DA 3VRZA 4ESRA 1Z9QA 2EGCA 1QWFA 5L23A 1VYUA 2BZXA 1TG0A 2DYBA 5GJWB 1KIKA 3UA7A 5IXFA 2PNIA 1ZBJA 4AG1C 3EHRA 1MV3A 2LJ1A 3SEMA 2KYMA 1SPKA 4AFQC 2GBQA 1ZX6A 2CH4A 2KXCA 2KRSA 3VS7A 1TUCA 4JJCA 3I9QA 2NWMA 1AVZC 4JZ3A 1AZEA 4JJDA 4KRTA 4DEYA 1UHFA 4X1VA 2D1XA 1WXBA 2LNHB 4F17A 2AKKA 1YNZA 4Z89A 2BZ8A 1QKXA 2DF6A 4HVVA 2HBWA 3I5SA 1QKWA 3VS0A 2SEMA 2VVKA 1CSKA 2ED1A 3VS5A 4J9IA 1RLQC 3I35A 2KNBB 4GLMA 2LCSA 1MV0B 1PKTA 4ZNXA 4IIMA 1YWPA 2RF0A 1X6GA 2DL5A 1E7OA 2RQWA 1SHFA 4JPBW 2EPDA 1VA7A 1NEGA 1IO6A 2B86A 2K6DA 2BTTA 1NYGA 2ENMA 2H8HA 2GTJA 2KBTA 5IHIA 2FPFA 1ZUYA 1H8KA 3UATA 2CUBA 4R0KA 1PNJA 2LZ6B 3NHNA 1K9AA 1CKAA 4LNPA 2CSQA 1BBZA 3UF4A 1QCFA 1GBQA 1X2QA 1K0SA 1ZLMA 4FSSA 3CQTA 1UDLA 2KT1A 5ECAA 2KRNA 1AZGB 2YUOA 2X3WD 2DL3A 1J3TA 2CT4A 2LP5A 2KE9A 1T0JA 2ESWA 1NLOC 2F2WA 4EIKA 1UGVA 2JW4A 2A28A 2OAWA 3EG2A 2DBMA 2K79A 1GBRA 3VS6A 1E6GA 2RQRA 3ULRB 2F2XA 2GNCA 5IH2A 1I0CA 2RQTA 1Z9ZA 2KGTA 1UG1A 1T3LA 2DJQA 4RTVA 1OPLA 4HXJA 1U3OA 1W70A 2M0YA 2JT4A 4AFUC 2RPNA 1OEBA 4RTYA 2CUDA 4RTZA 2RQVA 2VKNA 1S1NA 4RTXA 4LUEA 2DVJA 1ABQA 1SEMA 1RI9A 2DNUA 2KXDA 3UA6A 2ECZA 2G6FX 5IHNA 3NMZC 2DLPA 2W0ZA 4OMLA 2KYBA 2EBPA 2I0NA 4F14A 4HVUA 1BB9A 1GCPA 3I5RA 3SHWA 1GL5A 1JEGA 1PWTA 2AK5A 1M3AA 4OMPA 2EQIA 1UE9A 1M3BA 1WYXA 2FO0A 5FW9A 2EGAA 3REBB 1UECA 1OV3A 2C0IA 2E5KA 1KSWA 1GCQC 2V1RA 1NEBA 2FEIA 4CC4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  2RNA A;  4A63 B;  4DEX A;  2A08 A;  4HVW A;  2FPE A;  1OOT A;  3FJ5 A;  1HD3 A;  2KRM A;  3EG1 A;  1EFN A;  1YN8 A;  1WI7 A;  4J9C A;  2OI3 A;  2KT8 A;  1BU1 A;  3QWY A;  1FYN A;  1UJ0 A;  1W1F A;  1PHT A;  3QWX X;  4OMO A;  2J7I A;  2D8J A;  2O9V A;  2RMO A;  1JXM A;  2C0O A;  1UUE A;  2X3X D;  1PRL C;  4ORZ A;  2JS2 A;  2OJ2 A;  2IIM A;  2A36 A;  2DM1 A;  2AKL A;  3U23 A;  1MUZ A;  1B07 A;  1WA7 A;  2XMF A;  1UHC A;  1M27 C;  2HDA A;  4J9B A;  3TSZ A;  5EC7 A;  4AG2 C;  1YP5 A;  3R6N A;  3M0P A;  2GQI A;  2DL4 A;  3PVQ A;  2JM8 A;  1AEY A;  2FRY A;  2D0N A;  4J9F A;  2L3Q A;  3M0U A;  3EG0 A;  2M51 A;  1WXU A;  2EVR A;  1KFZ A;  3PE0 A;  4AFS C;  2C0T A;  3RNJ A;  2ROT A;  3LH5 A;  1HJD A;  4OMM A;  3H0H A;  1TUD A;  1GCQ A;  3M0S A;  2VWF A;  1HSQ A;  3VS3 A;  2LX7 A;  4LUD A;  1K1Z A;  5IHK A;  1RLP C;  2K7A A;  1X6B A;  2O31 A;  1NLP C;  1K0X A;  3TSW A;  2BZY A;  5IXB A;  2YT6 A;  4CC7 A;  1CKB A;  2JMA A;  2GGR A;  1NG2 A;  4J9H A;  2ABL A;  1AWO A;  2FG0 A;  3EG3 A;  4GBQ A;  1ARK A;  3ZL7 C;  3NPF A;  4JJB A;  3VS1 A;  1VYT A;  5I11 A;  3GBQ A;  2J6K A;  1X43 A;  3JV3 A;  1Y57 A;  3M0Q A;  2W10 A;  2L3S A;  1A0N B;  2YUP A;  3KFV A;  2EW3 A;  4HCK A;  1X27 A;  1SSH A;  2LMJ A;  1BK2 A;  2RQU A;  2P4R A;  2L0A A;  2QDL A;  4Y92 A;  2LQW A;  1QWE A;  2A37 A;  1M8M A;  1OPK A;  2PZ1 A;  1RUW A;  4D8D A;  2DMO A;  2LJ3 A;  2ROL A;  1UTI A;  3PVL A;  2SRC A;  4J9E A;  1AOJ A;  2DL8 A;  4K11 A;  1ABO A;  1UJY A;  1FMK A;  1NM7 A;  2DBK A;  1GFD A;  2GTO A;  4AFZ C;  3M0R A;  1SHG A;  1WXT A;  3NGP A;  5HCK A;  1GFC A;  2V1Q A;  1JQQ A;  1JU5 C;  5I22 A;  1SRM A;  1YWO A;  2F2V A;  1WDX A;  1JXO A;  2O88 A;  2JMC A;  2HCK A;  2CRE A;  4E6R A;  3H0I A;  3A98 A;  2O9S A;  1T0H A;  2LJ0 A;  1Y0M A;  1WIE A;  4D8K A;  2LQN A;  4OMN A;  4Z88 A;  3M0T A;  4LE9 A;  2AZV A;  3H41 A;  2CSI A;  1AWJ A;  1AWX A;  1ZSG A;  1YCS B;  4RTU A;  1U5S A;  2DA9 A;  2J6O A;  2ED0 A;  2EYX A;  4J9G A;  1I1J A;  1X69 A;  4RUG A;  1ZUK A;  2O2O A;  4RTT A;  4CC3 A;  1SRL A;  3O5Z A;  2DRM A;  2JM9 A;  1G83 A;  3EHQ A;  2CH4 W;  1AWW A;  3VRY A;  1ZUU A;  1H92 A;  2L3P A;  2FRW A;  3IQL A;  4JZ4 A;  1AD5 A;  2EGE A;  2MIO A;  2CT3 A;  2J6F A;  4OMQ A;  2KRO A;  1KJW A;  2JS0 A;  2L2P A;  2KR3 A;  2YSQ A;  1W6X A;  3C0C A;  3THK A;  1N5Z A;  2DX1 A;  1QLY A;  3REA B;  2NUZ A;  3TVT A;  2DL7 A;  1X2K A;  2CDT A;  2MCN A;  2PTK A;  1H3H A;  2EYY A;  4Z8A A;  2RN8 A;  1PRM C;  2J06 A;  2YUN A;  2JXB A;  1WFW A;  4LN2 A;  2DE0 X;  2HSP A;  2KEA A;  1M30 A;  1XOV A;  2J05 A;  4CC2 A;  2DIL A;  4F16 A;  2EYW A;  1K4U S;  2FPD A;  2EKH A;  4WCI A;  3VS2 A;  2K3B A;  4IIO A;  2D8H A;  1PKS A;  1VYV A;  2K9G A;  1T3S A;  2K2M A;  3H0F A;  1GRI A;  4M4Z A;  1I07 A;  1B3Q A;  3RBB B;  1WLP B;  1K76 A;  2YDL A;  5GJV B;  3VS4 A;  5FWB A;  1JO8 A;  5FWC A;  4RTW A;  1LCK A;  2EYZ A;  2HEQ A;  2JTE A;  1M3C A;  1UFF A;  1U06 A;  2AZS A;  4QT7 A;  1E6H A;  2MOX A;  1NYF A;  1WX6 A;  2DRK A;  3EGU A;  1V1C A;  2YUQ A;  4J9D A;  3VRZ A;  4ESR A;  1Z9Q A;  2EGC A;  1QWF A;  5L23 A;  1VYU A;  2BZX A;  1TG0 A;  2DYB A;  5GJW B;  1KIK A;  3UA7 A;  5IXF A;  2PNI A;  1ZBJ A;  4AG1 C;  3EHR A;  1MV3 A;  2LJ1 A;  3SEM A;  2KYM A;  1SPK A;  4AFQ C;  2GBQ A;  1ZX6 A;  2CH4 A;  2KXC A;  2KRS A;  3VS7 A;  1TUC A;  4JJC A;  3I9Q A;  2NWM A;  1AVZ C;  4JZ3 A;  1AZE A;  4JJD A;  4KRT A;  4DEY A;  1UHF A;  4X1V A;  2D1X A;  1WXB A;  2LNH B;  4F17 A;  2AKK A;  1YNZ A;  4Z89 A;  2BZ8 A;  1QKX A;  2DF6 A;  4HVV A;  2HBW A;  3I5S A;  1QKW A;  3VS0 A;  2SEM A;  2VVK A;  1CSK A;  2ED1 A;  3VS5 A;  4J9I A;  1RLQ C;  3I35 A;  2KNB B;  4GLM A;  2LCS A;  1MV0 B;  1PKT A;  4ZNX A;  4IIM A;  1YWP A;  2RF0 A;  1X6G A;  2DL5 A;  1E7O A;  2RQW A;  1SHF A;  4JPB W;  2EPD A;  1VA7 A;  1NEG A;  1IO6 A;  2B86 A;  2K6D A;  2BTT A;  1NYG A;  2ENM A;  2H8H A;  2GTJ A;  2KBT A;  5IHI A;  2FPF A;  1ZUY A;  1H8K A;  3UAT A;  2CUB A;  4R0K A;  1PNJ A;  2LZ6 B;  3NHN A;  1K9A A;  1CKA A;  4LNP A;  2CSQ A;  1BBZ A;  3UF4 A;  1QCF A;  1GBQ A;  1X2Q A;  1K0S A;  1ZLM A;  4FSS A;  3CQT A;  1UDL A;  2KT1 A;  5ECA A;  2KRN A;  1AZG B;  2YUO A;  2X3W D;  2DL3 A;  1J3T A;  2CT4 A;  2LP5 A;  2KE9 A;  1T0J A;  2ESW A;  1NLO C;  2F2W A;  4EIK A;  1UGV A;  2JW4 A;  2A28 A;  2OAW A;  3EG2 A;  2DBM A;  2K79 A;  1GBR A;  3VS6 A;  1E6G A;  2RQR A;  3ULR B;  2F2X A;  2GNC A;  5IH2 A;  1I0C A;  2RQT A;  1Z9Z A;  2KGT A;  1UG1 A;  1T3L A;  2DJQ A;  4RTV A;  1OPL A;  4HXJ A;  1U3O A;  1W70 A;  2M0Y A;  2JT4 A;  4AFU C;  2RPN A;  1OEB A;  4RTY A;  2CUD A;  4RTZ A;  2RQV A;  2VKN A;  1S1N A;  4RTX A;  4LUE A;  2DVJ A;  1ABQ A;  1SEM A;  1RI9 A;  2DNU A;  2KXD A;  3UA6 A;  2ECZ A;  2G6F X;  5IHN A;  3NMZ C;  2DLP A;  2W0Z A;  4OML A;  2KYB A;  2EBP A;  2I0N A;  4F14 A;  4HVU A;  1BB9 A;  1GCP A;  3I5R A;  3SHW A;  1GL5 A;  1JEG A;  1PWT A;  2AK5 A;  1M3A A;  4OMP A;  2EQI A;  1UE9 A;  1M3B A;  1WYX A;  2FO0 A;  5FW9 A;  2EGA A;  3REB B;  1UEC A;  1OV3 A;  2C0I A;  2E5K A;  1KSW A;  1GCQ C;  2V1R A;  1NEB A;  2FEI A;  4CC4 B; 
#chains in the Genus database with same CATH topology
 4F7U A;  4C5I A;  1N8R R;  2YRV A;  1OYX A;  2ZPG B;  3CMA T;  2LQK A;  2FPE A;  4J8O A;  3FJ5 A;  1KC8 R;  3CCU Q;  2VAS A;  4C92 F;  3LW5 E;  1EFN A;  3TQ7 P;  3QO3 A;  1BU1 A;  1WHL A;  4XTZ A;  3OW2 A;  4PFZ A;  1RAA B;  1JJ2 A;  2C0O A;  1UUE A;  1VQN A;  2HQH A;  2XIC A;  3G71 A;  2IIM A;  2A36 A;  2DM1 A;  2GF7 A;  3SB2 A;  3EAE A;  3P8H A;  4FSX A;  3U23 A;  1ZHI A;  1B07 A;  4HCZ A;  4MZT A;  4ZGJ B;  4NOY A;  2IG0 A;  1I8F A;  1KQ2 A;  4C8Q B;  4ATO A;  1N27 A;  3JCM c;  1Q86 R;  1QVF S;  2JM8 A;  1AEY A;  3JAM E;  4BY6 C;  2BIV A;  4A54 A;  2FRY A;  3EG0 A;  1YJW A;  1PC0 A;  1KFZ A;  2RJD A;  1VUB A;  3SWN C;  5GAN 2;  4C92 A;  5CKE A;  3CC7 T;  2DD4 A;  2YWW A;  3QZ5 B;  1HJD A;  1O9S A;  3CD6 Q;  1IGU A;  1GCQ A;  3M0S A;  2HQE A;  1HSQ A;  3VS3 A;  2LX7 A;  2QA4 Q;  2OX7 A;  1C1A A;  2DEU A;  3A8M B;  1H3Z A;  3CCV A;  2GFU A;  2MAM A;  1X6B A;  5GAN 8;  2O31 A;  1MMA A;  2EQM A;  1NPP A;  5GAO m;  2X35 A;  4CC7 A;  4XK8 E;  5CKH A;  1VQ7 Q;  5FRN A;  2JNG A;  1P92 A;  3RKY A;  2CP5 A;  4BD3 A;  1HYO A;  1UGP B;  3EG3 A;  1ARK A;  4KH1 B;  1NJI U;  3GIB A;  1OZ3 A;  3QII A;  4PNO A;  4B6M A;  3JV3 A;  5GAM e;  4E7K A;  3FJP A;  5FU7 C;  5A0D A;  1VQ9 Q;  2MMP A;  2QTV A;  3MJX A;  1RAF B;  3SFM A;  3DB4 A;  1Q82 U;  1X27 A;  4KGV B;  3CCU T;  3A8G B;  2LX9 A;  3E2U A;  2L0A A;  1QVF P;  1N9S A;  1DJ7 B;  4QW2 A;  1QWE A;  2RHI A;  5LJ3 j;  5FRM A;  1M8M A;  1NPR A;  1M90 U;  2E65 A;  1RUW A;  2QQR A;  3CCM Q;  5FRO A;  1UTI A;  1U8R A;  3PVL A;  5CVI A;  5GAO r;  1AOJ A;  2DL8 A;  3CPW S;  2X4W A;  2HMA A;  1WQW A;  1VQP A;  1ABO A;  2ZPF B;  3BFM A;  3F70 A;  1MMN A;  3FB9 A;  2ZAE A;  4EMH A;  3OYC A;  2CYZ B;  1GFC A;  2G3R A;  5IN1 A;  3S3N A;  1SRM A;  1WDX A;  4C0D B;  2JMC A;  3A8L B;  1VQ4 A;  5DY9 A;  3A98 A;  2ZPH B;  1Y0M A;  4BI3 A;  4D8K A;  4OMN A;  3CEY A;  2DK3 A;  4Y28 E;  5LJ5 d;  1YIJ T;  4M7A G;  3CCS A;  3I55 A;  3LX7 A;  2DA9 A;  5D6X A;  1TH7 A;  2O01 E;  2CP2 A;  1OQK A;  4M75 B;  4RUG A;  4QVD A;  1VQ6 T;  2JM9 A;  3V8L A;  4C0F A;  1ZUU A;  1H92 A;  5GMK m;  5GAO q;  1N6A A;  3QDF A;  3IQL A;  4JZ4 A;  5C0M A;  1YIT Q;  2DXC A;  3ER0 A;  2QXF A;  1R8O B;  2KRO A;  1VQ7 T;  2EJF A;  4M78 F;  4E7L A;  3C0C A;  3THK A;  1N5Z A;  2DX1 A;  2NUZ A;  2RI2 A;  5CQX A;  1PSE A;  5M9O A;  4OB1 B;  2V8J A;  3BW1 A;  2J06 A;  3URG A;  4XTV A;  2DE0 X;  2HSP A;  3FC3 A;  1VQ9 T;  4N4G A;  1XOV A;  4Z02 A;  3OBY A;  1K73 C;  2VGM A;  4DBH A;  2MWO A;  3C94 A;  1YJN Q;  3QXE B;  3CPW A;  1EIF A;  3CCL A;  3M56 A;  1F1B B;  3RBB B;  1K76 A;  3CC7 A;  2YDL A;  1LCK A;  2EYZ A;  3CCM T;  3S3O A;  3VYG A;  1KQS A;  2AZS A;  1UFF A;  4QT7 A;  1TUG B;  4EMK C;  2MOX A;  4A4E A;  1WX6 A;  1Q95 G;  4PJJ A;  3BDU A;  3PT9 A;  4UC4 A;  1M5Q 1;  4M78 A;  4NS5 A;  2DZC A;  1TG0 A;  4FYY B;  1KIK A;  5IXF A;  4BB7 A;  2EKO A;  5KYU A;  1MV3 A;  2LJ1 A;  1JRI A;  4XTU A;  5FU6 C;  4A4F A;  4C8Q G;  5CIU A;  4JRK A;  1K73 R;  1ZX6 A;  5J26 A;  4F7U B;  3OY9 A;  5D6Y A;  2CP0 A;  1WJQ A;  4JRQ A;  4JJC A;  5GAM f;  1MMD A;  4KRT A;  2YLB A;  1UHF A;  1WXB A;  3QUI A;  2HBW A;  2FYK A;  2X9H A;  3VS0 A;  4C0Z A;  2Y90 A;  3O8V A;  3VS5 A;  1RI0 A;  2VV5 A;  3I35 A;  4GLM A;  2LCS A;  3FRN A;  2DJZ A;  1YWP A;  4Y91 A;  2K3Y A;  2Z0W A;  4C5E A;  3CCQ Q;  5KYY A;  4DBF A;  1LVK A;  3E1S A;  1NEG A;  3P8B B;  1AT1 B;  1UB4 A;  2KY9 A;  3X26 B;  4BI8 B;  1FXX A;  3M9Q A;  2FPF A;  1WQ7 A;  2DVE A;  1PNJ A;  2LZ6 B;  1VQM Q;  4LNP A;  3WXM B;  3OYF A;  1BBZ A;  3UF4 A;  1QCF A;  2VXE A;  1K0S A;  2DZ9 A;  2QAZ A;  2KRN A;  2YUO A;  1UGS B;  2KI7 A;  5HK0 A;  1YJN T;  2ESW A;  2A3L A;  3L2W A;  3PIP A;  4XTY A;  3VS6 A;  2EQK A;  2PU9 B;  3CD6 A;  2F2X A;  1WHH A;  5IH2 A;  1I0C A;  1VQK Q;  1VQO Q;  2RQT A;  2XID A;  2QA4 A;  2RI3 A;  3M53 A;  3VUZ A;  2E4H A;  4M75 D;  2ZZD A;  2QEX T;  2JT4 A;  2E6N A;  4ELY C;  4RTY A;  2CUD A;  1GXI E;  2CGH A;  1KD1 C;  1M1G A;  1VQ7 A;  2VGN A;  3OSV A;  4FM4 B;  4RCB A;  2DAQ A;  2KXD A;  2DXU A;  1BYM A;  2A7Y A;  3NMZ C;  3FLG A;  3NFC A;  4HA8 A;  1VQ9 A;  2HD0 A;  1BCO A;  2EAY A;  1RAH B;  4HCC A;  2FO0 A;  2YXY A;  1K9M U;  4QKU A;  3H6Z A;  8ATC B;  4N0A A;  1WHK A;  2V1R A;  1BCM A;  1TS9 A;  5L8R E;  4M75 G;  1ZSZ A;  2RNA A;  4M7A E;  4DEX A;  2A08 A;  2ZPB B;  4HVW A;  4GLK A;  1KD1 R;  1HD3 A;  4DQ2 A;  5C6S A;  3PMI A;  1MND A;  5IAY A;  4OF1 A;  5GAN 5;  2FVU A;  5LJ5 e;  3KUF A;  3QWX X;  3CXC S;  4IUP A;  2E6Z A;  4OB0 B;  4JS5 A;  4HT9 A;  1JXM A;  4N4H A;  2BE9 B;  3L2Q A;  1PG5 B;  2K4Y A;  3MEV A;  2M1H A;  1Y7X A;  2WSE E;  4ME7 A;  1G8X A;  1B34 A;  1BI2 A;  1MUZ A;  2XMF A;  1W2B S;  2HDA A;  3TSZ A;  5EC7 A;  4AG2 C;  4KUD K;  3C95 A;  1YP5 A;  3R6N A;  3M0P A;  4LD9 K;  2XK0 A;  3PVQ A;  4B9X A;  5GAN d;  5GAO p;  3JCM f;  2D0N A;  1VQ8 T;  2L3Q A;  4A53 A;  1LNX A;  1WXU A;  2MK5 A;  1I5O B;  1YIT A;  1U1S A;  4ZTJ A;  2C0T A;  4LD6 A;  3G6E T;  3H0H A;  1TUD A;  1OUL A;  2BE7 D;  3OS0 A;  5KYX A;  1K1Z A;  4XU0 A;  3L42 A;  1M2O A;  2FZC B;  2FZG B;  3M4G A;  1K0X A;  2YT6 A;  1KHI A;  2E3I A;  4F7U G;  2JMA A;  1RAB B;  2KQW A;  3CXC P;  1V29 B;  1AWO A;  3QKJ A;  2DEQ A;  4GBQ A;  2X4J A;  4JJB A;  4C8Q C;  3VS1 A;  1VYT A;  5I11 A;  2RB6 A;  4C8Q E;  3G4S Q;  3BE3 A;  1V76 A;  2LDM A;  1AHJ B;  1YHQ A;  1IGQ A;  1K8A C;  3KFV A;  4HCK A;  3QDR B;  4Q5W A;  3RIR A;  2RQU A;  2P4R A;  4M78 B;  1VQ5 A;  5CO7 A;  3QSU A;  3M59 A;  2NLU A;  4FW2 A;  4CI0 C;  2OAU A;  2XDB A;  2LQ8 A;  2O4X A;  5KYU B;  2MPX C;  1W2B A;  2E1H A;  3BY7 A;  3HRU A;  3HFN A;  4M77 D;  2SRC A;  1M2V A;  1UJY A;  3HPW A;  2CS7 A;  1FMK A;  1XJW B;  2DBK A;  2GTO A;  4ANJ A;  1UEB A;  2COY A;  3M0R A;  2ZPE B;  2BKD N;  3NGP A;  2F5K A;  4J7F A;  1JU5 C;  1YWO A;  1PSF A;  1JXO A;  3JCM d;  2K5F A;  2MF2 A;  4M7D F;  1K8A R;  2CRE A;  2O9S A;  1T0H A;  2LJ0 A;  2JVV A;  3JSC A;  2FL7 A;  2P0P A;  2F69 A;  1WIE A;  2LQN A;  5DLO A;  2HKN A;  1WJR A;  2JTM A;  1EZZ B;  5KYY B;  3EFO A;  3CCE T;  2K5I A;  3BDL A;  2DO3 A;  4WTO B;  3CCQ A;  1AWX A;  1YCS B;  2LC4 A;  3MEA A;  4FYW B;  1UGR B;  3V7R A;  2DTO A;  2EYX A;  4J9G A;  1WHJ A;  3J81 E;  2NYS A;  3OB9 A;  2O2O A;  2A0F B;  2FHD A;  2COZ A;  4M77 G;  2DRM A;  4MZM A;  1VQM A;  4E2F B;  2YRC A;  3UDC A;  3VRY A;  1YIJ Q;  2ZPI B;  1MGQ A;  1TU0 B;  2V26 A;  3QG1 A;  2FRW A;  4L6V 5;  5LJ5 f;  1TTH B;  2CT3 A;  4OMQ A;  3RKX A;  2JS0 A;  4JUV A;  1Q81 U;  4LDV A;  4PL6 A;  3TCJ A;  5EG2 A;  1QLY A;  3TVT A;  3OYK A;  2DL7 A;  4JJN K;  1VQ6 Q;  2MCN A;  1G3Y A;  2RHZ A;  1H3H A;  3G4S T;  2E41 A;  1Q7Y U;  1PRM C;  2YUN A;  1LJO A;  4LN2 A;  2KEA A;  4F04 B;  4M7D A;  5CAI A;  4BE1 A;  4LXC A;  2J05 A;  4HCB A;  2DIL A;  1VQK A;  1VQO A;  2EYW A;  2FPD A;  2EKH A;  4IIO A;  4E7S A;  2D8H A;  1VYV A;  3EH1 A;  2K2M A;  5LJ5 h;  4FL6 A;  4CRI A;  4FCY A;  1FX7 A;  1GRI A;  4X9D A;  1I07 A;  3GNF B;  4M75 C;  3KXT A;  1D1B A;  2DER A;  4M75 E;  5GJV B;  3CC4 T;  3VS4 A;  1OX8 A;  4RTW A;  2HEQ A;  4RKU E;  2FZK B;  1D1A A;  1M3C A;  5KYW A;  1MMG A;  3OS5 A;  4XU3 A;  2DIG A;  1X01 A;  3OYA A;  3LLR A;  4MDW A;  2EJG A;  4M7A D;  3FDR A;  3G1J A;  1S72 Q;  1D0Z A;  4ELZ C;  3OQ5 A;  4LDW A;  4ESR A;  1Z9Q A;  2EGC A;  1QWF A;  4ZTF A;  1VYU A;  5GJW B;  2R5A A;  3NTH A;  4N4I A;  5GAM g;  1ZBJ A;  2QAS A;  4AG1 C;  2RO0 A;  1Y96 A;  2LCC A;  2MI6 A;  3SEM A;  4JRI A;  3VKI A;  1QVF A;  4AFQ C;  1ZSZ B;  3JB9 D;  3MKD A;  4VUB A;  1M1K C;  4IKF A;  3E9F A;  3GPL A;  2F5T X;  2HQX A;  2NWM A;  1AZE A;  1EX4 A;  4X1V A;  4F17 A;  1NBE B;  2LNH B;  5I2M A;  5KE2 A;  4OP0 A;  4Z89 A;  2R58 A;  1QKX A;  4HVV A;  3S6W A;  2CZ7 B;  2SEM A;  4IUV A;  1CSK A;  2KNB B;  3M57 A;  1MV0 B;  4ZNX A;  1TSF A;  1X6G A;  2DL5 A;  2YHT A;  1E7O A;  3CMA A;  4EMG A;  5IT9 E;  2OTL Q;  2E10 A;  2H3E B;  4EDU A;  4XAX B;  4JPB W;  1VA7 A;  3RUX A;  1IO6 A;  1RAE B;  3RR6 A;  1B34 B;  2K6D A;  1U1T A;  5GAN e;  1NYG A;  2H8H A;  2KBT A;  2D6F A;  4TVR A;  4AT1 B;  2HSE B;  1XQH A;  1IHV A;  2L3R A;  4DOV A;  1I5L A;  1RAC B;  3EGD A;  2E5Q A;  4QVC A;  4PLL A;  3JB9 G;  2CZ1 B;  1M1K R;  1ZBX A;  2JTF A;  1FMW A;  4QVZ A;  2E64 A;  1UDL A;  4F7U E;  5ECA A;  1AZG B;  2DTI A;  4LDU A;  2X3W D;  2LP5 A;  1T0J A;  5GAN g;  2F2W A;  3TU4 K;  4J83 A;  1D09 B;  2YRD A;  3OYD A;  4PKC C;  2IVW A;  2HZY A;  2CP6 A;  4M78 G;  2KAF A;  1SSF A;  4BUG A;  5KYX B;  4C8Q D;  2AT1 B;  1Z9Z A;  2KGT A;  1T3L A;  4HXJ A;  4MML A;  2M0Y A;  1YI2 T;  2RPN A;  2ZCF B;  1S72 T;  1OEB A;  4RTZ A;  1YJ9 Q;  1S1N A;  2XG8 D;  4LUE A;  1ABQ A;  3UA6 A;  2ECZ A;  4E7H A;  4LDX A;  3HFO A;  3G4S A;  4FT4 A;  2QEX Q;  1KQ1 A;  4C5G A;  2EBP A;  4KUL A;  4F14 A;  1BB9 A;  3RMQ A;  3I5R A;  1GL5 A;  5I21 A;  2QGF B;  2AK5 A;  3CCJ Q;  1M3A A;  2PUK B;  2RJC A;  5FW9 A;  2EGA A;  4PJO F;  5GAO n;  2E5K A;  4XU2 A;  1M4Z A;  1MNE A;  4D6W A;  2O4X B;  1GCQ C;  3EFS A;  2FEI A;  4MDX A;  2JJ9 A;  4II1 A;  1N8R U;  1JBM A;  4A63 B;  2OTL T;  1N9R A;  2H3J A;  3JCM e;  1M2V B;  1VQL Q;  3CCU A;  1KC8 U;  4E7Z A;  1BI1 A;  2KRM A;  3H9N A;  5KCO A;  1R0B G;  3CME T;  1YN8 A;  4M77 C;  1WI7 A;  4M77 E;  2OI3 A;  1FYN A;  1UJ0 A;  1W1F A;  5CR2 A;  1PHT A;  2J7I A;  2D8J A;  2M16 A;  2M02 A;  3HRS A;  1I4K 1;  1QVG P;  3JCM Q;  5A0L A;  4ORZ A;  2JS2 A;  2OJ2 A;  1BKB A;  3EFO B;  2CZ6 B;  5GAM h;  1YBY A;  3JCM g;  2X4Y A;  1ZA1 B;  2DIQ A;  1WA7 A;  1UHC A;  4PFP A;  2P0Q A;  4PJO A;  1Q86 U;  3E9G A;  5CK9 A;  3QPH A;  1NJI C;  1NE8 A;  2K2V A;  1RAG B;  1XTD A;  1TWB A;  4OMF B;  4J9F A;  5J3B A;  3UWN A;  4C92 B;  2XD0 A;  2X51 A;  3EH2 A;  3RER A;  1YIJ A;  3FEO A;  3PE0 A;  1Q82 C;  3OYB A;  4AFS C;  1YJ9 T;  3CBM A;  2ROT A;  3ASK A;  3LH5 A;  3T9N A;  2PVO B;  2RHY A;  1VQ6 A;  1VQ8 Q;  5GAN f;  4M7D B;  1M90 C;  1RLP C;  2K7A A;  2V8K A;  4EPC A;  1WHG A;  5LL6 S;  1YCY A;  2NUT A;  3TSW A;  2BZY A;  5IXB A;  2WSC E;  3CCJ T;  3G6E Q;  2OTJ Q;  3C12 A;  2RK1 A;  2GGR A;  4FYV B;  4DOW A;  1NG2 A;  4J9H A;  2ABL A;  2HBP A;  5D6W A;  5DM7 R;  3I56 T;  1NJI R;  1JB0 E;  2QI2 A;  4E7J A;  2J6K A;  2RA2 A;  5GAN 3;  1RAD B;  1Y57 A;  2W10 A;  5KE3 A;  2XHC A;  1LOJ A;  1G5V A;  3L2Z A;  2COW A;  5KYW B;  1BIB A;  1A0N B;  4BI4 A;  1M1F A;  2YUP A;  5GAN h;  2F1L A;  1Q82 R;  1VQL T;  1M9S A;  5A2Q E;  1OU9 A;  3GNG A;  4J7I A;  3JB9 H;  2LQW A;  2QQS A;  3QZ9 B;  3OYN A;  1KK7 A;  4FW1 A;  4M7A C;  1Y96 B;  1M90 R;  4D8D A;  3CCM A;  1IHW A;  1VIF A;  2DMO A;  2LJ3 A;  4J9E A;  4K11 A;  2R57 A;  4NL2 A;  4X34 A;  3SWN A;  1GFD A;  2AIR B;  4AFZ C;  5GMK e;  3X24 B;  1SHG A;  3L2U A;  1WHM A;  1WXT A;  5LJ3 f;  3LH0 A;  2M0O A;  3GF5 A;  5I22 A;  2F2V A;  4C0G A;  3DLM A;  2RD1 A;  3JCM X;  2ATC B;  2HCK A;  1VQ4 Q;  2DYI A;  4J6Y A;  4Z88 A;  2LNV A;  3M0T A;  4LE9 A;  1YJW T;  3H41 A;  2OTL A;  2CZ0 B;  1AWJ A;  4WF2 A;  1G3T A;  3I55 Q;  1HK9 A;  2J6O A;  3L2V A;  4M78 C;  3A5Z B;  3ME9 A;  4M78 E;  5LJ5 g;  2X4X A;  1I1J A;  1ZUK A;  3EGD B;  1SRL A;  3O5Z A;  3EFR A;  1QCN A;  1G83 A;  3CCE Q;  2CH4 W;  3CCV T;  3JRZ A;  4DA4 A;  1AWW A;  1WGS A;  2EWN A;  2EGE A;  4JDS A;  3OS2 A;  2OTJ T;  3MET A;  1KJW A;  3JB9 I;  1W6X A;  3JCM b;  1RAI B;  3REA B;  1X2K A;  3OBW A;  2CDT A;  2VC8 A;  3OYY A;  4KGZ B;  3GOX A;  4IUT A;  2EYY A;  1ACM B;  1WFW A;  2KMT A;  2P4T A;  1KHC A;  3JCM h;  5GAN 7;  4F16 A;  1K4U S;  4WCI A;  1WNL A;  3JCM W;  2K3B A;  3M4Y A;  1YJN A;  2DFU A;  2K57 A;  4XU1 A;  4C92 D;  4RCC A;  3PTA A;  2RK2 A;  3PMT A;  5FWB A;  5FWC A;  3CXC A;  5AT1 B;  1WZO A;  2B8A A;  2JTE A;  2PVG B;  1U06 A;  1R77 A;  2RH2 A;  1E6H A;  1NYF A;  4P5N A;  2QEX A;  4MZP A;  2DRK A;  1VQP T;  2R5M A;  5LJ3 d;  4J9D A;  2D9T A;  5GAM j;  5L23 A;  1PD0 A;  3QJY A;  4PJN A;  4M7D D;  3CCJ A;  3CC4 Q;  2EFI A;  3OYM A;  1ZA2 B;  2PNI A;  2QDY B;  3S3M A;  3H8Z A;  3PFS A;  4PFO A;  3EHR A;  2PUO B;  6AT1 B;  3CCR Q;  3RMS A;  1SPK A;  2QQ9 A;  3PIO A;  1IB8 A;  1K73 U;  1VQ4 T;  2GBQ A;  2CH4 A;  1OZ2 A;  2L89 A;  3D7S B;  4QQ6 A;  1KG1 A;  4J5Y A;  1TUC A;  3ZBD A;  1AVZ C;  4JZ3 A;  3CCS T;  3OW2 P;  3I55 T;  2YLC A;  4DEY A;  1JJ2 P;  1VQL A;  4C92 G;  2AKK A;  1YNZ A;  3JCM P;  2DF6 A;  2QTX A;  4BE2 A;  4B9W A;  1WPY A;  2QG9 B;  4J9I A;  1RLQ C;  1SKU B;  2DTH A;  2HKQ B;  2RF0 A;  1YFN A;  1TXQ A;  1D3B A;  1SHF A;  3HKS A;  4M7D G;  2B86 A;  2BTT A;  3NTK A;  2ENM A;  3HHT B;  3QYH B;  4RG8 A;  3Q1J A;  4DBR A;  4R56 A;  2GTJ A;  1H8K A;  4PJO B;  4R0K A;  4ZGD B;  5CKB A;  4N0A C;  4M77 F;  3A8H B;  3HTR A;  3MP6 A;  1CKA A;  3VUB A;  4L5G A;  2CSQ A;  4R55 A;  4EMK A;  3M5A A;  4FSS A;  3CQT A;  1ZSZ C;  3ZFJ A;  3OYH A;  5GAN j;  5CQY A;  4KH0 B;  4XTW A;  5GMK i;  3CCL T;  4YTL A;  4C0D C;  2DBM A;  1TOV A;  1K9M C;  4KT0 E;  2GNC A;  1UG1 A;  2DJQ A;  1VQ8 A;  1OPL A;  1U3O A;  2NUT B;  1W70 A;  5GMK h;  2L8D A;  3MO8 A;  5GAO l;  4AFU C;  3MPU B;  2M9U A;  2VKN A;  1PD1 A;  4PK4 A;  3CBO A;  3G6E A;  2OTJ A;  4FIB A;  4RTX A;  9ATC B;  3X20 B;  3EGX A;  4M77 A;  4RG2 A;  3A1P A;  3CCR T;  3E19 A;  2CP7 A;  5GAN 6;  3HRT A;  2DLP A;  2W0Z A;  1YI2 Q;  8AT1 B;  7AT1 B;  1PWT A;  3WVD B;  4ZN1 A;  4BDY A;  4OMP A;  3RDV A;  3J80 E;  1UE9 A;  1M3B A;  1NZ9 A;  1K9M R;  3REB B;  1OV3 A;  4LDY A;  1KSW A;  4BY6 B;  1G2B A;  2RJF A;  4PJM A;  2CKK A;  4AMC A;  4BDZ A;  3HP9 A;  4OB3 B;  1OOT A;  1KD1 U;  3SWN B;  4X9C A;  2EJ9 A;  3EG9 A;  3M55 A;  5CKF A;  3EG1 A;  3GLX A;  4KUI A;  1D0Y A;  3OYG A;  2VYT A;  4J9C A;  3PNW C;  2MWP A;  3M54 A;  3G7Z A;  2KT8 A;  1HXD A;  3QWY A;  4M78 D;  5CCA A;  1WJS A;  4OMO A;  1IRE B;  3LWH A;  3MCA B;  1KQS S;  4OB2 B;  2O9V A;  2RMO A;  4M7A F;  3MEU A;  2X3X D;  1PRL C;  2P0K A;  4E7I A;  2WAC A;  3A8O B;  4FT2 A;  2LCL A;  3CME Q;  2JUF A;  2AKL A;  3V7C A;  1SG5 A;  2ZGW A;  2QQB A;  1XNI A;  3UT1 A;  1M27 C;  4J9B A;  3FIF A;  3OA6 A;  4QQD A;  1PM3 A;  4PLI A;  3TRE A;  3JB9 F;  2GQI A;  2DL4 A;  5FU7 B;  2V8I A;  4BE0 A;  3CD6 T;  5DLQ E;  5FLX E;  2P84 A;  2QA4 T;  4QQG A;  2Y4X A;  2RJE A;  3X28 B;  2NUP A;  3LWI A;  3M0U A;  3DKM A;  5GMK l;  3CCE A;  3L2R A;  2EYQ A;  2M51 A;  4MMK A;  3RKW A;  2EVR A;  4JRP A;  2C06 A;  1O75 A;  3RNJ A;  3V8J A;  2MYS A;  4OMM A;  4DBQ A;  3CC2 Q;  2VWF A;  4LUD A;  3HL8 A;  1D0X A;  1ZQ1 A;  5IHK A;  4M7A A;  4HKE A;  3CPW P;  2DXT A;  3OYL A;  1QVG S;  2RHU A;  4PJO D;  1NLP C;  2JZ2 A;  3PGG A;  3QBY A;  4OGC A;  1CKB A;  3JCM J;  2FG0 A;  3LGL A;  1KQS P;  3ZEH A;  3ZL7 C;  3NPF A;  3V7S A;  1B7T A;  3GBQ A;  5LJ3 e;  1MHN A;  3C4S A;  1X43 A;  3LGF A;  3M0Q A;  2L3S A;  1YHQ Q;  1IRX A;  3RES A;  2EW3 A;  4C92 C;  2DXB A;  4C92 E;  1SSH A;  3QYG B;  2LMJ A;  3I56 Q;  1PCX A;  1BK2 A;  2QDL A;  4Y92 A;  1VQ5 Q;  4C8Q F;  5HK3 A;  5HY6 A;  1FWZ A;  2A37 A;  4XQ3 A;  3CC4 A;  3OYI A;  2QYZ A;  1OPK A;  2PZ1 A;  3QHS A;  4PJO G;  5LJ3 g;  2GFA A;  2ROL A;  4M7D C;  2EQU A;  3CCR A;  4M7D E;  3HSB A;  4C5H A;  5KCH A;  3MEW A;  2GCX A;  1NM7 A;  4JS4 A;  3DLL A;  5HCK A;  2V1Q A;  5KH6 A;  1Q81 C;  2K5L A;  4ZGE B;  1JQQ A;  2LVM A;  3MP8 A;  4IUQ A;  1VQN Q;  2JN0 A;  3P8D A;  2O88 A;  1SF9 A;  1M8V A;  2KK4 A;  1K8A U;  4E6R A;  1G3W A;  3H0I A;  5CKD A;  3G71 Q;  1Q7Y C;  1I81 A;  2E3H A;  2JOY A;  1D3B B;  2XKO C;  4OVA A;  3SDZ A;  2AZV A;  2CSI A;  4FU6 A;  5LJ5 j;  5GMK j;  3OMG A;  1YIT T;  1QVG A;  1ZSG A;  4RTU A;  1U5S A;  2ED0 A;  3OS1 A;  4C8Q A;  1IXD A;  3CC2 T;  2XDD A;  3R6O A;  1X69 A;  3V8K A;  4RTT A;  2PVD B;  4CC3 A;  4L59 A;  2RI5 A;  3EHQ A;  4J6X A;  1YJW Q;  4EMK B;  3TEE A;  3J7A F;  5KYN A;  2BUD A;  2L3P A;  2IPO B;  4O5V A;  1AD5 A;  2DPP B;  2MIO A;  2J6F A;  1QW1 A;  4A4K A;  2EIF A;  2L2P A;  1Q81 R;  2KR3 A;  2YSQ A;  2HNI A;  2LT4 A;  2QGG A;  3OYE A;  3AHU A;  2PTK A;  3WVE B;  5D7U A;  5FU6 B;  3CCV Q;  4Z8A A;  2RN8 A;  1Q7Y R;  2JXB A;  1OI1 A;  2LRQ A;  5A0G A;  1M30 A;  1OX9 A;  4CC2 A;  1YHQ T;  2AHJ B;  2XI9 A;  3VS2 A;  1G3S A;  1PKS A;  2K9G A;  1T3S A;  2RM4 A;  3H0F A;  1VQ5 T;  1QQJ A;  4M4Z A;  1B3Q A;  4V2S A;  1QP3 A;  1WLP B;  4JLI A;  3EGX B;  1H64 1;  4M77 B;  1R0C B;  1LPL A;  3NTI A;  1JO8 A;  2LT1 A;  2HL3 A;  2XDP A;  2I2L A;  5AYF A;  4ZN3 A;  3OYJ A;  3GP8 A;  1BI3 A;  1IZ6 A;  1YI2 A;  1OU8 A;  1S72 A;  3EGU A;  1V1C A;  2YUQ A;  3MHX A;  3JCM V;  1Y07 A;  5GAM d;  3VRZ A;  1UGQ B;  2BZX A;  2DYB A;  2VB6 A;  5GAN 4;  2RHX A;  3QJ6 A;  4M75 F;  3UA7 A;  2QQA A;  2HAX A;  2KDS A;  4XTX A;  1X75 C;  4RMO A;  1VQN T;  2KYM A;  2E12 A;  3G71 T;  1VQP Q;  2KXC A;  2EQJ A;  2KRS A;  3VS7 A;  3X25 B;  3CBP A;  3I9Q A;  4JJD A;  3EG9 B;  4A4G A;  3CCQ T;  2D1X A;  2QK0 A;  2BZ8 A;  3I5S A;  1QKW A;  2K3X A;  4NL3 A;  2KVQ G;  2VVK A;  2ED1 A;  4BAC A;  1W4S A;  2GQV A;  1PKT A;  1QP2 A;  1VQM T;  4IIM A;  3JB9 J;  1QVP A;  1BI0 A;  3AT1 B;  2D0Q B;  3CCS Q;  2RQW A;  3CMA Q;  1X6O A;  2EPD A;  1QCO A;  4HT8 A;  4O6J A;  4IUR A;  2DKG A;  3M58 A;  3VJP A;  5IHI A;  3CME A;  5LJ3 h;  1ZUY A;  3UAT A;  2CUB A;  4M75 A;  3KBG A;  3NHN A;  2HL5 C;  1K9A A;  2VUB A;  2XU8 A;  2DET A;  4OGE A;  3N5B B;  4PJL A;  4A4H A;  4FYX B;  1M1K U;  1D1C A;  1GBQ A;  1X2Q A;  3OMC A;  1ZLM A;  2NUP B;  3DB3 A;  2KT1 A;  1C0M A;  1VQO T;  2L5Q A;  1VQK T;  2DL3 A;  4IUU A;  2CT4 A;  5J39 A;  1J3T A;  2KE9 A;  2Y4Y A;  1Y71 A;  3OW2 S;  1NLO C;  4EIK A;  1UGV A;  2JW4 A;  2WSF E;  2A28 A;  1JJ2 S;  2OAW A;  3EG2 A;  1FMV A;  3VYH B;  2K79 A;  1GBR A;  1C6V X;  4E47 A;  1E6G A;  2RQR A;  3ULR B;  3VU3 C;  3CC2 A;  1VIE A;  4M7A B;  4F7U F;  2PQW A;  2VXF A;  4RTV A;  1RL2 A;  3OSS C;  1QMC A;  5I2S A;  1N8R C;  3CCL Q;  2LTO A;  1YJ9 A;  2RQV A;  1KC8 C;  3CC7 Q;  3L1A A;  2DVJ A;  3INZ A;  1SEM A;  1RI9 A;  4PJO C;  2DNU A;  4PJO E;  3MP1 A;  2CP3 A;  3SD4 A;  2G6F X;  5IHN A;  4JLG A;  3VV0 A;  4GY5 A;  4OML A;  2KYB A;  1BIA A;  2I0N A;  4HVU A;  2KSS A;  1GCP A;  3SHW A;  1JEG A;  1W2B P;  3UPU A;  5HKC A;  2FB7 A;  2EQI A;  1WYX A;  4KBM B;  3CPF A;  3LYI A;  3I56 A;  1VOM A;  2DD5 A;  1UEC A;  2C0I A;  4J6W A;  2E70 A;  1NEB A;  4KGX B;  1Q86 C;  4CC4 B; 
#chains in the Genus database with same CATH homology
 1G2B A;  2RNA A;  4A63 B;  4DEX A;  2A08 A;  4HVW A;  2FPE A;  1OOT A;  3FJ5 A;  1HD3 A;  2KRM A;  3EG1 A;  1EFN A;  1YN8 A;  1WI7 A;  4J9C A;  2OI3 A;  2KT8 A;  1BU1 A;  3QWY A;  1FYN A;  1UJ0 A;  1W1F A;  1PHT A;  3QWX X;  4OMO A;  2J7I A;  2D8J A;  2O9V A;  2RMO A;  1JXM A;  2C0O A;  1UUE A;  2X3X D;  1PRL C;  4ORZ A;  2JS2 A;  2OJ2 A;  2IIM A;  2A36 A;  2DM1 A;  2AKL A;  3U23 A;  1MUZ A;  1B07 A;  1WA7 A;  2XMF A;  1UHC A;  1M27 C;  2HDA A;  4J9B A;  3TSZ A;  5EC7 A;  4AG2 C;  1YP5 A;  3R6N A;  3M0P A;  2GQI A;  2DL4 A;  3PVQ A;  2JM8 A;  1AEY A;  2FRY A;  2D0N A;  4J9F A;  2L3Q A;  3M0U A;  3EG0 A;  2M51 A;  1WXU A;  2EVR A;  1KFZ A;  3PE0 A;  4AFS C;  2C0T A;  3RNJ A;  2ROT A;  3LH5 A;  1HJD A;  4OMM A;  3H0H A;  1TUD A;  1GCQ A;  3M0S A;  2VWF A;  1HSQ A;  3VS3 A;  2LX7 A;  4LUD A;  1K1Z A;  5IHK A;  1RLP C;  2K7A A;  1X6B A;  2O31 A;  1NLP C;  1K0X A;  3TSW A;  2BZY A;  5IXB A;  2YT6 A;  4CC7 A;  1CKB A;  2JMA A;  2GGR A;  1NG2 A;  4J9H A;  2ABL A;  1AWO A;  2FG0 A;  3EG3 A;  4GBQ A;  1ARK A;  3ZL7 C;  3NPF A;  4JJB A;  3VS1 A;  1VYT A;  5I11 A;  3GBQ A;  2J6K A;  1X43 A;  3JV3 A;  1Y57 A;  3M0Q A;  2W10 A;  2L3S A;  1A0N B;  2YUP A;  3KFV A;  2EW3 A;  4HCK A;  1X27 A;  1SSH A;  2LMJ A;  1BK2 A;  2RQU A;  2P4R A;  2L0A A;  2QDL A;  4Y92 A;  2LQW A;  1QWE A;  2A37 A;  1M8M A;  1OPK A;  2PZ1 A;  1RUW A;  4D8D A;  2DMO A;  2LJ3 A;  2ROL A;  1UTI A;  3PVL A;  2SRC A;  4J9E A;  1AOJ A;  2DL8 A;  4K11 A;  1ABO A;  1UJY A;  1FMK A;  1NM7 A;  2DBK A;  1GFD A;  2GTO A;  4AFZ C;  3M0R A;  1SHG A;  1WXT A;  3NGP A;  5HCK A;  1GFC A;  2V1Q A;  1JQQ A;  1JU5 C;  5I22 A;  1SRM A;  1YWO A;  2F2V A;  1WDX A;  1JXO A;  2O88 A;  2JMC A;  2HCK A;  2CRE A;  4E6R A;  3H0I A;  3A98 A;  2O9S A;  1T0H A;  2LJ0 A;  1Y0M A;  1WIE A;  4D8K A;  2LQN A;  4OMN A;  4Z88 A;  3M0T A;  4LE9 A;  2AZV A;  3H41 A;  2CSI A;  1AWJ A;  1AWX A;  1ZSG A;  1YCS B;  4RTU A;  1U5S A;  2DA9 A;  2J6O A;  2ED0 A;  2EYX A;  4J9G A;  1I1J A;  1X69 A;  4RUG A;  1ZUK A;  2O2O A;  4RTT A;  4CC3 A;  1SRL A;  3O5Z A;  2DRM A;  2JM9 A;  1G83 A;  3EHQ A;  2CH4 W;  1AWW A;  3VRY A;  1ZUU A;  1H92 A;  2L3P A;  2FRW A;  3IQL A;  4JZ4 A;  1AD5 A;  2EGE A;  2MIO A;  2CT3 A;  2J6F A;  4OMQ A;  2KRO A;  1KJW A;  2JS0 A;  2L2P A;  2KR3 A;  2YSQ A;  1W6X A;  3C0C A;  3THK A;  1N5Z A;  2DX1 A;  1QLY A;  3REA B;  2NUZ A;  3TVT A;  2DL7 A;  1X2K A;  2CDT A;  2MCN A;  2PTK A;  1H3H A;  2EYY A;  4Z8A A;  2RN8 A;  1PRM C;  2J06 A;  2YUN A;  2JXB A;  1WFW A;  4LN2 A;  2DE0 X;  2HSP A;  2KEA A;  1M30 A;  1XOV A;  2J05 A;  4CC2 A;  2DIL A;  4F16 A;  2EYW A;  1K4U S;  2FPD A;  2EKH A;  4WCI A;  3VS2 A;  2K3B A;  4IIO A;  2D8H A;  1PKS A;  1VYV A;  2K9G A;  1T3S A;  2K2M A;  3H0F A;  1GRI A;  4M4Z A;  1I07 A;  1B3Q A;  3RBB B;  1WLP B;  1K76 A;  2YDL A;  5GJV B;  3VS4 A;  5FWB A;  1JO8 A;  5FWC A;  4RTW A;  1LCK A;  2EYZ A;  2HEQ A;  2JTE A;  1M3C A;  1UFF A;  1U06 A;  2AZS A;  4QT7 A;  1E6H A;  2MOX A;  1NYF A;  1WX6 A;  2DRK A;  3EGU A;  1V1C A;  2YUQ A;  4J9D A;  3VRZ A;  4ESR A;  1Z9Q A;  2EGC A;  1QWF A;  5L23 A;  1VYU A;  2BZX A;  1TG0 A;  2DYB A;  5GJW B;  1KIK A;  3UA7 A;  5IXF A;  2PNI A;  1ZBJ A;  4AG1 C;  3EHR A;  1MV3 A;  2LJ1 A;  3SEM A;  2KYM A;  1SPK A;  4AFQ C;  2GBQ A;  1ZX6 A;  2CH4 A;  2KXC A;  2KRS A;  3VS7 A;  1TUC A;  4JJC A;  3I9Q A;  2NWM A;  1AVZ C;  4JZ3 A;  1AZE A;  4JJD A;  4KRT A;  4DEY A;  1UHF A;  4X1V A;  2D1X A;  1WXB A;  2LNH B;  4F17 A;  2AKK A;  1YNZ A;  4Z89 A;  2BZ8 A;  1QKX A;  2DF6 A;  4HVV A;  2HBW A;  3I5S A;  1QKW A;  3VS0 A;  2SEM A;  2VVK A;  1CSK A;  2ED1 A;  3VS5 A;  4J9I A;  1RLQ C;  3I35 A;  2KNB B;  4GLM A;  2LCS A;  1MV0 B;  1PKT A;  4ZNX A;  4IIM A;  1YWP A;  2RF0 A;  1X6G A;  2DL5 A;  1E7O A;  2RQW A;  1SHF A;  4JPB W;  2EPD A;  1VA7 A;  1NEG A;  1IO6 A;  2B86 A;  2K6D A;  2BTT A;  1NYG A;  2ENM A;  2H8H A;  2GTJ A;  2KBT A;  5IHI A;  2FPF A;  1ZUY A;  1H8K A;  3UAT A;  2CUB A;  4R0K A;  1PNJ A;  2LZ6 B;  3NHN A;  1K9A A;  1CKA A;  4LNP A;  2CSQ A;  1BBZ A;  3UF4 A;  1QCF A;  1GBQ A;  1X2Q A;  1K0S A;  1ZLM A;  4FSS A;  3CQT A;  1UDL A;  2KT1 A;  5ECA A;  2KRN A;  1AZG B;  2YUO A;  2X3W D;  2DL3 A;  1J3T A;  2CT4 A;  2LP5 A;  2KE9 A;  1T0J A;  2ESW A;  1NLO C;  2F2W A;  4EIK A;  1UGV A;  2JW4 A;  2A28 A;  2OAW A;  3EG2 A;  2DBM A;  2K79 A;  1GBR A;  3VS6 A;  1E6G A;  2RQR A;  3ULR B;  2F2X A;  2GNC A;  5IH2 A;  1I0C A;  2RQT A;  1Z9Z A;  2KGT A;  1UG1 A;  1T3L A;  2DJQ A;  4RTV A;  1OPL A;  4HXJ A;  1U3O A;  1W70 A;  2M0Y A;  2JT4 A;  4AFU C;  2RPN A;  1OEB A;  4RTY A;  2CUD A;  4RTZ A;  2RQV A;  2VKN A;  1S1N A;  4RTX A;  4LUE A;  2DVJ A;  1ABQ A;  1SEM A;  1RI9 A;  2DNU A;  2KXD A;  3UA6 A;  2ECZ A;  2G6F X;  5IHN A;  3NMZ C;  2DLP A;  2W0Z A;  4OML A;  2KYB A;  2EBP A;  2I0N A;  4F14 A;  4HVU A;  1BB9 A;  1GCP A;  3I5R A;  3SHW A;  1GL5 A;  1JEG A;  1PWT A;  2AK5 A;  1M3A A;  4OMP A;  2EQI A;  1UE9 A;  1M3B A;  1WYX A;  2FO0 A;  5FW9 A;  2EGA A;  3REB B;  1UEC A;  1OV3 A;  2C0I A;  2E5K A;  1KSW A;  1GCQ C;  2V1R A;  1NEB A;  2FEI A;  4CC4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...