2B86A

Solution structure of the first src homology 3 domain of nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
b'MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Solution structure of the first SRC homology 3 domain of human nck2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2b86A00
1WYXA 1OPLA 4OMLA 2ECZA 1GFCA 2OAWA 3TVTA 3M0QA 1X6GA 4AG2C 2BTTA 1SSHA 1FYNA 2C0IA 2EGCA 1SRLA 2DBKA 3QWYA 4OMMA 1FMKA 4D8DA 3CQTA 3I35A 2EVRA 3VS7A 1UG1A 1CKAA 2CUDA 3A98A 2GTJA 2DMOA 1OPKA 1WI7A 4CC3A 1GBRA 4HXJA 2RQUA 1N5ZA 1PWTA 1MUZA 3I9QA 2D8HA 1WLPB 1AVZC 1JQQA 1WIEA 2MIOA 4RTXA 1QKXA 2O9VA 1WA7A 1I0CA 1WFWA 4RTWA 5FWCA 3H0HA 4GLMA 3UA7A 5IHKA 2HCKA 2M0YA 2LP5A 2CSQA 3VS5A 3PVLA 2DM1A 2VWFA 1KIKA 1PRMC 2RN8A 2DX1A 2E5KA 1AD5A 3VRYA 5GJVB 3H41A 2EGEA 5FW9A 1X27A 2KRMA 4IIOA 2JM9A 1PHTA 2CT3A 2LX7A 2DYBA 4AFZC 1M27C 1OOTA 2H8HA 2L0AA 2IIMA 1GBQA 4E6RA 2RQVA 1AZGB 1UTIA 2RQWA 3UATA 1WXTA 2J6FA 4J9EA 5GJWB 1UJ0A 2CDTA 2PTKA 2DF6A 2K79A 4CC4B 2K6DA 4Y92A 2YUOA 3M0UA 2VKNA 4DEYA 3NGPA 2GTOA 5ECAA 1QLYA 1G83A 1WDXA 4ZNXA 2ROTA 2AKLA 1M8MA 3R6NA 1YP5A 5IXFA 1ZUUA 1W6XA 3VS1A 2P4RA 2NUZA 4J9IA 4RTVA 1EFNA 3LH5A 2LMJA 1SRMA 1BK2A 4LNPA 2X3XD 1I1JA 1X2QA 1PRLC 2RNAA 2KBTA 1ABQA 2SRCA 1NLOC 1WXUA 4AFQC 3RBBB 4Z8AA 1XOVA 3M0TA 2J6KA 2DILA 2KYBA 3PE0A 2DLPA 1JXOA 2A08A 1S1NA 4JZ4A 1NM7A 4D8KA 1T0HA 2AZSA 1M3CA 1GCQA 2BZYA 3EHQA 4KRTA 1LCKA 1SPKA 2OI3A 1ZUYA 2I0NA 2KXCA 2D0NA 2SEMA 2EYYA 2D8JA 1UJYA 2RMOA 3TSZA 1AWXA 3ZL7C 2YUPA 5FWBA 4HVVA 3I5RA 4A63B 1U3OA 4F16A 1ARKA 1E7OA 2L3QA 2JM8A 3H0IA 1AOJA 4WCIA 2A36A 2KXDA 4OMQA 2CSIA 4F17A 5I22A 2DRKA 2JTEA 3VS2A 2CH4A 1H92A 1K1ZA 1X2KA 2DBMA 2FRWA 1BBZA 2ESWA 3VS4A 1J3TA 1VYUA 2J06A 1UHFA 2W0ZA 1YN8A 2DL7A 2JMCA 2RPNA 2OJ2A 2EPDA 1E6GA 1SHGA 3EHRA 1K4US 4ORZA 2GNCA 1MV3A 4K11A 1QWEA 2DE0X 1BU1A 2C0TA 2ED1A 2O2OA 3VS0A 4X1VA 2KE9A 2HDAA 4OMOA 2GQIA 3I5SA 1AZEA 1JEGA 1WXBA 2J7IA 2O31A 4JJBA 2LQNA 2V1RA 1ZX6A 1T0JA 2ED0A 2JT4A 1H3HA 3PVQA 2DL4A 2YSQA 1M30A 1CKBA 2FG0A 4EIKA 4RTTA 4M4ZA 1T3LA 2V1QA 1VYTA 1NYGA 1B07A 2LCSA 3FJ5A 1SEMA 4R0KA 1OV3A 1RUWA 1W70A 1X69A 2MOXA 2CREA 3VS6A 1JO8A 5I11A 2VVKA 4AFSC 1KSWA 2AKKA 1AWJA 2A37A 2JS0A 1K9AA 1WX6A 2PZ1A 2KNBB 2M51A 3IQLA 3UF4A 2A28A 1V1CA 1VA7A 4JZ3A 4OMPA 1YWOA 4LUEA 2ENMA 1QWFA 4LUDA 1YCSB 3KFVA 3M0RA 3NHNA 4J9GA 4JJCA 2KT8A 4OMNA 2AK5A 4RTZA 1QCFA 2W10A 1KFZA 4RTUA 2JMAA 1ZLMA 3NMZC 1ABOA 5IHNA 3VS3A 1RI9A 2XMFA 1UFFA 1IO6A 1U06A 2AZVA 2YUNA 2KGTA 4Z89A 1HD3A 1JU5C 1HJDA 4FSSA 1Y57A 2F2VA 2BZ8A 2KROA 2HEQA 2KR3A 2L2PA 1UUEA 4RTYA 1AWOA 1NG2A 2EYZA 2EBPA 3SEMA 1OEBA 1Z9QA 4HVUA 1AEYA 1GFDA 2JW4A 3O5ZA 2ROLA 2HSPA 2X3WD 2L3SA 2KYMA 1I07A 2EQIA 1K76A 2NWMA 2QDLA 2DVJA 3C0CA 1JXMA 4DEXA 2O88A 1AWWA 1K0SA 3ULRB 3GBQA 2RQRA 4Z88A 2L3PA 3EGUA 3EG1A 1PNJA 2HBWA 2MCNA 1GRIA 2GBQA 1QKWA 4J9FA 2K2MA 3THKA 4CC7A 4HCKA 1RLPC 1NEBA 1GCPA 4HVWA 5L23A 2FPFA 2B86A 2FPEA 2K9GA 2DJQA 1PKTA 3UA6A 5IXBA 1CSKA 2CT4A 2C0OA 2J6OA 2LJ0A 2CUBA 1HSQA 4LE9A 1UHCA 1UGVA 5IH2A 4GBQA 2LZ6B 4RUGA 1ZBJA 1Z9ZA 1YWPA 4CC2A 3TSWA 2KRSA 1UECA 4LN2A 3M0SA 1TUCA 1VYVA 2FO0A 2FEIA 4IIMA 2LJ1A 1T3SA 2CH4W 1UE9A 2KEAA 2ABLA 2F2WA 5IHIA 2DL5A 3RNJA 2RQTA 2KT1A 2RF0A 2G6FX 1Y0MA 2BZXA 3M0PA 1E6HA 2EKHA 2KRNA 2EGAA 3QWXX 3EG3A 3H0FA 2LNHB 1RLQC 1X6BA 2JXBA 1ZSGA 3SHWA 1H8KA 1NEGA 2EW3A 1KJWA 2EYXA 2YUQA 2K3BA 2YT6A 1PKSA 1M3AA 1TUDA 4ESRA 2DA9A 2LJ3A 3JV3A 4J9DA 1BB9A 4F14A 1G2BA 2J05A 2F2XA 4QT7A 5HCKA 2EYWA 1TG0A 2DL3A 1NYFA 2O9SA 3EG2A 4JPBW 4AG1C 2YDLA 2DNUA 2D1XA 2DRMA 4AFUC 1X43A 1YNZA 2FPDA 1M3BA 1W1FA 3U23A 4J9BA 1UDLA 1NLPC 4J9HA 1ZUKA 1U5SA 1SHFA 3REAB 2PNIA 1GCQC 4JJDA 2GGRA 2K7AA 3NPFA 3EG0A 1GL5A 5EC7A 4J9CA 2JS2A 1A0NB 3REBB 2FRYA 1B3QA 3VRZA 2DL8A 1MV0B 2LQWA 1K0XA
chains in the Genus database with same CATH superfamily
2WACA 4C5IA 3CEYA 2LT4A 4VUBA 1Q86R 3X28B 4PFPA 4A54A 1TUGB 4AG2C 2BTTA 3SWNC 3GP8A 1FYNA 1WHJA 4KULA 2DBKA 3V8KA 1YJWA 2QQBA 3CQTA 3VYGA 1IGQA 1U1SA 3OBWA 1C0MA 4M77D 3TEEA 1UG1A 4PJOC 1N9RA 3A98A 5CCAA 2RI5A 4CC3A 1VUBA 3EGXB 1VQ5T 4FYXB 5LJ3g 1JBMA 2DD4A 1HK9A 4C5HA 3I9QA 3M57A 2DPPB 1Q7YU 4LXCA 1UEBA 1QKXA 3OY9A 1YIJA 2O9VA 2L3RA 1G3WA 2KQWA 3EG9B 3TREA 1PC0A 3FB9A 3KBGA 2HCKA 2M0YA 4A4GA 2B8AA 2CSQA 2VWFA 3SB2A 5GMKj 1PRMC 2QGGA 2DX1A 2A0FB 5FU7C 4M7DC 2LT1A 5GJVB 2HBPA 2YRVA 2EGEA 1HYOA 3OYLA 1V76A 5CK9A 2DJZA 5D7UA 2LX7A 2DYBA 4C0GA 1M27C 1OOTA 2DYIA 3JSCA 3I55Q 2H8HA 2OTLA 1YHQT 2RQVA 3JAME 4XTZA 3NTKA 1AZGB 3JCMW 3I56Q 1KC8U 4M78E 4FL6A 2DF6A 8ATCB 3M58A 3QJ6A 1NBEB 2F5KA 3NGPA 4ZNXA 4IUUA 2GCXA 2AKLA 3X24B 3MEWA 5GAN7 1K9MU 2EQMA 3CMEQ 5DY9A 1I8FA 3HTRA 2P4RA 1EFNA 1VQOA 3LH5A 2LMJA 3CCQQ 5GAMg 3G71A 5GMKh 2X3XD 1I1JA 5CQXA 3ME9A 3MPUB 2YRDA 4C92A 3GLXA 2LCLA 3CCET 5LJ5e 4X9DA 5KYNA 5D6YA 4II1A 4ZGDB 2SRCA 1NLOC 3CCLT 2V8KA 4E7SA 3M0TA 2AIRB 2DILA 2IVWA 2DLPA 2A08A 1S1NA 5KE2A 2DTOA 1NM7A 4D8KA 1UGRB 1M5Q1 1VQ6Q 4M75C 2D0NA 3CCJT 1UJYA 3ZL7C 3GIBA 1JB0E 2EKOA 3CCRT 2EJFA 1Y7XA 4A63B 3EFOA 1VQMA 2PQWA 5GAN6 4BY6B 2HD0A 1FX7A 3CMAT 3SWNA 4EMGA 3PFSA 3G6EA 5I22A 3OYAA 1D1BA 3UDCA 4M78C 4HA8A 1H92A 1X2KA 4PJOA 1YJWQ 2ESWA 3VS4A 1WHHA 4KH1B 1UHFA 4F7UG 3HPWA 5IAYA 4MZPA 4E7IA 2RPNA 2EPDA 1SHGA 3EHRA 3EH1A 3VUBA 3OYIA 1Q81U 4K11A 2DE0X 2OAUA 1FMWA 4LDYA 4DBFA 5KCHA 2O2OA 1YIJQ 1BCOA 2HKQB 2JVVA 3QYGB 1U1TA 5CAIA 2YLCA 1WXBA 2O31A 4JJBA 2V1RA 1ZX6A 1T0JA 1H3HA 4M7DA 1PCXA 2EQKA 4EIKA 1NYGA 2EQJA 5GAOl 4J8OA 3RMQA 1X69A 1VQLT 1B34A 1WJSA 3UPUA 4FU6A 1JO8A 4AFSC 1KSWA 2LNVA 1TH7A 1Y07A 2OTLQ 2PZ1A 2E70A 4RMOA 1ACMB 1IB8A 4XU0A 2XK0A 4JZ3A 5I21A 4KGZB 1K8AR 4OMPA 2RM4A 1YWOA 3JRZA 2ENMA 5KYWB 3CC2T 1BCMA 4KBMB 2RB6A 2D0QB 3GOXA 3MJXA 3KXTA 3CXCA 2KT8A 4E2FB 4RTZA 4EDUA 1QCFA 5FRMA 1Y96B 2OX7A 1R0CB 3BY7A 3VS3A 2GFAA 2HKNA 2JUFA 1TTHB 1IO6A 1U06A 4RG2A 1Q95G 2KGTA 2JTFA 3L2UA 1VQOQ 3HHTB 4E47A 5KYYA 3SDZA 3G71Q 4C0FA 3OB9A 3GPLA 1NG2A 2EYZA 4FIBA 1D1AA 3PT9A 2QYZA 6AT1B 1GFDA 3VU3C 3CC7A 2D6FA 2E64A 2ROLA 3JB9I 2L3SA 1M9SA 1VQ9Q 4EPCA 1JXMA 2MMPA 1NJIC 4DEXA 2O88A 2VB6A 4CRIA 3MP1A 2LRQA 4C8QC 1LVKA 4M7AG 2L3PA 3EG1A 2GBQA 2QEXT 4CC7A 1JJ2S 2A3LA 3NFCA 3L2ZA 4BI8B 4M78A 3OYMA 1BI0A 2B86A 3OYJA 1H641 1YJWT 4M77B 2GQVA 3G6EQ 1OX9A 2DJQA 2QDYB 1CSKA 4RCCA 3VYHB 1Q86C 5IH2A 1PD1A 4DOWA 4ATOA 3FLGA 3RIRA 2EAYA 2YXYA 1ZBJA 1PG5B 3OW2A 1UECA 2R5AA 3GNGA 1TUCA 5CVIA 3CD6A 4IIMA 2LJ1A 2QQSA 4IUQA 4NOYA 3JB9G 1VQ8T 2F2WA 1YJ9A 2DL5A 2RQTA 5DM7R 2CP0A 2YHTA 1R0BG 3CXCS 3CC4A 1VQNT 3M0PA 2EGAA 2RHYA 3EG3A 1ZA1B 4AT1B 2X4YA 4MMLA 4IURA 1NEGA 1QW1A 2K2VA 5CO7A 2K3BA 2FZCB 2K4YA 4PJOF 1M3AA 4NS5A 4ESRA 2DA9A 3JV3A 5CKBA 1WQ7A 3S3NA 2KAFA 2F2XA 4QT7A 5HCKA 1MMDA 5LJ5g 2DAQA 1NYFA 4BE0A 3T9NA 2O9SA 3EG2A 3EH2A 1ZSZA 4YTLA 1KD1U 1PM3A 3L2VA 4C0DC 4J9BA 4LDUA 5GANf 1K73U 3E9FA 5CKDA 1UDLA 1UGSB 2DXTA 2X4WA 1VOMA 4O5VA 2ZZDA 4DBHA 4B6MA 4O6JA 5LJ3h 4E7JA 4JJDA 3DLLA 3M53A 5A0LA 5EC7A 2JS2A 3PIOA 2FRYA 5EG2A 2DL8A 1MV0B 4DA4A 1WYXA 4OMLA 2ECZA 4V2SA 3HL8A 2E65A 1X6GA 1OU8A 1SSHA 5KH6A 3DLMA 2C0IA 2M16A 3CC7Q 4OMMA 1FMKA 1M1GA 2E41A 3I35A 3OW2S 2F1LA 3CBMA 2NUTB 1CKAA 4PLIA 2QA4A 1B7TA 1WI7A 2HMAA 2K57A 1VQMT 2VASA 2O01E 1PWTA 4PFZA 2D8HA 2BKDN 1H3ZA 5KYUB 2M1HA 1AVZC 3M4GA 4BY6C 4RTXA 2MYSA 3VKIA 1I0CA 1WFWA 4KT0E 4RTWA 5FWCA 1O9SA 3JCMP 4E7KA 2MAMA 3FJPA 2V8JA 3UA7A 3UT1A 5GAOm 3G1JA 2K5FA 5IHKA 1PSFA 5LJ3f 4JS5A 3PVLA 2PVDB 1TWBA 1AD5A 1KC8R 3URGA 3VRYA 1QMCA 2QASA 2DXCA 3H41A 4PJMA 3QSUA 2KRMA 4IIOA 1IXDA 2JM9A 1PHTA 2CT3A 1S72A 4M75F 3CD6Q 1R8OB 3JCMe 2XDBA 4QW2A 4E7HA 3H6ZA 4XQ3A 5GAMh 2DXBA 1GBQA 1X6OA 4EMKA 1IZ6A 2V8IA 1W4SA 1YJ9Q 4J9EA 2K79A 3JCMX 3J81E 3CC4Q 2COWA 4Y92A 4HCBA 2YUOA 2VKNA 4A53A 4C5GA 1G83A 3R6NA 1YP5A 4IUPA 3RMSA 3VJPA 4RTVA 2WSCE 1Q82R 4LNPA 3QHSA 1K73C 3KUFA 4ELYC 1X2QA 2DO3A 4M7AB 4XTVA 4FM4B 1PRLC 2K5IA 2KBTA 2RNAA 1QVFS 3O8VA 2E12A 1BI2A 4AFQC 1D3BA 1VQ7A 5GAMf 4JRQA 2CS7A 4PJOD 3PE0A 2RHIA 2COYA 2AZSA 2VV5A 3EHQA 4KRTA 4C92G 2EYYA 3OMCA 2QG9B 4LDVA 2JOYA 4JJNK 2YUPA 2QGFB 2VYTA 1OZ2A 2RH2A 5FWBA 2FB7A 4JRIA 5GAN5 1M2VB 1ARKA 1E7OA 2L3QA 2JM8A 5J26A 3CCVT 5DLQE 4MMKA 4OMQA 4F17A 5KYXB 3VS2A 3ZFJA 4M7DD 2FRWA 2X51A 3QDFA 3GF5A 1M90R 1X75C 4XTXA 4L5GA 2QA4Q 3OYCA 5IT9E 3CCUT 2GF7A 3J80E 4BUGA 1MNDA 1N8RU 2GNCA 4CI0C 3LX7A 1BU1A 2C0TA 2ED1A 4M75E 2X4JA 1RABB 2MK5A 2HDAA 4IUVA 5GAN4 1W2BP 2GQIA 1AZEA 1JEGA 2J7IA 1GXIE 1BIAA 2JT4A 1OYXA 5GANd 4EMKB 5A2QE 4EMHA 1WHGA 2YSQA 3OS0A 2PVOB 4M77G 2AT1B 2L8DA 4M4ZA 1T3LA 5KCOA 2V1QA 4L59A 4FW1A 2LCSA 1VQPT 1SEMA 2RJFA 1BIBA 5GAOr 1M1KR 1W70A 1IHVA 1QVGS 3VS6A 2VVKA 2AKKA 1S72Q 2RA2A 4LD6A 4M7DG 2A37A 3PGGA 2M51A 3UF4A 1V1CA 4C8QF 2R5MA 3CC4T 3AT1B 2BIVA 1VQKA 1QWFA 4PJNA 2BUDA 2FVUA 3M0RA 3N5BB 3MHXA 1MMGA 4JJCA 1EX4A 2WSEE 2AK5A 2P0QA 4E7ZA 4M75D 9ATCB 4PLLA 1D3BB 2QI2A 4OMFB 1VQ4A 2WSFE 4XTYA 4PL6A 5IHNA 1RI9A 1NPPA 3LGFA 5GMKl 4Z89A 1HD3A 2DIQA 1JU5C 4OB1B 5LJ3d 2F2VA 3OYHA 2KR3A 1UGQB 2L2PA 1VQ9A 4BI3A 4M78D 2EBPA 3SEMA 5J3BA 1TSFA 3E9GA 4KH0B 1WNLA 2QQ9A 3JB9H 1AEYA 5LJ5j 3RKXA 1VQ7Q 3LWHA 2JW4A 1C6VX 1I07A 3RKYA 3MEVA 5A0DA 1K76A 3V8JA 2DVJA 2HNIA 4IKFA 1AWWA 1NJIU 1SG5A 3GBQA 1WGSA 2RQRA 3HRTA 4Z88A 2RD1A 3OYBA 1PNJA 4N0AC 2MCNA 1FWZA 3MEUA 2PVGB 4PJLA 4P5NA 2M9UA 2RJCA 4UC4A 3S6WA 2FPEA 1RACB 3V8LA 5IXBA 2RJEA 1N8RC 3P8HA 3AHUA 2CUBA 1UGVA 1Q86U 4QKUA 1RAHB 1YI2A 2HAXA 4DOVA 3EGDA 1Z9ZA 4M78G 4CC2A 2RK2A 2KRSA 2JN0A 4TVRA 4WF2A 3JCMg 2F69A 2FO0A 1OI1A 3OYEA 4JLIA 1W2BA 5LJ5h 4J7IA 3JCMc 2CGHA 3TCJA 2E5QA 3NTIA 3I55T 2KEAA 2AHJB 3SD4A 5IHIA 5GAMd 3BW1A 2G6FX 3M56A 2BZXA 3PMIA 4C8QE 2KSSA 2CZ6B 4OB2B 2Y4YA 2ZPFB 4X9CA 3I56T 1RLQC 4PNOA 1H8KA 4R56A 1KJWA 2EYXA 3F70A 5CQYA 2FYKA 2YT6A 2H3JA 2RK1A 4OGEA 1PKSA 3L1AA 2NLUA 5CKHA 4C92B 1F1BB 4IUTA 3CMET 3PMTA 3JCMJ 2DL3A 2ZGWA 3E19A 2XDDA 5LL6S 1N6AA 2QTXA 3CCQT 1EIFA 1VQKQ 4KUIA 4MZMA 2DNUA 4HCZA 1KHIA 2DRMA 4AFUC 1X43A 2FPDA 3L42A 7AT1B 2HSEB 2E4HA 3OS1A 3V7SA 1QP3A 1EZZB 3EFRA 1OU9A 1VQ4Q 3EFOB 4C8QD 1SHFA 3REAB 2PNIA 1GCQC 2Y90A 2GGRA 2CP6A 1VQ6T 3SWNB 4M75A 2Z0WA 1WJRA 1A0NB 2HL3A 3VRZA 2DTHA 4M7AC 1Q82C 2CP5A 4PJOB 1OPLA 4XAXB 1VQ7T 4JRKA 1GFCA 3TVTA 3M0QA 2BE9B 4N4HA 3S3OA 1LNXA 4J5YA 5AT1B 2EGCA 3QWYA 4D8DA 1VQ5A 5L8RE 1G3TA 4A4FA 2ZPEB 2DK3A 1N9SA 1OPKA 3E1SA 2DEQA 1BI3A 3M55A 2O4XA 2LVMA 2E6ZA 1WLPB 1WPYA 3WVDB 2ZAEA 5FU7B 3LYIA 4M7DB 1WA7A 3FIFA 5CR2A 4FYYB 2IPOB 1YIJT 3WXMB 2LP5A 3VS5A 1MGQA 1KIKA 2DM1A 2MF2A 4XTWA 2CZ0B 1MNEA 2XKOC 3V7CA 1YI2Q 1B34B 1G3YA 1D0YA 5A0GA 2V26A 5FW9A 2G3RA 1D0ZA 2DVEA 1M90C 4A4EA 1PD0A 4BE2A 2L89A 4AFZC 2X35A 2QQRA 5CKFA 2L0AA 2IIMA 4E6RA 1UTIA 3X20B 2RQWA 2C06A 3UATA 2COZA 2J6FA 2RI2A 2OTLT 3E2UA 1UJ0A 4D6WA 2PTKA 2DZ9A 4ZTFA 1NE8A 3DKMA 2K6DA 2QTVA 3M0UA 2EFIA 3QZ9B 4DEYA 2GTOA 5ECAA 3RERA 1QLYA 2ROTA 3FDRA 5KYYB 5GAOq 4C5EA 5M9OA 4B9XA 3M59A 1ZUUA 3MO8A 1W6XA 3VS1A 4J9IA 4QQGA 1M1KC 2HL5C 3CCEA 1SRMA 1VQKT 4RCBA 1M1FA 3CCLA 5GAOp 1VQOT 1ABQA 3G71T 3RKWA 1YITA 1K8AU 5D6XA 1M2OA 4M77F 3RBBB 4Z8AA 4OB0B 2J6KA 2KYBA 4JZ4A 1JXOA 3BDLA 3ER0A 4XU3A 4LDXA 3HP9A 1ZBXA 1GCQA 2BZYA 4QVDA 1LCKA 1SPKA 3QXEB 1ZUYA 3CCRA 2I0NA 4DQ2A 3D7SB 2D8JA 2KY9A 2RMOA 4ZGJB 1Q7YR 3TSZA 2CP2A 1ZQ1A 1MHNA 4M78B 4ZN1A 5GAN3 3CMAA 1VQ9T 4HVVA 4HT9A 3HKSA 4F16A 3H0IA 2EQUA 2NUPA 3OSVA 2PUKB 4WCIA 3PNWC 4C8QA 2KXDA 1WQWA 1YCYA 2CSIA 4GLKA 2JTEA 2LQKA 3LGLA 1M8VA 3OBYA 2CH4A 4JDSA 2DBMA 2EJ9A 3G6ET 4R55A 1VQ5Q 4FYVB 3X25B 1VYUA 2J06A 3OA6A 1OULA 2L5QA 3HRUA 3P8BB 4Y91A 2DL7A 1E6GA 2BE7D 1K4US 2HQXA 4ORZA 1MV3A 1QWEA 2E6NA 2LQ8A 5C6SA 3VS0A 4X1VA 2KE9A 5D6WA 4J6XA 4OMOA 5LJ5d 2CP3A 4ELZC 2MPXC 3A8GB 1WHKA 3PTAA 2DL4A 3EG9A 1M30A 1CKBA 4RTTA 1K9MR 3SFMA 1I5OB 1VYTA 1N27A 4R0KA 4MZTA 1OV3A 1RL2A 3L2WA 1RUWA 1HXDA 4OP0A 2R57A 2VC8A 1WX6A 2KNBB 3CC2A 4HCCA 4F7UF 3IQLA 3LLRA 1ZSZB 3V7RA 8AT1B 1VA7A 2XU8A 1RAEB 2DIGA 4LUEA 3OYKA 5GMKi 1TU0B 4LUDA 1YCSB 3KFVA 4J9GA 1C1AA 4J7FA 3PIPA 2OTJA 1G8XA 4RTUA 1G3SA 3FEOA 4M77E 1ZLMA 5GANg 2FZGB 2Y4XA 1ABOA 1K8AC 2XMFA 3QZ5B 3CCSA 1I81A 2ATCB 4C92C 2MWPA 4N4IA 2YUNA 2VGNA 4XK8E 4J83A 5GAN8 3CCEQ 4AMCA 3A1PA 3CCLQ 1Y57A 3DB4A 1AWOA 4RTYA 5CIUA 3BE3A 5FLXE 1YITQ 1OEBA 4F04B 2M02A 2X3WD 2IG0A 2ZPHB 4ANJA 2KYMA 3CPWP 2PU9B 2QDLA 3C0CA 3CC7T 3CCRQ 4ZN3A 3JCMh 1TS9A 1Q81R 3INZA 2QEXA 4JLGA 3ULRB 3CMAQ 3EGUA 1U8RA 2XIDA 1JRIA 1GRIA 1QKWA 1NEBA 2MI6A 4HVWA 5L23A 2R58A 1RI0A 5GMKe 3UA6A 2C0OA 2CT4A 3Q1JA 2LJ0A 4PK4A 4PJOG 3VUZA 2KK4A 4LD9K 4M77C 1XQHA 2FEIA 1QCNA 2XDPA 1IREB 2JJ9A 1JJ2P 1VQ8A 3EAEA 2QXFA 3UWNA 1DJ7B 2RO0A 1SSFA 2CP7A 1VQNA 1UE9A 3CD6T 3RNJA 3JCMf 1QVPA 3MEAA 2KT1A 4F7UE 3C4SA 4M7AF 4JRPA 3QWXX 2EKHA 1YJ9T 2H3EB 2EJGA 3H0FA 2LNHB 3BDUA 3SHWA 1VQLQ 3JCMV 4ZTJA 2YUQA 2D9TA 4ZGEB 2LC4A 5IN1A 2LCCA 1TUDA 3J7AF 2LJ3A 4J9DA 4F14A 1G2BA 2J05A 3OYDA 3CC2Q 3M4YA 2LTOA 1MMAA 2EYWA 4FYWB 1TG0A 4C0DB 4JS4A 2E10A 4JPBW 3JB9J 3CXCP 2YDLA 4Q5WA 3OYNA 1I4K1 3JCMb 1M3BA 1SF9A 2DETA 2P0KA 5KYWA 3JB9F 3U23A 2FZKB 2OTJQ 2X4XA 2HQEA 1VIEA 3A8LB 1NLPC 4KUDK 3OS2A 4J9HA 5FU6B 1ZUKA 3OYYA 5FRNA 1XTDA 2CYZB 5C0MA 3CCSQ 1Y96A 4XU2A 3L2RA 1WHLA 2K7AA 3LW5E 3EG0A 3DB3A 3MCAB 4J9CA 2K3XA 2LQWA 1YITT 3OMGA 1Q82U 4BI4A 2OAWA 3QO3A 4WTOB 1IGUA 3M9QA 3CPWA 5HK0A 4BDYA 1SRLA 4M75G 2EVRA 3VS7A 2JZ2A 5HKCA 2CUDA 3OYGA 2GTJA 2DMOA 4NL2A 5GAN2 1GBRA 4HXJA 3A8OB 2QEXQ 1D09B 2RQUA 1N5ZA 3CCMA 1MUZA 2QA4T 3CBPA 3QUIA 1Q7YC 1QQJA 1OQKA 1JQQA 1WIEA 2MIOA 3OSSC 1SKUB 3H0HA 4GLMA 4MDWA 3LWIA 3QPHA 3JCMQ 3OW2P 2RN8A 3MP6A 4M77A 2QK0A 2E5KA 1RADB 1LOJA 4M7AE 4OVAA 1I5LA 2VXEA 1IHWA 1X27A 1JJ2A 1FXXA 1M90U 2VXFA 4B9WA 2EYQA 2YRCA 3EFSA 1VQ8Q 4OGCA 2KDSA 1TOVA 3CPFA 5HK3A 2DXUA 1S72T 3WVEB 3X26B 1WXTA 1VQNQ 3C12A 2EIFA 1KD1R 5GJWB 1KC8C 2E3IA 2CDTA 5J39A 4CC4B 1K73R 3G4SA 3ZBDA 2ZPGB 5DLOA 1WHMA 3R6OA 4X34A 1WDXA 1YJNA 2K3YA 1M8MA 2LX9A 5IXFA 2E3HA 1K9MC 2P84A 2FL7A 2XG8D 2NUZA 2CZ7B 2GFUA 5LJ5f 1M1KU 3MP8A 1BK2A 1ZSZC 4M7AD 3TQ7P 4FT2A 2ZPBB 2K5LA 1UGPB 3HSBA 3CBOA 4KGVB 4C0ZA 3BFMA 4QQDA 5HY6A 3CPWS 2OTJT 5GANe 1WXUA 2RI3A 4J6YA 1OZ3A 4ME7A 1XOVA 2DKGA 1WJQA 1T0HA 3CCST 5I2MA 1M3CA 2CKKA 1RAGB 1AHJB 2OI3A 2KXCA 1QCOA 2SEMA 2PUOB 4LDWA 1AWXA 2ZPIB 3G7ZA 1KQSP 2MWOA 3MKDA 3OQ5A 3CCVA 2VGMA 3M5AA 4OB3B 3I5RA 4KGXB 3JCMd 1U3OA 1AT1B 1KHCA 5GANj 1LJOA 1QVFP 2P0PA 4F7UA 1AOJA 3JB9D 2A36A 3H9NA 2NYSA 4N0AA 1O75A 3META 2DRKA 2X9HA 1RAFB 1W2BS 1K1ZA 4NL3A 3EGDB 1BBZA 3M54A 1VQMQ 3CCUA 4A4KA 1J3TA 1D1CA 1NZ9A 2DEUA 1G5VA 1LPLA 2HZYA 4C8QG 2W0ZA 1YN8A 2JMCA 5FROA 2OJ2A 2RHZA 2NUTA 3CCMQ 3RUXA 1Q81C 1M4ZA 2XICA 5LJ3e 4BD3A 2EWNA 4C92F 4QVCA 2F5TX 4JUVA 3A8MB 3I5SA 5CKEA 5KYUA 1YHQA 2LQNA 2ED0A 3C95A 3PVQA 3LH0A 1VQPA 4Y28E 3QG1A 2FG0A 1OX8A 2DD5A 4DBQA 4A4HA 3RESA 1B07A 5GANh 1UB4A 2RHXA 2E1HA 3FJ5A 5LJ3j 3NTHA 2MOXA 2CREA 5I11A 2RJDA 4EMKC 3ASKA 4FCYA 1AWJA 3HFNA 5KE3A 2KI7A 2JS0A 5GMKm 1K9AA 2A28A 3QJYA 3QIIA 1D0XA 3NHNA 1YBYA 3G4SQ 4BB7A 4OMNA 3QKJA 2W10A 1KFZA 4XTUA 1QVGP 4Z02A 2JMAA 3A8HB 3NMZC 1KQ1A 1YJNQ 4M75B 4N4GA 2XD0A 4FW2A 4OF1A 1UFFA 3FC3A 3HRSA 2AZVA 4XU1A 3OYFA 2XI9A 3CCJA 1VQ4T 1XNIA 1IRXA 1HJDA 4FSSA 3A5ZB 4QQ6A 2KROA 2BZ8A 2HEQA 3RDVA 1ZA2B 3P8DA 1UUEA 5GAMe 4M7DF 1Z9QA 4HVUA 2YWWA 4F7UB 4M7AA 3O5ZA 3QYHB 2HSPA 1R77A 3OS5A 4PFOA 1ZHIA 2EQIA 1KQSA 2O4XB 2NWMA 2QAZA 5FU6C 4FT4A 1RAIB 1N8RR 1K0SA 1BI1A 5GAMj 2CZ1B 1QVFA 3CCVQ 1QP2A 3TU4K 2HBWA 1Y71A 4J9FA 2JNGA 2YLBA 4BDZA 2K2MA 3THKA 4HCKA 1RLPC 1GCPA 2FPFA 2K9GA 1RAAB 3L2QA 1M2VA 1PKTA 4C92E 2J6OA 1PSEA 1HSQA 2VUBA 1UHCA 4LE9A 4GBQA 2RHUA 3EGXA 2LZ6B 4GY5A 4QVZA 5KYXA 3CCUQ 4RUGA 3CCMT 1YWPA 3TSWA 4RKUE 1YI2T 4LN2A 3M0SA 1VYVA 2A7YA 5I2SA 3I55A 3C94A 1BKBA 4HT8A 1VQLA 1MMNA 1T3SA 2DZCA 2CH4W 2ABLA 3HFOA 2ZCFB 3I56A 1YHQQ 3GNFB 2DFUA 2RF0A 3S3MA 1Y0MA 3ZEHA 1E6HA 2KRNA 2M0OA 4BACA 1VQPQ 1X6BA 2JXBA 1ZSGA 1VIFA 2DTIA 3QBYA 4PJOE 2EW3A 1BYMA 4MDXA 4E7LA 1X01A 2P4TA 1XJWB 4C92D 3CMEA 1FMVA 3FRNA 2FHDA 1BB9A 3CCQA 4M78F 1NPRA 1KK7A 1V29B 1TXQA 4J6WA 4AG1C 1KQ2A 4HKEA 3G4ST 3H8ZA 1KG1A 1WZOA 2XHCA 2KVQG 2D1XA 1YNZA 2KMTA 1KD1C 3QDRB 1QVGA 1W1FA 4PKCC 1YJNT 2JTMA 4BE1A 1KQSS 4M7DE 1NJIR 2LDMA 2HQHA 1VQ6A 2I2LA 3RR6A 5AYFA 1U5SA 1P92A 3VV0A 1YFNA 2NUPB 3NPFA 4C8QB 1GL5A 3CCJQ 4L6V5 2DERA 4PJJA 4FSXA 3REBB 4RG8A 1B3QA 4DBRA 1K0XA 2QQAA 5GAOn
chains in the Genus database with same CATH topology
1WYXA 1OPLA 4OMLA 2ECZA 1GFCA 2OAWA 3TVTA 3M0QA 1X6GA 4AG2C 2BTTA 1SSHA 1FYNA 2C0IA 2EGCA 1SRLA 2DBKA 3QWYA 4OMMA 1FMKA 4D8DA 3CQTA 3I35A 2EVRA 3VS7A 1UG1A 1CKAA 2CUDA 3A98A 2GTJA 2DMOA 1OPKA 1WI7A 4CC3A 1GBRA 4HXJA 2RQUA 1N5ZA 1PWTA 1MUZA 3I9QA 2D8HA 1WLPB 1AVZC 1JQQA 1WIEA 2MIOA 4RTXA 1QKXA 2O9VA 1WA7A 1I0CA 1WFWA 4RTWA 5FWCA 3H0HA 4GLMA 3UA7A 5IHKA 2HCKA 2M0YA 2LP5A 2CSQA 3VS5A 3PVLA 2DM1A 2VWFA 1KIKA 1PRMC 2RN8A 2DX1A 2E5KA 1AD5A 3VRYA 5GJVB 3H41A 2EGEA 5FW9A 1X27A 2KRMA 4IIOA 2JM9A 1PHTA 2CT3A 2LX7A 2DYBA 4AFZC 1M27C 1OOTA 2H8HA 2L0AA 2IIMA 1GBQA 4E6RA 2RQVA 1AZGB 1UTIA 2RQWA 3UATA 1WXTA 2J6FA 4J9EA 5GJWB 1UJ0A 2CDTA 2PTKA 2DF6A 2K79A 4CC4B 2K6DA 4Y92A 2YUOA 3M0UA 2VKNA 4DEYA 3NGPA 2GTOA 5ECAA 1QLYA 1G83A 1WDXA 4ZNXA 2ROTA 2AKLA 1M8MA 3R6NA 1YP5A 5IXFA 1ZUUA 1W6XA 3VS1A 2P4RA 2NUZA 4J9IA 4RTVA 1EFNA 3LH5A 2LMJA 1SRMA 1BK2A 4LNPA 2X3XD 1I1JA 1X2QA 1PRLC 2RNAA 2KBTA 1ABQA 2SRCA 1NLOC 1WXUA 4AFQC 3RBBB 4Z8AA 1XOVA 3M0TA 2J6KA 2DILA 2KYBA 3PE0A 2DLPA 1JXOA 2A08A 1S1NA 4JZ4A 1NM7A 4D8KA 1T0HA 2AZSA 1M3CA 1GCQA 2BZYA 3EHQA 4KRTA 1LCKA 1SPKA 2OI3A 1ZUYA 2I0NA 2KXCA 2D0NA 2SEMA 2EYYA 2D8JA 1UJYA 2RMOA 3TSZA 1AWXA 3ZL7C 2YUPA 5FWBA 4HVVA 3I5RA 4A63B 1U3OA 4F16A 1ARKA 1E7OA 2L3QA 2JM8A 3H0IA 1AOJA 4WCIA 2A36A 2KXDA 4OMQA 2CSIA 4F17A 5I22A 2DRKA 2JTEA 3VS2A 2CH4A 1H92A 1K1ZA 1X2KA 2DBMA 2FRWA 1BBZA 2ESWA 3VS4A 1J3TA 1VYUA 2J06A 1UHFA 2W0ZA 1YN8A 2DL7A 2JMCA 2RPNA 2OJ2A 2EPDA 1E6GA 1SHGA 3EHRA 1K4US 4ORZA 2GNCA 1MV3A 4K11A 1QWEA 2DE0X 1BU1A 2C0TA 2ED1A 2O2OA 3VS0A 4X1VA 2KE9A 2HDAA 4OMOA 2GQIA 3I5SA 1AZEA 1JEGA 1WXBA 2J7IA 2O31A 4JJBA 2LQNA 2V1RA 1ZX6A 1T0JA 2ED0A 2JT4A 1H3HA 3PVQA 2DL4A 2YSQA 1M30A 1CKBA 2FG0A 4EIKA 4RTTA 4M4ZA 1T3LA 2V1QA 1VYTA 1NYGA 1B07A 2LCSA 3FJ5A 1SEMA 4R0KA 1OV3A 1RUWA 1W70A 1X69A 2MOXA 2CREA 3VS6A 1JO8A 5I11A 2VVKA 4AFSC 1KSWA 2AKKA 1AWJA 2A37A 2JS0A 1K9AA 1WX6A 2PZ1A 2KNBB 2M51A 3IQLA 3UF4A 2A28A 1V1CA 1VA7A 4JZ3A 4OMPA 1YWOA 4LUEA 2ENMA 1QWFA 4LUDA 1YCSB 3KFVA 3M0RA 3NHNA 4J9GA 4JJCA 2KT8A 4OMNA 2AK5A 4RTZA 1QCFA 2W10A 1KFZA 4RTUA 2JMAA 1ZLMA 3NMZC 1ABOA 5IHNA 3VS3A 1RI9A 2XMFA 1UFFA 1IO6A 1U06A 2AZVA 2YUNA 2KGTA 4Z89A 1HD3A 1JU5C 1HJDA 4FSSA 1Y57A 2F2VA 2BZ8A 2KROA 2HEQA 2KR3A 2L2PA 1UUEA 4RTYA 1AWOA 1NG2A 2EYZA 2EBPA 3SEMA 1OEBA 1Z9QA 4HVUA 1AEYA 1GFDA 2JW4A 3O5ZA 2ROLA 2HSPA 2X3WD 2L3SA 2KYMA 1I07A 2EQIA 1K76A 2NWMA 2QDLA 2DVJA 3C0CA 1JXMA 4DEXA 2O88A 1AWWA 1K0SA 3ULRB 3GBQA 2RQRA 4Z88A 2L3PA 3EGUA 3EG1A 1PNJA 2HBWA 2MCNA 1GRIA 2GBQA 1QKWA 4J9FA 2K2MA 3THKA 4CC7A 4HCKA 1RLPC 1NEBA 1GCPA 4HVWA 5L23A 2FPFA 2B86A 2FPEA 2K9GA 2DJQA 1PKTA 3UA6A 5IXBA 1CSKA 2CT4A 2C0OA 2J6OA 2LJ0A 2CUBA 1HSQA 4LE9A 1UHCA 1UGVA 5IH2A 4GBQA 2LZ6B 4RUGA 1ZBJA 1Z9ZA 1YWPA 4CC2A 3TSWA 2KRSA 1UECA 4LN2A 3M0SA 1TUCA 1VYVA 2FO0A 2FEIA 4IIMA 2LJ1A 1T3SA 2CH4W 1UE9A 2KEAA 2ABLA 2F2WA 5IHIA 2DL5A 3RNJA 2RQTA 2KT1A 2RF0A 2G6FX 1Y0MA 2BZXA 3M0PA 1E6HA 2EKHA 2KRNA 2EGAA 3QWXX 3EG3A 3H0FA 2LNHB 1RLQC 1X6BA 2JXBA 1ZSGA 3SHWA 1H8KA 1NEGA 2EW3A 1KJWA 2EYXA 2YUQA 2K3BA 2YT6A 1PKSA 1M3AA 1TUDA 4ESRA 2DA9A 2LJ3A 3JV3A 4J9DA 1BB9A 4F14A 1G2BA 2J05A 2F2XA 4QT7A 5HCKA 2EYWA 1TG0A 2DL3A 1NYFA 2O9SA 3EG2A 4JPBW 4AG1C 2YDLA 2DNUA 2D1XA 2DRMA 4AFUC 1X43A 1YNZA 2FPDA 1M3BA 1W1FA 3U23A 4J9BA 1UDLA 1NLPC 4J9HA 1ZUKA 1U5SA 1SHFA 3REAB 2PNIA 1GCQC 4JJDA 2GGRA 2K7AA 3NPFA 3EG0A 1GL5A 5EC7A 4J9CA 2JS2A 1A0NB 3REBB 2FRYA 1B3QA 3VRZA 2DL8A 1MV0B 2LQWA 1K0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYX A;  1OPL A;  4OML A;  2ECZ A;  1GFC A;  2OAW A;  3TVT A;  3M0Q A;  1X6G A;  4AG2 C;  2BTT A;  1SSH A;  1FYN A;  2C0I A;  2EGC A;  1SRL A;  2DBK A;  3QWY A;  4OMM A;  1FMK A;  4D8D A;  3CQT A;  3I35 A;  2EVR A;  3VS7 A;  1UG1 A;  1CKA A;  2CUD A;  3A98 A;  2GTJ A;  2DMO A;  1OPK A;  1WI7 A;  4CC3 A;  1GBR A;  4HXJ A;  2RQU A;  1N5Z A;  1PWT A;  1MUZ A;  3I9Q A;  2D8H A;  1WLP B;  1AVZ C;  1JQQ A;  1WIE A;  2MIO A;  4RTX A;  1QKX A;  2O9V A;  1WA7 A;  1I0C A;  1WFW A;  4RTW A;  5FWC A;  3H0H A;  4GLM A;  3UA7 A;  5IHK A;  2HCK A;  2M0Y A;  2LP5 A;  2CSQ A;  3VS5 A;  3PVL A;  2DM1 A;  2VWF A;  1KIK A;  1PRM C;  2RN8 A;  2DX1 A;  2E5K A;  1AD5 A;  3VRY A;  5GJV B;  3H41 A;  2EGE A;  5FW9 A;  1X27 A;  2KRM A;  4IIO A;  2JM9 A;  1PHT A;  2CT3 A;  2LX7 A;  2DYB A;  4AFZ C;  1M27 C;  1OOT A;  2H8H A;  2L0A A;  2IIM A;  1GBQ A;  4E6R A;  2RQV A;  1AZG B;  1UTI A;  2RQW A;  3UAT A;  1WXT A;  2J6F A;  4J9E A;  5GJW B;  1UJ0 A;  2CDT A;  2PTK A;  2DF6 A;  2K79 A;  4CC4 B;  2K6D A;  4Y92 A;  2YUO A;  3M0U A;  2VKN A;  4DEY A;  3NGP A;  2GTO A;  5ECA A;  1QLY A;  1G83 A;  1WDX A;  4ZNX A;  2ROT A;  2AKL A;  1M8M A;  3R6N A;  1YP5 A;  5IXF A;  1ZUU A;  1W6X A;  3VS1 A;  2P4R A;  2NUZ A;  4J9I A;  4RTV A;  1EFN A;  3LH5 A;  2LMJ A;  1SRM A;  1BK2 A;  4LNP A;  2X3X D;  1I1J A;  1X2Q A;  1PRL C;  2RNA A;  2KBT A;  1ABQ A;  2SRC A;  1NLO C;  1WXU A;  4AFQ C;  3RBB B;  4Z8A A;  1XOV A;  3M0T A;  2J6K A;  2DIL A;  2KYB A;  3PE0 A;  2DLP A;  1JXO A;  2A08 A;  1S1N A;  4JZ4 A;  1NM7 A;  4D8K A;  1T0H A;  2AZS A;  1M3C A;  1GCQ A;  2BZY A;  3EHQ A;  4KRT A;  1LCK A;  1SPK A;  2OI3 A;  1ZUY A;  2I0N A;  2KXC A;  2D0N A;  2SEM A;  2EYY A;  2D8J A;  1UJY A;  2RMO A;  3TSZ A;  1AWX A;  3ZL7 C;  2YUP A;  5FWB A;  4HVV A;  3I5R A;  4A63 B;  1U3O A;  4F16 A;  1ARK A;  1E7O A;  2L3Q A;  2JM8 A;  3H0I A;  1AOJ A;  4WCI A;  2A36 A;  2KXD A;  4OMQ A;  2CSI A;  4F17 A;  5I22 A;  2DRK A;  2JTE A;  3VS2 A;  2CH4 A;  1H92 A;  1K1Z A;  1X2K A;  2DBM A;  2FRW A;  1BBZ A;  2ESW A;  3VS4 A;  1J3T A;  1VYU A;  2J06 A;  1UHF A;  2W0Z A;  1YN8 A;  2DL7 A;  2JMC A;  2RPN A;  2OJ2 A;  2EPD A;  1E6G A;  1SHG A;  3EHR A;  1K4U S;  4ORZ A;  2GNC A;  1MV3 A;  4K11 A;  1QWE A;  2DE0 X;  1BU1 A;  2C0T A;  2ED1 A;  2O2O A;  3VS0 A;  4X1V A;  2KE9 A;  2HDA A;  4OMO A;  2GQI A;  3I5S A;  1AZE A;  1JEG A;  1WXB A;  2J7I A;  2O31 A;  4JJB A;  2LQN A;  2V1R A;  1ZX6 A;  1T0J A;  2ED0 A;  2JT4 A;  1H3H A;  3PVQ A;  2DL4 A;  2YSQ A;  1M30 A;  1CKB A;  2FG0 A;  4EIK A;  4RTT A;  4M4Z A;  1T3L A;  2V1Q A;  1VYT A;  1NYG A;  1B07 A;  2LCS A;  3FJ5 A;  1SEM A;  4R0K A;  1OV3 A;  1RUW A;  1W70 A;  1X69 A;  2MOX A;  2CRE A;  3VS6 A;  1JO8 A;  5I11 A;  2VVK A;  4AFS C;  1KSW A;  2AKK A;  1AWJ A;  2A37 A;  2JS0 A;  1K9A A;  1WX6 A;  2PZ1 A;  2KNB B;  2M51 A;  3IQL A;  3UF4 A;  2A28 A;  1V1C A;  1VA7 A;  4JZ3 A;  4OMP A;  1YWO A;  4LUE A;  2ENM A;  1QWF A;  4LUD A;  1YCS B;  3KFV A;  3M0R A;  3NHN A;  4J9G A;  4JJC A;  2KT8 A;  4OMN A;  2AK5 A;  4RTZ A;  1QCF A;  2W10 A;  1KFZ A;  4RTU A;  2JMA A;  1ZLM A;  3NMZ C;  1ABO A;  5IHN A;  3VS3 A;  1RI9 A;  2XMF A;  1UFF A;  1IO6 A;  1U06 A;  2AZV A;  2YUN A;  2KGT A;  4Z89 A;  1HD3 A;  1JU5 C;  1HJD A;  4FSS A;  1Y57 A;  2F2V A;  2BZ8 A;  2KRO A;  2HEQ A;  2KR3 A;  2L2P A;  1UUE A;  4RTY A;  1AWO A;  1NG2 A;  2EYZ A;  2EBP A;  3SEM A;  1OEB A;  1Z9Q A;  4HVU A;  1AEY A;  1GFD A;  2JW4 A;  3O5Z A;  2ROL A;  2HSP A;  2X3W D;  2L3S A;  2KYM A;  1I07 A;  2EQI A;  1K76 A;  2NWM A;  2QDL A;  2DVJ A;  3C0C A;  1JXM A;  4DEX A;  2O88 A;  1AWW A;  1K0S A;  3ULR B;  3GBQ A;  2RQR A;  4Z88 A;  2L3P A;  3EGU A;  3EG1 A;  1PNJ A;  2HBW A;  2MCN A;  1GRI A;  2GBQ A;  1QKW A;  4J9F A;  2K2M A;  3THK A;  4CC7 A;  4HCK A;  1RLP C;  1NEB A;  1GCP A;  4HVW A;  5L23 A;  2FPF A;  2B86 A;  2FPE A;  2K9G A;  2DJQ A;  1PKT A;  3UA6 A;  5IXB A;  1CSK A;  2CT4 A;  2C0O A;  2J6O A;  2LJ0 A;  2CUB A;  1HSQ A;  4LE9 A;  1UHC A;  1UGV A;  5IH2 A;  4GBQ A;  2LZ6 B;  4RUG A;  1ZBJ A;  1Z9Z A;  1YWP A;  4CC2 A;  3TSW A;  2KRS A;  1UEC A;  4LN2 A;  3M0S A;  1TUC A;  1VYV A;  2FO0 A;  2FEI A;  4IIM A;  2LJ1 A;  1T3S A;  2CH4 W;  1UE9 A;  2KEA A;  2ABL A;  2F2W A;  5IHI A;  2DL5 A;  3RNJ A;  2RQT A;  2KT1 A;  2RF0 A;  2G6F X;  1Y0M A;  2BZX A;  3M0P A;  1E6H A;  2EKH A;  2KRN A;  2EGA A;  3QWX X;  3EG3 A;  3H0F A;  2LNH B;  1RLQ C;  1X6B A;  2JXB A;  1ZSG A;  3SHW A;  1H8K A;  1NEG A;  2EW3 A;  1KJW A;  2EYX A;  2YUQ A;  2K3B A;  2YT6 A;  1PKS A;  1M3A A;  1TUD A;  4ESR A;  2DA9 A;  2LJ3 A;  3JV3 A;  4J9D A;  1BB9 A;  4F14 A;  1G2B A;  2J05 A;  2F2X A;  4QT7 A;  5HCK A;  2EYW A;  1TG0 A;  2DL3 A;  1NYF A;  2O9S A;  3EG2 A;  4JPB W;  4AG1 C;  2YDL A;  2DNU A;  2D1X A;  2DRM A;  4AFU C;  1X43 A;  1YNZ A;  2FPD A;  1M3B A;  1W1F A;  3U23 A;  4J9B A;  1UDL A;  1NLP C;  4J9H A;  1ZUK A;  1U5S A;  1SHF A;  3REA B;  2PNI A;  1GCQ C;  4JJD A;  2GGR A;  2K7A A;  3NPF A;  3EG0 A;  1GL5 A;  5EC7 A;  4J9C A;  2JS2 A;  1A0N B;  3REB B;  2FRY A;  1B3Q A;  3VRZ A;  2DL8 A;  1MV0 B;  2LQW A;  1K0X A; 
#chains in the Genus database with same CATH topology
 2WAC A;  4C5I A;  3CEY A;  2LT4 A;  4VUB A;  1Q86 R;  3X28 B;  4PFP A;  4A54 A;  1TUG B;  4AG2 C;  2BTT A;  3SWN C;  3GP8 A;  1FYN A;  1WHJ A;  4KUL A;  2DBK A;  3V8K A;  1YJW A;  2QQB A;  3CQT A;  3VYG A;  1IGQ A;  1U1S A;  3OBW A;  1C0M A;  4M77 D;  3TEE A;  1UG1 A;  4PJO C;  1N9R A;  3A98 A;  5CCA A;  2RI5 A;  4CC3 A;  1VUB A;  3EGX B;  1VQ5 T;  4FYX B;  5LJ3 g;  1JBM A;  2DD4 A;  1HK9 A;  4C5H A;  3I9Q A;  3M57 A;  2DPP B;  1Q7Y U;  4LXC A;  1UEB A;  1QKX A;  3OY9 A;  1YIJ A;  2O9V A;  2L3R A;  1G3W A;  2KQW A;  3EG9 B;  3TRE A;  1PC0 A;  3FB9 A;  3KBG A;  2HCK A;  2M0Y A;  4A4G A;  2B8A A;  2CSQ A;  2VWF A;  3SB2 A;  5GMK j;  1PRM C;  2QGG A;  2DX1 A;  2A0F B;  5FU7 C;  4M7D C;  2LT1 A;  5GJV B;  2HBP A;  2YRV A;  2EGE A;  1HYO A;  3OYL A;  1V76 A;  5CK9 A;  2DJZ A;  5D7U A;  2LX7 A;  2DYB A;  4C0G A;  1M27 C;  1OOT A;  2DYI A;  3JSC A;  3I55 Q;  2H8H A;  2OTL A;  1YHQ T;  2RQV A;  3JAM E;  4XTZ A;  3NTK A;  1AZG B;  3JCM W;  3I56 Q;  1KC8 U;  4M78 E;  4FL6 A;  2DF6 A;  8ATC B;  3M58 A;  3QJ6 A;  1NBE B;  2F5K A;  3NGP A;  4ZNX A;  4IUU A;  2GCX A;  2AKL A;  3X24 B;  3MEW A;  5GAN 7;  1K9M U;  2EQM A;  3CME Q;  5DY9 A;  1I8F A;  3HTR A;  2P4R A;  1EFN A;  1VQO A;  3LH5 A;  2LMJ A;  3CCQ Q;  5GAM g;  3G71 A;  5GMK h;  2X3X D;  1I1J A;  5CQX A;  3ME9 A;  3MPU B;  2YRD A;  4C92 A;  3GLX A;  2LCL A;  3CCE T;  5LJ5 e;  4X9D A;  5KYN A;  5D6Y A;  4II1 A;  4ZGD B;  2SRC A;  1NLO C;  3CCL T;  2V8K A;  4E7S A;  3M0T A;  2AIR B;  2DIL A;  2IVW A;  2DLP A;  2A08 A;  1S1N A;  5KE2 A;  2DTO A;  1NM7 A;  4D8K A;  1UGR B;  1M5Q 1;  1VQ6 Q;  4M75 C;  2D0N A;  3CCJ T;  1UJY A;  3ZL7 C;  3GIB A;  1JB0 E;  2EKO A;  3CCR T;  2EJF A;  1Y7X A;  4A63 B;  3EFO A;  1VQM A;  2PQW A;  5GAN 6;  4BY6 B;  2HD0 A;  1FX7 A;  3CMA T;  3SWN A;  4EMG A;  3PFS A;  3G6E A;  5I22 A;  3OYA A;  1D1B A;  3UDC A;  4M78 C;  4HA8 A;  1H92 A;  1X2K A;  4PJO A;  1YJW Q;  2ESW A;  3VS4 A;  1WHH A;  4KH1 B;  1UHF A;  4F7U G;  3HPW A;  5IAY A;  4MZP A;  4E7I A;  2RPN A;  2EPD A;  1SHG A;  3EHR A;  3EH1 A;  3VUB A;  3OYI A;  1Q81 U;  4K11 A;  2DE0 X;  2OAU A;  1FMW A;  4LDY A;  4DBF A;  5KCH A;  2O2O A;  1YIJ Q;  1BCO A;  2HKQ B;  2JVV A;  3QYG B;  1U1T A;  5CAI A;  2YLC A;  1WXB A;  2O31 A;  4JJB A;  2V1R A;  1ZX6 A;  1T0J A;  1H3H A;  4M7D A;  1PCX A;  2EQK A;  4EIK A;  1NYG A;  2EQJ A;  5GAO l;  4J8O A;  3RMQ A;  1X69 A;  1VQL T;  1B34 A;  1WJS A;  3UPU A;  4FU6 A;  1JO8 A;  4AFS C;  1KSW A;  2LNV A;  1TH7 A;  1Y07 A;  2OTL Q;  2PZ1 A;  2E70 A;  4RMO A;  1ACM B;  1IB8 A;  4XU0 A;  2XK0 A;  4JZ3 A;  5I21 A;  4KGZ B;  1K8A R;  4OMP A;  2RM4 A;  1YWO A;  3JRZ A;  2ENM A;  5KYW B;  3CC2 T;  1BCM A;  4KBM B;  2RB6 A;  2D0Q B;  3GOX A;  3MJX A;  3KXT A;  3CXC A;  2KT8 A;  4E2F B;  4RTZ A;  4EDU A;  1QCF A;  5FRM A;  1Y96 B;  2OX7 A;  1R0C B;  3BY7 A;  3VS3 A;  2GFA A;  2HKN A;  2JUF A;  1TTH B;  1IO6 A;  1U06 A;  4RG2 A;  1Q95 G;  2KGT A;  2JTF A;  3L2U A;  1VQO Q;  3HHT B;  4E47 A;  5KYY A;  3SDZ A;  3G71 Q;  4C0F A;  3OB9 A;  3GPL A;  1NG2 A;  2EYZ A;  4FIB A;  1D1A A;  3PT9 A;  2QYZ A;  6AT1 B;  1GFD A;  3VU3 C;  3CC7 A;  2D6F A;  2E64 A;  2ROL A;  3JB9 I;  2L3S A;  1M9S A;  1VQ9 Q;  4EPC A;  1JXM A;  2MMP A;  1NJI C;  4DEX A;  2O88 A;  2VB6 A;  4CRI A;  3MP1 A;  2LRQ A;  4C8Q C;  1LVK A;  4M7A G;  2L3P A;  3EG1 A;  2GBQ A;  2QEX T;  4CC7 A;  1JJ2 S;  2A3L A;  3NFC A;  3L2Z A;  4BI8 B;  4M78 A;  3OYM A;  1BI0 A;  2B86 A;  3OYJ A;  1H64 1;  1YJW T;  4M77 B;  2GQV A;  3G6E Q;  1OX9 A;  2DJQ A;  2QDY B;  1CSK A;  4RCC A;  3VYH B;  1Q86 C;  5IH2 A;  1PD1 A;  4DOW A;  4ATO A;  3FLG A;  3RIR A;  2EAY A;  2YXY A;  1ZBJ A;  1PG5 B;  3OW2 A;  1UEC A;  2R5A A;  3GNG A;  1TUC A;  5CVI A;  3CD6 A;  4IIM A;  2LJ1 A;  2QQS A;  4IUQ A;  4NOY A;  3JB9 G;  1VQ8 T;  2F2W A;  1YJ9 A;  2DL5 A;  2RQT A;  5DM7 R;  2CP0 A;  2YHT A;  1R0B G;  3CXC S;  3CC4 A;  1VQN T;  3M0P A;  2EGA A;  2RHY A;  3EG3 A;  1ZA1 B;  4AT1 B;  2X4Y A;  4MML A;  4IUR A;  1NEG A;  1QW1 A;  2K2V A;  5CO7 A;  2K3B A;  2FZC B;  2K4Y A;  4PJO F;  1M3A A;  4NS5 A;  4ESR A;  2DA9 A;  3JV3 A;  5CKB A;  1WQ7 A;  3S3N A;  2KAF A;  2F2X A;  4QT7 A;  5HCK A;  1MMD A;  5LJ5 g;  2DAQ A;  1NYF A;  4BE0 A;  3T9N A;  2O9S A;  3EG2 A;  3EH2 A;  1ZSZ A;  4YTL A;  1KD1 U;  1PM3 A;  3L2V A;  4C0D C;  4J9B A;  4LDU A;  5GAN f;  1K73 U;  3E9F A;  5CKD A;  1UDL A;  1UGS B;  2DXT A;  2X4W A;  1VOM A;  4O5V A;  2ZZD A;  4DBH A;  4B6M A;  4O6J A;  5LJ3 h;  4E7J A;  4JJD A;  3DLL A;  3M53 A;  5A0L A;  5EC7 A;  2JS2 A;  3PIO A;  2FRY A;  5EG2 A;  2DL8 A;  1MV0 B;  4DA4 A;  1WYX A;  4OML A;  2ECZ A;  4V2S A;  3HL8 A;  2E65 A;  1X6G A;  1OU8 A;  1SSH A;  5KH6 A;  3DLM A;  2C0I A;  2M16 A;  3CC7 Q;  4OMM A;  1FMK A;  1M1G A;  2E41 A;  3I35 A;  3OW2 S;  2F1L A;  3CBM A;  2NUT B;  1CKA A;  4PLI A;  2QA4 A;  1B7T A;  1WI7 A;  2HMA A;  2K57 A;  1VQM T;  2VAS A;  2O01 E;  1PWT A;  4PFZ A;  2D8H A;  2BKD N;  1H3Z A;  5KYU B;  2M1H A;  1AVZ C;  3M4G A;  4BY6 C;  4RTX A;  2MYS A;  3VKI A;  1I0C A;  1WFW A;  4KT0 E;  4RTW A;  5FWC A;  1O9S A;  3JCM P;  4E7K A;  2MAM A;  3FJP A;  2V8J A;  3UA7 A;  3UT1 A;  5GAO m;  3G1J A;  2K5F A;  5IHK A;  1PSF A;  5LJ3 f;  4JS5 A;  3PVL A;  2PVD B;  1TWB A;  1AD5 A;  1KC8 R;  3URG A;  3VRY A;  1QMC A;  2QAS A;  2DXC A;  3H41 A;  4PJM A;  3QSU A;  2KRM A;  4IIO A;  1IXD A;  2JM9 A;  1PHT A;  2CT3 A;  1S72 A;  4M75 F;  3CD6 Q;  1R8O B;  3JCM e;  2XDB A;  4QW2 A;  4E7H A;  3H6Z A;  4XQ3 A;  5GAM h;  2DXB A;  1GBQ A;  1X6O A;  4EMK A;  1IZ6 A;  2V8I A;  1W4S A;  1YJ9 Q;  4J9E A;  2K79 A;  3JCM X;  3J81 E;  3CC4 Q;  2COW A;  4Y92 A;  4HCB A;  2YUO A;  2VKN A;  4A53 A;  4C5G A;  1G83 A;  3R6N A;  1YP5 A;  4IUP A;  3RMS A;  3VJP A;  4RTV A;  2WSC E;  1Q82 R;  4LNP A;  3QHS A;  1K73 C;  3KUF A;  4ELY C;  1X2Q A;  2DO3 A;  4M7A B;  4XTV A;  4FM4 B;  1PRL C;  2K5I A;  2KBT A;  2RNA A;  1QVF S;  3O8V A;  2E12 A;  1BI2 A;  4AFQ C;  1D3B A;  1VQ7 A;  5GAM f;  4JRQ A;  2CS7 A;  4PJO D;  3PE0 A;  2RHI A;  2COY A;  2AZS A;  2VV5 A;  3EHQ A;  4KRT A;  4C92 G;  2EYY A;  3OMC A;  2QG9 B;  4LDV A;  2JOY A;  4JJN K;  2YUP A;  2QGF B;  2VYT A;  1OZ2 A;  2RH2 A;  5FWB A;  2FB7 A;  4JRI A;  5GAN 5;  1M2V B;  1ARK A;  1E7O A;  2L3Q A;  2JM8 A;  5J26 A;  3CCV T;  5DLQ E;  4MMK A;  4OMQ A;  4F17 A;  5KYX B;  3VS2 A;  3ZFJ A;  4M7D D;  2FRW A;  2X51 A;  3QDF A;  3GF5 A;  1M90 R;  1X75 C;  4XTX A;  4L5G A;  2QA4 Q;  3OYC A;  5IT9 E;  3CCU T;  2GF7 A;  3J80 E;  4BUG A;  1MND A;  1N8R U;  2GNC A;  4CI0 C;  3LX7 A;  1BU1 A;  2C0T A;  2ED1 A;  4M75 E;  2X4J A;  1RAB B;  2MK5 A;  2HDA A;  4IUV A;  5GAN 4;  1W2B P;  2GQI A;  1AZE A;  1JEG A;  2J7I A;  1GXI E;  1BIA A;  2JT4 A;  1OYX A;  5GAN d;  4EMK B;  5A2Q E;  4EMH A;  1WHG A;  2YSQ A;  3OS0 A;  2PVO B;  4M77 G;  2AT1 B;  2L8D A;  4M4Z A;  1T3L A;  5KCO A;  2V1Q A;  4L59 A;  4FW1 A;  2LCS A;  1VQP T;  1SEM A;  2RJF A;  1BIB A;  5GAO r;  1M1K R;  1W70 A;  1IHV A;  1QVG S;  3VS6 A;  2VVK A;  2AKK A;  1S72 Q;  2RA2 A;  4LD6 A;  4M7D G;  2A37 A;  3PGG A;  2M51 A;  3UF4 A;  1V1C A;  4C8Q F;  2R5M A;  3CC4 T;  3AT1 B;  2BIV A;  1VQK A;  1QWF A;  4PJN A;  2BUD A;  2FVU A;  3M0R A;  3N5B B;  3MHX A;  1MMG A;  4JJC A;  1EX4 A;  2WSE E;  2AK5 A;  2P0Q A;  4E7Z A;  4M75 D;  9ATC B;  4PLL A;  1D3B B;  2QI2 A;  4OMF B;  1VQ4 A;  2WSF E;  4XTY A;  4PL6 A;  5IHN A;  1RI9 A;  1NPP A;  3LGF A;  5GMK l;  4Z89 A;  1HD3 A;  2DIQ A;  1JU5 C;  4OB1 B;  5LJ3 d;  2F2V A;  3OYH A;  2KR3 A;  1UGQ B;  2L2P A;  1VQ9 A;  4BI3 A;  4M78 D;  2EBP A;  3SEM A;  5J3B A;  1TSF A;  3E9G A;  4KH0 B;  1WNL A;  2QQ9 A;  3JB9 H;  1AEY A;  5LJ5 j;  3RKX A;  1VQ7 Q;  3LWH A;  2JW4 A;  1C6V X;  1I07 A;  3RKY A;  3MEV A;  5A0D A;  1K76 A;  3V8J A;  2DVJ A;  2HNI A;  4IKF A;  1AWW A;  1NJI U;  1SG5 A;  3GBQ A;  1WGS A;  2RQR A;  3HRT A;  4Z88 A;  2RD1 A;  3OYB A;  1PNJ A;  4N0A C;  2MCN A;  1FWZ A;  3MEU A;  2PVG B;  4PJL A;  4P5N A;  2M9U A;  2RJC A;  4UC4 A;  3S6W A;  2FPE A;  1RAC B;  3V8L A;  5IXB A;  2RJE A;  1N8R C;  3P8H A;  3AHU A;  2CUB A;  1UGV A;  1Q86 U;  4QKU A;  1RAH B;  1YI2 A;  2HAX A;  4DOV A;  3EGD A;  1Z9Z A;  4M78 G;  4CC2 A;  2RK2 A;  2KRS A;  2JN0 A;  4TVR A;  4WF2 A;  3JCM g;  2F69 A;  2FO0 A;  1OI1 A;  3OYE A;  4JLI A;  1W2B A;  5LJ5 h;  4J7I A;  3JCM c;  2CGH A;  3TCJ A;  2E5Q A;  3NTI A;  3I55 T;  2KEA A;  2AHJ B;  3SD4 A;  5IHI A;  5GAM d;  3BW1 A;  2G6F X;  3M56 A;  2BZX A;  3PMI A;  4C8Q E;  2KSS A;  2CZ6 B;  4OB2 B;  2Y4Y A;  2ZPF B;  4X9C A;  3I56 T;  1RLQ C;  4PNO A;  1H8K A;  4R56 A;  1KJW A;  2EYX A;  3F70 A;  5CQY A;  2FYK A;  2YT6 A;  2H3J A;  2RK1 A;  4OGE A;  1PKS A;  3L1A A;  2NLU A;  5CKH A;  4C92 B;  1F1B B;  4IUT A;  3CME T;  3PMT A;  3JCM J;  2DL3 A;  2ZGW A;  3E19 A;  2XDD A;  5LL6 S;  1N6A A;  2QTX A;  3CCQ T;  1EIF A;  1VQK Q;  4KUI A;  4MZM A;  2DNU A;  4HCZ A;  1KHI A;  2DRM A;  4AFU C;  1X43 A;  2FPD A;  3L42 A;  7AT1 B;  2HSE B;  2E4H A;  3OS1 A;  3V7S A;  1QP3 A;  1EZZ B;  3EFR A;  1OU9 A;  1VQ4 Q;  3EFO B;  4C8Q D;  1SHF A;  3REA B;  2PNI A;  1GCQ C;  2Y90 A;  2GGR A;  2CP6 A;  1VQ6 T;  3SWN B;  4M75 A;  2Z0W A;  1WJR A;  1A0N B;  2HL3 A;  3VRZ A;  2DTH A;  4M7A C;  1Q82 C;  2CP5 A;  4PJO B;  1OPL A;  4XAX B;  1VQ7 T;  4JRK A;  1GFC A;  3TVT A;  3M0Q A;  2BE9 B;  4N4H A;  3S3O A;  1LNX A;  4J5Y A;  5AT1 B;  2EGC A;  3QWY A;  4D8D A;  1VQ5 A;  5L8R E;  1G3T A;  4A4F A;  2ZPE B;  2DK3 A;  1N9S A;  1OPK A;  3E1S A;  2DEQ A;  1BI3 A;  3M55 A;  2O4X A;  2LVM A;  2E6Z A;  1WLP B;  1WPY A;  3WVD B;  2ZAE A;  5FU7 B;  3LYI A;  4M7D B;  1WA7 A;  3FIF A;  5CR2 A;  4FYY B;  2IPO B;  1YIJ T;  3WXM B;  2LP5 A;  3VS5 A;  1MGQ A;  1KIK A;  2DM1 A;  2MF2 A;  4XTW A;  2CZ0 B;  1MNE A;  2XKO C;  3V7C A;  1YI2 Q;  1B34 B;  1G3Y A;  1D0Y A;  5A0G A;  2V26 A;  5FW9 A;  2G3R A;  1D0Z A;  2DVE A;  1M90 C;  4A4E A;  1PD0 A;  4BE2 A;  2L89 A;  4AFZ C;  2X35 A;  2QQR A;  5CKF A;  2L0A A;  2IIM A;  4E6R A;  1UTI A;  3X20 B;  2RQW A;  2C06 A;  3UAT A;  2COZ A;  2J6F A;  2RI2 A;  2OTL T;  3E2U A;  1UJ0 A;  4D6W A;  2PTK A;  2DZ9 A;  4ZTF A;  1NE8 A;  3DKM A;  2K6D A;  2QTV A;  3M0U A;  2EFI A;  3QZ9 B;  4DEY A;  2GTO A;  5ECA A;  3RER A;  1QLY A;  2ROT A;  3FDR A;  5KYY B;  5GAO q;  4C5E A;  5M9O A;  4B9X A;  3M59 A;  1ZUU A;  3MO8 A;  1W6X A;  3VS1 A;  4J9I A;  4QQG A;  1M1K C;  2HL5 C;  3CCE A;  1SRM A;  1VQK T;  4RCB A;  1M1F A;  3CCL A;  5GAO p;  1VQO T;  1ABQ A;  3G71 T;  3RKW A;  1YIT A;  1K8A U;  5D6X A;  1M2O A;  4M77 F;  3RBB B;  4Z8A A;  4OB0 B;  2J6K A;  2KYB A;  4JZ4 A;  1JXO A;  3BDL A;  3ER0 A;  4XU3 A;  4LDX A;  3HP9 A;  1ZBX A;  1GCQ A;  2BZY A;  4QVD A;  1LCK A;  1SPK A;  3QXE B;  1ZUY A;  3CCR A;  2I0N A;  4DQ2 A;  3D7S B;  2D8J A;  2KY9 A;  2RMO A;  4ZGJ B;  1Q7Y R;  3TSZ A;  2CP2 A;  1ZQ1 A;  1MHN A;  4M78 B;  4ZN1 A;  5GAN 3;  3CMA A;  1VQ9 T;  4HVV A;  4HT9 A;  3HKS A;  4F16 A;  3H0I A;  2EQU A;  2NUP A;  3OSV A;  2PUK B;  4WCI A;  3PNW C;  4C8Q A;  2KXD A;  1WQW A;  1YCY A;  2CSI A;  4GLK A;  2JTE A;  2LQK A;  3LGL A;  1M8V A;  3OBY A;  2CH4 A;  4JDS A;  2DBM A;  2EJ9 A;  3G6E T;  4R55 A;  1VQ5 Q;  4FYV B;  3X25 B;  1VYU A;  2J06 A;  3OA6 A;  1OUL A;  2L5Q A;  3HRU A;  3P8B B;  4Y91 A;  2DL7 A;  1E6G A;  2BE7 D;  1K4U S;  2HQX A;  4ORZ A;  1MV3 A;  1QWE A;  2E6N A;  2LQ8 A;  5C6S A;  3VS0 A;  4X1V A;  2KE9 A;  5D6W A;  4J6X A;  4OMO A;  5LJ5 d;  2CP3 A;  4ELZ C;  2MPX C;  3A8G B;  1WHK A;  3PTA A;  2DL4 A;  3EG9 A;  1M30 A;  1CKB A;  4RTT A;  1K9M R;  3SFM A;  1I5O B;  1VYT A;  1N27 A;  4R0K A;  4MZT A;  1OV3 A;  1RL2 A;  3L2W A;  1RUW A;  1HXD A;  4OP0 A;  2R57 A;  2VC8 A;  1WX6 A;  2KNB B;  3CC2 A;  4HCC A;  4F7U F;  3IQL A;  3LLR A;  1ZSZ B;  3V7R A;  8AT1 B;  1VA7 A;  2XU8 A;  1RAE B;  2DIG A;  4LUE A;  3OYK A;  5GMK i;  1TU0 B;  4LUD A;  1YCS B;  3KFV A;  4J9G A;  1C1A A;  4J7F A;  3PIP A;  2OTJ A;  1G8X A;  4RTU A;  1G3S A;  3FEO A;  4M77 E;  1ZLM A;  5GAN g;  2FZG B;  2Y4X A;  1ABO A;  1K8A C;  2XMF A;  3QZ5 B;  3CCS A;  1I81 A;  2ATC B;  4C92 C;  2MWP A;  4N4I A;  2YUN A;  2VGN A;  4XK8 E;  4J83 A;  5GAN 8;  3CCE Q;  4AMC A;  3A1P A;  3CCL Q;  1Y57 A;  3DB4 A;  1AWO A;  4RTY A;  5CIU A;  3BE3 A;  5FLX E;  1YIT Q;  1OEB A;  4F04 B;  2M02 A;  2X3W D;  2IG0 A;  2ZPH B;  4ANJ A;  2KYM A;  3CPW P;  2PU9 B;  2QDL A;  3C0C A;  3CC7 T;  3CCR Q;  4ZN3 A;  3JCM h;  1TS9 A;  1Q81 R;  3INZ A;  2QEX A;  4JLG A;  3ULR B;  3CMA Q;  3EGU A;  1U8R A;  2XID A;  1JRI A;  1GRI A;  1QKW A;  1NEB A;  2MI6 A;  4HVW A;  5L23 A;  2R58 A;  1RI0 A;  5GMK e;  3UA6 A;  2C0O A;  2CT4 A;  3Q1J A;  2LJ0 A;  4PK4 A;  4PJO G;  3VUZ A;  2KK4 A;  4LD9 K;  4M77 C;  1XQH A;  2FEI A;  1QCN A;  2XDP A;  1IRE B;  2JJ9 A;  1JJ2 P;  1VQ8 A;  3EAE A;  2QXF A;  3UWN A;  1DJ7 B;  2RO0 A;  1SSF A;  2CP7 A;  1VQN A;  1UE9 A;  3CD6 T;  3RNJ A;  3JCM f;  1QVP A;  3MEA A;  2KT1 A;  4F7U E;  3C4S A;  4M7A F;  4JRP A;  3QWX X;  2EKH A;  1YJ9 T;  2H3E B;  2EJG A;  3H0F A;  2LNH B;  3BDU A;  3SHW A;  1VQL Q;  3JCM V;  4ZTJ A;  2YUQ A;  2D9T A;  4ZGE B;  2LC4 A;  5IN1 A;  2LCC A;  1TUD A;  3J7A F;  2LJ3 A;  4J9D A;  4F14 A;  1G2B A;  2J05 A;  3OYD A;  3CC2 Q;  3M4Y A;  2LTO A;  1MMA A;  2EYW A;  4FYW B;  1TG0 A;  4C0D B;  4JS4 A;  2E10 A;  4JPB W;  3JB9 J;  3CXC P;  2YDL A;  4Q5W A;  3OYN A;  1I4K 1;  3JCM b;  1M3B A;  1SF9 A;  2DET A;  2P0K A;  5KYW A;  3JB9 F;  3U23 A;  2FZK B;  2OTJ Q;  2X4X A;  2HQE A;  1VIE A;  3A8L B;  1NLP C;  4KUD K;  3OS2 A;  4J9H A;  5FU6 B;  1ZUK A;  3OYY A;  5FRN A;  1XTD A;  2CYZ B;  5C0M A;  3CCS Q;  1Y96 A;  4XU2 A;  3L2R A;  1WHL A;  2K7A A;  3LW5 E;  3EG0 A;  3DB3 A;  3MCA B;  4J9C A;  2K3X A;  2LQW A;  1YIT T;  3OMG A;  1Q82 U;  4BI4 A;  2OAW A;  3QO3 A;  4WTO B;  1IGU A;  3M9Q A;  3CPW A;  5HK0 A;  4BDY A;  1SRL A;  4M75 G;  2EVR A;  3VS7 A;  2JZ2 A;  5HKC A;  2CUD A;  3OYG A;  2GTJ A;  2DMO A;  4NL2 A;  5GAN 2;  1GBR A;  4HXJ A;  3A8O B;  2QEX Q;  1D09 B;  2RQU A;  1N5Z A;  3CCM A;  1MUZ A;  2QA4 T;  3CBP A;  3QUI A;  1Q7Y C;  1QQJ A;  1OQK A;  1JQQ A;  1WIE A;  2MIO A;  3OSS C;  1SKU B;  3H0H A;  4GLM A;  4MDW A;  3LWI A;  3QPH A;  3JCM Q;  3OW2 P;  2RN8 A;  3MP6 A;  4M77 A;  2QK0 A;  2E5K A;  1RAD B;  1LOJ A;  4M7A E;  4OVA A;  1I5L A;  2VXE A;  1IHW A;  1X27 A;  1JJ2 A;  1FXX A;  1M90 U;  2VXF A;  4B9W A;  2EYQ A;  2YRC A;  3EFS A;  1VQ8 Q;  4OGC A;  2KDS A;  1TOV A;  3CPF A;  5HK3 A;  2DXU A;  1S72 T;  3WVE B;  3X26 B;  1WXT A;  1VQN Q;  3C12 A;  2EIF A;  1KD1 R;  5GJW B;  1KC8 C;  2E3I A;  2CDT A;  5J39 A;  4CC4 B;  1K73 R;  3G4S A;  3ZBD A;  2ZPG B;  5DLO A;  1WHM A;  3R6O A;  4X34 A;  1WDX A;  1YJN A;  2K3Y A;  1M8M A;  2LX9 A;  5IXF A;  2E3H A;  1K9M C;  2P84 A;  2FL7 A;  2XG8 D;  2NUZ A;  2CZ7 B;  2GFU A;  5LJ5 f;  1M1K U;  3MP8 A;  1BK2 A;  1ZSZ C;  4M7A D;  3TQ7 P;  4FT2 A;  2ZPB B;  2K5L A;  1UGP B;  3HSB A;  3CBO A;  4KGV B;  4C0Z A;  3BFM A;  4QQD A;  5HY6 A;  3CPW S;  2OTJ T;  5GAN e;  1WXU A;  2RI3 A;  4J6Y A;  1OZ3 A;  4ME7 A;  1XOV A;  2DKG A;  1WJQ A;  1T0H A;  3CCS T;  5I2M A;  1M3C A;  2CKK A;  1RAG B;  1AHJ B;  2OI3 A;  2KXC A;  1QCO A;  2SEM A;  2PUO B;  4LDW A;  1AWX A;  2ZPI B;  3G7Z A;  1KQS P;  2MWO A;  3MKD A;  3OQ5 A;  3CCV A;  2VGM A;  3M5A A;  4OB3 B;  3I5R A;  4KGX B;  3JCM d;  1U3O A;  1AT1 B;  1KHC A;  5GAN j;  1LJO A;  1QVF P;  2P0P A;  4F7U A;  1AOJ A;  3JB9 D;  2A36 A;  3H9N A;  2NYS A;  4N0A A;  1O75 A;  3MET A;  2DRK A;  2X9H A;  1RAF B;  1W2B S;  1K1Z A;  4NL3 A;  3EGD B;  1BBZ A;  3M54 A;  1VQM Q;  3CCU A;  4A4K A;  1J3T A;  1D1C A;  1NZ9 A;  2DEU A;  1G5V A;  1LPL A;  2HZY A;  4C8Q G;  2W0Z A;  1YN8 A;  2JMC A;  5FRO A;  2OJ2 A;  2RHZ A;  2NUT A;  3CCM Q;  3RUX A;  1Q81 C;  1M4Z A;  2XIC A;  5LJ3 e;  4BD3 A;  2EWN A;  4C92 F;  4QVC A;  2F5T X;  4JUV A;  3A8M B;  3I5S A;  5CKE A;  5KYU A;  1YHQ A;  2LQN A;  2ED0 A;  3C95 A;  3PVQ A;  3LH0 A;  1VQP A;  4Y28 E;  3QG1 A;  2FG0 A;  1OX8 A;  2DD5 A;  4DBQ A;  4A4H A;  3RES A;  1B07 A;  5GAN h;  1UB4 A;  2RHX A;  2E1H A;  3FJ5 A;  5LJ3 j;  3NTH A;  2MOX A;  2CRE A;  5I11 A;  2RJD A;  4EMK C;  3ASK A;  4FCY A;  1AWJ A;  3HFN A;  5KE3 A;  2KI7 A;  2JS0 A;  5GMK m;  1K9A A;  2A28 A;  3QJY A;  3QII A;  1D0X A;  3NHN A;  1YBY A;  3G4S Q;  4BB7 A;  4OMN A;  3QKJ A;  2W10 A;  1KFZ A;  4XTU A;  1QVG P;  4Z02 A;  2JMA A;  3A8H B;  3NMZ C;  1KQ1 A;  1YJN Q;  4M75 B;  4N4G A;  2XD0 A;  4FW2 A;  4OF1 A;  1UFF A;  3FC3 A;  3HRS A;  2AZV A;  4XU1 A;  3OYF A;  2XI9 A;  3CCJ A;  1VQ4 T;  1XNI A;  1IRX A;  1HJD A;  4FSS A;  3A5Z B;  4QQ6 A;  2KRO A;  2BZ8 A;  2HEQ A;  3RDV A;  1ZA2 B;  3P8D A;  1UUE A;  5GAM e;  4M7D F;  1Z9Q A;  4HVU A;  2YWW A;  4F7U B;  4M7A A;  3O5Z A;  3QYH B;  2HSP A;  1R77 A;  3OS5 A;  4PFO A;  1ZHI A;  2EQI A;  1KQS A;  2O4X B;  2NWM A;  2QAZ A;  5FU6 C;  4FT4 A;  1RAI B;  1N8R R;  1K0S A;  1BI1 A;  5GAM j;  2CZ1 B;  1QVF A;  3CCV Q;  1QP2 A;  3TU4 K;  2HBW A;  1Y71 A;  4J9F A;  2JNG A;  2YLB A;  4BDZ A;  2K2M A;  3THK A;  4HCK A;  1RLP C;  1GCP A;  2FPF A;  2K9G A;  1RAA B;  3L2Q A;  1M2V A;  1PKT A;  4C92 E;  2J6O A;  1PSE A;  1HSQ A;  2VUB A;  1UHC A;  4LE9 A;  4GBQ A;  2RHU A;  3EGX A;  2LZ6 B;  4GY5 A;  4QVZ A;  5KYX A;  3CCU Q;  4RUG A;  3CCM T;  1YWP A;  3TSW A;  4RKU E;  1YI2 T;  4LN2 A;  3M0S A;  1VYV A;  2A7Y A;  5I2S A;  3I55 A;  3C94 A;  1BKB A;  4HT8 A;  1VQL A;  1MMN A;  1T3S A;  2DZC A;  2CH4 W;  2ABL A;  3HFO A;  2ZCF B;  3I56 A;  1YHQ Q;  3GNF B;  2DFU A;  2RF0 A;  3S3M A;  1Y0M A;  3ZEH A;  1E6H A;  2KRN A;  2M0O A;  4BAC A;  1VQP Q;  1X6B A;  2JXB A;  1ZSG A;  1VIF A;  2DTI A;  3QBY A;  4PJO E;  2EW3 A;  1BYM A;  4MDX A;  4E7L A;  1X01 A;  2P4T A;  1XJW B;  4C92 D;  3CME A;  1FMV A;  3FRN A;  2FHD A;  1BB9 A;  3CCQ A;  4M78 F;  1NPR A;  1KK7 A;  1V29 B;  1TXQ A;  4J6W A;  4AG1 C;  1KQ2 A;  4HKE A;  3G4S T;  3H8Z A;  1KG1 A;  1WZO A;  2XHC A;  2KVQ G;  2D1X A;  1YNZ A;  2KMT A;  1KD1 C;  3QDR B;  1QVG A;  1W1F A;  4PKC C;  1YJN T;  2JTM A;  4BE1 A;  1KQS S;  4M7D E;  1NJI R;  2LDM A;  2HQH A;  1VQ6 A;  2I2L A;  3RR6 A;  5AYF A;  1U5S A;  1P92 A;  3VV0 A;  1YFN A;  2NUP B;  3NPF A;  4C8Q B;  1GL5 A;  3CCJ Q;  4L6V 5;  2DER A;  4PJJ A;  4FSX A;  3REB B;  4RG8 A;  1B3Q A;  4DBR A;  1K0X A;  2QQA A;  5GAO n; 
#chains in the Genus database with same CATH homology
 1WYX A;  1OPL A;  4OML A;  2ECZ A;  1GFC A;  2OAW A;  3TVT A;  3M0Q A;  1X6G A;  4AG2 C;  2BTT A;  1SSH A;  1FYN A;  2C0I A;  2EGC A;  1SRL A;  2DBK A;  3QWY A;  4OMM A;  1FMK A;  4D8D A;  3CQT A;  3I35 A;  2EVR A;  3VS7 A;  1UG1 A;  1CKA A;  2CUD A;  3A98 A;  2GTJ A;  2DMO A;  1OPK A;  1WI7 A;  4CC3 A;  1GBR A;  4HXJ A;  2RQU A;  1N5Z A;  1PWT A;  1MUZ A;  3I9Q A;  2D8H A;  1WLP B;  1AVZ C;  1JQQ A;  1WIE A;  2MIO A;  4RTX A;  1QKX A;  2O9V A;  1WA7 A;  1I0C A;  1WFW A;  4RTW A;  5FWC A;  3H0H A;  4GLM A;  3UA7 A;  5IHK A;  2HCK A;  2M0Y A;  2LP5 A;  2CSQ A;  3VS5 A;  3PVL A;  2DM1 A;  2VWF A;  1KIK A;  1PRM C;  2RN8 A;  2DX1 A;  2E5K A;  1AD5 A;  3VRY A;  5GJV B;  3H41 A;  2EGE A;  5FW9 A;  1X27 A;  2KRM A;  4IIO A;  2JM9 A;  1PHT A;  2CT3 A;  2LX7 A;  2DYB A;  4AFZ C;  1M27 C;  1OOT A;  2H8H A;  2L0A A;  2IIM A;  1GBQ A;  4E6R A;  2RQV A;  1AZG B;  1UTI A;  2RQW A;  3UAT A;  1WXT A;  2J6F A;  4J9E A;  5GJW B;  1UJ0 A;  2CDT A;  2PTK A;  2DF6 A;  2K79 A;  4CC4 B;  2K6D A;  4Y92 A;  2YUO A;  3M0U A;  2VKN A;  4DEY A;  3NGP A;  2GTO A;  5ECA A;  1QLY A;  1G83 A;  1WDX A;  4ZNX A;  2ROT A;  2AKL A;  1M8M A;  3R6N A;  1YP5 A;  5IXF A;  1ZUU A;  1W6X A;  3VS1 A;  2P4R A;  2NUZ A;  4J9I A;  4RTV A;  1EFN A;  3LH5 A;  2LMJ A;  1SRM A;  1BK2 A;  4LNP A;  2X3X D;  1I1J A;  1X2Q A;  1PRL C;  2RNA A;  2KBT A;  1ABQ A;  2SRC A;  1NLO C;  1WXU A;  4AFQ C;  3RBB B;  4Z8A A;  1XOV A;  3M0T A;  2J6K A;  2DIL A;  2KYB A;  3PE0 A;  2DLP A;  1JXO A;  2A08 A;  1S1N A;  4JZ4 A;  1NM7 A;  4D8K A;  1T0H A;  2AZS A;  1M3C A;  1GCQ A;  2BZY A;  3EHQ A;  4KRT A;  1LCK A;  1SPK A;  2OI3 A;  1ZUY A;  2I0N A;  2KXC A;  2D0N A;  2SEM A;  2EYY A;  2D8J A;  1UJY A;  2RMO A;  3TSZ A;  1AWX A;  3ZL7 C;  2YUP A;  5FWB A;  4HVV A;  3I5R A;  4A63 B;  1U3O A;  4F16 A;  1ARK A;  1E7O A;  2L3Q A;  2JM8 A;  3H0I A;  1AOJ A;  4WCI A;  2A36 A;  2KXD A;  4OMQ A;  2CSI A;  4F17 A;  5I22 A;  2DRK A;  2JTE A;  3VS2 A;  2CH4 A;  1H92 A;  1K1Z A;  1X2K A;  2DBM A;  2FRW A;  1BBZ A;  2ESW A;  3VS4 A;  1J3T A;  1VYU A;  2J06 A;  1UHF A;  2W0Z A;  1YN8 A;  2DL7 A;  2JMC A;  2RPN A;  2OJ2 A;  2EPD A;  1E6G A;  1SHG A;  3EHR A;  1K4U S;  4ORZ A;  2GNC A;  1MV3 A;  4K11 A;  1QWE A;  2DE0 X;  1BU1 A;  2C0T A;  2ED1 A;  2O2O A;  3VS0 A;  4X1V A;  2KE9 A;  2HDA A;  4OMO A;  2GQI A;  3I5S A;  1AZE A;  1JEG A;  1WXB A;  2J7I A;  2O31 A;  4JJB A;  2LQN A;  2V1R A;  1ZX6 A;  1T0J A;  2ED0 A;  2JT4 A;  1H3H A;  3PVQ A;  2DL4 A;  2YSQ A;  1M30 A;  1CKB A;  2FG0 A;  4EIK A;  4RTT A;  4M4Z A;  1T3L A;  2V1Q A;  1VYT A;  1NYG A;  1B07 A;  2LCS A;  3FJ5 A;  1SEM A;  4R0K A;  1OV3 A;  1RUW A;  1W70 A;  1X69 A;  2MOX A;  2CRE A;  3VS6 A;  1JO8 A;  5I11 A;  2VVK A;  4AFS C;  1KSW A;  2AKK A;  1AWJ A;  2A37 A;  2JS0 A;  1K9A A;  1WX6 A;  2PZ1 A;  2KNB B;  2M51 A;  3IQL A;  3UF4 A;  2A28 A;  1V1C A;  1VA7 A;  4JZ3 A;  4OMP A;  1YWO A;  4LUE A;  2ENM A;  1QWF A;  4LUD A;  1YCS B;  3KFV A;  3M0R A;  3NHN A;  4J9G A;  4JJC A;  2KT8 A;  4OMN A;  2AK5 A;  4RTZ A;  1QCF A;  2W10 A;  1KFZ A;  4RTU A;  2JMA A;  1ZLM A;  3NMZ C;  1ABO A;  5IHN A;  3VS3 A;  1RI9 A;  2XMF A;  1UFF A;  1IO6 A;  1U06 A;  2AZV A;  2YUN A;  2KGT A;  4Z89 A;  1HD3 A;  1JU5 C;  1HJD A;  4FSS A;  1Y57 A;  2F2V A;  2BZ8 A;  2KRO A;  2HEQ A;  2KR3 A;  2L2P A;  1UUE A;  4RTY A;  1AWO A;  1NG2 A;  2EYZ A;  2EBP A;  3SEM A;  1OEB A;  1Z9Q A;  4HVU A;  1AEY A;  1GFD A;  2JW4 A;  3O5Z A;  2ROL A;  2HSP A;  2X3W D;  2L3S A;  2KYM A;  1I07 A;  2EQI A;  1K76 A;  2NWM A;  2QDL A;  2DVJ A;  3C0C A;  1JXM A;  4DEX A;  2O88 A;  1AWW A;  1K0S A;  3ULR B;  3GBQ A;  2RQR A;  4Z88 A;  2L3P A;  3EGU A;  3EG1 A;  1PNJ A;  2HBW A;  2MCN A;  1GRI A;  2GBQ A;  1QKW A;  4J9F A;  2K2M A;  3THK A;  4CC7 A;  4HCK A;  1RLP C;  1NEB A;  1GCP A;  4HVW A;  5L23 A;  2FPF A;  2B86 A;  2FPE A;  2K9G A;  2DJQ A;  1PKT A;  3UA6 A;  5IXB A;  1CSK A;  2CT4 A;  2C0O A;  2J6O A;  2LJ0 A;  2CUB A;  1HSQ A;  4LE9 A;  1UHC A;  1UGV A;  5IH2 A;  4GBQ A;  2LZ6 B;  4RUG A;  1ZBJ A;  1Z9Z A;  1YWP A;  4CC2 A;  3TSW A;  2KRS A;  1UEC A;  4LN2 A;  3M0S A;  1TUC A;  1VYV A;  2FO0 A;  2FEI A;  4IIM A;  2LJ1 A;  1T3S A;  2CH4 W;  1UE9 A;  2KEA A;  2ABL A;  2F2W A;  5IHI A;  2DL5 A;  3RNJ A;  2RQT A;  2KT1 A;  2RF0 A;  2G6F X;  1Y0M A;  2BZX A;  3M0P A;  1E6H A;  2EKH A;  2KRN A;  2EGA A;  3QWX X;  3EG3 A;  3H0F A;  2LNH B;  1RLQ C;  1X6B A;  2JXB A;  1ZSG A;  3SHW A;  1H8K A;  1NEG A;  2EW3 A;  1KJW A;  2EYX A;  2YUQ A;  2K3B A;  2YT6 A;  1PKS A;  1M3A A;  1TUD A;  4ESR A;  2DA9 A;  2LJ3 A;  3JV3 A;  4J9D A;  1BB9 A;  4F14 A;  1G2B A;  2J05 A;  2F2X A;  4QT7 A;  5HCK A;  2EYW A;  1TG0 A;  2DL3 A;  1NYF A;  2O9S A;  3EG2 A;  4JPB W;  4AG1 C;  2YDL A;  2DNU A;  2D1X A;  2DRM A;  4AFU C;  1X43 A;  1YNZ A;  2FPD A;  1M3B A;  1W1F A;  3U23 A;  4J9B A;  1UDL A;  1NLP C;  4J9H A;  1ZUK A;  1U5S A;  1SHF A;  3REA B;  2PNI A;  1GCQ C;  4JJD A;  2GGR A;  2K7A A;  3NPF A;  3EG0 A;  1GL5 A;  5EC7 A;  4J9C A;  2JS2 A;  1A0N B;  3REB B;  2FRY A;  1B3Q A;  3VRZ A;  2DL8 A;  1MV0 B;  2LQW A;  1K0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...