2B86A

Solution structure of the first src homology 3 domain of nck2
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the first SRC homology 3 domain of human nck2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Cytoplasmic protein NCK2
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2005-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2b86A00
3THKA 2CH4W 1QKWA 2DL8A 2J7IA 4JZ3A 4RUGA 2CDTA 2EGCA 2FRYA 5ECAA 2ROLA 2J6OA 1UHCA 1RUWA 1UE9A 1PKTA 2YUNA 4J9BA 2CT3A 2DILA 5IHIA 4J9EA 2JT4A 1RI9A 1GFDA 2E5KA 2O9VA 1AWXA 2A08A 2RNAA 2L2PA 3QWXX 2J6KA 1BK2A 2W10A 2ROTA 2LNHB 1SRLA 4KRTA 2M0YA 1E7OA 2QDLA 4HVWA 2X3WD 2JMAA 2KNBB 2KROA 1VYTA 1FYNA 4IIOA 4F14A 2FPFA 2DYBA 3UA7A 2EKHA 2LJ3A 1UJYA 3I9QA 5IH2A 1K1ZA 2H8HA 2O9SA 2OAWA 1KJWA 3ULRB 1PWTA 2GNCA 4QT7A 2M51A 1Y57A 2LQNA 2O31A 2LP5A 3UF4A 1AWOA 1WXTA 3U23A 2JS0A 2EYYA 1TG0A 1X43A 4RTXA 3VS2A 2A28A 4A63B 2C0IA 2D1XA 2C0OA 3PE0A 4JZ4A 3VS5A 4AG2C 2KYBA 2LQWA 2FPDA 1NYGA 1Z9QA 1SHFA 2YUPA 2J6FA 3UA6A 3H41A 4HCKA 1AZGB 1YCSB 2K2MA 2NUZA 4EIKA 1IO6A 3IQLA 4LE9A 2LZ6B 2DL5A 2YSQA 2K3BA 2KXCA 2ED1A 4RTTA 3EHRA 5IXBA 1KSWA 4LUDA 1E6HA 3H0FA 2RPNA 1NLOC 2CUBA 2JM8A 1I07A 1YP5A 1OV3A 3FJ5A 3O5ZA 1UECA 1ZSGA 1WDXA 2CUDA 2DL7A 5FWCA 2KXDA 2DL3A 2JS2A 3TVTA 4DEXA 5IHKA 3EG3A 1Z9ZA 4ZNXA 2EYWA 4JJBA 1TUDA 1ZX6A 2DBKA 2YUOA 2DVJA 3RBBB 4D8DA 1ZBJA 1T0JA 1K76A 2L3QA 1A0NB 4WCIA 4J9IA 1NLPC 1ABQA 2D8HA 1W1FA 5FW9A 4ORZA 2AKLA 2RQWA 2RQUA 1UHFA 1G2BA 3SHWA 2K7AA 1GRIA 2LJ0A 3SEMA 3RNJA 1HSQA 1QWEA 1QCFA 4DEYA 2KRNA 4OMNA 1WX6A 2KT8A 1GBRA 1CKBA 3M0SA 1SHGA 4CC4B 1U06A 1K9AA 4ESRA 1HJDA 2V1QA 4LN2A 2AZVA 3C0CA 1OEBA 4RTZA 5IHNA 1W70A 2YT6A 2LCSA 2EBPA 2GGRA 5HCKA 1UG1A 3I5RA 3ZL7C 1H3HA 2DL4A 3M0UA 3PVQA 2DJQA 4F17A 1H92A 4LUEA 2EVRA 3H0IA 4RTWA 3NPFA 2D8JA 1T3LA 2BTTA 4AFSC 1UTIA 2JM9A 1VYUA 4OMMA 2AKKA 3VRYA 3EG1A 2L0AA 2DNUA 5GJVB 1GCQA 4AG1C 1LCKA 1PNJA 1RLPC 2FEIA 2B86A 2JMCA 2DA9A 2ECZA 3VS4A 1WXUA 4AFZC 1JQQA 1BU1A 2F2XA 2DF6A 2ENMA 3A98A 1PHTA 1HD3A 2VWFA 4J9DA 2MCNA 5IXFA 2GBQA 2KYMA 1YNZA 1X2QA 2DX1A 5GJWB 2YDLA 3H0HA 4OMOA 4CC2A 1CSKA 2SRCA 3M0TA 1QKXA 2SEMA 2PNIA 1K0XA 4HVUA 2F2VA 2IIMA 2EYXA 3TSWA 1NM7A 3CQTA 1VA7A 1AD5A 1ARKA 4R0KA 1PRLC 2KBTA 1GFCA 2AZSA 1SSHA 1MUZA 1RLQC 1M30A 3M0QA 1QWFA 1WXBA 1CKAA 1JO8A 2GTOA 1M3CA 1M3BA 2FRWA 2RMOA 4FSSA 4OMQA 2EYZA 1ABOA 2P4RA 2ABLA 1E6GA 2EPDA 2JTEA 3EG0A 1AVZC 2HBWA 1K4US 1ZLMA 1N5ZA 4IIMA 3VS7A 2F2WA 1QLYA 2KR3A 4CC7A 2LX7A 1UDLA 3M0PA 3VS6A 2O88A 1EFNA 1SRMA 2K79A 4Z88A 3VS3A 1ZUUA 1NYFA 4J9HA 3REAB 2FG0A 1JXMA 4AFQC 1OOTA 1KIKA 4F16A 2HCKA 4Z8AA 1WIEA 4E6RA 2RQTA 4X1VA 1YWOA 1BBZA 1UFFA 3VRZA 1FMKA 1X27A 2KT1A 1T0HA 2YUQA 1MV3A 2NWMA 1NEGA 4RTYA 2JXBA 2HSPA 1SEMA 3VS1A 2RQVA 2JW4A 3I5SA 2C0TA 2L3PA 4LNPA 2ESWA 2MOXA 4GLMA 1KFZA 1PRMC 2KE9A 1YN8A 1JXOA 1TUCA 2XMFA 2RN8A 1NG2A 1GCQC 1BB9A 2FO0A 1X6BA 4J9FA 5L23A 2G6FX 3EGUA 2J06A 1AOJA 5I11A 1OPLA 1X69A 5EC7A 1S1NA 2K6DA 1J3TA 1WLPB 2MIOA 1T3SA 2DLPA 1YWPA 2O2OA 1AWJA 2RF0A 1X2KA 3NMZC 2A36A 1NEBA 3KFVA 2CSQA 3EHQA 1VYVA 2BZ8A 2D0NA 4D8KA 2OJ2A 1X6GA 2EGAA 3REBB 2PZ1A 3TSZA 5FWBA 1OPKA 1M3AA 2RQRA 2EW3A 2AK5A 2W0ZA 4J9CA 1JEGA 1SPKA 2I0NA 1I1JA 1UUEA 2CREA 2BZYA 2VVKA 3PVLA 1B3QA 2CH4A 2ED0A 2V1RA 1M27C 2CSIA 2FPEA 3UATA 3LH5A 2OI3A 4GBQA 2EQIA 4RTVA 2DM1A 1WYXA 4K11A 3NHNA 1GBQA 3GBQA 4HVVA 1Y0MA 2L3SA 2DRKA 1PKSA 1G83A 3R6NA 3M0RA 4Y92A 1WA7A 2EGEA 1I0CA 2GQIA 1GL5A 1M8MA 1V1CA 2A37A 1MV0B 5I22A 1UGVA 2CT4A 2KEAA 1JU5C 4M4ZA 1U3OA 4CC3A 2BZXA 3NGPA 2DBMA 3QWYA 4J9GA 1ZUYA 1B07A 2HDAA 3I35A 4Z89A 2KRMA 1UJ0A 3JV3A 1WI7A 2KRSA 1GCPA 2HEQA 3EG2A 2KGTA 2LJ1A 2DRMA 2X3XD 1AEYA 4OMLA 2J05A 4JJDA 1AWWA 2PTKA 3VS0A 1AZEA 4HXJA 2K9GA 2DE0X 1K0SA 2GTJA 4JJCA 1WFWA 2VKNA 4AFUC 1W6XA 1U5SA 1XOVA 1H8KA 4JPBW 2DMOA 1ZUKA 4RTUA 4OMPA 2LMJA
chains in the Genus database with same CATH superfamily
1VQLA 2VUBA 2F69A 1RAGB 2KY9A 4M77G 4PFOA 4RUGA 2CDTA 1KQ2A 3DB3A 1NZ9A 4BE0A 2DILA 4F7UE 1PSEA 5FU6B 2JT4A 3MEWA 1BI2A 2XDDA 1YHQA 3H9NA 2XDBA 2COYA 2M0YA 1YJNQ 1M1KC 1WHHA 2QDLA 4HVWA 1VQ8Q 2X3WD 5KYWA 2JMAA 3CMEQ 1FYNA 2BIVA 2X51A 1WJRA 1N8RR 3HPWA 1U1SA 2JZ2A 2O9SA 4AT1B 3L2RA 3LGFA 3ULRB 3G1JA 2R5MA 5J26A 1MMDA 2MMPA 2M51A 1QW1A 2LQNA 2BUDA 4J7IA 1VQ4Q 2D6FA 4OB3B 1AWOA 3E19A 2QEXQ 3MEAA 3U23A 2EYYA 1X43A 1KC8C 3CD6A 1QVFA 4XTXA 4JLIA 2FPDA 3I55T 2QXFA 1W4SA 4E7JA 5GAOl 2ZPHB 5AYFA 1JJ2A 3H41A 2NUTA 3WVEB 1QVGP 1YCSB 1K9MC 4EIKA 4M75A 3UDCA 4C0ZA 3HRTA 1PM3A 4OP0A 5KCOA 3JAME 4LDWA 2QA4Q 2CP2A 2EAYA 4IUVA 5FU7C 4RTTA 1KSWA 4MMKA 1YBYA 1NLOC 2QQ9A 2JM8A 2RO0A 1I07A 1OV3A 1RAAB 3HRUA 1WDXA 3OYEA 2V26A 5FWCA 2QDYB 1QQJA 2JS2A 5FROA 4DEXA 4ZNXA 3EG3A 2LX9A 4J6WA 4XTZA 1VQ8T 3SWNA 3RERA 3NFCA 5KCHA 4HCBA 3CXCA 3SDZA 1YJNT 2DVJA 2OTLQ 3QPHA 4IURA 5CKEA 3M56A 3OMGA 4BACA 3MP6A 4WCIA 1Q86R 3JB9J 1G5VA 4PFZA 4FU6A 4N4IA 4DOVA 1IZ6A 2RQWA 1X75C 5LJ5e 5CKDA 4ANJA 4EMKB 3RNJA 1HSQA 3HKSA 1ZSZA 4QQDA 1GBRA 1CKBA 2EIFA 4CC4B 2E41A 1K9AA 4ESRA 2RD1A 5M9OA 3C0CA 3QHSA 5FU6C 4RTZA 3QZ5B 5IHNA 1W70A 2KK4A 2LCSA 1VQMT 1RI0A 5HCKA 4LDXA 1LJOA 4E7LA 2EJGA 1N6AA 4FYVB 3ZL7C 3P8DA 1TTHB 4C92B 1GXIE 4M78B 1VQKT 2X9HA 5GAMd 3HL8A 5GAOr 1D3BB 3OYFA 1R8OB 2LTOA 1WHLA 1Q81U 1N9SA 2QQAA 3QIIA 2JM9A 4OMMA 1VQ7A 3G71A 1YJNA 2WSCE 2DNUA 2EQUA 3JCMf 1FMWA 1GCQA 3OYHA 2E6NA 1LCKA 1PD1A 3EGDA 1H641 2A3LA 2B86A 4XTYA 2RJEA 2JMCA 2ECZA 1WXUA 2DIGA 3A98A 2OTJQ 2VGNA 2VWFA 3KXTA 1YI2T 4M7AA 2QAZA 2DX1A 5GJWB 1NJIR 2YDLA 3H0HA 2A0FB 2CP0A 2F5KA 3M0TA 4C5GA 2PNIA 4HVUA 1Y71A 1AHJB 5GAN7 2EJFA 3EAEA 4C92F 3TEEA 3X28B 2EWNA 5J39A 2ZPGB 2KBTA 2AZSA 2ZCFB 5GMKl 4C5EA 1WXBA 1CKAA 1TH7A 5GAOm 1K73C 4KH0B 4CRIA 1JO8A 2GTOA 4ZN3A 1M3CA 1M3BA 2RMOA 4FSSA 5CKBA 4M7DD 2CS7A 1RAHB 4EMKC 1Y96B 4JJNK 5GAMj 5CCAA 1N5ZA 1KHIA 5GAN5 3VYHB 4JRQA 4M75B 4CC7A 3OS1A 2LX7A 4A4FA 2GCXA 3CCSA 2R5AA 3A8HB 3E9GA 4Z88A 4J6YA 1OQKA 4Z02A 1JXMA 1QMCA 4M77D 5A2QE 1MMNA 3CCEA 4J7FA 1KIKA 3VUBA 2YXYA 2HCKA 3WVDB 3JB9G 4Z8AA 3MEUA 1U8RA 1YWOA 3GIBA 5KYYB 3M9QA 3JCMb 3WXMB 4DOWA 1OZ2A 1T0HA 3HP9A 1MV3A 5GAN4 1NEGA 5CAIA 1OU9A 2L5QA 4M7AB 1PRMC 1NG2A 1VOMA 1IHWA 3TREA 1YJWQ 4J9FA 1WHGA 4DBRA 3EGUA 3QYGB 5CK9A 2AHJB 3CCLA 2HSEB 3G4SQ 2WACA 1X69A 5EC7A 1S72Q 1S1NA 2O2OA 3CXCP 3NMZC 4C92C 3ZBDA 4V2SA 1VYVA 2OJ2A 1X6GA 4IUTA 4PLLA 2DTOA 2QYZA 3ME9A 4DBFA 3QKJA 2RQRA 2D9TA 3I55Q 2ZPBB 4M78A 2BZYA 4QVDA 3PFSA 3CEYA 4TVRA 3QZ9B 2BKDN 2CSIA 4PJNA 2XD0A 2OI3A 1VQ5A 3HRSA 1KQ1A 2EQIA 3C12A 3CPFA 3PIPA 1YJWT 3OYAA 3PGGA 3UT1A 1GBQA 4JRKA 1K73U 1JJ2P 3GBQA 4HVVA 4C0DC 4XU2A 2L3SA 4OMFB 3MEVA 3E2UA 3R6NA 4Y92A 4C0FA 4ZTFA 1Q7YC 2GQIA 2RK1A 2P84A 2A37A 4M75E 5I22A 3G6EQ 3G6EA 2ZAEA 1UGVA 3VUZA 1JU5C 1U3OA 2QEXA 3X26B 3L2VA 3I35A 2I2LA 1UJ0A 2KRMA 3OYNA 3OYIA 5D6WA 2HEQA 3JCMd 2PUOB 3RMQA 2LJ1A 2X3XD 4HA8A 1AWWA 1B34A 1AZEA 2GTJA 3CC2T 1WFWA 4PJOD 2EYQA 3EGXA 1D1AA 4OB2B 4FT4A 1XOVA 3OSVA 4M75G 4X9DA 3JCMJ 1SF9A 1YITA 3OYYA 3LX7A 4M78D 5IN1A 2DL8A 5CR2A 1YJ9A 2IPOB 1VQ5T 4JZ3A 3S6WA 3MO8A 4BE2A 3MHXA 2EGCA 2FRYA 4UC4A 2PU9B 4F04B 3J7AF 2ROLA 2J6OA 1RUWA 1UE9A 4J9BA 4LD9K 4JUVA 1JB0E 1RI9A 4ZTJA 2O9VA 1MHNA 2A08A 3QWXX 2JJ9A 2ROTA 1WNLA 1SRLA 2LNHB 3MPUB 1E7OA 2FZKB 1DJ7B 4M75D 2E3HA 2KROA 4IIOA 4F14A 6AT1B 2P0KA 1VQLT 1UJYA 5IH2A 4HT8A 2H8HA 1VQ6T 2HNIA 2OAWA 2HQXA 3G4SA 1PWTA 4QKUA 2O31A 3UF4A 1PC0A 2JS0A 3G7ZA 3CBOA 2C0IA 2D1XA 2JOYA 3M4YA 2KYBA 3V8JA 2LQWA 3OB9A 1R77A 2LQ8A 2H3JA 3OQ5A 4II1A 3L2UA 1NYGA 2CZ7B 2JVVA 1VQKQ 2YUPA 1YIJT 3UA6A 4GLKA 1KD1R 3M55A 2K2MA 2QTVA 2NUZA 3S3OA 1VQOA 2LCCA 4FYWB 2RHXA 2EQKA 2CP7A 3CPWS 2YSQA 1F1BB 1D0ZA 3FC3A 5IXBA 1YITT 1NE8A 2LNVA 3FJ5A 2VV5A 4BY6C 3F70A 5LJ5f 4ZGJB 4M77C 2CUDA 2DK3A 5CQXA 2DL3A 3TVTA 5IHKA 2X4JA 1JRIA 4C5IA 1TUDA 3JCMc 5GAN6 5KYWB 2DBKA 3CCRQ 1QVFS 3RBBB 1ZBJA 3V7RA 2KQWA 2L3QA 3QJ6A 1ABQA 4N4HA 1W1FA 4M7AD 4HT9A 1TS9A 2RI2A 3EFOA 3CC4A 1G2BA 3CPWA 3FRNA 4M77F 2DD5A 3SEMA 3LH0A 4DEYA 1QCFA 3QSUA 3M0SA 2VB6A 2V1QA 2AZVA 4DBHA 1OEBA 4RCBA 2GGRA 5HKCA 5GANg 3RKWA 3I5RA 5KYUA 4PK4A 2DXTA 1H3HA 2YRDA 3PVQA 4F17A 1W2BP 1H92A 2RHYA 5LL6S 3H0IA 4JS5A 2DD4A 2M0OA 3FDRA 4XU1A 1Y7XA 3CC7Q 5DLQE 1UTIA 2QEXT 1VYUA 5FRMA 4ME7A 3M5AA 3OY9A 2L0AA 4BI8B 2E10A 1Q7YU 2HAXA 5GJVB 2DXUA 3OS0A 4AG1C 4FW2A 4NS5A 1YI2A 1RLPC 3CCMQ 1M1KR 5KYNA 2GQVA 4N0AC 4EMGA 3CMET 2L3RA 2WSFE 1UGPB 2F2XA 2E4HA 2DF6A 3OW2A 3JCMV 2FYKA 4D6WA 4J9DA 3CC2Q 2GBQA 1YNZA 1M2VB 1X2QA 3L2WA 4OMOA 3EFOB 3CC4T 1CSKA 2K3YA 4JRPA 4EMKA 3OYCA 1ZSZB 1NM7A 5GMKi 4BE1A 2QTXA 2EJ9A 5CKFA 2NLUA 1ARKA 1VUBA 3PTAA 2P4TA 2YLBA 1GFCA 5GAN2 1SSHA 1MUZA 1V29B 1M30A 3VV0A 5LJ3h 3CCUA 4P5NA 5GAOn 3FIFA 2XU8A 4MMLA 2CYZB 1TUGB 2RJFA 2ZZDA 1K9MR 2EYZA 4E2FB 2RM4A 4M77B 3FB9A 2HBWA 4LDYA 1TU0B 1P92A 2EQMA 4BD3A 3VS7A 1XNIA 1QLYA 1YITQ 2O88A 3RUXA 1FMVA 1RADB 1C0MA 3OW2S 2K79A 4F7UA 2JNGA 2AIRB 4LD6A 2FL7A 3MP8A 1IB8A 3S3MA 1OOTA 1QVFP 2RK2A 3GNGA 1OX8A 2RQTA 3CCUQ 4M7AF 3V8LA 1UFFA 5CO7A 5GAMg 4JLGA 1FMKA 2QQBA 7AT1B 2NWMA 4F7UG 2QASA 4GY5A 3QXEB 4FL6A 4RTYA 3LYIA 3CCMA 2HSPA 3VS1A 2JW4A 2L3PA 2ESWA 4M78C 4GLMA 1KFZA 1H3ZA 3CCQQ 1JXOA 2RHIA 1GCQC 1SG5A 4M7DG 1BB9A 2CZ0B 5GANe 3CCSQ 2E12A 2GFAA 3DLMA 1WQWA 3CCJA 1AOJA 5LJ5g 2XG8D 1OPLA 2K6DA 1J3TA 5KYXB 1WLPB 2MIOA 1T3SA 3A1PA 1YWPA 5KE2A 2CP5A 3OYMA 1VQPQ 8AT1B 3QUIA 3C94A 4D8KA 2EGAA 2PZ1A 2RHZA 1KQSA 1ZBXA 3I56T 4VUBA 1WZOA 1OPKA 2CP6A 4M77A 4J5YA 5KYUB 1VQ9T 1Y96A 5GMKj 3INZA 3I55A 3X25B 1JEGA 3KBGA 2CREA 1NBEB 2VVKA 3PVLA 2KSSA 1B3QA 3E1SA 2ED0A 2FPEA 5I2SA 3LGLA 2GF7A 1QCOA 5HY6A 2HQHA 4C5HA 1K8AU 2CKKA 1Q86C 2DXCA 1BCOA 2DAQA 2QGFB 2DJZA 1BI1A 3M57A 2ZPIB 1G83A 4PJOG 1RAIB 2EGEA 1O75A 5LJ5j 1M8MA 1V1CA 2LCLA 1R0CB 1QP3A 1SKUB 2QQRA 4M7AG 1KK7A 4A53A 2DXBA 4C8QB 4A4HA 2GFUA 4O5VA 3RKXA 2BZXA 3NGPA 2DBMA 3EG9B 4Y28E 3OS5A 3JV3A 1WI7A 3G6ET 5KYXA 3CBPA 3GF5A 3KUFA 2E5QA 1FX7A 5LJ3f 3FEOA 3D7SB 2PTKA 3A8OB 4R56A 2DE0X 4A4GA 1AT1B 2MK5A 1QVGS 4M78F 1W6XA 3CCLT 2NUTB 2G3RA 4JPBW 1ZUKA 4OB0B 2LMJA 1NLPC 4HCCA 4B9XA 2MPXC 2CH4W 1QKWA 2E65A 2J7IA 4FIBA 5LJ3g 1YJ9Q 4RKUE 4M7AC 4KT0E 3QO3A 2FZGB 4MZMA 5ECAA 1IGQA 3EH1A 1UHCA 4B9WA 3OYLA 2M16A 4J9EA 3TQ7P 2E5KA 1UB4A 2ATCB 2J6KA 1BK2A 1N27A 5IT9E 2F1LA 2YHTA 5CQYA 3NTHA 5CVIA 2K4YA 1VQ8A 2DKGA 1MNEA 3JB9F 3JRZA 2FPFA 2DYBA 3UA7A 4C8QC 1S72T 2EKHA 2D0QB 3G4ST 2MI6A 1QVGA 3I9QA 1G3SA 2MWPA 5LJ5d 4BUGA 1RABB 1K1ZA 1RAFB 2EFIA 2GNCA 4QT7A 2R58A 5FRNA 3QDFA 2P0PA 2K3XA 4N4GA 1TG0A 3VS2A 2H3EB 2A28A 2JUFA 1VQNQ 2OTLA 4A63B 4JZ4A 2C0OA 4BI3A 4RG8A 3VS5A 4AG2C 3HFNA 3V7CA 1RAEB 1VQ9A 2J6FA 2YWWA 2V8IA 3AT1B 5GMKm 4HCKA 5DM7R 2QGGA 2P0QA 3QYHB 2LT4A 2OTLT 4C8QG 1IO6A 4BDZA 3IQLA 4LE9A 1HXDA 2DL5A 4ELZC 4B6MA 2NUPB 4M78G 2K3BA 4M7DA 2ED1A 1XQHA 3JSCA 4LUDA 3CC4Q 1G3TA 1E6HA 2RPNA 2CUBA 3DLLA 4IKFA 1YP5A 2E70A 2Y4YA 4WTOB 3SFMA 1UECA 1ZSGA 3GNFB 3BE3A 2DPPB 2KXDA 5KYYA 1Z9ZA 3PNWC 2EYWA 2HKQB 2XK0A 3RESA 3CCMT 5A0DA 4IUQA 2O4XA 1N9RA 2D8HA 5FW9A 4M7DE 1X6OA 3I56A 4ORZA 4A4EA 1M4ZA 3OSSC 2E3IA 5C6SA 2AKLA 1NPRA 2FB7A 4L5GA 3CC7T 1UHFA 4XTUA 3N5BB 3SHWA 4PJOB 2K7AA 1GRIA 4XU0A 1QWEA 3CCST 1K8AR 4KUIA 2KRNA 4OMNA 1MMAA 1SHGA 1U06A 3BDUA 4C0DB 1HJDA 2M1HA 5GAMe 1M5Q1 1HYOA 2YT6A 2KVQG 2XDPA 1SSFA 5GANd 2LC4A 1U1TA 1R0BG 3A8LB 2MWOA 4M7DF 4N0AA 1VQOT 8ATCB 4LUEA 1EX4A 2EVRA 2HKNA 1VQ7T 4PNOA 3TU4K 3DKMA 1Q82C 1T3LA 2BTTA 1YIJA 3MP1A 1WHMA 1VIFA 2AKKA 3VRYA 3MCAB 4DA4A 3CCET 3EG1A 4E7ZA 3G71Q 4XU3A 1Y07A 2RJCA 2X4YA 1PNJA 4OGEA 3OYKA 2FEIA 2AT1B 3CCRT 2CZ6B 1VQMQ 4MDXA 3QJYA 2DA9A 2VXEA 4AFZC 4Y91A 3M53A 3L1AA 3JCMQ 2ENMA 5HK3A 3CCRA 1HD3A 1WHJA 2MCNA 1ACMB 4QQGA 5IXFA 5GANh 2LRQA 2DETA 2PVGB 2SRCA 3NTIA 4PJOA 1QKXA 3G71T 4X34A 2F2VA 2IIMA 3QDRB 3OMCA 3X24B 2EYXA 3HTRA 1MGQA 2K2VA 2HQEA 3TSWA 3CQTA 2DEUA 3S3NA 3NTKA 4L6V5 1ZQ1A 1NJIU 1RLQC 3M0QA 2CP3A 3GOXA 4RG2A 3CCVT 1I5LA 1VQ7Q 4MZTA 2KMTA 5L8RE 1VQOQ 3CD6T 1VQPT 3VKIA 3M59A 4E7IA 2FRWA 2EQJA 1ABOA 2ABLA 1WJSA 2E6ZA 4XTVA 3EG0A 3OYDA 4XAXB 1D09B 2LT1A 3URGA 2E1HA 1ZLMA 2V8JA 4PJOE 2HL3A 2JTFA 2QG9B 2MAMA 2KR3A 3M0PA 3VS6A 3LWHA 5FLXE 4C8QE 1SRMA 1G3WA 2PVDB 2CZ1B 1VQ6Q 3VS3A 1ZUUA 1EZZB 4J9HA 4NL3A 2Y90A 1Q7YR 2DZCA 5GAOp 1XJWB 2Z0WA 3BDLA 2XIDA 3EGDB 1WIEA 3PMIA 4E6RA 4BDYA 1M1KU 4X1VA 3CD6Q 3VRZA 1X27A 2QA4A 2KT1A 3RMSA 3SWNB 3CMAA 3ZFJA 1MMGA 2F5TX 3I5SA 2PUKB 4LNPA 1ZA2B 2KE9A 2XMFA 3FJPA 3RKYA 2DVEA 1O9SA 2E64A 2FO0A 1X6BA 5L23A 2K5FA 1M90R 2G6FX 2LDMA 2J06A 2DYIA 1Q82R 1G8XA 4JDSA 2DLPA 1AWJA 2A36A 2CSQA 2B8AA 1M90U 3EHQA 2BZ8A 2D0NA 3TSZA 1BIAA 5LJ3e 3OW2P 1K9MU 3JCMe 5FWBA 1Q82U 1M3AA 1Q86U 4ZN1A 2ZPFB 2EW3A 3C95A 2W0ZA 5GAMh 2L8DA 3CCEQ 4J9CA 1FWZA 4QQ6A 3JCMg 2DTHA 3L2ZA 1UUEA 4FM4B 5GAOq 1WJQA 3MJXA 2V1RA 2X35A 3OS2A 5GMKe 2VXFA 1I81A 4WF2A 4RTVA 3J80E 4O6JA 5A0GA 2DM1A 1WYXA 4K11A 4FYYB 1ZA1B 2M02A 2DRKA 3TCJA 4DQ2A 9ATCB 1S72A 3VJPA 3M0RA 1WA7A 1W2BA 1YCYA 1TWBA 3AHUA 1I0CA 1VQPA 1YIJQ 1GL5A 1D0XA 1MV0B 2HL5C 5DY9A 3CCVA 4CC3A 2KEAA 5AT1B 3CMAT 4M4ZA 1KQSS 3QWYA 3JCMP 3RR6A 2DEQA 4Z89A 4EDUA 4PJJA 2VYTA 1GCPA 3Q1JA 4C92D 4NL2A 2RHUA 2KGTA 1D0YA 3SD4A 4EPCA 1VQKA 3OYGA 1AEYA 1BYMA 2JN0A 4A4KA 2K9GA 1YJ9T 4JJCA 1PSFA 3VU3C 1TSFA 4QVCA 4AFUC 1VQ4A 4BB7A 1U5SA 1D3BA 2DMOA 4XQ3A 4OMPA 1PG5B 2FVUA 1ZHIA 3THKA 3HHTB 4OVAA 2X4XA 3EH2A 5LJ3d 1PCXA 1EIFA 2HD0A 5GANf 1W2BS 3ER0A 4KGXB 2NUPA 1KC8R 1NJIC 3R6OA 2DTIA 4FSXA 2COZA 1PKTA 2YUNA 1OX9A 2EKOA 2CT3A 3OBWA 3GLXA 5IHIA 3MKDA 3RDVA 1GFDA 1JJ2S 1AWXA 1YHQQ 2RNAA 2L2PA 2W10A 2K5LA 2WSEE 4KRTA 3A5ZB 5IAYA 5D6XA 2R57A 1ZSZC 3FLGA 2KNBB 1VYTA 2JTMA 1IRXA 1M2VA 3CPWP 2ZGWA 4ZGDB 2LJ3A 4JRIA 1VQNT 1I5OB 1VQ6A 4C92E 3L42A 5D6YA 1KQSP 4F7UF 4C8QD 1TOVA 1KJWA 1Y57A 2PQWA 1M1FA 2LP5A 1WXTA 4RTXA 4E7HA 3CXCS 1IHVA 3PE0A 2RH2A 1LPLA 1MNDA 4BI4A 4L59A 4BY6B 1Z9QA 1SHFA 1VQ9Q 2V8KA 2NYSA 2QQSA 3JCMX 4FYXB 1AZGB 2RI5A 1M2OA 2CGHA 1K8AC 2A7YA 4C92A 2LZ6B 1K73R 4M7DC 2BE7D 3OBYA 2KXCA 4C8QF 3EHRA 5LJ3j 2DZ9A 2VASA 1LOJA 4HCZA 1BKBA 3H0FA 5HK0A 3CMEA 3CCJT 3O5ZA 1YI2Q 1VQLQ 1I8FA 4M75C 4Q5WA 1LNXA 1YJWA 2DL7A 1OYXA 2Y4XA 3CCLQ 4JJBA 4PJMA 2OAUA 1ZX6A 4LDUA 3EFSA 4LDVA 2YUOA 4J6XA 2OTJA 3CC7A 2MF2A 4AMCA 1X01A 4D8DA 1T0JA 1IREB 1K76A 3UWNA 3JB9H 3ASKA 1A0NB 5J3BA 1N8RU 4J9IA 3JCMW 3DB4A 2XHCA 2RQUA 2HMAA 4C8QA 4HKEA 2O01E 4OGCA 3P8BB 4X9CA 2LJ0A 3EG9A 3PIOA 2KDSA 3A8GB 1WX6A 2KT8A 1JBMA 4R55A 3GPLA 4IUUA 4LN2A 4M78E 4A54A 1M9SA 3LLRA 2K5IA 2EBPA 2X4WA 4PL6A 1UG1A 2KI7A 3SWNC 4JS4A 3QG1A 2LQKA 2XI9A 2IG0A 2RJDA 3CBMA 1B7TA 2DL4A 3M0UA 1Q95G 2DJQA 4XTWA 3RIRA 4FCYA 4RMOA 2OX7A 1UGRB 4C92G 3M54A 5GAN8 4DBQA 4RTWA 3NPFA 2D8JA 4YTLA 1FXXA 4QW2A 1M90C 4ELYC 2DO3A 4QVZA 5KH6A 4AFSC 3O8VA 4ZGEB 1UGQB 3UPUA 4MZPA 3META 2DFUA 4FT2A 1N8RC 3HFOA 2YLCA 2VGMA 3V8KA 2FZCB 1BCMA 1UEBA 3I56Q 2HZYA 2C06A 1D1CA 4KULA 3OA6A 2M9UA 4IUPA 1QP2A 1OU8A 1I4K1 3VS4A 4EMHA 1VIEA 1BIBA 1JQQA 4KBMB 1BU1A 3H8ZA 1IGUA 1PHTA 3C4SA 3CC2A 2KYMA 1QCNA 1KC8U 4CC2A 1WQ7A 4PJOC 2SEMA 1K0XA 3CCQT 1KD1U 2QA4T 3GP8A 4KGZB 1VA7A 4PLIA 3OYBA 1AD5A 1D1BA 4R0KA 2K57A 5LJ5h 1PRLC 4E7KA 4C0GA 2RI3A 2MYSA 3CCQA 2RA2A 1QWFA 3E9FA 3BFMA 3PMTA 3JCMh 2OTJT 3PT9A 5FU7B 5I2MA 1V76A 4OMQA 1G3YA 2P4RA 2IVWA 4M77E 4E47A 1E6GA 3J81E 2EPDA 4PFPA 2JTEA 4J83A 1VQMA 1AVZC 4MDWA 1NPPA 2FHDA 1OZ3A 3CCJQ 1K4US 3EFRA 5GMKh 1Q81C 4IIMA 1VQ4T 2F2WA 2YRCA 3L2QA 1VQNA 1UDLA 1WHKA 1EFNA 1UGSB 4KH1B 1WGSA 1NYFA 3REAB 2FG0A 4AFQC 3P8HA 4F16A 4LXCA 4E7SA 5GANj 4M7AE 1BBZA 3LWIA 1YFNA 5D7UA 4XK8E 4OF1A 2YUQA 2XKOC 1TXQA 4FW1A 2DERA 2JXBA 1SEMA 2RQVA 2C0TA 2MOXA 1YN8A 5EG2A 1TUCA 2RN8A 1LVKA 3ZEHA 1HK9A 5GAMf 3VYGA 1BI3A 4PJLA 1OI1A 1RL2A 2QK0A 5I11A 5C0MA 3JB9D 1XTDA 4M75F 2RF0A 1X2KA 1OULA 1NEBA 3KFVA 1B34B 4KUDK 1KG1A 2L89A 5GAN3 3REBB 2DIQA 3EGXB 1YHQT 4M7DB 5DLOA 2BE9B 4RCCA 4ATOA 2AK5A 1QVPA 3HSBA 1SPKA 2I0NA 2RB6A 4PKCC 1I1JA 2COWA 2CH4A 1PD0A 3T9NA 4F7UB 1M27C 4CI0C 3UATA 5A0LA 3LH5A 4GBQA 3M4GA 2YRVA 3OYJA 1C1AA 3NHNA 3X20B 4PJOF 1Y0MA 3V7SA 1M8VA 1PKSA 2QI2A 2O4XB 1M1GA 3BW1A 5CIUA 2VC8A 2LVMA 5CKHA 1IXDA 3CCUT 1WPYA 3BY7A 4KGVB 2CT4A 3CCVQ 4J9GA 1ZUYA 1B07A 2HDAA 1Q81R 3CMAQ 2KRSA 1C6VX 3SB2A 5KE3A 3EG2A 4NOYA 3M58A 3JB9I 3QBYA 2DRMA 2KAFA 2PVOB 4OMLA 2J05A 1BI0A 4JJDA 3VS0A 4OB1B 1KHCA 4HXJA 1VQ5Q 1K0SA 3A8MB 2VKNA 2HBPA 5I21A 1KD1C 4J8OA 3H6ZA 2XICA 1RACB 1H8KA 4RTUA 3LW5E 2ZPEB
chains in the Genus database with same CATH topology
3THKA 2CH4W 1QKWA 2DL8A 2J7IA 4JZ3A 4RUGA 2CDTA 2EGCA 2FRYA 5ECAA 2ROLA 2J6OA 1UHCA 1RUWA 1UE9A 1PKTA 2YUNA 4J9BA 2CT3A 2DILA 5IHIA 4J9EA 2JT4A 1RI9A 1GFDA 2E5KA 2O9VA 1AWXA 2A08A 2RNAA 2L2PA 3QWXX 2J6KA 1BK2A 2W10A 2ROTA 2LNHB 1SRLA 4KRTA 2M0YA 1E7OA 2QDLA 4HVWA 2X3WD 2JMAA 2KNBB 2KROA 1VYTA 1FYNA 4IIOA 4F14A 2FPFA 2DYBA 3UA7A 2EKHA 2LJ3A 1UJYA 3I9QA 5IH2A 1K1ZA 2H8HA 2O9SA 2OAWA 1KJWA 3ULRB 1PWTA 2GNCA 4QT7A 2M51A 1Y57A 2LQNA 2O31A 2LP5A 3UF4A 1AWOA 1WXTA 3U23A 2JS0A 2EYYA 1TG0A 1X43A 4RTXA 3VS2A 2A28A 4A63B 2C0IA 2D1XA 2C0OA 3PE0A 4JZ4A 3VS5A 4AG2C 2KYBA 2LQWA 2FPDA 1NYGA 1Z9QA 1SHFA 2YUPA 2J6FA 3UA6A 3H41A 4HCKA 1AZGB 1YCSB 2K2MA 2NUZA 4EIKA 1IO6A 3IQLA 4LE9A 2LZ6B 2DL5A 2YSQA 2K3BA 2KXCA 2ED1A 4RTTA 3EHRA 5IXBA 1KSWA 4LUDA 1E6HA 3H0FA 2RPNA 1NLOC 2CUBA 2JM8A 1I07A 1YP5A 1OV3A 3FJ5A 3O5ZA 1UECA 1ZSGA 1WDXA 2CUDA 2DL7A 5FWCA 2KXDA 2DL3A 2JS2A 3TVTA 4DEXA 5IHKA 3EG3A 1Z9ZA 4ZNXA 2EYWA 4JJBA 1TUDA 1ZX6A 2DBKA 2YUOA 2DVJA 3RBBB 4D8DA 1ZBJA 1T0JA 1K76A 2L3QA 1A0NB 4WCIA 4J9IA 1NLPC 1ABQA 2D8HA 1W1FA 5FW9A 4ORZA 2AKLA 2RQWA 2RQUA 1UHFA 1G2BA 3SHWA 2K7AA 1GRIA 2LJ0A 3SEMA 3RNJA 1HSQA 1QWEA 1QCFA 4DEYA 2KRNA 4OMNA 1WX6A 2KT8A 1GBRA 1CKBA 3M0SA 1SHGA 4CC4B 1U06A 1K9AA 4ESRA 1HJDA 2V1QA 4LN2A 2AZVA 3C0CA 1OEBA 4RTZA 5IHNA 1W70A 2YT6A 2LCSA 2EBPA 2GGRA 5HCKA 1UG1A 3I5RA 3ZL7C 1H3HA 2DL4A 3M0UA 3PVQA 2DJQA 4F17A 1H92A 4LUEA 2EVRA 3H0IA 4RTWA 3NPFA 2D8JA 1T3LA 2BTTA 4AFSC 1UTIA 2JM9A 1VYUA 4OMMA 2AKKA 3VRYA 3EG1A 2L0AA 2DNUA 5GJVB 1GCQA 4AG1C 1LCKA 1PNJA 1RLPC 2FEIA 2B86A 2JMCA 2DA9A 2ECZA 3VS4A 1WXUA 4AFZC 1JQQA 1BU1A 2F2XA 2DF6A 2ENMA 3A98A 1PHTA 1HD3A 2VWFA 4J9DA 2MCNA 5IXFA 2GBQA 2KYMA 1YNZA 1X2QA 2DX1A 5GJWB 2YDLA 3H0HA 4OMOA 4CC2A 1CSKA 2SRCA 3M0TA 1QKXA 2SEMA 2PNIA 1K0XA 4HVUA 2F2VA 2IIMA 2EYXA 3TSWA 1NM7A 3CQTA 1VA7A 1AD5A 1ARKA 4R0KA 1PRLC 2KBTA 1GFCA 2AZSA 1SSHA 1MUZA 1RLQC 1M30A 3M0QA 1QWFA 1WXBA 1CKAA 1JO8A 2GTOA 1M3CA 1M3BA 2FRWA 2RMOA 4FSSA 4OMQA 2EYZA 1ABOA 2P4RA 2ABLA 1E6GA 2EPDA 2JTEA 3EG0A 1AVZC 2HBWA 1K4US 1ZLMA 1N5ZA 4IIMA 3VS7A 2F2WA 1QLYA 2KR3A 4CC7A 2LX7A 1UDLA 3M0PA 3VS6A 2O88A 1EFNA 1SRMA 2K79A 4Z88A 3VS3A 1ZUUA 1NYFA 4J9HA 3REAB 2FG0A 1JXMA 4AFQC 1OOTA 1KIKA 4F16A 2HCKA 4Z8AA 1WIEA 4E6RA 2RQTA 4X1VA 1YWOA 1BBZA 1UFFA 3VRZA 1FMKA 1X27A 2KT1A 1T0HA 2YUQA 1MV3A 2NWMA 1NEGA 4RTYA 2JXBA 2HSPA 1SEMA 3VS1A 2RQVA 2JW4A 3I5SA 2C0TA 2L3PA 4LNPA 2ESWA 2MOXA 4GLMA 1KFZA 1PRMC 2KE9A 1YN8A 1JXOA 1TUCA 2XMFA 2RN8A 1NG2A 1GCQC 1BB9A 2FO0A 1X6BA 4J9FA 5L23A 2G6FX 3EGUA 2J06A 1AOJA 5I11A 1OPLA 1X69A 5EC7A 1S1NA 2K6DA 1J3TA 1WLPB 2MIOA 1T3SA 2DLPA 1YWPA 2O2OA 1AWJA 2RF0A 1X2KA 3NMZC 2A36A 1NEBA 3KFVA 2CSQA 3EHQA 1VYVA 2BZ8A 2D0NA 4D8KA 2OJ2A 1X6GA 2EGAA 3REBB 2PZ1A 3TSZA 5FWBA 1OPKA 1M3AA 2RQRA 2EW3A 2AK5A 2W0ZA 4J9CA 1JEGA 1SPKA 2I0NA 1I1JA 1UUEA 2CREA 2BZYA 2VVKA 3PVLA 1B3QA 2CH4A 2ED0A 2V1RA 1M27C 2CSIA 2FPEA 3UATA 3LH5A 2OI3A 4GBQA 2EQIA 4RTVA 2DM1A 1WYXA 4K11A 3NHNA 1GBQA 3GBQA 4HVVA 1Y0MA 2L3SA 2DRKA 1PKSA 1G83A 3R6NA 3M0RA 4Y92A 1WA7A 2EGEA 1I0CA 2GQIA 1GL5A 1M8MA 1V1CA 2A37A 1MV0B 5I22A 1UGVA 2CT4A 2KEAA 1JU5C 4M4ZA 1U3OA 4CC3A 2BZXA 3NGPA 2DBMA 3QWYA 4J9GA 1ZUYA 1B07A 2HDAA 3I35A 4Z89A 2KRMA 1UJ0A 3JV3A 1WI7A 2KRSA 1GCPA 2HEQA 3EG2A 2KGTA 2LJ1A 2DRMA 2X3XD 1AEYA 4OMLA 2J05A 4JJDA 1AWWA 2PTKA 3VS0A 1AZEA 4HXJA 2K9GA 2DE0X 1K0SA 2GTJA 4JJCA 1WFWA 2VKNA 4AFUC 1W6XA 1U5SA 1XOVA 1H8KA 4JPBW 2DMOA 1ZUKA 4RTUA 4OMPA 2LMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3THK A;  2CH4 W;  1QKW A;  2DL8 A;  2J7I A;  4JZ3 A;  4RUG A;  2CDT A;  2EGC A;  2FRY A;  5ECA A;  2ROL A;  2J6O A;  1UHC A;  1RUW A;  1UE9 A;  1PKT A;  2YUN A;  4J9B A;  2CT3 A;  2DIL A;  5IHI A;  4J9E A;  2JT4 A;  1RI9 A;  1GFD A;  2E5K A;  2O9V A;  1AWX A;  2A08 A;  2RNA A;  2L2P A;  3QWX X;  2J6K A;  1BK2 A;  2W10 A;  2ROT A;  2LNH B;  1SRL A;  4KRT A;  2M0Y A;  1E7O A;  2QDL A;  4HVW A;  2X3W D;  2JMA A;  2KNB B;  2KRO A;  1VYT A;  1FYN A;  4IIO A;  4F14 A;  2FPF A;  2DYB A;  3UA7 A;  2EKH A;  2LJ3 A;  1UJY A;  3I9Q A;  5IH2 A;  1K1Z A;  2H8H A;  2O9S A;  2OAW A;  1KJW A;  3ULR B;  1PWT A;  2GNC A;  4QT7 A;  2M51 A;  1Y57 A;  2LQN A;  2O31 A;  2LP5 A;  3UF4 A;  1AWO A;  1WXT A;  3U23 A;  2JS0 A;  2EYY A;  1TG0 A;  1X43 A;  4RTX A;  3VS2 A;  2A28 A;  4A63 B;  2C0I A;  2D1X A;  2C0O A;  3PE0 A;  4JZ4 A;  3VS5 A;  4AG2 C;  2KYB A;  2LQW A;  2FPD A;  1NYG A;  1Z9Q A;  1SHF A;  2YUP A;  2J6F A;  3UA6 A;  3H41 A;  4HCK A;  1AZG B;  1YCS B;  2K2M A;  2NUZ A;  4EIK A;  1IO6 A;  3IQL A;  4LE9 A;  2LZ6 B;  2DL5 A;  2YSQ A;  2K3B A;  2KXC A;  2ED1 A;  4RTT A;  3EHR A;  5IXB A;  1KSW A;  4LUD A;  1E6H A;  3H0F A;  2RPN A;  1NLO C;  2CUB A;  2JM8 A;  1I07 A;  1YP5 A;  1OV3 A;  3FJ5 A;  3O5Z A;  1UEC A;  1ZSG A;  1WDX A;  2CUD A;  2DL7 A;  5FWC A;  2KXD A;  2DL3 A;  2JS2 A;  3TVT A;  4DEX A;  5IHK A;  3EG3 A;  1Z9Z A;  4ZNX A;  2EYW A;  4JJB A;  1TUD A;  1ZX6 A;  2DBK A;  2YUO A;  2DVJ A;  3RBB B;  4D8D A;  1ZBJ A;  1T0J A;  1K76 A;  2L3Q A;  1A0N B;  4WCI A;  4J9I A;  1NLP C;  1ABQ A;  2D8H A;  1W1F A;  5FW9 A;  4ORZ A;  2AKL A;  2RQW A;  2RQU A;  1UHF A;  1G2B A;  3SHW A;  2K7A A;  1GRI A;  2LJ0 A;  3SEM A;  3RNJ A;  1HSQ A;  1QWE A;  1QCF A;  4DEY A;  2KRN A;  4OMN A;  1WX6 A;  2KT8 A;  1GBR A;  1CKB A;  3M0S A;  1SHG A;  4CC4 B;  1U06 A;  1K9A A;  4ESR A;  1HJD A;  2V1Q A;  4LN2 A;  2AZV A;  3C0C A;  1OEB A;  4RTZ A;  5IHN A;  1W70 A;  2YT6 A;  2LCS A;  2EBP A;  2GGR A;  5HCK A;  1UG1 A;  3I5R A;  3ZL7 C;  1H3H A;  2DL4 A;  3M0U A;  3PVQ A;  2DJQ A;  4F17 A;  1H92 A;  4LUE A;  2EVR A;  3H0I A;  4RTW A;  3NPF A;  2D8J A;  1T3L A;  2BTT A;  4AFS C;  1UTI A;  2JM9 A;  1VYU A;  4OMM A;  2AKK A;  3VRY A;  3EG1 A;  2L0A A;  2DNU A;  5GJV B;  1GCQ A;  4AG1 C;  1LCK A;  1PNJ A;  1RLP C;  2FEI A;  2B86 A;  2JMC A;  2DA9 A;  2ECZ A;  3VS4 A;  1WXU A;  4AFZ C;  1JQQ A;  1BU1 A;  2F2X A;  2DF6 A;  2ENM A;  3A98 A;  1PHT A;  1HD3 A;  2VWF A;  4J9D A;  2MCN A;  5IXF A;  2GBQ A;  2KYM A;  1YNZ A;  1X2Q A;  2DX1 A;  5GJW B;  2YDL A;  3H0H A;  4OMO A;  4CC2 A;  1CSK A;  2SRC A;  3M0T A;  1QKX A;  2SEM A;  2PNI A;  1K0X A;  4HVU A;  2F2V A;  2IIM A;  2EYX A;  3TSW A;  1NM7 A;  3CQT A;  1VA7 A;  1AD5 A;  1ARK A;  4R0K A;  1PRL C;  2KBT A;  1GFC A;  2AZS A;  1SSH A;  1MUZ A;  1RLQ C;  1M30 A;  3M0Q A;  1QWF A;  1WXB A;  1CKA A;  1JO8 A;  2GTO A;  1M3C A;  1M3B A;  2FRW A;  2RMO A;  4FSS A;  4OMQ A;  2EYZ A;  1ABO A;  2P4R A;  2ABL A;  1E6G A;  2EPD A;  2JTE A;  3EG0 A;  1AVZ C;  2HBW A;  1K4U S;  1ZLM A;  1N5Z A;  4IIM A;  3VS7 A;  2F2W A;  1QLY A;  2KR3 A;  4CC7 A;  2LX7 A;  1UDL A;  3M0P A;  3VS6 A;  2O88 A;  1EFN A;  1SRM A;  2K79 A;  4Z88 A;  3VS3 A;  1ZUU A;  1NYF A;  4J9H A;  3REA B;  2FG0 A;  1JXM A;  4AFQ C;  1OOT A;  1KIK A;  4F16 A;  2HCK A;  4Z8A A;  1WIE A;  4E6R A;  2RQT A;  4X1V A;  1YWO A;  1BBZ A;  1UFF A;  3VRZ A;  1FMK A;  1X27 A;  2KT1 A;  1T0H A;  2YUQ A;  1MV3 A;  2NWM A;  1NEG A;  4RTY A;  2JXB A;  2HSP A;  1SEM A;  3VS1 A;  2RQV A;  2JW4 A;  3I5S A;  2C0T A;  2L3P A;  4LNP A;  2ESW A;  2MOX A;  4GLM A;  1KFZ A;  1PRM C;  2KE9 A;  1YN8 A;  1JXO A;  1TUC A;  2XMF A;  2RN8 A;  1NG2 A;  1GCQ C;  1BB9 A;  2FO0 A;  1X6B A;  4J9F A;  5L23 A;  2G6F X;  3EGU A;  2J06 A;  1AOJ A;  5I11 A;  1OPL A;  1X69 A;  5EC7 A;  1S1N A;  2K6D A;  1J3T A;  1WLP B;  2MIO A;  1T3S A;  2DLP A;  1YWP A;  2O2O A;  1AWJ A;  2RF0 A;  1X2K A;  3NMZ C;  2A36 A;  1NEB A;  3KFV A;  2CSQ A;  3EHQ A;  1VYV A;  2BZ8 A;  2D0N A;  4D8K A;  2OJ2 A;  1X6G A;  2EGA A;  3REB B;  2PZ1 A;  3TSZ A;  5FWB A;  1OPK A;  1M3A A;  2RQR A;  2EW3 A;  2AK5 A;  2W0Z A;  4J9C A;  1JEG A;  1SPK A;  2I0N A;  1I1J A;  1UUE A;  2CRE A;  2BZY A;  2VVK A;  3PVL A;  1B3Q A;  2CH4 A;  2ED0 A;  2V1R A;  1M27 C;  2CSI A;  2FPE A;  3UAT A;  3LH5 A;  2OI3 A;  4GBQ A;  2EQI A;  4RTV A;  2DM1 A;  1WYX A;  4K11 A;  3NHN A;  1GBQ A;  3GBQ A;  4HVV A;  1Y0M A;  2L3S A;  2DRK A;  1PKS A;  1G83 A;  3R6N A;  3M0R A;  4Y92 A;  1WA7 A;  2EGE A;  1I0C A;  2GQI A;  1GL5 A;  1M8M A;  1V1C A;  2A37 A;  1MV0 B;  5I22 A;  1UGV A;  2CT4 A;  2KEA A;  1JU5 C;  4M4Z A;  1U3O A;  4CC3 A;  2BZX A;  3NGP A;  2DBM A;  3QWY A;  4J9G A;  1ZUY A;  1B07 A;  2HDA A;  3I35 A;  4Z89 A;  2KRM A;  1UJ0 A;  3JV3 A;  1WI7 A;  2KRS A;  1GCP A;  2HEQ A;  3EG2 A;  2KGT A;  2LJ1 A;  2DRM A;  2X3X D;  1AEY A;  4OML A;  2J05 A;  4JJD A;  1AWW A;  2PTK A;  3VS0 A;  1AZE A;  4HXJ A;  2K9G A;  2DE0 X;  1K0S A;  2GTJ A;  4JJC A;  1WFW A;  2VKN A;  4AFU C;  1W6X A;  1U5S A;  1XOV A;  1H8K A;  4JPB W;  2DMO A;  1ZUK A;  4RTU A;  4OMP A;  2LMJ A; 
#chains in the Genus database with same CATH topology
 1VQL A;  2VUB A;  2F69 A;  1RAG B;  2KY9 A;  4M77 G;  4PFO A;  4RUG A;  2CDT A;  1KQ2 A;  3DB3 A;  1NZ9 A;  4BE0 A;  2DIL A;  4F7U E;  1PSE A;  5FU6 B;  2JT4 A;  3MEW A;  1BI2 A;  2XDD A;  1YHQ A;  3H9N A;  2XDB A;  2COY A;  2M0Y A;  1YJN Q;  1M1K C;  1WHH A;  2QDL A;  4HVW A;  1VQ8 Q;  2X3W D;  5KYW A;  2JMA A;  3CME Q;  1FYN A;  2BIV A;  2X51 A;  1WJR A;  1N8R R;  3HPW A;  1U1S A;  2JZ2 A;  2O9S A;  4AT1 B;  3L2R A;  3LGF A;  3ULR B;  3G1J A;  2R5M A;  5J26 A;  1MMD A;  2MMP A;  2M51 A;  1QW1 A;  2LQN A;  2BUD A;  4J7I A;  1VQ4 Q;  2D6F A;  4OB3 B;  1AWO A;  3E19 A;  2QEX Q;  3MEA A;  3U23 A;  2EYY A;  1X43 A;  1KC8 C;  3CD6 A;  1QVF A;  4XTX A;  4JLI A;  2FPD A;  3I55 T;  2QXF A;  1W4S A;  4E7J A;  5GAO l;  2ZPH B;  5AYF A;  1JJ2 A;  3H41 A;  2NUT A;  3WVE B;  1QVG P;  1YCS B;  1K9M C;  4EIK A;  4M75 A;  3UDC A;  4C0Z A;  3HRT A;  1PM3 A;  4OP0 A;  5KCO A;  3JAM E;  4LDW A;  2QA4 Q;  2CP2 A;  2EAY A;  4IUV A;  5FU7 C;  4RTT A;  1KSW A;  4MMK A;  1YBY A;  1NLO C;  2QQ9 A;  2JM8 A;  2RO0 A;  1I07 A;  1OV3 A;  1RAA B;  3HRU A;  1WDX A;  3OYE A;  2V26 A;  5FWC A;  2QDY B;  1QQJ A;  2JS2 A;  5FRO A;  4DEX A;  4ZNX A;  3EG3 A;  2LX9 A;  4J6W A;  4XTZ A;  1VQ8 T;  3SWN A;  3RER A;  3NFC A;  5KCH A;  4HCB A;  3CXC A;  3SDZ A;  1YJN T;  2DVJ A;  2OTL Q;  3QPH A;  4IUR A;  5CKE A;  3M56 A;  3OMG A;  4BAC A;  3MP6 A;  4WCI A;  1Q86 R;  3JB9 J;  1G5V A;  4PFZ A;  4FU6 A;  4N4I A;  4DOV A;  1IZ6 A;  2RQW A;  1X75 C;  5LJ5 e;  5CKD A;  4ANJ A;  4EMK B;  3RNJ A;  1HSQ A;  3HKS A;  1ZSZ A;  4QQD A;  1GBR A;  1CKB A;  2EIF A;  4CC4 B;  2E41 A;  1K9A A;  4ESR A;  2RD1 A;  5M9O A;  3C0C A;  3QHS A;  5FU6 C;  4RTZ A;  3QZ5 B;  5IHN A;  1W70 A;  2KK4 A;  2LCS A;  1VQM T;  1RI0 A;  5HCK A;  4LDX A;  1LJO A;  4E7L A;  2EJG A;  1N6A A;  4FYV B;  3ZL7 C;  3P8D A;  1TTH B;  4C92 B;  1GXI E;  4M78 B;  1VQK T;  2X9H A;  5GAM d;  3HL8 A;  5GAO r;  1D3B B;  3OYF A;  1R8O B;  2LTO A;  1WHL A;  1Q81 U;  1N9S A;  2QQA A;  3QII A;  2JM9 A;  4OMM A;  1VQ7 A;  3G71 A;  1YJN A;  2WSC E;  2DNU A;  2EQU A;  3JCM f;  1FMW A;  1GCQ A;  3OYH A;  2E6N A;  1LCK A;  1PD1 A;  3EGD A;  1H64 1;  2A3L A;  2B86 A;  4XTY A;  2RJE A;  2JMC A;  2ECZ A;  1WXU A;  2DIG A;  3A98 A;  2OTJ Q;  2VGN A;  2VWF A;  3KXT A;  1YI2 T;  4M7A A;  2QAZ A;  2DX1 A;  5GJW B;  1NJI R;  2YDL A;  3H0H A;  2A0F B;  2CP0 A;  2F5K A;  3M0T A;  4C5G A;  2PNI A;  4HVU A;  1Y71 A;  1AHJ B;  5GAN 7;  2EJF A;  3EAE A;  4C92 F;  3TEE A;  3X28 B;  2EWN A;  5J39 A;  2ZPG B;  2KBT A;  2AZS A;  2ZCF B;  5GMK l;  4C5E A;  1WXB A;  1CKA A;  1TH7 A;  5GAO m;  1K73 C;  4KH0 B;  4CRI A;  1JO8 A;  2GTO A;  4ZN3 A;  1M3C A;  1M3B A;  2RMO A;  4FSS A;  5CKB A;  4M7D D;  2CS7 A;  1RAH B;  4EMK C;  1Y96 B;  4JJN K;  5GAM j;  5CCA A;  1N5Z A;  1KHI A;  5GAN 5;  3VYH B;  4JRQ A;  4M75 B;  4CC7 A;  3OS1 A;  2LX7 A;  4A4F A;  2GCX A;  3CCS A;  2R5A A;  3A8H B;  3E9G A;  4Z88 A;  4J6Y A;  1OQK A;  4Z02 A;  1JXM A;  1QMC A;  4M77 D;  5A2Q E;  1MMN A;  3CCE A;  4J7F A;  1KIK A;  3VUB A;  2YXY A;  2HCK A;  3WVD B;  3JB9 G;  4Z8A A;  3MEU A;  1U8R A;  1YWO A;  3GIB A;  5KYY B;  3M9Q A;  3JCM b;  3WXM B;  4DOW A;  1OZ2 A;  1T0H A;  3HP9 A;  1MV3 A;  5GAN 4;  1NEG A;  5CAI A;  1OU9 A;  2L5Q A;  4M7A B;  1PRM C;  1NG2 A;  1VOM A;  1IHW A;  3TRE A;  1YJW Q;  4J9F A;  1WHG A;  4DBR A;  3EGU A;  3QYG B;  5CK9 A;  2AHJ B;  3CCL A;  2HSE B;  3G4S Q;  2WAC A;  1X69 A;  5EC7 A;  1S72 Q;  1S1N A;  2O2O A;  3CXC P;  3NMZ C;  4C92 C;  3ZBD A;  4V2S A;  1VYV A;  2OJ2 A;  1X6G A;  4IUT A;  4PLL A;  2DTO A;  2QYZ A;  3ME9 A;  4DBF A;  3QKJ A;  2RQR A;  2D9T A;  3I55 Q;  2ZPB B;  4M78 A;  2BZY A;  4QVD A;  3PFS A;  3CEY A;  4TVR A;  3QZ9 B;  2BKD N;  2CSI A;  4PJN A;  2XD0 A;  2OI3 A;  1VQ5 A;  3HRS A;  1KQ1 A;  2EQI A;  3C12 A;  3CPF A;  3PIP A;  1YJW T;  3OYA A;  3PGG A;  3UT1 A;  1GBQ A;  4JRK A;  1K73 U;  1JJ2 P;  3GBQ A;  4HVV A;  4C0D C;  4XU2 A;  2L3S A;  4OMF B;  3MEV A;  3E2U A;  3R6N A;  4Y92 A;  4C0F A;  4ZTF A;  1Q7Y C;  2GQI A;  2RK1 A;  2P84 A;  2A37 A;  4M75 E;  5I22 A;  3G6E Q;  3G6E A;  2ZAE A;  1UGV A;  3VUZ A;  1JU5 C;  1U3O A;  2QEX A;  3X26 B;  3L2V A;  3I35 A;  2I2L A;  1UJ0 A;  2KRM A;  3OYN A;  3OYI A;  5D6W A;  2HEQ A;  3JCM d;  2PUO B;  3RMQ A;  2LJ1 A;  2X3X D;  4HA8 A;  1AWW A;  1B34 A;  1AZE A;  2GTJ A;  3CC2 T;  1WFW A;  4PJO D;  2EYQ A;  3EGX A;  1D1A A;  4OB2 B;  4FT4 A;  1XOV A;  3OSV A;  4M75 G;  4X9D A;  3JCM J;  1SF9 A;  1YIT A;  3OYY A;  3LX7 A;  4M78 D;  5IN1 A;  2DL8 A;  5CR2 A;  1YJ9 A;  2IPO B;  1VQ5 T;  4JZ3 A;  3S6W A;  3MO8 A;  4BE2 A;  3MHX A;  2EGC A;  2FRY A;  4UC4 A;  2PU9 B;  4F04 B;  3J7A F;  2ROL A;  2J6O A;  1RUW A;  1UE9 A;  4J9B A;  4LD9 K;  4JUV A;  1JB0 E;  1RI9 A;  4ZTJ A;  2O9V A;  1MHN A;  2A08 A;  3QWX X;  2JJ9 A;  2ROT A;  1WNL A;  1SRL A;  2LNH B;  3MPU B;  1E7O A;  2FZK B;  1DJ7 B;  4M75 D;  2E3H A;  2KRO A;  4IIO A;  4F14 A;  6AT1 B;  2P0K A;  1VQL T;  1UJY A;  5IH2 A;  4HT8 A;  2H8H A;  1VQ6 T;  2HNI A;  2OAW A;  2HQX A;  3G4S A;  1PWT A;  4QKU A;  2O31 A;  3UF4 A;  1PC0 A;  2JS0 A;  3G7Z A;  3CBO A;  2C0I A;  2D1X A;  2JOY A;  3M4Y A;  2KYB A;  3V8J A;  2LQW A;  3OB9 A;  1R77 A;  2LQ8 A;  2H3J A;  3OQ5 A;  4II1 A;  3L2U A;  1NYG A;  2CZ7 B;  2JVV A;  1VQK Q;  2YUP A;  1YIJ T;  3UA6 A;  4GLK A;  1KD1 R;  3M55 A;  2K2M A;  2QTV A;  2NUZ A;  3S3O A;  1VQO A;  2LCC A;  4FYW B;  2RHX A;  2EQK A;  2CP7 A;  3CPW S;  2YSQ A;  1F1B B;  1D0Z A;  3FC3 A;  5IXB A;  1YIT T;  1NE8 A;  2LNV A;  3FJ5 A;  2VV5 A;  4BY6 C;  3F70 A;  5LJ5 f;  4ZGJ B;  4M77 C;  2CUD A;  2DK3 A;  5CQX A;  2DL3 A;  3TVT A;  5IHK A;  2X4J A;  1JRI A;  4C5I A;  1TUD A;  3JCM c;  5GAN 6;  5KYW B;  2DBK A;  3CCR Q;  1QVF S;  3RBB B;  1ZBJ A;  3V7R A;  2KQW A;  2L3Q A;  3QJ6 A;  1ABQ A;  4N4H A;  1W1F A;  4M7A D;  4HT9 A;  1TS9 A;  2RI2 A;  3EFO A;  3CC4 A;  1G2B A;  3CPW A;  3FRN A;  4M77 F;  2DD5 A;  3SEM A;  3LH0 A;  4DEY A;  1QCF A;  3QSU A;  3M0S A;  2VB6 A;  2V1Q A;  2AZV A;  4DBH A;  1OEB A;  4RCB A;  2GGR A;  5HKC A;  5GAN g;  3RKW A;  3I5R A;  5KYU A;  4PK4 A;  2DXT A;  1H3H A;  2YRD A;  3PVQ A;  4F17 A;  1W2B P;  1H92 A;  2RHY A;  5LL6 S;  3H0I A;  4JS5 A;  2DD4 A;  2M0O A;  3FDR A;  4XU1 A;  1Y7X A;  3CC7 Q;  5DLQ E;  1UTI A;  2QEX T;  1VYU A;  5FRM A;  4ME7 A;  3M5A A;  3OY9 A;  2L0A A;  4BI8 B;  2E10 A;  1Q7Y U;  2HAX A;  5GJV B;  2DXU A;  3OS0 A;  4AG1 C;  4FW2 A;  4NS5 A;  1YI2 A;  1RLP C;  3CCM Q;  1M1K R;  5KYN A;  2GQV A;  4N0A C;  4EMG A;  3CME T;  2L3R A;  2WSF E;  1UGP B;  2F2X A;  2E4H A;  2DF6 A;  3OW2 A;  3JCM V;  2FYK A;  4D6W A;  4J9D A;  3CC2 Q;  2GBQ A;  1YNZ A;  1M2V B;  1X2Q A;  3L2W A;  4OMO A;  3EFO B;  3CC4 T;  1CSK A;  2K3Y A;  4JRP A;  4EMK A;  3OYC A;  1ZSZ B;  1NM7 A;  5GMK i;  4BE1 A;  2QTX A;  2EJ9 A;  5CKF A;  2NLU A;  1ARK A;  1VUB A;  3PTA A;  2P4T A;  2YLB A;  1GFC A;  5GAN 2;  1SSH A;  1MUZ A;  1V29 B;  1M30 A;  3VV0 A;  5LJ3 h;  3CCU A;  4P5N A;  5GAO n;  3FIF A;  2XU8 A;  4MML A;  2CYZ B;  1TUG B;  2RJF A;  2ZZD A;  1K9M R;  2EYZ A;  4E2F B;  2RM4 A;  4M77 B;  3FB9 A;  2HBW A;  4LDY A;  1TU0 B;  1P92 A;  2EQM A;  4BD3 A;  3VS7 A;  1XNI A;  1QLY A;  1YIT Q;  2O88 A;  3RUX A;  1FMV A;  1RAD B;  1C0M A;  3OW2 S;  2K79 A;  4F7U A;  2JNG A;  2AIR B;  4LD6 A;  2FL7 A;  3MP8 A;  1IB8 A;  3S3M A;  1OOT A;  1QVF P;  2RK2 A;  3GNG A;  1OX8 A;  2RQT A;  3CCU Q;  4M7A F;  3V8L A;  1UFF A;  5CO7 A;  5GAM g;  4JLG A;  1FMK A;  2QQB A;  7AT1 B;  2NWM A;  4F7U G;  2QAS A;  4GY5 A;  3QXE B;  4FL6 A;  4RTY A;  3LYI A;  3CCM A;  2HSP A;  3VS1 A;  2JW4 A;  2L3P A;  2ESW A;  4M78 C;  4GLM A;  1KFZ A;  1H3Z A;  3CCQ Q;  1JXO A;  2RHI A;  1GCQ C;  1SG5 A;  4M7D G;  1BB9 A;  2CZ0 B;  5GAN e;  3CCS Q;  2E12 A;  2GFA A;  3DLM A;  1WQW A;  3CCJ A;  1AOJ A;  5LJ5 g;  2XG8 D;  1OPL A;  2K6D A;  1J3T A;  5KYX B;  1WLP B;  2MIO A;  1T3S A;  3A1P A;  1YWP A;  5KE2 A;  2CP5 A;  3OYM A;  1VQP Q;  8AT1 B;  3QUI A;  3C94 A;  4D8K A;  2EGA A;  2PZ1 A;  2RHZ A;  1KQS A;  1ZBX A;  3I56 T;  4VUB A;  1WZO A;  1OPK A;  2CP6 A;  4M77 A;  4J5Y A;  5KYU B;  1VQ9 T;  1Y96 A;  5GMK j;  3INZ A;  3I55 A;  3X25 B;  1JEG A;  3KBG A;  2CRE A;  1NBE B;  2VVK A;  3PVL A;  2KSS A;  1B3Q A;  3E1S A;  2ED0 A;  2FPE A;  5I2S A;  3LGL A;  2GF7 A;  1QCO A;  5HY6 A;  2HQH A;  4C5H A;  1K8A U;  2CKK A;  1Q86 C;  2DXC A;  1BCO A;  2DAQ A;  2QGF B;  2DJZ A;  1BI1 A;  3M57 A;  2ZPI B;  1G83 A;  4PJO G;  1RAI B;  2EGE A;  1O75 A;  5LJ5 j;  1M8M A;  1V1C A;  2LCL A;  1R0C B;  1QP3 A;  1SKU B;  2QQR A;  4M7A G;  1KK7 A;  4A53 A;  2DXB A;  4C8Q B;  4A4H A;  2GFU A;  4O5V A;  3RKX A;  2BZX A;  3NGP A;  2DBM A;  3EG9 B;  4Y28 E;  3OS5 A;  3JV3 A;  1WI7 A;  3G6E T;  5KYX A;  3CBP A;  3GF5 A;  3KUF A;  2E5Q A;  1FX7 A;  5LJ3 f;  3FEO A;  3D7S B;  2PTK A;  3A8O B;  4R56 A;  2DE0 X;  4A4G A;  1AT1 B;  2MK5 A;  1QVG S;  4M78 F;  1W6X A;  3CCL T;  2NUT B;  2G3R A;  4JPB W;  1ZUK A;  4OB0 B;  2LMJ A;  1NLP C;  4HCC A;  4B9X A;  2MPX C;  2CH4 W;  1QKW A;  2E65 A;  2J7I A;  4FIB A;  5LJ3 g;  1YJ9 Q;  4RKU E;  4M7A C;  4KT0 E;  3QO3 A;  2FZG B;  4MZM A;  5ECA A;  1IGQ A;  3EH1 A;  1UHC A;  4B9W A;  3OYL A;  2M16 A;  4J9E A;  3TQ7 P;  2E5K A;  1UB4 A;  2ATC B;  2J6K A;  1BK2 A;  1N27 A;  5IT9 E;  2F1L A;  2YHT A;  5CQY A;  3NTH A;  5CVI A;  2K4Y A;  1VQ8 A;  2DKG A;  1MNE A;  3JB9 F;  3JRZ A;  2FPF A;  2DYB A;  3UA7 A;  4C8Q C;  1S72 T;  2EKH A;  2D0Q B;  3G4S T;  2MI6 A;  1QVG A;  3I9Q A;  1G3S A;  2MWP A;  5LJ5 d;  4BUG A;  1RAB B;  1K1Z A;  1RAF B;  2EFI A;  2GNC A;  4QT7 A;  2R58 A;  5FRN A;  3QDF A;  2P0P A;  2K3X A;  4N4G A;  1TG0 A;  3VS2 A;  2H3E B;  2A28 A;  2JUF A;  1VQN Q;  2OTL A;  4A63 B;  4JZ4 A;  2C0O A;  4BI3 A;  4RG8 A;  3VS5 A;  4AG2 C;  3HFN A;  3V7C A;  1RAE B;  1VQ9 A;  2J6F A;  2YWW A;  2V8I A;  3AT1 B;  5GMK m;  4HCK A;  5DM7 R;  2QGG A;  2P0Q A;  3QYH B;  2LT4 A;  2OTL T;  4C8Q G;  1IO6 A;  4BDZ A;  3IQL A;  4LE9 A;  1HXD A;  2DL5 A;  4ELZ C;  4B6M A;  2NUP B;  4M78 G;  2K3B A;  4M7D A;  2ED1 A;  1XQH A;  3JSC A;  4LUD A;  3CC4 Q;  1G3T A;  1E6H A;  2RPN A;  2CUB A;  3DLL A;  4IKF A;  1YP5 A;  2E70 A;  2Y4Y A;  4WTO B;  3SFM A;  1UEC A;  1ZSG A;  3GNF B;  3BE3 A;  2DPP B;  2KXD A;  5KYY A;  1Z9Z A;  3PNW C;  2EYW A;  2HKQ B;  2XK0 A;  3RES A;  3CCM T;  5A0D A;  4IUQ A;  2O4X A;  1N9R A;  2D8H A;  5FW9 A;  4M7D E;  1X6O A;  3I56 A;  4ORZ A;  4A4E A;  1M4Z A;  3OSS C;  2E3I A;  5C6S A;  2AKL A;  1NPR A;  2FB7 A;  4L5G A;  3CC7 T;  1UHF A;  4XTU A;  3N5B B;  3SHW A;  4PJO B;  2K7A A;  1GRI A;  4XU0 A;  1QWE A;  3CCS T;  1K8A R;  4KUI A;  2KRN A;  4OMN A;  1MMA A;  1SHG A;  1U06 A;  3BDU A;  4C0D B;  1HJD A;  2M1H A;  5GAM e;  1M5Q 1;  1HYO A;  2YT6 A;  2KVQ G;  2XDP A;  1SSF A;  5GAN d;  2LC4 A;  1U1T A;  1R0B G;  3A8L B;  2MWO A;  4M7D F;  4N0A A;  1VQO T;  8ATC B;  4LUE A;  1EX4 A;  2EVR A;  2HKN A;  1VQ7 T;  4PNO A;  3TU4 K;  3DKM A;  1Q82 C;  1T3L A;  2BTT A;  1YIJ A;  3MP1 A;  1WHM A;  1VIF A;  2AKK A;  3VRY A;  3MCA B;  4DA4 A;  3CCE T;  3EG1 A;  4E7Z A;  3G71 Q;  4XU3 A;  1Y07 A;  2RJC A;  2X4Y A;  1PNJ A;  4OGE A;  3OYK A;  2FEI A;  2AT1 B;  3CCR T;  2CZ6 B;  1VQM Q;  4MDX A;  3QJY A;  2DA9 A;  2VXE A;  4AFZ C;  4Y91 A;  3M53 A;  3L1A A;  3JCM Q;  2ENM A;  5HK3 A;  3CCR A;  1HD3 A;  1WHJ A;  2MCN A;  1ACM B;  4QQG A;  5IXF A;  5GAN h;  2LRQ A;  2DET A;  2PVG B;  2SRC A;  3NTI A;  4PJO A;  1QKX A;  3G71 T;  4X34 A;  2F2V A;  2IIM A;  3QDR B;  3OMC A;  3X24 B;  2EYX A;  3HTR A;  1MGQ A;  2K2V A;  2HQE A;  3TSW A;  3CQT A;  2DEU A;  3S3N A;  3NTK A;  4L6V 5;  1ZQ1 A;  1NJI U;  1RLQ C;  3M0Q A;  2CP3 A;  3GOX A;  4RG2 A;  3CCV T;  1I5L A;  1VQ7 Q;  4MZT A;  2KMT A;  5L8R E;  1VQO Q;  3CD6 T;  1VQP T;  3VKI A;  3M59 A;  4E7I A;  2FRW A;  2EQJ A;  1ABO A;  2ABL A;  1WJS A;  2E6Z A;  4XTV A;  3EG0 A;  3OYD A;  4XAX B;  1D09 B;  2LT1 A;  3URG A;  2E1H A;  1ZLM A;  2V8J A;  4PJO E;  2HL3 A;  2JTF A;  2QG9 B;  2MAM A;  2KR3 A;  3M0P A;  3VS6 A;  3LWH A;  5FLX E;  4C8Q E;  1SRM A;  1G3W A;  2PVD B;  2CZ1 B;  1VQ6 Q;  3VS3 A;  1ZUU A;  1EZZ B;  4J9H A;  4NL3 A;  2Y90 A;  1Q7Y R;  2DZC A;  5GAO p;  1XJW B;  2Z0W A;  3BDL A;  2XID A;  3EGD B;  1WIE A;  3PMI A;  4E6R A;  4BDY A;  1M1K U;  4X1V A;  3CD6 Q;  3VRZ A;  1X27 A;  2QA4 A;  2KT1 A;  3RMS A;  3SWN B;  3CMA A;  3ZFJ A;  1MMG A;  2F5T X;  3I5S A;  2PUK B;  4LNP A;  1ZA2 B;  2KE9 A;  2XMF A;  3FJP A;  3RKY A;  2DVE A;  1O9S A;  2E64 A;  2FO0 A;  1X6B A;  5L23 A;  2K5F A;  1M90 R;  2G6F X;  2LDM A;  2J06 A;  2DYI A;  1Q82 R;  1G8X A;  4JDS A;  2DLP A;  1AWJ A;  2A36 A;  2CSQ A;  2B8A A;  1M90 U;  3EHQ A;  2BZ8 A;  2D0N A;  3TSZ A;  1BIA A;  5LJ3 e;  3OW2 P;  1K9M U;  3JCM e;  5FWB A;  1Q82 U;  1M3A A;  1Q86 U;  4ZN1 A;  2ZPF B;  2EW3 A;  3C95 A;  2W0Z A;  5GAM h;  2L8D A;  3CCE Q;  4J9C A;  1FWZ A;  4QQ6 A;  3JCM g;  2DTH A;  3L2Z A;  1UUE A;  4FM4 B;  5GAO q;  1WJQ A;  3MJX A;  2V1R A;  2X35 A;  3OS2 A;  5GMK e;  2VXF A;  1I81 A;  4WF2 A;  4RTV A;  3J80 E;  4O6J A;  5A0G A;  2DM1 A;  1WYX A;  4K11 A;  4FYY B;  1ZA1 B;  2M02 A;  2DRK A;  3TCJ A;  4DQ2 A;  9ATC B;  1S72 A;  3VJP A;  3M0R A;  1WA7 A;  1W2B A;  1YCY A;  1TWB A;  3AHU A;  1I0C A;  1VQP A;  1YIJ Q;  1GL5 A;  1D0X A;  1MV0 B;  2HL5 C;  5DY9 A;  3CCV A;  4CC3 A;  2KEA A;  5AT1 B;  3CMA T;  4M4Z A;  1KQS S;  3QWY A;  3JCM P;  3RR6 A;  2DEQ A;  4Z89 A;  4EDU A;  4PJJ A;  2VYT A;  1GCP A;  3Q1J A;  4C92 D;  4NL2 A;  2RHU A;  2KGT A;  1D0Y A;  3SD4 A;  4EPC A;  1VQK A;  3OYG A;  1AEY A;  1BYM A;  2JN0 A;  4A4K A;  2K9G A;  1YJ9 T;  4JJC A;  1PSF A;  3VU3 C;  1TSF A;  4QVC A;  4AFU C;  1VQ4 A;  4BB7 A;  1U5S A;  1D3B A;  2DMO A;  4XQ3 A;  4OMP A;  1PG5 B;  2FVU A;  1ZHI A;  3THK A;  3HHT B;  4OVA A;  2X4X A;  3EH2 A;  5LJ3 d;  1PCX A;  1EIF A;  2HD0 A;  5GAN f;  1W2B S;  3ER0 A;  4KGX B;  2NUP A;  1KC8 R;  1NJI C;  3R6O A;  2DTI A;  4FSX A;  2COZ A;  1PKT A;  2YUN A;  1OX9 A;  2EKO A;  2CT3 A;  3OBW A;  3GLX A;  5IHI A;  3MKD A;  3RDV A;  1GFD A;  1JJ2 S;  1AWX A;  1YHQ Q;  2RNA A;  2L2P A;  2W10 A;  2K5L A;  2WSE E;  4KRT A;  3A5Z B;  5IAY A;  5D6X A;  2R57 A;  1ZSZ C;  3FLG A;  2KNB B;  1VYT A;  2JTM A;  1IRX A;  1M2V A;  3CPW P;  2ZGW A;  4ZGD B;  2LJ3 A;  4JRI A;  1VQN T;  1I5O B;  1VQ6 A;  4C92 E;  3L42 A;  5D6Y A;  1KQS P;  4F7U F;  4C8Q D;  1TOV A;  1KJW A;  1Y57 A;  2PQW A;  1M1F A;  2LP5 A;  1WXT A;  4RTX A;  4E7H A;  3CXC S;  1IHV A;  3PE0 A;  2RH2 A;  1LPL A;  1MND A;  4BI4 A;  4L59 A;  4BY6 B;  1Z9Q A;  1SHF A;  1VQ9 Q;  2V8K A;  2NYS A;  2QQS A;  3JCM X;  4FYX B;  1AZG B;  2RI5 A;  1M2O A;  2CGH A;  1K8A C;  2A7Y A;  4C92 A;  2LZ6 B;  1K73 R;  4M7D C;  2BE7 D;  3OBY A;  2KXC A;  4C8Q F;  3EHR A;  5LJ3 j;  2DZ9 A;  2VAS A;  1LOJ A;  4HCZ A;  1BKB A;  3H0F A;  5HK0 A;  3CME A;  3CCJ T;  3O5Z A;  1YI2 Q;  1VQL Q;  1I8F A;  4M75 C;  4Q5W A;  1LNX A;  1YJW A;  2DL7 A;  1OYX A;  2Y4X A;  3CCL Q;  4JJB A;  4PJM A;  2OAU A;  1ZX6 A;  4LDU A;  3EFS A;  4LDV A;  2YUO A;  4J6X A;  2OTJ A;  3CC7 A;  2MF2 A;  4AMC A;  1X01 A;  4D8D A;  1T0J A;  1IRE B;  1K76 A;  3UWN A;  3JB9 H;  3ASK A;  1A0N B;  5J3B A;  1N8R U;  4J9I A;  3JCM W;  3DB4 A;  2XHC A;  2RQU A;  2HMA A;  4C8Q A;  4HKE A;  2O01 E;  4OGC A;  3P8B B;  4X9C A;  2LJ0 A;  3EG9 A;  3PIO A;  2KDS A;  3A8G B;  1WX6 A;  2KT8 A;  1JBM A;  4R55 A;  3GPL A;  4IUU A;  4LN2 A;  4M78 E;  4A54 A;  1M9S A;  3LLR A;  2K5I A;  2EBP A;  2X4W A;  4PL6 A;  1UG1 A;  2KI7 A;  3SWN C;  4JS4 A;  3QG1 A;  2LQK A;  2XI9 A;  2IG0 A;  2RJD A;  3CBM A;  1B7T A;  2DL4 A;  3M0U A;  1Q95 G;  2DJQ A;  4XTW A;  3RIR A;  4FCY A;  4RMO A;  2OX7 A;  1UGR B;  4C92 G;  3M54 A;  5GAN 8;  4DBQ A;  4RTW A;  3NPF A;  2D8J A;  4YTL A;  1FXX A;  4QW2 A;  1M90 C;  4ELY C;  2DO3 A;  4QVZ A;  5KH6 A;  4AFS C;  3O8V A;  4ZGE B;  1UGQ B;  3UPU A;  4MZP A;  3MET A;  2DFU A;  4FT2 A;  1N8R C;  3HFO A;  2YLC A;  2VGM A;  3V8K A;  2FZC B;  1BCM A;  1UEB A;  3I56 Q;  2HZY A;  2C06 A;  1D1C A;  4KUL A;  3OA6 A;  2M9U A;  4IUP A;  1QP2 A;  1OU8 A;  1I4K 1;  3VS4 A;  4EMH A;  1VIE A;  1BIB A;  1JQQ A;  4KBM B;  1BU1 A;  3H8Z A;  1IGU A;  1PHT A;  3C4S A;  3CC2 A;  2KYM A;  1QCN A;  1KC8 U;  4CC2 A;  1WQ7 A;  4PJO C;  2SEM A;  1K0X A;  3CCQ T;  1KD1 U;  2QA4 T;  3GP8 A;  4KGZ B;  1VA7 A;  4PLI A;  3OYB A;  1AD5 A;  1D1B A;  4R0K A;  2K57 A;  5LJ5 h;  1PRL C;  4E7K A;  4C0G A;  2RI3 A;  2MYS A;  3CCQ A;  2RA2 A;  1QWF A;  3E9F A;  3BFM A;  3PMT A;  3JCM h;  2OTJ T;  3PT9 A;  5FU7 B;  5I2M A;  1V76 A;  4OMQ A;  1G3Y A;  2P4R A;  2IVW A;  4M77 E;  4E47 A;  1E6G A;  3J81 E;  2EPD A;  4PFP A;  2JTE A;  4J83 A;  1VQM A;  1AVZ C;  4MDW A;  1NPP A;  2FHD A;  1OZ3 A;  3CCJ Q;  1K4U S;  3EFR A;  5GMK h;  1Q81 C;  4IIM A;  1VQ4 T;  2F2W A;  2YRC A;  3L2Q A;  1VQN A;  1UDL A;  1WHK A;  1EFN A;  1UGS B;  4KH1 B;  1WGS A;  1NYF A;  3REA B;  2FG0 A;  4AFQ C;  3P8H A;  4F16 A;  4LXC A;  4E7S A;  5GAN j;  4M7A E;  1BBZ A;  3LWI A;  1YFN A;  5D7U A;  4XK8 E;  4OF1 A;  2YUQ A;  2XKO C;  1TXQ A;  4FW1 A;  2DER A;  2JXB A;  1SEM A;  2RQV A;  2C0T A;  2MOX A;  1YN8 A;  5EG2 A;  1TUC A;  2RN8 A;  1LVK A;  3ZEH A;  1HK9 A;  5GAM f;  3VYG A;  1BI3 A;  4PJL A;  1OI1 A;  1RL2 A;  2QK0 A;  5I11 A;  5C0M A;  3JB9 D;  1XTD A;  4M75 F;  2RF0 A;  1X2K A;  1OUL A;  1NEB A;  3KFV A;  1B34 B;  4KUD K;  1KG1 A;  2L89 A;  5GAN 3;  3REB B;  2DIQ A;  3EGX B;  1YHQ T;  4M7D B;  5DLO A;  2BE9 B;  4RCC A;  4ATO A;  2AK5 A;  1QVP A;  3HSB A;  1SPK A;  2I0N A;  2RB6 A;  4PKC C;  1I1J A;  2COW A;  2CH4 A;  1PD0 A;  3T9N A;  4F7U B;  1M27 C;  4CI0 C;  3UAT A;  5A0L A;  3LH5 A;  4GBQ A;  3M4G A;  2YRV A;  3OYJ A;  1C1A A;  3NHN A;  3X20 B;  4PJO F;  1Y0M A;  3V7S A;  1M8V A;  1PKS A;  2QI2 A;  2O4X B;  1M1G A;  3BW1 A;  5CIU A;  2VC8 A;  2LVM A;  5CKH A;  1IXD A;  3CCU T;  1WPY A;  3BY7 A;  4KGV B;  2CT4 A;  3CCV Q;  4J9G A;  1ZUY A;  1B07 A;  2HDA A;  1Q81 R;  3CMA Q;  2KRS A;  1C6V X;  3SB2 A;  5KE3 A;  3EG2 A;  4NOY A;  3M58 A;  3JB9 I;  3QBY A;  2DRM A;  2KAF A;  2PVO B;  4OML A;  2J05 A;  1BI0 A;  4JJD A;  3VS0 A;  4OB1 B;  1KHC A;  4HXJ A;  1VQ5 Q;  1K0S A;  3A8M B;  2VKN A;  2HBP A;  5I21 A;  1KD1 C;  4J8O A;  3H6Z A;  2XIC A;  1RAC B;  1H8K A;  4RTU A;  3LW5 E;  2ZPE B; 
#chains in the Genus database with same CATH homology
 3THK A;  2CH4 W;  1QKW A;  2DL8 A;  2J7I A;  4JZ3 A;  4RUG A;  2CDT A;  2EGC A;  2FRY A;  5ECA A;  2ROL A;  2J6O A;  1UHC A;  1RUW A;  1UE9 A;  1PKT A;  2YUN A;  4J9B A;  2CT3 A;  2DIL A;  5IHI A;  4J9E A;  2JT4 A;  1RI9 A;  1GFD A;  2E5K A;  2O9V A;  1AWX A;  2A08 A;  2RNA A;  2L2P A;  3QWX X;  2J6K A;  1BK2 A;  2W10 A;  2ROT A;  2LNH B;  1SRL A;  4KRT A;  2M0Y A;  1E7O A;  2QDL A;  4HVW A;  2X3W D;  2JMA A;  2KNB B;  2KRO A;  1VYT A;  1FYN A;  4IIO A;  4F14 A;  2FPF A;  2DYB A;  3UA7 A;  2EKH A;  2LJ3 A;  1UJY A;  3I9Q A;  5IH2 A;  1K1Z A;  2H8H A;  2O9S A;  2OAW A;  1KJW A;  3ULR B;  1PWT A;  2GNC A;  4QT7 A;  2M51 A;  1Y57 A;  2LQN A;  2O31 A;  2LP5 A;  3UF4 A;  1AWO A;  1WXT A;  3U23 A;  2JS0 A;  2EYY A;  1TG0 A;  1X43 A;  4RTX A;  3VS2 A;  2A28 A;  4A63 B;  2C0I A;  2D1X A;  2C0O A;  3PE0 A;  4JZ4 A;  3VS5 A;  4AG2 C;  2KYB A;  2LQW A;  2FPD A;  1NYG A;  1Z9Q A;  1SHF A;  2YUP A;  2J6F A;  3UA6 A;  3H41 A;  4HCK A;  1AZG B;  1YCS B;  2K2M A;  2NUZ A;  4EIK A;  1IO6 A;  3IQL A;  4LE9 A;  2LZ6 B;  2DL5 A;  2YSQ A;  2K3B A;  2KXC A;  2ED1 A;  4RTT A;  3EHR A;  5IXB A;  1KSW A;  4LUD A;  1E6H A;  3H0F A;  2RPN A;  1NLO C;  2CUB A;  2JM8 A;  1I07 A;  1YP5 A;  1OV3 A;  3FJ5 A;  3O5Z A;  1UEC A;  1ZSG A;  1WDX A;  2CUD A;  2DL7 A;  5FWC A;  2KXD A;  2DL3 A;  2JS2 A;  3TVT A;  4DEX A;  5IHK A;  3EG3 A;  1Z9Z A;  4ZNX A;  2EYW A;  4JJB A;  1TUD A;  1ZX6 A;  2DBK A;  2YUO A;  2DVJ A;  3RBB B;  4D8D A;  1ZBJ A;  1T0J A;  1K76 A;  2L3Q A;  1A0N B;  4WCI A;  4J9I A;  1NLP C;  1ABQ A;  2D8H A;  1W1F A;  5FW9 A;  4ORZ A;  2AKL A;  2RQW A;  2RQU A;  1UHF A;  1G2B A;  3SHW A;  2K7A A;  1GRI A;  2LJ0 A;  3SEM A;  3RNJ A;  1HSQ A;  1QWE A;  1QCF A;  4DEY A;  2KRN A;  4OMN A;  1WX6 A;  2KT8 A;  1GBR A;  1CKB A;  3M0S A;  1SHG A;  4CC4 B;  1U06 A;  1K9A A;  4ESR A;  1HJD A;  2V1Q A;  4LN2 A;  2AZV A;  3C0C A;  1OEB A;  4RTZ A;  5IHN A;  1W70 A;  2YT6 A;  2LCS A;  2EBP A;  2GGR A;  5HCK A;  1UG1 A;  3I5R A;  3ZL7 C;  1H3H A;  2DL4 A;  3M0U A;  3PVQ A;  2DJQ A;  4F17 A;  1H92 A;  4LUE A;  2EVR A;  3H0I A;  4RTW A;  3NPF A;  2D8J A;  1T3L A;  2BTT A;  4AFS C;  1UTI A;  2JM9 A;  1VYU A;  4OMM A;  2AKK A;  3VRY A;  3EG1 A;  2L0A A;  2DNU A;  5GJV B;  1GCQ A;  4AG1 C;  1LCK A;  1PNJ A;  1RLP C;  2FEI A;  2B86 A;  2JMC A;  2DA9 A;  2ECZ A;  3VS4 A;  1WXU A;  4AFZ C;  1JQQ A;  1BU1 A;  2F2X A;  2DF6 A;  2ENM A;  3A98 A;  1PHT A;  1HD3 A;  2VWF A;  4J9D A;  2MCN A;  5IXF A;  2GBQ A;  2KYM A;  1YNZ A;  1X2Q A;  2DX1 A;  5GJW B;  2YDL A;  3H0H A;  4OMO A;  4CC2 A;  1CSK A;  2SRC A;  3M0T A;  1QKX A;  2SEM A;  2PNI A;  1K0X A;  4HVU A;  2F2V A;  2IIM A;  2EYX A;  3TSW A;  1NM7 A;  3CQT A;  1VA7 A;  1AD5 A;  1ARK A;  4R0K A;  1PRL C;  2KBT A;  1GFC A;  2AZS A;  1SSH A;  1MUZ A;  1RLQ C;  1M30 A;  3M0Q A;  1QWF A;  1WXB A;  1CKA A;  1JO8 A;  2GTO A;  1M3C A;  1M3B A;  2FRW A;  2RMO A;  4FSS A;  4OMQ A;  2EYZ A;  1ABO A;  2P4R A;  2ABL A;  1E6G A;  2EPD A;  2JTE A;  3EG0 A;  1AVZ C;  2HBW A;  1K4U S;  1ZLM A;  1N5Z A;  4IIM A;  3VS7 A;  2F2W A;  1QLY A;  2KR3 A;  4CC7 A;  2LX7 A;  1UDL A;  3M0P A;  3VS6 A;  2O88 A;  1EFN A;  1SRM A;  2K79 A;  4Z88 A;  3VS3 A;  1ZUU A;  1NYF A;  4J9H A;  3REA B;  2FG0 A;  1JXM A;  4AFQ C;  1OOT A;  1KIK A;  4F16 A;  2HCK A;  4Z8A A;  1WIE A;  4E6R A;  2RQT A;  4X1V A;  1YWO A;  1BBZ A;  1UFF A;  3VRZ A;  1FMK A;  1X27 A;  2KT1 A;  1T0H A;  2YUQ A;  1MV3 A;  2NWM A;  1NEG A;  4RTY A;  2JXB A;  2HSP A;  1SEM A;  3VS1 A;  2RQV A;  2JW4 A;  3I5S A;  2C0T A;  2L3P A;  4LNP A;  2ESW A;  2MOX A;  4GLM A;  1KFZ A;  1PRM C;  2KE9 A;  1YN8 A;  1JXO A;  1TUC A;  2XMF A;  2RN8 A;  1NG2 A;  1GCQ C;  1BB9 A;  2FO0 A;  1X6B A;  4J9F A;  5L23 A;  2G6F X;  3EGU A;  2J06 A;  1AOJ A;  5I11 A;  1OPL A;  1X69 A;  5EC7 A;  1S1N A;  2K6D A;  1J3T A;  1WLP B;  2MIO A;  1T3S A;  2DLP A;  1YWP A;  2O2O A;  1AWJ A;  2RF0 A;  1X2K A;  3NMZ C;  2A36 A;  1NEB A;  3KFV A;  2CSQ A;  3EHQ A;  1VYV A;  2BZ8 A;  2D0N A;  4D8K A;  2OJ2 A;  1X6G A;  2EGA A;  3REB B;  2PZ1 A;  3TSZ A;  5FWB A;  1OPK A;  1M3A A;  2RQR A;  2EW3 A;  2AK5 A;  2W0Z A;  4J9C A;  1JEG A;  1SPK A;  2I0N A;  1I1J A;  1UUE A;  2CRE A;  2BZY A;  2VVK A;  3PVL A;  1B3Q A;  2CH4 A;  2ED0 A;  2V1R A;  1M27 C;  2CSI A;  2FPE A;  3UAT A;  3LH5 A;  2OI3 A;  4GBQ A;  2EQI A;  4RTV A;  2DM1 A;  1WYX A;  4K11 A;  3NHN A;  1GBQ A;  3GBQ A;  4HVV A;  1Y0M A;  2L3S A;  2DRK A;  1PKS A;  1G83 A;  3R6N A;  3M0R A;  4Y92 A;  1WA7 A;  2EGE A;  1I0C A;  2GQI A;  1GL5 A;  1M8M A;  1V1C A;  2A37 A;  1MV0 B;  5I22 A;  1UGV A;  2CT4 A;  2KEA A;  1JU5 C;  4M4Z A;  1U3O A;  4CC3 A;  2BZX A;  3NGP A;  2DBM A;  3QWY A;  4J9G A;  1ZUY A;  1B07 A;  2HDA A;  3I35 A;  4Z89 A;  2KRM A;  1UJ0 A;  3JV3 A;  1WI7 A;  2KRS A;  1GCP A;  2HEQ A;  3EG2 A;  2KGT A;  2LJ1 A;  2DRM A;  2X3X D;  1AEY A;  4OML A;  2J05 A;  4JJD A;  1AWW A;  2PTK A;  3VS0 A;  1AZE A;  4HXJ A;  2K9G A;  2DE0 X;  1K0S A;  2GTJ A;  4JJC A;  1WFW A;  2VKN A;  4AFU C;  1W6X A;  1U5S A;  1XOV A;  1H8K A;  4JPB W;  2DMO A;  1ZUK A;  4RTU A;  4OMP A;  2LMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...