3QBYA

Crystal structure of the pwwp domain of human hepatoma-derived growth factor 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 19
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qbyA00
2O4XB 2FHDA 2RHXA 3SD4A 4BACA 3MEAA 3NTIA 3O8VA 4IUTA 2JZ2A 5IAYA 3OS2A 3UWNA 4QQDA 3OYFA 4N4IA 3OYLA 4GY5A 3BDLA 3QBYA 2QQSA 4CRIA 4LD6A 5KCOA 3H8ZA 3OYHA 4BDZA 2R5MA 2RHIA 3OYMA 2GFUA 4C5HA 2X4WA 2MWPA 3FDRA 2EQJA 1OZ3A 3OMGA 1RI0A 3GOXA 1WJRA 3E9FA 2LTOA 3M9QA 2X4XA 2WACA 3PFSA 4ZTJA 2K3YA 3META 2L3RA 2R57A 2EKOA 4OVAA 4E7KA 2M16A 4IKFA 3LGFA 2K3XA 2XDPA 4A4GA 5J26A 3OYGA 4A4FA 3P8DA 2R58A 3NTKA 5C6SA 4QQGA 3OA6A 3L2WA 3L2UA 4E7JA 2BUDA 1OI1A 3MEUA 2LRQA 2RI2A 5FRNA 1H3ZA 4A4EA 2BKDN 2IG0A 2YRVA 5D6YA 2EQKA 5IN1A 2LVMA 5KCHA 2D9TA 3OMCA 3P8HA 1KHCA 3L2VA 4PL6A 2GFAA 4RG2A 4BDYA 2F5KA 3OY9A 4N4HA 3UT1A 2RHUA 5D6WA 1OYXA 2GF7A 2VYTA 3MO8A 3L2QA 3OYEA 4Q5WA 3OYNA 2M0OA 4E7LA 4IUVA 2RI3A 4C5GA 1SSFA 2RJEA 1G5VA 2G3RA 3OYCA 2X35A 4QVZA 4C5IA 3OYAA 3OYDA 4QW2A 3OYKA 2O4XA 3LX7A 3OS1A 3ASKA 3PMIA 3KUFA 3FC3A 3F70A 5FROA 3LLRA 1MHNA 3FLGA 5KE3A 1XNIA 3PNWC 4UC4A 4Z02A 2PQWA 4B9WA 4QQ6A 3FEOA 3LH0A 1WJSA 2RJDA 2EQUA 2X4YA 2B8AA 3Q1JA 3S3OA 3DB3A 3MP6A 2RI5A 3DB4A 3E9GA 4ZTFA 2HQEA 4FU6A 5CIUA 3CEYA 4B9XA 2JTFA 4BD3A 2MWOA 1OZ2A 3OYIA 4BE1A 2E6NA 2RJCA 1N27A 3L2RA 4A4HA 4N4GA 5KE2A 2DAQA 3OYJA 4C5EA 5C0MA 4IUUA 3NTHA 3ME9A 3PMTA 4IUQA 2NLUA 3OB9A 2L89A 2M1HA 3MP8A 2CKKA 2DIQA 2DIGA 4E7IA 3S3NA 3OYBA 2RHZA 2EFIA 2LDMA 4II1A 2QQRA 3MEWA 4NS5A 5KH6A 3QJ6A 2EQMA 4BE0A 5D6XA 2RJFA 3QKJA 2P0KA 2RHYA 2HQXA 3EAEA 2LCCA 4BE2A 4HCZA 3S6WA 1WJQA 5FRMA 3LGLA 3DLMA 3MEVA 4PLLA 3H6ZA 3MP1A 3OQ5A 3QIIA 3S3MA 2E5QA 4FL6A 4X34A 5M9OA 5J39A 4PLIA 3L42A 4L59A 3ZEHA 3LYIA 2L8DA 4IUPA 1WGSA 3C4SA 4IURA 2BIVA 2RO0A 4EDUA 4E7HA 2XK0A 2R5AA 3OS0A
chains in the Genus database with same CATH superfamily
1NEBA 2XKOC 1FMKA 1YITT 1VQ8A 1T0HA 4M7DB 4GLMA 3M5AA 2LJ0A 2ZPGB 1YJWA 1I1JA 5GANj 1AEYA 2D6FA 2YLCA 4LUDA 1UB4A 1WNLA 2EQJA 4AFUC 1RI0A 4C92G 4HT9A 4N0AC 3M0QA 3TEEA 1IB8A 1ARKA 3VYHB 2DX1A 1YJ9Q 2FB7A 4PJOA 2DLPA 1FMWA 5C6SA 1QKWA 2B86A 4PFZA 4BY6B 5CKFA 1D1BA 2BKDN 4PJJA 4LDXA 5KCHA 1JO8A 5GAN2 1JB0E 2ZPIB 1D3BA 1OQKA 3CCSQ 1SRLA 1YN8A 1ZUYA 2RJEA 4QW2A 3OS1A 4OMNA 3VS0A 4KH0B 5KYXB 1TOVA 4JJNK 1KQSA 4NL3A 4J9GA 4DA4A 4KUIA 2VWFA 1D09B 2CYZB 4BE1A 2DF6A 2JS0A 5GAMj 4J9EA 4C8QG 3REBB 2BE7D 3EGXA 2RQVA 2DIQA 4JUVA 4P5NA 2RM4A 2ECZA 2LP5A 2X4JA 3CC2T 2OTJA 2DTOA 2D8JA 2Y4YA 5HK0A 1AHJB 4BE2A 4FSSA 1KHIA 2EGAA 4LDUA 3CC7Q 4M77F 2E4HA 4PLLA 1VQLT 2HKQB 3EG1A 2WSFE 3NGPA 2ENMA 3O5ZA 3QDRB 2L8DA 4EIKA 4BI4A 1UECA 4J9BA 2VB6A 2KNBB 1IREB 4FSXA 5CQYA 2JZ2A 1K8AU 4N4IA 5KCOA 3G4SA 1U8RA 3MHXA 3CMET 5GJVB 3G71Q 2GGRA 4JZ4A 2DILA 2M02A 4FYYB 1VQ7Q 3THKA 5GAOl 3LGFA 2YT6A 3A1PA 2ZPHB 1NBEB 1B34B 1M90C 2DYIA 4M75F 3JCMW 4C8QC 5D6YA 5IN1A 2J6KA 2O9VA 4ATOA 4OB2B 4M78E 2F5KA 5CQXA 1S72Q 1AOJA 3CCQT 3JB9H 5GAN7 1K1ZA 2LT4A 4L5GA 2QQAA 4QVZA 2XHCA 3I9QA 3PMIA 5GAN4 3FJPA 1WPYA 2EPDA 4M7DA 2JW4A 1XNIA 1UUEA 1RABB 3M54A 1M1KR 1YFNA 3QXEB 4BD3A 2E6NA 2XU8A 2HSPA 3CCVT 2VXFA 4ESRA 2L89A 2X51A 2KGTA 3CCJA 1WDXA 2G6FX 2YUQA 5GANd 5KH6A 3C94A 3QKJA 3QPHA 3S6WA 1VIFA 1WJQA 3OW2S 4KGZB 5GAOr 3VUBA 5CAIA 4M77G 4FL6A 2DMOA 3SWNB 2ZAEA 4M75D 4Y92A 4HVVA 2PVOB 1M3AA 3PGGA 1QVGA 3VKIA 4J83A 3UWNA 2PU9B 4IIMA 2GQVA 2O2OA 2AK5A 3BDLA 3CXCP 3V8LA 2K79A 2YDLA 2DNUA 2FRWA 5IHIA 2HBWA 4PK4A 1X27A 2M16A 4HVUA 2E10A 1UGRB 3SB2A 3CCEA 4R55A 2RK2A 3AT1B 4QQGA 3OBWA 4LUEA 2LRQA 2V1QA 1IGQA 1M3CA 2YRDA 1G8XA 2AZSA 2V26A 4PL6A 2DETA 4RG2A 1TWBA 5GAMd 4N4HA 3VS1A 2AKLA 2IVWA 3UA6A 3ZBDA 3QWXX 1VOMA 1ACMB 4PJOC 1TSFA 4XTZA 2PQWA 3UDCA 3Q1JA 5AYFA 3MJXA 4HCKA 1HJDA 1LCKA 2KT8A 2JOYA 2K6DA 2F2XA 1EFNA 2DAQA 2VC8A 1UGPB 3ZL7C 1M2OA 2CZ7B 2K4YA 2LT1A 2DEQA 4ZNXA 3URGA 4IUUA 4RTWA 2HL3A 3PIPA 1VQKT 1B34A 2KK4A 4C0GA 4C92E 3GIBA 1YIJA 2C06A 5GANg 1VQ5Q 2V8IA 3QJ6A 5GMKi 2V8JA 5GAN6 3A8OB 1AZEA 1AD5A 1H8KA 5GMKh 2ROTA 5CR2A 2FZCB 3TVTA 4E47A 3C95A 3RMQA 1VYVA 4LD9K 4M7AE 5A0DA 1WGSA 2BIVA 1RAEB 5IT9E 3CD6T 1V29B 3X26B 2HNIA 1FMVA 9ATCB 3OYFA 3QG1A 5FWBA 2BZ8A 2VKNA 1YWPA 4RTUA 4BI3A 1VQNA 5FU7B 5I2SA 1E6HA 1W6XA 1OZ3A 1AWXA 1N6AA 2YUOA 4IKFA 1W70A 5FWCA 2KSSA 1BCMA 2LJ1A 3L2WA 1VA7A 1ZA2B 1AWOA 2BUDA 2KXDA 1K0XA 1NJIR 3PT9A 2CSIA 2ROLA 1YI2A 4FYVB 1M1KC 1TTHB 5GAMg 3UF4A 3N5BB 1YHQA 1ZA1B 3SWNA 3EFOB 2HQHA 2JMAA 1YJ9T 1O9SA 2QAZA 2K57A 3X20B 3JB9G 2E3HA 2LZ6B 5ECAA 5FROA 4JRPA 1TG0A 3MCAB 1Q81R 4DEXA 3CCST 1M1KU 1VQ6A 5L23A 3V8KA 3I55Q 4M78D 2MYSA 3CQTA 3HFNA 2GNCA 4FW2A 4L6V5 4ANJA 4M7DC 3CC4A 1UDLA 3S3NA 1RADB 5CCAA 2K7AA 2X3XD 3LGLA 1K9MR 3GNFB 3WVDB 3S3MA 2KY9A 2FRYA 4L59A 3OW2A 4QKUA 6AT1B 2DL4A 3VS3A 3FIFA 4EMHA 4BY6C 1WXUA 2RHXA 3SD4A 2MAMA 2LX9A 4BB7A 3CXCS 3OYLA 3R6NA 3V7CA 1O75A 2HSEB 4PFOA 3CC7T 2GFUA 1K4US 4AFQC 2CS7A 4XU0A 4XK8E 1JXOA 1WFWA 1Q86C 3R6OA 2XDPA 1OX9A 1RAIB 3UA7A 2DERA 1IGUA 2K3BA 1OU9A 3PVLA 2M9UA 2RI2A 1H3ZA 1QMCA 1FYNA 3CPFA 2GFAA 1V76A 5GMKe 1RUWA 2GF7A 2H8HA 4XQ3A 3G71T 3HPWA 1VQ7T 1SSFA 4E7ZA 3OYCA 2CZ0B 4DEYA 5FLXE 1KK7A 3KUFA 4FYXB 4MDXA 3QZ9B 4M77E 4XU2A 5KE3A 4ME7A 1SSHA 2ZCFB 4OMOA 4YTLA 3RESA 2EQUA 2X4YA 1KC8R 2JS2A 3MP6A 3GNGA 1S72T 5CIUA 3H0HA 4RCBA 2JTFA 1G2BA 2E5KA 4M75B 3I5RA 1RAAB 1M8VA 5KE2A 2C0OA 5LJ5h 3JB9I 1SF9A 3V7SA 5IHNA 1OPKA 2E3IA 4VUBA 4QVDA 1WQWA 1IHWA 1YCYA 3MEWA 4J9IA 1WYXA 3EFRA 4NL2A 1JJ2A 4F7UB 2HD0A 3EAEA 2Y4XA 4HCCA 1M5Q1 4HA8A 1YITA 4LXCA 1JXMA 3EFOA 4PLIA 2CUBA 4C8QF 1X2QA 2NUTB 2XK0A 3E9GA 1BI1A 2JTEA 3EGDB 1NYFA 3MEAA 2QTVA 3GBQA 2NUPB 2X9HA 3SDZA 1NPRA 2DA9A 1NJIC 5LJ3h 2JM9A 3OYHA 3I56Q 5CKBA 4AG2C 3M0RA 2QQ9A 1BU1A 3OMGA 2CP6A 4EPCA 3RR6A 2LTOA 1I5OB 1WA7A 4OGEA 3JCMh 2AKKA 1KQ1A 1A0NB 3HP9A 1NJIU 1KD1R 4MMLA 4BDYA 3J7AF 3M0PA 1B7TA 5DLOA 3MO8A 3L2QA 1ZUUA 4Q5WA 5CK9A 5EG2A 2EKHA 4E7SA 2F2VA 3CMAA 1PNJA 4OMFB 1VQ4Q 2VUBA 4XU1A 1BYMA 5IXBA 4JJBA 4CI0C 3LH0A 2LQ8A 2B8AA 1D1AA 4J6XA 2F69A 2HQEA 4B9XA 4C8QD 1Y96B 3QYHB 2DM1A 4HVWA 3SWNC 1VYTA 2JN0A 3HL8A 3CC2A 1NPPA 2KE9A 4QT7A 3QJYA 1TUDA 1HSQA 4R56A 3RKWA 2K5FA 1Q82R 1LNXA 1VQLA 3MP8A 1BKBA 2COZA 2FYKA 4MDWA 1QCOA 1WQ7A 2JM8A 2FPFA 2QA4Q 2QG9B 4Z88A 5DM7R 4HCZA 5FRMA 2KBTA 1SG5A 3CMAT 1K9MU 4AFSC 3MP1A 1J3TA 3QIIA 1VQ9A 1WHMA 2ZPEB 4CC3A 2CZ6B 1D1CA 1VQOQ 3L42A 2QEXQ 5HK3A 2DE0X 3OYMA 3CMEA 3QO3A 3M4GA 3NTIA 3FB9A 4IUTA 3J80E 3JB9J 1P92A 1M8MA 1K8AC 1VQ5T 3UPUA 2R5MA 1E7OA 2FZKB 4M75A 2YXYA 1M1FA 4J9CA 1WJRA 1RI9A 4O6JA 1OX8A 1K0SA 1UTIA 5LJ5e 4KRTA 4F04B 2DK3A 3CCQA 1JJ2P 3NHNA 1YWOA 1QVFP 2PNIA 2L2PA 4XTYA 4EMKB 3JCMP 5J3BA 2XG8D 1ZHIA 2EAYA 3CCLQ 4F7UA 2ED1A 2RB6A 2DTHA 1WLPB 4PNOA 1VQ9T 4M78B 3EGUA 1MMAA 1QKXA 2FPDA 3ER0A 1U1SA 4KT0E 3KXTA 3I35A 1LOJA 1D0YA 1Q95G 4XTXA 2NUTA 2KRMA 4DOVA 1IRXA 4ZGEB 2JJ9A 3HHTB 3EGDA 2A28A 3LX7A 2NUPA 1MHNA 3CCMA 4Z02A 3CCVA 5LJ3e 1BI2A 3DKMA 1YJNQ 1SKUB 4LNPA 3TCJA 2E6ZA 2OI3A 4F14A 3EH2A 2KT1A 4J5YA 1I07A 5FW9A 4C5EA 3G6EQ 1CKAA 3JCMe 2QGFB 3A8LB 1IHVA 5HKCA 4M77D 4ELYC 3M0TA 1NYGA 3LW5E 1K73R 4KGXB 5FU7C 2O01E 3RDVA 2JUFA 2E64A 5IXFA 1QQJA 3I55T 1VUBA 2Y90A 2DRKA 2RN8A 4X34A 5L8RE 1XTDA 4XTWA 4OB1B 3CCMT 2K5LA 3CCUQ 4J9FA 3CPWA 4BACA 1Q7YR 4X9DA 3O8VA 2M0YA 4OB3B 4GY5A 1KD1C 2C0TA 2X3WD 1G3WA 4JJDA 5GAOm 1Y96A 1BIAA 1U06A 2RMOA 4PJOG 2YSQA 3T9NA 4KUDK 4R0KA 3PFSA 2MIOA 1K9AA 2IIMA 1U3OA 2KRNA 3L1AA 1KQSP 1OU8A 1W2BA 3RMSA 4RKUE 2CREA 2KQWA 2P4TA 3A8HB 1OI1A 5CO7A 5KYXA 3C12A 1T0JA 3OS5A 1MMNA 2CZ1B 1OOTA 1QLYA 2D9TA 2GTOA 1KD1U 2KI7A 4IIOA 1EX4A 1VQMQ 1QCNA 5LL6S 5D6WA 2L3PA 1ZBXA 3PVQA 2A37A 2XDDA 3OYNA 5I11A 4M7DF 1D0XA 3OYAA 1U1TA 3ASKA 2LQWA 2L3QA 2FG0A 1Y71A 1GFCA 3CCRQ 4HKEA 1BCOA 2LMJA 4PJNA 3J81E 4QQ6A 2RJDA 1VQKA 3HRSA 3VS5A 1TH7A 3CEYA 3D7SB 1OV3A 3JSCA 3BFMA 2OTLQ 1N5ZA 1GCQC 4IUQA 1VQPQ 1IXDA 5GMKl 4C92B 3JB9F 5GAOp 2RF0A 2LNVA 3QHSA 3QWYA 4M78A 3CD6A 1KFZA 2HMAA 1HK9A 2LCCA 1HXDA 4GLKA 3DLMA 3RKXA 4Y28E 3OQ5A 5M9OA 4M7AB 4J7FA 1VQ8Q 5I21A 4IUPA 1C1AA 2RO0A 1MGQA 4HXJA 2O4XB 1YBYA 1KJWA 1YJWQ 5IAYA 1N9SA 3QBYA 2QQSA 2QI2A 1V1CA 3H8ZA 1M3BA 1X6GA 2FVUA 2RA2A 2W10A 4ZTJA 2L3RA 3M59A 4AMCA 2R57A 4E7KA 4JJCA 4A4GA 1QVFS 2CP5A 2XD0A 4J7IA 2AZVA 1ZSZB 4QVCA 3L2UA 4OF1A 5GMKj 3TSWA 4AG1C 1YJ9A 4FYWB 2IG0A 2YRVA 4RTXA 1VIEA 3I56T 1TUCA 2DXTA 2D8HA 3QSUA 1PG5B 3LWHA 2RPNA 2I0NA 5EC7A 2J7IA 3UT1A 1UE9A 2DKGA 4M75C 1OYXA 3CPWP 2RI3A 2FO0A 4M7DG 3JB9D 3CCSA 3OYDA 2X35A 1FXXA 2LNHB 2KVQG 3WVEB 1ZX6A 3JRZA 2V8KA 3FC3A 2CP3A 4LDYA 3JV3A 2LQKA 2DL7A 1GCPA 4C0ZA 3KBGA 4MZPA 4ZTFA 2RI5A 2XICA 4C8QE 2MOXA 2FPEA 2E12A 2XMFA 5GAN5 1T3LA 4RCCA 2A08A 1JQQA 1QVGP 2EQIA 4ZN3A 2MMPA 5LJ5f 1NZ9A 2KYMA 2OTJQ 1VQ4T 2XIDA 1Q7YC 2RHZA 2XI9A 1WX6A 5CVIA 3EG9B 2MF2A 2DL8A 1K73U 1RLPC 3P8BB 1UGSB 3TSZA 1R8OB 3X28B 4CC7A 1E6GA 1WZOA 4DBHA 1X69A 3CC7A 2CDTA 1S1NA 4PJMA 2JNGA 4FIBA 3G4SQ 2I2LA 1Q7YU 2D1XA 2ZPBB 1OPLA 5LJ3f 3JCMJ 1GBQA 2HDAA 1AVZC 2QA4T 1SRMA 4O5VA 4JS4A 1R77A 2ZZDA 4C5HA 5KYWB 1HYOA 1WIEA 1X75C 3OBYA 2EJGA 3HRTA 1NM7A 3GOXA 2PUOB 3M9QA 2EW3A 3HSBA 2JT4A 2QEXT 1GXIE 2EKOA 2PTKA 4X1VA 5J26A 3JAME 1KQSS 4C92A 3JCMf 1D0ZA 3G71A 1WHGA 4TVRA 3OA6A 4JRQA 1VQ7A 2ZGWA 3KFVA 2DYBA 3EHRA 1XJWB 2L3SA 4OMPA 2YWWA 5CKDA 1KSWA 2K2VA 4M7AA 4FW1A 3NMZC 3U23A 1S72A 3OYKA 2O4XA 1PRLC 2KDSA 4Z89A 2AIRB 2D0QB 4M77B 1MMGA 2WSEE 1KQ2A 4RTZA 4B9WA 3CCLT 5FU6B 4JLIA 1X6BA 3AHUA 2VGMA 4A63B 4XAXB 3IQLA 1SEMA 3CCJQ 5C0MA 3NTHA 3M57A 3MKDA 3TU4K 1ZSZA 4PJOE 4E7IA 2PVDB 4RUGA 4II1A 3CCUA 1WHKA 2CSQA 2L5QA 1MNDA 2HQXA 1EZZB 4CC4B 4XTVA 4WTOB 1WXTA 3MEVA 5DY9A 5KYUB 2E5QA 2RQWA 3M56A 2ESWA 2DBKA 3G6ET 4MZTA 3EG0A 3C4SA 2R5AA 4M4ZA 3OS0A 4LE9A 4EMKC 1GL5A 1CKBA 4OMLA 1Y7XA 2CH4A 4KH1B 2D0NA 4M78C 4LD6A 1AT1B 5LJ5j 1BI3A 1T3SA 1G83A 4JRKA 3CCEQ 2WSCE 2COWA 3SEMA 2H3EB 1OULA 1PD1A 3CCUT 3BW1A 2K3XA 2M51A 1UJ0A 4A4KA 1M90R 1SHGA 1TXQA 2YHTA 2CT3A 1QVPA 3QZ5B 3EG9A 3OYYA 4PKCC 3RUXA 2EQKA 2PVGB 3L2VA 4KULA 3V7RA 1YNZA 2NUZA 2EYXA 3REAB 5GAOn 2CT4A 1UHFA 3LH5A 5LJ3j 4OGCA 1M1GA 2HKNA 2OJ2A 4ORZA 4JDSA 5I2MA 1WI7A 1Q81C 1WJSA 1PM3A 5KYWA 1VQMT 2KYBA 3OW2P 4XTUA 3JCMV 1QVGS 2P0QA 3OYJA 1YIJQ 1PKSA 5GANh 2LCLA 1UGVA 1W4SA 1GCQA 2DL3A 2F1LA 4RMOA 2DXUA 3CCRT 1XOVA 4DBRA 2KMTA 2HCKA 3NPFA 1Q81U 2CUDA 1QP3A 3EG3A 4RG8A 1JRIA 4ZGDB 4AT1B 4J9DA 2EGEA 1K9MC 1VQ5A 2CP2A 1ABQA 2OTLT 3V8JA 4F17A 1Z9ZA 2K2MA 2QGGA 2QDYB 2QQBA 4E7HA 1VQPT 3A5ZB 4J9HA 5GAOq 4M77A 1VQNQ 2E65A 2EYWA 3BY7A 4QQDA 4M7DE 4M7AG 1X43A 5A0GA 2DVJA 2W0ZA 1BBZA 1H641 3I5SA 3L2ZA 4PJLA 3FDRA 3G1JA 1AZGB 2X4XA 2E41A 1VQ8T 2DD5A 1F1BB 2NYSA 2R58A 2KEAA 3JCMX 1YI2Q 1YJWT 3RKYA 2FZGB 4E7JA 2RQTA 1RAHB 5GAMh 2EGCA 1YHQQ 4FM4B 2JVVA 1LVKA 1JEGA 5KYNA 3VS4A 2LCSA 4PJOF 1Y0MA 5KYUA 1G3YA 3CXCA 3FJ5A 3H0IA 1Y07A 2A36A 2IPOB 4C92C 1MV0B 1BI0A 4FCYA 2SRCA 1TU0B 4D8DA 1VQ6Q 2QASA 1N8RR 5IH2A 1KC8C 3SHWA 1I4K1 2F2WA 4C0DB 4M7AC 8ATCB 2YRCA 1M27C 2DTIA 3CC4Q 3ZFJA 1B3QA 2CH4W 2GCXA 2KROA 3I55A 2JTMA 4ELZC 3VS2A 1G3TA 3G7ZA 1PCXA 5LJ5d 1NG2A 2RHYA 5GJWB 1KC8U 1Z9QA 2HZYA 2QDLA 2RQRA 2LX7A 4ZGJB 4KBMB 2OTJT 5I22A 2DD4A 1PC0A 1ZSZC 2DPPB 4XU3A 4CC2A 2SEMA 3UATA 2RD1A 1NEGA 5CKHA 4PJOD 2GBQA 3M0SA 2BZYA 4BDZA 1YCSB 2EYZA 3LWIA 1PSEA 4OB0B 3CBOA 2GTJA 5LJ3d 3E9FA 1TUGB 2WACA 3BE3A 3META 1JBMA 1MV3A 4A53A 1QCFA 5GANe 4F7UF 3VRZA 3G4ST 1M90U 2MCNA 2QXFA 1PD0A 2J06A 2AT1B 2BE9B 4E2FB 3QYGB 4AFZC 2LVMA 4GBQA 3JCMd 1I81A 4E7LA 1B07A 1G5VA 2G3RA 2HEQA 3VV0A 1GFDA 2LQNA 3FRNA 2V1RA 3EG2A 2OAUA 2ED0A 3VUZA 1PRMC 3LLRA 4LN2A 2Z0WA 3FEOA 3VS7A 3HRUA 2DJQA 4ZN1A 4C0FA 1IZ6A 4KGVB 5KYYB 3M4YA 2P4RA 5CKEA 4MMKA 1H3HA 1MUZA 1IO6A 3GF5A 2O31A 1Q82C 4OMQA 2M1HA 2CKKA 5GAMe 2DIGA 3OYBA 1MNEA 1YITQ 4B6MA 7AT1B 4V2SA 1GRIA 4NS5A 3JCMQ 2EYYA 2F5TX 5LJ5g 4BE0A 5D6XA 1X01A 2P0KA 1PKTA 3BDUA 3M0UA 2KR3A 1M30A 1M2VB 2PZ1A 2QTXA 3CCJT 3VYGA 1Y57A 2K5IA 4EDUA 1BIBA 1Q82U 1R0CB 1SPKA 2EYQA 3OS2A 4EMKA 4M75G 2RHIA 4JRIA 2C0IA 3A98A 3DLLA 2MWPA 3WXMB 4DOWA 5LJ3g 3I56A 4MZMA 2K3YA 3JCMb 1Q86R 3OYGA 4A4FA 4M77C 3HKSA 3QUIA 3A8GB 4F7UG 1WHLA 5GAN3 2PUKB 5FRNA 1RAGB 2A7YA 4A4EA 1N8RC 5FU6C 1NLPC 1LJOA 3H41A 3OMCA 3RERA 3QDFA 1KHCA 1UG1A 2VV5A 4M7DD 3JCMg 1RAFB 2JMCA 3OY9A 2DJZA 1R0BG 2CP0A 3CMAQ 3CCET 2DXCA 1UGQB 2VYTA 3PTAA 2ZPFB 4DBQA 1FWZA 3EHQA 2BZXA 2DXBA 3GLXA 4C5IA 2QK0A 1JJ2S 2J6FA 1FX7A 3CBMA 1RACB 1N8RU 2FL7A 3CC2Q 4C8QB 3S3OA 4BI8B 2DRMA 1VQ4A 3E2UA 2MWOA 1U5SA 5GMKm 1WXBA 1ZQ1A 1VQLQ 2J6OA 5D7UA 1UFFA 4M78F 1WHJA 3OB9A 3HFOA 1PHTA 1SHFA 1UHCA 2EWNA 1G3SA 2RJFA 4Z8AA 4OMMA 1K73C 1VQ9Q 8AT1B 1I8FA 3CMEQ 1W2BP 4N0AA 2QA4A 5J39A 3M55A 1YIJT 3LYIA 2EVRA 1XQHA 1VQOA 2QEXA 1K76A 4CRIA 1PWTA 3CBPA 2RK1A 3X25B 2OX7A 4JS5A 3M53A 5GAN8 2X4WA 5KYYA 3PE0A 3CCQQ 1VYUA 3NFCA 4RTYA 3EFSA 3EH1A 3A8MB 1CSKA 4WF2A 4OVAA 5AT1B 4E6RA 2P0PA 3NTKA 2VXEA 3INZA 1VQNT 3TREA 4J8OA 2A0FB 4J6YA 1EIFA 4OP0A 3H9NA 5A2QE 4HT8A 3P8HA 2RQUA 5HCKA 2E70A 2P84A 4K11A 4BUGA 2RHUA 5HY6A 1M2VA 3OYEA 2DFUA 2M0OA 4IUVA 3X24B 4C5GA 3CCLA 1UEBA 2GQIA 1VQOT 1AWJA 2RH2A 3CCMQ 1W1FA 3CCVQ 4JPBW 2MI6A 1YI2T 1H92A 1YP5A 3F70A 5A0LA 4LDWA 1TS9A 3FLGA 1YHQT 4DQ2A 2COYA 1GBRA 3DB3A 3DB4A 4D6WA 1QWEA 2K9GA 2BTTA 2EJFA 3HTRA 2O88A 1I5LA 4A4HA 4N4GA 1YJNA 2KRSA 2VASA 5GANf 3JCMc 1MMDA 4JLGA 2HL5C 3ME9A 2E1HA 2EJ9A 4PJOB 1BK2A 4M78G 2DO3A 2YUNA 4LDVA 4RTVA 1VQ6T 2EFIA 4HCBA 2EBPA 2QQRA 2DZ9A 3G6EA 4JZ3A 3OSSC 4FT2A 4RTTA 1HD3A 2H3JA 1X2KA 1QP2A 2A3LA 1D3BB 2DZCA 2J05A 1PSFA 2KAFA 3H6ZA 3MPUB 3CC4T 3M58A 1DJ7B 3ZEHA 2ABLA 1KG1A 1QW1A 2FHDA 4WCIA 1K8AR 4C8QA 3ULRB 1YJNT 2JXBA 4C92F 3PIOA 3RIRA 1ZSGA 1N9RA 1ZBJA 1X6OA 5IHKA 1OEBA 4D8KA 1M4ZA 1ZLMA 1Q86U 2YLBA 2DEUA 2HAXA 3P8DA 1KIKA 4A54A 3SFMA 3EGXB 5GAMf 3MEUA 4M7AF 3GPLA 3VU3C 1WHHA 1ABOA 3RBBB 1ZUKA 4C0DC 3E19A 2KXCA 4F16A 2ATCB 1LPLA 3RNJA 3GP8A 4X9CA 2OAWA 1VQMA 5DLQE 1NLOC 1M9SA 1VQKQ 2VVKA 2CGHA 2MK5A 1BB9A 3TQ7P 2FEIA 3PNWC 4UC4A 3VRYA 4NOYA 1I0CA 1AWWA 2DVEA 1QVFA 3H0FA 2VGNA 2DBMA 4FU6A 3E1SA 3CCRA 3VJPA 3OSVA 2NWMA 1OZ2A 3OYIA 2MPXC 3CPWS 2RJCA 1N27A 2AHJB 3L2RA 4M75E 1JU5C 3VS6A 2QYZA 2LJ3A 3PMTA 1C6VX 2DL5A 2NLUA 1UJYA 2XDBA 3CD6Q 1C0MA 4J6WA 2OTLA 2CP7A 2LDMA 2EIFA 1RLQC 4C92D 2EQMA 1VQPA 1NE8A 1RL2A 4F7UE 4EMGA 2YUPA 1W2BS 4Y91A 2RNAA 4DBFA 4FT4A 1QWFA 2O9SA 2HBPA 4IURA 2L0AA 2LC4A 4PFPA 4M7AD 3C0CA
chains in the Genus database with same CATH topology
2DPPB 1YBYA 2O4XB 4XU3A 2RHXA 3SD4A 2RD1A 2XKOC 2MAMA 5CKHA 2LX9A 5IAYA 1YITT 4BB7A 1VQ8A 1N9SA 4M7DB 4PJOD 3CXCS 3OYLA 3M5AA 3QBYA 2QQSA 2QI2A 3H8ZA 3V7CA 4BDZA 1O75A 2ZPGB 2FVUA 1YJWA 5GANj 2GFUA 3CC7T 3LWIA 2D6FA 2CS7A 2YLCA 1PSEA 1UB4A 1WNLA 2EQJA 1RI0A 2RA2A 3CBOA 4OB0B 4N0AC 4XU0A 5LJ3d 3E9FA 4XK8E 3TEEA 4ZTJA 2WACA 3META 1JBMA 2L3RA 3M59A 3VYHB 2R57A 4A53A 4E7KA 3R6OA 1Q86C 5GANe 4F7UF 2XDPA 2FB7A 4A4GA 4PJOA 1QVFS 2XD0A 5C6SA 4J7IA 3G4ST 1M90U 2QXFA 4QVCA 2M9UA 4BY6B 3L2UA 4OF1A 5CKFA 5GMKj 2RI2A 1H3ZA 1YJ9A 2BKDN 2IG0A 2YRVA 3QYGB 4LDXA 1VIEA 2LVMA 5KCHA 3I56T 2DXTA 3CPFA 5GAN2 3QSUA 1JB0E 3LWHA 2GFAA 2ZPIB 1D3BA 3JCMd 1I81A 5GMKe 3UT1A 4M75C 2DKGA 1OYXA 2GF7A 4XQ3A 3G71T 4E7LA 3HPWA 1Q81U 2RI3A 4M7DG 1VQ7T 1SSFA 2RJEA 3JB9D 1G5VA 2G3RA 3CCSA 3OYCA 2CZ0B 2X35A 3OYDA 3VV0A 1FXXA 5FLXE 2KVQG 4QW2A 3FRNA 3OS1A 2OAUA 3WVEB 3VUZA 3KUFA 4MDXA 3JRZA 2V8KA 3FC3A 3QZ9B 4M77E 3LLRA 4XU2A 5KE3A 4ME7A 4LDYA 2ZCFB 4YTLA 4JJNK 3RESA 2LQKA 3FEOA 3HRUA 4C0ZA 2EQUA 2X4YA 3KBGA 4MZPA 3MP6A 4ZN1A 2RI5A 4C0FA 2XICA 4C8QE 4ZTFA 1KQSA 3GNGA 4NL3A 2E12A 5CIUA 4KUIA 4RCBA 5GAN5 4DA4A 1S72T 1IZ6A 2JTFA 4RCCA 2CYZB 4BE1A 4M75B 3M4YA 5GAMj 5KE2A 1M8VA 5CKEA 4ZN3A 2MMPA 4C8QG 1NZ9A 4MMKA 5LJ5f 5LJ5h 3JB9I 3GF5A 1VQ4T 1Q82C 2M1HA 2XIDA 3V7SA 1Q7YC 2CKKA 2DIQA 4JUVA 2DIGA 5GAMe 3OYBA 4P5NA 4VUBA 2RM4A 2RHZA 4QVDA 2XI9A 4V2SA 1WQWA 2X4JA 1YCYA 3MEWA 4NS5A 2MF2A 2F5TX 5CVIA 5LJ5g 3JCMQ 4BE0A 2DTOA 3EFRA 1X01A 2Y4YA 5D6XA 5HK0A 1K73U 2P0KA 2OTJA 4NL2A 1AHJB 3P8BB 4F7UB 3BDUA 1UGSB 1JJ2A 2HD0A 3EAEA 4BE2A 2Y4XA 1KHIA 4HCCA 1R8OB 1M5Q1 4HA8A 4LDUA 4M77F 3X28B 1YITA 4PLLA 1VQLT 2WSFE 2QTXA 3CCJT 4PLIA 4C8QF 3VYGA 3QDRB 2L8DA 2K5IA 4EDUA 3CC7A 4BI4A 1BIBA 2XK0A 3E9GA 1BI1A 2JNGA 4FIBA 1Q82U 2I2LA 1Q7YU 3MEAA 1IREB 2EYQA 4FSXA 5CQYA 2JZ2A 3OS2A 4EMKA 4M75G 3SDZA 1K8AU 1NPRA 2ZPBB 4N4IA 5LJ3f 3JCMJ 1NJIC 5KCOA 5LJ3h 3OYHA 2QA4T 4O5VA 5CKBA 3G4SA 1U8RA 2RHIA 4JRIA 4JS4A 2ZZDA 4C5HA 2QQ9A 3DLLA 2MWPA 3MHXA 3CMET 3OMGA 1X75C 4EPCA 3OBYA 2EJGA 3HRTA 3WXMB 4DOWA 2PUOB 3M9QA 5LJ3g 2LTOA 3GOXA 3I56A 3HSBA 4MZMA 2K3YA 3JCMb 2QEXT 5GAOl 1GXIE 2EKOA 3LGFA 3OYGA 5J26A 2ZPHB 3JAME 4A4FA 1KQSS 4M77C 3HKSA 3QUIA 3A8GB 4C92A 4F7UG 3JCMf 3G71A 1B34B 4OGEA 5GAN3 1M90C 3JCMh 2PUKB 4TVRA 3OA6A 4JRQA 1VQ7A 4M75F 2ZGWA 1KQ1A 2A7YA 4A4EA 4C8QC 3HP9A 5FU6C 3JCMW 1N8RC 5D6YA 1LJOA 5IN1A 1NJIU 3OMCA 3RERA 4ATOA 1KHCA 4MMLA 2VV5A 4BDYA 4M7DD 3JCMg 4OB2B 3J7AF 4M78E 2F5KA 5CQXA 3OY9A 2DJZA 3CCQT 3CCET 2DXCA 1UGQB 5DLOA 2VYTA 3MO8A 5CKDA 5GAN7 3PTAA 3L2QA 4Q5WA 2ZPFB 5CK9A 2K2VA 1FWZA 4M7AA 2LT4A 2DXBA 3GLXA 2QQAA 4L5GA 5EG2A 4QVZA 4C5IA 1S72A 3CMAA 2XHCA 3OYKA 2O4XA 1JJ2S 2KDSA 4OMFB 1FX7A 3PMIA 2D0QB 5GAN4 3CBMA 4M77B 2WSEE 3FJPA 1WPYA 2VUBA 4M7DA 4XU1A 1BYMA 4EMHA 1XNIA 4CI0C 1KQ2A 1N8RU 4B9WA 3LH0A 2FL7A 2LQ8A 3CCLT 4C8QB 2B8AA 5FU6B 4BI8B 3S3OA 4J6XA 4JLIA 1VQ4A 2F69A 2HQEA 3M54A 4B9XA 3AHUA 3QXEB 4C8QD 1Y96B 3QYHB 4BD3A 2MWOA 5GMKm 2E6NA 2VGMA 1ZQ1A 3SWNC 2JN0A 2XU8A 3HL8A 3CC2A 4XAXB 1NPPA 3QJYA 3CCVT 5C0MA 4M78F 4R56A 4HT9A 3NTHA 2VXFA 3M57A 3RKWA 2K5FA 3OB9A 1LNXA 3TU4K 2L89A 1VQLA 4PJOE 3HFOA 3MP8A 1BKBA 2FYKA 4MDWA 4E7IA 2PVDB 1WQ7A 3CCJA 4II1A 3CCUA 5GANd 2EWNA 1G3SA 5KH6A 3C94A 2RJFA 3QKJA 3QPHA 1K73C 2L5QA 2HQXA 5DM7R 4HCZA 3S6WA 1I8FA 1VIFA 1WJQA 4XTVA 3OW2S 5GAOr 5FRMA 3VUBA 3CMAT 3MEVA 5DY9A 5CAIA 1K9MU 4M77G 3MP1A 3QIIA 4N0AA 2E5QA 4FL6A 2QA4A 3SWNB 2ZPEB 5J39A 2CZ6B 3M56A 1VQ9A 3M55A 3L42A 1YIJT 3G6ET 3LYIA 4MZTA 5HK3A 4M75D 3C4SA 3OYMA 2R5AA 3CMEA 3OS0A 3QO3A 2PVOB 1XQHA 3PGGA 4EMKC 1QVGA 3M4GA 3NTIA 3FB9A 4IUTA 3VKIA 4J83A 3J80E 1VQOA 1Y7XA 3UWNA 3JB9J 2QEXA 2PU9B 1P92A 2GQVA 1K8AC 1VQ5T 3UPUA 3BDLA 4M78C 4CRIA 3V8LA 4LD6A 3CBPA 2RK1A 3X25B 2R5MA 4JS5A 3M53A 5LJ5j 5GAN8 2X4WA 1BI3A 4JRKA 4M75A 2WSCE 3NFCA 1M1FA 3EFSA 1WJRA 3A8MB 4O6JA 4WF2A 4OVAA 2M16A 3CCUT 3BW1A 2K3XA 2E10A 5LJ5e 2DK3A 4C92G 3CCQA 1UGRB 3SB2A 2P0PA 3NTKA 4R55A 2RK2A 3CCEA 4QQGA 4A4KA 3OBWA 2VXEA 3INZA 1VQNT 2YHTA 3TREA 3QZ5B 1QVPA 2LRQA 4XTYA 4EMKB 3JCMP 3OYYA 4J6YA 4J8OA 2XG8D 1EIFA 4PKCC 5J3BA 1ZHIA 2EQKA 2EAYA 4OP0A 3RUXA 5A2QE 4HT8A 2PVGB 3P8HA 2RB6A 4PNOA 2DTHA 4F7UA 1VQ9T 3L2VA 4PL6A 4KULA 4M78B 2E70A 4RG2A 3V7RA 3ER0A 4BUGA 5GAMd 1U1SA 4N4HA 4KT0E 3KXTA 2IVWA 2RHUA 5HY6A 1LOJA 3OYEA 2M0OA 4IUVA 3X24B 4C5GA 3CCLA 4XTXA 1UEBA 5GAOn 3ZBDA 1VQOT 4DOVA 2RH2A 4PJOC 4ZGEB 5LJ3j 4OGCA 3HHTB 3LX7A 2MI6A 1YI2T 1M1GA 3F70A 5A0LA 4JDSA 4LDWA 1MHNA 3FLGA 5I2MA 1YHQT 4DQ2A 3CCMA 4Z02A 4XTZA 2PQWA 3UDCA 3CCVA 1Q81C 5LJ3e 1WJSA 3Q1JA 5AYFA 1BI2A 3DB3A 3DKMA 3DB4A 4D6WA 1VQMT 2EJFA 3TCJA 4XTUA 2JOYA 2E6ZA 3JCMV 1QVGS 2P0QA 1I5LA 4A4HA 4N4GA 1YJNA 2DAQA 2VC8A 3OYJA 1UGPB 4J5YA 4C5EA 5GANf 3JCMc 2CZ7B 2K4YA 2LT1A 3URGA 2DEQA 4JLGA 5GANh 2LCLA 4IUUA 3ME9A 3PIPA 2E1HA 1VQKT 1W4SA 2EJ9A 4M78G 1B34A 4PJOB 2KK4A 2DO3A 3JCMe 4C0GA 3A8LB 4LDVA 4C92E 4RMOA 2DXUA 3GIBA 3CCRT 1XOVA 1VQ6T 2EFIA 2KMTA 4HCBA 2QQRA 1YIJA 2DZ9A 3G6EA 2C06A 5GANg 3OSSC 2V8IA 3QJ6A 4FT2A 5HKCA 5GMKi 1QP3A 4M77D 2V8JA 4ELYC 3LW5E 1JRIA 2H3JA 3A8OB 4RG8A 1QP2A 2A3LA 5FU7C 5GAN6 4ZGDB 1D3BB 2DZCA 2O01E 5GMKh 2JUFA 2E64A 3I55T 1K9MC 1PSFA 1VUBA 2KAFA 2Y90A 3H6ZA 3C95A 4E47A 5CR2A 3CC4T 3M58A 1VQ5A 2OTLT 5FRNA 4X34A 3RMQA 1DJ7B 1XTDA 5L8RE 3V8JA 4XTWA 4LD9K 3ZEHA 4OB1B 4M7AE 2QDYB 3CCMT 5A0DA 2K5LA 1WGSA 2QQBA 4E7HA 2BIVA 1VQPT 3A5ZB 1KG1A 1QW1A 5GAOq 5IT9E 4M77A 3CD6T 3CPWA 1V29B 2FHDA 4X9DA 4BACA 3X26B 2HNIA 3O8VA 2E65A 3BY7A 4QQDA 3QG1A 4OB3B 3OYFA 4M7DE 4M7AG 4GY5A 4C8QA 1KD1C 5A0GA 1G3WA 4BI3A 1YJNT 5GAOm 1H641 1VQNA 3L2ZA 5FU7B 1Y96A 4C92F 1BIAA 5I2SA 3PIOA 4PJOG 3RIRA 3FDRA 1OZ3A 3T9NA 1N9RA 4KUDK 1X6OA 2X4XA 2E41A 3PFSA 1VQ8T 1M4ZA 1N6AA 1Q86U 2YLBA 4IKFA 2DD5A 2KSSA 2HAXA 3P8DA 2R58A 3JCMX 3L1AA 4A54A 3SFMA 1W2BA 1YJWT 3RMSA 3RKYA 5GAMf 4RKUE 3L2WA 4E7JA 2KQWA 2P4TA 2BUDA 1OI1A 3A8HB 3MEUA 5CO7A 5GAMh 3C12A 4M7AF 4FM4B 2JVVA 3OS5A 2CZ1B 3PT9A 2D9TA 1KD1U 3GPLA 1YI2A 3VU3C 4C0DC 1M1KC 4PJOF 5GAMg 3E19A 5LL6S 5D6WA 3N5BB 1YHQA 1G3YA 1ZBXA 2XDDA 3OYNA 3CXCA 3GP8A 4M7DF 3SWNA 4X9CA 1Y07A 1YJ9T 3OYAA 1VQMA 1U1TA 5DLQE 4C92C 1M9SA 1O9SA 3JB9H 2K57A 3ASKA 3X20B 1BI0A 3JB9G 1Y71A 2CGHA 5FROA 4HKEA 4JRPA 3MCAB 3PNWC 4UC4A 3J81E 4QQ6A 4NOYA 2RJDA 1VQKA 2DVEA 1QVFA 1KC8C 2VGNA 3HRSA 3CCST 3CC2T 1I4K1 4FU6A 1TH7A 3CEYA 3E1SA 1M1KU 3CCRA 3VJPA 1VQ6A 4C0DB 3OSVA 1OZ2A 3JSCA 3OYIA 3CPWS 3V8KA 2RJCA 4M7AC 1N27A 2AHJB 4M78D 4M75E 3BFMA 2DTIA 3L2RA 3ZFJA 3HFNA 2GCXA 3PMTA 4IUQA 2NLUA 5GMKl 4L6V5 3I55A 2XDBA 2JTMA 4C92B 4ELZC 1G3TA 4J6WA 3G7ZA 3CC4A 3JB9F 2OTLA 4M7DC 5GAOp 3S3NA 2LNVA 2LDMA 2EIFA 4C92D 5LJ5d 2EQMA 5CCAA 1VQPA 3QHSA 4M78A 1NE8A 2RHYA 1RL2A 3CD6A 1KC8U 1HK9A 2LCCA 4F7UE 1HXDA 4EMGA 3LGLA 4GLKA 3DLMA 3GNFB 3RKXA 3WVDB 1W2BS 4Y28E 4Y91A 3OQ5A 4ZGJB 3S3MA 4FT4A 4M7AB 5M9OA 2KY9A 4J7FA 4L59A 5I21A 3OW2A 4KBMB 2HBPA 4IUPA 4IURA 2OTJT 2RO0A 3FIFA 2LC4A 2DD4A 4M7AD 1MGQA 4BY6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X B;  2FHD A;  2RHX A;  3SD4 A;  4BAC A;  3MEA A;  3NTI A;  3O8V A;  4IUT A;  2JZ2 A;  5IAY A;  3OS2 A;  3UWN A;  4QQD A;  3OYF A;  4N4I A;  3OYL A;  4GY5 A;  3BDL A;  3QBY A;  2QQS A;  4CRI A;  4LD6 A;  5KCO A;  3H8Z A;  3OYH A;  4BDZ A;  2R5M A;  2RHI A;  3OYM A;  2GFU A;  4C5H A;  2X4W A;  2MWP A;  3FDR A;  2EQJ A;  1OZ3 A;  3OMG A;  1RI0 A;  3GOX A;  1WJR A;  3E9F A;  2LTO A;  3M9Q A;  2X4X A;  2WAC A;  3PFS A;  4ZTJ A;  2K3Y A;  3MET A;  2L3R A;  2R57 A;  2EKO A;  4OVA A;  4E7K A;  2M16 A;  4IKF A;  3LGF A;  2K3X A;  2XDP A;  4A4G A;  5J26 A;  3OYG A;  4A4F A;  3P8D A;  2R58 A;  3NTK A;  5C6S A;  4QQG A;  3OA6 A;  3L2W A;  3L2U A;  4E7J A;  2BUD A;  1OI1 A;  3MEU A;  2LRQ A;  2RI2 A;  5FRN A;  1H3Z A;  4A4E A;  2BKD N;  2IG0 A;  2YRV A;  5D6Y A;  2EQK A;  5IN1 A;  2LVM A;  5KCH A;  2D9T A;  3OMC A;  3P8H A;  1KHC A;  3L2V A;  4PL6 A;  2GFA A;  4RG2 A;  4BDY A;  2F5K A;  3OY9 A;  4N4H A;  3UT1 A;  2RHU A;  5D6W A;  1OYX A;  2GF7 A;  2VYT A;  3MO8 A;  3L2Q A;  3OYE A;  4Q5W A;  3OYN A;  2M0O A;  4E7L A;  4IUV A;  2RI3 A;  4C5G A;  1SSF A;  2RJE A;  1G5V A;  2G3R A;  3OYC A;  2X35 A;  4QVZ A;  4C5I A;  3OYA A;  3OYD A;  4QW2 A;  3OYK A;  2O4X A;  3LX7 A;  3OS1 A;  3ASK A;  3PMI A;  3KUF A;  3FC3 A;  3F70 A;  5FRO A;  3LLR A;  1MHN A;  3FLG A;  5KE3 A;  1XNI A;  3PNW C;  4UC4 A;  4Z02 A;  2PQW A;  4B9W A;  4QQ6 A;  3FEO A;  3LH0 A;  1WJS A;  2RJD A;  2EQU A;  2X4Y A;  2B8A A;  3Q1J A;  3S3O A;  3DB3 A;  3MP6 A;  2RI5 A;  3DB4 A;  3E9G A;  4ZTF A;  2HQE A;  4FU6 A;  5CIU A;  3CEY A;  4B9X A;  2JTF A;  4BD3 A;  2MWO A;  1OZ2 A;  3OYI A;  4BE1 A;  2E6N A;  2RJC A;  1N27 A;  3L2R A;  4A4H A;  4N4G A;  5KE2 A;  2DAQ A;  3OYJ A;  4C5E A;  5C0M A;  4IUU A;  3NTH A;  3ME9 A;  3PMT A;  4IUQ A;  2NLU A;  3OB9 A;  2L89 A;  2M1H A;  3MP8 A;  2CKK A;  2DIQ A;  2DIG A;  4E7I A;  3S3N A;  3OYB A;  2RHZ A;  2EFI A;  2LDM A;  4II1 A;  2QQR A;  3MEW A;  4NS5 A;  5KH6 A;  3QJ6 A;  2EQM A;  4BE0 A;  5D6X A;  2RJF A;  3QKJ A;  2P0K A;  2RHY A;  2HQX A;  3EAE A;  2LCC A;  4BE2 A;  4HCZ A;  3S6W A;  1WJQ A;  5FRM A;  3LGL A;  3DLM A;  3MEV A;  4PLL A;  3H6Z A;  3MP1 A;  3OQ5 A;  3QII A;  3S3M A;  2E5Q A;  4FL6 A;  4X34 A;  5M9O A;  5J39 A;  4PLI A;  3L42 A;  4L59 A;  3ZEH A;  3LYI A;  2L8D A;  4IUP A;  1WGS A;  3C4S A;  4IUR A;  2BIV A;  2RO0 A;  4EDU A;  4E7H A;  2XK0 A;  2R5A A;  3OS0 A; 
#chains in the Genus database with same CATH topology
 1NEB A;  2XKO C;  1FMK A;  1YIT T;  1VQ8 A;  1T0H A;  4M7D B;  4GLM A;  3M5A A;  2LJ0 A;  2ZPG B;  1YJW A;  1I1J A;  5GAN j;  1AEY A;  2D6F A;  2YLC A;  4LUD A;  1UB4 A;  1WNL A;  2EQJ A;  4AFU C;  1RI0 A;  4C92 G;  4HT9 A;  4N0A C;  3M0Q A;  3TEE A;  1IB8 A;  1ARK A;  3VYH B;  2DX1 A;  1YJ9 Q;  2FB7 A;  4PJO A;  2DLP A;  1FMW A;  5C6S A;  1QKW A;  2B86 A;  4PFZ A;  4BY6 B;  5CKF A;  1D1B A;  2BKD N;  4PJJ A;  4LDX A;  5KCH A;  1JO8 A;  5GAN 2;  1JB0 E;  2ZPI B;  1D3B A;  1OQK A;  3CCS Q;  1SRL A;  1YN8 A;  1ZUY A;  2RJE A;  4QW2 A;  3OS1 A;  4OMN A;  3VS0 A;  4KH0 B;  5KYX B;  1TOV A;  4JJN K;  1KQS A;  4NL3 A;  4J9G A;  4DA4 A;  4KUI A;  2VWF A;  1D09 B;  2CYZ B;  4BE1 A;  2DF6 A;  2JS0 A;  5GAM j;  4J9E A;  4C8Q G;  3REB B;  2BE7 D;  3EGX A;  2RQV A;  2DIQ A;  4JUV A;  4P5N A;  2RM4 A;  2ECZ A;  2LP5 A;  2X4J A;  3CC2 T;  2OTJ A;  2DTO A;  2D8J A;  2Y4Y A;  5HK0 A;  1AHJ B;  4BE2 A;  4FSS A;  1KHI A;  2EGA A;  4LDU A;  3CC7 Q;  4M77 F;  2E4H A;  4PLL A;  1VQL T;  2HKQ B;  3EG1 A;  2WSF E;  3NGP A;  2ENM A;  3O5Z A;  3QDR B;  2L8D A;  4EIK A;  4BI4 A;  1UEC A;  4J9B A;  2VB6 A;  2KNB B;  1IRE B;  4FSX A;  5CQY A;  2JZ2 A;  1K8A U;  4N4I A;  5KCO A;  3G4S A;  1U8R A;  3MHX A;  3CME T;  5GJV B;  3G71 Q;  2GGR A;  4JZ4 A;  2DIL A;  2M02 A;  4FYY B;  1VQ7 Q;  3THK A;  5GAO l;  3LGF A;  2YT6 A;  3A1P A;  2ZPH B;  1NBE B;  1B34 B;  1M90 C;  2DYI A;  4M75 F;  3JCM W;  4C8Q C;  5D6Y A;  5IN1 A;  2J6K A;  2O9V A;  4ATO A;  4OB2 B;  4M78 E;  2F5K A;  5CQX A;  1S72 Q;  1AOJ A;  3CCQ T;  3JB9 H;  5GAN 7;  1K1Z A;  2LT4 A;  4L5G A;  2QQA A;  4QVZ A;  2XHC A;  3I9Q A;  3PMI A;  5GAN 4;  3FJP A;  1WPY A;  2EPD A;  4M7D A;  2JW4 A;  1XNI A;  1UUE A;  1RAB B;  3M54 A;  1M1K R;  1YFN A;  3QXE B;  4BD3 A;  2E6N A;  2XU8 A;  2HSP A;  3CCV T;  2VXF A;  4ESR A;  2L89 A;  2X51 A;  2KGT A;  3CCJ A;  1WDX A;  2G6F X;  2YUQ A;  5GAN d;  5KH6 A;  3C94 A;  3QKJ A;  3QPH A;  3S6W A;  1VIF A;  1WJQ A;  3OW2 S;  4KGZ B;  5GAO r;  3VUB A;  5CAI A;  4M77 G;  4FL6 A;  2DMO A;  3SWN B;  2ZAE A;  4M75 D;  4Y92 A;  4HVV A;  2PVO B;  1M3A A;  3PGG A;  1QVG A;  3VKI A;  4J83 A;  3UWN A;  2PU9 B;  4IIM A;  2GQV A;  2O2O A;  2AK5 A;  3BDL A;  3CXC P;  3V8L A;  2K79 A;  2YDL A;  2DNU A;  2FRW A;  5IHI A;  2HBW A;  4PK4 A;  1X27 A;  2M16 A;  4HVU A;  2E10 A;  1UGR B;  3SB2 A;  3CCE A;  4R55 A;  2RK2 A;  3AT1 B;  4QQG A;  3OBW A;  4LUE A;  2LRQ A;  2V1Q A;  1IGQ A;  1M3C A;  2YRD A;  1G8X A;  2AZS A;  2V26 A;  4PL6 A;  2DET A;  4RG2 A;  1TWB A;  5GAM d;  4N4H A;  3VS1 A;  2AKL A;  2IVW A;  3UA6 A;  3ZBD A;  3QWX X;  1VOM A;  1ACM B;  4PJO C;  1TSF A;  4XTZ A;  2PQW A;  3UDC A;  3Q1J A;  5AYF A;  3MJX A;  4HCK A;  1HJD A;  1LCK A;  2KT8 A;  2JOY A;  2K6D A;  2F2X A;  1EFN A;  2DAQ A;  2VC8 A;  1UGP B;  3ZL7 C;  1M2O A;  2CZ7 B;  2K4Y A;  2LT1 A;  2DEQ A;  4ZNX A;  3URG A;  4IUU A;  4RTW A;  2HL3 A;  3PIP A;  1VQK T;  1B34 A;  2KK4 A;  4C0G A;  4C92 E;  3GIB A;  1YIJ A;  2C06 A;  5GAN g;  1VQ5 Q;  2V8I A;  3QJ6 A;  5GMK i;  2V8J A;  5GAN 6;  3A8O B;  1AZE A;  1AD5 A;  1H8K A;  5GMK h;  2ROT A;  5CR2 A;  2FZC B;  3TVT A;  4E47 A;  3C95 A;  3RMQ A;  1VYV A;  4LD9 K;  4M7A E;  5A0D A;  1WGS A;  2BIV A;  1RAE B;  5IT9 E;  3CD6 T;  1V29 B;  3X26 B;  2HNI A;  1FMV A;  9ATC B;  3OYF A;  3QG1 A;  5FWB A;  2BZ8 A;  2VKN A;  1YWP A;  4RTU A;  4BI3 A;  1VQN A;  5FU7 B;  5I2S A;  1E6H A;  1W6X A;  1OZ3 A;  1AWX A;  1N6A A;  2YUO A;  4IKF A;  1W70 A;  5FWC A;  2KSS A;  1BCM A;  2LJ1 A;  3L2W A;  1VA7 A;  1ZA2 B;  1AWO A;  2BUD A;  2KXD A;  1K0X A;  1NJI R;  3PT9 A;  2CSI A;  2ROL A;  1YI2 A;  4FYV B;  1M1K C;  1TTH B;  5GAM g;  3UF4 A;  3N5B B;  1YHQ A;  1ZA1 B;  3SWN A;  3EFO B;  2HQH A;  2JMA A;  1YJ9 T;  1O9S A;  2QAZ A;  2K57 A;  3X20 B;  3JB9 G;  2E3H A;  2LZ6 B;  5ECA A;  5FRO A;  4JRP A;  1TG0 A;  3MCA B;  1Q81 R;  4DEX A;  3CCS T;  1M1K U;  1VQ6 A;  5L23 A;  3V8K A;  3I55 Q;  4M78 D;  2MYS A;  3CQT A;  3HFN A;  2GNC A;  4FW2 A;  4L6V 5;  4ANJ A;  4M7D C;  3CC4 A;  1UDL A;  3S3N A;  1RAD B;  5CCA A;  2K7A A;  2X3X D;  3LGL A;  1K9M R;  3GNF B;  3WVD B;  3S3M A;  2KY9 A;  2FRY A;  4L59 A;  3OW2 A;  4QKU A;  6AT1 B;  2DL4 A;  3VS3 A;  3FIF A;  4EMH A;  4BY6 C;  1WXU A;  2RHX A;  3SD4 A;  2MAM A;  2LX9 A;  4BB7 A;  3CXC S;  3OYL A;  3R6N A;  3V7C A;  1O75 A;  2HSE B;  4PFO A;  3CC7 T;  2GFU A;  1K4U S;  4AFQ C;  2CS7 A;  4XU0 A;  4XK8 E;  1JXO A;  1WFW A;  1Q86 C;  3R6O A;  2XDP A;  1OX9 A;  1RAI B;  3UA7 A;  2DER A;  1IGU A;  2K3B A;  1OU9 A;  3PVL A;  2M9U A;  2RI2 A;  1H3Z A;  1QMC A;  1FYN A;  3CPF A;  2GFA A;  1V76 A;  5GMK e;  1RUW A;  2GF7 A;  2H8H A;  4XQ3 A;  3G71 T;  3HPW A;  1VQ7 T;  1SSF A;  4E7Z A;  3OYC A;  2CZ0 B;  4DEY A;  5FLX E;  1KK7 A;  3KUF A;  4FYX B;  4MDX A;  3QZ9 B;  4M77 E;  4XU2 A;  5KE3 A;  4ME7 A;  1SSH A;  2ZCF B;  4OMO A;  4YTL A;  3RES A;  2EQU A;  2X4Y A;  1KC8 R;  2JS2 A;  3MP6 A;  3GNG A;  1S72 T;  5CIU A;  3H0H A;  4RCB A;  2JTF A;  1G2B A;  2E5K A;  4M75 B;  3I5R A;  1RAA B;  1M8V A;  5KE2 A;  2C0O A;  5LJ5 h;  3JB9 I;  1SF9 A;  3V7S A;  5IHN A;  1OPK A;  2E3I A;  4VUB A;  4QVD A;  1WQW A;  1IHW A;  1YCY A;  3MEW A;  4J9I A;  1WYX A;  3EFR A;  4NL2 A;  1JJ2 A;  4F7U B;  2HD0 A;  3EAE A;  2Y4X A;  4HCC A;  1M5Q 1;  4HA8 A;  1YIT A;  4LXC A;  1JXM A;  3EFO A;  4PLI A;  2CUB A;  4C8Q F;  1X2Q A;  2NUT B;  2XK0 A;  3E9G A;  1BI1 A;  2JTE A;  3EGD B;  1NYF A;  3MEA A;  2QTV A;  3GBQ A;  2NUP B;  2X9H A;  3SDZ A;  1NPR A;  2DA9 A;  1NJI C;  5LJ3 h;  2JM9 A;  3OYH A;  3I56 Q;  5CKB A;  4AG2 C;  3M0R A;  2QQ9 A;  1BU1 A;  3OMG A;  2CP6 A;  4EPC A;  3RR6 A;  2LTO A;  1I5O B;  1WA7 A;  4OGE A;  3JCM h;  2AKK A;  1KQ1 A;  1A0N B;  3HP9 A;  1NJI U;  1KD1 R;  4MML A;  4BDY A;  3J7A F;  3M0P A;  1B7T A;  5DLO A;  3MO8 A;  3L2Q A;  1ZUU A;  4Q5W A;  5CK9 A;  5EG2 A;  2EKH A;  4E7S A;  2F2V A;  3CMA A;  1PNJ A;  4OMF B;  1VQ4 Q;  2VUB A;  4XU1 A;  1BYM A;  5IXB A;  4JJB A;  4CI0 C;  3LH0 A;  2LQ8 A;  2B8A A;  1D1A A;  4J6X A;  2F69 A;  2HQE A;  4B9X A;  4C8Q D;  1Y96 B;  3QYH B;  2DM1 A;  4HVW A;  3SWN C;  1VYT A;  2JN0 A;  3HL8 A;  3CC2 A;  1NPP A;  2KE9 A;  4QT7 A;  3QJY A;  1TUD A;  1HSQ A;  4R56 A;  3RKW A;  2K5F A;  1Q82 R;  1LNX A;  1VQL A;  3MP8 A;  1BKB A;  2COZ A;  2FYK A;  4MDW A;  1QCO A;  1WQ7 A;  2JM8 A;  2FPF A;  2QA4 Q;  2QG9 B;  4Z88 A;  5DM7 R;  4HCZ A;  5FRM A;  2KBT A;  1SG5 A;  3CMA T;  1K9M U;  4AFS C;  3MP1 A;  1J3T A;  3QII A;  1VQ9 A;  1WHM A;  2ZPE B;  4CC3 A;  2CZ6 B;  1D1C A;  1VQO Q;  3L42 A;  2QEX Q;  5HK3 A;  2DE0 X;  3OYM A;  3CME A;  3QO3 A;  3M4G A;  3NTI A;  3FB9 A;  4IUT A;  3J80 E;  3JB9 J;  1P92 A;  1M8M A;  1K8A C;  1VQ5 T;  3UPU A;  2R5M A;  1E7O A;  2FZK B;  4M75 A;  2YXY A;  1M1F A;  4J9C A;  1WJR A;  1RI9 A;  4O6J A;  1OX8 A;  1K0S A;  1UTI A;  5LJ5 e;  4KRT A;  4F04 B;  2DK3 A;  3CCQ A;  1JJ2 P;  3NHN A;  1YWO A;  1QVF P;  2PNI A;  2L2P A;  4XTY A;  4EMK B;  3JCM P;  5J3B A;  2XG8 D;  1ZHI A;  2EAY A;  3CCL Q;  4F7U A;  2ED1 A;  2RB6 A;  2DTH A;  1WLP B;  4PNO A;  1VQ9 T;  4M78 B;  3EGU A;  1MMA A;  1QKX A;  2FPD A;  3ER0 A;  1U1S A;  4KT0 E;  3KXT A;  3I35 A;  1LOJ A;  1D0Y A;  1Q95 G;  4XTX A;  2NUT A;  2KRM A;  4DOV A;  1IRX A;  4ZGE B;  2JJ9 A;  3HHT B;  3EGD A;  2A28 A;  3LX7 A;  2NUP A;  1MHN A;  3CCM A;  4Z02 A;  3CCV A;  5LJ3 e;  1BI2 A;  3DKM A;  1YJN Q;  1SKU B;  4LNP A;  3TCJ A;  2E6Z A;  2OI3 A;  4F14 A;  3EH2 A;  2KT1 A;  4J5Y A;  1I07 A;  5FW9 A;  4C5E A;  3G6E Q;  1CKA A;  3JCM e;  2QGF B;  3A8L B;  1IHV A;  5HKC A;  4M77 D;  4ELY C;  3M0T A;  1NYG A;  3LW5 E;  1K73 R;  4KGX B;  5FU7 C;  2O01 E;  3RDV A;  2JUF A;  2E64 A;  5IXF A;  1QQJ A;  3I55 T;  1VUB A;  2Y90 A;  2DRK A;  2RN8 A;  4X34 A;  5L8R E;  1XTD A;  4XTW A;  4OB1 B;  3CCM T;  2K5L A;  3CCU Q;  4J9F A;  3CPW A;  4BAC A;  1Q7Y R;  4X9D A;  3O8V A;  2M0Y A;  4OB3 B;  4GY5 A;  1KD1 C;  2C0T A;  2X3W D;  1G3W A;  4JJD A;  5GAO m;  1Y96 A;  1BIA A;  1U06 A;  2RMO A;  4PJO G;  2YSQ A;  3T9N A;  4KUD K;  4R0K A;  3PFS A;  2MIO A;  1K9A A;  2IIM A;  1U3O A;  2KRN A;  3L1A A;  1KQS P;  1OU8 A;  1W2B A;  3RMS A;  4RKU E;  2CRE A;  2KQW A;  2P4T A;  3A8H B;  1OI1 A;  5CO7 A;  5KYX A;  3C12 A;  1T0J A;  3OS5 A;  1MMN A;  2CZ1 B;  1OOT A;  1QLY A;  2D9T A;  2GTO A;  1KD1 U;  2KI7 A;  4IIO A;  1EX4 A;  1VQM Q;  1QCN A;  5LL6 S;  5D6W A;  2L3P A;  1ZBX A;  3PVQ A;  2A37 A;  2XDD A;  3OYN A;  5I11 A;  4M7D F;  1D0X A;  3OYA A;  1U1T A;  3ASK A;  2LQW A;  2L3Q A;  2FG0 A;  1Y71 A;  1GFC A;  3CCR Q;  4HKE A;  1BCO A;  2LMJ A;  4PJN A;  3J81 E;  4QQ6 A;  2RJD A;  1VQK A;  3HRS A;  3VS5 A;  1TH7 A;  3CEY A;  3D7S B;  1OV3 A;  3JSC A;  3BFM A;  2OTL Q;  1N5Z A;  1GCQ C;  4IUQ A;  1VQP Q;  1IXD A;  5GMK l;  4C92 B;  3JB9 F;  5GAO p;  2RF0 A;  2LNV A;  3QHS A;  3QWY A;  4M78 A;  3CD6 A;  1KFZ A;  2HMA A;  1HK9 A;  2LCC A;  1HXD A;  4GLK A;  3DLM A;  3RKX A;  4Y28 E;  3OQ5 A;  5M9O A;  4M7A B;  4J7F A;  1VQ8 Q;  5I21 A;  4IUP A;  1C1A A;  2RO0 A;  1MGQ A;  4HXJ A;  2O4X B;  1YBY A;  1KJW A;  1YJW Q;  5IAY A;  1N9S A;  3QBY A;  2QQS A;  2QI2 A;  1V1C A;  3H8Z A;  1M3B A;  1X6G A;  2FVU A;  2RA2 A;  2W10 A;  4ZTJ A;  2L3R A;  3M59 A;  4AMC A;  2R57 A;  4E7K A;  4JJC A;  4A4G A;  1QVF S;  2CP5 A;  2XD0 A;  4J7I A;  2AZV A;  1ZSZ B;  4QVC A;  3L2U A;  4OF1 A;  5GMK j;  3TSW A;  4AG1 C;  1YJ9 A;  4FYW B;  2IG0 A;  2YRV A;  4RTX A;  1VIE A;  3I56 T;  1TUC A;  2DXT A;  2D8H A;  3QSU A;  1PG5 B;  3LWH A;  2RPN A;  2I0N A;  5EC7 A;  2J7I A;  3UT1 A;  1UE9 A;  2DKG A;  4M75 C;  1OYX A;  3CPW P;  2RI3 A;  2FO0 A;  4M7D G;  3JB9 D;  3CCS A;  3OYD A;  2X35 A;  1FXX A;  2LNH B;  2KVQ G;  3WVE B;  1ZX6 A;  3JRZ A;  2V8K A;  3FC3 A;  2CP3 A;  4LDY A;  3JV3 A;  2LQK A;  2DL7 A;  1GCP A;  4C0Z A;  3KBG A;  4MZP A;  4ZTF A;  2RI5 A;  2XIC A;  4C8Q E;  2MOX A;  2FPE A;  2E12 A;  2XMF A;  5GAN 5;  1T3L A;  4RCC A;  2A08 A;  1JQQ A;  1QVG P;  2EQI A;  4ZN3 A;  2MMP A;  5LJ5 f;  1NZ9 A;  2KYM A;  2OTJ Q;  1VQ4 T;  2XID A;  1Q7Y C;  2RHZ A;  2XI9 A;  1WX6 A;  5CVI A;  3EG9 B;  2MF2 A;  2DL8 A;  1K73 U;  1RLP C;  3P8B B;  1UGS B;  3TSZ A;  1R8O B;  3X28 B;  4CC7 A;  1E6G A;  1WZO A;  4DBH A;  1X69 A;  3CC7 A;  2CDT A;  1S1N A;  4PJM A;  2JNG A;  4FIB A;  3G4S Q;  2I2L A;  1Q7Y U;  2D1X A;  2ZPB B;  1OPL A;  5LJ3 f;  3JCM J;  1GBQ A;  2HDA A;  1AVZ C;  2QA4 T;  1SRM A;  4O5V A;  4JS4 A;  1R77 A;  2ZZD A;  4C5H A;  5KYW B;  1HYO A;  1WIE A;  1X75 C;  3OBY A;  2EJG A;  3HRT A;  1NM7 A;  3GOX A;  2PUO B;  3M9Q A;  2EW3 A;  3HSB A;  2JT4 A;  2QEX T;  1GXI E;  2EKO A;  2PTK A;  4X1V A;  5J26 A;  3JAM E;  1KQS S;  4C92 A;  3JCM f;  1D0Z A;  3G71 A;  1WHG A;  4TVR A;  3OA6 A;  4JRQ A;  1VQ7 A;  2ZGW A;  3KFV A;  2DYB A;  3EHR A;  1XJW B;  2L3S A;  4OMP A;  2YWW A;  5CKD A;  1KSW A;  2K2V A;  4M7A A;  4FW1 A;  3NMZ C;  3U23 A;  1S72 A;  3OYK A;  2O4X A;  1PRL C;  2KDS A;  4Z89 A;  2AIR B;  2D0Q B;  4M77 B;  1MMG A;  2WSE E;  1KQ2 A;  4RTZ A;  4B9W A;  3CCL T;  5FU6 B;  4JLI A;  1X6B A;  3AHU A;  2VGM A;  4A63 B;  4XAX B;  3IQL A;  1SEM A;  3CCJ Q;  5C0M A;  3NTH A;  3M57 A;  3MKD A;  3TU4 K;  1ZSZ A;  4PJO E;  4E7I A;  2PVD B;  4RUG A;  4II1 A;  3CCU A;  1WHK A;  2CSQ A;  2L5Q A;  1MND A;  2HQX A;  1EZZ B;  4CC4 B;  4XTV A;  4WTO B;  1WXT A;  3MEV A;  5DY9 A;  5KYU B;  2E5Q A;  2RQW A;  3M56 A;  2ESW A;  2DBK A;  3G6E T;  4MZT A;  3EG0 A;  3C4S A;  2R5A A;  4M4Z A;  3OS0 A;  4LE9 A;  4EMK C;  1GL5 A;  1CKB A;  4OML A;  1Y7X A;  2CH4 A;  4KH1 B;  2D0N A;  4M78 C;  4LD6 A;  1AT1 B;  5LJ5 j;  1BI3 A;  1T3S A;  1G83 A;  4JRK A;  3CCE Q;  2WSC E;  2COW A;  3SEM A;  2H3E B;  1OUL A;  1PD1 A;  3CCU T;  3BW1 A;  2K3X A;  2M51 A;  1UJ0 A;  4A4K A;  1M90 R;  1SHG A;  1TXQ A;  2YHT A;  2CT3 A;  1QVP A;  3QZ5 B;  3EG9 A;  3OYY A;  4PKC C;  3RUX A;  2EQK A;  2PVG B;  3L2V A;  4KUL A;  3V7R A;  1YNZ A;  2NUZ A;  2EYX A;  3REA B;  5GAO n;  2CT4 A;  1UHF A;  3LH5 A;  5LJ3 j;  4OGC A;  1M1G A;  2HKN A;  2OJ2 A;  4ORZ A;  4JDS A;  5I2M A;  1WI7 A;  1Q81 C;  1WJS A;  1PM3 A;  5KYW A;  1VQM T;  2KYB A;  3OW2 P;  4XTU A;  3JCM V;  1QVG S;  2P0Q A;  3OYJ A;  1YIJ Q;  1PKS A;  5GAN h;  2LCL A;  1UGV A;  1W4S A;  1GCQ A;  2DL3 A;  2F1L A;  4RMO A;  2DXU A;  3CCR T;  1XOV A;  4DBR A;  2KMT A;  2HCK A;  3NPF A;  1Q81 U;  2CUD A;  1QP3 A;  3EG3 A;  4RG8 A;  1JRI A;  4ZGD B;  4AT1 B;  4J9D A;  2EGE A;  1K9M C;  1VQ5 A;  2CP2 A;  1ABQ A;  2OTL T;  3V8J A;  4F17 A;  1Z9Z A;  2K2M A;  2QGG A;  2QDY B;  2QQB A;  4E7H A;  1VQP T;  3A5Z B;  4J9H A;  5GAO q;  4M77 A;  1VQN Q;  2E65 A;  2EYW A;  3BY7 A;  4QQD A;  4M7D E;  4M7A G;  1X43 A;  5A0G A;  2DVJ A;  2W0Z A;  1BBZ A;  1H64 1;  3I5S A;  3L2Z A;  4PJL A;  3FDR A;  3G1J A;  1AZG B;  2X4X A;  2E41 A;  1VQ8 T;  2DD5 A;  1F1B B;  2NYS A;  2R58 A;  2KEA A;  3JCM X;  1YI2 Q;  1YJW T;  3RKY A;  2FZG B;  4E7J A;  2RQT A;  1RAH B;  5GAM h;  2EGC A;  1YHQ Q;  4FM4 B;  2JVV A;  1LVK A;  1JEG A;  5KYN A;  3VS4 A;  2LCS A;  4PJO F;  1Y0M A;  5KYU A;  1G3Y A;  3CXC A;  3FJ5 A;  3H0I A;  1Y07 A;  2A36 A;  2IPO B;  4C92 C;  1MV0 B;  1BI0 A;  4FCY A;  2SRC A;  1TU0 B;  4D8D A;  1VQ6 Q;  2QAS A;  1N8R R;  5IH2 A;  1KC8 C;  3SHW A;  1I4K 1;  2F2W A;  4C0D B;  4M7A C;  8ATC B;  2YRC A;  1M27 C;  2DTI A;  3CC4 Q;  3ZFJ A;  1B3Q A;  2CH4 W;  2GCX A;  2KRO A;  3I55 A;  2JTM A;  4ELZ C;  3VS2 A;  1G3T A;  3G7Z A;  1PCX A;  5LJ5 d;  1NG2 A;  2RHY A;  5GJW B;  1KC8 U;  1Z9Q A;  2HZY A;  2QDL A;  2RQR A;  2LX7 A;  4ZGJ B;  4KBM B;  2OTJ T;  5I22 A;  2DD4 A;  1PC0 A;  1ZSZ C;  2DPP B;  4XU3 A;  4CC2 A;  2SEM A;  3UAT A;  2RD1 A;  1NEG A;  5CKH A;  4PJO D;  2GBQ A;  3M0S A;  2BZY A;  4BDZ A;  1YCS B;  2EYZ A;  3LWI A;  1PSE A;  4OB0 B;  3CBO A;  2GTJ A;  5LJ3 d;  3E9F A;  1TUG B;  2WAC A;  3BE3 A;  3MET A;  1JBM A;  1MV3 A;  4A53 A;  1QCF A;  5GAN e;  4F7U F;  3VRZ A;  3G4S T;  1M90 U;  2MCN A;  2QXF A;  1PD0 A;  2J06 A;  2AT1 B;  2BE9 B;  4E2F B;  3QYG B;  4AFZ C;  2LVM A;  4GBQ A;  3JCM d;  1I81 A;  4E7L A;  1B07 A;  1G5V A;  2G3R A;  2HEQ A;  3VV0 A;  1GFD A;  2LQN A;  3FRN A;  2V1R A;  3EG2 A;  2OAU A;  2ED0 A;  3VUZ A;  1PRM C;  3LLR A;  4LN2 A;  2Z0W A;  3FEO A;  3VS7 A;  3HRU A;  2DJQ A;  4ZN1 A;  4C0F A;  1IZ6 A;  4KGV B;  5KYY B;  3M4Y A;  2P4R A;  5CKE A;  4MMK A;  1H3H A;  1MUZ A;  1IO6 A;  3GF5 A;  2O31 A;  1Q82 C;  4OMQ A;  2M1H A;  2CKK A;  5GAM e;  2DIG A;  3OYB A;  1MNE A;  1YIT Q;  4B6M A;  7AT1 B;  4V2S A;  1GRI A;  4NS5 A;  3JCM Q;  2EYY A;  2F5T X;  5LJ5 g;  4BE0 A;  5D6X A;  1X01 A;  2P0K A;  1PKT A;  3BDU A;  3M0U A;  2KR3 A;  1M30 A;  1M2V B;  2PZ1 A;  2QTX A;  3CCJ T;  3VYG A;  1Y57 A;  2K5I A;  4EDU A;  1BIB A;  1Q82 U;  1R0C B;  1SPK A;  2EYQ A;  3OS2 A;  4EMK A;  4M75 G;  2RHI A;  4JRI A;  2C0I A;  3A98 A;  3DLL A;  2MWP A;  3WXM B;  4DOW A;  5LJ3 g;  3I56 A;  4MZM A;  2K3Y A;  3JCM b;  1Q86 R;  3OYG A;  4A4F A;  4M77 C;  3HKS A;  3QUI A;  3A8G B;  4F7U G;  1WHL A;  5GAN 3;  2PUK B;  5FRN A;  1RAG B;  2A7Y A;  4A4E A;  1N8R C;  5FU6 C;  1NLP C;  1LJO A;  3H41 A;  3OMC A;  3RER A;  3QDF A;  1KHC A;  1UG1 A;  2VV5 A;  4M7D D;  3JCM g;  1RAF B;  2JMC A;  3OY9 A;  2DJZ A;  1R0B G;  2CP0 A;  3CMA Q;  3CCE T;  2DXC A;  1UGQ B;  2VYT A;  3PTA A;  2ZPF B;  4DBQ A;  1FWZ A;  3EHQ A;  2BZX A;  2DXB A;  3GLX A;  4C5I A;  2QK0 A;  1JJ2 S;  2J6F A;  1FX7 A;  3CBM A;  1RAC B;  1N8R U;  2FL7 A;  3CC2 Q;  4C8Q B;  3S3O A;  4BI8 B;  2DRM A;  1VQ4 A;  3E2U A;  2MWO A;  1U5S A;  5GMK m;  1WXB A;  1ZQ1 A;  1VQL Q;  2J6O A;  5D7U A;  1UFF A;  4M78 F;  1WHJ A;  3OB9 A;  3HFO A;  1PHT A;  1SHF A;  1UHC A;  2EWN A;  1G3S A;  2RJF A;  4Z8A A;  4OMM A;  1K73 C;  1VQ9 Q;  8AT1 B;  1I8F A;  3CME Q;  1W2B P;  4N0A A;  2QA4 A;  5J39 A;  3M55 A;  1YIJ T;  3LYI A;  2EVR A;  1XQH A;  1VQO A;  2QEX A;  1K76 A;  4CRI A;  1PWT A;  3CBP A;  2RK1 A;  3X25 B;  2OX7 A;  4JS5 A;  3M53 A;  5GAN 8;  2X4W A;  5KYY A;  3PE0 A;  3CCQ Q;  1VYU A;  3NFC A;  4RTY A;  3EFS A;  3EH1 A;  3A8M B;  1CSK A;  4WF2 A;  4OVA A;  5AT1 B;  4E6R A;  2P0P A;  3NTK A;  2VXE A;  3INZ A;  1VQN T;  3TRE A;  4J8O A;  2A0F B;  4J6Y A;  1EIF A;  4OP0 A;  3H9N A;  5A2Q E;  4HT8 A;  3P8H A;  2RQU A;  5HCK A;  2E70 A;  2P84 A;  4K11 A;  4BUG A;  2RHU A;  5HY6 A;  1M2V A;  3OYE A;  2DFU A;  2M0O A;  4IUV A;  3X24 B;  4C5G A;  3CCL A;  1UEB A;  2GQI A;  1VQO T;  1AWJ A;  2RH2 A;  3CCM Q;  1W1F A;  3CCV Q;  4JPB W;  2MI6 A;  1YI2 T;  1H92 A;  1YP5 A;  3F70 A;  5A0L A;  4LDW A;  1TS9 A;  3FLG A;  1YHQ T;  4DQ2 A;  2COY A;  1GBR A;  3DB3 A;  3DB4 A;  4D6W A;  1QWE A;  2K9G A;  2BTT A;  2EJF A;  3HTR A;  2O88 A;  1I5L A;  4A4H A;  4N4G A;  1YJN A;  2KRS A;  2VAS A;  5GAN f;  3JCM c;  1MMD A;  4JLG A;  2HL5 C;  3ME9 A;  2E1H A;  2EJ9 A;  4PJO B;  1BK2 A;  4M78 G;  2DO3 A;  2YUN A;  4LDV A;  4RTV A;  1VQ6 T;  2EFI A;  4HCB A;  2EBP A;  2QQR A;  2DZ9 A;  3G6E A;  4JZ3 A;  3OSS C;  4FT2 A;  4RTT A;  1HD3 A;  2H3J A;  1X2K A;  1QP2 A;  2A3L A;  1D3B B;  2DZC A;  2J05 A;  1PSF A;  2KAF A;  3H6Z A;  3MPU B;  3CC4 T;  3M58 A;  1DJ7 B;  3ZEH A;  2ABL A;  1KG1 A;  1QW1 A;  2FHD A;  4WCI A;  1K8A R;  4C8Q A;  3ULR B;  1YJN T;  2JXB A;  4C92 F;  3PIO A;  3RIR A;  1ZSG A;  1N9R A;  1ZBJ A;  1X6O A;  5IHK A;  1OEB A;  4D8K A;  1M4Z A;  1ZLM A;  1Q86 U;  2YLB A;  2DEU A;  2HAX A;  3P8D A;  1KIK A;  4A54 A;  3SFM A;  3EGX B;  5GAM f;  3MEU A;  4M7A F;  3GPL A;  3VU3 C;  1WHH A;  1ABO A;  3RBB B;  1ZUK A;  4C0D C;  3E19 A;  2KXC A;  4F16 A;  2ATC B;  1LPL A;  3RNJ A;  3GP8 A;  4X9C A;  2OAW A;  1VQM A;  5DLQ E;  1NLO C;  1M9S A;  1VQK Q;  2VVK A;  2CGH A;  2MK5 A;  1BB9 A;  3TQ7 P;  2FEI A;  3PNW C;  4UC4 A;  3VRY A;  4NOY A;  1I0C A;  1AWW A;  2DVE A;  1QVF A;  3H0F A;  2VGN A;  2DBM A;  4FU6 A;  3E1S A;  3CCR A;  3VJP A;  3OSV A;  2NWM A;  1OZ2 A;  3OYI A;  2MPX C;  3CPW S;  2RJC A;  1N27 A;  2AHJ B;  3L2R A;  4M75 E;  1JU5 C;  3VS6 A;  2QYZ A;  2LJ3 A;  3PMT A;  1C6V X;  2DL5 A;  2NLU A;  1UJY A;  2XDB A;  3CD6 Q;  1C0M A;  4J6W A;  2OTL A;  2CP7 A;  2LDM A;  2EIF A;  1RLQ C;  4C92 D;  2EQM A;  1VQP A;  1NE8 A;  1RL2 A;  4F7U E;  4EMG A;  2YUP A;  1W2B S;  4Y91 A;  2RNA A;  4DBF A;  4FT4 A;  1QWF A;  2O9S A;  2HBP A;  4IUR A;  2L0A A;  2LC4 A;  4PFP A;  4M7A D;  3C0C A; 
#chains in the Genus database with same CATH homology
 2DPP B;  1YBY A;  2O4X B;  4XU3 A;  2RHX A;  3SD4 A;  2RD1 A;  2XKO C;  2MAM A;  5CKH A;  2LX9 A;  5IAY A;  1YIT T;  4BB7 A;  1VQ8 A;  1N9S A;  4M7D B;  4PJO D;  3CXC S;  3OYL A;  3M5A A;  3QBY A;  2QQS A;  2QI2 A;  3H8Z A;  3V7C A;  4BDZ A;  1O75 A;  2ZPG B;  2FVU A;  1YJW A;  5GAN j;  2GFU A;  3CC7 T;  3LWI A;  2D6F A;  2CS7 A;  2YLC A;  1PSE A;  1UB4 A;  1WNL A;  2EQJ A;  1RI0 A;  2RA2 A;  3CBO A;  4OB0 B;  4N0A C;  4XU0 A;  5LJ3 d;  3E9F A;  4XK8 E;  3TEE A;  4ZTJ A;  2WAC A;  3MET A;  1JBM A;  2L3R A;  3M59 A;  3VYH B;  2R57 A;  4A53 A;  4E7K A;  3R6O A;  1Q86 C;  5GAN e;  4F7U F;  2XDP A;  2FB7 A;  4A4G A;  4PJO A;  1QVF S;  2XD0 A;  5C6S A;  4J7I A;  3G4S T;  1M90 U;  2QXF A;  4QVC A;  2M9U A;  4BY6 B;  3L2U A;  4OF1 A;  5CKF A;  5GMK j;  2RI2 A;  1H3Z A;  1YJ9 A;  2BKD N;  2IG0 A;  2YRV A;  3QYG B;  4LDX A;  1VIE A;  2LVM A;  5KCH A;  3I56 T;  2DXT A;  3CPF A;  5GAN 2;  3QSU A;  1JB0 E;  3LWH A;  2GFA A;  2ZPI B;  1D3B A;  3JCM d;  1I81 A;  5GMK e;  3UT1 A;  4M75 C;  2DKG A;  1OYX A;  2GF7 A;  4XQ3 A;  3G71 T;  4E7L A;  3HPW A;  1Q81 U;  2RI3 A;  4M7D G;  1VQ7 T;  1SSF A;  2RJE A;  3JB9 D;  1G5V A;  2G3R A;  3CCS A;  3OYC A;  2CZ0 B;  2X35 A;  3OYD A;  3VV0 A;  1FXX A;  5FLX E;  2KVQ G;  4QW2 A;  3FRN A;  3OS1 A;  2OAU A;  3WVE B;  3VUZ A;  3KUF A;  4MDX A;  3JRZ A;  2V8K A;  3FC3 A;  3QZ9 B;  4M77 E;  3LLR A;  4XU2 A;  5KE3 A;  4ME7 A;  4LDY A;  2ZCF B;  4YTL A;  4JJN K;  3RES A;  2LQK A;  3FEO A;  3HRU A;  4C0Z A;  2EQU A;  2X4Y A;  3KBG A;  4MZP A;  3MP6 A;  4ZN1 A;  2RI5 A;  4C0F A;  2XIC A;  4C8Q E;  4ZTF A;  1KQS A;  3GNG A;  4NL3 A;  2E12 A;  5CIU A;  4KUI A;  4RCB A;  5GAN 5;  4DA4 A;  1S72 T;  1IZ6 A;  2JTF A;  4RCC A;  2CYZ B;  4BE1 A;  4M75 B;  3M4Y A;  5GAM j;  5KE2 A;  1M8V A;  5CKE A;  4ZN3 A;  2MMP A;  4C8Q G;  1NZ9 A;  4MMK A;  5LJ5 f;  5LJ5 h;  3JB9 I;  3GF5 A;  1VQ4 T;  1Q82 C;  2M1H A;  2XID A;  3V7S A;  1Q7Y C;  2CKK A;  2DIQ A;  4JUV A;  2DIG A;  5GAM e;  3OYB A;  4P5N A;  4VUB A;  2RM4 A;  2RHZ A;  4QVD A;  2XI9 A;  4V2S A;  1WQW A;  2X4J A;  1YCY A;  3MEW A;  4NS5 A;  2MF2 A;  2F5T X;  5CVI A;  5LJ5 g;  3JCM Q;  4BE0 A;  2DTO A;  3EFR A;  1X01 A;  2Y4Y A;  5D6X A;  5HK0 A;  1K73 U;  2P0K A;  2OTJ A;  4NL2 A;  1AHJ B;  3P8B B;  4F7U B;  3BDU A;  1UGS B;  1JJ2 A;  2HD0 A;  3EAE A;  4BE2 A;  2Y4X A;  1KHI A;  4HCC A;  1R8O B;  1M5Q 1;  4HA8 A;  4LDU A;  4M77 F;  3X28 B;  1YIT A;  4PLL A;  1VQL T;  2WSF E;  2QTX A;  3CCJ T;  4PLI A;  4C8Q F;  3VYG A;  3QDR B;  2L8D A;  2K5I A;  4EDU A;  3CC7 A;  4BI4 A;  1BIB A;  2XK0 A;  3E9G A;  1BI1 A;  2JNG A;  4FIB A;  1Q82 U;  2I2L A;  1Q7Y U;  3MEA A;  1IRE B;  2EYQ A;  4FSX A;  5CQY A;  2JZ2 A;  3OS2 A;  4EMK A;  4M75 G;  3SDZ A;  1K8A U;  1NPR A;  2ZPB B;  4N4I A;  5LJ3 f;  3JCM J;  1NJI C;  5KCO A;  5LJ3 h;  3OYH A;  2QA4 T;  4O5V A;  5CKB A;  3G4S A;  1U8R A;  2RHI A;  4JRI A;  4JS4 A;  2ZZD A;  4C5H A;  2QQ9 A;  3DLL A;  2MWP A;  3MHX A;  3CME T;  3OMG A;  1X75 C;  4EPC A;  3OBY A;  2EJG A;  3HRT A;  3WXM B;  4DOW A;  2PUO B;  3M9Q A;  5LJ3 g;  2LTO A;  3GOX A;  3I56 A;  3HSB A;  4MZM A;  2K3Y A;  3JCM b;  2QEX T;  5GAO l;  1GXI E;  2EKO A;  3LGF A;  3OYG A;  5J26 A;  2ZPH B;  3JAM E;  4A4F A;  1KQS S;  4M77 C;  3HKS A;  3QUI A;  3A8G B;  4C92 A;  4F7U G;  3JCM f;  3G71 A;  1B34 B;  4OGE A;  5GAN 3;  1M90 C;  3JCM h;  2PUK B;  4TVR A;  3OA6 A;  4JRQ A;  1VQ7 A;  4M75 F;  2ZGW A;  1KQ1 A;  2A7Y A;  4A4E A;  4C8Q C;  3HP9 A;  5FU6 C;  3JCM W;  1N8R C;  5D6Y A;  1LJO A;  5IN1 A;  1NJI U;  3OMC A;  3RER A;  4ATO A;  1KHC A;  4MML A;  2VV5 A;  4BDY A;  4M7D D;  3JCM g;  4OB2 B;  3J7A F;  4M78 E;  2F5K A;  5CQX A;  3OY9 A;  2DJZ A;  3CCQ T;  3CCE T;  2DXC A;  1UGQ B;  5DLO A;  2VYT A;  3MO8 A;  5CKD A;  5GAN 7;  3PTA A;  3L2Q A;  4Q5W A;  2ZPF B;  5CK9 A;  2K2V A;  1FWZ A;  4M7A A;  2LT4 A;  2DXB A;  3GLX A;  2QQA A;  4L5G A;  5EG2 A;  4QVZ A;  4C5I A;  1S72 A;  3CMA A;  2XHC A;  3OYK A;  2O4X A;  1JJ2 S;  2KDS A;  4OMF B;  1FX7 A;  3PMI A;  2D0Q B;  5GAN 4;  3CBM A;  4M77 B;  2WSE E;  3FJP A;  1WPY A;  2VUB A;  4M7D A;  4XU1 A;  1BYM A;  4EMH A;  1XNI A;  4CI0 C;  1KQ2 A;  1N8R U;  4B9W A;  3LH0 A;  2FL7 A;  2LQ8 A;  3CCL T;  4C8Q B;  2B8A A;  5FU6 B;  4BI8 B;  3S3O A;  4J6X A;  4JLI A;  1VQ4 A;  2F69 A;  2HQE A;  3M54 A;  4B9X A;  3AHU A;  3QXE B;  4C8Q D;  1Y96 B;  3QYH B;  4BD3 A;  2MWO A;  5GMK m;  2E6N A;  2VGM A;  1ZQ1 A;  3SWN C;  2JN0 A;  2XU8 A;  3HL8 A;  3CC2 A;  4XAX B;  1NPP A;  3QJY A;  3CCV T;  5C0M A;  4M78 F;  4R56 A;  4HT9 A;  3NTH A;  2VXF A;  3M57 A;  3RKW A;  2K5F A;  3OB9 A;  1LNX A;  3TU4 K;  2L89 A;  1VQL A;  4PJO E;  3HFO A;  3MP8 A;  1BKB A;  2FYK A;  4MDW A;  4E7I A;  2PVD B;  1WQ7 A;  3CCJ A;  4II1 A;  3CCU A;  5GAN d;  2EWN A;  1G3S A;  5KH6 A;  3C94 A;  2RJF A;  3QKJ A;  3QPH A;  1K73 C;  2L5Q A;  2HQX A;  5DM7 R;  4HCZ A;  3S6W A;  1I8F A;  1VIF A;  1WJQ A;  4XTV A;  3OW2 S;  5GAO r;  5FRM A;  3VUB A;  3CMA T;  3MEV A;  5DY9 A;  5CAI A;  1K9M U;  4M77 G;  3MP1 A;  3QII A;  4N0A A;  2E5Q A;  4FL6 A;  2QA4 A;  3SWN B;  2ZPE B;  5J39 A;  2CZ6 B;  3M56 A;  1VQ9 A;  3M55 A;  3L42 A;  1YIJ T;  3G6E T;  3LYI A;  4MZT A;  5HK3 A;  4M75 D;  3C4S A;  3OYM A;  2R5A A;  3CME A;  3OS0 A;  3QO3 A;  2PVO B;  1XQH A;  3PGG A;  4EMK C;  1QVG A;  3M4G A;  3NTI A;  3FB9 A;  4IUT A;  3VKI A;  4J83 A;  3J80 E;  1VQO A;  1Y7X A;  3UWN A;  3JB9 J;  2QEX A;  2PU9 B;  1P92 A;  2GQV A;  1K8A C;  1VQ5 T;  3UPU A;  3BDL A;  4M78 C;  4CRI A;  3V8L A;  4LD6 A;  3CBP A;  2RK1 A;  3X25 B;  2R5M A;  4JS5 A;  3M53 A;  5LJ5 j;  5GAN 8;  2X4W A;  1BI3 A;  4JRK A;  4M75 A;  2WSC E;  3NFC A;  1M1F A;  3EFS A;  1WJR A;  3A8M B;  4O6J A;  4WF2 A;  4OVA A;  2M16 A;  3CCU T;  3BW1 A;  2K3X A;  2E10 A;  5LJ5 e;  2DK3 A;  4C92 G;  3CCQ A;  1UGR B;  3SB2 A;  2P0P A;  3NTK A;  4R55 A;  2RK2 A;  3CCE A;  4QQG A;  4A4K A;  3OBW A;  2VXE A;  3INZ A;  1VQN T;  2YHT A;  3TRE A;  3QZ5 B;  1QVP A;  2LRQ A;  4XTY A;  4EMK B;  3JCM P;  3OYY A;  4J6Y A;  4J8O A;  2XG8 D;  1EIF A;  4PKC C;  5J3B A;  1ZHI A;  2EQK A;  2EAY A;  4OP0 A;  3RUX A;  5A2Q E;  4HT8 A;  2PVG B;  3P8H A;  2RB6 A;  4PNO A;  2DTH A;  4F7U A;  1VQ9 T;  3L2V A;  4PL6 A;  4KUL A;  4M78 B;  2E70 A;  4RG2 A;  3V7R A;  3ER0 A;  4BUG A;  5GAM d;  1U1S A;  4N4H A;  4KT0 E;  3KXT A;  2IVW A;  2RHU A;  5HY6 A;  1LOJ A;  3OYE A;  2M0O A;  4IUV A;  3X24 B;  4C5G A;  3CCL A;  4XTX A;  1UEB A;  5GAO n;  3ZBD A;  1VQO T;  4DOV A;  2RH2 A;  4PJO C;  4ZGE B;  5LJ3 j;  4OGC A;  3HHT B;  3LX7 A;  2MI6 A;  1YI2 T;  1M1G A;  3F70 A;  5A0L A;  4JDS A;  4LDW A;  1MHN A;  3FLG A;  5I2M A;  1YHQ T;  4DQ2 A;  3CCM A;  4Z02 A;  4XTZ A;  2PQW A;  3UDC A;  3CCV A;  1Q81 C;  5LJ3 e;  1WJS A;  3Q1J A;  5AYF A;  1BI2 A;  3DB3 A;  3DKM A;  3DB4 A;  4D6W A;  1VQM T;  2EJF A;  3TCJ A;  4XTU A;  2JOY A;  2E6Z A;  3JCM V;  1QVG S;  2P0Q A;  1I5L A;  4A4H A;  4N4G A;  1YJN A;  2DAQ A;  2VC8 A;  3OYJ A;  1UGP B;  4J5Y A;  4C5E A;  5GAN f;  3JCM c;  2CZ7 B;  2K4Y A;  2LT1 A;  3URG A;  2DEQ A;  4JLG A;  5GAN h;  2LCL A;  4IUU A;  3ME9 A;  3PIP A;  2E1H A;  1VQK T;  1W4S A;  2EJ9 A;  4M78 G;  1B34 A;  4PJO B;  2KK4 A;  2DO3 A;  3JCM e;  4C0G A;  3A8L B;  4LDV A;  4C92 E;  4RMO A;  2DXU A;  3GIB A;  3CCR T;  1XOV A;  1VQ6 T;  2EFI A;  2KMT A;  4HCB A;  2QQR A;  1YIJ A;  2DZ9 A;  3G6E A;  2C06 A;  5GAN g;  3OSS C;  2V8I A;  3QJ6 A;  4FT2 A;  5HKC A;  5GMK i;  1QP3 A;  4M77 D;  2V8J A;  4ELY C;  3LW5 E;  1JRI A;  2H3J A;  3A8O B;  4RG8 A;  1QP2 A;  2A3L A;  5FU7 C;  5GAN 6;  4ZGD B;  1D3B B;  2DZC A;  2O01 E;  5GMK h;  2JUF A;  2E64 A;  3I55 T;  1K9M C;  1PSF A;  1VUB A;  2KAF A;  2Y90 A;  3H6Z A;  3C95 A;  4E47 A;  5CR2 A;  3CC4 T;  3M58 A;  1VQ5 A;  2OTL T;  5FRN A;  4X34 A;  3RMQ A;  1DJ7 B;  1XTD A;  5L8R E;  3V8J A;  4XTW A;  4LD9 K;  3ZEH A;  4OB1 B;  4M7A E;  2QDY B;  3CCM T;  5A0D A;  2K5L A;  1WGS A;  2QQB A;  4E7H A;  2BIV A;  1VQP T;  3A5Z B;  1KG1 A;  1QW1 A;  5GAO q;  5IT9 E;  4M77 A;  3CD6 T;  3CPW A;  1V29 B;  2FHD A;  4X9D A;  4BAC A;  3X26 B;  2HNI A;  3O8V A;  2E65 A;  3BY7 A;  4QQD A;  3QG1 A;  4OB3 B;  3OYF A;  4M7D E;  4M7A G;  4GY5 A;  4C8Q A;  1KD1 C;  5A0G A;  1G3W A;  4BI3 A;  1YJN T;  5GAO m;  1H64 1;  1VQN A;  3L2Z A;  5FU7 B;  1Y96 A;  4C92 F;  1BIA A;  5I2S A;  3PIO A;  4PJO G;  3RIR A;  3FDR A;  1OZ3 A;  3T9N A;  1N9R A;  4KUD K;  1X6O A;  2X4X A;  2E41 A;  3PFS A;  1VQ8 T;  1M4Z A;  1N6A A;  1Q86 U;  2YLB A;  4IKF A;  2DD5 A;  2KSS A;  2HAX A;  3P8D A;  2R58 A;  3JCM X;  3L1A A;  4A54 A;  3SFM A;  1W2B A;  1YJW T;  3RMS A;  3RKY A;  5GAM f;  4RKU E;  3L2W A;  4E7J A;  2KQW A;  2P4T A;  2BUD A;  1OI1 A;  3A8H B;  3MEU A;  5CO7 A;  5GAM h;  3C12 A;  4M7A F;  4FM4 B;  2JVV A;  3OS5 A;  2CZ1 B;  3PT9 A;  2D9T A;  1KD1 U;  3GPL A;  1YI2 A;  3VU3 C;  4C0D C;  1M1K C;  4PJO F;  5GAM g;  3E19 A;  5LL6 S;  5D6W A;  3N5B B;  1YHQ A;  1G3Y A;  1ZBX A;  2XDD A;  3OYN A;  3CXC A;  3GP8 A;  4M7D F;  3SWN A;  4X9C A;  1Y07 A;  1YJ9 T;  3OYA A;  1VQM A;  1U1T A;  5DLQ E;  4C92 C;  1M9S A;  1O9S A;  3JB9 H;  2K57 A;  3ASK A;  3X20 B;  1BI0 A;  3JB9 G;  1Y71 A;  2CGH A;  5FRO A;  4HKE A;  4JRP A;  3MCA B;  3PNW C;  4UC4 A;  3J81 E;  4QQ6 A;  4NOY A;  2RJD A;  1VQK A;  2DVE A;  1QVF A;  1KC8 C;  2VGN A;  3HRS A;  3CCS T;  3CC2 T;  1I4K 1;  4FU6 A;  1TH7 A;  3CEY A;  3E1S A;  1M1K U;  3CCR A;  3VJP A;  1VQ6 A;  4C0D B;  3OSV A;  1OZ2 A;  3JSC A;  3OYI A;  3CPW S;  3V8K A;  2RJC A;  4M7A C;  1N27 A;  2AHJ B;  4M78 D;  4M75 E;  3BFM A;  2DTI A;  3L2R A;  3ZFJ A;  3HFN A;  2GCX A;  3PMT A;  4IUQ A;  2NLU A;  5GMK l;  4L6V 5;  3I55 A;  2XDB A;  2JTM A;  4C92 B;  4ELZ C;  1G3T A;  4J6W A;  3G7Z A;  3CC4 A;  3JB9 F;  2OTL A;  4M7D C;  5GAO p;  3S3N A;  2LNV A;  2LDM A;  2EIF A;  4C92 D;  5LJ5 d;  2EQM A;  5CCA A;  1VQP A;  3QHS A;  4M78 A;  1NE8 A;  2RHY A;  1RL2 A;  3CD6 A;  1KC8 U;  1HK9 A;  2LCC A;  4F7U E;  1HXD A;  4EMG A;  3LGL A;  4GLK A;  3DLM A;  3GNF B;  3RKX A;  3WVD B;  1W2B S;  4Y28 E;  4Y91 A;  3OQ5 A;  4ZGJ B;  3S3M A;  4FT4 A;  4M7A B;  5M9O A;  2KY9 A;  4J7F A;  4L59 A;  5I21 A;  3OW2 A;  4KBM B;  2HBP A;  4IUP A;  4IUR A;  2OTJ T;  2RO0 A;  3FIF A;  2LC4 A;  2DD4 A;  4M7A D;  1MGQ A;  4BY6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...