3QBYA

Crystal structure of the pwwp domain of human hepatoma-derived growth factor 2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
93
structure length
93
Chain Sequence
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Hepatoma-derived growth factor-related protein 2
publication title Structural and Histone Binding Ability Characterizations of Human PWWP Domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 93
sequence length 93
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00855 PWWP PWWP domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3qbyA00
2CKKA 3S3OA 2P0KA 5IAYA 5J39A 1OZ2A 2RJDA 3MO8A 3QKJA 3UWNA 4BE2A 2RI2A 3OYIA 3QIIA 5M9OA 3MEVA 4B9XA 2L8DA 5FRNA 4QQGA 1WJQA 3OYHA 2M1HA 4LD6A 3OYEA 3OYFA 2MWOA 3S3NA 3UT1A 3META 2K3XA 4E7LA 4BE1A 2EKOA 2QQRA 1MHNA 2L89A 3CEYA 2LVMA 2M16A 2LCCA 3DB4A 4N4IA 4IUPA 1H3ZA 2EQKA 4QW2A 3OY9A 4C5HA 2RHYA 4BACA 4BD3A 3OS2A 2JTFA 2XDPA 2DIGA 4IUTA 4IKFA 2XK0A 4IUUA 3NTIA 5FRMA 2MWPA 2RI3A 4QQ6A 4ZTJA 3LYIA 3E9GA 3H8ZA 4L59A 5KE3A 3OS1A 3PMTA 1WGSA 3C4SA 2FHDA 4GY5A 4X34A 5D6YA 2L3RA 2YRVA 4FU6A 3OYNA 4E7IA 2RJFA 3OMCA 3OYMA 3PFSA 2RHIA 3OYGA 4FL6A 3S3MA 2DIQA 2E5QA 2GFUA 3P8HA 2RHUA 4EDUA 2PQWA 2HQXA 4C5IA 4QVZA 2LTOA 2BIVA 3LX7A 3L2WA 4B9WA 5FROA 2R5AA 3ME9A 3F70A 3DB3A 1WJSA 3KUFA 4NS5A 1G5VA 3QJ6A 1OYXA 3LGFA 4BDYA 4C5EA 2DAQA 3FDRA 4Q5WA 1OI1A 4RG2A 2LRQA 2RJEA 5C0MA 3P8DA 1N27A 2EQMA 4A4FA 3OS0A 2GFAA 3FEOA 2EQUA 4BDZA 3MEUA 2VYTA 3ASKA 3MEAA 4N4GA 4II1A 3FC3A 2K3YA 1SSFA 2HQEA 5IN1A 4CRIA 2QQSA 5C6SA 3EAEA 3LLRA 3H6ZA 3OQ5A 5KE2A 2NLUA 4A4EA 3MEWA 5KCOA 2X4YA 2X4XA 4C5GA 2BUDA 2RI5A 4A4GA 2RHZA 4A4HA 1RI0A 3DLMA 2R57A 4E7KA 4IUVA 3LH0A 1OZ3A 3MP8A 2IG0A 3OMGA 4OVAA 3OA6A 3L2RA 2R5MA 2O4XA 3L42A 3QBYA 2EQJA 4IUQA 3E9FA 4HCZA 3OYLA 5D6WA 3SD4A 4E7JA 2D9TA 3L2UA 2EFIA 3L2VA 2O4XB 3MP6A 3PNWC 1XNIA 3OYDA 3ZEHA 2X4WA 2R58A 4E7HA 5D6XA 4IURA 2BKDN 3PMIA 4PLIA 3OYCA 3L2QA 2M0OA 2G3RA 1KHCA 3NTKA 3OYJA 4BE0A 2RHXA 4UC4A 3FLGA 5KH6A 3GOXA 3OYKA 1WJRA 2E6NA 2JZ2A 3M9QA 4PLLA 2F5KA 4QQDA 3OB9A 2RO0A 4ZTFA 3OYAA 3MP1A 2B8AA 2X35A 3LGLA 4N4HA 3NTHA 2LDMA 2RJCA 4Z02A 3Q1JA 5CIUA 3S6WA 2WACA 2GF7A 5KCHA 4PL6A 5J26A 3OYBA 3BDLA 3O8VA
chains in the Genus database with same CATH superfamily
5LL6S 4DBRA 3S3OA 3OYYA 3PIOA 2KNBB 2Y4XA 3QIIA 1Q95G 2L8DA 2DD4A 1V76A 1K9AA 4BY6B 5I11A 4NOYA 4MZPA 2RNAA 2EKOA 3JCMJ 6AT1B 2JN0A 2K5LA 4KULA 2XDDA 4N4IA 2FPDA 1AVZC 3PE0A 4BD3A 1QVFS 5GJWB 3H41A 3VV0A 2YHTA 4KBMB 4EIKA 2YLBA 2NUPA 1WGSA 2LJ0A 2LX9A 3RESA 2LQNA 2H8HA 2YLCA 2O01E 3RBBB 2K9GA 1MMNA 2KSSA 5IH2A 1KSWA 1VQ9T 2QA4Q 4D6WA 2QQAA 2I0NA 4X1VA 1H641 4M77C 2VC8A 3JRZA 1S72Q 2J06A 1NLPC 3VS3A 4RTTA 1E6GA 5GMKm 3ZBDA 3HL8A 3EGDA 4J9HA 1U1TA 1QKWA 2QQSA 5CAIA 3LLRA 2V1RA 2K5IA 2X4JA 1QVFA 3EH1A 2IVWA 2EPDA 1YITT 2EQJA 3JCMW 4LUEA 1KD1C 2LT1A 1PCXA 3CXCA 2EFIA 3PNWC 2GTJA 1VQ7T 3GNGA 2FPEA 2HL3A 2VUBA 4O6JA 4LDUA 2O9VA 4Z8AA 4FYVB 1UGRB 1ZBXA 3QO3A 2HMAA 5LJ3f 1A0NB 5J26A 3CC2Q 1I4K1 2CKKA 3HKSA 1MMGA 1SKUB 2RA2A 3OYIA 2LQKA 3EG3A 4VUBA 2FZCB 2BE9B 2F2VA 2HQHA 3VUZA 2B86A 3OY9A 3CMAA 4KH0B 4OB2B 3JCMX 3CC7Q 2EQIA 4IKFA 1OQKA 3NTIA 4EMKA 2I2LA 4AG1C 3ZL7C 2PZ1A 1G3YA 3BW1A 2QA4T 2YWWA 4AG2C 3OMCA 2RHIA 2ED0A 4KRTA 3ER0A 4M4ZA 1FMVA 1EX4A 4AFSC 2LQWA 1S72T 5GANe 1NZ9A 2D6FA 5LJ5e 3CCUA 3X20B 4C8QC 3LGFA 1G3WA 4BDYA 1BKBA 1LOJA 1NEBA 4N4GA 2AIRB 2CZ1B 3I9QA 2CDTA 1OPLA 2FYKA 1WA7A 3RKWA 1K1ZA 3EFOA 3DLMA 2DXBA 2X3WD 2IG0A 2DJQA 3SWNA 2RQWA 2MF2A 5FWCA 2DL5A 3QYGB 1B34B 1M2VA 2CP5A 4M78F 5LJ3g 2NWMA 2JXBA 3CCQQ 1ZBJA 1Q86U 2FEIA 3CC2T 3EHQA 2JOYA 2YDLA 1TOVA 1HK9A 2X35A 5I22A 1W2BP 1Q7YR 2HEQA 5GAN6 1OPKA 2Z0WA 2HAXA 3QSUA 3GIBA 2JJ9A 3M0SA 2CP0A 3O8VA 3A8HB 5J39A 1PM3A 1OZ2A 4HVUA 5M9OA 3G71Q 3CCRQ 1BIAA 1RACB 4OB1B 4E7LA 5FU7B 4XTXA 1N9RA 3CC7T 1I8FA 2LCCA 4M7AF 4E2FB 2V26A 3I56A 2DBKA 1KJWA 1Y71A 4PJNA 1RAIB 1M1GA 2FZGB 4QQ6A 2DL4A 2KXDA 3RKXA 5KE3A 1X75C 2GCXA 4M75A 2SEMA 3HP9A 5CKEA 1W70A 3S3MA 3OS5A 2O88A 2RHUA 3H9NA 1HXDA 1M8VA 4M7DB 5KYUA 2VXFA 1TXQA 3M57A 1WJSA 2QQBA 2QASA 2DEUA 3RUXA 2M0YA 2COWA 2HSEB 4E7SA 1YJ9Q 1JEGA 2FVUA 1RAHB 1K9MR 2DZCA 4NL2A 2RPNA 4OMMA 1PSFA 1ARKA 4ZGDB 4C92B 4C8QG 1W6XA 2AK5A 5IN1A 3HPWA 1VQPQ 5HK3A 4B6MA 2CUDA 1SF9A 4JLGA 2F5TX 5IXFA 5GAMd 1MGQA 2R57A 2LP5A 4IUVA 2KDSA 3OMGA 4OVAA 2O4XA 1B7TA 1D3BB 2WSFE 2MI6A 2QDYB 3JCMg 4NL3A 2OTJQ 1ZHIA 4D8KA 3CCQT 2QAZA 3HFNA 3CPWP 1CKBA 2M0OA 2JVVA 2RK2A 1TWBA 1Q81U 4J9EA 1W2BS 1UEBA 1GCQA 3R6OA 3LWHA 2G6FX 4C0DB 3G71T 5KYYA 5KCHA 1WXBA 1R8OB 3CCRT 2YT6A 2AZVA 4BE2A 3QG1A 3M4GA 1FWZA 4LD6A 1G83A 2MWOA 3OBWA 3UT1A 1PRLC 3E2UA 3URGA 3CEYA 1VQLA 1Q82C 2A36A 4JUVA 3TQ7P 2ESWA 3EH2A 1D1BA 1RLPC 1Z9ZA 1ZQ1A 2MAMA 1PRMC 1PWTA 4IUTA 2F2WA 2MWPA 5GJVB 5GAMf 2OJ2A 3G4SQ 4N0AA 1YP5A 1YI2Q 1T3LA 2YRVA 2JS0A 4OMQA 1UE9A 4E7IA 1ABQA 3DKMA 4JS4A 3NGPA 2D8HA 5KYWA 3PTAA 2XI9A 1TUGB 4RTVA 2V8IA 5GAN5 5KYXB 1GCPA 1YJ9T 1SHGA 3ME9A 3JAME 2FB7A 1TU0B 2X9HA 2RB6A 1SEMA 1KC8U 4M77B 2CP6A 4M78E 2DBMA 3RMSA 1N27A 1VQPT 2EQUA 4BDZA 3MEUA 4LDYA 3CD6Q 3FC3A 4ZN3A 4ZGEB 2HSPA 2PVOB 3L2ZA 1DJ7B 2OTJT 4AFZC 4EMHA 1SG5A 3E9FA 4L6V5 1NBEB 2ZPFB 2H3JA 2CYZB 1FMWA 2LCLA 3CPWS 3MHXA 4J6WA 4M7AE 2QGFB 4RG8A 1IZ6A 4F04B 4FT4A 1IGQA 4F16A 3M58A 1M90C 3QPHA 2LC4A 2JT4A 1YJWA 1ZLMA 5CVIA 2GF7A 2P0QA 3JCMQ 2A3LA 4M7DF 2FG0A 3UATA 1KHIA 5GANj 3AHUA 3MJXA 1R0BG 3U23A 1D0YA 2EYZA 5GAMg 4C92F 1D09B 3G4ST 2ROLA 3H0FA 3M56A 3VS4A 2LJ3A 1UHFA 2KQWA 4K11A 4OMOA 3KXTA 3CPWA 4L59A 3CCEQ 1UECA 4OMLA 2KE9A 2RQRA 3PFSA 3M55A 1IREB 2HBWA 2RF0A 4LD9K 2QYZA 3QYHB 3V7SA 4MDXA 1ZUKA 3GNFB 2PU9B 2ZZDA 4MZMA 3HFOA 1X01A 1VQMQ 1K8AU 2VASA 3CD6T 4PJOB 3PVLA 1I5OB 1D0ZA 1AWWA 3EHRA 5GAMh 1CSKA 2QI2A 2YUPA 3CXCP 4CC3A 2GQIA 1U8RA 4FW1A 3EAEA 5GMKh 1YJNA 2X51A 1VQ6Q 4PFZA 3A8GB 1M30A 1YWPA 5IHIA 1GRIA 2EIFA 3A8OB 1RABB 2JM9A 1N9SA 1WFWA 1YCSB 3G6EA 2X4WA 4A54A 3CCVA 1YNZA 4BUGA 1HSQA 4J6YA 4E7HA 4LE9A 5D6XA 3QHSA 4C0GA 4EPCA 1KHCA 1Q86C 2NUZA 1EFNA 3MP1A 3LGLA 4C8QD 1WIEA 1JRIA 3I5RA 1FYNA 1TG0A 4EMKC 1K73C 3CCJA 4JRQA 4RTUA 2EYWA 1LJOA 2RI2A 2JS2A 3J81E 4MDWA 4M77F 1YJ9A 5FU6C 3V8JA 1U3OA 2M16A 2DYIA 2C0IA 1YN8A 1ZSZB 3CCET 2DIGA 2E65A 4FYWB 1BI2A 2E3HA 5FRMA 2CP2A 3VS1A 2DEQA 2LX7A 2LJ1A 1YIJQ 3QDFA 1ZA2B 3OYGA 1KIKA 3CCSA 2PUOB 2XDBA 1N8RU 3G7ZA 1Q82U 1VQMT 5FROA 3SWNC 2DE0X 3F70A 1JJ2S 2EBPA 1YHQQ 2EAYA 3FB9A 2P84A 1VQ8Q 1QVGS 4O5VA 2QEXQ 1IRXA 5L8RE 3CXCS 2EQMA 4M78B 1J3TA 2KROA 4HT8A 4KUDK 2QXFA 1VQ6T 2K3YA 1OV3A 1SSFA 2DO3A 2IPOB 3LH5A 2DRKA 3A8LB 4M7DE 3GF5A 1B07A 4HCZA 5LJ3e 2DLPA 4E7JA 1IXDA 9ATCB 1M3AA 1VYUA 2CT3A 2H3EB 1B34A 2R58A 2NUTB 4FCYA 2KGTA 2WSCE 4XTWA 4C92E 3PMIA 3TEEA 4M7AB 3NTKA 3CC4Q 1Q81C 4LNPA 1N6AA 2JMAA 3P8BB 3JB9J 3VS6A 3OYKA 5CKDA 8AT1B 1E7OA 1JJ2A 2DTOA 2EVRA 2LDMA 3CPFA 1QVGA 1VQ4Q 1VQKQ 1QMCA 3WVEB 1M5Q1 2AHJB 2RJDA 5A0LA 3I55A 1KQ2A 4B9XA 4M75C 3OYHA 2BTTA 3OYEA 2K57A 2MMPA 4PJOF 4AMCA 1M8MA 3QWYA 1JXOA 3BDUA 2ATCB 1UDLA 2CREA 1XTDA 1VYVA 1M90U 3R6NA 2A08A 1G8XA 5J3BA 1YIJT 3E9GA 2DERA 3LW5E 4LDWA 3PMTA 2DA9A 4FU6A 5I2SA 2VKNA 2DK3A 4RKUE 2MOXA 4KH1B 3JB9I 1PSEA 1KFZA 4CC4B 4M7DA 1YHQT 3MKDA 2DKGA 1KQSA 2K79A 1UJYA 1VQ8T 3JB9G 4B9WA 2R5AA 4AT1B 2QEXT 2Y90A 3BFMA 3A8MB 2FZKB 1KC8C 1M1KR 1Y96B 2C06A 2OTLA 2DAQA 3EGXB 1OI1A 5ECAA 4C92A 2O31A 4A4FA 2A37A 3G1JA 4Y92A 2L3PA 3JCMe 4A4EA 1TSFA 3SFMA 3TU4K 1VQOQ 4GLKA 2OAUA 1D3BA 4A4GA 1BBZA 1OX8A 1GCQC 1I1JA 1OZ3A 3MP8A 3REAB 3L2RA 4OB3B 3L42A 3EG0A 2RMOA 4ZN1A 5GAOn 4JRKA 2ZPHB 1R0CB 1QWEA 2D9TA 4M77E 1JO8A 4FM4B 3EFSA 4J83A 1BK2A 3VRYA 4J9GA 1R77A 5GANd 1RAFB 4J9FA 4XTZA 3HHTB 5LJ5d 4BE0A 3RIRA 3FLGA 2DF6A 1VQ4T 1VQKT 4BI3A 3RMQA 2GQVA 2KT1A 1M9SA 1U5SA 2XG8D 3E19A 3Q1JA 1VIFA 4LUDA 4N0AC 4J9DA 2IIMA 3CCMQ 2GBQA 2VB6A 3REBB 2K4YA 3HTRA 3KFVA 2HZYA 2PVGB 1H92A 2JW4A 4M75G 8ATCB 2PTKA 2XDPA 2JTMA 2OI3A 2XK0A 2E10A 2RI3A 4AFQC 4E7ZA 3PGGA 4AFUC 1MUZA 3OS1A 1VQ9A 1K73U 5FWBA 5D6YA 2L3RA 4X9CA 2M02A 2CZ7B 1AZEA 4KGVB 1KD1R 3FIFA 5KYXA 4PJJA 1OU9A 5GANf 5GAOl 1JB0E 2CUBA 2PQWA 1VQNQ 2EYQA 5LJ5f 2JMCA 4M77A 1M3CA 5I21A 1K8AC 1OOTA 1BIBA 2QK0A 4OMNA 4R55A 2DL8A 1W1FA 3M54A 1VQOT 1OX9A 4LDVA 2XU8A 4PJLA 4BI4A 5C6SA 4CRIA 1YITA 2M9UA 3V7CA 4QKUA 1VQ7A 1HJDA 4E7KA 1UGQB 2DX1A 2EGAA 2PVDB 5EC7A 4ZNXA 4F7UE 3QUIA 1VYTA 1XNIA 4PJOE 4C8QE 4BY6C 2MIOA 5CQYA 2O9SA 4JZ3A 2VWFA 2E41A 3UDCA 4KUIA 1KC8R 3C95A 2RHXA 3EFRA 2RQVA 1TTHB 5HY6A 4PLLA 1I5LA 1FXXA 3RKYA 2D8JA 3GPLA 4D8DA 4J9CA 1AD5A 5D7UA 3AT1B 4N4HA 2A28A 3JV3A 1O9SA 2DPPB 3CCMT 4OF1A 1BI3A 2WSEE 1MNEA 1ZSGA 5GAMe 3OBYA 2QTXA 1V29B 2DMOA 1YHQA 1RAEB 1VQ8A 1YBYA 4A63B 4XU1A 3SB2A 3S3NA 1RAGB 1ZX6A 5GAOm 2COZA 2L89A 2ZGWA 4J8OA 3CCLQ 3WXMB 4Y28E 2OAWA 4XTUA 2J6KA 2ZAEA 2QA4A 1NJIC 2RQUA 2EWNA 2KBTA 1RI9A 4A4KA 5CR2A 3CMEQ 2DFUA 1HD3A 1U06A 1S72A 5IHNA 2DVJA 1VQNT 4X9DA 1XOVA 3VKIA 1PD1A 1N8RC 3P8HA 3UA6A 1EIFA 1O75A 1XQHA 3DLLA 4PJOA 1GFDA 4JJDA 3M4YA 2EKHA 1OULA 4ELYC 1MMAA 2RJEA 5C0MA 2DL7A 4YTLA 3CBOA 1LPLA 2CP7A 3RERA 4LN2A 1C6VX 1F1BB 2W10A 2YUNA 3LH0A 1QP3A 3EG9B 5GANh 2L3SA 2KYBA 3OYLA 1MMDA 3HSBA 3J7AF 3OYDA 3JCMc 1IHVA 5LJ5h 4DQ2A 3JB9D 2L0AA 4IIMA 3CC2A 3I35A 1PNJA 1H3HA 1K8AR 2KVQG 2G3RA 2W0ZA 4ATOA 1QKXA 2L5QA 2D0QB 3ULRB 2KI7A 1MNDA 4QQDA 3C12A 4XTVA 3OYAA 4JRIA 3VUBA 1WQ7A 3M0PA 3I5SA 2VVKA 2GGRA 4IIOA 1VOMA 2QGGA 3CC7A 5IHKA 2JUFA 2ENMA 2VV5A 4J7FA 5GAN7 3CCLT 2HD0A 4XU2A 2E64A 2F1LA 4M78G 2XICA 2CH4W 4RCBA 2V8KA 4JZ4A 5I2MA 2LVMA 1ZSZA 2DXUA 1RUWA 2C0OA 3DB4A 1KG1A 3NHNA 1NLOC 4C5HA 4FYYB 1WLPB 2DM1A 3CMET 2AKKA 2VXEA 1IHWA 1VQ5Q 2BZYA 2DJZA 3H8ZA 4Y91A 4E6RA 4ME7A 5AYFA 2CT4A 2K2VA 3CMAQ 4J6XA 5CKBA 2LCSA 4KGXB 5LJ5j 4M7AG 2JM8A 3L2WA 1YI2T 2CS7A 4RUGA 2CH4A 3KUFA 1G5VA 3C94A 2P0PA 3QJYA 4M75D 4M78A 4J7IA 4DOVA 4MMLA 2RD1A 4RG2A 2LRQA 3GBQA 2GFAA 2FRWA 2SRCA 1WHMA 1WNLA 1NEGA 3MEWA 2MK5A 1NG2A 3CCUQ 2RK1A 2E70A 3TCJA 3HRTA 3CCQA 1QCNA 1X2QA 3WVDB 1W4SA 1IGUA 3JB9H 1IB8A 3OW2P 2DILA 1Q82R 4RTZA 1Y57A 2NUTA 1JJ2P 4F7UB 1JQQA 4M7AA 1QVGP 3GLXA 4C8QB 4HT9A 5FU7C 3VU3C 4WCIA 1TH7A 1X6OA 3G71A 3QWXX 3CCRA 3L1AA 1WXTA 2AT1B 3IQLA 2KR3A 2CSQA 2RN8A 5HKCA 2XD0A 1AHJB 3VS2A 4JS5A 3QKJA 4QT7A 1WHLA 3X24B 5FRNA 3H0HA 3M53A 2J6FA 1OEBA 1KK7A 4PFOA 1NYFA 2QQRA 1MHNA 3OSSC 4M7DC 4OGEA 4HVWA 1VQ5T 2CZ0B 4HCKA 4WTOB 2V1QA 5GMKi 1GBRA 4IUUA 1LCKA 1M3BA 1KQSP 1M1FA 2BZXA 2XIDA 1KQ1A 3CMAT 1Z9QA 3C4SA 4PNOA 2EGCA 1GL5A 1QW1A 3I56Q 2HDAA 1VUBA 2RQTA 3CBMA 3NMZC 4R56A 2FO0A 2A7YA 3RR6A 1VQPA 1Y96A 1QQJA 3EGXA 3TREA 4NS5A 1I07A 1BCMA 5CKFA 4C5EA 1NJIU 3TVTA 1WHHA 2XHCA 1M90R 1X43A 3OS0A 2DVEA 1GBQA 2LQ8A 3VYHB 1X6GA 1G3TA 1JXMA 2OTJA 3CCUT 1D1AA 5KE2A 2HNIA 3X25B 4JJNK 4C0DC 1RI0A 1FX7A 3OW2S 3H0IA 1SHFA 2E6ZA 3QDRB 1C1AA 4RTWA 3BE3A 2E1HA 3O5ZA 1X27A 2KAFA 3CMEA 2K3BA 2ZPIB 5CCAA 4CI0C 3EGUA 3VRZA 2P4TA 1PD0A 4JLIA 3T9NA 2E4HA 2EYXA 2RJCA 2BZ8A 2CGHA 3BDLA 1BB9A 4F17A 1D0XA 3NPFA 1AOJA 1LVKA 3G4SA 3X28B 1YI2A 5LJ3d 3META 4JDSA 2D1XA 5AT1B 3OW2A 3MCAB 4BACA 5FW9A 5GAN2 1KQSS 4M7DG 2YRDA 4OB0B 3I56T 2M51A 1VQLQ 2KEAA 3EG2A 4F7UF 3OYMA 1Q7YC 2KXCA 4FL6A 1QCOA 4C8QF 1G2BA 2DIQA 1QCFA 2E5QA 4C92G 1T0HA 3CD6A 4JPBW 4M78D 1AWOA 2K7AA 2ZPBB 2KMTA 5A2QE 1WPYA 1Q86R 2DTHA 1H8KA 4J9IA 1VIEA 2HKQB 3VJPA 3ASKA 2FPFA 1K73R 4RCCA 3V8KA 1T3SA 2X3XD 2JNGA 4ELZC 2BUDA 2QDLA 4A4HA 4ESRA 2EGEA 3M0RA 4M7AD 3ZFJA 2P4RA 3L2VA 1D1CA 3KBGA 2ZPGB 1UB4A 3JCMb 2AKLA 1VQ5A 4JRPA 4IURA 1JBMA 2BKDN 3CBPA 3M0TA 3OYCA 3A98A 4JJBA 3OYJA 2D0NA 4XU0A 4BB7A 3EG1A 1TUCA 3OB9A 1K9MC 2E5KA 3NTHA 4KGZB 3S6WA 3OYBA 3JCMd 2XKOC 1AZGB 2KT8A 4CC2A 3CC4T 1WYXA 3MEVA 4E47A 5DLQE 3CCEA 1UGSB 2MPXC 4L5GA 4PK4A 1YJWQ 1WI7A 3OSVA 3INZA 2ZPEB 3J80E 2CSIA 1WX6A 1HYOA 1VQLT 3TSWA 4ANJA 4EMGA 4PJOC 3D7SB 1UGPB 1RL2A 2L3QA 4GY5A 4M77G 3OYNA 1VA7A 1VQMA 1BYMA 1M4ZA 2NUPB 4M75E 1K4US 3VYGA 3PVQA 1Y07A 5GAOq 2VGNA 2L2PA 4QVZA 4OP0A 2DTIA 4MZTA 2LNVA 5CK9A 3CQTA 5IT9E 3UPUA 1QLYA 1Q81R 1VQ6A 3QZ5B 1I0CA 1M2OA 1XJWB 4FSSA 3FEOA 2YSQA 3JCMf 3MEAA 2EW3A 3A1PA 4LXCA 2Y4YA 2NLUA 1UUEA 1QP2A 3EG9A 3EGDB 2RHZA 2K5FA 3E1SA 4Z88A 5D6WA 3SD4A 4XU3A 2BE7D 5DM7R 3HRSA 3ZEHA 1PKTA 4HVVA 1YJNQ 4J9BA 2LNHB 5EG2A 2YUQA 1ZSZC 2ROTA 3GOXA 1M1KU 3M9QA 2E6NA 2RO0A 3V8LA 1QWFA 3G6EQ 2GTOA 1ZUYA 5CO7A 4Z02A 5KYNA 3CCVQ 4RTXA 4PKCC 4PL6A 4GLMA 1N5ZA 2P0KA 5IAYA 3SEMA 5LJ3h 1YJWT 1X6BA 2O2OA 4QQGA 2MCNA 2AZSA 5DLOA 1FMKA 4BE1A 3PIPA 1WHGA 1YIJA 1NM7A 2ED1A 2J7IA 3CCJQ 4TVRA 2K6DA 4FT2A 2PNIA 1EZZB 4OMPA 1K76A 4ZTJA 1T0JA 4M78C 1YCYA 1K0XA 4EMKB 4F7UG 2CZ6B 1RADB 4XK8E 4PJOG 4DOWA 5DY9A 5GMKe 2QEXA 3V7RA 4XQ3A 5FU6B 2HQXA 2F2XA 4DEXA 1Y7XA 1NYGA 1ZUUA 3M0UA 3FJ5A 1K0SA 1OYXA 2HCKA 5GANg 1SRLA 2DYBA 4M7AC 3CCSQ 5GAOp 4M7DD 3QZ9B 4II1A 3NFCA 5LJ5g 1Q7YU 5LJ3j 2X4YA 3MPUB 3CC4A 1V1CA 3EFOB 2R5MA 3QBYA 2V8JA 3LWIA 4F7UA 2KRMA 1SPKA 4C92D 4DBFA 3GP8A 1WHJA 1WHKA 1WDXA 4C8QA 3SWNB 4MMKA 1YJNT 1KD1U 3SHWA 1UG1A 5HCKA 4ZGJB 1VQ4A 1VQKA 3TSZA 4OGCA 3VS5A 1OU8A 2VGMA 2EJGA 3RDVA 4UC4A 1BI1A 5FLXE 3M0QA 3G6ET 1M2VB 2JZ2A 3CCVT 2PUKB 4FSXA 3JCMh 1YFNA 5L23A 1UJ0A 3HRUA 2DZ9A 4HA8A 2WACA 5KH6A 3MO8A 3UWNA 4PJMA 2F69A 1UTIA 2M1HA 3VS7A 3OYFA 1AWXA 2YUOA 3CCJT 1W2BA 2RH2A 1H3ZA 2DNUA 4R0KA 1PKSA 3OS2A 4GBQA 1K9MU 1ZA1B 1NE8A 2LT4A 3I55Q 1PC0A 4WF2A 5GAOr 3LYIA 4V2SA 1X2KA 1E6HA 2A0FB 2RJFA 4J5YA 4RTYA 4M75B 3RNJA 2GFUA 4OMFB 1GXIE 2BIVA 1Y0MA 2ZCFB 3VS0A 1VQOA 3QJ6A 3CCST 5KYUB 1UFFA 2C0TA 3P8DA 5HK0A 4LDXA 1GFCA 1RAAB 2EYYA 3JSCA 2LMJA 5GAN3 2HQEA 1UHCA 4PFPA 2FL7A 4DEYA 4M77D 4C5GA 2QQ9A 4HCBA 4P5NA 2FRYA 1QVPA 3SDZA 2DRMA 2OTLQ 2KYMA 4CC7A 3L2UA 2O4XB 2YRCA 2RM4A 1M27C 3FRNA 4PLIA 4DBHA 2KK4A 5IXBA 1NJIR 1CKAA 2LZ6B 3CCMA 2YXYA 3UA7A 1WJRA 2QTVA 1SSHA 1U1SA 2MYSA 3FJPA 3BY7A 5A0DA 1NPRA 3M5AA 1ABOA 2E3IA 5CIUA 5CKHA 1YWOA 1N8RR 1TS9A 5KYYB 4RMOA 2KY9A 2DETA 1MV3A 4KT0E 1WJQA 4JJCA 1C0MA 1WXUA 4HCCA 1AWJA 1JU5C 2K3XA 1B3QA 4DA4A 2KRNA 4A53A 2J6OA 2GNCA 2HL5C 4IUPA 4C0ZA 3I55T 4XAXB 2EQKA 2DXTA 1TUDA 1I81A 4QW2A 4XTYA 2RHYA 2JTFA 3JB9F 2DL3A 1WQWA 4FW2A 1QVFP 1VQNA 1IO6A 2OX7A 3X26B 1BU1A 1MV0B 2FHDA 4X34A 3A5ZB 2KRSA 2XMFA 4FYXB 1RLQC 1S1NA 2ECZA 4EDUA 2ABLA 5KYWB 4C5IA 2LTOA 3LX7A 1AEYA 1VQ9Q 3DB3A 1X69A 4BI8B 1PG5B 3QXEB 4Z89A 1ACMB 3FDRA 1NPPA 2CP3A 4Q5WA 3PT9A 2J05A 4C92C 1G3SA 2DD5A 2VYTA 4C0FA 3THKA 2OTLT 2DXCA 3H6ZA 3OQ5A 5KCOA 2X4XA 2K2MA 3UF4A 3JCMP 2RI5A 4PJOD 1PHTA 3OA6A 2HBPA 2QG9B 2JTEA 4IUQA 4QVDA 2EJFA 1UGVA 1BCOA 1BI0A 2E12A 3MP6A 5GAN4 2COYA 1YITQ 7AT1B 3JCMV 1SRMA 4DBQA 2EJ9A 3L2QA 5GMKl 1VQ7Q 5CQXA 4QVCA 1AT1B 3C0CA 1M1KC 1P92A 4HXJA 2NYSA 3M59A 1WZOA 2F5KA 5GAN8 4ZTFA 5A0GA 3N5BB 4HKEA 5GAMj 4M75F 2B8AA 4FIBA 4ORZA 4F14A 3CCLA 2HKNA 5GMKj 1LNXA
chains in the Genus database with same CATH topology
4M7DF 5LL6S 2WSEE 3S3OA 5GAMe 3OYYA 3OBYA 2QTXA 1V29B 3PIOA 1YHQA 2Y4XA 3QIIA 1KHIA 3MEVA 3CC4T 5GANj 1VQ8A 2L8DA 3AHUA 1YBYA 2DD4A 4XU1A 4BY6B 3SB2A 3S3NA 4NOYA 4E47A 4MZPA 5DLQE 3CCEA 1UGSB 2EKOA 5GAOm 3JCMJ 2L89A 4L5GA 2JN0A 2K5LA 4KULA 2XDDA 2ZGWA 4N4IA 4J8OA 3OSVA 5GAMg 3INZA 2ZPEB 4Y28E 3WXMB 4C92F 3J80E 3G4ST 4XTUA 4BD3A 3M56A 1QVFS 2QA4A 1VQLT 4EMGA 1NJIC 4PJOC 3VV0A 2KQWA 2YHTA 4KBMB 2EWNA 3KXTA 1UGPB 3CPWA 4L59A 2YLBA 5CR2A 4A4KA 1RL2A 1WGSA 4GY5A 2LX9A 4M77G 1S72A 3OYNA 3RESA 1VQMA 1BYMA 1M4ZA 4M75E 1VQNT 2YLCA 2O01E 3PFSA 3M55A 1IREB 4X9DA 3VYGA 1XOVA 2KSSA 4LD9K 3VKIA 1Y07A 1VQ9T 1N8RC 3P8HA 4D6WA 5GAOq 2QQAA 2VGNA 1H641 4QVZA 3QYHB 1EIFA 4OP0A 3GNFB 2DTIA 2PU9B 2LNVA 4MZTA 3V7SA 2ZZDA 4MDXA 5CK9A 1O75A 5IT9E 1XQHA 4MZMA 3DLLA 4M77C 4PJOA 3UPUA 2VC8A 3JRZA 3HFOA 1X01A 3M4YA 1VQ6A 1K8AU 3QZ5B 4ELYC 3CD6T 4PJOB 2RJEA 5C0MA 5GMKm 3FEOA 4YTLA 5GAMh 2QI2A 3CBOA 3ZBDA 3JCMf 3MEAA 3HL8A 1U1TA 1U8RA 2Y4YA 2QQSA 5CAIA 3RERA 3EAEA 3LLRA 2NLUA 2K5IA 1QP2A 2X4JA 5GMKh 1YJNA 2RHZA 1QVFA 3A8GB 3LH0A 2IVWA 1QP3A 2K5FA 5GANh 1YITT 2EQJA 3E1SA 3JCMW 1KD1C 2LT1A 2EIFA 3A8OB 3OYLA 5D6WA 3SD4A 3CXCA 4XU3A 3HSBA 2EFIA 5DM7R 3HRSA 3PNWC 3OYDA 3J7AF 1N9SA 3GNGA 3JCMc 3ZEHA 5LJ5h 1VQ7T 4DQ2A 3JB9D 3G6EA 2X4WA 4A54A 2VUBA 4BUGA 4O6JA 3CCVA 4J6YA 4E7HA 3CC2A 4LDUA 5D6XA 3QHSA 2KVQG 4C0GA 4EPCA 2G3RA 5EG2A 1KHCA 1Q86C 4ATOA 2L5QA 2D0QB 3GOXA 1M1KU 3M9QA 2E6NA 4QQDA 2RO0A 3C12A 4XTVA 3OYAA 3MP1A 4JRIA 3VUBA 1UGRB 1ZBXA 1WQ7A 3LGLA 3V8LA 4C8QD 3QO3A 5LJ3f 5CO7A 4Z02A 1JRIA 4PKCC 4PL6A 5J26A 1K73C 4EMKC 3CCJA 1I4K1 2CKKA 3HKSA 4JRQA 2P0KA 5IAYA 2RA2A 5LJ3h 1LJOA 3CC7A 2RI2A 3OYIA 1YJWT 2LQKA 2JUFA 3J81E 4VUBA 4MDWA 4QQGA 2VV5A 4J7FA 4M77F 5GAN7 2HD0A 4XU2A 3CCLT 2E64A 4M78G 5DLOA 2XICA 4RCBA 3VUZA 3JCMQ 1YJ9A 4BE1A 2V8KA 5FU6C 3PIPA 5I2MA 3V8JA 2LVMA 2DXUA 2M16A 3DB4A 1KG1A 1YIJA 3OY9A 3CMAA 4C5HA 4OB2B 4TVRA 3JCMX 4FT2A 3CCET 3CMET 2DIGA 4IKFA 2E65A 1BI2A 2VXEA 3NTIA 5FRMA 4ZTJA 2DEQA 4EMKA 4HCBA 2I2LA 2DJZA 3H8ZA 4M78C 4Y91A 1YCYA 4ME7A 1G3YA 4EMKB 5AYFA 3BW1A 2CZ6B 4F7UG 2QA4T 4XK8E 4PJOG 5GAMd 3OMCA 2K2VA 4DOWA 2RHIA 5DY9A 3OYGA 5GMKe 4J6XA 2QEXA 3V7RA 3ER0A 5CKBA 4XQ3A 4M7AG 5LJ5j 3CCSA 2PUOB 2XDBA 1N8RU 3G7ZA 2HQXA 5FU6B 1S72T 1Q82U 5GANe 1VQMT 1NZ9A 1Y7XA 3L2WA 5FROA 1YI2T 2CS7A 3SWNC 3F70A 2D6FA 1JJ2S 3KUFA 1G5VA 2EAYA 3C94A 5LJ5e 3CCUA 3FB9A 1OYXA 2P0PA 3QJYA 4M75D 3X20B 3LGFA 4J7IA 1G3WA 4M78A 4MMLA 1BKBA 4O5VA 4C8QC 4DOVA 4BDYA 2RD1A 4RG2A 2LRQA 5L8RE 1LOJA 5GANg 3CXCS 4M7AC 2EQMA 4M78B 2GFAA 5GAOp 4M7DD 4N4GA 4HT8A 3QZ9B 4KUDK 4II1A 2QXFA 1VQ6T 2CZ1B 2K3YA 1SSFA 3NFCA 5LJ5g 2FYKA 1WNLA 2DO3A 3RKWA 1Q7YU 5LJ3j 3MEWA 2X4YA 2RK1A 2E70A 3TCJA 3A8LB 3DLMA 2DXBA 4M7DE 3GF5A 3CC4A 3HRTA 3CCQA 2IG0A 3SWNA 2R5MA 3QBYA 3WVDB 2V8JA 1W4SA 3LWIA 4F7UA 3JB9H 2MF2A 4C92D 4HCZA 5LJ3e 3GP8A 4E7JA 4C8QA 3SWNB 4MMKA 1YJNT 1KD1U 4F7UB 4ZGJB 1B34A 1VQ4A 1VQKA 2R58A 4M7AA 3GLXA 4C8QB 4HT9A 4OGCA 5FU7C 3VU3C 2WSCE 2VGMA 1TH7A 3QYGB 4XTWA 3PMIA 4C92E 1X6OA 1B34B 3TEEA 2EJGA 4M7AB 3NTKA 4M78F 5LJ3g 1Q81C 4UC4A 1N6AA 3G71A 1BI1A 5FLXE 3P8BB 3G6ET 3OYKA 3JB9J 1Q86U 2JZ2A 3CCVT 2PUKB 4FSXA 1K9MC 5CKDA 3CCRA 3JCMh 2JOYA 3L1AA 3CC2T 2X35A 1HK9A 1JJ2A 2DTOA 3HRUA 2LDMA 3CPFA 1QVGA 5GAN6 5HKCA 2DZ9A 2HAXA 4HA8A 2WACA 2XD0A 1AHJB 3GIBA 3QSUA 5KH6A 3WVEB 3O8VA 3A8HB 1M5Q1 2AHJB 5J39A 4JS5A 1OZ2A 2RJDA 3MO8A 3QKJA 3UWNA 5A0LA 3I55A 2F69A 3X24B 4B9XA 5M9OA 1KQ2A 4M75C 5FRNA 3OYHA 3M53A 2M1HA 3OYEA 2K57A 3OYFA 2MMPA 4PJOF 1BIAA 3CCJT 4OB1B 4E7LA 5FU7B 2QQRA 1MHNA 3BDUA 1W2BA 4XTXA 2RH2A 1N9RA 3CC7T 1I8FA 2LCCA 3OSSC 4M7DC 4M7AF 4OGEA 1H3ZA 1XTDA 1QVGS 3I56A 1VQ5T 2CZ0B 3OS2A 1K9MU 1Y71A 1M90U 1NE8A 5GMKi 2LT4A 1M1GA 4IUUA 5J3BA 4WF2A 4QQ6A 5GAOr 3LYIA 1M1FA 3E9GA 1YIJT 2XIDA 1KQ1A 4V2SA 3CMAT 3LW5E 4LDWA 3RKXA 5KE3A 3PMTA 1X75C 2GCXA 3C4SA 4PNOA 4FU6A 4M75A 1QW1A 2RJFA 4J5YA 5I2SA 3HP9A 1VUBA 2DK3A 3CBMA 4M75B 4RKUE 5CKEA 3S3MA 3JB9I 1PSEA 3OS5A 2GFUA 4OMFB 1GXIE 2RHUA 4M7DA 1YHQT 4R56A 1KQSA 2DKGA 1VQ8T 1HXDA 1M8VA 2A7YA 2BIVA 3JB9G 4B9WA 4M7DB 2R5AA 2QEXT 1VQPA 1Y96A 2VXFA 2Y90A 3BFMA 2ZCFB 1WJSA 3A8MB 3M57A 4NS5A 3TREA 1VQOA 1KC8C 2QQBA 3QJ6A 3CCST 5CKFA 1Y96B 3RUXA 4C5EA 2DAQA 2C06A 2OTLA 1NJIU 1OI1A 2FVUA 2XHCA 2DZCA 4NL2A 4C92A 3OS0A 3P8DA 2DVEA 2LQ8A 4A4FA 5HK0A 3VYHB 4LDXA 1G3TA 1PSFA 2OTJA 3JSCA 3CCUT 4ZGDB 4C92B 4C8QG 5GAN3 2HQEA 5IN1A 3HPWA 5KE2A 3JCMe 4A4EA 5HK3A 3SFMA 3TU4K 2FL7A 4JLGA 4M77D 2F5TX 4GLKA 2HNIA 2OAUA 4C5GA 2QQ9A 1D3BA 3X25B 4A4GA 4C0DC 1MGQA 1RI0A 4P5NA 4JJNK 1QVPA 2R57A 2KDSA 4IUVA 3SDZA 3OMGA 1FX7A 1OZ3A 3MP8A 4OVAA 3L2RA 3OW2S 4OB3B 2O4XA 3L42A 1D3BB 5GAOn 2WSFE 4ZN1A 2MI6A 4JRKA 2ZPHB 2E6ZA 2QDYB 2D9TA 4M77E 3QDRB 3JCMg 4NL3A 4FM4B 2O4XB 3EFSA 4J83A 3L2UA 1I5LA 2RM4A 5GANd 1ZHIA 2E1HA 3CCQT 4XTZA 3HFNA 3FRNA 2KAFA 4PLIA 3HHTB 2M0OA 2KK4A 3CMEA 5LJ5d 4BE0A 2JVVA 2RK2A 2ZPIB 5CCAA 3RIRA 3CCMA 3FLGA 4CI0C 1VQ4T 1WJRA 1Q81U 1VQKT 1U1SA 2P4TA 4JLIA 3FJPA 3T9NA 3BY7A 4BI3A 5A0DA 1W2BS 1NPRA 3RMQA 1UEBA 2GQVA 3M5AA 3R6OA 3LWHA 1M9SA 2XG8D 2RJCA 4C0DB 3E19A 3Q1JA 5CIUA 3G71T 5KCHA 1VIFA 2CGHA 1R8OB 3BDLA 5CKHA 4N0AC 3CCRT 4RMOA 4BE2A 3QG1A 2KY9A 3M4GA 4KT0E 1WJQA 3G4SA 1FWZA 2K4YA 4LD6A 3X28B 1YI2A 2MWOA 4HCCA 3OBWA 3UT1A 5LJ3d 3META 2K3XA 4JDSA 3URGA 4DA4A 3CEYA 1VQLA 2PVGB 1Q82C 4JUVA 4A53A 4IUPA 4C0ZA 3I55T 1ZQ1A 4M75G 4XAXB 2EQKA 2DXTA 3OW2A 4QW2A 1I81A 3MCAB 4XTYA 2RHYA 4BACA 2MAMA 2JTFA 2XDPA 5GAN2 3JB9F 4IUTA 2JTMA 2XK0A 1KQSS 1WQWA 2E10A 2MWPA 2RI3A 1VQNA 4M7DG 5GAMf 3X26B 4N0AA 4OB0B 3PGGA 3I56T 3OS1A 1VQ9A 1K73U 2FHDA 4X34A 5D6YA 2L3RA 2YRVA 3A5ZB 4X9CA 4E7IA 2CZ7B 3DKMA 3JCMd 4F7UF 3OYMA 4JS4A 1Q7YC 4FL6A 4C8QF 3FIFA 2DIQA 2E5QA 3PTAA 5GANf 2XI9A 5GAOl 4C92G 1JB0E 4EDUA 2PQWA 2V8IA 4C5IA 5GAN5 3CD6A 2LTOA 3LX7A 2EYQA 4M78D 2ZPBB 5LJ5f 2KMTA 5A2QE 1YJ9T 1WPYA 3ME9A 4M77A 3JAME 2FB7A 3DB3A 5I21A 1K8AC 4BI8B 3QXEB 1BIBA 2RB6A 1KC8U 4M77B 2DTHA 3FDRA 1NPPA 4Q5WA 4M78E 3PT9A 4R55A 3RMSA 1N27A 1VQPT 1VIEA 4C92C 3VJPA 1G3SA 2EQUA 3M54A 2DD5A 4LDVA 3MEUA 2VYTA 3ASKA 4BDZA 1VQOT 2XU8A 4LDYA 4BI4A 3FC3A 4C0FA 5C6SA 4CRIA 1YITA 2OTLT 2DXCA 4ZN3A 3H6ZA 3OQ5A 4ZGEB 4RCCA 3V8KA 5KCOA 2X4XA 2M9UA 2JNGA 2PVOB 3V7CA 4ELZC 3JCMP 2BUDA 2RI5A 1VQ7A 4A4HA 4PJOD 3L2ZA 1DJ7B 4E7KA 2OTJT 3OA6A 1UGQB 4EMHA 2HBPA 2PVDB 4IUQA 4M7AD 4QVDA 2EJFA 3E9FA 4L6V5 2ZPFB 3ZFJA 4F7UE 2H3JA 2CYZB 3QUIA 3L2VA 1BI0A 2E12A 3MP6A 1XNIA 5GAN4 4PJOE 2LCLA 4C8QE 3KBGA 4BY6C 2ZPGB 3JCMV 1UB4A 5CQYA 3MHXA 3JCMb 3CPWS 1VQ5A 4J6WA 2EJ9A 4JRPA 2E41A 4IURA 1JBMA 2BKDN 3CBPA 3UDCA 4M7AE 4KUIA 4RG8A 5GMKl 3C95A 5CQXA 3OYCA 4QVCA 3L2QA 3OYJA 1IZ6A 4XU0A 1M1KC 1P92A 2RHXA 3EFRA 5HY6A 4FT4A 4BB7A 4PLLA 3M59A 2F5KA 5GAN8 3OB9A 1FXXA 3M58A 3RKYA 3N5BB 4HKEA 5A0GA 3GPLA 4ZTFA 5GAMj 4M75F 1M90C 2B8AA 4FIBA 3QPHA 2LC4A 1YJWA 4N4HA 3NTHA 5CVIA 3CCMT 1O9SA 2DPPB 3CCLA 3S6WA 2GF7A 4OF1A 3OYBA 5GMKj 2P0QA 1LNXA 2XKOC 1BI3A 2A3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKK A;  3S3O A;  2P0K A;  5IAY A;  5J39 A;  1OZ2 A;  2RJD A;  3MO8 A;  3QKJ A;  3UWN A;  4BE2 A;  2RI2 A;  3OYI A;  3QII A;  5M9O A;  3MEV A;  4B9X A;  2L8D A;  5FRN A;  4QQG A;  1WJQ A;  3OYH A;  2M1H A;  4LD6 A;  3OYE A;  3OYF A;  2MWO A;  3S3N A;  3UT1 A;  3MET A;  2K3X A;  4E7L A;  4BE1 A;  2EKO A;  2QQR A;  1MHN A;  2L89 A;  3CEY A;  2LVM A;  2M16 A;  2LCC A;  3DB4 A;  4N4I A;  4IUP A;  1H3Z A;  2EQK A;  4QW2 A;  3OY9 A;  4C5H A;  2RHY A;  4BAC A;  4BD3 A;  3OS2 A;  2JTF A;  2XDP A;  2DIG A;  4IUT A;  4IKF A;  2XK0 A;  4IUU A;  3NTI A;  5FRM A;  2MWP A;  2RI3 A;  4QQ6 A;  4ZTJ A;  3LYI A;  3E9G A;  3H8Z A;  4L59 A;  5KE3 A;  3OS1 A;  3PMT A;  1WGS A;  3C4S A;  2FHD A;  4GY5 A;  4X34 A;  5D6Y A;  2L3R A;  2YRV A;  4FU6 A;  3OYN A;  4E7I A;  2RJF A;  3OMC A;  3OYM A;  3PFS A;  2RHI A;  3OYG A;  4FL6 A;  3S3M A;  2DIQ A;  2E5Q A;  2GFU A;  3P8H A;  2RHU A;  4EDU A;  2PQW A;  2HQX A;  4C5I A;  4QVZ A;  2LTO A;  2BIV A;  3LX7 A;  3L2W A;  4B9W A;  5FRO A;  2R5A A;  3ME9 A;  3F70 A;  3DB3 A;  1WJS A;  3KUF A;  4NS5 A;  1G5V A;  3QJ6 A;  1OYX A;  3LGF A;  4BDY A;  4C5E A;  2DAQ A;  3FDR A;  4Q5W A;  1OI1 A;  4RG2 A;  2LRQ A;  2RJE A;  5C0M A;  3P8D A;  1N27 A;  2EQM A;  4A4F A;  3OS0 A;  2GFA A;  3FEO A;  2EQU A;  4BDZ A;  3MEU A;  2VYT A;  3ASK A;  3MEA A;  4N4G A;  4II1 A;  3FC3 A;  2K3Y A;  1SSF A;  2HQE A;  5IN1 A;  4CRI A;  2QQS A;  5C6S A;  3EAE A;  3LLR A;  3H6Z A;  3OQ5 A;  5KE2 A;  2NLU A;  4A4E A;  3MEW A;  5KCO A;  2X4Y A;  2X4X A;  4C5G A;  2BUD A;  2RI5 A;  4A4G A;  2RHZ A;  4A4H A;  1RI0 A;  3DLM A;  2R57 A;  4E7K A;  4IUV A;  3LH0 A;  1OZ3 A;  3MP8 A;  2IG0 A;  3OMG A;  4OVA A;  3OA6 A;  3L2R A;  2R5M A;  2O4X A;  3L42 A;  3QBY A;  2EQJ A;  4IUQ A;  3E9F A;  4HCZ A;  3OYL A;  5D6W A;  3SD4 A;  4E7J A;  2D9T A;  3L2U A;  2EFI A;  3L2V A;  2O4X B;  3MP6 A;  3PNW C;  1XNI A;  3OYD A;  3ZEH A;  2X4W A;  2R58 A;  4E7H A;  5D6X A;  4IUR A;  2BKD N;  3PMI A;  4PLI A;  3OYC A;  3L2Q A;  2M0O A;  2G3R A;  1KHC A;  3NTK A;  3OYJ A;  4BE0 A;  2RHX A;  4UC4 A;  3FLG A;  5KH6 A;  3GOX A;  3OYK A;  1WJR A;  2E6N A;  2JZ2 A;  3M9Q A;  4PLL A;  2F5K A;  4QQD A;  3OB9 A;  2RO0 A;  4ZTF A;  3OYA A;  3MP1 A;  2B8A A;  2X35 A;  3LGL A;  4N4H A;  3NTH A;  2LDM A;  2RJC A;  4Z02 A;  3Q1J A;  5CIU A;  3S6W A;  2WAC A;  2GF7 A;  5KCH A;  4PL6 A;  5J26 A;  3OYB A;  3BDL A;  3O8V A; 
#chains in the Genus database with same CATH topology
 5LL6 S;  4DBR A;  3S3O A;  3OYY A;  3PIO A;  2KNB B;  2Y4X A;  3QII A;  1Q95 G;  2L8D A;  2DD4 A;  1V76 A;  1K9A A;  4BY6 B;  5I11 A;  4NOY A;  4MZP A;  2RNA A;  2EKO A;  3JCM J;  6AT1 B;  2JN0 A;  2K5L A;  4KUL A;  2XDD A;  4N4I A;  2FPD A;  1AVZ C;  3PE0 A;  4BD3 A;  1QVF S;  5GJW B;  3H41 A;  3VV0 A;  2YHT A;  4KBM B;  4EIK A;  2YLB A;  2NUP A;  1WGS A;  2LJ0 A;  2LX9 A;  3RES A;  2LQN A;  2H8H A;  2YLC A;  2O01 E;  3RBB B;  2K9G A;  1MMN A;  2KSS A;  5IH2 A;  1KSW A;  1VQ9 T;  2QA4 Q;  4D6W A;  2QQA A;  2I0N A;  4X1V A;  1H64 1;  4M77 C;  2VC8 A;  3JRZ A;  1S72 Q;  2J06 A;  1NLP C;  3VS3 A;  4RTT A;  1E6G A;  5GMK m;  3ZBD A;  3HL8 A;  3EGD A;  4J9H A;  1U1T A;  1QKW A;  2QQS A;  5CAI A;  3LLR A;  2V1R A;  2K5I A;  2X4J A;  1QVF A;  3EH1 A;  2IVW A;  2EPD A;  1YIT T;  2EQJ A;  3JCM W;  4LUE A;  1KD1 C;  2LT1 A;  1PCX A;  3CXC A;  2EFI A;  3PNW C;  2GTJ A;  1VQ7 T;  3GNG A;  2FPE A;  2HL3 A;  2VUB A;  4O6J A;  4LDU A;  2O9V A;  4Z8A A;  4FYV B;  1UGR B;  1ZBX A;  3QO3 A;  2HMA A;  5LJ3 f;  1A0N B;  5J26 A;  3CC2 Q;  1I4K 1;  2CKK A;  3HKS A;  1MMG A;  1SKU B;  2RA2 A;  3OYI A;  2LQK A;  3EG3 A;  4VUB A;  2FZC B;  2BE9 B;  2F2V A;  2HQH A;  3VUZ A;  2B86 A;  3OY9 A;  3CMA A;  4KH0 B;  4OB2 B;  3JCM X;  3CC7 Q;  2EQI A;  4IKF A;  1OQK A;  3NTI A;  4EMK A;  2I2L A;  4AG1 C;  3ZL7 C;  2PZ1 A;  1G3Y A;  3BW1 A;  2QA4 T;  2YWW A;  4AG2 C;  3OMC A;  2RHI A;  2ED0 A;  4KRT A;  3ER0 A;  4M4Z A;  1FMV A;  1EX4 A;  4AFS C;  2LQW A;  1S72 T;  5GAN e;  1NZ9 A;  2D6F A;  5LJ5 e;  3CCU A;  3X20 B;  4C8Q C;  3LGF A;  1G3W A;  4BDY A;  1BKB A;  1LOJ A;  1NEB A;  4N4G A;  2AIR B;  2CZ1 B;  3I9Q A;  2CDT A;  1OPL A;  2FYK A;  1WA7 A;  3RKW A;  1K1Z A;  3EFO A;  3DLM A;  2DXB A;  2X3W D;  2IG0 A;  2DJQ A;  3SWN A;  2RQW A;  2MF2 A;  5FWC A;  2DL5 A;  3QYG B;  1B34 B;  1M2V A;  2CP5 A;  4M78 F;  5LJ3 g;  2NWM A;  2JXB A;  3CCQ Q;  1ZBJ A;  1Q86 U;  2FEI A;  3CC2 T;  3EHQ A;  2JOY A;  2YDL A;  1TOV A;  1HK9 A;  2X35 A;  5I22 A;  1W2B P;  1Q7Y R;  2HEQ A;  5GAN 6;  1OPK A;  2Z0W A;  2HAX A;  3QSU A;  3GIB A;  2JJ9 A;  3M0S A;  2CP0 A;  3O8V A;  3A8H B;  5J39 A;  1PM3 A;  1OZ2 A;  4HVU A;  5M9O A;  3G71 Q;  3CCR Q;  1BIA A;  1RAC B;  4OB1 B;  4E7L A;  5FU7 B;  4XTX A;  1N9R A;  3CC7 T;  1I8F A;  2LCC A;  4M7A F;  4E2F B;  2V26 A;  3I56 A;  2DBK A;  1KJW A;  1Y71 A;  4PJN A;  1RAI B;  1M1G A;  2FZG B;  4QQ6 A;  2DL4 A;  2KXD A;  3RKX A;  5KE3 A;  1X75 C;  2GCX A;  4M75 A;  2SEM A;  3HP9 A;  5CKE A;  1W70 A;  3S3M A;  3OS5 A;  2O88 A;  2RHU A;  3H9N A;  1HXD A;  1M8V A;  4M7D B;  5KYU A;  2VXF A;  1TXQ A;  3M57 A;  1WJS A;  2QQB A;  2QAS A;  2DEU A;  3RUX A;  2M0Y A;  2COW A;  2HSE B;  4E7S A;  1YJ9 Q;  1JEG A;  2FVU A;  1RAH B;  1K9M R;  2DZC A;  4NL2 A;  2RPN A;  4OMM A;  1PSF A;  1ARK A;  4ZGD B;  4C92 B;  4C8Q G;  1W6X A;  2AK5 A;  5IN1 A;  3HPW A;  1VQP Q;  5HK3 A;  4B6M A;  2CUD A;  1SF9 A;  4JLG A;  2F5T X;  5IXF A;  5GAM d;  1MGQ A;  2R57 A;  2LP5 A;  4IUV A;  2KDS A;  3OMG A;  4OVA A;  2O4X A;  1B7T A;  1D3B B;  2WSF E;  2MI6 A;  2QDY B;  3JCM g;  4NL3 A;  2OTJ Q;  1ZHI A;  4D8K A;  3CCQ T;  2QAZ A;  3HFN A;  3CPW P;  1CKB A;  2M0O A;  2JVV A;  2RK2 A;  1TWB A;  1Q81 U;  4J9E A;  1W2B S;  1UEB A;  1GCQ A;  3R6O A;  3LWH A;  2G6F X;  4C0D B;  3G71 T;  5KYY A;  5KCH A;  1WXB A;  1R8O B;  3CCR T;  2YT6 A;  2AZV A;  4BE2 A;  3QG1 A;  3M4G A;  1FWZ A;  4LD6 A;  1G83 A;  2MWO A;  3OBW A;  3UT1 A;  1PRL C;  3E2U A;  3URG A;  3CEY A;  1VQL A;  1Q82 C;  2A36 A;  4JUV A;  3TQ7 P;  2ESW A;  3EH2 A;  1D1B A;  1RLP C;  1Z9Z A;  1ZQ1 A;  2MAM A;  1PRM C;  1PWT A;  4IUT A;  2F2W A;  2MWP A;  5GJV B;  5GAM f;  2OJ2 A;  3G4S Q;  4N0A A;  1YP5 A;  1YI2 Q;  1T3L A;  2YRV A;  2JS0 A;  4OMQ A;  1UE9 A;  4E7I A;  1ABQ A;  3DKM A;  4JS4 A;  3NGP A;  2D8H A;  5KYW A;  3PTA A;  2XI9 A;  1TUG B;  4RTV A;  2V8I A;  5GAN 5;  5KYX B;  1GCP A;  1YJ9 T;  1SHG A;  3ME9 A;  3JAM E;  2FB7 A;  1TU0 B;  2X9H A;  2RB6 A;  1SEM A;  1KC8 U;  4M77 B;  2CP6 A;  4M78 E;  2DBM A;  3RMS A;  1N27 A;  1VQP T;  2EQU A;  4BDZ A;  3MEU A;  4LDY A;  3CD6 Q;  3FC3 A;  4ZN3 A;  4ZGE B;  2HSP A;  2PVO B;  3L2Z A;  1DJ7 B;  2OTJ T;  4AFZ C;  4EMH A;  1SG5 A;  3E9F A;  4L6V 5;  1NBE B;  2ZPF B;  2H3J A;  2CYZ B;  1FMW A;  2LCL A;  3CPW S;  3MHX A;  4J6W A;  4M7A E;  2QGF B;  4RG8 A;  1IZ6 A;  4F04 B;  4FT4 A;  1IGQ A;  4F16 A;  3M58 A;  1M90 C;  3QPH A;  2LC4 A;  2JT4 A;  1YJW A;  1ZLM A;  5CVI A;  2GF7 A;  2P0Q A;  3JCM Q;  2A3L A;  4M7D F;  2FG0 A;  3UAT A;  1KHI A;  5GAN j;  3AHU A;  3MJX A;  1R0B G;  3U23 A;  1D0Y A;  2EYZ A;  5GAM g;  4C92 F;  1D09 B;  3G4S T;  2ROL A;  3H0F A;  3M56 A;  3VS4 A;  2LJ3 A;  1UHF A;  2KQW A;  4K11 A;  4OMO A;  3KXT A;  3CPW A;  4L59 A;  3CCE Q;  1UEC A;  4OML A;  2KE9 A;  2RQR A;  3PFS A;  3M55 A;  1IRE B;  2HBW A;  2RF0 A;  4LD9 K;  2QYZ A;  3QYH B;  3V7S A;  4MDX A;  1ZUK A;  3GNF B;  2PU9 B;  2ZZD A;  4MZM A;  3HFO A;  1X01 A;  1VQM Q;  1K8A U;  2VAS A;  3CD6 T;  4PJO B;  3PVL A;  1I5O B;  1D0Z A;  1AWW A;  3EHR A;  5GAM h;  1CSK A;  2QI2 A;  2YUP A;  3CXC P;  4CC3 A;  2GQI A;  1U8R A;  4FW1 A;  3EAE A;  5GMK h;  1YJN A;  2X51 A;  1VQ6 Q;  4PFZ A;  3A8G B;  1M30 A;  1YWP A;  5IHI A;  1GRI A;  2EIF A;  3A8O B;  1RAB B;  2JM9 A;  1N9S A;  1WFW A;  1YCS B;  3G6E A;  2X4W A;  4A54 A;  3CCV A;  1YNZ A;  4BUG A;  1HSQ A;  4J6Y A;  4E7H A;  4LE9 A;  5D6X A;  3QHS A;  4C0G A;  4EPC A;  1KHC A;  1Q86 C;  2NUZ A;  1EFN A;  3MP1 A;  3LGL A;  4C8Q D;  1WIE A;  1JRI A;  3I5R A;  1FYN A;  1TG0 A;  4EMK C;  1K73 C;  3CCJ A;  4JRQ A;  4RTU A;  2EYW A;  1LJO A;  2RI2 A;  2JS2 A;  3J81 E;  4MDW A;  4M77 F;  1YJ9 A;  5FU6 C;  3V8J A;  1U3O A;  2M16 A;  2DYI A;  2C0I A;  1YN8 A;  1ZSZ B;  3CCE T;  2DIG A;  2E65 A;  4FYW B;  1BI2 A;  2E3H A;  5FRM A;  2CP2 A;  3VS1 A;  2DEQ A;  2LX7 A;  2LJ1 A;  1YIJ Q;  3QDF A;  1ZA2 B;  3OYG A;  1KIK A;  3CCS A;  2PUO B;  2XDB A;  1N8R U;  3G7Z A;  1Q82 U;  1VQM T;  5FRO A;  3SWN C;  2DE0 X;  3F70 A;  1JJ2 S;  2EBP A;  1YHQ Q;  2EAY A;  3FB9 A;  2P84 A;  1VQ8 Q;  1QVG S;  4O5V A;  2QEX Q;  1IRX A;  5L8R E;  3CXC S;  2EQM A;  4M78 B;  1J3T A;  2KRO A;  4HT8 A;  4KUD K;  2QXF A;  1VQ6 T;  2K3Y A;  1OV3 A;  1SSF A;  2DO3 A;  2IPO B;  3LH5 A;  2DRK A;  3A8L B;  4M7D E;  3GF5 A;  1B07 A;  4HCZ A;  5LJ3 e;  2DLP A;  4E7J A;  1IXD A;  9ATC B;  1M3A A;  1VYU A;  2CT3 A;  2H3E B;  1B34 A;  2R58 A;  2NUT B;  4FCY A;  2KGT A;  2WSC E;  4XTW A;  4C92 E;  3PMI A;  3TEE A;  4M7A B;  3NTK A;  3CC4 Q;  1Q81 C;  4LNP A;  1N6A A;  2JMA A;  3P8B B;  3JB9 J;  3VS6 A;  3OYK A;  5CKD A;  8AT1 B;  1E7O A;  1JJ2 A;  2DTO A;  2EVR A;  2LDM A;  3CPF A;  1QVG A;  1VQ4 Q;  1VQK Q;  1QMC A;  3WVE B;  1M5Q 1;  2AHJ B;  2RJD A;  5A0L A;  3I55 A;  1KQ2 A;  4B9X A;  4M75 C;  3OYH A;  2BTT A;  3OYE A;  2K57 A;  2MMP A;  4PJO F;  4AMC A;  1M8M A;  3QWY A;  1JXO A;  3BDU A;  2ATC B;  1UDL A;  2CRE A;  1XTD A;  1VYV A;  1M90 U;  3R6N A;  2A08 A;  1G8X A;  5J3B A;  1YIJ T;  3E9G A;  2DER A;  3LW5 E;  4LDW A;  3PMT A;  2DA9 A;  4FU6 A;  5I2S A;  2VKN A;  2DK3 A;  4RKU E;  2MOX A;  4KH1 B;  3JB9 I;  1PSE A;  1KFZ A;  4CC4 B;  4M7D A;  1YHQ T;  3MKD A;  2DKG A;  1KQS A;  2K79 A;  1UJY A;  1VQ8 T;  3JB9 G;  4B9W A;  2R5A A;  4AT1 B;  2QEX T;  2Y90 A;  3BFM A;  3A8M B;  2FZK B;  1KC8 C;  1M1K R;  1Y96 B;  2C06 A;  2OTL A;  2DAQ A;  3EGX B;  1OI1 A;  5ECA A;  4C92 A;  2O31 A;  4A4F A;  2A37 A;  3G1J A;  4Y92 A;  2L3P A;  3JCM e;  4A4E A;  1TSF A;  3SFM A;  3TU4 K;  1VQO Q;  4GLK A;  2OAU A;  1D3B A;  4A4G A;  1BBZ A;  1OX8 A;  1GCQ C;  1I1J A;  1OZ3 A;  3MP8 A;  3REA B;  3L2R A;  4OB3 B;  3L42 A;  3EG0 A;  2RMO A;  4ZN1 A;  5GAO n;  4JRK A;  2ZPH B;  1R0C B;  1QWE A;  2D9T A;  4M77 E;  1JO8 A;  4FM4 B;  3EFS A;  4J83 A;  1BK2 A;  3VRY A;  4J9G A;  1R77 A;  5GAN d;  1RAF B;  4J9F A;  4XTZ A;  3HHT B;  5LJ5 d;  4BE0 A;  3RIR A;  3FLG A;  2DF6 A;  1VQ4 T;  1VQK T;  4BI3 A;  3RMQ A;  2GQV A;  2KT1 A;  1M9S A;  1U5S A;  2XG8 D;  3E19 A;  3Q1J A;  1VIF A;  4LUD A;  4N0A C;  4J9D A;  2IIM A;  3CCM Q;  2GBQ A;  2VB6 A;  3REB B;  2K4Y A;  3HTR A;  3KFV A;  2HZY A;  2PVG B;  1H92 A;  2JW4 A;  4M75 G;  8ATC B;  2PTK A;  2XDP A;  2JTM A;  2OI3 A;  2XK0 A;  2E10 A;  2RI3 A;  4AFQ C;  4E7Z A;  3PGG A;  4AFU C;  1MUZ A;  3OS1 A;  1VQ9 A;  1K73 U;  5FWB A;  5D6Y A;  2L3R A;  4X9C A;  2M02 A;  2CZ7 B;  1AZE A;  4KGV B;  1KD1 R;  3FIF A;  5KYX A;  4PJJ A;  1OU9 A;  5GAN f;  5GAO l;  1JB0 E;  2CUB A;  2PQW A;  1VQN Q;  2EYQ A;  5LJ5 f;  2JMC A;  4M77 A;  1M3C A;  5I21 A;  1K8A C;  1OOT A;  1BIB A;  2QK0 A;  4OMN A;  4R55 A;  2DL8 A;  1W1F A;  3M54 A;  1VQO T;  1OX9 A;  4LDV A;  2XU8 A;  4PJL A;  4BI4 A;  5C6S A;  4CRI A;  1YIT A;  2M9U A;  3V7C A;  4QKU A;  1VQ7 A;  1HJD A;  4E7K A;  1UGQ B;  2DX1 A;  2EGA A;  2PVD B;  5EC7 A;  4ZNX A;  4F7U E;  3QUI A;  1VYT A;  1XNI A;  4PJO E;  4C8Q E;  4BY6 C;  2MIO A;  5CQY A;  2O9S A;  4JZ3 A;  2VWF A;  2E41 A;  3UDC A;  4KUI A;  1KC8 R;  3C95 A;  2RHX A;  3EFR A;  2RQV A;  1TTH B;  5HY6 A;  4PLL A;  1I5L A;  1FXX A;  3RKY A;  2D8J A;  3GPL A;  4D8D A;  4J9C A;  1AD5 A;  5D7U A;  3AT1 B;  4N4H A;  2A28 A;  3JV3 A;  1O9S A;  2DPP B;  3CCM T;  4OF1 A;  1BI3 A;  2WSE E;  1MNE A;  1ZSG A;  5GAM e;  3OBY A;  2QTX A;  1V29 B;  2DMO A;  1YHQ A;  1RAE B;  1VQ8 A;  1YBY A;  4A63 B;  4XU1 A;  3SB2 A;  3S3N A;  1RAG B;  1ZX6 A;  5GAO m;  2COZ A;  2L89 A;  2ZGW A;  4J8O A;  3CCL Q;  3WXM B;  4Y28 E;  2OAW A;  4XTU A;  2J6K A;  2ZAE A;  2QA4 A;  1NJI C;  2RQU A;  2EWN A;  2KBT A;  1RI9 A;  4A4K A;  5CR2 A;  3CME Q;  2DFU A;  1HD3 A;  1U06 A;  1S72 A;  5IHN A;  2DVJ A;  1VQN T;  4X9D A;  1XOV A;  3VKI A;  1PD1 A;  1N8R C;  3P8H A;  3UA6 A;  1EIF A;  1O75 A;  1XQH A;  3DLL A;  4PJO A;  1GFD A;  4JJD A;  3M4Y A;  2EKH A;  1OUL A;  4ELY C;  1MMA A;  2RJE A;  5C0M A;  2DL7 A;  4YTL A;  3CBO A;  1LPL A;  2CP7 A;  3RER A;  4LN2 A;  1C6V X;  1F1B B;  2W10 A;  2YUN A;  3LH0 A;  1QP3 A;  3EG9 B;  5GAN h;  2L3S A;  2KYB A;  3OYL A;  1MMD A;  3HSB A;  3J7A F;  3OYD A;  3JCM c;  1IHV A;  5LJ5 h;  4DQ2 A;  3JB9 D;  2L0A A;  4IIM A;  3CC2 A;  3I35 A;  1PNJ A;  1H3H A;  1K8A R;  2KVQ G;  2G3R A;  2W0Z A;  4ATO A;  1QKX A;  2L5Q A;  2D0Q B;  3ULR B;  2KI7 A;  1MND A;  4QQD A;  3C12 A;  4XTV A;  3OYA A;  4JRI A;  3VUB A;  1WQ7 A;  3M0P A;  3I5S A;  2VVK A;  2GGR A;  4IIO A;  1VOM A;  2QGG A;  3CC7 A;  5IHK A;  2JUF A;  2ENM A;  2VV5 A;  4J7F A;  5GAN 7;  3CCL T;  2HD0 A;  4XU2 A;  2E64 A;  2F1L A;  4M78 G;  2XIC A;  2CH4 W;  4RCB A;  2V8K A;  4JZ4 A;  5I2M A;  2LVM A;  1ZSZ A;  2DXU A;  1RUW A;  2C0O A;  3DB4 A;  1KG1 A;  3NHN A;  1NLO C;  4C5H A;  4FYY B;  1WLP B;  2DM1 A;  3CME T;  2AKK A;  2VXE A;  1IHW A;  1VQ5 Q;  2BZY A;  2DJZ A;  3H8Z A;  4Y91 A;  4E6R A;  4ME7 A;  5AYF A;  2CT4 A;  2K2V A;  3CMA Q;  4J6X A;  5CKB A;  2LCS A;  4KGX B;  5LJ5 j;  4M7A G;  2JM8 A;  3L2W A;  1YI2 T;  2CS7 A;  4RUG A;  2CH4 A;  3KUF A;  1G5V A;  3C94 A;  2P0P A;  3QJY A;  4M75 D;  4M78 A;  4J7I A;  4DOV A;  4MML A;  2RD1 A;  4RG2 A;  2LRQ A;  3GBQ A;  2GFA A;  2FRW A;  2SRC A;  1WHM A;  1WNL A;  1NEG A;  3MEW A;  2MK5 A;  1NG2 A;  3CCU Q;  2RK1 A;  2E70 A;  3TCJ A;  3HRT A;  3CCQ A;  1QCN A;  1X2Q A;  3WVD B;  1W4S A;  1IGU A;  3JB9 H;  1IB8 A;  3OW2 P;  2DIL A;  1Q82 R;  4RTZ A;  1Y57 A;  2NUT A;  1JJ2 P;  4F7U B;  1JQQ A;  4M7A A;  1QVG P;  3GLX A;  4C8Q B;  4HT9 A;  5FU7 C;  3VU3 C;  4WCI A;  1TH7 A;  1X6O A;  3G71 A;  3QWX X;  3CCR A;  3L1A A;  1WXT A;  2AT1 B;  3IQL A;  2KR3 A;  2CSQ A;  2RN8 A;  5HKC A;  2XD0 A;  1AHJ B;  3VS2 A;  4JS5 A;  3QKJ A;  4QT7 A;  1WHL A;  3X24 B;  5FRN A;  3H0H A;  3M53 A;  2J6F A;  1OEB A;  1KK7 A;  4PFO A;  1NYF A;  2QQR A;  1MHN A;  3OSS C;  4M7D C;  4OGE A;  4HVW A;  1VQ5 T;  2CZ0 B;  4HCK A;  4WTO B;  2V1Q A;  5GMK i;  1GBR A;  4IUU A;  1LCK A;  1M3B A;  1KQS P;  1M1F A;  2BZX A;  2XID A;  1KQ1 A;  3CMA T;  1Z9Q A;  3C4S A;  4PNO A;  2EGC A;  1GL5 A;  1QW1 A;  3I56 Q;  2HDA A;  1VUB A;  2RQT A;  3CBM A;  3NMZ C;  4R56 A;  2FO0 A;  2A7Y A;  3RR6 A;  1VQP A;  1Y96 A;  1QQJ A;  3EGX A;  3TRE A;  4NS5 A;  1I07 A;  1BCM A;  5CKF A;  4C5E A;  1NJI U;  3TVT A;  1WHH A;  2XHC A;  1M90 R;  1X43 A;  3OS0 A;  2DVE A;  1GBQ A;  2LQ8 A;  3VYH B;  1X6G A;  1G3T A;  1JXM A;  2OTJ A;  3CCU T;  1D1A A;  5KE2 A;  2HNI A;  3X25 B;  4JJN K;  4C0D C;  1RI0 A;  1FX7 A;  3OW2 S;  3H0I A;  1SHF A;  2E6Z A;  3QDR B;  1C1A A;  4RTW A;  3BE3 A;  2E1H A;  3O5Z A;  1X27 A;  2KAF A;  3CME A;  2K3B A;  2ZPI B;  5CCA A;  4CI0 C;  3EGU A;  3VRZ A;  2P4T A;  1PD0 A;  4JLI A;  3T9N A;  2E4H A;  2EYX A;  2RJC A;  2BZ8 A;  2CGH A;  3BDL A;  1BB9 A;  4F17 A;  1D0X A;  3NPF A;  1AOJ A;  1LVK A;  3G4S A;  3X28 B;  1YI2 A;  5LJ3 d;  3MET A;  4JDS A;  2D1X A;  5AT1 B;  3OW2 A;  3MCA B;  4BAC A;  5FW9 A;  5GAN 2;  1KQS S;  4M7D G;  2YRD A;  4OB0 B;  3I56 T;  2M51 A;  1VQL Q;  2KEA A;  3EG2 A;  4F7U F;  3OYM A;  1Q7Y C;  2KXC A;  4FL6 A;  1QCO A;  4C8Q F;  1G2B A;  2DIQ A;  1QCF A;  2E5Q A;  4C92 G;  1T0H A;  3CD6 A;  4JPB W;  4M78 D;  1AWO A;  2K7A A;  2ZPB B;  2KMT A;  5A2Q E;  1WPY A;  1Q86 R;  2DTH A;  1H8K A;  4J9I A;  1VIE A;  2HKQ B;  3VJP A;  3ASK A;  2FPF A;  1K73 R;  4RCC A;  3V8K A;  1T3S A;  2X3X D;  2JNG A;  4ELZ C;  2BUD A;  2QDL A;  4A4H A;  4ESR A;  2EGE A;  3M0R A;  4M7A D;  3ZFJ A;  2P4R A;  3L2V A;  1D1C A;  3KBG A;  2ZPG B;  1UB4 A;  3JCM b;  2AKL A;  1VQ5 A;  4JRP A;  4IUR A;  1JBM A;  2BKD N;  3CBP A;  3M0T A;  3OYC A;  3A98 A;  4JJB A;  3OYJ A;  2D0N A;  4XU0 A;  4BB7 A;  3EG1 A;  1TUC A;  3OB9 A;  1K9M C;  2E5K A;  3NTH A;  4KGZ B;  3S6W A;  3OYB A;  3JCM d;  2XKO C;  1AZG B;  2KT8 A;  4CC2 A;  3CC4 T;  1WYX A;  3MEV A;  4E47 A;  5DLQ E;  3CCE A;  1UGS B;  2MPX C;  4L5G A;  4PK4 A;  1YJW Q;  1WI7 A;  3OSV A;  3INZ A;  2ZPE B;  3J80 E;  2CSI A;  1WX6 A;  1HYO A;  1VQL T;  3TSW A;  4ANJ A;  4EMG A;  4PJO C;  3D7S B;  1UGP B;  1RL2 A;  2L3Q A;  4GY5 A;  4M77 G;  3OYN A;  1VA7 A;  1VQM A;  1BYM A;  1M4Z A;  2NUP B;  4M75 E;  1K4U S;  3VYG A;  3PVQ A;  1Y07 A;  5GAO q;  2VGN A;  2L2P A;  4QVZ A;  4OP0 A;  2DTI A;  4MZT A;  2LNV A;  5CK9 A;  3CQT A;  5IT9 E;  3UPU A;  1QLY A;  1Q81 R;  1VQ6 A;  3QZ5 B;  1I0C A;  1M2O A;  1XJW B;  4FSS A;  3FEO A;  2YSQ A;  3JCM f;  3MEA A;  2EW3 A;  3A1P A;  4LXC A;  2Y4Y A;  2NLU A;  1UUE A;  1QP2 A;  3EG9 A;  3EGD B;  2RHZ A;  2K5F A;  3E1S A;  4Z88 A;  5D6W A;  3SD4 A;  4XU3 A;  2BE7 D;  5DM7 R;  3HRS A;  3ZEH A;  1PKT A;  4HVV A;  1YJN Q;  4J9B A;  2LNH B;  5EG2 A;  2YUQ A;  1ZSZ C;  2ROT A;  3GOX A;  1M1K U;  3M9Q A;  2E6N A;  2RO0 A;  3V8L A;  1QWF A;  3G6E Q;  2GTO A;  1ZUY A;  5CO7 A;  4Z02 A;  5KYN A;  3CCV Q;  4RTX A;  4PKC C;  4PL6 A;  4GLM A;  1N5Z A;  2P0K A;  5IAY A;  3SEM A;  5LJ3 h;  1YJW T;  1X6B A;  2O2O A;  4QQG A;  2MCN A;  2AZS A;  5DLO A;  1FMK A;  4BE1 A;  3PIP A;  1WHG A;  1YIJ A;  1NM7 A;  2ED1 A;  2J7I A;  3CCJ Q;  4TVR A;  2K6D A;  4FT2 A;  2PNI A;  1EZZ B;  4OMP A;  1K76 A;  4ZTJ A;  1T0J A;  4M78 C;  1YCY A;  1K0X A;  4EMK B;  4F7U G;  2CZ6 B;  1RAD B;  4XK8 E;  4PJO G;  4DOW A;  5DY9 A;  5GMK e;  2QEX A;  3V7R A;  4XQ3 A;  5FU6 B;  2HQX A;  2F2X A;  4DEX A;  1Y7X A;  1NYG A;  1ZUU A;  3M0U A;  3FJ5 A;  1K0S A;  1OYX A;  2HCK A;  5GAN g;  1SRL A;  2DYB A;  4M7A C;  3CCS Q;  5GAO p;  4M7D D;  3QZ9 B;  4II1 A;  3NFC A;  5LJ5 g;  1Q7Y U;  5LJ3 j;  2X4Y A;  3MPU B;  3CC4 A;  1V1C A;  3EFO B;  2R5M A;  3QBY A;  2V8J A;  3LWI A;  4F7U A;  2KRM A;  1SPK A;  4C92 D;  4DBF A;  3GP8 A;  1WHJ A;  1WHK A;  1WDX A;  4C8Q A;  3SWN B;  4MMK A;  1YJN T;  1KD1 U;  3SHW A;  1UG1 A;  5HCK A;  4ZGJ B;  1VQ4 A;  1VQK A;  3TSZ A;  4OGC A;  3VS5 A;  1OU8 A;  2VGM A;  2EJG A;  3RDV A;  4UC4 A;  1BI1 A;  5FLX E;  3M0Q A;  3G6E T;  1M2V B;  2JZ2 A;  3CCV T;  2PUK B;  4FSX A;  3JCM h;  1YFN A;  5L23 A;  1UJ0 A;  3HRU A;  2DZ9 A;  4HA8 A;  2WAC A;  5KH6 A;  3MO8 A;  3UWN A;  4PJM A;  2F69 A;  1UTI A;  2M1H A;  3VS7 A;  3OYF A;  1AWX A;  2YUO A;  3CCJ T;  1W2B A;  2RH2 A;  1H3Z A;  2DNU A;  4R0K A;  1PKS A;  3OS2 A;  4GBQ A;  1K9M U;  1ZA1 B;  1NE8 A;  2LT4 A;  3I55 Q;  1PC0 A;  4WF2 A;  5GAO r;  3LYI A;  4V2S A;  1X2K A;  1E6H A;  2A0F B;  2RJF A;  4J5Y A;  4RTY A;  4M75 B;  3RNJ A;  2GFU A;  4OMF B;  1GXI E;  2BIV A;  1Y0M A;  2ZCF B;  3VS0 A;  1VQO A;  3QJ6 A;  3CCS T;  5KYU B;  1UFF A;  2C0T A;  3P8D A;  5HK0 A;  4LDX A;  1GFC A;  1RAA B;  2EYY A;  3JSC A;  2LMJ A;  5GAN 3;  2HQE A;  1UHC A;  4PFP A;  2FL7 A;  4DEY A;  4M77 D;  4C5G A;  2QQ9 A;  4HCB A;  4P5N A;  2FRY A;  1QVP A;  3SDZ A;  2DRM A;  2OTL Q;  2KYM A;  4CC7 A;  3L2U A;  2O4X B;  2YRC A;  2RM4 A;  1M27 C;  3FRN A;  4PLI A;  4DBH A;  2KK4 A;  5IXB A;  1NJI R;  1CKA A;  2LZ6 B;  3CCM A;  2YXY A;  3UA7 A;  1WJR A;  2QTV A;  1SSH A;  1U1S A;  2MYS A;  3FJP A;  3BY7 A;  5A0D A;  1NPR A;  3M5A A;  1ABO A;  2E3I A;  5CIU A;  5CKH A;  1YWO A;  1N8R R;  1TS9 A;  5KYY B;  4RMO A;  2KY9 A;  2DET A;  1MV3 A;  4KT0 E;  1WJQ A;  4JJC A;  1C0M A;  1WXU A;  4HCC A;  1AWJ A;  1JU5 C;  2K3X A;  1B3Q A;  4DA4 A;  2KRN A;  4A53 A;  2J6O A;  2GNC A;  2HL5 C;  4IUP A;  4C0Z A;  3I55 T;  4XAX B;  2EQK A;  2DXT A;  1TUD A;  1I81 A;  4QW2 A;  4XTY A;  2RHY A;  2JTF A;  3JB9 F;  2DL3 A;  1WQW A;  4FW2 A;  1QVF P;  1VQN A;  1IO6 A;  2OX7 A;  3X26 B;  1BU1 A;  1MV0 B;  2FHD A;  4X34 A;  3A5Z B;  2KRS A;  2XMF A;  4FYX B;  1RLQ C;  1S1N A;  2ECZ A;  4EDU A;  2ABL A;  5KYW B;  4C5I A;  2LTO A;  3LX7 A;  1AEY A;  1VQ9 Q;  3DB3 A;  1X69 A;  4BI8 B;  1PG5 B;  3QXE B;  4Z89 A;  1ACM B;  3FDR A;  1NPP A;  2CP3 A;  4Q5W A;  3PT9 A;  2J05 A;  4C92 C;  1G3S A;  2DD5 A;  2VYT A;  4C0F A;  3THK A;  2OTL T;  2DXC A;  3H6Z A;  3OQ5 A;  5KCO A;  2X4X A;  2K2M A;  3UF4 A;  3JCM P;  2RI5 A;  4PJO D;  1PHT A;  3OA6 A;  2HBP A;  2QG9 B;  2JTE A;  4IUQ A;  4QVD A;  2EJF A;  1UGV A;  1BCO A;  1BI0 A;  2E12 A;  3MP6 A;  5GAN 4;  2COY A;  1YIT Q;  7AT1 B;  3JCM V;  1SRM A;  4DBQ A;  2EJ9 A;  3L2Q A;  5GMK l;  1VQ7 Q;  5CQX A;  4QVC A;  1AT1 B;  3C0C A;  1M1K C;  1P92 A;  4HXJ A;  2NYS A;  3M59 A;  1WZO A;  2F5K A;  5GAN 8;  4ZTF A;  5A0G A;  3N5B B;  4HKE A;  5GAM j;  4M75 F;  2B8A A;  4FIB A;  4ORZ A;  4F14 A;  3CCL A;  2HKN A;  5GMK j;  1LNX A; 
#chains in the Genus database with same CATH homology
 4M7D F;  5LL6 S;  2WSE E;  3S3O A;  5GAM e;  3OYY A;  3OBY A;  2QTX A;  1V29 B;  3PIO A;  1YHQ A;  2Y4X A;  3QII A;  1KHI A;  3MEV A;  3CC4 T;  5GAN j;  1VQ8 A;  2L8D A;  3AHU A;  1YBY A;  2DD4 A;  4XU1 A;  4BY6 B;  3SB2 A;  3S3N A;  4NOY A;  4E47 A;  4MZP A;  5DLQ E;  3CCE A;  1UGS B;  2EKO A;  5GAO m;  3JCM J;  2L89 A;  4L5G A;  2JN0 A;  2K5L A;  4KUL A;  2XDD A;  2ZGW A;  4N4I A;  4J8O A;  3OSV A;  5GAM g;  3INZ A;  2ZPE B;  4Y28 E;  3WXM B;  4C92 F;  3J80 E;  3G4S T;  4XTU A;  4BD3 A;  3M56 A;  1QVF S;  2QA4 A;  1VQL T;  4EMG A;  1NJI C;  4PJO C;  3VV0 A;  2KQW A;  2YHT A;  4KBM B;  2EWN A;  3KXT A;  1UGP B;  3CPW A;  4L59 A;  2YLB A;  5CR2 A;  4A4K A;  1RL2 A;  1WGS A;  4GY5 A;  2LX9 A;  4M77 G;  1S72 A;  3OYN A;  3RES A;  1VQM A;  1BYM A;  1M4Z A;  4M75 E;  1VQN T;  2YLC A;  2O01 E;  3PFS A;  3M55 A;  1IRE B;  4X9D A;  3VYG A;  1XOV A;  2KSS A;  4LD9 K;  3VKI A;  1Y07 A;  1VQ9 T;  1N8R C;  3P8H A;  4D6W A;  5GAO q;  2QQA A;  2VGN A;  1H64 1;  4QVZ A;  3QYH B;  1EIF A;  4OP0 A;  3GNF B;  2DTI A;  2PU9 B;  2LNV A;  4MZT A;  3V7S A;  2ZZD A;  4MDX A;  5CK9 A;  1O75 A;  5IT9 E;  1XQH A;  4MZM A;  3DLL A;  4M77 C;  4PJO A;  3UPU A;  2VC8 A;  3JRZ A;  3HFO A;  1X01 A;  3M4Y A;  1VQ6 A;  1K8A U;  3QZ5 B;  4ELY C;  3CD6 T;  4PJO B;  2RJE A;  5C0M A;  5GMK m;  3FEO A;  4YTL A;  5GAM h;  2QI2 A;  3CBO A;  3ZBD A;  3JCM f;  3MEA A;  3HL8 A;  1U1T A;  1U8R A;  2Y4Y A;  2QQS A;  5CAI A;  3RER A;  3EAE A;  3LLR A;  2NLU A;  2K5I A;  1QP2 A;  2X4J A;  5GMK h;  1YJN A;  2RHZ A;  1QVF A;  3A8G B;  3LH0 A;  2IVW A;  1QP3 A;  2K5F A;  5GAN h;  1YIT T;  2EQJ A;  3E1S A;  3JCM W;  1KD1 C;  2LT1 A;  2EIF A;  3A8O B;  3OYL A;  5D6W A;  3SD4 A;  3CXC A;  4XU3 A;  3HSB A;  2EFI A;  5DM7 R;  3HRS A;  3PNW C;  3OYD A;  3J7A F;  1N9S A;  3GNG A;  3JCM c;  3ZEH A;  5LJ5 h;  1VQ7 T;  4DQ2 A;  3JB9 D;  3G6E A;  2X4W A;  4A54 A;  2VUB A;  4BUG A;  4O6J A;  3CCV A;  4J6Y A;  4E7H A;  3CC2 A;  4LDU A;  5D6X A;  3QHS A;  2KVQ G;  4C0G A;  4EPC A;  2G3R A;  5EG2 A;  1KHC A;  1Q86 C;  4ATO A;  2L5Q A;  2D0Q B;  3GOX A;  1M1K U;  3M9Q A;  2E6N A;  4QQD A;  2RO0 A;  3C12 A;  4XTV A;  3OYA A;  3MP1 A;  4JRI A;  3VUB A;  1UGR B;  1ZBX A;  1WQ7 A;  3LGL A;  3V8L A;  4C8Q D;  3QO3 A;  5LJ3 f;  5CO7 A;  4Z02 A;  1JRI A;  4PKC C;  4PL6 A;  5J26 A;  1K73 C;  4EMK C;  3CCJ A;  1I4K 1;  2CKK A;  3HKS A;  4JRQ A;  2P0K A;  5IAY A;  2RA2 A;  5LJ3 h;  1LJO A;  3CC7 A;  2RI2 A;  3OYI A;  1YJW T;  2LQK A;  2JUF A;  3J81 E;  4VUB A;  4MDW A;  4QQG A;  2VV5 A;  4J7F A;  4M77 F;  5GAN 7;  2HD0 A;  4XU2 A;  3CCL T;  2E64 A;  4M78 G;  5DLO A;  2XIC A;  4RCB A;  3VUZ A;  3JCM Q;  1YJ9 A;  4BE1 A;  2V8K A;  5FU6 C;  3PIP A;  5I2M A;  3V8J A;  2LVM A;  2DXU A;  2M16 A;  3DB4 A;  1KG1 A;  1YIJ A;  3OY9 A;  3CMA A;  4C5H A;  4OB2 B;  4TVR A;  3JCM X;  4FT2 A;  3CCE T;  3CME T;  2DIG A;  4IKF A;  2E65 A;  1BI2 A;  2VXE A;  3NTI A;  5FRM A;  4ZTJ A;  2DEQ A;  4EMK A;  4HCB A;  2I2L A;  2DJZ A;  3H8Z A;  4M78 C;  4Y91 A;  1YCY A;  4ME7 A;  1G3Y A;  4EMK B;  5AYF A;  3BW1 A;  2CZ6 B;  4F7U G;  2QA4 T;  4XK8 E;  4PJO G;  5GAM d;  3OMC A;  2K2V A;  4DOW A;  2RHI A;  5DY9 A;  3OYG A;  5GMK e;  4J6X A;  2QEX A;  3V7R A;  3ER0 A;  5CKB A;  4XQ3 A;  4M7A G;  5LJ5 j;  3CCS A;  2PUO B;  2XDB A;  1N8R U;  3G7Z A;  2HQX A;  5FU6 B;  1S72 T;  1Q82 U;  5GAN e;  1VQM T;  1NZ9 A;  1Y7X A;  3L2W A;  5FRO A;  1YI2 T;  2CS7 A;  3SWN C;  3F70 A;  2D6F A;  1JJ2 S;  3KUF A;  1G5V A;  2EAY A;  3C94 A;  5LJ5 e;  3CCU A;  3FB9 A;  1OYX A;  2P0P A;  3QJY A;  4M75 D;  3X20 B;  3LGF A;  4J7I A;  1G3W A;  4M78 A;  4MML A;  1BKB A;  4O5V A;  4C8Q C;  4DOV A;  4BDY A;  2RD1 A;  4RG2 A;  2LRQ A;  5L8R E;  1LOJ A;  5GAN g;  3CXC S;  4M7A C;  2EQM A;  4M78 B;  2GFA A;  5GAO p;  4M7D D;  4N4G A;  4HT8 A;  3QZ9 B;  4KUD K;  4II1 A;  2QXF A;  1VQ6 T;  2CZ1 B;  2K3Y A;  1SSF A;  3NFC A;  5LJ5 g;  2FYK A;  1WNL A;  2DO3 A;  3RKW A;  1Q7Y U;  5LJ3 j;  3MEW A;  2X4Y A;  2RK1 A;  2E70 A;  3TCJ A;  3A8L B;  3DLM A;  2DXB A;  4M7D E;  3GF5 A;  3CC4 A;  3HRT A;  3CCQ A;  2IG0 A;  3SWN A;  2R5M A;  3QBY A;  3WVD B;  2V8J A;  1W4S A;  3LWI A;  4F7U A;  3JB9 H;  2MF2 A;  4C92 D;  4HCZ A;  5LJ3 e;  3GP8 A;  4E7J A;  4C8Q A;  3SWN B;  4MMK A;  1YJN T;  1KD1 U;  4F7U B;  4ZGJ B;  1B34 A;  1VQ4 A;  1VQK A;  2R58 A;  4M7A A;  3GLX A;  4C8Q B;  4HT9 A;  4OGC A;  5FU7 C;  3VU3 C;  2WSC E;  2VGM A;  1TH7 A;  3QYG B;  4XTW A;  3PMI A;  4C92 E;  1X6O A;  1B34 B;  3TEE A;  2EJG A;  4M7A B;  3NTK A;  4M78 F;  5LJ3 g;  1Q81 C;  4UC4 A;  1N6A A;  3G71 A;  1BI1 A;  5FLX E;  3P8B B;  3G6E T;  3OYK A;  3JB9 J;  1Q86 U;  2JZ2 A;  3CCV T;  2PUK B;  4FSX A;  1K9M C;  5CKD A;  3CCR A;  3JCM h;  2JOY A;  3L1A A;  3CC2 T;  2X35 A;  1HK9 A;  1JJ2 A;  2DTO A;  3HRU A;  2LDM A;  3CPF A;  1QVG A;  5GAN 6;  5HKC A;  2DZ9 A;  2HAX A;  4HA8 A;  2WAC A;  2XD0 A;  1AHJ B;  3GIB A;  3QSU A;  5KH6 A;  3WVE B;  3O8V A;  3A8H B;  1M5Q 1;  2AHJ B;  5J39 A;  4JS5 A;  1OZ2 A;  2RJD A;  3MO8 A;  3QKJ A;  3UWN A;  5A0L A;  3I55 A;  2F69 A;  3X24 B;  4B9X A;  5M9O A;  1KQ2 A;  4M75 C;  5FRN A;  3OYH A;  3M53 A;  2M1H A;  3OYE A;  2K57 A;  3OYF A;  2MMP A;  4PJO F;  1BIA A;  3CCJ T;  4OB1 B;  4E7L A;  5FU7 B;  2QQR A;  1MHN A;  3BDU A;  1W2B A;  4XTX A;  2RH2 A;  1N9R A;  3CC7 T;  1I8F A;  2LCC A;  3OSS C;  4M7D C;  4M7A F;  4OGE A;  1H3Z A;  1XTD A;  1QVG S;  3I56 A;  1VQ5 T;  2CZ0 B;  3OS2 A;  1K9M U;  1Y71 A;  1M90 U;  1NE8 A;  5GMK i;  2LT4 A;  1M1G A;  4IUU A;  5J3B A;  4WF2 A;  4QQ6 A;  5GAO r;  3LYI A;  1M1F A;  3E9G A;  1YIJ T;  2XID A;  1KQ1 A;  4V2S A;  3CMA T;  3LW5 E;  4LDW A;  3RKX A;  5KE3 A;  3PMT A;  1X75 C;  2GCX A;  3C4S A;  4PNO A;  4FU6 A;  4M75 A;  1QW1 A;  2RJF A;  4J5Y A;  5I2S A;  3HP9 A;  1VUB A;  2DK3 A;  3CBM A;  4M75 B;  4RKU E;  5CKE A;  3S3M A;  3JB9 I;  1PSE A;  3OS5 A;  2GFU A;  4OMF B;  1GXI E;  2RHU A;  4M7D A;  1YHQ T;  4R56 A;  1KQS A;  2DKG A;  1VQ8 T;  1HXD A;  1M8V A;  2A7Y A;  2BIV A;  3JB9 G;  4B9W A;  4M7D B;  2R5A A;  2QEX T;  1VQP A;  1Y96 A;  2VXF A;  2Y90 A;  3BFM A;  2ZCF B;  1WJS A;  3A8M B;  3M57 A;  4NS5 A;  3TRE A;  1VQO A;  1KC8 C;  2QQB A;  3QJ6 A;  3CCS T;  5CKF A;  1Y96 B;  3RUX A;  4C5E A;  2DAQ A;  2C06 A;  2OTL A;  1NJI U;  1OI1 A;  2FVU A;  2XHC A;  2DZC A;  4NL2 A;  4C92 A;  3OS0 A;  3P8D A;  2DVE A;  2LQ8 A;  4A4F A;  5HK0 A;  3VYH B;  4LDX A;  1G3T A;  1PSF A;  2OTJ A;  3JSC A;  3CCU T;  4ZGD B;  4C92 B;  4C8Q G;  5GAN 3;  2HQE A;  5IN1 A;  3HPW A;  5KE2 A;  3JCM e;  4A4E A;  5HK3 A;  3SFM A;  3TU4 K;  2FL7 A;  4JLG A;  4M77 D;  2F5T X;  4GLK A;  2HNI A;  2OAU A;  4C5G A;  2QQ9 A;  1D3B A;  3X25 B;  4A4G A;  4C0D C;  1MGQ A;  1RI0 A;  4P5N A;  4JJN K;  1QVP A;  2R57 A;  2KDS A;  4IUV A;  3SDZ A;  3OMG A;  1FX7 A;  1OZ3 A;  3MP8 A;  4OVA A;  3L2R A;  3OW2 S;  4OB3 B;  2O4X A;  3L42 A;  1D3B B;  5GAO n;  2WSF E;  4ZN1 A;  2MI6 A;  4JRK A;  2ZPH B;  2E6Z A;  2QDY B;  2D9T A;  4M77 E;  3QDR B;  3JCM g;  4NL3 A;  4FM4 B;  2O4X B;  3EFS A;  4J83 A;  3L2U A;  1I5L A;  2RM4 A;  5GAN d;  1ZHI A;  2E1H A;  3CCQ T;  4XTZ A;  3HFN A;  3FRN A;  2KAF A;  4PLI A;  3HHT B;  2M0O A;  2KK4 A;  3CME A;  5LJ5 d;  4BE0 A;  2JVV A;  2RK2 A;  2ZPI B;  5CCA A;  3RIR A;  3CCM A;  3FLG A;  4CI0 C;  1VQ4 T;  1WJR A;  1Q81 U;  1VQK T;  1U1S A;  2P4T A;  4JLI A;  3FJP A;  3T9N A;  3BY7 A;  4BI3 A;  5A0D A;  1W2B S;  1NPR A;  3RMQ A;  1UEB A;  2GQV A;  3M5A A;  3R6O A;  3LWH A;  1M9S A;  2XG8 D;  2RJC A;  4C0D B;  3E19 A;  3Q1J A;  5CIU A;  3G71 T;  5KCH A;  1VIF A;  2CGH A;  1R8O B;  3BDL A;  5CKH A;  4N0A C;  3CCR T;  4RMO A;  4BE2 A;  3QG1 A;  2KY9 A;  3M4G A;  4KT0 E;  1WJQ A;  3G4S A;  1FWZ A;  2K4Y A;  4LD6 A;  3X28 B;  1YI2 A;  2MWO A;  4HCC A;  3OBW A;  3UT1 A;  5LJ3 d;  3MET A;  2K3X A;  4JDS A;  3URG A;  4DA4 A;  3CEY A;  1VQL A;  2PVG B;  1Q82 C;  4JUV A;  4A53 A;  4IUP A;  4C0Z A;  3I55 T;  1ZQ1 A;  4M75 G;  4XAX B;  2EQK A;  2DXT A;  3OW2 A;  4QW2 A;  1I81 A;  3MCA B;  4XTY A;  2RHY A;  4BAC A;  2MAM A;  2JTF A;  2XDP A;  5GAN 2;  3JB9 F;  4IUT A;  2JTM A;  2XK0 A;  1KQS S;  1WQW A;  2E10 A;  2MWP A;  2RI3 A;  1VQN A;  4M7D G;  5GAM f;  3X26 B;  4N0A A;  4OB0 B;  3PGG A;  3I56 T;  3OS1 A;  1VQ9 A;  1K73 U;  2FHD A;  4X34 A;  5D6Y A;  2L3R A;  2YRV A;  3A5Z B;  4X9C A;  4E7I A;  2CZ7 B;  3DKM A;  3JCM d;  4F7U F;  3OYM A;  4JS4 A;  1Q7Y C;  4FL6 A;  4C8Q F;  3FIF A;  2DIQ A;  2E5Q A;  3PTA A;  5GAN f;  2XI9 A;  5GAO l;  4C92 G;  1JB0 E;  4EDU A;  2PQW A;  2V8I A;  4C5I A;  5GAN 5;  3CD6 A;  2LTO A;  3LX7 A;  2EYQ A;  4M78 D;  2ZPB B;  5LJ5 f;  2KMT A;  5A2Q E;  1YJ9 T;  1WPY A;  3ME9 A;  4M77 A;  3JAM E;  2FB7 A;  3DB3 A;  5I21 A;  1K8A C;  4BI8 B;  3QXE B;  1BIB A;  2RB6 A;  1KC8 U;  4M77 B;  2DTH A;  3FDR A;  1NPP A;  4Q5W A;  4M78 E;  3PT9 A;  4R55 A;  3RMS A;  1N27 A;  1VQP T;  1VIE A;  4C92 C;  3VJP A;  1G3S A;  2EQU A;  3M54 A;  2DD5 A;  4LDV A;  3MEU A;  2VYT A;  3ASK A;  4BDZ A;  1VQO T;  2XU8 A;  4LDY A;  4BI4 A;  3FC3 A;  4C0F A;  5C6S A;  4CRI A;  1YIT A;  2OTL T;  2DXC A;  4ZN3 A;  3H6Z A;  3OQ5 A;  4ZGE B;  4RCC A;  3V8K A;  5KCO A;  2X4X A;  2M9U A;  2JNG A;  2PVO B;  3V7C A;  4ELZ C;  3JCM P;  2BUD A;  2RI5 A;  1VQ7 A;  4A4H A;  4PJO D;  3L2Z A;  1DJ7 B;  4E7K A;  2OTJ T;  3OA6 A;  1UGQ B;  4EMH A;  2HBP A;  2PVD B;  4IUQ A;  4M7A D;  4QVD A;  2EJF A;  3E9F A;  4L6V 5;  2ZPF B;  3ZFJ A;  4F7U E;  2H3J A;  2CYZ B;  3QUI A;  3L2V A;  1BI0 A;  2E12 A;  3MP6 A;  1XNI A;  5GAN 4;  4PJO E;  2LCL A;  4C8Q E;  3KBG A;  4BY6 C;  2ZPG B;  3JCM V;  1UB4 A;  5CQY A;  3MHX A;  3JCM b;  3CPW S;  1VQ5 A;  4J6W A;  2EJ9 A;  4JRP A;  2E41 A;  4IUR A;  1JBM A;  2BKD N;  3CBP A;  3UDC A;  4M7A E;  4KUI A;  4RG8 A;  5GMK l;  3C95 A;  5CQX A;  3OYC A;  4QVC A;  3L2Q A;  3OYJ A;  1IZ6 A;  4XU0 A;  1M1K C;  1P92 A;  2RHX A;  3EFR A;  5HY6 A;  4FT4 A;  4BB7 A;  4PLL A;  3M59 A;  2F5K A;  5GAN 8;  3OB9 A;  1FXX A;  3M58 A;  3RKY A;  3N5B B;  4HKE A;  5A0G A;  3GPL A;  4ZTF A;  5GAM j;  4M75 F;  1M90 C;  2B8A A;  4FIB A;  3QPH A;  2LC4 A;  1YJW A;  4N4H A;  3NTH A;  5CVI A;  3CCM T;  1O9S A;  2DPP B;  3CCL A;  3S6W A;  2GF7 A;  4OF1 A;  3OYB A;  5GMK j;  2P0Q A;  1LNX A;  2XKO C;  1BI3 A;  2A3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...