3PGGA

Crystal structure of cryptosporidium parvum u6 snrna-associated sm-like protein lsm5
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
89
structure length
78
Chain Sequence
NIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADKRVMVNRLETILLSGNNVAMLVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords U6 snRNA-associated Sm-like protein LSm5. SM domain
publication title Genome-Scale Protein Expression and Structural Biology of Plasmodium Falciparum and Related Apicomplexan Organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
total genus 15
structure length 78
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pggA00
4M7DF 4PJOA 4QVDA 4JUVA 1H641 4C8QA 5LJ5j 4PJOB 4WF2A 1B34B 4Y91A 5LJ5h 5GAOr 2VXEA 1N9SA 5LJ3j 4HT9A 5LJ3h 2HNIA 4C92E 5GAN4 1KQ2A 4PJOD 1LNXA 4J6WA 1Y96A 3QO3A 4XTZA 1U1TA 1Y96B 5GANf 3JCMX 4HA8A 4JRKA 4XU3A 1HXDA 1I81A 2DKGA 4C92F 4N0AA 4XU2A 4EMKA 5GMKe 5GMKi 3V7CA 2DXTA 3JB9H 4C8QE 4PJOE 5GAMd 4XU1A 4M7AC 2RA2A 5LJ5f 4M77C 5GAOp 3PGGA 5GAMe 3JCMb 5LJ3f 3V8LA 3JCMW 1MGQA 2I2LA 3SWNC 2EJFA 3JB9J 2DVEA 4J6YA 1JBMA 1U1SA 4F7UA 2JN0A 3AHUA 4F7UB 2FB7A 4M77A 4M7AG 4M7AB 5GMKh 4EMHA 3SWNA 5GAMj 3SWNB 4M7AD 5GAMh 5GAOq 2E65A 4PJOG 4C8QG 2DXUA 4C8QB 1LOJA 4EMGA 4F7UE 3BW1A 2DTIA 3JCMP 4M7AE 2EJ9A 5GAN3 1X01A 4M78A 4N0AC 4EMKC 4M75A 2FYKA 1LJOA 4C8QD 5GAN6 3JB9D 3QSUA 5GAMf 4M7AF 3JCMd 3HFOA 2ZGWA 1HK9A 1I5LA 4EMKB 2DZCA 3JB9I 4NL3A 3JCMe 5GAN7 2EWNA 4XTWA 1I4K1 4QVCA 5GANg 3RKWA 5GAN5 3V8JA 2YLCA 1WQWA 4HT8A 4PJOF 3FB9A 1YCYA 4C8QF 4F7UG 5GMKj 4MMLA 4J6XA 4M77G 5LJ5g 2QTXA 1WPYA 4M77B 3JCMV 3HFNA 4NOYA 4RCCA 4X9CA 5LJ3g 3HSBA 4XTYA 5GMKm 4M7DC 1I8FA 5I21A 2YLBA 4M77D 4OP0A 4M78C 2EJGA 4JLIA 2Y90A 4M75C 4RCBA 5GAOm 3BDUA 2RM4A 3JB9G 3EFSA 3L1AA 4MMKA 4M7DA 3BY7A 4M77E 4M7DB 4JRIA 5GANd 4M78G 4M75G 4M78B 4M75B 1KQ1A 1WQ7A 5GAN2 4F7UF 4J5YA 3GIBA 2YHTA 4M78D 4XQ3A 2DZ9A 2E64A 4M75D 4M77F 4XTXA 5LJ5d 4PNOA 3JCMQ 3RERA 4C92A 2VXFA 4M7DE 2CGHA 5DY9A 2EAYA 4M78E 3RESA 4M75E 4XTVA 5GAMg 2K57A 3JCMJ 4XU0A 3JCMc 4V2SA 3JB9F 3EFRA 2DTOA 2DEQA 1JRIA 4DQ2A 2E10A 5GAOl 1B34A 4M78F 3JCMh 4M75F 3FJPA 2DJZA 1BIAA 1WNLA 1TH7A 3QHSA 1M8VA 3VU3C 2VC8A 3FIFA 3V7RA 5GAN8 3RIRA 4M7DG 3SB2A 3QUIA 3RKYA 3RKXA 3BFMA 4A54A 4NL2A 3JCMf 5GANe 4C92C 3L2ZA 4M7DD 3V7SA 4X9DA 1BIBA 2RD1A 1M5Q1 1D3BA 3INZA 5LJ3d 1D3BB 5LJ5e 4M7AA 3JCMg 4C92G 4C92B 4PJOC 2DTHA 4A53A 5LJ3e 4XTUA 2E41A 1N9RA 4C8QC 5GANh 5GAOn 5GANj 5GMKl 2RB6A 3M4GA 5CAIA 4C92D 2E1HA 3V8KA 3RUXA
chains in the Genus database with same CATH superfamily
4QVDA 1BBZA 3CPWS 1YWPA 1B7TA 1GFDA 3ZL7C 2NWMA 2J6KA 1QCNA 3X26B 2JMAA 1ZBJA 4XU3A 1YJ9A 2YUQA 2JTEA 2FVUA 4DBQA 2EYWA 1M1KR 3A1PA 2P0PA 3DKMA 4J6YA 3HP9A 1YJNT 2FPEA 2JN0A 3H8ZA 2EPDA 3CMEA 1LPLA 2OTJA 3JRZA 2F5TX 2JXBA 2YUNA 1H8KA 4BI8B 4PJNA 3JCMP 3E19A 4OMPA 3QYGB 4MZMA 3C0CA 2KEAA 2QA4T 2DZCA 1W2BA 3LGLA 3EHQA 5GAN5 1NE8A 3EG0A 1K8AC 3A8LB 1E6GA 1PRMC 3HFNA 3FJ5A 1R0BG 1VQLQ 3EGDA 4M75C 2PU9B 3M9QA 5C6SA 5A0DA 1OULA 2BE9B 1VQ6A 4OF1A 3CCLT 4M75B 4JPBW 2XU8A 1K9MC 1AWXA 4C92A 4JLGA 1X27A 4XU0A 2D6FA 4QQGA 1H3HA 1EIFA 1YBYA 3VRZA 3CC7Q 4A4HA 3PMTA 2O2OA 3QHSA 2F2WA 1XOVA 1AZEA 4J9EA 1HJDA 4A54A 4M7DD 5L23A 1M5Q1 2GF7A 2KYMA 1JQQA 2KT8A 1QVFS 2F5KA 2LVMA 4ELYC 1PKTA 2DL5A 2HBWA 2JTMA 1UHFA 4PJOA 4WF2A 3G4ST 4PJOD 1G8XA 4RTXA 1U1TA 3M59A 4J9GA 2ROLA 3VS7A 2O31A 1OV3A 4J8OA 1WXBA 4N4GA 1Y71A 2CZ7B 4M7AC 5FRNA 2EYQA 3GNFB 2DM1A 4LE9A 4FW1A 1BI0A 1H92A 1YJWA 3RNJA 6AT1B 1SG5A 1YJ9Q 2L3RA 4R0KA 3OYAA 4M7AB 2K9GA 2DPPB 2ECZA 3M4YA 3REBB 2EIFA 1VQ5A 2OAUA 1NM7A 2JZ2A 2RJCA 3CMEQ 2OTJQ 5DM7R 1LJOA 3PE0A 5KYNA 1QCFA 2VB6A 2AK5A 1GBQA 4XK8E 2QA4A 4FT4A 5CCAA 4FYWB 5D7UA 1R0CB 1G2BA 3FB9A 2ZPHB 1V76A 3RBBB 3TCJA 3HSBA 1R8OB 1ZBXA 3BDUA 2HBPA 2HQEA 1K1ZA 2XMFA 3I55T 4M78G 1U5SA 1WQ7A 2RPNA 4E6RA 4CC2A 3CXCA 3VYGA 1GCQA 1VQ6Q 1FWZA 2JT4A 1ZSGA 4ZGJB 3RESA 3CBMA 1O75A 1Q82U 3JCMJ 4DQ2A 3GPLA 4M78F 2J7IA 1NYGA 4ESRA 1ZA1B 3MEAA 2JS2A 1MNEA 1B07A 3QWXX 2DYBA 2O88A 4A4FA 2BZXA 5CQXA 2DO3A 3HRTA 1YNZA 1YP5A 1SRMA 3JCMg 2OJ2A 2JW4A 1R77A 3L2RA 1VYUA 3OW2S 3CPWA 2A36A 2E6NA 2LP5A 4JJBA 4X34A 3M0RA 2XDDA 2PVGB 2DRKA 3QZ9B 3NTHA 4J6WA 5I2MA 3CCRA 2HSPA 2KAFA 3PVQA 2FEIA 1PRLC 4DEXA 3S3OA 2KMTA 5GAMd 4B9WA 1RI0A 1UG1A 1NYFA 3L2UA 3P8DA 1VQPT 2QK0A 1U1SA 1Q86R 3KUFA 2QEXT 3MO8A 2YXYA 2QQAA 5GJWB 4C5HA 1YJWQ 4KGZB 3OS5A 4C0FA 4C8QD 3OYYA 1MMGA 2RK2A 1VQ5Q 1OEBA 4XAXB 1VYTA 1IO6A 3J7AF 1IHVA 4NL3A 4FSXA 2DE0X 4KH0B 1ABOA 1QVGP 1VQNT 4FYXB 1G3YA 2CSQA 4MMLA 3LWHA 3S3NA 4OP0A 2ZAEA 1KJWA 3VS4A 3E2UA 1TU0B 1OYXA 1TS9A 4C5GA 2DL4A 4BE0A 3E1SA 4XQ3A 2E64A 4IUUA 4Z89A 1WHLA 2JM9A 2CGHA 5DY9A 1SKUB 1NPRA 5FW9A 1JRIA 5HKCA 2E10A 4JZ4A 1WA7A 3QIIA 5A0GA 1SEMA 2DJZA 3EGXB 3VU3C 2AKKA 1SF9A 1SSFA 2FRYA 3PTAA 4UC4A 2I0NA 1OX8A 1M1FA 2LDMA 4E7JA 1S72T 4AG2C 1Y07A 1M90R 1K9AA 4C5IA 3RDVA 2VUBA 4C92G 5LJ3e 4OGEA 5GMKl 1GL5A 3RUXA 1QVGS 4HT9A 4ZTFA 1B3QA 3VJPA 5LJ3h 4RG2A 1GCPA 3GP8A 1G3TA 1Y96B 4E47A 1WXUA 4C0ZA 2DF6A 3LGFA 1TG0A 2CZ1B 2K7AA 4C92F 4PJOE 2BUDA 1WJSA 3CCRQ 3PGGA 2DD4A 2I2LA 4GLKA 1K0SA 3DB4A 3FLGA 2B8AA 4EMHA 3SWNA 2DNUA 5IAYA 2MWPA 3OYNA 4HCCA 4PJOG 2L89A 4EDUA 2EJ9A 3URGA 4M75A 3I35A 2K5IA 1WFWA 4JS5A 1HK9A 3A8HB 4AT1B 1I5LA 2EQMA 5M9OA 4LDXA 1A0NB 3GF5A 2YLCA 1PNJA 4PJOF 3CCSA 1YHQT 2RHXA 4J9IA 4ORZA 4LD6A 2GTJA 1G83A 3PIOA 4M7DC 4BE2A 3EFOB 2E70A 3UA7A 3J80E 3RMQA 1VQ4T 4M7DB 3EHRA 1QCOA 2E3HA 3VRYA 3CCET 3E9FA 2ZPEB 1SHGA 2VC8A 4RG8A 3V7RA 5KCHA 2RN8A 3TREA 1Q7YC 3QUIA 2FRWA 1FMVA 3PMIA 4BDZA 3A8OB 3HKSA 1WDXA 4AFUC 3OW2A 1U3OA 5LJ5e 4M7AA 1VQ9A 4QKUA 4XTUA 1IB8A 2E5QA 1Q81R 1VQOA 2E1HA 1UGPB 5LJ5h 2KRMA 1K73U 1SSHA 1ZQ1A 4LDVA 2K79A 1HXDA 1YWOA 5CQYA 1WGSA 5GAOp 2GNCA 3CC2T 5LJ3f 2VV5A 1PD0A 4F7UB 2FZGB 1M1KC 4FM4B 5I22A 2RQWA 1BCMA 1TUCA 4AG1C 2K6DA 1UDLA 3OMCA 1MNDA 2D0NA 2CUBA 4EMKC 1HD3A 2F2XA 5GAN6 3M53A 2DL7A 5CKDA 4FIBA 3CXCP 2DD5A 1UECA 1M8MA 4JZ3A 4L59A 4EMKB 1TUGB 4E7LA 1PSEA 1YCSB 4RTUA 1OZ3A 5I11A 1CKBA 2V1RA 2YRVA 4M77B 8ATCB 4J9DA 4WCIA 3I56T 1I8FA 2ABLA 3CCSQ 2LJ0A 2QAZA 2KDSA 1KC8R 4KUDK 2KYBA 4K11A 2RK1A 1VOMA 4J5YA 4M78D 3OY9A 3TSWA 5LJ5d 2HQHA 2ESWA 1OQKA 2LQKA 3HRUA 2C0IA 1N8RU 2O01E 4XTVA 3CCEA 1YN8A 3EAEA 1LVKA 3CPWP 1AWJA 5D6XA 3CCJA 2COZA 3C12A 4OB3B 1QWEA 4BD3A 2LMJA 2H3JA 1VQMT 3L2ZA 3MP1A 1T3SA 5EG2A 3QWYA 1ZUYA 3UA6A 1UGVA 1QVGA 4HVUA 4C8QC 3FC3A 2Y4YA 2RQVA 1K9MU 3TSZA 1VQ9Q 4J9HA 1X6BA 1VQOQ 4JRPA 3GOXA 2RHUA 2NLUA 4Z88A 3JB9H 4FYYB 5LJ5f 2X35A 2CS7A 1JB0E 3FRNA 3JCMb 3JCMW 3CC2A 1IREB 4Z02A 3AHUA 3QDFA 2C0TA 4LNPA 2CZ0B 3G71A 3FEOA 1JJ2S 3LLRA 3GBQA 2ED0A 2DXUA 1QMCA 2K3XA 2DTIA 3ZEHA 4N0AC 3CCUA 4OMQA 1YIJA 2FO0A 2XDPA 4JS4A 2LCCA 2EWNA 3ULRB 1YITA 4XTWA 2ZPBB 5ECAA 3OBWA 3Q1JA 4ZN1A 3MCAB 7AT1B 3LWIA 5GMKj 1VQKT 1WPYA 3EGXA 2BTTA 2DYIA 3G6EA 3MP6A 3I56A 2VWFA 3TEEA 4JLIA 2Y90A 4O5VA 3ASKA 3CMAA 2XDBA 2KNBB 2RJEA 2YSQA 3BY7A 3M58A 2LC4A 1W6XA 4M75G 3CBOA 3OYBA 1RAGB 4IKFA 2L2PA 2YHTA 1N8RC 2DZ9A 1QVFP 4D8DA 1K0XA 2GFAA 1RAFB 2GQIA 1G3WA 2DIGA 3PNWC 1WIEA 1E6HA 3MPUB 2DL8A 4PLLA 4M75F 1TTHB 2CREA 3OSVA 2KT1A 1PSFA 2A37A 3CCEQ 2IVWA 1NZ9A 5CK9A 2XICA 1WI7A 4AFQC 2QQSA 3DLMA 3BFMA 1BB9A 1G3SA 3SHWA 3CCMT 3CCJQ 1M30A 2K2MA 3V7SA 2LNHB 2G3RA 2P0KA 4JJCA 2CT3A 2AZSA 3WVDB 3VKIA 4ZN3A 2D0QB 2M0YA 2E41A 5GAOn 5GANj 3UATA 2E4HA 5CAIA 4BB7A 4C92D 1BI1A 1H641 3UT1A 3IQLA 4OMOA 4Y91A 2P4RA 2OI3A 4DBFA 1UFFA 4F17A 4XU2A 5GMKe 2LQWA 3CD6T 1MGQA 3JB9J 2DVEA 2GTOA 1CKAA 2FB7A 1C6VX 4M7AG 5GMKh 4E7ZA 1ZHIA 1BK2A 5A2QE 5GAMj 1WHKA 3CC2Q 1QQJA 3EFOA 1X2KA 2HL3A 3MJXA 5IHIA 2PZ1A 2VYTA 1X01A 3M0UA 4DOWA 3G71Q 3HTRA 1BKBA 4OGCA 5CKFA 4M7AF 2EKHA 5GAN7 3CCUQ 1IGQA 3N5BB 5GANg 1YIJQ 3HRSA 2CP3A 4QQDA 4RTVA 2JVVA 1YJNA 3X28B 1KHCA 5LL6S 2VKNA 2QTXA 1YITQ 1M9SA 1WHMA 2J6OA 2PUOB 3NTIA 2D9TA 2ATCB 2A7YA 3G6EQ 1UGQB 1KQ1A 3I56Q 1VQ8T 3WXMB 3CMAQ 3VV0A 3OW2P 4JJDA 2WSFE 5FU6C 4M78E 3H6ZA 2HZYA 4FSSA 5GAMg 2FZCB 1JXMA 3A5ZB 1N6AA 1FMWA 2L3PA 1HSQA 3R6OA 4L5GA 2X3WD 1SRLA 1BYMA 3F70A 1RACB 4CC7A 1ZSZC 1NJIU 2DXBA 2E12A 4NL2A 1Y57A 4ZGDB 3CCLA 5CKBA 5KE2A 1D1BA 2MYSA 2RD1A 2DFUA 1Y0MA 4BUGA 2DLPA 4WTOB 2KSSA 3I5RA 1W1FA 1VQ7T 4JDSA 2HD0A 1KK7A 1SHFA 3A98A 2LTOA 3TVTA 1PCXA 2DKGA 1YI2T 4EMKA 1K8AR 1X69A 4QVZA 1OOTA 2HL5C 3V8LA 4E7HA 4N4HA 1JJ2A 1WJRA 3D7SB 4M77A 5KYWB 4MZPA 1Y7XA 4E7IA 2VGMA 1EFNA 3G4SA 5IHNA 3JB9D 3QSUA 1G5VA 2GFUA 5HCKA 3LX7A 4J7IA 3JCMe 1KD1U 4OMNA 1UJ0A 1UJYA 3M5AA 2DX1A 4BACA 1IRXA 9ATCB 5IHKA 4BDYA 4E7KA 2RJDA 1D0XA 3EH2A 5FROA 1BU1A 3C94A 3M0PA 1YJNQ 1BI2A 5KYYA 3CC4T 1WX6A 2G6FX 3OYFA 4PNOA 2LRQA 2GCXA 4ZNXA 3X25B 1RL2A 2K57A 2OAWA 3EFRA 2DTOA 2ED1A 2QA4Q 3EG9B 5J26A 2M9UA 1BIAA 1NJIC 1M8VA 5CO7A 4RTZA 4HXJA 3FDRA 3RIRA 3I55A 1YFNA 2QTVA 3MEVA 3CCQT 3O5ZA 4X9DA 1J3TA 1D3BA 2XD0A 3CCLQ 4PL6A 3OS0A 2PNIA 2OTLT 1RUWA 2SRCA 2CP5A 4BY6C 5GAOr 2P4TA 2R5AA 2OX7A 4C92E 2L5QA 2L3QA 4HVVA 4BY6B 3KXTA 1DJ7B 4OMFB 4N0AA 5GMKi 4CI0C 2RMOA 5HK3A 3S3MA 1I1JA 1Q7YU 1QVFA 1NPPA 4PFOA 2EJFA 4PJLA 2QI2A 2X4XA 1GRIA 2CP0A 2M1HA 2F1LA 3OS1A 4C5EA 4ATOA 2YT6A 5FWCA 1KD1C 2IPOB 3OQ5A 1V29B 2KY9A 5AYFA 4C0DC 4F04B 3G4SQ 1NLOC 3NGPA 2HKNA 4OVAA 3UF4A 2EYZA 1K76A 4PJMA 1LCKA 4A4KA 1VQPA 4C0DB 4J6XA 2QEXA 1X2QA 2L8DA 1T3LA 4RCCA 5I21A 3OBYA 3EGDB 1M1KU 2EYXA 2CZ6B 2HQXA 3HPWA 1UUEA 3OYGA 1OX9A 1XTDA 1AZGB 1NEGA 3H41A 4XTXA 4KH1B 4M75D 3RERA 2RH2A 3S6WA 2P84A 2KE9A 1VQNA 4EIKA 4LUEA 1T0JA 4A4EA 5D6YA 3BE3A 2O9SA 1PC0A 3U23A 1TH7A 4DBRA 3MEWA 4QQ6A 1M2VB 1I0CA 5KYUB 2KBTA 3CCQA 2JNGA 5CIUA 2RI5A 1U8RA 4GBQA 4B9XA 3I55Q 5LJ3d 4BE1A 4PJOC 4A53A 3L2WA 3CQTA 2YUOA 1D0YA 4MDXA 4PJOB 4NS5A 3I5SA 1LNXA 3C4SA 2DILA 1UHCA 3MKDA 2EFIA 2MPXC 2CSIA 5I2SA 1VQLT 1S72A 2M0OA 3VS2A 2WSEE 5AT1B 3OB9A 2J06A 2JMCA 1VYVA 2CDTA 4M7AD 1N27A 3TQ7P 2KRNA 2WACA 2WSCE 3M0SA 2FYKA 1Q82R 4IUQA 3MHXA 1AD5A 2NUZA 3CC7T 2R58A 1I4K1 4HT8A 1UGSB 1WQWA 2KXCA 3RR6A 4M77G 3NMZC 3JCMV 2H3EB 2EBPA 5FU7C 4O6JA 1P92A 1H3ZA 1VQPQ 2QEXQ 1BI3A 3JB9G 5J3BA 5FU7B 4QT7A 1EZZB 1S1NA 3QPHA 3H0HA 2LCSA 4M77F 2A28A 1FYNA 1D1CA 2FPDA 2KRSA 4Q5WA 5J39A 1YHQA 2RJFA 2C06A 3JB9F 4JRQA 2DEQA 2PVOB 3THKA 4J83A 1VQNQ 2LQ8A 3VS0A 4RTTA 2X4WA 3FIFA 3PT9A 1YJ9T 2VVKA 1WYXA 1VQ4A 2EW3A 2ZZDA 1M2OA 2QGFB 1K4US 1JJ2P 1NEBA 5KYWA 3EG2A 2DRMA 1M3BA 3JAME 2OTJT 2RB6A 2DL3A 3L2QA 3TU4K 2HAXA 2MF2A 2MCNA 1U06A 1B34B 5GAN4 1FX7A 2FZKB 2DBMA 4AFSC 2J05A 1QKWA 5CVIA 1I81A 2YRDA 2DXTA 5D6WA 4ME7A 4II1A 4F14A 1KQSP 2ZPIB 3P8BB 5DLQE 3DB3A 3KFVA 1S72Q 2RHYA 3CBPA 1MMNA 1BCOA 2COWA 1T0HA 1VQ6T 4C8QB 2BZYA 1LOJA 3L42A 5GAN3 4LDWA 3E9GA 2JM8A 4CC4B 3HFOA 4FU6A 4VUBA 1OZ2A 4Z8AA 1KHIA 2MAMA 1TXQA 2LX7A 3NPFA 1OU9A 3H9NA 5HY6A 3EG9A 2FHDA 3M55A 1RLPC 1PWTA 3ME9A 2FPFA 2KI7A 1Q86U 4MMKA 3GNGA 2LZ6B 2ZCFB 1NBEB 3M57A 2RNAA 2CP2A 4M75E 4PLIA 2QQRA 2F69A 1KQSS 1RABB 4HKEA 3OMGA 3QJYA 3A8MB 3CCVT 1YHQQ 1XNIA 3LH0A 4IUPA 5DLOA 1OPKA 1W4SA 4J7FA 2RHZA 4RUGA 4DA4A 1KIKA 4DEYA 4OB0B 3VS5A 1YJWT 1BIBA 2QDYB 2DETA 2R57A 1ZUKA 4LDYA 2H8HA 1VQ4Q 2DIQA 3OYKA 4FCYA 2RQRA 1IZ6A 5CKEA 1VQ5T 2ENMA 1GXIE 4CRIA 3QBYA 2VXEA 2MK5A 1Y96A 2LCLA 2XHCA 4HA8A 4JRKA 3GLXA 4KRTA 2X3XD 1OI1A 1VQMA 2D8JA 1JEGA 3PVLA 2DA9A 3SWNC 5IXBA 3CPFA 2YUPA 3EGUA 3SWNB 1C1AA 1M90U 3UDCA 4M7AE 5IXFA 1VUBA 2HKQB 4FT2A 2V26A 2K5LA 1RADB 2CH4A 2QQBA 2KGTA 3REAB 2BZ8A 1WHJA 4IIOA 2LQNA 1UGRB 4LXCA 4NOYA 2CYZB 5L8RE 2V8IA 1Q86C 3PIPA 3WVEB 4RCBA 3SFMA 4LN2A 1VA7A 1M2VA 2O4XB 4M7DA 5KYUA 1Z9ZA 2EKOA 3ZBDA 4E7SA 1K73R 3LYIA 3KBGA 2CP6A 2A08A 3QJ6A 3JCMc 3C95A 4V2SA 2V8JA 5GAOl 1GFCA 3NHNA 1VQKA 2CKKA 3CCRT 1ZUUA 3CCVA 4J9CA 2A3LA 1PD1A 4BI4A 1RAHB 2PUKB 1XJWB 2SEMA 2AHJB 3L2VA 1RI9A 5GANe 3LH5A 2MWOA 5FRMA 2EQUA 2X9HA 2DXCA 3HL8A 4LD9K 5GANh 2PTKA 4J9BA 3M4GA 1Z9QA 1RAIB 3OYEA 5FU6B 2QQ9A 4Y92A 1N9SA 2QYZA 4IUTA 2AIRB 2K5FA 2L3SA 5KYXB 2JUFA 3JV3A 3CCMA 1D09B 5GAMe 3BDLA 3G1JA 1ZSZB 1EX4A 1JBMA 3QXEB 4F7UA 1KSWA 1M90C 1QW1A 2W0ZA 3X20B 1VQMQ 3OYCA 5GAMh 5FWBA 4PKCC 1GBRA 2KK4A 3QDRB 1N8RR 2W10A 3A8GB 2RI3A 3H0IA 1Q81U 1ZLMA 2NUPB 2RO0A 3CD6A 3R6NA 3V8JA 1MMDA 1M27C 1UB4A 4GY5A 2M16A 2XG8D 4M77D 4M78C 2A0FB 1M3AA 2NUTB 5GAOm 2ZPGB 2MMPA 1PM3A 5GANd 2LX9A 2EQIA 4M78B 3NTKA 1K9MR 1MV0B 5EC7A 4HCZA 2RHIA 3JSCA 2XK0A 1MV3A 1I5OB 1KQSA 2EAYA 3P8HA 2RI2A 4FL6A 1B34A 3JCMh 3M56A 1XQHA 3M0QA 5GAN8 1VQKQ 3SB2A 1AT1B 1IHWA 2XI9A 4D6WA 2EGAA 2YRCA 3CCVQ 3OA6A 4JJNK 1VQ8A 1AWOA 1MHNA 5CKHA 5KE3A 4FYVB 2IIMA 1KC8U 2AT1B 1W70A 2DTHA 2F2VA 2Y4XA 1N9RA 2MIOA 4D8KA 5C0MA 1QKXA 3V8KA 3QG1A 3CEYA 4C8QA 4PJJA 3EH1A 1IXDA 2LJ3A 1AVZC 5LJ3j 2HNIA 4OMMA 2NYSA 2K3BA 4KGXB 5GANf 2DERA 3JCMX 2EGCA 1AOJA 1ABQA 2PVDB 3V7CA 2E6ZA 4XU1A 1QP2A 2HCKA 3CCST 4ELZC 3ZFJA 2DVJA 2K2VA 3CCMQ 2VASA 2RQUA 1VQ7A 4R56A 2CP7A 4HVWA 2E65A 2BE7D 1Q81C 3G7ZA 5HK0A 2ROTA 2JTFA 5GAMf 2D1XA 4QW2A 3JCMd 1YI2A 1O9SA 2RF0A 1Q82C 3OYLA 3OS2A 2Z0WA 1Q95G 5KH6A 3X24B 2BIVA 1YCYA 1RAEB 1ARKA 2VGNA 2DEUA 4X9CA 5LJ3g 3CD6Q 1VIEA 1AHJB 1CSKA 1UTIA 3EFSA 3L1AA 3MEUA 4RMOA 2E5KA 1ZX6A 4PFZA 1IGUA 3VYHB 3GIBA 4N4IA 1WHHA 3OYDA 2DK3A 2LT1A 4A63B 1VQ9T 4M7DE 4IUVA 1VQOT 4J9FA 2FG0A 2CH4W 4KBMB 2HEQA 1TUDA 1FXXA 3OYHA 1WNLA 2HDAA 2R5MA 5KCOA 1MUZA 4BI3A 4CC3A 1TSFA 4M7DG 2LT4A 3RKXA 1AEYA 3CC4A 3ER0A 4YTLA 3VS1A 3JCMf 3OSSC 4C92C 1W2BP 3M0TA 4ZGEB 4LUDA 1KC8C 2KVQG 3INZA 1X75C 4C92B 5CR2A 3I9QA 2X51A 1VQ8Q 1C0MA 5A0LA 2XKOC 1M1GA 4RTWA 4M7DF 1PG5B 5LJ5j 2ZPFB 1VIFA 2IG0A 2JOYA 3QO3A 4XTZA 3DLLA 3VUZA 3VS3A 1AWWA 4ZTJA 4M4ZA 1JXOA 1NLPC 3VS6A 5FLXE 4PFPA 2KROA 2RA2A 1RAAB 2K4YA 2QG9B 2YWWA 1JU5C 1KG1A 2FL7A 2P0QA 2D8HA 4Y28E 4R55A 2COYA 4DOVA 2PQWA 2X4JA 2EVRA 2OTLA 2CUDA 2O4XA 3EG1A 4F7UE 3OYJA 2GQVA 1VQ7Q 4C0GA 2AKLA 2E3IA 1E7OA 2ZGWA 4QVCA 2HMAA 3UPUA 2KXDA 1QLYA 4F7UG 1NJIR 1YI2Q 1W2BS 5LJ5g 1PHTA 4ANJA 4HCKA 1ZA2B 5GMKm 3CCJT 2M51A 2YLBA 4MDWA 2EJGA 4OB1B 5IN1A 2MI6A 4OB2B 3AT1B 3MP8A 1D0ZA 2BKDN 2MOXA 3QYHB 4M77E 3META 4JRIA 1M4ZA 2GBQA 5GAN2 4F7UF 2V8KA 3JCMQ 8AT1B 4GLMA 4KULA 3PFSA 2DJQA 3OYMA 3RMSA 4AFZC 4HCBA 1I07A 1N5ZA 2L0AA 3FJPA 1UE9A 2K3YA 4OMLA 3SDZA 3M54A 4KGVB 1GCQC 5KYXA 2GGRA 2YDLA 1ZSZA 4EPCA 3CC4Q 3G71T 4KT0E 1PKSA 4JUVA 1KD1R 1WXTA 1WHGA 4X1VA 4RKUE 3CCUT 1KQ2A 1YIJT 1QWFA 4A4GA 1HYOA 3QKJA 1NG2A 2C0OA 2NUPA 2KR3A 1D1AA 2RQTA 4C8QE 3QZ5B 1YITT 4M77C 4IURA 1UEBA 5IH2A 3CMET 4IIMA 3CCQQ 3T9NA 2DAQA 3G6ET 1TOVA 5GAOq 2NUTA 2JS0A 3CMAT 3SD4A 1SPKA 4C8QG 1KFZA 4EMGA 3BW1A 4M78A 4B6MA 2OTLQ 4TVRA 2QDLA 3J81E 2X4YA 4DBHA 1WLPB 3JB9I 1X6GA 2DBKA 2QGGA 3O8VA 4PK4A 3UWNA 1VQLA 1X6OA 2EQKA 3RKWA 1WZOA 4C8QF 4F16A 1V1CA 4LDUA 3HHTB 1FMKA 3OYIA 1K8AU 4XTYA 1F1BB 2B86A 1ACMB 2O9VA 3EG3A 2RM4A 2HSEB 5KYYB 1MMAA 4E2FB 2AZVA 2DMOA 5GJVB 4MZTA 1QP3A 1QVPA 3CC7A 2VXFA 1WJQA 2EYYA 3CXCS 1OU8A 4FW2A 1JO8A 3VUBA 3LW5E 2J6FA 1K73C 2JJ9A 4KUIA 1OPLA 1M3CA 3NFCA 5IT9E 2KQWA 4AMCA 1Q7YR 1X43A 3SEMA 2M02A 2EGEA 3RKYA 4RTYA 3H0FA 2QXFA 2EQJA 2CT4A 4P5NA 2LNVA 2LJ1A 2V1QA 1D3BB 1RLQC 1TWBA 2XIDA 4L6V5 2QASA
chains in the Genus database with same CATH topology
5FU6B 4QVDA 4BY6C 2QQ9A 5LJ5h 5GAOr 2P4TA 1N9SA 2R5AA 3CPWS 4C92E 4IUTA 1K73U 1UGPB 3X26B 2L5QA 4BY6B 1ZQ1A 4LDVA 3KXTA 1DJ7B 2K5FA 1HXDA 4XU3A 4OMFB 1YJ9A 4N0AA 5GMKi 2FVUA 2JUFA 3CCMA 4CI0C 5CQYA 1WGSA 5HK3A 5GAOp 3S3MA 5GAMe 3BDLA 5LJ3f 1Q7YU 3CC2T 1NPPA 2VV5A 1QVFA 2P0PA 3DKMA 2EJFA 2QI2A 4J6YA 1JBMA 3HP9A 3QXEB 2JN0A 4F7UA 1YJNT 4F7UB 3H8ZA 2X4XA 1M90C 1M1KC 1QW1A 3X20B 3CMEA 2OTJA 3JRZA 4FM4B 2F5TX 3OYCA 5GAMh 2M1HA 4PKCC 3OS1A 4BI8B 3CC7T 4C5EA 3OMCA 4ATOA 2KK4A 3JCMP 3QDRB 3E19A 4EMKC 3QYGB 3A8GB 2RI3A 4MZMA 5GAN6 1KD1C 1Q81U 3M53A 3OQ5A 5CKDA 4FIBA 1V29B 2DD5A 2KY9A 5AYFA 4L59A 4C0DC 2DZCA 4EMKB 2QA4T 1W2BA 2RO0A 3LGLA 3CD6A 4OVAA 4E7LA 5GAN5 3V8JA 1NE8A 1PSEA 1OZ3A 4A4KA 1K8AC 3A8LB 1VQPA 4C0DB 1UB4A 4J6XA 2QEXA 2YRVA 2L8DA 4M77B 4GY5A 3HFNA 4RCCA 2M16A 2XG8D 1I8FA 5I21A 4M77D 3I56T 4M78C 3OBYA 4M75C 2PU9B 5GAOm 1M1KU 3M9QA 5C6SA 5A0DA 1VQ6A 2ZPGB 2CZ6B 2HQXA 2KDSA 2MMPA 3HPWA 4KUDK 5GANd 4OF1A 3CCLT 2LX9A 1XTDA 4M78B 4M75B 3OYGA 3NTKA 2RK1A 4J5YA 4M78D 4HCZA 2RHIA 4M75D 4XTXA 3OY9A 2XU8A 5LJ5d 3JSCA 4JS4A 2XK0A 3RERA 2RH2A 3HRUA 2LQKA 3S6WA 4C92A 1K9MC 1KQSA 1N8RU 2EAYA 2O01E 1VQNA 4XTVA 3CCEA 3P8HA 4JLGA 3EAEA 4XU0A 2D6FA 4QQGA 2RI2A 4A4EA 1EIFA 4FL6A 1YBYA 5D6YA 1B34A 3JCMh 4A4HA 3M56A 3PMTA 5D6XA 3CCJA 1XQHA 1TH7A 3C12A 3QHSA 3MEWA 1XOVA 4QQ6A 4OB3B 5GAN8 4BD3A 3SB2A 4A54A 2XI9A 2H3JA 1VQMT 4D6WA 3L2ZA 2JNGA 3CCQA 3OA6A 4JJNK 1VQ8A 4M7DD 3MP1A 2RI5A 5CIUA 1M5Q1 1MHNA 2GF7A 5CKHA 5EG2A 1U8RA 5KE3A 4B9XA 4BE1A 5LJ3d 1KC8U 1QVGA 4PJOC 2DTHA 4A53A 2Y4XA 4C8QC 1N9RA 3FC3A 2Y4YA 1QVFS 3L2WA 2F5KA 5C0MA 3V8KA 1K9MU 2LVMA 4ELYC 2JTMA 4MDXA 3QG1A 3CEYA 4PJOA 4C8QA 4PJOB 4NS5A 4WF2A 5LJ3j 3G4ST 2HNIA 4PJOD 1LNXA 4JRPA 1U1TA 3C4SA 3GOXA 3M59A 5GANf 2RHUA 3JCMX 2NLUA 2EFIA 4J8OA 2PVDB 1Y71A 4N4GA 3V7CA 2E6ZA 3JB9H 5I2SA 2CZ7B 4XU1A 4M7AC 5LJ5f 2EYQA 1QP2A 2X35A 2M0OA 2CS7A 3GNFB 1JB0E 1BI0A 3FRNA 3JCMb 3JCMW 1YJWA 3CCST 4ELZC 3CC2A 3ZFJA 2L3RA 2K2VA 2WSEE 1IREB 4Z02A 3OYAA 3AHUA 3OB9A 4M7AB 1VQ7A 2CZ0B 2DPPB 3G71A 4R56A 4M7AD 1N27A 3FEOA 2E65A 3M4YA 1JJ2S 2EIFA 3LLRA 1VQ5A 2DXUA 1Q81C 2K3XA 2OAUA 2WSCE 2WACA 2DTIA 2JZ2A 2RJCA 3ZEHA 4N0AC 3CCUA 3G7ZA 5HK0A 2FYKA 5DM7R 1LJOA 1YIJA 4IUQA 3MHXA 2JTFA 5GAMf 4QW2A 3JCMd 1YI2A 1O9SA 2XDPA 1Q82C 4XK8E 2QA4A 2LCCA 2EWNA 2R58A 4FT4A 3OS2A 4XTWA 1I4K1 2ZPBB 3OBWA 3Q1JA 3OYLA 5CCAA 4HT8A 1UGSB 1WQWA 5KH6A 3FB9A 3X24B 2BIVA 1YCYA 4ZN1A 2ZPHB 3MCAB 3LWIA 5GMKj 1VQKT 4M77G 2VGNA 1WPYA 3TCJA 3JCMV 3HSBA 4X9CA 5LJ3g 1VIEA 5FU7C 1AHJB 1R8OB 1ZBXA 3G6EA 3MP6A 4O6JA 3I56A 1P92A 1S72A 3TEEA 4JLIA 2Y90A 1H3ZA 4O5VA 3ASKA 3BDUA 3CMAA 2XDBA 2HBPA 1BI3A 3JB9G 2HQEA 2RJEA 3EFSA 3L1AA 3MEUA 5FU7B 3BY7A 5J3BA 4RMOA 3I55T 3M58A 2LC4A 4M78G 4M75G 3CBOA 1WQ7A 3QPHA 3OYBA 3VYHB 4IKFA 3CXCA 2YHTA 4N4IA 3OYDA 2DK3A 2DZ9A 4M77F 3VYGA 1N8RC 2LT1A 1FWZA 4ZGJB 1VQ9T 2GFAA 4M7DE 1G3WA 2DIGA 4Q5WA 3PNWC 4IUVA 3CBMA 3RESA 5J39A 1O75A 1VQOT 1Q82U 3JCMJ 1YHQA 2RJFA 2C06A 3JB9F 4JRQA 2DEQA 4DQ2A 3GPLA 4PLLA 4KBMB 4M78F 2PVOB 4M75F 4J83A 3OSVA 1FXXA 3OYHA 1PSFA 1WNLA 2LQ8A 3MEAA 2IVWA 1NZ9A 2R5MA 5CK9A 2X4WA 2XICA 5KCOA 3FIFA 3PT9A 4BI3A 1YJ9T 2QQSA 4M7DG 2LT4A 3DLMA 3BFMA 3RKXA 1G3SA 3ER0A 4A4FA 4YTLA 3CCMT 1VQ4A 3CC4A 5CQXA 2ZZDA 3OSSC 3JCMf 4C92C 2DO3A 3HRTA 3V7SA 4ZGEB 1KC8C 2KVQG 2G3RA 2P0KA 3INZA 1X75C 3WVDB 3VKIA 3JCMg 4ZN3A 4C92B 5CR2A 2D0QB 5GAOn 2E41A 3JAME 5GANj 2OTJT 3L2RA 3OW2S 2RB6A 3L2QA 5CAIA 2E6NA 4BB7A 4C92D 5A0LA 2XKOC 1M1GA 3CPWA 3TU4K 1BI1A 2MF2A 4X34A 2HAXA 4M7DF 1H641 3UT1A 5LJ5j 2XDDA 2ZPFB 1VIFA 1B34B 4Y91A 2PVGB 5GAN4 3QZ9B 3NTHA 1FX7A 3GIBA 4J6WA 2IG0A 2JOYA 3QO3A 4XTZA 5I2MA 3VUZA 3DLLA 3CCRA 2KAFA 4ZTJA 5CVIA 1I81A 5FLXE 4XU2A 5GMKe 2DXTA 5D6WA 3S3OA 2KMTA 5GAMd 4ME7A 1RI0A 2RA2A 4B9WA 3CD6T 4II1A 2K4YA 3L2UA 2ZPIB 1MGQA 3P8BB 3P8DA 2FL7A 5DLQE 2P0QA 3JB9J 2DVEA 4Y28E 1U1SA 1YITA 1VQPT 4R55A 3KUFA 2QEXT 2FB7A 3MO8A 4DOVA 4M7AG 5GMKh 3DB3A 2PQWA 1ZHIA 2X4JA 2QQAA 5A2QE 5GAMj 4C5HA 2OTLA 2RHYA 5FRNA 3CBPA 1VQ6T 2O4XA 4C8QB 1LOJA 4F7UE 3OS5A 3L42A 2VYTA 2GQVA 1X01A 5GAN3 3OYJA 4C0FA 4DOWA 4LDWA 4C8QD 3OYYA 4C0GA 3E9GA 1BKBA 4OGCA 2RK2A 4XAXB 5CKFA 4M7AF 3HFOA 2ZGWA 4FU6A 4VUBA 3J7AF 4NL3A 5GAN7 4FSXA 3N5BB 4QVCA 5GANg 1OZ2A 3HRSA 3UPUA 1VQNT 1G3YA 4QQDA 1KHIA 2MAMA 2JVVA 4F7UG 1YJNA 3X28B 1KHCA 4MMLA 5LL6S 1W2BS 5LJ5g 2QTXA 3LWHA 5HY6A 3S3NA 3M55A 2FHDA 1M9SA 5GMKm 3CCJT 2YLBA 3ME9A 4MDWA 4OP0A 2EJGA 4OB1B 5IN1A 2MI6A 4OB2B 3MP8A 2PUOB 2BKDN 3QYHB 1Q86U 4MMKA 3NTIA 3META 2D9TA 4JRIA 1M4ZA 1OYXA 4M77E 2A7YA 4C5GA 1UGQB 1KQ1A 3GNGA 4BE0A 5GAN2 1VQ8T 3E1SA 2ZCFB 3WXMB 4F7UF 4XQ3A 2E64A 2V8KA 4IUUA 3JCMQ 3VV0A 3M57A 2WSFE 4KULA 5FU6C 2CGHA 5DY9A 4M78E 3H6ZA 3PFSA 4M75E 5GAMg 3OYMA 1NPRA 3RMSA 4HCBA 3A5ZB 1N6AA 4PLIA 1JRIA 2QQRA 2F69A 2E10A 5HKCA 1KQSS 4HKEA 3OMGA 3QIIA 3R6OA 3FJPA 5A0GA 2K3YA 2DJZA 3QJYA 3A8MB 4L5GA 3CCVT 3VU3C 1SSFA 1XNIA 3PTAA 3SDZA 3LH0A 4IUPA 5DLOA 1BYMA 1W4SA 3F70A 3M54A 4J7FA 4UC4A 2RHZA 4DA4A 1NJIU 1M1FA 2LDMA 2DXBA 2E12A 4NL2A 4ZGDB 3CCLA 5CKBA 5KE2A 4E7JA 1S72T 1Y07A 4OB0B 1YJWT 1BIBA 2QDYB 2RD1A 2R57A 4EPCA 4C5IA 4LDYA 4BUGA 2KSSA 2VUBA 2DIQA 4C92G 3OYKA 5LJ3e 1VQ7T 4OGEA 4JDSA 5GMKl 3G71T 2HD0A 1IZ6A 5CKEA 3RUXA 4KT0E 1VQ5T 4JUVA 1QVGS 1GXIE 4HT9A 2LTOA 3QBYA 2VXEA 4CRIA 3VJPA 4ZTFA 4RKUE 5LJ3h 4RG2A 3CCUT 1KQ2A 3GP8A 1Y96A 1YIJT 4A4GA 1G3TA 1Y96B 4E47A 2LCLA 2XHCA 3QKJA 4C0ZA 3LGFA 4HA8A 4JRKA 2DKGA 2CZ1B 3GLXA 4C92F 4EMKA 1YI2T 4PJOE 4C8QE 1YITT 2BUDA 3QZ5B 4QVZA 1OI1A 4M77C 1WJSA 1VQMA 3PGGA 3V8LA 4E7HA 2DD4A 2I2LA 4N4HA 3SWNC 4IURA 1UEBA 4GLKA 1JJ2A 1WJRA 3DB4A 4M77A 3FLGA 4MZPA 1Y7XA 4E7IA 3CMET 3CPFA 2B8AA 3T9NA 2DAQA 3SWNA 2VGMA 4EMHA 3G6ET 3SWNB 5IAYA 5GAOq 1M90U 2MWPA 3OYNA 3CMAT 4PJOG 3SD4A 4HCCA 2L89A 4C8QG 3UDCA 4EMGA 3BW1A 1KG1A 4EDUA 3G4SA 2EJ9A 4M7AE 3URGA 4M78A 4M75A 1VUBA 4TVRA 2K5IA 3J81E 2X4YA 3JB9D 3QSUA 1G5VA 4FT2A 4JS5A 2GFUA 1HK9A 3A8HB 1I5LA 3JB9I 2K5LA 3LX7A 4J7IA 3JCMe 1KD1U 2EQMA 3O8VA 5M9OA 4LDXA 3M5AA 3GF5A 3UWNA 1VQLA 1X6OA 2EQKA 2QQBA 3RKWA 2YLCA 4PJOF 3CCSA 4BACA 1YHQT 2RHXA 4C8QF 4LDUA 4BDYA 4E7KA 3HHTB 1UGRB 2RJDA 3OYIA 4NOYA 4LD6A 1K8AU 2CYZB 4XTYA 5L8RE 2V8IA 3PIOA 1Q86C 5FROA 3PIPA 3WVEB 4BE2A 4M7DC 3C94A 4RCBA 3SFMA 2E70A 1BI2A 2RM4A 2O4XB 4M7DA 3J80E 3RMQA 1VQ4T 3CC4T 4M7DB 2EKOA 3ZBDA 3OYFA 4MZTA 4PNOA 1QP3A 2LRQA 2GCXA 1QVPA 3CC7A 3X25B 1RL2A 2VXFA 3LYIA 3KBGA 1WJQA 3CXCS 3CCET 3QJ6A 2K57A 3E9FA 3VUBA 3JCMc 3LW5E 3C95A 1K73C 3EFRA 4V2SA 2V8JA 2DTOA 5GAOl 1VQKA 4KUIA 3NFCA 2ZPEB 5IT9E 2KQWA 5J26A 2CKKA 2M9UA 1BIAA 1NJIC 3CCRT 3CCVA 1M8VA 5CO7A 2VC8A 4RG8A 3V7RA 2A3LA 5KCHA 3FDRA 3RIRA 4BI4A 2PUKB 3TREA 1Q7YC 3I55A 3QUIA 3RKYA 2AHJB 3PMIA 3MEVA 3L2VA 4BDZA 2QXFA 5GANe 3A8OB 3HKSA 2EQJA 2MWOA 3CCQT 5FRMA 4X9DA 4P5NA 2EQUA 3OW2A 2LNVA 1D3BA 2DXCA 1D3BB 3HL8A 5LJ5e 4LD9K 2XD0A 4M7AA 1VQ9A 4PL6A 2XIDA 4XTUA 2E5QA 4L6V5 5GANh 3OS0A 2OTLT 3M4GA 1VQOA 3OYEA 2E1HA 1VQLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D F;  4PJO A;  4QVD A;  4JUV A;  1H64 1;  4C8Q A;  5LJ5 j;  4PJO B;  4WF2 A;  1B34 B;  4Y91 A;  5LJ5 h;  5GAO r;  2VXE A;  1N9S A;  5LJ3 j;  4HT9 A;  5LJ3 h;  2HNI A;  4C92 E;  5GAN 4;  1KQ2 A;  4PJO D;  1LNX A;  4J6W A;  1Y96 A;  3QO3 A;  4XTZ A;  1U1T A;  1Y96 B;  5GAN f;  3JCM X;  4HA8 A;  4JRK A;  4XU3 A;  1HXD A;  1I81 A;  2DKG A;  4C92 F;  4N0A A;  4XU2 A;  4EMK A;  5GMK e;  5GMK i;  3V7C A;  2DXT A;  3JB9 H;  4C8Q E;  4PJO E;  5GAM d;  4XU1 A;  4M7A C;  2RA2 A;  5LJ5 f;  4M77 C;  5GAO p;  3PGG A;  5GAM e;  3JCM b;  5LJ3 f;  3V8L A;  3JCM W;  1MGQ A;  2I2L A;  3SWN C;  2EJF A;  3JB9 J;  2DVE A;  4J6Y A;  1JBM A;  1U1S A;  4F7U A;  2JN0 A;  3AHU A;  4F7U B;  2FB7 A;  4M77 A;  4M7A G;  4M7A B;  5GMK h;  4EMH A;  3SWN A;  5GAM j;  3SWN B;  4M7A D;  5GAM h;  5GAO q;  2E65 A;  4PJO G;  4C8Q G;  2DXU A;  4C8Q B;  1LOJ A;  4EMG A;  4F7U E;  3BW1 A;  2DTI A;  3JCM P;  4M7A E;  2EJ9 A;  5GAN 3;  1X01 A;  4M78 A;  4N0A C;  4EMK C;  4M75 A;  2FYK A;  1LJO A;  4C8Q D;  5GAN 6;  3JB9 D;  3QSU A;  5GAM f;  4M7A F;  3JCM d;  3HFO A;  2ZGW A;  1HK9 A;  1I5L A;  4EMK B;  2DZC A;  3JB9 I;  4NL3 A;  3JCM e;  5GAN 7;  2EWN A;  4XTW A;  1I4K 1;  4QVC A;  5GAN g;  3RKW A;  5GAN 5;  3V8J A;  2YLC A;  1WQW A;  4HT8 A;  4PJO F;  3FB9 A;  1YCY A;  4C8Q F;  4F7U G;  5GMK j;  4MML A;  4J6X A;  4M77 G;  5LJ5 g;  2QTX A;  1WPY A;  4M77 B;  3JCM V;  3HFN A;  4NOY A;  4RCC A;  4X9C A;  5LJ3 g;  3HSB A;  4XTY A;  5GMK m;  4M7D C;  1I8F A;  5I21 A;  2YLB A;  4M77 D;  4OP0 A;  4M78 C;  2EJG A;  4JLI A;  2Y90 A;  4M75 C;  4RCB A;  5GAO m;  3BDU A;  2RM4 A;  3JB9 G;  3EFS A;  3L1A A;  4MMK A;  4M7D A;  3BY7 A;  4M77 E;  4M7D B;  4JRI A;  5GAN d;  4M78 G;  4M75 G;  4M78 B;  4M75 B;  1KQ1 A;  1WQ7 A;  5GAN 2;  4F7U F;  4J5Y A;  3GIB A;  2YHT A;  4M78 D;  4XQ3 A;  2DZ9 A;  2E64 A;  4M75 D;  4M77 F;  4XTX A;  5LJ5 d;  4PNO A;  3JCM Q;  3RER A;  4C92 A;  2VXF A;  4M7D E;  2CGH A;  5DY9 A;  2EAY A;  4M78 E;  3RES A;  4M75 E;  4XTV A;  5GAM g;  2K57 A;  3JCM J;  4XU0 A;  3JCM c;  4V2S A;  3JB9 F;  3EFR A;  2DTO A;  2DEQ A;  1JRI A;  4DQ2 A;  2E10 A;  5GAO l;  1B34 A;  4M78 F;  3JCM h;  4M75 F;  3FJP A;  2DJZ A;  1BIA A;  1WNL A;  1TH7 A;  3QHS A;  1M8V A;  3VU3 C;  2VC8 A;  3FIF A;  3V7R A;  5GAN 8;  3RIR A;  4M7D G;  3SB2 A;  3QUI A;  3RKY A;  3RKX A;  3BFM A;  4A54 A;  4NL2 A;  3JCM f;  5GAN e;  4C92 C;  3L2Z A;  4M7D D;  3V7S A;  4X9D A;  1BIB A;  2RD1 A;  1M5Q 1;  1D3B A;  3INZ A;  5LJ3 d;  1D3B B;  5LJ5 e;  4M7A A;  3JCM g;  4C92 G;  4C92 B;  4PJO C;  2DTH A;  4A53 A;  5LJ3 e;  4XTU A;  2E41 A;  1N9R A;  4C8Q C;  5GAN h;  5GAO n;  5GAN j;  5GMK l;  2RB6 A;  3M4G A;  5CAI A;  4C92 D;  2E1H A;  3V8K A;  3RUX A; 
#chains in the Genus database with same CATH topology
 4QVD A;  1BBZ A;  3CPW S;  1YWP A;  1B7T A;  1GFD A;  3ZL7 C;  2NWM A;  2J6K A;  1QCN A;  3X26 B;  2JMA A;  1ZBJ A;  4XU3 A;  1YJ9 A;  2YUQ A;  2JTE A;  2FVU A;  4DBQ A;  2EYW A;  1M1K R;  3A1P A;  2P0P A;  3DKM A;  4J6Y A;  3HP9 A;  1YJN T;  2FPE A;  2JN0 A;  3H8Z A;  2EPD A;  3CME A;  1LPL A;  2OTJ A;  3JRZ A;  2F5T X;  2JXB A;  2YUN A;  1H8K A;  4BI8 B;  4PJN A;  3JCM P;  3E19 A;  4OMP A;  3QYG B;  4MZM A;  3C0C A;  2KEA A;  2QA4 T;  2DZC A;  1W2B A;  3LGL A;  3EHQ A;  5GAN 5;  1NE8 A;  3EG0 A;  1K8A C;  3A8L B;  1E6G A;  1PRM C;  3HFN A;  3FJ5 A;  1R0B G;  1VQL Q;  3EGD A;  4M75 C;  2PU9 B;  3M9Q A;  5C6S A;  5A0D A;  1OUL A;  2BE9 B;  1VQ6 A;  4OF1 A;  3CCL T;  4M75 B;  4JPB W;  2XU8 A;  1K9M C;  1AWX A;  4C92 A;  4JLG A;  1X27 A;  4XU0 A;  2D6F A;  4QQG A;  1H3H A;  1EIF A;  1YBY A;  3VRZ A;  3CC7 Q;  4A4H A;  3PMT A;  2O2O A;  3QHS A;  2F2W A;  1XOV A;  1AZE A;  4J9E A;  1HJD A;  4A54 A;  4M7D D;  5L23 A;  1M5Q 1;  2GF7 A;  2KYM A;  1JQQ A;  2KT8 A;  1QVF S;  2F5K A;  2LVM A;  4ELY C;  1PKT A;  2DL5 A;  2HBW A;  2JTM A;  1UHF A;  4PJO A;  4WF2 A;  3G4S T;  4PJO D;  1G8X A;  4RTX A;  1U1T A;  3M59 A;  4J9G A;  2ROL A;  3VS7 A;  2O31 A;  1OV3 A;  4J8O A;  1WXB A;  4N4G A;  1Y71 A;  2CZ7 B;  4M7A C;  5FRN A;  2EYQ A;  3GNF B;  2DM1 A;  4LE9 A;  4FW1 A;  1BI0 A;  1H92 A;  1YJW A;  3RNJ A;  6AT1 B;  1SG5 A;  1YJ9 Q;  2L3R A;  4R0K A;  3OYA A;  4M7A B;  2K9G A;  2DPP B;  2ECZ A;  3M4Y A;  3REB B;  2EIF A;  1VQ5 A;  2OAU A;  1NM7 A;  2JZ2 A;  2RJC A;  3CME Q;  2OTJ Q;  5DM7 R;  1LJO A;  3PE0 A;  5KYN A;  1QCF A;  2VB6 A;  2AK5 A;  1GBQ A;  4XK8 E;  2QA4 A;  4FT4 A;  5CCA A;  4FYW B;  5D7U A;  1R0C B;  1G2B A;  3FB9 A;  2ZPH B;  1V76 A;  3RBB B;  3TCJ A;  3HSB A;  1R8O B;  1ZBX A;  3BDU A;  2HBP A;  2HQE A;  1K1Z A;  2XMF A;  3I55 T;  4M78 G;  1U5S A;  1WQ7 A;  2RPN A;  4E6R A;  4CC2 A;  3CXC A;  3VYG A;  1GCQ A;  1VQ6 Q;  1FWZ A;  2JT4 A;  1ZSG A;  4ZGJ B;  3RES A;  3CBM A;  1O75 A;  1Q82 U;  3JCM J;  4DQ2 A;  3GPL A;  4M78 F;  2J7I A;  1NYG A;  4ESR A;  1ZA1 B;  3MEA A;  2JS2 A;  1MNE A;  1B07 A;  3QWX X;  2DYB A;  2O88 A;  4A4F A;  2BZX A;  5CQX A;  2DO3 A;  3HRT A;  1YNZ A;  1YP5 A;  1SRM A;  3JCM g;  2OJ2 A;  2JW4 A;  1R77 A;  3L2R A;  1VYU A;  3OW2 S;  3CPW A;  2A36 A;  2E6N A;  2LP5 A;  4JJB A;  4X34 A;  3M0R A;  2XDD A;  2PVG B;  2DRK A;  3QZ9 B;  3NTH A;  4J6W A;  5I2M A;  3CCR A;  2HSP A;  2KAF A;  3PVQ A;  2FEI A;  1PRL C;  4DEX A;  3S3O A;  2KMT A;  5GAM d;  4B9W A;  1RI0 A;  1UG1 A;  1NYF A;  3L2U A;  3P8D A;  1VQP T;  2QK0 A;  1U1S A;  1Q86 R;  3KUF A;  2QEX T;  3MO8 A;  2YXY A;  2QQA A;  5GJW B;  4C5H A;  1YJW Q;  4KGZ B;  3OS5 A;  4C0F A;  4C8Q D;  3OYY A;  1MMG A;  2RK2 A;  1VQ5 Q;  1OEB A;  4XAX B;  1VYT A;  1IO6 A;  3J7A F;  1IHV A;  4NL3 A;  4FSX A;  2DE0 X;  4KH0 B;  1ABO A;  1QVG P;  1VQN T;  4FYX B;  1G3Y A;  2CSQ A;  4MML A;  3LWH A;  3S3N A;  4OP0 A;  2ZAE A;  1KJW A;  3VS4 A;  3E2U A;  1TU0 B;  1OYX A;  1TS9 A;  4C5G A;  2DL4 A;  4BE0 A;  3E1S A;  4XQ3 A;  2E64 A;  4IUU A;  4Z89 A;  1WHL A;  2JM9 A;  2CGH A;  5DY9 A;  1SKU B;  1NPR A;  5FW9 A;  1JRI A;  5HKC A;  2E10 A;  4JZ4 A;  1WA7 A;  3QII A;  5A0G A;  1SEM A;  2DJZ A;  3EGX B;  3VU3 C;  2AKK A;  1SF9 A;  1SSF A;  2FRY A;  3PTA A;  4UC4 A;  2I0N A;  1OX8 A;  1M1F A;  2LDM A;  4E7J A;  1S72 T;  4AG2 C;  1Y07 A;  1M90 R;  1K9A A;  4C5I A;  3RDV A;  2VUB A;  4C92 G;  5LJ3 e;  4OGE A;  5GMK l;  1GL5 A;  3RUX A;  1QVG S;  4HT9 A;  4ZTF A;  1B3Q A;  3VJP A;  5LJ3 h;  4RG2 A;  1GCP A;  3GP8 A;  1G3T A;  1Y96 B;  4E47 A;  1WXU A;  4C0Z A;  2DF6 A;  3LGF A;  1TG0 A;  2CZ1 B;  2K7A A;  4C92 F;  4PJO E;  2BUD A;  1WJS A;  3CCR Q;  3PGG A;  2DD4 A;  2I2L A;  4GLK A;  1K0S A;  3DB4 A;  3FLG A;  2B8A A;  4EMH A;  3SWN A;  2DNU A;  5IAY A;  2MWP A;  3OYN A;  4HCC A;  4PJO G;  2L89 A;  4EDU A;  2EJ9 A;  3URG A;  4M75 A;  3I35 A;  2K5I A;  1WFW A;  4JS5 A;  1HK9 A;  3A8H B;  4AT1 B;  1I5L A;  2EQM A;  5M9O A;  4LDX A;  1A0N B;  3GF5 A;  2YLC A;  1PNJ A;  4PJO F;  3CCS A;  1YHQ T;  2RHX A;  4J9I A;  4ORZ A;  4LD6 A;  2GTJ A;  1G83 A;  3PIO A;  4M7D C;  4BE2 A;  3EFO B;  2E70 A;  3UA7 A;  3J80 E;  3RMQ A;  1VQ4 T;  4M7D B;  3EHR A;  1QCO A;  2E3H A;  3VRY A;  3CCE T;  3E9F A;  2ZPE B;  1SHG A;  2VC8 A;  4RG8 A;  3V7R A;  5KCH A;  2RN8 A;  3TRE A;  1Q7Y C;  3QUI A;  2FRW A;  1FMV A;  3PMI A;  4BDZ A;  3A8O B;  3HKS A;  1WDX A;  4AFU C;  3OW2 A;  1U3O A;  5LJ5 e;  4M7A A;  1VQ9 A;  4QKU A;  4XTU A;  1IB8 A;  2E5Q A;  1Q81 R;  1VQO A;  2E1H A;  1UGP B;  5LJ5 h;  2KRM A;  1K73 U;  1SSH A;  1ZQ1 A;  4LDV A;  2K79 A;  1HXD A;  1YWO A;  5CQY A;  1WGS A;  5GAO p;  2GNC A;  3CC2 T;  5LJ3 f;  2VV5 A;  1PD0 A;  4F7U B;  2FZG B;  1M1K C;  4FM4 B;  5I22 A;  2RQW A;  1BCM A;  1TUC A;  4AG1 C;  2K6D A;  1UDL A;  3OMC A;  1MND A;  2D0N A;  2CUB A;  4EMK C;  1HD3 A;  2F2X A;  5GAN 6;  3M53 A;  2DL7 A;  5CKD A;  4FIB A;  3CXC P;  2DD5 A;  1UEC A;  1M8M A;  4JZ3 A;  4L59 A;  4EMK B;  1TUG B;  4E7L A;  1PSE A;  1YCS B;  4RTU A;  1OZ3 A;  5I11 A;  1CKB A;  2V1R A;  2YRV A;  4M77 B;  8ATC B;  4J9D A;  4WCI A;  3I56 T;  1I8F A;  2ABL A;  3CCS Q;  2LJ0 A;  2QAZ A;  2KDS A;  1KC8 R;  4KUD K;  2KYB A;  4K11 A;  2RK1 A;  1VOM A;  4J5Y A;  4M78 D;  3OY9 A;  3TSW A;  5LJ5 d;  2HQH A;  2ESW A;  1OQK A;  2LQK A;  3HRU A;  2C0I A;  1N8R U;  2O01 E;  4XTV A;  3CCE A;  1YN8 A;  3EAE A;  1LVK A;  3CPW P;  1AWJ A;  5D6X A;  3CCJ A;  2COZ A;  3C12 A;  4OB3 B;  1QWE A;  4BD3 A;  2LMJ A;  2H3J A;  1VQM T;  3L2Z A;  3MP1 A;  1T3S A;  5EG2 A;  3QWY A;  1ZUY A;  3UA6 A;  1UGV A;  1QVG A;  4HVU A;  4C8Q C;  3FC3 A;  2Y4Y A;  2RQV A;  1K9M U;  3TSZ A;  1VQ9 Q;  4J9H A;  1X6B A;  1VQO Q;  4JRP A;  3GOX A;  2RHU A;  2NLU A;  4Z88 A;  3JB9 H;  4FYY B;  5LJ5 f;  2X35 A;  2CS7 A;  1JB0 E;  3FRN A;  3JCM b;  3JCM W;  3CC2 A;  1IRE B;  4Z02 A;  3AHU A;  3QDF A;  2C0T A;  4LNP A;  2CZ0 B;  3G71 A;  3FEO A;  1JJ2 S;  3LLR A;  3GBQ A;  2ED0 A;  2DXU A;  1QMC A;  2K3X A;  2DTI A;  3ZEH A;  4N0A C;  3CCU A;  4OMQ A;  1YIJ A;  2FO0 A;  2XDP A;  4JS4 A;  2LCC A;  2EWN A;  3ULR B;  1YIT A;  4XTW A;  2ZPB B;  5ECA A;  3OBW A;  3Q1J A;  4ZN1 A;  3MCA B;  7AT1 B;  3LWI A;  5GMK j;  1VQK T;  1WPY A;  3EGX A;  2BTT A;  2DYI A;  3G6E A;  3MP6 A;  3I56 A;  2VWF A;  3TEE A;  4JLI A;  2Y90 A;  4O5V A;  3ASK A;  3CMA A;  2XDB A;  2KNB B;  2RJE A;  2YSQ A;  3BY7 A;  3M58 A;  2LC4 A;  1W6X A;  4M75 G;  3CBO A;  3OYB A;  1RAG B;  4IKF A;  2L2P A;  2YHT A;  1N8R C;  2DZ9 A;  1QVF P;  4D8D A;  1K0X A;  2GFA A;  1RAF B;  2GQI A;  1G3W A;  2DIG A;  3PNW C;  1WIE A;  1E6H A;  3MPU B;  2DL8 A;  4PLL A;  4M75 F;  1TTH B;  2CRE A;  3OSV A;  2KT1 A;  1PSF A;  2A37 A;  3CCE Q;  2IVW A;  1NZ9 A;  5CK9 A;  2XIC A;  1WI7 A;  4AFQ C;  2QQS A;  3DLM A;  3BFM A;  1BB9 A;  1G3S A;  3SHW A;  3CCM T;  3CCJ Q;  1M30 A;  2K2M A;  3V7S A;  2LNH B;  2G3R A;  2P0K A;  4JJC A;  2CT3 A;  2AZS A;  3WVD B;  3VKI A;  4ZN3 A;  2D0Q B;  2M0Y A;  2E41 A;  5GAO n;  5GAN j;  3UAT A;  2E4H A;  5CAI A;  4BB7 A;  4C92 D;  1BI1 A;  1H64 1;  3UT1 A;  3IQL A;  4OMO A;  4Y91 A;  2P4R A;  2OI3 A;  4DBF A;  1UFF A;  4F17 A;  4XU2 A;  5GMK e;  2LQW A;  3CD6 T;  1MGQ A;  3JB9 J;  2DVE A;  2GTO A;  1CKA A;  2FB7 A;  1C6V X;  4M7A G;  5GMK h;  4E7Z A;  1ZHI A;  1BK2 A;  5A2Q E;  5GAM j;  1WHK A;  3CC2 Q;  1QQJ A;  3EFO A;  1X2K A;  2HL3 A;  3MJX A;  5IHI A;  2PZ1 A;  2VYT A;  1X01 A;  3M0U A;  4DOW A;  3G71 Q;  3HTR A;  1BKB A;  4OGC A;  5CKF A;  4M7A F;  2EKH A;  5GAN 7;  3CCU Q;  1IGQ A;  3N5B B;  5GAN g;  1YIJ Q;  3HRS A;  2CP3 A;  4QQD A;  4RTV A;  2JVV A;  1YJN A;  3X28 B;  1KHC A;  5LL6 S;  2VKN A;  2QTX A;  1YIT Q;  1M9S A;  1WHM A;  2J6O A;  2PUO B;  3NTI A;  2D9T A;  2ATC B;  2A7Y A;  3G6E Q;  1UGQ B;  1KQ1 A;  3I56 Q;  1VQ8 T;  3WXM B;  3CMA Q;  3VV0 A;  3OW2 P;  4JJD A;  2WSF E;  5FU6 C;  4M78 E;  3H6Z A;  2HZY A;  4FSS A;  5GAM g;  2FZC B;  1JXM A;  3A5Z B;  1N6A A;  1FMW A;  2L3P A;  1HSQ A;  3R6O A;  4L5G A;  2X3W D;  1SRL A;  1BYM A;  3F70 A;  1RAC B;  4CC7 A;  1ZSZ C;  1NJI U;  2DXB A;  2E12 A;  4NL2 A;  1Y57 A;  4ZGD B;  3CCL A;  5CKB A;  5KE2 A;  1D1B A;  2MYS A;  2RD1 A;  2DFU A;  1Y0M A;  4BUG A;  2DLP A;  4WTO B;  2KSS A;  3I5R A;  1W1F A;  1VQ7 T;  4JDS A;  2HD0 A;  1KK7 A;  1SHF A;  3A98 A;  2LTO A;  3TVT A;  1PCX A;  2DKG A;  1YI2 T;  4EMK A;  1K8A R;  1X69 A;  4QVZ A;  1OOT A;  2HL5 C;  3V8L A;  4E7H A;  4N4H A;  1JJ2 A;  1WJR A;  3D7S B;  4M77 A;  5KYW B;  4MZP A;  1Y7X A;  4E7I A;  2VGM A;  1EFN A;  3G4S A;  5IHN A;  3JB9 D;  3QSU A;  1G5V A;  2GFU A;  5HCK A;  3LX7 A;  4J7I A;  3JCM e;  1KD1 U;  4OMN A;  1UJ0 A;  1UJY A;  3M5A A;  2DX1 A;  4BAC A;  1IRX A;  9ATC B;  5IHK A;  4BDY A;  4E7K A;  2RJD A;  1D0X A;  3EH2 A;  5FRO A;  1BU1 A;  3C94 A;  3M0P A;  1YJN Q;  1BI2 A;  5KYY A;  3CC4 T;  1WX6 A;  2G6F X;  3OYF A;  4PNO A;  2LRQ A;  2GCX A;  4ZNX A;  3X25 B;  1RL2 A;  2K57 A;  2OAW A;  3EFR A;  2DTO A;  2ED1 A;  2QA4 Q;  3EG9 B;  5J26 A;  2M9U A;  1BIA A;  1NJI C;  1M8V A;  5CO7 A;  4RTZ A;  4HXJ A;  3FDR A;  3RIR A;  3I55 A;  1YFN A;  2QTV A;  3MEV A;  3CCQ T;  3O5Z A;  4X9D A;  1J3T A;  1D3B A;  2XD0 A;  3CCL Q;  4PL6 A;  3OS0 A;  2PNI A;  2OTL T;  1RUW A;  2SRC A;  2CP5 A;  4BY6 C;  5GAO r;  2P4T A;  2R5A A;  2OX7 A;  4C92 E;  2L5Q A;  2L3Q A;  4HVV A;  4BY6 B;  3KXT A;  1DJ7 B;  4OMF B;  4N0A A;  5GMK i;  4CI0 C;  2RMO A;  5HK3 A;  3S3M A;  1I1J A;  1Q7Y U;  1QVF A;  1NPP A;  4PFO A;  2EJF A;  4PJL A;  2QI2 A;  2X4X A;  1GRI A;  2CP0 A;  2M1H A;  2F1L A;  3OS1 A;  4C5E A;  4ATO A;  2YT6 A;  5FWC A;  1KD1 C;  2IPO B;  3OQ5 A;  1V29 B;  2KY9 A;  5AYF A;  4C0D C;  4F04 B;  3G4S Q;  1NLO C;  3NGP A;  2HKN A;  4OVA A;  3UF4 A;  2EYZ A;  1K76 A;  4PJM A;  1LCK A;  4A4K A;  1VQP A;  4C0D B;  4J6X A;  2QEX A;  1X2Q A;  2L8D A;  1T3L A;  4RCC A;  5I21 A;  3OBY A;  3EGD B;  1M1K U;  2EYX A;  2CZ6 B;  2HQX A;  3HPW A;  1UUE A;  3OYG A;  1OX9 A;  1XTD A;  1AZG B;  1NEG A;  3H41 A;  4XTX A;  4KH1 B;  4M75 D;  3RER A;  2RH2 A;  3S6W A;  2P84 A;  2KE9 A;  1VQN A;  4EIK A;  4LUE A;  1T0J A;  4A4E A;  5D6Y A;  3BE3 A;  2O9S A;  1PC0 A;  3U23 A;  1TH7 A;  4DBR A;  3MEW A;  4QQ6 A;  1M2V B;  1I0C A;  5KYU B;  2KBT A;  3CCQ A;  2JNG A;  5CIU A;  2RI5 A;  1U8R A;  4GBQ A;  4B9X A;  3I55 Q;  5LJ3 d;  4BE1 A;  4PJO C;  4A53 A;  3L2W A;  3CQT A;  2YUO A;  1D0Y A;  4MDX A;  4PJO B;  4NS5 A;  3I5S A;  1LNX A;  3C4S A;  2DIL A;  1UHC A;  3MKD A;  2EFI A;  2MPX C;  2CSI A;  5I2S A;  1VQL T;  1S72 A;  2M0O A;  3VS2 A;  2WSE E;  5AT1 B;  3OB9 A;  2J06 A;  2JMC A;  1VYV A;  2CDT A;  4M7A D;  1N27 A;  3TQ7 P;  2KRN A;  2WAC A;  2WSC E;  3M0S A;  2FYK A;  1Q82 R;  4IUQ A;  3MHX A;  1AD5 A;  2NUZ A;  3CC7 T;  2R58 A;  1I4K 1;  4HT8 A;  1UGS B;  1WQW A;  2KXC A;  3RR6 A;  4M77 G;  3NMZ C;  3JCM V;  2H3E B;  2EBP A;  5FU7 C;  4O6J A;  1P92 A;  1H3Z A;  1VQP Q;  2QEX Q;  1BI3 A;  3JB9 G;  5J3B A;  5FU7 B;  4QT7 A;  1EZZ B;  1S1N A;  3QPH A;  3H0H A;  2LCS A;  4M77 F;  2A28 A;  1FYN A;  1D1C A;  2FPD A;  2KRS A;  4Q5W A;  5J39 A;  1YHQ A;  2RJF A;  2C06 A;  3JB9 F;  4JRQ A;  2DEQ A;  2PVO B;  3THK A;  4J83 A;  1VQN Q;  2LQ8 A;  3VS0 A;  4RTT A;  2X4W A;  3FIF A;  3PT9 A;  1YJ9 T;  2VVK A;  1WYX A;  1VQ4 A;  2EW3 A;  2ZZD A;  1M2O A;  2QGF B;  1K4U S;  1JJ2 P;  1NEB A;  5KYW A;  3EG2 A;  2DRM A;  1M3B A;  3JAM E;  2OTJ T;  2RB6 A;  2DL3 A;  3L2Q A;  3TU4 K;  2HAX A;  2MF2 A;  2MCN A;  1U06 A;  1B34 B;  5GAN 4;  1FX7 A;  2FZK B;  2DBM A;  4AFS C;  2J05 A;  1QKW A;  5CVI A;  1I81 A;  2YRD A;  2DXT A;  5D6W A;  4ME7 A;  4II1 A;  4F14 A;  1KQS P;  2ZPI B;  3P8B B;  5DLQ E;  3DB3 A;  3KFV A;  1S72 Q;  2RHY A;  3CBP A;  1MMN A;  1BCO A;  2COW A;  1T0H A;  1VQ6 T;  4C8Q B;  2BZY A;  1LOJ A;  3L42 A;  5GAN 3;  4LDW A;  3E9G A;  2JM8 A;  4CC4 B;  3HFO A;  4FU6 A;  4VUB A;  1OZ2 A;  4Z8A A;  1KHI A;  2MAM A;  1TXQ A;  2LX7 A;  3NPF A;  1OU9 A;  3H9N A;  5HY6 A;  3EG9 A;  2FHD A;  3M55 A;  1RLP C;  1PWT A;  3ME9 A;  2FPF A;  2KI7 A;  1Q86 U;  4MMK A;  3GNG A;  2LZ6 B;  2ZCF B;  1NBE B;  3M57 A;  2RNA A;  2CP2 A;  4M75 E;  4PLI A;  2QQR A;  2F69 A;  1KQS S;  1RAB B;  4HKE A;  3OMG A;  3QJY A;  3A8M B;  3CCV T;  1YHQ Q;  1XNI A;  3LH0 A;  4IUP A;  5DLO A;  1OPK A;  1W4S A;  4J7F A;  2RHZ A;  4RUG A;  4DA4 A;  1KIK A;  4DEY A;  4OB0 B;  3VS5 A;  1YJW T;  1BIB A;  2QDY B;  2DET A;  2R57 A;  1ZUK A;  4LDY A;  2H8H A;  1VQ4 Q;  2DIQ A;  3OYK A;  4FCY A;  2RQR A;  1IZ6 A;  5CKE A;  1VQ5 T;  2ENM A;  1GXI E;  4CRI A;  3QBY A;  2VXE A;  2MK5 A;  1Y96 A;  2LCL A;  2XHC A;  4HA8 A;  4JRK A;  3GLX A;  4KRT A;  2X3X D;  1OI1 A;  1VQM A;  2D8J A;  1JEG A;  3PVL A;  2DA9 A;  3SWN C;  5IXB A;  3CPF A;  2YUP A;  3EGU A;  3SWN B;  1C1A A;  1M90 U;  3UDC A;  4M7A E;  5IXF A;  1VUB A;  2HKQ B;  4FT2 A;  2V26 A;  2K5L A;  1RAD B;  2CH4 A;  2QQB A;  2KGT A;  3REA B;  2BZ8 A;  1WHJ A;  4IIO A;  2LQN A;  1UGR B;  4LXC A;  4NOY A;  2CYZ B;  5L8R E;  2V8I A;  1Q86 C;  3PIP A;  3WVE B;  4RCB A;  3SFM A;  4LN2 A;  1VA7 A;  1M2V A;  2O4X B;  4M7D A;  5KYU A;  1Z9Z A;  2EKO A;  3ZBD A;  4E7S A;  1K73 R;  3LYI A;  3KBG A;  2CP6 A;  2A08 A;  3QJ6 A;  3JCM c;  3C95 A;  4V2S A;  2V8J A;  5GAO l;  1GFC A;  3NHN A;  1VQK A;  2CKK A;  3CCR T;  1ZUU A;  3CCV A;  4J9C A;  2A3L A;  1PD1 A;  4BI4 A;  1RAH B;  2PUK B;  1XJW B;  2SEM A;  2AHJ B;  3L2V A;  1RI9 A;  5GAN e;  3LH5 A;  2MWO A;  5FRM A;  2EQU A;  2X9H A;  2DXC A;  3HL8 A;  4LD9 K;  5GAN h;  2PTK A;  4J9B A;  3M4G A;  1Z9Q A;  1RAI B;  3OYE A;  5FU6 B;  2QQ9 A;  4Y92 A;  1N9S A;  2QYZ A;  4IUT A;  2AIR B;  2K5F A;  2L3S A;  5KYX B;  2JUF A;  3JV3 A;  3CCM A;  1D09 B;  5GAM e;  3BDL A;  3G1J A;  1ZSZ B;  1EX4 A;  1JBM A;  3QXE B;  4F7U A;  1KSW A;  1M90 C;  1QW1 A;  2W0Z A;  3X20 B;  1VQM Q;  3OYC A;  5GAM h;  5FWB A;  4PKC C;  1GBR A;  2KK4 A;  3QDR B;  1N8R R;  2W10 A;  3A8G B;  2RI3 A;  3H0I A;  1Q81 U;  1ZLM A;  2NUP B;  2RO0 A;  3CD6 A;  3R6N A;  3V8J A;  1MMD A;  1M27 C;  1UB4 A;  4GY5 A;  2M16 A;  2XG8 D;  4M77 D;  4M78 C;  2A0F B;  1M3A A;  2NUT B;  5GAO m;  2ZPG B;  2MMP A;  1PM3 A;  5GAN d;  2LX9 A;  2EQI A;  4M78 B;  3NTK A;  1K9M R;  1MV0 B;  5EC7 A;  4HCZ A;  2RHI A;  3JSC A;  2XK0 A;  1MV3 A;  1I5O B;  1KQS A;  2EAY A;  3P8H A;  2RI2 A;  4FL6 A;  1B34 A;  3JCM h;  3M56 A;  1XQH A;  3M0Q A;  5GAN 8;  1VQK Q;  3SB2 A;  1AT1 B;  1IHW A;  2XI9 A;  4D6W A;  2EGA A;  2YRC A;  3CCV Q;  3OA6 A;  4JJN K;  1VQ8 A;  1AWO A;  1MHN A;  5CKH A;  5KE3 A;  4FYV B;  2IIM A;  1KC8 U;  2AT1 B;  1W70 A;  2DTH A;  2F2V A;  2Y4X A;  1N9R A;  2MIO A;  4D8K A;  5C0M A;  1QKX A;  3V8K A;  3QG1 A;  3CEY A;  4C8Q A;  4PJJ A;  3EH1 A;  1IXD A;  2LJ3 A;  1AVZ C;  5LJ3 j;  2HNI A;  4OMM A;  2NYS A;  2K3B A;  4KGX B;  5GAN f;  2DER A;  3JCM X;  2EGC A;  1AOJ A;  1ABQ A;  2PVD B;  3V7C A;  2E6Z A;  4XU1 A;  1QP2 A;  2HCK A;  3CCS T;  4ELZ C;  3ZFJ A;  2DVJ A;  2K2V A;  3CCM Q;  2VAS A;  2RQU A;  1VQ7 A;  4R56 A;  2CP7 A;  4HVW A;  2E65 A;  2BE7 D;  1Q81 C;  3G7Z A;  5HK0 A;  2ROT A;  2JTF A;  5GAM f;  2D1X A;  4QW2 A;  3JCM d;  1YI2 A;  1O9S A;  2RF0 A;  1Q82 C;  3OYL A;  3OS2 A;  2Z0W A;  1Q95 G;  5KH6 A;  3X24 B;  2BIV A;  1YCY A;  1RAE B;  1ARK A;  2VGN A;  2DEU A;  4X9C A;  5LJ3 g;  3CD6 Q;  1VIE A;  1AHJ B;  1CSK A;  1UTI A;  3EFS A;  3L1A A;  3MEU A;  4RMO A;  2E5K A;  1ZX6 A;  4PFZ A;  1IGU A;  3VYH B;  3GIB A;  4N4I A;  1WHH A;  3OYD A;  2DK3 A;  2LT1 A;  4A63 B;  1VQ9 T;  4M7D E;  4IUV A;  1VQO T;  4J9F A;  2FG0 A;  2CH4 W;  4KBM B;  2HEQ A;  1TUD A;  1FXX A;  3OYH A;  1WNL A;  2HDA A;  2R5M A;  5KCO A;  1MUZ A;  4BI3 A;  4CC3 A;  1TSF A;  4M7D G;  2LT4 A;  3RKX A;  1AEY A;  3CC4 A;  3ER0 A;  4YTL A;  3VS1 A;  3JCM f;  3OSS C;  4C92 C;  1W2B P;  3M0T A;  4ZGE B;  4LUD A;  1KC8 C;  2KVQ G;  3INZ A;  1X75 C;  4C92 B;  5CR2 A;  3I9Q A;  2X51 A;  1VQ8 Q;  1C0M A;  5A0L A;  2XKO C;  1M1G A;  4RTW A;  4M7D F;  1PG5 B;  5LJ5 j;  2ZPF B;  1VIF A;  2IG0 A;  2JOY A;  3QO3 A;  4XTZ A;  3DLL A;  3VUZ A;  3VS3 A;  1AWW A;  4ZTJ A;  4M4Z A;  1JXO A;  1NLP C;  3VS6 A;  5FLX E;  4PFP A;  2KRO A;  2RA2 A;  1RAA B;  2K4Y A;  2QG9 B;  2YWW A;  1JU5 C;  1KG1 A;  2FL7 A;  2P0Q A;  2D8H A;  4Y28 E;  4R55 A;  2COY A;  4DOV A;  2PQW A;  2X4J A;  2EVR A;  2OTL A;  2CUD A;  2O4X A;  3EG1 A;  4F7U E;  3OYJ A;  2GQV A;  1VQ7 Q;  4C0G A;  2AKL A;  2E3I A;  1E7O A;  2ZGW A;  4QVC A;  2HMA A;  3UPU A;  2KXD A;  1QLY A;  4F7U G;  1NJI R;  1YI2 Q;  1W2B S;  5LJ5 g;  1PHT A;  4ANJ A;  4HCK A;  1ZA2 B;  5GMK m;  3CCJ T;  2M51 A;  2YLB A;  4MDW A;  2EJG A;  4OB1 B;  5IN1 A;  2MI6 A;  4OB2 B;  3AT1 B;  3MP8 A;  1D0Z A;  2BKD N;  2MOX A;  3QYH B;  4M77 E;  3MET A;  4JRI A;  1M4Z A;  2GBQ A;  5GAN 2;  4F7U F;  2V8K A;  3JCM Q;  8AT1 B;  4GLM A;  4KUL A;  3PFS A;  2DJQ A;  3OYM A;  3RMS A;  4AFZ C;  4HCB A;  1I07 A;  1N5Z A;  2L0A A;  3FJP A;  1UE9 A;  2K3Y A;  4OML A;  3SDZ A;  3M54 A;  4KGV B;  1GCQ C;  5KYX A;  2GGR A;  2YDL A;  1ZSZ A;  4EPC A;  3CC4 Q;  3G71 T;  4KT0 E;  1PKS A;  4JUV A;  1KD1 R;  1WXT A;  1WHG A;  4X1V A;  4RKU E;  3CCU T;  1KQ2 A;  1YIJ T;  1QWF A;  4A4G A;  1HYO A;  3QKJ A;  1NG2 A;  2C0O A;  2NUP A;  2KR3 A;  1D1A A;  2RQT A;  4C8Q E;  3QZ5 B;  1YIT T;  4M77 C;  4IUR A;  1UEB A;  5IH2 A;  3CME T;  4IIM A;  3CCQ Q;  3T9N A;  2DAQ A;  3G6E T;  1TOV A;  5GAO q;  2NUT A;  2JS0 A;  3CMA T;  3SD4 A;  1SPK A;  4C8Q G;  1KFZ A;  4EMG A;  3BW1 A;  4M78 A;  4B6M A;  2OTL Q;  4TVR A;  2QDL A;  3J81 E;  2X4Y A;  4DBH A;  1WLP B;  3JB9 I;  1X6G A;  2DBK A;  2QGG A;  3O8V A;  4PK4 A;  3UWN A;  1VQL A;  1X6O A;  2EQK A;  3RKW A;  1WZO A;  4C8Q F;  4F16 A;  1V1C A;  4LDU A;  3HHT B;  1FMK A;  3OYI A;  1K8A U;  4XTY A;  1F1B B;  2B86 A;  1ACM B;  2O9V A;  3EG3 A;  2RM4 A;  2HSE B;  5KYY B;  1MMA A;  4E2F B;  2AZV A;  2DMO A;  5GJV B;  4MZT A;  1QP3 A;  1QVP A;  3CC7 A;  2VXF A;  1WJQ A;  2EYY A;  3CXC S;  1OU8 A;  4FW2 A;  1JO8 A;  3VUB A;  3LW5 E;  2J6F A;  1K73 C;  2JJ9 A;  4KUI A;  1OPL A;  1M3C A;  3NFC A;  5IT9 E;  2KQW A;  4AMC A;  1Q7Y R;  1X43 A;  3SEM A;  2M02 A;  2EGE A;  3RKY A;  4RTY A;  3H0F A;  2QXF A;  2EQJ A;  2CT4 A;  4P5N A;  2LNV A;  2LJ1 A;  2V1Q A;  1D3B B;  1RLQ C;  1TWB A;  2XID A;  4L6V 5;  2QAS A; 
#chains in the Genus database with same CATH homology
 5FU6 B;  4QVD A;  4BY6 C;  2QQ9 A;  5LJ5 h;  5GAO r;  2P4T A;  1N9S A;  2R5A A;  3CPW S;  4C92 E;  4IUT A;  1K73 U;  1UGP B;  3X26 B;  2L5Q A;  4BY6 B;  1ZQ1 A;  4LDV A;  3KXT A;  1DJ7 B;  2K5F A;  1HXD A;  4XU3 A;  4OMF B;  1YJ9 A;  4N0A A;  5GMK i;  2FVU A;  2JUF A;  3CCM A;  4CI0 C;  5CQY A;  1WGS A;  5HK3 A;  5GAO p;  3S3M A;  5GAM e;  3BDL A;  5LJ3 f;  1Q7Y U;  3CC2 T;  1NPP A;  2VV5 A;  1QVF A;  2P0P A;  3DKM A;  2EJF A;  2QI2 A;  4J6Y A;  1JBM A;  3HP9 A;  3QXE B;  2JN0 A;  4F7U A;  1YJN T;  4F7U B;  3H8Z A;  2X4X A;  1M90 C;  1M1K C;  1QW1 A;  3X20 B;  3CME A;  2OTJ A;  3JRZ A;  4FM4 B;  2F5T X;  3OYC A;  5GAM h;  2M1H A;  4PKC C;  3OS1 A;  4BI8 B;  3CC7 T;  4C5E A;  3OMC A;  4ATO A;  2KK4 A;  3JCM P;  3QDR B;  3E19 A;  4EMK C;  3QYG B;  3A8G B;  2RI3 A;  4MZM A;  5GAN 6;  1KD1 C;  1Q81 U;  3M53 A;  3OQ5 A;  5CKD A;  4FIB A;  1V29 B;  2DD5 A;  2KY9 A;  5AYF A;  4L59 A;  4C0D C;  2DZC A;  4EMK B;  2QA4 T;  1W2B A;  2RO0 A;  3LGL A;  3CD6 A;  4OVA A;  4E7L A;  5GAN 5;  3V8J A;  1NE8 A;  1PSE A;  1OZ3 A;  4A4K A;  1K8A C;  3A8L B;  1VQP A;  4C0D B;  1UB4 A;  4J6X A;  2QEX A;  2YRV A;  2L8D A;  4M77 B;  4GY5 A;  3HFN A;  4RCC A;  2M16 A;  2XG8 D;  1I8F A;  5I21 A;  4M77 D;  3I56 T;  4M78 C;  3OBY A;  4M75 C;  2PU9 B;  5GAO m;  1M1K U;  3M9Q A;  5C6S A;  5A0D A;  1VQ6 A;  2ZPG B;  2CZ6 B;  2HQX A;  2KDS A;  2MMP A;  3HPW A;  4KUD K;  5GAN d;  4OF1 A;  3CCL T;  2LX9 A;  1XTD A;  4M78 B;  4M75 B;  3OYG A;  3NTK A;  2RK1 A;  4J5Y A;  4M78 D;  4HCZ A;  2RHI A;  4M75 D;  4XTX A;  3OY9 A;  2XU8 A;  5LJ5 d;  3JSC A;  4JS4 A;  2XK0 A;  3RER A;  2RH2 A;  3HRU A;  2LQK A;  3S6W A;  4C92 A;  1K9M C;  1KQS A;  1N8R U;  2EAY A;  2O01 E;  1VQN A;  4XTV A;  3CCE A;  3P8H A;  4JLG A;  3EAE A;  4XU0 A;  2D6F A;  4QQG A;  2RI2 A;  4A4E A;  1EIF A;  4FL6 A;  1YBY A;  5D6Y A;  1B34 A;  3JCM h;  4A4H A;  3M56 A;  3PMT A;  5D6X A;  3CCJ A;  1XQH A;  1TH7 A;  3C12 A;  3QHS A;  3MEW A;  1XOV A;  4QQ6 A;  4OB3 B;  5GAN 8;  4BD3 A;  3SB2 A;  4A54 A;  2XI9 A;  2H3J A;  1VQM T;  4D6W A;  3L2Z A;  2JNG A;  3CCQ A;  3OA6 A;  4JJN K;  1VQ8 A;  4M7D D;  3MP1 A;  2RI5 A;  5CIU A;  1M5Q 1;  1MHN A;  2GF7 A;  5CKH A;  5EG2 A;  1U8R A;  5KE3 A;  4B9X A;  4BE1 A;  5LJ3 d;  1KC8 U;  1QVG A;  4PJO C;  2DTH A;  4A53 A;  2Y4X A;  4C8Q C;  1N9R A;  3FC3 A;  2Y4Y A;  1QVF S;  3L2W A;  2F5K A;  5C0M A;  3V8K A;  1K9M U;  2LVM A;  4ELY C;  2JTM A;  4MDX A;  3QG1 A;  3CEY A;  4PJO A;  4C8Q A;  4PJO B;  4NS5 A;  4WF2 A;  5LJ3 j;  3G4S T;  2HNI A;  4PJO D;  1LNX A;  4JRP A;  1U1T A;  3C4S A;  3GOX A;  3M59 A;  5GAN f;  2RHU A;  3JCM X;  2NLU A;  2EFI A;  4J8O A;  2PVD B;  1Y71 A;  4N4G A;  3V7C A;  2E6Z A;  3JB9 H;  5I2S A;  2CZ7 B;  4XU1 A;  4M7A C;  5LJ5 f;  2EYQ A;  1QP2 A;  2X35 A;  2M0O A;  2CS7 A;  3GNF B;  1JB0 E;  1BI0 A;  3FRN A;  3JCM b;  3JCM W;  1YJW A;  3CCS T;  4ELZ C;  3CC2 A;  3ZFJ A;  2L3R A;  2K2V A;  2WSE E;  1IRE B;  4Z02 A;  3OYA A;  3AHU A;  3OB9 A;  4M7A B;  1VQ7 A;  2CZ0 B;  2DPP B;  3G71 A;  4R56 A;  4M7A D;  1N27 A;  3FEO A;  2E65 A;  3M4Y A;  1JJ2 S;  2EIF A;  3LLR A;  1VQ5 A;  2DXU A;  1Q81 C;  2K3X A;  2OAU A;  2WSC E;  2WAC A;  2DTI A;  2JZ2 A;  2RJC A;  3ZEH A;  4N0A C;  3CCU A;  3G7Z A;  5HK0 A;  2FYK A;  5DM7 R;  1LJO A;  1YIJ A;  4IUQ A;  3MHX A;  2JTF A;  5GAM f;  4QW2 A;  3JCM d;  1YI2 A;  1O9S A;  2XDP A;  1Q82 C;  4XK8 E;  2QA4 A;  2LCC A;  2EWN A;  2R58 A;  4FT4 A;  3OS2 A;  4XTW A;  1I4K 1;  2ZPB B;  3OBW A;  3Q1J A;  3OYL A;  5CCA A;  4HT8 A;  1UGS B;  1WQW A;  5KH6 A;  3FB9 A;  3X24 B;  2BIV A;  1YCY A;  4ZN1 A;  2ZPH B;  3MCA B;  3LWI A;  5GMK j;  1VQK T;  4M77 G;  2VGN A;  1WPY A;  3TCJ A;  3JCM V;  3HSB A;  4X9C A;  5LJ3 g;  1VIE A;  5FU7 C;  1AHJ B;  1R8O B;  1ZBX A;  3G6E A;  3MP6 A;  4O6J A;  3I56 A;  1P92 A;  1S72 A;  3TEE A;  4JLI A;  2Y90 A;  1H3Z A;  4O5V A;  3ASK A;  3BDU A;  3CMA A;  2XDB A;  2HBP A;  1BI3 A;  3JB9 G;  2HQE A;  2RJE A;  3EFS A;  3L1A A;  3MEU A;  5FU7 B;  3BY7 A;  5J3B A;  4RMO A;  3I55 T;  3M58 A;  2LC4 A;  4M78 G;  4M75 G;  3CBO A;  1WQ7 A;  3QPH A;  3OYB A;  3VYH B;  4IKF A;  3CXC A;  2YHT A;  4N4I A;  3OYD A;  2DK3 A;  2DZ9 A;  4M77 F;  3VYG A;  1N8R C;  2LT1 A;  1FWZ A;  4ZGJ B;  1VQ9 T;  2GFA A;  4M7D E;  1G3W A;  2DIG A;  4Q5W A;  3PNW C;  4IUV A;  3CBM A;  3RES A;  5J39 A;  1O75 A;  1VQO T;  1Q82 U;  3JCM J;  1YHQ A;  2RJF A;  2C06 A;  3JB9 F;  4JRQ A;  2DEQ A;  4DQ2 A;  3GPL A;  4PLL A;  4KBM B;  4M78 F;  2PVO B;  4M75 F;  4J83 A;  3OSV A;  1FXX A;  3OYH A;  1PSF A;  1WNL A;  2LQ8 A;  3MEA A;  2IVW A;  1NZ9 A;  2R5M A;  5CK9 A;  2X4W A;  2XIC A;  5KCO A;  3FIF A;  3PT9 A;  4BI3 A;  1YJ9 T;  2QQS A;  4M7D G;  2LT4 A;  3DLM A;  3BFM A;  3RKX A;  1G3S A;  3ER0 A;  4A4F A;  4YTL A;  3CCM T;  1VQ4 A;  3CC4 A;  5CQX A;  2ZZD A;  3OSS C;  3JCM f;  4C92 C;  2DO3 A;  3HRT A;  3V7S A;  4ZGE B;  1KC8 C;  2KVQ G;  2G3R A;  2P0K A;  3INZ A;  1X75 C;  3WVD B;  3VKI A;  3JCM g;  4ZN3 A;  4C92 B;  5CR2 A;  2D0Q B;  5GAO n;  2E41 A;  3JAM E;  5GAN j;  2OTJ T;  3L2R A;  3OW2 S;  2RB6 A;  3L2Q A;  5CAI A;  2E6N A;  4BB7 A;  4C92 D;  5A0L A;  2XKO C;  1M1G A;  3CPW A;  3TU4 K;  1BI1 A;  2MF2 A;  4X34 A;  2HAX A;  4M7D F;  1H64 1;  3UT1 A;  5LJ5 j;  2XDD A;  2ZPF B;  1VIF A;  1B34 B;  4Y91 A;  2PVG B;  5GAN 4;  3QZ9 B;  3NTH A;  1FX7 A;  3GIB A;  4J6W A;  2IG0 A;  2JOY A;  3QO3 A;  4XTZ A;  5I2M A;  3VUZ A;  3DLL A;  3CCR A;  2KAF A;  4ZTJ A;  5CVI A;  1I81 A;  5FLX E;  4XU2 A;  5GMK e;  2DXT A;  5D6W A;  3S3O A;  2KMT A;  5GAM d;  4ME7 A;  1RI0 A;  2RA2 A;  4B9W A;  3CD6 T;  4II1 A;  2K4Y A;  3L2U A;  2ZPI B;  1MGQ A;  3P8B B;  3P8D A;  2FL7 A;  5DLQ E;  2P0Q A;  3JB9 J;  2DVE A;  4Y28 E;  1U1S A;  1YIT A;  1VQP T;  4R55 A;  3KUF A;  2QEX T;  2FB7 A;  3MO8 A;  4DOV A;  4M7A G;  5GMK h;  3DB3 A;  2PQW A;  1ZHI A;  2X4J A;  2QQA A;  5A2Q E;  5GAM j;  4C5H A;  2OTL A;  2RHY A;  5FRN A;  3CBP A;  1VQ6 T;  2O4X A;  4C8Q B;  1LOJ A;  4F7U E;  3OS5 A;  3L42 A;  2VYT A;  2GQV A;  1X01 A;  5GAN 3;  3OYJ A;  4C0F A;  4DOW A;  4LDW A;  4C8Q D;  3OYY A;  4C0G A;  3E9G A;  1BKB A;  4OGC A;  2RK2 A;  4XAX B;  5CKF A;  4M7A F;  3HFO A;  2ZGW A;  4FU6 A;  4VUB A;  3J7A F;  4NL3 A;  5GAN 7;  4FSX A;  3N5B B;  4QVC A;  5GAN g;  1OZ2 A;  3HRS A;  3UPU A;  1VQN T;  1G3Y A;  4QQD A;  1KHI A;  2MAM A;  2JVV A;  4F7U G;  1YJN A;  3X28 B;  1KHC A;  4MML A;  5LL6 S;  1W2B S;  5LJ5 g;  2QTX A;  3LWH A;  5HY6 A;  3S3N A;  3M55 A;  2FHD A;  1M9S A;  5GMK m;  3CCJ T;  2YLB A;  3ME9 A;  4MDW A;  4OP0 A;  2EJG A;  4OB1 B;  5IN1 A;  2MI6 A;  4OB2 B;  3MP8 A;  2PUO B;  2BKD N;  3QYH B;  1Q86 U;  4MMK A;  3NTI A;  3MET A;  2D9T A;  4JRI A;  1M4Z A;  1OYX A;  4M77 E;  2A7Y A;  4C5G A;  1UGQ B;  1KQ1 A;  3GNG A;  4BE0 A;  5GAN 2;  1VQ8 T;  3E1S A;  2ZCF B;  3WXM B;  4F7U F;  4XQ3 A;  2E64 A;  2V8K A;  4IUU A;  3JCM Q;  3VV0 A;  3M57 A;  2WSF E;  4KUL A;  5FU6 C;  2CGH A;  5DY9 A;  4M78 E;  3H6Z A;  3PFS A;  4M75 E;  5GAM g;  3OYM A;  1NPR A;  3RMS A;  4HCB A;  3A5Z B;  1N6A A;  4PLI A;  1JRI A;  2QQR A;  2F69 A;  2E10 A;  5HKC A;  1KQS S;  4HKE A;  3OMG A;  3QII A;  3R6O A;  3FJP A;  5A0G A;  2K3Y A;  2DJZ A;  3QJY A;  3A8M B;  4L5G A;  3CCV T;  3VU3 C;  1SSF A;  1XNI A;  3PTA A;  3SDZ A;  3LH0 A;  4IUP A;  5DLO A;  1BYM A;  1W4S A;  3F70 A;  3M54 A;  4J7F A;  4UC4 A;  2RHZ A;  4DA4 A;  1NJI U;  1M1F A;  2LDM A;  2DXB A;  2E12 A;  4NL2 A;  4ZGD B;  3CCL A;  5CKB A;  5KE2 A;  4E7J A;  1S72 T;  1Y07 A;  4OB0 B;  1YJW T;  1BIB A;  2QDY B;  2RD1 A;  2R57 A;  4EPC A;  4C5I A;  4LDY A;  4BUG A;  2KSS A;  2VUB A;  2DIQ A;  4C92 G;  3OYK A;  5LJ3 e;  1VQ7 T;  4OGE A;  4JDS A;  5GMK l;  3G71 T;  2HD0 A;  1IZ6 A;  5CKE A;  3RUX A;  4KT0 E;  1VQ5 T;  4JUV A;  1QVG S;  1GXI E;  4HT9 A;  2LTO A;  3QBY A;  2VXE A;  4CRI A;  3VJP A;  4ZTF A;  4RKU E;  5LJ3 h;  4RG2 A;  3CCU T;  1KQ2 A;  3GP8 A;  1Y96 A;  1YIJ T;  4A4G A;  1G3T A;  1Y96 B;  4E47 A;  2LCL A;  2XHC A;  3QKJ A;  4C0Z A;  3LGF A;  4HA8 A;  4JRK A;  2DKG A;  2CZ1 B;  3GLX A;  4C92 F;  4EMK A;  1YI2 T;  4PJO E;  4C8Q E;  1YIT T;  2BUD A;  3QZ5 B;  4QVZ A;  1OI1 A;  4M77 C;  1WJS A;  1VQM A;  3PGG A;  3V8L A;  4E7H A;  2DD4 A;  2I2L A;  4N4H A;  3SWN C;  4IUR A;  1UEB A;  4GLK A;  1JJ2 A;  1WJR A;  3DB4 A;  4M77 A;  3FLG A;  4MZP A;  1Y7X A;  4E7I A;  3CME T;  3CPF A;  2B8A A;  3T9N A;  2DAQ A;  3SWN A;  2VGM A;  4EMH A;  3G6E T;  3SWN B;  5IAY A;  5GAO q;  1M90 U;  2MWP A;  3OYN A;  3CMA T;  4PJO G;  3SD4 A;  4HCC A;  2L89 A;  4C8Q G;  3UDC A;  4EMG A;  3BW1 A;  1KG1 A;  4EDU A;  3G4S A;  2EJ9 A;  4M7A E;  3URG A;  4M78 A;  4M75 A;  1VUB A;  4TVR A;  2K5I A;  3J81 E;  2X4Y A;  3JB9 D;  3QSU A;  1G5V A;  4FT2 A;  4JS5 A;  2GFU A;  1HK9 A;  3A8H B;  1I5L A;  3JB9 I;  2K5L A;  3LX7 A;  4J7I A;  3JCM e;  1KD1 U;  2EQM A;  3O8V A;  5M9O A;  4LDX A;  3M5A A;  3GF5 A;  3UWN A;  1VQL A;  1X6O A;  2EQK A;  2QQB A;  3RKW A;  2YLC A;  4PJO F;  3CCS A;  4BAC A;  1YHQ T;  2RHX A;  4C8Q F;  4LDU A;  4BDY A;  4E7K A;  3HHT B;  1UGR B;  2RJD A;  3OYI A;  4NOY A;  4LD6 A;  1K8A U;  2CYZ B;  4XTY A;  5L8R E;  2V8I A;  3PIO A;  1Q86 C;  5FRO A;  3PIP A;  3WVE B;  4BE2 A;  4M7D C;  3C94 A;  4RCB A;  3SFM A;  2E70 A;  1BI2 A;  2RM4 A;  2O4X B;  4M7D A;  3J80 E;  3RMQ A;  1VQ4 T;  3CC4 T;  4M7D B;  2EKO A;  3ZBD A;  3OYF A;  4MZT A;  4PNO A;  1QP3 A;  2LRQ A;  2GCX A;  1QVP A;  3CC7 A;  3X25 B;  1RL2 A;  2VXF A;  3LYI A;  3KBG A;  1WJQ A;  3CXC S;  3CCE T;  3QJ6 A;  2K57 A;  3E9F A;  3VUB A;  3JCM c;  3LW5 E;  3C95 A;  1K73 C;  3EFR A;  4V2S A;  2V8J A;  2DTO A;  5GAO l;  1VQK A;  4KUI A;  3NFC A;  2ZPE B;  5IT9 E;  2KQW A;  5J26 A;  2CKK A;  2M9U A;  1BIA A;  1NJI C;  3CCR T;  3CCV A;  1M8V A;  5CO7 A;  2VC8 A;  4RG8 A;  3V7R A;  2A3L A;  5KCH A;  3FDR A;  3RIR A;  4BI4 A;  2PUK B;  3TRE A;  1Q7Y C;  3I55 A;  3QUI A;  3RKY A;  2AHJ B;  3PMI A;  3MEV A;  3L2V A;  4BDZ A;  2QXF A;  5GAN e;  3A8O B;  3HKS A;  2EQJ A;  2MWO A;  3CCQ T;  5FRM A;  4X9D A;  4P5N A;  2EQU A;  3OW2 A;  2LNV A;  1D3B A;  2DXC A;  1D3B B;  3HL8 A;  5LJ5 e;  4LD9 K;  2XD0 A;  4M7A A;  1VQ9 A;  4PL6 A;  2XID A;  4XTU A;  2E5Q A;  4L6V 5;  5GAN h;  3OS0 A;  2OTL T;  3M4G A;  1VQO A;  3OYE A;  2E1H A;  1VQL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...