3PGGA

Crystal structure of cryptosporidium parvum u6 snrna-associated sm-like protein lsm5
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
89
structure length
78
Chain Sequence
NIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADKRVMVNRLETILLSGNNVAMLVPGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5. SM domain
publication title Genome-Scale Protein Expression and Structural Biology of Plasmodium Falciparum and Related Apicomplexan Organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Dna binding protein
total genus 15
structure length 78
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pggA00
3FIFA 2JN0A 2E65A 4HA8A 4C92C 4M7AC 3EFSA 3V7SA 4M7DE 4HT8A 5GAN4 4XTWA 1M5Q1 3JCMP 3JB9G 4JLIA 1N9RA 3JCMQ 4M7DA 4M7AE 2I2LA 4XTZA 4V2SA 2DJZA 3RERA 4C92G 5LJ5f 1BIAA 4M7AG 4OP0A 4XTVA 5GANg 4MMLA 4XQ3A 4M7AA 1WQWA 2EAYA 3V8KA 1JBMA 1I81A 1YCYA 5GAOp 2DTOA 1B34B 4EMKA 1I4K1 2DVEA 4F7UB 3JB9D 4M7DD 5GAMj 3RIRA 5GMKj 2ZGWA 5I21A 5LJ3e 3JCMf 5LJ5e 2YLBA 4PJOB 4XU1A 5GMKi 4M77B 2E1HA 3QSUA 4M7DC 1D3BA 2DZ9A 4XTXA 1U1SA 4RCBA 3BDUA 3JCMe 2RA2A 1I5LA 3JB9J 3SWNA 3INZA 3JB9H 5GAMh 4EMKC 2EJ9A 4M75B 5LJ3d 2E10A 5GMKh 4X9CA 5LJ5d 5GANh 3AHUA 2DZCA 1TH7A 4J6WA 4M7DG 4J6YA 3V8LA 2VXFA 1U1TA 4C8QB 4JRKA 4EMGA 2RM4A 4M78F 1WQ7A 4PJOF 4A54A 4M77F 2VXEA 4XTUA 4WF2A 4DQ2A 3JCMX 3JCMd 3HFOA 1Y96B 2HNIA 4M78D 5GAMf 5GANf 3RESA 4MMKA 2FYKA 3SWNC 2Y90A 4NL2A 3FJPA 3L2ZA 5GANj 1I8FA 4J5YA 4JRIA 3V7CA 5GAN5 2YHTA 2CGHA 3HFNA 4M78C 4N0AC 4C92B 3JCMb 3QUIA 1X01A 4M7AB 3V8JA 2K57A 1BIBA 4J6XA 2EWNA 4C8QF 1LJOA 2RB6A 3M4GA 4M78E 3PGGA 1B34A 4Y91A 4EMHA 5GAN2 5LJ5g 5LJ3g 4HT9A 4RCCA 3RKXA 1MGQA 2EJFA 4M78G 4N0AA 4M78A 1N9SA 4F7UF 4M77A 5GAN3 2DKGA 4XU0A 5GAMd 5GAOn 2RD1A 3JCMg 4QVDA 5GANd 4C92F 4QVCA 3JCMJ 2QTXA 2FB7A 1HXDA 5GMKm 5GAN8 4PJOD 1WPYA 4M77D 4XTYA 2E64A 1KQ1A 5GMKl 4C8QE 4M7DB 4NOYA 4XU2A 5CAIA 1LNXA 1H641 3BY7A 4C8QG 4PJOC 4C8QA 5LJ3h 3BFMA 4M75F 2DEQA 4M77C 4F7UE 5GAMe 5GAN6 5GMKe 5LJ5h 5GAOq 3BW1A 4EMKB 5GANe 5GAOm 3GIBA 4M75D 2E41A 1Y96A 4F7UG 4NL3A 5GAOl 4PJOE 4F7UA 3FB9A 4C92E 4M77E 4PNOA 2EJGA 2VC8A 4X9DA 3EFRA 3RUXA 3L1AA 3JCMh 4C8QD 3HSBA 4PJOG 3JCMV 3RKWA 3JCMc 1HK9A 4M77G 5GAMg 4PJOA 5LJ3f 4M75C 4C92A 5GAN7 3JB9F 1JRIA 1D3BB 2DXTA 4A53A 5LJ3j 5LJ5j 1KQ2A 4M7DF 4C8QC 3RKYA 1LOJA 3SWNB 2DTIA 1M8VA 4M75E 5GAOr 4M7AF 1WNLA 2YLCA 4M78B 3VU3C 4C92D 3JCMW 4M75G 2DTHA 4M7AD 2DXUA 4M75A 3SB2A 3V7RA 3QO3A 4JUVA 3JB9I 4XU3A 3QHSA 5DY9A
chains in the Genus database with same CATH superfamily
2J6FA 1K9MR 4AFUC 2LNHB 2PUOB 4E7ZA 4JLIA 1YI2A 2YSQA 1PNJA 4IUTA 3E9GA 3CBMA 3UPUA 1WQWA 1YN8A 3OYMA 2DETA 2E6NA 3TU4K 1F1BB 1OV3A 4LDWA 3H0HA 2JMAA 2AK5A 2RHIA 3QWXX 4LUDA 4C5GA 1S72A 2YRCA 3H8ZA 1U1SA 4JPBW 1XJWB 1JQQA 1MMGA 2LQWA 4PLIA 2K5LA 1NYFA 2HNIA 1BB9A 2QGFB 2RQTA 4Y28E 4ZNXA 1M2OA 3HPWA 3QWYA 1I8FA 2MCNA 2YT6A 1QW1A 4E47A 2RQRA 3OB9A 3VS6A 3R6NA 4PK4A 4JZ3A 1KHCA 2EJFA 1VQPQ 3U23A 1NZ9A 1R0CB 1EZZB 3SFMA 4IUPA 4RTYA 1AD5A 3I56Q 2ZPIB 2RHUA 3VJPA 3RNJA 1E7OA 1HXDA 1IO6A 5GAN8 3DLLA 3I5RA 2D8HA 1RL2A 1FMVA 1T0JA 5FU7C 2KT1A 1LNXA 4C8QG 2GFAA 2DEQA 1KQSA 4EMKB 4CC7A 2FPEA 3UWNA 4F7UG 3BE3A 3FB9A 4FW2A 4PFZA 2A3LA 2EYWA 5KYYB 2AIRB 2RQVA 2LQ8A 1D1CA 2PVDB 3CCVA 5A0GA 2LJ1A 2RPNA 3CCJT 5J26A 2MYSA 3H0FA 5KYXA 3V7SA 2JTEA 4ELZC 4F17A 3VS4A 2O31A 4JJBA 3HKSA 4RG8A 5KYWA 4NS5A 2KRMA 2WSCE 4XTVA 3VUBA 3MEUA 2EAYA 3V8KA 2K9GA 2DILA 1ABOA 5I21A 4E7JA 1KIKA 2VKNA 1W2BS 4J7IA 1SEMA 1NJIR 4EMKC 3O5ZA 2L3SA 1JEGA 2GCXA 2DXCA 2SEMA 3V8LA 4EMGA 2H3JA 4AMCA 2F1LA 2MF2A 2DL7A 4A54A 3PT9A 1RAEB 4LDUA 4OGEA 2Y90A 2CP3A 3GNGA 4KUDK 1XQHA 1PRMC 1IXDA 4M78E 4EMHA 4LDYA 1NEGA 1U06A 1TUCA 1BCOA 1YBYA 4PJMA 3MP8A 4E7SA 2VYTA 5GMKl 4NOYA 2RK1A 3HL8A 4OMPA 4BD3A 1VA7A 1VQ5T 4OF1A 3CCJQ 2K5FA 5GAOm 1Y96A 3LH0A 2LC4A 3TVTA 1QVFA 3JCMV 5I11A 2P0QA 1N8RR 2AKKA 4A53A 2J6KA 1YITQ 3QYHB 4JJNK 2VV5A 4J9BA 2D0QB 1Q82U 2GTJA 1GBQA 1W6XA 3H9NA 4N4GA 2QK0A 1D0ZA 2Z0WA 3NHNA 2HBPA 1PC0A 1M4ZA 4J9EA 1IB8A 3G71A 1S1NA 1H92A 2NYSA 2KMTA 4XTWA 4FW1A 2E5KA 4FT4A 1NG2A 1VQMT 3OYCA 1ZLMA 3M0RA 1I81A 3HRSA 4LN2A 4KGVB 1WGSA 3CCMT 1PG5B 2X4XA 1ZUUA 2K4YA 3OW2S 4BE1A 1BU1A 3VRYA 1BI0A 4LXCA 2QDYB 1B7TA 1H3ZA 4X9CA 1FXXA 1LCKA 4ZTFA 4J6YA 2VXFA 4KH0B 1K0SA 2EKOA 1Q95G 3A8OB 1UECA 2AZVA 5FW9A 1LVKA 5KYWB 3L2ZA 4FM4B 2KROA 1O75A 1YJNA 4XK8E 1VQ5Q 1KHIA 3CBPA 2RB6A 2YRDA 2CDTA 1G83A 3FJ5A 1M30A 1QCNA 3G4SA 1NM7A 2V1QA 2K3BA 1R0BG 2RK2A 3NMZC 2EYXA 4QVCA 2JTMA 2X9HA 3CC4T 3JCMJ 4BACA 1GFDA 4M7DB 1KC8U 4BI4A 3I55T 4IIMA 2KAFA 5FROA 4X9DA 1QCFA 3EFRA 3JCMh 4ESRA 4WTOB 1YIJA 2JJ9A 1JRIA 2DL4A 2KK4A 4LD6A 5LJ5j 2EIFA 2KEAA 2QTVA 1VQMQ 5GAOr 3A8GB 2OTJA 2EKHA 3CCSA 4DEYA 3CCMQ 2ZPFB 1YFNA 1Q86C 2QA4A 3CCRT 4C5IA 3FDRA 3O8VA 2D9TA 3L2VA 2QQSA 2HL3A 1VQ9A 3ER0A 3THKA 1K73R 2A28A 2JXBA 1M5Q1 3M0UA 3ASKA 3ZBDA 5LJ5f 1TS9A 2QQRA 1AWJA 3I35A 2VASA 1Y0MA 1OOTA 3QBYA 2ED0A 4F14A 2CZ7B 4EIKA 4OB1B 4QQDA 1NJIU 3CC7T 4EDUA 4M7DC 3GPLA 2RA2A 3QDRB 1BI3A 3S6WA 2EJ9A 5LJ3d 5GMKh 3PTAA 1TH7A 1UB4A 1PHTA 1QLYA 4JS4A 1MNDA 3VKIA 4ME7A 1P92A 3CC4Q 2B86A 4K11A 4M4ZA 3CCQT 3JCMb 3L2WA 2K57A 1VQKA 3I55Q 3MEVA 2DBMA 1B34A 1AT1B 4OMQA 2RI2A 4M78G 4C5HA 4YTLA 4M77A 2EQIA 1M3CA 2RD1A 2VVKA 5HKCA 1OULA 5HCKA 3VS0A 2FHDA 2RI5A 2E64A 4A4EA 5IXFA 1SSHA 2OTLA 3QXEB 4C8QA 3CCRQ 1SKUB 4PFOA 5GAOq 1YWOA 1D1AA 1N8RU 4F7UA 4M77E 2KBTA 5DLQE 4C92A 1M90R 4M75E 2HL5C 1E6GA 5I2SA 3JCMW 3SB2A 3CPWA 1M8MA 2V26A 3ULRB 3SEMA 3RKXA 2O01E 2DRKA 1RUWA 2CZ6B 2EQUA 3QZ5B 5GAN4 4O6JA 3JB9G 1M1KR 1V76A 1YHQA 3CD6Q 3M53A 2FO0A 2JS2A 4XTZA 3ZFJA 1YJWT 4M7AE 1PD0A 3CCUT 6AT1B 1H8KA 2KXDA 4DBRA 1BK2A 2K5IA 1UGRB 1WJSA 5DM7R 2R5AA 4QQGA 2YUQA 1KC8C 1JJ2P 1VQ7A 2BE7D 3NTHA 1PWTA 3CCQQ 2ROTA 4RCBA 3JCMe 1K8AR 2HAXA 3OS0A 3TREA 2CT3A 4J6WA 3P8BB 1G2BA 1WXUA 1WHGA 1JXOA 4M77F 2AZSA 2DJQA 1VQOA 3HP9A 4M78D 4Z8AA 2GFUA 1UHCA 5EC7A 2EYZA 4FYXB 1KQSS 2CP2A 3LLRA 4E7HA 4C8QF 1Y07A 1PKSA 2O88A 1V1CA 5KYUA 1MGQA 4E2FB 4N0AA 4F7UF 4P5NA 4QVDA 4FSXA 4C92F 1VQLA 2X4YA 4DOWA 8ATCB 1UGQB 4J7FA 1ZSZA 4ZGEB 2JTFA 2CKKA 2LT4A 4PL6A 4A63B 1JB0E 1GRIA 3A98A 5GMKe 5D6YA 1GCQC 3E19A 3PIPA 2QQAA 3G6ET 1SRLA 2QDLA 1IRXA 4QVZA 5LL6S 1X43A 2MMPA 1BBZA 1Z9QA 3CCUQ 1LOJA 1WJQA 2YLCA 3FRNA 2DTHA 2DXUA 1K73U 1MV3A 1UGVA 2KQWA 4IUUA 5DY9A 2L5QA 1ABQA 2XI9A 4E6RA 2DLPA 2WSFE 2KDSA 2J05A 3MKDA 4V2SA 2FPFA 4N4IA 1RAFB 1OI1A 5IXBA 1K1ZA 4MMLA 1W1FA 1YCYA 5D6XA 4F7UB 3UF4A 3EH1A 5GMKj 1IGQA 1I07A 4RTZA 5GMKi 1QVGP 4L5GA 4D6WA 3FLGA 2RO0A 4D8DA 2Y4XA 2RHZA 1WYXA 2LQKA 3AHUA 3T9NA 2RI3A 1U8RA 2FEIA 1N27A 4DQ2A 3GP8A 1E6HA 2OAUA 4IIOA 3GF5A 2F2VA 4L6V5 2DO3A 4R55A 2LQNA 4DBQA 2EWNA 1AZEA 1QVFS 5CKHA 2MIOA 3OYAA 1RAHB 3G6EQ 1N9SA 3C94A 1PKTA 2KVQG 3H6ZA 2CREA 4XU0A 2DL5A 3QYGB 2EBPA 4CC2A 3VS3A 5GMKm 1UGPB 1YI2T 1WPYA 4XTYA 2MOXA 5D7UA 4CI0C 1ARKA 3EG9A 3N5BB 1TG0A 1KD1C 3RR6A 1Q7YR 2FG0A 3PNWC 2DYIA 3EAEA 1S72T 2FRYA 2J06A 2B8AA 1BKBA 2EQMA 3ME9A 4M77G 3OYIA 3L2UA 1M8VA 2JT4A 1VQ8A 5D6WA 5ECAA 2EGEA 2V8JA 3SWNB 3GLXA 4KULA 5KYUB 1X6OA 2MWPA 4J9CA 3VS1A 4M75G 1G8XA 4OB2B 4RKUE 4XU3A 2BUDA 4BUGA 1M1KU 1RAGB 2L8DA 3KUFA 2WACA 4ZN3A 1UUEA 2LT1A 4HT8A 2P0KA 1ZSZB 3JCMQ 2BTTA 4II1A 2JMCA 4C92G 1BIAA 4M7AG 1IZ6A 1I4K1 1VYVA 4A4KA 4GY5A 2PQWA 2DIGA 1YJ9A 4XU1A 3J7AF 1K8AU 3QJYA 3QSUA 3UA7A 3TSWA 3HHTB 2DZ9A 2KRSA 1YITA 1VOMA 3M0SA 2MI6A 2CUDA 5CO7A 2IVWA 2ECZA 4OMFB 3P8HA 1IHWA 3DB3A 2RJCA 2D8JA 2CH4W 4HXJA 1VQ4A 2DD4A 3SWNC 1YI2Q 2H8HA 1K0XA 2XU8A 2YHTA 2BZXA 4N0AC 1EIFA 1MMAA 1TSFA 1T3SA 3SDZA 2WSEE 1O9SA 2KRNA 2K79A 1OU9A 3CCVT 5J3BA 4RCCA 2VB6A 4M78A 1ZSZC 2YUOA 3UATA 5IAYA 3JCMg 2K3XA 2DA9A 4MZTA 2QTXA 4M77D 4MZPA 1W70A 1IREB 4CC3A 3EHQA 4XU2A 1G3SA 1H641 4J9GA 4QT7A 3BW1A 1OPLA 1FMWA 4M75D 2MWOA 4PJOE 2OJ2A 2G6FX 1K4US 1ZA1B 1PSFA 4C8QD 3CXCP 5GAMg 1I1JA 1C6VX 4AFQC 5KE2A 5AYFA 5HK0A 2LP5A 4C92D 4M7AD 3CEYA 2AHJB 1AOJA 4J83A 2HDAA 2BZ8A 1SHGA 1WA7A 4M7DE 1TXQA 2E3HA 2OI3A 1AWXA 1N9RA 2DFUA 2EYYA 3EHRA 2RQUA 4F16A 2IG0A 5FWCA 2A08A 1M2VA 2PVGB 4KH1B 4C0FA 3RIRA 1PCXA 1WHMA 1PRLC 2NLUA 2E1HA 1Q81R 2MK5A 2D1XA 1K9MU 2QASA 5CKFA 2KYBA 2GQVA 5LJ5d 4Z02A 2E10A 3CCMA 2X3XD 3CCVQ 3EH2A 3MO8A 2FZKB 4JRKA 4M78F 1IGUA 1WQ7A 4PJOF 1YNZA 4WF2A 3JCMX 1MUZA 1TU0B 2HQHA 2HQEA 4MMKA 4NL2A 1D0YA 3QDFA 1NE8A 3WVDB 4J6XA 2NUPA 3OS2A 3PGGA 2KY9A 4JZ4A 3VYGA 1RACB 3EFOA 3LH5A 3M56A 4AFZC 1GXIE 4O5VA 4OMMA 4AG2C 2LX9A 3G71T 5KYXB 2DERA 5J39A 3CPWS 4FYWB 2GQIA 4HCZA 1Q7YU 5LJ3h 2ZPEB 3EGUA 2DL8A 3JAME 2ROLA 1YCSB 2HQXA 3HRUA 3CMAT 2FRWA 3PE0A 2QG9B 3EGXA 3JB9F 1OX9A 4HKEA 2F5TX 1G3TA 2P4TA 1OZ3A 4M78B 3OMCA 1NLOC 3TSZA 4VUBA 4CC4B 1C0MA 2LZ6B 5GAOp 4JDSA 2LCSA 2HMAA 3G4ST 2ZGWA 1WLPB 4CRIA 2FZGB 2R5MA 2ZPHB 3JSCA 3E9FA 2QEXA 1ZQ1A 5CKBA 1I5LA 5GAMh 1RAIB 1GL5A 5GANh 5CKEA 1WHHA 2CSIA 2V8KA 3G71Q 1UFFA 2RJFA 1Y96B 3C12A 3UT1A 2K7AA 3CD6A 3M0TA 2CGHA 2HZYA 2RHYA 2YRVA 1VIEA 4M78C 1X01A 1N6AA 1ZHIA 3MP1A 1M2VB 1ZUKA 1K9AA 3C95A 1QVPA 2YXYA 2OTJT 3CCST 3M4GA 1M27C 1PSEA 4E7IA 2QA4T 2O9SA 1MMNA 3CMAQ 2RH2A 2ZCFB 1VQNT 1X27A 1KJWA 1Q82C 1KQ1A 4C5EA 1G3WA 1K9MC 8AT1B 3I5SA 3A1PA 3M0QA 3JV3A 4OB0B 4NL3A 1WXTA 5C6SA 3HSBA 2EJGA 4PJOG 2M0OA 4B6MA 3WXMB 1W2BP 2YUNA 2DXTA 1JJ2A 3A8HB 1WI7A 2DVJA 3M9QA 3EFOB 2JM9A 3C0CA 3G4SQ 2DL3A 4AFSC 1X69A 4M75A 1M9SA 1MMDA 2E65A 3NTIA 2COYA 4UC4A 3CC2A 9ATCB 1ZA2B 2M1HA 3QG1A 4HVWA 1VQKT 1WFWA 1QQJA 4X34A 1KG1A 3L42A 1UE9A 4M7AA 5FRMA 1JBMA 2O4XA 3NTKA 2QXFA 2XICA 2C0IA 2K2MA 5LJ3e 3OS5A 4ZTJA 2PTKA 1R8OB 1D3BA 3CCUA 2VGMA 3CC7Q 3JB9H 1FX7A 3CCSQ 4BE0A 2QA4Q 3GOXA 2W10A 4L59A 4XTUA 1VQ6A 1VQNQ 3RMQA 2X35A 2GGRA 2LCLA 3CCEA 3V7CA 1QWEA 2M0YA 3HFNA 2DM1A 2O9VA 4FCYA 1YP5A 4MZMA 3OS1A 4Y91A 2RJEA 2VGNA 2O2OA 2VUBA 5GAN3 2ABLA 2M51A 1KFZA 5GAOn 2XDDA 2DRMA 2KNBB 3TQ7P 4LE9A 3EG0A 2YUPA 1YHQT 3QKJA 2DBKA 2HD0A 4PJOD 4IUQA 3PMTA 1RI9A 2DXBA 3DKMA 2DD5A 2GTOA 4HT9A 3MHXA 4M75F 5GAMe 3CMET 4FL6A 2QQ9A 2XKOC 2CT4A 5GANe 2NWMA 3EG1A 2A7YA 1NYGA 2GNCA 3JCMc 5LJ3f 4A4GA 2ED1A 1VQKQ 2YWWA 1OEBA 3M54A 1QVGA 2COWA 4N4HA 1SSFA 3A8LB 4M7AF 2KI7A 2LMJA 1G5VA 3JB9I 2XDBA 2F2WA 1VQOT 3QHSA 1NJIC 4A4FA 3OQ5A 3OYBA 1VUBA 4FSSA 1KK7A 2PNIA 2BIVA 1WHLA 3LWHA 2RMOA 2RF0A 3DB4A 1YJWQ 4XQ3A 2CZ0B 3JB9D 2F69A 1B34B 4EMKA 5GAMj 2EGCA 2CSQA 3JCMf 3M57A 4M77B 3VS5A 4FYVB 1VQPA 5I2MA 1VQLT 1Q86R 1KSWA 4AT1B 2L0AA 5KYYA 3I56A 2KSSA 4XAXB 2D6FA 4RTWA 4LDXA 3VYHB 2C06A 4M75B 1VIFA 4C8QB 1VYUA 2RM4A 2ZPGB 2V1RA 2L3PA 2JW4A 5GAMf 3MP6A 1RABB 5GANf 1YHQQ 2HBWA 2BE9B 3EG2A 1NBEB 2E12A 3G1JA 4F04B 4C92B 5M9OA 3MJXA 4M7AB 1CKAA 2O4XB 3CMEQ 3CCLT 5GAN2 3OYFA 1WDXA 1N8RC 1AHJB 1U5SA 4QW2A 3TCJA 2C0OA 3L2RA 5C0MA 3EGDA 2QGGA 3M58A 2FB7A 1RLQC 2YDLA 4PLLA 1WIEA 3M4YA 3EG3A 4M77C 2NUZA 1VQOQ 1GCPA 1UGSB 4PJLA 4DBFA 4KGXB 1HK9A 4M75C 4HCCA 5IH2A 5L8RE 5FU7B 4C8QC 3C4SA 2D0NA 3L2QA 1QP3A 3V7RA 3QO3A 3J81E 2PUKB 2JN0A 2LTOA 4C92C 2L89A 3G7ZA 1VQLQ 4M7AC 2ATCB 2HCKA 3JCMP 1J3TA 2W0ZA 1M90U 4J9DA 4J8OA 1VYTA 1Y7XA 3OYLA 3SD4A 3LX7A 3A8MB 3OYGA 3AT1B 2IPOB 2JM8A 4BDZA 2CYZB 2ZPBB 4C0GA 3KXTA 4R56A 2KYMA 4Q5WA 1D0XA 3LW5E 3BDUA 4PKCC 4QKUA 4DBHA 3INZA 3CCLQ 1G3YA 4JRPA 4HVVA 3ZEHA 2KXCA 1MNEA 4X1VA 3MEAA 4ANJA 3CCJA 2K3YA 3VUZA 4E7LA 2FYKA 2KR3A 1VQ8T 3FJPA 1T3LA 3CXCA 2DPPB 3PIOA 5KCOA 1KC8R 3HRTA 7AT1B 1GFCA 5AT1B 1LJOA 2FZCB 2XMFA 5LJ3g 3OYEA 1OQKA 4RUGA 4JJDA 2L2PA 5IHIA 4EPCA 4BE2A 1X75C 1ZUYA 1TWBA 1AWOA 2GF7A 4RMOA 4BB7A 1QWFA 1K73C 3BY7A 2JUFA 1XOVA 2LVMA 2L3QA 5GAN6 5LJ5h 3H41A 1UG1A 3UDCA 2E41A 1YJ9T 2P4RA 2JZ2A 4BI3A 5KE3A 3I9QA 3L1AA 2LJ0A 2JS0A 1YITT 4PJOA 1S72Q 1QP2A 1TTHB 2DEUA 2DK3A 3TEEA 1JO8A 1UJYA 3X26B 5CKDA 2RQWA 5CIUA 4MDXA 3IQLA 4JUVA 2LX7A 3EGDB 2NUTA 1N5ZA 4HA8A 1VQ4T 1D1BA 3EFSA 2BKDN 3E2UA 1SRMA 2C0TA 1M1GA 3X28B 1X6GA 4M7DA 2QI2A 2DJZA 1KQSP 2V8IA 2EFIA 5GANg 4IKFA 1NPRA 4FIBA 1W4SA 5FU6B 2A0FB 3KFVA 1VQ5A 1Y71A 1WJRA 2EGAA 1Q86U 1VQ8Q 3QIIA 1UTIA 2X4JA 4BY6B 5FWBA 4XTXA 2FL7A 1ZX6A 3NGPA 2DF6A 2FVUA 4Y92A 3VS2A 4RTXA 2K2VA 2PZ1A 1NPPA 5GJWB 1UJ0A 1RADB 2ENMA 2R58A 2XDPA 3BDLA 3EG9B 3FEOA 5CQYA 3VRZA 2LCCA 2CP5A 5CR2A 1QKXA 4B9WA 1OZ2A 3DLMA 1RLPC 2DIQA 2E4HA 4PJNA 3RESA 1HSQA 2COZA 4OMNA 2KT8A 2E5QA 5GAN5 3OBWA 2MAMA 2HSPA 2JVVA 2M02A 1JU5C 2G3RA 2LJ3A 1VQMA 1HD3A 1T0HA 1YJ9Q 3QPHA 4OB3B 2KE9A 1M90C 1JJ2S 4PFPA 2CP0A 2EVRA 5CK9A 2J7IA 1R77A 4HCBA 5FU6C 1OPKA 1UDLA 2E70A 5IT9E 1LPLA 3CBOA 2EQKA 4Z88A 3BFMA 1M1KC 3OYJA 3GIBA 4BY6C 1VQ4Q 4PNOA 3RKWA 5GAN7 4ZGJB 4M7DF 3RBBB 1ZBJA 3RKYA 3WVEB 3QJ6A 2DTIA 2E6ZA 2CH4A 2JOYA 1M1FA 4TVRA 2MPXC 3HTRA 1B3QA 1NEBA 2QQBA 3CMAA 1K8AC 3FIFA 1AVZC 3OYHA 1FMKA 4KBMB 2OX7A 2R57A 4R0KA 1KD1R 4QQ6A 3CC4A 4AG1C 1A0NB 1X2QA 1Z9ZA 3X20B 1I5OB 3MCAB 2AKLA 1NLPC 3I55A 1QVFP 1IHVA 5LJ5e 1U3OA 1SPKA 4PJOB 3OYKA 3OSVA 1WZOA 4ZN1A 1CKBA 5IN1A 5HK3A 2F5KA 1PD1A 1YWPA 2HEQA 1X2KA 2KGTA 2PVOB 3CQTA 3OSSC 1U1TA 2L3RA 2NUTB 3OYDA 1YJNT 4ATOA 4RTTA 3CCRA 2RN8A 2VXEA 3H0IA 3HFOA 5A2QE 4J5YA 1CSKA 3CPFA 1TUGB 1ZBXA 2XIDA 3QUIA 5CVIA 3V8JA 2EQJA 1W2BA 4DOVA 4JS5A 2QYZA 4GBQA 1MHNA 1TUDA 3KBGA 1QVGS 5I22A 1GCQA 1OU8A 2CUBA 4ELYC 5A0DA 3CC7A 1M3BA 1YIJT 1C1AA 1GBRA 3OY9A 2EPDA 5CAIA 3OA6A 4PJOC 2A36A 1VQNA 2K6DA 4KGZB 5GAOl 4OVAA 3PMIA 3PVQA 4J9IA 2QEXT 2DX1A 2SRCA 1VQ9T 3LWIA 3CCQA 3E1SA 3GBQA 2XHCA 2I0NA 1XTDA 4E7KA 1WNLA 3MPUB 3VU3C 1HYOA 2DMOA 5IHKA 3Q1JA 2M9UA 1B07A 1SHFA 2HSEB 4B9XA 2XK0A 2CZ1B 3CD6T 4GLMA 2I2LA 4KUIA 1AEYA 4D8KA 1AZGB 1YJNQ 3OYYA 1DJ7B 2NUPB 5CQXA 3REAB 2HKQB 1H3HA 5KCHA 2YLBA 1FWZA 3PFSA 1QMCA 2DE0X 2ZZDA 2AT1B 4C0DB 1WX6A 4HVUA 1RAAB 2ESWA 2RHXA 4M7DG 4C0ZA 2P84A 4LUEA 3JCMd 1Q81U 3LGLA 1OX8A 1WHJA 2GBQA 4JRIA 1ACMB 3EGXB 3OMGA 4JJCA 3OW2A 1YIJQ 1Q7YC 1EFNA 1BIBA 5HY6A 1YJWA 4DEXA 4ZGDB 2EYQA 2LNVA 3META 2VWFA 4MDWA 2OTLT 2OTJQ 3NPFA 2CS7A 2RJDA 2ZAEA 2BZYA 2DKGA 2QEXQ 5GAMd 1XNIA 3M55A 1VQ9Q 5GANd 1M3AA 3CC2T 3FC3A 1QKWA 3MEWA 4J9FA 5KYNA 3J80E 2XG8D 4C8QE 2X3WD 3SHWA 3VV0A 2PU9B 1FYNA 4RTUA 2DYBA 2HKNA 4F7UE 4J9HA 2H3EB 1BI2A 3X25B 3LGFA 4C92E 3R6OA 4C0DC 2VC8A 1EX4A 4KRTA 1QCOA 1PM3A 1KQ2A 5LJ3j 1I0CA 4FU6A 5CCAA 2EW3A 3CMEA 4HCKA 3M5AA 2JNGA 5FRNA 1HJDA 4RG2A 1VQ6T 2LRQA 1KD1U 4BDYA 2OAWA 3GNFB 3JRZA 1AWWA 3CCET 5L23A 3D7SB 4OGCA 1VQ7T 2CP6A 2J6OA 3OW2P 2FPDA 3RERA 2IIMA 4OP0A 4LD9K 2A37A 2DTOA 2DNUA 2QAZA 2DVEA 4KT0E 3OYNA 4M7DD 2XD0A 2F2XA 3CXCS 3G6EA 1Y57A 2CP7A 3NFCA 3JB9J 1SG5A 3SWNA 5EG2A 3CPWP 3M0PA 5GJVB 2DZCA 2E3IA 4A4HA 2OTLQ 4Z89A 4JRQA 3OBYA 4BI8B 3S3MA 3S3OA 1JXMA 3CC2Q 3X24B 1D09B 1SF9A 1UEBA 1BYMA 4JLGA 5FLXE 5GANj 5A0LA 1V29B 1RI0A 1ZSGA 3A5ZB 4GLKA 1TOVA 4LDVA 4IUVA 2LDMA 5KH6A 4WCIA 1K76A 1WHKA 5LJ5g 2X51A 2X4WA 3F70A 3RMSA 5DLOA 3UA6A 4RTVA 3CCLA 4OMOA 4FT2A 3ZL7C 1MV0B 2Y4YA 3M59A 3URGA 4PJJA 3VS7A 1VQ6Q 4IURA 2M16A 4DA4A 1OYXA 1UHFA 4OMLA 1BCMA 1WXBA 3PVLA 1VQPT 3S3NA 3CCEQ 3RUXA 5IHNA 3REBB 1VQ7Q 3LYIA 3P8DA 3I56T 2P0PA 1D3BB 3RDVA 2DAQA 4FYYB 1Q81C 4ORZA 4LNPA 1X6BA 2RNAA 1Q82R 1BI1A 3QZ9B
chains in the Genus database with same CATH topology
2CZ6B 4HA8A 1VQ4T 2EQUA 3EFSA 2BKDN 3QZ5B 5GAN4 1M1GA 4O6JA 3JB9G 2PUOB 4JLIA 3X28B 4VUBA 1YHQA 1YI2A 4M7DA 3M53A 2QI2A 4XTZA 3ZFJA 1YJWT 2DJZA 4M7AE 2V8IA 4IUTA 3CCUT 2EFIA 3E9GA 3CBMA 5GANg 4IKFA 1NPRA 1WQWA 1W4SA 4FIBA 5FU6B 5GAOp 3OYMA 3UPUA 4JDSA 2E6NA 2K5IA 3TU4K 3G4ST 1VQ5A 1UGRB 1Y71A 1WJSA 5DM7R 4LDWA 1WJRA 2R5AA 2ZGWA 4QQGA 1Q86U 4CRIA 2RHIA 1KC8C 1VQ7A 2R5MA 3NTHA 4C5GA 1S72A 2ZPHB 3JSCA 2X4JA 3QIIA 3E9FA 4BY6B 1ZQ1A 2QEXA 3H8ZA 4XTXA 1U1SA 4RCBA 2FL7A 5CKBA 3JCMe 3CXCA 1I5LA 2HAXA 2FVUA 3OS0A 5GAMh 3TREA 2K2VA 5GANh 1NPPA 4J6WA 3P8BB 2R58A 2XDPA 3BDLA 5CQYA 3FEOA 5CKEA 4PLIA 2LCCA 2V8KA 5CR2A 4M77F 2K5LA 4B9WA 2RJFA 1OZ2A 3HP9A 1Y96B 2HNIA 4M78D 1VQOA 3C12A 3DLMA 4JRPA 3UT1A 2DIQA 4Y28E 3RESA 2GFUA 3HPWA 3CD6A 1I8FA 2E5QA 5GAN5 3OBWA 2CGHA 2RHYA 4M78C 2YRVA 1VIEA 1X01A 2MAMA 1QW1A 1N6AA 1ZHIA 2JVVA 3MP1A 4E47A 1KQSS 2G3RA 3C95A 1QVPA 3LLRA 4E7HA 3OB9A 3CCST 2OTJT 4C8QF 1VQMA 3M4GA 1Y07A 1PSEA 4E7IA 2QA4T 1KHCA 1MGQA 2EJFA 3QPHA 4OB3B 4N0AA 4F7UF 1NZ9A 1M90C 3SFMA 1JJ2S 4P5NA 2RH2A 2ZCFB 4IUPA 1VQNT 4QVDA 2ZPIB 2RHUA 4FSXA 3VJPA 4C92F 1VQLA 2X4YA 5CK9A 1HXDA 5GAN8 4DOWA 3DLLA 4HCBA 5FU6C 1UGQB 1KQ1A 4C5EA 1Q82C 4J7FA 1RL2A 5FU7C 4ZGEB 2E70A 2JTFA 2CKKA 1LNXA 2LT4A 3CBOA 2EQKA 1G3WA 4PL6A 4C8QG 5IT9E 1K9MC 1JB0E 2GFAA 3BFMA 2DEQA 1M1KC 5GMKe 1KQSA 4OB0B 3OYJA 5D6YA 4EMKB 3GIBA 4BY6C 3UWNA 4F7UG 4NL3A 3E19A 3PIPA 2QQAA 3FB9A 5C6SA 3G6ET 4PNOA 2EJGA 3HSBA 4PJOG 2M0OA 3RKWA 3WXMB 5GAN7 4QVZA 5LL6S 4ZGJB 2A3LA 2DXTA 2MMPA 1JJ2A 4M7DF 3A8HB 3RKYA 1LOJA 1WJQA 2DTIA 3QJ6A 2E6ZA 3WVEB 2JOYA 3M9QA 1M1FA 2YLCA 3FRNA 2LQ8A 2DTHA 2PVDB 2DXUA 4TVRA 4M75A 1K73U 3CCVA 5A0GA 1M9SA 3CMAA 2QQBA 2KQWA 1K8AC 4IUUA 3CCJT 5DY9A 5J26A 2L5QA 3FIFA 3OYHA 2E65A 3NTIA 3V7SA 2XI9A 4KBMB 2R57A 4ELZC 4UC4A 3CC2A 2WSFE 2KDSA 2M1HA 3QG1A 4QQ6A 3CC4A 1VQKT 3HKSA 4V2SA 4RG8A 3X20B 4NS5A 4N4IA 1OI1A 4X34A 1KG1A 3L42A 2WSCE 3MCAB 4XTVA 4MMLA 3VUBA 3MEUA 4M7AA 2EAYA 3V8KA 1JBMA 3I55A 1YCYA 5D6XA 4F7UB 2O4XA 5FRMA 3NTKA 2QXFA 2XICA 5GMKj 5I21A 4E7JA 5LJ3e 5LJ5e 3OS5A 4PJOB 5GMKi 3OYKA 4ZTJA 3OSVA 4L5GA 4ZN1A 5IN1A 1R8OB 5HK3A 4D6WA 1W2BS 1D3BA 2F5KA 3FLGA 3CCUA 2VGMA 4J7IA 2RO0A 2Y4XA 2RHZA 1FX7A 3JB9H 4EMKC 2LQKA 4BE0A 3AHUA 3T9NA 2GCXA 2DXCA 2RI3A 1U8RA 2PVOB 3OSSC 3V8LA 1U1TA 2L3RA 3OYDA 3GOXA 1YJNT 4L59A 4ATOA 4EMGA 1N27A 2H3JA 2MF2A 3CCRA 4A54A 4XTUA 2VXEA 4DQ2A 1VQ6A 3GP8A 3HFOA 3RMQA 2X35A 3PT9A 5A2QE 4LDUA 4OGEA 2LCLA 2OAUA 3GF5A 2Y90A 4L6V5 3CCEA 4J5YA 3V7CA 2DO3A 3GNGA 3HFNA 3CPFA 4KUDK 1ZBXA 2XIDA 3QUIA 5CVIA 3V8JA 1XQHA 2EQJA 4R55A 1W2BA 4MZMA 2EWNA 4DOVA 3OS1A 4JS5A 4M78E 4Y91A 4EMHA 2RJEA 2VGNA 1QVFS 4LDYA 1MHNA 5CKHA 3OYAA 1N9SA 2VUBA 3C94A 3H6ZA 2KVQG 1YBYA 3KBGA 5GAN3 1QVGS 4XU0A 5GAOn 2XDDA 3QYGB 4ELYC 5A0DA 3MP8A 3CC7A 1YHQT 2VYTA 1UGPB 3QKJA 2HD0A 5GMKm 1YI2T 1WPYA 4IUQA 4XTYA 4PJOD 3PMTA 5GMKl 1YIJT 2DXBA 3DKMA 4NOYA 4CI0C 3OY9A 2DD5A 2RK1A 3HL8A 5CAIA 3OA6A 4BD3A 3N5BB 1VQ5T 4PJOC 4HT9A 3MHXA 4M75F 4OF1A 5GAMe 3CMET 1KD1C 4FL6A 1VQNA 2K5FA 2QQ9A 2XKOC 5GANe 5GAOm 3PNWC 1Y96A 3EAEA 5GAOl 2A7YA 3LH0A 2LC4A 4OVAA 1S72T 3PMIA 1QVFA 2B8AA 1BKBA 2QEXT 3JCMV 3JCMc 2EQMA 2P0QA 3ME9A 4M77G 3OYIA 5LJ3f 4A4GA 3L2UA 1VQ9T 1VQ8A 1M8VA 5D6WA 3M54A 4A53A 1QVGA 2V8JA 3LWIA 3QYHB 3CCQA 4JJNK 3E1SA 4N4HA 3SWNB 1SSFA 3GLXA 2XHCA 4KULA 2VV5A 1XTDA 3A8LB 1Q82U 1X6OA 2D0QB 2MWPA 4E7KA 1WNLA 4M7AF 3VU3C 4M75G 1G5VA 3Q1JA 3JB9I 4OB2B 4N4GA 4RKUE 4XU3A 1VQOT 3QHSA 2XDBA 2BUDA 1NJIC 2M9UA 2HBPA 4BUGA 2L8DA 1M4ZA 4A4FA 1M1KU 3OQ5A 3KUFA 3OYBA 1VUBA 3G71A 2WACA 4B9XA 4ZN3A 2XK0A 2CZ1B 2KMTA 3CD6T 2LT1A 4HT8A 2P0KA 4XTWA 2BIVA 3JCMQ 3LWHA 2I2LA 4II1A 4FT4A 3DB4A 4C92G 4KUIA 1VQMT 1BIAA 4M7AG 3OYCA 3OYYA 4XQ3A 1DJ7B 1IZ6A 2CZ0B 1I81A 3HRSA 2F69A 5CQXA 1B34B 4EMKA 1I4K1 1WGSA 3JB9D 3CCMT 4A4KA 5GAMj 2X4XA 4GY5A 5KCHA 3JCMf 2K4YA 2PQWA 2DIGA 2YLBA 3M57A 4XU1A 4BE1A 3OW2S 4M77B 1YJ9A 3J7AF 1K8AU 3QJYA 1VQPA 5I2MA 3QSUA 1FWZA 1VQLT 1BI0A 2DZ9A 3HHTB 3PFSA 1YITA 3I56A 2KSSA 2ZZDA 4XAXB 2QDYB 4C0DB 2MI6A 2D6FA 4LDXA 1H3ZA 3VYHB 2C06A 4M75B 1VIFA 4X9CA 5CO7A 4M7DG 1FXXA 2RHXA 4C0ZA 4J6YA 4ZTFA 2IVWA 2VXFA 4OMFB 4C8QB 3P8HA 2RM4A 2ZPGB 2EKOA 3DB3A 3JCMd 2RJCA 3A8OB 5GAMf 1Q81U 3MP6A 1VQ4A 3LGLA 5GANf 2DD4A 3SWNC 3L2ZA 4JRIA 3OMGA 2E12A 3OW2A 4FM4B 2XU8A 2YHTA 4N0AC 4C92B 5M9OA 1Q7YC 1EIFA 4M7AB 1O75A 1BIBA 3SDZA 2WSEE 5HY6A 1O9SA 4XK8E 1YJWA 1YJNA 2O4XB 1KHIA 4ZGDB 3CBPA 2EYQA 3CCLT 2RB6A 5GAN2 3OYFA 2LNVA 3META 4MDWA 3CCVT 1N8RC 5J3BA 4RCCA 2OTLT 2CS7A 3G4SA 2RJDA 4M78A 1AHJB 2DKGA 5IAYA 4QW2A 5GAMd 3TCJA 1XNIA 3L2RA 3M55A 2RK2A 3JCMg 5C0MA 2K3XA 5GANd 3CC2T 4QVCA 3FC3A 3M58A 2JTMA 3CC4T 4MZTA 3JCMJ 3MEWA 2QTXA 2FB7A 4BACA 4M77D 4MZPA 1IREB 2XG8D 3J80E 4C8QE 4M7DB 4PLLA 1KC8U 4XU2A 1G3SA 3VV0A 2PU9B 1H641 3M4YA 4BI4A 3I55T 4M77C 4F7UE 1UGSB 3BW1A 4M75D 1BI2A 2MWOA 3LGFA 3X25B 4PJOE 4C92E 2KAFA 3R6OA 4X9DA 2VC8A 5FROA 3EFRA 4C0DC 3JCMh 1PSFA 4C8QD 1YIJA 1HK9A 5GAMg 4M75C 4HCCA 1JRIA 2KK4A 4LD6A 5LJ3j 5LJ5j 1KQ2A 4FU6A 2EIFA 5L8RE 5CCAA 5FU7B 4C8QC 3CMEA 5KE2A 3C4SA 5AYFA 5HK0A 5GAOr 3L2QA 3A8GB 3M5AA 2OTJA 3CCSA 4C92D 2JNGA 5FRNA 2ZPFB 4RG2A 1Q86C 3CEYA 4M7AD 2QA4A 2AHJB 3CCRT 4C5IA 1QP3A 3FDRA 3V7RA 3O8VA 3QO3A 2D9TA 2LRQA 3L2VA 3J81E 1VQ6T 2QQSA 2PUKB 4J83A 1KD1U 1VQ9A 4BDYA 2JN0A 2LTOA 3ER0A 3GNFB 2L89A 3G7ZA 4C92C 3JRZA 4M7AC 4M7DE 3CCET 1M5Q1 3JCMP 4OGCA 1VQ7T 1N9RA 3RERA 1M90U 3ASKA 3ZBDA 4J8OA 5LJ5f 1Y7XA 4OP0A 2QQRA 2IG0A 3OYLA 3SD4A 2PVGB 2DTOA 4LD9K 3QBYA 2DVEA 4KT0E 3OYNA 4M7DD 3LX7A 4C0FA 2XD0A 3RIRA 3A8MB 3OYGA 2CZ7B 4BDZA 4OB1B 2NLUA 2CYZB 2E1HA 2ZPBB 4QQDA 4C0GA 4R56A 3KXTA 3CXCS 3G6EA 4Q5WA 1NJIU 4EDUA 1K9MU 3CC7T 4M7DC 3GPLA 3LW5E 3BDUA 3NFCA 4PKCC 5CKFA 2RA2A 3QDRB 3JB9J 3SWNA 3INZA 5EG2A 1BI3A 2GQVA 3S6WA 1G3YA 2EJ9A 4Z02A 2E10A 5LJ3d 5GMKh 5LJ5d 3PTAA 3ZEHA 3CCMA 2DZCA 1TH7A 4A4HA 1UB4A 4JS4A 3MO8A 4JRQA 4JRKA 3OBYA 4M78F 4PJOF 1WQ7A 3VKIA 3MEAA 4BI8B 4WF2A 3JCMX 3S3MA 3CCJA 3S3OA 4ME7A 1P92A 2K3YA 2HQEA 3X24B 3VUZA 1UEBA 4E7LA 4MMKA 2FYKA 4JLGA 1BYMA 4NL2A 1VQ8T 3FJPA 5FLXE 5GANj 5A0LA 3CCQT 1V29B 1RI0A 1NE8A 2DPPB 3JCMb 3A5ZB 2K57A 3WVDB 5KCOA 3PIOA 3L2WA 4GLKA 1VQKA 4J6XA 3HRTA 4LDVA 5KH6A 4IUVA 2LDMA 3MEVA 1LJOA 3OS2A 3PGGA 1B34A 2KY9A 5LJ5g 5LJ3g 3OYEA 3VYGA 3RKXA 2RI2A 4M78G 2X4WA 3M56A 4C5HA 1GXIE 4O5VA 4YTLA 4M77A 2LX9A 3G71T 4EPCA 3F70A 2RD1A 3RMSA 5DLOA 5HKCA 2FHDA 4BE2A 1X75C 2RI5A 3CCLA 2E64A 4A4EA 2GF7A 4RMOA 5J39A 3CPWS 4BB7A 4FT2A 2OTLA 3M59A 2Y4YA 4HCZA 3URGA 1Q7YU 1K73C 3BY7A 2JUFA 3QXEB 1XOVA 2LVMA 4C8QA 5LJ3h 5GAN6 5LJ5h 4IURA 2M16A 5GAOq 4DA4A 1OYXA 3UDCA 2ZPEB 2E41A 1YJ9T 1N8RU 2JZ2A 3JAME 4F7UA 2HQXA 4BI3A 4M77E 5KE3A 3S3NA 1VQPT 3HRUA 3RUXA 3L1AA 3CMAT 5DLQE 1YITT 3LYIA 3P8DA 3I56T 4PJOA 3JB9F 2P0PA 1QP2A 4C92A 1D3BB 2DK3A 3TEEA 2DAQA 4HKEA 3X26B 2F5TX 1G3TA 4M75E 5CKDA 1Q81C 5I2SA 2P4TA 1OZ3A 4M78B 3JCMW 5CIUA 3OMCA 4MDXA 3SB2A 3CPWA 4JUVA 1BI1A 2O01E 3QZ9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIF A;  2JN0 A;  2E65 A;  4HA8 A;  4C92 C;  4M7A C;  3EFS A;  3V7S A;  4M7D E;  4HT8 A;  5GAN 4;  4XTW A;  1M5Q 1;  3JCM P;  3JB9 G;  4JLI A;  1N9R A;  3JCM Q;  4M7D A;  4M7A E;  2I2L A;  4XTZ A;  4V2S A;  2DJZ A;  3RER A;  4C92 G;  5LJ5 f;  1BIA A;  4M7A G;  4OP0 A;  4XTV A;  5GAN g;  4MML A;  4XQ3 A;  4M7A A;  1WQW A;  2EAY A;  3V8K A;  1JBM A;  1I81 A;  1YCY A;  5GAO p;  2DTO A;  1B34 B;  4EMK A;  1I4K 1;  2DVE A;  4F7U B;  3JB9 D;  4M7D D;  5GAM j;  3RIR A;  5GMK j;  2ZGW A;  5I21 A;  5LJ3 e;  3JCM f;  5LJ5 e;  2YLB A;  4PJO B;  4XU1 A;  5GMK i;  4M77 B;  2E1H A;  3QSU A;  4M7D C;  1D3B A;  2DZ9 A;  4XTX A;  1U1S A;  4RCB A;  3BDU A;  3JCM e;  2RA2 A;  1I5L A;  3JB9 J;  3SWN A;  3INZ A;  3JB9 H;  5GAM h;  4EMK C;  2EJ9 A;  4M75 B;  5LJ3 d;  2E10 A;  5GMK h;  4X9C A;  5LJ5 d;  5GAN h;  3AHU A;  2DZC A;  1TH7 A;  4J6W A;  4M7D G;  4J6Y A;  3V8L A;  2VXF A;  1U1T A;  4C8Q B;  4JRK A;  4EMG A;  2RM4 A;  4M78 F;  1WQ7 A;  4PJO F;  4A54 A;  4M77 F;  2VXE A;  4XTU A;  4WF2 A;  4DQ2 A;  3JCM X;  3JCM d;  3HFO A;  1Y96 B;  2HNI A;  4M78 D;  5GAM f;  5GAN f;  3RES A;  4MMK A;  2FYK A;  3SWN C;  2Y90 A;  4NL2 A;  3FJP A;  3L2Z A;  5GAN j;  1I8F A;  4J5Y A;  4JRI A;  3V7C A;  5GAN 5;  2YHT A;  2CGH A;  3HFN A;  4M78 C;  4N0A C;  4C92 B;  3JCM b;  3QUI A;  1X01 A;  4M7A B;  3V8J A;  2K57 A;  1BIB A;  4J6X A;  2EWN A;  4C8Q F;  1LJO A;  2RB6 A;  3M4G A;  4M78 E;  3PGG A;  1B34 A;  4Y91 A;  4EMH A;  5GAN 2;  5LJ5 g;  5LJ3 g;  4HT9 A;  4RCC A;  3RKX A;  1MGQ A;  2EJF A;  4M78 G;  4N0A A;  4M78 A;  1N9S A;  4F7U F;  4M77 A;  5GAN 3;  2DKG A;  4XU0 A;  5GAM d;  5GAO n;  2RD1 A;  3JCM g;  4QVD A;  5GAN d;  4C92 F;  4QVC A;  3JCM J;  2QTX A;  2FB7 A;  1HXD A;  5GMK m;  5GAN 8;  4PJO D;  1WPY A;  4M77 D;  4XTY A;  2E64 A;  1KQ1 A;  5GMK l;  4C8Q E;  4M7D B;  4NOY A;  4XU2 A;  5CAI A;  1LNX A;  1H64 1;  3BY7 A;  4C8Q G;  4PJO C;  4C8Q A;  5LJ3 h;  3BFM A;  4M75 F;  2DEQ A;  4M77 C;  4F7U E;  5GAM e;  5GAN 6;  5GMK e;  5LJ5 h;  5GAO q;  3BW1 A;  4EMK B;  5GAN e;  5GAO m;  3GIB A;  4M75 D;  2E41 A;  1Y96 A;  4F7U G;  4NL3 A;  5GAO l;  4PJO E;  4F7U A;  3FB9 A;  4C92 E;  4M77 E;  4PNO A;  2EJG A;  2VC8 A;  4X9D A;  3EFR A;  3RUX A;  3L1A A;  3JCM h;  4C8Q D;  3HSB A;  4PJO G;  3JCM V;  3RKW A;  3JCM c;  1HK9 A;  4M77 G;  5GAM g;  4PJO A;  5LJ3 f;  4M75 C;  4C92 A;  5GAN 7;  3JB9 F;  1JRI A;  1D3B B;  2DXT A;  4A53 A;  5LJ3 j;  5LJ5 j;  1KQ2 A;  4M7D F;  4C8Q C;  3RKY A;  1LOJ A;  3SWN B;  2DTI A;  1M8V A;  4M75 E;  5GAO r;  4M7A F;  1WNL A;  2YLC A;  4M78 B;  3VU3 C;  4C92 D;  3JCM W;  4M75 G;  2DTH A;  4M7A D;  2DXU A;  4M75 A;  3SB2 A;  3V7R A;  3QO3 A;  4JUV A;  3JB9 I;  4XU3 A;  3QHS A;  5DY9 A; 
#chains in the Genus database with same CATH topology
 2J6F A;  1K9M R;  4AFU C;  2LNH B;  2PUO B;  4E7Z A;  4JLI A;  1YI2 A;  2YSQ A;  1PNJ A;  4IUT A;  3E9G A;  3CBM A;  3UPU A;  1WQW A;  1YN8 A;  3OYM A;  2DET A;  2E6N A;  3TU4 K;  1F1B B;  1OV3 A;  4LDW A;  3H0H A;  2JMA A;  2AK5 A;  2RHI A;  3QWX X;  4LUD A;  4C5G A;  1S72 A;  2YRC A;  3H8Z A;  1U1S A;  4JPB W;  1XJW B;  1JQQ A;  1MMG A;  2LQW A;  4PLI A;  2K5L A;  1NYF A;  2HNI A;  1BB9 A;  2QGF B;  2RQT A;  4Y28 E;  4ZNX A;  1M2O A;  3HPW A;  3QWY A;  1I8F A;  2MCN A;  2YT6 A;  1QW1 A;  4E47 A;  2RQR A;  3OB9 A;  3VS6 A;  3R6N A;  4PK4 A;  4JZ3 A;  1KHC A;  2EJF A;  1VQP Q;  3U23 A;  1NZ9 A;  1R0C B;  1EZZ B;  3SFM A;  4IUP A;  4RTY A;  1AD5 A;  3I56 Q;  2ZPI B;  2RHU A;  3VJP A;  3RNJ A;  1E7O A;  1HXD A;  1IO6 A;  5GAN 8;  3DLL A;  3I5R A;  2D8H A;  1RL2 A;  1FMV A;  1T0J A;  5FU7 C;  2KT1 A;  1LNX A;  4C8Q G;  2GFA A;  2DEQ A;  1KQS A;  4EMK B;  4CC7 A;  2FPE A;  3UWN A;  4F7U G;  3BE3 A;  3FB9 A;  4FW2 A;  4PFZ A;  2A3L A;  2EYW A;  5KYY B;  2AIR B;  2RQV A;  2LQ8 A;  1D1C A;  2PVD B;  3CCV A;  5A0G A;  2LJ1 A;  2RPN A;  3CCJ T;  5J26 A;  2MYS A;  3H0F A;  5KYX A;  3V7S A;  2JTE A;  4ELZ C;  4F17 A;  3VS4 A;  2O31 A;  4JJB A;  3HKS A;  4RG8 A;  5KYW A;  4NS5 A;  2KRM A;  2WSC E;  4XTV A;  3VUB A;  3MEU A;  2EAY A;  3V8K A;  2K9G A;  2DIL A;  1ABO A;  5I21 A;  4E7J A;  1KIK A;  2VKN A;  1W2B S;  4J7I A;  1SEM A;  1NJI R;  4EMK C;  3O5Z A;  2L3S A;  1JEG A;  2GCX A;  2DXC A;  2SEM A;  3V8L A;  4EMG A;  2H3J A;  4AMC A;  2F1L A;  2MF2 A;  2DL7 A;  4A54 A;  3PT9 A;  1RAE B;  4LDU A;  4OGE A;  2Y90 A;  2CP3 A;  3GNG A;  4KUD K;  1XQH A;  1PRM C;  1IXD A;  4M78 E;  4EMH A;  4LDY A;  1NEG A;  1U06 A;  1TUC A;  1BCO A;  1YBY A;  4PJM A;  3MP8 A;  4E7S A;  2VYT A;  5GMK l;  4NOY A;  2RK1 A;  3HL8 A;  4OMP A;  4BD3 A;  1VA7 A;  1VQ5 T;  4OF1 A;  3CCJ Q;  2K5F A;  5GAO m;  1Y96 A;  3LH0 A;  2LC4 A;  3TVT A;  1QVF A;  3JCM V;  5I11 A;  2P0Q A;  1N8R R;  2AKK A;  4A53 A;  2J6K A;  1YIT Q;  3QYH B;  4JJN K;  2VV5 A;  4J9B A;  2D0Q B;  1Q82 U;  2GTJ A;  1GBQ A;  1W6X A;  3H9N A;  4N4G A;  2QK0 A;  1D0Z A;  2Z0W A;  3NHN A;  2HBP A;  1PC0 A;  1M4Z A;  4J9E A;  1IB8 A;  3G71 A;  1S1N A;  1H92 A;  2NYS A;  2KMT A;  4XTW A;  4FW1 A;  2E5K A;  4FT4 A;  1NG2 A;  1VQM T;  3OYC A;  1ZLM A;  3M0R A;  1I81 A;  3HRS A;  4LN2 A;  4KGV B;  1WGS A;  3CCM T;  1PG5 B;  2X4X A;  1ZUU A;  2K4Y A;  3OW2 S;  4BE1 A;  1BU1 A;  3VRY A;  1BI0 A;  4LXC A;  2QDY B;  1B7T A;  1H3Z A;  4X9C A;  1FXX A;  1LCK A;  4ZTF A;  4J6Y A;  2VXF A;  4KH0 B;  1K0S A;  2EKO A;  1Q95 G;  3A8O B;  1UEC A;  2AZV A;  5FW9 A;  1LVK A;  5KYW B;  3L2Z A;  4FM4 B;  2KRO A;  1O75 A;  1YJN A;  4XK8 E;  1VQ5 Q;  1KHI A;  3CBP A;  2RB6 A;  2YRD A;  2CDT A;  1G83 A;  3FJ5 A;  1M30 A;  1QCN A;  3G4S A;  1NM7 A;  2V1Q A;  2K3B A;  1R0B G;  2RK2 A;  3NMZ C;  2EYX A;  4QVC A;  2JTM A;  2X9H A;  3CC4 T;  3JCM J;  4BAC A;  1GFD A;  4M7D B;  1KC8 U;  4BI4 A;  3I55 T;  4IIM A;  2KAF A;  5FRO A;  4X9D A;  1QCF A;  3EFR A;  3JCM h;  4ESR A;  4WTO B;  1YIJ A;  2JJ9 A;  1JRI A;  2DL4 A;  2KK4 A;  4LD6 A;  5LJ5 j;  2EIF A;  2KEA A;  2QTV A;  1VQM Q;  5GAO r;  3A8G B;  2OTJ A;  2EKH A;  3CCS A;  4DEY A;  3CCM Q;  2ZPF B;  1YFN A;  1Q86 C;  2QA4 A;  3CCR T;  4C5I A;  3FDR A;  3O8V A;  2D9T A;  3L2V A;  2QQS A;  2HL3 A;  1VQ9 A;  3ER0 A;  3THK A;  1K73 R;  2A28 A;  2JXB A;  1M5Q 1;  3M0U A;  3ASK A;  3ZBD A;  5LJ5 f;  1TS9 A;  2QQR A;  1AWJ A;  3I35 A;  2VAS A;  1Y0M A;  1OOT A;  3QBY A;  2ED0 A;  4F14 A;  2CZ7 B;  4EIK A;  4OB1 B;  4QQD A;  1NJI U;  3CC7 T;  4EDU A;  4M7D C;  3GPL A;  2RA2 A;  3QDR B;  1BI3 A;  3S6W A;  2EJ9 A;  5LJ3 d;  5GMK h;  3PTA A;  1TH7 A;  1UB4 A;  1PHT A;  1QLY A;  4JS4 A;  1MND A;  3VKI A;  4ME7 A;  1P92 A;  3CC4 Q;  2B86 A;  4K11 A;  4M4Z A;  3CCQ T;  3JCM b;  3L2W A;  2K57 A;  1VQK A;  3I55 Q;  3MEV A;  2DBM A;  1B34 A;  1AT1 B;  4OMQ A;  2RI2 A;  4M78 G;  4C5H A;  4YTL A;  4M77 A;  2EQI A;  1M3C A;  2RD1 A;  2VVK A;  5HKC A;  1OUL A;  5HCK A;  3VS0 A;  2FHD A;  2RI5 A;  2E64 A;  4A4E A;  5IXF A;  1SSH A;  2OTL A;  3QXE B;  4C8Q A;  3CCR Q;  1SKU B;  4PFO A;  5GAO q;  1YWO A;  1D1A A;  1N8R U;  4F7U A;  4M77 E;  2KBT A;  5DLQ E;  4C92 A;  1M90 R;  4M75 E;  2HL5 C;  1E6G A;  5I2S A;  3JCM W;  3SB2 A;  3CPW A;  1M8M A;  2V26 A;  3ULR B;  3SEM A;  3RKX A;  2O01 E;  2DRK A;  1RUW A;  2CZ6 B;  2EQU A;  3QZ5 B;  5GAN 4;  4O6J A;  3JB9 G;  1M1K R;  1V76 A;  1YHQ A;  3CD6 Q;  3M53 A;  2FO0 A;  2JS2 A;  4XTZ A;  3ZFJ A;  1YJW T;  4M7A E;  1PD0 A;  3CCU T;  6AT1 B;  1H8K A;  2KXD A;  4DBR A;  1BK2 A;  2K5I A;  1UGR B;  1WJS A;  5DM7 R;  2R5A A;  4QQG A;  2YUQ A;  1KC8 C;  1JJ2 P;  1VQ7 A;  2BE7 D;  3NTH A;  1PWT A;  3CCQ Q;  2ROT A;  4RCB A;  3JCM e;  1K8A R;  2HAX A;  3OS0 A;  3TRE A;  2CT3 A;  4J6W A;  3P8B B;  1G2B A;  1WXU A;  1WHG A;  1JXO A;  4M77 F;  2AZS A;  2DJQ A;  1VQO A;  3HP9 A;  4M78 D;  4Z8A A;  2GFU A;  1UHC A;  5EC7 A;  2EYZ A;  4FYX B;  1KQS S;  2CP2 A;  3LLR A;  4E7H A;  4C8Q F;  1Y07 A;  1PKS A;  2O88 A;  1V1C A;  5KYU A;  1MGQ A;  4E2F B;  4N0A A;  4F7U F;  4P5N A;  4QVD A;  4FSX A;  4C92 F;  1VQL A;  2X4Y A;  4DOW A;  8ATC B;  1UGQ B;  4J7F A;  1ZSZ A;  4ZGE B;  2JTF A;  2CKK A;  2LT4 A;  4PL6 A;  4A63 B;  1JB0 E;  1GRI A;  3A98 A;  5GMK e;  5D6Y A;  1GCQ C;  3E19 A;  3PIP A;  2QQA A;  3G6E T;  1SRL A;  2QDL A;  1IRX A;  4QVZ A;  5LL6 S;  1X43 A;  2MMP A;  1BBZ A;  1Z9Q A;  3CCU Q;  1LOJ A;  1WJQ A;  2YLC A;  3FRN A;  2DTH A;  2DXU A;  1K73 U;  1MV3 A;  1UGV A;  2KQW A;  4IUU A;  5DY9 A;  2L5Q A;  1ABQ A;  2XI9 A;  4E6R A;  2DLP A;  2WSF E;  2KDS A;  2J05 A;  3MKD A;  4V2S A;  2FPF A;  4N4I A;  1RAF B;  1OI1 A;  5IXB A;  1K1Z A;  4MML A;  1W1F A;  1YCY A;  5D6X A;  4F7U B;  3UF4 A;  3EH1 A;  5GMK j;  1IGQ A;  1I07 A;  4RTZ A;  5GMK i;  1QVG P;  4L5G A;  4D6W A;  3FLG A;  2RO0 A;  4D8D A;  2Y4X A;  2RHZ A;  1WYX A;  2LQK A;  3AHU A;  3T9N A;  2RI3 A;  1U8R A;  2FEI A;  1N27 A;  4DQ2 A;  3GP8 A;  1E6H A;  2OAU A;  4IIO A;  3GF5 A;  2F2V A;  4L6V 5;  2DO3 A;  4R55 A;  2LQN A;  4DBQ A;  2EWN A;  1AZE A;  1QVF S;  5CKH A;  2MIO A;  3OYA A;  1RAH B;  3G6E Q;  1N9S A;  3C94 A;  1PKT A;  2KVQ G;  3H6Z A;  2CRE A;  4XU0 A;  2DL5 A;  3QYG B;  2EBP A;  4CC2 A;  3VS3 A;  5GMK m;  1UGP B;  1YI2 T;  1WPY A;  4XTY A;  2MOX A;  5D7U A;  4CI0 C;  1ARK A;  3EG9 A;  3N5B B;  1TG0 A;  1KD1 C;  3RR6 A;  1Q7Y R;  2FG0 A;  3PNW C;  2DYI A;  3EAE A;  1S72 T;  2FRY A;  2J06 A;  2B8A A;  1BKB A;  2EQM A;  3ME9 A;  4M77 G;  3OYI A;  3L2U A;  1M8V A;  2JT4 A;  1VQ8 A;  5D6W A;  5ECA A;  2EGE A;  2V8J A;  3SWN B;  3GLX A;  4KUL A;  5KYU B;  1X6O A;  2MWP A;  4J9C A;  3VS1 A;  4M75 G;  1G8X A;  4OB2 B;  4RKU E;  4XU3 A;  2BUD A;  4BUG A;  1M1K U;  1RAG B;  2L8D A;  3KUF A;  2WAC A;  4ZN3 A;  1UUE A;  2LT1 A;  4HT8 A;  2P0K A;  1ZSZ B;  3JCM Q;  2BTT A;  4II1 A;  2JMC A;  4C92 G;  1BIA A;  4M7A G;  1IZ6 A;  1I4K 1;  1VYV A;  4A4K A;  4GY5 A;  2PQW A;  2DIG A;  1YJ9 A;  4XU1 A;  3J7A F;  1K8A U;  3QJY A;  3QSU A;  3UA7 A;  3TSW A;  3HHT B;  2DZ9 A;  2KRS A;  1YIT A;  1VOM A;  3M0S A;  2MI6 A;  2CUD A;  5CO7 A;  2IVW A;  2ECZ A;  4OMF B;  3P8H A;  1IHW A;  3DB3 A;  2RJC A;  2D8J A;  2CH4 W;  4HXJ A;  1VQ4 A;  2DD4 A;  3SWN C;  1YI2 Q;  2H8H A;  1K0X A;  2XU8 A;  2YHT A;  2BZX A;  4N0A C;  1EIF A;  1MMA A;  1TSF A;  1T3S A;  3SDZ A;  2WSE E;  1O9S A;  2KRN A;  2K79 A;  1OU9 A;  3CCV T;  5J3B A;  4RCC A;  2VB6 A;  4M78 A;  1ZSZ C;  2YUO A;  3UAT A;  5IAY A;  3JCM g;  2K3X A;  2DA9 A;  4MZT A;  2QTX A;  4M77 D;  4MZP A;  1W70 A;  1IRE B;  4CC3 A;  3EHQ A;  4XU2 A;  1G3S A;  1H64 1;  4J9G A;  4QT7 A;  3BW1 A;  1OPL A;  1FMW A;  4M75 D;  2MWO A;  4PJO E;  2OJ2 A;  2G6F X;  1K4U S;  1ZA1 B;  1PSF A;  4C8Q D;  3CXC P;  5GAM g;  1I1J A;  1C6V X;  4AFQ C;  5KE2 A;  5AYF A;  5HK0 A;  2LP5 A;  4C92 D;  4M7A D;  3CEY A;  2AHJ B;  1AOJ A;  4J83 A;  2HDA A;  2BZ8 A;  1SHG A;  1WA7 A;  4M7D E;  1TXQ A;  2E3H A;  2OI3 A;  1AWX A;  1N9R A;  2DFU A;  2EYY A;  3EHR A;  2RQU A;  4F16 A;  2IG0 A;  5FWC A;  2A08 A;  1M2V A;  2PVG B;  4KH1 B;  4C0F A;  3RIR A;  1PCX A;  1WHM A;  1PRL C;  2NLU A;  2E1H A;  1Q81 R;  2MK5 A;  2D1X A;  1K9M U;  2QAS A;  5CKF A;  2KYB A;  2GQV A;  5LJ5 d;  4Z02 A;  2E10 A;  3CCM A;  2X3X D;  3CCV Q;  3EH2 A;  3MO8 A;  2FZK B;  4JRK A;  4M78 F;  1IGU A;  1WQ7 A;  4PJO F;  1YNZ A;  4WF2 A;  3JCM X;  1MUZ A;  1TU0 B;  2HQH A;  2HQE A;  4MMK A;  4NL2 A;  1D0Y A;  3QDF A;  1NE8 A;  3WVD B;  4J6X A;  2NUP A;  3OS2 A;  3PGG A;  2KY9 A;  4JZ4 A;  3VYG A;  1RAC B;  3EFO A;  3LH5 A;  3M56 A;  4AFZ C;  1GXI E;  4O5V A;  4OMM A;  4AG2 C;  2LX9 A;  3G71 T;  5KYX B;  2DER A;  5J39 A;  3CPW S;  4FYW B;  2GQI A;  4HCZ A;  1Q7Y U;  5LJ3 h;  2ZPE B;  3EGU A;  2DL8 A;  3JAM E;  2ROL A;  1YCS B;  2HQX A;  3HRU A;  3CMA T;  2FRW A;  3PE0 A;  2QG9 B;  3EGX A;  3JB9 F;  1OX9 A;  4HKE A;  2F5T X;  1G3T A;  2P4T A;  1OZ3 A;  4M78 B;  3OMC A;  1NLO C;  3TSZ A;  4VUB A;  4CC4 B;  1C0M A;  2LZ6 B;  5GAO p;  4JDS A;  2LCS A;  2HMA A;  3G4S T;  2ZGW A;  1WLP B;  4CRI A;  2FZG B;  2R5M A;  2ZPH B;  3JSC A;  3E9F A;  2QEX A;  1ZQ1 A;  5CKB A;  1I5L A;  5GAM h;  1RAI B;  1GL5 A;  5GAN h;  5CKE A;  1WHH A;  2CSI A;  2V8K A;  3G71 Q;  1UFF A;  2RJF A;  1Y96 B;  3C12 A;  3UT1 A;  2K7A A;  3CD6 A;  3M0T A;  2CGH A;  2HZY A;  2RHY A;  2YRV A;  1VIE A;  4M78 C;  1X01 A;  1N6A A;  1ZHI A;  3MP1 A;  1M2V B;  1ZUK A;  1K9A A;  3C95 A;  1QVP A;  2YXY A;  2OTJ T;  3CCS T;  3M4G A;  1M27 C;  1PSE A;  4E7I A;  2QA4 T;  2O9S A;  1MMN A;  3CMA Q;  2RH2 A;  2ZCF B;  1VQN T;  1X27 A;  1KJW A;  1Q82 C;  1KQ1 A;  4C5E A;  1G3W A;  1K9M C;  8AT1 B;  3I5S A;  3A1P A;  3M0Q A;  3JV3 A;  4OB0 B;  4NL3 A;  1WXT A;  5C6S A;  3HSB A;  2EJG A;  4PJO G;  2M0O A;  4B6M A;  3WXM B;  1W2B P;  2YUN A;  2DXT A;  1JJ2 A;  3A8H B;  1WI7 A;  2DVJ A;  3M9Q A;  3EFO B;  2JM9 A;  3C0C A;  3G4S Q;  2DL3 A;  4AFS C;  1X69 A;  4M75 A;  1M9S A;  1MMD A;  2E65 A;  3NTI A;  2COY A;  4UC4 A;  3CC2 A;  9ATC B;  1ZA2 B;  2M1H A;  3QG1 A;  4HVW A;  1VQK T;  1WFW A;  1QQJ A;  4X34 A;  1KG1 A;  3L42 A;  1UE9 A;  4M7A A;  5FRM A;  1JBM A;  2O4X A;  3NTK A;  2QXF A;  2XIC A;  2C0I A;  2K2M A;  5LJ3 e;  3OS5 A;  4ZTJ A;  2PTK A;  1R8O B;  1D3B A;  3CCU A;  2VGM A;  3CC7 Q;  3JB9 H;  1FX7 A;  3CCS Q;  4BE0 A;  2QA4 Q;  3GOX A;  2W10 A;  4L59 A;  4XTU A;  1VQ6 A;  1VQN Q;  3RMQ A;  2X35 A;  2GGR A;  2LCL A;  3CCE A;  3V7C A;  1QWE A;  2M0Y A;  3HFN A;  2DM1 A;  2O9V A;  4FCY A;  1YP5 A;  4MZM A;  3OS1 A;  4Y91 A;  2RJE A;  2VGN A;  2O2O A;  2VUB A;  5GAN 3;  2ABL A;  2M51 A;  1KFZ A;  5GAO n;  2XDD A;  2DRM A;  2KNB B;  3TQ7 P;  4LE9 A;  3EG0 A;  2YUP A;  1YHQ T;  3QKJ A;  2DBK A;  2HD0 A;  4PJO D;  4IUQ A;  3PMT A;  1RI9 A;  2DXB A;  3DKM A;  2DD5 A;  2GTO A;  4HT9 A;  3MHX A;  4M75 F;  5GAM e;  3CME T;  4FL6 A;  2QQ9 A;  2XKO C;  2CT4 A;  5GAN e;  2NWM A;  3EG1 A;  2A7Y A;  1NYG A;  2GNC A;  3JCM c;  5LJ3 f;  4A4G A;  2ED1 A;  1VQK Q;  2YWW A;  1OEB A;  3M54 A;  1QVG A;  2COW A;  4N4H A;  1SSF A;  3A8L B;  4M7A F;  2KI7 A;  2LMJ A;  1G5V A;  3JB9 I;  2XDB A;  2F2W A;  1VQO T;  3QHS A;  1NJI C;  4A4F A;  3OQ5 A;  3OYB A;  1VUB A;  4FSS A;  1KK7 A;  2PNI A;  2BIV A;  1WHL A;  3LWH A;  2RMO A;  2RF0 A;  3DB4 A;  1YJW Q;  4XQ3 A;  2CZ0 B;  3JB9 D;  2F69 A;  1B34 B;  4EMK A;  5GAM j;  2EGC A;  2CSQ A;  3JCM f;  3M57 A;  4M77 B;  3VS5 A;  4FYV B;  1VQP A;  5I2M A;  1VQL T;  1Q86 R;  1KSW A;  4AT1 B;  2L0A A;  5KYY A;  3I56 A;  2KSS A;  4XAX B;  2D6F A;  4RTW A;  4LDX A;  3VYH B;  2C06 A;  4M75 B;  1VIF A;  4C8Q B;  1VYU A;  2RM4 A;  2ZPG B;  2V1R A;  2L3P A;  2JW4 A;  5GAM f;  3MP6 A;  1RAB B;  5GAN f;  1YHQ Q;  2HBW A;  2BE9 B;  3EG2 A;  1NBE B;  2E12 A;  3G1J A;  4F04 B;  4C92 B;  5M9O A;  3MJX A;  4M7A B;  1CKA A;  2O4X B;  3CME Q;  3CCL T;  5GAN 2;  3OYF A;  1WDX A;  1N8R C;  1AHJ B;  1U5S A;  4QW2 A;  3TCJ A;  2C0O A;  3L2R A;  5C0M A;  3EGD A;  2QGG A;  3M58 A;  2FB7 A;  1RLQ C;  2YDL A;  4PLL A;  1WIE A;  3M4Y A;  3EG3 A;  4M77 C;  2NUZ A;  1VQO Q;  1GCP A;  1UGS B;  4PJL A;  4DBF A;  4KGX B;  1HK9 A;  4M75 C;  4HCC A;  5IH2 A;  5L8R E;  5FU7 B;  4C8Q C;  3C4S A;  2D0N A;  3L2Q A;  1QP3 A;  3V7R A;  3QO3 A;  3J81 E;  2PUK B;  2JN0 A;  2LTO A;  4C92 C;  2L89 A;  3G7Z A;  1VQL Q;  4M7A C;  2ATC B;  2HCK A;  3JCM P;  1J3T A;  2W0Z A;  1M90 U;  4J9D A;  4J8O A;  1VYT A;  1Y7X A;  3OYL A;  3SD4 A;  3LX7 A;  3A8M B;  3OYG A;  3AT1 B;  2IPO B;  2JM8 A;  4BDZ A;  2CYZ B;  2ZPB B;  4C0G A;  3KXT A;  4R56 A;  2KYM A;  4Q5W A;  1D0X A;  3LW5 E;  3BDU A;  4PKC C;  4QKU A;  4DBH A;  3INZ A;  3CCL Q;  1G3Y A;  4JRP A;  4HVV A;  3ZEH A;  2KXC A;  1MNE A;  4X1V A;  3MEA A;  4ANJ A;  3CCJ A;  2K3Y A;  3VUZ A;  4E7L A;  2FYK A;  2KR3 A;  1VQ8 T;  3FJP A;  1T3L A;  3CXC A;  2DPP B;  3PIO A;  5KCO A;  1KC8 R;  3HRT A;  7AT1 B;  1GFC A;  5AT1 B;  1LJO A;  2FZC B;  2XMF A;  5LJ3 g;  3OYE A;  1OQK A;  4RUG A;  4JJD A;  2L2P A;  5IHI A;  4EPC A;  4BE2 A;  1X75 C;  1ZUY A;  1TWB A;  1AWO A;  2GF7 A;  4RMO A;  4BB7 A;  1QWF A;  1K73 C;  3BY7 A;  2JUF A;  1XOV A;  2LVM A;  2L3Q A;  5GAN 6;  5LJ5 h;  3H41 A;  1UG1 A;  3UDC A;  2E41 A;  1YJ9 T;  2P4R A;  2JZ2 A;  4BI3 A;  5KE3 A;  3I9Q A;  3L1A A;  2LJ0 A;  2JS0 A;  1YIT T;  4PJO A;  1S72 Q;  1QP2 A;  1TTH B;  2DEU A;  2DK3 A;  3TEE A;  1JO8 A;  1UJY A;  3X26 B;  5CKD A;  2RQW A;  5CIU A;  4MDX A;  3IQL A;  4JUV A;  2LX7 A;  3EGD B;  2NUT A;  1N5Z A;  4HA8 A;  1VQ4 T;  1D1B A;  3EFS A;  2BKD N;  3E2U A;  1SRM A;  2C0T A;  1M1G A;  3X28 B;  1X6G A;  4M7D A;  2QI2 A;  2DJZ A;  1KQS P;  2V8I A;  2EFI A;  5GAN g;  4IKF A;  1NPR A;  4FIB A;  1W4S A;  5FU6 B;  2A0F B;  3KFV A;  1VQ5 A;  1Y71 A;  1WJR A;  2EGA A;  1Q86 U;  1VQ8 Q;  3QII A;  1UTI A;  2X4J A;  4BY6 B;  5FWB A;  4XTX A;  2FL7 A;  1ZX6 A;  3NGP A;  2DF6 A;  2FVU A;  4Y92 A;  3VS2 A;  4RTX A;  2K2V A;  2PZ1 A;  1NPP A;  5GJW B;  1UJ0 A;  1RAD B;  2ENM A;  2R58 A;  2XDP A;  3BDL A;  3EG9 B;  3FEO A;  5CQY A;  3VRZ A;  2LCC A;  2CP5 A;  5CR2 A;  1QKX A;  4B9W A;  1OZ2 A;  3DLM A;  1RLP C;  2DIQ A;  2E4H A;  4PJN A;  3RES A;  1HSQ A;  2COZ A;  4OMN A;  2KT8 A;  2E5Q A;  5GAN 5;  3OBW A;  2MAM A;  2HSP A;  2JVV A;  2M02 A;  1JU5 C;  2G3R A;  2LJ3 A;  1VQM A;  1HD3 A;  1T0H A;  1YJ9 Q;  3QPH A;  4OB3 B;  2KE9 A;  1M90 C;  1JJ2 S;  4PFP A;  2CP0 A;  2EVR A;  5CK9 A;  2J7I A;  1R77 A;  4HCB A;  5FU6 C;  1OPK A;  1UDL A;  2E70 A;  5IT9 E;  1LPL A;  3CBO A;  2EQK A;  4Z88 A;  3BFM A;  1M1K C;  3OYJ A;  3GIB A;  4BY6 C;  1VQ4 Q;  4PNO A;  3RKW A;  5GAN 7;  4ZGJ B;  4M7D F;  3RBB B;  1ZBJ A;  3RKY A;  3WVE B;  3QJ6 A;  2DTI A;  2E6Z A;  2CH4 A;  2JOY A;  1M1F A;  4TVR A;  2MPX C;  3HTR A;  1B3Q A;  1NEB A;  2QQB A;  3CMA A;  1K8A C;  3FIF A;  1AVZ C;  3OYH A;  1FMK A;  4KBM B;  2OX7 A;  2R57 A;  4R0K A;  1KD1 R;  4QQ6 A;  3CC4 A;  4AG1 C;  1A0N B;  1X2Q A;  1Z9Z A;  3X20 B;  1I5O B;  3MCA B;  2AKL A;  1NLP C;  3I55 A;  1QVF P;  1IHV A;  5LJ5 e;  1U3O A;  1SPK A;  4PJO B;  3OYK A;  3OSV A;  1WZO A;  4ZN1 A;  1CKB A;  5IN1 A;  5HK3 A;  2F5K A;  1PD1 A;  1YWP A;  2HEQ A;  1X2K A;  2KGT A;  2PVO B;  3CQT A;  3OSS C;  1U1T A;  2L3R A;  2NUT B;  3OYD A;  1YJN T;  4ATO A;  4RTT A;  3CCR A;  2RN8 A;  2VXE A;  3H0I A;  3HFO A;  5A2Q E;  4J5Y A;  1CSK A;  3CPF A;  1TUG B;  1ZBX A;  2XID A;  3QUI A;  5CVI A;  3V8J A;  2EQJ A;  1W2B A;  4DOV A;  4JS5 A;  2QYZ A;  4GBQ A;  1MHN A;  1TUD A;  3KBG A;  1QVG S;  5I22 A;  1GCQ A;  1OU8 A;  2CUB A;  4ELY C;  5A0D A;  3CC7 A;  1M3B A;  1YIJ T;  1C1A A;  1GBR A;  3OY9 A;  2EPD A;  5CAI A;  3OA6 A;  4PJO C;  2A36 A;  1VQN A;  2K6D A;  4KGZ B;  5GAO l;  4OVA A;  3PMI A;  3PVQ A;  4J9I A;  2QEX T;  2DX1 A;  2SRC A;  1VQ9 T;  3LWI A;  3CCQ A;  3E1S A;  3GBQ A;  2XHC A;  2I0N A;  1XTD A;  4E7K A;  1WNL A;  3MPU B;  3VU3 C;  1HYO A;  2DMO A;  5IHK A;  3Q1J A;  2M9U A;  1B07 A;  1SHF A;  2HSE B;  4B9X A;  2XK0 A;  2CZ1 B;  3CD6 T;  4GLM A;  2I2L A;  4KUI A;  1AEY A;  4D8K A;  1AZG B;  1YJN Q;  3OYY A;  1DJ7 B;  2NUP B;  5CQX A;  3REA B;  2HKQ B;  1H3H A;  5KCH A;  2YLB A;  1FWZ A;  3PFS A;  1QMC A;  2DE0 X;  2ZZD A;  2AT1 B;  4C0D B;  1WX6 A;  4HVU A;  1RAA B;  2ESW A;  2RHX A;  4M7D G;  4C0Z A;  2P84 A;  4LUE A;  3JCM d;  1Q81 U;  3LGL A;  1OX8 A;  1WHJ A;  2GBQ A;  4JRI A;  1ACM B;  3EGX B;  3OMG A;  4JJC A;  3OW2 A;  1YIJ Q;  1Q7Y C;  1EFN A;  1BIB A;  5HY6 A;  1YJW A;  4DEX A;  4ZGD B;  2EYQ A;  2LNV A;  3MET A;  2VWF A;  4MDW A;  2OTL T;  2OTJ Q;  3NPF A;  2CS7 A;  2RJD A;  2ZAE A;  2BZY A;  2DKG A;  2QEX Q;  5GAM d;  1XNI A;  3M55 A;  1VQ9 Q;  5GAN d;  1M3A A;  3CC2 T;  3FC3 A;  1QKW A;  3MEW A;  4J9F A;  5KYN A;  3J80 E;  2XG8 D;  4C8Q E;  2X3W D;  3SHW A;  3VV0 A;  2PU9 B;  1FYN A;  4RTU A;  2DYB A;  2HKN A;  4F7U E;  4J9H A;  2H3E B;  1BI2 A;  3X25 B;  3LGF A;  4C92 E;  3R6O A;  4C0D C;  2VC8 A;  1EX4 A;  4KRT A;  1QCO A;  1PM3 A;  1KQ2 A;  5LJ3 j;  1I0C A;  4FU6 A;  5CCA A;  2EW3 A;  3CME A;  4HCK A;  3M5A A;  2JNG A;  5FRN A;  1HJD A;  4RG2 A;  1VQ6 T;  2LRQ A;  1KD1 U;  4BDY A;  2OAW A;  3GNF B;  3JRZ A;  1AWW A;  3CCE T;  5L23 A;  3D7S B;  4OGC A;  1VQ7 T;  2CP6 A;  2J6O A;  3OW2 P;  2FPD A;  3RER A;  2IIM A;  4OP0 A;  4LD9 K;  2A37 A;  2DTO A;  2DNU A;  2QAZ A;  2DVE A;  4KT0 E;  3OYN A;  4M7D D;  2XD0 A;  2F2X A;  3CXC S;  3G6E A;  1Y57 A;  2CP7 A;  3NFC A;  3JB9 J;  1SG5 A;  3SWN A;  5EG2 A;  3CPW P;  3M0P A;  5GJV B;  2DZC A;  2E3I A;  4A4H A;  2OTL Q;  4Z89 A;  4JRQ A;  3OBY A;  4BI8 B;  3S3M A;  3S3O A;  1JXM A;  3CC2 Q;  3X24 B;  1D09 B;  1SF9 A;  1UEB A;  1BYM A;  4JLG A;  5FLX E;  5GAN j;  5A0L A;  1V29 B;  1RI0 A;  1ZSG A;  3A5Z B;  4GLK A;  1TOV A;  4LDV A;  4IUV A;  2LDM A;  5KH6 A;  4WCI A;  1K76 A;  1WHK A;  5LJ5 g;  2X51 A;  2X4W A;  3F70 A;  3RMS A;  5DLO A;  3UA6 A;  4RTV A;  3CCL A;  4OMO A;  4FT2 A;  3ZL7 C;  1MV0 B;  2Y4Y A;  3M59 A;  3URG A;  4PJJ A;  3VS7 A;  1VQ6 Q;  4IUR A;  2M16 A;  4DA4 A;  1OYX A;  1UHF A;  4OML A;  1BCM A;  1WXB A;  3PVL A;  1VQP T;  3S3N A;  3CCE Q;  3RUX A;  5IHN A;  3REB B;  1VQ7 Q;  3LYI A;  3P8D A;  3I56 T;  2P0P A;  1D3B B;  3RDV A;  2DAQ A;  4FYY B;  1Q81 C;  4ORZ A;  4LNP A;  1X6B A;  2RNA A;  1Q82 R;  1BI1 A;  3QZ9 B; 
#chains in the Genus database with same CATH homology
 2CZ6 B;  4HA8 A;  1VQ4 T;  2EQU A;  3EFS A;  2BKD N;  3QZ5 B;  5GAN 4;  1M1G A;  4O6J A;  3JB9 G;  2PUO B;  4JLI A;  3X28 B;  4VUB A;  1YHQ A;  1YI2 A;  4M7D A;  3M53 A;  2QI2 A;  4XTZ A;  3ZFJ A;  1YJW T;  2DJZ A;  4M7A E;  2V8I A;  4IUT A;  3CCU T;  2EFI A;  3E9G A;  3CBM A;  5GAN g;  4IKF A;  1NPR A;  1WQW A;  1W4S A;  4FIB A;  5FU6 B;  5GAO p;  3OYM A;  3UPU A;  4JDS A;  2E6N A;  2K5I A;  3TU4 K;  3G4S T;  1VQ5 A;  1UGR B;  1Y71 A;  1WJS A;  5DM7 R;  4LDW A;  1WJR A;  2R5A A;  2ZGW A;  4QQG A;  1Q86 U;  4CRI A;  2RHI A;  1KC8 C;  1VQ7 A;  2R5M A;  3NTH A;  4C5G A;  1S72 A;  2ZPH B;  3JSC A;  2X4J A;  3QII A;  3E9F A;  4BY6 B;  1ZQ1 A;  2QEX A;  3H8Z A;  4XTX A;  1U1S A;  4RCB A;  2FL7 A;  5CKB A;  3JCM e;  3CXC A;  1I5L A;  2HAX A;  2FVU A;  3OS0 A;  5GAM h;  3TRE A;  2K2V A;  5GAN h;  1NPP A;  4J6W A;  3P8B B;  2R58 A;  2XDP A;  3BDL A;  5CQY A;  3FEO A;  5CKE A;  4PLI A;  2LCC A;  2V8K A;  5CR2 A;  4M77 F;  2K5L A;  4B9W A;  2RJF A;  1OZ2 A;  3HP9 A;  1Y96 B;  2HNI A;  4M78 D;  1VQO A;  3C12 A;  3DLM A;  4JRP A;  3UT1 A;  2DIQ A;  4Y28 E;  3RES A;  2GFU A;  3HPW A;  3CD6 A;  1I8F A;  2E5Q A;  5GAN 5;  3OBW A;  2CGH A;  2RHY A;  4M78 C;  2YRV A;  1VIE A;  1X01 A;  2MAM A;  1QW1 A;  1N6A A;  1ZHI A;  2JVV A;  3MP1 A;  4E47 A;  1KQS S;  2G3R A;  3C95 A;  1QVP A;  3LLR A;  4E7H A;  3OB9 A;  3CCS T;  2OTJ T;  4C8Q F;  1VQM A;  3M4G A;  1Y07 A;  1PSE A;  4E7I A;  2QA4 T;  1KHC A;  1MGQ A;  2EJF A;  3QPH A;  4OB3 B;  4N0A A;  4F7U F;  1NZ9 A;  1M90 C;  3SFM A;  1JJ2 S;  4P5N A;  2RH2 A;  2ZCF B;  4IUP A;  1VQN T;  4QVD A;  2ZPI B;  2RHU A;  4FSX A;  3VJP A;  4C92 F;  1VQL A;  2X4Y A;  5CK9 A;  1HXD A;  5GAN 8;  4DOW A;  3DLL A;  4HCB A;  5FU6 C;  1UGQ B;  1KQ1 A;  4C5E A;  1Q82 C;  4J7F A;  1RL2 A;  5FU7 C;  4ZGE B;  2E70 A;  2JTF A;  2CKK A;  1LNX A;  2LT4 A;  3CBO A;  2EQK A;  1G3W A;  4PL6 A;  4C8Q G;  5IT9 E;  1K9M C;  1JB0 E;  2GFA A;  3BFM A;  2DEQ A;  1M1K C;  5GMK e;  1KQS A;  4OB0 B;  3OYJ A;  5D6Y A;  4EMK B;  3GIB A;  4BY6 C;  3UWN A;  4F7U G;  4NL3 A;  3E19 A;  3PIP A;  2QQA A;  3FB9 A;  5C6S A;  3G6E T;  4PNO A;  2EJG A;  3HSB A;  4PJO G;  2M0O A;  3RKW A;  3WXM B;  5GAN 7;  4QVZ A;  5LL6 S;  4ZGJ B;  2A3L A;  2DXT A;  2MMP A;  1JJ2 A;  4M7D F;  3A8H B;  3RKY A;  1LOJ A;  1WJQ A;  2DTI A;  3QJ6 A;  2E6Z A;  3WVE B;  2JOY A;  3M9Q A;  1M1F A;  2YLC A;  3FRN A;  2LQ8 A;  2DTH A;  2PVD B;  2DXU A;  4TVR A;  4M75 A;  1K73 U;  3CCV A;  5A0G A;  1M9S A;  3CMA A;  2QQB A;  2KQW A;  1K8A C;  4IUU A;  3CCJ T;  5DY9 A;  5J26 A;  2L5Q A;  3FIF A;  3OYH A;  2E65 A;  3NTI A;  3V7S A;  2XI9 A;  4KBM B;  2R57 A;  4ELZ C;  4UC4 A;  3CC2 A;  2WSF E;  2KDS A;  2M1H A;  3QG1 A;  4QQ6 A;  3CC4 A;  1VQK T;  3HKS A;  4V2S A;  4RG8 A;  3X20 B;  4NS5 A;  4N4I A;  1OI1 A;  4X34 A;  1KG1 A;  3L42 A;  2WSC E;  3MCA B;  4XTV A;  4MML A;  3VUB A;  3MEU A;  4M7A A;  2EAY A;  3V8K A;  1JBM A;  3I55 A;  1YCY A;  5D6X A;  4F7U B;  2O4X A;  5FRM A;  3NTK A;  2QXF A;  2XIC A;  5GMK j;  5I21 A;  4E7J A;  5LJ3 e;  5LJ5 e;  3OS5 A;  4PJO B;  5GMK i;  3OYK A;  4ZTJ A;  3OSV A;  4L5G A;  4ZN1 A;  5IN1 A;  1R8O B;  5HK3 A;  4D6W A;  1W2B S;  1D3B A;  2F5K A;  3FLG A;  3CCU A;  2VGM A;  4J7I A;  2RO0 A;  2Y4X A;  2RHZ A;  1FX7 A;  3JB9 H;  4EMK C;  2LQK A;  4BE0 A;  3AHU A;  3T9N A;  2GCX A;  2DXC A;  2RI3 A;  1U8R A;  2PVO B;  3OSS C;  3V8L A;  1U1T A;  2L3R A;  3OYD A;  3GOX A;  1YJN T;  4L59 A;  4ATO A;  4EMG A;  1N27 A;  2H3J A;  2MF2 A;  3CCR A;  4A54 A;  4XTU A;  2VXE A;  4DQ2 A;  1VQ6 A;  3GP8 A;  3HFO A;  3RMQ A;  2X35 A;  3PT9 A;  5A2Q E;  4LDU A;  4OGE A;  2LCL A;  2OAU A;  3GF5 A;  2Y90 A;  4L6V 5;  3CCE A;  4J5Y A;  3V7C A;  2DO3 A;  3GNG A;  3HFN A;  3CPF A;  4KUD K;  1ZBX A;  2XID A;  3QUI A;  5CVI A;  3V8J A;  1XQH A;  2EQJ A;  4R55 A;  1W2B A;  4MZM A;  2EWN A;  4DOV A;  3OS1 A;  4JS5 A;  4M78 E;  4Y91 A;  4EMH A;  2RJE A;  2VGN A;  1QVF S;  4LDY A;  1MHN A;  5CKH A;  3OYA A;  1N9S A;  2VUB A;  3C94 A;  3H6Z A;  2KVQ G;  1YBY A;  3KBG A;  5GAN 3;  1QVG S;  4XU0 A;  5GAO n;  2XDD A;  3QYG B;  4ELY C;  5A0D A;  3MP8 A;  3CC7 A;  1YHQ T;  2VYT A;  1UGP B;  3QKJ A;  2HD0 A;  5GMK m;  1YI2 T;  1WPY A;  4IUQ A;  4XTY A;  4PJO D;  3PMT A;  5GMK l;  1YIJ T;  2DXB A;  3DKM A;  4NOY A;  4CI0 C;  3OY9 A;  2DD5 A;  2RK1 A;  3HL8 A;  5CAI A;  3OA6 A;  4BD3 A;  3N5B B;  1VQ5 T;  4PJO C;  4HT9 A;  3MHX A;  4M75 F;  4OF1 A;  5GAM e;  3CME T;  1KD1 C;  4FL6 A;  1VQN A;  2K5F A;  2QQ9 A;  2XKO C;  5GAN e;  5GAO m;  3PNW C;  1Y96 A;  3EAE A;  5GAO l;  2A7Y A;  3LH0 A;  2LC4 A;  4OVA A;  1S72 T;  3PMI A;  1QVF A;  2B8A A;  1BKB A;  2QEX T;  3JCM V;  3JCM c;  2EQM A;  2P0Q A;  3ME9 A;  4M77 G;  3OYI A;  5LJ3 f;  4A4G A;  3L2U A;  1VQ9 T;  1VQ8 A;  1M8V A;  5D6W A;  3M54 A;  4A53 A;  1QVG A;  2V8J A;  3LWI A;  3QYH B;  3CCQ A;  4JJN K;  3E1S A;  4N4H A;  3SWN B;  1SSF A;  3GLX A;  2XHC A;  4KUL A;  2VV5 A;  1XTD A;  3A8L B;  1Q82 U;  1X6O A;  2D0Q B;  2MWP A;  4E7K A;  1WNL A;  4M7A F;  3VU3 C;  4M75 G;  1G5V A;  3Q1J A;  3JB9 I;  4OB2 B;  4N4G A;  4RKU E;  4XU3 A;  1VQO T;  3QHS A;  2XDB A;  2BUD A;  1NJI C;  2M9U A;  2HBP A;  4BUG A;  2L8D A;  1M4Z A;  4A4F A;  1M1K U;  3OQ5 A;  3KUF A;  3OYB A;  1VUB A;  3G71 A;  2WAC A;  4B9X A;  4ZN3 A;  2XK0 A;  2CZ1 B;  2KMT A;  3CD6 T;  2LT1 A;  4HT8 A;  2P0K A;  4XTW A;  2BIV A;  3JCM Q;  3LWH A;  2I2L A;  4II1 A;  4FT4 A;  3DB4 A;  4C92 G;  4KUI A;  1VQM T;  1BIA A;  4M7A G;  3OYC A;  3OYY A;  4XQ3 A;  1DJ7 B;  1IZ6 A;  2CZ0 B;  1I81 A;  3HRS A;  2F69 A;  5CQX A;  1B34 B;  4EMK A;  1I4K 1;  1WGS A;  3JB9 D;  3CCM T;  4A4K A;  5GAM j;  2X4X A;  4GY5 A;  5KCH A;  3JCM f;  2K4Y A;  2PQW A;  2DIG A;  2YLB A;  3M57 A;  4XU1 A;  4BE1 A;  3OW2 S;  4M77 B;  1YJ9 A;  3J7A F;  1K8A U;  3QJY A;  1VQP A;  5I2M A;  3QSU A;  1FWZ A;  1VQL T;  1BI0 A;  2DZ9 A;  3HHT B;  3PFS A;  1YIT A;  3I56 A;  2KSS A;  2ZZD A;  4XAX B;  2QDY B;  4C0D B;  2MI6 A;  2D6F A;  4LDX A;  1H3Z A;  3VYH B;  2C06 A;  4M75 B;  1VIF A;  4X9C A;  5CO7 A;  4M7D G;  1FXX A;  2RHX A;  4C0Z A;  4J6Y A;  4ZTF A;  2IVW A;  2VXF A;  4OMF B;  4C8Q B;  3P8H A;  2RM4 A;  2ZPG B;  2EKO A;  3DB3 A;  3JCM d;  2RJC A;  3A8O B;  5GAM f;  1Q81 U;  3MP6 A;  1VQ4 A;  3LGL A;  5GAN f;  2DD4 A;  3SWN C;  3L2Z A;  4JRI A;  3OMG A;  2E12 A;  3OW2 A;  4FM4 B;  2XU8 A;  2YHT A;  4N0A C;  4C92 B;  5M9O A;  1Q7Y C;  1EIF A;  4M7A B;  1O75 A;  1BIB A;  3SDZ A;  2WSE E;  5HY6 A;  1O9S A;  4XK8 E;  1YJW A;  1YJN A;  2O4X B;  1KHI A;  4ZGD B;  3CBP A;  2EYQ A;  3CCL T;  2RB6 A;  5GAN 2;  3OYF A;  2LNV A;  3MET A;  4MDW A;  3CCV T;  1N8R C;  5J3B A;  4RCC A;  2OTL T;  2CS7 A;  3G4S A;  2RJD A;  4M78 A;  1AHJ B;  2DKG A;  5IAY A;  4QW2 A;  5GAM d;  3TCJ A;  1XNI A;  3L2R A;  3M55 A;  2RK2 A;  3JCM g;  5C0M A;  2K3X A;  5GAN d;  3CC2 T;  4QVC A;  3FC3 A;  3M58 A;  2JTM A;  3CC4 T;  4MZT A;  3JCM J;  3MEW A;  2QTX A;  2FB7 A;  4BAC A;  4M77 D;  4MZP A;  1IRE B;  2XG8 D;  3J80 E;  4C8Q E;  4M7D B;  4PLL A;  1KC8 U;  4XU2 A;  1G3S A;  3VV0 A;  2PU9 B;  1H64 1;  3M4Y A;  4BI4 A;  3I55 T;  4M77 C;  4F7U E;  1UGS B;  3BW1 A;  4M75 D;  1BI2 A;  2MWO A;  3LGF A;  3X25 B;  4PJO E;  4C92 E;  2KAF A;  3R6O A;  4X9D A;  2VC8 A;  5FRO A;  3EFR A;  4C0D C;  3JCM h;  1PSF A;  4C8Q D;  1YIJ A;  1HK9 A;  5GAM g;  4M75 C;  4HCC A;  1JRI A;  2KK4 A;  4LD6 A;  5LJ3 j;  5LJ5 j;  1KQ2 A;  4FU6 A;  2EIF A;  5L8R E;  5CCA A;  5FU7 B;  4C8Q C;  3CME A;  5KE2 A;  3C4S A;  5AYF A;  5HK0 A;  5GAO r;  3L2Q A;  3A8G B;  3M5A A;  2OTJ A;  3CCS A;  4C92 D;  2JNG A;  5FRN A;  2ZPF B;  4RG2 A;  1Q86 C;  3CEY A;  4M7A D;  2QA4 A;  2AHJ B;  3CCR T;  4C5I A;  1QP3 A;  3FDR A;  3V7R A;  3O8V A;  3QO3 A;  2D9T A;  2LRQ A;  3L2V A;  3J81 E;  1VQ6 T;  2QQS A;  2PUK B;  4J83 A;  1KD1 U;  1VQ9 A;  4BDY A;  2JN0 A;  2LTO A;  3ER0 A;  3GNF B;  2L89 A;  3G7Z A;  4C92 C;  3JRZ A;  4M7A C;  4M7D E;  3CCE T;  1M5Q 1;  3JCM P;  4OGC A;  1VQ7 T;  1N9R A;  3RER A;  1M90 U;  3ASK A;  3ZBD A;  4J8O A;  5LJ5 f;  1Y7X A;  4OP0 A;  2QQR A;  2IG0 A;  3OYL A;  3SD4 A;  2PVG B;  2DTO A;  4LD9 K;  3QBY A;  2DVE A;  4KT0 E;  3OYN A;  4M7D D;  3LX7 A;  4C0F A;  2XD0 A;  3RIR A;  3A8M B;  3OYG A;  2CZ7 B;  4BDZ A;  4OB1 B;  2NLU A;  2CYZ B;  2E1H A;  2ZPB B;  4QQD A;  4C0G A;  4R56 A;  3KXT A;  3CXC S;  3G6E A;  4Q5W A;  1NJI U;  4EDU A;  1K9M U;  3CC7 T;  4M7D C;  3GPL A;  3LW5 E;  3BDU A;  3NFC A;  4PKC C;  5CKF A;  2RA2 A;  3QDR B;  3JB9 J;  3SWN A;  3INZ A;  5EG2 A;  1BI3 A;  2GQV A;  3S6W A;  1G3Y A;  2EJ9 A;  4Z02 A;  2E10 A;  5LJ3 d;  5GMK h;  5LJ5 d;  3PTA A;  3ZEH A;  3CCM A;  2DZC A;  1TH7 A;  4A4H A;  1UB4 A;  4JS4 A;  3MO8 A;  4JRQ A;  4JRK A;  3OBY A;  4M78 F;  4PJO F;  1WQ7 A;  3VKI A;  3MEA A;  4BI8 B;  4WF2 A;  3JCM X;  3S3M A;  3CCJ A;  3S3O A;  4ME7 A;  1P92 A;  2K3Y A;  2HQE A;  3X24 B;  3VUZ A;  1UEB A;  4E7L A;  4MMK A;  2FYK A;  4JLG A;  1BYM A;  4NL2 A;  1VQ8 T;  3FJP A;  5FLX E;  5GAN j;  5A0L A;  3CCQ T;  1V29 B;  1RI0 A;  1NE8 A;  2DPP B;  3JCM b;  3A5Z B;  2K57 A;  3WVD B;  5KCO A;  3PIO A;  3L2W A;  4GLK A;  1VQK A;  4J6X A;  3HRT A;  4LDV A;  5KH6 A;  4IUV A;  2LDM A;  3MEV A;  1LJO A;  3OS2 A;  3PGG A;  1B34 A;  2KY9 A;  5LJ5 g;  5LJ3 g;  3OYE A;  3VYG A;  3RKX A;  2RI2 A;  4M78 G;  2X4W A;  3M56 A;  4C5H A;  1GXI E;  4O5V A;  4YTL A;  4M77 A;  2LX9 A;  3G71 T;  4EPC A;  3F70 A;  2RD1 A;  3RMS A;  5DLO A;  5HKC A;  2FHD A;  4BE2 A;  1X75 C;  2RI5 A;  3CCL A;  2E64 A;  4A4E A;  2GF7 A;  4RMO A;  5J39 A;  3CPW S;  4BB7 A;  4FT2 A;  2OTL A;  3M59 A;  2Y4Y A;  4HCZ A;  3URG A;  1Q7Y U;  1K73 C;  3BY7 A;  2JUF A;  3QXE B;  1XOV A;  2LVM A;  4C8Q A;  5LJ3 h;  5GAN 6;  5LJ5 h;  4IUR A;  2M16 A;  5GAO q;  4DA4 A;  1OYX A;  3UDC A;  2ZPE B;  2E41 A;  1YJ9 T;  1N8R U;  2JZ2 A;  3JAM E;  4F7U A;  2HQX A;  4BI3 A;  4M77 E;  5KE3 A;  3S3N A;  1VQP T;  3HRU A;  3RUX A;  3L1A A;  3CMA T;  5DLQ E;  1YIT T;  3LYI A;  3P8D A;  3I56 T;  4PJO A;  3JB9 F;  2P0P A;  1QP2 A;  4C92 A;  1D3B B;  2DK3 A;  3TEE A;  2DAQ A;  4HKE A;  3X26 B;  2F5T X;  1G3T A;  4M75 E;  5CKD A;  1Q81 C;  5I2S A;  2P4T A;  1OZ3 A;  4M78 B;  3JCM W;  5CIU A;  3OMC A;  4MDX A;  3SB2 A;  3CPW A;  4JUV A;  1BI1 A;  2O01 E;  3QZ9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...