3PGGA

Crystal structure of cryptosporidium parvum u6 snrna-associated sm-like protein lsm5
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
89
structure length
78
Chain Sequence
b'NIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADKRVMVNRLETILLSGNNVAMLVPGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm5. SM domain
publication title Genome-Scale Protein Expression and Structural Biology of Plasmodium Falciparum and Related Apicomplexan Organisms.
pubmed doi rcsb
source organism Cryptosporidium parvum
molecule tags Dna binding protein
total genus 15
structure length 78
sequence length 89
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3pggA00
2DTOA 4M78A 4M75F 4RCCA 5LJ5e 5GAOm 5I21A 3RESA 3JCMe 5GANf 1JBMA 1WQWA 2EAYA 2EJ9A 2QTXA 4A54A 2HNIA 1I5LA 5LJ3f 5GAN8 4M7AD 5GAN2 5GAN5 3HSBA 2DJZA 3V8LA 4PJOC 4JLIA 4XU3A 4PJOB 4M78E 4PJOG 1B34A 3JCMX 5GAMd 5GAOl 2RM4A 3VU3C 5LJ3d 2EJFA 3V8JA 5GMKh 4MMKA 1X01A 1D3BB 3BFMA 3FJPA 4C8QB 4EMHA 3JCMW 5GAMj 4M75A 4C92B 1WPYA 4M7AE 5LJ3j 4JRIA 1Y96B 4RCBA 4M77F 2Y90A 3JCMc 3V7RA 3JCMd 2VXEA 5GAOn 2DXTA 5LJ5j 4XU2A 4C8QF 5GAOr 3RIRA 3FIFA 4JRKA 3RUXA 4C92F 3JB9I 3QUIA 5GMKl 4M7DC 4M7DB 4M7DG 2RA2A 4DQ2A 2DTIA 4F7UF 3RKYA 1LOJA 5CAIA 3PGGA 5GANh 1I81A 1LJOA 4XTVA 1HXDA 4QVCA 5GMKe 1JRIA 4M77D 3HFOA 3BW1A 5GAMf 4M77A 4EMKC 4M7AC 5GANg 4M7AG 1M5Q1 1D3BA 4J5YA 4C8QA 5LJ5f 4C92A 3JCMf 3JCMP 3GIBA 2DVEA 2E41A 3SWNC 3JB9F 1I8FA 2I2LA 4M75D 4NOYA 4F7UA 5GMKm 2E10A 2DXUA 2FYKA 2E1HA 2DKGA 4M77E 4XTWA 4PJOF 5LJ5d 3JB9G 2CGHA 4V2SA 3RKXA 1LNXA 2DEQA 3JCMQ 1KQ1A 2DTHA 1TH7A 4XTXA 5GMKj 5GAN7 3INZA 3QHSA 4N0AC 3JCMb 4J6WA 1BIBA 3EFSA 4M75E 2DZCA 3L1AA 3JB9D 5GAOp 1MGQA 4M78C 5GAMh 4M78B 1N9RA 4M78G 5LJ3h 5GAN4 4PJOD 4M7DF 2YHTA 3RKWA 3V7SA 1WNLA 4PJOA 1U1TA 4HT8A 3RERA 5LJ5h 4C8QD 3JCMh 4M7AB 4EMKB 5GAMg 4C92D 4JUVA 1M8VA 5LJ3g 2JN0A 3JB9H 5DY9A 3AHUA 4XQ3A 3JCMJ 1I4K1 1Y96A 1B34B 4MMLA 5LJ5g 4J6YA 4NL2A 4M7AF 3SWNB 3JCMg 3BY7A 4M75C 4M7DD 4Y91A 5GANe 4M75G 3V7CA 2YLBA 4M7DA 1H641 2EWNA 4C8QE 4X9CA 4XTUA 4C92E 3JB9J 2YLCA 3L2ZA 4HA8A 4F7UE 2E64A 1U1SA 4XTYA 2FB7A 4QVDA 5GAOq 3QSUA 4M7DE 1KQ2A 4EMKA 4M7AA 4X9DA 2EJGA 2VXFA 1YCYA 2E65A 3FB9A 5GMKi 4WF2A 2ZGWA 1N9SA 1HK9A 2K57A 5GANd 4NL3A 1BIAA 4M77C 3EFRA 4OP0A 4M77B 3SB2A 4M78F 3JCMV 4M77G 3SWNA 5GAN6 3M4GA 1WQ7A 4HT9A 3V8KA 4C8QC 4XU1A 2RB6A 2DZ9A 5GANj 3QO3A 4C92C 4C8QG 4C92G 4XU0A 5GAN3 2VC8A 3BDUA 2RD1A 4EMGA 4PNOA 4XTZA 3HFNA 4F7UB 4PJOE 4J6XA 4F7UG 4M75B 5GAMe 4N0AA 5LJ3e 4M78D 4A53A
chains in the Genus database with same CATH superfamily
2DTOA 4FYWB 4RUGA 1WXTA 1AOJA 2CSQA 1K8AU 2CP7A 3L2VA 3MP8A 4ZGJB 5GAN2 4BDZA 2LX7A 1WGSA 4J7FA 4RG8A 4Z8AA 4PJOC 4PJOB 1BI1A 1MMDA 4ZNXA 3UATA 3QZ9B 1PD1A 2E3HA 2DE0X 2JOYA 1KC8R 2H8HA 4QT7A 4XU2A 5GAOr 5FROA 1I07A 1X27A 3CC7T 2CZ0B 4F7UF 1OX9A 4FCYA 5GAMf 2DL5A 2LJ3A 2BZ8A 3LX7A 2CP5A 1PKSA 7AT1B 2R5AA 5KYUB 2WSFE 1I8FA 2L0AA 2KGTA 5CK9A 3EG9B 5A2QE 1U8RA 1PM3A 2D8HA 1S1NA 2QG9B 1Q86U 3VS6A 2NUTB 2X4XA 4R55A 4RTVA 1GCQA 1B3QA 1VQOQ 3VS2A 4IKFA 4PJOD 2J6FA 1YHQT 2LC4A 2F69A 3OYAA 2GNCA 1TUGB 1NYFA 1JJ2P 2DAQA 4JS5A 4RTWA 1VQNT 3MO8A 4DOVA 3L2ZA 4F7UE 1WZOA 4JZ4A 1KQ2A 1H8KA 2RHYA 4KULA 2JZ2A 2OTLT 2A3LA 5IHKA 2FZKB 1AD5A 2K5LA 1N27A 2L3QA 1KJWA 3OSSC 3LYIA 3I9QA 1DJ7B 4EIKA 5FU7C 8ATCB 3P8BB 3OYDA 3VS5A 2HKNA 2XDDA 1VQ9Q 5CVIA 3NGPA 4CI0C 3HRSA 3FC3A 2O4XB 2Y4YA 3OYFA 4II1A 2P4RA 4BY6C 3HSBA 2O01E 2M0OA 1TUDA 3R6NA 1SRMA 5GAMd 2RM4A 5LJ3d 1MMGA 1VQMA 2K2VA 3KXTA 1Q81C 3M0SA 2O31A 4A4GA 1IHWA 5GJWB 4LD6A 4Z89A 4F17A 4HCCA 1UUEA 2ED0A 2DTIA 2KRNA 2EQJA 2L3PA 2PUKB 1M3CA 1AZGB 3H6ZA 1VQ7T 3OYIA 1YJNQ 4RTZA 1YITA 4KBMB 3CMAQ 4M77E 3CC2T 4V2SA 1RABB 2XDPA 2QI2A 1KC8U 1I0CA 5FRMA 1KQ1A 4XTXA 2RI3A 1Q81R 4N0AC 1I1JA 3CPWS 1VQLT 4BDYA 2FRYA 3OY9A 3M0UA 2P84A 1LPLA 1YJWA 5KE3A 4PLIA 2DX1A 3A8GB 4HVWA 3PIOA 2EGEA 2DEUA 3ULRB 4OB0B 5D7UA 2X35A 2PUOB 2A08A 3CCMQ 1IREB 2F2WA 3D7SB 2CDTA 4M78F 2HKQB 3V8KA 1Y07A 3X25B 2MOXA 1O9SA 4XTZA 4EPCA 3UA7A 3CCQT 3PMIA 1BB9A 1WX6A 1KSWA 3FDRA 1M2VB 2FPEA 4BUGA 1GCPA 3CC4T 4R0KA 2O2OA 5FRNA 3QKJA 5IT9E 3V8JA 1RAFB 2ZPGB 2E70A 2VGMA 2RK2A 1G3YA 1XOVA 2MIOA 3CCET 2L2PA 1BK2A 3FJ5A 2QYZA 1QVGA 2VB6A 1ZX6A 3HL8A 3I55T 2K9GA 3HTRA 4JJDA 5EC7A 4FT4A 5GANg 3QDFA 2KMTA 2AHJB 2XMFA 4XTWA 2DKGA 4N4IA 3SHWA 3OYGA 3GP8A 3CC7A 3R6OA 4C5HA 4DBRA 3INZA 2XD0A 5FW9A 3EFSA 3VV0A 3EG1A 2A37A 4DEXA 2MAMA 4ME7A 2PZ1A 4LDVA 1JJ2S 2CP6A 1VQPQ 1QVFP 2GFUA 2QQBA 2AZSA 5CKEA 3JB9H 3PT9A 2FZGB 3GOXA 4M75C 3SEMA 4FIBA 4RG2A 5KYXB 2JTFA 2YDLA 5CKFA 1Q81U 1Y57A 2KQWA 2L8DA 2DA9A 2QQAA 2FB7A 2K5IA 1YHQA 5GAOq 4HVVA 1G3WA 1Y0MA 4OB3B 2EPDA 4M77C 4M77B 4DOWA 3OMCA 3M4GA 2OI3A 3O5ZA 1UHFA 5ECAA 3CD6T 4GLMA 2HBPA 5GJVB 1VQNA 2RQTA 4C0ZA 1SPKA 2RHUA 3NFCA 2KE9A 5FU6C 5FU6B 2XK0A 5GANf 2MYSA 1GBRA 2OTLA 4A54A 1I5LA 2RO0A 4LXCA 1P92A 5D6YA 1IHVA 1G3TA 3LLRA 3L42A 3URGA 3CXCS 4Q5WA 3G6ET 2XG8D 3EHQA 1D3BB 2LTOA 3UDCA 4C8QF 3RIRA 4C92F 1R0CB 2EGAA 2KYBA 1BCMA 2M1HA 4ZN3A 2LJ0A 2HSPA 2ENMA 4KH1B 4M77D 2DL4A 2LQ8A 2K3XA 3EFOA 4OMNA 1E6GA 1RLPC 1ZA1B 2BZXA 2KR3A 1ZUUA 1OU8A 1UG1A 4JS4A 4ORZA 5GMKm 4PJOF 1RI9A 1UB4A 4LDYA 1F1BB 3OYKA 2JMCA 2GGRA 5IXBA 1ARKA 5GAOp 2QDLA 1VQ7A 1NEGA 1CKBA 2ROLA 4OMFB 2RJCA 3KBGA 4E7IA 3CC2A 2DJQA 3UF4A 1SEMA 2DBMA 2LCCA 5LJ5g 2RMOA 2YLBA 3ER0A 4C8QE 4LDUA 1G8XA 4C92E 1VQLA 3MP1A 1M3AA 1QMCA 1PCXA 3P8HA 1N9SA 3OYLA 1RAHB 5GANd 3SB2A 5GAN6 1KIKA 3SWNA 1YJ9T 1RADB 2DZ9A 2NWMA 4Y28E 1H3HA 5KYWA 1YCSB 4PJOE 4OB1B 1S72Q 4E2FB 2EQKA 3M9QA 2RJDA 3MEWA 4QVZA 1JXMA 2QEXT 2C06A 1Q82U 5CO7A 4E47A 3MEAA 5GAN5 2E3IA 2X4YA 3F70A 4M4ZA 4MZPA 5GAOl 3HPWA 1TU0B 1XQHA 1GL5A 4EMHA 4JPBW 4PLLA 1NJIU 4JRIA 3CCQA 4ANJA 2Y90A 1MUZA 2HCKA 3OBWA 4FW2A 2FO0A 5DM7R 2MI6A 4B6MA 3PGGA 1JRIA 3CC4A 5HK0A 3BW1A 4WCIA 2MMPA 4M7AC 3CCSQ 5LJ5f 3A5ZB 5CR2A 4LDXA 3GIBA 2DVEA 1WJRA 4E7KA 4IUTA 1WFWA 3CCEA 3QJ6A 3I55A 2NLUA 2DEQA 2DIQA 3JCMQ 1QVFS 3HP9A 2K3BA 2DZCA 5GAMh 1IRXA 4PKCC 5LJ3h 1N5ZA 3RERA 3HRTA 4EMKB 2D8JA 5DLQE 4ZGDB 2CZ6B 3EG9A 1I4K1 1AZEA 2RJFA 3QIIA 4Y91A 3CPWA 2QA4T 4DBHA 1H641 4X9CA 4XTUA 2NUTA 3VUBA 1IO6A 3X24B 4LE9A 1U1SA 1VUBA 4QVDA 4OMLA 4M7DE 1KHCA 4X9DA 1VQ6T 4FSXA 2ED1A 1HK9A 5EG2A 3TEEA 5CCAA 2RJEA 4ELYC 1PNJA 4J9GA 2HQEA 4EMGA 3HFNA 1SKUB 4J9EA 4F7UG 1NZ9A 2HBWA 2LQWA 4QQDA 4ELZC 5GAMe 3QZ5B 3NPFA 5LJ3e 2DL3A 1U5SA 4OMMA 2JM9A 2M51A 4PJNA 1SRLA 3CQTA 3QJYA 3PTAA 3CD6A 2DYBA 2M9UA 1H3ZA 1M9SA 2ZCFB 4F16A 4ZN1A 1WJQA 4C8QB 1M1FA 1UGRB 4C92B 2BUDA 2CZ7B 1TOVA 2KEAA 4O5VA 5IN1A 1QCOA 3VYHB 2LNHB 3O8VA 4PL6A 4MZTA 3A98A 3C12A 1G2BA 1I81A 1VYTA 2XI9A 1LVKA 1TWBA 1YIJQ 3VS1A 4JZ3A 3G6EA 1KHIA 1WHLA 3GNFB 1QP2A 4RTTA 3JV3A 1VQ5T 3CCVT 3META 3EHRA 1RAGB 2MWPA 3H0IA 3KFVA 1MNEA 2E10A 3E1SA 2J6KA 3CCLT 1V76A 3OYYA 1TTHB 2DTHA 1AWJA 1TH7A 4CC7A 3OSVA 1OPLA 1ZQ1A 4J6WA 5FWCA 2JS0A 4KGXB 5I2MA 1VIFA 3LGLA 2EBPA 3I5SA 1TG0A 4BE1A 1E7OA 2K7AA 1X2QA 2HSEB 4KRTA 2BE7D 3NHNA 4C8QD 3EG3A 4C92D 4MDWA 4J83A 5DY9A 3CCJA 1D0YA 3QYGB 4MMLA 4NS5A 2YRDA 4HVUA 4C0GA 1JJ2A 2KRMA 2LNVA 4HA8A 1OOTA 1UJYA 4RKUE 1ZSZC 2EJGA 1UECA 2VXFA 3PIPA 5I11A 2GCXA 4NL3A 3VYGA 4J7IA 1W4SA 2WSEE 2PVGB 1BBZA 2RH2A 4FT2A 3N5BB 1AT1B 2B86A 3ME9A 4OVAA 1LCKA 2HAXA 4OGEA 2KYMA 3QXEB 3VRYA 5IHNA 4PFZA 4M75F 2Z0WA 3FLGA 3ZEHA 3TSZA 1WQWA 5GAN8 3I56T 3EGDB 1YJ9A 1NE8A 1X43A 2RQRA 3V8LA 2JJ9A 3S3MA 3GPLA 2CREA 4L5GA 1CSKA 1Y96B 4KT0E 4M77F 3JCMc 2XDBA 2QEXA 2A7YA 2VXEA 3G71Q 1K73C 1QQJA 3RUXA 4M7DC 2KROA 4M7DB 5FU7B 2LZ6B 1R0BG 2YT6A 4J9FA 4OF1A 2K5FA 2PQWA 4BY6B 2GTJA 2E41A 2EQIA 2CKKA 2KNBB 4IIOA 4BD3A 4F7UA 4NOYA 3M58A 1K0SA 5KYNA 3DLMA 2R5MA 4GLKA 4Z02A 3OS5A 4JDSA 5GAN7 3CXCP 3WVEB 2E6ZA 1FXXA 4M75E 1VQ9T 3M59A 3JB9D 1K73R 4M78G 4FU6A 3E19A 1K4US 3RKWA 3V7SA 1WNLA 4LNPA 1EIFA 3OS0A 1M3BA 2J7IA 1M8VA 8AT1B 2RK1A 4NL2A 4J6YA 2P0PA 2K2MA 2IG0A 2VWFA 5HK3A 3OS1A 4M7DD 5KE2A 2V8IA 2HL3A 1U3OA 3M5AA 3VUZA 3CEYA 4RTYA 2BE9B 2E64A 1V29B 1VQKQ 4WF2A 2EYWA 2QAZA 3LWHA 1BIAA 3TQ7P 3MEVA 3LWIA 1YJNT 4JJNK 3S3OA 1SHFA 5KYXA 1VQ8Q 2CH4W 2QA4A 1Y7XA 1J3TA 2EYYA 1K76A 3CMAT 2RD1A 4PNOA 2RNAA 1PWTA 2LQKA 1FX7A 1T3SA 1MMAA 1UJ0A 4RCCA 3G4SQ 3OW2P 1VQ6A 3QWXX 4CC4B 2EAYA 1B07A 1VQ4Q 2HNIA 2K4YA 1GCQC 2FL7A 1SG5A 2WACA 4JLIA 3QBYA 2EJFA 4IURA 4E7JA 4BACA 3CCQQ 5GAOn 1QCNA 3JAME 3JB9I 5GMKl 4BI4A 2V8KA 1NLOC 5GANh 1NPRA 3MEUA 1X2KA 2QK0A 1PG5B 2BIVA 1D3BA 1N8RC 1WJSA 2CUDA 2KRSA 2DVJA 2YRCA 3CBPA 2X9HA 1VIEA 3M0TA 3I55Q 2JTMA 1WYXA 3EGXB 2COYA 4N4GA 1UEBA 2LCLA 5GAN4 4UC4A 1G3SA 3OBYA 3UT1A 1VQ5A 3CCVA 1ZLMA 2MCNA 1JO8A 1TXQA 3HRUA 3QPHA 2QDYB 3CCLA 1QVFA 4FYYB 4M7AF 2FRWA 2MPXC 2RHXA 1N8RR 5GANe 2EWNA 1IXDA 5KYYA 2PVOB 3ASKA 4AG1C 1AWWA 3QSUA 2K6DA 1YI2Q 3NTHA 1MMNA 1QW1A 1OI1A 4OP0A 4A63B 4XU1A 4C8QG 3UA6A 4C92G 1XTDA 2NUPA 2RI5A 2JNGA 4IIMA 2DD4A 3THKA 4M75B 3L2QA 2GTOA 2C0TA 1YWOA 3CCUQ 4M78A 2QQSA 2WSCE 2HL5C 2EJ9A 2KDSA 2BKDN 4PFOA 2KY9A 2EYXA 2M0YA 1VQPT 2X3XD 4F04B 4PJOG 3OS2A 3A8LB 3ZL7C 3VS3A 4MMKA 1QCFA 4DEYA 1Q95G 4M7AE 2ZPBB 2LT4A 5IHIA 3DB4A 2E12A 3RNJA 4D8KA 1M27C 2AKLA 3M0RA 3I56A 1Q7YC 1WHKA 5IH2A 1LJOA 1RLQC 2DFUA 2L5QA 4X1VA 2DLPA 5KCOA 1ZUKA 1BYMA 3PFSA 5A0GA 3H0FA 1KG1A 4WTOB 4M75D 2BZYA 1YNZA 2DXUA 1UDLA 4MZMA 3A1PA 2CS7A 2XHCA 4JJCA 2KAFA 3M57A 1NPPA 2XKOC 2B8AA 3MCAB 2CP3A 3JRZA 4FL6A 2VVKA 5J39A 2YWWA 1U1TA 5LJ5h 1Q7YR 2CYZB 1TS9A 2RQVA 9ATCB 1EX4A 3EG0A 3BY7A 3CCJT 1UHCA 2LP5A 1VQ9A 1M30A 2E6NA 2YLCA 1BCOA 2F2XA 1WHHA 4OMOA 1WLPB 3BDLA 4EMKA 2ROTA 1PKTA 1HSQA 3JB9G 2EQUA 1WDXA 1AWOA 1FYNA 1ACMB 2RB6A 2KT8A 3M55A 2DRKA 2YRVA 3OW2S 2V8JA 1N8RU 2HQHA 2CP0A 1BI3A 4HXJA 4HCKA 1KK7A 5LJ5e 1QWEA 4XK8E 2VKNA 2PU9B 3RBBB 1YJNA 2JXBA 4XU3A 3U23A 1B34A 4C0DC 2NUZA 4C0DB 3VU3C 2PNIA 3CMAA 1X01A 2MWOA 3PVQA 2RQUA 2VASA 2OTJT 1MV3A 1M1GA 3GLXA 4C5EA 4DQ2A 5CKBA 2G6FX 1RACB 1D1BA 1ABOA 2P0QA 5GMKe 4E7LA 3HFOA 4OMPA 2E5KA 4AFQC 2X3WD 2AZVA 4C8QA 2DXCA 4C92A 2V26A 3CMET 1M90C 2DXBA 3REAB 3JB9F 1M4ZA 1VQMQ 1C6VX 1S72T 3PMTA 5A0LA 1UGQB 2YXYA 2QASA 3HHTB 1W6XA 3GBQA 3P8DA 2YUQA 1MGQA 2OX7A 3L2UA 4AFUC 4M7DF 2DERA 4AG2C 3M54A 3CCRT 4PJOA 3Q1JA 2GQVA 3X28B 4M7AB 3OYMA 5CQYA 4JUVA 2DILA 4N4HA 1Q86C 2M02A 4QW2A 2R58A 3JCMg 4IUVA 3JSCA 1YITQ 2AKKA 3REBB 2P4TA 1M90R 4ATOA 1ZA2B 1WI7A 4ZGEB 1W2BP 3TREA 1QVGS 3M56A 2YUNA 2ZPEB 2DF6A 4BE0A 1SSFA 1X6GA 5KYUA 3CCST 1Q7YU 1YJWQ 3OA6A 2IVWA 2D0NA 4C0FA 1SHGA 4XU0A 2QA4Q 6AT1B 2O9SA 1Q86R 1FMVA 4R56A 3TCJA 4ESRA 1UGPB 3OYEA 2HZYA 4M7AD 3J80E 2PTKA 2DYIA 3A8HB 4KUDK 4J9DA 3QDRB 2LJ1A 3OYBA 1WPYA 5C0MA 1IZ6A 1TSFA 2LMJA 1AWXA 3AT1B 4IUPA 3EH1A 4FM4B 1LOJA 1K9MC 3ZBDA 4L6V5 1BU1A 1VQPA 1R8OB 3JCMf 2GFAA 4RTUA 3SWNC 1WHGA 2EIFA 5LJ5d 1H92A 2EKOA 4X34A 1YWPA 2DETA 3MPUB 5KYWB 1V1CA 1RL2A 2E5QA 4YTLA 2O4XA 2JUFA 4AFZC 4TVRA 1N9RA 3VS7A 1FWZA 3X20B 5I2SA 4HKEA 2I0NA 2J06A 1WXBA 2C0IA 4JRQA 1K9MR 4FYVB 2DBKA 4P5NA 1KQSP 1TUCA 3VS0A 3OQ5A 1HD3A 4PJMA 1D0ZA 4M75G 2ZPHB 2AT1B 1JU5C 1C1AA 3CC7Q 2RHZA 3OYHA 3KUFA 2KVQG 4D8DA 2FVUA 5FWBA 5KCHA 4A4EA 1YIJT 4HT9A 2K79A 4M77G 2CSIA 3A8OB 3MHXA 1PD0A 3BE3A 1QKWA 1K9AA 1G83A 2ZAEA 2RQWA 4N0AA 1M90U 3L2RA 3GNGA 3C4SA 3OB9A 5GAOm 5I21A 2DIGA 2HEQA 1PHTA 5LJ3f 4A4FA 2RPNA 1YHQQ 1ZSZB 5J3BA 1VOMA 1ZSGA 3NTKA 2KBTA 1OU9A 1AHJB 3PE0A 1KD1C 2EVRA 1RUWA 1OX8A 5GAMj 3IQLA 5LJ3j 3JCMd 3TVTA 3EG2A 3SD4A 1VQNQ 3QUIA 4CC2A 2RA2A 2JT4A 1T0JA 3I56Q 5AYFA 1D1CA 1VQOT 2OTLQ 1GFCA 4LUDA 2OAWA 2PVDB 1HYOA 1QKXA 3VS4A 3SFMA 3VKIA 1UFFA 4QQGA 2HMAA 2I2LA 4LN2A 4BE2A 2E1HA 2COWA 2OTJA 1LNXA 2W10A 1D0XA 1KD1R 1M2VA 1M1KC 4EDUA 1OULA 1VYUA 3I5RA 3LGFA 1X75C 3CXCA 1Z9ZA 2YUPA 1QWFA 3OYCA 3CMEA 1PRLC 1VA7A 3M0PA 3MP6A 4PJJA 2JN0A 4XQ3A 1MV0B 1S72A 1W2BS 1NYGA 3GF5A 3EGXA 3V7CA 2QQRA 2MF2A 3G71T 4E7SA 1W1FA 5HKCA 3CCRA 2D0QB 5L23A 1T3LA 1YCYA 4L59A 3M4YA 1VQ7Q 2GF7A 2A36A 1K9MU 1M1KR 5CKDA 3OMGA 1WQ7A 1NLPC 3RMSA 4KH0B 3EAEA 2MK5A 1NEBA 3CC2Q 2JMAA 2NYSA 1A0NB 1WHMA 3C94A 3H9NA 2P0KA 4E6RA 4A53A 4FSSA 2G3RA 1VQLQ 2EYZA 5AT1B 3CCSA 2FHDA 3MJXA 1NBEB 2DJZA 3FRNA 3QYHB 4F14A 3OW2A 2KXDA 3JCMW 3OYNA 4M75A 4QKUA 5HCKA 4E7HA 1RAIB 2DNUA 1QP3A 2CH4A 4JRKA 2D9TA 2JTEA 3CPFA 3NMZC 2LDMA 4CC3A 4PFPA 2KT1A 4OGCA 1VQKT 1HXDA 4KUIA 1X6BA 4M77A 1MNDA 1E6HA 2A28A 4M7AG 3ZFJA 3JCMP 5HY6A 1BKBA 1VQ8T 1GRIA 3RR6A 3DB3A 3RKXA 3MKDA 5IAYA 2LT1A 3JCMb 2GBQA 2ECZA 3G4ST 3I35A 3A8MB 1KQSS 2KXCA 3NTIA 1VQ4T 1O75A 3CC4Q 2VUBA 3RMQA 3CCMT 2L3RA 2VV5A 2RN8A 4JRPA 1OPKA 3X26B 3CCEQ 3HKSA 3J7AF 1KD1U 5LL6S 1ZBXA 2V1RA 1RAEB 1C0MA 2VGNA 2QQ9A 2E65A 1VYVA 3EFRA 3JCMV 2L3SA 2FPFA 5GAN3 1W70A 3BDUA 4F7UB 3WVDB 4ZTFA 5J26A 2QGFB 1UTIA 1M8MA 1Y71A 1X6OA 3M53A 2QGGA 4AFSC 2D1XA 2SRCA 3M0QA 2ZPFB 1YIJA 1K73U 4KGZB 1WXUA 4M78E 1M1KU 5IXFA 1SSHA 3BFMA 1QVGP 1EZZB 4RCBA 3V7RA 1Q82C 4LDWA 2V1QA 1BI2A 3LH5A 4IUUA 3FIFA 4KGVB 3E9FA 1CKAA 3RKYA 5FLXE 1GFDA 2DL7A 4QVCA 2CUBA 1NJIC 1YI2T 2J6OA 1G5VA 3FEOA 3L2WA 4J8OA 1OV3A 2XIDA 4AT1B 1EFNA 3CD6Q 2DK3A 2H3EB 3LW5E 2JW4A 3SDZA 4J9BA 1Z9QA 1OQKA 2EFIA 4D6WA 1Q82R 4HCZA 2DO3A 3CCUT 1VQOA 5A0DA 3RDVA 2YHTA 1AVZC 4HT8A 1K0XA 3G6EQ 1NJIR 2HD0A 4Y92A 3J81E 2COZA 3UPUA 4OB2B 1JQQA 3OYJA 3H8ZA 4B9WA 3TSWA 3H0HA 2E4HA 3VJPA 2YUOA 3JB9J 1KFZA 5CQXA 1OZ2A 4JLGA 4XTYA 1NG2A 1JEGA 2LQNA 4M7AA 2ZGWA 2K57A 4LUEA 4DBQA 2DL8A 4QQ6A 2X51A 3C95A 4CRIA 2CT3A 2F2VA 5GANj 3QO3A 4VUBA 2XICA 2ZZDA 3CCJQ 3G71A 2VC8A 2KK4A 4J6XA 1GXIE 2D6FA 1WA7A 1GBQA 1WHJA 4J9CA 1AEYA 2EW3A 3H41A 2QTXA 2LX9A 1OEBA 2H3JA 5D6XA 1UE9A 1JXOA 3G7ZA 2O9VA 2O88A 3JCMX 3TU4K 2F1LA 3S6WA 5GMKh 3E9GA 2EYQA 2JS2A 1PSEA 4AMCA 2RI2A 4M7DG 1I5OB 5KYYB 1FMWA 4GY5A 2KI7A 2LRQA 2AIRB 1R77A 2QTVA 1M5Q1 4J5YA 4LD9K 1YJ9Q 4MDXA 2M16A 1SF9A 4A4KA 4BB7A 2FYKA 2CGHA 2CT4A 2DD5A 3G1JA 3T9NA 2NUPB 1K8AC 2OTJQ 2Y4XA 3PVLA 2FPDA 2QEXQ 3VRZA 4B9XA 3QHSA 1VQKA 1BIBA 4M78C 5D6WA 4M78B 2EKHA 2ESWA 2LVMA 2F5KA 1QLYA 3JCMh 2L89A 3CMEQ 1VQ8A 3AHUA 2J05A 1ZUYA 4DBFA 4IUQA 2CZ1B 4XAXB 2FZCB 5I22A 1XJWB 4RMOA 1ABQA 2DPPB 2A0FB 4BI8B 2VYTA 3G4SA 2AK5A 4JJBA 1VQ4A 1IGUA 1YBYA 1UGVA 2BTTA 1K8AR 3C0CA 3CCRQ 2GQIA 1PSFA 3CCMA 3EGUA 5GMKi 2X4JA 4C5GA 2CP2A 2X4WA 3LH0A 3UWNA 1W2BA 1WIEA 2HQXA 4O6JA 1RI0A 2DMOA 1X69A 5CKHA 1QVPA 4FW1A 1XNIA 1VQMT 2FG0A 2ABLA 4M78D 5CIUA 1MHNA 4FYXB 2QXFA 2ZPIB 3RESA 3JCMe 1JBMA 1HJDA 5KH6A 2RHIA 1D1AA 2RF0A 2K3YA 3EFOB 4PJLA 2JVVA 3FJPA 3QWYA 3WXMB 2IPOB 5M9OA 3CBMA 4E7ZA 2DXTA 5LJ5j 1YITT 2ATCB 2KSSA 4C5IA 4RTXA 2FEIA 1ZSZA 1PRMC 4XTVA 1BI0A 1D09B 2EGCA 2HDAA 1VQ6Q 1YN8A 4EMKC 3DLLA 2F5TX 4BI3A 2YSQA 4HCBA 1YJWT 1RAAB 1OZ3A 1JB0E 1K1ZA 2OJ2A 4A4HA 1NM7A 1IB8A 5GMKj 5L8RE 1YI2A 3L1AA 3EGDA 3E2UA 5C6SA 1OYXA 5DLOA 1PC0A 2JM8A 1YP5A 1FMKA 2DRMA 2LCSA 5GAMg 3CPWP 5LJ3g 3JCMJ 1ZHIA 1Y96A 1B34B 3SWNB 4PK4A 2SEMA 1YFNA 4OMQA 3CBOA 4M7DA 1KQSA 3CCUA 2W0ZA 3DKMA 2C0OA 2XU8A 1UGSB 3EH2A 4J9IA 4DA4A 1IGQA 2DM1A 4Z88A 2EQMA 2IIMA 3FB9A 1ZBJA 2R57A 5CAIA 3S3NA 1VQ5Q 3CCVQ 3QG1A 1KC8C 2OAUA 4J9HA 4C8QC 4ZTJA 1M2OA 4C92C 4K11A 1N6AA 1T0HA 4GBQA 3CCLQ 1B7TA 1U06A 3PNWC
chains in the Genus database with same CATH topology
2G3RA 2DTOA 4M78A 2QQSA 2C06A 1Q82U 5CO7A 2WSCE 1K8AU 2EJ9A 4E47A 2KDSA 2BKDN 3MEAA 3MP8A 4ZGJB 3L2VA 3CCSA 2KY9A 2FHDA 5GAN2 4BDZA 5GAN5 1WGSA 4J7FA 2DJZA 2X4YA 3F70A 3FRNA 4RG8A 3QYHB 3OW2A 1VQPT 4PJOC 4PJOB 1BI1A 4MZPA 4PJOG 3OS2A 3A8LB 5GAOl 3HPWA 4MMKA 1XQHA 4EMHA 3JCMW 3QZ9B 3OYNA 4PLLA 4M75A 1NJIU 4M7AE 4JRIA 2ZPBB 2LT4A 3CCQA 2Y90A 2JOYA 4E7HA 3DB4A 1QP3A 4XU2A 5GAOr 3OBWA 2E12A 4JRKA 2D9TA 5FROA 5DM7R 3CC7T 2CZ0B 2MI6A 4F7UF 1Q7YC 3CPFA 3I56A 3PGGA 2LDMA 4OGCA 1LJOA 1VQKT 1HXDA 4KUIA 1JRIA 2L5QA 5GAMf 3BW1A 5HK0A 3CC4A 3LX7A 2MMPA 4M77A 5KCOA 1BYMA 3PFSA 4M7AC 4M7AG 5LJ5f 3A5ZB 5CR2A 3ZFJA 4LDXA 5A0GA 3JCMP 3GIBA 2DVEA 2R5AA 5HY6A 1WJRA 2WSFE 1BKBA 1KG1A 4E7KA 4IUTA 1I8FA 4M75D 3CCEA 5CK9A 2DXUA 1VQ8T 1VQ7A 3DB3A 4MZMA 3QJ6A 3RKXA 5A2QE 2CS7A 1U8RA 2XHCA 3I55A 2NLUA 2DEQA 2DIQA 3JCMQ 1QVFS 5IAYA 2KAFA 3HP9A 2LT1A 3M57A 1Q86U 1NPPA 2XKOC 2B8AA 3MCAB 3JCMb 3JRZA 2DZCA 2X4XA 3G4ST 4FL6A 4R55A 5GAMh 4M7DA 3A8MB 4PKCC 1KQSS 5LJ3h 4IKFA 4PJOD 3NTIA 1VQ4T 5J39A 1U1TA 1O75A 3RERA 5LJ5h 1YHQT 2LC4A 2F69A 2VUBA 2CYZB 3HRTA 3RMQA 4EMKB 3OYAA 3CCMT 2L3RA 2VV5A 5DLQE 4ZGDB 2CZ6B 1I4K1 4JRPA 2DAQA 3BY7A 3X26B 4JS5A 2RJFA 3QIIA 4Y91A 3CPWA 3CCJT 3HKSA 2QA4T 1H641 3J7AF 4X9CA 4XTUA 1KD1U 1VQNT 5LL6S 3MO8A 1VQ9A 1ZBXA 2E6NA 3VUBA 2YLCA 4DOVA 3L2ZA 3X24B 4F7UE 1U1SA 1VUBA 4QVDA 3BDLA 2VGNA 4M7DE 1KQ2A 1KHCA 4EMKA 2RHYA 4X9DA 1VQ6T 2QQ9A 4FSXA 3JB9G 2E65A 2EQUA 4KULA 2JZ2A 1HK9A 5EG2A 3TEEA 2OTLT 5CCAA 2A3LA 2RJEA 3EFRA 3JCMV 4ELYC 2RB6A 3M55A 2K5LA 2HQEA 5GAN3 2YRVA 3OW2S 2V8JA 3BDUA 1N27A 4EMGA 3HFNA 4F7UB 3WVDB 3OSSC 4F7UG 3LYIA 4ZTFA 1NZ9A 5J26A 4QQDA 4ELZC 1N8RU 1DJ7B 1Y71A 5FU7C 5GAMe 1BI3A 3P8BB 1X6OA 3QZ5B 5LJ3e 3M53A 3OYDA 5LJ5e 2XDDA 4XK8E 5CVIA 4CI0C 1KD1C 2ZPFB 3HRSA 3FC3A 1YIJA 2O4XB 2Y4YA 3OYFA 4II1A 1K73U 2PU9B 4BY6C 3QJYA 3PTAA 3HSBA 2O01E 1YJNA 2M0OA 3CD6A 4XU3A 2M9UA 4M78E 1H3ZA 1B34A 4C0DC 5GAMd 1M9SA 2RM4A 2ZCFB 5LJ3d 3VU3C 4C0DB 4ZN1A 3CMAA 1M1KU 1VQMA 1WJQA 1X01A 2K2VA 3BFMA 4C8QB 3KXTA 1M1FA 1Q81C 1UGRB 4C92B 4M7DD 2BUDA 2CZ7B 4RCBA 3V7RA 4A4GA 2MWOA 1Q82C 4LDWA 1BI2A 4IUUA 3FIFA 4O5VA 5IN1A 4LD6A 3VYHB 2OTJT 1M1GA 3E9FA 3GLXA 3O8VA 4PL6A 4HCCA 4MZTA 3C12A 2DTIA 4C5EA 4DQ2A 5CKBA 3RKYA 5FLXE 1I81A 2P0QA 2EQJA 4QVCA 2XI9A 5GMKe 4E7LA 3HFOA 1NJIC 1YI2T 1G5VA 2PUKB 3FEOA 3L2WA 4J8OA 3G6EA 1KHIA 3GNFB 1JJ2S 1QP2A 3H6ZA 4C8QA 2XIDA 2DXCA 1VQ7T 4C92A 1VQ5T 3OYIA 3CCVT 3META 3CMET 1M90C 2DK3A 2DXBA 2MWPA 3JB9F 1YITA 4KBMB 1M4ZA 2E10A 3LW5E 4M77E 3E1SA 3CC2T 4V2SA 3SDZA 3CCLT 3OYYA 2XDPA 2QI2A 1S72T 3PMTA 1KC8U 5A0LA 1UGQB 5FRMA 1KQ1A 2DTHA 1TH7A 2RI3A 3OSVA 4XTXA 5GAOm 4N0AC 2EFIA 3HHTB 1ZQ1A 4J6WA 4D6WA 4HCZA 2DO3A 3CPWS 3P8DA 5I2MA 1VIFA 3CCUT 4BDYA 1MGQA 3L2UA 3LGLA 3OY9A 1VQOA 5A0DA 4M7DF 2YHTA 3M54A 3CCRT 4BE1A 4PJOA 1YJWA 3Q1JA 4HT8A 2GQVA 5KE3A 3X28B 4PLIA 4C8QD 4M7AB 3OYMA 5CQYA 4JUVA 4C92D 4N4HA 4MDWA 4J83A 5DY9A 3CCJA 1Q86C 2HD0A 3A8GB 3QYGB 4MMLA 3J81E 4NS5A 4QW2A 2R58A 3JCMg 4IUVA 4OB2B 3UPUA 3JSCA 3OYJA 3PIOA 3H8ZA 4B9WA 2P4TA 4C0GA 1JJ2A 3VJPA 4OB0B 3JB9J 4ATOA 2LNVA 5CQXA 1OZ2A 4JLGA 4HA8A 4ZGEB 4XTYA 3TREA 1QVGS 2X35A 3M56A 2PUOB 4RKUE 4M7AA 2ZPEB 2EJGA 2VXFA 4BE0A 3PIPA 2ZGWA 2K57A 1IREB 2GCXA 1SSFA 3VYGA 4J7IA 4NL3A 3CCST 1W4SA 4M78F 1Q7YU 2WSEE 2PVGB 4QQ6A 3C95A 3V8KA 4CRIA 3OA6A 2IVWA 5GANj 3QO3A 2RH2A 4VUBA 2XICA 4C0FA 4FT2A 1Y07A 2ZZDA 3N5BB 4XU0A 3G71A 2VC8A 3X25B 4EPCA 1O9SA 4XTZA 3ME9A 2KK4A 4J6XA 1GXIE 4OVAA 2D6FA 3CCQT 2HAXA 3PMIA 4OGEA 3QXEB 4R56A 3TCJA 4M75F 3FDRA 1UGPB 3FLGA 3ZEHA 4BUGA 1WQWA 3OYEA 2QTXA 4M7AD 2LX9A 2H3JA 4TVRA 5D6XA 5GAN8 3I56T 3J80E 3G7ZA 1YJ9A 1NE8A 3V8LA 3CC4T 3S3MA 3GPLA 3JCMX 3A8HB 3TU4K 3QKJA 4L5GA 3S6WA 4KUDK 5IT9E 5FRNA 3V8JA 5GMKh 2ZPGB 3E9GA 2E70A 3QDRB 2EYQA 2VGMA 3OYBA 1WPYA 5C0MA 1Y96B 4KT0E 4M77F 1IZ6A 1PSEA 1G3YA 2RK2A 3JCMc 1XOVA 2QEXA 2A7YA 2VXEA 1K9MU 1VQLT 3CCET 1K73C 4IUPA 3RUXA 1QVGA 4M7DC 4M7DB 5FU7B 2RI2A 3HL8A 3I55T 4M7DG 4FM4B 1LOJA 1K9MC 3ZBDA 4L6V5 4OF1A 1VQPA 2K5FA 4GY5A 2LRQA 2PQWA 5GANg 4FT4A 4BY6B 1M5Q1 4J5YA 4LD9K 1R8OB 3JCMf 2GFAA 4MDXA 2E41A 2KMTA 2CKKA 2AHJB 2M16A 3SWNC 4A4KA 4BD3A 2EIFA 4F7UA 4NOYA 4XTWA 2FYKA 4BB7A 2DKGA 2EKOA 3M58A 4N4IA 4X34A 5LJ5d 2CGHA 2DD5A 2R5MA 3DLMA 3OYGA 4GLKA 4Z02A 3OS5A 3T9NA 3GP8A 3R6OA 4C5HA 2Y4XA 3CC7A 1K8AC 4JDSA 1RL2A 5GAN7 4B9XA 3INZA 3QHSA 1VQKA 2XD0A 2E5QA 3WVEB 2E6ZA 1BIBA 3EFSA 3VV0A 1FXXA 4M75E 4YTLA 2O4XA 2JUFA 3M59A 3JB9D 1VQ9T 4M78C 5D6WA 4M78B 1N9RA 2MAMA 1FWZA 4LDVA 4FU6A 3E19A 4M78G 4ME7A 4HKEA 3X20B 3RKWA 2LVMA 5I2SA 3V7SA 1WNLA 2GFUA 2QQBA 2F5KA 4JRQA 1EIFA 3JCMh 2L89A 3OS0A 1M8VA 5CKEA 1VQ8A 3JB9H 3AHUA 2RK1A 4P5NA 3PT9A 4IUQA 4J6YA 2CZ1B 3OQ5A 2P0PA 4NL2A 2IG0A 4XAXB 3GOXA 5HK3A 4M75C 3OS1A 4FIBA 2V8IA 4RG2A 5KE2A 2JTFA 4M75G 2DPPB 4RMOA 2ZPHB 4BI8B 2VYTA 3M5AA 3VUZA 5CKFA 3G4SA 3L2QA 1Q81U 2KQWA 2RHZA 2L8DA 3CEYA 3OYHA 1VQ4A 2E64A 1V29B 1YBYA 2QQAA 2FB7A 2K5IA 1YHQA 5GAOq 3KUFA 2KVQG 2FVUA 1PSFA 3CCMA 5GMKi 4WF2A 2X4JA 1G3WA 4C5GA 5KCHA 4A4EA 3LWHA 4OB3B 1YIJT 1BIAA 2X4WA 4M77C 3LH0A 4M77B 3UWNA 1W2BA 4HT9A 4M77G 3OMCA 4DOWA 3M4GA 3MEVA 3A8OB 2HQXA 3LWIA 1YJNT 4JJNK 3CD6T 4O6JA 3S3OA 1RI0A 5CKHA 1QVPA 2QA4A 1Y7XA 3MHXA 2HBPA 3CMAT 2RD1A 1XNIA 4PNOA 1VQMT 1VQNA 4N0AA 4C0ZA 1M90U 3L2RA 2LQKA 1FX7A 2RHUA 3GNGA 4M78D 3C4SA 3NFCA 1MHNA 3OB9A 4RCCA 5CIUA 5FU6C 1VQ6A 5FU6B 2XK0A 2QXFA 2ZPIB 3RESA 5I21A 3JCMe 5GANf 1JBMA 2DIGA 2EAYA 2OTLA 4A54A 2HNIA 2K4YA 5LJ3f 1I5LA 2FL7A 4A4FA 2RO0A 1P92A 5D6YA 2RHIA 5J3BA 5KH6A 1G3TA 3LLRA 3NTKA 2WACA 4JLIA 2XDBA 2K3YA 3L42A 3QBYA 2EJFA 1AHJB 2JVVA 4IURA 3URGA 4Q5WA 3CXCS 2XG8D 3G6ET 1D3BB 2LTOA 3FJPA 3UDCA 4E7JA 5GAMj 4BACA 3WXMB 5LJ3j 5M9OA 3JCMd 3CBMA 5GAOn 2DXTA 5LJ5j 1YITT 3SD4A 4C8QF 3RIRA 4C92F 3JAME 3JB9I 3QUIA 5GMKl 4BI4A 2V8KA 2KSSA 2M1HA 4ZN3A 2RA2A 4C5IA 5GANh 1NPRA 4XTVA 3MEUA 1BI0A 5AYFA 4M77D 2LQ8A 2K3XA 1VQOT 4EMKC 3DLLA 2BIVA 2F5TX 4BI3A 1D3BA 1KC8C 4HCBA 2PVDB 1N8RC 1YJWT 1WJSA 3SFMA 3VKIA 4QQGA 4JS4A 1OZ3A 2I2LA 5GMKm 1JB0E 4BE2A 2E1HA 4PJOF 1UB4A 3CBPA 2OTJA 1LNXA 4LDYA 3OYKA 4A4HA 1VIEA 2JTMA 5GMKj 5L8RE 1YI2A 3L1AA 1M1KC 5GAOp 4N4GA 4EDUA 1UEBA 2LCLA 5GAN4 5C6SA 4UC4A 1G3SA 1OYXA 3LGFA 1X75C 5DLOA 3OBYA 3UT1A 3CXCA 1VQ5A 3CCVA 3OYCA 3CMEA 4OMFB 3MP6A 5GAMg 2RJCA 3KBGA 3HRUA 5LJ3g 2JN0A 3QPHA 4E7IA 3CC2A 4XQ3A 3JCMJ 1ZHIA 1Y96A 1B34B 2QDYB 2LCCA 3CCLA 5LJ5g 1S72A 1QVFA 4M7AF 3SWNB 1W2BS 2RHXA 3GF5A 5GANe 3V7CA 2YLBA 2QQRA 3CBOA 3ER0A 2EWNA 2MF2A 4LDUA 4C8QE 3G71T 1KQSA 3CCUA 4C92E 1VQLA 2PVOB 3MP1A 3ASKA 3DKMA 2XU8A 1UGSB 4DA4A 5HKCA 3CCRA 2D0QB 3QSUA 2EQMA 1YCYA 3FB9A 3M4YA 2R57A 3NTHA 3P8HA 1N9SA 4L59A 3OYLA 5GANd 1QW1A 5CAIA 2GF7A 1OI1A 4OP0A 3SB2A 5GAN6 5CKDA 3QG1A 3OMGA 2OAUA 3SWNA 1WQ7A 3S3NA 3RMSA 1YJ9T 4C8QC 4XU1A 4ZTJA 2DZ9A 4C92C 4C8QG 3EAEA 4Y28E 4C92G 1XTDA 1N6AA 2RI5A 3C94A 4PJOE 4OB1B 2JNGA 2DD4A 2EQKA 3M9QA 4M75B 2RJDA 3MEWA 4QVZA 2P0KA 2QEXT 3PNWC 4A53A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTO A;  4M78 A;  4M75 F;  4RCC A;  5LJ5 e;  5GAO m;  5I21 A;  3RES A;  3JCM e;  5GAN f;  1JBM A;  1WQW A;  2EAY A;  2EJ9 A;  2QTX A;  4A54 A;  2HNI A;  1I5L A;  5LJ3 f;  5GAN 8;  4M7A D;  5GAN 2;  5GAN 5;  3HSB A;  2DJZ A;  3V8L A;  4PJO C;  4JLI A;  4XU3 A;  4PJO B;  4M78 E;  4PJO G;  1B34 A;  3JCM X;  5GAM d;  5GAO l;  2RM4 A;  3VU3 C;  5LJ3 d;  2EJF A;  3V8J A;  5GMK h;  4MMK A;  1X01 A;  1D3B B;  3BFM A;  3FJP A;  4C8Q B;  4EMH A;  3JCM W;  5GAM j;  4M75 A;  4C92 B;  1WPY A;  4M7A E;  5LJ3 j;  4JRI A;  1Y96 B;  4RCB A;  4M77 F;  2Y90 A;  3JCM c;  3V7R A;  3JCM d;  2VXE A;  5GAO n;  2DXT A;  5LJ5 j;  4XU2 A;  4C8Q F;  5GAO r;  3RIR A;  3FIF A;  4JRK A;  3RUX A;  4C92 F;  3JB9 I;  3QUI A;  5GMK l;  4M7D C;  4M7D B;  4M7D G;  2RA2 A;  4DQ2 A;  2DTI A;  4F7U F;  3RKY A;  1LOJ A;  5CAI A;  3PGG A;  5GAN h;  1I81 A;  1LJO A;  4XTV A;  1HXD A;  4QVC A;  5GMK e;  1JRI A;  4M77 D;  3HFO A;  3BW1 A;  5GAM f;  4M77 A;  4EMK C;  4M7A C;  5GAN g;  4M7A G;  1M5Q 1;  1D3B A;  4J5Y A;  4C8Q A;  5LJ5 f;  4C92 A;  3JCM f;  3JCM P;  3GIB A;  2DVE A;  2E41 A;  3SWN C;  3JB9 F;  1I8F A;  2I2L A;  4M75 D;  4NOY A;  4F7U A;  5GMK m;  2E10 A;  2DXU A;  2FYK A;  2E1H A;  2DKG A;  4M77 E;  4XTW A;  4PJO F;  5LJ5 d;  3JB9 G;  2CGH A;  4V2S A;  3RKX A;  1LNX A;  2DEQ A;  3JCM Q;  1KQ1 A;  2DTH A;  1TH7 A;  4XTX A;  5GMK j;  5GAN 7;  3INZ A;  3QHS A;  4N0A C;  3JCM b;  4J6W A;  1BIB A;  3EFS A;  4M75 E;  2DZC A;  3L1A A;  3JB9 D;  5GAO p;  1MGQ A;  4M78 C;  5GAM h;  4M78 B;  1N9R A;  4M78 G;  5LJ3 h;  5GAN 4;  4PJO D;  4M7D F;  2YHT A;  3RKW A;  3V7S A;  1WNL A;  4PJO A;  1U1T A;  4HT8 A;  3RER A;  5LJ5 h;  4C8Q D;  3JCM h;  4M7A B;  4EMK B;  5GAM g;  4C92 D;  4JUV A;  1M8V A;  5LJ3 g;  2JN0 A;  3JB9 H;  5DY9 A;  3AHU A;  4XQ3 A;  3JCM J;  1I4K 1;  1Y96 A;  1B34 B;  4MML A;  5LJ5 g;  4J6Y A;  4NL2 A;  4M7A F;  3SWN B;  3JCM g;  3BY7 A;  4M75 C;  4M7D D;  4Y91 A;  5GAN e;  4M75 G;  3V7C A;  2YLB A;  4M7D A;  1H64 1;  2EWN A;  4C8Q E;  4X9C A;  4XTU A;  4C92 E;  3JB9 J;  2YLC A;  3L2Z A;  4HA8 A;  4F7U E;  2E64 A;  1U1S A;  4XTY A;  2FB7 A;  4QVD A;  5GAO q;  3QSU A;  4M7D E;  1KQ2 A;  4EMK A;  4M7A A;  4X9D A;  2EJG A;  2VXF A;  1YCY A;  2E65 A;  3FB9 A;  5GMK i;  4WF2 A;  2ZGW A;  1N9S A;  1HK9 A;  2K57 A;  5GAN d;  4NL3 A;  1BIA A;  4M77 C;  3EFR A;  4OP0 A;  4M77 B;  3SB2 A;  4M78 F;  3JCM V;  4M77 G;  3SWN A;  5GAN 6;  3M4G A;  1WQ7 A;  4HT9 A;  3V8K A;  4C8Q C;  4XU1 A;  2RB6 A;  2DZ9 A;  5GAN j;  3QO3 A;  4C92 C;  4C8Q G;  4C92 G;  4XU0 A;  5GAN 3;  2VC8 A;  3BDU A;  2RD1 A;  4EMG A;  4PNO A;  4XTZ A;  3HFN A;  4F7U B;  4PJO E;  4J6X A;  4F7U G;  4M75 B;  5GAM e;  4N0A A;  5LJ3 e;  4M78 D;  4A53 A; 
#chains in the Genus database with same CATH topology
 2DTO A;  4FYW B;  4RUG A;  1WXT A;  1AOJ A;  2CSQ A;  1K8A U;  2CP7 A;  3L2V A;  3MP8 A;  4ZGJ B;  5GAN 2;  4BDZ A;  2LX7 A;  1WGS A;  4J7F A;  4RG8 A;  4Z8A A;  4PJO C;  4PJO B;  1BI1 A;  1MMD A;  4ZNX A;  3UAT A;  3QZ9 B;  1PD1 A;  2E3H A;  2DE0 X;  2JOY A;  1KC8 R;  2H8H A;  4QT7 A;  4XU2 A;  5GAO r;  5FRO A;  1I07 A;  1X27 A;  3CC7 T;  2CZ0 B;  4F7U F;  1OX9 A;  4FCY A;  5GAM f;  2DL5 A;  2LJ3 A;  2BZ8 A;  3LX7 A;  2CP5 A;  1PKS A;  7AT1 B;  2R5A A;  5KYU B;  2WSF E;  1I8F A;  2L0A A;  2KGT A;  5CK9 A;  3EG9 B;  5A2Q E;  1U8R A;  1PM3 A;  2D8H A;  1S1N A;  2QG9 B;  1Q86 U;  3VS6 A;  2NUT B;  2X4X A;  4R55 A;  4RTV A;  1GCQ A;  1B3Q A;  1VQO Q;  3VS2 A;  4IKF A;  4PJO D;  2J6F A;  1YHQ T;  2LC4 A;  2F69 A;  3OYA A;  2GNC A;  1TUG B;  1NYF A;  1JJ2 P;  2DAQ A;  4JS5 A;  4RTW A;  1VQN T;  3MO8 A;  4DOV A;  3L2Z A;  4F7U E;  1WZO A;  4JZ4 A;  1KQ2 A;  1H8K A;  2RHY A;  4KUL A;  2JZ2 A;  2OTL T;  2A3L A;  5IHK A;  2FZK B;  1AD5 A;  2K5L A;  1N27 A;  2L3Q A;  1KJW A;  3OSS C;  3LYI A;  3I9Q A;  1DJ7 B;  4EIK A;  5FU7 C;  8ATC B;  3P8B B;  3OYD A;  3VS5 A;  2HKN A;  2XDD A;  1VQ9 Q;  5CVI A;  3NGP A;  4CI0 C;  3HRS A;  3FC3 A;  2O4X B;  2Y4Y A;  3OYF A;  4II1 A;  2P4R A;  4BY6 C;  3HSB A;  2O01 E;  2M0O A;  1TUD A;  3R6N A;  1SRM A;  5GAM d;  2RM4 A;  5LJ3 d;  1MMG A;  1VQM A;  2K2V A;  3KXT A;  1Q81 C;  3M0S A;  2O31 A;  4A4G A;  1IHW A;  5GJW B;  4LD6 A;  4Z89 A;  4F17 A;  4HCC A;  1UUE A;  2ED0 A;  2DTI A;  2KRN A;  2EQJ A;  2L3P A;  2PUK B;  1M3C A;  1AZG B;  3H6Z A;  1VQ7 T;  3OYI A;  1YJN Q;  4RTZ A;  1YIT A;  4KBM B;  3CMA Q;  4M77 E;  3CC2 T;  4V2S A;  1RAB B;  2XDP A;  2QI2 A;  1KC8 U;  1I0C A;  5FRM A;  1KQ1 A;  4XTX A;  2RI3 A;  1Q81 R;  4N0A C;  1I1J A;  3CPW S;  1VQL T;  4BDY A;  2FRY A;  3OY9 A;  3M0U A;  2P84 A;  1LPL A;  1YJW A;  5KE3 A;  4PLI A;  2DX1 A;  3A8G B;  4HVW A;  3PIO A;  2EGE A;  2DEU A;  3ULR B;  4OB0 B;  5D7U A;  2X35 A;  2PUO B;  2A08 A;  3CCM Q;  1IRE B;  2F2W A;  3D7S B;  2CDT A;  4M78 F;  2HKQ B;  3V8K A;  1Y07 A;  3X25 B;  2MOX A;  1O9S A;  4XTZ A;  4EPC A;  3UA7 A;  3CCQ T;  3PMI A;  1BB9 A;  1WX6 A;  1KSW A;  3FDR A;  1M2V B;  2FPE A;  4BUG A;  1GCP A;  3CC4 T;  4R0K A;  2O2O A;  5FRN A;  3QKJ A;  5IT9 E;  3V8J A;  1RAF B;  2ZPG B;  2E70 A;  2VGM A;  2RK2 A;  1G3Y A;  1XOV A;  2MIO A;  3CCE T;  2L2P A;  1BK2 A;  3FJ5 A;  2QYZ A;  1QVG A;  2VB6 A;  1ZX6 A;  3HL8 A;  3I55 T;  2K9G A;  3HTR A;  4JJD A;  5EC7 A;  4FT4 A;  5GAN g;  3QDF A;  2KMT A;  2AHJ B;  2XMF A;  4XTW A;  2DKG A;  4N4I A;  3SHW A;  3OYG A;  3GP8 A;  3CC7 A;  3R6O A;  4C5H A;  4DBR A;  3INZ A;  2XD0 A;  5FW9 A;  3EFS A;  3VV0 A;  3EG1 A;  2A37 A;  4DEX A;  2MAM A;  4ME7 A;  2PZ1 A;  4LDV A;  1JJ2 S;  2CP6 A;  1VQP Q;  1QVF P;  2GFU A;  2QQB A;  2AZS A;  5CKE A;  3JB9 H;  3PT9 A;  2FZG B;  3GOX A;  4M75 C;  3SEM A;  4FIB A;  4RG2 A;  5KYX B;  2JTF A;  2YDL A;  5CKF A;  1Q81 U;  1Y57 A;  2KQW A;  2L8D A;  2DA9 A;  2QQA A;  2FB7 A;  2K5I A;  1YHQ A;  5GAO q;  4HVV A;  1G3W A;  1Y0M A;  4OB3 B;  2EPD A;  4M77 C;  4M77 B;  4DOW A;  3OMC A;  3M4G A;  2OI3 A;  3O5Z A;  1UHF A;  5ECA A;  3CD6 T;  4GLM A;  2HBP A;  5GJV B;  1VQN A;  2RQT A;  4C0Z A;  1SPK A;  2RHU A;  3NFC A;  2KE9 A;  5FU6 C;  5FU6 B;  2XK0 A;  5GAN f;  2MYS A;  1GBR A;  2OTL A;  4A54 A;  1I5L A;  2RO0 A;  4LXC A;  1P92 A;  5D6Y A;  1IHV A;  1G3T A;  3LLR A;  3L42 A;  3URG A;  3CXC S;  4Q5W A;  3G6E T;  2XG8 D;  3EHQ A;  1D3B B;  2LTO A;  3UDC A;  4C8Q F;  3RIR A;  4C92 F;  1R0C B;  2EGA A;  2KYB A;  1BCM A;  2M1H A;  4ZN3 A;  2LJ0 A;  2HSP A;  2ENM A;  4KH1 B;  4M77 D;  2DL4 A;  2LQ8 A;  2K3X A;  3EFO A;  4OMN A;  1E6G A;  1RLP C;  1ZA1 B;  2BZX A;  2KR3 A;  1ZUU A;  1OU8 A;  1UG1 A;  4JS4 A;  4ORZ A;  5GMK m;  4PJO F;  1RI9 A;  1UB4 A;  4LDY A;  1F1B B;  3OYK A;  2JMC A;  2GGR A;  5IXB A;  1ARK A;  5GAO p;  2QDL A;  1VQ7 A;  1NEG A;  1CKB A;  2ROL A;  4OMF B;  2RJC A;  3KBG A;  4E7I A;  3CC2 A;  2DJQ A;  3UF4 A;  1SEM A;  2DBM A;  2LCC A;  5LJ5 g;  2RMO A;  2YLB A;  3ER0 A;  4C8Q E;  4LDU A;  1G8X A;  4C92 E;  1VQL A;  3MP1 A;  1M3A A;  1QMC A;  1PCX A;  3P8H A;  1N9S A;  3OYL A;  1RAH B;  5GAN d;  3SB2 A;  5GAN 6;  1KIK A;  3SWN A;  1YJ9 T;  1RAD B;  2DZ9 A;  2NWM A;  4Y28 E;  1H3H A;  5KYW A;  1YCS B;  4PJO E;  4OB1 B;  1S72 Q;  4E2F B;  2EQK A;  3M9Q A;  2RJD A;  3MEW A;  4QVZ A;  1JXM A;  2QEX T;  2C06 A;  1Q82 U;  5CO7 A;  4E47 A;  3MEA A;  5GAN 5;  2E3I A;  2X4Y A;  3F70 A;  4M4Z A;  4MZP A;  5GAO l;  3HPW A;  1TU0 B;  1XQH A;  1GL5 A;  4EMH A;  4JPB W;  4PLL A;  1NJI U;  4JRI A;  3CCQ A;  4ANJ A;  2Y90 A;  1MUZ A;  2HCK A;  3OBW A;  4FW2 A;  2FO0 A;  5DM7 R;  2MI6 A;  4B6M A;  3PGG A;  1JRI A;  3CC4 A;  5HK0 A;  3BW1 A;  4WCI A;  2MMP A;  4M7A C;  3CCS Q;  5LJ5 f;  3A5Z B;  5CR2 A;  4LDX A;  3GIB A;  2DVE A;  1WJR A;  4E7K A;  4IUT A;  1WFW A;  3CCE A;  3QJ6 A;  3I55 A;  2NLU A;  2DEQ A;  2DIQ A;  3JCM Q;  1QVF S;  3HP9 A;  2K3B A;  2DZC A;  5GAM h;  1IRX A;  4PKC C;  5LJ3 h;  1N5Z A;  3RER A;  3HRT A;  4EMK B;  2D8J A;  5DLQ E;  4ZGD B;  2CZ6 B;  3EG9 A;  1I4K 1;  1AZE A;  2RJF A;  3QII A;  4Y91 A;  3CPW A;  2QA4 T;  4DBH A;  1H64 1;  4X9C A;  4XTU A;  2NUT A;  3VUB A;  1IO6 A;  3X24 B;  4LE9 A;  1U1S A;  1VUB A;  4QVD A;  4OML A;  4M7D E;  1KHC A;  4X9D A;  1VQ6 T;  4FSX A;  2ED1 A;  1HK9 A;  5EG2 A;  3TEE A;  5CCA A;  2RJE A;  4ELY C;  1PNJ A;  4J9G A;  2HQE A;  4EMG A;  3HFN A;  1SKU B;  4J9E A;  4F7U G;  1NZ9 A;  2HBW A;  2LQW A;  4QQD A;  4ELZ C;  5GAM e;  3QZ5 B;  3NPF A;  5LJ3 e;  2DL3 A;  1U5S A;  4OMM A;  2JM9 A;  2M51 A;  4PJN A;  1SRL A;  3CQT A;  3QJY A;  3PTA A;  3CD6 A;  2DYB A;  2M9U A;  1H3Z A;  1M9S A;  2ZCF B;  4F16 A;  4ZN1 A;  1WJQ A;  4C8Q B;  1M1F A;  1UGR B;  4C92 B;  2BUD A;  2CZ7 B;  1TOV A;  2KEA A;  4O5V A;  5IN1 A;  1QCO A;  3VYH B;  2LNH B;  3O8V A;  4PL6 A;  4MZT A;  3A98 A;  3C12 A;  1G2B A;  1I81 A;  1VYT A;  2XI9 A;  1LVK A;  1TWB A;  1YIJ Q;  3VS1 A;  4JZ3 A;  3G6E A;  1KHI A;  1WHL A;  3GNF B;  1QP2 A;  4RTT A;  3JV3 A;  1VQ5 T;  3CCV T;  3MET A;  3EHR A;  1RAG B;  2MWP A;  3H0I A;  3KFV A;  1MNE A;  2E10 A;  3E1S A;  2J6K A;  3CCL T;  1V76 A;  3OYY A;  1TTH B;  2DTH A;  1AWJ A;  1TH7 A;  4CC7 A;  3OSV A;  1OPL A;  1ZQ1 A;  4J6W A;  5FWC A;  2JS0 A;  4KGX B;  5I2M A;  1VIF A;  3LGL A;  2EBP A;  3I5S A;  1TG0 A;  4BE1 A;  1E7O A;  2K7A A;  1X2Q A;  2HSE B;  4KRT A;  2BE7 D;  3NHN A;  4C8Q D;  3EG3 A;  4C92 D;  4MDW A;  4J83 A;  5DY9 A;  3CCJ A;  1D0Y A;  3QYG B;  4MML A;  4NS5 A;  2YRD A;  4HVU A;  4C0G A;  1JJ2 A;  2KRM A;  2LNV A;  4HA8 A;  1OOT A;  1UJY A;  4RKU E;  1ZSZ C;  2EJG A;  1UEC A;  2VXF A;  3PIP A;  5I11 A;  2GCX A;  4NL3 A;  3VYG A;  4J7I A;  1W4S A;  2WSE E;  2PVG B;  1BBZ A;  2RH2 A;  4FT2 A;  3N5B B;  1AT1 B;  2B86 A;  3ME9 A;  4OVA A;  1LCK A;  2HAX A;  4OGE A;  2KYM A;  3QXE B;  3VRY A;  5IHN A;  4PFZ A;  4M75 F;  2Z0W A;  3FLG A;  3ZEH A;  3TSZ A;  1WQW A;  5GAN 8;  3I56 T;  3EGD B;  1YJ9 A;  1NE8 A;  1X43 A;  2RQR A;  3V8L A;  2JJ9 A;  3S3M A;  3GPL A;  2CRE A;  4L5G A;  1CSK A;  1Y96 B;  4KT0 E;  4M77 F;  3JCM c;  2XDB A;  2QEX A;  2A7Y A;  2VXE A;  3G71 Q;  1K73 C;  1QQJ A;  3RUX A;  4M7D C;  2KRO A;  4M7D B;  5FU7 B;  2LZ6 B;  1R0B G;  2YT6 A;  4J9F A;  4OF1 A;  2K5F A;  2PQW A;  4BY6 B;  2GTJ A;  2E41 A;  2EQI A;  2CKK A;  2KNB B;  4IIO A;  4BD3 A;  4F7U A;  4NOY A;  3M58 A;  1K0S A;  5KYN A;  3DLM A;  2R5M A;  4GLK A;  4Z02 A;  3OS5 A;  4JDS A;  5GAN 7;  3CXC P;  3WVE B;  2E6Z A;  1FXX A;  4M75 E;  1VQ9 T;  3M59 A;  3JB9 D;  1K73 R;  4M78 G;  4FU6 A;  3E19 A;  1K4U S;  3RKW A;  3V7S A;  1WNL A;  4LNP A;  1EIF A;  3OS0 A;  1M3B A;  2J7I A;  1M8V A;  8AT1 B;  2RK1 A;  4NL2 A;  4J6Y A;  2P0P A;  2K2M A;  2IG0 A;  2VWF A;  5HK3 A;  3OS1 A;  4M7D D;  5KE2 A;  2V8I A;  2HL3 A;  1U3O A;  3M5A A;  3VUZ A;  3CEY A;  4RTY A;  2BE9 B;  2E64 A;  1V29 B;  1VQK Q;  4WF2 A;  2EYW A;  2QAZ A;  3LWH A;  1BIA A;  3TQ7 P;  3MEV A;  3LWI A;  1YJN T;  4JJN K;  3S3O A;  1SHF A;  5KYX A;  1VQ8 Q;  2CH4 W;  2QA4 A;  1Y7X A;  1J3T A;  2EYY A;  1K76 A;  3CMA T;  2RD1 A;  4PNO A;  2RNA A;  1PWT A;  2LQK A;  1FX7 A;  1T3S A;  1MMA A;  1UJ0 A;  4RCC A;  3G4S Q;  3OW2 P;  1VQ6 A;  3QWX X;  4CC4 B;  2EAY A;  1B07 A;  1VQ4 Q;  2HNI A;  2K4Y A;  1GCQ C;  2FL7 A;  1SG5 A;  2WAC A;  4JLI A;  3QBY A;  2EJF A;  4IUR A;  4E7J A;  4BAC A;  3CCQ Q;  5GAO n;  1QCN A;  3JAM E;  3JB9 I;  5GMK l;  4BI4 A;  2V8K A;  1NLO C;  5GAN h;  1NPR A;  3MEU A;  1X2K A;  2QK0 A;  1PG5 B;  2BIV A;  1D3B A;  1N8R C;  1WJS A;  2CUD A;  2KRS A;  2DVJ A;  2YRC A;  3CBP A;  2X9H A;  1VIE A;  3M0T A;  3I55 Q;  2JTM A;  1WYX A;  3EGX B;  2COY A;  4N4G A;  1UEB A;  2LCL A;  5GAN 4;  4UC4 A;  1G3S A;  3OBY A;  3UT1 A;  1VQ5 A;  3CCV A;  1ZLM A;  2MCN A;  1JO8 A;  1TXQ A;  3HRU A;  3QPH A;  2QDY B;  3CCL A;  1QVF A;  4FYY B;  4M7A F;  2FRW A;  2MPX C;  2RHX A;  1N8R R;  5GAN e;  2EWN A;  1IXD A;  5KYY A;  2PVO B;  3ASK A;  4AG1 C;  1AWW A;  3QSU A;  2K6D A;  1YI2 Q;  3NTH A;  1MMN A;  1QW1 A;  1OI1 A;  4OP0 A;  4A63 B;  4XU1 A;  4C8Q G;  3UA6 A;  4C92 G;  1XTD A;  2NUP A;  2RI5 A;  2JNG A;  4IIM A;  2DD4 A;  3THK A;  4M75 B;  3L2Q A;  2GTO A;  2C0T A;  1YWO A;  3CCU Q;  4M78 A;  2QQS A;  2WSC E;  2HL5 C;  2EJ9 A;  2KDS A;  2BKD N;  4PFO A;  2KY9 A;  2EYX A;  2M0Y A;  1VQP T;  2X3X D;  4F04 B;  4PJO G;  3OS2 A;  3A8L B;  3ZL7 C;  3VS3 A;  4MMK A;  1QCF A;  4DEY A;  1Q95 G;  4M7A E;  2ZPB B;  2LT4 A;  5IHI A;  3DB4 A;  2E12 A;  3RNJ A;  4D8K A;  1M27 C;  2AKL A;  3M0R A;  3I56 A;  1Q7Y C;  1WHK A;  5IH2 A;  1LJO A;  1RLQ C;  2DFU A;  2L5Q A;  4X1V A;  2DLP A;  5KCO A;  1ZUK A;  1BYM A;  3PFS A;  5A0G A;  3H0F A;  1KG1 A;  4WTO B;  4M75 D;  2BZY A;  1YNZ A;  2DXU A;  1UDL A;  4MZM A;  3A1P A;  2CS7 A;  2XHC A;  4JJC A;  2KAF A;  3M57 A;  1NPP A;  2XKO C;  2B8A A;  3MCA B;  2CP3 A;  3JRZ A;  4FL6 A;  2VVK A;  5J39 A;  2YWW A;  1U1T A;  5LJ5 h;  1Q7Y R;  2CYZ B;  1TS9 A;  2RQV A;  9ATC B;  1EX4 A;  3EG0 A;  3BY7 A;  3CCJ T;  1UHC A;  2LP5 A;  1VQ9 A;  1M30 A;  2E6N A;  2YLC A;  1BCO A;  2F2X A;  1WHH A;  4OMO A;  1WLP B;  3BDL A;  4EMK A;  2ROT A;  1PKT A;  1HSQ A;  3JB9 G;  2EQU A;  1WDX A;  1AWO A;  1FYN A;  1ACM B;  2RB6 A;  2KT8 A;  3M55 A;  2DRK A;  2YRV A;  3OW2 S;  2V8J A;  1N8R U;  2HQH A;  2CP0 A;  1BI3 A;  4HXJ A;  4HCK A;  1KK7 A;  5LJ5 e;  1QWE A;  4XK8 E;  2VKN A;  2PU9 B;  3RBB B;  1YJN A;  2JXB A;  4XU3 A;  3U23 A;  1B34 A;  4C0D C;  2NUZ A;  4C0D B;  3VU3 C;  2PNI A;  3CMA A;  1X01 A;  2MWO A;  3PVQ A;  2RQU A;  2VAS A;  2OTJ T;  1MV3 A;  1M1G A;  3GLX A;  4C5E A;  4DQ2 A;  5CKB A;  2G6F X;  1RAC B;  1D1B A;  1ABO A;  2P0Q A;  5GMK e;  4E7L A;  3HFO A;  4OMP A;  2E5K A;  4AFQ C;  2X3W D;  2AZV A;  4C8Q A;  2DXC A;  4C92 A;  2V26 A;  3CME T;  1M90 C;  2DXB A;  3REA B;  3JB9 F;  1M4Z A;  1VQM Q;  1C6V X;  1S72 T;  3PMT A;  5A0L A;  1UGQ B;  2YXY A;  2QAS A;  3HHT B;  1W6X A;  3GBQ A;  3P8D A;  2YUQ A;  1MGQ A;  2OX7 A;  3L2U A;  4AFU C;  4M7D F;  2DER A;  4AG2 C;  3M54 A;  3CCR T;  4PJO A;  3Q1J A;  2GQV A;  3X28 B;  4M7A B;  3OYM A;  5CQY A;  4JUV A;  2DIL A;  4N4H A;  1Q86 C;  2M02 A;  4QW2 A;  2R58 A;  3JCM g;  4IUV A;  3JSC A;  1YIT Q;  2AKK A;  3REB B;  2P4T A;  1M90 R;  4ATO A;  1ZA2 B;  1WI7 A;  4ZGE B;  1W2B P;  3TRE A;  1QVG S;  3M56 A;  2YUN A;  2ZPE B;  2DF6 A;  4BE0 A;  1SSF A;  1X6G A;  5KYU A;  3CCS T;  1Q7Y U;  1YJW Q;  3OA6 A;  2IVW A;  2D0N A;  4C0F A;  1SHG A;  4XU0 A;  2QA4 Q;  6AT1 B;  2O9S A;  1Q86 R;  1FMV A;  4R56 A;  3TCJ A;  4ESR A;  1UGP B;  3OYE A;  2HZY A;  4M7A D;  3J80 E;  2PTK A;  2DYI A;  3A8H B;  4KUD K;  4J9D A;  3QDR B;  2LJ1 A;  3OYB A;  1WPY A;  5C0M A;  1IZ6 A;  1TSF A;  2LMJ A;  1AWX A;  3AT1 B;  4IUP A;  3EH1 A;  4FM4 B;  1LOJ A;  1K9M C;  3ZBD A;  4L6V 5;  1BU1 A;  1VQP A;  1R8O B;  3JCM f;  2GFA A;  4RTU A;  3SWN C;  1WHG A;  2EIF A;  5LJ5 d;  1H92 A;  2EKO A;  4X34 A;  1YWP A;  2DET A;  3MPU B;  5KYW B;  1V1C A;  1RL2 A;  2E5Q A;  4YTL A;  2O4X A;  2JUF A;  4AFZ C;  4TVR A;  1N9R A;  3VS7 A;  1FWZ A;  3X20 B;  5I2S A;  4HKE A;  2I0N A;  2J06 A;  1WXB A;  2C0I A;  4JRQ A;  1K9M R;  4FYV B;  2DBK A;  4P5N A;  1KQS P;  1TUC A;  3VS0 A;  3OQ5 A;  1HD3 A;  4PJM A;  1D0Z A;  4M75 G;  2ZPH B;  2AT1 B;  1JU5 C;  1C1A A;  3CC7 Q;  2RHZ A;  3OYH A;  3KUF A;  2KVQ G;  4D8D A;  2FVU A;  5FWB A;  5KCH A;  4A4E A;  1YIJ T;  4HT9 A;  2K79 A;  4M77 G;  2CSI A;  3A8O B;  3MHX A;  1PD0 A;  3BE3 A;  1QKW A;  1K9A A;  1G83 A;  2ZAE A;  2RQW A;  4N0A A;  1M90 U;  3L2R A;  3GNG A;  3C4S A;  3OB9 A;  5GAO m;  5I21 A;  2DIG A;  2HEQ A;  1PHT A;  5LJ3 f;  4A4F A;  2RPN A;  1YHQ Q;  1ZSZ B;  5J3B A;  1VOM A;  1ZSG A;  3NTK A;  2KBT A;  1OU9 A;  1AHJ B;  3PE0 A;  1KD1 C;  2EVR A;  1RUW A;  1OX8 A;  5GAM j;  3IQL A;  5LJ3 j;  3JCM d;  3TVT A;  3EG2 A;  3SD4 A;  1VQN Q;  3QUI A;  4CC2 A;  2RA2 A;  2JT4 A;  1T0J A;  3I56 Q;  5AYF A;  1D1C A;  1VQO T;  2OTL Q;  1GFC A;  4LUD A;  2OAW A;  2PVD B;  1HYO A;  1QKX A;  3VS4 A;  3SFM A;  3VKI A;  1UFF A;  4QQG A;  2HMA A;  2I2L A;  4LN2 A;  4BE2 A;  2E1H A;  2COW A;  2OTJ A;  1LNX A;  2W10 A;  1D0X A;  1KD1 R;  1M2V A;  1M1K C;  4EDU A;  1OUL A;  1VYU A;  3I5R A;  3LGF A;  1X75 C;  3CXC A;  1Z9Z A;  2YUP A;  1QWF A;  3OYC A;  3CME A;  1PRL C;  1VA7 A;  3M0P A;  3MP6 A;  4PJJ A;  2JN0 A;  4XQ3 A;  1MV0 B;  1S72 A;  1W2B S;  1NYG A;  3GF5 A;  3EGX A;  3V7C A;  2QQR A;  2MF2 A;  3G71 T;  4E7S A;  1W1F A;  5HKC A;  3CCR A;  2D0Q B;  5L23 A;  1T3L A;  1YCY A;  4L59 A;  3M4Y A;  1VQ7 Q;  2GF7 A;  2A36 A;  1K9M U;  1M1K R;  5CKD A;  3OMG A;  1WQ7 A;  1NLP C;  3RMS A;  4KH0 B;  3EAE A;  2MK5 A;  1NEB A;  3CC2 Q;  2JMA A;  2NYS A;  1A0N B;  1WHM A;  3C94 A;  3H9N A;  2P0K A;  4E6R A;  4A53 A;  4FSS A;  2G3R A;  1VQL Q;  2EYZ A;  5AT1 B;  3CCS A;  2FHD A;  3MJX A;  1NBE B;  2DJZ A;  3FRN A;  3QYH B;  4F14 A;  3OW2 A;  2KXD A;  3JCM W;  3OYN A;  4M75 A;  4QKU A;  5HCK A;  4E7H A;  1RAI B;  2DNU A;  1QP3 A;  2CH4 A;  4JRK A;  2D9T A;  2JTE A;  3CPF A;  3NMZ C;  2LDM A;  4CC3 A;  4PFP A;  2KT1 A;  4OGC A;  1VQK T;  1HXD A;  4KUI A;  1X6B A;  4M77 A;  1MND A;  1E6H A;  2A28 A;  4M7A G;  3ZFJ A;  3JCM P;  5HY6 A;  1BKB A;  1VQ8 T;  1GRI A;  3RR6 A;  3DB3 A;  3RKX A;  3MKD A;  5IAY A;  2LT1 A;  3JCM b;  2GBQ A;  2ECZ A;  3G4S T;  3I35 A;  3A8M B;  1KQS S;  2KXC A;  3NTI A;  1VQ4 T;  1O75 A;  3CC4 Q;  2VUB A;  3RMQ A;  3CCM T;  2L3R A;  2VV5 A;  2RN8 A;  4JRP A;  1OPK A;  3X26 B;  3CCE Q;  3HKS A;  3J7A F;  1KD1 U;  5LL6 S;  1ZBX A;  2V1R A;  1RAE B;  1C0M A;  2VGN A;  2QQ9 A;  2E65 A;  1VYV A;  3EFR A;  3JCM V;  2L3S A;  2FPF A;  5GAN 3;  1W70 A;  3BDU A;  4F7U B;  3WVD B;  4ZTF A;  5J26 A;  2QGF B;  1UTI A;  1M8M A;  1Y71 A;  1X6O A;  3M53 A;  2QGG A;  4AFS C;  2D1X A;  2SRC A;  3M0Q A;  2ZPF B;  1YIJ A;  1K73 U;  4KGZ B;  1WXU A;  4M78 E;  1M1K U;  5IXF A;  1SSH A;  3BFM A;  1QVG P;  1EZZ B;  4RCB A;  3V7R A;  1Q82 C;  4LDW A;  2V1Q A;  1BI2 A;  3LH5 A;  4IUU A;  3FIF A;  4KGV B;  3E9F A;  1CKA A;  3RKY A;  5FLX E;  1GFD A;  2DL7 A;  4QVC A;  2CUB A;  1NJI C;  1YI2 T;  2J6O A;  1G5V A;  3FEO A;  3L2W A;  4J8O A;  1OV3 A;  2XID A;  4AT1 B;  1EFN A;  3CD6 Q;  2DK3 A;  2H3E B;  3LW5 E;  2JW4 A;  3SDZ A;  4J9B A;  1Z9Q A;  1OQK A;  2EFI A;  4D6W A;  1Q82 R;  4HCZ A;  2DO3 A;  3CCU T;  1VQO A;  5A0D A;  3RDV A;  2YHT A;  1AVZ C;  4HT8 A;  1K0X A;  3G6E Q;  1NJI R;  2HD0 A;  4Y92 A;  3J81 E;  2COZ A;  3UPU A;  4OB2 B;  1JQQ A;  3OYJ A;  3H8Z A;  4B9W A;  3TSW A;  3H0H A;  2E4H A;  3VJP A;  2YUO A;  3JB9 J;  1KFZ A;  5CQX A;  1OZ2 A;  4JLG A;  4XTY A;  1NG2 A;  1JEG A;  2LQN A;  4M7A A;  2ZGW A;  2K57 A;  4LUE A;  4DBQ A;  2DL8 A;  4QQ6 A;  2X51 A;  3C95 A;  4CRI A;  2CT3 A;  2F2V A;  5GAN j;  3QO3 A;  4VUB A;  2XIC A;  2ZZD A;  3CCJ Q;  3G71 A;  2VC8 A;  2KK4 A;  4J6X A;  1GXI E;  2D6F A;  1WA7 A;  1GBQ A;  1WHJ A;  4J9C A;  1AEY A;  2EW3 A;  3H41 A;  2QTX A;  2LX9 A;  1OEB A;  2H3J A;  5D6X A;  1UE9 A;  1JXO A;  3G7Z A;  2O9V A;  2O88 A;  3JCM X;  3TU4 K;  2F1L A;  3S6W A;  5GMK h;  3E9G A;  2EYQ A;  2JS2 A;  1PSE A;  4AMC A;  2RI2 A;  4M7D G;  1I5O B;  5KYY B;  1FMW A;  4GY5 A;  2KI7 A;  2LRQ A;  2AIR B;  1R77 A;  2QTV A;  1M5Q 1;  4J5Y A;  4LD9 K;  1YJ9 Q;  4MDX A;  2M16 A;  1SF9 A;  4A4K A;  4BB7 A;  2FYK A;  2CGH A;  2CT4 A;  2DD5 A;  3G1J A;  3T9N A;  2NUP B;  1K8A C;  2OTJ Q;  2Y4X A;  3PVL A;  2FPD A;  2QEX Q;  3VRZ A;  4B9X A;  3QHS A;  1VQK A;  1BIB A;  4M78 C;  5D6W A;  4M78 B;  2EKH A;  2ESW A;  2LVM A;  2F5K A;  1QLY A;  3JCM h;  2L89 A;  3CME Q;  1VQ8 A;  3AHU A;  2J05 A;  1ZUY A;  4DBF A;  4IUQ A;  2CZ1 B;  4XAX B;  2FZC B;  5I22 A;  1XJW B;  4RMO A;  1ABQ A;  2DPP B;  2A0F B;  4BI8 B;  2VYT A;  3G4S A;  2AK5 A;  4JJB A;  1VQ4 A;  1IGU A;  1YBY A;  1UGV A;  2BTT A;  1K8A R;  3C0C A;  3CCR Q;  2GQI A;  1PSF A;  3CCM A;  3EGU A;  5GMK i;  2X4J A;  4C5G A;  2CP2 A;  2X4W A;  3LH0 A;  3UWN A;  1W2B A;  1WIE A;  2HQX A;  4O6J A;  1RI0 A;  2DMO A;  1X69 A;  5CKH A;  1QVP A;  4FW1 A;  1XNI A;  1VQM T;  2FG0 A;  2ABL A;  4M78 D;  5CIU A;  1MHN A;  4FYX B;  2QXF A;  2ZPI B;  3RES A;  3JCM e;  1JBM A;  1HJD A;  5KH6 A;  2RHI A;  1D1A A;  2RF0 A;  2K3Y A;  3EFO B;  4PJL A;  2JVV A;  3FJP A;  3QWY A;  3WXM B;  2IPO B;  5M9O A;  3CBM A;  4E7Z A;  2DXT A;  5LJ5 j;  1YIT T;  2ATC B;  2KSS A;  4C5I A;  4RTX A;  2FEI A;  1ZSZ A;  1PRM C;  4XTV A;  1BI0 A;  1D09 B;  2EGC A;  2HDA A;  1VQ6 Q;  1YN8 A;  4EMK C;  3DLL A;  2F5T X;  4BI3 A;  2YSQ A;  4HCB A;  1YJW T;  1RAA B;  1OZ3 A;  1JB0 E;  1K1Z A;  2OJ2 A;  4A4H A;  1NM7 A;  1IB8 A;  5GMK j;  5L8R E;  1YI2 A;  3L1A A;  3EGD A;  3E2U A;  5C6S A;  1OYX A;  5DLO A;  1PC0 A;  2JM8 A;  1YP5 A;  1FMK A;  2DRM A;  2LCS A;  5GAM g;  3CPW P;  5LJ3 g;  3JCM J;  1ZHI A;  1Y96 A;  1B34 B;  3SWN B;  4PK4 A;  2SEM A;  1YFN A;  4OMQ A;  3CBO A;  4M7D A;  1KQS A;  3CCU A;  2W0Z A;  3DKM A;  2C0O A;  2XU8 A;  1UGS B;  3EH2 A;  4J9I A;  4DA4 A;  1IGQ A;  2DM1 A;  4Z88 A;  2EQM A;  2IIM A;  3FB9 A;  1ZBJ A;  2R57 A;  5CAI A;  3S3N A;  1VQ5 Q;  3CCV Q;  3QG1 A;  1KC8 C;  2OAU A;  4J9H A;  4C8Q C;  4ZTJ A;  1M2O A;  4C92 C;  4K11 A;  1N6A A;  1T0H A;  4GBQ A;  3CCL Q;  1B7T A;  1U06 A;  3PNW C; 
#chains in the Genus database with same CATH homology
 2G3R A;  2DTO A;  4M78 A;  2QQS A;  2C06 A;  1Q82 U;  5CO7 A;  2WSC E;  1K8A U;  2EJ9 A;  4E47 A;  2KDS A;  2BKD N;  3MEA A;  3MP8 A;  4ZGJ B;  3L2V A;  3CCS A;  2KY9 A;  2FHD A;  5GAN 2;  4BDZ A;  5GAN 5;  1WGS A;  4J7F A;  2DJZ A;  2X4Y A;  3F70 A;  3FRN A;  4RG8 A;  3QYH B;  3OW2 A;  1VQP T;  4PJO C;  4PJO B;  1BI1 A;  4MZP A;  4PJO G;  3OS2 A;  3A8L B;  5GAO l;  3HPW A;  4MMK A;  1XQH A;  4EMH A;  3JCM W;  3QZ9 B;  3OYN A;  4PLL A;  4M75 A;  1NJI U;  4M7A E;  4JRI A;  2ZPB B;  2LT4 A;  3CCQ A;  2Y90 A;  2JOY A;  4E7H A;  3DB4 A;  1QP3 A;  4XU2 A;  5GAO r;  3OBW A;  2E12 A;  4JRK A;  2D9T A;  5FRO A;  5DM7 R;  3CC7 T;  2CZ0 B;  2MI6 A;  4F7U F;  1Q7Y C;  3CPF A;  3I56 A;  3PGG A;  2LDM A;  4OGC A;  1LJO A;  1VQK T;  1HXD A;  4KUI A;  1JRI A;  2L5Q A;  5GAM f;  3BW1 A;  5HK0 A;  3CC4 A;  3LX7 A;  2MMP A;  4M77 A;  5KCO A;  1BYM A;  3PFS A;  4M7A C;  4M7A G;  5LJ5 f;  3A5Z B;  5CR2 A;  3ZFJ A;  4LDX A;  5A0G A;  3JCM P;  3GIB A;  2DVE A;  2R5A A;  5HY6 A;  1WJR A;  2WSF E;  1BKB A;  1KG1 A;  4E7K A;  4IUT A;  1I8F A;  4M75 D;  3CCE A;  5CK9 A;  2DXU A;  1VQ8 T;  1VQ7 A;  3DB3 A;  4MZM A;  3QJ6 A;  3RKX A;  5A2Q E;  2CS7 A;  1U8R A;  2XHC A;  3I55 A;  2NLU A;  2DEQ A;  2DIQ A;  3JCM Q;  1QVF S;  5IAY A;  2KAF A;  3HP9 A;  2LT1 A;  3M57 A;  1Q86 U;  1NPP A;  2XKO C;  2B8A A;  3MCA B;  3JCM b;  3JRZ A;  2DZC A;  2X4X A;  3G4S T;  4FL6 A;  4R55 A;  5GAM h;  4M7D A;  3A8M B;  4PKC C;  1KQS S;  5LJ3 h;  4IKF A;  4PJO D;  3NTI A;  1VQ4 T;  5J39 A;  1U1T A;  1O75 A;  3RER A;  5LJ5 h;  1YHQ T;  2LC4 A;  2F69 A;  2VUB A;  2CYZ B;  3HRT A;  3RMQ A;  4EMK B;  3OYA A;  3CCM T;  2L3R A;  2VV5 A;  5DLQ E;  4ZGD B;  2CZ6 B;  1I4K 1;  4JRP A;  2DAQ A;  3BY7 A;  3X26 B;  4JS5 A;  2RJF A;  3QII A;  4Y91 A;  3CPW A;  3CCJ T;  3HKS A;  2QA4 T;  1H64 1;  3J7A F;  4X9C A;  4XTU A;  1KD1 U;  1VQN T;  5LL6 S;  3MO8 A;  1VQ9 A;  1ZBX A;  2E6N A;  3VUB A;  2YLC A;  4DOV A;  3L2Z A;  3X24 B;  4F7U E;  1U1S A;  1VUB A;  4QVD A;  3BDL A;  2VGN A;  4M7D E;  1KQ2 A;  1KHC A;  4EMK A;  2RHY A;  4X9D A;  1VQ6 T;  2QQ9 A;  4FSX A;  3JB9 G;  2E65 A;  2EQU A;  4KUL A;  2JZ2 A;  1HK9 A;  5EG2 A;  3TEE A;  2OTL T;  5CCA A;  2A3L A;  2RJE A;  3EFR A;  3JCM V;  4ELY C;  2RB6 A;  3M55 A;  2K5L A;  2HQE A;  5GAN 3;  2YRV A;  3OW2 S;  2V8J A;  3BDU A;  1N27 A;  4EMG A;  3HFN A;  4F7U B;  3WVD B;  3OSS C;  4F7U G;  3LYI A;  4ZTF A;  1NZ9 A;  5J26 A;  4QQD A;  4ELZ C;  1N8R U;  1DJ7 B;  1Y71 A;  5FU7 C;  5GAM e;  1BI3 A;  3P8B B;  1X6O A;  3QZ5 B;  5LJ3 e;  3M53 A;  3OYD A;  5LJ5 e;  2XDD A;  4XK8 E;  5CVI A;  4CI0 C;  1KD1 C;  2ZPF B;  3HRS A;  3FC3 A;  1YIJ A;  2O4X B;  2Y4Y A;  3OYF A;  4II1 A;  1K73 U;  2PU9 B;  4BY6 C;  3QJY A;  3PTA A;  3HSB A;  2O01 E;  1YJN A;  2M0O A;  3CD6 A;  4XU3 A;  2M9U A;  4M78 E;  1H3Z A;  1B34 A;  4C0D C;  5GAM d;  1M9S A;  2RM4 A;  2ZCF B;  5LJ3 d;  3VU3 C;  4C0D B;  4ZN1 A;  3CMA A;  1M1K U;  1VQM A;  1WJQ A;  1X01 A;  2K2V A;  3BFM A;  4C8Q B;  3KXT A;  1M1F A;  1Q81 C;  1UGR B;  4C92 B;  4M7D D;  2BUD A;  2CZ7 B;  4RCB A;  3V7R A;  4A4G A;  2MWO A;  1Q82 C;  4LDW A;  1BI2 A;  4IUU A;  3FIF A;  4O5V A;  5IN1 A;  4LD6 A;  3VYH B;  2OTJ T;  1M1G A;  3E9F A;  3GLX A;  3O8V A;  4PL6 A;  4HCC A;  4MZT A;  3C12 A;  2DTI A;  4C5E A;  4DQ2 A;  5CKB A;  3RKY A;  5FLX E;  1I81 A;  2P0Q A;  2EQJ A;  4QVC A;  2XI9 A;  5GMK e;  4E7L A;  3HFO A;  1NJI C;  1YI2 T;  1G5V A;  2PUK B;  3FEO A;  3L2W A;  4J8O A;  3G6E A;  1KHI A;  3GNF B;  1JJ2 S;  1QP2 A;  3H6Z A;  4C8Q A;  2XID A;  2DXC A;  1VQ7 T;  4C92 A;  1VQ5 T;  3OYI A;  3CCV T;  3MET A;  3CME T;  1M90 C;  2DK3 A;  2DXB A;  2MWP A;  3JB9 F;  1YIT A;  4KBM B;  1M4Z A;  2E10 A;  3LW5 E;  4M77 E;  3E1S A;  3CC2 T;  4V2S A;  3SDZ A;  3CCL T;  3OYY A;  2XDP A;  2QI2 A;  1S72 T;  3PMT A;  1KC8 U;  5A0L A;  1UGQ B;  5FRM A;  1KQ1 A;  2DTH A;  1TH7 A;  2RI3 A;  3OSV A;  4XTX A;  5GAO m;  4N0A C;  2EFI A;  3HHT B;  1ZQ1 A;  4J6W A;  4D6W A;  4HCZ A;  2DO3 A;  3CPW S;  3P8D A;  5I2M A;  1VIF A;  3CCU T;  4BDY A;  1MGQ A;  3L2U A;  3LGL A;  3OY9 A;  1VQO A;  5A0D A;  4M7D F;  2YHT A;  3M54 A;  3CCR T;  4BE1 A;  4PJO A;  1YJW A;  3Q1J A;  4HT8 A;  2GQV A;  5KE3 A;  3X28 B;  4PLI A;  4C8Q D;  4M7A B;  3OYM A;  5CQY A;  4JUV A;  4C92 D;  4N4H A;  4MDW A;  4J83 A;  5DY9 A;  3CCJ A;  1Q86 C;  2HD0 A;  3A8G B;  3QYG B;  4MML A;  3J81 E;  4NS5 A;  4QW2 A;  2R58 A;  3JCM g;  4IUV A;  4OB2 B;  3UPU A;  3JSC A;  3OYJ A;  3PIO A;  3H8Z A;  4B9W A;  2P4T A;  4C0G A;  1JJ2 A;  3VJP A;  4OB0 B;  3JB9 J;  4ATO A;  2LNV A;  5CQX A;  1OZ2 A;  4JLG A;  4HA8 A;  4ZGE B;  4XTY A;  3TRE A;  1QVG S;  2X35 A;  3M56 A;  2PUO B;  4RKU E;  4M7A A;  2ZPE B;  2EJG A;  2VXF A;  4BE0 A;  3PIP A;  2ZGW A;  2K57 A;  1IRE B;  2GCX A;  1SSF A;  3VYG A;  4J7I A;  4NL3 A;  3CCS T;  1W4S A;  4M78 F;  1Q7Y U;  2WSE E;  2PVG B;  4QQ6 A;  3C95 A;  3V8K A;  4CRI A;  3OA6 A;  2IVW A;  5GAN j;  3QO3 A;  2RH2 A;  4VUB A;  2XIC A;  4C0F A;  4FT2 A;  1Y07 A;  2ZZD A;  3N5B B;  4XU0 A;  3G71 A;  2VC8 A;  3X25 B;  4EPC A;  1O9S A;  4XTZ A;  3ME9 A;  2KK4 A;  4J6X A;  1GXI E;  4OVA A;  2D6F A;  3CCQ T;  2HAX A;  3PMI A;  4OGE A;  3QXE B;  4R56 A;  3TCJ A;  4M75 F;  3FDR A;  1UGP B;  3FLG A;  3ZEH A;  4BUG A;  1WQW A;  3OYE A;  2QTX A;  4M7A D;  2LX9 A;  2H3J A;  4TVR A;  5D6X A;  5GAN 8;  3I56 T;  3J80 E;  3G7Z A;  1YJ9 A;  1NE8 A;  3V8L A;  3CC4 T;  3S3M A;  3GPL A;  3JCM X;  3A8H B;  3TU4 K;  3QKJ A;  4L5G A;  3S6W A;  4KUD K;  5IT9 E;  5FRN A;  3V8J A;  5GMK h;  2ZPG B;  3E9G A;  2E70 A;  3QDR B;  2EYQ A;  2VGM A;  3OYB A;  1WPY A;  5C0M A;  1Y96 B;  4KT0 E;  4M77 F;  1IZ6 A;  1PSE A;  1G3Y A;  2RK2 A;  3JCM c;  1XOV A;  2QEX A;  2A7Y A;  2VXE A;  1K9M U;  1VQL T;  3CCE T;  1K73 C;  4IUP A;  3RUX A;  1QVG A;  4M7D C;  4M7D B;  5FU7 B;  2RI2 A;  3HL8 A;  3I55 T;  4M7D G;  4FM4 B;  1LOJ A;  1K9M C;  3ZBD A;  4L6V 5;  4OF1 A;  1VQP A;  2K5F A;  4GY5 A;  2LRQ A;  2PQW A;  5GAN g;  4FT4 A;  4BY6 B;  1M5Q 1;  4J5Y A;  4LD9 K;  1R8O B;  3JCM f;  2GFA A;  4MDX A;  2E41 A;  2KMT A;  2CKK A;  2AHJ B;  2M16 A;  3SWN C;  4A4K A;  4BD3 A;  2EIF A;  4F7U A;  4NOY A;  4XTW A;  2FYK A;  4BB7 A;  2DKG A;  2EKO A;  3M58 A;  4N4I A;  4X34 A;  5LJ5 d;  2CGH A;  2DD5 A;  2R5M A;  3DLM A;  3OYG A;  4GLK A;  4Z02 A;  3OS5 A;  3T9N A;  3GP8 A;  3R6O A;  4C5H A;  2Y4X A;  3CC7 A;  1K8A C;  4JDS A;  1RL2 A;  5GAN 7;  4B9X A;  3INZ A;  3QHS A;  1VQK A;  2XD0 A;  2E5Q A;  3WVE B;  2E6Z A;  1BIB A;  3EFS A;  3VV0 A;  1FXX A;  4M75 E;  4YTL A;  2O4X A;  2JUF A;  3M59 A;  3JB9 D;  1VQ9 T;  4M78 C;  5D6W A;  4M78 B;  1N9R A;  2MAM A;  1FWZ A;  4LDV A;  4FU6 A;  3E19 A;  4M78 G;  4ME7 A;  4HKE A;  3X20 B;  3RKW A;  2LVM A;  5I2S A;  3V7S A;  1WNL A;  2GFU A;  2QQB A;  2F5K A;  4JRQ A;  1EIF A;  3JCM h;  2L89 A;  3OS0 A;  1M8V A;  5CKE A;  1VQ8 A;  3JB9 H;  3AHU A;  2RK1 A;  4P5N A;  3PT9 A;  4IUQ A;  4J6Y A;  2CZ1 B;  3OQ5 A;  2P0P A;  4NL2 A;  2IG0 A;  4XAX B;  3GOX A;  5HK3 A;  4M75 C;  3OS1 A;  4FIB A;  2V8I A;  4RG2 A;  5KE2 A;  2JTF A;  4M75 G;  2DPP B;  4RMO A;  2ZPH B;  4BI8 B;  2VYT A;  3M5A A;  3VUZ A;  5CKF A;  3G4S A;  3L2Q A;  1Q81 U;  2KQW A;  2RHZ A;  2L8D A;  3CEY A;  3OYH A;  1VQ4 A;  2E64 A;  1V29 B;  1YBY A;  2QQA A;  2FB7 A;  2K5I A;  1YHQ A;  5GAO q;  3KUF A;  2KVQ G;  2FVU A;  1PSF A;  3CCM A;  5GMK i;  4WF2 A;  2X4J A;  1G3W A;  4C5G A;  5KCH A;  4A4E A;  3LWH A;  4OB3 B;  1YIJ T;  1BIA A;  2X4W A;  4M77 C;  3LH0 A;  4M77 B;  3UWN A;  1W2B A;  4HT9 A;  4M77 G;  3OMC A;  4DOW A;  3M4G A;  3MEV A;  3A8O B;  2HQX A;  3LWI A;  1YJN T;  4JJN K;  3CD6 T;  4O6J A;  3S3O A;  1RI0 A;  5CKH A;  1QVP A;  2QA4 A;  1Y7X A;  3MHX A;  2HBP A;  3CMA T;  2RD1 A;  1XNI A;  4PNO A;  1VQM T;  1VQN A;  4N0A A;  4C0Z A;  1M90 U;  3L2R A;  2LQK A;  1FX7 A;  2RHU A;  3GNG A;  4M78 D;  3C4S A;  3NFC A;  1MHN A;  3OB9 A;  4RCC A;  5CIU A;  5FU6 C;  1VQ6 A;  5FU6 B;  2XK0 A;  2QXF A;  2ZPI B;  3RES A;  5I21 A;  3JCM e;  5GAN f;  1JBM A;  2DIG A;  2EAY A;  2OTL A;  4A54 A;  2HNI A;  2K4Y A;  5LJ3 f;  1I5L A;  2FL7 A;  4A4F A;  2RO0 A;  1P92 A;  5D6Y A;  2RHI A;  5J3B A;  5KH6 A;  1G3T A;  3LLR A;  3NTK A;  2WAC A;  4JLI A;  2XDB A;  2K3Y A;  3L42 A;  3QBY A;  2EJF A;  1AHJ B;  2JVV A;  4IUR A;  3URG A;  4Q5W A;  3CXC S;  2XG8 D;  3G6E T;  1D3B B;  2LTO A;  3FJP A;  3UDC A;  4E7J A;  5GAM j;  4BAC A;  3WXM B;  5LJ3 j;  5M9O A;  3JCM d;  3CBM A;  5GAO n;  2DXT A;  5LJ5 j;  1YIT T;  3SD4 A;  4C8Q F;  3RIR A;  4C92 F;  3JAM E;  3JB9 I;  3QUI A;  5GMK l;  4BI4 A;  2V8K A;  2KSS A;  2M1H A;  4ZN3 A;  2RA2 A;  4C5I A;  5GAN h;  1NPR A;  4XTV A;  3MEU A;  1BI0 A;  5AYF A;  4M77 D;  2LQ8 A;  2K3X A;  1VQO T;  4EMK C;  3DLL A;  2BIV A;  2F5T X;  4BI3 A;  1D3B A;  1KC8 C;  4HCB A;  2PVD B;  1N8R C;  1YJW T;  1WJS A;  3SFM A;  3VKI A;  4QQG A;  4JS4 A;  1OZ3 A;  2I2L A;  5GMK m;  1JB0 E;  4BE2 A;  2E1H A;  4PJO F;  1UB4 A;  3CBP A;  2OTJ A;  1LNX A;  4LDY A;  3OYK A;  4A4H A;  1VIE A;  2JTM A;  5GMK j;  5L8R E;  1YI2 A;  3L1A A;  1M1K C;  5GAO p;  4N4G A;  4EDU A;  1UEB A;  2LCL A;  5GAN 4;  5C6S A;  4UC4 A;  1G3S A;  1OYX A;  3LGF A;  1X75 C;  5DLO A;  3OBY A;  3UT1 A;  3CXC A;  1VQ5 A;  3CCV A;  3OYC A;  3CME A;  4OMF B;  3MP6 A;  5GAM g;  2RJC A;  3KBG A;  3HRU A;  5LJ3 g;  2JN0 A;  3QPH A;  4E7I A;  3CC2 A;  4XQ3 A;  3JCM J;  1ZHI A;  1Y96 A;  1B34 B;  2QDY B;  2LCC A;  3CCL A;  5LJ5 g;  1S72 A;  1QVF A;  4M7A F;  3SWN B;  1W2B S;  2RHX A;  3GF5 A;  5GAN e;  3V7C A;  2YLB A;  2QQR A;  3CBO A;  3ER0 A;  2EWN A;  2MF2 A;  4LDU A;  4C8Q E;  3G71 T;  1KQS A;  3CCU A;  4C92 E;  1VQL A;  2PVO B;  3MP1 A;  3ASK A;  3DKM A;  2XU8 A;  1UGS B;  4DA4 A;  5HKC A;  3CCR A;  2D0Q B;  3QSU A;  2EQM A;  1YCY A;  3FB9 A;  3M4Y A;  2R57 A;  3NTH A;  3P8H A;  1N9S A;  4L59 A;  3OYL A;  5GAN d;  1QW1 A;  5CAI A;  2GF7 A;  1OI1 A;  4OP0 A;  3SB2 A;  5GAN 6;  5CKD A;  3QG1 A;  3OMG A;  2OAU A;  3SWN A;  1WQ7 A;  3S3N A;  3RMS A;  1YJ9 T;  4C8Q C;  4XU1 A;  4ZTJ A;  2DZ9 A;  4C92 C;  4C8Q G;  3EAE A;  4Y28 E;  4C92 G;  1XTD A;  1N6A A;  2RI5 A;  3C94 A;  4PJO E;  4OB1 B;  2JNG A;  2DD4 A;  2EQK A;  3M9Q A;  4M75 B;  2RJD A;  3MEW A;  4QVZ A;  2P0K A;  2QEX T;  3PNW C;  4A53 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...