3E9GA

Crystal structure long-form (residue1-124) of eaf3 chromo domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
107
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin modification-related protein EAF3
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 24
structure length 107
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9gA01
2F5KA 2HQEA 4IKFA 2EKOA 2D9TA 2RHIA 4A4FA 4E7LA 2GFAA 1OI1A 4GY5A 4X34A 3MEVA 5KE2A 2RHUA 3S3NA 4IUQA 3MP8A 4QQGA 3QJ6A 5D6YA 2LTOA 4QQDA 1KHCA 5IN1A 4C5GA 3P8DA 3H8ZA 5D6WA 3OYGA 4E7IA 2X4XA 2EQMA 2XK0A 4N4HA 3L2QA 3PMTA 2RI5A 2E6NA 2RHZA 3OMGA 3MP6A 3LGFA 2M0OA 3MEWA 5M9OA 4BDZA 1N27A 2X4WA 2LDMA 2RJFA 4RG2A 2DIGA 1WJRA 1WJQA 4QW2A 5J26A 4PLIA 1MHNA 4N4IA 4PL6A 3OYAA 3OB9A 2L89A 3BDLA 3E9FA 5KCHA 3OS0A 4IUVA 2O4XA 3OQ5A 3OY9A 3KUFA 2NLUA 2L8DA 2QQSA 3FDRA 3META 4C5EA 4ZTJA 2RI2A 3OYFA 3EAEA 3UWNA 3H6ZA 3ASKA 2GF7A 2B8AA 3DB4A 5FROA 4EDUA 2R57A 5KCOA 4BDYA 3LYIA 4IURA 3DB3A 2O4XB 5C0MA 4Q5WA 3CEYA 3OS1A 4C5HA 3OYNA 1SSFA 4Z02A 3LGLA 3ZEHA 3OYMA 2YRVA 4BE2A 4C5IA 3M9QA 4FU6A 1H3ZA 3OS2A 2WACA 2RHYA 3DLMA 2BUDA 2MWOA 2R5MA 4BACA 3SD4A 3MEUA 3MEAA 3OYKA 2FHDA 3QBYA 3S3MA 1OZ3A 3C4SA 2LRQA 2X35A 2K3XA 3F70A 2HQXA 4BD3A 5KH6A 4UC4A 4BE1A 3OMCA 2P0KA 3L42A 4IUPA 5FRMA 2EFIA 3OYLA 3P8HA 4II1A 4ZTFA 2RJDA 1WGSA 4QVZA 3OYCA 3PNWC 5J39A 5KE3A 3OA6A 4HCZA 3PFSA 4E7KA 3L2VA 2BKDN 2E5QA 4A4EA 2IG0A 3OYBA 3OYEA 2JZ2A 4A4HA 3L2WA 4N4GA 3L2RA 3GOXA 3MP1A 3PMIA 3OYJA 5FRNA 4NS5A 3NTKA 5CIUA 2LCCA 2RO0A 2VYTA 4L59A 2QQRA 2BIVA 4E7HA 2JTFA 3FEOA 3LLRA 4A4GA 2RJCA 4LD6A 4BE0A 3OYIA 2MWPA 3Q1JA 3E9GA 2R5AA 2LVMA 2M16A 3OYHA 3L2UA 2EQKA 3NTIA 5IAYA 1XNIA 1G5VA 3S6WA 2R58A 2EQUA 4IUTA 1WJSA 3ME9A 2L3RA 2RI3A 3LH0A 2M1HA 3FLGA 4PLLA 4B9XA 3FC3A 3QIIA 3OYDA 2PQWA 2XDPA 4CRIA 4E7JA 1RI0A 2G3RA 2GFUA 4OVAA 3LX7A 2X4YA 3S3OA 2K3YA 4FL6A 1OZ2A 3NTHA 4QQ6A 3O8VA 2EQJA 3QKJA 4IUUA 5D6XA 3UT1A 2CKKA 1OYXA 2RJEA 2DIQA 4B9WA 5C6SA 3MO8A 2DAQA 2RHXA
chains in the Genus database with same CATH superfamily
2MMPA 1X6BA 2ZCFB 4M75G 4GY5A 2O31A 1VQ6A 1VQ7T 1RLPC 2QQAA 2D0QB 1LNXA 1S72A 1OV3A 2H3JA 1OQKA 2PZ1A 3RR6A 2ZPFB 2HQHA 2K6DA 3QZ9B 5M9OA 3M0SA 2PVGB 1SPKA 2DIGA 5GMKe 2XIDA 3CBMA 3I5RA 1PKSA 2J6KA 2RPNA 2JN0A 3CCLT 5IXFA 3EHRA 3PE0A 2QI2A 3META 1B07A 2HBPA 4F16A 4JJNK 5DLQE 1D0YA 2DL5A 3DB3A 4DOVA 5C0MA 4C5HA 1WI7A 4ZGEB 2XDDA 2K3BA 1MMGA 4RTUA 2DO3A 3HFNA 2CH4W 3X25B 3EH2A 1YHQA 3EGUA 2R5MA 3J7AF 3CXCP 5LJ3e 1N5ZA 2LRQA 3CCEQ 2DKGA 2CGHA 1WHKA 1AWOA 5EC7A 2JMCA 4FIBA 3TVTA 4RTXA 2A36A 4XU3A 2KRNA 3A8LB 2QTXA 1QWEA 4FCYA 4M7DD 1PM3A 2RO0A 3MJXA 2F5TX 2DRKA 1NZ9A 3CXCA 3OYHA 2CZ0B 3ME9A 4HA8A 5GAOq 1JEGA 2HEQA 2K5FA 3EG9A 3P8BB 2QG9B 4L5GA 2FG0A 5CCAA 3UPUA 3CC4Q 2F69A 1N9SA 2K7AA 1FYNA 4IUUA 4RMOA 5HKCA 4C92F 1SHGA 2K5LA 2JNGA 2EKOA 5GANj 2K9GA 5FU6B 2KI7A 3LW5E 4QQGA 3E2UA 4M75B 3KBGA 3QDRB 5IN1A 4M78D 1UJ0A 1BB9A 1ABOA 2XK0A 4LUEA 4E7IA 3SHWA 1LJOA 2RHZA 1OPKA 2LDMA 2MAMA 1VQ8T 5IHIA 1VQPA 3M57A 3CCQQ 1SRMA 2EVRA 3RERA 3A5ZB 2E4HA 1JXOA 4ELYC 1X6OA 4EMGA 3CCVQ 2RQRA 3X28B 5FLXE 1RAGB 3JCMc 1MV0B 5HY6A 3CBPA 3ASKA 1FMWA 1X27A 3UF4A 4GBQA 4DA4A 1M2VA 4Z8AA 2JMAA 5LL6S 5GAMd 1BIAA 2WACA 2OTJT 3CPFA 3HP9A 1K73C 1Z9QA 1WXTA 2K3XA 5KH6A 3CCSA 1AOJA 1Y71A 1IXDA 1OX9A 5FRMA 3WXMB 4II1A 3M58A 2FO0A 2KK4A 2E10A 1YJ9Q 1C1AA 5A0LA 3G4ST 2D8HA 2YUQA 4A4EA 3OBYA 2OAWA 4N4GA 4Z89A 1IO6A 3VS5A 2QQRA 3CD6Q 1GXIE 4JLIA 3HRSA 2G6FX 3QWXX 3NFCA 3CCJT 3VS3A 5KYNA 1D3BA 3JCMV 2EQKA 3HFOA 2GGRA 2KR3A 3VUZA 3A8MB 1K8AR 1WHGA 3C94A 4CRIA 4FW1A 4OVAA 5FWCA 3VV0A 3CCMT 1VQ4Q 4M77G 5DLOA 3CPWA 5GMKm 5D6XA 2ED1A 2HD0A 1YBYA 3CC2A 3LH5A 2F5KA 2O01E 2QXFA 2O9SA 1AWXA 2AKKA 4FW2A 4M75E 2E6ZA 2E3IA 1G3WA 3CCRT 1BBZA 1N6AA 3H8ZA 2X4XA 4CC7A 1YIJT 2RI5A 2YRDA 2XKOC 4BDZA 2NUTA 3GPLA 3AHUA 4JPBW 1U06A 3C0CA 2JM8A 2LP5A 2NUTB 1AWWA 5AT1B 2FL7A 1CSKA 2A37A 4RTTA 2IPOB 3UWNA 3G71Q 2QAZA 1ZHIA 4M7DA 2AZVA 4YTLA 1MGQA 1PHTA 1HYOA 1SSFA 4KT0E 1OEBA 3FJPA 2CZ1B 1M8MA 4D8DA 5CKDA 1VQ7A 4PJOC 1H3HA 1M9SA 2JTMA 2C0IA 4N0AA 2A28A 1IZ6A 4FYYB 1WGSA 2PUOB 3HKSA 1G83A 1YJWT 4E7KA 2OI3A 4LDXA 1IREB 1EIFA 2YHTA 4GLKA 3GOXA 4C92D 3CCLA 3A8HB 3LLRA 2YWWA 2E41A 1LVKA 2EGAA 3OYIA 4M78A 4BI3A 2R5AA 4ATOA 4RTZA 1M5Q1 1VYVA 1M90R 5I21A 1X43A 4PJOG 4M78B 1QCOA 1WFWA 3OYDA 4V2SA 1CKBA 1Y96A 1M1KR 3JB9D 2QA4T 2A08A 3A8GB 3CCUA 1QW1A 3ZFJA 1ZUUA 4E7LA 2E12A 3MEVA 1KQSA 1ZSZA 2DFUA 5D6WA 1O75A 4N4HA 4DBHA 4OMOA 1TS9A 2SRCA 2M0OA 4J9DA 1XTDA 1NEGA 2DX1A 3AT1B 5LJ3f 2ZPBB 5J26A 1M90U 4PLIA 2D0NA 1VQ9Q 2XD0A 2DK3A 1SEMA 1MMAA 2LNHB 1M1KU 2ZPEB 5GMKh 2QYZA 4IUVA 3OQ5A 3M5AA 4J9GA 1T0HA 3DLLA 1PKTA 5GAMj 5LJ5j 3EAEA 3I56T 1KJWA 3DB4A 1RADB 1QVFA 2M0YA 3M0TA 2X3XD 1V29B 2VWFA 3X20B 5KYYA 1GBRA 3OYMA 2ROLA 1UGRB 1B34B 2LZ6B 1UG1A 5FU7C 4OGEA 3MEUA 2D6FA 4XU2A 1I4K1 4JUVA 4UC4A 4X9DA 1GFDA 3EFOA 5AYFA 3JCMe 4ZTFA 1VQOQ 5LJ3h 4OB3B 3PNWC 4JZ3A 2DTHA 4QVDA 1NPRA 4EMKA 2EYXA 3ZBDA 3EGXA 2E5QA 2F2XA 3EFOB 1M1FA 2CP0A 1OULA 1IHVA 3JCMJ 1LOJA 4EMKB 1YI2Q 3JRZA 1BYMA 2VGNA 2L3PA 4J5YA 3FRNA 3JCMP 2EBPA 5L23A 4J9IA 1XNIA 3ER0A 2JVVA 3VYGA 1PD0A 2XDBA 3HTRA 3CCET 1KHIA 5KYUA 3OSSC 3URGA 5GAN5 4M77E 1GL5A 2OTJA 1YCYA 4IKFA 4J9BA 1YITQ 1KC8C 4XK8E 1D09B 3NHNA 1D1CA 1WZOA 2HKQB 4BB7A 2RM4A 1BI3A 2JW4A 3G4SA 1BI0A 2MYSA 2HMAA 1NJIC 4J9EA 1WHHA 1E6HA 4MMLA 2OJ2A 2V1QA 1TUGB 1AHJB 4MZMA 3NMZC 4AFSC 1TSFA 1ZSGA 1QCFA 3CC4T 5GAMg 2JJ9A 3VS0A 5LJ5g 2RQUA 4JS5A 1M3BA 2DTOA 2K79A 1YJNA 4HCBA 5HK3A 1WA7A 2R57A 5L8RE 2COYA 2CUBA 4C92A 3CCMA 5GANd 2KT8A 3BDUA 4LDWA 4D6WA 3I55Q 2LMJA 3CC7A 4C5IA 1QVGA 4C92B 2DPPB 4OMQA 2RMOA 2OTLA 2BUDA 1EX4A 3G6EQ 4BACA 1RAIB 2F2WA 2FHDA 1RUWA 4JJBA 4BE1A 3QPHA 4BD3A 4J7FA 2FZCB 3CCQT 3JV3A 1O9SA 1I5LA 2RJDA 3MPUB 2RQVA 1VQKQ 1R0BG 1GCQA 2QEXA 3CCVT 1Q7YR 2DXCA 4O5VA 2J7IA 4NS5A 4RTYA 4XQ3A 1M1GA 2Y4YA 4OB1B 2JTFA 2D8JA 4MDXA 3JCMb 2QQ9A 3X26B 4J9HA 2EGCA 2YUOA 1WHLA 2VASA 2KMTA 2JS2A 4IUTA 4M7AD 5FU7B 1Y7XA 5FU6C 4PJOE 2EYWA 3GBQA 2EKHA 4FL6A 1BIBA 1TUDA 2JXBA 4OMFB 1YJ9T 4HVWA 2RJEA 5CR2A 1S72Q 3SB2A 3EGDA 3CMAA 1Q81U 4NL2A 2V8JA 5CKFA 6AT1B 4FSXA 1JU5C 3IQLA 1TTHB 1YJWA 3CD6T 1Q86U 3L2QA 2JUFA 1RAHB 4C8QF 3LGFA 1C0MA 1KD1C 4OMLA 2CP6A 1JBMA 1W1FA 2CREA 2V8IA 4J8OA 3U23A 2L89A 1P92A 4JZ4A 1ARKA 4R0KA 1VUBA 2O4XA 1XQHA 3FDRA 3M55A 1UGVA 4IIOA 1IGQA 5FROA 5I11A 4XAXB 3SFMA 2O4XB 4Q5WA 3CEYA 1YHQQ 1Q82R 2L3SA 3GNGA 1RL2A 1QMCA 1TH7A 3OS2A 1K0SA 1AZGB 3JCMX 1Z9ZA 4PJMA 4HXJA 1UGQB 3OYCA 1WIEA 4OMPA 5GAN7 4XTZA 3G71T 4JRPA 4L6V5 1BKBA 1HJDA 2KEAA 1OU8A 3M53A 2HZYA 3I35A 1YNZA 3SWNA 1AVZC 1Q82U 1QWFA 3A8OB 2KYMA 1VQNQ 3M0UA 5IAYA 3SWNB 1G2BA 2EQUA 4ZNXA 4XTUA 1D1AA 5DM7R 2XI9A 1SHFA 2K3YA 3RMQA 1T3SA 4QQ6A 3PTAA 2EQJA 4B9WA 3H9NA 3MO8A 3E1SA 2RHXA 1IRXA 4XU1A 1F1BB 3REBB 2V8KA 7AT1B 2P0QA 4F7UA 5CVIA 3QJ6A 2CSQA 2JTEA 2RNAA 4J7IA 4GLMA 4HVUA 3WVEB 5GJVB 2RQTA 4ZGDB 3PMTA 3RMSA 5IT9E 1VIEA 1U1SA 1M2OA 2LQKA 5HK0A 1K76A 3EG9B 4N4IA 3JCMf 4QVCA 8AT1B 1MMNA 1ZUYA 1UGPB 4KUDK 4JJDA 4M7DC 3PVLA 4OGCA 1ACMB 3LYIA 2O88A 1HK9A 1V76A 1FMKA 1M30A 4DEYA 1ZBXA 4AG1C 3CCSQ 1JRIA 1EFNA 3DLMA 3JB9F 2HKNA 2LJ3A 2DXTA 2KNBB 4N0AC 4M7AA 5FW9A 3BFMA 2LJ0A 2P0KA 1VYUA 2P4RA 2DVJA 2ZPGB 1VQ9T 1FX7A 2KXCA 2DJQA 5CKHA 4WF2A 2X3WD 3JCMh 2BZYA 4C0ZA 8ATCB 4FYVB 4M7DG 5LJ5d 5CIUA 4RCCA 3RIRA 3CMEQ 1RAAB 2AT1B 4M78C 2ECZA 2M51A 4BE0A 1J3TA 1M2VB 1U3OA 2DMOA 2HNIA 5GAOr 5CQXA 2LJ1A 3M56A 4KULA 2RI3A 2HDAA 1GFCA 2AK5A 1Y0MA 2ZPHB 4C8QD 1VA7A 3CC2Q 2DEQA 2XDPA 1OU9A 1PC0A 4EIKA 1UUEA 1VQOT 4JRKA 3V7RA 1K1ZA 4HKEA 2GFAA 3QG1A 2DL7A 1ZSZC 3S3NA 2FVUA 2KYBA 4ZN1A 3D7SB 2O9VA 1YWPA 4DEXA 3CCQA 3RUXA 1W2BS 5I22A 1YI2T 4M78G 4FYWB 5A0GA 1X75C 5GAN3 2EIFA 1VIFA 2E65A 3JB9H 4LUDA 1KC8U 1D3BB 4KGZB 1OOTA 4RTVA 1NYGA 2EYYA 1R8OB 1YCSB 1VQLQ 5GANg 1GBQA 1TG0A 2OAUA 5GMKi 1NJIU 1OPLA 4BI4A 1VQMT 2GCXA 2L8DA 3RESA 2GTJA 2FPEA 4C5EA 2V26A 2FB7A 2I2LA 1Q7YC 1NLOC 1YITT 2CP2A 3OS1A 4C0GA 1H3ZA 2RHYA 2VB6A 2BTTA 3VS2A 4BY6C 3FJ5A 3UA6A 3VS1A 2NWMA 2HL3A 2BZ8A 2LT1A 3L42A 5A2QE 1QP3A 3GF5A 1I8FA 2PTKA 4EMHA 4EMKC 5J39A 1NPPA 4WCIA 3CCLQ 1D0ZA 1MV3A 3QXEB 3L2RA 3PMIA 2FPDA 2P84A 1K9MC 5GAOp 4M7DB 3I55T 2LVMA 2DZ9A 4A53A 2J6OA 3L2UA 3NTIA 1SF9A 4BI8B 2RQWA 3G6ET 1QLYA 2M1HA 2KRSA 3CCUQ 1WXUA 2PQWA 2A0FB 2GTOA 4F7UF 2AIRB 1UGSB 4J6WA 1MUZA 2PVOB 2QGGA 1VQKT 1FWZA 2NYSA 1VOMA 1SG5A 4X34A 1N8RU 1KHCA 4C5GA 3P8DA 1T3LA 2EQMA 5GANe 4J9CA 2GQIA 1K4US 2QQBA 1TOVA 1PCXA 1KQ1A 4NOYA 4XTVA 4B6MA 1WLPB 5KYWA 1WJRA 3GLXA 3RKXA 2MCNA 1Y96B 3G1JA 3OY9A 2MI6A 5CK9A 2YSQA 1S72T 4M77A 4C92C 2GF7A 4BDYA 4DBQA 4NL3A 4ME7A 4M7AF 3OS5A 4LXCA 1ZSZB 2DLPA 2CZ6B 2ZAEA 1YN8A 4X1VA 3BE3A 4C8QA 3VS6A 3VRZA 1GCQC 1PRMC 3OA6A 1A0NB 4C8QB 1JQQA 4ZGJB 3OYEA 2EYQA 4Y28E 2M9UA 4C92G 3MP1A 2YXYA 2P0PA 4L59A 2A3LA 4M7DE 4DOWA 1YHQT 2KBTA 2PU9B 2E5KA 5KYYB 3QUIA 2CUDA 3TCJA 2FPFA 3Q1JA 1UHFA 2M16A 4JJCA 1HSQA 1WJSA 4C0DC 4BY6B 2EYZA 2GFUA 3T9NA 1I5OB 3JB9G 1VQ8A 1Y07A 2EW3A 3NTHA 1VQ5Q 2EAYA 1ZA1B 2XICA 4MDWA 4A4FA 3EGXB 1HXDA 1MNEA 2DEUA 3JB9I 1T0JA 3C12A 2H3EB 5GMKj 3HRUA 3E19A 2EGEA 2XG8D 1ABQA 2YUNA 1X2KA 3PT9A 4M78E 5CAIA 2DTIA 2E6NA 2ABLA 4ELZC 1VQNT 5IHNA 5CKEA 1KIKA 4LE9A 1RAEB 2GNCA 5GAOm 1YJNQ 2DXUA 1MHNA 1NEBA 2KE9A 4M4ZA 1SSHA 5KYUB 1AT1B 4KGVB 1U1TA 1PSEA 3O5ZA 3PGGA 3CC7Q 2CDTA 2WSFE 4IURA 2OTLQ 1QCNA 5LJ3j 1QKWA 2C0OA 3V8LA 4PNOA 2JS0A 2YLBA 2J05A 3JSCA 2JOYA 1UTIA 2L5QA 3CCJA 1K73R 2QEXQ 2HQXA 1UJYA 2K2MA 2WSCE 3A98A 5ECAA 2RD1A 5GJWB 1NM7A 3EFSA 2VXFA 2JZ2A 4A4HA 3OYJA 2MIOA 4TVRA 3SWNC 4AT1B 2RB6A 2NUZA 2FZGB 4OB0B 2RJCA 1VQMA 3EHQA 1X6GA 2KXDA 3CCST 1I81A 4R55A 1KQ2A 3CCRA 1WQWA 1K8AC 2VGMA 1YITA 3FC3A 4J6XA 1YIJA 4JRQA 4AFZC 4CC2A 4OB2B 1RI0A 1K73U 3LX7A 3CMAQ 1Q81R 1H641 4RUGA 3G7ZA 3O8VA 2HSEB 1BU1A 1I1JA 2DAQA 2VC8A 3H41A 3SDZA 5GAN8 2LX9A 5FWBA 4RKUE 1YJWQ 1Q86R 4DBRA 3PIOA 3EH1A 3VYHB 4E7SA 3CMET 1GCPA 4RCBA 3KXTA 1H92A 3OW2P 1N9RA 1RAFB 3JCMW 1TU0B 4RG8A 2KSSA 2F1LA 5KYXA 2RF0A 2VXEA 2XMFA 1ZQ1A 2X4WA 1VQ6Q 4QW2A 4M77F 3HRTA 4A4KA 2P4TA 1FXXA 2LNVA 4Z88A 4C0DB 4LDUA 5GAOl 1SKUB 2FYKA 2LQNA 3H6ZA 1NBEB 1WHJA 2MK5A 4F7UG 3EGDB 1H8KA 2QDLA 2X4JA 1BI2A 3LGLA 4HVVA 3RKYA 5GAMe 5LJ5e 1QP2A 4FU6A 2FZKB 2E1HA 4XTYA 4M7AC 4D8KA 3HHTB 1VQ4T 1OZ3A 4ESRA 3OMCA 1VQLT 2PUKB 3P8HA 2QASA 1IHWA 4ORZA 1BCMA 3NPFA 2K5IA 3PFSA 2H8HA 2IIMA 2QA4A 1NLPC 2I0NA 4KUIA 4ZN3A 4C92E 3QO3A 3RKWA 2A7YA 1JJ2S 5GANf 2Y4XA 3L1AA 3OW2S 2QGFB 2EQIA 2VV5A 1M90C 4PFOA 4M7AG 3LH0A 2CS7A 1K9MU 3H0IA 3VRYA 1M1KC 1I07A 4DQ2A 1WQ7A 2X4YA 2DZCA 4LNPA 5DY9A 3FIFA 3J81E 1Q95G 5C6SA 4HCCA 2VUBA 1YFNA 2DIQA 1LPLA 2D9TA 2RHIA 4QT7A 1E7OA 3J80E 3MKDA 2DA9A 2ZGWA 3I56A 2XU8A 1K0XA 3RDVA 2VVKA 1ZBJA 4BUGA 2KQWA 4PJOF 3EG0A 2LT4A 1RI9A 1N27A 2MOXA 1ZA2B 5GANh 1FMVA 4J6YA 5CKBA 3CCUT 2Y90A 1PWTA 2NUPA 2NLUA 2QQSA 4ZTJA 3WVDB 4KH0B 1VQPQ 3R6OA 3TU4K 2NUPB 4F7UB 4DBFA 1PD1A 3PVQA 1BK2A 4FSSA 1UE9A 3SD4A 3LWIA 2E64A 3OYKA 1JO8A 1V1CA 2Z0WA 1NYFA 4QVZA 2KGTA 2CYZB 2E70A 2K4YA 1VQNA 3CCEA 1W2BP 3QSUA 2KRMA 2AKLA 4J9FA 2BKDN 2IVWA 3MHXA 4M75A 2X9HA 1AWJA 2LC4A 3MCAB 1X69A 3RBBB 3FEOA 3OBWA 3EG2A 3TREA 1TXQA 1UECA 1WPYA 1W4SA 1XJWB 5A0DA 2R58A 2L3RA 3FLGA 4B9XA 1G8XA 2F2VA 2CP3A 1RABB 4LDVA 4M7AB 3VU3C 2YUPA 3S3OA 3HSBA 4M77D 1W2BA 3CXCS 4O6JA 3CQTA 4F04B 2C06A 1D1BA 3UT1A 2CKKA 1S1NA 3OS0A 2HSPA 2JT4A 3CC4A 3GNFB 2ZZDA 1KC8R 3CBOA 5CO7A 3QZ5B 2W0ZA 1YWOA 4QKUA 3A1PA 2J6FA 3VS7A 3QHSA 3MEWA 1NJIR 5IXBA 1C6VX 2DVEA 1PNJA 4AFUC 3OYAA 3OB9A 3X24B 5I2MA 2AZSA 2DL4A 4M77C 1VQ5T 2DL3A 4FT4A 2GBQA 2DF6A 1KSWA 2MPXC 2B8AA 4EDUA 2KY9A 1AZEA 3OSVA 4F7UE 2OX7A 3JAME 3CPWP 3CCVA 2BE9B 1R0CB 2PNIA 3ZEHA 1DJ7B 2YRVA 4KRTA 3ULRB 2DJZA 2ZPIB 2AHJB 1UB4A 3V7SA 3VKIA 2MWOA 2YDLA 4C8QC 1X2QA 3M4GA 2KVQG 3F70A 4PJLA 3CMEA 2DERA 3PIPA 1YJNT 3TQ7P 3QYGB 4FYXB 1Q81C 4IIMA 3M59A 4WTOB 1ZX6A 1UFFA 2J06A 2RK1A 1VQ7Q 2YRCA 2FRYA 3CC7T 1I0CA 1YJ9A 3NTKA 1ZUKA 1M3AA 1Q86C 1G3YA 2OTLT 4E7HA 1E6GA 4A4GA 2CSIA 3UATA 4RTWA 1D0XA 3SEMA 1ZLMA 5LJ3d 1HD3A 2DBMA 4KH1B 2VKNA 1AEYA 3CD6A 4C8QG 3QIIA 4PJOD 4M7AE 2QEXT 1IGUA 1Y57A 1N8RR 2EWNA 1PG5B 1M4ZA 1K8AU 4F17A 1VQ4A 1MNDA 1OI1A 2QDYB 5KE2A 1QVPA 1VQLA 1TWBA 3UDCA 1WHMA 3CPWS 4JLGA 3EFRA 4ANJA 5GAMf 5LJ5f 1GRIA 2FRWA 3MP6A 2DRMA 4PKCC 2EPDA 1OX8A 2YT6A 3QWYA 1KD1R 1IB8A 1G3SA 2K57A 3RNJA 3H0FA 5KCHA 3CMAT 2L0AA 2SEMA 3QDFA 3EG1A 1JXMA 4OMMA 1AD5A 4OP0A 1Q82C 2HBWA 4KBMB 1WXBA 3JCMg 2X51A 3G71A 4MZTA 2JM9A 3QYHB 2E3HA 1KQSP 1EZZB 4E47A 5GAMh 5LJ5h 2BZXA 1VQ6T 3M0QA 5KYWB 4IUPA 4CC3A 4M75F 1KD1U 4AMCA 1RACB 3VJPA 4AG2C 2PVDB 5GAN6 2RH2A 2IG0A 3OYBA 3L2WA 1CKAA 1BCOA 2CZ7B 4M77B 4OMNA 2W10A 4LD9K 2VYTA 2LQ8A 4AFQC 1G3TA 2BIVA 2DBKA 4CI0C 3M4YA 2DXBA 4HT8A 5GMKl 1B7TA 3L2ZA 4CC4B 1QVFP 2C0TA 1VQ8Q 4XTXA 2LX7A 2YLCA 5IH2A 5CQYA 1TUCA 3M54A 1UHCA 2K2VA 3THKA 4HCKA 1OYXA 4E2FB 2COZA 4C0FA 2RHUA 5J3BA 4IUQA 2DE0X 2LTOA 1B34A 2M02A 3VS4A 2KAFA 5I2SA 3I5SA 2GQVA 1QKXA 4MMKA 2CT4A 5D7UA 2OTJQ 1M27C 4FT2A 1UDLA 2KT1A 3V7CA 1KQSS 2RJFA 4RG2A 2XHCA 1WJQA 3TSWA 1U8RA 3NGPA 4PL6A 3JCMQ 3BDLA 4LN2A 4VUBA 3BY7A 1VYTA 3G4SQ 2QK0A 2RI2A 3OYFA 3VUBA 1VQ9A 1QQJA 5KCOA 1RLQC 2D1XA 3GIBA 2DD4A 2WSEE 4A63B 4A54A 3OYYA 3HL8A 4BE2A 3CCJQ 3QJYA 1M3CA 2KROA 5EG2A 3MEAA 1QVFS 3S3MA 3C4SA 4PJOA 3CCMQ 1NE8A 4PFZA 1B3QA 2EFIA 3OYLA 1U5SA 2RK2A 2EJGA 2HL5C 3GP8A 1KG1A 5KE3A 4HCZA 1JB0E 3M0RA 3L2VA 4PJOB 3FB9A 1NG2A 2DL8A 1SRLA 2DILA 2FEIA 3REAB 1VQMQ 2DETA 2RA2A 5IHKA 1VQOA 5FRNA 2LCLA 3M0PA 2LCCA 3H0HA 1VQPT 3CCRQ 3I9QA 4J83A 1WDXA 2MWPA 1YIJQ 3EG3A 3E9GA 1VQ5A 1X01A 3V8KA 1YI2A 3S6WA 1BI1A 4PLLA 4PK4A 4P5NA 1QVGP 2G3RA 4C8QE 1MMDA 1OZ2A 1W6XA 4KGXB 1LCKA 1KK7A 5GAN2 2L3QA 3JB9J 4E7JA 4M7DF 2HQEA 4EPCA 2LQWA 3MP8A 5D6YA 1M8VA 4QQDA 3INZA 3HPWA 3OYGA 2RN8A 2MF2A 4JRIA 4MZPA 4X9CA 3OMGA 1K9AA 3LWHA 4PJJA 4Y91A 2KDSA 2L2PA 4JS4A 4Y92A 4HT9A 4JDSA 3E9FA 4M75D 3KUFA 4F14A 3TSZA 1JJ2P 2ESWA 5GAOn 2O2OA 4M78F 9ATCB 2DM1A 1KFZA 2DNUA 1XOVA 1UEBA 2CP5A 1PSFA 4E6RA 4Z02A 3OYNA 2BE7D 2QTVA 3M9QA 4R56A 4PFPA 3CC2T 3ZL7C 2ROTA 3DKMA 5KYXB 2DD5A 3I55A 3QBYA 2B86A 2X35A 2EJFA 2QA4Q 3R6NA 3V8JA 1W70A 2COWA 2LCSA 3G6EA 1QVGS 4XTWA 1WNLA 3KFVA 5LJ3g 1N8RC 1JJ2A 2ATCB 4M75C 1R77A 2CH4A 3OW2A 4LDYA 4OF1A 1VQKA 1Q7YU 1YP5A 1K9MR 4LD6A 2ENMA 2DYIA 2HAXA 1WYXA 4FM4B 4K11A 1G5VA 3JCMd 1WX6A 5HCKA 4XU0A 2DYBA 3N5BB 3C95A 3BW1A 2V1RA 2HCKA 4E7ZA 2ED0A 3TEEA 4PJNA 2EJ9A 5GAN4 1PRLC 3UA7A 3QKJA 2CT3A 3I56Q 2CP7A
chains in the Genus database with same CATH topology
1VQKT 2MMPA 4IKFA 2ZCFB 1FWZA 3CC4A 4M75G 4GY5A 1KC8C 4X34A 3GNFB 1VQ6A 4XK8E 1N8RU 1VQ7T 2ZZDA 2QQAA 2D0QB 3CBOA 5CO7A 1LNXA 3QZ5B 4BB7A 1S72A 2H3JA 2RM4A 1KHCA 4C5GA 1BI3A 2ZPFB 3P8DA 3G4SA 1BI0A 2EQMA 5GANe 1NJIC 3QZ9B 3QHSA 3MEWA 2QQBA 5M9OA 1KQ1A 2PVGB 4MMLA 4NOYA 4XTVA 2DIGA 5GMKe 1WJRA 3GLXA 2XIDA 3CBMA 2DVEA 1AHJB 4MZMA 3RKXA 3OYAA 3OB9A 2JN0A 3X24B 1Y96B 3CCLT 5I2MA 3CC4T 5GAMg 5LJ5g 3OY9A 2MI6A 2QI2A 3META 5CK9A 4M77C 4JS5A 1VQ5T 2DTOA 1YJNA 4FT4A 2HBPA 4HCBA 1S72T 4M77A 4C92C 5HK3A 2GF7A 2B8AA 4JJNK 4EDUA 4BDYA 2KY9A 2R57A 5DLQE 5L8RE 4C92A 4NL3A 3DB3A 4DOVA 5C0MA 4ME7A 3OSVA 4F7UE 5GANd 3JAME 3CCVA 3CCMA 4M7AF 4C5HA 3OS5A 3ZEHA 3BDUA 4LDWA 4ZGEB 1DJ7B 2YRVA 4D6WA 2XDDA 3CC7A 4C5IA 2DJZA 2ZPIB 1QVGA 2DO3A 3HFNA 2AHJB 3X25B 2CZ6B 1UB4A 2DPPB 3V7SA 4C92B 2OTLA 3VKIA 2BUDA 1YHQA 2MWOA 2R5MA 4BACA 3J7AF 4C8QC 2FHDA 5LJ3e 3M4GA 2LRQA 2KVQG 2DKGA 3F70A 3QPHA 2CGHA 4BD3A 4C8QA 4J7FA 3PIPA 3CMEA 4BE1A 3CCQT 1O9SA 1YJNT 4FIBA 1I5LA 2RJDA 3QYGB 4XU3A 1Q81C 3OA6A 3M59A 2QEXA 3CCVT 2DXCA 4C8QB 3A8LB 4ZGJB 3OYEA 2RK1A 2EYQA 4Y28E 2M9UA 2QTXA 4C92G 4O5VA 3MP1A 4M7DD 2P0PA 3CC7T 4NS5A 3NTKA 1YJ9A 2RO0A 4XQ3A 4L59A 1M1GA 2A3LA 4M7DE 2Y4YA 4OB1B 1Q86C 1G3YA 4DOWA 2OTLT 4E7HA 2JTFA 2PU9B 1YHQT 4A4GA 4MDXA 2F5TX 3QUIA 2QQ9A 3X26B 3JCMb 3TCJA 1NZ9A 3Q1JA 5LJ3d 2M16A 3CXCA 3OYHA 2KMTA 2CZ0B 4IUTA 1WJSA 3ME9A 4M7AD 4HA8A 5GAOq 3CD6A 2K5FA 3P8BB 4C8QG 3QIIA 4C0DC 4PJOD 4M7AE 4L5GA 5FU7B 1Y7XA 5FU6C 4BY6B 5CCAA 2GFUA 3T9NA 2QEXT 3UPUA 4PJOE 3JB9G 4FL6A 1VQ8A 1Y07A 2F69A 1BIBA 3NTHA 4OMFB 1N9SA 2EWNA 4IUUA 1YJ9T 2RJEA 1M4ZA 2EAYA 5CR2A 4RMOA 5HKCA 4C92F 2K5LA 1K8AU 2JNGA 2XICA 4MDWA 3SB2A 2EKOA 4A4FA 5GANj 1VQ4A 1HXDA 3CMAA 1OI1A 5FU6B 1Q81U 4NL2A 2V8JA 2QDYB 5KE2A 3JB9I 1QVPA 5CKFA 3LW5E 1VQLA 3C12A 4QQGA 4M75B 4FSXA 3UDCA 5GMKj 3KBGA 3HRUA 3CPWS 3E19A 3QDRB 5IN1A 4M78D 2XG8D 3EFRA 4JLGA 5GAMf 5LJ5f 1YJWA 3CD6T 4E7IA 2XK0A 3PT9A 5CAIA 4M78E 3L2QA 2JUFA 1Q86U 2DTIA 2E6NA 1LJOA 2RHZA 4ELZC 3MP6A 1VQNT 4C8QF 3LGFA 4PKCC 5CKEA 1KD1C 2LDMA 2MAMA 1VQ8T 1VQPA 1JBMA 3M57A 5GAOm 1G3SA 2DXUA 1MHNA 2K57A 2V8IA 4J8OA 3RERA 3A5ZB 2L89A 1P92A 5KCHA 3CMAT 4ELYC 3OS0A 1X6OA 1VUBA 2O4XA 1XQHA 4EMGA 3FDRA 3X28B 5FLXE 1U1TA 3M55A 3JCMc 1PSEA 5HY6A 3CBPA 3ASKA 5FROA 3PGGA 2WSFE 4XAXB 4OP0A 4DA4A 1Q82C 4IURA 3SFMA 2O4XB 4Q5WA 3CEYA 4KBMB 5LJ3j 3JCMg 3GNGA 3G71A 1RL2A 4MZTA 5LL6S 5GAMd 3QYHB 1TH7A 3V8LA 1BIAA 4PNOA 3OS2A 2WACA 3JCMX 2YLBA 2OTJT 3CPFA 4E47A 3HP9A 3JSCA 1K73C 2JOYA 5GAMh 5LJ5h 2L5QA 3CCJA 2K3XA 1VQ6T 2HQXA 5KH6A 3CCSA 1Y71A 4IUPA 2WSCE 1UGQB 4M75F 3WXMB 1KD1U 5FRMA 4II1A 3M58A 2RD1A 2KK4A 2E10A 3VJPA 3EFSA 3OYCA 2PVDB 5GAN6 5A0LA 3G4ST 2VXFA 2RH2A 5GAN7 4XTZA 2IG0A 4A4EA 3OYBA 2JZ2A 4A4HA 3OBYA 3L2WA 4N4GA 3G71T 4L6V5 1BKBA 4JRPA 4M77B 3OYJA 2CZ7B 4TVRA 3SWNC 4LD9K 2VYTA 2LQ8A 3M53A 2QQRA 2RB6A 1G3TA 2BIVA 3SWNA 4CI0C 4OB0B 3M4YA 2DXBA 4HT8A 5GMKl 2RJCA 1VQMA 1Q82U 3A8OB 4JLIA 3HRSA 1GXIE 3NFCA 3CCJT 3L2ZA 1D3BA 3JCMV 3CCST 1I81A 4R55A 1KQ2A 2EQKA 5IAYA 3CCRA 3HFOA 3SWNB 1WQWA 2EQUA 1K8AC 2VGMA 1YITA 4XTXA 3VUZA 2YLCA 4J6XA 3FC3A 1YIJA 3A8MB 5CQYA 4JRQA 4XTUA 3C94A 4CRIA 3M54A 4OB2B 1RI0A 4OVAA 1K73U 5DM7R 2K2VA 3LX7A 3VV0A 3CCMT 2XI9A 4M77G 5DLOA 2K3YA 1H641 3RMQA 3CPWA 5GMKm 3G7ZA 4QQ6A 3PTAA 3O8VA 2EQJA 4B9WA 5D6XA 1OYXA 2HD0A 1YBYA 3MO8A 2DAQA 2VC8A 2RHXA 3E1SA 2F5KA 3CC2A 4XU1A 3SDZA 4C0FA 5GAN8 2O01E 2LX9A 2QXFA 4RKUE 2V8KA 2P0QA 3PIOA 2RHUA 5J3BA 4F7UA 5CVIA 4IUQA 4M75E 3VYHB 3QJ6A 4J7IA 2E6ZA 2LTOA 3CMET 1G3WA 1B34A 4RCBA 3KXTA 3WVEB 3CCRT 2KAFA 5I2SA 1N6AA 3H8ZA 4ZGDB 1N9RA 2GQVA 2X4XA 4MMKA 1YIJT 3PMTA 2RI5A 3JCMW 4RG8A 2KSSA 2XKOC 3RMSA 2VXEA 4FT2A 4BDZA 5IT9E 1VIEA 1U1SA 1ZQ1A 2X4WA 3V7CA 3GPLA 2RJFA 1KQSS 4RG2A 2XHCA 4QW2A 1WJQA 2LQKA 3AHUA 4M77F 5HK0A 3HRTA 4A4KA 4N4IA 3JCMf 1U8RA 2P4TA 4PL6A 1FXXA 3JCMQ 4QVCA 3BDLA 2LNVA 4C0DB 4VUBA 4LDUA 3BY7A 1UGPB 5GAOl 4KUDK 2FL7A 2FYKA 2RI2A 3OYFA 3VUBA 3UWNA 3H6ZA 1VQ9A 4M7DC 4OGCA 4F7UG 5KCOA 3LYIA 1ZHIA 4M7DA 3GIBA 2DD4A 2X4JA 4YTLA 1MGQA 1HK9A 2WSEE 1BI2A 1SSFA 3OYYA 3LGLA 4A54A 3HL8A 4KT0E 3RKYA 5GAMe 3FJPA 5LJ5e 4BE2A 1QP2A 1ZBXA 3QJYA 4FU6A 1JRIA 3DLMA 3JB9F 2E1HA 2CZ1B 4XTYA 5EG2A 4M7AC 3MEAA 2DXTA 5CKDA 1VQ7A 1QVFS 4PJOC 4N0AC 3HHTB 1VQ4T 3S3MA 1OZ3A 4M7AA 1M9SA 3C4SA 2JTMA 3BFMA 4PJOA 4N0AA 3OMCA 1NE8A 2P0KA 1VQLT 2EFIA 2PUKB 2ZPGB 1IZ6A 3P8HA 3OYLA 1VQ9T 2RK2A 1FX7A 2EJGA 1WGSA 2PUOB 3HKSA 3GP8A 1KG1A 5KE3A 5CKHA 4HCZA 2K5IA 4WF2A 3PFSA 1JB0E 1YJWT 4E7KA 3L2VA 3JCMh 4PJOB 3FB9A 4C0ZA 4LDXA 2QA4A 1IREB 1EIFA 2RA2A 2YHTA 1VQOA 4GLKA 3GOXA 4M7DG 4C92D 5LJ5d 4KUIA 2LCLA 5CIUA 5FRNA 4RCCA 2LCCA 3RIRA 4ZN3A 1VQPT 4C92E 3CCLA 3QO3A 3RKWA 4M78C 3A8HB 3LLRA 4J83A 2E41A 2A7YA 4BE0A 3OYIA 2MWPA 4M78A 1JJ2S 3E9GA 4BI3A 2R5AA 1VQ5A 5GANf 2Y4XA 3L1AA 4ATOA 3OW2S 1X01A 2HNIA 3V8KA 2VV5A 1M5Q1 1M90C 1YI2A 5GAOr 3S6WA 5CQXA 3M56A 1BI1A 4KULA 4M7AG 3LH0A 2CS7A 2RI3A 5I21A 1K9MU 4PLLA 4PJOG 4M78B 3OYDA 4C8QD 2ZPHB 1M1KC 4V2SA 4DQ2A 2DEQA 2XDPA 4P5NA 1Y96A 1WQ7A 2G3RA 4C8QE 2X4YA 2DZCA 3JB9D 2QA4T 5DY9A 1OZ2A 3A8GB 3FIFA 3J81E 4JRKA 1VQOT 3V7RA 5C6SA 5GAN2 2VUBA 3JB9J 4HCCA 2DIQA 3CCUA 4E7JA 4M7DF 1QW1A 2HQEA 4HKEA 3ZFJA 2D9TA 2RHIA 4E7LA 2GFAA 3QG1A 2E12A 3MEVA 3S3NA 2FVUA 4EPCA 4ZN1A 3J80E 1KQSA 3MP8A 3CCQA 3RUXA 5D6YA 1W2BS 2ZGWA 1M8VA 4QQDA 3I56A 2XU8A 4M78G 1YI2T 3INZA 5A0GA 1X75C 3HPWA 5D6WA 5GAN3 3OYGA 1O75A 2EIFA 2MF2A 4JRIA 4N4HA 1VIFA 2E65A 4MZPA 4X9CA 2KQWA 3OMGA 4BUGA 3JB9H 1KC8U 4PJOF 2M0OA 3LWHA 1D3BB 2LT4A 1N27A 1XTDA 4Y91A 2KDSA 5LJ3f 1R8OB 2ZPBB 5J26A 5GANh 1M90U 4JS4A 4J6YA 5CKBA 4PLIA 5GANg 3CCUT 2Y90A 4HT9A 2XD0A 2DK3A 4JDSA 2OAUA 5GMKi 3E9FA 1NJIU 1M1KU 2ZPEB 5GMKh 4BI4A 4IUVA 3OQ5A 4M75D 1VQMT 3KUFA 2GCXA 2L8DA 2NLUA 2QQSA 3M5AA 3RESA 3DLLA 4C5EA 5GAMj 4ZTJA 5LJ5j 3WVDB 2FB7A 2I2LA 3EAEA 3I56T 1Q7YC 3DB4A 1YITT 1QVFA 3R6OA 5GAOn 4M78F 3TU4K 4F7UB 1V29B 3X20B 3OS1A 1XOVA 1UEBA 3OYNA 1PSFA 4Z02A 3OYMA 4C0GA 1UGRB 1B34B 3M9QA 1H3ZA 2RHYA 4R56A 5FU7C 4OGEA 4BY6C 3SD4A 3CC2T 3MEUA 3LWIA 2E64A 3DKMA 2D6FA 3OYKA 2DD5A 3I55A 3QBYA 4XU2A 2X35A 1I4K1 4JUVA 4UC4A 2LT1A 4X9DA 3L42A 2EJFA 5AYFA 3JCMe 5A2QE 3V8JA 4ZTFA 1QVGS 1QP3A 3GF5A 3G6EA 1I8FA 4XTWA 4QVZA 1WNLA 4OB3B 5LJ3h 4EMHA 4EMKC 3PNWC 5J39A 2CYZB 2DTHA 2E70A 1NPPA 1NPRA 2K4YA 4EMKA 4QVDA 5LJ3g 3CCEA 1N8RC 3ZBDA 1JJ2A 1VQNA 3QSUA 2BKDN 2E5QA 4M75C 1M1FA 3OW2A 3QXEB 2IVWA 3MHXA 4LDYA 3L2RA 4M75A 3PMIA 4OF1A 3JCMJ 1K9MC 1LOJA 4EMKB 2LC4A 5GAOp 1VQKA 4M7DB 3MCAB 1Q7YU 3JRZA 3FEOA 1BYMA 2VGNA 4LD6A 4J5YA 3OBWA 3TREA 3I55T 2HAXA 1WPYA 2LVMA 1W4SA 2DZ9A 3FRNA 3JCMP 4A53A 5A0DA 4FM4B 3L2UA 3NTIA 1G5VA 1XNIA 3JCMd 3ER0A 2JVVA 2R58A 3VYGA 4XU0A 4BI8B 3G6ET 2L3RA 3N5BB 2M1HA 3C95A 3FLGA 4B9XA 2XDBA 3BW1A 2PQWA 4LDVA 4M7AB 3CCET 3VU3C 3TEEA 4F7UF 1KHIA 3S3OA 2EJ9A 3OSSC 1UGSB 4M77D 5GAN4 1W2BA 3CXCS 3URGA 4O6JA 3HSBA 5GAN5 4J6WA 2C06A 4M77E 3QKJA 3UT1A 2CKKA 2PVOB 1YCYA 2OTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5K A;  2HQE A;  4IKF A;  2EKO A;  2D9T A;  2RHI A;  4A4F A;  4E7L A;  2GFA A;  1OI1 A;  4GY5 A;  4X34 A;  3MEV A;  5KE2 A;  2RHU A;  3S3N A;  4IUQ A;  3MP8 A;  4QQG A;  3QJ6 A;  5D6Y A;  2LTO A;  4QQD A;  1KHC A;  5IN1 A;  4C5G A;  3P8D A;  3H8Z A;  5D6W A;  3OYG A;  4E7I A;  2X4X A;  2EQM A;  2XK0 A;  4N4H A;  3L2Q A;  3PMT A;  2RI5 A;  2E6N A;  2RHZ A;  3OMG A;  3MP6 A;  3LGF A;  2M0O A;  3MEW A;  5M9O A;  4BDZ A;  1N27 A;  2X4W A;  2LDM A;  2RJF A;  4RG2 A;  2DIG A;  1WJR A;  1WJQ A;  4QW2 A;  5J26 A;  4PLI A;  1MHN A;  4N4I A;  4PL6 A;  3OYA A;  3OB9 A;  2L89 A;  3BDL A;  3E9F A;  5KCH A;  3OS0 A;  4IUV A;  2O4X A;  3OQ5 A;  3OY9 A;  3KUF A;  2NLU A;  2L8D A;  2QQS A;  3FDR A;  3MET A;  4C5E A;  4ZTJ A;  2RI2 A;  3OYF A;  3EAE A;  3UWN A;  3H6Z A;  3ASK A;  2GF7 A;  2B8A A;  3DB4 A;  5FRO A;  4EDU A;  2R57 A;  5KCO A;  4BDY A;  3LYI A;  4IUR A;  3DB3 A;  2O4X B;  5C0M A;  4Q5W A;  3CEY A;  3OS1 A;  4C5H A;  3OYN A;  1SSF A;  4Z02 A;  3LGL A;  3ZEH A;  3OYM A;  2YRV A;  4BE2 A;  4C5I A;  3M9Q A;  4FU6 A;  1H3Z A;  3OS2 A;  2WAC A;  2RHY A;  3DLM A;  2BUD A;  2MWO A;  2R5M A;  4BAC A;  3SD4 A;  3MEU A;  3MEA A;  3OYK A;  2FHD A;  3QBY A;  3S3M A;  1OZ3 A;  3C4S A;  2LRQ A;  2X35 A;  2K3X A;  3F70 A;  2HQX A;  4BD3 A;  5KH6 A;  4UC4 A;  4BE1 A;  3OMC A;  2P0K A;  3L42 A;  4IUP A;  5FRM A;  2EFI A;  3OYL A;  3P8H A;  4II1 A;  4ZTF A;  2RJD A;  1WGS A;  4QVZ A;  3OYC A;  3PNW C;  5J39 A;  5KE3 A;  3OA6 A;  4HCZ A;  3PFS A;  4E7K A;  3L2V A;  2BKD N;  2E5Q A;  4A4E A;  2IG0 A;  3OYB A;  3OYE A;  2JZ2 A;  4A4H A;  3L2W A;  4N4G A;  3L2R A;  3GOX A;  3MP1 A;  3PMI A;  3OYJ A;  5FRN A;  4NS5 A;  3NTK A;  5CIU A;  2LCC A;  2RO0 A;  2VYT A;  4L59 A;  2QQR A;  2BIV A;  4E7H A;  2JTF A;  3FEO A;  3LLR A;  4A4G A;  2RJC A;  4LD6 A;  4BE0 A;  3OYI A;  2MWP A;  3Q1J A;  3E9G A;  2R5A A;  2LVM A;  2M16 A;  3OYH A;  3L2U A;  2EQK A;  3NTI A;  5IAY A;  1XNI A;  1G5V A;  3S6W A;  2R58 A;  2EQU A;  4IUT A;  1WJS A;  3ME9 A;  2L3R A;  2RI3 A;  3LH0 A;  2M1H A;  3FLG A;  4PLL A;  4B9X A;  3FC3 A;  3QII A;  3OYD A;  2PQW A;  2XDP A;  4CRI A;  4E7J A;  1RI0 A;  2G3R A;  2GFU A;  4OVA A;  3LX7 A;  2X4Y A;  3S3O A;  2K3Y A;  4FL6 A;  1OZ2 A;  3NTH A;  4QQ6 A;  3O8V A;  2EQJ A;  3QKJ A;  4IUU A;  5D6X A;  3UT1 A;  2CKK A;  1OYX A;  2RJE A;  2DIQ A;  4B9W A;  5C6S A;  3MO8 A;  2DAQ A;  2RHX A; 
#chains in the Genus database with same CATH topology
 2MMP A;  1X6B A;  2ZCF B;  4M75 G;  4GY5 A;  2O31 A;  1VQ6 A;  1VQ7 T;  1RLP C;  2QQA A;  2D0Q B;  1LNX A;  1S72 A;  1OV3 A;  2H3J A;  1OQK A;  2PZ1 A;  3RR6 A;  2ZPF B;  2HQH A;  2K6D A;  3QZ9 B;  5M9O A;  3M0S A;  2PVG B;  1SPK A;  2DIG A;  5GMK e;  2XID A;  3CBM A;  3I5R A;  1PKS A;  2J6K A;  2RPN A;  2JN0 A;  3CCL T;  5IXF A;  3EHR A;  3PE0 A;  2QI2 A;  3MET A;  1B07 A;  2HBP A;  4F16 A;  4JJN K;  5DLQ E;  1D0Y A;  2DL5 A;  3DB3 A;  4DOV A;  5C0M A;  4C5H A;  1WI7 A;  4ZGE B;  2XDD A;  2K3B A;  1MMG A;  4RTU A;  2DO3 A;  3HFN A;  2CH4 W;  3X25 B;  3EH2 A;  1YHQ A;  3EGU A;  2R5M A;  3J7A F;  3CXC P;  5LJ3 e;  1N5Z A;  2LRQ A;  3CCE Q;  2DKG A;  2CGH A;  1WHK A;  1AWO A;  5EC7 A;  2JMC A;  4FIB A;  3TVT A;  4RTX A;  2A36 A;  4XU3 A;  2KRN A;  3A8L B;  2QTX A;  1QWE A;  4FCY A;  4M7D D;  1PM3 A;  2RO0 A;  3MJX A;  2F5T X;  2DRK A;  1NZ9 A;  3CXC A;  3OYH A;  2CZ0 B;  3ME9 A;  4HA8 A;  5GAO q;  1JEG A;  2HEQ A;  2K5F A;  3EG9 A;  3P8B B;  2QG9 B;  4L5G A;  2FG0 A;  5CCA A;  3UPU A;  3CC4 Q;  2F69 A;  1N9S A;  2K7A A;  1FYN A;  4IUU A;  4RMO A;  5HKC A;  4C92 F;  1SHG A;  2K5L A;  2JNG A;  2EKO A;  5GAN j;  2K9G A;  5FU6 B;  2KI7 A;  3LW5 E;  4QQG A;  3E2U A;  4M75 B;  3KBG A;  3QDR B;  5IN1 A;  4M78 D;  1UJ0 A;  1BB9 A;  1ABO A;  2XK0 A;  4LUE A;  4E7I A;  3SHW A;  1LJO A;  2RHZ A;  1OPK A;  2LDM A;  2MAM A;  1VQ8 T;  5IHI A;  1VQP A;  3M57 A;  3CCQ Q;  1SRM A;  2EVR A;  3RER A;  3A5Z B;  2E4H A;  1JXO A;  4ELY C;  1X6O A;  4EMG A;  3CCV Q;  2RQR A;  3X28 B;  5FLX E;  1RAG B;  3JCM c;  1MV0 B;  5HY6 A;  3CBP A;  3ASK A;  1FMW A;  1X27 A;  3UF4 A;  4GBQ A;  4DA4 A;  1M2V A;  4Z8A A;  2JMA A;  5LL6 S;  5GAM d;  1BIA A;  2WAC A;  2OTJ T;  3CPF A;  3HP9 A;  1K73 C;  1Z9Q A;  1WXT A;  2K3X A;  5KH6 A;  3CCS A;  1AOJ A;  1Y71 A;  1IXD A;  1OX9 A;  5FRM A;  3WXM B;  4II1 A;  3M58 A;  2FO0 A;  2KK4 A;  2E10 A;  1YJ9 Q;  1C1A A;  5A0L A;  3G4S T;  2D8H A;  2YUQ A;  4A4E A;  3OBY A;  2OAW A;  4N4G A;  4Z89 A;  1IO6 A;  3VS5 A;  2QQR A;  3CD6 Q;  1GXI E;  4JLI A;  3HRS A;  2G6F X;  3QWX X;  3NFC A;  3CCJ T;  3VS3 A;  5KYN A;  1D3B A;  3JCM V;  2EQK A;  3HFO A;  2GGR A;  2KR3 A;  3VUZ A;  3A8M B;  1K8A R;  1WHG A;  3C94 A;  4CRI A;  4FW1 A;  4OVA A;  5FWC A;  3VV0 A;  3CCM T;  1VQ4 Q;  4M77 G;  5DLO A;  3CPW A;  5GMK m;  5D6X A;  2ED1 A;  2HD0 A;  1YBY A;  3CC2 A;  3LH5 A;  2F5K A;  2O01 E;  2QXF A;  2O9S A;  1AWX A;  2AKK A;  4FW2 A;  4M75 E;  2E6Z A;  2E3I A;  1G3W A;  3CCR T;  1BBZ A;  1N6A A;  3H8Z A;  2X4X A;  4CC7 A;  1YIJ T;  2RI5 A;  2YRD A;  2XKO C;  4BDZ A;  2NUT A;  3GPL A;  3AHU A;  4JPB W;  1U06 A;  3C0C A;  2JM8 A;  2LP5 A;  2NUT B;  1AWW A;  5AT1 B;  2FL7 A;  1CSK A;  2A37 A;  4RTT A;  2IPO B;  3UWN A;  3G71 Q;  2QAZ A;  1ZHI A;  4M7D A;  2AZV A;  4YTL A;  1MGQ A;  1PHT A;  1HYO A;  1SSF A;  4KT0 E;  1OEB A;  3FJP A;  2CZ1 B;  1M8M A;  4D8D A;  5CKD A;  1VQ7 A;  4PJO C;  1H3H A;  1M9S A;  2JTM A;  2C0I A;  4N0A A;  2A28 A;  1IZ6 A;  4FYY B;  1WGS A;  2PUO B;  3HKS A;  1G83 A;  1YJW T;  4E7K A;  2OI3 A;  4LDX A;  1IRE B;  1EIF A;  2YHT A;  4GLK A;  3GOX A;  4C92 D;  3CCL A;  3A8H B;  3LLR A;  2YWW A;  2E41 A;  1LVK A;  2EGA A;  3OYI A;  4M78 A;  4BI3 A;  2R5A A;  4ATO A;  4RTZ A;  1M5Q 1;  1VYV A;  1M90 R;  5I21 A;  1X43 A;  4PJO G;  4M78 B;  1QCO A;  1WFW A;  3OYD A;  4V2S A;  1CKB A;  1Y96 A;  1M1K R;  3JB9 D;  2QA4 T;  2A08 A;  3A8G B;  3CCU A;  1QW1 A;  3ZFJ A;  1ZUU A;  4E7L A;  2E12 A;  3MEV A;  1KQS A;  1ZSZ A;  2DFU A;  5D6W A;  1O75 A;  4N4H A;  4DBH A;  4OMO A;  1TS9 A;  2SRC A;  2M0O A;  4J9D A;  1XTD A;  1NEG A;  2DX1 A;  3AT1 B;  5LJ3 f;  2ZPB B;  5J26 A;  1M90 U;  4PLI A;  2D0N A;  1VQ9 Q;  2XD0 A;  2DK3 A;  1SEM A;  1MMA A;  2LNH B;  1M1K U;  2ZPE B;  5GMK h;  2QYZ A;  4IUV A;  3OQ5 A;  3M5A A;  4J9G A;  1T0H A;  3DLL A;  1PKT A;  5GAM j;  5LJ5 j;  3EAE A;  3I56 T;  1KJW A;  3DB4 A;  1RAD B;  1QVF A;  2M0Y A;  3M0T A;  2X3X D;  1V29 B;  2VWF A;  3X20 B;  5KYY A;  1GBR A;  3OYM A;  2ROL A;  1UGR B;  1B34 B;  2LZ6 B;  1UG1 A;  5FU7 C;  4OGE A;  3MEU A;  2D6F A;  4XU2 A;  1I4K 1;  4JUV A;  4UC4 A;  4X9D A;  1GFD A;  3EFO A;  5AYF A;  3JCM e;  4ZTF A;  1VQO Q;  5LJ3 h;  4OB3 B;  3PNW C;  4JZ3 A;  2DTH A;  4QVD A;  1NPR A;  4EMK A;  2EYX A;  3ZBD A;  3EGX A;  2E5Q A;  2F2X A;  3EFO B;  1M1F A;  2CP0 A;  1OUL A;  1IHV A;  3JCM J;  1LOJ A;  4EMK B;  1YI2 Q;  3JRZ A;  1BYM A;  2VGN A;  2L3P A;  4J5Y A;  3FRN A;  3JCM P;  2EBP A;  5L23 A;  4J9I A;  1XNI A;  3ER0 A;  2JVV A;  3VYG A;  1PD0 A;  2XDB A;  3HTR A;  3CCE T;  1KHI A;  5KYU A;  3OSS C;  3URG A;  5GAN 5;  4M77 E;  1GL5 A;  2OTJ A;  1YCY A;  4IKF A;  4J9B A;  1YIT Q;  1KC8 C;  4XK8 E;  1D09 B;  3NHN A;  1D1C A;  1WZO A;  2HKQ B;  4BB7 A;  2RM4 A;  1BI3 A;  2JW4 A;  3G4S A;  1BI0 A;  2MYS A;  2HMA A;  1NJI C;  4J9E A;  1WHH A;  1E6H A;  4MML A;  2OJ2 A;  2V1Q A;  1TUG B;  1AHJ B;  4MZM A;  3NMZ C;  4AFS C;  1TSF A;  1ZSG A;  1QCF A;  3CC4 T;  5GAM g;  2JJ9 A;  3VS0 A;  5LJ5 g;  2RQU A;  4JS5 A;  1M3B A;  2DTO A;  2K79 A;  1YJN A;  4HCB A;  5HK3 A;  1WA7 A;  2R57 A;  5L8R E;  2COY A;  2CUB A;  4C92 A;  3CCM A;  5GAN d;  2KT8 A;  3BDU A;  4LDW A;  4D6W A;  3I55 Q;  2LMJ A;  3CC7 A;  4C5I A;  1QVG A;  4C92 B;  2DPP B;  4OMQ A;  2RMO A;  2OTL A;  2BUD A;  1EX4 A;  3G6E Q;  4BAC A;  1RAI B;  2F2W A;  2FHD A;  1RUW A;  4JJB A;  4BE1 A;  3QPH A;  4BD3 A;  4J7F A;  2FZC B;  3CCQ T;  3JV3 A;  1O9S A;  1I5L A;  2RJD A;  3MPU B;  2RQV A;  1VQK Q;  1R0B G;  1GCQ A;  2QEX A;  3CCV T;  1Q7Y R;  2DXC A;  4O5V A;  2J7I A;  4NS5 A;  4RTY A;  4XQ3 A;  1M1G A;  2Y4Y A;  4OB1 B;  2JTF A;  2D8J A;  4MDX A;  3JCM b;  2QQ9 A;  3X26 B;  4J9H A;  2EGC A;  2YUO A;  1WHL A;  2VAS A;  2KMT A;  2JS2 A;  4IUT A;  4M7A D;  5FU7 B;  1Y7X A;  5FU6 C;  4PJO E;  2EYW A;  3GBQ A;  2EKH A;  4FL6 A;  1BIB A;  1TUD A;  2JXB A;  4OMF B;  1YJ9 T;  4HVW A;  2RJE A;  5CR2 A;  1S72 Q;  3SB2 A;  3EGD A;  3CMA A;  1Q81 U;  4NL2 A;  2V8J A;  5CKF A;  6AT1 B;  4FSX A;  1JU5 C;  3IQL A;  1TTH B;  1YJW A;  3CD6 T;  1Q86 U;  3L2Q A;  2JUF A;  1RAH B;  4C8Q F;  3LGF A;  1C0M A;  1KD1 C;  4OML A;  2CP6 A;  1JBM A;  1W1F A;  2CRE A;  2V8I A;  4J8O A;  3U23 A;  2L89 A;  1P92 A;  4JZ4 A;  1ARK A;  4R0K A;  1VUB A;  2O4X A;  1XQH A;  3FDR A;  3M55 A;  1UGV A;  4IIO A;  1IGQ A;  5FRO A;  5I11 A;  4XAX B;  3SFM A;  2O4X B;  4Q5W A;  3CEY A;  1YHQ Q;  1Q82 R;  2L3S A;  3GNG A;  1RL2 A;  1QMC A;  1TH7 A;  3OS2 A;  1K0S A;  1AZG B;  3JCM X;  1Z9Z A;  4PJM A;  4HXJ A;  1UGQ B;  3OYC A;  1WIE A;  4OMP A;  5GAN 7;  4XTZ A;  3G71 T;  4JRP A;  4L6V 5;  1BKB A;  1HJD A;  2KEA A;  1OU8 A;  3M53 A;  2HZY A;  3I35 A;  1YNZ A;  3SWN A;  1AVZ C;  1Q82 U;  1QWF A;  3A8O B;  2KYM A;  1VQN Q;  3M0U A;  5IAY A;  3SWN B;  1G2B A;  2EQU A;  4ZNX A;  4XTU A;  1D1A A;  5DM7 R;  2XI9 A;  1SHF A;  2K3Y A;  3RMQ A;  1T3S A;  4QQ6 A;  3PTA A;  2EQJ A;  4B9W A;  3H9N A;  3MO8 A;  3E1S A;  2RHX A;  1IRX A;  4XU1 A;  1F1B B;  3REB B;  2V8K A;  7AT1 B;  2P0Q A;  4F7U A;  5CVI A;  3QJ6 A;  2CSQ A;  2JTE A;  2RNA A;  4J7I A;  4GLM A;  4HVU A;  3WVE B;  5GJV B;  2RQT A;  4ZGD B;  3PMT A;  3RMS A;  5IT9 E;  1VIE A;  1U1S A;  1M2O A;  2LQK A;  5HK0 A;  1K76 A;  3EG9 B;  4N4I A;  3JCM f;  4QVC A;  8AT1 B;  1MMN A;  1ZUY A;  1UGP B;  4KUD K;  4JJD A;  4M7D C;  3PVL A;  4OGC A;  1ACM B;  3LYI A;  2O88 A;  1HK9 A;  1V76 A;  1FMK A;  1M30 A;  4DEY A;  1ZBX A;  4AG1 C;  3CCS Q;  1JRI A;  1EFN A;  3DLM A;  3JB9 F;  2HKN A;  2LJ3 A;  2DXT A;  2KNB B;  4N0A C;  4M7A A;  5FW9 A;  3BFM A;  2LJ0 A;  2P0K A;  1VYU A;  2P4R A;  2DVJ A;  2ZPG B;  1VQ9 T;  1FX7 A;  2KXC A;  2DJQ A;  5CKH A;  4WF2 A;  2X3W D;  3JCM h;  2BZY A;  4C0Z A;  8ATC B;  4FYV B;  4M7D G;  5LJ5 d;  5CIU A;  4RCC A;  3RIR A;  3CME Q;  1RAA B;  2AT1 B;  4M78 C;  2ECZ A;  2M51 A;  4BE0 A;  1J3T A;  1M2V B;  1U3O A;  2DMO A;  2HNI A;  5GAO r;  5CQX A;  2LJ1 A;  3M56 A;  4KUL A;  2RI3 A;  2HDA A;  1GFC A;  2AK5 A;  1Y0M A;  2ZPH B;  4C8Q D;  1VA7 A;  3CC2 Q;  2DEQ A;  2XDP A;  1OU9 A;  1PC0 A;  4EIK A;  1UUE A;  1VQO T;  4JRK A;  3V7R A;  1K1Z A;  4HKE A;  2GFA A;  3QG1 A;  2DL7 A;  1ZSZ C;  3S3N A;  2FVU A;  2KYB A;  4ZN1 A;  3D7S B;  2O9V A;  1YWP A;  4DEX A;  3CCQ A;  3RUX A;  1W2B S;  5I22 A;  1YI2 T;  4M78 G;  4FYW B;  5A0G A;  1X75 C;  5GAN 3;  2EIF A;  1VIF A;  2E65 A;  3JB9 H;  4LUD A;  1KC8 U;  1D3B B;  4KGZ B;  1OOT A;  4RTV A;  1NYG A;  2EYY A;  1R8O B;  1YCS B;  1VQL Q;  5GAN g;  1GBQ A;  1TG0 A;  2OAU A;  5GMK i;  1NJI U;  1OPL A;  4BI4 A;  1VQM T;  2GCX A;  2L8D A;  3RES A;  2GTJ A;  2FPE A;  4C5E A;  2V26 A;  2FB7 A;  2I2L A;  1Q7Y C;  1NLO C;  1YIT T;  2CP2 A;  3OS1 A;  4C0G A;  1H3Z A;  2RHY A;  2VB6 A;  2BTT A;  3VS2 A;  4BY6 C;  3FJ5 A;  3UA6 A;  3VS1 A;  2NWM A;  2HL3 A;  2BZ8 A;  2LT1 A;  3L42 A;  5A2Q E;  1QP3 A;  3GF5 A;  1I8F A;  2PTK A;  4EMH A;  4EMK C;  5J39 A;  1NPP A;  4WCI A;  3CCL Q;  1D0Z A;  1MV3 A;  3QXE B;  3L2R A;  3PMI A;  2FPD A;  2P84 A;  1K9M C;  5GAO p;  4M7D B;  3I55 T;  2LVM A;  2DZ9 A;  4A53 A;  2J6O A;  3L2U A;  3NTI A;  1SF9 A;  4BI8 B;  2RQW A;  3G6E T;  1QLY A;  2M1H A;  2KRS A;  3CCU Q;  1WXU A;  2PQW A;  2A0F B;  2GTO A;  4F7U F;  2AIR B;  1UGS B;  4J6W A;  1MUZ A;  2PVO B;  2QGG A;  1VQK T;  1FWZ A;  2NYS A;  1VOM A;  1SG5 A;  4X34 A;  1N8R U;  1KHC A;  4C5G A;  3P8D A;  1T3L A;  2EQM A;  5GAN e;  4J9C A;  2GQI A;  1K4U S;  2QQB A;  1TOV A;  1PCX A;  1KQ1 A;  4NOY A;  4XTV A;  4B6M A;  1WLP B;  5KYW A;  1WJR A;  3GLX A;  3RKX A;  2MCN A;  1Y96 B;  3G1J A;  3OY9 A;  2MI6 A;  5CK9 A;  2YSQ A;  1S72 T;  4M77 A;  4C92 C;  2GF7 A;  4BDY A;  4DBQ A;  4NL3 A;  4ME7 A;  4M7A F;  3OS5 A;  4LXC A;  1ZSZ B;  2DLP A;  2CZ6 B;  2ZAE A;  1YN8 A;  4X1V A;  3BE3 A;  4C8Q A;  3VS6 A;  3VRZ A;  1GCQ C;  1PRM C;  3OA6 A;  1A0N B;  4C8Q B;  1JQQ A;  4ZGJ B;  3OYE A;  2EYQ A;  4Y28 E;  2M9U A;  4C92 G;  3MP1 A;  2YXY A;  2P0P A;  4L59 A;  2A3L A;  4M7D E;  4DOW A;  1YHQ T;  2KBT A;  2PU9 B;  2E5K A;  5KYY B;  3QUI A;  2CUD A;  3TCJ A;  2FPF A;  3Q1J A;  1UHF A;  2M16 A;  4JJC A;  1HSQ A;  1WJS A;  4C0D C;  4BY6 B;  2EYZ A;  2GFU A;  3T9N A;  1I5O B;  3JB9 G;  1VQ8 A;  1Y07 A;  2EW3 A;  3NTH A;  1VQ5 Q;  2EAY A;  1ZA1 B;  2XIC A;  4MDW A;  4A4F A;  3EGX B;  1HXD A;  1MNE A;  2DEU A;  3JB9 I;  1T0J A;  3C12 A;  2H3E B;  5GMK j;  3HRU A;  3E19 A;  2EGE A;  2XG8 D;  1ABQ A;  2YUN A;  1X2K A;  3PT9 A;  4M78 E;  5CAI A;  2DTI A;  2E6N A;  2ABL A;  4ELZ C;  1VQN T;  5IHN A;  5CKE A;  1KIK A;  4LE9 A;  1RAE B;  2GNC A;  5GAO m;  1YJN Q;  2DXU A;  1MHN A;  1NEB A;  2KE9 A;  4M4Z A;  1SSH A;  5KYU B;  1AT1 B;  4KGV B;  1U1T A;  1PSE A;  3O5Z A;  3PGG A;  3CC7 Q;  2CDT A;  2WSF E;  4IUR A;  2OTL Q;  1QCN A;  5LJ3 j;  1QKW A;  2C0O A;  3V8L A;  4PNO A;  2JS0 A;  2YLB A;  2J05 A;  3JSC A;  2JOY A;  1UTI A;  2L5Q A;  3CCJ A;  1K73 R;  2QEX Q;  2HQX A;  1UJY A;  2K2M A;  2WSC E;  3A98 A;  5ECA A;  2RD1 A;  5GJW B;  1NM7 A;  3EFS A;  2VXF A;  2JZ2 A;  4A4H A;  3OYJ A;  2MIO A;  4TVR A;  3SWN C;  4AT1 B;  2RB6 A;  2NUZ A;  2FZG B;  4OB0 B;  2RJC A;  1VQM A;  3EHQ A;  1X6G A;  2KXD A;  3CCS T;  1I81 A;  4R55 A;  1KQ2 A;  3CCR A;  1WQW A;  1K8A C;  2VGM A;  1YIT A;  3FC3 A;  4J6X A;  1YIJ A;  4JRQ A;  4AFZ C;  4CC2 A;  4OB2 B;  1RI0 A;  1K73 U;  3LX7 A;  3CMA Q;  1Q81 R;  1H64 1;  4RUG A;  3G7Z A;  3O8V A;  2HSE B;  1BU1 A;  1I1J A;  2DAQ A;  2VC8 A;  3H41 A;  3SDZ A;  5GAN 8;  2LX9 A;  5FWB A;  4RKU E;  1YJW Q;  1Q86 R;  4DBR A;  3PIO A;  3EH1 A;  3VYH B;  4E7S A;  3CME T;  1GCP A;  4RCB A;  3KXT A;  1H92 A;  3OW2 P;  1N9R A;  1RAF B;  3JCM W;  1TU0 B;  4RG8 A;  2KSS A;  2F1L A;  5KYX A;  2RF0 A;  2VXE A;  2XMF A;  1ZQ1 A;  2X4W A;  1VQ6 Q;  4QW2 A;  4M77 F;  3HRT A;  4A4K A;  2P4T A;  1FXX A;  2LNV A;  4Z88 A;  4C0D B;  4LDU A;  5GAO l;  1SKU B;  2FYK A;  2LQN A;  3H6Z A;  1NBE B;  1WHJ A;  2MK5 A;  4F7U G;  3EGD B;  1H8K A;  2QDL A;  2X4J A;  1BI2 A;  3LGL A;  4HVV A;  3RKY A;  5GAM e;  5LJ5 e;  1QP2 A;  4FU6 A;  2FZK B;  2E1H A;  4XTY A;  4M7A C;  4D8K A;  3HHT B;  1VQ4 T;  1OZ3 A;  4ESR A;  3OMC A;  1VQL T;  2PUK B;  3P8H A;  2QAS A;  1IHW A;  4ORZ A;  1BCM A;  3NPF A;  2K5I A;  3PFS A;  2H8H A;  2IIM A;  2QA4 A;  1NLP C;  2I0N A;  4KUI A;  4ZN3 A;  4C92 E;  3QO3 A;  3RKW A;  2A7Y A;  1JJ2 S;  5GAN f;  2Y4X A;  3L1A A;  3OW2 S;  2QGF B;  2EQI A;  2VV5 A;  1M90 C;  4PFO A;  4M7A G;  3LH0 A;  2CS7 A;  1K9M U;  3H0I A;  3VRY A;  1M1K C;  1I07 A;  4DQ2 A;  1WQ7 A;  2X4Y A;  2DZC A;  4LNP A;  5DY9 A;  3FIF A;  3J81 E;  1Q95 G;  5C6S A;  4HCC A;  2VUB A;  1YFN A;  2DIQ A;  1LPL A;  2D9T A;  2RHI A;  4QT7 A;  1E7O A;  3J80 E;  3MKD A;  2DA9 A;  2ZGW A;  3I56 A;  2XU8 A;  1K0X A;  3RDV A;  2VVK A;  1ZBJ A;  4BUG A;  2KQW A;  4PJO F;  3EG0 A;  2LT4 A;  1RI9 A;  1N27 A;  2MOX A;  1ZA2 B;  5GAN h;  1FMV A;  4J6Y A;  5CKB A;  3CCU T;  2Y90 A;  1PWT A;  2NUP A;  2NLU A;  2QQS A;  4ZTJ A;  3WVD B;  4KH0 B;  1VQP Q;  3R6O A;  3TU4 K;  2NUP B;  4F7U B;  4DBF A;  1PD1 A;  3PVQ A;  1BK2 A;  4FSS A;  1UE9 A;  3SD4 A;  3LWI A;  2E64 A;  3OYK A;  1JO8 A;  1V1C A;  2Z0W A;  1NYF A;  4QVZ A;  2KGT A;  2CYZ B;  2E70 A;  2K4Y A;  1VQN A;  3CCE A;  1W2B P;  3QSU A;  2KRM A;  2AKL A;  4J9F A;  2BKD N;  2IVW A;  3MHX A;  4M75 A;  2X9H A;  1AWJ A;  2LC4 A;  3MCA B;  1X69 A;  3RBB B;  3FEO A;  3OBW A;  3EG2 A;  3TRE A;  1TXQ A;  1UEC A;  1WPY A;  1W4S A;  1XJW B;  5A0D A;  2R58 A;  2L3R A;  3FLG A;  4B9X A;  1G8X A;  2F2V A;  2CP3 A;  1RAB B;  4LDV A;  4M7A B;  3VU3 C;  2YUP A;  3S3O A;  3HSB A;  4M77 D;  1W2B A;  3CXC S;  4O6J A;  3CQT A;  4F04 B;  2C06 A;  1D1B A;  3UT1 A;  2CKK A;  1S1N A;  3OS0 A;  2HSP A;  2JT4 A;  3CC4 A;  3GNF B;  2ZZD A;  1KC8 R;  3CBO A;  5CO7 A;  3QZ5 B;  2W0Z A;  1YWO A;  4QKU A;  3A1P A;  2J6F A;  3VS7 A;  3QHS A;  3MEW A;  1NJI R;  5IXB A;  1C6V X;  2DVE A;  1PNJ A;  4AFU C;  3OYA A;  3OB9 A;  3X24 B;  5I2M A;  2AZS A;  2DL4 A;  4M77 C;  1VQ5 T;  2DL3 A;  4FT4 A;  2GBQ A;  2DF6 A;  1KSW A;  2MPX C;  2B8A A;  4EDU A;  2KY9 A;  1AZE A;  3OSV A;  4F7U E;  2OX7 A;  3JAM E;  3CPW P;  3CCV A;  2BE9 B;  1R0C B;  2PNI A;  3ZEH A;  1DJ7 B;  2YRV A;  4KRT A;  3ULR B;  2DJZ A;  2ZPI B;  2AHJ B;  1UB4 A;  3V7S A;  3VKI A;  2MWO A;  2YDL A;  4C8Q C;  1X2Q A;  3M4G A;  2KVQ G;  3F70 A;  4PJL A;  3CME A;  2DER A;  3PIP A;  1YJN T;  3TQ7 P;  3QYG B;  4FYX B;  1Q81 C;  4IIM A;  3M59 A;  4WTO B;  1ZX6 A;  1UFF A;  2J06 A;  2RK1 A;  1VQ7 Q;  2YRC A;  2FRY A;  3CC7 T;  1I0C A;  1YJ9 A;  3NTK A;  1ZUK A;  1M3A A;  1Q86 C;  1G3Y A;  2OTL T;  4E7H A;  1E6G A;  4A4G A;  2CSI A;  3UAT A;  4RTW A;  1D0X A;  3SEM A;  1ZLM A;  5LJ3 d;  1HD3 A;  2DBM A;  4KH1 B;  2VKN A;  1AEY A;  3CD6 A;  4C8Q G;  3QII A;  4PJO D;  4M7A E;  2QEX T;  1IGU A;  1Y57 A;  1N8R R;  2EWN A;  1PG5 B;  1M4Z A;  1K8A U;  4F17 A;  1VQ4 A;  1MND A;  1OI1 A;  2QDY B;  5KE2 A;  1QVP A;  1VQL A;  1TWB A;  3UDC A;  1WHM A;  3CPW S;  4JLG A;  3EFR A;  4ANJ A;  5GAM f;  5LJ5 f;  1GRI A;  2FRW A;  3MP6 A;  2DRM A;  4PKC C;  2EPD A;  1OX8 A;  2YT6 A;  3QWY A;  1KD1 R;  1IB8 A;  1G3S A;  2K57 A;  3RNJ A;  3H0F A;  5KCH A;  3CMA T;  2L0A A;  2SEM A;  3QDF A;  3EG1 A;  1JXM A;  4OMM A;  1AD5 A;  4OP0 A;  1Q82 C;  2HBW A;  4KBM B;  1WXB A;  3JCM g;  2X51 A;  3G71 A;  4MZT A;  2JM9 A;  3QYH B;  2E3H A;  1KQS P;  1EZZ B;  4E47 A;  5GAM h;  5LJ5 h;  2BZX A;  1VQ6 T;  3M0Q A;  5KYW B;  4IUP A;  4CC3 A;  4M75 F;  1KD1 U;  4AMC A;  1RAC B;  3VJP A;  4AG2 C;  2PVD B;  5GAN 6;  2RH2 A;  2IG0 A;  3OYB A;  3L2W A;  1CKA A;  1BCO A;  2CZ7 B;  4M77 B;  4OMN A;  2W10 A;  4LD9 K;  2VYT A;  2LQ8 A;  4AFQ C;  1G3T A;  2BIV A;  2DBK A;  4CI0 C;  3M4Y A;  2DXB A;  4HT8 A;  5GMK l;  1B7T A;  3L2Z A;  4CC4 B;  1QVF P;  2C0T A;  1VQ8 Q;  4XTX A;  2LX7 A;  2YLC A;  5IH2 A;  5CQY A;  1TUC A;  3M54 A;  1UHC A;  2K2V A;  3THK A;  4HCK A;  1OYX A;  4E2F B;  2COZ A;  4C0F A;  2RHU A;  5J3B A;  4IUQ A;  2DE0 X;  2LTO A;  1B34 A;  2M02 A;  3VS4 A;  2KAF A;  5I2S A;  3I5S A;  2GQV A;  1QKX A;  4MMK A;  2CT4 A;  5D7U A;  2OTJ Q;  1M27 C;  4FT2 A;  1UDL A;  2KT1 A;  3V7C A;  1KQS S;  2RJF A;  4RG2 A;  2XHC A;  1WJQ A;  3TSW A;  1U8R A;  3NGP A;  4PL6 A;  3JCM Q;  3BDL A;  4LN2 A;  4VUB A;  3BY7 A;  1VYT A;  3G4S Q;  2QK0 A;  2RI2 A;  3OYF A;  3VUB A;  1VQ9 A;  1QQJ A;  5KCO A;  1RLQ C;  2D1X A;  3GIB A;  2DD4 A;  2WSE E;  4A63 B;  4A54 A;  3OYY A;  3HL8 A;  4BE2 A;  3CCJ Q;  3QJY A;  1M3C A;  2KRO A;  5EG2 A;  3MEA A;  1QVF S;  3S3M A;  3C4S A;  4PJO A;  3CCM Q;  1NE8 A;  4PFZ A;  1B3Q A;  2EFI A;  3OYL A;  1U5S A;  2RK2 A;  2EJG A;  2HL5 C;  3GP8 A;  1KG1 A;  5KE3 A;  4HCZ A;  1JB0 E;  3M0R A;  3L2V A;  4PJO B;  3FB9 A;  1NG2 A;  2DL8 A;  1SRL A;  2DIL A;  2FEI A;  3REA B;  1VQM Q;  2DET A;  2RA2 A;  5IHK A;  1VQO A;  5FRN A;  2LCL A;  3M0P A;  2LCC A;  3H0H A;  1VQP T;  3CCR Q;  3I9Q A;  4J83 A;  1WDX A;  2MWP A;  1YIJ Q;  3EG3 A;  3E9G A;  1VQ5 A;  1X01 A;  3V8K A;  1YI2 A;  3S6W A;  1BI1 A;  4PLL A;  4PK4 A;  4P5N A;  1QVG P;  2G3R A;  4C8Q E;  1MMD A;  1OZ2 A;  1W6X A;  4KGX B;  1LCK A;  1KK7 A;  5GAN 2;  2L3Q A;  3JB9 J;  4E7J A;  4M7D F;  2HQE A;  4EPC A;  2LQW A;  3MP8 A;  5D6Y A;  1M8V A;  4QQD A;  3INZ A;  3HPW A;  3OYG A;  2RN8 A;  2MF2 A;  4JRI A;  4MZP A;  4X9C A;  3OMG A;  1K9A A;  3LWH A;  4PJJ A;  4Y91 A;  2KDS A;  2L2P A;  4JS4 A;  4Y92 A;  4HT9 A;  4JDS A;  3E9F A;  4M75 D;  3KUF A;  4F14 A;  3TSZ A;  1JJ2 P;  2ESW A;  5GAO n;  2O2O A;  4M78 F;  9ATC B;  2DM1 A;  1KFZ A;  2DNU A;  1XOV A;  1UEB A;  2CP5 A;  1PSF A;  4E6R A;  4Z02 A;  3OYN A;  2BE7 D;  2QTV A;  3M9Q A;  4R56 A;  4PFP A;  3CC2 T;  3ZL7 C;  2ROT A;  3DKM A;  5KYX B;  2DD5 A;  3I55 A;  3QBY A;  2B86 A;  2X35 A;  2EJF A;  2QA4 Q;  3R6N A;  3V8J A;  1W70 A;  2COW A;  2LCS A;  3G6E A;  1QVG S;  4XTW A;  1WNL A;  3KFV A;  5LJ3 g;  1N8R C;  1JJ2 A;  2ATC B;  4M75 C;  1R77 A;  2CH4 A;  3OW2 A;  4LDY A;  4OF1 A;  1VQK A;  1Q7Y U;  1YP5 A;  1K9M R;  4LD6 A;  2ENM A;  2DYI A;  2HAX A;  1WYX A;  4FM4 B;  4K11 A;  1G5V A;  3JCM d;  1WX6 A;  5HCK A;  4XU0 A;  2DYB A;  3N5B B;  3C95 A;  3BW1 A;  2V1R A;  2HCK A;  4E7Z A;  2ED0 A;  3TEE A;  4PJN A;  2EJ9 A;  5GAN 4;  1PRL C;  3UA7 A;  3QKJ A;  2CT3 A;  3I56 Q;  2CP7 A; 
#chains in the Genus database with same CATH homology
 1VQK T;  2MMP A;  4IKF A;  2ZCF B;  1FWZ A;  3CC4 A;  4M75 G;  4GY5 A;  1KC8 C;  4X34 A;  3GNF B;  1VQ6 A;  4XK8 E;  1N8R U;  1VQ7 T;  2ZZD A;  2QQA A;  2D0Q B;  3CBO A;  5CO7 A;  1LNX A;  3QZ5 B;  4BB7 A;  1S72 A;  2H3J A;  2RM4 A;  1KHC A;  4C5G A;  1BI3 A;  2ZPF B;  3P8D A;  3G4S A;  1BI0 A;  2EQM A;  5GAN e;  1NJI C;  3QZ9 B;  3QHS A;  3MEW A;  2QQB A;  5M9O A;  1KQ1 A;  2PVG B;  4MML A;  4NOY A;  4XTV A;  2DIG A;  5GMK e;  1WJR A;  3GLX A;  2XID A;  3CBM A;  2DVE A;  1AHJ B;  4MZM A;  3RKX A;  3OYA A;  3OB9 A;  2JN0 A;  3X24 B;  1Y96 B;  3CCL T;  5I2M A;  3CC4 T;  5GAM g;  5LJ5 g;  3OY9 A;  2MI6 A;  2QI2 A;  3MET A;  5CK9 A;  4M77 C;  4JS5 A;  1VQ5 T;  2DTO A;  1YJN A;  4FT4 A;  2HBP A;  4HCB A;  1S72 T;  4M77 A;  4C92 C;  5HK3 A;  2GF7 A;  2B8A A;  4JJN K;  4EDU A;  4BDY A;  2KY9 A;  2R57 A;  5DLQ E;  5L8R E;  4C92 A;  4NL3 A;  3DB3 A;  4DOV A;  5C0M A;  4ME7 A;  3OSV A;  4F7U E;  5GAN d;  3JAM E;  3CCV A;  3CCM A;  4M7A F;  4C5H A;  3OS5 A;  3ZEH A;  3BDU A;  4LDW A;  4ZGE B;  1DJ7 B;  2YRV A;  4D6W A;  2XDD A;  3CC7 A;  4C5I A;  2DJZ A;  2ZPI B;  1QVG A;  2DO3 A;  3HFN A;  2AHJ B;  3X25 B;  2CZ6 B;  1UB4 A;  2DPP B;  3V7S A;  4C92 B;  2OTL A;  3VKI A;  2BUD A;  1YHQ A;  2MWO A;  2R5M A;  4BAC A;  3J7A F;  4C8Q C;  2FHD A;  5LJ3 e;  3M4G A;  2LRQ A;  2KVQ G;  2DKG A;  3F70 A;  3QPH A;  2CGH A;  4BD3 A;  4C8Q A;  4J7F A;  3PIP A;  3CME A;  4BE1 A;  3CCQ T;  1O9S A;  1YJN T;  4FIB A;  1I5L A;  2RJD A;  3QYG B;  4XU3 A;  1Q81 C;  3OA6 A;  3M59 A;  2QEX A;  3CCV T;  2DXC A;  4C8Q B;  3A8L B;  4ZGJ B;  3OYE A;  2RK1 A;  2EYQ A;  4Y28 E;  2M9U A;  2QTX A;  4C92 G;  4O5V A;  3MP1 A;  4M7D D;  2P0P A;  3CC7 T;  4NS5 A;  3NTK A;  1YJ9 A;  2RO0 A;  4XQ3 A;  4L59 A;  1M1G A;  2A3L A;  4M7D E;  2Y4Y A;  4OB1 B;  1Q86 C;  1G3Y A;  4DOW A;  2OTL T;  4E7H A;  2JTF A;  2PU9 B;  1YHQ T;  4A4G A;  4MDX A;  2F5T X;  3QUI A;  2QQ9 A;  3X26 B;  3JCM b;  3TCJ A;  1NZ9 A;  3Q1J A;  5LJ3 d;  2M16 A;  3CXC A;  3OYH A;  2KMT A;  2CZ0 B;  4IUT A;  1WJS A;  3ME9 A;  4M7A D;  4HA8 A;  5GAO q;  3CD6 A;  2K5F A;  3P8B B;  4C8Q G;  3QII A;  4C0D C;  4PJO D;  4M7A E;  4L5G A;  5FU7 B;  1Y7X A;  5FU6 C;  4BY6 B;  5CCA A;  2GFU A;  3T9N A;  2QEX T;  3UPU A;  4PJO E;  3JB9 G;  4FL6 A;  1VQ8 A;  1Y07 A;  2F69 A;  1BIB A;  3NTH A;  4OMF B;  1N9S A;  2EWN A;  4IUU A;  1YJ9 T;  2RJE A;  1M4Z A;  2EAY A;  5CR2 A;  4RMO A;  5HKC A;  4C92 F;  2K5L A;  1K8A U;  2JNG A;  2XIC A;  4MDW A;  3SB2 A;  2EKO A;  4A4F A;  5GAN j;  1VQ4 A;  1HXD A;  3CMA A;  1OI1 A;  5FU6 B;  1Q81 U;  4NL2 A;  2V8J A;  2QDY B;  5KE2 A;  3JB9 I;  1QVP A;  5CKF A;  3LW5 E;  1VQL A;  3C12 A;  4QQG A;  4M75 B;  4FSX A;  3UDC A;  5GMK j;  3KBG A;  3HRU A;  3CPW S;  3E19 A;  3QDR B;  5IN1 A;  4M78 D;  2XG8 D;  3EFR A;  4JLG A;  5GAM f;  5LJ5 f;  1YJW A;  3CD6 T;  4E7I A;  2XK0 A;  3PT9 A;  5CAI A;  4M78 E;  3L2Q A;  2JUF A;  1Q86 U;  2DTI A;  2E6N A;  1LJO A;  2RHZ A;  4ELZ C;  3MP6 A;  1VQN T;  4C8Q F;  3LGF A;  4PKC C;  5CKE A;  1KD1 C;  2LDM A;  2MAM A;  1VQ8 T;  1VQP A;  1JBM A;  3M57 A;  5GAO m;  1G3S A;  2DXU A;  1MHN A;  2K57 A;  2V8I A;  4J8O A;  3RER A;  3A5Z B;  2L89 A;  1P92 A;  5KCH A;  3CMA T;  4ELY C;  3OS0 A;  1X6O A;  1VUB A;  2O4X A;  1XQH A;  4EMG A;  3FDR A;  3X28 B;  5FLX E;  1U1T A;  3M55 A;  3JCM c;  1PSE A;  5HY6 A;  3CBP A;  3ASK A;  5FRO A;  3PGG A;  2WSF E;  4XAX B;  4OP0 A;  4DA4 A;  1Q82 C;  4IUR A;  3SFM A;  2O4X B;  4Q5W A;  3CEY A;  4KBM B;  5LJ3 j;  3JCM g;  3GNG A;  3G71 A;  1RL2 A;  4MZT A;  5LL6 S;  5GAM d;  3QYH B;  1TH7 A;  3V8L A;  1BIA A;  4PNO A;  3OS2 A;  2WAC A;  3JCM X;  2YLB A;  2OTJ T;  3CPF A;  4E47 A;  3HP9 A;  3JSC A;  1K73 C;  2JOY A;  5GAM h;  5LJ5 h;  2L5Q A;  3CCJ A;  2K3X A;  1VQ6 T;  2HQX A;  5KH6 A;  3CCS A;  1Y71 A;  4IUP A;  2WSC E;  1UGQ B;  4M75 F;  3WXM B;  1KD1 U;  5FRM A;  4II1 A;  3M58 A;  2RD1 A;  2KK4 A;  2E10 A;  3VJP A;  3EFS A;  3OYC A;  2PVD B;  5GAN 6;  5A0L A;  3G4S T;  2VXF A;  2RH2 A;  5GAN 7;  4XTZ A;  2IG0 A;  4A4E A;  3OYB A;  2JZ2 A;  4A4H A;  3OBY A;  3L2W A;  4N4G A;  3G71 T;  4L6V 5;  1BKB A;  4JRP A;  4M77 B;  3OYJ A;  2CZ7 B;  4TVR A;  3SWN C;  4LD9 K;  2VYT A;  2LQ8 A;  3M53 A;  2QQR A;  2RB6 A;  1G3T A;  2BIV A;  3SWN A;  4CI0 C;  4OB0 B;  3M4Y A;  2DXB A;  4HT8 A;  5GMK l;  2RJC A;  1VQM A;  1Q82 U;  3A8O B;  4JLI A;  3HRS A;  1GXI E;  3NFC A;  3CCJ T;  3L2Z A;  1D3B A;  3JCM V;  3CCS T;  1I81 A;  4R55 A;  1KQ2 A;  2EQK A;  5IAY A;  3CCR A;  3HFO A;  3SWN B;  1WQW A;  2EQU A;  1K8A C;  2VGM A;  1YIT A;  4XTX A;  3VUZ A;  2YLC A;  4J6X A;  3FC3 A;  1YIJ A;  3A8M B;  5CQY A;  4JRQ A;  4XTU A;  3C94 A;  4CRI A;  3M54 A;  4OB2 B;  1RI0 A;  4OVA A;  1K73 U;  5DM7 R;  2K2V A;  3LX7 A;  3VV0 A;  3CCM T;  2XI9 A;  4M77 G;  5DLO A;  2K3Y A;  1H64 1;  3RMQ A;  3CPW A;  5GMK m;  3G7Z A;  4QQ6 A;  3PTA A;  3O8V A;  2EQJ A;  4B9W A;  5D6X A;  1OYX A;  2HD0 A;  1YBY A;  3MO8 A;  2DAQ A;  2VC8 A;  2RHX A;  3E1S A;  2F5K A;  3CC2 A;  4XU1 A;  3SDZ A;  4C0F A;  5GAN 8;  2O01 E;  2LX9 A;  2QXF A;  4RKU E;  2V8K A;  2P0Q A;  3PIO A;  2RHU A;  5J3B A;  4F7U A;  5CVI A;  4IUQ A;  4M75 E;  3VYH B;  3QJ6 A;  4J7I A;  2E6Z A;  2LTO A;  3CME T;  1G3W A;  1B34 A;  4RCB A;  3KXT A;  3WVE B;  3CCR T;  2KAF A;  5I2S A;  1N6A A;  3H8Z A;  4ZGD B;  1N9R A;  2GQV A;  2X4X A;  4MMK A;  1YIJ T;  3PMT A;  2RI5 A;  3JCM W;  4RG8 A;  2KSS A;  2XKO C;  3RMS A;  2VXE A;  4FT2 A;  4BDZ A;  5IT9 E;  1VIE A;  1U1S A;  1ZQ1 A;  2X4W A;  3V7C A;  3GPL A;  2RJF A;  1KQS S;  4RG2 A;  2XHC A;  4QW2 A;  1WJQ A;  2LQK A;  3AHU A;  4M77 F;  5HK0 A;  3HRT A;  4A4K A;  4N4I A;  3JCM f;  1U8R A;  2P4T A;  4PL6 A;  1FXX A;  3JCM Q;  4QVC A;  3BDL A;  2LNV A;  4C0D B;  4VUB A;  4LDU A;  3BY7 A;  1UGP B;  5GAO l;  4KUD K;  2FL7 A;  2FYK A;  2RI2 A;  3OYF A;  3VUB A;  3UWN A;  3H6Z A;  1VQ9 A;  4M7D C;  4OGC A;  4F7U G;  5KCO A;  3LYI A;  1ZHI A;  4M7D A;  3GIB A;  2DD4 A;  2X4J A;  4YTL A;  1MGQ A;  1HK9 A;  2WSE E;  1BI2 A;  1SSF A;  3OYY A;  3LGL A;  4A54 A;  3HL8 A;  4KT0 E;  3RKY A;  5GAM e;  3FJP A;  5LJ5 e;  4BE2 A;  1QP2 A;  1ZBX A;  3QJY A;  4FU6 A;  1JRI A;  3DLM A;  3JB9 F;  2E1H A;  2CZ1 B;  4XTY A;  5EG2 A;  4M7A C;  3MEA A;  2DXT A;  5CKD A;  1VQ7 A;  1QVF S;  4PJO C;  4N0A C;  3HHT B;  1VQ4 T;  3S3M A;  1OZ3 A;  4M7A A;  1M9S A;  3C4S A;  2JTM A;  3BFM A;  4PJO A;  4N0A A;  3OMC A;  1NE8 A;  2P0K A;  1VQL T;  2EFI A;  2PUK B;  2ZPG B;  1IZ6 A;  3P8H A;  3OYL A;  1VQ9 T;  2RK2 A;  1FX7 A;  2EJG A;  1WGS A;  2PUO B;  3HKS A;  3GP8 A;  1KG1 A;  5KE3 A;  5CKH A;  4HCZ A;  2K5I A;  4WF2 A;  3PFS A;  1JB0 E;  1YJW T;  4E7K A;  3L2V A;  3JCM h;  4PJO B;  3FB9 A;  4C0Z A;  4LDX A;  2QA4 A;  1IRE B;  1EIF A;  2RA2 A;  2YHT A;  1VQO A;  4GLK A;  3GOX A;  4M7D G;  4C92 D;  5LJ5 d;  4KUI A;  2LCL A;  5CIU A;  5FRN A;  4RCC A;  2LCC A;  3RIR A;  4ZN3 A;  1VQP T;  4C92 E;  3CCL A;  3QO3 A;  3RKW A;  4M78 C;  3A8H B;  3LLR A;  4J83 A;  2E41 A;  2A7Y A;  4BE0 A;  3OYI A;  2MWP A;  4M78 A;  1JJ2 S;  3E9G A;  4BI3 A;  2R5A A;  1VQ5 A;  5GAN f;  2Y4X A;  3L1A A;  4ATO A;  3OW2 S;  1X01 A;  2HNI A;  3V8K A;  2VV5 A;  1M5Q 1;  1M90 C;  1YI2 A;  5GAO r;  3S6W A;  5CQX A;  3M56 A;  1BI1 A;  4KUL A;  4M7A G;  3LH0 A;  2CS7 A;  2RI3 A;  5I21 A;  1K9M U;  4PLL A;  4PJO G;  4M78 B;  3OYD A;  4C8Q D;  2ZPH B;  1M1K C;  4V2S A;  4DQ2 A;  2DEQ A;  2XDP A;  4P5N A;  1Y96 A;  1WQ7 A;  2G3R A;  4C8Q E;  2X4Y A;  2DZC A;  3JB9 D;  2QA4 T;  5DY9 A;  1OZ2 A;  3A8G B;  3FIF A;  3J81 E;  4JRK A;  1VQO T;  3V7R A;  5C6S A;  5GAN 2;  2VUB A;  3JB9 J;  4HCC A;  2DIQ A;  3CCU A;  4E7J A;  4M7D F;  1QW1 A;  2HQE A;  4HKE A;  3ZFJ A;  2D9T A;  2RHI A;  4E7L A;  2GFA A;  3QG1 A;  2E12 A;  3MEV A;  3S3N A;  2FVU A;  4EPC A;  4ZN1 A;  3J80 E;  1KQS A;  3MP8 A;  3CCQ A;  3RUX A;  5D6Y A;  1W2B S;  2ZGW A;  1M8V A;  4QQD A;  3I56 A;  2XU8 A;  4M78 G;  1YI2 T;  3INZ A;  5A0G A;  1X75 C;  3HPW A;  5D6W A;  5GAN 3;  3OYG A;  1O75 A;  2EIF A;  2MF2 A;  4JRI A;  4N4H A;  1VIF A;  2E65 A;  4MZP A;  4X9C A;  2KQW A;  3OMG A;  4BUG A;  3JB9 H;  1KC8 U;  4PJO F;  2M0O A;  3LWH A;  1D3B B;  2LT4 A;  1N27 A;  1XTD A;  4Y91 A;  2KDS A;  5LJ3 f;  1R8O B;  2ZPB B;  5J26 A;  5GAN h;  1M90 U;  4JS4 A;  4J6Y A;  5CKB A;  4PLI A;  5GAN g;  3CCU T;  2Y90 A;  4HT9 A;  2XD0 A;  2DK3 A;  4JDS A;  2OAU A;  5GMK i;  3E9F A;  1NJI U;  1M1K U;  2ZPE B;  5GMK h;  4BI4 A;  4IUV A;  3OQ5 A;  4M75 D;  1VQM T;  3KUF A;  2GCX A;  2L8D A;  2NLU A;  2QQS A;  3M5A A;  3RES A;  3DLL A;  4C5E A;  5GAM j;  4ZTJ A;  5LJ5 j;  3WVD B;  2FB7 A;  2I2L A;  3EAE A;  3I56 T;  1Q7Y C;  3DB4 A;  1YIT T;  1QVF A;  3R6O A;  5GAO n;  4M78 F;  3TU4 K;  4F7U B;  1V29 B;  3X20 B;  3OS1 A;  1XOV A;  1UEB A;  3OYN A;  1PSF A;  4Z02 A;  3OYM A;  4C0G A;  1UGR B;  1B34 B;  3M9Q A;  1H3Z A;  2RHY A;  4R56 A;  5FU7 C;  4OGE A;  4BY6 C;  3SD4 A;  3CC2 T;  3MEU A;  3LWI A;  2E64 A;  3DKM A;  2D6F A;  3OYK A;  2DD5 A;  3I55 A;  3QBY A;  4XU2 A;  2X35 A;  1I4K 1;  4JUV A;  4UC4 A;  2LT1 A;  4X9D A;  3L42 A;  2EJF A;  5AYF A;  3JCM e;  5A2Q E;  3V8J A;  4ZTF A;  1QVG S;  1QP3 A;  3GF5 A;  3G6E A;  1I8F A;  4XTW A;  4QVZ A;  1WNL A;  4OB3 B;  5LJ3 h;  4EMH A;  4EMK C;  3PNW C;  5J39 A;  2CYZ B;  2DTH A;  2E70 A;  1NPP A;  1NPR A;  2K4Y A;  4EMK A;  4QVD A;  5LJ3 g;  3CCE A;  1N8R C;  3ZBD A;  1JJ2 A;  1VQN A;  3QSU A;  2BKD N;  2E5Q A;  4M75 C;  1M1F A;  3OW2 A;  3QXE B;  2IVW A;  3MHX A;  4LDY A;  3L2R A;  4M75 A;  3PMI A;  4OF1 A;  3JCM J;  1K9M C;  1LOJ A;  4EMK B;  2LC4 A;  5GAO p;  1VQK A;  4M7D B;  3MCA B;  1Q7Y U;  3JRZ A;  3FEO A;  1BYM A;  2VGN A;  4LD6 A;  4J5Y A;  3OBW A;  3TRE A;  3I55 T;  2HAX A;  1WPY A;  2LVM A;  1W4S A;  2DZ9 A;  3FRN A;  3JCM P;  4A53 A;  5A0D A;  4FM4 B;  3L2U A;  3NTI A;  1G5V A;  1XNI A;  3JCM d;  3ER0 A;  2JVV A;  2R58 A;  3VYG A;  4XU0 A;  4BI8 B;  3G6E T;  2L3R A;  3N5B B;  2M1H A;  3C95 A;  3FLG A;  4B9X A;  2XDB A;  3BW1 A;  2PQW A;  4LDV A;  4M7A B;  3CCE T;  3VU3 C;  3TEE A;  4F7U F;  1KHI A;  3S3O A;  2EJ9 A;  3OSS C;  1UGS B;  4M77 D;  5GAN 4;  1W2B A;  3CXC S;  3URG A;  4O6J A;  3HSB A;  5GAN 5;  4J6W A;  2C06 A;  4M77 E;  3QKJ A;  3UT1 A;  2CKK A;  2PVO B;  1YCY A;  2OTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...