3E9GA

Crystal structure long-form (residue1-124) of eaf3 chromo domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
107
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromatin modification-related protein EAF3
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 24
structure length 107
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9gA01
4IUVA 4IURA 3MEAA 1OZ3A 3OS0A 3FEOA 3OYAA 4E7IA 3FC3A 4BE0A 2QQRA 4BDZA 4IUTA 2RJEA 3LGFA 3LX7A 4IUUA 3OYGA 3E9FA 2LTOA 2BKDN 3FLGA 3L2WA 4HCZA 2P0KA 3L42A 3NTIA 2EKOA 3OMGA 5FROA 2MWPA 3NTKA 3BDLA 2XK0A 2DIQA 3DB3A 3LYIA 5CIUA 4E7LA 5KCHA 2LVMA 1OZ2A 2EQMA 2F5KA 3UWNA 3MEVA 2GF7A 1N27A 2R58A 3MP1A 4FU6A 2X35A 4QW2A 4C5HA 4E7JA 4A4FA 4QQ6A 2M16A 4GY5A 4C5EA 5C0MA 2RI2A 2L3RA 2GFAA 3MO8A 4PL6A 3S3MA 2RHZA 4IUPA 2X4YA 2X4WA 4QQDA 5J39A 2L8DA 3M9QA 4E7KA 1RI0A 2QQSA 4C5IA 2D9TA 4B9XA 4A4GA 1WGSA 3OQ5A 3PMTA 3OYEA 3OYHA 3LH0A 2E5QA 4QVZA 3OYJA 2RJDA 4N4HA 2RJFA 2IG0A 3L2RA 3LLRA 3DB4A 2MWOA 4A4EA 3E9GA 3MEWA 1OI1A 2PQWA 3PNWC 3OA6A 3QIIA 3ASKA 3QBYA 2JTFA 3F70A 3OMCA 4N4GA 4RG2A 4BD3A 4E7HA 3OYFA 3SD4A 3ME9A 3GOXA 2BUDA 2HQXA 2R5MA 4LD6A 4ZTFA 2DIGA 4C5GA 2LDMA 3OS2A 3MEUA 2K3XA 2NLUA 4B9WA 5KCOA 3OYDA 1G5VA 2EQKA 3FDRA 2XDPA 2K3YA 4X34A 3S3NA 3LGLA 4II1A 4ZTJA 3PFSA 3UT1A 5KH6A 2DAQA 3L2QA 2RHYA 1MHNA 2RHIA 4N4IA 4OVAA 4Q5WA 5FRMA 4FL6A 4BE1A 1KHCA 5IAYA 2R57A 3OYMA 1WJRA 2EQJA 5J26A 3OY9A 4PLLA 3DLMA 4Z02A 1WJSA 1XNIA 2RHXA 3S3OA 1H3ZA 3CEYA 3L2VA 3OYNA 3OYLA 5M9OA 3OYKA 4PLIA 4UC4A 2LCCA 3OYCA 2G3RA 2LRQA 2R5AA 2WACA 5FRNA 3L2UA 5D6YA 5KE2A 4BDYA 2RHUA 5KE3A 3NTHA 2RI5A 2YRVA 2FHDA 3MP6A 2X4XA 1SSFA 2RI3A 3PMIA 3P8HA 2EFIA 2RO0A 3C4SA 1WJQA 3OB9A 2O4XA 4A4HA 2JZ2A 2M1HA 3H8ZA 5C6SA 3O8VA 3META 4QQGA 4BACA 2E6NA 2EQUA 3OYBA 3EAEA 4BE2A 2CKKA 3MP8A 1OYXA 4NS5A 3QKJA 3OS1A 2BIVA 4EDUA 2L89A 3S6WA 2B8AA 2HQEA 3P8DA 4L59A 5D6XA 2VYTA 4CRIA 3OYIA 2RJCA 5D6WA 4IKFA 3H6ZA 4IUQA 3QJ6A 3Q1JA 2M0OA 2O4XB 3KUFA 5IN1A 2GFUA 3ZEHA
chains in the Genus database with same CATH superfamily
1X43A 2OX7A 3EG0A 4IURA 1QP2A 4RG8A 2GTOA 4FW2A 1KSWA 4HCZA 2P0KA 1BIBA 9ATCB 1S72Q 4FYWB 1AWWA 3C0CA 4FU6A 2X35A 5GANe 4RCCA 1BCMA 4QQ6A 1OU9A 1ZSZA 4PK4A 1YJWT 1NG2A 4LUDA 4C5IA 1FMWA 1X6GA 4N0AA 2EGCA 2C06A 1YN8A 1FX7A 2KYBA 3QBYA 2DTIA 4BD3A 2ZGWA 1I5OB 1MMDA 3SD4A 3TSWA 1QP3A 3CCQQ 3MEUA 2OJ2A 4DOVA 2KQWA 4Y92A 3LGLA 4RTXA 5GAMh 2H8HA 2LQNA 1TSFA 2RHYA 1MHNA 2HQHA 5FRMA 2QA4A 2PVDB 2DA9A 4ELYC 1YIJQ 1NLPC 2V8IA 2FYKA 1QWEA 2HDAA 3CCMQ 3CCUQ 3CC2Q 5LJ5e 4LNPA 3G1JA 3PTAA 4PFZA 4XTXA 2KDSA 5A0LA 4C8QD 5ECAA 1D09B 4EMGA 4QQGA 3QHSA 1B34A 1VUBA 3BY7A 3EAEA 2RK1A 4F04B 3M5AA 2FG0A 3JCMb 2HBPA 1VQOQ 5HKCA 4XTYA 3PE0A 3UF4A 4RTVA 4ZNXA 2OI3A 3CMAQ 4LD6A 2FL7A 5LJ3g 2GBQA 2ZPGB 3OYAA 2GNCA 3FEOA 4E7IA 1X2QA 3TQ7P 3E9FA 4GBQA 2E10A 4RTWA 3NTKA 4M7DA 2DIQA 1RAFB 4DBRA 2F5KA 2FZKB 4KRTA 3J81E 4PJOE 2XDDA 1K0XA 3M4GA 3FRNA 3MO8A 4Z88A 1VQPT 2X4YA 4KH1B 3CC7T 1QVFS 1VQ4T 5GMKi 4C8QE 4PJOG 2CT3A 4F7UA 4OB0B 2E5QA 2EJ9A 3TCJA 3L2RA 3DKMA 2KRNA 3OS5A 1KQSA 2RD1A 3OBWA 2CP5A 3PNWC 1NM7A 2ZCFB 3CCLT 2J6FA 5LJ5j 2GGRA 4C8QG 1PD1A 4RUGA 1GCQA 4C5GA 4MZTA 2OAWA 2K3YA 4X34A 4C92D 3TEEA 5GAN7 1WNLA 1VQNA 2JXBA 3I55T 2NUPB 3H0HA 4C0FA 2DEUA 3GBQA 2EQJA 3BDUA 4Y28E 3H0IA 4PLLA 4C92C 1NJIC 1VQLQ 5KYUA 1XNIA 4GLKA 2KT8A 1VQ5T 1AT1B 4PLIA 2WACA 2DL4A 4KGVB 2YRVA 1FWZA 3JCMP 1I5LA 1WHHA 2YUQA 2D6FA 1UUEA 3V7RA 4FW1A 1YJ9Q 4FIBA 4A4HA 4X9CA 1T3LA 1SHFA 1NJIR 4EDUA 4GLMA 3EFOA 3G4SQ 1NJIU 1YHQQ 1MMGA 4IUQA 4J9CA 3SDZA 2J06A 4HCCA 3A5ZB 1MNDA 1YJNQ 1OZ3A 1M30A 1BI3A 4C8QF 3NGPA 4IIMA 2CYZB 5GANd 2FPFA 2MWPA 1Y07A 1ZBXA 2XK0A 4DBFA 1NPPA 1WZOA 4V2SA 3FJ5A 5IXFA 1Q81U 4KULA 1PSFA 2GQVA 3RNJA 1JO8A 5IT9E 1BBZA 4IUPA 4J9IA 4OMMA 3EGXB 4B9XA 2HSPA 3LW5E 3M0UA 1XJWB 4JRPA 3QUIA 3VU3C 5DLOA 2AHJB 1EIFA 3DB4A 3H9NA 1M5Q1 3OMCA 3G6EA 3M55A 1YJWQ 3D7SB 1Q7YU 2LDMA 4B9WA 2EQKA 1PKSA 2M9UA 1OU8A 1PNJA 5I2SA 2RHIA 4QT7A 1W4SA 4PJLA 4DEYA 5CK9A 1M1FA 3WVDB 2PVGB 2AK5A 1NYGA 1WJSA 4R0KA 3G71A 3V8JA 1VQ8T 1MGQA 2OTLT 2DVJA 1JJ2A 1B7TA 2DPPB 2CZ6B 1OV3A 3EH1A 1ZSZC 2AT1B 1J3TA 4KGXB 4C92F 2DXCA 2J05A 3CMET 2P0QA 3CCVT 3M0SA 4MDXA 2X3XD 1Z9QA 2E6NA 4OB3B 4N0AC 2CKKA 2LJ1A 3IQLA 1UGVA 2SEMA 1VA7A 3ZL7C 4CRIA 2YLBA 5FW9A 2F5TX 2KY9A 1O75A 2L2PA 1HYOA 1GFCA 4E6RA 2W0ZA 3UT1A 2QYZA 3N5BB 4AFZC 3OS0A 1H641 1U3OA 3FLGA 4AT1B 2DRMA 3CXCP 2L3SA 2DXUA 3DB3A 1Y57A 1YITA 3QZ9B 2LVMA 4BI8B 4Y91A 2VUBA 2KAFA 2O31A 4HXJA 4OB1B 4E7JA 2M16A 1VQMT 2JVVA 5C0MA 2GFAA 4PL6A 2HZYA 5GAN5 4LDYA 4DOWA 3SWNB 4HKEA 3CBPA 3NFCA 1BI0A 4RTZA 3OYHA 2EYQA 4LD9K 2E64A 1YI2T 1BB9A 3LLRA 4D6WA 5GAOq 1OI1A 3QIIA 3WVEB 3CC4A 1VQPQ 3J7AF 1AHJB 2QASA 3CC7Q 2BUDA 2PU9B 2EQIA 1VQ4Q 2COZA 3OYDA 4QVDA 2DERA 1TUGB 3FIFA 1ZSGA 4M7DD 1ZA1B 4PJOA 4N4IA 4FL6A 1MMAA 2YUPA 3CPWP 1Y96A 2LX7A 1V1CA 1WHGA 3R6NA 5IH2A 3CCLQ 4M7DC 1UGRB 1H3ZA 1ZX6A 3JCMg 2JTMA 4C8QA 1X2KA 1V29B 2Y4YA 2DYIA 1UJ0A 5LJ5h 3I55Q 1X75C 4M77B 3KXTA 1YWPA 2KSSA 4JZ4A 5CO7A 4LDVA 1VQ7A 1GXIE 1M3CA 2F2XA 2E1HA 5C6SA 2QEXQ 4KGZB 4RCBA 4BACA 3RUXA 1OX8A 1VQ5Q 4DEXA 3CPFA 4CC2A 3HKSA 1VQ9T 1WFWA 1PG5B 1D3BB 4FSXA 1R77A 4XTVA 1V76A 5KYYB 3QWXX 1KG1A 4J9DA 1GCQC 2LNVA 1WXUA 1UG1A 2VASA 2G6FX 2YXYA 3KFVA 1ZLMA 2ENMA 3CBOA 4A53A 1PRLC 3SFMA 2O9VA 2QA4T 4ESRA 1X6OA 4FM4B 2HD0A 3L2ZA 4C5EA 3QPHA 1TG0A 2L3RA 2K4YA 4KT0E 2FRWA 3A8OB 4C0GA 4M7AB 1M4ZA 1RI0A 2QQSA 4D8DA 2PVOB 4A4GA 2ZPEB 2FPDA 4QVZA 3RMSA 2IG0A 3VS7A 4ME7A 3LH5A 2EYZA 2M51A 3GPLA 1I8FA 4AFSC 2CP6A 2LX9A 3JB9J 2RN8A 2OAUA 3OS2A 2EJFA 2L0AA 5KH6A 2DAQA 4Q5WA 2A28A 1KHCA 2CP0A 2DKGA 2L5QA 1LNXA 3QDRB 1E6GA 1UJYA 2G3RA 5GAOm 3M59A 5KE2A 5GAMd 2QDLA 2CSIA 3NTHA 2EVRA 4FT2A 1IGQA 1WXTA 1B07A 2DNUA 2RI3A 2XU8A 4M7DF 4BUGA 2BZYA 3JAME 4HCKA 1YNZA 4JUVA 2OTLQ 1VQ8Q 1S1NA 2JMAA 3QYHB 3RKXA 1M90C 5IHKA 8AT1B 2KBTA 5GJVB 2QQAA 3CMEQ 4AFQC 1OOTA 3CCVQ 2A0FB 1SEMA 1ZHIA 2RMOA 3JB9H 3ZEHA 2DD4A 2XKOC 1Q95G 1QQJA 2QQRA 1WHMA 1UEBA 1R8OB 3A8HB 3H41A 4JZ3A 3RR6A 3OBYA 3JCMf 1VQNT 4QKUA 2VB6A 3TU4K 1K8AU 4FT4A 1RAAB 2ZZDA 2YUNA 1OZ2A 4MZPA 2VGMA 3MP1A 3OW2S 4M78E 4M77E 1M90R 4L5GA 1K9AA 4GY5A 4J9FA 1UHCA 3S3MA 2RHZA 1BU1A 1JXMA 3MPUB 4M78G 4M77G 1NYFA 2NUPA 2E70A 2PQWA 3TSZA 1VQMQ 4N4GA 3QXEB 1PSEA 3M0QA 1M27C 1D0ZA 1I4K1 1XOVA 1QVGS 3MKDA 1M2VB 1WPYA 2K3BA 2M02A 3PIPA 3SHWA 1M8MA 5FU6C 3L2QA 4RTUA 3THKA 3HPWA 3MHXA 5IHNA 6AT1B 1YI2Q 5CCAA 4BE1A 2K5FA 5CKEA 4OB2B 1IB8A 1WX6A 2DJQA 2K5LA 4OGEA 2O2OA 2DETA 1BYMA 1JEGA 2XG8D 3EG9B 3OYLA 4XU2A 2HKNA 1W2BP 5CKDA 3I35A 1FMVA 2DX1A 2PZ1A 3CC2A 2BE7D 1M1GA 1SSFA 4E7ZA 5KYXB 2EFIA 1QKWA 4EMHA 4IIOA 1NE8A 2CH4W 2VV5A 1M1KC 4CC3A 5GAOp 4M7AG 3CCSA 3CXCA 1Q82U 4PJOD 4FYXB 2LP5A 3CMAA 1BI1A 2Z0WA 2EWNA 3M0TA 2GFUA 2ZAEA 2HKQB 3G6ET 4BE0A 4PJOC 4XTWA 1VQ9Q 4EMKA 2HNIA 5GANg 5CIUA 2EGEA 1M1KR 5DM7R 1M1KU 3EGXA 2LT1A 4C8QC 1G2BA 3MEVA 4QW2A 4C5HA 2X4JA 1SSHA 4JJNK 2YSQA 3BW1A 3G71T 3G7ZA 4F17A 5EG2A 1OPLA 3PVQA 2DZ9A 4ELZC 2WSCE 2AKKA 1T0HA 3PMTA 1UECA 1IO6A 1PRMC 2QA4Q 2CUDA 1KQSS 2D0QB 3JCMX 5J3BA 3CPWA 3F70A 4LXCA 1E6HA 1X01A 3ME9A 3R6OA 4ZGJB 2DLPA 2KXDA 4LDXA 1UDLA 2K6DA 1PCXA 5FU7C 3TVTA 5LJ3j 1TUDA 1QW1A 1OPKA 2EGAA 4F14A 2ED1A 2R57A 2RB6A 2LCSA 2FZGB 1E7OA 1G3WA 1N5ZA 2CS7A 2I0NA 3A98A 4JDSA 5FWCA 3GIBA 1GRIA 2P4RA 2XD0A 2YRDA 2R5AA 1ABOA 3EGDA 2C0IA 1YITT 1K1ZA 2VXFA 3GF5A 1VQ6T 2XICA 3EFSA 3EH2A 1YJ9A 2GQIA 2D8HA 3EGUA 1IXDA 3M0PA 1LVKA 3E19A 1MV0B 4KBMB 1VQKA 4FYVB 1GBRA 2MK5A 3LWIA 2DL8A 4ZN3A 2ED0A 2VVKA 2BIVA 2C0TA 2K2VA 2QEXT 2JNGA 2HQEA 3VYGA 2QTVA 2JMCA 4MDWA 4PJJA 3DLLA 1QCNA 3CC4T 2CZ7B 4J6YA 1K9MC 2Y4XA 2BZXA 3JCMV 2HBWA 2L3PA 2MOXA 3HP9A 1GBQA 3RMQA 1C0MA 4LUEA 3VV0A 4LDWA 4C0ZA 1ZSZB 4O5VA 5GMKl 3SWNA 1Q81C 1HJDA 2GF7A 1ZQ1A 2FRYA 3I56A 4PJOF 2LJ3A 2BE9B 3CBMA 3L1AA 2DL5A 2A08A 5KYWA 2X4WA 3CCJA 2DRKA 1VQNQ 1M3AA 2ABLA 1K9MR 3CD6T 1WGSA 3OQ5A 1K9MU 1T0JA 3RKWA 3QZ5B 2DZCA 3OYJA 2OTJT 2A3LA 2P84A 4J7FA 3MEWA 1N9SA 1Q7YC 1YJWA 1ZUUA 3V7SA 2HCKA 4HA8A 3HL8A 2MMPA 2YHTA 1Q81R 2NYSA 1RL2A 2JT4A 4CI0C 2K7AA 3AHUA 1WLPB 4BB7A 3CCEA 2FPEA 1XQHA 4RKUE 4M78A 4OVAA 4M77A 2QQBA 2VWFA 3PT9A 3OY9A 5FWBA 1QMCA 2WSFE 1B3QA 2RQRA 2DXTA 2HSEB 1JJ2S 1W6XA 1Y71A 1Q7YR 5LJ3f 1D3BA 1EFNA 1IGUA 1U06A 1KQ2A 2P4TA 3PMIA 2MYSA 4KUIA 1KQ1A 4OF1A 1SF9A 1OQKA 3M57A 4PNOA 2RNAA 3E2UA 4P5NA 2CP7A 4L6V5 5IHIA 3JCMc 1ZUYA 1ABQA 5LJ5d 3QDFA 4L59A 4LDUA 1VYTA 2DK3A 1D1AA 4XU3A 1UGQB 3H0FA 5A2QE 4IUVA 3JCMJ 1UTIA 2EIFA 4JS5A 2KMTA 1H3HA 3L2WA 2E65A 4M75B 1P92A 3OW2P 2F69A 2CGHA 2R58A 4NL3A 3G6EQ 1PKTA 4F7UB 2X51A 3EG1A 4QQDA 3QSUA 2L8DA 1H92A 5GAN2 2DMOA 4JJCA 1KFZA 2RJFA 3PIOA 3HSBA 1MMNA 1QVGP 2MWOA 3E9GA 1OX9A 3VYHB 2JTFA 2V26A 1VIEA 4CC7A 3G71Q 3NMZC 1VQ4A 1ZA2B 2KYMA 4MMLA 5I2MA 3VS3A 3JCMe 1W2BA 2K5IA 4OP0A 2QGFB 2MPXC 4ORZA 1H8KA 4JRQA 2PTKA 4EMKC 3CCLA 3VS6A 3HTRA 3DLMA 2RHXA 4JRKA 1AZGB 1LCKA 1PWTA 2DD5A 3CCRA 3L2VA 3VS4A 1GCPA 2JTEA 4WCIA 1T3SA 5GAN3 3M56A 5GAMg 4A4KA 2JUFA 1ACMB 2D0NA 3P8HA 5LJ3h 2YLCA 3X24B 3EFOB 3O8VA 5HY6A 1HD3A 2ROLA 3VS1A 4ZN1A 3EFRA 4NS5A 1YITQ 4JS4A 2WSEE 5KYNA 1VQ6Q 5D6XA 1SRMA 4AFUC 5A0DA 4J83A 3KUFA 2O4XB 1YP5A 2AIRB 1R0CB 3MEAA 2KRSA 1K73U 1RACB 2DEQA 4IUTA 2V8JA 1AWOA 2LTOA 1QKXA 1R0BG 3UPUA 2LMJA 4E7LA 1C1AA 4LE9A 3HRTA 3UWNA 3CC4Q 4JJBA 3HRSA 5I21A 2RQWA 1NEBA 4A4FA 1TWBA 1IHWA 1IHVA 4FCYA 1UFFA 2KE9A 1CSKA 1M2VA 2PUKB 3HRUA 2AZSA 1PC0A 4JPBW 4BY6C 2EYXA 3OA6A 2JS0A 2R5MA 4ZTFA 8ATCB 1QVFP 2K3XA 3EG9A 3CD6Q 1U1SA 3CCST 1G5VA 2XDPA 3S3NA 1I81A 3OSVA 3V8LA 3JB9G 4ZTJA 2OTJQ 1N8RC 3I5SA 5DY9A 1KK7A 4KUDK 4M75E 2DL3A 2JN0A 3E1SA 4WF2A 2DF6A 1U1TA 3SWNC 5M9OA 2J7IA 2P0PA 2LRQA 1VOMA 4M75G 4BDYA 2COWA 3QO3A 2QG9B 1D1CA 4JLIA 2VGNA 5CKBA 2M1HA 5GMKj 1BK2A 1N8RR 1TTHB 2K79A 1N8RU 5GAOr 3QKJA 1OEBA 2ESWA 4J7IA 4C0DC 5CR2A 3O5ZA 3CMEA 3NPFA 4M78D 4M77D 4IKFA 5IN1A 3LWHA 1G3YA 1Q86U 1WQ7A 2XIDA 4BDZA 4M78C 3M54A 4M77C 2BKDN 1K8AC 2HL3A 2KVQG 3LYIA 2HAXA 1RAEB 1WXBA 1GFDA 3VRZA 1YCSB 1UB4A 2DBKA 4MZMA 5GAMf 2RF0A 2B86A 1RAHB 3JB9I 3EHQA 4J9EA 3QWYA 4NOYA 4J6WA 1FYNA 2LQKA 1QCFA 1FXXA 1JQQA 2Y90A 3RDVA 3C95A 3JCMQ 1HXDA 2RJDA 1VQMA 4JJDA 1K8AR 1S72A 2KK4A 2IPOB 1VQKT 2H3JA 2CSQA 4RTYA 2HQXA 4XTZA 2YT6A 2EKHA 3VS2A 1A0NB 5HCKA 3RESA 3PVLA 3A8LB 4M7AD 2VKNA 3C94A 4PJMA 5D7UA 3HHTB 4C8QB 2L3QA 1JJ2P 1VIFA 4Z02A 4EIKA 4HT9A 3GLXA 1RAGB 3OYKA 3OYCA 1WI7A 2LQ8A 3ZFJA 3CCQA 3L2UA 5DLQE 2DILA 2QDYB 2YRCA 5L8RE 5KE3A 4E2FB 1YWOA 1RADB 3I56T 2W10A 1WJQA 3GP8A 2JZ2A 1AVZC 3H8ZA 3META 5CAIA 3CCJT 3WXMB 1Q82C 2M0YA 3CXCS 1YIJA 5FU7B 1M8VA 1TS9A 2EW3A 1RABB 3OW2A 1G8XA 4ZGEB 1EX4A 3CCMA 3CCUA 2KNBB 4J9HA 1TXQA 3QJ6A 4HVVA 2ECZA 3AT1B 3JCMW 1BIAA 4A54A 2XI9A 1X27A 1PD0A 4M7AE 1VQ9A 1QWFA 2LQWA 1CKBA 5LJ3e 3CCET 3UATA 1VQOA 2KRMA 3MJXA 1Q82R 1W1FA 2QGGA 2CUBA 1QVGA 5GJWB 4M78F 4RTTA 1NZ9A 2QK0A 4M77F 3GNFB 4PFPA 2X3WD 1KHIA 5LL6S 4CC4B 4C92B 3A8GB 2D9TA 2QXFA 1MNEA 3JRZA 1ZUKA 4N4HA 4ZGDB 3CPWS 1G83A 1JRIA 3RERA 2LZ6B 1M2OA 1N6AA 2DFUA 2NUTB 2CT4A 3JCMh 1QVPA 2EAYA 2D1XA 3X26B 2CZ1B 3A1PA 3TREA 1UE9A 4FSSA 4BI3A 4OMFB 4AG2C 2E3IA 1UGPB 3FJPA 1IZ6A 3V8KA 5GANj 1AZEA 4QVCA 3S3OA 2PNIA 3CCSQ 3JSCA 2LCCA 3SB2A 4E7SA 3SEMA 4OMLA 1LJOA 2RHUA 2A37A 4Z8AA 4M7AF 4OMPA 4AMCA 2K57A 5GAN6 1VQLA 2EQUA 3OYBA 3QG1A 2L89A 5LJ5g 1JB0E 5GAOl 2RA2A 3P8DA 4M75A 1TOVA 2FZCB 2KR3A 1M9SA 3OYIA 2RJCA 4HVUA 2FVUA 5D6WA 3Q1JA 1WHLA 2MAMA 5GMKh 5FROA 1ZBJA 2RK2A 3G4SA 1YHQA 1I07A 1N27A 4XU1A 4XAXB 2RI2A 3CCRT 2O01E 3REAB 1YJNA 1WHKA 3M58A 3UDCA 4E7KA 3BE3A 1QVFA 3OYEA 3LH0A 2QAZA 2EJGA 4J6XA 2D8JA 1YBYA 3P8BB 4XTUA 3M53A 3ASKA 5CVIA 4E7HA 1YCYA 3OYFA 2V1RA 3EHRA 3GOXA 1WDXA 2DIGA 1OULA 1KC8C 2O9SA 3EG3A 1XTDA 2EYYA 3OYYA 4F16A 3T9NA 1X6BA 2DTHA 4MMKA 3PFSA 5IAYA 2DL7A 5J26A 3I5RA 1AOJA 1VQKQ 1UHFA 3JV3A 1VYUA 2SRCA 2DM1A 2HMAA 1M3BA 2F2VA 1VQ7T 3OYNA 1JXOA 4J8OA 5HK3A 3RIRA 4C92E 2DVEA 4HT8A 2XDBA 1KC8R 3VUZA 1KC8U 4K11A 2A36A 4DBQA 2RO0A 5GANf 2O4XA 2E3HA 1RI9A 2RQVA 4OGCA 2RQTA 1VYVA 1WA7A 2YDLA 4C92G 1JU5C 1OYXA 2JM8A 3OS1A 3MCAB 2CREA 2VYTA 2ZPHB 3I56Q 4EMKB 2DJZA 5FLXE 1SRLA 5LJ3d 4FYYB 3V7CA 2DO3A 5KYYA 1B34B 2X9HA 3CCJQ 2CDTA 2RJEA 4IUUA 3VS5A 1W70A 3L42A 4DA4A 3GNGA 1O9SA 1IREB 1QLYA 2ROTA 3CQTA 4A63B 1ARKA 4ANJA 3VJPA 1U8RA 3HFOA 5AYFA 3M9QA 4M7DB 3CCEQ 2HEQA 2H3EB 2BZ8A 4LN2A 4X1VA 2FB7A 4DBHA 5LJ5f 4M7AA 2RQUA 4A4EA 1D0YA 2NWMA 4YTLA 2E41A 4OMQA 1CKAA 4D8KA 3EG2A 2E6ZA 5A0GA 1BI2A 1W2BS 2NLUA 5CKFA 3FDRA 4OMOA 3VKIA 4II1A 2J6KA 4VUBA 5GAMe 2JW4A 1K76A 2IVWA 3U23A 1TUCA 3C12A 1TH7A 2A7YA 2IIMA 2DE0X 3EGDB 2K2MA 3CEYA 1WYXA 4E47A 1VQPA 2I2LA 4UC4A 3CC7A 5D6YA 4AG1C 2ZPIB 4XQ3A 2J6OA 4BY6B 2RI5A 4J9GA 3MP6A 2X4XA 1AWXA 5KYUB 3ZBDA 3C4SA 3OB9A 2XHCA 4R56A 2FEIA 3ER0A 4BE2A 2E4HA 4PKCC 5GANh 2MCNA 1VQ6A 4WTOB 1AD5A 5GAN8 1RLQC 2F1LA 3I55A 2EPDA 2FO0A 3H6ZA 1S72T 1K73C 5EC7A 2GCXA 1RUWA 3HFNA 2VC8A 3UA6A 2MIOA 3LX7A 1NLOC 1BKBA 2QEXA 4HVWA 2O88A 5HK0A 1VQ5A 2EKOA 1F1BB 3M0RA 3BDLA 4JLGA 5CKHA 4DQ2A 2KGTA 3PGGA 1X69A 2XMFA 3JB9D 4M4ZA 5KYWB 2LT4A 2QI2A 1AWJA 5GAMj 3J80E 5GAOn 3I9QA 1N9RA 5J39A 1K73R 3CCQT 1I1JA 1U5SA 4C0DB 1LOJA 2F2WA 4M75D 1K4US 3VS0A 1Y7XA 3QJYA 5GMKe 1KD1C 1GL5A 3CCRQ 4RG2A 2LJ0A 3M4YA 2ZPBB 4M75C 1LPLA 2EBPA 1TU0B 3CD6A 2DTOA 4M78B 1YIJT 5KCOA 4OMNA 4XU0A 2OTJA 2LNHB 2V1QA 2QQ9A 2QTXA 1K0SA 2E12A 5CQYA 1KQSP 3CCMT 3CCUT 2GTJA 5IXBA 3CC2T 1WJRA 4JRIA 5I11A 1Y0MA 4PFOA 1UGSB 1D0XA 2LCLA 1D1BA 3OSSC 1MUZA 1KD1R 5FRNA 3VUBA 1KD1U 1VQOT 1HK9A 2VXEA 4M7DE 2CZ0B 1FMKA 4J5YA 4HCBA 3KBGA 3CMAT 1PHTA 1SKUB 2KXCA 1G3TA 1VQ7Q 2V8KA 4KH0B 3X25B 2YWWA 1RLPC 5KYXA 4M7DG 2C0OA 3S6WA 3NHNA 1MV3A 2B8AA 3BFMA 4B6MA 2DYBA 2DXBA 2JOYA 3VRYA 1Q86C 4F7UE 2M0OA 3RKYA 4EPCA 4PJNA 3FC3A 5I22A 3RBBB 3LGFA 3OYGA 2LC4A 1NEGA 2OTLA 1VQ8A 3NTIA 1RAIB 3OMGA 2EYWA 4C92A 4F7UG 2ZPFB 2BTTA 2CP3A 4R55A 1KIKA 5KCHA 2DBMA 1EZZB 2EQMA 2MF2A 1C6VX 5FU6B 3CCVA 2CP2A 1DJ7B 1KJWA 2JM9A 2KI7A 4J9BA 2NUTA 2AKLA 3X20B 1Q86R 1AEYA 2KROA 2YUOA 3INZA 1WIEA 1YFNA 4NL2A 4BI4A 2COYA 1PM3A 4Z89A 1I0CA 3JB9F 2CH4A 1BCOA 1WQWA 2RH2A 1VQLT 2AZVA 7AT1B 2MI6A 4XK8E 1NBEB 2PUOB 3OYMA 2RM4A 3ULRB 1G3SA 4M75F 4RMOA 2KT1A 2JS2A 1YJ9T 1SPKA 2HL5C 3FB9A 2RPNA 3JCMd 1SG5A 4PJOB 3QYGB 4F7UF 4ATOA 3G4ST 1Y96B 1YHQT 2E5KA 2FHDA 5AT1B 1YI2A 4TVRA 3REBB 2K9GA 1IRXA 2NUZA 2JJ9A 1YJNT 3UA7A 2KEAA 1WHJA 1JBMA 1QCOA 3MP8A 1SHGA 4M7AC 1Z9ZA 3URGA 1NPRA 5GMKm 1M90U 3A8MB 5L23A 5GAN4 1HSQA 5CQXA 2ATCB 4X9DA 4O6JA 3X28B
chains in the Genus database with same CATH topology
4IUVA 4IURA 1QP2A 3JCMJ 4RG8A 2MAMA 2EIFA 4JS5A 2KMTA 3L2WA 4HCZA 2P0KA 1BIBA 3CBOA 2E65A 5GMKh 4A53A 4M75B 5FROA 1P92A 2RK2A 3SFMA 3G4SA 2F69A 1YHQA 2QA4T 2CGHA 1X6OA 1N27A 2R58A 4FU6A 4XU1A 4NL3A 2X35A 5GANe 4FM4B 4RCCA 2HD0A 4QQ6A 3L2ZA 4C5EA 3QPHA 4XAXB 2RI2A 2L3RA 4F7UB 3CCRT 2O01E 1YJNA 2K4YA 1YJWT 4KT0E 3M58A 3A8OB 4QQDA 3QSUA 4C0GA 2L8DA 4M7AB 1M4ZA 3UDCA 4E7KA 1RI0A 2QQSA 4C5IA 3S3NA 1QVFA 2PVOB 4A4GA 5GAN2 2ZPEB 3OYEA 3LH0A 4QVZA 2EJGA 4N0AA 3RMSA 2RJFA 2IG0A 4J6XA 3PIOA 2C06A 1FX7A 3HSBA 4ME7A 2MWOA 1YBYA 3E9GA 3P8BB 4XTUA 3VYHB 3GPLA 3M53A 3ASKA 3QBYA 1I8FA 2DTIA 2JTFA 1VIEA 5CVIA 1YCYA 2ZGWA 4BD3A 4E7HA 3OYFA 1VQ4A 3SD4A 3GOXA 2LX9A 3JB9J 1QP3A 2DIGA 4MMLA 2OAUA 1KC8C 3OS2A 3MEUA 5I2MA 3JCMe 4DOVA 2EJFA 1XTDA 1W2BA 2KQWA 3OYYA 2K5IA 3T9NA 3LGLA 5GAMh 2DTHA 4MMKA 4OP0A 3PFSA 5KH6A 2DAQA 2RHYA 1MHNA 4JRQA 5FRMA 4Q5WA 1KHCA 5IAYA 5J26A 4EMKC 2QA4A 3CCLA 2PVDB 2DKGA 2L5QA 3DLMA 2RHXA 4JRKA 4ELYC 1LNXA 2DD5A 3CCRA 3L2VA 1VQ7T 3QDRB 3OYNA 2G3RA 5GAN3 5GAOm 3M56A 4J8OA 3M59A 5KE2A 5GAMg 2V8IA 2FYKA 4A4KA 5HK3A 5GAMd 2JUFA 3RIRA 3NTHA 4C92E 2DVEA 5LJ5e 4FT2A 4HT8A 2XDBA 3PTAA 3VUZA 2RI3A 2XU8A 3P8HA 1KC8U 4M7DF 4XTXA 4BUGA 2KDSA 5A0LA 5LJ3h 2YLCA 4C8QD 2RO0A 5GANf 3X24B 2O4XA 3JAME 4EMGA 3O8VA 4JUVA 4OGCA 4QQGA 5HY6A 3QHSA 1B34A 1VUBA 3BY7A 3EAEA 2RK1A 3QYHB 4ZN1A 3EFRA 3M5AA 3RKXA 4C92G 3JCMb 1OYXA 2HBPA 4NS5A 3OS1A 4JS4A 3MCAB 5HKCA 1M90C 4XTYA 2WSEE 5D6XA 2VYTA 2QQAA 2ZPHB 5A0DA 4J83A 4EMKB 2DJZA 5FLXE 3KUFA 2O4XB 4LD6A 2FL7A 1ZHIA 3JB9H 3ZEHA 5LJ3g 5LJ3d 2DD4A 3V7CA 2DO3A 2ZPGB 1B34B 2XKOC 3MEAA 3OYAA 1K73U 3FEOA 4E7IA 2DEQA 2QQRA 4IUTA 2RJEA 2V8JA 1UEBA 4IUUA 3E9FA 1R8OB 2LTOA 3A8HB 2E10A 3L42A 3UPUA 3OBYA 3JCMf 3NTKA 1VQNT 4M7DA 4E7LA 4DA4A 2DIQA 3TU4K 1K8AU 3GNGA 1O9SA 4FT4A 2ZZDA 1IREB 1OZ2A 3HRTA 2F5KA 4MZPA 3UWNA 3HRSA 2VGMA 3J81E 3MP1A 4PJOE 2XDDA 3M4GA 3OW2S 4M78E 5I21A 4M77E 3FRNA 4A4FA 4L5GA 4GY5A 3MO8A 1VQPT 3VJPA 1U8RA 3S3MA 2RHZA 2X4YA 3HFOA 3CC7T 5AYFA 3M9QA 1QVFS 4M7DB 1VQ4T 5GMKi 4C8QE 4PJOG 2PUKB 4OB0B 4M78G 4F7UA 3HRUA 4M77G 2FB7A 2E5QA 4BY6C 2EJ9A 3TCJA 3L2RA 5LJ5f 3DKMA 4M7AA 3OS5A 4A4EA 1KQSA 2RD1A 3OBWA 2E70A 2PQWA 3PNWC 3OA6A 4N4GA 3QXEB 4YTLA 1PSEA 2E41A 2ZCFB 3CCLT 5LJ5j 1I4K1 1XOVA 4C8QG 1QVGS 2R5MA 4ZTFA 4C5GA 2E6ZA 4MZTA 1BI2A 5A0GA 2K3XA 1W2BS 2NLUA 5CKFA 1U1SA 1WPYA 3CCST 1G5VA 3FDRA 2XDPA 2K3YA 4X34A 4C92D 3TEEA 5GAN7 1WNLA 3VKIA 1I81A 3OSVA 4II1A 3V8LA 3PIPA 3JB9G 4ZTJA 1VQNA 5FU6C 3I55T 3L2QA 1N8RC 3HPWA 3MHXA 4VUBA 4C0FA 5GAMe 5CCAA 4BE1A 5DY9A 2IVWA 2K5FA 2EQJA 4M75E 2JN0A 3E1SA 3BDUA 3C12A 1TH7A 4OB2B 4WF2A 4Y28E 2A7YA 4PLLA 4C92C 1NJIC 2K5LA 4OGEA 1U1TA 1BYMA 1XNIA 3CEYA 4GLKA 2XG8D 4E47A 1VQPA 3SWNC 3OYLA 4XU2A 5M9OA 1VQ5T 2I2LA 2P0PA 4PLIA 4UC4A 5CKDA 3CC7A 2LRQA 2WACA 5D6YA 4M75G 3CC2A 2ZPIB 4XQ3A 4BDYA 5A2QE 3QO3A 4BY6B 2RI5A 2YRVA 1FWZA 3MP6A 3JCMP 1I5LA 2X4XA 1M1GA 1SSFA 2D6FA 2EFIA 3V7RA 4EMHA 3ZBDA 3C4SA 4FIBA 3OB9A 4JLIA 2VGNA 2XHCA 2M1HA 1NE8A 2VV5A 4X9CA 5CKBA 4A4HA 5GMKj 4R56A 1M1KC 5GAOp 1N8RU 3ER0A 4BE2A 4PKCC 5GANh 5GAOr 3QKJA 4M7AG 3CCSA 3CXCA 4C0DC 4J7IA 4EDUA 5CR2A 1Q82U 1VQ6A 1NJIU 3CMEA 5GAN8 4PJOD 3I55A 3CMAA 4M78D 4M77D 1BI1A 4IKFA 3H6ZA 4IUQA 3SDZA 1S72T 2EWNA 1K73C 4HCCA 3A5ZB 5IN1A 2GFUA 3LWHA 1G3YA 2GCXA 3HFNA 3G6ET 1Q86U 1WQ7A 2XIDA 1OZ3A 2VC8A 4BE0A 4PJOC 4BDZA 4XTWA 3LX7A 4M78C 1BKBA 1BI3A 3M54A 2BKDN 4M77C 4C8QF 4EMKA 2QEXA 5HK0A 1K8AC 1VQ5A 2HNIA 2CYZB 2KVQG 2EKOA 5GANg 5GANd 2MWPA 1Y07A 1ZBXA 2XK0A 3BDLA 3LYIA 4JLGA 5CKHA 1NPPA 3PGGA 5CIUA 4DQ2A 5DM7R 1M1KU 3JB9D 2LT1A 1UB4A 4MZMA 5GAMf 4C8QC 3MEVA 4V2SA 4QW2A 1Q81U 4C5HA 3JB9I 2LT4A 2X4JA 4KULA 2QI2A 4JJNK 4NOYA 1PSFA 2GQVA 4J6WA 5GAMj 2LQKA 3BW1A 3G71T 3G7ZA 1FXXA 3J80E 4IUPA 5IT9E 5GAOn 1N9RA 5J39A 5EG2A 3CCQT 2Y90A 4ELZC 2DZ9A 4C0DB 4B9XA 2WSCE 1LOJA 3C95A 3LW5E 3PMTA 4JRPA 3QUIA 4M75D 3VU3C 3JCMQ 1HXDA 2RJDA 5DLOA 2AHJB 1KQSS 1Y7XA 1EIFA 2D0QB 3JCMX 1VQMA 3DB4A 3QJYA 5J3BA 3CPWA 1S72A 2HAXA 1M5Q1 2KK4A 5GMKe 1KD1C 3F70A 3OMCA 4RG2A 3M4YA 3G6EA 3M55A 2H3JA 2ZPBB 1VQKT 1X01A 4M75C 3ME9A 3R6OA 4ZGJB 2HQXA 1Q7YU 3CD6A 2DTOA 4M78B 4XTZA 2LDMA 4LDXA 1YIJT 4B9WA 5KCOA 4XU0A 2EQKA 2OTJA 5FU7C 2M9UA 3RESA 4M7AD 3A8LB 2QQ9A 2QTXA 5LJ3j 1QW1A 2E12A 5CQYA 5I2SA 2RHIA 3C94A 3CCMT 3CCUT 2R57A 2RB6A 3HHTB 4C8QB 3CC2T 1W4SA 1WJRA 1G3WA 1M1FA 3WVDB 5CK9A 4JRIA 2PVGB 1VIFA 2CS7A 4Z02A 1UGSB 1WJSA 4HT9A 3GLXA 2LCLA 4JDSA 3GIBA 3G71A 3V8JA 1VQ8T 1MGQA 2OTLT 3OYKA 3OYCA 2LQ8A 1JJ2A 2XD0A 3ZFJA 3OSSC 2R5AA 3CCQA 5FRNA 2DPPB 3L2UA 2CZ6B 5DLQE 3VUBA 1YITT 1KD1U 2QDYB 1VQOT 1HK9A 2VXFA 5L8RE 5KE3A 3GF5A 2VXEA 1VQ6T 2CZ0B 2XICA 3EFSA 4C92F 2DXCA 4M7DE 3CMET 4J5YA 1YJ9A 3I56T 4HCBA 3KBGA 2P0QA 3CCVT 3CMAT 1WJQA 3GP8A 2JZ2A 4MDXA 3H8ZA 1G3TA 3META 2V8KA 3E19A 4KBMB 3X25B 2E6NA 5CAIA 1VQKA 3LWIA 4OB3B 4N0AC 3CCJT 3WXMB 4ZN3A 1Q82C 2CKKA 3CXCS 1YIJA 4M7DG 5FU7B 2BIVA 1M8VA 2K2VA 2QEXT 2JNGA 3S6WA 2B8AA 2HQEA 3BFMA 3VYGA 2DXBA 4CRIA 2YLBA 3OW2A 4MDWA 2JOYA 2F5TX 4ZGEB 2KY9A 1O75A 3CCMA 4F7UE 3CCUA 1Q86C 3QJ6A 2M0OA 3DLLA 3UT1A 3RKYA 1BIAA 2CZ7B 4A54A 3CC4T 3N5BB 4EPCA 3JCMW 4J6YA 1K9MC 2XI9A 2Y4XA 4M7AE 3OS0A 3JCMV 1VQ9A 3FC3A 1H641 3LGFA 3OYGA 2LC4A 3FLGA 3HP9A 2OTLA 3RMQA 1VQ8A 3NTIA 3VV0A 3OMGA 4C92A 5LJ3e 2DXUA 2ZPFB 4F7UG 3DB3A 4LDWA 3CCET 4C0ZA 1YITA 4R55A 3QZ9B 1VQOA 4KUDK 4O5VA 5KCHA 2LVMA 3SWNA 5GMKl 2EQMA 4Y91A 4BI8B 1Q81C 2VUBA 2MF2A 2KAFA 2GF7A 1ZQ1A 4OB1B 3I56A 5FU6B 4PJOF 3CCVA 1QVGA 4E7JA 4M78F 2M16A 1NZ9A 4M77F 1VQMT 2JVVA 3GNFB 5C0MA 3CBMA 2GFAA 3L1AA 4PL6A 1DJ7B 1KHIA 2X4WA 5LL6S 3X20B 4C92B 5GAN5 3CCJA 3A8GB 2D9TA 4LDYA 3INZA 2QXFA 3CD6T 1WGSA 3JRZA 3OQ5A 4DOWA 3SWNB 4NL2A 4BI4A 4HKEA 3RKWA 3CBPA 1K9MU 3NFCA 1BI0A 3OYHA 3QZ5B 2DZCA 3OYJA 2OTJT 2EYQA 4N4HA 4LD9K 4ZGDB 2E64A 1YI2T 3CPWS 2A3LA 3LLRA 4J7FA 4D6WA 3MEWA 5GAOq 1N9SA 1OI1A 3QIIA 1Q7YC 1JRIA 3WVEB 1YJWA 3CC4A 3JB9F 3J7AF 3V7SA 3RERA 4HA8A 1AHJB 1WQWA 1N6AA 2MMPA 2RH2A 3HL8A 1VQLT 2YHTA 2BUDA 3JCMh 1QVPA 2PU9B 1RL2A 2MI6A 2EAYA 4CI0C 3OYDA 3X26B 2CZ1B 4QVDA 3FIFA 4M7DD 4XK8E 3TREA 3AHUA 5CKEA 4PJOA 4BB7A 3CCEA 1XQHA 2PUOB 4RKUE 4M78A 4N4IA 4OVAA 4M77A 2QQBA 4FL6A 3OYMA 2RM4A 4OMFB 4BI3A 3PT9A 1Y96A 3OY9A 1G3SA 4M75F 4RMOA 1UGPB 3FJPA 1IZ6A 3V8KA 5GANj 4M7DC 4QVCA 2WSFE 1UGRB 1YJ9T 1H3ZA 3FB9A 3S3OA 3JCMg 2DXTA 2JTMA 4C8QA 3JCMd 1JJ2S 1V29B 3JSCA 2LCCA 3SB2A 2Y4YA 1Y71A 4PJOB 3QYGB 5LJ5h 1X75C 5LJ3f 1LJOA 4M77B 4F7UF 1D3BA 2RHUA 4ATOA 3G4ST 3KXTA 1Y96B 1YHQT 2KSSA 2FHDA 1KQ2A 1YI2A 4TVRA 2P4TA 3PMIA 5CO7A 4M7AF 4LDVA 4KUIA 1VQ7A 1GXIE 2E1HA 2K57A 5C6SA 4RCBA 1KQ1A 4OF1A 5GAN6 3RUXA 4BACA 1YJNT 1VQLA 2EQUA 3OYBA 1JBMA 3M57A 3CPFA 3HKSA 3MP8A 4PNOA 3QG1A 1VQ9T 4M7AC 4P5NA 4L6V5 1D3BB 3JCMc 4FSXA 2L89A 3URGA 5LJ5g 4XTVA 1NPRA 1JB0E 5LJ5d 2RA2A 4L59A 4LDUA 3P8DA 4M75A 5GMKm 5GAOl 1KG1A 3OYIA 1M9SA 1M90U 2RJCA 3A8MB 2FVUA 2DK3A 5D6WA 2LNVA 4XU3A 5GAN4 1UGQB 5CQXA 3Q1JA 4X9DA 4O6JA 3X28B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUV A;  4IUR A;  3MEA A;  1OZ3 A;  3OS0 A;  3FEO A;  3OYA A;  4E7I A;  3FC3 A;  4BE0 A;  2QQR A;  4BDZ A;  4IUT A;  2RJE A;  3LGF A;  3LX7 A;  4IUU A;  3OYG A;  3E9F A;  2LTO A;  2BKD N;  3FLG A;  3L2W A;  4HCZ A;  2P0K A;  3L42 A;  3NTI A;  2EKO A;  3OMG A;  5FRO A;  2MWP A;  3NTK A;  3BDL A;  2XK0 A;  2DIQ A;  3DB3 A;  3LYI A;  5CIU A;  4E7L A;  5KCH A;  2LVM A;  1OZ2 A;  2EQM A;  2F5K A;  3UWN A;  3MEV A;  2GF7 A;  1N27 A;  2R58 A;  3MP1 A;  4FU6 A;  2X35 A;  4QW2 A;  4C5H A;  4E7J A;  4A4F A;  4QQ6 A;  2M16 A;  4GY5 A;  4C5E A;  5C0M A;  2RI2 A;  2L3R A;  2GFA A;  3MO8 A;  4PL6 A;  3S3M A;  2RHZ A;  4IUP A;  2X4Y A;  2X4W A;  4QQD A;  5J39 A;  2L8D A;  3M9Q A;  4E7K A;  1RI0 A;  2QQS A;  4C5I A;  2D9T A;  4B9X A;  4A4G A;  1WGS A;  3OQ5 A;  3PMT A;  3OYE A;  3OYH A;  3LH0 A;  2E5Q A;  4QVZ A;  3OYJ A;  2RJD A;  4N4H A;  2RJF A;  2IG0 A;  3L2R A;  3LLR A;  3DB4 A;  2MWO A;  4A4E A;  3E9G A;  3MEW A;  1OI1 A;  2PQW A;  3PNW C;  3OA6 A;  3QII A;  3ASK A;  3QBY A;  2JTF A;  3F70 A;  3OMC A;  4N4G A;  4RG2 A;  4BD3 A;  4E7H A;  3OYF A;  3SD4 A;  3ME9 A;  3GOX A;  2BUD A;  2HQX A;  2R5M A;  4LD6 A;  4ZTF A;  2DIG A;  4C5G A;  2LDM A;  3OS2 A;  3MEU A;  2K3X A;  2NLU A;  4B9W A;  5KCO A;  3OYD A;  1G5V A;  2EQK A;  3FDR A;  2XDP A;  2K3Y A;  4X34 A;  3S3N A;  3LGL A;  4II1 A;  4ZTJ A;  3PFS A;  3UT1 A;  5KH6 A;  2DAQ A;  3L2Q A;  2RHY A;  1MHN A;  2RHI A;  4N4I A;  4OVA A;  4Q5W A;  5FRM A;  4FL6 A;  4BE1 A;  1KHC A;  5IAY A;  2R57 A;  3OYM A;  1WJR A;  2EQJ A;  5J26 A;  3OY9 A;  4PLL A;  3DLM A;  4Z02 A;  1WJS A;  1XNI A;  2RHX A;  3S3O A;  1H3Z A;  3CEY A;  3L2V A;  3OYN A;  3OYL A;  5M9O A;  3OYK A;  4PLI A;  4UC4 A;  2LCC A;  3OYC A;  2G3R A;  2LRQ A;  2R5A A;  2WAC A;  5FRN A;  3L2U A;  5D6Y A;  5KE2 A;  4BDY A;  2RHU A;  5KE3 A;  3NTH A;  2RI5 A;  2YRV A;  2FHD A;  3MP6 A;  2X4X A;  1SSF A;  2RI3 A;  3PMI A;  3P8H A;  2EFI A;  2RO0 A;  3C4S A;  1WJQ A;  3OB9 A;  2O4X A;  4A4H A;  2JZ2 A;  2M1H A;  3H8Z A;  5C6S A;  3O8V A;  3MET A;  4QQG A;  4BAC A;  2E6N A;  2EQU A;  3OYB A;  3EAE A;  4BE2 A;  2CKK A;  3MP8 A;  1OYX A;  4NS5 A;  3QKJ A;  3OS1 A;  2BIV A;  4EDU A;  2L89 A;  3S6W A;  2B8A A;  2HQE A;  3P8D A;  4L59 A;  5D6X A;  2VYT A;  4CRI A;  3OYI A;  2RJC A;  5D6W A;  4IKF A;  3H6Z A;  4IUQ A;  3QJ6 A;  3Q1J A;  2M0O A;  2O4X B;  3KUF A;  5IN1 A;  2GFU A;  3ZEH A; 
#chains in the Genus database with same CATH topology
 1X43 A;  2OX7 A;  3EG0 A;  4IUR A;  1QP2 A;  4RG8 A;  2GTO A;  4FW2 A;  1KSW A;  4HCZ A;  2P0K A;  1BIB A;  9ATC B;  1S72 Q;  4FYW B;  1AWW A;  3C0C A;  4FU6 A;  2X35 A;  5GAN e;  4RCC A;  1BCM A;  4QQ6 A;  1OU9 A;  1ZSZ A;  4PK4 A;  1YJW T;  1NG2 A;  4LUD A;  4C5I A;  1FMW A;  1X6G A;  4N0A A;  2EGC A;  2C06 A;  1YN8 A;  1FX7 A;  2KYB A;  3QBY A;  2DTI A;  4BD3 A;  2ZGW A;  1I5O B;  1MMD A;  3SD4 A;  3TSW A;  1QP3 A;  3CCQ Q;  3MEU A;  2OJ2 A;  4DOV A;  2KQW A;  4Y92 A;  3LGL A;  4RTX A;  5GAM h;  2H8H A;  2LQN A;  1TSF A;  2RHY A;  1MHN A;  2HQH A;  5FRM A;  2QA4 A;  2PVD B;  2DA9 A;  4ELY C;  1YIJ Q;  1NLP C;  2V8I A;  2FYK A;  1QWE A;  2HDA A;  3CCM Q;  3CCU Q;  3CC2 Q;  5LJ5 e;  4LNP A;  3G1J A;  3PTA A;  4PFZ A;  4XTX A;  2KDS A;  5A0L A;  4C8Q D;  5ECA A;  1D09 B;  4EMG A;  4QQG A;  3QHS A;  1B34 A;  1VUB A;  3BY7 A;  3EAE A;  2RK1 A;  4F04 B;  3M5A A;  2FG0 A;  3JCM b;  2HBP A;  1VQO Q;  5HKC A;  4XTY A;  3PE0 A;  3UF4 A;  4RTV A;  4ZNX A;  2OI3 A;  3CMA Q;  4LD6 A;  2FL7 A;  5LJ3 g;  2GBQ A;  2ZPG B;  3OYA A;  2GNC A;  3FEO A;  4E7I A;  1X2Q A;  3TQ7 P;  3E9F A;  4GBQ A;  2E10 A;  4RTW A;  3NTK A;  4M7D A;  2DIQ A;  1RAF B;  4DBR A;  2F5K A;  2FZK B;  4KRT A;  3J81 E;  4PJO E;  2XDD A;  1K0X A;  3M4G A;  3FRN A;  3MO8 A;  4Z88 A;  1VQP T;  2X4Y A;  4KH1 B;  3CC7 T;  1QVF S;  1VQ4 T;  5GMK i;  4C8Q E;  4PJO G;  2CT3 A;  4F7U A;  4OB0 B;  2E5Q A;  2EJ9 A;  3TCJ A;  3L2R A;  3DKM A;  2KRN A;  3OS5 A;  1KQS A;  2RD1 A;  3OBW A;  2CP5 A;  3PNW C;  1NM7 A;  2ZCF B;  3CCL T;  2J6F A;  5LJ5 j;  2GGR A;  4C8Q G;  1PD1 A;  4RUG A;  1GCQ A;  4C5G A;  4MZT A;  2OAW A;  2K3Y A;  4X34 A;  4C92 D;  3TEE A;  5GAN 7;  1WNL A;  1VQN A;  2JXB A;  3I55 T;  2NUP B;  3H0H A;  4C0F A;  2DEU A;  3GBQ A;  2EQJ A;  3BDU A;  4Y28 E;  3H0I A;  4PLL A;  4C92 C;  1NJI C;  1VQL Q;  5KYU A;  1XNI A;  4GLK A;  2KT8 A;  1VQ5 T;  1AT1 B;  4PLI A;  2WAC A;  2DL4 A;  4KGV B;  2YRV A;  1FWZ A;  3JCM P;  1I5L A;  1WHH A;  2YUQ A;  2D6F A;  1UUE A;  3V7R A;  4FW1 A;  1YJ9 Q;  4FIB A;  4A4H A;  4X9C A;  1T3L A;  1SHF A;  1NJI R;  4EDU A;  4GLM A;  3EFO A;  3G4S Q;  1NJI U;  1YHQ Q;  1MMG A;  4IUQ A;  4J9C A;  3SDZ A;  2J06 A;  4HCC A;  3A5Z B;  1MND A;  1YJN Q;  1OZ3 A;  1M30 A;  1BI3 A;  4C8Q F;  3NGP A;  4IIM A;  2CYZ B;  5GAN d;  2FPF A;  2MWP A;  1Y07 A;  1ZBX A;  2XK0 A;  4DBF A;  1NPP A;  1WZO A;  4V2S A;  3FJ5 A;  5IXF A;  1Q81 U;  4KUL A;  1PSF A;  2GQV A;  3RNJ A;  1JO8 A;  5IT9 E;  1BBZ A;  4IUP A;  4J9I A;  4OMM A;  3EGX B;  4B9X A;  2HSP A;  3LW5 E;  3M0U A;  1XJW B;  4JRP A;  3QUI A;  3VU3 C;  5DLO A;  2AHJ B;  1EIF A;  3DB4 A;  3H9N A;  1M5Q 1;  3OMC A;  3G6E A;  3M55 A;  1YJW Q;  3D7S B;  1Q7Y U;  2LDM A;  4B9W A;  2EQK A;  1PKS A;  2M9U A;  1OU8 A;  1PNJ A;  5I2S A;  2RHI A;  4QT7 A;  1W4S A;  4PJL A;  4DEY A;  5CK9 A;  1M1F A;  3WVD B;  2PVG B;  2AK5 A;  1NYG A;  1WJS A;  4R0K A;  3G71 A;  3V8J A;  1VQ8 T;  1MGQ A;  2OTL T;  2DVJ A;  1JJ2 A;  1B7T A;  2DPP B;  2CZ6 B;  1OV3 A;  3EH1 A;  1ZSZ C;  2AT1 B;  1J3T A;  4KGX B;  4C92 F;  2DXC A;  2J05 A;  3CME T;  2P0Q A;  3CCV T;  3M0S A;  4MDX A;  2X3X D;  1Z9Q A;  2E6N A;  4OB3 B;  4N0A C;  2CKK A;  2LJ1 A;  3IQL A;  1UGV A;  2SEM A;  1VA7 A;  3ZL7 C;  4CRI A;  2YLB A;  5FW9 A;  2F5T X;  2KY9 A;  1O75 A;  2L2P A;  1HYO A;  1GFC A;  4E6R A;  2W0Z A;  3UT1 A;  2QYZ A;  3N5B B;  4AFZ C;  3OS0 A;  1H64 1;  1U3O A;  3FLG A;  4AT1 B;  2DRM A;  3CXC P;  2L3S A;  2DXU A;  3DB3 A;  1Y57 A;  1YIT A;  3QZ9 B;  2LVM A;  4BI8 B;  4Y91 A;  2VUB A;  2KAF A;  2O31 A;  4HXJ A;  4OB1 B;  4E7J A;  2M16 A;  1VQM T;  2JVV A;  5C0M A;  2GFA A;  4PL6 A;  2HZY A;  5GAN 5;  4LDY A;  4DOW A;  3SWN B;  4HKE A;  3CBP A;  3NFC A;  1BI0 A;  4RTZ A;  3OYH A;  2EYQ A;  4LD9 K;  2E64 A;  1YI2 T;  1BB9 A;  3LLR A;  4D6W A;  5GAO q;  1OI1 A;  3QII A;  3WVE B;  3CC4 A;  1VQP Q;  3J7A F;  1AHJ B;  2QAS A;  3CC7 Q;  2BUD A;  2PU9 B;  2EQI A;  1VQ4 Q;  2COZ A;  3OYD A;  4QVD A;  2DER A;  1TUG B;  3FIF A;  1ZSG A;  4M7D D;  1ZA1 B;  4PJO A;  4N4I A;  4FL6 A;  1MMA A;  2YUP A;  3CPW P;  1Y96 A;  2LX7 A;  1V1C A;  1WHG A;  3R6N A;  5IH2 A;  3CCL Q;  4M7D C;  1UGR B;  1H3Z A;  1ZX6 A;  3JCM g;  2JTM A;  4C8Q A;  1X2K A;  1V29 B;  2Y4Y A;  2DYI A;  1UJ0 A;  5LJ5 h;  3I55 Q;  1X75 C;  4M77 B;  3KXT A;  1YWP A;  2KSS A;  4JZ4 A;  5CO7 A;  4LDV A;  1VQ7 A;  1GXI E;  1M3C A;  2F2X A;  2E1H A;  5C6S A;  2QEX Q;  4KGZ B;  4RCB A;  4BAC A;  3RUX A;  1OX8 A;  1VQ5 Q;  4DEX A;  3CPF A;  4CC2 A;  3HKS A;  1VQ9 T;  1WFW A;  1PG5 B;  1D3B B;  4FSX A;  1R77 A;  4XTV A;  1V76 A;  5KYY B;  3QWX X;  1KG1 A;  4J9D A;  1GCQ C;  2LNV A;  1WXU A;  1UG1 A;  2VAS A;  2G6F X;  2YXY A;  3KFV A;  1ZLM A;  2ENM A;  3CBO A;  4A53 A;  1PRL C;  3SFM A;  2O9V A;  2QA4 T;  4ESR A;  1X6O A;  4FM4 B;  2HD0 A;  3L2Z A;  4C5E A;  3QPH A;  1TG0 A;  2L3R A;  2K4Y A;  4KT0 E;  2FRW A;  3A8O B;  4C0G A;  4M7A B;  1M4Z A;  1RI0 A;  2QQS A;  4D8D A;  2PVO B;  4A4G A;  2ZPE B;  2FPD A;  4QVZ A;  3RMS A;  2IG0 A;  3VS7 A;  4ME7 A;  3LH5 A;  2EYZ A;  2M51 A;  3GPL A;  1I8F A;  4AFS C;  2CP6 A;  2LX9 A;  3JB9 J;  2RN8 A;  2OAU A;  3OS2 A;  2EJF A;  2L0A A;  5KH6 A;  2DAQ A;  4Q5W A;  2A28 A;  1KHC A;  2CP0 A;  2DKG A;  2L5Q A;  1LNX A;  3QDR B;  1E6G A;  1UJY A;  2G3R A;  5GAO m;  3M59 A;  5KE2 A;  5GAM d;  2QDL A;  2CSI A;  3NTH A;  2EVR A;  4FT2 A;  1IGQ A;  1WXT A;  1B07 A;  2DNU A;  2RI3 A;  2XU8 A;  4M7D F;  4BUG A;  2BZY A;  3JAM E;  4HCK A;  1YNZ A;  4JUV A;  2OTL Q;  1VQ8 Q;  1S1N A;  2JMA A;  3QYH B;  3RKX A;  1M90 C;  5IHK A;  8AT1 B;  2KBT A;  5GJV B;  2QQA A;  3CME Q;  4AFQ C;  1OOT A;  3CCV Q;  2A0F B;  1SEM A;  1ZHI A;  2RMO A;  3JB9 H;  3ZEH A;  2DD4 A;  2XKO C;  1Q95 G;  1QQJ A;  2QQR A;  1WHM A;  1UEB A;  1R8O B;  3A8H B;  3H41 A;  4JZ3 A;  3RR6 A;  3OBY A;  3JCM f;  1VQN T;  4QKU A;  2VB6 A;  3TU4 K;  1K8A U;  4FT4 A;  1RAA B;  2ZZD A;  2YUN A;  1OZ2 A;  4MZP A;  2VGM A;  3MP1 A;  3OW2 S;  4M78 E;  4M77 E;  1M90 R;  4L5G A;  1K9A A;  4GY5 A;  4J9F A;  1UHC A;  3S3M A;  2RHZ A;  1BU1 A;  1JXM A;  3MPU B;  4M78 G;  4M77 G;  1NYF A;  2NUP A;  2E70 A;  2PQW A;  3TSZ A;  1VQM Q;  4N4G A;  3QXE B;  1PSE A;  3M0Q A;  1M27 C;  1D0Z A;  1I4K 1;  1XOV A;  1QVG S;  3MKD A;  1M2V B;  1WPY A;  2K3B A;  2M02 A;  3PIP A;  3SHW A;  1M8M A;  5FU6 C;  3L2Q A;  4RTU A;  3THK A;  3HPW A;  3MHX A;  5IHN A;  6AT1 B;  1YI2 Q;  5CCA A;  4BE1 A;  2K5F A;  5CKE A;  4OB2 B;  1IB8 A;  1WX6 A;  2DJQ A;  2K5L A;  4OGE A;  2O2O A;  2DET A;  1BYM A;  1JEG A;  2XG8 D;  3EG9 B;  3OYL A;  4XU2 A;  2HKN A;  1W2B P;  5CKD A;  3I35 A;  1FMV A;  2DX1 A;  2PZ1 A;  3CC2 A;  2BE7 D;  1M1G A;  1SSF A;  4E7Z A;  5KYX B;  2EFI A;  1QKW A;  4EMH A;  4IIO A;  1NE8 A;  2CH4 W;  2VV5 A;  1M1K C;  4CC3 A;  5GAO p;  4M7A G;  3CCS A;  3CXC A;  1Q82 U;  4PJO D;  4FYX B;  2LP5 A;  3CMA A;  1BI1 A;  2Z0W A;  2EWN A;  3M0T A;  2GFU A;  2ZAE A;  2HKQ B;  3G6E T;  4BE0 A;  4PJO C;  4XTW A;  1VQ9 Q;  4EMK A;  2HNI A;  5GAN g;  5CIU A;  2EGE A;  1M1K R;  5DM7 R;  1M1K U;  3EGX A;  2LT1 A;  4C8Q C;  1G2B A;  3MEV A;  4QW2 A;  4C5H A;  2X4J A;  1SSH A;  4JJN K;  2YSQ A;  3BW1 A;  3G71 T;  3G7Z A;  4F17 A;  5EG2 A;  1OPL A;  3PVQ A;  2DZ9 A;  4ELZ C;  2WSC E;  2AKK A;  1T0H A;  3PMT A;  1UEC A;  1IO6 A;  1PRM C;  2QA4 Q;  2CUD A;  1KQS S;  2D0Q B;  3JCM X;  5J3B A;  3CPW A;  3F70 A;  4LXC A;  1E6H A;  1X01 A;  3ME9 A;  3R6O A;  4ZGJ B;  2DLP A;  2KXD A;  4LDX A;  1UDL A;  2K6D A;  1PCX A;  5FU7 C;  3TVT A;  5LJ3 j;  1TUD A;  1QW1 A;  1OPK A;  2EGA A;  4F14 A;  2ED1 A;  2R57 A;  2RB6 A;  2LCS A;  2FZG B;  1E7O A;  1G3W A;  1N5Z A;  2CS7 A;  2I0N A;  3A98 A;  4JDS A;  5FWC A;  3GIB A;  1GRI A;  2P4R A;  2XD0 A;  2YRD A;  2R5A A;  1ABO A;  3EGD A;  2C0I A;  1YIT T;  1K1Z A;  2VXF A;  3GF5 A;  1VQ6 T;  2XIC A;  3EFS A;  3EH2 A;  1YJ9 A;  2GQI A;  2D8H A;  3EGU A;  1IXD A;  3M0P A;  1LVK A;  3E19 A;  1MV0 B;  4KBM B;  1VQK A;  4FYV B;  1GBR A;  2MK5 A;  3LWI A;  2DL8 A;  4ZN3 A;  2ED0 A;  2VVK A;  2BIV A;  2C0T A;  2K2V A;  2QEX T;  2JNG A;  2HQE A;  3VYG A;  2QTV A;  2JMC A;  4MDW A;  4PJJ A;  3DLL A;  1QCN A;  3CC4 T;  2CZ7 B;  4J6Y A;  1K9M C;  2Y4X A;  2BZX A;  3JCM V;  2HBW A;  2L3P A;  2MOX A;  3HP9 A;  1GBQ A;  3RMQ A;  1C0M A;  4LUE A;  3VV0 A;  4LDW A;  4C0Z A;  1ZSZ B;  4O5V A;  5GMK l;  3SWN A;  1Q81 C;  1HJD A;  2GF7 A;  1ZQ1 A;  2FRY A;  3I56 A;  4PJO F;  2LJ3 A;  2BE9 B;  3CBM A;  3L1A A;  2DL5 A;  2A08 A;  5KYW A;  2X4W A;  3CCJ A;  2DRK A;  1VQN Q;  1M3A A;  2ABL A;  1K9M R;  3CD6 T;  1WGS A;  3OQ5 A;  1K9M U;  1T0J A;  3RKW A;  3QZ5 B;  2DZC A;  3OYJ A;  2OTJ T;  2A3L A;  2P84 A;  4J7F A;  3MEW A;  1N9S A;  1Q7Y C;  1YJW A;  1ZUU A;  3V7S A;  2HCK A;  4HA8 A;  3HL8 A;  2MMP A;  2YHT A;  1Q81 R;  2NYS A;  1RL2 A;  2JT4 A;  4CI0 C;  2K7A A;  3AHU A;  1WLP B;  4BB7 A;  3CCE A;  2FPE A;  1XQH A;  4RKU E;  4M78 A;  4OVA A;  4M77 A;  2QQB A;  2VWF A;  3PT9 A;  3OY9 A;  5FWB A;  1QMC A;  2WSF E;  1B3Q A;  2RQR A;  2DXT A;  2HSE B;  1JJ2 S;  1W6X A;  1Y71 A;  1Q7Y R;  5LJ3 f;  1D3B A;  1EFN A;  1IGU A;  1U06 A;  1KQ2 A;  2P4T A;  3PMI A;  2MYS A;  4KUI A;  1KQ1 A;  4OF1 A;  1SF9 A;  1OQK A;  3M57 A;  4PNO A;  2RNA A;  3E2U A;  4P5N A;  2CP7 A;  4L6V 5;  5IHI A;  3JCM c;  1ZUY A;  1ABQ A;  5LJ5 d;  3QDF A;  4L59 A;  4LDU A;  1VYT A;  2DK3 A;  1D1A A;  4XU3 A;  1UGQ B;  3H0F A;  5A2Q E;  4IUV A;  3JCM J;  1UTI A;  2EIF A;  4JS5 A;  2KMT A;  1H3H A;  3L2W A;  2E65 A;  4M75 B;  1P92 A;  3OW2 P;  2F69 A;  2CGH A;  2R58 A;  4NL3 A;  3G6E Q;  1PKT A;  4F7U B;  2X51 A;  3EG1 A;  4QQD A;  3QSU A;  2L8D A;  1H92 A;  5GAN 2;  2DMO A;  4JJC A;  1KFZ A;  2RJF A;  3PIO A;  3HSB A;  1MMN A;  1QVG P;  2MWO A;  3E9G A;  1OX9 A;  3VYH B;  2JTF A;  2V26 A;  1VIE A;  4CC7 A;  3G71 Q;  3NMZ C;  1VQ4 A;  1ZA2 B;  2KYM A;  4MML A;  5I2M A;  3VS3 A;  3JCM e;  1W2B A;  2K5I A;  4OP0 A;  2QGF B;  2MPX C;  4ORZ A;  1H8K A;  4JRQ A;  2PTK A;  4EMK C;  3CCL A;  3VS6 A;  3HTR A;  3DLM A;  2RHX A;  4JRK A;  1AZG B;  1LCK A;  1PWT A;  2DD5 A;  3CCR A;  3L2V A;  3VS4 A;  1GCP A;  2JTE A;  4WCI A;  1T3S A;  5GAN 3;  3M56 A;  5GAM g;  4A4K A;  2JUF A;  1ACM B;  2D0N A;  3P8H A;  5LJ3 h;  2YLC A;  3X24 B;  3EFO B;  3O8V A;  5HY6 A;  1HD3 A;  2ROL A;  3VS1 A;  4ZN1 A;  3EFR A;  4NS5 A;  1YIT Q;  4JS4 A;  2WSE E;  5KYN A;  1VQ6 Q;  5D6X A;  1SRM A;  4AFU C;  5A0D A;  4J83 A;  3KUF A;  2O4X B;  1YP5 A;  2AIR B;  1R0C B;  3MEA A;  2KRS A;  1K73 U;  1RAC B;  2DEQ A;  4IUT A;  2V8J A;  1AWO A;  2LTO A;  1QKX A;  1R0B G;  3UPU A;  2LMJ A;  4E7L A;  1C1A A;  4LE9 A;  3HRT A;  3UWN A;  3CC4 Q;  4JJB A;  3HRS A;  5I21 A;  2RQW A;  1NEB A;  4A4F A;  1TWB A;  1IHW A;  1IHV A;  4FCY A;  1UFF A;  2KE9 A;  1CSK A;  1M2V A;  2PUK B;  3HRU A;  2AZS A;  1PC0 A;  4JPB W;  4BY6 C;  2EYX A;  3OA6 A;  2JS0 A;  2R5M A;  4ZTF A;  8ATC B;  1QVF P;  2K3X A;  3EG9 A;  3CD6 Q;  1U1S A;  3CCS T;  1G5V A;  2XDP A;  3S3N A;  1I81 A;  3OSV A;  3V8L A;  3JB9 G;  4ZTJ A;  2OTJ Q;  1N8R C;  3I5S A;  5DY9 A;  1KK7 A;  4KUD K;  4M75 E;  2DL3 A;  2JN0 A;  3E1S A;  4WF2 A;  2DF6 A;  1U1T A;  3SWN C;  5M9O A;  2J7I A;  2P0P A;  2LRQ A;  1VOM A;  4M75 G;  4BDY A;  2COW A;  3QO3 A;  2QG9 B;  1D1C A;  4JLI A;  2VGN A;  5CKB A;  2M1H A;  5GMK j;  1BK2 A;  1N8R R;  1TTH B;  2K79 A;  1N8R U;  5GAO r;  3QKJ A;  1OEB A;  2ESW A;  4J7I A;  4C0D C;  5CR2 A;  3O5Z A;  3CME A;  3NPF A;  4M78 D;  4M77 D;  4IKF A;  5IN1 A;  3LWH A;  1G3Y A;  1Q86 U;  1WQ7 A;  2XID A;  4BDZ A;  4M78 C;  3M54 A;  4M77 C;  2BKD N;  1K8A C;  2HL3 A;  2KVQ G;  3LYI A;  2HAX A;  1RAE B;  1WXB A;  1GFD A;  3VRZ A;  1YCS B;  1UB4 A;  2DBK A;  4MZM A;  5GAM f;  2RF0 A;  2B86 A;  1RAH B;  3JB9 I;  3EHQ A;  4J9E A;  3QWY A;  4NOY A;  4J6W A;  1FYN A;  2LQK A;  1QCF A;  1FXX A;  1JQQ A;  2Y90 A;  3RDV A;  3C95 A;  3JCM Q;  1HXD A;  2RJD A;  1VQM A;  4JJD A;  1K8A R;  1S72 A;  2KK4 A;  2IPO B;  1VQK T;  2H3J A;  2CSQ A;  4RTY A;  2HQX A;  4XTZ A;  2YT6 A;  2EKH A;  3VS2 A;  1A0N B;  5HCK A;  3RES A;  3PVL A;  3A8L B;  4M7A D;  2VKN A;  3C94 A;  4PJM A;  5D7U A;  3HHT B;  4C8Q B;  2L3Q A;  1JJ2 P;  1VIF A;  4Z02 A;  4EIK A;  4HT9 A;  3GLX A;  1RAG B;  3OYK A;  3OYC A;  1WI7 A;  2LQ8 A;  3ZFJ A;  3CCQ A;  3L2U A;  5DLQ E;  2DIL A;  2QDY B;  2YRC A;  5L8R E;  5KE3 A;  4E2F B;  1YWO A;  1RAD B;  3I56 T;  2W10 A;  1WJQ A;  3GP8 A;  2JZ2 A;  1AVZ C;  3H8Z A;  3MET A;  5CAI A;  3CCJ T;  3WXM B;  1Q82 C;  2M0Y A;  3CXC S;  1YIJ A;  5FU7 B;  1M8V A;  1TS9 A;  2EW3 A;  1RAB B;  3OW2 A;  1G8X A;  4ZGE B;  1EX4 A;  3CCM A;  3CCU A;  2KNB B;  4J9H A;  1TXQ A;  3QJ6 A;  4HVV A;  2ECZ A;  3AT1 B;  3JCM W;  1BIA A;  4A54 A;  2XI9 A;  1X27 A;  1PD0 A;  4M7A E;  1VQ9 A;  1QWF A;  2LQW A;  1CKB A;  5LJ3 e;  3CCE T;  3UAT A;  1VQO A;  2KRM A;  3MJX A;  1Q82 R;  1W1F A;  2QGG A;  2CUB A;  1QVG A;  5GJW B;  4M78 F;  4RTT A;  1NZ9 A;  2QK0 A;  4M77 F;  3GNF B;  4PFP A;  2X3W D;  1KHI A;  5LL6 S;  4CC4 B;  4C92 B;  3A8G B;  2D9T A;  2QXF A;  1MNE A;  3JRZ A;  1ZUK A;  4N4H A;  4ZGD B;  3CPW S;  1G83 A;  1JRI A;  3RER A;  2LZ6 B;  1M2O A;  1N6A A;  2DFU A;  2NUT B;  2CT4 A;  3JCM h;  1QVP A;  2EAY A;  2D1X A;  3X26 B;  2CZ1 B;  3A1P A;  3TRE A;  1UE9 A;  4FSS A;  4BI3 A;  4OMF B;  4AG2 C;  2E3I A;  1UGP B;  3FJP A;  1IZ6 A;  3V8K A;  5GAN j;  1AZE A;  4QVC A;  3S3O A;  2PNI A;  3CCS Q;  3JSC A;  2LCC A;  3SB2 A;  4E7S A;  3SEM A;  4OML A;  1LJO A;  2RHU A;  2A37 A;  4Z8A A;  4M7A F;  4OMP A;  4AMC A;  2K57 A;  5GAN 6;  1VQL A;  2EQU A;  3OYB A;  3QG1 A;  2L89 A;  5LJ5 g;  1JB0 E;  5GAO l;  2RA2 A;  3P8D A;  4M75 A;  1TOV A;  2FZC B;  2KR3 A;  1M9S A;  3OYI A;  2RJC A;  4HVU A;  2FVU A;  5D6W A;  3Q1J A;  1WHL A;  2MAM A;  5GMK h;  5FRO A;  1ZBJ A;  2RK2 A;  3G4S A;  1YHQ A;  1I07 A;  1N27 A;  4XU1 A;  4XAX B;  2RI2 A;  3CCR T;  2O01 E;  3REA B;  1YJN A;  1WHK A;  3M58 A;  3UDC A;  4E7K A;  3BE3 A;  1QVF A;  3OYE A;  3LH0 A;  2QAZ A;  2EJG A;  4J6X A;  2D8J A;  1YBY A;  3P8B B;  4XTU A;  3M53 A;  3ASK A;  5CVI A;  4E7H A;  1YCY A;  3OYF A;  2V1R A;  3EHR A;  3GOX A;  1WDX A;  2DIG A;  1OUL A;  1KC8 C;  2O9S A;  3EG3 A;  1XTD A;  2EYY A;  3OYY A;  4F16 A;  3T9N A;  1X6B A;  2DTH A;  4MMK A;  3PFS A;  5IAY A;  2DL7 A;  5J26 A;  3I5R A;  1AOJ A;  1VQK Q;  1UHF A;  3JV3 A;  1VYU A;  2SRC A;  2DM1 A;  2HMA A;  1M3B A;  2F2V A;  1VQ7 T;  3OYN A;  1JXO A;  4J8O A;  5HK3 A;  3RIR A;  4C92 E;  2DVE A;  4HT8 A;  2XDB A;  1KC8 R;  3VUZ A;  1KC8 U;  4K11 A;  2A36 A;  4DBQ A;  2RO0 A;  5GAN f;  2O4X A;  2E3H A;  1RI9 A;  2RQV A;  4OGC A;  2RQT A;  1VYV A;  1WA7 A;  2YDL A;  4C92 G;  1JU5 C;  1OYX A;  2JM8 A;  3OS1 A;  3MCA B;  2CRE A;  2VYT A;  2ZPH B;  3I56 Q;  4EMK B;  2DJZ A;  5FLX E;  1SRL A;  5LJ3 d;  4FYY B;  3V7C A;  2DO3 A;  5KYY A;  1B34 B;  2X9H A;  3CCJ Q;  2CDT A;  2RJE A;  4IUU A;  3VS5 A;  1W70 A;  3L42 A;  4DA4 A;  3GNG A;  1O9S A;  1IRE B;  1QLY A;  2ROT A;  3CQT A;  4A63 B;  1ARK A;  4ANJ A;  3VJP A;  1U8R A;  3HFO A;  5AYF A;  3M9Q A;  4M7D B;  3CCE Q;  2HEQ A;  2H3E B;  2BZ8 A;  4LN2 A;  4X1V A;  2FB7 A;  4DBH A;  5LJ5 f;  4M7A A;  2RQU A;  4A4E A;  1D0Y A;  2NWM A;  4YTL A;  2E41 A;  4OMQ A;  1CKA A;  4D8K A;  3EG2 A;  2E6Z A;  5A0G A;  1BI2 A;  1W2B S;  2NLU A;  5CKF A;  3FDR A;  4OMO A;  3VKI A;  4II1 A;  2J6K A;  4VUB A;  5GAM e;  2JW4 A;  1K76 A;  2IVW A;  3U23 A;  1TUC A;  3C12 A;  1TH7 A;  2A7Y A;  2IIM A;  2DE0 X;  3EGD B;  2K2M A;  3CEY A;  1WYX A;  4E47 A;  1VQP A;  2I2L A;  4UC4 A;  3CC7 A;  5D6Y A;  4AG1 C;  2ZPI B;  4XQ3 A;  2J6O A;  4BY6 B;  2RI5 A;  4J9G A;  3MP6 A;  2X4X A;  1AWX A;  5KYU B;  3ZBD A;  3C4S A;  3OB9 A;  2XHC A;  4R56 A;  2FEI A;  3ER0 A;  4BE2 A;  2E4H A;  4PKC C;  5GAN h;  2MCN A;  1VQ6 A;  4WTO B;  1AD5 A;  5GAN 8;  1RLQ C;  2F1L A;  3I55 A;  2EPD A;  2FO0 A;  3H6Z A;  1S72 T;  1K73 C;  5EC7 A;  2GCX A;  1RUW A;  3HFN A;  2VC8 A;  3UA6 A;  2MIO A;  3LX7 A;  1NLO C;  1BKB A;  2QEX A;  4HVW A;  2O88 A;  5HK0 A;  1VQ5 A;  2EKO A;  1F1B B;  3M0R A;  3BDL A;  4JLG A;  5CKH A;  4DQ2 A;  2KGT A;  3PGG A;  1X69 A;  2XMF A;  3JB9 D;  4M4Z A;  5KYW B;  2LT4 A;  2QI2 A;  1AWJ A;  5GAM j;  3J80 E;  5GAO n;  3I9Q A;  1N9R A;  5J39 A;  1K73 R;  3CCQ T;  1I1J A;  1U5S A;  4C0D B;  1LOJ A;  2F2W A;  4M75 D;  1K4U S;  3VS0 A;  1Y7X A;  3QJY A;  5GMK e;  1KD1 C;  1GL5 A;  3CCR Q;  4RG2 A;  2LJ0 A;  3M4Y A;  2ZPB B;  4M75 C;  1LPL A;  2EBP A;  1TU0 B;  3CD6 A;  2DTO A;  4M78 B;  1YIJ T;  5KCO A;  4OMN A;  4XU0 A;  2OTJ A;  2LNH B;  2V1Q A;  2QQ9 A;  2QTX A;  1K0S A;  2E12 A;  5CQY A;  1KQS P;  3CCM T;  3CCU T;  2GTJ A;  5IXB A;  3CC2 T;  1WJR A;  4JRI A;  5I11 A;  1Y0M A;  4PFO A;  1UGS B;  1D0X A;  2LCL A;  1D1B A;  3OSS C;  1MUZ A;  1KD1 R;  5FRN A;  3VUB A;  1KD1 U;  1VQO T;  1HK9 A;  2VXE A;  4M7D E;  2CZ0 B;  1FMK A;  4J5Y A;  4HCB A;  3KBG A;  3CMA T;  1PHT A;  1SKU B;  2KXC A;  1G3T A;  1VQ7 Q;  2V8K A;  4KH0 B;  3X25 B;  2YWW A;  1RLP C;  5KYX A;  4M7D G;  2C0O A;  3S6W A;  3NHN A;  1MV3 A;  2B8A A;  3BFM A;  4B6M A;  2DYB A;  2DXB A;  2JOY A;  3VRY A;  1Q86 C;  4F7U E;  2M0O A;  3RKY A;  4EPC A;  4PJN A;  3FC3 A;  5I22 A;  3RBB B;  3LGF A;  3OYG A;  2LC4 A;  1NEG A;  2OTL A;  1VQ8 A;  3NTI A;  1RAI B;  3OMG A;  2EYW A;  4C92 A;  4F7U G;  2ZPF B;  2BTT A;  2CP3 A;  4R55 A;  1KIK A;  5KCH A;  2DBM A;  1EZZ B;  2EQM A;  2MF2 A;  1C6V X;  5FU6 B;  3CCV A;  2CP2 A;  1DJ7 B;  1KJW A;  2JM9 A;  2KI7 A;  4J9B A;  2NUT A;  2AKL A;  3X20 B;  1Q86 R;  1AEY A;  2KRO A;  2YUO A;  3INZ A;  1WIE A;  1YFN A;  4NL2 A;  4BI4 A;  2COY A;  1PM3 A;  4Z89 A;  1I0C A;  3JB9 F;  2CH4 A;  1BCO A;  1WQW A;  2RH2 A;  1VQL T;  2AZV A;  7AT1 B;  2MI6 A;  4XK8 E;  1NBE B;  2PUO B;  3OYM A;  2RM4 A;  3ULR B;  1G3S A;  4M75 F;  4RMO A;  2KT1 A;  2JS2 A;  1YJ9 T;  1SPK A;  2HL5 C;  3FB9 A;  2RPN A;  3JCM d;  1SG5 A;  4PJO B;  3QYG B;  4F7U F;  4ATO A;  3G4S T;  1Y96 B;  1YHQ T;  2E5K A;  2FHD A;  5AT1 B;  1YI2 A;  4TVR A;  3REB B;  2K9G A;  1IRX A;  2NUZ A;  2JJ9 A;  1YJN T;  3UA7 A;  2KEA A;  1WHJ A;  1JBM A;  1QCO A;  3MP8 A;  1SHG A;  4M7A C;  1Z9Z A;  3URG A;  1NPR A;  5GMK m;  1M90 U;  3A8M B;  5L23 A;  5GAN 4;  1HSQ A;  5CQX A;  2ATC B;  4X9D A;  4O6J A;  3X28 B; 
#chains in the Genus database with same CATH homology
 4IUV A;  4IUR A;  1QP2 A;  3JCM J;  4RG8 A;  2MAM A;  2EIF A;  4JS5 A;  2KMT A;  3L2W A;  4HCZ A;  2P0K A;  1BIB A;  3CBO A;  2E65 A;  5GMK h;  4A53 A;  4M75 B;  5FRO A;  1P92 A;  2RK2 A;  3SFM A;  3G4S A;  2F69 A;  1YHQ A;  2QA4 T;  2CGH A;  1X6O A;  1N27 A;  2R58 A;  4FU6 A;  4XU1 A;  4NL3 A;  2X35 A;  5GAN e;  4FM4 B;  4RCC A;  2HD0 A;  4QQ6 A;  3L2Z A;  4C5E A;  3QPH A;  4XAX B;  2RI2 A;  2L3R A;  4F7U B;  3CCR T;  2O01 E;  1YJN A;  2K4Y A;  1YJW T;  4KT0 E;  3M58 A;  3A8O B;  4QQD A;  3QSU A;  4C0G A;  2L8D A;  4M7A B;  1M4Z A;  3UDC A;  4E7K A;  1RI0 A;  2QQS A;  4C5I A;  3S3N A;  1QVF A;  2PVO B;  4A4G A;  5GAN 2;  2ZPE B;  3OYE A;  3LH0 A;  4QVZ A;  2EJG A;  4N0A A;  3RMS A;  2RJF A;  2IG0 A;  4J6X A;  3PIO A;  2C06 A;  1FX7 A;  3HSB A;  4ME7 A;  2MWO A;  1YBY A;  3E9G A;  3P8B B;  4XTU A;  3VYH B;  3GPL A;  3M53 A;  3ASK A;  3QBY A;  1I8F A;  2DTI A;  2JTF A;  1VIE A;  5CVI A;  1YCY A;  2ZGW A;  4BD3 A;  4E7H A;  3OYF A;  1VQ4 A;  3SD4 A;  3GOX A;  2LX9 A;  3JB9 J;  1QP3 A;  2DIG A;  4MML A;  2OAU A;  1KC8 C;  3OS2 A;  3MEU A;  5I2M A;  3JCM e;  4DOV A;  2EJF A;  1XTD A;  1W2B A;  2KQW A;  3OYY A;  2K5I A;  3T9N A;  3LGL A;  5GAM h;  2DTH A;  4MMK A;  4OP0 A;  3PFS A;  5KH6 A;  2DAQ A;  2RHY A;  1MHN A;  4JRQ A;  5FRM A;  4Q5W A;  1KHC A;  5IAY A;  5J26 A;  4EMK C;  2QA4 A;  3CCL A;  2PVD B;  2DKG A;  2L5Q A;  3DLM A;  2RHX A;  4JRK A;  4ELY C;  1LNX A;  2DD5 A;  3CCR A;  3L2V A;  1VQ7 T;  3QDR B;  3OYN A;  2G3R A;  5GAN 3;  5GAO m;  3M56 A;  4J8O A;  3M59 A;  5KE2 A;  5GAM g;  2V8I A;  2FYK A;  4A4K A;  5HK3 A;  5GAM d;  2JUF A;  3RIR A;  3NTH A;  4C92 E;  2DVE A;  5LJ5 e;  4FT2 A;  4HT8 A;  2XDB A;  3PTA A;  3VUZ A;  2RI3 A;  2XU8 A;  3P8H A;  1KC8 U;  4M7D F;  4XTX A;  4BUG A;  2KDS A;  5A0L A;  5LJ3 h;  2YLC A;  4C8Q D;  2RO0 A;  5GAN f;  3X24 B;  2O4X A;  3JAM E;  4EMG A;  3O8V A;  4JUV A;  4OGC A;  4QQG A;  5HY6 A;  3QHS A;  1B34 A;  1VUB A;  3BY7 A;  3EAE A;  2RK1 A;  3QYH B;  4ZN1 A;  3EFR A;  3M5A A;  3RKX A;  4C92 G;  3JCM b;  1OYX A;  2HBP A;  4NS5 A;  3OS1 A;  4JS4 A;  3MCA B;  5HKC A;  1M90 C;  4XTY A;  2WSE E;  5D6X A;  2VYT A;  2QQA A;  2ZPH B;  5A0D A;  4J83 A;  4EMK B;  2DJZ A;  5FLX E;  3KUF A;  2O4X B;  4LD6 A;  2FL7 A;  1ZHI A;  3JB9 H;  3ZEH A;  5LJ3 g;  5LJ3 d;  2DD4 A;  3V7C A;  2DO3 A;  2ZPG B;  1B34 B;  2XKO C;  3MEA A;  3OYA A;  1K73 U;  3FEO A;  4E7I A;  2DEQ A;  2QQR A;  4IUT A;  2RJE A;  2V8J A;  1UEB A;  4IUU A;  3E9F A;  1R8O B;  2LTO A;  3A8H B;  2E10 A;  3L42 A;  3UPU A;  3OBY A;  3JCM f;  3NTK A;  1VQN T;  4M7D A;  4E7L A;  4DA4 A;  2DIQ A;  3TU4 K;  1K8A U;  3GNG A;  1O9S A;  4FT4 A;  2ZZD A;  1IRE B;  1OZ2 A;  3HRT A;  2F5K A;  4MZP A;  3UWN A;  3HRS A;  2VGM A;  3J81 E;  3MP1 A;  4PJO E;  2XDD A;  3M4G A;  3OW2 S;  4M78 E;  5I21 A;  4M77 E;  3FRN A;  4A4F A;  4L5G A;  4GY5 A;  3MO8 A;  1VQP T;  3VJP A;  1U8R A;  3S3M A;  2RHZ A;  2X4Y A;  3HFO A;  3CC7 T;  5AYF A;  3M9Q A;  1QVF S;  4M7D B;  1VQ4 T;  5GMK i;  4C8Q E;  4PJO G;  2PUK B;  4OB0 B;  4M78 G;  4F7U A;  3HRU A;  4M77 G;  2FB7 A;  2E5Q A;  4BY6 C;  2EJ9 A;  3TCJ A;  3L2R A;  5LJ5 f;  3DKM A;  4M7A A;  3OS5 A;  4A4E A;  1KQS A;  2RD1 A;  3OBW A;  2E70 A;  2PQW A;  3PNW C;  3OA6 A;  4N4G A;  3QXE B;  4YTL A;  1PSE A;  2E41 A;  2ZCF B;  3CCL T;  5LJ5 j;  1I4K 1;  1XOV A;  4C8Q G;  1QVG S;  2R5M A;  4ZTF A;  4C5G A;  2E6Z A;  4MZT A;  1BI2 A;  5A0G A;  2K3X A;  1W2B S;  2NLU A;  5CKF A;  1U1S A;  1WPY A;  3CCS T;  1G5V A;  3FDR A;  2XDP A;  2K3Y A;  4X34 A;  4C92 D;  3TEE A;  5GAN 7;  1WNL A;  3VKI A;  1I81 A;  3OSV A;  4II1 A;  3V8L A;  3PIP A;  3JB9 G;  4ZTJ A;  1VQN A;  5FU6 C;  3I55 T;  3L2Q A;  1N8R C;  3HPW A;  3MHX A;  4VUB A;  4C0F A;  5GAM e;  5CCA A;  4BE1 A;  5DY9 A;  2IVW A;  2K5F A;  2EQJ A;  4M75 E;  2JN0 A;  3E1S A;  3BDU A;  3C12 A;  1TH7 A;  4OB2 B;  4WF2 A;  4Y28 E;  2A7Y A;  4PLL A;  4C92 C;  1NJI C;  2K5L A;  4OGE A;  1U1T A;  1BYM A;  1XNI A;  3CEY A;  4GLK A;  2XG8 D;  4E47 A;  1VQP A;  3SWN C;  3OYL A;  4XU2 A;  5M9O A;  1VQ5 T;  2I2L A;  2P0P A;  4PLI A;  4UC4 A;  5CKD A;  3CC7 A;  2LRQ A;  2WAC A;  5D6Y A;  4M75 G;  3CC2 A;  2ZPI B;  4XQ3 A;  4BDY A;  5A2Q E;  3QO3 A;  4BY6 B;  2RI5 A;  2YRV A;  1FWZ A;  3MP6 A;  3JCM P;  1I5L A;  2X4X A;  1M1G A;  1SSF A;  2D6F A;  2EFI A;  3V7R A;  4EMH A;  3ZBD A;  3C4S A;  4FIB A;  3OB9 A;  4JLI A;  2VGN A;  2XHC A;  2M1H A;  1NE8 A;  2VV5 A;  4X9C A;  5CKB A;  4A4H A;  5GMK j;  4R56 A;  1M1K C;  5GAO p;  1N8R U;  3ER0 A;  4BE2 A;  4PKC C;  5GAN h;  5GAO r;  3QKJ A;  4M7A G;  3CCS A;  3CXC A;  4C0D C;  4J7I A;  4EDU A;  5CR2 A;  1Q82 U;  1VQ6 A;  1NJI U;  3CME A;  5GAN 8;  4PJO D;  3I55 A;  3CMA A;  4M78 D;  4M77 D;  1BI1 A;  4IKF A;  3H6Z A;  4IUQ A;  3SDZ A;  1S72 T;  2EWN A;  1K73 C;  4HCC A;  3A5Z B;  5IN1 A;  2GFU A;  3LWH A;  1G3Y A;  2GCX A;  3HFN A;  3G6E T;  1Q86 U;  1WQ7 A;  2XID A;  1OZ3 A;  2VC8 A;  4BE0 A;  4PJO C;  4BDZ A;  4XTW A;  3LX7 A;  4M78 C;  1BKB A;  1BI3 A;  3M54 A;  2BKD N;  4M77 C;  4C8Q F;  4EMK A;  2QEX A;  5HK0 A;  1K8A C;  1VQ5 A;  2HNI A;  2CYZ B;  2KVQ G;  2EKO A;  5GAN g;  5GAN d;  2MWP A;  1Y07 A;  1ZBX A;  2XK0 A;  3BDL A;  3LYI A;  4JLG A;  5CKH A;  1NPP A;  3PGG A;  5CIU A;  4DQ2 A;  5DM7 R;  1M1K U;  3JB9 D;  2LT1 A;  1UB4 A;  4MZM A;  5GAM f;  4C8Q C;  3MEV A;  4V2S A;  4QW2 A;  1Q81 U;  4C5H A;  3JB9 I;  2LT4 A;  2X4J A;  4KUL A;  2QI2 A;  4JJN K;  4NOY A;  1PSF A;  2GQV A;  4J6W A;  5GAM j;  2LQK A;  3BW1 A;  3G71 T;  3G7Z A;  1FXX A;  3J80 E;  4IUP A;  5IT9 E;  5GAO n;  1N9R A;  5J39 A;  5EG2 A;  3CCQ T;  2Y90 A;  4ELZ C;  2DZ9 A;  4C0D B;  4B9X A;  2WSC E;  1LOJ A;  3C95 A;  3LW5 E;  3PMT A;  4JRP A;  3QUI A;  4M75 D;  3VU3 C;  3JCM Q;  1HXD A;  2RJD A;  5DLO A;  2AHJ B;  1KQS S;  1Y7X A;  1EIF A;  2D0Q B;  3JCM X;  1VQM A;  3DB4 A;  3QJY A;  5J3B A;  3CPW A;  1S72 A;  2HAX A;  1M5Q 1;  2KK4 A;  5GMK e;  1KD1 C;  3F70 A;  3OMC A;  4RG2 A;  3M4Y A;  3G6E A;  3M55 A;  2H3J A;  2ZPB B;  1VQK T;  1X01 A;  4M75 C;  3ME9 A;  3R6O A;  4ZGJ B;  2HQX A;  1Q7Y U;  3CD6 A;  2DTO A;  4M78 B;  4XTZ A;  2LDM A;  4LDX A;  1YIJ T;  4B9W A;  5KCO A;  4XU0 A;  2EQK A;  2OTJ A;  5FU7 C;  2M9U A;  3RES A;  4M7A D;  3A8L B;  2QQ9 A;  2QTX A;  5LJ3 j;  1QW1 A;  2E12 A;  5CQY A;  5I2S A;  2RHI A;  3C94 A;  3CCM T;  3CCU T;  2R57 A;  2RB6 A;  3HHT B;  4C8Q B;  3CC2 T;  1W4S A;  1WJR A;  1G3W A;  1M1F A;  3WVD B;  5CK9 A;  4JRI A;  2PVG B;  1VIF A;  2CS7 A;  4Z02 A;  1UGS B;  1WJS A;  4HT9 A;  3GLX A;  2LCL A;  4JDS A;  3GIB A;  3G71 A;  3V8J A;  1VQ8 T;  1MGQ A;  2OTL T;  3OYK A;  3OYC A;  2LQ8 A;  1JJ2 A;  2XD0 A;  3ZFJ A;  3OSS C;  2R5A A;  3CCQ A;  5FRN A;  2DPP B;  3L2U A;  2CZ6 B;  5DLQ E;  3VUB A;  1YIT T;  1KD1 U;  2QDY B;  1VQO T;  1HK9 A;  2VXF A;  5L8R E;  5KE3 A;  3GF5 A;  2VXE A;  1VQ6 T;  2CZ0 B;  2XIC A;  3EFS A;  4C92 F;  2DXC A;  4M7D E;  3CME T;  4J5Y A;  1YJ9 A;  3I56 T;  4HCB A;  3KBG A;  2P0Q A;  3CCV T;  3CMA T;  1WJQ A;  3GP8 A;  2JZ2 A;  4MDX A;  3H8Z A;  1G3T A;  3MET A;  2V8K A;  3E19 A;  4KBM B;  3X25 B;  2E6N A;  5CAI A;  1VQK A;  3LWI A;  4OB3 B;  4N0A C;  3CCJ T;  3WXM B;  4ZN3 A;  1Q82 C;  2CKK A;  3CXC S;  1YIJ A;  4M7D G;  5FU7 B;  2BIV A;  1M8V A;  2K2V A;  2QEX T;  2JNG A;  3S6W A;  2B8A A;  2HQE A;  3BFM A;  3VYG A;  2DXB A;  4CRI A;  2YLB A;  3OW2 A;  4MDW A;  2JOY A;  2F5T X;  4ZGE B;  2KY9 A;  1O75 A;  3CCM A;  4F7U E;  3CCU A;  1Q86 C;  3QJ6 A;  2M0O A;  3DLL A;  3UT1 A;  3RKY A;  1BIA A;  2CZ7 B;  4A54 A;  3CC4 T;  3N5B B;  4EPC A;  3JCM W;  4J6Y A;  1K9M C;  2XI9 A;  2Y4X A;  4M7A E;  3OS0 A;  3JCM V;  1VQ9 A;  3FC3 A;  1H64 1;  3LGF A;  3OYG A;  2LC4 A;  3FLG A;  3HP9 A;  2OTL A;  3RMQ A;  1VQ8 A;  3NTI A;  3VV0 A;  3OMG A;  4C92 A;  5LJ3 e;  2DXU A;  2ZPF B;  4F7U G;  3DB3 A;  4LDW A;  3CCE T;  4C0Z A;  1YIT A;  4R55 A;  3QZ9 B;  1VQO A;  4KUD K;  4O5V A;  5KCH A;  2LVM A;  3SWN A;  5GMK l;  2EQM A;  4Y91 A;  4BI8 B;  1Q81 C;  2VUB A;  2MF2 A;  2KAF A;  2GF7 A;  1ZQ1 A;  4OB1 B;  3I56 A;  5FU6 B;  4PJO F;  3CCV A;  1QVG A;  4E7J A;  4M78 F;  2M16 A;  1NZ9 A;  4M77 F;  1VQM T;  2JVV A;  3GNF B;  5C0M A;  3CBM A;  2GFA A;  3L1A A;  4PL6 A;  1DJ7 B;  1KHI A;  2X4W A;  5LL6 S;  3X20 B;  4C92 B;  5GAN 5;  3CCJ A;  3A8G B;  2D9T A;  4LDY A;  3INZ A;  2QXF A;  3CD6 T;  1WGS A;  3JRZ A;  3OQ5 A;  4DOW A;  3SWN B;  4NL2 A;  4BI4 A;  4HKE A;  3RKW A;  3CBP A;  1K9M U;  3NFC A;  1BI0 A;  3OYH A;  3QZ5 B;  2DZC A;  3OYJ A;  2OTJ T;  2EYQ A;  4N4H A;  4LD9 K;  4ZGD B;  2E64 A;  1YI2 T;  3CPW S;  2A3L A;  3LLR A;  4J7F A;  4D6W A;  3MEW A;  5GAO q;  1N9S A;  1OI1 A;  3QII A;  1Q7Y C;  1JRI A;  3WVE B;  1YJW A;  3CC4 A;  3JB9 F;  3J7A F;  3V7S A;  3RER A;  4HA8 A;  1AHJ B;  1WQW A;  1N6A A;  2MMP A;  2RH2 A;  3HL8 A;  1VQL T;  2YHT A;  2BUD A;  3JCM h;  1QVP A;  2PU9 B;  1RL2 A;  2MI6 A;  2EAY A;  4CI0 C;  3OYD A;  3X26 B;  2CZ1 B;  4QVD A;  3FIF A;  4M7D D;  4XK8 E;  3TRE A;  3AHU A;  5CKE A;  4PJO A;  4BB7 A;  3CCE A;  1XQH A;  2PUO B;  4RKU E;  4M78 A;  4N4I A;  4OVA A;  4M77 A;  2QQB A;  4FL6 A;  3OYM A;  2RM4 A;  4OMF B;  4BI3 A;  3PT9 A;  1Y96 A;  3OY9 A;  1G3S A;  4M75 F;  4RMO A;  1UGP B;  3FJP A;  1IZ6 A;  3V8K A;  5GAN j;  4M7D C;  4QVC A;  2WSF E;  1UGR B;  1YJ9 T;  1H3Z A;  3FB9 A;  3S3O A;  3JCM g;  2DXT A;  2JTM A;  4C8Q A;  3JCM d;  1JJ2 S;  1V29 B;  3JSC A;  2LCC A;  3SB2 A;  2Y4Y A;  1Y71 A;  4PJO B;  3QYG B;  5LJ5 h;  1X75 C;  5LJ3 f;  1LJO A;  4M77 B;  4F7U F;  1D3B A;  2RHU A;  4ATO A;  3G4S T;  3KXT A;  1Y96 B;  1YHQ T;  2KSS A;  2FHD A;  1KQ2 A;  1YI2 A;  4TVR A;  2P4T A;  3PMI A;  5CO7 A;  4M7A F;  4LDV A;  4KUI A;  1VQ7 A;  1GXI E;  2E1H A;  2K57 A;  5C6S A;  4RCB A;  1KQ1 A;  4OF1 A;  5GAN 6;  3RUX A;  4BAC A;  1YJN T;  1VQL A;  2EQU A;  3OYB A;  1JBM A;  3M57 A;  3CPF A;  3HKS A;  3MP8 A;  4PNO A;  3QG1 A;  1VQ9 T;  4M7A C;  4P5N A;  4L6V 5;  1D3B B;  3JCM c;  4FSX A;  2L89 A;  3URG A;  5LJ5 g;  4XTV A;  1NPR A;  1JB0 E;  5LJ5 d;  2RA2 A;  4L59 A;  4LDU A;  3P8D A;  4M75 A;  5GMK m;  5GAO l;  1KG1 A;  3OYI A;  1M9S A;  1M90 U;  2RJC A;  3A8M B;  2FVU A;  2DK3 A;  5D6W A;  2LNV A;  4XU3 A;  5GAN 4;  1UGQ B;  5CQX A;  3Q1J A;  4X9D A;  4O6J A;  3X28 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...