3E9GA

Crystal structure long-form (residue1-124) of eaf3 chromo domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
107
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Chromatin modification-related protein EAF3
total genus 24
structure length 107
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9gA01
2K3YA 2L89A 1H3ZA 3LYIA 4C5HA 4N4HA 2E5QA 3PNWC 2BIVA 3L42A 4E7JA 3BDLA 2RO0A 3EAEA 3H8ZA 3F70A 2R58A 1OZ3A 3ME9A 3OYIA 2CKKA 3OYDA 3DB3A 2F5KA 3LLRA 4X34A 5KE2A 4BE0A 2RI2A 2X35A 2M0OA 1MHNA 4L59A 2GFUA 4Z02A 3S3MA 4NS5A 4ZTFA 2XDPA 5D6WA 3KUFA 3OYBA 4QQ6A 3LX7A 4E7KA 4Q5WA 2EQKA 2JTFA 4QQGA 3MP8A 3OQ5A 4PL6A 4QVZA 5FRNA 3PFSA 4BDZA 3Q1JA 2E6NA 2M1HA 2RI3A 3PMIA 4IUTA 2MWOA 2EQMA 5FRMA 3PMTA 1WJSA 2X4YA 3OYJA 2RI5A 5J39A 3MP1A 4II1A 4FU6A 4B9WA 4RG2A 5IAYA 2RJEA 5D6YA 2HQEA 2RHYA 3QKJA 3P8HA 3DB4A 2MWPA 3UWNA 1WGSA 2DAQA 3OY9A 4CRIA 2K3XA 5CIUA 2EKOA 3LGLA 3O8VA 3OYAA 1RI0A 3OYEA 4B9XA 2HQXA 4QQDA 4C5IA 4BACA 2D9TA 2R5MA 4E7IA 1SSFA 4HCZA 3LH0A 4BDYA 2B8AA 3QJ6A 2LVMA 4BE2A 4GY5A 1XNIA 3OYGA 3NTHA 5FROA 3FEOA 4QW2A 4E7LA 2L3RA 4N4GA 4BE1A 2IG0A 2EQUA 5C0MA 2G3RA 2BUDA 3QIIA 3LGFA 4FL6A 2JZ2A 2DIQA 3S6WA 3E9FA 4BD3A 1OZ2A 1OYXA 5KCHA 3S3NA 3FC3A 3CEYA 4C5GA 3OS2A 3OYHA 3MEUA 5KCOA 3L2WA 2X4WA 2EQJA 4UC4A 3OYMA 5KH6A 3OYCA 3META 4A4EA 2M16A 5M9OA 1OI1A 2GF7A 3OMCA 3L2RA 2O4XB 2RHXA 4PLLA 3SD4A 2BKDN 3ASKA 2DIGA 2RHIA 3OS1A 3ZEHA 3DLMA 4OVAA 4ZTJA 2O4XA 3MO8A 1KHCA 2L8DA 2VYTA 5C6SA 2FHDA 3MP6A 3OYKA 2LTOA 2R5AA 5J26A 4IUPA 1N27A 3FLGA 3M9QA 3E9GA 2RJFA 2NLUA 1WJRA 3L2UA 2RHZA 4PLIA 4A4GA 4C5EA 3QBYA 3OA6A 3UT1A 3S3OA 3NTKA 3OS0A 1WJQA 2LDMA 2YRVA 3H6ZA 3MEVA 3OYFA 4E7HA 4EDUA 5IN1A 4A4HA 3OYLA 3FDRA 2QQSA 2EFIA 3NTIA 4LD6A 2X4XA 4IUQA 4IURA 4IKFA 2RJCA 3MEWA 2LCCA 2RHUA 3MEAA 4IUUA 4IUVA 2PQWA 3OB9A 3L2VA 3P8DA 4N4IA 2WACA 2QQRA 2P0KA 2RJDA 3OYNA 5D6XA 1G5VA 2GFAA 2XK0A 3C4SA 2R57A 3OMGA 3L2QA 2LRQA 3GOXA 4A4FA 5KE3A
chains in the Genus database with same CATH superfamily
1VQNA 1G8XA 1NYGA 3E1SA 1WQWA 3L42A 2QQAA 2MPXC 5CKHA 3GP8A 1WXTA 2ZCFB 2ZPEB 2XDDA 1FWZA 5GAMf 1ZA1B 2HSEB 4LD9K 3S3MA 4AFSC 2JTFA 5FRNA 3OYYA 1D09B 2E65A 4E7ZA 4RTZA 2AZVA 3CCVT 1KQ2A 3OYEA 1U8RA 5KYNA 3LH0A 3GBQA 2CT4A 4M7DG 1BK2A 4M7AC 1M27C 3J80E 4E7LA 3EG9A 4ZGDB 4LDWA 1HJDA 4X9CA 5KCHA 4AG1C 4K11A 1VQ4Q 1JJ2P 2VV5A 2NUPB 2KAFA 5KH6A 4A53A 4M7AG 3H41A 1QVFA 2CZ1B 2CZ7B 4JLGA 3EGDB 2D0NA 2O4XA 4FSXA 3HL8A 5GAOl 1U5SA 4M7DF 2FHDA 3GNFB 4FM4B 1IXDA 1I4K1 2HL5C 2PVDB 4NL2A 4M78B 5GAMe 5CR2A 2RD1A 5FLXE 2Y4YA 1J3TA 4M77F 1NPPA 3OA6A 3S3OA 1QP3A 2CP6A 4EDUA 1K8AR 4LD6A 2PTKA 1VQ4A 4LN2A 4PJOE 4F7UB 1UHCA 3M54A 4PFOA 2DBMA 4M77G 3JCMg 1S72Q 2XK0A 1WA7A 2HNIA 1E6GA 2X9HA 1PKTA 4C5HA 2E5QA 3VS3A 4E7JA 3BDLA 3EAEA 2DXUA 2J6KA 4PK4A 1C1AA 5LJ3d 5KYXB 1WDXA 3SDZA 3V7SA 3SEMA 4FT2A 2GFUA 3GLXA 5D6WA 4QQ6A 3JSCA 3CCUA 1WHJA 4PJLA 4BDZA 2HBPA 1KD1C 2M1HA 1KFZA 1IGQA 4DOWA 4FIBA 2EAYA 3EGUA 1Q81U 3A98A 1PWTA 1HK9A 2QQ9A 4RG2A 4C0GA 3FJPA 3OW2P 2CP5A 5CIUA 1RI0A 3I55T 2R5MA 3HFNA 4OB1B 5CQYA 1MMDA 1AWWA 2VVKA 1VQLQ 2ATCB 4DOVA 8ATCB 2LJ3A 4JJCA 1YITA 2K57A 2JW4A 2ECZA 1OZ2A 3G6EQ 3OBWA 2EQJA 2PUKB 1AWJA 3OSSC 2DE0X 1TTHB 2LQWA 2RHIA 1KQSP 3ZEHA 4OVAA 2L8DA 1M1KU 3A8GB 3QPHA 1MNDA 3URGA 2DERA 2KY9A 3EFOA 1VQ9A 1IZ6A 1IO6A 1WJQA 2YRVA 1UTIA 4E7HA 1M30A 2EPDA 4XTWA 4J9HA 2DK3A 2RMOA 4PJOC 1BU1A 4PJOD 1CKAA 3CC4A 1X6BA 3VJPA 4C0ZA 2ZPHB 1VQ6T 5GANh 4FSSA 1PHTA 1M1FA 3CC4Q 1KC8C 3BDUA 4KGVB 1JO8A 2CP3A 1OULA 3CMAA 1BB9A 2FVUA 3DB3A 2D8JA 3X20B 4XAXB 1LNXA 4DA4A 1OV3A 1QP2A 1FXXA 3C94A 4JS4A 2XG8D 3KUFA 2V8KA 4QQGA 4KUDK 3PFSA 2LC4A 1M1KR 2EQMA 5FRMA 4OMNA 2J7IA 3QYGB 2D8HA 2HL3A 3PE0A 3CMAT 2HQEA 2MWPA 1WGSA 1M8VA 1WIEA 4ZGEB 3G6EA 5GAOn 4HXJA 3OW2S 4Y28E 2WSEE 2EYZA 1SSFA 4HCZA 4C92B 5GANe 2VKNA 4C92D 1M9SA 3M55A 4JDSA 4ZN3A 5CO7A 2E3HA 2VGMA 2DVJA 2QAZA 1WNLA 1PM3A 2F69A 5C0MA 2DIQA 1UGQB 3M58A 2XU8A 2QTXA 2YRCA 4M7DE 3A5ZB 2P0QA 1OI1A 1NJIU 2E1HA 3SD4A 5GMKm 4ZTJA 1G2BA 1D1AA 3DLMA 2HKNA 1Q82R 2VYTA 2P84A 2DTIA 2CH4A 4F04B 1K76A 3PVLA 4LNPA 2DM1A 4MZMA 5FU7B 2Y4XA 2PUOB 1WJRA 1R0CB 1KC8R 4A4GA 1QKXA 1TUDA 3MEVA 2DXBA 2QA4T 1H3HA 4KRTA 3I5RA 4M77A 2FB7A 4FYYB 4F14A 2DRMA 5AYFA 4PJOB 1VA7A 3JB9F 1V76A 2QQRA 3DLLA 1S72A 4R56A 1S72T 3PT9A 4DEXA 3GOXA 5FU6B 2LX7A 1K9MC 2K3YA 1M1KC 3CC7T 2DETA 4F7UG 1XQHA 5IXBA 2CKKA 2MK5A 2KXCA 2KYBA 4M75A 4F17A 1RLPC 4A4KA 1I8FA 4KH1B 4Q5WA 1Q7YC 4RKUE 3X26B 5CKBA 3H9NA 2J06A 2RI3A 3WXMB 2EQIA 1MMGA 1FMKA 4II1A 4X1VA 5GAN8 1KC8U 1A0NB 1RAGB 2DTOA 2K3XA 3LGLA 5HKCA 1O75A 1Q7YU 3EG1A 1G3WA 2GNCA 2J6OA 4BDYA 4XTVA 5GAMj 1GBQA 1VQLT 1LOJA 2HSPA 4KUIA 1YIJA 3LGFA 3CCMA 3HKSA 3CBMA 3G6ET 2QG9B 4OMPA 2K7AA 2X4WA 1C0MA 3D7SB 1MV3A 4C8QA 4PLLA 1W1FA 5GAMg 3SWNA 2DIGA 1KHCA 2KK4A 3HHTB 2DX1A 3LWIA 2A08A 1NBEB 4OMFB 1IHWA 1VOMA 4MZTA 4KULA 2DL3A 4M7AE 1ZA2B 3NTIA 2C0IA 4RG8A 5GMKh 1FMWA 3BW1A 1WHLA 2J6FA 1HSQA 2P0KA 2DTHA 4Y91A 2RJDA 1UG1A 3EH1A 1K8AU 1VQ6A 3C4SA 1GXIE 3CC4T 4J9FA 4EPCA 1H3ZA 2FYKA 1U1SA 3X25B 3SFMA 2M0YA 3NFCA 2JM9A 1N5ZA 2JMCA 1G3YA 2AK5A 1QLYA 2QQBA 2X35A 4J7FA 4C8QC 3X28B 1OEBA 2YUNA 1SPKA 4C0FA 2K2VA 1ZQ1A 3TREA 5J3BA 1YJ9A 3EHQA 3JRZA 3QJYA 4M7DA 3MP1A 3CMAQ 2DZCA 1FX7A 2K9GA 2RHYA 3JCMX 4PJOF 5GAN4 4BACA 2J05A 3QG1A 2DF6A 4PJOA 2DD5A 4F7UA 2ZPBB 1H92A 1WHHA 4BE2A 4CI0C 1BIBA 1PRMC 2VB6A 2YHTA 5I11A 4IIMA 1TUGB 3CCQQ 3JCMh 4M78A 1WXBA 3FC3A 2I0NA 2DEUA 3RERA 1RADB 3OYMA 2YUQA 2GF7A 2EW3A 3E19A 3L2RA 3EGDA 2L3PA 3QYHB 4ORZA 4TVRA 4BUGA 2NUTB 4N0AA 1ZHIA 3VU3C 4MDXA 1UB4A 9ATCB 3OS0A 3HP9A 4M7AD 2O31A 2QA4Q 4M75G 2RF0A 5CKEA 1VQ7Q 3MPUB 4JRIA 3RESA 1VQLA 2CZ0B 1QCFA 1AWXA 1K9AA 2HMAA 1RAFB 4AMCA 2QDYB 3CC7Q 1KQSS 5FU7C 4HVUA 4RTWA 1YHQT 1WFWA 2VASA 1N6AA 2V1QA 2XHCA 2D1XA 3UATA 3MP8A 4M77E 5KYYA 5I2MA 4HCBA 1UGRB 2MWOA 1VQMQ 2JVVA 2DJQA 1K8AC 1QWEA 1RLQC 5IAYA 4ZNXA 2DJZA 2DAQA 4OGCA 4CRIA 3NHNA 1CSKA 4PJMA 4B9XA 1KSWA 3J7AF 1K73R 1I07A 2DYIA 4RTXA 1X2KA 3CXCP 2K3BA 1VQ5T 1GCPA 2QEXQ 1VYTA 1IB8A 1OYXA 3CCLA 3MJXA 5LJ5j 5D7UA 3M53A 2XMFA 3META 1I5OB 5A0GA 3RKXA 2QYZA 2XI9A 3C12A 4C92A 2DFUA 1IHVA 1Y7XA 3INZA 5HCKA 5KYUB 2RPNA 2LT4A 2RH2A 1UJ0A 3FLGA 4NOYA 1N8RC 3GF5A 3VRZA 4PLIA 1UE9A 3UT1A 3VUZA 3M4GA 3CC2T 3OYFA 1OX8A 3OYLA 8AT1B 5LJ3g 1ABQA 1E6HA 3G71Q 5GAOp 1GBRA 3MEWA 3MEAA 4HVWA 1T3SA 2KSSA 3QSUA 5D6XA 2GFAA 4F7UF 5LJ3e 3REAB 4VUBA 2RK2A 5I22A 2A7YA 4A4FA 4FW2A 3ZL7C 4FYWB 4OGEA 4BI8B 4MMLA 4GLKA 1MV0B 1VIFA 1M2VB 2RK1A 1Q81R 3OYIA 3KXTA 1N9RA 2YDLA 3OYDA 3JB9G 5GMKj 1NE8A 4M78F 2AIRB 4Z02A 5KYYB 1AEYA 4J6WA 4PNOA 4J83A 3I56Q 1X69A 2OTJA 3H0FA 1AHJB 2QTVA 2KR3A 1D3BB 3EH2A 1G3SA 1AVZC 1YBYA 4BY6C 4KBMB 3A1PA 4FU6A 2JS0A 2KGTA 3HFOA 1YJNQ 3KFVA 4XQ3A 1N9SA 1KQSA 1AT1B 5A0LA 1VQKA 3RUXA 1T3LA 1QMCA 2DD4A 5KYUA 2WSCE 3VRYA 3UPUA 1YJWT 1BIAA 1QCOA 5FROA 5EG2A 1VQ8Q 1UEBA 4LDYA 5GAN5 2IVWA 3QWYA 1B3QA 3VS0A 3CCQT 3E9FA 1UFFA 4UC4A 1G3TA 1VYVA 1TG0A 1LVKA 4ME7A 2LT1A 1VQOQ 1W70A 2DNUA 2BKDN 1VQKT 3JCMQ 4JRPA 3JCMP 3L1AA 4HVVA 2OJ2A 2RQUA 2NUPA 3A8MB 3CD6Q 1F1BB 1RL2A 4J9BA 3RIRA 4QKUA 3QBYA 2DL7A 2C0OA 2W10A 1UDLA 2Y90A 2IIMA 1QVFS 1YNZA 1UGSB 2DO3A 4A4HA 2QQSA 1QCNA 1VQ7T 2W0ZA 4EMKB 3PTAA 1U06A 4IUVA 3L2VA 1GL5A 4JLIA 2YLCA 4KGZB 2KQWA 4AT1B 1RAHB 1ARKA 1ZSZB 2F2XA 2PVGB 3GIBA 2JOYA 4N4HA 3H8ZA 2D6FA 1FYNA 4J9CA 3AT1B 4XU3A 1X01A 2EYXA 1YHQQ 1X6GA 5GANg 3JB9J 1Y0MA 2RQWA 3KBGA 4E47A 2JNGA 1VQMT 1WJSA 2X4YA 1GCQA 4Z88A 1WX6A 1VQPA 2DXCA 5D6YA 2NUTA 1JRIA 1PD1A 1EZZB 4M7AB 2BE7D 2NYSA 4L5GA 5IHNA 4WF2A 2JS2A 3THKA 1SEMA 1K4US 4EMHA 1Q95G 4DBHA 5KYWB 1XNIA 2B86A 3CMEA 2L3RA 1VQ5A 1VQ5Q 2EQUA 5GAMd 5IHIA 2CP7A 2QEXT 3NPFA 4M75F 3CMEQ 1C6VX 3EG0A 4ZN1A 3L2WA 3WVDB 4M75C 2CS7A 2YXYA 3FIFA 5IH2A 2COZA 2DL8A 7AT1B 1SRMA 3OS1A 3QXEB 1P92A 5CKFA 1D0YA 2CGHA 2FPDA 2E41A 3CCSQ 2X3WD 1AZEA 1YP5A 2EGAA 1NYFA 3PGGA 2K5LA 4C8QG 3TSWA 3JB9H 3CC2Q 2E4HA 2A3LA 2EFIA 1BI2A 3G71T 1Y96B 2OTLT 4IURA 3JCMf 2LCCA 1FMVA 2RM4A 4F7UE 3OB9A 1T0HA 2EGEA 5IXFA 2H8HA 5LJ5f 4JZ4A 4HT8A 1U1TA 3JCMe 2O2OA 2L89A 5IHKA 2GGRA 3PNWC 2DVEA 4M78E 4OMQA 3ME9A 2RQRA 3CCVA 1Q82C 2F5KA 2QI2A 4NS5A 2XDPA 1XOVA 3I56T 2SEMA 3U23A 1DJ7B 1VQPT 3VV0A 1Q86U 4QVZA 1M90U 2K6DA 3TEEA 3CBPA 2DPPB 2E6NA 4V2SA 1GRIA 3PMTA 3CD6A 3QO3A 2RJEA 3JB9D 5GMKl 1YJNT 3HRTA 3UWNA 2QGFB 2EKOA 3OYAA 3M56A 5EC7A 3M57A 2E6ZA 1NZ9A 1QW1A 3JAME 3CCJA 2PZ1A 1RI9A 1TXQA 3AHUA 1YJWQ 3OYGA 1V1CA 1KHIA 4GLMA 1VQ8T 3TQ7P 1QVGA 1KG1A 5GMKi 3RMQA 1RAAB 2NWMA 3RKYA 3M0SA 2LQKA 1UJYA 3L2ZA 3QWXX 3OS2A 1Q7YR 3MEUA 4C0DC 1PD0A 2HDAA 2MYSA 2O4XB 1VQOT 1VQKQ 2CH4W 2ROTA 1W2BP 2XIDA 3CQTA 5ECAA 1D1CA 3CD6T 1D1BA 2LCSA 1SHGA 3L2UA 2LCLA 2OAWA 1SRLA 4RTUA 2ZPGB 2HEQA 2LDMA 5GAMh 3EGXA 4EMGA 1M5Q1 2MMPA 2OX7A 2E64A 2OAUA 3VYGA 4HCCA 1YCSB 3JCMb 4OB2B 1ZUUA 5GMKe 2JTMA 5KYXA 2H3EB 1EX4A 1PCXA 2QGGA 4M78D 4M78C 4NL3A 1ZSZA 1YI2A 1M3AA 1AOJA 2M0OA 1MMNA 4PFPA 2KRNA 4F16A 1M1GA 3G71A 4XTZA 3OQ5A 2XKOC 2KMTA 2KT1A 3CCRA 1OPLA 3JV3A 1OPKA 3PMIA 4XTYA 1IGUA 3G4SA 1M2OA 1JQQA 1T0JA 4ATOA 5DLQE 4FT4A 3UA6A 1LJOA 3NMZC 3M0RA 3QZ5B 2L0AA 2JJ9A 4FYXB 4AG2C 2B8AA 1NEGA 2LVMA 1BI0A 2GQVA 4Z8AA 2JM8A 1YN8A 3LW5E 2QEXA 1YIJT 4L6V5 3LH5A 5GJWB 2V1RA 1RAEB 4J6XA 1M8MA 5L8RE 4BD3A 2CSQA 3CMET 2M02A 3CEYA 1KQ1A 4KT0E 2HKQB 2M16A 4XU1A 2EIFA 2EGCA 3CC2A 1EFNA 4MZPA 2DKGA 2VUBA 3V8JA 4EMKC 3O5ZA 2R5AA 4CC3A 3CCSA 1PC0A 4JJBA 1JXOA 3TSZA 3CCST 1HXDA 1YCYA 5GAN3 2RHZA 1TS9A 4C5EA 4XU2A 5FU6C 1PRLC 3NTKA 4CC2A 4J9IA 1XTDA 2OTLQ 4KH0B 4AFQC 3ER0A 4JRKA 4N4IA 2WACA 1ZX6A 4AFZC 1OU8A 1PSEA 2GTJA 3L2QA 3CC7A 2COWA 2VWFA 2RA2A 1JEGA 3CXCA 1VUBA 2OTLA 3CCET 1HD3A 2PVOB 2JT4A 3VUBA 1QVGP 1NM7A 1SSHA 1R8OB 1V29B 3OYBA 2G6FX 2KRMA 3REBB 2EBPA 3PVQA 4DEYA 1VQPQ 4C92E 2CP0A 3TU4K 4M75B 5FW9A 3CXCS 3RKWA 2ESWA 2A37A 2COYA 3VS4A 2ZZDA 2O9VA 2ZAEA 4DQ2A 2E5KA 3P8HA 3CCEA 5CKDA 4J6YA 4QQDA 1YFNA 4E7IA 4C92C 3CBOA 1SG5A 2D0QB 2RN8A 3EGXB 5GANf 2VC8A 1B34B 1BCOA 4ELYC 2KNBB 2V26A 4FL6A 2P4RA 5GAOq 3S3NA 4RTVA 1W2BS 3CPWA 4D6WA 2RHXA 2KRSA 2QASA 4PJOG 3ZFJA 2AT1B 3T9NA 3M0QA 3BE3A 2DZ9A 3CCRQ 2BZ8A 1M3CA 1ZUKA 2YSQA 3EG2A 4DBQA 4JJDA 2FZKB 2BE9B 2L5QA 1W2BA 1YJ9Q 1K73C 4M7DD 2ZPIB 3EG9B 1B34A 3H6ZA 2FL7A 3QDRB 3LWHA 1TU0B 3I5SA 4LXCA 2X4XA 4IUQA 2AZSA 2RJCA 1KK7A 2MF2A 3H0IA 3H0HA 3P8DA 4OMMA 3SWNC 2ED1A 2EWNA 1K0XA 3UA7A 1G5VA 1OU9A 4M75E 1VQ8A 2BZXA 5LJ3h 3F70A 2RQVA 4QT7A 5GAOr 1PG5B 1OQKA 4X34A 1W6XA 4MDWA 1Q86R 1M90R 1Z9QA 2RI2A 3RNJA 2IPOB 3M4YA 2RB6A 1YWPA 4ZGJB 1SHFA 3GPLA 4JZ3A 2GBQA 3N5BB 3A8OB 1YJNA 2KE9A 2M51A 4EMKA 2AKKA 2QDLA 4M77B 1R77A 2V8JA 3MKDA 3OYJA 1M2VA 5FWCA 3FJ5A 1Y57A 2L3SA 2MAMA 5HY6A 3EHRA 3QHSA 3OY9A 2DL5A 1WLPB 2O88A 2KBTA 4C5IA 4A63B 2F5TX 4CC7A 4LDVA 1TH7A 1AZGB 3QJ6A 1UUEA 1Y96A 4OMOA 1Q81C 2EYYA 1YJWA 2F2WA 3FEOA 3CCMQ 1QVFP 3VS7A 1YIJQ 3I35A 4N4GA 1YITT 2IG0A 4A54A 2JUFA 5DLOA 2G3RA 2BUDA 3QIIA 3CCJQ 2XICA 2JZ2A 4Y92A 1NJIC 3VYHB 1X43A 2CUDA 2KYMA 4M77C 1I81A 2EYWA 4B6MA 4OP0A 3SWNB 4J9EA 3A8LB 3PIOA 3MO8A 4XK8E 3OS5A 3RBBB 2ENMA 4BI3A 2LZ6B 2OTJT 2RNAA 3M9QA 2FRWA 2DBKA 1VIEA 4BB7A 3CPFA 2NUZA 1WHKA 2KT8A 2MCNA 1KD1R 3VS2A 2PU9B 2P0PA 1HYOA 4RUGA 4ESRA 1JXMA 3ZBDA 2ROLA 1H641 2JXBA 2RHUA 3VS6A 3CPWS 5GANd 3UF4A 5LJ5e 4X9DA 3P8BB 4M75D 1MUZA 4JS5A 3OMGA 1BI1A 4M7DC 1K9MR 1EIFA 2BIVA 3CCEQ 3QUIA 4JPBW 1W4SA 2KDSA 3G7ZA 4L59A 4XTXA 1MHNA 2O01E 4C92F 5I21A 1TUCA 3QZ9B 5CK9A 2QXFA 3E2UA 4E6RA 3OW2A 3G1JA 2EKHA 1AD5A 2F1LA 1VQMA 4IUTA 3V8LA 1M3BA 4DBRA 5J39A 4PFZA 4B9WA 2F2VA 2L2PA 2C06A 4XTUA 2A28A 3DB4A 1ACMB 2DRKA 3CCLT 1NJIR 3TCJA 2LP5A 4RTTA 5LL6S 2DL4A 2VXFA 4QW2A 3HTRA 2ZPFB 1D0ZA 2HD0A 1WPYA 2DMOA 1VQ7A 3VKIA 2BZYA 5M9OA 2YUPA 3RMSA 1JB0E 4WCIA 3M0UA 1X6OA 4J8OA 2KVQG 2X51A 2QK0A 5C6SA 2DXTA 1QWFA 5J26A 3CCRT 4OB3B 2FPEA 2NLUA 5A0DA 4J9DA 5IT9E 2EJ9A 1NEBA 1YHQA 1YJ9T 2CT3A 3EFRA 2HBWA 4D8KA 2HCKA 1ZBJA 2JTEA 4IKFA 1UECA 3EG3A 3OBYA 2PQWA 1UGPB 3CCQA 3OYNA 2VXEA 4E7SA 2FPFA 1TOVA 5AT1B 1OOTA 1VQNT 4KGXB 4N0AC 2E12A 3BY7A 3NGPA 2JN0A 2RQTA 2EVRA 4LUEA 1CKBA 2E3IA 5FWBA 3JCMd 2HAXA 3RDVA 2DA9A 3G4SQ 4HT9A 2LNVA 1WHMA 1VYUA 1N8RU 2DLPA 5CQXA 3V7CA 4J5YA 1QVGS 4C8QF 3Q1JA 3HRUA 4M4ZA 2GTOA 2KI7A 3C0CA 2DEQA 3DKMA 2RI5A 1D0XA 4GBQA 1YI2Q 5L23A 2OI3A 4J9GA 4JRQA 3WVEB 1X27A 3SHWA 4R55A 1G83A 1BBZA 2HQXA 2I2LA 2P4TA 5CAIA 5LJ5h 2X4JA 1ZUYA 4CC4B 6AT1B 4JJNK 4RCCA 1WQ7A 4E2FB 2MIOA 4M77D 2AHJB 1BI3A 2AKLA 4GY5A 1RABB 2SRCA 2BTTA 4FCYA 2K79A 3CCMT 1YITQ 2MOXA 3CCJT 2YT6A 3S6WA 3JCMJ 3X24B 4C5GA 3UDCA 4C8QE 5DM7R 2FZGB 4LUDA 2FG0A 2YLBA 2CZ6B 3I9QA 3ASKA 4C8QB 1VQ9T 2YWWA 1ABOA 1UHFA 3MP6A 5GAN6 1YWOA 4RTYA 2OTJQ 3I56A 4M7DB 2A36A 5DY9A 1ZSZC 1R0BG 3CCUQ 2DILA 5GJVB 3JCMV 3FRNA 1WZOA 1IREB 1LCKA 3MHXA 3ULRB 5KYWA 3PIPA 3VS5A 1JJ2A 5LJ3f 4OF1A 4D8DA 2KXDA 3MCAB 2HZYA 1U3OA 1IRXA 1WYXA 5KE3A 1RACB 3M5AA 3LYIA 5A2QE 1OZ3A 1WXUA 3JCMW 1QVPA 3JB9I 4PJJA 3LLRA 4BE0A 1JJ2S 1ZLMA 2PNIA 2ABLA 4P5NA 4PKCC 4ZTFA 5GANj 1NLPC 2LJ1A 1S1NA 4PL6A 3OSVA 4C0DB 2E10A 1TWBA 2K5IA 3BFMA 3FB9A 4OMLA 4HCKA 3A8HB 3EFSA 3JCMc 4M78G 2CYZB 1KD1U 1BYMA 1K0SA 3CCVQ 2O9SA 2YRDA 1E7OA 3QDFA 5GAOm 4LDXA 3O8VA 4EIKA 1NG2A 3CCLQ 2LNHB 1PKSA 2CREA 2K2MA 2GQIA 1NLOC 4PJNA 1ZBXA 1MNEA 4M7AF 1AWOA 2HQHA 1I0CA 3GNGA 1O9SA 1GCQC 4BY6B 4QVDA 1X75C 4C8QD 5LJ5g 2V8IA 3OYHA 1VQ4T 4DBFA 1QKWA 1KJWA 4A4EA 2E70A 1ZSGA 4RMOA 1Z9ZA 2YUOA 1K9MU 1XJWB 2FZCB 1WI7A 4RCBA 4IUPA 1TSFA 1N8RR 2CSIA 5I2SA 4ANJA 3SB2A 4YTLA 3M0PA 2LMJA 5LJ3j 5IN1A 2FO0A 3FDRA 2CP2A 1RAIB 3IQLA 2A0FB 1K1ZA 1BKBA 1I1JA 2WSFE 1SF9A 2FEIA 2R57A 1VQNQ 3J81E 2KROA 4C92G 1M4ZA 2RO0A 1JU5C 2R58A 5HK3A 2QA4A 3R6NA 5KE2A 2K5FA 3V7RA 5HK0A 3G4ST 1K73U 4MMKA 2X3XD 3C95A 3LX7A 1NPRA 3CPWP 4E7KA 2EQKA 2ZGWA 1MGQA 2KEAA 2ED0A 4O5VA 2CUBA 4LDUA 1GFCA 1PSFA 1YI2T 3RR6A 3QKJA 4WTOB 1JBMA 3I55Q 2XD0A 4OB0B 2D9TA 2XDBA 1Q82U 1I5LA 3TVTA 4R0KA 4Z89A 4JUVA 2EJGA 1B07A 2LQ8A 2VGNA 2EYQA 1Y07A 3NTHA 1QQJA 2GCXA 4XU0A 4BE1A 2EJFA 2L3QA 1Q86C 1M90C 4HKEA 1LPLA 3EFOB 1OX9A 1UGVA 1B7TA 5KCOA 3HSBA 3M0TA 3OYCA 1RUWA 5GAN2 4BI4A 1PNJA 3OMCA 1BCMA 3I55A 2FRYA 2K4YA 4HA8A 1KIKA 4O6JA 2JMAA 2M9UA 2H3JA 2C0TA 2MI6A 4AFUC 1VQ9Q 1H8KA 3OYKA 2LTOA 1VQOA 1N27A 5CVIA 3E9GA 2RJFA 3VS1A 4FYVB 5CCAA 1X2QA 4ELZC 4QVCA 2DYBA 4J7IA 1WHGA 1D3BA 3V8KA 3M59A 1Y71A 4IIOA 3HRSA 3CCUT 3R6OA 1SKUB 4IUUA 2CDTA 2Z0WA 4LE9A 4FW1A 1GFDA 2LQNA 3HPWA 5GAN7 1VQ6Q 1MMAA 4M7AA 2LJ0A 5LJ5d 2LX9A 2LRQA
chains in the Genus database with same CATH topology
2L89A 1VQNA 1H3ZA 2FYKA 3E1SA 1WQWA 1EIFA 1U1SA 2BIVA 3L42A 2DVEA 3PNWC 3SFMA 3X25B 2QQAA 3NFCA 4M78E 5CKHA 3ME9A 3QUIA 3CCVA 1G3YA 1Q82C 2F5KA 3GP8A 1W4SA 2ZCFB 2QQBA 2ZPEB 2KDSA 2XDDA 2QI2A 2X35A 3G7ZA 1MHNA 1FWZA 2O01E 4J7FA 4L59A 4XTXA 4C92F 4C8QC 5GAMf 5I21A 3QZ9B 5CK9A 3S3MA 4NS5A 3X28B 2XDPA 4C0FA 1XOVA 2K2VA 2QXFA 1ZQ1A 3JCMe 3I56T 3OW2A 1DJ7B 2JTFA 3TREA 5J3BA 3VV0A 1VQPT 1Q86U 4QVZA 1M90U 5FRNA 1YJ9A 3OYYA 3JRZA 3TEEA 3CBPA 2DPPB 2E6NA 1VQMA 4IUTA 3V8LA 4V2SA 3PMTA 2E65A 3QJYA 4M7DA 5J39A 3MP1A 4B9WA 3CD6A 2C06A 3QO3A 4XTUA 2RJEA 3CCVT 5GMKl 3JB9D 2DZCA 1YJNT 3HRTA 1FX7A 2RHYA 1KQ2A 3JCMX 3DB4A 3UWNA 4PJOF 2EKOA 5GAN4 3OYAA 3M56A 3OYEA 3CCLT 3TCJA 4BACA 3M57A 2E6ZA 1NZ9A 1QW1A 3QG1A 3JAME 3CCJA 1U8RA 3LH0A 5LL6S 4PJOA 2DD5A 4F7UA 2ZPBB 2VXFA 3AHUA 4BE2A 4CI0C 4M7DG 4M7AC 1BIBA 3OYGA 1KHIA 1VQ8T 2YHTA 4QW2A 3J80E 4E7LA 1QVGA 4ZGDB 1KG1A 4LDWA 5GMKi 2ZPFB 3RMQA 3JCMh 2HD0A 1WPYA 4M78A 3RKYA 4X9CA 5KCHA 2LQKA 3L2ZA 3FC3A 3OS2A 3MEUA 2VV5A 3RERA 3OYMA 4C0DC 1VQ7A 2KAFA 5KH6A 4A53A 4ZTFA 4M7AG 3VKIA 5M9OA 1QVFA 2GF7A 3RMSA 3E19A 3L2RA 2O4XB 1JB0E 1VQOT 2CZ1B 2CZ7B 4JLGA 1X6OA 4J8OA 2KVQG 2O4XA 3QYHB 4FSXA 3HL8A 5GAOl 4TVRA 5C6SA 4M7DF 2FHDA 3GNFB 2XIDA 2DXTA 4FM4B 5J26A 3CCRT 4OB3B 1I4K1 3CD6T 4BUGA 2PVDB 4NL2A 2NLUA 5A0DA 4M78B 4N0AA 5GAMe 3L2UA 5CR2A 1ZHIA 2LCLA 2RD1A 3VU3C 5FLXE 2EJ9A 2Y4YA 5IT9E 4M77F 4MDXA 1YHQA 1UB4A 1YJ9T 1NPPA 3OA6A 3S3OA 2ZPGB 3HP9A 3OS0A 2LDMA 1QP3A 3EFRA 4M7AD 5GAMh 4M75G 4EDUA 5CKEA 4EMGA 4LD6A 1VQ4A 4IKFA 3OBYA 4JRIA 1M5Q1 2MMPA 1UGPB 2PQWA 4F7UB 4PJOE 3M54A 3RESA 1VQLA 2E64A 2OAUA 3VYGA 4HCCA 3CCQA 3OYNA 4M77G 2CZ0B 2VXEA 4OB2B 3JCMb 5GMKe 2JTMA 3JCMg 2XK0A 1VQNT 2HNIA 2QDYB 4C5HA 4N0AC 2E12A 2E5QA 3BY7A 4M78D 1KQSS 4E7JA 3BDLA 4M78C 2JN0A 2DXUA 3EAEA 4NL3A 5FU7C 1YI2A 5LJ3d 3SDZA 3JCMd 3V7SA 1YHQT 2M0OA 2HAXA 4FT2A 2GFUA 3GLXA 1M1GA 1N6AA 2XHCA 3G71A 2LNVA 4XTZA 5D6WA 4HT9A 4QQ6A 3JSCA 3CCUA 1N8RU 3MP8A 3OQ5A 5CQXA 2XKOC 4J5YA 2KMTA 4M77E 3V7CA 4C8QF 3CCRA 1QVGS 4BDZA 2HBPA 3Q1JA 3HRUA 2M1HA 5I2MA 1KD1C 1UGRB 3PMIA 4XTYA 4HCBA 2MWOA 2JVVA 4DOWA 3G4SA 4FIBA 2EAYA 2DEQA 3DKMA 2RI5A 1Q81U 1HK9A 1K8AC 2QQ9A 4RG2A 4ATOA 5IAYA 4C0GA 5DLQE 3FJPA 4JRQA 4FT4A 2DJZA 3WVEB 2DAQA 4OGCA 4R55A 1LJOA 5CIUA 4CRIA 3QZ5B 1RI0A 4B9XA 2HQXA 2I2LA 2P4TA 5CAIA 3I55T 2R5MA 5LJ5h 2X4JA 3J7AF 3HFNA 4RCCA 4JJNK 1WQ7A 4OB1B 2B8AA 5CQYA 4M77D 2AHJB 1BI3A 2LVMA 4GY5A 1BI0A 2GQVA 3LW5E 2QEXA 4DOVA 3CCMT 1YIJT 4L6V5 1YITA 1VQ5T 2K57A 3CCJT 4J6XA 3S6WA 5L8RE 4BD3A 1OZ2A 3JCMJ 3CMET 3CCLA 1OYXA 3CEYA 3X24B 3OBWA 3UDCA 4C5GA 1KQ1A 4C8QE 4KT0E 4EPCA 5LJ5j 3M53A 5DM7R 2EQJA 2PUKB 3META 3OSSC 2M16A 4XU1A 5A0GA 3RKXA 2EIFA 3CC2A 2YLBA 2XI9A 3C12A 2CZ6B 3ASKA 4MZPA 2DKGA 2RHIA 2VUBA 3ZEHA 4C92A 4OVAA 1Y7XA 3V8JA 4C8QB 3INZA 2L8DA 1VQ9T 4EMKC 2LT4A 1M1KU 3A8GB 2RH2A 3MP6A 2R5AA 3QPHA 5GAN6 3CCSA 3FLGA 4NOYA 1N8RC 3URGA 3CCST 3I56A 2KY9A 1HXDA 3GF5A 1YCYA 5GAN3 2RHZA 1VQ9A 1IZ6A 4PLIA 4C5EA 4XU2A 4M7DB 5FU6C 3UT1A 3NTKA 5DY9A 3M4GA 3VUZA 1WJQA 2YRVA 3CC2T 3OYFA 4E7HA 4XTWA 3JCMV 3FRNA 3OYLA 5LJ3g 1IREB 3MHXA 2DK3A 5GAOp 1XTDA 3PIPA 4PJOC 3MEWA 3MEAA 1JJ2A 4PJOD 3ER0A 5LJ3f 2KSSA 4JRKA 4OF1A 4N4IA 3CC4A 2WACA 3QSUA 3VJPA 4C0ZA 2ZPHB 1VQ6T 5GANh 5D6XA 2GFAA 3MCAB 4F7UF 5LJ3e 4VUBA 2RK2A 1PSEA 2A7YA 3L2QA 3CC7A 1KC8C 1M1FA 4A4FA 5KE3A 2RA2A 3M5AA 4OGEA 4BI8B 3CXCA 3LYIA 5A2QE 4MMLA 1VUBA 3BDUA 4GLKA 2OTLA 3CCET 1VIFA 2RK1A 1OZ3A 3JCMW 3OYIA 1QVPA 3KXTA 2FVUA 1N9RA 3JB9I 3OYDA 3CMAA 3DB3A 3JB9G 3LLRA 5GMKj 3X20B 4BE0A 1JJ2S 4XAXB 1LNXA 1NE8A 2PVOB 4DA4A 4M78F 3VUBA 1QP2A 1R8OB 1V29B 4Z02A 1FXXA 3C94A 4J6WA 4P5NA 4PKCC 3OYBA 2XG8D 3KUFA 4PNOA 4JS4A 5GANj 4J83A 2V8KA 4QQGA 4C92E 3TU4K 4KUDK 2OTJA 4PL6A 4M75B 1AHJB 3OSVA 3PFSA 4C0DB 2E10A 3CXCS 2K5IA 2LC4A 3BFMA 3RKWA 2EQMA 3FB9A 5FRMA 1D3BB 1G3SA 1YBYA 3A8HB 3EFSA 4KBMB 4BY6C 3JCMc 2CYZB 2ZZDA 3QYGB 4FU6A 4M78G 1KD1U 1BYMA 3HFOA 3CMAT 4XQ3A 4DQ2A 2HQEA 3P8HA 2MWPA 1N9SA 1WGSA 3CCEA 5GAOm 1KQSA 4LDXA 1M8VA 3O8VA 4ZGEB 5CKDA 3G6EA 4J6YA 5A0LA 5GAOn 1VQKA 4QQDA 3RUXA 2DD4A 3OW2S 4Y28E 2WSCE 2WSEE 4E7IA 1SSFA 4HCZA 4C92B 1ZBXA 4M7AF 4C92C 5GANe 3CBOA 4C92D 3UPUA 1M9SA 3M55A 4JDSA 4ZN3A 5CO7A 1YJWT 2VGMA 1BIAA 2D0QB 5FROA 5EG2A 5GANf 1UEBA 2VC8A 1B34B 4LDYA 4ELYC 3GNGA 1WNLA 1O9SA 2F69A 5GAN5 5C0MA 2IVWA 3CCQT 4FL6A 2DIQA 4BY6B 1UGQB 3M58A 3E9FA 4QVDA 5GAOq 3S3NA 1X75C 2QTXA 2XU8A 4C8QD 5LJ5g 2V8IA 3OYHA 1VQ4T 4M7DE 3A5ZB 4UC4A 1G3TA 1W2BS 3CPWA 4A4EA 2P0QA 1OI1A 2E70A 4D6WA 4ME7A 1NJIU 2E1HA 2LT1A 2RHXA 3SD4A 1VQKT 2BKDN 5GMKm 4RMOA 4ZTJA 3DLMA 4PJOG 3ZFJA 3JCMQ 4JRPA 1K9MU 3T9NA 2VYTA 3JCMP 3L1AA 2DZ9A 4RCBA 2DTIA 4IUPA 3A8MB 1RL2A 4MZMA 5FU7B 2Y4XA 2PUOB 1WJRA 3RIRA 5I2SA 4A4GA 3QBYA 2L5QA 1W2BA 3SB2A 2Y90A 1K73C 4YTLA 4M7DD 2ZPIB 1QVFS 1B34A 1UGSB 2DO3A 2DXBA 3H6ZA 3MEVA 2QA4T 2FL7A 3QDRB 5IN1A 4A4HA 5LJ3j 3LWHA 3FDRA 2QQSA 1VQ7T 4M77A 2X4XA 4IUQA 4EMKB 3PTAA 2FB7A 2RJCA 4IUVA 2MF2A 3L2VA 4JLIA 2YLCA 3P8DA 5AYFA 3SWNC 1BKBA 4PJOB 3JB9F 2EWNA 2QQRA 2WSFE 2KQWA 3DLLA 1S72A 1G5VA 4R56A 1S72T 3PT9A 2R57A 4M75E 1VQ8A 3GOXA 5FU6B 3J81E 1K9MC 2K3YA 2PVGB 1M1KC 3GIBA 3CC7T 2JOYA 4N4HA 4C92G 1M4ZA 2RO0A 3H8ZA 1XQHA 5LJ3h 4F7UG 3F70A 2D6FA 2R58A 5HK3A 2CKKA 2QA4A 5GAOr 5KE2A 4X34A 2K5FA 4MDWA 4XU3A 1X01A 2RI2A 3V7RA 3M4YA 4M75A 5HK0A 2RB6A 3G4ST 4ZGJB 4A4KA 1K73U 1I8FA 4MMKA 5GANg 3GPLA 3JB9J 3N5BB 3A8OB 3C95A 3LX7A 1NPRA 4E7KA 1YJNA 4Q5WA 2EQKA 1Q7YC 4EMKA 2ZGWA 1MGQA 3KBGA 4M77B 4RKUE 5CKBA 3X26B 4O5VA 4E47A 1YIJA 2JNGA 2RI3A 3WXMB 1VQMT 1WJSA 2X4YA 2V8JA 4LDUA 3OYJA 1PSFA 4II1A 1YI2T 2MAMA 1VQPA 2DXCA 5HY6A 5GAN8 5D6YA 3QHSA 1KC8U 1JRIA 3QKJA 3OY9A 2DTOA 2K3XA 3LGLA 4M7AB 5HKCA 1O75A 1JBMA 1Q7YU 4L5GA 4C5IA 4OB0B 2XD0A 2D9TA 2F5TX 4WF2A 4LDVA 1TH7A 2XDBA 1G3WA 1Q82U 4BDYA 1I5LA 4XTVA 5GAMj 3QJ6A 4EMHA 4JUVA 2EJGA 2LQ8A 1Y96A 1VQLT 1Q81C 2VGNA 1XNIA 2EYQA 3CMEA 1Y07A 1LOJA 3NTHA 1YJWA 3FEOA 2GCXA 4XU0A 2L3RA 4KUIA 4N4GA 2EJFA 4BE1A 1YITT 1VQ5A 2IG0A 4A54A 1Q86C 1M90C 2EQUA 2JUFA 2G3RA 2BUDA 3QIIA 5DLOA 3LGFA 5GAMd 2QEXT 2XICA 2JZ2A 3HKSA 4HKEA 3CCMA 3CBMA 4M75F 4LD9K 3G6ET 4ZN1A 1NJIC 3VYHB 3L2WA 5KCOA 3WVDB 2X4WA 3HSBA 3OYCA 4M75C 4M77C 1I81A 5GAN2 4BI4A 2CS7A 3FIFA 3OMCA 4C8QA 4PLLA 3I55A 2K4YA 4OP0A 3SWNB 4HA8A 2DIGA 3SWNA 5GAMg 3OS1A 4O6JA 3A8LB 3QXEB 3PIOA 3MO8A 2M9UA 1KHCA 2H3JA 2KK4A 2MI6A 4XK8E 3HHTB 1P92A 3OS5A 5CKFA 2CGHA 4BI3A 2LTOA 3OYKA 1VQOA 3LWIA 2OTJT 2E41A 1N27A 5CVIA 3M9QA 3E9GA 2RJFA 4OMFB 5CCAA 1VIEA 4ELZC 4QVCA 4BB7A 3CPFA 3PGGA 2K5LA 4MZTA 4J7IA 4C8QG 1D3BA 4KULA 3JB9H 2PU9B 2P0PA 3M59A 3V8KA 4M7AE 1Y71A 3CCUT 3HRSA 3R6OA 2A3LA 3NTIA 3ZBDA 2EFIA 1BI2A 3G71T 1Y96B 1H641 2OTLT 4IURA 4RG8A 2LCCA 2RHUA 3JCMf 2RM4A 4IUUA 4F7UE 3OB9A 5GMKh 5GANd 3CPWS 3BW1A 5LJ5e 4X9DA 2P0KA 2DTHA 3HPWA 2RJDA 3P8BB 4Y91A 5LJ5f 5GAN7 1K8AU 4M7AA 4M75D 4HT8A 1U1TA 3C4SA 1VQ6A 5LJ5d 4JS5A 3OMGA 2LX9A 1GXIE 2LRQA 3CC4T 1BI1A 4M7DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K3Y A;  2L89 A;  1H3Z A;  3LYI A;  4C5H A;  4N4H A;  2E5Q A;  3PNW C;  2BIV A;  3L42 A;  4E7J A;  3BDL A;  2RO0 A;  3EAE A;  3H8Z A;  3F70 A;  2R58 A;  1OZ3 A;  3ME9 A;  3OYI A;  2CKK A;  3OYD A;  3DB3 A;  2F5K A;  3LLR A;  4X34 A;  5KE2 A;  4BE0 A;  2RI2 A;  2X35 A;  2M0O A;  1MHN A;  4L59 A;  2GFU A;  4Z02 A;  3S3M A;  4NS5 A;  4ZTF A;  2XDP A;  5D6W A;  3KUF A;  3OYB A;  4QQ6 A;  3LX7 A;  4E7K A;  4Q5W A;  2EQK A;  2JTF A;  4QQG A;  3MP8 A;  3OQ5 A;  4PL6 A;  4QVZ A;  5FRN A;  3PFS A;  4BDZ A;  3Q1J A;  2E6N A;  2M1H A;  2RI3 A;  3PMI A;  4IUT A;  2MWO A;  2EQM A;  5FRM A;  3PMT A;  1WJS A;  2X4Y A;  3OYJ A;  2RI5 A;  5J39 A;  3MP1 A;  4II1 A;  4FU6 A;  4B9W A;  4RG2 A;  5IAY A;  2RJE A;  5D6Y A;  2HQE A;  2RHY A;  3QKJ A;  3P8H A;  3DB4 A;  2MWP A;  3UWN A;  1WGS A;  2DAQ A;  3OY9 A;  4CRI A;  2K3X A;  5CIU A;  2EKO A;  3LGL A;  3O8V A;  3OYA A;  1RI0 A;  3OYE A;  4B9X A;  2HQX A;  4QQD A;  4C5I A;  4BAC A;  2D9T A;  2R5M A;  4E7I A;  1SSF A;  4HCZ A;  3LH0 A;  4BDY A;  2B8A A;  3QJ6 A;  2LVM A;  4BE2 A;  4GY5 A;  1XNI A;  3OYG A;  3NTH A;  5FRO A;  3FEO A;  4QW2 A;  4E7L A;  2L3R A;  4N4G A;  4BE1 A;  2IG0 A;  2EQU A;  5C0M A;  2G3R A;  2BUD A;  3QII A;  3LGF A;  4FL6 A;  2JZ2 A;  2DIQ A;  3S6W A;  3E9F A;  4BD3 A;  1OZ2 A;  1OYX A;  5KCH A;  3S3N A;  3FC3 A;  3CEY A;  4C5G A;  3OS2 A;  3OYH A;  3MEU A;  5KCO A;  3L2W A;  2X4W A;  2EQJ A;  4UC4 A;  3OYM A;  5KH6 A;  3OYC A;  3MET A;  4A4E A;  2M16 A;  5M9O A;  1OI1 A;  2GF7 A;  3OMC A;  3L2R A;  2O4X B;  2RHX A;  4PLL A;  3SD4 A;  2BKD N;  3ASK A;  2DIG A;  2RHI A;  3OS1 A;  3ZEH A;  3DLM A;  4OVA A;  4ZTJ A;  2O4X A;  3MO8 A;  1KHC A;  2L8D A;  2VYT A;  5C6S A;  2FHD A;  3MP6 A;  3OYK A;  2LTO A;  2R5A A;  5J26 A;  4IUP A;  1N27 A;  3FLG A;  3M9Q A;  3E9G A;  2RJF A;  2NLU A;  1WJR A;  3L2U A;  2RHZ A;  4PLI A;  4A4G A;  4C5E A;  3QBY A;  3OA6 A;  3UT1 A;  3S3O A;  3NTK A;  3OS0 A;  1WJQ A;  2LDM A;  2YRV A;  3H6Z A;  3MEV A;  3OYF A;  4E7H A;  4EDU A;  5IN1 A;  4A4H A;  3OYL A;  3FDR A;  2QQS A;  2EFI A;  3NTI A;  4LD6 A;  2X4X A;  4IUQ A;  4IUR A;  4IKF A;  2RJC A;  3MEW A;  2LCC A;  2RHU A;  3MEA A;  4IUU A;  4IUV A;  2PQW A;  3OB9 A;  3L2V A;  3P8D A;  4N4I A;  2WAC A;  2QQR A;  2P0K A;  2RJD A;  3OYN A;  5D6X A;  1G5V A;  2GFA A;  2XK0 A;  3C4S A;  2R57 A;  3OMG A;  3L2Q A;  2LRQ A;  3GOX A;  4A4F A;  5KE3 A; 
#chains in the Genus database with same CATH topology
 1VQN A;  1G8X A;  1NYG A;  3E1S A;  1WQW A;  3L42 A;  2QQA A;  2MPX C;  5CKH A;  3GP8 A;  1WXT A;  2ZCF B;  2ZPE B;  2XDD A;  1FWZ A;  5GAM f;  1ZA1 B;  2HSE B;  4LD9 K;  3S3M A;  4AFS C;  2JTF A;  5FRN A;  3OYY A;  1D09 B;  2E65 A;  4E7Z A;  4RTZ A;  2AZV A;  3CCV T;  1KQ2 A;  3OYE A;  1U8R A;  5KYN A;  3LH0 A;  3GBQ A;  2CT4 A;  4M7D G;  1BK2 A;  4M7A C;  1M27 C;  3J80 E;  4E7L A;  3EG9 A;  4ZGD B;  4LDW A;  1HJD A;  4X9C A;  5KCH A;  4AG1 C;  4K11 A;  1VQ4 Q;  1JJ2 P;  2VV5 A;  2NUP B;  2KAF A;  5KH6 A;  4A53 A;  4M7A G;  3H41 A;  1QVF A;  2CZ1 B;  2CZ7 B;  4JLG A;  3EGD B;  2D0N A;  2O4X A;  4FSX A;  3HL8 A;  5GAO l;  1U5S A;  4M7D F;  2FHD A;  3GNF B;  4FM4 B;  1IXD A;  1I4K 1;  2HL5 C;  2PVD B;  4NL2 A;  4M78 B;  5GAM e;  5CR2 A;  2RD1 A;  5FLX E;  2Y4Y A;  1J3T A;  4M77 F;  1NPP A;  3OA6 A;  3S3O A;  1QP3 A;  2CP6 A;  4EDU A;  1K8A R;  4LD6 A;  2PTK A;  1VQ4 A;  4LN2 A;  4PJO E;  4F7U B;  1UHC A;  3M54 A;  4PFO A;  2DBM A;  4M77 G;  3JCM g;  1S72 Q;  2XK0 A;  1WA7 A;  2HNI A;  1E6G A;  2X9H A;  1PKT A;  4C5H A;  2E5Q A;  3VS3 A;  4E7J A;  3BDL A;  3EAE A;  2DXU A;  2J6K A;  4PK4 A;  1C1A A;  5LJ3 d;  5KYX B;  1WDX A;  3SDZ A;  3V7S A;  3SEM A;  4FT2 A;  2GFU A;  3GLX A;  5D6W A;  4QQ6 A;  3JSC A;  3CCU A;  1WHJ A;  4PJL A;  4BDZ A;  2HBP A;  1KD1 C;  2M1H A;  1KFZ A;  1IGQ A;  4DOW A;  4FIB A;  2EAY A;  3EGU A;  1Q81 U;  3A98 A;  1PWT A;  1HK9 A;  2QQ9 A;  4RG2 A;  4C0G A;  3FJP A;  3OW2 P;  2CP5 A;  5CIU A;  1RI0 A;  3I55 T;  2R5M A;  3HFN A;  4OB1 B;  5CQY A;  1MMD A;  1AWW A;  2VVK A;  1VQL Q;  2ATC B;  4DOV A;  8ATC B;  2LJ3 A;  4JJC A;  1YIT A;  2K57 A;  2JW4 A;  2ECZ A;  1OZ2 A;  3G6E Q;  3OBW A;  2EQJ A;  2PUK B;  1AWJ A;  3OSS C;  2DE0 X;  1TTH B;  2LQW A;  2RHI A;  1KQS P;  3ZEH A;  4OVA A;  2L8D A;  1M1K U;  3A8G B;  3QPH A;  1MND A;  3URG A;  2DER A;  2KY9 A;  3EFO A;  1VQ9 A;  1IZ6 A;  1IO6 A;  1WJQ A;  2YRV A;  1UTI A;  4E7H A;  1M30 A;  2EPD A;  4XTW A;  4J9H A;  2DK3 A;  2RMO A;  4PJO C;  1BU1 A;  4PJO D;  1CKA A;  3CC4 A;  1X6B A;  3VJP A;  4C0Z A;  2ZPH B;  1VQ6 T;  5GAN h;  4FSS A;  1PHT A;  1M1F A;  3CC4 Q;  1KC8 C;  3BDU A;  4KGV B;  1JO8 A;  2CP3 A;  1OUL A;  3CMA A;  1BB9 A;  2FVU A;  3DB3 A;  2D8J A;  3X20 B;  4XAX B;  1LNX A;  4DA4 A;  1OV3 A;  1QP2 A;  1FXX A;  3C94 A;  4JS4 A;  2XG8 D;  3KUF A;  2V8K A;  4QQG A;  4KUD K;  3PFS A;  2LC4 A;  1M1K R;  2EQM A;  5FRM A;  4OMN A;  2J7I A;  3QYG B;  2D8H A;  2HL3 A;  3PE0 A;  3CMA T;  2HQE A;  2MWP A;  1WGS A;  1M8V A;  1WIE A;  4ZGE B;  3G6E A;  5GAO n;  4HXJ A;  3OW2 S;  4Y28 E;  2WSE E;  2EYZ A;  1SSF A;  4HCZ A;  4C92 B;  5GAN e;  2VKN A;  4C92 D;  1M9S A;  3M55 A;  4JDS A;  4ZN3 A;  5CO7 A;  2E3H A;  2VGM A;  2DVJ A;  2QAZ A;  1WNL A;  1PM3 A;  2F69 A;  5C0M A;  2DIQ A;  1UGQ B;  3M58 A;  2XU8 A;  2QTX A;  2YRC A;  4M7D E;  3A5Z B;  2P0Q A;  1OI1 A;  1NJI U;  2E1H A;  3SD4 A;  5GMK m;  4ZTJ A;  1G2B A;  1D1A A;  3DLM A;  2HKN A;  1Q82 R;  2VYT A;  2P84 A;  2DTI A;  2CH4 A;  4F04 B;  1K76 A;  3PVL A;  4LNP A;  2DM1 A;  4MZM A;  5FU7 B;  2Y4X A;  2PUO B;  1WJR A;  1R0C B;  1KC8 R;  4A4G A;  1QKX A;  1TUD A;  3MEV A;  2DXB A;  2QA4 T;  1H3H A;  4KRT A;  3I5R A;  4M77 A;  2FB7 A;  4FYY B;  4F14 A;  2DRM A;  5AYF A;  4PJO B;  1VA7 A;  3JB9 F;  1V76 A;  2QQR A;  3DLL A;  1S72 A;  4R56 A;  1S72 T;  3PT9 A;  4DEX A;  3GOX A;  5FU6 B;  2LX7 A;  1K9M C;  2K3Y A;  1M1K C;  3CC7 T;  2DET A;  4F7U G;  1XQH A;  5IXB A;  2CKK A;  2MK5 A;  2KXC A;  2KYB A;  4M75 A;  4F17 A;  1RLP C;  4A4K A;  1I8F A;  4KH1 B;  4Q5W A;  1Q7Y C;  4RKU E;  3X26 B;  5CKB A;  3H9N A;  2J06 A;  2RI3 A;  3WXM B;  2EQI A;  1MMG A;  1FMK A;  4II1 A;  4X1V A;  5GAN 8;  1KC8 U;  1A0N B;  1RAG B;  2DTO A;  2K3X A;  3LGL A;  5HKC A;  1O75 A;  1Q7Y U;  3EG1 A;  1G3W A;  2GNC A;  2J6O A;  4BDY A;  4XTV A;  5GAM j;  1GBQ A;  1VQL T;  1LOJ A;  2HSP A;  4KUI A;  1YIJ A;  3LGF A;  3CCM A;  3HKS A;  3CBM A;  3G6E T;  2QG9 B;  4OMP A;  2K7A A;  2X4W A;  1C0M A;  3D7S B;  1MV3 A;  4C8Q A;  4PLL A;  1W1F A;  5GAM g;  3SWN A;  2DIG A;  1KHC A;  2KK4 A;  3HHT B;  2DX1 A;  3LWI A;  2A08 A;  1NBE B;  4OMF B;  1IHW A;  1VOM A;  4MZT A;  4KUL A;  2DL3 A;  4M7A E;  1ZA2 B;  3NTI A;  2C0I A;  4RG8 A;  5GMK h;  1FMW A;  3BW1 A;  1WHL A;  2J6F A;  1HSQ A;  2P0K A;  2DTH A;  4Y91 A;  2RJD A;  1UG1 A;  3EH1 A;  1K8A U;  1VQ6 A;  3C4S A;  1GXI E;  3CC4 T;  4J9F A;  4EPC A;  1H3Z A;  2FYK A;  1U1S A;  3X25 B;  3SFM A;  2M0Y A;  3NFC A;  2JM9 A;  1N5Z A;  2JMC A;  1G3Y A;  2AK5 A;  1QLY A;  2QQB A;  2X35 A;  4J7F A;  4C8Q C;  3X28 B;  1OEB A;  2YUN A;  1SPK A;  4C0F A;  2K2V A;  1ZQ1 A;  3TRE A;  5J3B A;  1YJ9 A;  3EHQ A;  3JRZ A;  3QJY A;  4M7D A;  3MP1 A;  3CMA Q;  2DZC A;  1FX7 A;  2K9G A;  2RHY A;  3JCM X;  4PJO F;  5GAN 4;  4BAC A;  2J05 A;  3QG1 A;  2DF6 A;  4PJO A;  2DD5 A;  4F7U A;  2ZPB B;  1H92 A;  1WHH A;  4BE2 A;  4CI0 C;  1BIB A;  1PRM C;  2VB6 A;  2YHT A;  5I11 A;  4IIM A;  1TUG B;  3CCQ Q;  3JCM h;  4M78 A;  1WXB A;  3FC3 A;  2I0N A;  2DEU A;  3RER A;  1RAD B;  3OYM A;  2YUQ A;  2GF7 A;  2EW3 A;  3E19 A;  3L2R A;  3EGD A;  2L3P A;  3QYH B;  4ORZ A;  4TVR A;  4BUG A;  2NUT B;  4N0A A;  1ZHI A;  3VU3 C;  4MDX A;  1UB4 A;  9ATC B;  3OS0 A;  3HP9 A;  4M7A D;  2O31 A;  2QA4 Q;  4M75 G;  2RF0 A;  5CKE A;  1VQ7 Q;  3MPU B;  4JRI A;  3RES A;  1VQL A;  2CZ0 B;  1QCF A;  1AWX A;  1K9A A;  2HMA A;  1RAF B;  4AMC A;  2QDY B;  3CC7 Q;  1KQS S;  5FU7 C;  4HVU A;  4RTW A;  1YHQ T;  1WFW A;  2VAS A;  1N6A A;  2V1Q A;  2XHC A;  2D1X A;  3UAT A;  3MP8 A;  4M77 E;  5KYY A;  5I2M A;  4HCB A;  1UGR B;  2MWO A;  1VQM Q;  2JVV A;  2DJQ A;  1K8A C;  1QWE A;  1RLQ C;  5IAY A;  4ZNX A;  2DJZ A;  2DAQ A;  4OGC A;  4CRI A;  3NHN A;  1CSK A;  4PJM A;  4B9X A;  1KSW A;  3J7A F;  1K73 R;  1I07 A;  2DYI A;  4RTX A;  1X2K A;  3CXC P;  2K3B A;  1VQ5 T;  1GCP A;  2QEX Q;  1VYT A;  1IB8 A;  1OYX A;  3CCL A;  3MJX A;  5LJ5 j;  5D7U A;  3M53 A;  2XMF A;  3MET A;  1I5O B;  5A0G A;  3RKX A;  2QYZ A;  2XI9 A;  3C12 A;  4C92 A;  2DFU A;  1IHV A;  1Y7X A;  3INZ A;  5HCK A;  5KYU B;  2RPN A;  2LT4 A;  2RH2 A;  1UJ0 A;  3FLG A;  4NOY A;  1N8R C;  3GF5 A;  3VRZ A;  4PLI A;  1UE9 A;  3UT1 A;  3VUZ A;  3M4G A;  3CC2 T;  3OYF A;  1OX8 A;  3OYL A;  8AT1 B;  5LJ3 g;  1ABQ A;  1E6H A;  3G71 Q;  5GAO p;  1GBR A;  3MEW A;  3MEA A;  4HVW A;  1T3S A;  2KSS A;  3QSU A;  5D6X A;  2GFA A;  4F7U F;  5LJ3 e;  3REA B;  4VUB A;  2RK2 A;  5I22 A;  2A7Y A;  4A4F A;  4FW2 A;  3ZL7 C;  4FYW B;  4OGE A;  4BI8 B;  4MML A;  4GLK A;  1MV0 B;  1VIF A;  1M2V B;  2RK1 A;  1Q81 R;  3OYI A;  3KXT A;  1N9R A;  2YDL A;  3OYD A;  3JB9 G;  5GMK j;  1NE8 A;  4M78 F;  2AIR B;  4Z02 A;  5KYY B;  1AEY A;  4J6W A;  4PNO A;  4J83 A;  3I56 Q;  1X69 A;  2OTJ A;  3H0F A;  1AHJ B;  2QTV A;  2KR3 A;  1D3B B;  3EH2 A;  1G3S A;  1AVZ C;  1YBY A;  4BY6 C;  4KBM B;  3A1P A;  4FU6 A;  2JS0 A;  2KGT A;  3HFO A;  1YJN Q;  3KFV A;  4XQ3 A;  1N9S A;  1KQS A;  1AT1 B;  5A0L A;  1VQK A;  3RUX A;  1T3L A;  1QMC A;  2DD4 A;  5KYU A;  2WSC E;  3VRY A;  3UPU A;  1YJW T;  1BIA A;  1QCO A;  5FRO A;  5EG2 A;  1VQ8 Q;  1UEB A;  4LDY A;  5GAN 5;  2IVW A;  3QWY A;  1B3Q A;  3VS0 A;  3CCQ T;  3E9F A;  1UFF A;  4UC4 A;  1G3T A;  1VYV A;  1TG0 A;  1LVK A;  4ME7 A;  2LT1 A;  1VQO Q;  1W70 A;  2DNU A;  2BKD N;  1VQK T;  3JCM Q;  4JRP A;  3JCM P;  3L1A A;  4HVV A;  2OJ2 A;  2RQU A;  2NUP A;  3A8M B;  3CD6 Q;  1F1B B;  1RL2 A;  4J9B A;  3RIR A;  4QKU A;  3QBY A;  2DL7 A;  2C0O A;  2W10 A;  1UDL A;  2Y90 A;  2IIM A;  1QVF S;  1YNZ A;  1UGS B;  2DO3 A;  4A4H A;  2QQS A;  1QCN A;  1VQ7 T;  2W0Z A;  4EMK B;  3PTA A;  1U06 A;  4IUV A;  3L2V A;  1GL5 A;  4JLI A;  2YLC A;  4KGZ B;  2KQW A;  4AT1 B;  1RAH B;  1ARK A;  1ZSZ B;  2F2X A;  2PVG B;  3GIB A;  2JOY A;  4N4H A;  3H8Z A;  2D6F A;  1FYN A;  4J9C A;  3AT1 B;  4XU3 A;  1X01 A;  2EYX A;  1YHQ Q;  1X6G A;  5GAN g;  3JB9 J;  1Y0M A;  2RQW A;  3KBG A;  4E47 A;  2JNG A;  1VQM T;  1WJS A;  2X4Y A;  1GCQ A;  4Z88 A;  1WX6 A;  1VQP A;  2DXC A;  5D6Y A;  2NUT A;  1JRI A;  1PD1 A;  1EZZ B;  4M7A B;  2BE7 D;  2NYS A;  4L5G A;  5IHN A;  4WF2 A;  2JS2 A;  3THK A;  1SEM A;  1K4U S;  4EMH A;  1Q95 G;  4DBH A;  5KYW B;  1XNI A;  2B86 A;  3CME A;  2L3R A;  1VQ5 A;  1VQ5 Q;  2EQU A;  5GAM d;  5IHI A;  2CP7 A;  2QEX T;  3NPF A;  4M75 F;  3CME Q;  1C6V X;  3EG0 A;  4ZN1 A;  3L2W A;  3WVD B;  4M75 C;  2CS7 A;  2YXY A;  3FIF A;  5IH2 A;  2COZ A;  2DL8 A;  7AT1 B;  1SRM A;  3OS1 A;  3QXE B;  1P92 A;  5CKF A;  1D0Y A;  2CGH A;  2FPD A;  2E41 A;  3CCS Q;  2X3W D;  1AZE A;  1YP5 A;  2EGA A;  1NYF A;  3PGG A;  2K5L A;  4C8Q G;  3TSW A;  3JB9 H;  3CC2 Q;  2E4H A;  2A3L A;  2EFI A;  1BI2 A;  3G71 T;  1Y96 B;  2OTL T;  4IUR A;  3JCM f;  2LCC A;  1FMV A;  2RM4 A;  4F7U E;  3OB9 A;  1T0H A;  2EGE A;  5IXF A;  2H8H A;  5LJ5 f;  4JZ4 A;  4HT8 A;  1U1T A;  3JCM e;  2O2O A;  2L89 A;  5IHK A;  2GGR A;  3PNW C;  2DVE A;  4M78 E;  4OMQ A;  3ME9 A;  2RQR A;  3CCV A;  1Q82 C;  2F5K A;  2QI2 A;  4NS5 A;  2XDP A;  1XOV A;  3I56 T;  2SEM A;  3U23 A;  1DJ7 B;  1VQP T;  3VV0 A;  1Q86 U;  4QVZ A;  1M90 U;  2K6D A;  3TEE A;  3CBP A;  2DPP B;  2E6N A;  4V2S A;  1GRI A;  3PMT A;  3CD6 A;  3QO3 A;  2RJE A;  3JB9 D;  5GMK l;  1YJN T;  3HRT A;  3UWN A;  2QGF B;  2EKO A;  3OYA A;  3M56 A;  5EC7 A;  3M57 A;  2E6Z A;  1NZ9 A;  1QW1 A;  3JAM E;  3CCJ A;  2PZ1 A;  1RI9 A;  1TXQ A;  3AHU A;  1YJW Q;  3OYG A;  1V1C A;  1KHI A;  4GLM A;  1VQ8 T;  3TQ7 P;  1QVG A;  1KG1 A;  5GMK i;  3RMQ A;  1RAA B;  2NWM A;  3RKY A;  3M0S A;  2LQK A;  1UJY A;  3L2Z A;  3QWX X;  3OS2 A;  1Q7Y R;  3MEU A;  4C0D C;  1PD0 A;  2HDA A;  2MYS A;  2O4X B;  1VQO T;  1VQK Q;  2CH4 W;  2ROT A;  1W2B P;  2XID A;  3CQT A;  5ECA A;  1D1C A;  3CD6 T;  1D1B A;  2LCS A;  1SHG A;  3L2U A;  2LCL A;  2OAW A;  1SRL A;  4RTU A;  2ZPG B;  2HEQ A;  2LDM A;  5GAM h;  3EGX A;  4EMG A;  1M5Q 1;  2MMP A;  2OX7 A;  2E64 A;  2OAU A;  3VYG A;  4HCC A;  1YCS B;  3JCM b;  4OB2 B;  1ZUU A;  5GMK e;  2JTM A;  5KYX A;  2H3E B;  1EX4 A;  1PCX A;  2QGG A;  4M78 D;  4M78 C;  4NL3 A;  1ZSZ A;  1YI2 A;  1M3A A;  1AOJ A;  2M0O A;  1MMN A;  4PFP A;  2KRN A;  4F16 A;  1M1G A;  3G71 A;  4XTZ A;  3OQ5 A;  2XKO C;  2KMT A;  2KT1 A;  3CCR A;  1OPL A;  3JV3 A;  1OPK A;  3PMI A;  4XTY A;  1IGU A;  3G4S A;  1M2O A;  1JQQ A;  1T0J A;  4ATO A;  5DLQ E;  4FT4 A;  3UA6 A;  1LJO A;  3NMZ C;  3M0R A;  3QZ5 B;  2L0A A;  2JJ9 A;  4FYX B;  4AG2 C;  2B8A A;  1NEG A;  2LVM A;  1BI0 A;  2GQV A;  4Z8A A;  2JM8 A;  1YN8 A;  3LW5 E;  2QEX A;  1YIJ T;  4L6V 5;  3LH5 A;  5GJW B;  2V1R A;  1RAE B;  4J6X A;  1M8M A;  5L8R E;  4BD3 A;  2CSQ A;  3CME T;  2M02 A;  3CEY A;  1KQ1 A;  4KT0 E;  2HKQ B;  2M16 A;  4XU1 A;  2EIF A;  2EGC A;  3CC2 A;  1EFN A;  4MZP A;  2DKG A;  2VUB A;  3V8J A;  4EMK C;  3O5Z A;  2R5A A;  4CC3 A;  3CCS A;  1PC0 A;  4JJB A;  1JXO A;  3TSZ A;  3CCS T;  1HXD A;  1YCY A;  5GAN 3;  2RHZ A;  1TS9 A;  4C5E A;  4XU2 A;  5FU6 C;  1PRL C;  3NTK A;  4CC2 A;  4J9I A;  1XTD A;  2OTL Q;  4KH0 B;  4AFQ C;  3ER0 A;  4JRK A;  4N4I A;  2WAC A;  1ZX6 A;  4AFZ C;  1OU8 A;  1PSE A;  2GTJ A;  3L2Q A;  3CC7 A;  2COW A;  2VWF A;  2RA2 A;  1JEG A;  3CXC A;  1VUB A;  2OTL A;  3CCE T;  1HD3 A;  2PVO B;  2JT4 A;  3VUB A;  1QVG P;  1NM7 A;  1SSH A;  1R8O B;  1V29 B;  3OYB A;  2G6F X;  2KRM A;  3REB B;  2EBP A;  3PVQ A;  4DEY A;  1VQP Q;  4C92 E;  2CP0 A;  3TU4 K;  4M75 B;  5FW9 A;  3CXC S;  3RKW A;  2ESW A;  2A37 A;  2COY A;  3VS4 A;  2ZZD A;  2O9V A;  2ZAE A;  4DQ2 A;  2E5K A;  3P8H A;  3CCE A;  5CKD A;  4J6Y A;  4QQD A;  1YFN A;  4E7I A;  4C92 C;  3CBO A;  1SG5 A;  2D0Q B;  2RN8 A;  3EGX B;  5GAN f;  2VC8 A;  1B34 B;  1BCO A;  4ELY C;  2KNB B;  2V26 A;  4FL6 A;  2P4R A;  5GAO q;  3S3N A;  4RTV A;  1W2B S;  3CPW A;  4D6W A;  2RHX A;  2KRS A;  2QAS A;  4PJO G;  3ZFJ A;  2AT1 B;  3T9N A;  3M0Q A;  3BE3 A;  2DZ9 A;  3CCR Q;  2BZ8 A;  1M3C A;  1ZUK A;  2YSQ A;  3EG2 A;  4DBQ A;  4JJD A;  2FZK B;  2BE9 B;  2L5Q A;  1W2B A;  1YJ9 Q;  1K73 C;  4M7D D;  2ZPI B;  3EG9 B;  1B34 A;  3H6Z A;  2FL7 A;  3QDR B;  3LWH A;  1TU0 B;  3I5S A;  4LXC A;  2X4X A;  4IUQ A;  2AZS A;  2RJC A;  1KK7 A;  2MF2 A;  3H0I A;  3H0H A;  3P8D A;  4OMM A;  3SWN C;  2ED1 A;  2EWN A;  1K0X A;  3UA7 A;  1G5V A;  1OU9 A;  4M75 E;  1VQ8 A;  2BZX A;  5LJ3 h;  3F70 A;  2RQV A;  4QT7 A;  5GAO r;  1PG5 B;  1OQK A;  4X34 A;  1W6X A;  4MDW A;  1Q86 R;  1M90 R;  1Z9Q A;  2RI2 A;  3RNJ A;  2IPO B;  3M4Y A;  2RB6 A;  1YWP A;  4ZGJ B;  1SHF A;  3GPL A;  4JZ3 A;  2GBQ A;  3N5B B;  3A8O B;  1YJN A;  2KE9 A;  2M51 A;  4EMK A;  2AKK A;  2QDL A;  4M77 B;  1R77 A;  2V8J A;  3MKD A;  3OYJ A;  1M2V A;  5FWC A;  3FJ5 A;  1Y57 A;  2L3S A;  2MAM A;  5HY6 A;  3EHR A;  3QHS A;  3OY9 A;  2DL5 A;  1WLP B;  2O88 A;  2KBT A;  4C5I A;  4A63 B;  2F5T X;  4CC7 A;  4LDV A;  1TH7 A;  1AZG B;  3QJ6 A;  1UUE A;  1Y96 A;  4OMO A;  1Q81 C;  2EYY A;  1YJW A;  2F2W A;  3FEO A;  3CCM Q;  1QVF P;  3VS7 A;  1YIJ Q;  3I35 A;  4N4G A;  1YIT T;  2IG0 A;  4A54 A;  2JUF A;  5DLO A;  2G3R A;  2BUD A;  3QII A;  3CCJ Q;  2XIC A;  2JZ2 A;  4Y92 A;  1NJI C;  3VYH B;  1X43 A;  2CUD A;  2KYM A;  4M77 C;  1I81 A;  2EYW A;  4B6M A;  4OP0 A;  3SWN B;  4J9E A;  3A8L B;  3PIO A;  3MO8 A;  4XK8 E;  3OS5 A;  3RBB B;  2ENM A;  4BI3 A;  2LZ6 B;  2OTJ T;  2RNA A;  3M9Q A;  2FRW A;  2DBK A;  1VIE A;  4BB7 A;  3CPF A;  2NUZ A;  1WHK A;  2KT8 A;  2MCN A;  1KD1 R;  3VS2 A;  2PU9 B;  2P0P A;  1HYO A;  4RUG A;  4ESR A;  1JXM A;  3ZBD A;  2ROL A;  1H64 1;  2JXB A;  2RHU A;  3VS6 A;  3CPW S;  5GAN d;  3UF4 A;  5LJ5 e;  4X9D A;  3P8B B;  4M75 D;  1MUZ A;  4JS5 A;  3OMG A;  1BI1 A;  4M7D C;  1K9M R;  1EIF A;  2BIV A;  3CCE Q;  3QUI A;  4JPB W;  1W4S A;  2KDS A;  3G7Z A;  4L59 A;  4XTX A;  1MHN A;  2O01 E;  4C92 F;  5I21 A;  1TUC A;  3QZ9 B;  5CK9 A;  2QXF A;  3E2U A;  4E6R A;  3OW2 A;  3G1J A;  2EKH A;  1AD5 A;  2F1L A;  1VQM A;  4IUT A;  3V8L A;  1M3B A;  4DBR A;  5J39 A;  4PFZ A;  4B9W A;  2F2V A;  2L2P A;  2C06 A;  4XTU A;  2A28 A;  3DB4 A;  1ACM B;  2DRK A;  3CCL T;  1NJI R;  3TCJ A;  2LP5 A;  4RTT A;  5LL6 S;  2DL4 A;  2VXF A;  4QW2 A;  3HTR A;  2ZPF B;  1D0Z A;  2HD0 A;  1WPY A;  2DMO A;  1VQ7 A;  3VKI A;  2BZY A;  5M9O A;  2YUP A;  3RMS A;  1JB0 E;  4WCI A;  3M0U A;  1X6O A;  4J8O A;  2KVQ G;  2X51 A;  2QK0 A;  5C6S A;  2DXT A;  1QWF A;  5J26 A;  3CCR T;  4OB3 B;  2FPE A;  2NLU A;  5A0D A;  4J9D A;  5IT9 E;  2EJ9 A;  1NEB A;  1YHQ A;  1YJ9 T;  2CT3 A;  3EFR A;  2HBW A;  4D8K A;  2HCK A;  1ZBJ A;  2JTE A;  4IKF A;  1UEC A;  3EG3 A;  3OBY A;  2PQW A;  1UGP B;  3CCQ A;  3OYN A;  2VXE A;  4E7S A;  2FPF A;  1TOV A;  5AT1 B;  1OOT A;  1VQN T;  4KGX B;  4N0A C;  2E12 A;  3BY7 A;  3NGP A;  2JN0 A;  2RQT A;  2EVR A;  4LUE A;  1CKB A;  2E3I A;  5FWB A;  3JCM d;  2HAX A;  3RDV A;  2DA9 A;  3G4S Q;  4HT9 A;  2LNV A;  1WHM A;  1VYU A;  1N8R U;  2DLP A;  5CQX A;  3V7C A;  4J5Y A;  1QVG S;  4C8Q F;  3Q1J A;  3HRU A;  4M4Z A;  2GTO A;  2KI7 A;  3C0C A;  2DEQ A;  3DKM A;  2RI5 A;  1D0X A;  4GBQ A;  1YI2 Q;  5L23 A;  2OI3 A;  4J9G A;  4JRQ A;  3WVE B;  1X27 A;  3SHW A;  4R55 A;  1G83 A;  1BBZ A;  2HQX A;  2I2L A;  2P4T A;  5CAI A;  5LJ5 h;  2X4J A;  1ZUY A;  4CC4 B;  6AT1 B;  4JJN K;  4RCC A;  1WQ7 A;  4E2F B;  2MIO A;  4M77 D;  2AHJ B;  1BI3 A;  2AKL A;  4GY5 A;  1RAB B;  2SRC A;  2BTT A;  4FCY A;  2K79 A;  3CCM T;  1YIT Q;  2MOX A;  3CCJ T;  2YT6 A;  3S6W A;  3JCM J;  3X24 B;  4C5G A;  3UDC A;  4C8Q E;  5DM7 R;  2FZG B;  4LUD A;  2FG0 A;  2YLB A;  2CZ6 B;  3I9Q A;  3ASK A;  4C8Q B;  1VQ9 T;  2YWW A;  1ABO A;  1UHF A;  3MP6 A;  5GAN 6;  1YWO A;  4RTY A;  2OTJ Q;  3I56 A;  4M7D B;  2A36 A;  5DY9 A;  1ZSZ C;  1R0B G;  3CCU Q;  2DIL A;  5GJV B;  3JCM V;  3FRN A;  1WZO A;  1IRE B;  1LCK A;  3MHX A;  3ULR B;  5KYW A;  3PIP A;  3VS5 A;  1JJ2 A;  5LJ3 f;  4OF1 A;  4D8D A;  2KXD A;  3MCA B;  2HZY A;  1U3O A;  1IRX A;  1WYX A;  5KE3 A;  1RAC B;  3M5A A;  3LYI A;  5A2Q E;  1OZ3 A;  1WXU A;  3JCM W;  1QVP A;  3JB9 I;  4PJJ A;  3LLR A;  4BE0 A;  1JJ2 S;  1ZLM A;  2PNI A;  2ABL A;  4P5N A;  4PKC C;  4ZTF A;  5GAN j;  1NLP C;  2LJ1 A;  1S1N A;  4PL6 A;  3OSV A;  4C0D B;  2E10 A;  1TWB A;  2K5I A;  3BFM A;  3FB9 A;  4OML A;  4HCK A;  3A8H B;  3EFS A;  3JCM c;  4M78 G;  2CYZ B;  1KD1 U;  1BYM A;  1K0S A;  3CCV Q;  2O9S A;  2YRD A;  1E7O A;  3QDF A;  5GAO m;  4LDX A;  3O8V A;  4EIK A;  1NG2 A;  3CCL Q;  2LNH B;  1PKS A;  2CRE A;  2K2M A;  2GQI A;  1NLO C;  4PJN A;  1ZBX A;  1MNE A;  4M7A F;  1AWO A;  2HQH A;  1I0C A;  3GNG A;  1O9S A;  1GCQ C;  4BY6 B;  4QVD A;  1X75 C;  4C8Q D;  5LJ5 g;  2V8I A;  3OYH A;  1VQ4 T;  4DBF A;  1QKW A;  1KJW A;  4A4E A;  2E70 A;  1ZSG A;  4RMO A;  1Z9Z A;  2YUO A;  1K9M U;  1XJW B;  2FZC B;  1WI7 A;  4RCB A;  4IUP A;  1TSF A;  1N8R R;  2CSI A;  5I2S A;  4ANJ A;  3SB2 A;  4YTL A;  3M0P A;  2LMJ A;  5LJ3 j;  5IN1 A;  2FO0 A;  3FDR A;  2CP2 A;  1RAI B;  3IQL A;  2A0F B;  1K1Z A;  1BKB A;  1I1J A;  2WSF E;  1SF9 A;  2FEI A;  2R57 A;  1VQN Q;  3J81 E;  2KRO A;  4C92 G;  1M4Z A;  2RO0 A;  1JU5 C;  2R58 A;  5HK3 A;  2QA4 A;  3R6N A;  5KE2 A;  2K5F A;  3V7R A;  5HK0 A;  3G4S T;  1K73 U;  4MMK A;  2X3X D;  3C95 A;  3LX7 A;  1NPR A;  3CPW P;  4E7K A;  2EQK A;  2ZGW A;  1MGQ A;  2KEA A;  2ED0 A;  4O5V A;  2CUB A;  4LDU A;  1GFC A;  1PSF A;  1YI2 T;  3RR6 A;  3QKJ A;  4WTO B;  1JBM A;  3I55 Q;  2XD0 A;  4OB0 B;  2D9T A;  2XDB A;  1Q82 U;  1I5L A;  3TVT A;  4R0K A;  4Z89 A;  4JUV A;  2EJG A;  1B07 A;  2LQ8 A;  2VGN A;  2EYQ A;  1Y07 A;  3NTH A;  1QQJ A;  2GCX A;  4XU0 A;  4BE1 A;  2EJF A;  2L3Q A;  1Q86 C;  1M90 C;  4HKE A;  1LPL A;  3EFO B;  1OX9 A;  1UGV A;  1B7T A;  5KCO A;  3HSB A;  3M0T A;  3OYC A;  1RUW A;  5GAN 2;  4BI4 A;  1PNJ A;  3OMC A;  1BCM A;  3I55 A;  2FRY A;  2K4Y A;  4HA8 A;  1KIK A;  4O6J A;  2JMA A;  2M9U A;  2H3J A;  2C0T A;  2MI6 A;  4AFU C;  1VQ9 Q;  1H8K A;  3OYK A;  2LTO A;  1VQO A;  1N27 A;  5CVI A;  3E9G A;  2RJF A;  3VS1 A;  4FYV B;  5CCA A;  1X2Q A;  4ELZ C;  4QVC A;  2DYB A;  4J7I A;  1WHG A;  1D3B A;  3V8K A;  3M59 A;  1Y71 A;  4IIO A;  3HRS A;  3CCU T;  3R6O A;  1SKU B;  4IUU A;  2CDT A;  2Z0W A;  4LE9 A;  4FW1 A;  1GFD A;  2LQN A;  3HPW A;  5GAN 7;  1VQ6 Q;  1MMA A;  4M7A A;  2LJ0 A;  5LJ5 d;  2LX9 A;  2LRQ A; 
#chains in the Genus database with same CATH homology
 2L89 A;  1VQN A;  1H3Z A;  2FYK A;  3E1S A;  1WQW A;  1EIF A;  1U1S A;  2BIV A;  3L42 A;  2DVE A;  3PNW C;  3SFM A;  3X25 B;  2QQA A;  3NFC A;  4M78 E;  5CKH A;  3ME9 A;  3QUI A;  3CCV A;  1G3Y A;  1Q82 C;  2F5K A;  3GP8 A;  1W4S A;  2ZCF B;  2QQB A;  2ZPE B;  2KDS A;  2XDD A;  2QI2 A;  2X35 A;  3G7Z A;  1MHN A;  1FWZ A;  2O01 E;  4J7F A;  4L59 A;  4XTX A;  4C92 F;  4C8Q C;  5GAM f;  5I21 A;  3QZ9 B;  5CK9 A;  3S3M A;  4NS5 A;  3X28 B;  2XDP A;  4C0F A;  1XOV A;  2K2V A;  2QXF A;  1ZQ1 A;  3JCM e;  3I56 T;  3OW2 A;  1DJ7 B;  2JTF A;  3TRE A;  5J3B A;  3VV0 A;  1VQP T;  1Q86 U;  4QVZ A;  1M90 U;  5FRN A;  1YJ9 A;  3OYY A;  3JRZ A;  3TEE A;  3CBP A;  2DPP B;  2E6N A;  1VQM A;  4IUT A;  3V8L A;  4V2S A;  3PMT A;  2E65 A;  3QJY A;  4M7D A;  5J39 A;  3MP1 A;  4B9W A;  3CD6 A;  2C06 A;  3QO3 A;  4XTU A;  2RJE A;  3CCV T;  5GMK l;  3JB9 D;  2DZC A;  1YJN T;  3HRT A;  1FX7 A;  2RHY A;  1KQ2 A;  3JCM X;  3DB4 A;  3UWN A;  4PJO F;  2EKO A;  5GAN 4;  3OYA A;  3M56 A;  3OYE A;  3CCL T;  3TCJ A;  4BAC A;  3M57 A;  2E6Z A;  1NZ9 A;  1QW1 A;  3QG1 A;  3JAM E;  3CCJ A;  1U8R A;  3LH0 A;  5LL6 S;  4PJO A;  2DD5 A;  4F7U A;  2ZPB B;  2VXF A;  3AHU A;  4BE2 A;  4CI0 C;  4M7D G;  4M7A C;  1BIB A;  3OYG A;  1KHI A;  1VQ8 T;  2YHT A;  4QW2 A;  3J80 E;  4E7L A;  1QVG A;  4ZGD B;  1KG1 A;  4LDW A;  5GMK i;  2ZPF B;  3RMQ A;  3JCM h;  2HD0 A;  1WPY A;  4M78 A;  3RKY A;  4X9C A;  5KCH A;  2LQK A;  3L2Z A;  3FC3 A;  3OS2 A;  3MEU A;  2VV5 A;  3RER A;  3OYM A;  4C0D C;  1VQ7 A;  2KAF A;  5KH6 A;  4A53 A;  4ZTF A;  4M7A G;  3VKI A;  5M9O A;  1QVF A;  2GF7 A;  3RMS A;  3E19 A;  3L2R A;  2O4X B;  1JB0 E;  1VQO T;  2CZ1 B;  2CZ7 B;  4JLG A;  1X6O A;  4J8O A;  2KVQ G;  2O4X A;  3QYH B;  4FSX A;  3HL8 A;  5GAO l;  4TVR A;  5C6S A;  4M7D F;  2FHD A;  3GNF B;  2XID A;  2DXT A;  4FM4 B;  5J26 A;  3CCR T;  4OB3 B;  1I4K 1;  3CD6 T;  4BUG A;  2PVD B;  4NL2 A;  2NLU A;  5A0D A;  4M78 B;  4N0A A;  5GAM e;  3L2U A;  5CR2 A;  1ZHI A;  2LCL A;  2RD1 A;  3VU3 C;  5FLX E;  2EJ9 A;  2Y4Y A;  5IT9 E;  4M77 F;  4MDX A;  1YHQ A;  1UB4 A;  1YJ9 T;  1NPP A;  3OA6 A;  3S3O A;  2ZPG B;  3HP9 A;  3OS0 A;  2LDM A;  1QP3 A;  3EFR A;  4M7A D;  5GAM h;  4M75 G;  4EDU A;  5CKE A;  4EMG A;  4LD6 A;  1VQ4 A;  4IKF A;  3OBY A;  4JRI A;  1M5Q 1;  2MMP A;  1UGP B;  2PQW A;  4F7U B;  4PJO E;  3M54 A;  3RES A;  1VQL A;  2E64 A;  2OAU A;  3VYG A;  4HCC A;  3CCQ A;  3OYN A;  4M77 G;  2CZ0 B;  2VXE A;  4OB2 B;  3JCM b;  5GMK e;  2JTM A;  3JCM g;  2XK0 A;  1VQN T;  2HNI A;  2QDY B;  4C5H A;  4N0A C;  2E12 A;  2E5Q A;  3BY7 A;  4M78 D;  1KQS S;  4E7J A;  3BDL A;  4M78 C;  2JN0 A;  2DXU A;  3EAE A;  4NL3 A;  5FU7 C;  1YI2 A;  5LJ3 d;  3SDZ A;  3JCM d;  3V7S A;  1YHQ T;  2M0O A;  2HAX A;  4FT2 A;  2GFU A;  3GLX A;  1M1G A;  1N6A A;  2XHC A;  3G71 A;  2LNV A;  4XTZ A;  5D6W A;  4HT9 A;  4QQ6 A;  3JSC A;  3CCU A;  1N8R U;  3MP8 A;  3OQ5 A;  5CQX A;  2XKO C;  4J5Y A;  2KMT A;  4M77 E;  3V7C A;  4C8Q F;  3CCR A;  1QVG S;  4BDZ A;  2HBP A;  3Q1J A;  3HRU A;  2M1H A;  5I2M A;  1KD1 C;  1UGR B;  3PMI A;  4XTY A;  4HCB A;  2MWO A;  2JVV A;  4DOW A;  3G4S A;  4FIB A;  2EAY A;  2DEQ A;  3DKM A;  2RI5 A;  1Q81 U;  1HK9 A;  1K8A C;  2QQ9 A;  4RG2 A;  4ATO A;  5IAY A;  4C0G A;  5DLQ E;  3FJP A;  4JRQ A;  4FT4 A;  2DJZ A;  3WVE B;  2DAQ A;  4OGC A;  4R55 A;  1LJO A;  5CIU A;  4CRI A;  3QZ5 B;  1RI0 A;  4B9X A;  2HQX A;  2I2L A;  2P4T A;  5CAI A;  3I55 T;  2R5M A;  5LJ5 h;  2X4J A;  3J7A F;  3HFN A;  4RCC A;  4JJN K;  1WQ7 A;  4OB1 B;  2B8A A;  5CQY A;  4M77 D;  2AHJ B;  1BI3 A;  2LVM A;  4GY5 A;  1BI0 A;  2GQV A;  3LW5 E;  2QEX A;  4DOV A;  3CCM T;  1YIJ T;  4L6V 5;  1YIT A;  1VQ5 T;  2K57 A;  3CCJ T;  4J6X A;  3S6W A;  5L8R E;  4BD3 A;  1OZ2 A;  3JCM J;  3CME T;  3CCL A;  1OYX A;  3CEY A;  3X24 B;  3OBW A;  3UDC A;  4C5G A;  1KQ1 A;  4C8Q E;  4KT0 E;  4EPC A;  5LJ5 j;  3M53 A;  5DM7 R;  2EQJ A;  2PUK B;  3MET A;  3OSS C;  2M16 A;  4XU1 A;  5A0G A;  3RKX A;  2EIF A;  3CC2 A;  2YLB A;  2XI9 A;  3C12 A;  2CZ6 B;  3ASK A;  4MZP A;  2DKG A;  2RHI A;  2VUB A;  3ZEH A;  4C92 A;  4OVA A;  1Y7X A;  3V8J A;  4C8Q B;  3INZ A;  2L8D A;  1VQ9 T;  4EMK C;  2LT4 A;  1M1K U;  3A8G B;  2RH2 A;  3MP6 A;  2R5A A;  3QPH A;  5GAN 6;  3CCS A;  3FLG A;  4NOY A;  1N8R C;  3URG A;  3CCS T;  3I56 A;  2KY9 A;  1HXD A;  3GF5 A;  1YCY A;  5GAN 3;  2RHZ A;  1VQ9 A;  1IZ6 A;  4PLI A;  4C5E A;  4XU2 A;  4M7D B;  5FU6 C;  3UT1 A;  3NTK A;  5DY9 A;  3M4G A;  3VUZ A;  1WJQ A;  2YRV A;  3CC2 T;  3OYF A;  4E7H A;  4XTW A;  3JCM V;  3FRN A;  3OYL A;  5LJ3 g;  1IRE B;  3MHX A;  2DK3 A;  5GAO p;  1XTD A;  3PIP A;  4PJO C;  3MEW A;  3MEA A;  1JJ2 A;  4PJO D;  3ER0 A;  5LJ3 f;  2KSS A;  4JRK A;  4OF1 A;  4N4I A;  3CC4 A;  2WAC A;  3QSU A;  3VJP A;  4C0Z A;  2ZPH B;  1VQ6 T;  5GAN h;  5D6X A;  2GFA A;  3MCA B;  4F7U F;  5LJ3 e;  4VUB A;  2RK2 A;  1PSE A;  2A7Y A;  3L2Q A;  3CC7 A;  1KC8 C;  1M1F A;  4A4F A;  5KE3 A;  2RA2 A;  3M5A A;  4OGE A;  4BI8 B;  3CXC A;  3LYI A;  5A2Q E;  4MML A;  1VUB A;  3BDU A;  4GLK A;  2OTL A;  3CCE T;  1VIF A;  2RK1 A;  1OZ3 A;  3JCM W;  3OYI A;  1QVP A;  3KXT A;  2FVU A;  1N9R A;  3JB9 I;  3OYD A;  3CMA A;  3DB3 A;  3JB9 G;  3LLR A;  5GMK j;  3X20 B;  4BE0 A;  1JJ2 S;  4XAX B;  1LNX A;  1NE8 A;  2PVO B;  4DA4 A;  4M78 F;  3VUB A;  1QP2 A;  1R8O B;  1V29 B;  4Z02 A;  1FXX A;  3C94 A;  4J6W A;  4P5N A;  4PKC C;  3OYB A;  2XG8 D;  3KUF A;  4PNO A;  4JS4 A;  5GAN j;  4J83 A;  2V8K A;  4QQG A;  4C92 E;  3TU4 K;  4KUD K;  2OTJ A;  4PL6 A;  4M75 B;  1AHJ B;  3OSV A;  3PFS A;  4C0D B;  2E10 A;  3CXC S;  2K5I A;  2LC4 A;  3BFM A;  3RKW A;  2EQM A;  3FB9 A;  5FRM A;  1D3B B;  1G3S A;  1YBY A;  3A8H B;  3EFS A;  4KBM B;  4BY6 C;  3JCM c;  2CYZ B;  2ZZD A;  3QYG B;  4FU6 A;  4M78 G;  1KD1 U;  1BYM A;  3HFO A;  3CMA T;  4XQ3 A;  4DQ2 A;  2HQE A;  3P8H A;  2MWP A;  1N9S A;  1WGS A;  3CCE A;  5GAO m;  1KQS A;  4LDX A;  1M8V A;  3O8V A;  4ZGE B;  5CKD A;  3G6E A;  4J6Y A;  5A0L A;  5GAO n;  1VQK A;  4QQD A;  3RUX A;  2DD4 A;  3OW2 S;  4Y28 E;  2WSC E;  2WSE E;  4E7I A;  1SSF A;  4HCZ A;  4C92 B;  1ZBX A;  4M7A F;  4C92 C;  5GAN e;  3CBO A;  4C92 D;  3UPU A;  1M9S A;  3M55 A;  4JDS A;  4ZN3 A;  5CO7 A;  1YJW T;  2VGM A;  1BIA A;  2D0Q B;  5FRO A;  5EG2 A;  5GAN f;  1UEB A;  2VC8 A;  1B34 B;  4LDY A;  4ELY C;  3GNG A;  1WNL A;  1O9S A;  2F69 A;  5GAN 5;  5C0M A;  2IVW A;  3CCQ T;  4FL6 A;  2DIQ A;  4BY6 B;  1UGQ B;  3M58 A;  3E9F A;  4QVD A;  5GAO q;  3S3N A;  1X75 C;  2QTX A;  2XU8 A;  4C8Q D;  5LJ5 g;  2V8I A;  3OYH A;  1VQ4 T;  4M7D E;  3A5Z B;  4UC4 A;  1G3T A;  1W2B S;  3CPW A;  4A4E A;  2P0Q A;  1OI1 A;  2E70 A;  4D6W A;  4ME7 A;  1NJI U;  2E1H A;  2LT1 A;  2RHX A;  3SD4 A;  1VQK T;  2BKD N;  5GMK m;  4RMO A;  4ZTJ A;  3DLM A;  4PJO G;  3ZFJ A;  3JCM Q;  4JRP A;  1K9M U;  3T9N A;  2VYT A;  3JCM P;  3L1A A;  2DZ9 A;  4RCB A;  2DTI A;  4IUP A;  3A8M B;  1RL2 A;  4MZM A;  5FU7 B;  2Y4X A;  2PUO B;  1WJR A;  3RIR A;  5I2S A;  4A4G A;  3QBY A;  2L5Q A;  1W2B A;  3SB2 A;  2Y90 A;  1K73 C;  4YTL A;  4M7D D;  2ZPI B;  1QVF S;  1B34 A;  1UGS B;  2DO3 A;  2DXB A;  3H6Z A;  3MEV A;  2QA4 T;  2FL7 A;  3QDR B;  5IN1 A;  4A4H A;  5LJ3 j;  3LWH A;  3FDR A;  2QQS A;  1VQ7 T;  4M77 A;  2X4X A;  4IUQ A;  4EMK B;  3PTA A;  2FB7 A;  2RJC A;  4IUV A;  2MF2 A;  3L2V A;  4JLI A;  2YLC A;  3P8D A;  5AYF A;  3SWN C;  1BKB A;  4PJO B;  3JB9 F;  2EWN A;  2QQR A;  2WSF E;  2KQW A;  3DLL A;  1S72 A;  1G5V A;  4R56 A;  1S72 T;  3PT9 A;  2R57 A;  4M75 E;  1VQ8 A;  3GOX A;  5FU6 B;  3J81 E;  1K9M C;  2K3Y A;  2PVG B;  1M1K C;  3GIB A;  3CC7 T;  2JOY A;  4N4H A;  4C92 G;  1M4Z A;  2RO0 A;  3H8Z A;  1XQH A;  5LJ3 h;  4F7U G;  3F70 A;  2D6F A;  2R58 A;  5HK3 A;  2CKK A;  2QA4 A;  5GAO r;  5KE2 A;  4X34 A;  2K5F A;  4MDW A;  4XU3 A;  1X01 A;  2RI2 A;  3V7R A;  3M4Y A;  4M75 A;  5HK0 A;  2RB6 A;  3G4S T;  4ZGJ B;  4A4K A;  1K73 U;  1I8F A;  4MMK A;  5GAN g;  3GPL A;  3JB9 J;  3N5B B;  3A8O B;  3C95 A;  3LX7 A;  1NPR A;  4E7K A;  1YJN A;  4Q5W A;  2EQK A;  1Q7Y C;  4EMK A;  2ZGW A;  1MGQ A;  3KBG A;  4M77 B;  4RKU E;  5CKB A;  3X26 B;  4O5V A;  4E47 A;  1YIJ A;  2JNG A;  2RI3 A;  3WXM B;  1VQM T;  1WJS A;  2X4Y A;  2V8J A;  4LDU A;  3OYJ A;  1PSF A;  4II1 A;  1YI2 T;  2MAM A;  1VQP A;  2DXC A;  5HY6 A;  5GAN 8;  5D6Y A;  3QHS A;  1KC8 U;  1JRI A;  3QKJ A;  3OY9 A;  2DTO A;  2K3X A;  3LGL A;  4M7A B;  5HKC A;  1O75 A;  1JBM A;  1Q7Y U;  4L5G A;  4C5I A;  4OB0 B;  2XD0 A;  2D9T A;  2F5T X;  4WF2 A;  4LDV A;  1TH7 A;  2XDB A;  1G3W A;  1Q82 U;  4BDY A;  1I5L A;  4XTV A;  5GAM j;  3QJ6 A;  4EMH A;  4JUV A;  2EJG A;  2LQ8 A;  1Y96 A;  1VQL T;  1Q81 C;  2VGN A;  1XNI A;  2EYQ A;  3CME A;  1Y07 A;  1LOJ A;  3NTH A;  1YJW A;  3FEO A;  2GCX A;  4XU0 A;  2L3R A;  4KUI A;  4N4G A;  2EJF A;  4BE1 A;  1YIT T;  1VQ5 A;  2IG0 A;  4A54 A;  1Q86 C;  1M90 C;  2EQU A;  2JUF A;  2G3R A;  2BUD A;  3QII A;  5DLO A;  3LGF A;  5GAM d;  2QEX T;  2XIC A;  2JZ2 A;  3HKS A;  4HKE A;  3CCM A;  3CBM A;  4M75 F;  4LD9 K;  3G6E T;  4ZN1 A;  1NJI C;  3VYH B;  3L2W A;  5KCO A;  3WVD B;  2X4W A;  3HSB A;  3OYC A;  4M75 C;  4M77 C;  1I81 A;  5GAN 2;  4BI4 A;  2CS7 A;  3FIF A;  3OMC A;  4C8Q A;  4PLL A;  3I55 A;  2K4Y A;  4OP0 A;  3SWN B;  4HA8 A;  2DIG A;  3SWN A;  5GAM g;  3OS1 A;  4O6J A;  3A8L B;  3QXE B;  3PIO A;  3MO8 A;  2M9U A;  1KHC A;  2H3J A;  2KK4 A;  2MI6 A;  4XK8 E;  3HHT B;  1P92 A;  3OS5 A;  5CKF A;  2CGH A;  4BI3 A;  2LTO A;  3OYK A;  1VQO A;  3LWI A;  2OTJ T;  2E41 A;  1N27 A;  5CVI A;  3M9Q A;  3E9G A;  2RJF A;  4OMF B;  5CCA A;  1VIE A;  4ELZ C;  4QVC A;  4BB7 A;  3CPF A;  3PGG A;  2K5L A;  4MZT A;  4J7I A;  4C8Q G;  1D3B A;  4KUL A;  3JB9 H;  2PU9 B;  2P0P A;  3M59 A;  3V8K A;  4M7A E;  1Y71 A;  3CCU T;  3HRS A;  3R6O A;  2A3L A;  3NTI A;  3ZBD A;  2EFI A;  1BI2 A;  3G71 T;  1Y96 B;  1H64 1;  2OTL T;  4IUR A;  4RG8 A;  2LCC A;  2RHU A;  3JCM f;  2RM4 A;  4IUU A;  4F7U E;  3OB9 A;  5GMK h;  5GAN d;  3CPW S;  3BW1 A;  5LJ5 e;  4X9D A;  2P0K A;  2DTH A;  3HPW A;  2RJD A;  3P8B B;  4Y91 A;  5LJ5 f;  5GAN 7;  1K8A U;  4M7A A;  4M75 D;  4HT8 A;  1U1T A;  3C4S A;  1VQ6 A;  5LJ5 d;  4JS5 A;  3OMG A;  2LX9 A;  1GXI E;  2LRQ A;  3CC4 T;  1BI1 A;  4M7D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...