3E9GA

Crystal structure long-form (residue1-124) of eaf3 chromo domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
107
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Chromatin modification-related protein EAF3
total genus 24
structure length 107
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9gA01
2YRVA 4A4HA 5IAYA 2HQEA 2L8DA 2R57A 2RJFA 2F5KA 3LGLA 4FU6A 5FRNA 4PLLA 4A4GA 2RJCA 4IUQA 4N4IA 3L2QA 4C5GA 5KCOA 2LTOA 2X4XA 3OYBA 2RI5A 3OYMA 3UT1A 2RHZA 4RG2A 4E7KA 1RI0A 2CKKA 2XDPA 3OQ5A 3OS1A 2RHXA 3L42A 3M9QA 3META 5C6SA 4ZTFA 3BDLA 3NTKA 3PFSA 2GFAA 5J26A 3FEOA 3QBYA 3ME9A 4QQ6A 4X34A 3F70A 3Q1JA 3OYKA 2RO0A 3S3OA 3DLMA 4FL6A 3OS0A 3OS2A 1WJRA 2QQSA 4A4EA 2QQRA 3OYIA 2E6NA 4OVAA 2D9TA 3MEVA 4IUUA 5IN1A 2LDMA 4GY5A 5KE2A 4HCZA 3OYEA 4BDZA 4BD3A 3CEYA 4BE2A 2WACA 3L2RA 4C5IA 3L2WA 5J39A 5CIUA 1N27A 4Q5WA 3OYFA 4LD6A 2R58A 3OB9A 5FRMA 1H3ZA 3OMCA 4IUPA 3MEUA 2B8AA 1KHCA 4N4HA 3S3MA 1WGSA 2IG0A 3DB4A 1MHNA 3O8VA 2BIVA 5D6XA 2R5MA 4BDYA 4C5EA 3PNWC 2BKDN 2M0OA 2RI2A 3S3NA 3KUFA 3OYLA 4UC4A 3FC3A 3P8DA 3LGFA 3P8HA 4IUVA 2GF7A 2O4XB 5KE3A 5KCHA 3QJ6A 3GOXA 3DB3A 1OI1A 4BACA 2EQKA 4E7LA 4B9XA 4PL6A 3OYAA 3MO8A 2NLUA 4BE0A 2M16A 3FDRA 3NTIA 4IKFA 1SSFA 4NS5A 4CRIA 5FROA 3OYJA 2EKOA 2L3RA 1WJQA 4QVZA 4IUTA 5D6YA 3ASKA 2K3YA 3MP6A 2X4YA 4BE1A 2JTFA 2RJEA 3PMTA 4E7IA 2LRQA 2PQWA 2RHYA 1WJSA 2RHUA 2BUDA 2MWOA 2VYTA 3MEAA 3OA6A 3MP1A 3L2VA 2EQJA 4C5HA 2LCCA 4B9WA 2RJDA 2RHIA 3QKJA 2DIQA 3OYNA 2XK0A 2R5AA 4II1A 4QQDA 3OMGA 4N4GA 3OYDA 2M1HA 2O4XA 3NTHA 2L89A 3LX7A 3H6ZA 1OYXA 2GFUA 2EQUA 3E9FA 2RI3A 3QIIA 4PLIA 3OYGA 2LVMA 3L2UA 4L59A 3S6WA 5KH6A 5D6WA 1OZ3A 1XNIA 2P0KA 4Z02A 3H8ZA 4QW2A 3ZEHA 4ZTJA 2HQXA 1OZ2A 2EQMA 2MWPA 3E9GA 3MP8A 3LH0A 3C4SA 3SD4A 1G5VA 4QQGA 2DAQA 3UWNA 2X35A 3OYCA 5M9OA 2K3XA 2X4WA 3LYIA 3PMIA 2DIGA 4EDUA 4A4FA 2E5QA 3EAEA 3LLRA 5C0MA 3FLGA 2JZ2A 4IURA 3OY9A 3OYHA 4E7HA 3MEWA 4E7JA 2EFIA 2FHDA 2G3RA
chains in the Genus database with same CATH superfamily
4M77E 2DBKA 1RAEB 1JU5C 2KT1A 4C92F 1Y96B 2RI5A 3MJXA 2ZPGB 3FJPA 3OQ5A 1MV0B 2CP6A 3ZFJA 4F16A 2GFAA 4PFOA 2OJ2A 4FYVB 3OYKA 4C0GA 4J9BA 4DEYA 3MEVA 3OYEA 2DJZA 3JCMh 4GLMA 5IHKA 3VS3A 1U1TA 4C8QF 4KRTA 2KAFA 3OYFA 1OULA 1KHCA 2HSPA 1MHNA 4FM4B 4ANJA 4OGEA 4ORZA 2GF7A 4Z8AA 4ELZC 4HVWA 3JCMX 4OB2B 3NMZC 2GQVA 4DBFA 4BE0A 3CC2T 3SWNB 1JO8A 1JXOA 4HVVA 3GF5A 3CCVT 2CZ6B 1ZBJA 4OMMA 2EBPA 5IH2A 1YNZA 1FXXA 1KJWA 2QTVA 1FX7A 4PJOC 4PJOD 1VQOQ 4M77F 3JSCA 2KI7A 3A8HB 1VQLQ 2FYKA 2JXBA 4RKUE 2E1HA 4C0ZA 3J80E 1X2QA 2KSSA 1QLYA 2I2LA 1MUZA 4GLKA 3J7AF 2DXTA 2HKNA 4RTTA 4LE9A 2DNUA 2X51A 4ZNXA 4J9CA 1F1BB 2DILA 3EGUA 5FRNA 3TSWA 4LDUA 3X24B 2FZCB 1UJ0A 2JN0A 2EKHA 2ATCB 2JJ9A 2QXFA 5CAIA 1VUBA 2JM8A 4KGZB 3GNFB 1UTIA 3M9QA 1WX6A 1H3HA 1U06A 1NEGA 2XG8D 2YRDA 4PKCC 1TS9A 2CDTA 4RTZA 4JRKA 2KK4A 4AFUC 3F70A 1WJRA 2KMTA 4HCBA 1ZHIA 4J8OA 2DL7A 4A4EA 3OYIA 1TU0B 5IN1A 2QAZA 2RA2A 5IT9E 3OW2S 1VQ4A 2GTOA 3I5RA 2E3HA 4C5IA 1YHQA 4JJCA 2EYXA 2MK5A 3MEUA 5GAMf 2WSFE 3SWNA 5LJ3j 5IXFA 4C5EA 3GNGA 2RPNA 1JJ2S 2K6DA 2HQHA 2OAWA 4YTLA 3KUFA 4JZ3A 4J9FA 2F2XA 3P8HA 1BI2A 3VS2A 4ESRA 1EX4A 3V7RA 2VGMA 3VS4A 1UJYA 3CCRA 2ESWA 1M8MA 2QDLA 5KYUB 4LDVA 1WHJA 2NWMA 3M0PA 4J9EA 1I1JA 4M78D 1KC8C 3BFMA 3JCMQ 2P4RA 3LW5E 3I56Q 2DERA 2A36A 2AZSA 5EC7A 3U23A 2E4HA 2CP2A 2K5FA 6AT1B 2F2VA 2YLCA 5GJWB 4D6WA 4EMKB 1M8VA 3EG2A 2CUDA 1GRIA 2M1HA 5CO7A 1WHMA 2OTJQ 3UDCA 1OYXA 2LT1A 2K79A 4A63B 1O75A 4AFZC 2E65A 1U5SA 4QW2A 1LNXA 3GPLA 5IHIA 3CCJA 3UWNA 1U3OA 1VYVA 2CZ7B 1M3BA 5IXBA 1SF9A 4PJLA 4DQ2A 5LJ5d 2KR3A 3OYHA 2FL7A 1VA7A 2DETA 2L8DA 1GFCA 2R57A 2DFUA 4A4GA 4FSSA 3TU4K 4RCBA 4IUQA 1XJWB 1GCQC 4HT8A 3EG3A 3OYMA 3FRNA 1I0CA 2Y90A 3UA7A 3L42A 3OBYA 3HL8A 2DVJA 2DX1A 4X9DA 1OU9A 2JMAA 2RO0A 4E6RA 4J5YA 4RTWA 1Q86R 1FMWA 2QQSA 1RAIB 1J3TA 1E6GA 2KNBB 2K3BA 1B34B 2WACA 3BE3A 1W4SA 2RH2A 1HJDA 1FMKA 1E6HA 5DY9A 1D1CA 2DA9A 2K5LA 4M7AF 1YFNA 2OI3A 2QA4T 2LX7A 2V1RA 3EH1A 4C8QC 3CCJQ 5D6XA 4D8KA 4F7UA 3CPWP 1QVGS 5GAOp 3CCMQ 2BKDN 2OTLT 3TVTA 1YITA 3REBB 1YJNA 3P8DA 4IUVA 3H0IA 1K9MU 2EQKA 1Q95G 4M7DD 2EGCA 2NLUA 1SEMA 4F04B 4J6XA 2EKOA 3CC7Q 1M1GA 3MP6A 1S72A 1VQNQ 1EFNA 5LJ3d 1OV3A 1UGRB 2COYA 2RHUA 3OA6A 3CXCP 3MEAA 5FWCA 1UEBA 1YHQQ 3R6OA 2XK0A 4L6V5 3LX7A 1GCQA 1KC8R 4PLIA 2MYSA 4A53A 3OSSC 5KYWB 3CCUA 2P0KA 3RIRA 3E9GA 4MMLA 4M7DA 2DEUA 4QQGA 1BKBA 5LJ5h 2ZAEA 5GMKi 3LLRA 4M75A 1EZZB 2J6KA 1K9MC 3M56A 1G83A 2HQEA 3CCEA 3OS5A 1I4K1 3NFCA 1PKSA 4CC3A 3CCLQ 1G3SA 3PTAA 1WNLA 2BTTA 2VVKA 1JRIA 3EFRA 1ZX6A 1TUGB 3BY7A 1M2VB 2ED1A 4RTUA 4C92G 3JCMW 3SWNC 2D8HA 5A0DA 3OS0A 4PJMA 4IUUA 3JCMf 5IHNA 3CC4A 3VS5A 1I5OB 3L2RA 4JPBW 1VQ5Q 2B8AA 2A7YA 1YITQ 2DYIA 3MHXA 3RNJA 2LQWA 4PJOE 2IIMA 4J7IA 1Y57A 2VB6A 3QJ6A 1ABQA 2RQUA 5HY6A 1YJWQ 4A4KA 4DA4A 3C0CA 1LJOA 3G71Q 2OTJA 3OBWA 1E7OA 3QWXX 1YJNT 2EW3A 2RQRA 3RR6A 4RUGA 2KY9A 4R56A 1ZA2B 2J06A 3JB9I 1M90R 2EQJA 1Q82C 1TOVA 2KBTA 3OYDA 4C8QB 3N5BB 2GFUA 1WXBA 2EQUA 1KD1U 2EYZA 1FYNA 4TVRA 3EG0A 2Y4XA 5GJVB 1IRXA 2HQXA 1RL2A 4JS4A 4JLGA 3OYCA 3LYIA 4JS5A 4Z88A 2ZPFB 5CQYA 1UHFA 2EJFA 4A4HA 5LJ3g 1Y71A 2NUPB 4M75E 3QXEB 4PNOA 5LJ5e 1AEYA 2D1XA 2XU8A 1Q81R 2YDLA 5KCOA 1LOJA 1IGQA 1RI0A 1VQKA 3EFOB 4BI3A 1YWOA 3A98A 1UE9A 1SSHA 2BZ8A 2E3IA 3JRZA 4CC4B 4OMFB 4F7UF 1Y7XA 3VJPA 3LH5A 3I56A 5KYYA 3PGGA 1OX9A 2KRNA 2LJ0A 1BCOA 4BD3A 3RMQA 4JRQA 2MMPA 2WSCE 3PVQA 1A0NB 1AVZC 4FT2A 5CIUA 3CC2Q 2OTLQ 4KH0B 1IHVA 3SEMA 4IUPA 3VS0A 3CCLA 5DM7R 5GAN8 4M77A 1FWZA 2YHTA 1YIJT 1MNEA 3CD6T 5KCHA 1OI1A 1MV3A 4E7LA 2CS7A 1VQ5T 1K76A 3L1AA 3JB9J 1NE8A 1QP2A 3G6EA 2QK0A 3T9NA 2RJEA 4C92A 2XMFA 1VQLT 1M9SA 1TH7A 2COWA 1RAFB 4ATOA 2M51A 2RJDA 2NUTB 3VKIA 4LN2A 4ZN1A 1KFZA 1Q82U 3M53A 1P92A 1YJWT 2YT6A 1NYGA 4BI8B 4Z02A 2OAUA 2DTIA 1KD1R 3HRSA 3M0SA 2FO0A 3RKXA 1PSFA 4FYXB 2M9UA 4PFZA 2KT8A 2ECZA 3M54A 4J9IA 1W2BA 1VIFA 4LNPA 3SB2A 4ME7A 3L2QA 3X25B 2KEAA 2X4XA 4OB1B 2K57A 4PJJA 2CKKA 4F7UE 3X26B 4C8QD 1M2OA 4HA8A 5J26A 4LDXA 2JT4A 1LPLA 4Y28E 3MPUB 1QVFS 3BW1A 4X34A 1VQ7A 1UB4A 3S3OA 1V76A 1HK9A 4CI0C 2FPEA 2D9TA 2DD5A 1VQNT 2YSQA 4BDZA 3CCEQ 4F7UB 3CC4T 1M1FA 1KSWA 3HFNA 2E41A 2HEQA 4FYYB 4Q5WA 4M7AA 3G4ST 2R58A 5FRMA 1RAHB 3OMCA 1D3BB 1YI2T 3EHQA 1AWJA 8ATCB 1VQPT 3EGXB 2HL5C 2K2VA 4C0FA 4DOVA 1NLOC 2FEIA 1H641 4FIBA 2DEQA 4P5NA 2FPFA 1G2BA 5FU6C 1BI1A 1T3SA 1YP5A 2DXBA 3EG9B 3VS1A 1R0BG 2RHYA 4QVCA 3PE0A 4XTXA 1VQ5A 2MWOA 4C0DC 5EG2A 2CZ0B 2V26A 4JJNK 2PUOB 2GCXA 1QVFA 3JCMV 1PSEA 2LZ6B 2DBMA 1UGVA 4PK4A 4FYWB 1BCMA 4XTWA 3EFOA 3MP8A 1BI0A 3FIFA 3SD4A 1M30A 4ELYC 1Q82R 2XDDA 3M4GA 2CZ1B 2KXCA 3JCMg 1K0SA 3MEWA 4KULA 3H0FA 3TQ7P 2FPDA 1ACMB 2LC4A 3C95A 5CKEA 3LGLA 3M5AA 1RLPC 2FRWA 1B07A 4PLLA 4M78G 1U1SA 4C5GA 4AMCA 2M0YA 3QJYA 2RK2A 1VQOT 1M1KR 5KYWA 1VQLA 3BDLA 1VQOA 2QA4Q 3PFSA 5J3BA 2D0QB 2QEXA 3VUZA 1K73C 3M58A 1TXQA 5CKBA 1WHGA 2BE9B 3EFSA 4M75C 1YJWA 1D0ZA 1UGQB 1PKTA 2WSEE 3V8KA 3DLLA 1WIEA 3CBMA 3H9NA 4N4HA 3KBGA 2BIVA 3JB9F 1VQNA 3VUBA 1I5LA 2DPPB 5CKFA 1QWFA 3OYLA 4EIKA 1N8RU 2DM1A 3I35A 4PL6A 2YRCA 1X43A 2CP0A 3CCSA 1Z9QA 1N5ZA 5GAMj 2GNCA 3QWYA 2CT3A 2KROA 2DYBA 1N8RR 4E7IA 2EQIA 3MP1A 2LCCA 2HMAA 4MZMA 1G3TA 4IIMA 2O2OA 4XQ3A 3CCRQ 4M75D 1NJIR 5D6WA 1VQ7Q 1OZ3A 1VQ4T 3PIPA 3CCQT 1WHKA 2RD1A 2EGEA 1H92A 4M75F 4MZPA 1PC0A 1BBZA 2MOXA 3JB9H 3JV3A 5M9OA 5LL6S 1M3AA 2JTEA 2SEMA 3QO3A 1NG2A 2JNGA 3VYGA 4M7DF 5I11A 4IURA 1PRMC 3VRZA 2FG0A 1VQ8A 1JQQA 2J6FA 5FLXE 1MMGA 3CCUQ 1K9AA 3CMEA 1S72T 3HKSA 3RDVA 2YUQA 4Y92A 2L5QA 1ZBXA 3OS1A 2RB6A 3JCMb 2FB7A 4X9CA 2VWFA 3C12A 3A8GB 1TWBA 4QQ6A 4EPCA 5HK3A 2CP7A 2DTHA 4FL6A 1ZSGA 2LNHB 2E6NA 4NL3A 3TEEA 4KUDK 1WXTA 5GAMd 1KK7A 5LJ5j 2O01E 1K1ZA 3G71T 4R55A 1K4US 1NJIC 1Q81C 2YLBA 3S3MA 2JTMA 1WGSA 3I9QA 3HP9A 1QKXA 2EYWA 1YJ9Q 1M27C 4EMKA 8AT1B 3UF4A 1I81A 2PVGB 2MI6A 4M7AC 2DL5A 4X1VA 4DBRA 2C0TA 4Z89A 4E7ZA 1WJQA 2DKGA 2ED0A 4DEXA 1ZUKA 2PQWA 1W70A 3PT9A 2BUDA 2PTKA 4N4GA 3G7ZA 3EG1A 1G3WA 3H6ZA 1X75C 2L3QA 4O5VA 1UUEA 4R0KA 2LT4A 1IB8A 3BDUA 1AD5A 4M77G 1M5Q1 5LJ5f 1BI3A 3C4SA 3JB9G 3KFVA 2KDSA 1GCPA 4M4ZA 2VXEA 3PIOA 1OQKA 2AK5A 4C8QE 2HZYA 3PMIA 4A4FA 2GGRA 5C0MA 3RBBB 4E7HA 2VGNA 3RESA 1BIBA 1C6VX 5IAYA 4FU6A 1K73R 2JOYA 2JW4A 2D0NA 1CSKA 5CQXA 4J83A 3R6NA 4C8QG 4HXJA 1XTDA 2P0PA 3CCET 2KQWA 3CXCA 2CREA 5GAN4 1VQMQ 1QKWA 2EGAA 1VYUA 4PJOG 1TG0A 3CC7A 2E70A 4C92C 1VQ9T 2AHJB 4M78F 2ZGWA 2LDMA 1CKAA 2F69A 2MPXC 1Y0MA 5DLQE 2DXUA 1XQHA 3HFOA 1H3ZA 3CXCS 2MIOA 1Y07A 4QKUA 5CCAA 1NLPC 3DB4A 2IG0A 2ZCFB 3O8VA 2AKLA 1T0HA 5CVIA 1KD1C 2DVEA 4ZGEB 2PZ1A 2O9VA 5GANj 3G71A 5A0GA 2HBWA 2M02A 1S1NA 2ROTA 2BZXA 3NTIA 2RN8A 2DL8A 2L3RA 3ER0A 4QVZA 2K3YA 2X4YA 3RERA 3QYGB 4F14A 1I07A 3E1SA 1DJ7B 1M3CA 2K5IA 1PNJA 2L89A 2YUNA 1ZUUA 4K11A 2YXYA 2RI3A 3CCUT 4KUIA 3L2UA 1N6AA 4KH1B 1N8RC 3INZA 2DTOA 3A8LB 4M78C 2LQKA 3NGPA 3CMAQ 3QYHB 2PVOB 1B3QA 1JJ2A 2ZZDA 1IHWA 1D0YA 4NOYA 1X27A 1PD0A 2EJGA 3CCVQ 4M7DC 3OSVA 5GAOn 5I2SA 2EWNA 2LTOA 1QW1A 1K73U 3JCMJ 3TCJA 3CC7T 1WZOA 1X01A 4LUEA 4E2FB 2QG9B 2DRMA 4J7FA 3Q1JA 4BUGA 4CC7A 2KXDA 3HRTA 4BY6B 4NL2A 2CP5A 4OVAA 2VC8A 2CSQA 3VS6A 4CC2A 4OF1A 2ZPIB 5GAMg 5FW9A 1N27A 3MKDA 1RADB 2QQ9A 1LCKA 2EAYA 3URGA 1GBQA 4LDYA 4EMGA 3QDRB 1NM7A 1Q7YU 4M78A 1GXIE 4RTVA 1OX8A 5GMKj 3CCVA 3FC3A 4M7DG 4C8QA 4M7AG 1WHHA 4WTOB 3M0QA 1ABOA 1VQMT 4WF2A 1U8RA 2PU9B 1SSFA 2HD0A 1WHLA 1G3YA 4EMKC 1D3BA 4XTYA 3OYJA 3CQTA 4IUTA 1WQ7A 4PJOA 2LRQA 2LJ1A 1NZ9A 4M7AE 1SHGA 1K9MR 2VXFA 3OYYA 2J05A 2DIQA 3A1PA 2PUKB 3NHNA 3OMGA 3GBQA 9ATCB 5CR2A 5I21A 1HSQA 1AOJA 3OYGA 2K2MA 3SHWA 1B7TA 4HCCA 2CT4A 3CBPA 2QEXQ 1NPPA 3LH0A 2DXCA 5GMKm 3E19A 2L2PA 3CCLT 4ZN3A 1X6OA 4XTZA 4QVDA 2B86A 3RKWA 4PJOF 4KBMB 2F5KA 2W0ZA 3WVDB 3CC4Q 4M7AB 4OMOA 4JDSA 3LWIA 3FB9A 1VQ8Q 4N0AA 4N4IA 1X69A 3OYBA 1KC8U 1K0XA 1KG1A 2XDPA 3KXTA 4JUVA 1WPYA 4RCCA 1ZQ1A 3NTKA 1JEGA 2CP3A 4JLIA 3FEOA 1C0MA 1C1AA 1W2BP 4ZGJB 2CSIA 1RI9A 2MF2A 2QQRA 2RQWA 2LMJA 3SFMA 5DLOA 3CPWA 1VOMA 2E6ZA 4PJOB 1WDXA 4C0DB 3OB9A 5GAN6 1XOVA 2DE0X 1V29B 3H0HA 1OPKA 3UA6A 5AT1B 3HRUA 2F2WA 2O4XB 3QZ9B 1T0JA 4D8DA 1YCYA 4LXCA 2RM4A 5A2QE 4BY6C 5GANe 4XAXB 3PVLA 1VQPQ 2YUOA 5GAN2 2MAMA 3TREA 4RTXA 1TSFA 1VQ9A 4C5HA 4B9WA 1Q86C 1QCFA 2R5AA 2O4XA 1QP3A 2JS0A 4J6YA 3NTHA 1NYFA 2VUBA 3EG9A 4FW1A 3CMAT 3E9FA 2XD0A 4M77D 5KH6A 4KT0E 1VQ6A 3H8ZA 2MCNA 3CCMA 4ZTJA 2MWPA 3RUXA 5GMKh 2X35A 3G6EQ 3ZL7C 1BB9A 4MDXA 4KGXB 2GBQA 3G4SA 3THKA 3FLGA 4F17A 3OY9A 2KYMA 5D7UA 3HSBA 2KE9A 5KYXA 2RJFA 1CKBA 4RG8A 2SRCA 4RTYA 4M75B 4DBHA 2O88A 4FW2A 1H8KA 1NBEB 5GAMe 4ZTFA 5HCKA 4OGCA 4M78B 3VV0A 3CMAA 1OEBA 2LCLA 4L5GA 3QG1A 2GTJA 5GAN3 3DLMA 1AT1B 1QMCA 1GBRA 2W10A 5KE2A 4GY5A 4RMOA 2X9HA 4MDWA 3D7SB 3TSZA 1YITT 2DL4A 2EYQA 3P8BB 3HPWA 2KRSA 5HKCA 1BYMA 3JCMe 4XU3A 2QGGA 4E7SA 1QCNA 1EIFA 2R5MA 2IVWA 2QASA 3CMET 3PNWC 2V1QA 1QVPA 2K4YA 3NPFA 3H41A 3OW2A 1VQ8T 1NPRA 1QQJA 2L0AA 3L2ZA 4KGVB 1IGUA 4Y91A 2ZPBB 5GAOl 1VIEA 4IKFA 4E47A 2RF0A 2K9GA 3CCRT 5GANd 3M0UA 3M4YA 3OW2P 3O5ZA 2JTFA 4N0AC 2DO3A 1JBMA 2PNIA 1WYXA 3A8OB 4LUDA 2JM9A 4II1A 3G6ET 5CK9A 1ZSZA 4C92B 1RAAB 3QIIA 2EVRA 2QQBA 2LVMA 3SDZA 2A28A 1PRLC 2L3PA 4MZTA 1XNIA 5CKDA 3EH2A 1YHQT 3UPUA 2LX9A 1OZ2A 2EQMA 2QDYB 4XU2A 4OB0B 1QWEA 3FJ5A 2AT1B 1PHTA 1VQPA 1VQKQ 3IQLA 3QZ5B 3HHTB 4AFQC 5LJ3e 1IO6A 1Z9ZA 1OU8A 2FHDA 2RQVA 2YRVA 3V7SA 2HAXA 2GQIA 3AT1B 1AZEA 1WI7A 3M0RA 1Q7YC 3I55A 3UT1A 1WQWA 4RG2A 2OX7A 4AT1B 3I5SA 4E7KA 1X6BA 2HL3A 1W1FA 5KYYB 2A3LA 1IZ6A 1UGSB 4OB3B 1MMDA 1K8AC 2P84A 2AIRB 4J9DA 3I55Q 5FWBA 2RK1A 2E12A 4ZGDB 3CEYA 1SG5A 4PFPA 3EGDA 4BE2A 2LQNA 2QA4A 5GANg 2LJ3A 3L2WA 4M78E 4HVUA 3A8MB 2KRMA 1V1CA 4M7AD 5FU7C 3CMEQ 2V8JA 4XK8E 5ECAA 1BK2A 2LQ8A 5KE3A 3GOXA 2NUTA 2YUPA 3M0TA 1RLQC 2DL3A 4B9XA 2O9SA 3G4SQ 3EGXA 3UATA 2FRYA 2NUZA 4NS5A 4BB7A 1NEBA 1RACB 2CH4W 1KHIA 3CCQQ 3ASKA 4VUBA 1IREB 1VQ6Q 5CKHA 3ZBDA 4QQDA 5LJ3f 1QVGP 5GMKe 1RABB 2H8HA 3E2UA 1AZGB 3VYHB 2J6OA 5GANf 1KQSP 1WXUA 2CUBA 2DAQA 4XTVA 5AYFA 2HNIA 2KGTA 1X2KA 2ZPHB 2CYZB 1K8AU 2OTLA 4DBQA 3CD6A 3QUIA 3J81E 1MMNA 1YI2A 5FU6B 2XHCA 3AHUA 2V8IA 1YJNQ 2RJCA 3QHSA 1ZUYA 2QYZA 2RHZA 2VKNA 4PJNA 1VQMA 4M7DB 2RHXA 2YWWA 1TUDA 1AHJB 1WLPB 4C92D 4OMQA 2VV5A 3QBYA 2E5KA 3ME9A 3JCMd 3C94A 3OS2A 2JVVA 3MCAB 1M1KU 4M7DE 2A08A 3JCMP 1PD1A 3M55A 2ABLA 4EMHA 1PCXA 2J7IA 1PG5B 3CCJT 2NYSA 4O6JA 1KQSA 1M2VA 3CCST 2K7AA 3CPFA 2AZVA 5GAN7 3LGFA 5LJ5g 3CCSQ 1Q7YR 3MO8A 4AFSC 1W6XA 2DF6A 3I55T 1SRMA 4J6WA 2NUPA 5FROA 1KQSS 1YJ9A 5D6YA 2HDAA 2DJQA 4BE1A 2LNVA 1O9SA 3QSUA 4JRPA 1JJ2P 1SKUB 3L2VA 2VYTA 2JS2A 1S72Q 3QKJA 2RHIA 3OYNA 1VQKT 2H3JA 3HTRA 1UECA 1ZA1B 2XDBA 4J9GA 2FZKB 4B6MA 2V8KA 3JB9D 1UDLA 4F7UG 2QTXA 3VRYA 5LJ3h 1TTHB 1YCSB 1SRLA 1YIJQ 1HD3A 1HXDA 2C06A 2JUFA 3VS7A 1QVFP 1SHFA 1B34A 2DD4A 4DOWA 2BE7D 4QT7A 1D0XA 3A5ZB 4OMLA 4E7JA 2P0QA 1N9RA 4FCYA 2ROLA 1AWOA 1W2BS 3EGDB 3RKYA 3M57A 1GFDA 2HBPA 1RAGB 1UFFA 2DMOA 1VQ7T 2X4JA 1YJ9T 1QVGA 1BU1A 4WCIA 2F1LA 1KIKA 1Q81U 1NJIU 2L3SA 3META 3CC2A 2I0NA 5GMKl 1X6GA 3I56T 5HK0A 4XU0A 3CPWS 2IPOB 2C0IA 2COZA 1ZLMA 1R77A 2XI9A 2LCSA 4JZ4A 1KQ2A 1N9SA 2EPDA 1UHCA 4M75G 5J39A 4GBQA 2FVUA 4LD6A 1VQ9Q 2DZCA 1VYTA 3V7CA 4JJDA 4V2SA 1YIJA 1Q86U 2KVQG 4BDYA 1RUWA 2VASA 2RI2A 1UGPB 3S3NA 4UC4A 2QQAA 2E10A 3X28B 3DB3A 1IXDA 3CD6Q 3OYAA 3WXMB 2M16A 3FDRA 1QCOA 3WVEB 1ZSZB 4AG2C 4M77C 1PM3A 2ENMA 2H3EB 2D6FA 1R8OB 1WJSA 5KYUA 3ULRB 2CGHA 2XICA 3DKMA 2C0OA 1T3LA 2A0FB 4LDWA 4FSXA 2FZGB 2HCKA 2CH4A 1M1KC 2XIDA 2O31A 4OMPA 1VQ6T 4LD9K 2K3XA 1MGQA 4FT4A 2X4WA 4EDUA 5KYNA 2DIGA 4HT9A 2Z0WA 2JZ2A 3REAB 3QPHA 5KYXB 1JB0E 2EFIA 1BIAA 3JAME 2A37A 4OMNA 1D1AA 4XU1A 2EJ9A 2QI2A 2RNAA 4A54A 2ZPEB 3V8JA 2DK3A 3GP8A 1ZSZC 5L8RE 5GAOq 5GAOr 3GIBA 1KQ1A 5C6SA 2G6FX 1ARKA 4XTUA 1JXMA 1AWXA 5A0LA 1OPLA 1UG1A 1M90U 4OP0A 3GLXA 2KYBA 4HKEA 3LWHA 1K8AR 1MNDA 3CCMT 2PVDB 2AKKA 1FMVA 4HCZA 4J9HA 4HCKA 4JJBA 4M77B 1YI2Q 2DZ9A 1HYOA 5I2MA 2RQTA 1LVKA 2X3WD 3G1JA 2D8JA 1OOTA 3QDFA 1MMAA 4IIOA 1AWWA 2DRKA 1WA7A 2RMOA 5GANh 2M0OA 2P4TA 1M90C 1WFWA 4BACA 2F5TX 2XKOC 1TUCA 2DLPA 1M4ZA 2HSEB 3M59A 3V8LA 4CRIA 4JRIA 2HKQB 7AT1B 2QGFB 2Y4YA 3PMTA 5I22A 1YBYA 4BI4A 1Y96A 1PWTA 4MMKA 3X20B 2JMCA 5L23A 2X3XD 3CCQA 4AG1C 2EIFA 2E64A 2QEXT 1YN8A 1R0CB 1I8FA 3CBOA 3S6WA 4L59A 3EHRA 5GAOm 1GL5A 3ZEHA 1G8XA 1YWPA 1G5VA 1D1BA 1SPKA 2LP5A 3VU3C 2BZYA 2EYYA 1D09B 5GAN5 3RMSA 2E5QA 3EAEA 4C92E 3JCMc 5FU7B 2OTJT 1VQ4Q 2G3RA 5GAMh
chains in the Genus database with same CATH topology
1BIBA 2YRVA 4A4HA 5IAYA 4FU6A 5LJ3g 1Y71A 4M77E 4M75E 3QXEB 4PNOA 5LJ5e 3V7SA 2HAXA 2JOYA 2XU8A 1Q7YC 5KCOA 3I55A 4C92F 1Y96B 5CQXA 1LOJA 4J83A 2RI5A 4C8QG 3UT1A 2ZPGB 1XTDA 1WQWA 4RG2A 3FJPA 1RI0A 4E7KA 3OQ5A 1VQKA 4BI3A 3ZFJA 2P0PA 3CCET 2A3LA 1IZ6A 2KQWA 1UGSB 2GFAA 3CXCA 4OB3B 5GAN4 3JRZA 1K8AC 4OMFB 4F7UF 1Y7XA 3VJPA 3I56A 3OYKA 4C0GA 3PGGA 4PJOG 3CC7A 2E70A 4C92C 2RK1A 1VQ9T 2AHJB 4M78F 3MEVA 2ZGWA 3OYEA 2LDMA 2DJZA 2E12A 2F69A 3JCMh 4ZGDB 4BD3A 3CEYA 4BE2A 3RMQA 4JRQA 2MMPA 2WSCE 5DLQE 2QA4A 1U1TA 4C8QF 5GANg 2DXUA 1XQHA 4FT2A 5CIUA 3L2WA 2KAFA 3OYFA 3HFOA 4M78E 1H3ZA 4IUPA 3CXCS 1Y07A 1KHCA 5CCAA 3DB4A 2IG0A 2ZCFB 1MHNA 3O8VA 3A8MB 3CCLA 4FM4B 5CVIA 1KD1C 5DM7R 5GAN8 2DVEA 4M77A 4M7AD 4OGEA 1FWZA 2YHTA 5FU7C 4ZGEB 1YIJT 2V8JA 5GANj 3CD6T 4XK8E 3G71A 5A0GA 2GF7A 2LQ8A 5KE3A 4ELZC 5KCHA 3GOXA 1OI1A 4E7LA 2CS7A 4B9XA 4OB2B 3JCMX 1VQ5T 3L1AA 2GQVA 4BE0A 3JB9J 3NTIA 1NE8A 3SWNB 3CC2T 4NS5A 4BB7A 1QP2A 3G6EA 2L3RA 3ER0A 1KHIA 3GF5A 4QVZA 3ASKA 2K3YA 2CZ6B 4VUBA 2X4YA 3CCVT 3T9NA 2RJEA 1IREB 4C92A 1VQLT 3RERA 3QYGB 1M9SA 1FXXA 5CKHA 1TH7A 3E1SA 1FX7A 4PJOC 4ATOA 1DJ7B 4PJOD 2RJDA 4M77F 3JSCA 3A8HB 3ZBDA 2K5IA 4QQDA 2FYKA 5LJ3f 3VKIA 4RKUE 2L89A 2E1HA 4C0ZA 5GMKe 3J80E 2KSSA 4ZN1A 2RI3A 3CCUT 4KUIA 3L2UA 1Q82U 3M53A 1N6AA 1P92A 1YJWT 2I2LA 1N8RC 3INZA 2DTOA 3A8LB 4GLKA 2OAUA 2LQKA 4M78C 4Z02A 4BI8B 3J7AF 2DTIA 3QYHB 3VYHB 2PVOB 3HRSA 2DXTA 3RKXA 1PSFA 5GANf 2DAQA 5AYFA 4XTVA 1JJ2A 2HNIA 2M9UA 2ZPHB 2CYZB 2ZZDA 1K8AU 3M54A 2OTLA 4NOYA 1W2BA 3CD6A 3QUIA 3J81E 1VIFA 1YI2A 5FU6B 2EJGA 2XHCA 3AHUA 3SB2A 4M7DC 5FRNA 2V8IA 3OSVA 4ME7A 4LDUA 3X24B 5GAOn 2JN0A 2RJCA 5I2SA 3L2QA 3X25B 2EWNA 2LTOA 1QW1A 2X4XA 2QXFA 3QHSA 4OB1B 5CAIA 1K73U 3JCMJ 1VUBA 2K57A 2RHZA 2CKKA 4F7UE 3GNFB 2RHXA 3TCJA 1VQMA 3CC7T 4M7DB 1X01A 3M9QA 1AHJB 3X26B 4C8QD 4HA8A 5J26A 4C92D 2XG8D 4LDXA 2VV5A 3QBYA 4PKCC 3ME9A 3JCMd 4JRKA 2KK4A 4Y28E 4J7FA 1QVFS 3BW1A 4X34A 3F70A 3Q1JA 1VQ7A 1UB4A 4BUGA 3S3OA 3C94A 3OS2A 3HRTA 1WJRA 2KMTA 4BY6B 1ZHIA 1HK9A 2JVVA 4J8OA 4NL2A 4A4EA 4CI0C 3MCAB 4OVAA 3OYIA 2D9TA 2VC8A 5IN1A 2DD5A 4OF1A 1VQNT 2ZPIB 4BDZA 1M1KU 2RA2A 4F7UB 4M7DE 5IT9E 3OW2S 1VQ4A 5GAMg 3CC4T 1M1FA 3JCMP 4C5IA 3HFNA 1N27A 2E41A 3M55A 4Q5WA 1YHQA 4M7AA 3G4ST 2R58A 2QQ9A 4EMHA 5FRMA 2EAYA 3OMCA 3MEUA 3URGA 3CCJT 4O6JA 4LDYA 5GAMf 1D3BB 4EMGA 3QDRB 1YI2T 1KQSA 2WSFE 3SWNA 3CCST 1VQPT 1Q7YU 4M78A 1GXIE 2K2VA 4C0FA 5LJ3j 4C5EA 3GNGA 4DOVA 1JJ2S 3CPFA 5GMKj 4YTLA 3KUFA 5GAN7 3CCVA 3FC3A 1H641 4FIBA 3LGFA 3P8HA 2DEQA 4P5NA 1BI2A 4C8QA 5LJ5g 4M7DG 4M7AG 5FU6C 3V7RA 2VGMA 1VQMT 4WF2A 3MO8A 1U8RA 3CCRA 1BI1A 2PU9B 1SSFA 4LDVA 2HD0A 1G3YA 3I55T 4J6WA 4EMKC 4M78D 5FROA 1D3BA 4XTYA 3OYJA 1KC8C 1KQSS 1YJ9A 3BFMA 4IUTA 2DXBA 5D6YA 4BE1A 2LNVA 1WQ7A 3JCMQ 3LW5E 1O9SA 3QSUA 4PJOA 2LRQA 4JRPA 2RHYA 4QVCA 1NZ9A 2K5FA 4XTXA 1VQ5A 2MWOA 3L2VA 2VYTA 2VXFA 2YLCA 4D6WA 4EMKB 4M7AE 3OYYA 4C0DC 3QKJA 2RHIA 3OYNA 2DIQA 1VQKT 2PUKB 2H3JA 5EG2A 3OMGA 2M1HA 5CO7A 2CZ0B 2XDBA 4JJNK 2PUOB 3UDCA 1OYXA 5CR2A 5I21A 2GCXA 1QVFA 3OYGA 2LT1A 3JCMV 1O75A 1PSEA 2V8KA 3JB9D 4F7UG 4HCCA 2E65A 4XTWA 2QTXA 4QW2A 3CBPA 5LJ3h 1LNXA 3GPLA 1NPPA 3MP8A 1BI0A 2DXCA 3FIFA 3LH0A 3SD4A 4ELYC 5GMKm 3E19A 3CCJA 1M8VA 1HXDA 3UWNA 2C06A 2JUFA 2XDDA 3M4GA 3CCLT 1B34A 2CZ7B 2DD4A 4ZN3A 1X6OA 2CZ1B 4DOWA 4XTZA 3JCMg 4DQ2A 5LJ5d 3OYHA 3A5ZB 2FL7A 4QVDA 3MEWA 4KULA 4E7JA 2P0QA 3RKWA 1N9RA 2LC4A 4PJOF 3C95A 2L8DA 4KBMB 2R57A 3LGLA 2F5KA 3M5AA 5CKEA 3WVDB 4M7AB 1W2BS 4PLLA 4M78G 4A4GA 3TU4K 4JDSA 1U1SA 3FB9A 3M57A 4RCBA 4IUQA 4N0AA 4N4IA 3RKYA 4C5GA 3LWIA 2HBPA 3OYBA 4HT8A 1VQ7T 1KC8U 2X4JA 3OYMA 1YJ9T 1QVGA 1KG1A 3QJYA 2RK2A 3FRNA 2XDPA 2Y90A 1VQOT 1Q81U 1NJIU 3L42A 4JUVA 1WPYA 4RCCA 3KXTA 1ZQ1A 3META 3CC2A 1VQLA 3OBYA 3BDLA 3NTKA 3HL8A 5GMKl 1VQOA 3PFSA 5J3BA 4JLIA 2D0QB 3I56T 2QEXA 3FEOA 3VUZA 4X9DA 5HK0A 4XU0A 1K73C 3M58A 4ZGJB 2RO0A 3CPWS 4J5YA 2MF2A 2QQSA 5CKBA 2QQRA 2XI9A 5DLOA 3SFMA 1KQ2A 1B34B 4HCBA 3CPWA 2WACA 3EFSA 4M75C 1W4SA 2E6ZA 1N9SA 2RH2A 1YJWA 5DY9A 1UGQB 4M75G 2WSEE 2K5LA 3V8KA 2FVUA 5J39A 4LD6A 3DLLA 4M7AF 3CBMA 4C0DB 2DZCA 3OB9A 2QA4T 4PJOB 3V7CA 4N4HA 5GAN6 3KBGA 1XOVA 4C8QC 2BIVA 3JB9F 4V2SA 1VQNA 1YIJA 5D6XA 1V29B 3VUBA 1Q86U 2KVQG 1I5LA 2DPPB 4F7UA 4BDYA 5CKFA 1QVGS 5GAOp 2BKDN 2OTLT 2RI2A 1YITA 1UGPB 3S3NA 1YJNA 3OYLA 3HRUA 4UC4A 3P8DA 2QQAA 4IUVA 1N8RU 2O4XB 2E10A 3X28B 1K9MU 3QZ9B 3DB3A 2EQKA 1YCYA 2RM4A 5A2QE 4PL6A 3OYAA 4BY6C 2NLUA 3WXMB 4M7DD 2M16A 3FDRA 3CCSA 5GANe 4XAXB 5GAMj 4J6XA 2EKOA 1M1GA 3MP6A 3WVEB 1S72A 5GAN2 2MAMA 4M77C 3TREA 5LJ3d 4E7IA 2D6FA 1UGRB 1R8OB 1WJSA 2RHUA 3OA6A 3MEAA 3MP1A 2CGHA 1VQ9A 1UEBA 4C5HA 2LCCA 4B9WA 3R6OA 1Q86C 2XK0A 4MZMA 1G3TA 2R5AA 2XICA 3DKMA 4L6V5 4XQ3A 2O4XA 1QP3A 4J6YA 3NTHA 4LDWA 2VUBA 3LX7A 3CMAT 3E9FA 2XD0A 4FSXA 4M77D 4PLIA 4M75D 4A53A 5KH6A 4KT0E 5D6WA 1OZ3A 1M1KC 3OSSC 2XIDA 1VQ4T 3CCUA 3PIPA 3CCQT 2P0KA 1VQ6A 3H8ZA 3RIRA 3CCMA 4ZTJA 2RD1A 2MWPA 3E9GA 4MMLA 3RUXA 5GMKh 4M75F 1VQ6T 4M7DA 4QQGA 4MZPA 4LD9K 3JB9H 1BKBA 2X35A 5LJ5h 5M9OA 2K3XA 5LL6S 1MGQA 4FT4A 3VYGA 3QO3A 2X4WA 4EDUA 2JNGA 2DIGA 5GMKi 4HT9A 4MDXA 3LLRA 4M75A 3FLGA 2JZ2A 4IURA 3OY9A 3G4SA 4M7DF 3HSBA 3QPHA 1JB0E 2EFIA 1K9MC 1VQ8A 3M56A 1BIAA 2HQEA 2RJFA 5FLXE 3JAME 3CCEA 4RG8A 3OS5A 1I4K1 4M75B 3CMEA 1S72T 3HKSA 4XU1A 3NFCA 2EJ9A 2QI2A 4A54A 2ZPEB 2L5QA 3V8JA 1ZBXA 2DK3A 1G3SA 3PTAA 3GP8A 1WNLA 5L8RE 5GAOq 5GAOr 5GAMe 3OS1A 1KQ1A 2RB6A 3EFRA 1JRIA 3JCMb 3GIBA 2FB7A 5C6SA 4ZTFA 4X9CA 4OGCA 3BY7A 4XTUA 4M78B 3VV0A 5A0LA 3CMAA 3C12A 2LCLA 3A8GB 4QQ6A 5HK3A 4L5GA 3RESA 4EPCA 1M90U 4OP0A 3GLXA 4C92G 4HKEA 3QG1A 3SWNC 5GAN3 3LWHA 3JCMW 3DLMA 2DTHA 4FL6A 5A0DA 3OS0A 3CCMT 2E6NA 2PVDB 4IUUA 5KE2A 4GY5A 4NL3A 4HCZA 3JCMf 4RMOA 3CC4A 3TEEA 4KUDK 4M77B 5GAMd 4MDWA 2DZ9A 5LJ5j 1YITT 3L2RA 2O01E 2EYQA 3P8BB 5I2MA 4R55A 3G71T 1NJIC 3HPWA 2YLBA 1Q81C 2B8AA 5HKCA 3S3MA 2JTMA 1WGSA 2A7YA 1BYMA 3JCMe 3HP9A 4XU3A 1EIFA 2R5MA 3MHXA 2IVWA 4EMKA 5GANh 3CMET 3PNWC 2M0OA 2P4TA 4PJOE 4J7IA 1I81A 1M90C 1QVPA 2K4YA 1VQ8T 3OW2A 1NPRA 2PVGB 3L2ZA 3QJ6A 4BACA 4Y91A 2F5TX 2ZPBB 5HY6A 2XKOC 4A4KA 2MI6A 4DA4A 4M7AC 1LJOA 1VIEA 5GAOl 1M4ZA 4IKFA 4E47A 2OTJA 3M59A 3OBWA 3V8LA 4CRIA 3CCRT 4JRIA 5GANd 1YJNT 1WJQA 2DKGA 3M4YA 2Y4YA 2JTFA 3PMTA 4R56A 2KY9A 1YBYA 4N0AC 2PQWA 2DO3A 1JBMA 4BI4A 1Y96A 3PT9A 3JB9I 4MMKA 2BUDA 3A8OB 3X20B 2EQJA 1Q82C 3CCQA 4II1A 3OYDA 4N4GA 3G6ET 3G7ZA 4C8QB 5CK9A 1G3WA 3N5BB 4C92B 2EIFA 2E64A 3H6ZA 2GFUA 2EQUA 2QEXT 3QIIA 1I8FA 1X75C 2QQBA 3CBOA 2LT4A 2LVMA 4O5VA 3SDZA 4L59A 3S6WA 1KD1U 4TVRA 4MZTA 5GAOm 2Y4XA 1XNIA 3BDUA 5CKDA 4M77G 1YHQT 3ZEHA 1M5Q1 2LX9A 5LJ5f 3UPUA 2HQXA 1OZ2A 1RL2A 2EQMA 1BI3A 4JS4A 2QDYB 3C4SA 4JLGA 4OB0B 4XU2A 3JB9G 1G5VA 2KDSA 3OYCA 2VXEA 3VU3C 3PIOA 1VQPA 4C8QE 3LYIA 3PMIA 5GAN5 4JS5A 3RMSA 2E5QA 3EAEA 4A4FA 3QZ5B 4C92E 3HHTB 5C0MA 2ZPFB 3JCMc 5CQYA 4E7HA 5LJ3e 5FU7B 2OTJT 2VGNA 2EJFA 2FHDA 2G3RA 5GAMh
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YRV A;  4A4H A;  5IAY A;  2HQE A;  2L8D A;  2R57 A;  2RJF A;  2F5K A;  3LGL A;  4FU6 A;  5FRN A;  4PLL A;  4A4G A;  2RJC A;  4IUQ A;  4N4I A;  3L2Q A;  4C5G A;  5KCO A;  2LTO A;  2X4X A;  3OYB A;  2RI5 A;  3OYM A;  3UT1 A;  2RHZ A;  4RG2 A;  4E7K A;  1RI0 A;  2CKK A;  2XDP A;  3OQ5 A;  3OS1 A;  2RHX A;  3L42 A;  3M9Q A;  3MET A;  5C6S A;  4ZTF A;  3BDL A;  3NTK A;  3PFS A;  2GFA A;  5J26 A;  3FEO A;  3QBY A;  3ME9 A;  4QQ6 A;  4X34 A;  3F70 A;  3Q1J A;  3OYK A;  2RO0 A;  3S3O A;  3DLM A;  4FL6 A;  3OS0 A;  3OS2 A;  1WJR A;  2QQS A;  4A4E A;  2QQR A;  3OYI A;  2E6N A;  4OVA A;  2D9T A;  3MEV A;  4IUU A;  5IN1 A;  2LDM A;  4GY5 A;  5KE2 A;  4HCZ A;  3OYE A;  4BDZ A;  4BD3 A;  3CEY A;  4BE2 A;  2WAC A;  3L2R A;  4C5I A;  3L2W A;  5J39 A;  5CIU A;  1N27 A;  4Q5W A;  3OYF A;  4LD6 A;  2R58 A;  3OB9 A;  5FRM A;  1H3Z A;  3OMC A;  4IUP A;  3MEU A;  2B8A A;  1KHC A;  4N4H A;  3S3M A;  1WGS A;  2IG0 A;  3DB4 A;  1MHN A;  3O8V A;  2BIV A;  5D6X A;  2R5M A;  4BDY A;  4C5E A;  3PNW C;  2BKD N;  2M0O A;  2RI2 A;  3S3N A;  3KUF A;  3OYL A;  4UC4 A;  3FC3 A;  3P8D A;  3LGF A;  3P8H A;  4IUV A;  2GF7 A;  2O4X B;  5KE3 A;  5KCH A;  3QJ6 A;  3GOX A;  3DB3 A;  1OI1 A;  4BAC A;  2EQK A;  4E7L A;  4B9X A;  4PL6 A;  3OYA A;  3MO8 A;  2NLU A;  4BE0 A;  2M16 A;  3FDR A;  3NTI A;  4IKF A;  1SSF A;  4NS5 A;  4CRI A;  5FRO A;  3OYJ A;  2EKO A;  2L3R A;  1WJQ A;  4QVZ A;  4IUT A;  5D6Y A;  3ASK A;  2K3Y A;  3MP6 A;  2X4Y A;  4BE1 A;  2JTF A;  2RJE A;  3PMT A;  4E7I A;  2LRQ A;  2PQW A;  2RHY A;  1WJS A;  2RHU A;  2BUD A;  2MWO A;  2VYT A;  3MEA A;  3OA6 A;  3MP1 A;  3L2V A;  2EQJ A;  4C5H A;  2LCC A;  4B9W A;  2RJD A;  2RHI A;  3QKJ A;  2DIQ A;  3OYN A;  2XK0 A;  2R5A A;  4II1 A;  4QQD A;  3OMG A;  4N4G A;  3OYD A;  2M1H A;  2O4X A;  3NTH A;  2L89 A;  3LX7 A;  3H6Z A;  1OYX A;  2GFU A;  2EQU A;  3E9F A;  2RI3 A;  3QII A;  4PLI A;  3OYG A;  2LVM A;  3L2U A;  4L59 A;  3S6W A;  5KH6 A;  5D6W A;  1OZ3 A;  1XNI A;  2P0K A;  4Z02 A;  3H8Z A;  4QW2 A;  3ZEH A;  4ZTJ A;  2HQX A;  1OZ2 A;  2EQM A;  2MWP A;  3E9G A;  3MP8 A;  3LH0 A;  3C4S A;  3SD4 A;  1G5V A;  4QQG A;  2DAQ A;  3UWN A;  2X35 A;  3OYC A;  5M9O A;  2K3X A;  2X4W A;  3LYI A;  3PMI A;  2DIG A;  4EDU A;  4A4F A;  2E5Q A;  3EAE A;  3LLR A;  5C0M A;  3FLG A;  2JZ2 A;  4IUR A;  3OY9 A;  3OYH A;  4E7H A;  3MEW A;  4E7J A;  2EFI A;  2FHD A;  2G3R A; 
#chains in the Genus database with same CATH topology
 4M77 E;  2DBK A;  1RAE B;  1JU5 C;  2KT1 A;  4C92 F;  1Y96 B;  2RI5 A;  3MJX A;  2ZPG B;  3FJP A;  3OQ5 A;  1MV0 B;  2CP6 A;  3ZFJ A;  4F16 A;  2GFA A;  4PFO A;  2OJ2 A;  4FYV B;  3OYK A;  4C0G A;  4J9B A;  4DEY A;  3MEV A;  3OYE A;  2DJZ A;  3JCM h;  4GLM A;  5IHK A;  3VS3 A;  1U1T A;  4C8Q F;  4KRT A;  2KAF A;  3OYF A;  1OUL A;  1KHC A;  2HSP A;  1MHN A;  4FM4 B;  4ANJ A;  4OGE A;  4ORZ A;  2GF7 A;  4Z8A A;  4ELZ C;  4HVW A;  3JCM X;  4OB2 B;  3NMZ C;  2GQV A;  4DBF A;  4BE0 A;  3CC2 T;  3SWN B;  1JO8 A;  1JXO A;  4HVV A;  3GF5 A;  3CCV T;  2CZ6 B;  1ZBJ A;  4OMM A;  2EBP A;  5IH2 A;  1YNZ A;  1FXX A;  1KJW A;  2QTV A;  1FX7 A;  4PJO C;  4PJO D;  1VQO Q;  4M77 F;  3JSC A;  2KI7 A;  3A8H B;  1VQL Q;  2FYK A;  2JXB A;  4RKU E;  2E1H A;  4C0Z A;  3J80 E;  1X2Q A;  2KSS A;  1QLY A;  2I2L A;  1MUZ A;  4GLK A;  3J7A F;  2DXT A;  2HKN A;  4RTT A;  4LE9 A;  2DNU A;  2X51 A;  4ZNX A;  4J9C A;  1F1B B;  2DIL A;  3EGU A;  5FRN A;  3TSW A;  4LDU A;  3X24 B;  2FZC B;  1UJ0 A;  2JN0 A;  2EKH A;  2ATC B;  2JJ9 A;  2QXF A;  5CAI A;  1VUB A;  2JM8 A;  4KGZ B;  3GNF B;  1UTI A;  3M9Q A;  1WX6 A;  1H3H A;  1U06 A;  1NEG A;  2XG8 D;  2YRD A;  4PKC C;  1TS9 A;  2CDT A;  4RTZ A;  4JRK A;  2KK4 A;  4AFU C;  3F70 A;  1WJR A;  2KMT A;  4HCB A;  1ZHI A;  4J8O A;  2DL7 A;  4A4E A;  3OYI A;  1TU0 B;  5IN1 A;  2QAZ A;  2RA2 A;  5IT9 E;  3OW2 S;  1VQ4 A;  2GTO A;  3I5R A;  2E3H A;  4C5I A;  1YHQ A;  4JJC A;  2EYX A;  2MK5 A;  3MEU A;  5GAM f;  2WSF E;  3SWN A;  5LJ3 j;  5IXF A;  4C5E A;  3GNG A;  2RPN A;  1JJ2 S;  2K6D A;  2HQH A;  2OAW A;  4YTL A;  3KUF A;  4JZ3 A;  4J9F A;  2F2X A;  3P8H A;  1BI2 A;  3VS2 A;  4ESR A;  1EX4 A;  3V7R A;  2VGM A;  3VS4 A;  1UJY A;  3CCR A;  2ESW A;  1M8M A;  2QDL A;  5KYU B;  4LDV A;  1WHJ A;  2NWM A;  3M0P A;  4J9E A;  1I1J A;  4M78 D;  1KC8 C;  3BFM A;  3JCM Q;  2P4R A;  3LW5 E;  3I56 Q;  2DER A;  2A36 A;  2AZS A;  5EC7 A;  3U23 A;  2E4H A;  2CP2 A;  2K5F A;  6AT1 B;  2F2V A;  2YLC A;  5GJW B;  4D6W A;  4EMK B;  1M8V A;  3EG2 A;  2CUD A;  1GRI A;  2M1H A;  5CO7 A;  1WHM A;  2OTJ Q;  3UDC A;  1OYX A;  2LT1 A;  2K79 A;  4A63 B;  1O75 A;  4AFZ C;  2E65 A;  1U5S A;  4QW2 A;  1LNX A;  3GPL A;  5IHI A;  3CCJ A;  3UWN A;  1U3O A;  1VYV A;  2CZ7 B;  1M3B A;  5IXB A;  1SF9 A;  4PJL A;  4DQ2 A;  5LJ5 d;  2KR3 A;  3OYH A;  2FL7 A;  1VA7 A;  2DET A;  2L8D A;  1GFC A;  2R57 A;  2DFU A;  4A4G A;  4FSS A;  3TU4 K;  4RCB A;  4IUQ A;  1XJW B;  1GCQ C;  4HT8 A;  3EG3 A;  3OYM A;  3FRN A;  1I0C A;  2Y90 A;  3UA7 A;  3L42 A;  3OBY A;  3HL8 A;  2DVJ A;  2DX1 A;  4X9D A;  1OU9 A;  2JMA A;  2RO0 A;  4E6R A;  4J5Y A;  4RTW A;  1Q86 R;  1FMW A;  2QQS A;  1RAI B;  1J3T A;  1E6G A;  2KNB B;  2K3B A;  1B34 B;  2WAC A;  3BE3 A;  1W4S A;  2RH2 A;  1HJD A;  1FMK A;  1E6H A;  5DY9 A;  1D1C A;  2DA9 A;  2K5L A;  4M7A F;  1YFN A;  2OI3 A;  2QA4 T;  2LX7 A;  2V1R A;  3EH1 A;  4C8Q C;  3CCJ Q;  5D6X A;  4D8K A;  4F7U A;  3CPW P;  1QVG S;  5GAO p;  3CCM Q;  2BKD N;  2OTL T;  3TVT A;  1YIT A;  3REB B;  1YJN A;  3P8D A;  4IUV A;  3H0I A;  1K9M U;  2EQK A;  1Q95 G;  4M7D D;  2EGC A;  2NLU A;  1SEM A;  4F04 B;  4J6X A;  2EKO A;  3CC7 Q;  1M1G A;  3MP6 A;  1S72 A;  1VQN Q;  1EFN A;  5LJ3 d;  1OV3 A;  1UGR B;  2COY A;  2RHU A;  3OA6 A;  3CXC P;  3MEA A;  5FWC A;  1UEB A;  1YHQ Q;  3R6O A;  2XK0 A;  4L6V 5;  3LX7 A;  1GCQ A;  1KC8 R;  4PLI A;  2MYS A;  4A53 A;  3OSS C;  5KYW B;  3CCU A;  2P0K A;  3RIR A;  3E9G A;  4MML A;  4M7D A;  2DEU A;  4QQG A;  1BKB A;  5LJ5 h;  2ZAE A;  5GMK i;  3LLR A;  4M75 A;  1EZZ B;  2J6K A;  1K9M C;  3M56 A;  1G83 A;  2HQE A;  3CCE A;  3OS5 A;  1I4K 1;  3NFC A;  1PKS A;  4CC3 A;  3CCL Q;  1G3S A;  3PTA A;  1WNL A;  2BTT A;  2VVK A;  1JRI A;  3EFR A;  1ZX6 A;  1TUG B;  3BY7 A;  1M2V B;  2ED1 A;  4RTU A;  4C92 G;  3JCM W;  3SWN C;  2D8H A;  5A0D A;  3OS0 A;  4PJM A;  4IUU A;  3JCM f;  5IHN A;  3CC4 A;  3VS5 A;  1I5O B;  3L2R A;  4JPB W;  1VQ5 Q;  2B8A A;  2A7Y A;  1YIT Q;  2DYI A;  3MHX A;  3RNJ A;  2LQW A;  4PJO E;  2IIM A;  4J7I A;  1Y57 A;  2VB6 A;  3QJ6 A;  1ABQ A;  2RQU A;  5HY6 A;  1YJW Q;  4A4K A;  4DA4 A;  3C0C A;  1LJO A;  3G71 Q;  2OTJ A;  3OBW A;  1E7O A;  3QWX X;  1YJN T;  2EW3 A;  2RQR A;  3RR6 A;  4RUG A;  2KY9 A;  4R56 A;  1ZA2 B;  2J06 A;  3JB9 I;  1M90 R;  2EQJ A;  1Q82 C;  1TOV A;  2KBT A;  3OYD A;  4C8Q B;  3N5B B;  2GFU A;  1WXB A;  2EQU A;  1KD1 U;  2EYZ A;  1FYN A;  4TVR A;  3EG0 A;  2Y4X A;  5GJV B;  1IRX A;  2HQX A;  1RL2 A;  4JS4 A;  4JLG A;  3OYC A;  3LYI A;  4JS5 A;  4Z88 A;  2ZPF B;  5CQY A;  1UHF A;  2EJF A;  4A4H A;  5LJ3 g;  1Y71 A;  2NUP B;  4M75 E;  3QXE B;  4PNO A;  5LJ5 e;  1AEY A;  2D1X A;  2XU8 A;  1Q81 R;  2YDL A;  5KCO A;  1LOJ A;  1IGQ A;  1RI0 A;  1VQK A;  3EFO B;  4BI3 A;  1YWO A;  3A98 A;  1UE9 A;  1SSH A;  2BZ8 A;  2E3I A;  3JRZ A;  4CC4 B;  4OMF B;  4F7U F;  1Y7X A;  3VJP A;  3LH5 A;  3I56 A;  5KYY A;  3PGG A;  1OX9 A;  2KRN A;  2LJ0 A;  1BCO A;  4BD3 A;  3RMQ A;  4JRQ A;  2MMP A;  2WSC E;  3PVQ A;  1A0N B;  1AVZ C;  4FT2 A;  5CIU A;  3CC2 Q;  2OTL Q;  4KH0 B;  1IHV A;  3SEM A;  4IUP A;  3VS0 A;  3CCL A;  5DM7 R;  5GAN 8;  4M77 A;  1FWZ A;  2YHT A;  1YIJ T;  1MNE A;  3CD6 T;  5KCH A;  1OI1 A;  1MV3 A;  4E7L A;  2CS7 A;  1VQ5 T;  1K76 A;  3L1A A;  3JB9 J;  1NE8 A;  1QP2 A;  3G6E A;  2QK0 A;  3T9N A;  2RJE A;  4C92 A;  2XMF A;  1VQL T;  1M9S A;  1TH7 A;  2COW A;  1RAF B;  4ATO A;  2M51 A;  2RJD A;  2NUT B;  3VKI A;  4LN2 A;  4ZN1 A;  1KFZ A;  1Q82 U;  3M53 A;  1P92 A;  1YJW T;  2YT6 A;  1NYG A;  4BI8 B;  4Z02 A;  2OAU A;  2DTI A;  1KD1 R;  3HRS A;  3M0S A;  2FO0 A;  3RKX A;  1PSF A;  4FYX B;  2M9U A;  4PFZ A;  2KT8 A;  2ECZ A;  3M54 A;  4J9I A;  1W2B A;  1VIF A;  4LNP A;  3SB2 A;  4ME7 A;  3L2Q A;  3X25 B;  2KEA A;  2X4X A;  4OB1 B;  2K57 A;  4PJJ A;  2CKK A;  4F7U E;  3X26 B;  4C8Q D;  1M2O A;  4HA8 A;  5J26 A;  4LDX A;  2JT4 A;  1LPL A;  4Y28 E;  3MPU B;  1QVF S;  3BW1 A;  4X34 A;  1VQ7 A;  1UB4 A;  3S3O A;  1V76 A;  1HK9 A;  4CI0 C;  2FPE A;  2D9T A;  2DD5 A;  1VQN T;  2YSQ A;  4BDZ A;  3CCE Q;  4F7U B;  3CC4 T;  1M1F A;  1KSW A;  3HFN A;  2E41 A;  2HEQ A;  4FYY B;  4Q5W A;  4M7A A;  3G4S T;  2R58 A;  5FRM A;  1RAH B;  3OMC A;  1D3B B;  1YI2 T;  3EHQ A;  1AWJ A;  8ATC B;  1VQP T;  3EGX B;  2HL5 C;  2K2V A;  4C0F A;  4DOV A;  1NLO C;  2FEI A;  1H64 1;  4FIB A;  2DEQ A;  4P5N A;  2FPF A;  1G2B A;  5FU6 C;  1BI1 A;  1T3S A;  1YP5 A;  2DXB A;  3EG9 B;  3VS1 A;  1R0B G;  2RHY A;  4QVC A;  3PE0 A;  4XTX A;  1VQ5 A;  2MWO A;  4C0D C;  5EG2 A;  2CZ0 B;  2V26 A;  4JJN K;  2PUO B;  2GCX A;  1QVF A;  3JCM V;  1PSE A;  2LZ6 B;  2DBM A;  1UGV A;  4PK4 A;  4FYW B;  1BCM A;  4XTW A;  3EFO A;  3MP8 A;  1BI0 A;  3FIF A;  3SD4 A;  1M30 A;  4ELY C;  1Q82 R;  2XDD A;  3M4G A;  2CZ1 B;  2KXC A;  3JCM g;  1K0S A;  3MEW A;  4KUL A;  3H0F A;  3TQ7 P;  2FPD A;  1ACM B;  2LC4 A;  3C95 A;  5CKE A;  3LGL A;  3M5A A;  1RLP C;  2FRW A;  1B07 A;  4PLL A;  4M78 G;  1U1S A;  4C5G A;  4AMC A;  2M0Y A;  3QJY A;  2RK2 A;  1VQO T;  1M1K R;  5KYW A;  1VQL A;  3BDL A;  1VQO A;  2QA4 Q;  3PFS A;  5J3B A;  2D0Q B;  2QEX A;  3VUZ A;  1K73 C;  3M58 A;  1TXQ A;  5CKB A;  1WHG A;  2BE9 B;  3EFS A;  4M75 C;  1YJW A;  1D0Z A;  1UGQ B;  1PKT A;  2WSE E;  3V8K A;  3DLL A;  1WIE A;  3CBM A;  3H9N A;  4N4H A;  3KBG A;  2BIV A;  3JB9 F;  1VQN A;  3VUB A;  1I5L A;  2DPP B;  5CKF A;  1QWF A;  3OYL A;  4EIK A;  1N8R U;  2DM1 A;  3I35 A;  4PL6 A;  2YRC A;  1X43 A;  2CP0 A;  3CCS A;  1Z9Q A;  1N5Z A;  5GAM j;  2GNC A;  3QWY A;  2CT3 A;  2KRO A;  2DYB A;  1N8R R;  4E7I A;  2EQI A;  3MP1 A;  2LCC A;  2HMA A;  4MZM A;  1G3T A;  4IIM A;  2O2O A;  4XQ3 A;  3CCR Q;  4M75 D;  1NJI R;  5D6W A;  1VQ7 Q;  1OZ3 A;  1VQ4 T;  3PIP A;  3CCQ T;  1WHK A;  2RD1 A;  2EGE A;  1H92 A;  4M75 F;  4MZP A;  1PC0 A;  1BBZ A;  2MOX A;  3JB9 H;  3JV3 A;  5M9O A;  5LL6 S;  1M3A A;  2JTE A;  2SEM A;  3QO3 A;  1NG2 A;  2JNG A;  3VYG A;  4M7D F;  5I11 A;  4IUR A;  1PRM C;  3VRZ A;  2FG0 A;  1VQ8 A;  1JQQ A;  2J6F A;  5FLX E;  1MMG A;  3CCU Q;  1K9A A;  3CME A;  1S72 T;  3HKS A;  3RDV A;  2YUQ A;  4Y92 A;  2L5Q A;  1ZBX A;  3OS1 A;  2RB6 A;  3JCM b;  2FB7 A;  4X9C A;  2VWF A;  3C12 A;  3A8G B;  1TWB A;  4QQ6 A;  4EPC A;  5HK3 A;  2CP7 A;  2DTH A;  4FL6 A;  1ZSG A;  2LNH B;  2E6N A;  4NL3 A;  3TEE A;  4KUD K;  1WXT A;  5GAM d;  1KK7 A;  5LJ5 j;  2O01 E;  1K1Z A;  3G71 T;  4R55 A;  1K4U S;  1NJI C;  1Q81 C;  2YLB A;  3S3M A;  2JTM A;  1WGS A;  3I9Q A;  3HP9 A;  1QKX A;  2EYW A;  1YJ9 Q;  1M27 C;  4EMK A;  8AT1 B;  3UF4 A;  1I81 A;  2PVG B;  2MI6 A;  4M7A C;  2DL5 A;  4X1V A;  4DBR A;  2C0T A;  4Z89 A;  4E7Z A;  1WJQ A;  2DKG A;  2ED0 A;  4DEX A;  1ZUK A;  2PQW A;  1W70 A;  3PT9 A;  2BUD A;  2PTK A;  4N4G A;  3G7Z A;  3EG1 A;  1G3W A;  3H6Z A;  1X75 C;  2L3Q A;  4O5V A;  1UUE A;  4R0K A;  2LT4 A;  1IB8 A;  3BDU A;  1AD5 A;  4M77 G;  1M5Q 1;  5LJ5 f;  1BI3 A;  3C4S A;  3JB9 G;  3KFV A;  2KDS A;  1GCP A;  4M4Z A;  2VXE A;  3PIO A;  1OQK A;  2AK5 A;  4C8Q E;  2HZY A;  3PMI A;  4A4F A;  2GGR A;  5C0M A;  3RBB B;  4E7H A;  2VGN A;  3RES A;  1BIB A;  1C6V X;  5IAY A;  4FU6 A;  1K73 R;  2JOY A;  2JW4 A;  2D0N A;  1CSK A;  5CQX A;  4J83 A;  3R6N A;  4C8Q G;  4HXJ A;  1XTD A;  2P0P A;  3CCE T;  2KQW A;  3CXC A;  2CRE A;  5GAN 4;  1VQM Q;  1QKW A;  2EGA A;  1VYU A;  4PJO G;  1TG0 A;  3CC7 A;  2E70 A;  4C92 C;  1VQ9 T;  2AHJ B;  4M78 F;  2ZGW A;  2LDM A;  1CKA A;  2F69 A;  2MPX C;  1Y0M A;  5DLQ E;  2DXU A;  1XQH A;  3HFO A;  1H3Z A;  3CXC S;  2MIO A;  1Y07 A;  4QKU A;  5CCA A;  1NLP C;  3DB4 A;  2IG0 A;  2ZCF B;  3O8V A;  2AKL A;  1T0H A;  5CVI A;  1KD1 C;  2DVE A;  4ZGE B;  2PZ1 A;  2O9V A;  5GAN j;  3G71 A;  5A0G A;  2HBW A;  2M02 A;  1S1N A;  2ROT A;  2BZX A;  3NTI A;  2RN8 A;  2DL8 A;  2L3R A;  3ER0 A;  4QVZ A;  2K3Y A;  2X4Y A;  3RER A;  3QYG B;  4F14 A;  1I07 A;  3E1S A;  1DJ7 B;  1M3C A;  2K5I A;  1PNJ A;  2L89 A;  2YUN A;  1ZUU A;  4K11 A;  2YXY A;  2RI3 A;  3CCU T;  4KUI A;  3L2U A;  1N6A A;  4KH1 B;  1N8R C;  3INZ A;  2DTO A;  3A8L B;  4M78 C;  2LQK A;  3NGP A;  3CMA Q;  3QYH B;  2PVO B;  1B3Q A;  1JJ2 A;  2ZZD A;  1IHW A;  1D0Y A;  4NOY A;  1X27 A;  1PD0 A;  2EJG A;  3CCV Q;  4M7D C;  3OSV A;  5GAO n;  5I2S A;  2EWN A;  2LTO A;  1QW1 A;  1K73 U;  3JCM J;  3TCJ A;  3CC7 T;  1WZO A;  1X01 A;  4LUE A;  4E2F B;  2QG9 B;  2DRM A;  4J7F A;  3Q1J A;  4BUG A;  4CC7 A;  2KXD A;  3HRT A;  4BY6 B;  4NL2 A;  2CP5 A;  4OVA A;  2VC8 A;  2CSQ A;  3VS6 A;  4CC2 A;  4OF1 A;  2ZPI B;  5GAM g;  5FW9 A;  1N27 A;  3MKD A;  1RAD B;  2QQ9 A;  1LCK A;  2EAY A;  3URG A;  1GBQ A;  4LDY A;  4EMG A;  3QDR B;  1NM7 A;  1Q7Y U;  4M78 A;  1GXI E;  4RTV A;  1OX8 A;  5GMK j;  3CCV A;  3FC3 A;  4M7D G;  4C8Q A;  4M7A G;  1WHH A;  4WTO B;  3M0Q A;  1ABO A;  1VQM T;  4WF2 A;  1U8R A;  2PU9 B;  1SSF A;  2HD0 A;  1WHL A;  1G3Y A;  4EMK C;  1D3B A;  4XTY A;  3OYJ A;  3CQT A;  4IUT A;  1WQ7 A;  4PJO A;  2LRQ A;  2LJ1 A;  1NZ9 A;  4M7A E;  1SHG A;  1K9M R;  2VXF A;  3OYY A;  2J05 A;  2DIQ A;  3A1P A;  2PUK B;  3NHN A;  3OMG A;  3GBQ A;  9ATC B;  5CR2 A;  5I21 A;  1HSQ A;  1AOJ A;  3OYG A;  2K2M A;  3SHW A;  1B7T A;  4HCC A;  2CT4 A;  3CBP A;  2QEX Q;  1NPP A;  3LH0 A;  2DXC A;  5GMK m;  3E19 A;  2L2P A;  3CCL T;  4ZN3 A;  1X6O A;  4XTZ A;  4QVD A;  2B86 A;  3RKW A;  4PJO F;  4KBM B;  2F5K A;  2W0Z A;  3WVD B;  3CC4 Q;  4M7A B;  4OMO A;  4JDS A;  3LWI A;  3FB9 A;  1VQ8 Q;  4N0A A;  4N4I A;  1X69 A;  3OYB A;  1KC8 U;  1K0X A;  1KG1 A;  2XDP A;  3KXT A;  4JUV A;  1WPY A;  4RCC A;  1ZQ1 A;  3NTK A;  1JEG A;  2CP3 A;  4JLI A;  3FEO A;  1C0M A;  1C1A A;  1W2B P;  4ZGJ B;  2CSI A;  1RI9 A;  2MF2 A;  2QQR A;  2RQW A;  2LMJ A;  3SFM A;  5DLO A;  3CPW A;  1VOM A;  2E6Z A;  4PJO B;  1WDX A;  4C0D B;  3OB9 A;  5GAN 6;  1XOV A;  2DE0 X;  1V29 B;  3H0H A;  1OPK A;  3UA6 A;  5AT1 B;  3HRU A;  2F2W A;  2O4X B;  3QZ9 B;  1T0J A;  4D8D A;  1YCY A;  4LXC A;  2RM4 A;  5A2Q E;  4BY6 C;  5GAN e;  4XAX B;  3PVL A;  1VQP Q;  2YUO A;  5GAN 2;  2MAM A;  3TRE A;  4RTX A;  1TSF A;  1VQ9 A;  4C5H A;  4B9W A;  1Q86 C;  1QCF A;  2R5A A;  2O4X A;  1QP3 A;  2JS0 A;  4J6Y A;  3NTH A;  1NYF A;  2VUB A;  3EG9 A;  4FW1 A;  3CMA T;  3E9F A;  2XD0 A;  4M77 D;  5KH6 A;  4KT0 E;  1VQ6 A;  3H8Z A;  2MCN A;  3CCM A;  4ZTJ A;  2MWP A;  3RUX A;  5GMK h;  2X35 A;  3G6E Q;  3ZL7 C;  1BB9 A;  4MDX A;  4KGX B;  2GBQ A;  3G4S A;  3THK A;  3FLG A;  4F17 A;  3OY9 A;  2KYM A;  5D7U A;  3HSB A;  2KE9 A;  5KYX A;  2RJF A;  1CKB A;  4RG8 A;  2SRC A;  4RTY A;  4M75 B;  4DBH A;  2O88 A;  4FW2 A;  1H8K A;  1NBE B;  5GAM e;  4ZTF A;  5HCK A;  4OGC A;  4M78 B;  3VV0 A;  3CMA A;  1OEB A;  2LCL A;  4L5G A;  3QG1 A;  2GTJ A;  5GAN 3;  3DLM A;  1AT1 B;  1QMC A;  1GBR A;  2W10 A;  5KE2 A;  4GY5 A;  4RMO A;  2X9H A;  4MDW A;  3D7S B;  3TSZ A;  1YIT T;  2DL4 A;  2EYQ A;  3P8B B;  3HPW A;  2KRS A;  5HKC A;  1BYM A;  3JCM e;  4XU3 A;  2QGG A;  4E7S A;  1QCN A;  1EIF A;  2R5M A;  2IVW A;  2QAS A;  3CME T;  3PNW C;  2V1Q A;  1QVP A;  2K4Y A;  3NPF A;  3H41 A;  3OW2 A;  1VQ8 T;  1NPR A;  1QQJ A;  2L0A A;  3L2Z A;  4KGV B;  1IGU A;  4Y91 A;  2ZPB B;  5GAO l;  1VIE A;  4IKF A;  4E47 A;  2RF0 A;  2K9G A;  3CCR T;  5GAN d;  3M0U A;  3M4Y A;  3OW2 P;  3O5Z A;  2JTF A;  4N0A C;  2DO3 A;  1JBM A;  2PNI A;  1WYX A;  3A8O B;  4LUD A;  2JM9 A;  4II1 A;  3G6E T;  5CK9 A;  1ZSZ A;  4C92 B;  1RAA B;  3QII A;  2EVR A;  2QQB A;  2LVM A;  3SDZ A;  2A28 A;  1PRL C;  2L3P A;  4MZT A;  1XNI A;  5CKD A;  3EH2 A;  1YHQ T;  3UPU A;  2LX9 A;  1OZ2 A;  2EQM A;  2QDY B;  4XU2 A;  4OB0 B;  1QWE A;  3FJ5 A;  2AT1 B;  1PHT A;  1VQP A;  1VQK Q;  3IQL A;  3QZ5 B;  3HHT B;  4AFQ C;  5LJ3 e;  1IO6 A;  1Z9Z A;  1OU8 A;  2FHD A;  2RQV A;  2YRV A;  3V7S A;  2HAX A;  2GQI A;  3AT1 B;  1AZE A;  1WI7 A;  3M0R A;  1Q7Y C;  3I55 A;  3UT1 A;  1WQW A;  4RG2 A;  2OX7 A;  4AT1 B;  3I5S A;  4E7K A;  1X6B A;  2HL3 A;  1W1F A;  5KYY B;  2A3L A;  1IZ6 A;  1UGS B;  4OB3 B;  1MMD A;  1K8A C;  2P84 A;  2AIR B;  4J9D A;  3I55 Q;  5FWB A;  2RK1 A;  2E12 A;  4ZGD B;  3CEY A;  1SG5 A;  4PFP A;  3EGD A;  4BE2 A;  2LQN A;  2QA4 A;  5GAN g;  2LJ3 A;  3L2W A;  4M78 E;  4HVU A;  3A8M B;  2KRM A;  1V1C A;  4M7A D;  5FU7 C;  3CME Q;  2V8J A;  4XK8 E;  5ECA A;  1BK2 A;  2LQ8 A;  5KE3 A;  3GOX A;  2NUT A;  2YUP A;  3M0T A;  1RLQ C;  2DL3 A;  4B9X A;  2O9S A;  3G4S Q;  3EGX A;  3UAT A;  2FRY A;  2NUZ A;  4NS5 A;  4BB7 A;  1NEB A;  1RAC B;  2CH4 W;  1KHI A;  3CCQ Q;  3ASK A;  4VUB A;  1IRE B;  1VQ6 Q;  5CKH A;  3ZBD A;  4QQD A;  5LJ3 f;  1QVG P;  5GMK e;  1RAB B;  2H8H A;  3E2U A;  1AZG B;  3VYH B;  2J6O A;  5GAN f;  1KQS P;  1WXU A;  2CUB A;  2DAQ A;  4XTV A;  5AYF A;  2HNI A;  2KGT A;  1X2K A;  2ZPH B;  2CYZ B;  1K8A U;  2OTL A;  4DBQ A;  3CD6 A;  3QUI A;  3J81 E;  1MMN A;  1YI2 A;  5FU6 B;  2XHC A;  3AHU A;  2V8I A;  1YJN Q;  2RJC A;  3QHS A;  1ZUY A;  2QYZ A;  2RHZ A;  2VKN A;  4PJN A;  1VQM A;  4M7D B;  2RHX A;  2YWW A;  1TUD A;  1AHJ B;  1WLP B;  4C92 D;  4OMQ A;  2VV5 A;  3QBY A;  2E5K A;  3ME9 A;  3JCM d;  3C94 A;  3OS2 A;  2JVV A;  3MCA B;  1M1K U;  4M7D E;  2A08 A;  3JCM P;  1PD1 A;  3M55 A;  2ABL A;  4EMH A;  1PCX A;  2J7I A;  1PG5 B;  3CCJ T;  2NYS A;  4O6J A;  1KQS A;  1M2V A;  3CCS T;  2K7A A;  3CPF A;  2AZV A;  5GAN 7;  3LGF A;  5LJ5 g;  3CCS Q;  1Q7Y R;  3MO8 A;  4AFS C;  1W6X A;  2DF6 A;  3I55 T;  1SRM A;  4J6W A;  2NUP A;  5FRO A;  1KQS S;  1YJ9 A;  5D6Y A;  2HDA A;  2DJQ A;  4BE1 A;  2LNV A;  1O9S A;  3QSU A;  4JRP A;  1JJ2 P;  1SKU B;  3L2V A;  2VYT A;  2JS2 A;  1S72 Q;  3QKJ A;  2RHI A;  3OYN A;  1VQK T;  2H3J A;  3HTR A;  1UEC A;  1ZA1 B;  2XDB A;  4J9G A;  2FZK B;  4B6M A;  2V8K A;  3JB9 D;  1UDL A;  4F7U G;  2QTX A;  3VRY A;  5LJ3 h;  1TTH B;  1YCS B;  1SRL A;  1YIJ Q;  1HD3 A;  1HXD A;  2C06 A;  2JUF A;  3VS7 A;  1QVF P;  1SHF A;  1B34 A;  2DD4 A;  4DOW A;  2BE7 D;  4QT7 A;  1D0X A;  3A5Z B;  4OML A;  4E7J A;  2P0Q A;  1N9R A;  4FCY A;  2ROL A;  1AWO A;  1W2B S;  3EGD B;  3RKY A;  3M57 A;  1GFD A;  2HBP A;  1RAG B;  1UFF A;  2DMO A;  1VQ7 T;  2X4J A;  1YJ9 T;  1QVG A;  1BU1 A;  4WCI A;  2F1L A;  1KIK A;  1Q81 U;  1NJI U;  2L3S A;  3MET A;  3CC2 A;  2I0N A;  5GMK l;  1X6G A;  3I56 T;  5HK0 A;  4XU0 A;  3CPW S;  2IPO B;  2C0I A;  2COZ A;  1ZLM A;  1R77 A;  2XI9 A;  2LCS A;  4JZ4 A;  1KQ2 A;  1N9S A;  2EPD A;  1UHC A;  4M75 G;  5J39 A;  4GBQ A;  2FVU A;  4LD6 A;  1VQ9 Q;  2DZC A;  1VYT A;  3V7C A;  4JJD A;  4V2S A;  1YIJ A;  1Q86 U;  2KVQ G;  4BDY A;  1RUW A;  2VAS A;  2RI2 A;  1UGP B;  3S3N A;  4UC4 A;  2QQA A;  2E10 A;  3X28 B;  3DB3 A;  1IXD A;  3CD6 Q;  3OYA A;  3WXM B;  2M16 A;  3FDR A;  1QCO A;  3WVE B;  1ZSZ B;  4AG2 C;  4M77 C;  1PM3 A;  2ENM A;  2H3E B;  2D6F A;  1R8O B;  1WJS A;  5KYU A;  3ULR B;  2CGH A;  2XIC A;  3DKM A;  2C0O A;  1T3L A;  2A0F B;  4LDW A;  4FSX A;  2FZG B;  2HCK A;  2CH4 A;  1M1K C;  2XID A;  2O31 A;  4OMP A;  1VQ6 T;  4LD9 K;  2K3X A;  1MGQ A;  4FT4 A;  2X4W A;  4EDU A;  5KYN A;  2DIG A;  4HT9 A;  2Z0W A;  2JZ2 A;  3REA B;  3QPH A;  5KYX B;  1JB0 E;  2EFI A;  1BIA A;  3JAM E;  2A37 A;  4OMN A;  1D1A A;  4XU1 A;  2EJ9 A;  2QI2 A;  2RNA A;  4A54 A;  2ZPE B;  3V8J A;  2DK3 A;  3GP8 A;  1ZSZ C;  5L8R E;  5GAO q;  5GAO r;  3GIB A;  1KQ1 A;  5C6S A;  2G6F X;  1ARK A;  4XTU A;  1JXM A;  1AWX A;  5A0L A;  1OPL A;  1UG1 A;  1M90 U;  4OP0 A;  3GLX A;  2KYB A;  4HKE A;  3LWH A;  1K8A R;  1MND A;  3CCM T;  2PVD B;  2AKK A;  1FMV A;  4HCZ A;  4J9H A;  4HCK A;  4JJB A;  4M77 B;  1YI2 Q;  2DZ9 A;  1HYO A;  5I2M A;  2RQT A;  1LVK A;  2X3W D;  3G1J A;  2D8J A;  1OOT A;  3QDF A;  1MMA A;  4IIO A;  1AWW A;  2DRK A;  1WA7 A;  2RMO A;  5GAN h;  2M0O A;  2P4T A;  1M90 C;  1WFW A;  4BAC A;  2F5T X;  2XKO C;  1TUC A;  2DLP A;  1M4Z A;  2HSE B;  3M59 A;  3V8L A;  4CRI A;  4JRI A;  2HKQ B;  7AT1 B;  2QGF B;  2Y4Y A;  3PMT A;  5I22 A;  1YBY A;  4BI4 A;  1Y96 A;  1PWT A;  4MMK A;  3X20 B;  2JMC A;  5L23 A;  2X3X D;  3CCQ A;  4AG1 C;  2EIF A;  2E64 A;  2QEX T;  1YN8 A;  1R0C B;  1I8F A;  3CBO A;  3S6W A;  4L59 A;  3EHR A;  5GAO m;  1GL5 A;  3ZEH A;  1G8X A;  1YWP A;  1G5V A;  1D1B A;  1SPK A;  2LP5 A;  3VU3 C;  2BZY A;  2EYY A;  1D09 B;  5GAN 5;  3RMS A;  2E5Q A;  3EAE A;  4C92 E;  3JCM c;  5FU7 B;  2OTJ T;  1VQ4 Q;  2G3R A;  5GAM h; 
#chains in the Genus database with same CATH homology
 1BIB A;  2YRV A;  4A4H A;  5IAY A;  4FU6 A;  5LJ3 g;  1Y71 A;  4M77 E;  4M75 E;  3QXE B;  4PNO A;  5LJ5 e;  3V7S A;  2HAX A;  2JOY A;  2XU8 A;  1Q7Y C;  5KCO A;  3I55 A;  4C92 F;  1Y96 B;  5CQX A;  1LOJ A;  4J83 A;  2RI5 A;  4C8Q G;  3UT1 A;  2ZPG B;  1XTD A;  1WQW A;  4RG2 A;  3FJP A;  1RI0 A;  4E7K A;  3OQ5 A;  1VQK A;  4BI3 A;  3ZFJ A;  2P0P A;  3CCE T;  2A3L A;  1IZ6 A;  2KQW A;  1UGS B;  2GFA A;  3CXC A;  4OB3 B;  5GAN 4;  3JRZ A;  1K8A C;  4OMF B;  4F7U F;  1Y7X A;  3VJP A;  3I56 A;  3OYK A;  4C0G A;  3PGG A;  4PJO G;  3CC7 A;  2E70 A;  4C92 C;  2RK1 A;  1VQ9 T;  2AHJ B;  4M78 F;  3MEV A;  2ZGW A;  3OYE A;  2LDM A;  2DJZ A;  2E12 A;  2F69 A;  3JCM h;  4ZGD B;  4BD3 A;  3CEY A;  4BE2 A;  3RMQ A;  4JRQ A;  2MMP A;  2WSC E;  5DLQ E;  2QA4 A;  1U1T A;  4C8Q F;  5GAN g;  2DXU A;  1XQH A;  4FT2 A;  5CIU A;  3L2W A;  2KAF A;  3OYF A;  3HFO A;  4M78 E;  1H3Z A;  4IUP A;  3CXC S;  1Y07 A;  1KHC A;  5CCA A;  3DB4 A;  2IG0 A;  2ZCF B;  1MHN A;  3O8V A;  3A8M B;  3CCL A;  4FM4 B;  5CVI A;  1KD1 C;  5DM7 R;  5GAN 8;  2DVE A;  4M77 A;  4M7A D;  4OGE A;  1FWZ A;  2YHT A;  5FU7 C;  4ZGE B;  1YIJ T;  2V8J A;  5GAN j;  3CD6 T;  4XK8 E;  3G71 A;  5A0G A;  2GF7 A;  2LQ8 A;  5KE3 A;  4ELZ C;  5KCH A;  3GOX A;  1OI1 A;  4E7L A;  2CS7 A;  4B9X A;  4OB2 B;  3JCM X;  1VQ5 T;  3L1A A;  2GQV A;  4BE0 A;  3JB9 J;  3NTI A;  1NE8 A;  3SWN B;  3CC2 T;  4NS5 A;  4BB7 A;  1QP2 A;  3G6E A;  2L3R A;  3ER0 A;  1KHI A;  3GF5 A;  4QVZ A;  3ASK A;  2K3Y A;  2CZ6 B;  4VUB A;  2X4Y A;  3CCV T;  3T9N A;  2RJE A;  1IRE B;  4C92 A;  1VQL T;  3RER A;  3QYG B;  1M9S A;  1FXX A;  5CKH A;  1TH7 A;  3E1S A;  1FX7 A;  4PJO C;  4ATO A;  1DJ7 B;  4PJO D;  2RJD A;  4M77 F;  3JSC A;  3A8H B;  3ZBD A;  2K5I A;  4QQD A;  2FYK A;  5LJ3 f;  3VKI A;  4RKU E;  2L89 A;  2E1H A;  4C0Z A;  5GMK e;  3J80 E;  2KSS A;  4ZN1 A;  2RI3 A;  3CCU T;  4KUI A;  3L2U A;  1Q82 U;  3M53 A;  1N6A A;  1P92 A;  1YJW T;  2I2L A;  1N8R C;  3INZ A;  2DTO A;  3A8L B;  4GLK A;  2OAU A;  2LQK A;  4M78 C;  4Z02 A;  4BI8 B;  3J7A F;  2DTI A;  3QYH B;  3VYH B;  2PVO B;  3HRS A;  2DXT A;  3RKX A;  1PSF A;  5GAN f;  2DAQ A;  5AYF A;  4XTV A;  1JJ2 A;  2HNI A;  2M9U A;  2ZPH B;  2CYZ B;  2ZZD A;  1K8A U;  3M54 A;  2OTL A;  4NOY A;  1W2B A;  3CD6 A;  3QUI A;  3J81 E;  1VIF A;  1YI2 A;  5FU6 B;  2EJG A;  2XHC A;  3AHU A;  3SB2 A;  4M7D C;  5FRN A;  2V8I A;  3OSV A;  4ME7 A;  4LDU A;  3X24 B;  5GAO n;  2JN0 A;  2RJC A;  5I2S A;  3L2Q A;  3X25 B;  2EWN A;  2LTO A;  1QW1 A;  2X4X A;  2QXF A;  3QHS A;  4OB1 B;  5CAI A;  1K73 U;  3JCM J;  1VUB A;  2K57 A;  2RHZ A;  2CKK A;  4F7U E;  3GNF B;  2RHX A;  3TCJ A;  1VQM A;  3CC7 T;  4M7D B;  1X01 A;  3M9Q A;  1AHJ B;  3X26 B;  4C8Q D;  4HA8 A;  5J26 A;  4C92 D;  2XG8 D;  4LDX A;  2VV5 A;  3QBY A;  4PKC C;  3ME9 A;  3JCM d;  4JRK A;  2KK4 A;  4Y28 E;  4J7F A;  1QVF S;  3BW1 A;  4X34 A;  3F70 A;  3Q1J A;  1VQ7 A;  1UB4 A;  4BUG A;  3S3O A;  3C94 A;  3OS2 A;  3HRT A;  1WJR A;  2KMT A;  4BY6 B;  1ZHI A;  1HK9 A;  2JVV A;  4J8O A;  4NL2 A;  4A4E A;  4CI0 C;  3MCA B;  4OVA A;  3OYI A;  2D9T A;  2VC8 A;  5IN1 A;  2DD5 A;  4OF1 A;  1VQN T;  2ZPI B;  4BDZ A;  1M1K U;  2RA2 A;  4F7U B;  4M7D E;  5IT9 E;  3OW2 S;  1VQ4 A;  5GAM g;  3CC4 T;  1M1F A;  3JCM P;  4C5I A;  3HFN A;  1N27 A;  2E41 A;  3M55 A;  4Q5W A;  1YHQ A;  4M7A A;  3G4S T;  2R58 A;  2QQ9 A;  4EMH A;  5FRM A;  2EAY A;  3OMC A;  3MEU A;  3URG A;  3CCJ T;  4O6J A;  4LDY A;  5GAM f;  1D3B B;  4EMG A;  3QDR B;  1YI2 T;  1KQS A;  2WSF E;  3SWN A;  3CCS T;  1VQP T;  1Q7Y U;  4M78 A;  1GXI E;  2K2V A;  4C0F A;  5LJ3 j;  4C5E A;  3GNG A;  4DOV A;  1JJ2 S;  3CPF A;  5GMK j;  4YTL A;  3KUF A;  5GAN 7;  3CCV A;  3FC3 A;  1H64 1;  4FIB A;  3LGF A;  3P8H A;  2DEQ A;  4P5N A;  1BI2 A;  4C8Q A;  5LJ5 g;  4M7D G;  4M7A G;  5FU6 C;  3V7R A;  2VGM A;  1VQM T;  4WF2 A;  3MO8 A;  1U8R A;  3CCR A;  1BI1 A;  2PU9 B;  1SSF A;  4LDV A;  2HD0 A;  1G3Y A;  3I55 T;  4J6W A;  4EMK C;  4M78 D;  5FRO A;  1D3B A;  4XTY A;  3OYJ A;  1KC8 C;  1KQS S;  1YJ9 A;  3BFM A;  4IUT A;  2DXB A;  5D6Y A;  4BE1 A;  2LNV A;  1WQ7 A;  3JCM Q;  3LW5 E;  1O9S A;  3QSU A;  4PJO A;  2LRQ A;  4JRP A;  2RHY A;  4QVC A;  1NZ9 A;  2K5F A;  4XTX A;  1VQ5 A;  2MWO A;  3L2V A;  2VYT A;  2VXF A;  2YLC A;  4D6W A;  4EMK B;  4M7A E;  3OYY A;  4C0D C;  3QKJ A;  2RHI A;  3OYN A;  2DIQ A;  1VQK T;  2PUK B;  2H3J A;  5EG2 A;  3OMG A;  2M1H A;  5CO7 A;  2CZ0 B;  2XDB A;  4JJN K;  2PUO B;  3UDC A;  1OYX A;  5CR2 A;  5I21 A;  2GCX A;  1QVF A;  3OYG A;  2LT1 A;  3JCM V;  1O75 A;  1PSE A;  2V8K A;  3JB9 D;  4F7U G;  4HCC A;  2E65 A;  4XTW A;  2QTX A;  4QW2 A;  3CBP A;  5LJ3 h;  1LNX A;  3GPL A;  1NPP A;  3MP8 A;  1BI0 A;  2DXC A;  3FIF A;  3LH0 A;  3SD4 A;  4ELY C;  5GMK m;  3E19 A;  3CCJ A;  1M8V A;  1HXD A;  3UWN A;  2C06 A;  2JUF A;  2XDD A;  3M4G A;  3CCL T;  1B34 A;  2CZ7 B;  2DD4 A;  4ZN3 A;  1X6O A;  2CZ1 B;  4DOW A;  4XTZ A;  3JCM g;  4DQ2 A;  5LJ5 d;  3OYH A;  3A5Z B;  2FL7 A;  4QVD A;  3MEW A;  4KUL A;  4E7J A;  2P0Q A;  3RKW A;  1N9R A;  2LC4 A;  4PJO F;  3C95 A;  2L8D A;  4KBM B;  2R57 A;  3LGL A;  2F5K A;  3M5A A;  5CKE A;  3WVD B;  4M7A B;  1W2B S;  4PLL A;  4M78 G;  4A4G A;  3TU4 K;  4JDS A;  1U1S A;  3FB9 A;  3M57 A;  4RCB A;  4IUQ A;  4N0A A;  4N4I A;  3RKY A;  4C5G A;  3LWI A;  2HBP A;  3OYB A;  4HT8 A;  1VQ7 T;  1KC8 U;  2X4J A;  3OYM A;  1YJ9 T;  1QVG A;  1KG1 A;  3QJY A;  2RK2 A;  3FRN A;  2XDP A;  2Y90 A;  1VQO T;  1Q81 U;  1NJI U;  3L42 A;  4JUV A;  1WPY A;  4RCC A;  3KXT A;  1ZQ1 A;  3MET A;  3CC2 A;  1VQL A;  3OBY A;  3BDL A;  3NTK A;  3HL8 A;  5GMK l;  1VQO A;  3PFS A;  5J3B A;  4JLI A;  2D0Q B;  3I56 T;  2QEX A;  3FEO A;  3VUZ A;  4X9D A;  5HK0 A;  4XU0 A;  1K73 C;  3M58 A;  4ZGJ B;  2RO0 A;  3CPW S;  4J5Y A;  2MF2 A;  2QQS A;  5CKB A;  2QQR A;  2XI9 A;  5DLO A;  3SFM A;  1KQ2 A;  1B34 B;  4HCB A;  3CPW A;  2WAC A;  3EFS A;  4M75 C;  1W4S A;  2E6Z A;  1N9S A;  2RH2 A;  1YJW A;  5DY9 A;  1UGQ B;  4M75 G;  2WSE E;  2K5L A;  3V8K A;  2FVU A;  5J39 A;  4LD6 A;  3DLL A;  4M7A F;  3CBM A;  4C0D B;  2DZC A;  3OB9 A;  2QA4 T;  4PJO B;  3V7C A;  4N4H A;  5GAN 6;  3KBG A;  1XOV A;  4C8Q C;  2BIV A;  3JB9 F;  4V2S A;  1VQN A;  1YIJ A;  5D6X A;  1V29 B;  3VUB A;  1Q86 U;  2KVQ G;  1I5L A;  2DPP B;  4F7U A;  4BDY A;  5CKF A;  1QVG S;  5GAO p;  2BKD N;  2OTL T;  2RI2 A;  1YIT A;  1UGP B;  3S3N A;  1YJN A;  3OYL A;  3HRU A;  4UC4 A;  3P8D A;  2QQA A;  4IUV A;  1N8R U;  2O4X B;  2E10 A;  3X28 B;  1K9M U;  3QZ9 B;  3DB3 A;  2EQK A;  1YCY A;  2RM4 A;  5A2Q E;  4PL6 A;  3OYA A;  4BY6 C;  2NLU A;  3WXM B;  4M7D D;  2M16 A;  3FDR A;  3CCS A;  5GAN e;  4XAX B;  5GAM j;  4J6X A;  2EKO A;  1M1G A;  3MP6 A;  3WVE B;  1S72 A;  5GAN 2;  2MAM A;  4M77 C;  3TRE A;  5LJ3 d;  4E7I A;  2D6F A;  1UGR B;  1R8O B;  1WJS A;  2RHU A;  3OA6 A;  3MEA A;  3MP1 A;  2CGH A;  1VQ9 A;  1UEB A;  4C5H A;  2LCC A;  4B9W A;  3R6O A;  1Q86 C;  2XK0 A;  4MZM A;  1G3T A;  2R5A A;  2XIC A;  3DKM A;  4L6V 5;  4XQ3 A;  2O4X A;  1QP3 A;  4J6Y A;  3NTH A;  4LDW A;  2VUB A;  3LX7 A;  3CMA T;  3E9F A;  2XD0 A;  4FSX A;  4M77 D;  4PLI A;  4M75 D;  4A53 A;  5KH6 A;  4KT0 E;  5D6W A;  1OZ3 A;  1M1K C;  3OSS C;  2XID A;  1VQ4 T;  3CCU A;  3PIP A;  3CCQ T;  2P0K A;  1VQ6 A;  3H8Z A;  3RIR A;  3CCM A;  4ZTJ A;  2RD1 A;  2MWP A;  3E9G A;  4MML A;  3RUX A;  5GMK h;  4M75 F;  1VQ6 T;  4M7D A;  4QQG A;  4MZP A;  4LD9 K;  3JB9 H;  1BKB A;  2X35 A;  5LJ5 h;  5M9O A;  2K3X A;  5LL6 S;  1MGQ A;  4FT4 A;  3VYG A;  3QO3 A;  2X4W A;  4EDU A;  2JNG A;  2DIG A;  5GMK i;  4HT9 A;  4MDX A;  3LLR A;  4M75 A;  3FLG A;  2JZ2 A;  4IUR A;  3OY9 A;  3G4S A;  4M7D F;  3HSB A;  3QPH A;  1JB0 E;  2EFI A;  1K9M C;  1VQ8 A;  3M56 A;  1BIA A;  2HQE A;  2RJF A;  5FLX E;  3JAM E;  3CCE A;  4RG8 A;  3OS5 A;  1I4K 1;  4M75 B;  3CME A;  1S72 T;  3HKS A;  4XU1 A;  3NFC A;  2EJ9 A;  2QI2 A;  4A54 A;  2ZPE B;  2L5Q A;  3V8J A;  1ZBX A;  2DK3 A;  1G3S A;  3PTA A;  3GP8 A;  1WNL A;  5L8R E;  5GAO q;  5GAO r;  5GAM e;  3OS1 A;  1KQ1 A;  2RB6 A;  3EFR A;  1JRI A;  3JCM b;  3GIB A;  2FB7 A;  5C6S A;  4ZTF A;  4X9C A;  4OGC A;  3BY7 A;  4XTU A;  4M78 B;  3VV0 A;  5A0L A;  3CMA A;  3C12 A;  2LCL A;  3A8G B;  4QQ6 A;  5HK3 A;  4L5G A;  3RES A;  4EPC A;  1M90 U;  4OP0 A;  3GLX A;  4C92 G;  4HKE A;  3QG1 A;  3SWN C;  5GAN 3;  3LWH A;  3JCM W;  3DLM A;  2DTH A;  4FL6 A;  5A0D A;  3OS0 A;  3CCM T;  2E6N A;  2PVD B;  4IUU A;  5KE2 A;  4GY5 A;  4NL3 A;  4HCZ A;  3JCM f;  4RMO A;  3CC4 A;  3TEE A;  4KUD K;  4M77 B;  5GAM d;  4MDW A;  2DZ9 A;  5LJ5 j;  1YIT T;  3L2R A;  2O01 E;  2EYQ A;  3P8B B;  5I2M A;  4R55 A;  3G71 T;  1NJI C;  3HPW A;  2YLB A;  1Q81 C;  2B8A A;  5HKC A;  3S3M A;  2JTM A;  1WGS A;  2A7Y A;  1BYM A;  3JCM e;  3HP9 A;  4XU3 A;  1EIF A;  2R5M A;  3MHX A;  2IVW A;  4EMK A;  5GAN h;  3CME T;  3PNW C;  2M0O A;  2P4T A;  4PJO E;  4J7I A;  1I81 A;  1M90 C;  1QVP A;  2K4Y A;  1VQ8 T;  3OW2 A;  1NPR A;  2PVG B;  3L2Z A;  3QJ6 A;  4BAC A;  4Y91 A;  2F5T X;  2ZPB B;  5HY6 A;  2XKO C;  4A4K A;  2MI6 A;  4DA4 A;  4M7A C;  1LJO A;  1VIE A;  5GAO l;  1M4Z A;  4IKF A;  4E47 A;  2OTJ A;  3M59 A;  3OBW A;  3V8L A;  4CRI A;  3CCR T;  4JRI A;  5GAN d;  1YJN T;  1WJQ A;  2DKG A;  3M4Y A;  2Y4Y A;  2JTF A;  3PMT A;  4R56 A;  2KY9 A;  1YBY A;  4N0A C;  2PQW A;  2DO3 A;  1JBM A;  4BI4 A;  1Y96 A;  3PT9 A;  3JB9 I;  4MMK A;  2BUD A;  3A8O B;  3X20 B;  2EQJ A;  1Q82 C;  3CCQ A;  4II1 A;  3OYD A;  4N4G A;  3G6E T;  3G7Z A;  4C8Q B;  5CK9 A;  1G3W A;  3N5B B;  4C92 B;  2EIF A;  2E64 A;  3H6Z A;  2GFU A;  2EQU A;  2QEX T;  3QII A;  1I8F A;  1X75 C;  2QQB A;  3CBO A;  2LT4 A;  2LVM A;  4O5V A;  3SDZ A;  4L59 A;  3S6W A;  1KD1 U;  4TVR A;  4MZT A;  5GAO m;  2Y4X A;  1XNI A;  3BDU A;  5CKD A;  4M77 G;  1YHQ T;  3ZEH A;  1M5Q 1;  2LX9 A;  5LJ5 f;  3UPU A;  2HQX A;  1OZ2 A;  1RL2 A;  2EQM A;  1BI3 A;  4JS4 A;  2QDY B;  3C4S A;  4JLG A;  4OB0 B;  4XU2 A;  3JB9 G;  1G5V A;  2KDS A;  3OYC A;  2VXE A;  3VU3 C;  3PIO A;  1VQP A;  4C8Q E;  3LYI A;  3PMI A;  5GAN 5;  4JS5 A;  3RMS A;  2E5Q A;  3EAE A;  4A4F A;  3QZ5 B;  4C92 E;  3HHT B;  5C0M A;  2ZPF B;  3JCM c;  5CQY A;  4E7H A;  5LJ3 e;  5FU7 B;  2OTJ T;  2VGN A;  2EJF A;  2FHD A;  2G3R A;  5GAM h; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...