3E9GA

Crystal structure long-form (residue1-124) of eaf3 chromo domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
121
structure length
107
Chain Sequence
EFALGGRCLAFHGPLMYEAKILKIWDPSSKMYTSIPKPQKLGEDESIPEEIINGKCFFIHYQGWKSSWDEWVGYDRIRAYNEENIAMKKRLANEAKEAKKSLLEHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromatin modification-related protein EAF3
publication title Molecular Basis of the Interaction of Saccharomyces cerevisiae Eaf3 Chromo Domain with Methylated H3K36
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 107
sequence length 121
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11717 Tudor-knot RNA binding activity-knot of a chromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3e9gA01
1XNIA 4QQDA 3OQ5A 1SSFA 1OI1A 2R5MA 1N27A 4BE0A 2E5QA 2RI2A 3FLGA 3MEWA 4BD3A 4QW2A 2EQMA 4PL6A 1WJQA 3OYIA 3LYIA 2VYTA 2NLUA 4BE1A 2R5AA 2LDMA 3LLRA 3Q1JA 5KCHA 2HQEA 4B9WA 2RJFA 3PFSA 3DB4A 3FEOA 3P8HA 4II1A 3MEVA 4N4HA 3MP1A 4UC4A 2LRQA 3QJ6A 2RI3A 3MP8A 3MP6A 4IUQA 3OYFA 3UT1A 4FU6A 5C6SA 1KHCA 3OS2A 1OZ3A 1RI0A 3OB9A 1OYXA 4QVZA 3OYMA 3OYDA 3ME9A 2EQKA 3UWNA 3H8ZA 5M9OA 3OS1A 2BKDN 3QBYA 2LVMA 2X4WA 2CKKA 2G3RA 2RHIA 5CIUA 4IUPA 4A4FA 3L42A 5KH6A 4BACA 4E7LA 2P0KA 2PQWA 2DIQA 4QQ6A 4RG2A 4C5IA 2WACA 4CRIA 2R58A 4IUTA 5D6XA 4E7JA 1H3ZA 2YRVA 4C5GA 4N4IA 4BDZA 2BUDA 3S6WA 2DAQA 3OYAA 3OYKA 2L8DA 3C4SA 3KUFA 2RJDA 4IURA 2LTOA 4L59A 2RJEA 4EDUA 3LGLA 5C0MA 3E9GA 4B9XA 2QQRA 3PMTA 4PLIA 3BDLA 4ZTFA 3LH0A 4GY5A 2L3RA 5J39A 3FC3A 2EKOA 2JTFA 3F70A 2X4YA 3OYCA 4N4GA 3OYJA 3S3MA 2IG0A 2RHUA 2X4XA 4ZTJA 3META 3LGFA 2EFIA 4HCZA 2GFAA 4A4HA 3OYNA 2D9TA 2LCCA 3PMIA 1G5VA 3NTIA 2B8AA 5D6YA 4PLLA 5IN1A 2O4XA 4IKFA 2JZ2A 2RI5A 4E7IA 5FRNA 3EAEA 4Q5WA 3L2QA 3L2WA 2RHZA 1WGSA 3QKJA 3DB3A 2K3XA 2GF7A 2BIVA 2O4XB 3MEAA 4A4EA 4BE2A 3OYGA 5FROA 5FRMA 2MWPA 3PNWC 2HQXA 3S3NA 5KCOA 2XDPA 5IAYA 1WJRA 1MHNA 5KE2A 3GOXA 4E7KA 2EQUA 3CEYA 5KE3A 2M0OA 3OMCA 3L2VA 2R57A 4BDYA 1OZ2A 4C5EA 3SD4A 4OVAA 2FHDA 4A4GA 3H6ZA 2M16A 3OYBA 3DLMA 3OS0A 4E7HA 2F5KA 2GFUA 3M9QA 4X34A 4Z02A 3OYEA 3OYLA 3L2RA 3QIIA 2EQJA 4LD6A 4C5HA 2QQSA 2DIGA 2XK0A 2RHYA 4IUVA 2RJCA 3MO8A 2L89A 4QQGA 3LX7A 2X35A 2M1HA 3E9FA 1WJSA 3NTHA 3S3OA 3OA6A 3NTKA 4IUUA 2MWOA 2RO0A 4NS5A 3OY9A 2K3YA 4FL6A 3OMGA 3OYHA 3O8VA 3ASKA 3ZEHA 3L2UA 5D6WA 5J26A 3P8DA 3FDRA 2RHXA 3MEUA 2E6NA
chains in the Genus database with same CATH superfamily
2CH4A 1PRMC 1Z9QA 4QW2A 2HZYA 3LYIA 1RAGB 3LLRA 2FRYA 3NFCA 3OBYA 3QG1A 1ZHIA 1UEBA 4ZN3A 1AWXA 3CC4A 1KFZA 3QJ6A 3VUZA 2E5KA 2OTLT 3ME9A 2VV5A 2AIRB 1QP3A 2YUQA 1B3QA 5DLQE 1V1CA 2JUFA 4AG1C 4QQ6A 1KQSS 3JRZA 1PCXA 2F69A 1HK9A 5D6XA 2CT3A 2DL3A 1H3ZA 2QA4T 4R55A 3CCRT 5GANj 4HXJA 5DM7R 3OYKA 2KVQG 1IZ6A 4RTYA 2CS7A 1M1GA 4A53A 1I4K1 2RJEA 1SEMA 2EGCA 5LJ3d 1M9SA 1IHWA 3G1JA 3H0FA 1N9RA 1UGVA 1YNZA 4X1VA 3OYCA 1OX8A 4RCCA 2IG0A 4ZTJA 3J80E 1ABOA 1JO8A 1KD1C 2YXYA 1AHJB 5FRNA 1F1BB 1ZA2B 2K3XA 3HRUA 3CCQQ 1WQWA 2DXUA 4XTVA 4M7DC 2JM8A 2JS0A 2LJ3A 5KYUA 1OZ2A 2KSSA 3RMSA 1QQJA 2GCXA 1W2BA 2DRKA 5CKDA 2DILA 4Z02A 5GAMj 2QI2A 4MDWA 2CZ7B 4ZGJB 4M7DF 1W6XA 2PU9B 2KT8A 3CBPA 1Q7YU 1RAHB 3ZEHA 4PJLA 4YTLA 5A2QE 2DJQA 1ZBJA 1YP5A 1K8AU 1M1KC 1SSFA 1KQSP 3MEWA 3I35A 4PFZA 2ROLA 5A0DA 3G71Q 2EQMA 1C0MA 1YITT 2HL5C 4JRPA 2HQEA 4B9WA 4QKUA 3M54A 5GAOq 4A63B 3MP1A 3QDFA 2C0IA 2PUKB 1ZSZB 3TCJA 1T3LA 3OYFA 1WI7A 1KHCA 1NE8A 3OYMA 2EW3A 3CXCA 5M9OA 4DEXA 2ZPFB 5I11A 5KH6A 1VQOA 3QWXX 1U8RA 2I2LA 2WACA 1E7OA 4E2FB 3RKWA 1VQOQ 4JZ3A 1X27A 2XG8D 3M0TA 4J83A 1R77A 1KQ1A 1IO6A 4MZMA 2DX1A 1QVFA 2D0NA 2JW4A 1N8RR 2FEIA 5J39A 4M4ZA 2JTFA 2YRDA 5GMKi 1MMGA 1Z9ZA 4FSSA 2ED0A 2CH4W 3R6OA 2LCCA 3IQLA 3NTIA 5D6YA 3JCMb 2JZ2A 3JCMQ 2GF7A 1WHJA 5I2MA 5GANh 5KCOA 3PTAA 1BI1A 2RA2A 2MF2A 2M0OA 2R57A 3D7SB 1VQNT 2DL7A 2V8IA 2EYWA 1YJWA 3DLMA 5KYWB 1K73C 3QIIA 4C0DB 4XK8E 1GL5A 3CCUQ 3MO8A 1G8XA 4PKCC 1M30A 2K3YA 1PNJA 1T0HA 2DXTA 3QZ9B 1UGQB 4N0AA 1X69A 2YLCA 6AT1B 4M78B 3ER0A 3EHRA 4A4HA 1XNIA 3V7CA 3TU4K 4M7DE 2VXFA 4DBHA 3CC2A 4M7AD 4FYVB 2IIMA 1BI3A 2HAXA 5GAMh 1RAAB 3JCMJ 1ZSZA 1UGPB 3DB4A 3P8HA 4IIMA 3CMAA 2QQ9A 4C92C 3I56T 5L23A 3CMAQ 1NBEB 4FU6A 3E19A 2ROTA 3HL8A 5HK3A 1X75C 1GBRA 2G3RA 1YIJA 5CIUA 1WDXA 1M90U 1SRMA 1YIJQ 3H0HA 4LN2A 4M7DG 1PG5B 3VRZA 1VQ7A 4MZTA 1E6HA 3OYAA 3G4SQ 1VQMT 1VQ4A 2L8DA 3PIPA 1BKBA 1B07A 1QLYA 2EBPA 3A1PA 4EDUA 4XAXB 2EJ9A 2XDBA 2F5TX 2EKOA 2OJ2A 2MYSA 1Q7YR 3SFMA 1VOMA 1Q81C 1ZQ1A 3KBGA 1LCKA 1T3SA 1K8AR 3QXEB 1W1FA 1WGSA 2FL7A 4LUEA 4C8QB 1G3SA 4C0FA 4R0KA 1AWWA 1TSFA 4DBRA 2H8HA 4F17A 2E4HA 1MMDA 2HD0A 4PFPA 5KYWA 2DMOA 1PSEA 3CCSA 1QWEA 3OYYA 4M77C 3DKMA 2J06A 5FW9A 4AG2C 4DEYA 2E65A 5FU6B 2KXDA 1JB0E 2RHYA 4IUVA 4HA8A 3EG1A 3LX7A 1WJSA 3HP9A 1UHCA 3VS3A 2ZGWA 3ZFJA 3L2UA 5J26A 5J3BA 2LQWA 2LMJA 1R0CB 1OI1A 3AHUA 1FX7A 2M9UA 2HNIA 4PL6A 4Y92A 1VQLT 2RK2A 3GPLA 3CPWS 1IGUA 2DK3A 2E64A 2CZ0B 2EJFA 4ATOA 1GFDA 1I81A 1WA7A 1N9SA 1RI0A 3KFVA 2EQKA 2HBWA 1RUWA 2V26A 1KC8U 2RHIA 2QQBA 2LC4A 2PQWA 1VQKQ 2DIQA 3CCLT 2DE0X 3EG3A 3UDCA 4N4IA 1NEBA 3V7RA 4E7SA 4OB3B 3HRTA 2DBKA 1ZBXA 3PMTA 2EVRA 1OV3A 4AFSC 1OX9A 2QDYB 3OYNA 4C92E 5LJ5j 3H0IA 4HVWA 1JXMA 4C8QA 1LJOA 4P5NA 2COZA 3PVLA 2BIVA 2DD5A 2ZPGB 1GBQA 2LNVA 2BZ8A 1TS9A 3CPFA 1QCNA 5CVIA 3S3NA 2O31A 4E7KA 2MMPA 1VQ9A 2F2XA 1YHQA 2VB6A 1OOTA 1CSKA 3J7AF 2XKOC 2RPNA 4PJJA 3OYEA 3CPWP 2YUOA 2P4TA 1UB4A 1M90R 1E6GA 4J9DA 2P4RA 4IUUA 2DVJA 3M5AA 5GAN6 1RLQC 4JUVA 3O8VA 1MMNA 1FMKA 4PFOA 4ZNXA 3WVDB 3E2UA 4JS4A 1O75A 3OBWA 2D6FA 4WF2A 2VYTA 3GF5A 2R5AA 4EMKB 3CCQT 3RESA 1RI9A 1YJNA 3CCMA 4II1A 2CUBA 5GANg 3MPUB 2RI3A 4A4KA 3UT1A 4M77E 2F1LA 2CZ6B 3OS2A 2L3QA 5FU7B 3OB9A 2CREA 4CC3A 4RTZA 2X4WA 5ECAA 1BB9A 2KBTA 3J81E 1VIEA 3I55Q 2C0OA 1M8VA 2KK4A 4RG2A 3M4YA 3EFSA 5HCKA 2JMAA 4C5GA 2ZCFB 2A3LA 2OTJQ 3CC7Q 4XU3A 2DTIA 3H41A 1I8FA 3E9GA 2JVVA 5GANf 4PJOC 1W4SA 2DTHA 1Y0MA 3JCMc 1M2VB 4M77G 2X4YA 5IHKA 3OYJA 3LGFA 1AWJA 3G71T 1SG5A 2OAUA 4XTUA 3MHXA 2FVUA 2CP7A 1V76A 1UG1A 1S72Q 1VQ6Q 4IKFA 2YSQA 5GAMg 3VV0A 3M0SA 3FB9A 3UA7A 3MEAA 5FRMA 1PM3A 4PJOF 1YI2A 2KE9A 2RNAA 3EH1A 2KYMA 5KE3A 2JMCA 2DKGA 2BE9B 3L2VA 2QDLA 1KG1A 2EYYA 4OVAA 2E12A 4JS5A 3RBBB 3OYBA 5GANe 4Z8AA 4LD6A 5LJ5h 4M7AF 1KC8R 4PNOA 2V1RA 5GAMf 2YLBA 4LXCA 1IB8A 2FO0A 3EFOB 1C1AA 2E3IA 3H9NA 3I5SA 4M75D 5CR2A 2BE7D 4JRIA 2K9GA 1FWZA 5HK0A 3CMEA 5CAIA 4X9CA 3JB9D 2AKLA 4EMKA 5CO7A 4NOYA 3PT9A 2X3WD 2JXBA 3GBQA 3TREA 3JCMh 2PVOB 1N8RU 2DVEA 3MP6A 1WYXA 2ATCB 4M78D 4ZN1A 1RAEB 1X2QA 4QVZA 3H8ZA 3QJYA 5GAMe 2VVKA 4E7LA 1CKBA 4J6WA 2DL8A 3RR6A 3CCUT 1X6GA 1YCYA 4FSXA 4IUTA 2X3XD 2J05A 3PE0A 4F7UB 2EWNA 2MAMA 5GAN8 1PWTA 3HFOA 3CCVT 1Y71A 1M2VA 3CBOA 2J6KA 3CC4Q 2QQRA 2W0ZA 1JXOA 1X6OA 2DL5A 4J5YA 5FLXE 3FC3A 3TSZA 2YWWA 2QTVA 1Q82U 5GAN4 1LVKA 1D0ZA 2SEMA 1NG2A 3LW5E 1ABQA 4E7IA 3M56A 4L6V5 5GAN7 4HCCA 1M5Q1 4CC2A 1GCQA 4CI0C 4AMCA 7AT1B 3CMAT 3V8LA 1Q95G 2XI9A 2K7AA 2EAYA 2LQKA 1QP2A 4MDXA 1UUEA 2FHDA 3FRNA 3H6ZA 1QWFA 1SSHA 2MIOA 3AT1B 1YIJT 2DETA 3NGPA 2F5KA 1ZUKA 1WIEA 1YWPA 2DERA 3G4ST 1FMWA 4PJOE 2RD1A 4C8QD 2E10A 3EFOA 5GAOp 4J9GA 4KULA 3OMGA 2DYIA 3FDRA 2E6NA 2HKQB 2R5MA 4BE0A 4DA4A 4AFQC 1H3HA 2CGHA 2RQTA 2QASA 1PHTA 2ZPHB 1VQPA 2P0QA 5IH2A 1EFNA 4F7UF 4KGXB 4N4HA 2KDSA 4PJOG 1EIFA 1KD1U 1GFCA 4Z89A 1AVZC 1H641 1OZ3A 1K76A 2D0QB 3L2ZA 1PKSA 4ZGEB 3UWNA 4DBFA 5IXFA 2LVMA 2NUTB 3A5ZB 4ZGDB 2V8JA 2V1QA 5EC7A 1OEBA 4IUPA 2FB7A 1VQ5A 4BUGA 2KNBB 4RUGA 4M7AG 4ORZA 4F7UA 4OP0A 1QVGS 1K0XA 2Y4XA 1WNLA 4OGCA 2GTOA 4LUDA 5GAOl 3NMZC 5KYXB 3EG0A 1MGQA 5GMKj 2O9SA 2DPPB 2CSIA 4GY5A 1RAIB 1M8MA 2CDTA 2V8KA 1QW1A 5GAN3 4HCZA 4HVVA 2L3SA 1G3YA 1M1KU 1OU9A 1X43A 2P84A 2QEXA 1VQ8A 2EKHA 3CEYA 2QK0A 1UECA 1X2KA 1K9MC 1B34B 1VQKT 4F04B 4E7HA 3MCAB 2QTXA 4N0AC 4OMPA 2NUZA 2QQSA 3M0PA 2XK0A 3GLXA 2DF6A 2BZYA 2X51A 5EG2A 2XHCA 3M4GA 3EH2A 4NS5A 3OY9A 1WPYA 3T9NA 1ZSZC 1UDLA 3EG2A 4HVUA 1ZUUA 2LQNA 3QWYA 2L3PA 4M75B 3UA6A 2PVDB 2LT1A 2KI7A 4BD3A 5GAOm 3OSSC 4HT8A 2QGFB 1QVGP 2DRMA 1YJWQ 2A36A 3CPWA 4C92B 1Q82R 4JJNK 1JJ2S 1VIFA 1YJ9A 1XOVA 4ANJA 4JJBA 1IRXA 4IUQA 4HT9A 5KYYB 5C6SA 1TWBA 2NUTA 4J9BA 1OYXA 2P0PA 2DA9A 1NJIC 3CCJT 1HJDA 4JJDA 1U06A 2KY9A 1YCSB 4A54A 5LJ5g 3CC2Q 2KMTA 5GANd 4F16A 1P92A 3S6WA 5KYXA 3C4SA 1K73U 4OMOA 4LDXA 3LGLA 5GMKl 2Y4YA 2OTLA 1D1CA 2FZGB 5AYFA 2OTLQ 3M58A 9ATCB 2L0AA 2DZ9A 2NWMA 3C0CA 3PGGA 4QT7A 2DBMA 3X25B 4CC7A 2RI5A 2HEQA 3CCRA 2FZKB 3WXMB 4Y28E 2FYKA 3CBMA 3JCMg 1QCFA 3CCRQ 4C0DC 5LJ5f 1VQ7Q 1TUDA 2CSQA 1VQ4Q 4RG8A 2DM1A 2EQUA 4NL3A 2Y90A 4JRKA 3UF4A 1B34A 2CP0A 5GMKh 1KD1R 3HHTB 4M75F 3I55T 1WXUA 2GFUA 3M9QA 4LDYA 4X34A 5GAMd 2YT6A 2LX9A 1FXXA 3JB9F 4XU2A 3U23A 4OB2B 1SPKA 1JJ2P 1WXBA 1ZX6A 3SWNB 4ELZC 1C6VX 2OTJT 3TEEA 1RACB 2AK5A 2VUBA 4GLKA 3CC7T 2AZSA 2XICA 3JCMf 2ZPBB 4XTWA 4M78F 4M75A 5LJ5e 1JQQA 3GIBA 1NYGA 2E5QA 2DJZA 2LZ6B 1S72T 1VQ6T 1UHFA 3M0QA 3CCSQ 4KT0E 3TQ7P 1RABB 1Q81U 3N5BB 3VS7A 3MEVA 2AZVA 5KYYA 4CC4B 2JN0A 1K1ZA 4D6WA 1M1KR 2ZAEA 1SKUB 4M78A 2RN8A 4E6RA 1PD0A 1K0SA 2E41A 3JCMe 3NPFA 1HYOA 4CRIA 4JJCA 5CKBA 4FIBA 4BDZA 4KBMB 1NLPC 3BY7A 2JTEA 1UE9A 4NL2A 2L2PA 3HRSA 1ACMB 4B9XA 4PLIA 3BDLA 2AKKA 2MI6A 3F70A 1WHHA 2HMAA 3EGXB 4BY6B 2O9VA 3HTRA 2RB6A 1NPPA 3JB9J 4ELYC 3L2WA 1UFFA 4C8QF 5FU6C 5KE2A 1OPLA 2E70A 1D1BA 1RL2A 3ULRB 4Z88A 3SDZA 2QGGA 2YRCA 1OULA 3HPWA 4M7DD 3JAME 4J6YA 3SWNA 3FJPA 2EQJA 3JSCA 2VGMA 4KH0B 3OA6A 3VYGA 1AWOA 2MWOA 3CC4T 2EGEA 2OX7A 1JRIA 4RTVA 1RADB 3CD6A 3C12A 1G83A 4EMGA 2LCSA 5GAN2 1VQNA 1Q86C 1K73R 3CD6Q 1VQ9Q 2LP5A 1YHQQ 5I2SA 3FLGA 4J6XA 3JCMP 3BW1A 5FWCA 3Q1JA 1AD5A 2E1HA 2AHJB 1AEYA 2RMOA 3EG9B 4JPBW 1AZEA 3X26B 2LNHB 2JT4A 4OMQA 4M75G 3VKIA 4RTUA 1KSWA 1NYFA 4C5IA 2PVGB 4J7FA 2YRVA 5GJVB 3I56A 2SRCA 2EYZA 1YJNQ 4RMOA 3CCMQ 1H8KA 2DZCA 5C0MA 4DBQA 5LJ3j 4M78G 1WQ7A 2DXBA 5A0GA 3EGXA 2L3RA 1S1NA 3EGUA 2DL4A 2QG9B 3A8LB 2FPFA 4L5GA 2GNCA 1KQSA 3PMIA 1WHLA 1VQMA 3V8JA 4C0GA 4TVRA 5FROA 2K6DA 3A8MB 1FMVA 1EX4A 4HCBA 1Q81R 1SHGA 4BDYA 1BCOA 2K5FA 2XIDA 2HSEB 4PJMA 3L2RA 2GTJA 5IHNA 5CK9A 2YHTA 5IXBA 4AT1B 4M7AC 4EIKA 1BYMA 3I5RA 1YI2Q 3MEUA 2VXEA 4FYYB 4QQDA 5GJWB 1X01A 2L5QA 4LE9A 4RTWA 4XTZA 2HDAA 3OYIA 4IIOA 1VQOT 2LDMA 1VYUA 1M3AA 2ENMA 3REAB 4KRTA 3PFSA 2Z0WA 4C8QG 3EG9A 2X4JA 1QMCA 3MP8A 1GRIA 4WTOB 3FJ5A 4LNPA 1OU8A 2D1XA 2OAWA 3OYDA 1I5OB 4J9IA 4A4FA 3VYHB 4BACA 4C92D 3CMEQ 1PKTA 1QVGA 1VQLA 2KR3A 2RH2A 3RKXA 2F2VA 4JZ4A 4J7IA 1BCMA 1OPKA 1I0CA 3OSVA 1WFWA 3KUFA 2KROA 1AT1B 5CQYA 3VJPA 4XQ3A 3LH0A 2ECZA 3LWHA 4EMHA 3X20B 3VS5A 1WX6A 2PTKA 2A0FB 2EFIA 5LJ5d 4BI4A 3G6EA 1YJWT 4R56A 2B8AA 2K57A 3G6EQ 3OW2S 3M53A 3C94A 4XTXA 3L2QA 2RHZA 2QXFA 3QKJA 4FYWB 2O4XB 3VS4A 4LDUA 5GAOn 1V29B 1MHNA 2WSCE 2VC8A 1K4US 4BB7A 4HCKA 5LJ3h 3VS6A 1N6AA 1BIAA 3EGDB 3CC2T 4KGVB 4C5HA 3JCMd 1JBMA 4M7DB 3FIFA 4J8OA 5FWBA 2M1HA 5GMKe 1MV0B 1Q86R 3NTKA 5LL6S 5HY6A 3OYHA 2MOXA 2KRNA 3QZ5B 3P8DA 1ZA1B 4M77D 5GAOr 2DNUA 1OQKA 3HSBA 5CKFA 1UGRB 3RERA 1ZSGA 1IHVA 1PRLC 2GQIA 3RIRA 1JEGA 1JJ2A 2IPOB 1VQ7T 4LDWA 2DYBA 1W70A 1VQ4T 2LRQA 2ZPIB 5AT1B 4RKUE 5DY9A 1R8OB 3VRYA 1NEGA 3THKA 1IXDA 3OS1A 1UTIA 4FW1A 2GQVA 1IGQA 2CKKA 2ZZDA 1AZGB 3OW2P 3L42A 4M7AE 2X9HA 4MMLA 4RTXA 1D0XA 2HBPA 3RUXA 3CCQA 1Q7YC 3V7SA 1MMAA 4XU1A 2K2VA 5L8RE 1VQPQ 3VS0A 3LWIA 1K8AC 4D8DA 2C0TA 3OS5A 8ATCB 3QYGB 1U1TA 1O9SA 1RLPC 1ZUYA 1YN8A 2PZ1A 2KXCA 2X4XA 4FW2A 1G3TA 2KAFA 1XJWB 3CCST 4AFUC 3O5ZA 3GNGA 3G7ZA 3R6NA 2O4XA 1VQ5Q 3EAEA 4KGZB 3DB3A 4BE2A 3X24B 1DJ7B 4OB1B 4GLMA 4KUIA 3C95A 1RAFB 4ME7A 3SD4A 4WCIA 1VUBA 3M0RA 3G71A 1J3TA 3EGDA 3OS0A 4M7DA 2BZXA 1LNXA 4DOVA 3CCEA 2G6FX 3TVTA 1WLPB 1KJWA 2CUDA 2L89A 4QQGA 3CCEQ 2FRWA 5IHIA 2H3JA 4OB0B 4FL6A 4BI3A 2QEXQ 4QVDA 1VQ8Q 3M59A 2W10A 1ZLMA 2CP3A 2YUPA 3OQ5A 1Y7XA 1BI2A 2D8JA 1N27A 1R0BG 2HSPA 2J6FA 2NLUA 2RQRA 2YDLA 1TUCA 2EPDA 1Y07A 2CP2A 1GXIE 1ARKA 1G2BA 4XTYA 3RKYA 2FG0A 3ZBDA 2KGTA 2JNGA 3PVQA 4OMLA 3CQTA 1XQHA 2BTTA 3UATA 2FPDA 2VKNA 8AT1B 1X6BA 3JB9I 4KUDK 1M2OA 1NPRA 1K9MU 4FT2A 3X28B 4E7JA 1BIBA 1PD1A 1YFNA 2K79A 4FT4A 1PC0A 2RJDA 2LTOA 3HFNA 3WVEB 1YJ9Q 1N5ZA 4MMKA 3CD6T 1VQ9T 2CT4A 1MUZA 3QO3A 1YHQT 3S3MA 1KIKA 1KK7A 2DEUA 1M4ZA 3MJXA 3CCUA 1G5VA 4F7UE 4Y91A 3QUIA 1G3WA 4OMMA 3VU3C 2MPXC 1WHKA 4PJOD 2RQVA 3PNWC 3V8KA 5I22A 3P8BB 2HKNA 5IAYA 2DXCA 1M1FA 1WJRA 4J9HA 3GOXA 3CCVA 4RTTA 5HKCA 3CCVQ 1M90C 2IVWA 2KRMA 1HSQA 2KQWA 2FPEA 2OI3A 1WXTA 4C0ZA 1W2BS 3RMQA 3JCMX 4M75C 1MNDA 1NJIU 2DIGA 2DD4A 2M51A 4F7UG 2QA4A 1YJNT 3CCMT 1FYNA 2QA4Q 1MV3A 5I21A 1M3CA 5IT9E 2RO0A 2MCNA 4ESRA 4GBQA 1U1SA 3SHWA 2RHXA 3VS1A 1LPLA 4M77B 1KHIA 2QQAA 1M3BA 4M78C 3G4SA 4C92F 1D0YA 4BE1A 5KCHA 2EIFA 2O2OA 2DTOA 4X9DA 4UC4A 1BK2A 4J9EA 2COYA 5LJ3g 2BKDN 3QBYA 3CXCS 2A28A 2FZCB 1JU5C 4C92A 2LX7A 5GMKm 4D8KA 2DO3A 2BUDA 1YBYA 1WZOA 2NUPB 3REBB 4IURA 3JCMV 1XTDA 2HCKA 5CQXA 1YI2T 1D1AA 1YWOA 4ZTFA 4AFZC 2LT4A 1QVFS 1W2BP 2VWFA 4N4GA 4E47A 4F14A 2RHUA 2GFAA 1VYVA 3SB2A 5LJ3f 3BFMA 1T0JA 2LQ8A 2O01E 4PLLA 1YITA 1B7TA 1YITQ 5D7UA 1TXQA 1TTHB 1BI0A 2VGNA 2XDPA 3A8OB 3LH5A 3SWNC 2JM9A 1KC8C 2JOYA 2DFUA 1U3OA 1D09B 4C8QC 2K4YA 4C5EA 2XDDA 3A8GB 1TG0A 3RNJA 4M77F 3CMET 2LCLA 3JCMW 3QSUA 5CKHA 2WSFE 1WHMA 4K11A 3A98A 2X35A 4O6JA 3E9FA 3NTHA 1K9MR 1HD3A 5LJ3e 2ZPEB 1A0NB 4O5VA 3ASKA 5D6WA 2M02A 1Y96B 2NYSA 4FM4B 4M77A 3CXCP 2DAQA 2CZ1B 2VASA 4DOWA 1VQKA 2PNIA 2RI2A 2A08A 3EHQA 3G6ET 2J6OA 5GAN5 2K5LA 1QCOA 1LOJA 2RJFA 1SRLA 2RM4A 3I9QA 4JLIA 1HXDA 3JV3A 1QVFP 2JTMA 2E3HA 4M75E 3QPHA 4FYXB 4J9FA 2AT1B 2J7IA 1TUGB 1VQNQ 1TU0B 2LJ0A 2R58A 2XD0A 2NUPA 3EFRA 4BY6C 2HL3A 1KQ2A 4JRQA 4OMFB 2F2WA 1NJIR 1VYTA 1AOJA 4L59A 4LDVA 4M78E 2MK5A 1M27C 2A7YA 1K9AA 4JDSA 2GBQA 2EGAA 3CCJA 1I5LA 3GP8A 3CCJQ 2D9TA 2EYXA 3OW2A 3JB9H 5DLOA 4C92G 3JB9G 1I07A 5IN1A 1Q86U 1NZ9A 5CCAA 2D8HA 1UJ0A 2CYZB 4A4EA 2XU8A 3A8HB 4PJOB 1UJYA 4PJNA 4XU0A 2JJ9A 3I56Q 3OMCA 2ED1A 1PSFA 4A4GA 2CP6A 1EZZB 2RF0A 1BBZA 3MKDA 3UPUA 2DLPA 3OYLA 3RDVA 2DEQA 2M0YA 1VQPT 4M7AB 2KT1A 2RJCA 4RCBA 5A0LA 3BE3A 3QYHB 1D3BB 4V2SA 1VQMQ 1SF9A 3E1SA 4B6MA 3M0UA 1WHGA 1Y96A 4J9CA 5CKEA 3KXTA 3NHNA 1MNEA 1Y57A 3I55A 2QAZA 2RQWA 2LJ1A 2QYZA 1VQ5T 1WJQA 4C8QE 2I0NA 1GCPA 2OTJA 2COWA 4E7ZA 3FEOA 4QVCA 1TOVA 3CC7A 2YUNA 4KH1B 4EMKC 2K3BA 2EYQA 1BU1A 3ZL7C 2RK1A 4JLGA 4VUBA 4OF1A 3VUBA 1VQ6A 1S72A 2B86A 2HQHA 5FU7C 3L1AA 2P0KA 5KYNA 4LD9K 2JS2A 3CCET 3PIOA 1UGSB 2KRSA 1SHFA 1VA7A 2KYBA 2QEXT 1I1JA 1VQ8T 2A37A 2K5IA 2XMFA 2ESWA 2H3EB 3META 2E6ZA 2C06A 3M57A 3M55A 1N8RC 3HKSA 3VS2A 4MZPA 2KEAA 2PUOB 4Q5WA 1VQLQ 1QKWA 4PJOA 3QDRB 3OYGA 3URGA 1QKXA 2MWPA 4PK4A 2HQXA 1H92A 4EPCA 2RQUA 2O88A 3GNFB 2CP5A 1IREB 5KYUB 1GCQC 2ABLA 3BDUA 3INZA 2M16A 4DQ2A 2EQIA 2WSEE 2K2MA 1NM7A 4M7AA 1U5SA 3DLLA 3CCLA 1D3BA 1TH7A 1QVPA 3CCLQ 4HKEA 3S3OA 1YJ9T 4OMNA 3TSWA 1Q82C 1NLOC 4FCYA 2GGRA 3QHSA 4BI8B 1CKAA 2EJGA 4OGEA 3SEMA
chains in the Genus database with same CATH topology
3OQ5A 1Y7XA 1BI2A 3WVDB 1N27A 2E5QA 2DJZA 4JS4A 1S72T 1VQ6T 1O75A 4QW2A 3OBWA 2D6FA 3LYIA 4KT0E 4WF2A 2VYTA 2NLUA 3GF5A 2R5AA 3LLRA 4EMKB 3CCQT 1Q81U 3N5BB 3RESA 1YJNA 3CCMA 3NFCA 3OBYA 1Y07A 3QG1A 4II1A 1ZHIA 1UEBA 3MEVA 4ZN3A 1GXIE 5GANg 3CC4A 4XTYA 3RKYA 3ZBDA 2JN0A 3QJ6A 2RI3A 2JNGA 3VUZA 4D6WA 4A4KA 3UT1A 4M78A 4M77E 2CZ6B 1XQHA 3OS2A 5FU7B 3OB9A 2OTLT 3ME9A 2VV5A 1QP3A 2X4WA 3JB9I 5DLQE 4KUDK 2E41A 3JCMe 3J81E 1VIEA 2JUFA 1NPRA 1K9MU 2KK4A 1M8VA 4QQ6A 1KQSS 4RG2A 3JRZA 3EFSA 3M4YA 4FT2A 4CRIA 2F69A 1HK9A 5D6XA 3X28B 5CKBA 1BIBA 4FIBA 4E7JA 1H3ZA 2QA4T 4C5GA 4R55A 2ZCFB 3CCRT 4KBMB 4BDZA 5DM7R 5GANj 4FT4A 3OYKA 2KVQG 1IZ6A 2A3LA 3BY7A 2RJDA 2LTOA 2CS7A 3HFNA 1M1GA 4A53A 1I4K1 2RJEA 4NL2A 3WVEB 4XU3A 3HRSA 2DTIA 4MMKA 1I8FA 3E9GA 5LJ3d 1M9SA 4B9XA 4PLIA 3BDLA 2JVVA 5GANf 3CD6T 1VQ9T 4PJOC 1W4SA 2DTHA 3JCMc 2MI6A 3QO3A 1N9RA 4M77G 1YHQT 3F70A 2X4YA 3OYCA 3OYJA 4RCCA 3S3MA 2IG0A 4ZTJA 3LGFA 3J80E 3G71T 2OAUA 4XTUA 3MHXA 4BY6B 1M4ZA 3CCUA 2FVUA 1G5VA 4F7UE 2RB6A 1KD1C 1NPPA 4Y91A 3JB9J 1AHJB 4IKFA 5GAMg 5FRNA 3QUIA 1G3WA 3VV0A 4ELYC 3VU3C 3L2WA 3FB9A 4PJOD 2K3XA 3HRUA 3MEAA 1WQWA 2DXUA 4C8QF 5FRMA 3PNWC 4XTVA 5FU6C 3V8KA 4M7DC 3P8BB 3CCVA 5IAYA 2DXCA 1M1FA 1WJRA 4PJOF 5KE2A 3GOXA 1YI2A 5KE3A 5HKCA 1M90C 2E70A 3L2VA 2DKGA 2IVWA 1OZ2A 1KG1A 1RL2A 2KSSA 3SDZA 2KQWA 4OVAA 3RMSA 2E12A 2GCXA 4C0ZA 1W2BA 4JS5A 1W2BS 3OYBA 5CKDA 3HPWA 4M7DD 4Z02A 5GAMj 2QI2A 4MDWA 3JAME 4J6YA 5GANe 3RMQA 3FJPA 3SWNA 2EQJA 4LD6A 2CZ7B 4M75C 4ZGJB 5LJ5h 3JSCA 3JCMX 1NJIU 2DIGA 2VGMA 2DD4A 4M7DF 4M7AF 4F7UG 2QA4A 1YJNT 3CCMT 4PNOA 2PU9B 3CBPA 5I21A 3VYGA 3OA6A 5GAMf 5IT9E 2YLBA 2MWOA 2RO0A 3CC4T 1Q7YU 1JRIA 3ZEHA 4YTLA 5A2QE 3CD6A 3C12A 4M75D 4EMGA 5CR2A 5GAN2 1VQNA 1U1SA 1Q86C 2RHXA 1K8AU 4JRIA 1FWZA 5HK0A 3CMEA 1M1KC 4M77B 5I2SA 1SSFA 1KHIA 5CAIA 3FLGA 2QQAA 3MEWA 4J6XA 4X9CA 4M78C 3JB9D 4EMKA 5A0DA 3JCMP 2EQMA 4M7DB 5CO7A 3G4SA 4NOYA 3BW1A 4C92F 1YITT 3PT9A 4BE1A 3Q1JA 2E1HA 5KCHA 4JRPA 3TREA 2EIFA 2AHJB 2HQEA 4B9WA 3M54A 2DTOA 4X9DA 5GAOq 3JCMh 3MP1A 2PVOB 1N8RU 4UC4A 2PUKB 2DVEA 3TCJA 3MP6A 3OYFA 4M78D 3X26B 4ZN1A 1KHCA 1NE8A 4QVZA 3OYMA 3CXCA 4M75G 3H8ZA 3VKIA 5M9OA 5LJ3g 3QJYA 2BKDN 2ZPFB 3QBYA 5GAMe 3CXCS 4E7LA 5KH6A 4J6WA 4C92A 1VQOA 1U8RA 2I2LA 2WACA 4C5IA 3CCUT 5GMKm 1YCYA 4FSXA 2PVGB 3RKWA 4IUTA 4J7FA 2YRVA 2DO3A 2BUDA 2XG8D 1YBYA 4J83A 4F7UB 3I56A 2EWNA 1KQ1A 2MAMA 5GAN8 4IURA 4MZMA 4RMOA 3JCMV 1XTDA 2DZCA 3HFOA 5C0MA 1Y71A 5CQXA 3CCVT 3CBOA 1YI2T 5LJ3j 1WQ7A 2QQRA 4M78G 2DXBA 5A0GA 1QVFA 4ZTFA 1X6OA 4J5YA 2L3RA 5J39A 2LT4A 5FLXE 3FC3A 1QVFS 2JTFA 5GMKi 4N4GA 4E47A 3A8LB 1Q82U 2RHUA 5GAN4 2GFAA 4L5GA 3SB2A 5LJ3f 1KQSA 2LCCA 3BFMA 3PMIA 3NTIA 3R6OA 5D6YA 2LQ8A 2O01E 4PLLA 1YITA 3JCMb 3LW5E 2JZ2A 4E7IA 3M56A 1VQMA 3JCMQ 4L6V5 3V8JA 4C0GA 5GAN7 4HCCA 1M5Q1 2GF7A 4TVRA 4CI0C 3CMAT 5FROA 5I2MA 1BI0A 2VGNA 3A8MB 5GANh 5KCOA 2XDPA 3A8OB 3PTAA 3SWNC 3V8LA 1BI1A 4HCBA 2RA2A 1KC8C 2JOYA 2MF2A 2XI9A 2M0OA 2EAYA 2LQKA 2R57A 4BDYA 4C8QC 2K4YA 1QP2A 4C5EA 2XDDA 3A8GB 4MDXA 2K5FA 1VQNT 2V8IA 4M77F 2FHDA 3FRNA 3H6ZA 2XIDA 1YJWA 3CMET 1YIJT 3DLMA 2LCLA 2F5KA 3JCMW 3QSUA 3L2RA 3QIIA 5CKHA 1K73C 2WSFE 4C0DB 4XK8E 3G4ST 4PJOE 2RD1A 4C8QD 3MO8A 2E10A 5CK9A 4PKCC 2YHTA 2X35A 4O6JA 3E9FA 3NTHA 5GAOp 5LJ3e 2ZPEB 4M7AC 2K3YA 4KULA 3OMGA 2DXTA 4O5VA 3ASKA 3QZ9B 1UGQB 5D6WA 4N0AA 1BYMA 1Y96B 4FM4B 4M77A 2YLCA 4M78B 3ER0A 3FDRA 2DAQA 3MEUA 4A4HA 2E6NA 1XNIA 2CZ1B 2VXEA 4QQDA 3V7CA 4DOWA 1VQKA 2R5MA 4BE0A 4DA4A 2VXFA 1X01A 2L5QA 2RI2A 3TU4K 3G6ET 4M7DE 2CGHA 3CC2A 4XTZA 5GAN5 2K5LA 3OYIA 4M7AD 1VQOT 2ZPHB 1VQPA 1BI3A 2HAXA 2LDMA 5GAMh 2P0QA 1LOJA 3JCMJ 4F7UF 2RJFA 3PFSA 1UGPB 3DB4A 2RM4A 3P8HA 4N4HA 4C8QG 2KDSA 3CMAA 4JLIA 4PJOG 2QQ9A 4C92C 3I56T 1EIFA 1HXDA 2X4JA 1KD1U 3MP8A 4FU6A 2JTMA 4M75E 1H641 1OZ3A 3L2ZA 2D0QB 3QPHA 3E19A 3OYDA 4ZGEB 3UWNA 3HL8A 2LVMA 5HK3A 1X75C 3A5ZB 4ZGDB 2V8JA 2G3RA 1YIJA 5CIUA 4IUPA 4A4FA 2FB7A 3VYHB 4BACA 1M90U 1VQ5A 4C92D 4BUGA 1QVGA 1VQLA 4M7DG 2RH2A 4M7AG 3RKXA 2R58A 4F7UA 2XD0A 1VQ7A 4OP0A 4MZTA 1QVGS 3EFRA 4BY6C 4J7IA 1KQ2A 3OYAA 2Y4XA 1VQMT 3OSVA 1VQ4A 2L8DA 1WNLA 4OMFB 3KUFA 3PIPA 4JRQA 1BKBA 4OGCA 4L59A 5CQYA 4LDVA 5GAOl 4M78E 4EDUA 1MGQA 5GMKj 3VJPA 2A7YA 4XAXB 4XQ3A 2EJ9A 4JDSA 2DPPB 3LH0A 4GY5A 3LWHA 2XDBA 2F5TX 2EKOA 4EMHA 2V8KA 3X20B 3CCJA 3SFMA 1I5LA 1QW1A 5GAN3 1Q81C 1ZQ1A 3KBGA 4HCZA 2EFIA 3GP8A 5LJ5d 4BI4A 2D9TA 3G6EA 1YJWT 3OW2A 3JB9H 5DLOA 4C92G 4R56A 3JB9G 2B8AA 2K57A 3OW2S 5IN1A 3QXEB 3M53A 1Q86U 1NZ9A 5CCAA 1G3YA 3C94A 1M1KU 4XTXA 3L2QA 2RHZA 1WGSA 2FL7A 2QXFA 3QKJA 2O4XB 2CYZB 4A4EA 2XU8A 4C8QB 4LDUA 2QEXA 5GAOn 1G3SA 4C0FA 1V29B 1VQ8A 3A8HB 1MHNA 4PJOB 4XU0A 2WSCE 3CEYA 3OMCA 2VC8A 4BB7A 1PSFA 1K9MC 2HD0A 5LJ3h 4A4GA 1PSEA 1B34B 3CCSA 1VQKT 3OYYA 4E7HA 3UPUA 3MCAB 2QTXA 4N0AC 1N6AA 1BIAA 3OYLA 3CC2T 4M77C 2DEQA 3DKMA 4C5HA 3JCMd 2QQSA 1JBMA 2E65A 1VQPT 5FU6B 4M7AB 2XK0A 3GLXA 1JB0E 2RHYA 3FIFA 4IUVA 2RJCA 4HA8A 4J8OA 4RCBA 3LX7A 3QYHB 1D3BB 5A0LA 2M1HA 5EG2A 1WJSA 5GMKe 4V2SA 3NTKA 3HP9A 2XHCA 3E1SA 3M4GA 5LL6S 4NS5A 3OY9A 1Y96A 5CKEA 3KXTA 2ZGWA 5HY6A 3OYHA 3ZFJA 1WPYA 3L2UA 3QZ5B 5J26A 3P8DA 5J3BA 3T9NA 4M77D 5GAOr 3I55A 3HSBA 5CKFA 1UGRB 4M75B 1OI1A 2PVDB 3AHUA 2LT1A 1FX7A 4BD3A 3OSSC 5GAOm 3RERA 4HT8A 2M9UA 2HNIA 4PL6A 1VQ5T 1WJQA 3RIRA 3CPWA 4C92B 1VQLT 4C8QE 1JJ2A 2RK2A 4JJNK 3GPLA 3CPWS 1VQ7T 4LDWA 2OTJA 3FEOA 4QVCA 1JJ2S 1VIFA 1YJ9A 3CC7A 1VQ4T 2DK3A 2E64A 1XOVA 2CZ0B 2EJFA 2LRQA 4EMKC 4ATOA 2ZPIB 1I81A 4RKUE 4IUQA 4HT9A 5DY9A 5C6SA 2EYQA 1R8OB 1N9SA 1RI0A 1OYXA 2EQKA 2P0PA 3OS1A 1NJIC 2RK1A 4JLGA 2GQVA 4OF1A 4VUBA 3VUBA 3CCJT 2CKKA 2ZZDA 1S72A 1KC8U 2RHIA 2QQBA 5FU7C 1VQ6A 3L42A 2LC4A 3L1AA 4M7AE 2P0KA 2PQWA 2KY9A 2DIQA 4MMLA 4A54A 5LJ5g 4LD9K 2HBPA 3RUXA 3CCLT 3CCQA 1Q7YC 3V7SA 4XU1A 3CCET 3PIOA 3UDCA 2KMTA 2K2VA 1UGSB 4N4IA 5GANd 5L8RE 1P92A 3S6WA 3C4SA 3LWIA 3V7RA 1K8AC 4OB3B 3OS5A 1K73U 4LDXA 2QEXT 3QYGB 3LGLA 1VQ8T 5GMKl 3HRTA 2Y4YA 2K5IA 2OTLA 1ZBXA 3PMTA 1U1TA 1O9SA 5AYFA 2QDYB 3M58A 2X4XA 1G3TA 3META 2KAFA 2E6ZA 3OYNA 2C06A 3M57A 4C92E 5LJ5j 3CCST 2DZ9A 3M55A 1N8RC 3GNGA 3PGGA 3G7ZA 3HKSA 2O4XA 4MZPA 3X25B 2PUOB 2RI5A 3CCRA 3WXMB 4C8QA 3EAEA 1LJOA 4P5NA 2FYKA 4Q5WA 4Y28E 3CBMA 3JCMg 3DB3A 4BE2A 4PJOA 2BIVA 3X24B 3QDRB 2DD5A 2ZPGB 4C0DC 5LJ5f 2LNVA 3URGA 2MWPA 3OYGA 2HQXA 3CPFA 3S3NA 5CVIA 4EPCA 4RG8A 4E7KA 2EQUA 4NL3A 1DJ7B 2Y90A 4JRKA 4OB1B 2MMPA 3GNFB 4KUIA 1VQ9A 1YHQA 1B34A 5GMKh 1IREB 3C95A 3HHTB 4ME7A 3SD4A 1VUBA 3BDUA 4M75F 3INZA 3G71A 2M16A 4DQ2A 3I55T 3J7AF 2XKOC 3OS0A 2GFUA 3M9QA 2WSEE 4LDYA 4X34A 5GAMd 3OYEA 4M7AA 4M7DA 3DLLA 1LNXA 1FXXA 2LX9A 3CCLA 3JB9F 1D3BA 1TH7A 4XU2A 4DOVA 4OB2B 3CCEA 2P4TA 1QVPA 1UB4A 4HKEA 2L89A 4QQGA 3SWNB 4ELZC 2OTJT 3TEEA 3S3OA 2VUBA 4GLKA 1YJ9T 3CC7T 4IUUA 1Q82C 2H3JA 4OB0B 3M5AA 4FL6A 5GAN6 2XICA 4BI3A 4JUVA 3O8VA 3JCMf 2ZPBB 3QHSA 4XTWA 4QVDA 3M59A 4BI8B 4M78F 4M75A 2EJGA 5LJ5e 4OGEA 3GIBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNI A;  4QQD A;  3OQ5 A;  1SSF A;  1OI1 A;  2R5M A;  1N27 A;  4BE0 A;  2E5Q A;  2RI2 A;  3FLG A;  3MEW A;  4BD3 A;  4QW2 A;  2EQM A;  4PL6 A;  1WJQ A;  3OYI A;  3LYI A;  2VYT A;  2NLU A;  4BE1 A;  2R5A A;  2LDM A;  3LLR A;  3Q1J A;  5KCH A;  2HQE A;  4B9W A;  2RJF A;  3PFS A;  3DB4 A;  3FEO A;  3P8H A;  4II1 A;  3MEV A;  4N4H A;  3MP1 A;  4UC4 A;  2LRQ A;  3QJ6 A;  2RI3 A;  3MP8 A;  3MP6 A;  4IUQ A;  3OYF A;  3UT1 A;  4FU6 A;  5C6S A;  1KHC A;  3OS2 A;  1OZ3 A;  1RI0 A;  3OB9 A;  1OYX A;  4QVZ A;  3OYM A;  3OYD A;  3ME9 A;  2EQK A;  3UWN A;  3H8Z A;  5M9O A;  3OS1 A;  2BKD N;  3QBY A;  2LVM A;  2X4W A;  2CKK A;  2G3R A;  2RHI A;  5CIU A;  4IUP A;  4A4F A;  3L42 A;  5KH6 A;  4BAC A;  4E7L A;  2P0K A;  2PQW A;  2DIQ A;  4QQ6 A;  4RG2 A;  4C5I A;  2WAC A;  4CRI A;  2R58 A;  4IUT A;  5D6X A;  4E7J A;  1H3Z A;  2YRV A;  4C5G A;  4N4I A;  4BDZ A;  2BUD A;  3S6W A;  2DAQ A;  3OYA A;  3OYK A;  2L8D A;  3C4S A;  3KUF A;  2RJD A;  4IUR A;  2LTO A;  4L59 A;  2RJE A;  4EDU A;  3LGL A;  5C0M A;  3E9G A;  4B9X A;  2QQR A;  3PMT A;  4PLI A;  3BDL A;  4ZTF A;  3LH0 A;  4GY5 A;  2L3R A;  5J39 A;  3FC3 A;  2EKO A;  2JTF A;  3F70 A;  2X4Y A;  3OYC A;  4N4G A;  3OYJ A;  3S3M A;  2IG0 A;  2RHU A;  2X4X A;  4ZTJ A;  3MET A;  3LGF A;  2EFI A;  4HCZ A;  2GFA A;  4A4H A;  3OYN A;  2D9T A;  2LCC A;  3PMI A;  1G5V A;  3NTI A;  2B8A A;  5D6Y A;  4PLL A;  5IN1 A;  2O4X A;  4IKF A;  2JZ2 A;  2RI5 A;  4E7I A;  5FRN A;  3EAE A;  4Q5W A;  3L2Q A;  3L2W A;  2RHZ A;  1WGS A;  3QKJ A;  3DB3 A;  2K3X A;  2GF7 A;  2BIV A;  2O4X B;  3MEA A;  4A4E A;  4BE2 A;  3OYG A;  5FRO A;  5FRM A;  2MWP A;  3PNW C;  2HQX A;  3S3N A;  5KCO A;  2XDP A;  5IAY A;  1WJR A;  1MHN A;  5KE2 A;  3GOX A;  4E7K A;  2EQU A;  3CEY A;  5KE3 A;  2M0O A;  3OMC A;  3L2V A;  2R57 A;  4BDY A;  1OZ2 A;  4C5E A;  3SD4 A;  4OVA A;  2FHD A;  4A4G A;  3H6Z A;  2M16 A;  3OYB A;  3DLM A;  3OS0 A;  4E7H A;  2F5K A;  2GFU A;  3M9Q A;  4X34 A;  4Z02 A;  3OYE A;  3OYL A;  3L2R A;  3QII A;  2EQJ A;  4LD6 A;  4C5H A;  2QQS A;  2DIG A;  2XK0 A;  2RHY A;  4IUV A;  2RJC A;  3MO8 A;  2L89 A;  4QQG A;  3LX7 A;  2X35 A;  2M1H A;  3E9F A;  1WJS A;  3NTH A;  3S3O A;  3OA6 A;  3NTK A;  4IUU A;  2MWO A;  2RO0 A;  4NS5 A;  3OY9 A;  2K3Y A;  4FL6 A;  3OMG A;  3OYH A;  3O8V A;  3ASK A;  3ZEH A;  3L2U A;  5D6W A;  5J26 A;  3P8D A;  3FDR A;  2RHX A;  3MEU A;  2E6N A; 
#chains in the Genus database with same CATH topology
 2CH4 A;  1PRM C;  1Z9Q A;  4QW2 A;  2HZY A;  3LYI A;  1RAG B;  3LLR A;  2FRY A;  3NFC A;  3OBY A;  3QG1 A;  1ZHI A;  1UEB A;  4ZN3 A;  1AWX A;  3CC4 A;  1KFZ A;  3QJ6 A;  3VUZ A;  2E5K A;  2OTL T;  3ME9 A;  2VV5 A;  2AIR B;  1QP3 A;  2YUQ A;  1B3Q A;  5DLQ E;  1V1C A;  2JUF A;  4AG1 C;  4QQ6 A;  1KQS S;  3JRZ A;  1PCX A;  2F69 A;  1HK9 A;  5D6X A;  2CT3 A;  2DL3 A;  1H3Z A;  2QA4 T;  4R55 A;  3CCR T;  5GAN j;  4HXJ A;  5DM7 R;  3OYK A;  2KVQ G;  1IZ6 A;  4RTY A;  2CS7 A;  1M1G A;  4A53 A;  1I4K 1;  2RJE A;  1SEM A;  2EGC A;  5LJ3 d;  1M9S A;  1IHW A;  3G1J A;  3H0F A;  1N9R A;  1UGV A;  1YNZ A;  4X1V A;  3OYC A;  1OX8 A;  4RCC A;  2IG0 A;  4ZTJ A;  3J80 E;  1ABO A;  1JO8 A;  1KD1 C;  2YXY A;  1AHJ B;  5FRN A;  1F1B B;  1ZA2 B;  2K3X A;  3HRU A;  3CCQ Q;  1WQW A;  2DXU A;  4XTV A;  4M7D C;  2JM8 A;  2JS0 A;  2LJ3 A;  5KYU A;  1OZ2 A;  2KSS A;  3RMS A;  1QQJ A;  2GCX A;  1W2B A;  2DRK A;  5CKD A;  2DIL A;  4Z02 A;  5GAM j;  2QI2 A;  4MDW A;  2CZ7 B;  4ZGJ B;  4M7D F;  1W6X A;  2PU9 B;  2KT8 A;  3CBP A;  1Q7Y U;  1RAH B;  3ZEH A;  4PJL A;  4YTL A;  5A2Q E;  2DJQ A;  1ZBJ A;  1YP5 A;  1K8A U;  1M1K C;  1SSF A;  1KQS P;  3MEW A;  3I35 A;  4PFZ A;  2ROL A;  5A0D A;  3G71 Q;  2EQM A;  1C0M A;  1YIT T;  2HL5 C;  4JRP A;  2HQE A;  4B9W A;  4QKU A;  3M54 A;  5GAO q;  4A63 B;  3MP1 A;  3QDF A;  2C0I A;  2PUK B;  1ZSZ B;  3TCJ A;  1T3L A;  3OYF A;  1WI7 A;  1KHC A;  1NE8 A;  3OYM A;  2EW3 A;  3CXC A;  5M9O A;  4DEX A;  2ZPF B;  5I11 A;  5KH6 A;  1VQO A;  3QWX X;  1U8R A;  2I2L A;  2WAC A;  1E7O A;  4E2F B;  3RKW A;  1VQO Q;  4JZ3 A;  1X27 A;  2XG8 D;  3M0T A;  4J83 A;  1R77 A;  1KQ1 A;  1IO6 A;  4MZM A;  2DX1 A;  1QVF A;  2D0N A;  2JW4 A;  1N8R R;  2FEI A;  5J39 A;  4M4Z A;  2JTF A;  2YRD A;  5GMK i;  1MMG A;  1Z9Z A;  4FSS A;  2ED0 A;  2CH4 W;  3R6O A;  2LCC A;  3IQL A;  3NTI A;  5D6Y A;  3JCM b;  2JZ2 A;  3JCM Q;  2GF7 A;  1WHJ A;  5I2M A;  5GAN h;  5KCO A;  3PTA A;  1BI1 A;  2RA2 A;  2MF2 A;  2M0O A;  2R57 A;  3D7S B;  1VQN T;  2DL7 A;  2V8I A;  2EYW A;  1YJW A;  3DLM A;  5KYW B;  1K73 C;  3QII A;  4C0D B;  4XK8 E;  1GL5 A;  3CCU Q;  3MO8 A;  1G8X A;  4PKC C;  1M30 A;  2K3Y A;  1PNJ A;  1T0H A;  2DXT A;  3QZ9 B;  1UGQ B;  4N0A A;  1X69 A;  2YLC A;  6AT1 B;  4M78 B;  3ER0 A;  3EHR A;  4A4H A;  1XNI A;  3V7C A;  3TU4 K;  4M7D E;  2VXF A;  4DBH A;  3CC2 A;  4M7A D;  4FYV B;  2IIM A;  1BI3 A;  2HAX A;  5GAM h;  1RAA B;  3JCM J;  1ZSZ A;  1UGP B;  3DB4 A;  3P8H A;  4IIM A;  3CMA A;  2QQ9 A;  4C92 C;  3I56 T;  5L23 A;  3CMA Q;  1NBE B;  4FU6 A;  3E19 A;  2ROT A;  3HL8 A;  5HK3 A;  1X75 C;  1GBR A;  2G3R A;  1YIJ A;  5CIU A;  1WDX A;  1M90 U;  1SRM A;  1YIJ Q;  3H0H A;  4LN2 A;  4M7D G;  1PG5 B;  3VRZ A;  1VQ7 A;  4MZT A;  1E6H A;  3OYA A;  3G4S Q;  1VQM T;  1VQ4 A;  2L8D A;  3PIP A;  1BKB A;  1B07 A;  1QLY A;  2EBP A;  3A1P A;  4EDU A;  4XAX B;  2EJ9 A;  2XDB A;  2F5T X;  2EKO A;  2OJ2 A;  2MYS A;  1Q7Y R;  3SFM A;  1VOM A;  1Q81 C;  1ZQ1 A;  3KBG A;  1LCK A;  1T3S A;  1K8A R;  3QXE B;  1W1F A;  1WGS A;  2FL7 A;  4LUE A;  4C8Q B;  1G3S A;  4C0F A;  4R0K A;  1AWW A;  1TSF A;  4DBR A;  2H8H A;  4F17 A;  2E4H A;  1MMD A;  2HD0 A;  4PFP A;  5KYW A;  2DMO A;  1PSE A;  3CCS A;  1QWE A;  3OYY A;  4M77 C;  3DKM A;  2J06 A;  5FW9 A;  4AG2 C;  4DEY A;  2E65 A;  5FU6 B;  2KXD A;  1JB0 E;  2RHY A;  4IUV A;  4HA8 A;  3EG1 A;  3LX7 A;  1WJS A;  3HP9 A;  1UHC A;  3VS3 A;  2ZGW A;  3ZFJ A;  3L2U A;  5J26 A;  5J3B A;  2LQW A;  2LMJ A;  1R0C B;  1OI1 A;  3AHU A;  1FX7 A;  2M9U A;  2HNI A;  4PL6 A;  4Y92 A;  1VQL T;  2RK2 A;  3GPL A;  3CPW S;  1IGU A;  2DK3 A;  2E64 A;  2CZ0 B;  2EJF A;  4ATO A;  1GFD A;  1I81 A;  1WA7 A;  1N9S A;  1RI0 A;  3KFV A;  2EQK A;  2HBW A;  1RUW A;  2V26 A;  1KC8 U;  2RHI A;  2QQB A;  2LC4 A;  2PQW A;  1VQK Q;  2DIQ A;  3CCL T;  2DE0 X;  3EG3 A;  3UDC A;  4N4I A;  1NEB A;  3V7R A;  4E7S A;  4OB3 B;  3HRT A;  2DBK A;  1ZBX A;  3PMT A;  2EVR A;  1OV3 A;  4AFS C;  1OX9 A;  2QDY B;  3OYN A;  4C92 E;  5LJ5 j;  3H0I A;  4HVW A;  1JXM A;  4C8Q A;  1LJO A;  4P5N A;  2COZ A;  3PVL A;  2BIV A;  2DD5 A;  2ZPG B;  1GBQ A;  2LNV A;  2BZ8 A;  1TS9 A;  3CPF A;  1QCN A;  5CVI A;  3S3N A;  2O31 A;  4E7K A;  2MMP A;  1VQ9 A;  2F2X A;  1YHQ A;  2VB6 A;  1OOT A;  1CSK A;  3J7A F;  2XKO C;  2RPN A;  4PJJ A;  3OYE A;  3CPW P;  2YUO A;  2P4T A;  1UB4 A;  1M90 R;  1E6G A;  4J9D A;  2P4R A;  4IUU A;  2DVJ A;  3M5A A;  5GAN 6;  1RLQ C;  4JUV A;  3O8V A;  1MMN A;  1FMK A;  4PFO A;  4ZNX A;  3WVD B;  3E2U A;  4JS4 A;  1O75 A;  3OBW A;  2D6F A;  4WF2 A;  2VYT A;  3GF5 A;  2R5A A;  4EMK B;  3CCQ T;  3RES A;  1RI9 A;  1YJN A;  3CCM A;  4II1 A;  2CUB A;  5GAN g;  3MPU B;  2RI3 A;  4A4K A;  3UT1 A;  4M77 E;  2F1L A;  2CZ6 B;  3OS2 A;  2L3Q A;  5FU7 B;  3OB9 A;  2CRE A;  4CC3 A;  4RTZ A;  2X4W A;  5ECA A;  1BB9 A;  2KBT A;  3J81 E;  1VIE A;  3I55 Q;  2C0O A;  1M8V A;  2KK4 A;  4RG2 A;  3M4Y A;  3EFS A;  5HCK A;  2JMA A;  4C5G A;  2ZCF B;  2A3L A;  2OTJ Q;  3CC7 Q;  4XU3 A;  2DTI A;  3H41 A;  1I8F A;  3E9G A;  2JVV A;  5GAN f;  4PJO C;  1W4S A;  2DTH A;  1Y0M A;  3JCM c;  1M2V B;  4M77 G;  2X4Y A;  5IHK A;  3OYJ A;  3LGF A;  1AWJ A;  3G71 T;  1SG5 A;  2OAU A;  4XTU A;  3MHX A;  2FVU A;  2CP7 A;  1V76 A;  1UG1 A;  1S72 Q;  1VQ6 Q;  4IKF A;  2YSQ A;  5GAM g;  3VV0 A;  3M0S A;  3FB9 A;  3UA7 A;  3MEA A;  5FRM A;  1PM3 A;  4PJO F;  1YI2 A;  2KE9 A;  2RNA A;  3EH1 A;  2KYM A;  5KE3 A;  2JMC A;  2DKG A;  2BE9 B;  3L2V A;  2QDL A;  1KG1 A;  2EYY A;  4OVA A;  2E12 A;  4JS5 A;  3RBB B;  3OYB A;  5GAN e;  4Z8A A;  4LD6 A;  5LJ5 h;  4M7A F;  1KC8 R;  4PNO A;  2V1R A;  5GAM f;  2YLB A;  4LXC A;  1IB8 A;  2FO0 A;  3EFO B;  1C1A A;  2E3I A;  3H9N A;  3I5S A;  4M75 D;  5CR2 A;  2BE7 D;  4JRI A;  2K9G A;  1FWZ A;  5HK0 A;  3CME A;  5CAI A;  4X9C A;  3JB9 D;  2AKL A;  4EMK A;  5CO7 A;  4NOY A;  3PT9 A;  2X3W D;  2JXB A;  3GBQ A;  3TRE A;  3JCM h;  2PVO B;  1N8R U;  2DVE A;  3MP6 A;  1WYX A;  2ATC B;  4M78 D;  4ZN1 A;  1RAE B;  1X2Q A;  4QVZ A;  3H8Z A;  3QJY A;  5GAM e;  2VVK A;  4E7L A;  1CKB A;  4J6W A;  2DL8 A;  3RR6 A;  3CCU T;  1X6G A;  1YCY A;  4FSX A;  4IUT A;  2X3X D;  2J05 A;  3PE0 A;  4F7U B;  2EWN A;  2MAM A;  5GAN 8;  1PWT A;  3HFO A;  3CCV T;  1Y71 A;  1M2V A;  3CBO A;  2J6K A;  3CC4 Q;  2QQR A;  2W0Z A;  1JXO A;  1X6O A;  2DL5 A;  4J5Y A;  5FLX E;  3FC3 A;  3TSZ A;  2YWW A;  2QTV A;  1Q82 U;  5GAN 4;  1LVK A;  1D0Z A;  2SEM A;  1NG2 A;  3LW5 E;  1ABQ A;  4E7I A;  3M56 A;  4L6V 5;  5GAN 7;  4HCC A;  1M5Q 1;  4CC2 A;  1GCQ A;  4CI0 C;  4AMC A;  7AT1 B;  3CMA T;  3V8L A;  1Q95 G;  2XI9 A;  2K7A A;  2EAY A;  2LQK A;  1QP2 A;  4MDX A;  1UUE A;  2FHD A;  3FRN A;  3H6Z A;  1QWF A;  1SSH A;  2MIO A;  3AT1 B;  1YIJ T;  2DET A;  3NGP A;  2F5K A;  1ZUK A;  1WIE A;  1YWP A;  2DER A;  3G4S T;  1FMW A;  4PJO E;  2RD1 A;  4C8Q D;  2E10 A;  3EFO A;  5GAO p;  4J9G A;  4KUL A;  3OMG A;  2DYI A;  3FDR A;  2E6N A;  2HKQ B;  2R5M A;  4BE0 A;  4DA4 A;  4AFQ C;  1H3H A;  2CGH A;  2RQT A;  2QAS A;  1PHT A;  2ZPH B;  1VQP A;  2P0Q A;  5IH2 A;  1EFN A;  4F7U F;  4KGX B;  4N4H A;  2KDS A;  4PJO G;  1EIF A;  1KD1 U;  1GFC A;  4Z89 A;  1AVZ C;  1H64 1;  1OZ3 A;  1K76 A;  2D0Q B;  3L2Z A;  1PKS A;  4ZGE B;  3UWN A;  4DBF A;  5IXF A;  2LVM A;  2NUT B;  3A5Z B;  4ZGD B;  2V8J A;  2V1Q A;  5EC7 A;  1OEB A;  4IUP A;  2FB7 A;  1VQ5 A;  4BUG A;  2KNB B;  4RUG A;  4M7A G;  4ORZ A;  4F7U A;  4OP0 A;  1QVG S;  1K0X A;  2Y4X A;  1WNL A;  4OGC A;  2GTO A;  4LUD A;  5GAO l;  3NMZ C;  5KYX B;  3EG0 A;  1MGQ A;  5GMK j;  2O9S A;  2DPP B;  2CSI A;  4GY5 A;  1RAI B;  1M8M A;  2CDT A;  2V8K A;  1QW1 A;  5GAN 3;  4HCZ A;  4HVV A;  2L3S A;  1G3Y A;  1M1K U;  1OU9 A;  1X43 A;  2P84 A;  2QEX A;  1VQ8 A;  2EKH A;  3CEY A;  2QK0 A;  1UEC A;  1X2K A;  1K9M C;  1B34 B;  1VQK T;  4F04 B;  4E7H A;  3MCA B;  2QTX A;  4N0A C;  4OMP A;  2NUZ A;  2QQS A;  3M0P A;  2XK0 A;  3GLX A;  2DF6 A;  2BZY A;  2X51 A;  5EG2 A;  2XHC A;  3M4G A;  3EH2 A;  4NS5 A;  3OY9 A;  1WPY A;  3T9N A;  1ZSZ C;  1UDL A;  3EG2 A;  4HVU A;  1ZUU A;  2LQN A;  3QWY A;  2L3P A;  4M75 B;  3UA6 A;  2PVD B;  2LT1 A;  2KI7 A;  4BD3 A;  5GAO m;  3OSS C;  4HT8 A;  2QGF B;  1QVG P;  2DRM A;  1YJW Q;  2A36 A;  3CPW A;  4C92 B;  1Q82 R;  4JJN K;  1JJ2 S;  1VIF A;  1YJ9 A;  1XOV A;  4ANJ A;  4JJB A;  1IRX A;  4IUQ A;  4HT9 A;  5KYY B;  5C6S A;  1TWB A;  2NUT A;  4J9B A;  1OYX A;  2P0P A;  2DA9 A;  1NJI C;  3CCJ T;  1HJD A;  4JJD A;  1U06 A;  2KY9 A;  1YCS B;  4A54 A;  5LJ5 g;  3CC2 Q;  2KMT A;  5GAN d;  4F16 A;  1P92 A;  3S6W A;  5KYX A;  3C4S A;  1K73 U;  4OMO A;  4LDX A;  3LGL A;  5GMK l;  2Y4Y A;  2OTL A;  1D1C A;  2FZG B;  5AYF A;  2OTL Q;  3M58 A;  9ATC B;  2L0A A;  2DZ9 A;  2NWM A;  3C0C A;  3PGG A;  4QT7 A;  2DBM A;  3X25 B;  4CC7 A;  2RI5 A;  2HEQ A;  3CCR A;  2FZK B;  3WXM B;  4Y28 E;  2FYK A;  3CBM A;  3JCM g;  1QCF A;  3CCR Q;  4C0D C;  5LJ5 f;  1VQ7 Q;  1TUD A;  2CSQ A;  1VQ4 Q;  4RG8 A;  2DM1 A;  2EQU A;  4NL3 A;  2Y90 A;  4JRK A;  3UF4 A;  1B34 A;  2CP0 A;  5GMK h;  1KD1 R;  3HHT B;  4M75 F;  3I55 T;  1WXU A;  2GFU A;  3M9Q A;  4LDY A;  4X34 A;  5GAM d;  2YT6 A;  2LX9 A;  1FXX A;  3JB9 F;  4XU2 A;  3U23 A;  4OB2 B;  1SPK A;  1JJ2 P;  1WXB A;  1ZX6 A;  3SWN B;  4ELZ C;  1C6V X;  2OTJ T;  3TEE A;  1RAC B;  2AK5 A;  2VUB A;  4GLK A;  3CC7 T;  2AZS A;  2XIC A;  3JCM f;  2ZPB B;  4XTW A;  4M78 F;  4M75 A;  5LJ5 e;  1JQQ A;  3GIB A;  1NYG A;  2E5Q A;  2DJZ A;  2LZ6 B;  1S72 T;  1VQ6 T;  1UHF A;  3M0Q A;  3CCS Q;  4KT0 E;  3TQ7 P;  1RAB B;  1Q81 U;  3N5B B;  3VS7 A;  3MEV A;  2AZV A;  5KYY A;  4CC4 B;  2JN0 A;  1K1Z A;  4D6W A;  1M1K R;  2ZAE A;  1SKU B;  4M78 A;  2RN8 A;  4E6R A;  1PD0 A;  1K0S A;  2E41 A;  3JCM e;  3NPF A;  1HYO A;  4CRI A;  4JJC A;  5CKB A;  4FIB A;  4BDZ A;  4KBM B;  1NLP C;  3BY7 A;  2JTE A;  1UE9 A;  4NL2 A;  2L2P A;  3HRS A;  1ACM B;  4B9X A;  4PLI A;  3BDL A;  2AKK A;  2MI6 A;  3F70 A;  1WHH A;  2HMA A;  3EGX B;  4BY6 B;  2O9V A;  3HTR A;  2RB6 A;  1NPP A;  3JB9 J;  4ELY C;  3L2W A;  1UFF A;  4C8Q F;  5FU6 C;  5KE2 A;  1OPL A;  2E70 A;  1D1B A;  1RL2 A;  3ULR B;  4Z88 A;  3SDZ A;  2QGG A;  2YRC A;  1OUL A;  3HPW A;  4M7D D;  3JAM E;  4J6Y A;  3SWN A;  3FJP A;  2EQJ A;  3JSC A;  2VGM A;  4KH0 B;  3OA6 A;  3VYG A;  1AWO A;  2MWO A;  3CC4 T;  2EGE A;  2OX7 A;  1JRI A;  4RTV A;  1RAD B;  3CD6 A;  3C12 A;  1G83 A;  4EMG A;  2LCS A;  5GAN 2;  1VQN A;  1Q86 C;  1K73 R;  3CD6 Q;  1VQ9 Q;  2LP5 A;  1YHQ Q;  5I2S A;  3FLG A;  4J6X A;  3JCM P;  3BW1 A;  5FWC A;  3Q1J A;  1AD5 A;  2E1H A;  2AHJ B;  1AEY A;  2RMO A;  3EG9 B;  4JPB W;  1AZE A;  3X26 B;  2LNH B;  2JT4 A;  4OMQ A;  4M75 G;  3VKI A;  4RTU A;  1KSW A;  1NYF A;  4C5I A;  2PVG B;  4J7F A;  2YRV A;  5GJV B;  3I56 A;  2SRC A;  2EYZ A;  1YJN Q;  4RMO A;  3CCM Q;  1H8K A;  2DZC A;  5C0M A;  4DBQ A;  5LJ3 j;  4M78 G;  1WQ7 A;  2DXB A;  5A0G A;  3EGX A;  2L3R A;  1S1N A;  3EGU A;  2DL4 A;  2QG9 B;  3A8L B;  2FPF A;  4L5G A;  2GNC A;  1KQS A;  3PMI A;  1WHL A;  1VQM A;  3V8J A;  4C0G A;  4TVR A;  5FRO A;  2K6D A;  3A8M B;  1FMV A;  1EX4 A;  4HCB A;  1Q81 R;  1SHG A;  4BDY A;  1BCO A;  2K5F A;  2XID A;  2HSE B;  4PJM A;  3L2R A;  2GTJ A;  5IHN A;  5CK9 A;  2YHT A;  5IXB A;  4AT1 B;  4M7A C;  4EIK A;  1BYM A;  3I5R A;  1YI2 Q;  3MEU A;  2VXE A;  4FYY B;  4QQD A;  5GJW B;  1X01 A;  2L5Q A;  4LE9 A;  4RTW A;  4XTZ A;  2HDA A;  3OYI A;  4IIO A;  1VQO T;  2LDM A;  1VYU A;  1M3A A;  2ENM A;  3REA B;  4KRT A;  3PFS A;  2Z0W A;  4C8Q G;  3EG9 A;  2X4J A;  1QMC A;  3MP8 A;  1GRI A;  4WTO B;  3FJ5 A;  4LNP A;  1OU8 A;  2D1X A;  2OAW A;  3OYD A;  1I5O B;  4J9I A;  4A4F A;  3VYH B;  4BAC A;  4C92 D;  3CME Q;  1PKT A;  1QVG A;  1VQL A;  2KR3 A;  2RH2 A;  3RKX A;  2F2V A;  4JZ4 A;  4J7I A;  1BCM A;  1OPK A;  1I0C A;  3OSV A;  1WFW A;  3KUF A;  2KRO A;  1AT1 B;  5CQY A;  3VJP A;  4XQ3 A;  3LH0 A;  2ECZ A;  3LWH A;  4EMH A;  3X20 B;  3VS5 A;  1WX6 A;  2PTK A;  2A0F B;  2EFI A;  5LJ5 d;  4BI4 A;  3G6E A;  1YJW T;  4R56 A;  2B8A A;  2K57 A;  3G6E Q;  3OW2 S;  3M53 A;  3C94 A;  4XTX A;  3L2Q A;  2RHZ A;  2QXF A;  3QKJ A;  4FYW B;  2O4X B;  3VS4 A;  4LDU A;  5GAO n;  1V29 B;  1MHN A;  2WSC E;  2VC8 A;  1K4U S;  4BB7 A;  4HCK A;  5LJ3 h;  3VS6 A;  1N6A A;  1BIA A;  3EGD B;  3CC2 T;  4KGV B;  4C5H A;  3JCM d;  1JBM A;  4M7D B;  3FIF A;  4J8O A;  5FWB A;  2M1H A;  5GMK e;  1MV0 B;  1Q86 R;  3NTK A;  5LL6 S;  5HY6 A;  3OYH A;  2MOX A;  2KRN A;  3QZ5 B;  3P8D A;  1ZA1 B;  4M77 D;  5GAO r;  2DNU A;  1OQK A;  3HSB A;  5CKF A;  1UGR B;  3RER A;  1ZSG A;  1IHV A;  1PRL C;  2GQI A;  3RIR A;  1JEG A;  1JJ2 A;  2IPO B;  1VQ7 T;  4LDW A;  2DYB A;  1W70 A;  1VQ4 T;  2LRQ A;  2ZPI B;  5AT1 B;  4RKU E;  5DY9 A;  1R8O B;  3VRY A;  1NEG A;  3THK A;  1IXD A;  3OS1 A;  1UTI A;  4FW1 A;  2GQV A;  1IGQ A;  2CKK A;  2ZZD A;  1AZG B;  3OW2 P;  3L42 A;  4M7A E;  2X9H A;  4MML A;  4RTX A;  1D0X A;  2HBP A;  3RUX A;  3CCQ A;  1Q7Y C;  3V7S A;  1MMA A;  4XU1 A;  2K2V A;  5L8R E;  1VQP Q;  3VS0 A;  3LWI A;  1K8A C;  4D8D A;  2C0T A;  3OS5 A;  8ATC B;  3QYG B;  1U1T A;  1O9S A;  1RLP C;  1ZUY A;  1YN8 A;  2PZ1 A;  2KXC A;  2X4X A;  4FW2 A;  1G3T A;  2KAF A;  1XJW B;  3CCS T;  4AFU C;  3O5Z A;  3GNG A;  3G7Z A;  3R6N A;  2O4X A;  1VQ5 Q;  3EAE A;  4KGZ B;  3DB3 A;  4BE2 A;  3X24 B;  1DJ7 B;  4OB1 B;  4GLM A;  4KUI A;  3C95 A;  1RAF B;  4ME7 A;  3SD4 A;  4WCI A;  1VUB A;  3M0R A;  3G71 A;  1J3T A;  3EGD A;  3OS0 A;  4M7D A;  2BZX A;  1LNX A;  4DOV A;  3CCE A;  2G6F X;  3TVT A;  1WLP B;  1KJW A;  2CUD A;  2L89 A;  4QQG A;  3CCE Q;  2FRW A;  5IHI A;  2H3J A;  4OB0 B;  4FL6 A;  4BI3 A;  2QEX Q;  4QVD A;  1VQ8 Q;  3M59 A;  2W10 A;  1ZLM A;  2CP3 A;  2YUP A;  3OQ5 A;  1Y7X A;  1BI2 A;  2D8J A;  1N27 A;  1R0B G;  2HSP A;  2J6F A;  2NLU A;  2RQR A;  2YDL A;  1TUC A;  2EPD A;  1Y07 A;  2CP2 A;  1GXI E;  1ARK A;  1G2B A;  4XTY A;  3RKY A;  2FG0 A;  3ZBD A;  2KGT A;  2JNG A;  3PVQ A;  4OML A;  3CQT A;  1XQH A;  2BTT A;  3UAT A;  2FPD A;  2VKN A;  8AT1 B;  1X6B A;  3JB9 I;  4KUD K;  1M2O A;  1NPR A;  1K9M U;  4FT2 A;  3X28 B;  4E7J A;  1BIB A;  1PD1 A;  1YFN A;  2K79 A;  4FT4 A;  1PC0 A;  2RJD A;  2LTO A;  3HFN A;  3WVE B;  1YJ9 Q;  1N5Z A;  4MMK A;  3CD6 T;  1VQ9 T;  2CT4 A;  1MUZ A;  3QO3 A;  1YHQ T;  3S3M A;  1KIK A;  1KK7 A;  2DEU A;  1M4Z A;  3MJX A;  3CCU A;  1G5V A;  4F7U E;  4Y91 A;  3QUI A;  1G3W A;  4OMM A;  3VU3 C;  2MPX C;  1WHK A;  4PJO D;  2RQV A;  3PNW C;  3V8K A;  5I22 A;  3P8B B;  2HKN A;  5IAY A;  2DXC A;  1M1F A;  1WJR A;  4J9H A;  3GOX A;  3CCV A;  4RTT A;  5HKC A;  3CCV Q;  1M90 C;  2IVW A;  2KRM A;  1HSQ A;  2KQW A;  2FPE A;  2OI3 A;  1WXT A;  4C0Z A;  1W2B S;  3RMQ A;  3JCM X;  4M75 C;  1MND A;  1NJI U;  2DIG A;  2DD4 A;  2M51 A;  4F7U G;  2QA4 A;  1YJN T;  3CCM T;  1FYN A;  2QA4 Q;  1MV3 A;  5I21 A;  1M3C A;  5IT9 E;  2RO0 A;  2MCN A;  4ESR A;  4GBQ A;  1U1S A;  3SHW A;  2RHX A;  3VS1 A;  1LPL A;  4M77 B;  1KHI A;  2QQA A;  1M3B A;  4M78 C;  3G4S A;  4C92 F;  1D0Y A;  4BE1 A;  5KCH A;  2EIF A;  2O2O A;  2DTO A;  4X9D A;  4UC4 A;  1BK2 A;  4J9E A;  2COY A;  5LJ3 g;  2BKD N;  3QBY A;  3CXC S;  2A28 A;  2FZC B;  1JU5 C;  4C92 A;  2LX7 A;  5GMK m;  4D8K A;  2DO3 A;  2BUD A;  1YBY A;  1WZO A;  2NUP B;  3REB B;  4IUR A;  3JCM V;  1XTD A;  2HCK A;  5CQX A;  1YI2 T;  1D1A A;  1YWO A;  4ZTF A;  4AFZ C;  2LT4 A;  1QVF S;  1W2B P;  2VWF A;  4N4G A;  4E47 A;  4F14 A;  2RHU A;  2GFA A;  1VYV A;  3SB2 A;  5LJ3 f;  3BFM A;  1T0J A;  2LQ8 A;  2O01 E;  4PLL A;  1YIT A;  1B7T A;  1YIT Q;  5D7U A;  1TXQ A;  1TTH B;  1BI0 A;  2VGN A;  2XDP A;  3A8O B;  3LH5 A;  3SWN C;  2JM9 A;  1KC8 C;  2JOY A;  2DFU A;  1U3O A;  1D09 B;  4C8Q C;  2K4Y A;  4C5E A;  2XDD A;  3A8G B;  1TG0 A;  3RNJ A;  4M77 F;  3CME T;  2LCL A;  3JCM W;  3QSU A;  5CKH A;  2WSF E;  1WHM A;  4K11 A;  3A98 A;  2X35 A;  4O6J A;  3E9F A;  3NTH A;  1K9M R;  1HD3 A;  5LJ3 e;  2ZPE B;  1A0N B;  4O5V A;  3ASK A;  5D6W A;  2M02 A;  1Y96 B;  2NYS A;  4FM4 B;  4M77 A;  3CXC P;  2DAQ A;  2CZ1 B;  2VAS A;  4DOW A;  1VQK A;  2PNI A;  2RI2 A;  2A08 A;  3EHQ A;  3G6E T;  2J6O A;  5GAN 5;  2K5L A;  1QCO A;  1LOJ A;  2RJF A;  1SRL A;  2RM4 A;  3I9Q A;  4JLI A;  1HXD A;  3JV3 A;  1QVF P;  2JTM A;  2E3H A;  4M75 E;  3QPH A;  4FYX B;  4J9F A;  2AT1 B;  2J7I A;  1TUG B;  1VQN Q;  1TU0 B;  2LJ0 A;  2R58 A;  2XD0 A;  2NUP A;  3EFR A;  4BY6 C;  2HL3 A;  1KQ2 A;  4JRQ A;  4OMF B;  2F2W A;  1NJI R;  1VYT A;  1AOJ A;  4L59 A;  4LDV A;  4M78 E;  2MK5 A;  1M27 C;  2A7Y A;  1K9A A;  4JDS A;  2GBQ A;  2EGA A;  3CCJ A;  1I5L A;  3GP8 A;  3CCJ Q;  2D9T A;  2EYX A;  3OW2 A;  3JB9 H;  5DLO A;  4C92 G;  3JB9 G;  1I07 A;  5IN1 A;  1Q86 U;  1NZ9 A;  5CCA A;  2D8H A;  1UJ0 A;  2CYZ B;  4A4E A;  2XU8 A;  3A8H B;  4PJO B;  1UJY A;  4PJN A;  4XU0 A;  2JJ9 A;  3I56 Q;  3OMC A;  2ED1 A;  1PSF A;  4A4G A;  2CP6 A;  1EZZ B;  2RF0 A;  1BBZ A;  3MKD A;  3UPU A;  2DLP A;  3OYL A;  3RDV A;  2DEQ A;  2M0Y A;  1VQP T;  4M7A B;  2KT1 A;  2RJC A;  4RCB A;  5A0L A;  3BE3 A;  3QYH B;  1D3B B;  4V2S A;  1VQM Q;  1SF9 A;  3E1S A;  4B6M A;  3M0U A;  1WHG A;  1Y96 A;  4J9C A;  5CKE A;  3KXT A;  3NHN A;  1MNE A;  1Y57 A;  3I55 A;  2QAZ A;  2RQW A;  2LJ1 A;  2QYZ A;  1VQ5 T;  1WJQ A;  4C8Q E;  2I0N A;  1GCP A;  2OTJ A;  2COW A;  4E7Z A;  3FEO A;  4QVC A;  1TOV A;  3CC7 A;  2YUN A;  4KH1 B;  4EMK C;  2K3B A;  2EYQ A;  1BU1 A;  3ZL7 C;  2RK1 A;  4JLG A;  4VUB A;  4OF1 A;  3VUB A;  1VQ6 A;  1S72 A;  2B86 A;  2HQH A;  5FU7 C;  3L1A A;  2P0K A;  5KYN A;  4LD9 K;  2JS2 A;  3CCE T;  3PIO A;  1UGS B;  2KRS A;  1SHF A;  1VA7 A;  2KYB A;  2QEX T;  1I1J A;  1VQ8 T;  2A37 A;  2K5I A;  2XMF A;  2ESW A;  2H3E B;  3MET A;  2E6Z A;  2C06 A;  3M57 A;  3M55 A;  1N8R C;  3HKS A;  3VS2 A;  4MZP A;  2KEA A;  2PUO B;  4Q5W A;  1VQL Q;  1QKW A;  4PJO A;  3QDR B;  3OYG A;  3URG A;  1QKX A;  2MWP A;  4PK4 A;  2HQX A;  1H92 A;  4EPC A;  2RQU A;  2O88 A;  3GNF B;  2CP5 A;  1IRE B;  5KYU B;  1GCQ C;  2ABL A;  3BDU A;  3INZ A;  2M16 A;  4DQ2 A;  2EQI A;  2WSE E;  2K2M A;  1NM7 A;  4M7A A;  1U5S A;  3DLL A;  3CCL A;  1D3B A;  1TH7 A;  1QVP A;  3CCL Q;  4HKE A;  3S3O A;  1YJ9 T;  4OMN A;  3TSW A;  1Q82 C;  1NLO C;  4FCY A;  2GGR A;  3QHS A;  4BI8 B;  1CKA A;  2EJG A;  4OGE A;  3SEM A; 
#chains in the Genus database with same CATH homology
 3OQ5 A;  1Y7X A;  1BI2 A;  3WVD B;  1N27 A;  2E5Q A;  2DJZ A;  4JS4 A;  1S72 T;  1VQ6 T;  1O75 A;  4QW2 A;  3OBW A;  2D6F A;  3LYI A;  4KT0 E;  4WF2 A;  2VYT A;  2NLU A;  3GF5 A;  2R5A A;  3LLR A;  4EMK B;  3CCQ T;  1Q81 U;  3N5B B;  3RES A;  1YJN A;  3CCM A;  3NFC A;  3OBY A;  1Y07 A;  3QG1 A;  4II1 A;  1ZHI A;  1UEB A;  3MEV A;  4ZN3 A;  1GXI E;  5GAN g;  3CC4 A;  4XTY A;  3RKY A;  3ZBD A;  2JN0 A;  3QJ6 A;  2RI3 A;  2JNG A;  3VUZ A;  4D6W A;  4A4K A;  3UT1 A;  4M78 A;  4M77 E;  2CZ6 B;  1XQH A;  3OS2 A;  5FU7 B;  3OB9 A;  2OTL T;  3ME9 A;  2VV5 A;  1QP3 A;  2X4W A;  3JB9 I;  5DLQ E;  4KUD K;  2E41 A;  3JCM e;  3J81 E;  1VIE A;  2JUF A;  1NPR A;  1K9M U;  2KK4 A;  1M8V A;  4QQ6 A;  1KQS S;  4RG2 A;  3JRZ A;  3EFS A;  3M4Y A;  4FT2 A;  4CRI A;  2F69 A;  1HK9 A;  5D6X A;  3X28 B;  5CKB A;  1BIB A;  4FIB A;  4E7J A;  1H3Z A;  2QA4 T;  4C5G A;  4R55 A;  2ZCF B;  3CCR T;  4KBM B;  4BDZ A;  5DM7 R;  5GAN j;  4FT4 A;  3OYK A;  2KVQ G;  1IZ6 A;  2A3L A;  3BY7 A;  2RJD A;  2LTO A;  2CS7 A;  3HFN A;  1M1G A;  4A53 A;  1I4K 1;  2RJE A;  4NL2 A;  3WVE B;  4XU3 A;  3HRS A;  2DTI A;  4MMK A;  1I8F A;  3E9G A;  5LJ3 d;  1M9S A;  4B9X A;  4PLI A;  3BDL A;  2JVV A;  5GAN f;  3CD6 T;  1VQ9 T;  4PJO C;  1W4S A;  2DTH A;  3JCM c;  2MI6 A;  3QO3 A;  1N9R A;  4M77 G;  1YHQ T;  3F70 A;  2X4Y A;  3OYC A;  3OYJ A;  4RCC A;  3S3M A;  2IG0 A;  4ZTJ A;  3LGF A;  3J80 E;  3G71 T;  2OAU A;  4XTU A;  3MHX A;  4BY6 B;  1M4Z A;  3CCU A;  2FVU A;  1G5V A;  4F7U E;  2RB6 A;  1KD1 C;  1NPP A;  4Y91 A;  3JB9 J;  1AHJ B;  4IKF A;  5GAM g;  5FRN A;  3QUI A;  1G3W A;  3VV0 A;  4ELY C;  3VU3 C;  3L2W A;  3FB9 A;  4PJO D;  2K3X A;  3HRU A;  3MEA A;  1WQW A;  2DXU A;  4C8Q F;  5FRM A;  3PNW C;  4XTV A;  5FU6 C;  3V8K A;  4M7D C;  3P8B B;  3CCV A;  5IAY A;  2DXC A;  1M1F A;  1WJR A;  4PJO F;  5KE2 A;  3GOX A;  1YI2 A;  5KE3 A;  5HKC A;  1M90 C;  2E70 A;  3L2V A;  2DKG A;  2IVW A;  1OZ2 A;  1KG1 A;  1RL2 A;  2KSS A;  3SDZ A;  2KQW A;  4OVA A;  3RMS A;  2E12 A;  2GCX A;  4C0Z A;  1W2B A;  4JS5 A;  1W2B S;  3OYB A;  5CKD A;  3HPW A;  4M7D D;  4Z02 A;  5GAM j;  2QI2 A;  4MDW A;  3JAM E;  4J6Y A;  5GAN e;  3RMQ A;  3FJP A;  3SWN A;  2EQJ A;  4LD6 A;  2CZ7 B;  4M75 C;  4ZGJ B;  5LJ5 h;  3JSC A;  3JCM X;  1NJI U;  2DIG A;  2VGM A;  2DD4 A;  4M7D F;  4M7A F;  4F7U G;  2QA4 A;  1YJN T;  3CCM T;  4PNO A;  2PU9 B;  3CBP A;  5I21 A;  3VYG A;  3OA6 A;  5GAM f;  5IT9 E;  2YLB A;  2MWO A;  2RO0 A;  3CC4 T;  1Q7Y U;  1JRI A;  3ZEH A;  4YTL A;  5A2Q E;  3CD6 A;  3C12 A;  4M75 D;  4EMG A;  5CR2 A;  5GAN 2;  1VQN A;  1U1S A;  1Q86 C;  2RHX A;  1K8A U;  4JRI A;  1FWZ A;  5HK0 A;  3CME A;  1M1K C;  4M77 B;  5I2S A;  1SSF A;  1KHI A;  5CAI A;  3FLG A;  2QQA A;  3MEW A;  4J6X A;  4X9C A;  4M78 C;  3JB9 D;  4EMK A;  5A0D A;  3JCM P;  2EQM A;  4M7D B;  5CO7 A;  3G4S A;  4NOY A;  3BW1 A;  4C92 F;  1YIT T;  3PT9 A;  4BE1 A;  3Q1J A;  2E1H A;  5KCH A;  4JRP A;  3TRE A;  2EIF A;  2AHJ B;  2HQE A;  4B9W A;  3M54 A;  2DTO A;  4X9D A;  5GAO q;  3JCM h;  3MP1 A;  2PVO B;  1N8R U;  4UC4 A;  2PUK B;  2DVE A;  3TCJ A;  3MP6 A;  3OYF A;  4M78 D;  3X26 B;  4ZN1 A;  1KHC A;  1NE8 A;  4QVZ A;  3OYM A;  3CXC A;  4M75 G;  3H8Z A;  3VKI A;  5M9O A;  5LJ3 g;  3QJY A;  2BKD N;  2ZPF B;  3QBY A;  5GAM e;  3CXC S;  4E7L A;  5KH6 A;  4J6W A;  4C92 A;  1VQO A;  1U8R A;  2I2L A;  2WAC A;  4C5I A;  3CCU T;  5GMK m;  1YCY A;  4FSX A;  2PVG B;  3RKW A;  4IUT A;  4J7F A;  2YRV A;  2DO3 A;  2BUD A;  2XG8 D;  1YBY A;  4J83 A;  4F7U B;  3I56 A;  2EWN A;  1KQ1 A;  2MAM A;  5GAN 8;  4IUR A;  4MZM A;  4RMO A;  3JCM V;  1XTD A;  2DZC A;  3HFO A;  5C0M A;  1Y71 A;  5CQX A;  3CCV T;  3CBO A;  1YI2 T;  5LJ3 j;  1WQ7 A;  2QQR A;  4M78 G;  2DXB A;  5A0G A;  1QVF A;  4ZTF A;  1X6O A;  4J5Y A;  2L3R A;  5J39 A;  2LT4 A;  5FLX E;  3FC3 A;  1QVF S;  2JTF A;  5GMK i;  4N4G A;  4E47 A;  3A8L B;  1Q82 U;  2RHU A;  5GAN 4;  2GFA A;  4L5G A;  3SB2 A;  5LJ3 f;  1KQS A;  2LCC A;  3BFM A;  3PMI A;  3NTI A;  3R6O A;  5D6Y A;  2LQ8 A;  2O01 E;  4PLL A;  1YIT A;  3JCM b;  3LW5 E;  2JZ2 A;  4E7I A;  3M56 A;  1VQM A;  3JCM Q;  4L6V 5;  3V8J A;  4C0G A;  5GAN 7;  4HCC A;  1M5Q 1;  2GF7 A;  4TVR A;  4CI0 C;  3CMA T;  5FRO A;  5I2M A;  1BI0 A;  2VGN A;  3A8M B;  5GAN h;  5KCO A;  2XDP A;  3A8O B;  3PTA A;  3SWN C;  3V8L A;  1BI1 A;  4HCB A;  2RA2 A;  1KC8 C;  2JOY A;  2MF2 A;  2XI9 A;  2M0O A;  2EAY A;  2LQK A;  2R57 A;  4BDY A;  4C8Q C;  2K4Y A;  1QP2 A;  4C5E A;  2XDD A;  3A8G B;  4MDX A;  2K5F A;  1VQN T;  2V8I A;  4M77 F;  2FHD A;  3FRN A;  3H6Z A;  2XID A;  1YJW A;  3CME T;  1YIJ T;  3DLM A;  2LCL A;  2F5K A;  3JCM W;  3QSU A;  3L2R A;  3QII A;  5CKH A;  1K73 C;  2WSF E;  4C0D B;  4XK8 E;  3G4S T;  4PJO E;  2RD1 A;  4C8Q D;  3MO8 A;  2E10 A;  5CK9 A;  4PKC C;  2YHT A;  2X35 A;  4O6J A;  3E9F A;  3NTH A;  5GAO p;  5LJ3 e;  2ZPE B;  4M7A C;  2K3Y A;  4KUL A;  3OMG A;  2DXT A;  4O5V A;  3ASK A;  3QZ9 B;  1UGQ B;  5D6W A;  4N0A A;  1BYM A;  1Y96 B;  4FM4 B;  4M77 A;  2YLC A;  4M78 B;  3ER0 A;  3FDR A;  2DAQ A;  3MEU A;  4A4H A;  2E6N A;  1XNI A;  2CZ1 B;  2VXE A;  4QQD A;  3V7C A;  4DOW A;  1VQK A;  2R5M A;  4BE0 A;  4DA4 A;  2VXF A;  1X01 A;  2L5Q A;  2RI2 A;  3TU4 K;  3G6E T;  4M7D E;  2CGH A;  3CC2 A;  4XTZ A;  5GAN 5;  2K5L A;  3OYI A;  4M7A D;  1VQO T;  2ZPH B;  1VQP A;  1BI3 A;  2HAX A;  2LDM A;  5GAM h;  2P0Q A;  1LOJ A;  3JCM J;  4F7U F;  2RJF A;  3PFS A;  1UGP B;  3DB4 A;  2RM4 A;  3P8H A;  4N4H A;  4C8Q G;  2KDS A;  3CMA A;  4JLI A;  4PJO G;  2QQ9 A;  4C92 C;  3I56 T;  1EIF A;  1HXD A;  2X4J A;  1KD1 U;  3MP8 A;  4FU6 A;  2JTM A;  4M75 E;  1H64 1;  1OZ3 A;  3L2Z A;  2D0Q B;  3QPH A;  3E19 A;  3OYD A;  4ZGE B;  3UWN A;  3HL8 A;  2LVM A;  5HK3 A;  1X75 C;  3A5Z B;  4ZGD B;  2V8J A;  2G3R A;  1YIJ A;  5CIU A;  4IUP A;  4A4F A;  2FB7 A;  3VYH B;  4BAC A;  1M90 U;  1VQ5 A;  4C92 D;  4BUG A;  1QVG A;  1VQL A;  4M7D G;  2RH2 A;  4M7A G;  3RKX A;  2R58 A;  4F7U A;  2XD0 A;  1VQ7 A;  4OP0 A;  4MZT A;  1QVG S;  3EFR A;  4BY6 C;  4J7I A;  1KQ2 A;  3OYA A;  2Y4X A;  1VQM T;  3OSV A;  1VQ4 A;  2L8D A;  1WNL A;  4OMF B;  3KUF A;  3PIP A;  4JRQ A;  1BKB A;  4OGC A;  4L59 A;  5CQY A;  4LDV A;  5GAO l;  4M78 E;  4EDU A;  1MGQ A;  5GMK j;  3VJP A;  2A7Y A;  4XAX B;  4XQ3 A;  2EJ9 A;  4JDS A;  2DPP B;  3LH0 A;  4GY5 A;  3LWH A;  2XDB A;  2F5T X;  2EKO A;  4EMH A;  2V8K A;  3X20 B;  3CCJ A;  3SFM A;  1I5L A;  1QW1 A;  5GAN 3;  1Q81 C;  1ZQ1 A;  3KBG A;  4HCZ A;  2EFI A;  3GP8 A;  5LJ5 d;  4BI4 A;  2D9T A;  3G6E A;  1YJW T;  3OW2 A;  3JB9 H;  5DLO A;  4C92 G;  4R56 A;  3JB9 G;  2B8A A;  2K57 A;  3OW2 S;  5IN1 A;  3QXE B;  3M53 A;  1Q86 U;  1NZ9 A;  5CCA A;  1G3Y A;  3C94 A;  1M1K U;  4XTX A;  3L2Q A;  2RHZ A;  1WGS A;  2FL7 A;  2QXF A;  3QKJ A;  2O4X B;  2CYZ B;  4A4E A;  2XU8 A;  4C8Q B;  4LDU A;  2QEX A;  5GAO n;  1G3S A;  4C0F A;  1V29 B;  1VQ8 A;  3A8H B;  1MHN A;  4PJO B;  4XU0 A;  2WSC E;  3CEY A;  3OMC A;  2VC8 A;  4BB7 A;  1PSF A;  1K9M C;  2HD0 A;  5LJ3 h;  4A4G A;  1PSE A;  1B34 B;  3CCS A;  1VQK T;  3OYY A;  4E7H A;  3UPU A;  3MCA B;  2QTX A;  4N0A C;  1N6A A;  1BIA A;  3OYL A;  3CC2 T;  4M77 C;  2DEQ A;  3DKM A;  4C5H A;  3JCM d;  2QQS A;  1JBM A;  2E65 A;  1VQP T;  5FU6 B;  4M7A B;  2XK0 A;  3GLX A;  1JB0 E;  2RHY A;  3FIF A;  4IUV A;  2RJC A;  4HA8 A;  4J8O A;  4RCB A;  3LX7 A;  3QYH B;  1D3B B;  5A0L A;  2M1H A;  5EG2 A;  1WJS A;  5GMK e;  4V2S A;  3NTK A;  3HP9 A;  2XHC A;  3E1S A;  3M4G A;  5LL6 S;  4NS5 A;  3OY9 A;  1Y96 A;  5CKE A;  3KXT A;  2ZGW A;  5HY6 A;  3OYH A;  3ZFJ A;  1WPY A;  3L2U A;  3QZ5 B;  5J26 A;  3P8D A;  5J3B A;  3T9N A;  4M77 D;  5GAO r;  3I55 A;  3HSB A;  5CKF A;  1UGR B;  4M75 B;  1OI1 A;  2PVD B;  3AHU A;  2LT1 A;  1FX7 A;  4BD3 A;  3OSS C;  5GAO m;  3RER A;  4HT8 A;  2M9U A;  2HNI A;  4PL6 A;  1VQ5 T;  1WJQ A;  3RIR A;  3CPW A;  4C92 B;  1VQL T;  4C8Q E;  1JJ2 A;  2RK2 A;  4JJN K;  3GPL A;  3CPW S;  1VQ7 T;  4LDW A;  2OTJ A;  3FEO A;  4QVC A;  1JJ2 S;  1VIF A;  1YJ9 A;  3CC7 A;  1VQ4 T;  2DK3 A;  2E64 A;  1XOV A;  2CZ0 B;  2EJF A;  2LRQ A;  4EMK C;  4ATO A;  2ZPI B;  1I81 A;  4RKU E;  4IUQ A;  4HT9 A;  5DY9 A;  5C6S A;  2EYQ A;  1R8O B;  1N9S A;  1RI0 A;  1OYX A;  2EQK A;  2P0P A;  3OS1 A;  1NJI C;  2RK1 A;  4JLG A;  2GQV A;  4OF1 A;  4VUB A;  3VUB A;  3CCJ T;  2CKK A;  2ZZD A;  1S72 A;  1KC8 U;  2RHI A;  2QQB A;  5FU7 C;  1VQ6 A;  3L42 A;  2LC4 A;  3L1A A;  4M7A E;  2P0K A;  2PQW A;  2KY9 A;  2DIQ A;  4MML A;  4A54 A;  5LJ5 g;  4LD9 K;  2HBP A;  3RUX A;  3CCL T;  3CCQ A;  1Q7Y C;  3V7S A;  4XU1 A;  3CCE T;  3PIO A;  3UDC A;  2KMT A;  2K2V A;  1UGS B;  4N4I A;  5GAN d;  5L8R E;  1P92 A;  3S6W A;  3C4S A;  3LWI A;  3V7R A;  1K8A C;  4OB3 B;  3OS5 A;  1K73 U;  4LDX A;  2QEX T;  3QYG B;  3LGL A;  1VQ8 T;  5GMK l;  3HRT A;  2Y4Y A;  2K5I A;  2OTL A;  1ZBX A;  3PMT A;  1U1T A;  1O9S A;  5AYF A;  2QDY B;  3M58 A;  2X4X A;  1G3T A;  3MET A;  2KAF A;  2E6Z A;  3OYN A;  2C06 A;  3M57 A;  4C92 E;  5LJ5 j;  3CCS T;  2DZ9 A;  3M55 A;  1N8R C;  3GNG A;  3PGG A;  3G7Z A;  3HKS A;  2O4X A;  4MZP A;  3X25 B;  2PUO B;  2RI5 A;  3CCR A;  3WXM B;  4C8Q A;  3EAE A;  1LJO A;  4P5N A;  2FYK A;  4Q5W A;  4Y28 E;  3CBM A;  3JCM g;  3DB3 A;  4BE2 A;  4PJO A;  2BIV A;  3X24 B;  3QDR B;  2DD5 A;  2ZPG B;  4C0D C;  5LJ5 f;  2LNV A;  3URG A;  2MWP A;  3OYG A;  2HQX A;  3CPF A;  3S3N A;  5CVI A;  4EPC A;  4RG8 A;  4E7K A;  2EQU A;  4NL3 A;  1DJ7 B;  2Y90 A;  4JRK A;  4OB1 B;  2MMP A;  3GNF B;  4KUI A;  1VQ9 A;  1YHQ A;  1B34 A;  5GMK h;  1IRE B;  3C95 A;  3HHT B;  4ME7 A;  3SD4 A;  1VUB A;  3BDU A;  4M75 F;  3INZ A;  3G71 A;  2M16 A;  4DQ2 A;  3I55 T;  3J7A F;  2XKO C;  3OS0 A;  2GFU A;  3M9Q A;  2WSE E;  4LDY A;  4X34 A;  5GAM d;  3OYE A;  4M7A A;  4M7D A;  3DLL A;  1LNX A;  1FXX A;  2LX9 A;  3CCL A;  3JB9 F;  1D3B A;  1TH7 A;  4XU2 A;  4DOV A;  4OB2 B;  3CCE A;  2P4T A;  1QVP A;  1UB4 A;  4HKE A;  2L89 A;  4QQG A;  3SWN B;  4ELZ C;  2OTJ T;  3TEE A;  3S3O A;  2VUB A;  4GLK A;  1YJ9 T;  3CC7 T;  4IUU A;  1Q82 C;  2H3J A;  4OB0 B;  3M5A A;  4FL6 A;  5GAN 6;  2XIC A;  4BI3 A;  4JUV A;  3O8V A;  3JCM f;  2ZPB B;  3QHS A;  4XTW A;  4QVD A;  3M59 A;  4BI8 B;  4M78 F;  4M75 A;  2EJG A;  5LJ5 e;  4OGE A;  3GIB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...