2P0KA

Crystal structure of scmh1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
HFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polycomb protein SCMH1
publication title Structure of SCMH1
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 52
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA01
3E9FA 4N4GA 2LDMA 3GOXA 2XDPA 3E9GA 3OB9A 2MWOA 3OS0A 3BDLA 3ZEHA 4QW2A 4C5GA 3LGFA 3OYCA 5KE2A 3L42A 2RI3A 3MEUA 3O8VA 2RJCA 3F70A 3KUFA 5FRNA 5CIUA 3OYKA 3OYBA 2BIVA 2GFAA 4EDUA 5KH6A 3OYAA 4GY5A 3MP6A 3MP8A 2M0OA 3QJ6A 2O4XB 3FLGA 3ME9A 2L3RA 3S3MA 4IUUA 3NTIA 5C0MA 3C4SA 2WACA 4E7IA 2HQEA 4BACA 3L2WA 3OQ5A 3FEOA 5C6SA 3MEVA 2K3XA 2DIQA 4E7KA 2R5AA 2EQKA 3FDRA 2RHIA 2XK0A 4E7LA 2LRQA 1WJSA 4PLLA 2RO0A 3PNWC 2RJFA 3DB4A 5FROA 1G5VA 2EQJA 2EQMA 4X34A 2DIGA 3DB3A 3DLMA 4IURA 4IUTA 2QQSA 3OYFA 3L2UA 2O4XA 2D9TA 3UT1A 1WJQA 1OI1A 2R58A 4IUQA 3P8HA 2G3RA 2JTFA 2X4WA 4FU6A 5D6YA 2JZ2A 4HCZA 1OZ3A 5J39A 2X35A 4B9WA 4BE2A 2HQXA 3OYGA 1WGSA 5KCHA 2YRVA 4ZTFA 3P8DA 4IKFA 5KE3A 2EKOA 2DAQA 2E6NA 2EQUA 4RG2A 3MEWA 2GFUA 3QKJA 4E7HA 2RHZA 3L2VA 4PLIA 3PMIA 2RJEA 4BE0A 2M16A 2RI5A 1OYXA 1MHNA 3H8ZA 3EAEA 4BDYA 5IN1A 2IG0A 3LLRA 3PFSA 4L59A 3MO8A 4NS5A 5M9OA 3LYIA 3OA6A 3M9QA 2VYTA 4E7JA 2RHUA 5D6XA 4BDZA 2NLUA 5IAYA 4N4IA 4ZTJA 4A4EA 4A4FA 3OY9A 2GF7A 2X4XA 3PMTA 3S6WA 4LD6A 4Z02A 3LX7A 1N27A 3NTHA 3Q1JA 4QQ6A 2CKKA 1SSFA 3OS2A 5FRMA 4Q5WA 3OYNA 3OS1A 3OYDA 2B8AA 4QVZA 3UWNA 3OYLA 2L8DA 4OVAA 3QBYA 2LTOA 4PL6A 2P0KA 4UC4A 4BD3A 4QQDA 3CEYA 3ASKA 4C5EA 3MP1A 2E5QA 3L2RA 1RI0A 4B9XA 3OYEA 3H6ZA 4A4HA 4N4HA 3OYIA 5J26A 3OYMA 4QQGA 2RJDA 2FHDA 4BE1A 2F5KA 4C5IA 4A4GA 2PQWA 2BUDA 3SD4A 2RHYA 3L2QA 1OZ2A 1WJRA 3S3NA 2LCCA 3OMCA 3QIIA 2K3YA 4FL6A 3OYJA 4CRIA 4IUPA 3LGLA 2L89A 2LVMA 4C5HA 2RI2A 3MEAA 3META 3OYHA 2R5MA 2M1HA 2X4YA 2MWPA 3NTKA 1H3ZA 2BKDN 3OMGA 1KHCA 3S3OA 5KCOA 3LH0A 4IUVA 1XNIA 2EFIA 5D6WA 2RHXA 3FC3A 2QQRA 4II1A 2R57A
chains in the Genus database with same CATH superfamily
2QYZA 5GAMj 1QCFA 2VGMA 3BDLA 4A4KA 5KYYB 2VUBA 4J83A 5CIUA 4E7SA 1FYNA 5HK0A 3QDRB 1VQ9A 4IUUA 1YJNT 3G7ZA 3JCMc 4PK4A 1E7OA 1ZQ1A 5FWCA 2H3JA 2MCNA 2A0FB 1S72A 2PVDB 4J6XA 5FROA 1KFZA 3OBYA 2QASA 4ANJA 3L2UA 2QA4A 3P8HA 1BB9A 4F16A 4AFSC 2QDLA 1YJ9T 4BE2A 1A0NB 2BE9B 1MGQA 2L0AA 1K76A 2DL7A 3PVLA 1N8RC 3CD6Q 1Y07A 3PE0A 1D1BA 4Y91A 1ZBJA 3LLRA 1OU8A 4FYVB 3M9QA 2RHUA 1ZLMA 4N4IA 1NBEB 2ZAEA 3LX7A 2O31A 1LNXA 1YJ9A 4J6WA 1BKBA 3GNGA 3CPWS 3QYHB 4CC4B 1AVZC 2CUDA 3VYHB 2EGCA 2RF0A 4C5IA 2MYSA 4EMKA 5CKBA 2P0QA 4E6RA 4X9DA 2DRMA 2CP7A 3M0PA 4DQ2A 3OYJA 1YIJA 5GANj 3M54A 3R6NA 5AT1B 3T9NA 1IZ6A 3EG9A 3VYGA 4BI8B 3FC3A 1RACB 4II1A 4IIMA 3CCLT 1M8MA 5LJ3h 2VXFA 1EFNA 1IGQA 2JJ9A 1Z9ZA 2K4YA 3KUFA 3F70A 2NUTA 2WSEE 3JB9J 2GQVA 3MP8A 2A3LA 2WSFE 3C4SA 3QHSA 1VQPA 4FIBA 4RTTA 1OPLA 2A36A 4C8QB 2AKLA 1PD0A 5KYNA 3E19A 1M8VA 2LQ8A 2YRDA 4R0KA 3N5BB 5CQYA 1UECA 1VYTA 1K9MR 1Q86C 1WA7A 3DLMA 1VQ6T 4M75E 3GLXA 1VQMA 4C0DB 3THKA 4KRTA 4LDXA 3OS5A 2JOYA 4KH0B 1RI9A 2CZ6B 2EQUA 5GMKm 4EIKA 4HCBA 3RR6A 1SHFA 1OYXA 5LJ5e 4XTYA 2DPPB 2M0YA 3VUZA 3VS5A 1VYVA 4ZTJA 4GBQA 3G4ST 4C8QG 4M78F 1WHHA 2LT1A 1FXXA 2CZ7B 2YLCA 2MK5A 2DE0X 3INZA 2DILA 2CT3A 2DKGA 3HSBA 1G2BA 3L2RA 8ATCB 3GNFB 1ABQA 4M7DA 3A8OB 3G71A 2JM8A 1W2BP 3TREA 1WJRA 3I55A 1H92A 2QEXQ 1SSHA 4CRIA 3LGLA 1QWFA 3EGDA 5GAMh 2CDTA 4ESRA 1LVKA 3M55A 4ATOA 3VS7A 3V8LA 2JN0A 4C92F 1B07A 5GAOl 1CKBA 2ZCFB 4EPCA 1GCPA 1M5Q1 2YWWA 3EFOA 3CBOA 1NE8A 2K2MA 1IHVA 2RK2A 3OYKA 1YITT 5CQXA 1Q81R 3OYAA 4GY5A 5FU7B 1UB4A 3FLGA 4D8KA 3UPUA 3G6EQ 4JJBA 2HZYA 5C6SA 1V1CA 2EQKA 1PC0A 2X51A 5CR2A 2MPXC 1YBYA 2E3HA 2P0PA 2LQKA 1AT1B 3DB3A 4IURA 3SWNC 3NHNA 1PWTA 1QVFP 1OI1A 3H0FA 1M3AA 3ZL7C 1K8AC 3JCMW 2F2XA 4E2FB 3EGXB 1VQ8A 3QZ5B 4KBMB 1KQSP 2FZGB 3JCMV 1E6GA 1D3BA 4OGCA 2GFUA 1N9RA 2KROA 1MHNA 1Q82U 3KFVA 3OYYA 2JS2A 4NS5A 3CMEQ 1M90C 2L3PA 4PFOA 1PHTA 1FMKA 1SG5A 3RNJA 4ZGEB 4PJOB 3FB9A 2GF7A 4M78D 2QK0A 2PTKA 2BZXA 5DLOA 1VQOT 4PFZA 3EG3A 5GAOn 3CCUT 5FRMA 4O5VA 2XI9A 3X24B 2D6FA 4QVZA 5IHKA 5ECAA 1AWJA 2DEUA 3CEYA 2VV5A 2E5QA 1NLPC 3HRTA 5GANh 2F5KA 8AT1B 2DXBA 3CXCP 1VQ7T 2PQWA 1WNLA 3CMAA 3JV3A 2BZ8A 2DK3A 4X1VA 3S3NA 1EIFA 2JTMA 3NMZC 2EQIA 3JCMJ 4FYXB 3META 3QPHA 3VS1A 1OEBA 2GNCA 4M7AG 2A08A 2FYKA 3OSSC 1KQ2A 3M0SA 1G83A 2VWFA 2B86A 4C92D 4PJOG 1RAIB 1M27C 2SRCA 4C8QE 1QVGS 2RA2A 1NJIC 5HCKA 4M7DD 2IIMA 1BBZA 1VQNQ 1YHQA 2FPEA 4XTXA 4M78C 2RMOA 1CSKA 2VVKA 1BIBA 2M0OA 2LNHB 1ZUKA 1YJWT 3WVEB 4TVRA 4VUBA 4KGVB 1KG1A 1O9SA 3GP8A 5I2MA 2DD5A 1U06A 2KYMA 5LJ5d 4LE9A 3VS0A 3CC2A 2J05A 1BI3A 1VIFA 3UA6A 4J9EA 1Q7YR 2FO0A 4F7UF 1PD1A 3UT1A 1BI1A 4L5GA 4RUGA 2JTFA 4WF2A 5FW9A 2KEAA 2GGRA 4M7AA 5CKHA 3EG2A 3P8DA 2YHTA 1UTIA 2QGGA 1WPYA 4LDWA 3M56A 2RPNA 4C92C 4M77F 1VQKA 4AG2C 3U23A 1VUBA 2D0NA 2IG0A 4MZMA 4L59A 3CPFA 3OA6A 4M7DC 5D6XA 2C0IA 4A4EA 2F5TX 4RTXA 1VQ4Q 2YRCA 4MDXA 2C06A 3UA7A 2QQBA 1QLYA 3EGUA 5CO7A 3CCJA 1VQ5Q 4OVAA 3CCRA 3V7CA 3VS2A 1K9AA 3H6ZA 2E41A 5KYXA 4OF1A 3JCMb 3BDUA 2J6FA 2ZPFB 4FT4A 1K0SA 1NPPA 4JRQA 2KT8A 4NL3A 2OTLT 2JT4A 1FWZA 1M4ZA 2ABLA 2O88A 2PUKB 3JRZA 2RHXA 2YLBA 3CCSA 2AKKA 1W4SA 1MV0B 5I11A 3MEUA 2BE7D 4JZ4A 4OMQA 4RCBA 3MKDA 1HJDA 1B3QA 1VQ9Q 2ESWA 2K3BA 3VRYA 1W70A 2QG9B 3CC4A 1T0HA 4ELYC 3A5ZB 1YN8A 2R5AA 1TG0A 1NM7A 1I8FA 1R8OB 2CP0A 2Z0WA 5CAIA 3I5SA 4J9CA 9ATCB 1IB8A 5KYWA 3H9NA 1ZA2B 1WJQA 3EFSA 1BCMA 2CSIA 3QO3A 2CP2A 4PJOE 1RAFB 2X35A 3H0HA 1N8RR 2HQXA 2DXCA 1YJNQ 1VQLA 1G8XA 4XTUA 2E6NA 3MEWA 4M77D 1RAHB 1B34B 1AWOA 2CT4A 2EYWA 2YDLA 2ENMA 5GAOp 1TOVA 1E6HA 2NLUA 4A4FA 4MZPA 3PMTA 1M30A 2L5QA 1YJ9Q 1Q7YC 2JM9A 4Q5WA 4XK8E 2B8AA 1SRMA 4J8OA 5LJ5h 2HL3A 2Y90A 3CPWA 1ZSZC 3CCVT 4QQGA 3PVQA 2DTHA 1GFDA 2ZPIB 4A4GA 3M57A 1YP5A 1R77A 4F04B 1W1FA 1FMWA 3REBB 1PRMC 5KYUB 1M2VA 3CCET 3MEAA 1QCOA 2X4YA 2DXTA 2L3QA 3G1JA 4XTWA 2V8JA 4IUVA 1I0CA 3A1PA 1NYGA 2EFIA 2X3WD 4HKEA 4M77C 2LDMA 1WHKA 1ZX6A 4QW2A 3LGFA 3BW1A 1KQ1A 2RJCA 5FRNA 2DVEA 4LNPA 3MJXA 3SWNB 3I56A 3LH5A 3JCMX 2ATCB 3EHRA 3RKXA 2CS7A 3L2WA 3M4YA 4M75G 2DF6A 3CCLQ 3FDRA 2GTOA 2LRQA 1QP2A 2RO0A 4IIOA 1Q86R 1S72T 4DEYA 3DLLA 1PCXA 1BK2A 3C94A 5GAN2 1X01A 2QA4T 2OAWA 1UGVA 2QTVA 1GCQA 2PNIA 2YUQA 4PKCC 2DETA 1D1CA 3MCAB 1WHJA 1K73U 4B6MA 3MO8A 1VQ6Q 2KAFA 4ORZA 1W2BS 2VASA 4NOYA 3TSZA 1XQHA 3RDVA 1IGUA 1IRXA 1TS9A 5GAMd 3M5AA 3VS6A 1RAGB 4M75A 4O6JA 3OSVA 4QQDA 1RI0A 2RQWA 3OYIA 5LL6S 4DEXA 1GBRA 2ED0A 2RQRA 1M2OA 3V7SA 2DM1A 2RHYA 4KH1B 1WHMA 2LCCA 3G4SQ 3DKMA 2HBWA 2RQVA 1YIJT 4M78B 1UJYA 1KHCA 1M1KU 1Y71A 2O2OA 5GAN8 1NPRA 2F2WA 2YUOA 3V8JA 1WQ7A 2OTJA 3E9FA 1XTDA 3M0RA 5HY6A 2DYIA 2NWMA 5DLQE 2XDPA 5GAN7 3I5RA 2DL3A 3O8VA 2CZ0B 4HT9A 1QVFS 4JJNK 2LQNA 2LC4A 1W6XA 2F69A 2O4XB 1RAEB 3UATA 1SKUB 2M02A 1VQPT 4Y92A 4A53A 2VXEA 3X20B 1KD1U 4ZN1A 4OMOA 2XDBA 3JAME 5KYYA 5IHNA 2XIDA 1N5ZA 4PFPA 3A8LB 2ZPBB 4C92B 4PJNA 2EJFA 3FJPA 2QQAA 4CI0C 1AD5A 1YITQ 1IREB 2V8KA 2OAUA 1K8AR 2HMAA 4ME7A 1VQMT 1YI2A 3CC7A 3PTAA 1KC8U 1KIKA 2X3XD 3RKYA 2M51A 4XU1A 3JCMf 4AFUC 2D1XA 1HYOA 2DBMA 2KY9A 1U8RA 2D8HA 5DM7R 1H641 1XJWB 2HKQB 1M90R 4RG8A 4FT2A 3CXCS 5GANd 4BDZA 3CCQA 1SHGA 5L23A 2VC8A 4J9BA 2DTIA 1JXOA 5D7UA 2KVQG 1OPKA 4PL6A 2D8JA 1WLPB 1LPLA 3ASKA 4OMMA 1SPKA 2E70A 3SD4A 3G71T 2IVWA 1Q82C 1VQOQ 3I55T 4JDSA 5GMKj 3CCUQ 1AWXA 3EFRA 3CBMA 4AFZC 1JB0E 1Y96B 4LDVA 3HFOA 2R57A 1X2KA 3GOXA 3QWYA 1B7TA 5LJ3f 1NJIR 2KYBA 1VQ7Q 2K2VA 2ROTA 4ZGDB 2JXBA 2Y4XA 3C0CA 2MIOA 1SF9A 3OW2A 2I2LA 2M9UA 2DRKA 4OMFB 4BY6C 4DOVA 2FRYA 3VS4A 1OOTA 2AT1B 2CYZB 3NGPA 3NFCA 3QWXX 2O9SA 4P5NA 4WCIA 2NUPB 4DOWA 1G5VA 3SB2A 4M7DF 2MAMA 1BU1A 1C6VX 2K7AA 2X4WA 3JB9H 5GMKi 1YJWQ 2K9GA 4C8QA 1TSFA 2XHCA 1VQ8T 4E47A 4V2SA 4LUDA 4EMGA 1UEBA 2MF2A 1QWEA 3HKSA 2DX1A 5A0DA 2XDDA 1CKAA 3PFSA 1ZUUA 1ZSZB 3CCMT 2LJ1A 3A98A 4N0AA 4DBFA 2O01E 2PVOB 2X4XA 3JSCA 2VGNA 4F7UB 1AZEA 3JCMP 4J7FA 1UGQB 1AZGB 4JJCA 2V8IA 2C0OA 3JB9G 3CPWP 1LOJA 1MV3A 4M78E 4X9CA 1I4K1 5J26A 2COYA 4M77B 2WSCE 2VB6A 1HK9A 3CCMA 2BUDA 3CMAT 1RABB 3QIIA 4EMKC 2FZKB 5GAMf 1WXBA 1H3ZA 1PKSA 1K0XA 1V76A 3JB9I 2LJ3A 4KT0E 3JCMe 5IXFA 4F7UG 4C0ZA 5FU6C 1KSWA 1JRIA 1WX6A 2OTLQ 2DO3A 4C92E 2RQUA 3OYBA 1YHQT 3NPFA 4EDUA 2W10A 1U3OA 1M1FA 1TXQA 5C0MA 4OB1B 1P92A 2XD0A 3HP9A 2EYZA 3DB4A 2PVGB 3CC2T 1RL2A 2EJ9A 2QQSA 2D9TA 3EH2A 1X6GA 1XOVA 2G3RA 2RD1A 2EW3A 2FB7A 1GBQA 1OX8A 4JUVA 1UJ0A 1S1NA 4E7ZA 2NYSA 3V7RA 2HNIA 4ZTFA 2DZCA 4BUGA 2F2VA 1TUGB 4FYWB 3VJPA 3RBBB 1VQKT 2GTJA 5IN1A 1JQQA 3LYIA 4A63B 5IAYA 3EGXA 3JCMg 2QEXA 4LD6A 1IXDA 3EG1A 3FIFA 4C8QD 3OS2A 1WZOA 1D0XA 2A28A 3CCJT 4HCCA 3QBYA 4J6YA 3CCRT 2K5LA 4XU0A 2C0TA 5GANf 5GMKh 1JJ2A 3L1AA 4ZN3A 4N4HA 1OX9A 4PJOA 4F17A 1UHCA 3M0QA 1PG5B 1WXTA 3D7SB 2E65A 3L2QA 2YUPA 3X28B 2E5KA 1EX4A 2RI2A 3M58A 2R5MA 3OBWA 3C95A 3M0TA 4LN2A 3G6EA 4M7AF 4N4GA 3CCVQ 3QJYA 2DL4A 5GAOr 2D0QB 1K9MU 3CCST 1KJWA 4C5GA 4JPBW 5KE2A 3L42A 2RI3A 1IHWA 1H8KA 3BE3A 5AYFA 2GFAA 3CCEQ 3EHQA 1Q95G 2LX9A 4C8QC 3NTIA 4KUDK 1VA7A 4E7IA 3TEEA 5LJ3g 3CC4T 3FEOA 2DFUA 2F1LA 3MEVA 2DIQA 2L3SA 2ZPGB 1BI0A 2J06A 1AEYA 4MMLA 1ABOA 2RJFA 1ZA1B 4DBHA 3AHUA 4C0DC 2EQJA 4PJJA 3CMEA 1D09B 1IO6A 2OJ2A 2KR3A 1RADB 4F7UE 3OYGA 1TU0B 1VQLT 5KE3A 2KMTA 3J81E 1N9SA 4MMKA 3QKJA 1PM3A 2HD0A 5I2SA 5GMKl 4E7HA 1S72Q 3RERA 2J6KA 1H3HA 1UUEA 2M16A 2RI5A 1G3YA 2CP3A 3VV0A 1WHLA 3GIBA 5M9OA 1WDXA 2EBPA 2QA4Q 1KHIA 2H8HA 1X75C 1D1AA 2QTXA 2QXFA 3HTRA 2DZ9A 4C0GA 1WYXA 5FLXE 2DL5A 2FG0A 4NL2A 4JRKA 3PT9A 2FZCB 1HXDA 1I81A 2DBKA 4ZGJB 4C5EA 2DJZA 1PKTA 2YSQA 2LZ6B 1QCNA 1Q81U 2Y4YA 1VQNA 4R56A 1K73C 3X26B 1DJ7B 2HSEB 1AOJA 5LJ3j 3A8GB 3OYHA 2HEQA 2W0ZA 2KBTA 3TU4K 2ZPEB 3UF4A 2FRWA 4M7AD 1C0MA 1UHFA 2GQIA 5A2QE 2IPOB 5GAOm 1MUZA 3VRZA 1D0ZA 3ZFJA 3OS0A 3MHXA 3ZEHA 4FW2A 5GAMg 2OX7A 3OW2P 1QVPA 3M53A 4JJDA 5GAN5 1UGPB 1X2QA 4RCCA 1YIJQ 2CZ1B 2JNGA 3QJ6A 3I56T 2EAYA 1WHGA 4XAXB 2GCXA 3A8MB 1RAAB 2QAZA 2QGFB 5IXBA 3TCJA 2O9VA 2RHIA 3VUBA 4E7LA 1WJSA 5A0GA 2KGTA 1M1KC 1X6BA 1NG2A 1YCSB 2R58A 4J7IA 2JUFA 4IUQA 3WXMB 2DJQA 2JZ2A 1VQ4A 1OZ3A 2AK5A 1VQPQ 1MNDA 2KI7A 1WGSA 4K11A 2V1QA 3KBGA 2CSQA 3C12A 2E12A 3QYGB 1VQ5A 4LXCA 4M7AC 2DAQA 4BB7A 4MDWA 4RG2A 1K1ZA 1UDLA 1K4US 2RNAA 2XICA 3A8HB 1RLQC 4BE0A 1KD1C 3RESA 5L8RE 1TWBA 2LCLA 4OMNA 1YWOA 1VQMQ 1UGSB 3OY9A 1X69A 3SDZA 1BIAA 3NTHA 4EMKB 3LW5E 2OI3A 3OYDA 3RUXA 3UWNA 5LJ5f 1KC8C 1G3WA 1B34A 2LTOA 1I5OB 4BD3A 2PZ1A 5IH2A 1V29B 2DEQA 4Z8AA 3EG9B 5IT9E 4XU3A 4HT8A 7AT1B 3QZ9B 1Q82R 2DL8A 5GMKe 5FU6B 1OZ2A 2QQ9A 2I0NA 2K3YA 2ZZDA 2LVMA 2NUTB 3OMGA 5GANg 1ARKA 3TQ7P 1QKWA 2EVRA 2OTJT 1UE9A 2AZVA 1WQWA 4HVWA 2BZYA 1OV3A 2E6ZA 3OB9A 5KYUA 2DA9A 3G71Q 1Q7YU 2RH2A 3I55Q 4OB3B 1NEBA 2BIVA 3SEMA 4JZ3A 2KT1A 3S3MA 2DLPA 2WACA 1GRIA 4XTZA 1YJNA 2DD4A 3JCMh 1TUCA 4J9GA 1M3BA 4A54A 2XK0A 4PLLA 4M75F 5EC7A 3VU3C 3SWNA 2JTEA 2EQMA 2DIGA 4CC7A 2CP6A 3GBQA 1YI2T 2HDAA 3CC7T 1AHJB 3QDFA 3O5ZA 4IKFA 1KQSS 2EKOA 3MPUB 2LP5A 2HBPA 2KRMA 1BI2A 1PSFA 2E4HA 4XTVA 4CC2A 3L2VA 1PNJA 2A7YA 2RJEA 1ZSGA 2COWA 4BDYA 1O75A 3I9QA 5I22A 4YTLA 3RMQA 2VYTA 4LUEA 4M78G 3CCQT 3R6OA 1NZ9A 3SFMA 4M7DB 5I21A 3LWIA 1RUWA 4Z02A 4QQ6A 4M4ZA 1VQ8Q 2CKKA 4KGXB 1JJ2P 3EGDB 4HA8A 2HSPA 2FPDA 2P84A 3CCMQ 2ROLA 1OULA 1G3SA 2E64A 4Z88A 1JU5C 4BI4A 3OMCA 2YUNA 4LD9K 1UGRB 2ECZA 4IUPA 2L89A 3EFOB 2MWPA 2DTOA 2CH4W 4C92G 1GXIE 3CBPA 4FSSA 3CCLA 3UDCA 1NYFA 2FL7A 1LJOA 3E9GA 4M7DG 1JO8A 1Y0MA 4OB0B 3REAB 3OYCA 3PIPA 3V8KA 3CMAQ 4J9HA 1PRLC 4M78A 4D6WA 2MMPA 2XG8D 1MNEA 1VOMA 5CK9A 1N8RU 4JLGA 4CC3A 3ME9A 5FWBA 3SHWA 1OQKA 1ZUYA 3CD6T 1MMAA 4M75D 2CREA 1VYUA 1D3BB 1ACMB 2XMFA 1AWWA 2KSSA 4IUTA 4D8DA 1QVGA 1VQ6A 1YHQQ 1YFNA 2O4XA 4RTYA 2MOXA 2HKNA 3PIOA 2G6FX 1WXUA 4EMHA 4QVCA 5J39A 2YXYA 4B9WA 3ZBDA 1GCQC 2X4JA 3RIRA 2LT4A 5KCHA 4RMOA 3H41A 1I1JA 4C92A 2EYYA 5CVIA 3CD6A 2K57A 2HL5C 6AT1B 3PMIA 2CUBA 2RN8A 2EKHA 3CC2Q 5CKDA 4R55A 2AHJB 3X25B 3M0UA 4XU2A 2GBQA 1M3CA 3E2UA 3G4SA 4DBRA 4RKUE 1MMGA 3Q1JA 3L2ZA 3OS1A 2E10A 2DNUA 1I5LA 5DY9A 1VIEA 2V26A 4JS5A 1VQKQ 4M75C 2FVUA 4B9XA 2KDSA 4ZNXA 2RJDA 2CP5A 3QG1A 2E3IA 1WIEA 4LDUA 1MMDA 4JLIA 2LCSA 2K5FA 2KRNA 5LJ5g 2KK4A 4C5HA 3CCJQ 4OMPA 5KCOA 4C8QF 1XNIA 3CCRQ 5D6WA 3QUIA 5EG2A 1T3LA 1Q86U 2V1RA 3J80E 1R0BG 1JBMA 2PU9B 3HPWA 1YITA 3TSWA 3QSUA 1C1AA 1ZHIA 3KXTA 5KH6A 3MP6A 1Y96A 4HCKA 4PNOA 2LQWA 1HD3A 3CQTA 3OQ5A 1G3TA 2MI6A 2J6OA 4PJMA 4M7AB 3EH1A 3CCSQ 2EWNA 3HRSA 3BY7A 4FM4B 3OYFA 4GLKA 2HAXA 1K9MC 2AZSA 4HXJA 4HCZA 4M7DE 2FEIA 4FYYB 2YT6A 3CC4Q 2YRVA 4M77G 5HK3A 2EIFA 2DMOA 3HRUA 2NUPA 5J3BA 1U1SA 1X43A 2EGEA 1TTHB 3HFNA 1UFFA 4OB2B 2K79A 4E7JA 3VS3A 2ZPHB 5LJ5j 4DA4A 2K5IA 5KYXB 1VQOA 1T0JA 5GJVB 2COZA 2QEXT 3CCUA 1HSQA 1SSFA 1VQLQ 1UG1A 1X27A 3OYNA 1SRLA 3OYLA 3JB9F 1U1TA 1ZSZA 2FHDA 1VQ7A 4F7UA 4KULA 2JW4A 2XKOC 4QT7A 4JS4A 3OW2S 1K73R 1RLPC 1SEMA 5LJ3e 4HVVA 1X6OA 2JS0A 4DBQA 4KGZB 3JCMQ 3LH0A 4RTVA 4M77A 3G6ET 3HL8A 1GFCA 1TH7A 4RTZA 3FRNA 1K8AU 3TVTA 2K6DA 4OGEA 4Z89A 5KYWB 2KRSA 3AT1B 4BI3A 4J5YA 1YJWA 3EG0A 1Q81C 2KXDA 2A37A 3FJ5A 5CCAA 2K3XA 1M1KR 4E7KA 1M90U 3HHTB 2CH4A 3PNWC 2EYQA 5GAN4 4QVDA 4GLMA 1I07A 5IHIA 4X34A 3J7AF 4PJOF 4KUIA 3CMET 1NLOC 2LNVA 1FMVA 5D6YA 3I56Q 4C0FA 1J3TA 4AG1C 2JMCA 2NUZA 3P8BB 4FW1A 2L2PA 2RM4A 2FPFA 1QKXA 1KD1R 2HQHA 2RHZA 4PLIA 4QKUA 3H8ZA 4L6V5 1EZZB 2P4TA 2RB6A 3GF5A 1JXMA 3ER0A 1PSEA 4N0AC 5HKCA 2QDYB 3S6WA 1QW1A 5CKEA 1KC8R 1M2VB 2KNBB 4OMLA 4ELZC 1WI7A 2L8DA 5GAMe 3JB9D 5GAN3 1NJIU 3MP1A 4JRIA 3OYEA 4OP0A 4BE1A 2ED1A 3RKWA 2KQWA 3M59A 1N6AA 2OTLA 4M77E 1D0YA 4FL6A 4AT1B 1VQNT 3ULRB 2DYBA 1W2BA 1WFWA 2VKNA 2EYXA 2BKDN 2DXUA 4J9DA 3S3OA 2LMJA 3M4GA 2AIRB 5GJWB 1Y57A 2EGAA 3JCMd 5CKFA 4J9IA 4F14A 1YCYA 2MWOA 4M7AE 4HVUA 2RQTA 1QMCA 3RMSA 3I35A 4J9FA 2EPDA 3QXEB 1KK7A 2EJGA 5GAN6 4PJLA 2L3RA 3E1SA 1YWPA 1U5SA 2HQEA 4BACA 2LJ0A 2J7IA 1OU9A 2OTJQ 4BY6B 2JVVA 4AFQC 1GL5A 2E1HA 1QVGP 4AMCA 1ZBXA 4PJOD 4FSXA 1Y7XA 3H0IA 1F1BB 1QP3A 5FU7C 2ZGWA 2KE9A 3IQLA 1LCKA 4FU6A 2JMAA 3GPLA 1M1GA 1QVFA 1VQ4T 3LWHA 4Y28E 1BYMA 2DVJA 1JJ2S 1T3SA 2KXCA 3BFMA 1VQ5T 3WVDB 2PUOB 4WTOB 5A0LA 1KQSA 3URGA 3EAEA 4M75B 5LJ3d 1Z9QA 5GANe 2RK1A 2QI2A 1YI2Q 3CC7Q 1NEGA 1M9SA 5GAOq 1N27A 4XQ3A 2P4RA 2BTTA 1TUDA 4MZTA 1FX7A 2P0KA 4UC4A 4JRPA 2DERA 4A4HA 3CCVA 4RTWA 4RTUA 3OYMA 4LDYA 2CGHA 3PGGA 1QQJA 2HCKA 1MMNA 4PJOC 3CCQQ 4FCYA 3VKIA 2SEMA 3CXCA 2H3EB 2LX7A 3CCEA 2X9HA 1VQ9T 2M1HA 1YNZA 3NTKA 1JEGA 1R0CB 2QQRA 2XU8A 1BCOA
chains in the Genus database with same CATH topology
4KT0E 3CCLA 3UDCA 3JCMe 5GAMj 2YLBA 2FL7A 1LJOA 3E9GA 2VGMA 4F7UG 3CCSA 4M7DG 4C0ZA 4OB0B 3BDLA 1W4SA 5FU6C 3OYCA 4A4KA 3PIPA 1JRIA 3V8KA 3MEUA 2DO3A 2VUBA 4J83A 4C92E 4RCBA 5CIUA 4M78A 4D6WA 3OYBA 2MMPA 1YHQT 2XG8D 4EDUA 5HK0A 3QDRB 5CK9A 1N8RU 1VQ9A 4JLGA 1M1FA 3ME9A 4IUUA 5C0MA 3CC4A 4OB1B 1YJNT 4ELYC 3A5ZB 3G7ZA 3JCMc 1P92A 2XD0A 2R5AA 1I8FA 1ZQ1A 1R8OB 3CD6T 4M75D 3HP9A 5CAIA 2H3JA 1S72A 2PVDB 3DB4A 2PVGB 1D3BB 4J6XA 5FROA 3CC2T 3OBYA 2KSSA 1RL2A 2EJ9A 4IUTA 1VQ6A 1QVGA 2QQSA 3L2UA 2O4XA 2D9TA 2QA4A 1WJQA 3EFSA 1XOVA 3P8HA 2G3RA 3QO3A 3PIOA 2RD1A 2FB7A 4EMHA 4QVCA 5J39A 2X35A 4JUVA 4B9WA 3ZBDA 4BE2A 1YJ9T 2X4JA 2HQXA 2DXCA 3RIRA 1VQLA 1MGQA 2LT4A 2HNIA 3V7RA 5KCHA 2DZCA 4BUGA 4RMOA 4ZTFA 4XTUA 1N8RC 4C92A 2E6NA 3MEWA 5CVIA 4M77D 1Y07A 3CD6A 2K57A 3PMIA 3VJPA 1VQKT 4Y91A 1B34B 5IN1A 5CKDA 4R55A 2AHJB 3LLRA 3X25B 3LYIA 3M9QA 2RHUA 5GAOp 4XU2A 2NLUA 5IAYA 4N4IA 4A4FA 3JCMg 4MZPA 3G4SA 3PMTA 2QEXA 2L5QA 4RKUE 4LD6A 1Q7YC 3LX7A 3Q1JA 1YJ9A 1LNXA 3FIFA 4C8QD 3OS2A 4PJOE 3L2ZA 4Q5WA 4J6WA 4XK8E 3OS1A 2B8AA 3CCJT 1BKBA 2E10A 3GNGA 4HCCA 4J8OA 1I5LA 3CPWS 3QBYA 4J6YA 5DY9A 5LJ5h 3CCRT 1VIEA 2K5LA 4XU0A 3QYHB 4JS5A 2Y90A 4M75C 2FVUA 3L1AA 4B9XA 4ZN3A 2KDSA 4N4HA 5GMKh 5GANf 3CPWA 3VYHB 3CCVT 4QQGA 2RJDA 4PJOA 2DTHA 4C5IA 2ZPIB 4A4GA 3M57A 3QG1A 2E65A 4EMKA 5CKBA 2P0QA 3L2QA 4X9DA 4LDUA 4JLIA 4DQ2A 2K5FA 3X28B 3OYJA 5LJ5g 1YIJA 5GANj 2KK4A 2RI2A 3M58A 3M54A 3MEAA 2R5MA 4C5HA 3OBWA 2X4YA 3CCET 3C95A 2DXTA 3T9NA 1IZ6A 5KCOA 4XTWA 4C8QF 2V8JA 4IUVA 1XNIA 3VYGA 2EFIA 5D6WA 3FC3A 3QUIA 5EG2A 3G6EA 4M7AF 4II1A 4HKEA 4M77C 1Q86U 4N4GA 2LDMA 3QJYA 3CCLT 5GAOr 2D0QB 3J80E 1K9MU 5LJ3h 3CCST 2VXFA 4QW2A 4C5GA 3LGFA 5KE2A 3L42A 1JBMA 2PU9B 2K4YA 2RI3A 3BW1A 1KQ1A 2RJCA 3F70A 3HPWA 3KUFA 1YITA 2DVEA 5AYFA 5FRNA 3QSUA 2GFAA 1ZHIA 2WSEE 3SWNB 5KH6A 2GQVA 3KXTA 3JB9J 3MP6A 1Y96A 3MP8A 3I56A 2A3LA 3JCMX 2LX9A 4PNOA 4C8QC 3NTIA 4KUDK 2WSFE 3C4SA 3QHSA 4E7IA 1VQPA 4FIBA 3RKXA 2CS7A 3TEEA 5LJ3g 3L2WA 3OQ5A 3FEOA 3M4YA 3CC4T 3MEVA 4M75G 1G3TA 2DIQA 2MI6A 4C8QB 3FDRA 2ZPGB 1BI0A 2LRQA 4M7AB 3E19A 1QP2A 2LQ8A 2RO0A 4MMLA 1M8VA 2EWNA 2RJFA 1S72T 3N5BB 3HRSA 5CQYA 3DLLA 3AHUA 4C0DC 3BY7A 2EQJA 1Q86C 4FM4B 3CMEA 3DLMA 3OYFA 3C94A 5GAN2 1VQ6T 4GLKA 4M75E 2HAXA 3GLXA 1VQMA 1X01A 4C0DB 1K9MC 2QA4T 4HCZA 4LDXA 3OS5A 4F7UE 2JOYA 3OYGA 4M7DE 2YRVA 1VQLT 4M77G 5KE3A 5HK3A 2CZ6B 2KMTA 3J81E 1N9SA 2EIFA 2EQUA 4MMKA 3HRUA 4PKCC 5GMKm 5J3BA 4HCBA 3QKJA 3RERA 2HD0A 5I2SA 5GMKl 4E7HA 3MCAB 2M16A 2RI5A 1OYXA 1G3YA 1U1SA 3VV0A 5LJ5e 3HFNA 3GIBA 1K73U 4XTYA 5M9OA 2DPPB 3MO8A 4OB2B 4E7JA 2KAFA 3VUZA 1W2BS 2ZPHB 5LJ5j 4DA4A 2K5IA 4NOYA 4ZTJA 1KHIA 1XQHA 1VQOA 1X75C 2QTXA 3G4ST 2QXFA 4C8QG 2QEXT 4M78F 2DZ9A 4C0GA 3CCUA 5FLXE 2LT1A 1FXXA 4NL2A 1SSFA 4JRKA 3PT9A 2CZ7B 3OYNA 5GAMd 1HXDA 3OYLA 3M5AA 1I81A 2YLCA 3INZA 2DKGA 4M75A 4O6JA 3HSBA 3OSVA 4QQDA 4ZGJB 1U1TA 4C5EA 3JB9F 3L2RA 2DJZA 1RI0A 3OYIA 3GNFB 5LL6S 2FHDA 1VQ7A 4F7UA 4KULA 4M7DA 3A8OB 2XKOC 3G71A 4JS4A 3OW2S 3V7SA 3TREA 2RHYA 1Q81U 1WJRA 2Y4YA 2LCCA 5LJ3e 3I55A 1VQNA 3DKMA 4R56A 1K73C 3X26B 4CRIA 1DJ7B 1X6OA 3LGLA 5LJ3j 3A8GB 1YIJT 3OYHA 5GAMh 4M78B 3TU4K 2ZPEB 3M55A 4ATOA 1KHCA 3JCMQ 3LH0A 1M1KU 1Y71A 5GAN8 4M7AD 4M77A 1NPRA 3V8JA 1WQ7A 3HL8A 5A2QE 3G6ET 2OTJA 3E9FA 1XTDA 3V8LA 5GAOm 2JN0A 4C92F 1TH7A 5HY6A 5DLQE 2XDPA 5GAOl 3ZFJA 5GAN7 3OS0A 2ZCFB 4EPCA 3MHXA 3ZEHA 1M5Q1 5GAMg 3FRNA 1QVPA 1K8AU 3M53A 3O8VA 1JJ2A 3CBOA 1NE8A 5GAN5 1UGPB 2CZ0B 2RK2A 4OGEA 3OYKA 1YITT 1QVFS 4RCCA 5CQXA 4JJNK 4HT9A 3OYAA 2CZ1B 4GY5A 5FU7B 4BI3A 4J5YA 2JNGA 2LC4A 3QJ6A 2F69A 1UB4A 2O4XB 2EAYA 3FLGA 3I56T 1YJWA 1Q81C 4XAXB 3UPUA 1VQPT 2GCXA 2VXEA 3A8MB 3X20B 4A53A 5C6SA 4ZN1A 2K3XA 5CCAA 1KD1U 2XDBA 3TCJA 2EQKA 4E7KA 3JAME 1M90U 2RHIA 3HHTB 3VUBA 4E7LA 1WJSA 5CR2A 2XIDA 1YBYA 3PNWC 5A0GA 3A8LB 2EYQA 5GAN4 1M1KC 2ZPBB 4C92B 2EJFA 2P0PA 3FJPA 2LQKA 2QQAA 4QVDA 4CI0C 4X34A 3DB3A 4PJOF 1IREB 2V8KA 4IURA 4KUIA 3SWNC 2OAUA 3CMET 1OI1A 4ME7A 2R58A 1VQMT 4J7IA 2LNVA 2JUFA 4IUQA 3WXMB 3PTAA 3CC7A 1YI2A 5D6YA 1KC8U 1K8AC 4C0FA 3JCMW 2JZ2A 1VQ4A 1OZ3A 3P8BB 3RKYA 1VQ8A 3QZ5B 1WGSA 4KBMB 4XU1A 3JCMf 3KBGA 3C12A 2E12A 3QYGB 3JCMV 1VQ5A 2RM4A 4M7AC 2DAQA 2KY9A 4MDWA 4RG2A 1D3BA 4BB7A 1U8RA 4OGCA 1KD1C 2GFUA 1N9RA 2RHZA 5DM7R 1H641 2XICA 3A8HB 4PLIA 4BE0A 3H8ZA 1MHNA 4RG8A 5L8RE 3OYYA 4L6V5 2LCLA 4FT2A 3RESA 1Q82U 2P4TA 3CXCS 4NS5A 2RB6A 1M90C 3GF5A 5GANd 4BDZA 3CCQA 4ZGEB 3ER0A 4PJOB 1UGSB 3FB9A 1PSEA 4N0AC 3OY9A 2GF7A 4M78D 2QDYB 5HKCA 5DLOA 3S6WA 1VQOT 3SDZA 1BIAA 3NTHA 4EMKB 1QW1A 3LW5E 5CKEA 5GAOn 3CCUT 5FRMA 2VC8A 4O5VA 2XI9A 3X24B 2D6FA 2DTIA 4ELZC 4QVZA 3OYDA 3RUXA 3UWNA 5LJ5f 2L8DA 5GAMe 2KVQG 1KC8C 1G3WA 1B34A 3JB9D 5GAN3 2LTOA 4PL6A 4BD3A 1NJIU 3CEYA 3ASKA 1V29B 2DEQA 2E5QA 2VV5A 3MP1A 3HRTA 4JRIA 3OYEA 2E70A 4OP0A 5GANh 5IT9E 1GXIE 4BE1A 4XU3A 3RKWA 2KQWA 3M59A 2F5KA 3QZ9B 4HT8A 2DXBA 1VQ7T 2PQWA 1WNLA 5GMKe 3SD4A 3G71T 3CMAA 1N6AA 2OTLA 5FU6B 4M77E 1OZ2A 2DK3A 2IVWA 2QQ9A 3S3NA 1Q82C 1EIFA 2JTMA 4FL6A 3I55T 2K3YA 4JDSA 5GMKj 1VQNT 3JCMJ 1W2BA 2ZZDA 2LVMA 3META 3QPHA 2BKDN 2DXUA 3EFRA 3OMGA 4M7AG 5GANg 3S3OA 3CBMA 2FYKA 1JB0E 3OSSC 1KQ2A 1Y96B 4LDVA 3M4GA 3HFOA 2R57A 4C92D 3JCMd 5CKFA 2OTJT 3GOXA 4PJOG 5LJ3f 4C8QE 1WQWA 1QVGS 1YCYA 2E6ZA 3OB9A 2MWOA 2K2VA 4M7AE 2RA2A 4ZGDB 1Q7YU 1NJIC 4M7DD 2Y4XA 2RH2A 4OB3B 3RMSA 1YHQA 4XTXA 2BIVA 3OW2A 3QXEB 2I2LA 4M78C 1BIBA 2EJGA 2M0OA 2M9UA 5GAN6 2L3RA 3S3MA 1YJWT 4OMFB 3E1SA 4BY6C 2WACA 4DOVA 4XTZA 2HQEA 3WVEB 4BACA 2DD4A 3JCMh 4TVRA 4VUBA 1YJNA 1KG1A 1O9SA 4BY6B 2JVVA 3GP8A 2CYZB 4A54A 2XK0A 2DD5A 5I2MA 2E1HA 3NFCA 5LJ5d 4PLLA 4M75F 1ZBXA 3VU3C 3CC2A 4P5NA 1G5VA 1BI3A 3SWNA 1VIFA 4DOWA 4PJOD 4FSXA 1Y7XA 2EQMA 2DIGA 1QP3A 5FU7C 3SB2A 3UT1A 4F7UF 1BI1A 2MAMA 2ZGWA 4L5GA 4M7DF 1YI2T 2JTFA 2X4WA 4FU6A 3CC7T 3JB9H 5GMKi 3GPLA 1AHJB 1M1GA 4WF2A 1QVFA 4C8QA 1VQ4T 3LWHA 4Y28E 2XHCA 1BYMA 1VQ8T 4E47A 4M7AA 4IKFA 5CKHA 4V2SA 3P8DA 1JJ2S 1KQSS 2YHTA 4EMGA 2EKOA 3BFMA 1VQ5T 1UEBA 1WPYA 2HBPA 2MF2A 2PUOB 1BI2A 4LDWA 3M56A 1PSFA 3HKSA 3WVDB 4C92C 4M77F 4XTVA 5A0LA 3L2VA 1KQSA 1VQKA 2A7YA 2RJEA 3URGA 1VUBA 5A0DA 3EAEA 2XDDA 1O75A 4BDYA 2IG0A 4MZMA 4M75B 3PFSA 4L59A 4YTLA 5LJ3d 3CPFA 3RMQA 2VYTA 3OA6A 5D6XA 3CCMT 4M7DC 4N0AA 3J7AF 5GANe 2RK1A 4M78G 2QI2A 3CCQT 3R6OA 1NZ9A 2O01E 4A4EA 2F5TX 2PVOB 2X4XA 3JSCA 2VGNA 3SFMA 4F7UB 4M7DB 5I21A 3LWIA 4Z02A 3JCMP 4J7FA 1M9SA 1UGQB 1N27A 4QQ6A 5GAOq 2C06A 4MDXA 2CKKA 2V8IA 4XQ3A 2QQBA 5CO7A 3CCJA 3JB9G 4MZTA 1LOJA 1FX7A 4M78E 4OVAA 4X9CA 3CCRA 2P0KA 4UC4A 3V7CA 4JRPA 4HA8A 1I4K1 3H6ZA 4A4HA 3CCVA 5J26A 4M77B 3OYMA 2WSCE 2E41A 4LDYA 3JCMb 2CGHA 3PGGA 4OF1A 3BDUA 4PJOC 1HK9A 4FT4A 2ZPFB 3CCMA 1G3SA 1NPPA 2BUDA 2E64A 4JRQA 3CMAT 3VKIA 4NL3A 2OTLT 4BI4A 1FWZA 3OMCA 3QIIA 4EMKC 3CXCA 4LD9K 1UGRB 5GAMf 4IUPA 3CCEA 2L89A 1M4ZA 1VQ9T 2M1HA 2MWPA 3NTKA 1H3ZA 2DTOA 2PUKB 3JRZA 4C92G 2RHXA 2QQRA 3JB9I 2XU8A 3CBPA 4BI8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E9F A;  4N4G A;  2LDM A;  3GOX A;  2XDP A;  3E9G A;  3OB9 A;  2MWO A;  3OS0 A;  3BDL A;  3ZEH A;  4QW2 A;  4C5G A;  3LGF A;  3OYC A;  5KE2 A;  3L42 A;  2RI3 A;  3MEU A;  3O8V A;  2RJC A;  3F70 A;  3KUF A;  5FRN A;  5CIU A;  3OYK A;  3OYB A;  2BIV A;  2GFA A;  4EDU A;  5KH6 A;  3OYA A;  4GY5 A;  3MP6 A;  3MP8 A;  2M0O A;  3QJ6 A;  2O4X B;  3FLG A;  3ME9 A;  2L3R A;  3S3M A;  4IUU A;  3NTI A;  5C0M A;  3C4S A;  2WAC A;  4E7I A;  2HQE A;  4BAC A;  3L2W A;  3OQ5 A;  3FEO A;  5C6S A;  3MEV A;  2K3X A;  2DIQ A;  4E7K A;  2R5A A;  2EQK A;  3FDR A;  2RHI A;  2XK0 A;  4E7L A;  2LRQ A;  1WJS A;  4PLL A;  2RO0 A;  3PNW C;  2RJF A;  3DB4 A;  5FRO A;  1G5V A;  2EQJ A;  2EQM A;  4X34 A;  2DIG A;  3DB3 A;  3DLM A;  4IUR A;  4IUT A;  2QQS A;  3OYF A;  3L2U A;  2O4X A;  2D9T A;  3UT1 A;  1WJQ A;  1OI1 A;  2R58 A;  4IUQ A;  3P8H A;  2G3R A;  2JTF A;  2X4W A;  4FU6 A;  5D6Y A;  2JZ2 A;  4HCZ A;  1OZ3 A;  5J39 A;  2X35 A;  4B9W A;  4BE2 A;  2HQX A;  3OYG A;  1WGS A;  5KCH A;  2YRV A;  4ZTF A;  3P8D A;  4IKF A;  5KE3 A;  2EKO A;  2DAQ A;  2E6N A;  2EQU A;  4RG2 A;  3MEW A;  2GFU A;  3QKJ A;  4E7H A;  2RHZ A;  3L2V A;  4PLI A;  3PMI A;  2RJE A;  4BE0 A;  2M16 A;  2RI5 A;  1OYX A;  1MHN A;  3H8Z A;  3EAE A;  4BDY A;  5IN1 A;  2IG0 A;  3LLR A;  3PFS A;  4L59 A;  3MO8 A;  4NS5 A;  5M9O A;  3LYI A;  3OA6 A;  3M9Q A;  2VYT A;  4E7J A;  2RHU A;  5D6X A;  4BDZ A;  2NLU A;  5IAY A;  4N4I A;  4ZTJ A;  4A4E A;  4A4F A;  3OY9 A;  2GF7 A;  2X4X A;  3PMT A;  3S6W A;  4LD6 A;  4Z02 A;  3LX7 A;  1N27 A;  3NTH A;  3Q1J A;  4QQ6 A;  2CKK A;  1SSF A;  3OS2 A;  5FRM A;  4Q5W A;  3OYN A;  3OS1 A;  3OYD A;  2B8A A;  4QVZ A;  3UWN A;  3OYL A;  2L8D A;  4OVA A;  3QBY A;  2LTO A;  4PL6 A;  2P0K A;  4UC4 A;  4BD3 A;  4QQD A;  3CEY A;  3ASK A;  4C5E A;  3MP1 A;  2E5Q A;  3L2R A;  1RI0 A;  4B9X A;  3OYE A;  3H6Z A;  4A4H A;  4N4H A;  3OYI A;  5J26 A;  3OYM A;  4QQG A;  2RJD A;  2FHD A;  4BE1 A;  2F5K A;  4C5I A;  4A4G A;  2PQW A;  2BUD A;  3SD4 A;  2RHY A;  3L2Q A;  1OZ2 A;  1WJR A;  3S3N A;  2LCC A;  3OMC A;  3QII A;  2K3Y A;  4FL6 A;  3OYJ A;  4CRI A;  4IUP A;  3LGL A;  2L89 A;  2LVM A;  4C5H A;  2RI2 A;  3MEA A;  3MET A;  3OYH A;  2R5M A;  2M1H A;  2X4Y A;  2MWP A;  3NTK A;  1H3Z A;  2BKD N;  3OMG A;  1KHC A;  3S3O A;  5KCO A;  3LH0 A;  4IUV A;  1XNI A;  2EFI A;  5D6W A;  2RHX A;  3FC3 A;  2QQR A;  4II1 A;  2R57 A; 
#chains in the Genus database with same CATH topology
 2QYZ A;  5GAM j;  1QCF A;  2VGM A;  3BDL A;  4A4K A;  5KYY B;  2VUB A;  4J83 A;  5CIU A;  4E7S A;  1FYN A;  5HK0 A;  3QDR B;  1VQ9 A;  4IUU A;  1YJN T;  3G7Z A;  3JCM c;  4PK4 A;  1E7O A;  1ZQ1 A;  5FWC A;  2H3J A;  2MCN A;  2A0F B;  1S72 A;  2PVD B;  4J6X A;  5FRO A;  1KFZ A;  3OBY A;  2QAS A;  4ANJ A;  3L2U A;  2QA4 A;  3P8H A;  1BB9 A;  4F16 A;  4AFS C;  2QDL A;  1YJ9 T;  4BE2 A;  1A0N B;  2BE9 B;  1MGQ A;  2L0A A;  1K76 A;  2DL7 A;  3PVL A;  1N8R C;  3CD6 Q;  1Y07 A;  3PE0 A;  1D1B A;  4Y91 A;  1ZBJ A;  3LLR A;  1OU8 A;  4FYV B;  3M9Q A;  2RHU A;  1ZLM A;  4N4I A;  1NBE B;  2ZAE A;  3LX7 A;  2O31 A;  1LNX A;  1YJ9 A;  4J6W A;  1BKB A;  3GNG A;  3CPW S;  3QYH B;  4CC4 B;  1AVZ C;  2CUD A;  3VYH B;  2EGC A;  2RF0 A;  4C5I A;  2MYS A;  4EMK A;  5CKB A;  2P0Q A;  4E6R A;  4X9D A;  2DRM A;  2CP7 A;  3M0P A;  4DQ2 A;  3OYJ A;  1YIJ A;  5GAN j;  3M54 A;  3R6N A;  5AT1 B;  3T9N A;  1IZ6 A;  3EG9 A;  3VYG A;  4BI8 B;  3FC3 A;  1RAC B;  4II1 A;  4IIM A;  3CCL T;  1M8M A;  5LJ3 h;  2VXF A;  1EFN A;  1IGQ A;  2JJ9 A;  1Z9Z A;  2K4Y A;  3KUF A;  3F70 A;  2NUT A;  2WSE E;  3JB9 J;  2GQV A;  3MP8 A;  2A3L A;  2WSF E;  3C4S A;  3QHS A;  1VQP A;  4FIB A;  4RTT A;  1OPL A;  2A36 A;  4C8Q B;  2AKL A;  1PD0 A;  5KYN A;  3E19 A;  1M8V A;  2LQ8 A;  2YRD A;  4R0K A;  3N5B B;  5CQY A;  1UEC A;  1VYT A;  1K9M R;  1Q86 C;  1WA7 A;  3DLM A;  1VQ6 T;  4M75 E;  3GLX A;  1VQM A;  4C0D B;  3THK A;  4KRT A;  4LDX A;  3OS5 A;  2JOY A;  4KH0 B;  1RI9 A;  2CZ6 B;  2EQU A;  5GMK m;  4EIK A;  4HCB A;  3RR6 A;  1SHF A;  1OYX A;  5LJ5 e;  4XTY A;  2DPP B;  2M0Y A;  3VUZ A;  3VS5 A;  1VYV A;  4ZTJ A;  4GBQ A;  3G4S T;  4C8Q G;  4M78 F;  1WHH A;  2LT1 A;  1FXX A;  2CZ7 B;  2YLC A;  2MK5 A;  2DE0 X;  3INZ A;  2DIL A;  2CT3 A;  2DKG A;  3HSB A;  1G2B A;  3L2R A;  8ATC B;  3GNF B;  1ABQ A;  4M7D A;  3A8O B;  3G71 A;  2JM8 A;  1W2B P;  3TRE A;  1WJR A;  3I55 A;  1H92 A;  2QEX Q;  1SSH A;  4CRI A;  3LGL A;  1QWF A;  3EGD A;  5GAM h;  2CDT A;  4ESR A;  1LVK A;  3M55 A;  4ATO A;  3VS7 A;  3V8L A;  2JN0 A;  4C92 F;  1B07 A;  5GAO l;  1CKB A;  2ZCF B;  4EPC A;  1GCP A;  1M5Q 1;  2YWW A;  3EFO A;  3CBO A;  1NE8 A;  2K2M A;  1IHV A;  2RK2 A;  3OYK A;  1YIT T;  5CQX A;  1Q81 R;  3OYA A;  4GY5 A;  5FU7 B;  1UB4 A;  3FLG A;  4D8K A;  3UPU A;  3G6E Q;  4JJB A;  2HZY A;  5C6S A;  1V1C A;  2EQK A;  1PC0 A;  2X51 A;  5CR2 A;  2MPX C;  1YBY A;  2E3H A;  2P0P A;  2LQK A;  1AT1 B;  3DB3 A;  4IUR A;  3SWN C;  3NHN A;  1PWT A;  1QVF P;  1OI1 A;  3H0F A;  1M3A A;  3ZL7 C;  1K8A C;  3JCM W;  2F2X A;  4E2F B;  3EGX B;  1VQ8 A;  3QZ5 B;  4KBM B;  1KQS P;  2FZG B;  3JCM V;  1E6G A;  1D3B A;  4OGC A;  2GFU A;  1N9R A;  2KRO A;  1MHN A;  1Q82 U;  3KFV A;  3OYY A;  2JS2 A;  4NS5 A;  3CME Q;  1M90 C;  2L3P A;  4PFO A;  1PHT A;  1FMK A;  1SG5 A;  3RNJ A;  4ZGE B;  4PJO B;  3FB9 A;  2GF7 A;  4M78 D;  2QK0 A;  2PTK A;  2BZX A;  5DLO A;  1VQO T;  4PFZ A;  3EG3 A;  5GAO n;  3CCU T;  5FRM A;  4O5V A;  2XI9 A;  3X24 B;  2D6F A;  4QVZ A;  5IHK A;  5ECA A;  1AWJ A;  2DEU A;  3CEY A;  2VV5 A;  2E5Q A;  1NLP C;  3HRT A;  5GAN h;  2F5K A;  8AT1 B;  2DXB A;  3CXC P;  1VQ7 T;  2PQW A;  1WNL A;  3CMA A;  3JV3 A;  2BZ8 A;  2DK3 A;  4X1V A;  3S3N A;  1EIF A;  2JTM A;  3NMZ C;  2EQI A;  3JCM J;  4FYX B;  3MET A;  3QPH A;  3VS1 A;  1OEB A;  2GNC A;  4M7A G;  2A08 A;  2FYK A;  3OSS C;  1KQ2 A;  3M0S A;  1G83 A;  2VWF A;  2B86 A;  4C92 D;  4PJO G;  1RAI B;  1M27 C;  2SRC A;  4C8Q E;  1QVG S;  2RA2 A;  1NJI C;  5HCK A;  4M7D D;  2IIM A;  1BBZ A;  1VQN Q;  1YHQ A;  2FPE A;  4XTX A;  4M78 C;  2RMO A;  1CSK A;  2VVK A;  1BIB A;  2M0O A;  2LNH B;  1ZUK A;  1YJW T;  3WVE B;  4TVR A;  4VUB A;  4KGV B;  1KG1 A;  1O9S A;  3GP8 A;  5I2M A;  2DD5 A;  1U06 A;  2KYM A;  5LJ5 d;  4LE9 A;  3VS0 A;  3CC2 A;  2J05 A;  1BI3 A;  1VIF A;  3UA6 A;  4J9E A;  1Q7Y R;  2FO0 A;  4F7U F;  1PD1 A;  3UT1 A;  1BI1 A;  4L5G A;  4RUG A;  2JTF A;  4WF2 A;  5FW9 A;  2KEA A;  2GGR A;  4M7A A;  5CKH A;  3EG2 A;  3P8D A;  2YHT A;  1UTI A;  2QGG A;  1WPY A;  4LDW A;  3M56 A;  2RPN A;  4C92 C;  4M77 F;  1VQK A;  4AG2 C;  3U23 A;  1VUB A;  2D0N A;  2IG0 A;  4MZM A;  4L59 A;  3CPF A;  3OA6 A;  4M7D C;  5D6X A;  2C0I A;  4A4E A;  2F5T X;  4RTX A;  1VQ4 Q;  2YRC A;  4MDX A;  2C06 A;  3UA7 A;  2QQB A;  1QLY A;  3EGU A;  5CO7 A;  3CCJ A;  1VQ5 Q;  4OVA A;  3CCR A;  3V7C A;  3VS2 A;  1K9A A;  3H6Z A;  2E41 A;  5KYX A;  4OF1 A;  3JCM b;  3BDU A;  2J6F A;  2ZPF B;  4FT4 A;  1K0S A;  1NPP A;  4JRQ A;  2KT8 A;  4NL3 A;  2OTL T;  2JT4 A;  1FWZ A;  1M4Z A;  2ABL A;  2O88 A;  2PUK B;  3JRZ A;  2RHX A;  2YLB A;  3CCS A;  2AKK A;  1W4S A;  1MV0 B;  5I11 A;  3MEU A;  2BE7 D;  4JZ4 A;  4OMQ A;  4RCB A;  3MKD A;  1HJD A;  1B3Q A;  1VQ9 Q;  2ESW A;  2K3B A;  3VRY A;  1W70 A;  2QG9 B;  3CC4 A;  1T0H A;  4ELY C;  3A5Z B;  1YN8 A;  2R5A A;  1TG0 A;  1NM7 A;  1I8F A;  1R8O B;  2CP0 A;  2Z0W A;  5CAI A;  3I5S A;  4J9C A;  9ATC B;  1IB8 A;  5KYW A;  3H9N A;  1ZA2 B;  1WJQ A;  3EFS A;  1BCM A;  2CSI A;  3QO3 A;  2CP2 A;  4PJO E;  1RAF B;  2X35 A;  3H0H A;  1N8R R;  2HQX A;  2DXC A;  1YJN Q;  1VQL A;  1G8X A;  4XTU A;  2E6N A;  3MEW A;  4M77 D;  1RAH B;  1B34 B;  1AWO A;  2CT4 A;  2EYW A;  2YDL A;  2ENM A;  5GAO p;  1TOV A;  1E6H A;  2NLU A;  4A4F A;  4MZP A;  3PMT A;  1M30 A;  2L5Q A;  1YJ9 Q;  1Q7Y C;  2JM9 A;  4Q5W A;  4XK8 E;  2B8A A;  1SRM A;  4J8O A;  5LJ5 h;  2HL3 A;  2Y90 A;  3CPW A;  1ZSZ C;  3CCV T;  4QQG A;  3PVQ A;  2DTH A;  1GFD A;  2ZPI B;  4A4G A;  3M57 A;  1YP5 A;  1R77 A;  4F04 B;  1W1F A;  1FMW A;  3REB B;  1PRM C;  5KYU B;  1M2V A;  3CCE T;  3MEA A;  1QCO A;  2X4Y A;  2DXT A;  2L3Q A;  3G1J A;  4XTW A;  2V8J A;  4IUV A;  1I0C A;  3A1P A;  1NYG A;  2EFI A;  2X3W D;  4HKE A;  4M77 C;  2LDM A;  1WHK A;  1ZX6 A;  4QW2 A;  3LGF A;  3BW1 A;  1KQ1 A;  2RJC A;  5FRN A;  2DVE A;  4LNP A;  3MJX A;  3SWN B;  3I56 A;  3LH5 A;  3JCM X;  2ATC B;  3EHR A;  3RKX A;  2CS7 A;  3L2W A;  3M4Y A;  4M75 G;  2DF6 A;  3CCL Q;  3FDR A;  2GTO A;  2LRQ A;  1QP2 A;  2RO0 A;  4IIO A;  1Q86 R;  1S72 T;  4DEY A;  3DLL A;  1PCX A;  1BK2 A;  3C94 A;  5GAN 2;  1X01 A;  2QA4 T;  2OAW A;  1UGV A;  2QTV A;  1GCQ A;  2PNI A;  2YUQ A;  4PKC C;  2DET A;  1D1C A;  3MCA B;  1WHJ A;  1K73 U;  4B6M A;  3MO8 A;  1VQ6 Q;  2KAF A;  4ORZ A;  1W2B S;  2VAS A;  4NOY A;  3TSZ A;  1XQH A;  3RDV A;  1IGU A;  1IRX A;  1TS9 A;  5GAM d;  3M5A A;  3VS6 A;  1RAG B;  4M75 A;  4O6J A;  3OSV A;  4QQD A;  1RI0 A;  2RQW A;  3OYI A;  5LL6 S;  4DEX A;  1GBR A;  2ED0 A;  2RQR A;  1M2O A;  3V7S A;  2DM1 A;  2RHY A;  4KH1 B;  1WHM A;  2LCC A;  3G4S Q;  3DKM A;  2HBW A;  2RQV A;  1YIJ T;  4M78 B;  1UJY A;  1KHC A;  1M1K U;  1Y71 A;  2O2O A;  5GAN 8;  1NPR A;  2F2W A;  2YUO A;  3V8J A;  1WQ7 A;  2OTJ A;  3E9F A;  1XTD A;  3M0R A;  5HY6 A;  2DYI A;  2NWM A;  5DLQ E;  2XDP A;  5GAN 7;  3I5R A;  2DL3 A;  3O8V A;  2CZ0 B;  4HT9 A;  1QVF S;  4JJN K;  2LQN A;  2LC4 A;  1W6X A;  2F69 A;  2O4X B;  1RAE B;  3UAT A;  1SKU B;  2M02 A;  1VQP T;  4Y92 A;  4A53 A;  2VXE A;  3X20 B;  1KD1 U;  4ZN1 A;  4OMO A;  2XDB A;  3JAM E;  5KYY A;  5IHN A;  2XID A;  1N5Z A;  4PFP A;  3A8L B;  2ZPB B;  4C92 B;  4PJN A;  2EJF A;  3FJP A;  2QQA A;  4CI0 C;  1AD5 A;  1YIT Q;  1IRE B;  2V8K A;  2OAU A;  1K8A R;  2HMA A;  4ME7 A;  1VQM T;  1YI2 A;  3CC7 A;  3PTA A;  1KC8 U;  1KIK A;  2X3X D;  3RKY A;  2M51 A;  4XU1 A;  3JCM f;  4AFU C;  2D1X A;  1HYO A;  2DBM A;  2KY9 A;  1U8R A;  2D8H A;  5DM7 R;  1H64 1;  1XJW B;  2HKQ B;  1M90 R;  4RG8 A;  4FT2 A;  3CXC S;  5GAN d;  4BDZ A;  3CCQ A;  1SHG A;  5L23 A;  2VC8 A;  4J9B A;  2DTI A;  1JXO A;  5D7U A;  2KVQ G;  1OPK A;  4PL6 A;  2D8J A;  1WLP B;  1LPL A;  3ASK A;  4OMM A;  1SPK A;  2E70 A;  3SD4 A;  3G71 T;  2IVW A;  1Q82 C;  1VQO Q;  3I55 T;  4JDS A;  5GMK j;  3CCU Q;  1AWX A;  3EFR A;  3CBM A;  4AFZ C;  1JB0 E;  1Y96 B;  4LDV A;  3HFO A;  2R57 A;  1X2K A;  3GOX A;  3QWY A;  1B7T A;  5LJ3 f;  1NJI R;  2KYB A;  1VQ7 Q;  2K2V A;  2ROT A;  4ZGD B;  2JXB A;  2Y4X A;  3C0C A;  2MIO A;  1SF9 A;  3OW2 A;  2I2L A;  2M9U A;  2DRK A;  4OMF B;  4BY6 C;  4DOV A;  2FRY A;  3VS4 A;  1OOT A;  2AT1 B;  2CYZ B;  3NGP A;  3NFC A;  3QWX X;  2O9S A;  4P5N A;  4WCI A;  2NUP B;  4DOW A;  1G5V A;  3SB2 A;  4M7D F;  2MAM A;  1BU1 A;  1C6V X;  2K7A A;  2X4W A;  3JB9 H;  5GMK i;  1YJW Q;  2K9G A;  4C8Q A;  1TSF A;  2XHC A;  1VQ8 T;  4E47 A;  4V2S A;  4LUD A;  4EMG A;  1UEB A;  2MF2 A;  1QWE A;  3HKS A;  2DX1 A;  5A0D A;  2XDD A;  1CKA A;  3PFS A;  1ZUU A;  1ZSZ B;  3CCM T;  2LJ1 A;  3A98 A;  4N0A A;  4DBF A;  2O01 E;  2PVO B;  2X4X A;  3JSC A;  2VGN A;  4F7U B;  1AZE A;  3JCM P;  4J7F A;  1UGQ B;  1AZG B;  4JJC A;  2V8I A;  2C0O A;  3JB9 G;  3CPW P;  1LOJ A;  1MV3 A;  4M78 E;  4X9C A;  1I4K 1;  5J26 A;  2COY A;  4M77 B;  2WSC E;  2VB6 A;  1HK9 A;  3CCM A;  2BUD A;  3CMA T;  1RAB B;  3QII A;  4EMK C;  2FZK B;  5GAM f;  1WXB A;  1H3Z A;  1PKS A;  1K0X A;  1V76 A;  3JB9 I;  2LJ3 A;  4KT0 E;  3JCM e;  5IXF A;  4F7U G;  4C0Z A;  5FU6 C;  1KSW A;  1JRI A;  1WX6 A;  2OTL Q;  2DO3 A;  4C92 E;  2RQU A;  3OYB A;  1YHQ T;  3NPF A;  4EDU A;  2W10 A;  1U3O A;  1M1F A;  1TXQ A;  5C0M A;  4OB1 B;  1P92 A;  2XD0 A;  3HP9 A;  2EYZ A;  3DB4 A;  2PVG B;  3CC2 T;  1RL2 A;  2EJ9 A;  2QQS A;  2D9T A;  3EH2 A;  1X6G A;  1XOV A;  2G3R A;  2RD1 A;  2EW3 A;  2FB7 A;  1GBQ A;  1OX8 A;  4JUV A;  1UJ0 A;  1S1N A;  4E7Z A;  2NYS A;  3V7R A;  2HNI A;  4ZTF A;  2DZC A;  4BUG A;  2F2V A;  1TUG B;  4FYW B;  3VJP A;  3RBB B;  1VQK T;  2GTJ A;  5IN1 A;  1JQQ A;  3LYI A;  4A63 B;  5IAY A;  3EGX A;  3JCM g;  2QEX A;  4LD6 A;  1IXD A;  3EG1 A;  3FIF A;  4C8Q D;  3OS2 A;  1WZO A;  1D0X A;  2A28 A;  3CCJ T;  4HCC A;  3QBY A;  4J6Y A;  3CCR T;  2K5L A;  4XU0 A;  2C0T A;  5GAN f;  5GMK h;  1JJ2 A;  3L1A A;  4ZN3 A;  4N4H A;  1OX9 A;  4PJO A;  4F17 A;  1UHC A;  3M0Q A;  1PG5 B;  1WXT A;  3D7S B;  2E65 A;  3L2Q A;  2YUP A;  3X28 B;  2E5K A;  1EX4 A;  2RI2 A;  3M58 A;  2R5M A;  3OBW A;  3C95 A;  3M0T A;  4LN2 A;  3G6E A;  4M7A F;  4N4G A;  3CCV Q;  3QJY A;  2DL4 A;  5GAO r;  2D0Q B;  1K9M U;  3CCS T;  1KJW A;  4C5G A;  4JPB W;  5KE2 A;  3L42 A;  2RI3 A;  1IHW A;  1H8K A;  3BE3 A;  5AYF A;  2GFA A;  3CCE Q;  3EHQ A;  1Q95 G;  2LX9 A;  4C8Q C;  3NTI A;  4KUD K;  1VA7 A;  4E7I A;  3TEE A;  5LJ3 g;  3CC4 T;  3FEO A;  2DFU A;  2F1L A;  3MEV A;  2DIQ A;  2L3S A;  2ZPG B;  1BI0 A;  2J06 A;  1AEY A;  4MML A;  1ABO A;  2RJF A;  1ZA1 B;  4DBH A;  3AHU A;  4C0D C;  2EQJ A;  4PJJ A;  3CME A;  1D09 B;  1IO6 A;  2OJ2 A;  2KR3 A;  1RAD B;  4F7U E;  3OYG A;  1TU0 B;  1VQL T;  5KE3 A;  2KMT A;  3J81 E;  1N9S A;  4MMK A;  3QKJ A;  1PM3 A;  2HD0 A;  5I2S A;  5GMK l;  4E7H A;  1S72 Q;  3RER A;  2J6K A;  1H3H A;  1UUE A;  2M16 A;  2RI5 A;  1G3Y A;  2CP3 A;  3VV0 A;  1WHL A;  3GIB A;  5M9O A;  1WDX A;  2EBP A;  2QA4 Q;  1KHI A;  2H8H A;  1X75 C;  1D1A A;  2QTX A;  2QXF A;  3HTR A;  2DZ9 A;  4C0G A;  1WYX A;  5FLX E;  2DL5 A;  2FG0 A;  4NL2 A;  4JRK A;  3PT9 A;  2FZC B;  1HXD A;  1I81 A;  2DBK A;  4ZGJ B;  4C5E A;  2DJZ A;  1PKT A;  2YSQ A;  2LZ6 B;  1QCN A;  1Q81 U;  2Y4Y A;  1VQN A;  4R56 A;  1K73 C;  3X26 B;  1DJ7 B;  2HSE B;  1AOJ A;  5LJ3 j;  3A8G B;  3OYH A;  2HEQ A;  2W0Z A;  2KBT A;  3TU4 K;  2ZPE B;  3UF4 A;  2FRW A;  4M7A D;  1C0M A;  1UHF A;  2GQI A;  5A2Q E;  2IPO B;  5GAO m;  1MUZ A;  3VRZ A;  1D0Z A;  3ZFJ A;  3OS0 A;  3MHX A;  3ZEH A;  4FW2 A;  5GAM g;  2OX7 A;  3OW2 P;  1QVP A;  3M53 A;  4JJD A;  5GAN 5;  1UGP B;  1X2Q A;  4RCC A;  1YIJ Q;  2CZ1 B;  2JNG A;  3QJ6 A;  3I56 T;  2EAY A;  1WHG A;  4XAX B;  2GCX A;  3A8M B;  1RAA B;  2QAZ A;  2QGF B;  5IXB A;  3TCJ A;  2O9V A;  2RHI A;  3VUB A;  4E7L A;  1WJS A;  5A0G A;  2KGT A;  1M1K C;  1X6B A;  1NG2 A;  1YCS B;  2R58 A;  4J7I A;  2JUF A;  4IUQ A;  3WXM B;  2DJQ A;  2JZ2 A;  1VQ4 A;  1OZ3 A;  2AK5 A;  1VQP Q;  1MND A;  2KI7 A;  1WGS A;  4K11 A;  2V1Q A;  3KBG A;  2CSQ A;  3C12 A;  2E12 A;  3QYG B;  1VQ5 A;  4LXC A;  4M7A C;  2DAQ A;  4BB7 A;  4MDW A;  4RG2 A;  1K1Z A;  1UDL A;  1K4U S;  2RNA A;  2XIC A;  3A8H B;  1RLQ C;  4BE0 A;  1KD1 C;  3RES A;  5L8R E;  1TWB A;  2LCL A;  4OMN A;  1YWO A;  1VQM Q;  1UGS B;  3OY9 A;  1X69 A;  3SDZ A;  1BIA A;  3NTH A;  4EMK B;  3LW5 E;  2OI3 A;  3OYD A;  3RUX A;  3UWN A;  5LJ5 f;  1KC8 C;  1G3W A;  1B34 A;  2LTO A;  1I5O B;  4BD3 A;  2PZ1 A;  5IH2 A;  1V29 B;  2DEQ A;  4Z8A A;  3EG9 B;  5IT9 E;  4XU3 A;  4HT8 A;  7AT1 B;  3QZ9 B;  1Q82 R;  2DL8 A;  5GMK e;  5FU6 B;  1OZ2 A;  2QQ9 A;  2I0N A;  2K3Y A;  2ZZD A;  2LVM A;  2NUT B;  3OMG A;  5GAN g;  1ARK A;  3TQ7 P;  1QKW A;  2EVR A;  2OTJ T;  1UE9 A;  2AZV A;  1WQW A;  4HVW A;  2BZY A;  1OV3 A;  2E6Z A;  3OB9 A;  5KYU A;  2DA9 A;  3G71 Q;  1Q7Y U;  2RH2 A;  3I55 Q;  4OB3 B;  1NEB A;  2BIV A;  3SEM A;  4JZ3 A;  2KT1 A;  3S3M A;  2DLP A;  2WAC A;  1GRI A;  4XTZ A;  1YJN A;  2DD4 A;  3JCM h;  1TUC A;  4J9G A;  1M3B A;  4A54 A;  2XK0 A;  4PLL A;  4M75 F;  5EC7 A;  3VU3 C;  3SWN A;  2JTE A;  2EQM A;  2DIG A;  4CC7 A;  2CP6 A;  3GBQ A;  1YI2 T;  2HDA A;  3CC7 T;  1AHJ B;  3QDF A;  3O5Z A;  4IKF A;  1KQS S;  2EKO A;  3MPU B;  2LP5 A;  2HBP A;  2KRM A;  1BI2 A;  1PSF A;  2E4H A;  4XTV A;  4CC2 A;  3L2V A;  1PNJ A;  2A7Y A;  2RJE A;  1ZSG A;  2COW A;  4BDY A;  1O75 A;  3I9Q A;  5I22 A;  4YTL A;  3RMQ A;  2VYT A;  4LUE A;  4M78 G;  3CCQ T;  3R6O A;  1NZ9 A;  3SFM A;  4M7D B;  5I21 A;  3LWI A;  1RUW A;  4Z02 A;  4QQ6 A;  4M4Z A;  1VQ8 Q;  2CKK A;  4KGX B;  1JJ2 P;  3EGD B;  4HA8 A;  2HSP A;  2FPD A;  2P84 A;  3CCM Q;  2ROL A;  1OUL A;  1G3S A;  2E64 A;  4Z88 A;  1JU5 C;  4BI4 A;  3OMC A;  2YUN A;  4LD9 K;  1UGR B;  2ECZ A;  4IUP A;  2L89 A;  3EFO B;  2MWP A;  2DTO A;  2CH4 W;  4C92 G;  1GXI E;  3CBP A;  4FSS A;  3CCL A;  3UDC A;  1NYF A;  2FL7 A;  1LJO A;  3E9G A;  4M7D G;  1JO8 A;  1Y0M A;  4OB0 B;  3REA B;  3OYC A;  3PIP A;  3V8K A;  3CMA Q;  4J9H A;  1PRL C;  4M78 A;  4D6W A;  2MMP A;  2XG8 D;  1MNE A;  1VOM A;  5CK9 A;  1N8R U;  4JLG A;  4CC3 A;  3ME9 A;  5FWB A;  3SHW A;  1OQK A;  1ZUY A;  3CD6 T;  1MMA A;  4M75 D;  2CRE A;  1VYU A;  1D3B B;  1ACM B;  2XMF A;  1AWW A;  2KSS A;  4IUT A;  4D8D A;  1QVG A;  1VQ6 A;  1YHQ Q;  1YFN A;  2O4X A;  4RTY A;  2MOX A;  2HKN A;  3PIO A;  2G6F X;  1WXU A;  4EMH A;  4QVC A;  5J39 A;  2YXY A;  4B9W A;  3ZBD A;  1GCQ C;  2X4J A;  3RIR A;  2LT4 A;  5KCH A;  4RMO A;  3H41 A;  1I1J A;  4C92 A;  2EYY A;  5CVI A;  3CD6 A;  2K57 A;  2HL5 C;  6AT1 B;  3PMI A;  2CUB A;  2RN8 A;  2EKH A;  3CC2 Q;  5CKD A;  4R55 A;  2AHJ B;  3X25 B;  3M0U A;  4XU2 A;  2GBQ A;  1M3C A;  3E2U A;  3G4S A;  4DBR A;  4RKU E;  1MMG A;  3Q1J A;  3L2Z A;  3OS1 A;  2E10 A;  2DNU A;  1I5L A;  5DY9 A;  1VIE A;  2V26 A;  4JS5 A;  1VQK Q;  4M75 C;  2FVU A;  4B9X A;  2KDS A;  4ZNX A;  2RJD A;  2CP5 A;  3QG1 A;  2E3I A;  1WIE A;  4LDU A;  1MMD A;  4JLI A;  2LCS A;  2K5F A;  2KRN A;  5LJ5 g;  2KK4 A;  4C5H A;  3CCJ Q;  4OMP A;  5KCO A;  4C8Q F;  1XNI A;  3CCR Q;  5D6W A;  3QUI A;  5EG2 A;  1T3L A;  1Q86 U;  2V1R A;  3J80 E;  1R0B G;  1JBM A;  2PU9 B;  3HPW A;  1YIT A;  3TSW A;  3QSU A;  1C1A A;  1ZHI A;  3KXT A;  5KH6 A;  3MP6 A;  1Y96 A;  4HCK A;  4PNO A;  2LQW A;  1HD3 A;  3CQT A;  3OQ5 A;  1G3T A;  2MI6 A;  2J6O A;  4PJM A;  4M7A B;  3EH1 A;  3CCS Q;  2EWN A;  3HRS A;  3BY7 A;  4FM4 B;  3OYF A;  4GLK A;  2HAX A;  1K9M C;  2AZS A;  4HXJ A;  4HCZ A;  4M7D E;  2FEI A;  4FYY B;  2YT6 A;  3CC4 Q;  2YRV A;  4M77 G;  5HK3 A;  2EIF A;  2DMO A;  3HRU A;  2NUP A;  5J3B A;  1U1S A;  1X43 A;  2EGE A;  1TTH B;  3HFN A;  1UFF A;  4OB2 B;  2K79 A;  4E7J A;  3VS3 A;  2ZPH B;  5LJ5 j;  4DA4 A;  2K5I A;  5KYX B;  1VQO A;  1T0J A;  5GJV B;  2COZ A;  2QEX T;  3CCU A;  1HSQ A;  1SSF A;  1VQL Q;  1UG1 A;  1X27 A;  3OYN A;  1SRL A;  3OYL A;  3JB9 F;  1U1T A;  1ZSZ A;  2FHD A;  1VQ7 A;  4F7U A;  4KUL A;  2JW4 A;  2XKO C;  4QT7 A;  4JS4 A;  3OW2 S;  1K73 R;  1RLP C;  1SEM A;  5LJ3 e;  4HVV A;  1X6O A;  2JS0 A;  4DBQ A;  4KGZ B;  3JCM Q;  3LH0 A;  4RTV A;  4M77 A;  3G6E T;  3HL8 A;  1GFC A;  1TH7 A;  4RTZ A;  3FRN A;  1K8A U;  3TVT A;  2K6D A;  4OGE A;  4Z89 A;  5KYW B;  2KRS A;  3AT1 B;  4BI3 A;  4J5Y A;  1YJW A;  3EG0 A;  1Q81 C;  2KXD A;  2A37 A;  3FJ5 A;  5CCA A;  2K3X A;  1M1K R;  4E7K A;  1M90 U;  3HHT B;  2CH4 A;  3PNW C;  2EYQ A;  5GAN 4;  4QVD A;  4GLM A;  1I07 A;  5IHI A;  4X34 A;  3J7A F;  4PJO F;  4KUI A;  3CME T;  1NLO C;  2LNV A;  1FMV A;  5D6Y A;  3I56 Q;  4C0F A;  1J3T A;  4AG1 C;  2JMC A;  2NUZ A;  3P8B B;  4FW1 A;  2L2P A;  2RM4 A;  2FPF A;  1QKX A;  1KD1 R;  2HQH A;  2RHZ A;  4PLI A;  4QKU A;  3H8Z A;  4L6V 5;  1EZZ B;  2P4T A;  2RB6 A;  3GF5 A;  1JXM A;  3ER0 A;  1PSE A;  4N0A C;  5HKC A;  2QDY B;  3S6W A;  1QW1 A;  5CKE A;  1KC8 R;  1M2V B;  2KNB B;  4OML A;  4ELZ C;  1WI7 A;  2L8D A;  5GAM e;  3JB9 D;  5GAN 3;  1NJI U;  3MP1 A;  4JRI A;  3OYE A;  4OP0 A;  4BE1 A;  2ED1 A;  3RKW A;  2KQW A;  3M59 A;  1N6A A;  2OTL A;  4M77 E;  1D0Y A;  4FL6 A;  4AT1 B;  1VQN T;  3ULR B;  2DYB A;  1W2B A;  1WFW A;  2VKN A;  2EYX A;  2BKD N;  2DXU A;  4J9D A;  3S3O A;  2LMJ A;  3M4G A;  2AIR B;  5GJW B;  1Y57 A;  2EGA A;  3JCM d;  5CKF A;  4J9I A;  4F14 A;  1YCY A;  2MWO A;  4M7A E;  4HVU A;  2RQT A;  1QMC A;  3RMS A;  3I35 A;  4J9F A;  2EPD A;  3QXE B;  1KK7 A;  2EJG A;  5GAN 6;  4PJL A;  2L3R A;  3E1S A;  1YWP A;  1U5S A;  2HQE A;  4BAC A;  2LJ0 A;  2J7I A;  1OU9 A;  2OTJ Q;  4BY6 B;  2JVV A;  4AFQ C;  1GL5 A;  2E1H A;  1QVG P;  4AMC A;  1ZBX A;  4PJO D;  4FSX A;  1Y7X A;  3H0I A;  1F1B B;  1QP3 A;  5FU7 C;  2ZGW A;  2KE9 A;  3IQL A;  1LCK A;  4FU6 A;  2JMA A;  3GPL A;  1M1G A;  1QVF A;  1VQ4 T;  3LWH A;  4Y28 E;  1BYM A;  2DVJ A;  1JJ2 S;  1T3S A;  2KXC A;  3BFM A;  1VQ5 T;  3WVD B;  2PUO B;  4WTO B;  5A0L A;  1KQS A;  3URG A;  3EAE A;  4M75 B;  5LJ3 d;  1Z9Q A;  5GAN e;  2RK1 A;  2QI2 A;  1YI2 Q;  3CC7 Q;  1NEG A;  1M9S A;  5GAO q;  1N27 A;  4XQ3 A;  2P4R A;  2BTT A;  1TUD A;  4MZT A;  1FX7 A;  2P0K A;  4UC4 A;  4JRP A;  2DER A;  4A4H A;  3CCV A;  4RTW A;  4RTU A;  3OYM A;  4LDY A;  2CGH A;  3PGG A;  1QQJ A;  2HCK A;  1MMN A;  4PJO C;  3CCQ Q;  4FCY A;  3VKI A;  2SEM A;  3CXC A;  2H3E B;  2LX7 A;  3CCE A;  2X9H A;  1VQ9 T;  2M1H A;  1YNZ A;  3NTK A;  1JEG A;  1R0C B;  2QQR A;  2XU8 A;  1BCO A; 
#chains in the Genus database with same CATH homology
 4KT0 E;  3CCL A;  3UDC A;  3JCM e;  5GAM j;  2YLB A;  2FL7 A;  1LJO A;  3E9G A;  2VGM A;  4F7U G;  3CCS A;  4M7D G;  4C0Z A;  4OB0 B;  3BDL A;  1W4S A;  5FU6 C;  3OYC A;  4A4K A;  3PIP A;  1JRI A;  3V8K A;  3MEU A;  2DO3 A;  2VUB A;  4J83 A;  4C92 E;  4RCB A;  5CIU A;  4M78 A;  4D6W A;  3OYB A;  2MMP A;  1YHQ T;  2XG8 D;  4EDU A;  5HK0 A;  3QDR B;  5CK9 A;  1N8R U;  1VQ9 A;  4JLG A;  1M1F A;  3ME9 A;  4IUU A;  5C0M A;  3CC4 A;  4OB1 B;  1YJN T;  4ELY C;  3A5Z B;  3G7Z A;  3JCM c;  1P92 A;  2XD0 A;  2R5A A;  1I8F A;  1ZQ1 A;  1R8O B;  3CD6 T;  4M75 D;  3HP9 A;  5CAI A;  2H3J A;  1S72 A;  2PVD B;  3DB4 A;  2PVG B;  1D3B B;  4J6X A;  5FRO A;  3CC2 T;  3OBY A;  2KSS A;  1RL2 A;  2EJ9 A;  4IUT A;  1VQ6 A;  1QVG A;  2QQS A;  3L2U A;  2O4X A;  2D9T A;  2QA4 A;  1WJQ A;  3EFS A;  1XOV A;  3P8H A;  2G3R A;  3QO3 A;  3PIO A;  2RD1 A;  2FB7 A;  4EMH A;  4QVC A;  5J39 A;  2X35 A;  4JUV A;  4B9W A;  3ZBD A;  4BE2 A;  1YJ9 T;  2X4J A;  2HQX A;  2DXC A;  3RIR A;  1VQL A;  1MGQ A;  2LT4 A;  2HNI A;  3V7R A;  5KCH A;  2DZC A;  4BUG A;  4RMO A;  4ZTF A;  4XTU A;  1N8R C;  4C92 A;  2E6N A;  3MEW A;  5CVI A;  4M77 D;  1Y07 A;  3CD6 A;  2K57 A;  3PMI A;  3VJP A;  1VQK T;  4Y91 A;  1B34 B;  5IN1 A;  5CKD A;  4R55 A;  2AHJ B;  3LLR A;  3X25 B;  3LYI A;  3M9Q A;  2RHU A;  5GAO p;  4XU2 A;  2NLU A;  5IAY A;  4N4I A;  4A4F A;  3JCM g;  4MZP A;  3G4S A;  3PMT A;  2QEX A;  2L5Q A;  4RKU E;  4LD6 A;  1Q7Y C;  3LX7 A;  3Q1J A;  1YJ9 A;  1LNX A;  3FIF A;  4C8Q D;  3OS2 A;  4PJO E;  3L2Z A;  4Q5W A;  4J6W A;  4XK8 E;  3OS1 A;  2B8A A;  3CCJ T;  1BKB A;  2E10 A;  3GNG A;  4HCC A;  4J8O A;  1I5L A;  3CPW S;  3QBY A;  4J6Y A;  5DY9 A;  5LJ5 h;  3CCR T;  1VIE A;  2K5L A;  4XU0 A;  3QYH B;  4JS5 A;  2Y90 A;  4M75 C;  2FVU A;  3L1A A;  4B9X A;  4ZN3 A;  2KDS A;  4N4H A;  5GMK h;  5GAN f;  3CPW A;  3VYH B;  3CCV T;  4QQG A;  2RJD A;  4PJO A;  2DTH A;  4C5I A;  2ZPI B;  4A4G A;  3M57 A;  3QG1 A;  2E65 A;  4EMK A;  5CKB A;  2P0Q A;  3L2Q A;  4X9D A;  4LDU A;  4JLI A;  4DQ2 A;  2K5F A;  3X28 B;  3OYJ A;  5LJ5 g;  1YIJ A;  5GAN j;  2KK4 A;  2RI2 A;  3M58 A;  3M54 A;  3MEA A;  2R5M A;  4C5H A;  3OBW A;  2X4Y A;  3CCE T;  3C95 A;  2DXT A;  3T9N A;  1IZ6 A;  5KCO A;  4XTW A;  4C8Q F;  2V8J A;  4IUV A;  1XNI A;  3VYG A;  2EFI A;  5D6W A;  3FC3 A;  3QUI A;  5EG2 A;  3G6E A;  4M7A F;  4II1 A;  4HKE A;  4M77 C;  1Q86 U;  4N4G A;  2LDM A;  3QJY A;  3CCL T;  5GAO r;  2D0Q B;  3J80 E;  1K9M U;  5LJ3 h;  3CCS T;  2VXF A;  4QW2 A;  4C5G A;  3LGF A;  5KE2 A;  3L42 A;  1JBM A;  2PU9 B;  2K4Y A;  2RI3 A;  3BW1 A;  1KQ1 A;  2RJC A;  3F70 A;  3HPW A;  3KUF A;  1YIT A;  2DVE A;  5AYF A;  5FRN A;  3QSU A;  2GFA A;  1ZHI A;  2WSE E;  3SWN B;  5KH6 A;  2GQV A;  3KXT A;  3JB9 J;  3MP6 A;  1Y96 A;  3MP8 A;  3I56 A;  2A3L A;  3JCM X;  2LX9 A;  4PNO A;  4C8Q C;  3NTI A;  4KUD K;  2WSF E;  3C4S A;  3QHS A;  4E7I A;  1VQP A;  4FIB A;  3RKX A;  2CS7 A;  3TEE A;  5LJ3 g;  3L2W A;  3OQ5 A;  3FEO A;  3M4Y A;  3CC4 T;  3MEV A;  4M75 G;  1G3T A;  2DIQ A;  2MI6 A;  4C8Q B;  3FDR A;  2ZPG B;  1BI0 A;  2LRQ A;  4M7A B;  3E19 A;  1QP2 A;  2LQ8 A;  2RO0 A;  4MML A;  1M8V A;  2EWN A;  2RJF A;  1S72 T;  3N5B B;  3HRS A;  5CQY A;  3DLL A;  3AHU A;  4C0D C;  3BY7 A;  2EQJ A;  1Q86 C;  4FM4 B;  3CME A;  3DLM A;  3OYF A;  3C94 A;  5GAN 2;  1VQ6 T;  4GLK A;  4M75 E;  2HAX A;  3GLX A;  1VQM A;  1X01 A;  4C0D B;  1K9M C;  2QA4 T;  4HCZ A;  4LDX A;  3OS5 A;  4F7U E;  2JOY A;  3OYG A;  4M7D E;  2YRV A;  1VQL T;  4M77 G;  5KE3 A;  5HK3 A;  2CZ6 B;  2KMT A;  3J81 E;  1N9S A;  2EIF A;  2EQU A;  4MMK A;  3HRU A;  4PKC C;  5GMK m;  5J3B A;  4HCB A;  3QKJ A;  3RER A;  2HD0 A;  5I2S A;  5GMK l;  4E7H A;  3MCA B;  2M16 A;  2RI5 A;  1OYX A;  1G3Y A;  1U1S A;  3VV0 A;  5LJ5 e;  3HFN A;  3GIB A;  1K73 U;  4XTY A;  5M9O A;  2DPP B;  3MO8 A;  4OB2 B;  4E7J A;  2KAF A;  3VUZ A;  1W2B S;  2ZPH B;  5LJ5 j;  4DA4 A;  2K5I A;  4NOY A;  4ZTJ A;  1KHI A;  1XQH A;  1VQO A;  1X75 C;  2QTX A;  3G4S T;  2QXF A;  4C8Q G;  2QEX T;  4M78 F;  2DZ9 A;  4C0G A;  3CCU A;  5FLX E;  2LT1 A;  1FXX A;  4NL2 A;  1SSF A;  4JRK A;  3PT9 A;  2CZ7 B;  3OYN A;  5GAM d;  1HXD A;  3OYL A;  3M5A A;  1I81 A;  2YLC A;  3INZ A;  2DKG A;  4M75 A;  4O6J A;  3HSB A;  3OSV A;  4QQD A;  4ZGJ B;  1U1T A;  4C5E A;  3JB9 F;  3L2R A;  2DJZ A;  1RI0 A;  3OYI A;  3GNF B;  5LL6 S;  2FHD A;  1VQ7 A;  4F7U A;  4KUL A;  4M7D A;  3A8O B;  2XKO C;  3G71 A;  4JS4 A;  3OW2 S;  3V7S A;  3TRE A;  2RHY A;  1Q81 U;  1WJR A;  2Y4Y A;  2LCC A;  5LJ3 e;  3I55 A;  1VQN A;  3DKM A;  4R56 A;  1K73 C;  3X26 B;  4CRI A;  1DJ7 B;  1X6O A;  3LGL A;  5LJ3 j;  3A8G B;  1YIJ T;  3OYH A;  5GAM h;  4M78 B;  3TU4 K;  2ZPE B;  3M55 A;  4ATO A;  1KHC A;  3JCM Q;  3LH0 A;  1M1K U;  1Y71 A;  5GAN 8;  4M7A D;  4M77 A;  1NPR A;  3V8J A;  1WQ7 A;  3HL8 A;  5A2Q E;  3G6E T;  2OTJ A;  3E9F A;  1XTD A;  3V8L A;  5GAO m;  2JN0 A;  4C92 F;  1TH7 A;  5HY6 A;  5DLQ E;  2XDP A;  5GAO l;  3ZFJ A;  5GAN 7;  3OS0 A;  2ZCF B;  4EPC A;  3MHX A;  3ZEH A;  1M5Q 1;  5GAM g;  3FRN A;  1QVP A;  1K8A U;  3M53 A;  3O8V A;  1JJ2 A;  3CBO A;  1NE8 A;  5GAN 5;  1UGP B;  2CZ0 B;  2RK2 A;  4OGE A;  3OYK A;  1YIT T;  1QVF S;  4RCC A;  5CQX A;  4JJN K;  4HT9 A;  3OYA A;  2CZ1 B;  4GY5 A;  5FU7 B;  4BI3 A;  4J5Y A;  2JNG A;  2LC4 A;  3QJ6 A;  2F69 A;  1UB4 A;  2O4X B;  2EAY A;  3FLG A;  3I56 T;  1YJW A;  1Q81 C;  4XAX B;  3UPU A;  1VQP T;  2GCX A;  2VXE A;  3A8M B;  3X20 B;  4A53 A;  5C6S A;  4ZN1 A;  2K3X A;  5CCA A;  1KD1 U;  2XDB A;  3TCJ A;  2EQK A;  4E7K A;  3JAM E;  1M90 U;  2RHI A;  3HHT B;  3VUB A;  4E7L A;  1WJS A;  5CR2 A;  2XID A;  1YBY A;  3PNW C;  5A0G A;  3A8L B;  2EYQ A;  5GAN 4;  1M1K C;  2ZPB B;  4C92 B;  2EJF A;  2P0P A;  3FJP A;  2LQK A;  2QQA A;  4QVD A;  4CI0 C;  4X34 A;  3DB3 A;  4PJO F;  1IRE B;  2V8K A;  4IUR A;  4KUI A;  3SWN C;  2OAU A;  3CME T;  1OI1 A;  4ME7 A;  2R58 A;  1VQM T;  4J7I A;  2LNV A;  2JUF A;  4IUQ A;  3WXM B;  3PTA A;  3CC7 A;  1YI2 A;  5D6Y A;  1KC8 U;  1K8A C;  4C0F A;  3JCM W;  2JZ2 A;  1VQ4 A;  1OZ3 A;  3P8B B;  3RKY A;  1VQ8 A;  3QZ5 B;  1WGS A;  4KBM B;  4XU1 A;  3JCM f;  3KBG A;  3C12 A;  2E12 A;  3QYG B;  3JCM V;  1VQ5 A;  2RM4 A;  4M7A C;  2DAQ A;  2KY9 A;  4MDW A;  4RG2 A;  1D3B A;  4BB7 A;  1U8R A;  4OGC A;  1KD1 C;  2GFU A;  1N9R A;  2RHZ A;  5DM7 R;  1H64 1;  2XIC A;  3A8H B;  4PLI A;  4BE0 A;  3H8Z A;  1MHN A;  4RG8 A;  5L8R E;  3OYY A;  4L6V 5;  2LCL A;  4FT2 A;  3RES A;  1Q82 U;  2P4T A;  3CXC S;  4NS5 A;  2RB6 A;  1M90 C;  3GF5 A;  5GAN d;  4BDZ A;  3CCQ A;  4ZGE B;  3ER0 A;  4PJO B;  1UGS B;  3FB9 A;  1PSE A;  4N0A C;  3OY9 A;  2GF7 A;  4M78 D;  2QDY B;  5HKC A;  5DLO A;  3S6W A;  1VQO T;  3SDZ A;  1BIA A;  3NTH A;  4EMK B;  1QW1 A;  3LW5 E;  5CKE A;  5GAO n;  3CCU T;  5FRM A;  2VC8 A;  4O5V A;  2XI9 A;  3X24 B;  2D6F A;  2DTI A;  4ELZ C;  4QVZ A;  3OYD A;  3RUX A;  3UWN A;  5LJ5 f;  2L8D A;  5GAM e;  2KVQ G;  1KC8 C;  1G3W A;  1B34 A;  3JB9 D;  5GAN 3;  2LTO A;  4PL6 A;  4BD3 A;  1NJI U;  3CEY A;  3ASK A;  1V29 B;  2DEQ A;  2E5Q A;  2VV5 A;  3MP1 A;  3HRT A;  4JRI A;  3OYE A;  2E70 A;  4OP0 A;  5GAN h;  5IT9 E;  1GXI E;  4BE1 A;  4XU3 A;  3RKW A;  2KQW A;  3M59 A;  2F5K A;  3QZ9 B;  4HT8 A;  2DXB A;  1VQ7 T;  2PQW A;  1WNL A;  5GMK e;  3SD4 A;  3G71 T;  3CMA A;  1N6A A;  2OTL A;  5FU6 B;  4M77 E;  1OZ2 A;  2DK3 A;  2IVW A;  2QQ9 A;  3S3N A;  1Q82 C;  1EIF A;  2JTM A;  4FL6 A;  3I55 T;  2K3Y A;  4JDS A;  5GMK j;  1VQN T;  3JCM J;  1W2B A;  2ZZD A;  2LVM A;  3MET A;  3QPH A;  2BKD N;  2DXU A;  3EFR A;  3OMG A;  4M7A G;  5GAN g;  3S3O A;  3CBM A;  2FYK A;  1JB0 E;  3OSS C;  1KQ2 A;  1Y96 B;  4LDV A;  3M4G A;  3HFO A;  2R57 A;  4C92 D;  3JCM d;  5CKF A;  2OTJ T;  3GOX A;  4PJO G;  5LJ3 f;  4C8Q E;  1WQW A;  1QVG S;  1YCY A;  2E6Z A;  3OB9 A;  2MWO A;  2K2V A;  4M7A E;  2RA2 A;  4ZGD B;  1Q7Y U;  1NJI C;  4M7D D;  2Y4X A;  2RH2 A;  4OB3 B;  3RMS A;  1YHQ A;  4XTX A;  2BIV A;  3OW2 A;  3QXE B;  2I2L A;  4M78 C;  1BIB A;  2EJG A;  2M0O A;  2M9U A;  5GAN 6;  2L3R A;  3S3M A;  1YJW T;  4OMF B;  3E1S A;  4BY6 C;  2WAC A;  4DOV A;  4XTZ A;  2HQE A;  3WVE B;  4BAC A;  2DD4 A;  3JCM h;  4TVR A;  4VUB A;  1YJN A;  1KG1 A;  1O9S A;  4BY6 B;  2JVV A;  3GP8 A;  2CYZ B;  4A54 A;  2XK0 A;  2DD5 A;  5I2M A;  2E1H A;  3NFC A;  5LJ5 d;  4PLL A;  4M75 F;  1ZBX A;  3VU3 C;  3CC2 A;  4P5N A;  1G5V A;  1BI3 A;  3SWN A;  1VIF A;  4DOW A;  4PJO D;  4FSX A;  1Y7X A;  2EQM A;  2DIG A;  1QP3 A;  5FU7 C;  3SB2 A;  3UT1 A;  4F7U F;  1BI1 A;  2MAM A;  2ZGW A;  4L5G A;  4M7D F;  1YI2 T;  2JTF A;  2X4W A;  4FU6 A;  3CC7 T;  3JB9 H;  5GMK i;  3GPL A;  1AHJ B;  1M1G A;  4WF2 A;  1QVF A;  4C8Q A;  1VQ4 T;  3LWH A;  4Y28 E;  2XHC A;  1BYM A;  1VQ8 T;  4E47 A;  4M7A A;  4IKF A;  5CKH A;  4V2S A;  3P8D A;  1JJ2 S;  1KQS S;  2YHT A;  4EMG A;  2EKO A;  3BFM A;  1VQ5 T;  1UEB A;  1WPY A;  2HBP A;  2MF2 A;  2PUO B;  1BI2 A;  4LDW A;  3M56 A;  1PSF A;  3HKS A;  3WVD B;  4C92 C;  4M77 F;  4XTV A;  5A0L A;  3L2V A;  1KQS A;  1VQK A;  2A7Y A;  2RJE A;  3URG A;  1VUB A;  5A0D A;  3EAE A;  2XDD A;  1O75 A;  4BDY A;  2IG0 A;  4MZM A;  4M75 B;  3PFS A;  4L59 A;  4YTL A;  5LJ3 d;  3CPF A;  3RMQ A;  2VYT A;  3OA6 A;  5D6X A;  3CCM T;  4M7D C;  4N0A A;  3J7A F;  5GAN e;  2RK1 A;  4M78 G;  2QI2 A;  3CCQ T;  3R6O A;  1NZ9 A;  2O01 E;  4A4E A;  2F5T X;  2PVO B;  2X4X A;  3JSC A;  2VGN A;  3SFM A;  4F7U B;  4M7D B;  5I21 A;  3LWI A;  4Z02 A;  3JCM P;  4J7F A;  1M9S A;  1UGQ B;  1N27 A;  4QQ6 A;  5GAO q;  2C06 A;  4MDX A;  2CKK A;  2V8I A;  4XQ3 A;  2QQB A;  5CO7 A;  3CCJ A;  3JB9 G;  4MZT A;  1LOJ A;  1FX7 A;  4M78 E;  4OVA A;  4X9C A;  3CCR A;  2P0K A;  4UC4 A;  3V7C A;  4JRP A;  4HA8 A;  1I4K 1;  3H6Z A;  4A4H A;  3CCV A;  5J26 A;  4M77 B;  3OYM A;  2WSC E;  2E41 A;  4LDY A;  3JCM b;  2CGH A;  3PGG A;  4OF1 A;  3BDU A;  4PJO C;  1HK9 A;  4FT4 A;  2ZPF B;  3CCM A;  1G3S A;  1NPP A;  2BUD A;  2E64 A;  4JRQ A;  3CMA T;  3VKI A;  4NL3 A;  2OTL T;  4BI4 A;  1FWZ A;  3OMC A;  3QII A;  4EMK C;  3CXC A;  4LD9 K;  1UGR B;  5GAM f;  4IUP A;  3CCE A;  2L89 A;  1M4Z A;  1VQ9 T;  2M1H A;  2MWP A;  3NTK A;  1H3Z A;  2DTO A;  2PUK B;  3JRZ A;  4C92 G;  2RHX A;  2QQR A;  3JB9 I;  2XU8 A;  3CBP A;  4BI8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...