2P0KA

Crystal structure of scmh1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
HFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of SCMH1
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Polycomb protein SCMH1
total genus 52
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA01
4A4EA 2EQJA 2LRQA 2L8DA 3META 4QW2A 1OYXA 2QQSA 4C5HA 1OZ2A 4RG2A 3GOXA 4BDZA 2RJCA 2RHYA 5C6SA 4LD6A 2LVMA 3OYNA 4E7KA 3MP1A 3PMTA 3NTHA 5FRNA 3O8VA 3MEWA 3EAEA 5D6XA 3C4SA 3P8HA 4QQGA 3OYIA 4BDYA 4E7IA 3BDLA 3OYLA 2LDMA 3LYIA 3OMCA 4IKFA 2EQMA 3OYJA 4C5EA 3S3NA 3F70A 3PMIA 5FROA 2RHUA 4EDUA 2K3XA 4FL6A 4IUPA 5D6YA 5IN1A 4BE2A 3LLRA 4N4HA 2YRVA 3MEAA 2MWPA 3OYGA 3FEOA 3DB3A 2M16A 2RJFA 1KHCA 3MEVA 3ME9A 4CRIA 2K3YA 2HQXA 2RHXA 3ZEHA 1WJQA 4II1A 3LH0A 4BE1A 3OB9A 2B8AA 2MWOA 3S6WA 3FC3A 2RI5A 3CEYA 2R58A 2R5MA 4N4IA 2RHIA 4PL6A 4QVZA 4B9WA 5IAYA 5KE2A 3Q1JA 4GY5A 2JTFA 4X34A 3FLGA 5FRMA 3MP8A 3S3MA 4E7HA 4Z02A 1WGSA 4IUQA 3OYCA 3QKJA 1XNIA 2DIQA 2EFIA 2M1HA 2RHZA 2XK0A 5M9OA 4IUTA 2RI3A 2X35A 5C0MA 3OYBA 3LX7A 2CKKA 1G5VA 3MEUA 2O4XB 2PQWA 2X4XA 3OQ5A 3QBYA 5KCOA 2DIGA 2IG0A 2E6NA 3ASKA 3H6ZA 3DLMA 4N4GA 2HQEA 4PLLA 4UC4A 1OI1A 1MHNA 4IURA 4A4GA 1H3ZA 2R57A 3OYDA 2BKDN 3OYHA 1WJSA 2NLUA 4IUUA 4BE0A 3OMGA 4QQDA 4A4HA 2RJDA 1WJRA 3H8ZA 3LGLA 2E5QA 4FU6A 3PNWC 3OYFA 3OA6A 2LCCA 2GF7A 4HCZA 3QIIA 4IUVA 1RI0A 3KUFA 2RO0A 4C5IA 2EQUA 1OZ3A 5KCHA 3OYAA 2EKOA 4NS5A 2VYTA 3OY9A 4BACA 2L3RA 2G3RA 2JZ2A 3P8DA 3E9GA 2O4XA 4QQ6A 4ZTJA 3MO8A 3MP6A 3L2QA 3OS2A 2F5KA 4BD3A 1SSFA 2D9TA 2RJEA 2X4WA 3NTIA 1N27A 4OVAA 4C5GA 3UWNA 2GFAA 4E7LA 2WACA 2RI2A 4Q5WA 2BUDA 4A4FA 3L2VA 3M9QA 3S3OA 3PFSA 5J26A 2FHDA 3SD4A 3FDRA 3OS1A 2XDPA 4PLIA 4ZTFA 3L42A 2QQRA 3OYKA 3DB4A 5J39A 2L89A 4B9XA 3UT1A 3E9FA 4L59A 3L2UA 3OYEA 2LTOA 2BIVA 2P0KA 2GFUA 3NTKA 5KE3A 5KH6A 3L2RA 3OS0A 2X4YA 2M0OA 3OYMA 5D6WA 3L2WA 3LGFA 2DAQA 2R5AA 5CIUA 3QJ6A 2EQKA 4E7JA
chains in the Genus database with same CATH superfamily
4M78B 1OZ2A 2EJGA 3JCMh 2RHYA 1BI1A 2LJ1A 1RACB 1TH7A 2CSQA 2KNBB 1KJWA 3M0TA 1JQQA 3I5RA 2E10A 1JO8A 4EDUA 2RK2A 3CD6Q 4J9HA 5D6YA 5IN1A 3GBQA 3A98A 5GMKh 2JS2A 2OTLT 1U1TA 5A0DA 3CCVT 3DB3A 1FWZA 2DKGA 1KHCA 1KSWA 2C0TA 5GAN6 2HQXA 5IHNA 1S72Q 1VQ6Q 2QQBA 3X26B 2RI5A 2RHIA 2K79A 2QA4A 4F14A 1X6OA 1D0XA 1WHMA 4C0DB 1FMKA 2L2PA 3EFRA 4BI8B 2I0NA 4LDYA 1B7TA 3RKXA 1ZSZA 3VKIA 5HKCA 5KYNA 1YNZA 2VXEA 4PJOB 3TEEA 4C92F 2D8HA 3AHUA 3BFMA 2HBPA 1RAIB 3PNWC 4RTWA 3UA6A 3KUFA 4JJBA 4FYYB 2LNHB 1NLPC 3OW2A 1QKWA 4M75E 2E4HA 3RR6A 3QG1A 2QQAA 5FU7B 4M7DA 2GFAA 4E7LA 3M0SA 1AOJA 2KRSA 3QDRB 3FDRA 3L2ZA 5LJ3f 2XDPA 1R0CB 5LJ3g 1X6GA 2VKNA 3EFOB 2QTXA 3X28B 3I55Q 1ZUYA 3CC2Q 1YITQ 2WSCE 2DL5A 4M75C 1VQOT 1RAHB 1D1CA 5C6SA 5HCKA 3GLXA 5GANh 3TSZA 1PKSA 4ANJA 1UGPB 1N8RR 2AZSA 1EIFA 1W6XA 2KVQG 3OYJA 1Q86U 4OMPA 5GAOm 1UHCA 5FROA 2XICA 4BE2A 1X27A 2ECZA 4JZ4A 4N4HA 2QI2A 2BZXA 4LXCA 4KT0E 4M7DE 1UTIA 3LH0A 4OGCA 2XG8D 4YTLA 5KYWA 3Q1JA 4DOWA 1M2VA 3NFCA 1BI2A 2V8IA 1VQKT 5CAIA 1PSEA 2DXBA 2YSQA 4JRKA 4C8QE 2GQVA 3X25B 5IT9E 2QGGA 1I8FA 1ZSZC 4A4KA 1YJ9T 5FU6C 2CDTA 2DIGA 2E6NA 4X1VA 1MV3A 1BI3A 3HKSA 1KD1C 4J6WA 4LD9K 5I22A 2QEXQ 2KT1A 1N8RC 2L5QA 2JXBA 3PTAA 2MK5A 3M0QA 5KCHA 4D8DA 2E5KA 2NUPB 5I21A 2C0IA 3P8DA 4RKUE 1SRLA 4M7AC 2D6FA 1GBQA 1N27A 1WZOA 2EYQA 4M78G 2RI2A 4RTZA 1KQSS 2FHDA 1SSHA 4C92G 1R0BG 5IHIA 2ZPIB 1QKXA 4ZN3A 2D1XA 1FXXA 2DE0X 2FEIA 4B9XA 5CR2A 3L2UA 2CP5A 2E12A 3M0PA 4V2SA 2CZ7B 3OYMA 2DVJA 4MZTA 2KAFA 3NMZC 5GANj 1TUCA 4M77C 2LT1A 2YUNA 2V1QA 3CCJT 3EAEA 5D6XA 2EWNA 4K11A 3V7RA 5GAMg 3OYLA 5GAN2 1TUGB 3JCMV 2DEUA 3H0IA 4J9CA 5LJ3d 2PTKA 4PJLA 2DXCA 2ED0A 2OJ2A 4EMKA 5ECAA 2J6KA 2A7YA 4FW2A 1FYNA 1K9AA 3HL8A 4X34A 3I56Q 1WQWA 2KMTA 2JVVA 2F5TX 1YIJQ 2X3WD 5HK0A 3CPFA 3CBOA 5A2QE 3OYBA 3VJPA 2OTLA 1I4K1 1PHTA 4EMGA 1SHFA 3C94A 4PLLA 4GBQA 5LJ5e 4R56A 2R57A 3QUIA 4BI4A 3BDUA 1OX8A 2B86A 2E5QA 2KXDA 4HT9A 5A0GA 2JTMA 1T3LA 3FB9A 1M4ZA 2P4RA 3OY9A 3CCLQ 1GCPA 3JCMg 1O75A 3L2QA 1WHKA 3HTRA 1Y71A 2BUDA 3QO3A 4XU1A 2YWWA 3JCMQ 1QQJA 2GGRA 4RTXA 5GAN4 3NTKA 2CP7A 4JPBW 5CIUA 1BB9A 3TCJA 1IREB 4RG2A 1QVGS 3RMSA 2CS7A 4EMKC 3CCJA 3EHRA 1YHQT 1Q82U 1U8RA 1Q82C 4AG2C 4F7UE 3CD6T 2DZCA 3LYIA 1NLOC 1K76A 1KD1U 2DYBA 1VQ7Q 3PMIA 2C06A 1VIEA 2K5FA 2RHUA 3C95A 1ZSGA 4C8QG 1SPKA 4KRTA 3JB9J 3CQTA 3EH1A 2RJFA 1YITA 1UUEA 4CRIA 3PT9A 5GAN7 3REBB 2B8AA 3QWXX 4PFPA 3VUZA 3OBYA 4PL6A 3VS4A 4C0DC 4OB1B 3M4GA 2FZCB 1X69A 4E7HA 1PCXA 2JT4A 3EFSA 5DLQE 3MKDA 2K7AA 1IXDA 3CC4A 2M1HA 1OQKA 1M1KR 2FRWA 2K6DA 4ZN1A 1U3OA 1G3YA 5GMKm 1G83A 3PIOA 1CKAA 3OQ5A 4KUIA 3OW2S 3QBYA 3CCUT 2W10A 4FM4B 1WNLA 5KYWB 2EBPA 2J06A 1YWPA 4JUVA 3OYHA 3JV3A 1F1BB 3OMGA 1VQMA 2P0QA 5GAOr 2RQVA 3JCMf 5GAMf 4FCYA 3FJPA 2DYIA 3J80E 4MMKA 4BACA 4DQ2A 1WHHA 2KDSA 3E9GA 3I56A 1WA7A 4FSSA 4C5GA 1JXMA 2DL4A 1AZEA 2MAMA 2WACA 3VS1A 2OTJA 2EGCA 3L2VA 3PFSA 4M78C 5CVIA 4NL2A 1Q81R 3JCMJ 4FW1A 1AHJB 2BZYA 4AFUC 2DXUA 4M75A 1M3AA 4E2FB 1LJOA 1AZGB 5J39A 1YITT 1ARKA 2L3QA 1BK2A 2XIDA 5GAOp 2EJFA 2FZGB 2RF0A 2VGMA 3CD6A 2KXCA 3EG3A 3FJ5A 2V8KA 1IGUA 3CMAA 2J7IA 3SB2A 2V8JA 2QG9B 3CC4Q 1QCOA 2KT8A 3JB9D 3KXTA 3UF4A 2FVUA 1WYXA 3M55A 1KIKA 4ORZA 1VIFA 3UDCA 4N0AC 4HVVA 2ZPBB 3OSSC 1M1GA 2KBTA 2RQWA 3CCVQ 2L0AA 2DMOA 1Z9ZA 3S6WA 3FC3A 2NWMA 2GCXA 1RAFB 4M7AB 2QDLA 1VQ7T 1VQLT 2JTEA 4IUQA 2JNGA 1XNIA 2RQTA 2QDYB 4PJOF 1WI7A 4IUTA 4JS4A 5DM7R 4Z8AA 3LX7A 1NYFA 2E3IA 3GP8A 3QZ9B 1W70A 2YLBA 4N4GA 2HQEA 1IHWA 1TU0B 1HK9A 1JU5C 4AFQC 1H3ZA 3OYDA 3EG9A 1EX4A 2DK3A 2JM9A 2RJDA 4M77B 4FU6A 3G4SA 3PIPA 2RA2A 1RLQC 2DL8A 2RO0A 2FPDA 8ATCB 4HVWA 4M77G 2X4JA 1TXQA 5CKFA 2J05A 4M7DC 4PKCC 1UGRB 3I35A 4XK8E 2DL7A 4XTVA 1QCNA 3SFMA 2KROA 4F7UA 4ZTFA 1RAGB 3EFOA 1YJNQ 2COZA 2X3XD 2HQHA 5CKBA 2AHJB 1E7OA 1BYMA 1YI2A 1Q81C 1VQLA 1BCOA 1Q82R 1X75C 1NM7A 2K4YA 1GFCA 4E7IA 3CBPA 1NPPA 3OMCA 2I2LA 4KGZB 1UJYA 1VQ5A 5I11A 1YJNA 1M3BA 4HCCA 4N0AA 2JS0A 4A53A 1CKBA 2LCLA 2YRVA 3JCMP 4C8QC 3A8OB 3QYHB 4PNOA 4ESRA 4DBHA 2GTJA 2DO3A 3DKMA 1TOVA 2HMAA 5LJ5g 4F7UG 1QVFP 3QZ5B 2YLCA 1WIEA 4J7IA 2F2VA 4XTXA 2KE9A 1M90U 2K5LA 3G6EQ 3CCRQ 5GMKj 1K0SA 2O2OA 1K4US 2IIMA 2OI3A 3JCMW 3REAB 2CYZB 4RCBA 3VU3C 4MDXA 2CT3A 3R6OA 3H41A 3JRZA 1Q7YR 2QA4T 2MF2A 2DL3A 1VQOA 1LCKA 1W2BA 3RESA 1WPYA 2E41A 1I07A 3CCMA 3H0FA 1QVGA 2VVKA 5KYUA 1M1KU 1I1JA 4M7DD 3QWYA 3OS2A 2M51A 3NTIA 3JCMc 3WVDB 2HZYA 4FT4A 1JJ2S 2ESWA 1MNEA 5J26A 5GANg 4ZNXA 4Z89A 1VQMT 2CP0A 3M57A 4C8QB 4M7AF 2QQRA 2H8HA 2OX7A 3DB4A 3D7SB 5EG2A 1N9SA 2EKHA 1NPRA 1RLPC 1VQ4Q 2RNAA 2FPEA 3LWHA 2H3JA 2DAQA 2R5AA 1PG5B 2WSFE 4F04B 5LJ3h 1A0NB 2ROTA 2P84A 2EGEA 5KYXB 2LX7A 2H3EB 2YUQA 4ZGDB 1GL5A 2OTJT 2DD5A 1QVFA 2F2XA 4C5EA 1HXDA 2ED1A 1KQSP 4C8QA 3MJXA 4F16A 2OTJQ 1K9MR 3OYGA 3FEOA 2V26A 3U23A 2A3LA 3VYHB 2K3YA 2E70A 5GJVB 1OPLA 3M5AA 4B9WA 1D3BA 1BIBA 2JTFA 1YP5A 3MP8A 3JCMd 2LX9A 4ATOA 5HK3A 2JMCA 3SDZA 2Y4YA 3X24B 1BIAA 2JW4A 2YUOA 1D1BA 2EFIA 2EYWA 3O5ZA 4FYVB 4C0GA 1VQPQ 1IRXA 3MEUA 1I0CA 3RUXA 2QK0A 2FL7A 4IIOA 2CUDA 2VV5A 4DEYA 4BE0A 4LDUA 3H8ZA 4OF1A 2LCCA 4FYWB 1RAAB 2KEAA 1OZ3A 2DEQA 2EKOA 3VS6A 4NS5A 1HSQA 2CZ6B 2NUTA 1K9MC 2PNIA 1KG1A 2K3BA 4IIMA 1JXOA 1K8AR 1YHQQ 4J6XA 4M7DG 3V8LA 4QKUA 4DBQA 3R6NA 5GAMj 1U5SA 1IB8A 1V76A 4CI0C 4MZMA 3EGXB 1QW1A 1VQOQ 1CSKA 4RMOA 4JJNK 3M58A 1B3QA 4OMNA 4MMLA 3RKYA 2ZPGB 5LJ3j 1Q95G 4F7UB 2M0OA 1WFWA 3P8BB 3I55T 2E3HA 4DOVA 1W2BP 3JSCA 1X43A 5GANe 1BU1A 4M78D 1QMCA 2EPDA 1ZA2B 2JOYA 2DM1A 4BDYA 4R0KA 3P8HA 1BI0A 3CMEA 3CCLT 2ZPFB 5GAOn 2E65A 3BY7A 3F70A 3VS5A 3A1PA 2K3XA 4FL6A 3SEMA 4BY6C 2LQNA 2FPFA 3CCST 4PK4A 1ZLMA 5AT1B 4KBMB 4BE1A 1KQSA 1M9SA 5I2SA 1M5Q1 1VQNQ 2GTOA 2HNIA 2IVWA 3AT1B 2R5MA 4N4IA 4XTZA 3WXMB 4LE9A 2OTLQ 3LH5A 1N6AA 2F69A 2BE9B 3GNFB 4QT7A 3TREA 4Z02A 2D0QB 5IXBA 1TWBA 3RIRA 2QTVA 1WXTA 4OMLA 4KUDK 3QKJA 1AT1B 3C0CA 1YIJT 5IHKA 1YI2Q 2O4XB 2PQWA 3CMAQ 2QEXT 2IG0A 1KC8R 1MHNA 1UG1A 3NGPA 3CC2T 4JJCA 1RL2A 3CCQT 2HKQB 4IUVA 4C5IA 1S72T 1VQ6T 2Z0WA 1XOVA 4XQ3A 2VYTA 2PVGB 3BW1A 4QQ6A 2CP3A 2GBQA 2W0ZA 3MO8A 2D9TA 4BY6B 1IZ6A 1GCQA 1WHJA 2MI6A 3N5BB 4JDSA 2VWFA 4CC4B 4DEXA 4F7UF 2LC4A 3OS5A 3OS1A 1D3BB 2LNVA 2AKLA 1LOJA 2C0OA 5LJ5d 3EH2A 4J9BA 3E9FA 3FRNA 3L2RA 1WX6A 1VQMQ 1VOMA 4WF2A 4E7JA 3CC7Q 2EQJA 2HAXA 1UECA 2CZ0B 1OYXA 1PRMC 2HCKA 4J7FA 2O9SA 4E6RA 3CCMQ 2JMAA 3C4SA 4QQGA 3OYIA 5LL6S 2LQWA 3PGGA 2DX1A 1C6VX 1AVZC 1NBEB 4IUPA 3I55A 4JLIA 3CCMT 1Z9QA 3CC7A 3ZEHA 3OB9A 4RUGA 2MWOA 2RMOA 1RAEB 1ZA1B 1VQ9Q 3JB9G 2HSPA 4WCIA 1D0ZA 1VYTA 1QP2A 3SWNC 2GQIA 2DIQA 2XK0A 3GPLA 2L3SA 2QQ9A 2DRKA 2MMPA 5GJWB 3SHWA 2KR3A 4LNPA 1M8MA 1E6HA 1K9MU 4PFOA 5CKHA 1NZ9A 4FYXB 1MV0B 5KYYA 1Q86R 2DVEA 2K9GA 2HKNA 3LW5E 2E64A 3JCMX 4J6YA 3LGLA 3OA6A 1T0HA 1ABQA 2HD0A 2PZ1A 2VGNA 2G3RA 2DZ9A 4JS5A 2JJ9A 1I5OB 3VS3A 4PJOG 4VUBA 1TTHB 1KC8C 2XHCA 1NJIU 4OVAA 5CK9A 4J9FA 1SEMA 4JZ3A 1ZSZB 4FSXA 3M9QA 1YI2T 3TU4K 1SG5A 7AT1B 2VASA 4M7AA 1JEGA 3G1JA 2VXFA 2LCSA 2LTOA 5IXFA 2BIVA 3HFOA 5D6WA 4CC2A 4A54A 2EQKA 1VQNT 2O31A 1VYVA 2QQSA 4J9EA 2QYZA 2RJCA 3TSWA 2NYSA 3RDVA 1R77A 5GAOl 1FX7A 3CMEQ 1YBYA 2ROLA 2FO0A 1O9SA 4M7DF 4PJOC 3MEAA 3EG1A 5A0LA 2X51A 2CZ1B 2RHXA 1HJDA 4GLKA 1M90R 5AYFA 4GLMA 1ZUUA 1YFNA 3CCUQ 3CMAT 3UPUA 4HT8A 5KYXA 2PU9B 1QVPA 1QWFA 2RI3A 4ELZC 5C0MA 3CCJQ 1AWWA 1B34A 5FLXE 4HKEA 2DETA 2A0FB 1C0MA 2EGAA 5HY6A 4PJOE 1TUDA 2COYA 3CCEA 3CCLA 4C0ZA 3IQLA 3ZFJA 1N8RU 4OMQA 3JB9F 4L6V5 2FYKA 3OYFA 1UFFA 3JCMb 4M75B 3CCSQ 1H641 1SRMA 2DNUA 4ZTJA 4C0FA 1VQ9T 1BBZA 2F5KA 4M7DB 1M90C 4KH0B 4A4FA 2XI9A 4X9DA 4OB3B 2A36A 4PLIA 4M7AG 5L23A 3OYKA 1JJ2A 1YJWT 2E1HA 4JRIA 2BZ8A 4MZPA 3CCSA 2FB7A 2DTHA 1RABB 2QEXA 2VUBA 4EPCA 1D0YA 5GMKl 1WXUA 1FMWA 1JJ2P 5CQYA 4ZGJB 3A8GB 1KD1R 3C12A 3PMTA 3QXEB 2AZVA 2LJ0A 3A5ZB 1Y96B 4RTTA 3BDLA 3EG2A 3INZA 3VUBA 1VQ5Q 2ENMA 2K2MA 2A08A 4L5GA 1B07A 4XU3A 4A63B 2ABLA 1PWTA 1NE8A 1HD3A 1LNXA 1WJQA 3EG0A 3L1AA 4NL3A 3LWIA 2MYSA 9ATCB 2DA9A 1MMNA 1VA7A 1MMGA 5I2MA 2QAZA 3FLGA 5GAMd 3S3MA 4O5VA 3M59A 1YHQA 3JAME 3RERA 4KULA 1NG2A 2EQIA 1MGQA 2X35A 4ELYC 2EAYA 3CC7T 1M8VA 4C8QD 4E7ZA 1GCQC 5GMKe 3G6ET 3G71Q 1XTDA 3I56T 1E6GA 1KHIA 2YHTA 3M4YA 3GF5A 3G7ZA 2K57A 1KK7A 1C1AA 4A4GA 1D09B 1TSFA 2DTOA 1M30A 2KQWA 4OB0B 2PVOB 4QQDA 4E47A 3DLLA 4JLGA 4C92D 2GF7A 1RI0A 3RNJA 1M1KC 1QCFA 4AFSC 1R8OB 4M75F 1XQHA 4J9GA 5GMKi 3OSVA 1VQ5T 3JCMe 1WQ7A 4M78A 2DRMA 2SEMA 1BKBA 2ZPHB 1OOTA 4PJMA 3CCQQ 4FIBA 1SKUB 2ZZDA 3V7SA 2A37A 1QLYA 8AT1B 4BUGA 1TG0A 4RTYA 2KK4A 4OMFB 1OEBA 4Z88A 3OYEA 5KYUB 2SRCA 4JRQA 1KQ2A 4E7SA 2Y90A 2ZCFB 1PKTA 3QJ6A 4KGVB 2CUBA 3PVLA 2ZAEA 4QW2A 1YWOA 4FT2A 4BI3A 4OP0A 2XKOC 5J3BA 2DF6A 4M77F 5GAN8 3TVTA 3V8JA 3MHXA 3M0RA 2QXFA 3X20B 2DBKA 2M9UA 1VQ4A 1V1CA 4LDXA 1P92A 3HHTB 2DXTA 4PJOA 3EGDB 4II1A 4XTUA 1WHGA 1WDXA 2LZ6B 4GY5A 2K2VA 3HRSA 4CC3A 3VYGA 1GFDA 1NEGA 2KRNA 3BE3A 3T9NA 2XMFA 2CKKA 2ZPEB 3M0UA 3ZL7C 3CCRT 1VQKQ 1NYGA 1VQ4T 1OI1A 1VQ7A 3EGDA 4M78E 1Y57A 5CCAA 2QGFB 1IGQA 4M78F 4TVRA 1XJWB 2CGHA 3CXCA 6AT1B 2MIOA 1PM3A 2IPOB 4J8OA 2L3RA 1QVGP 1LVKA 5CKDA 2RQRA 4BD3A 2EYYA 2DJZA 1DJ7B 3E2UA 3CXCP 1FMVA 2AIRB 2HL3A 1RUWA 4BB7A 3CCQA 1EFNA 4LDVA 1K8AU 2P0KA 1T3SA 3OS0A 1VQ8T 1YJ9A 2FRYA 2NUTB 5KYYB 2KSSA 5IH2A 3CCVA 3I5SA 3GOXA 4BDZA 5GAMh 3V8KA 1K73U 5CO7A 2CT4A 4M77E 4RCCA 3NTHA 1VQLQ 3O8VA 3MEWA 1VQKA 1ZHIA 1K73R 5LJ5f 4C92C 2LDMA 2CP6A 4O6JA 1H92A 3S3NA 2OAUA 3LLRA 4J5YA 2MWPA 3J7AF 3MEVA 3EG9B 1PRLC 1PC0A 1S72A 1VQ6A 4WTOB 2CH4A 1ZX6A 4HVUA 4PJJA 3CEYA 1YJWA 3CMET 2K5IA 1MMDA 5LJ5j 3E19A 2RB6A 3KBGA 3OYCA 4EMKB 3J81E 5GAN3 2DTIA 1NJIR 3CBMA 3VS2A 1UHFA 1G5VA 2A28A 2X4XA 1VQPT 4PJOD 2NUPA 5KCOA 4DBRA 4D6WA 2WSEE 1JRIA 5FWBA 4UC4A 3SWNA 2MCNA 4IURA 1H3HA 1M1FA 5DY9A 1QWEA 1YCSB 5FWCA 2BKDN 4IUUA 1UGSB 2YRDA 1PSFA 1OULA 3URGA 2G6FX 2RM4A 2M0YA 3NHNA 1QVFS 3THKA 2XD0A 4MDWA 2EVRA 2EYZA 3CCUA 3EGXA 2PUKB 1SF9A 4P5NA 4HA8A 1SSFA 2JUFA 2KYBA 1IO6A 2KRMA 1G8XA 3FIFA 4Y92A 1M27C 2YXYA 3GIBA 3L42A 2L89A 2V1RA 4PJNA 4B6MA 4L59A 1VQNA 1K1ZA 2LMJA 3CPWS 2COWA 4X9CA 5L8RE 3L2WA 3LGFA 1AWJA 3QDFA 2DBMA 4RTUA 4C8QF 1N5ZA 3META 2NUZA 3OYNA 3CC2A 1K0XA 4DA4A 1ZBJA 2J6OA 1VQ8Q 2Y4XA 1W2BS 2LP5A 2FG0A 2M02A 1UEBA 2F2WA 1W4SA 4OB2B 4XU2A 1GXIE 5LJ5h 4LN2A 2LQ8A 4M7AE 3CC4T 1AD5A 3G4ST 3ZBDA 5IAYA 1JBMA 2RD1A 2X9HA 1K73C 3QJYA 1D1AA 3QYGB 1PD0A 5GAOq 1M3CA 4XAXB 2AT1B 5M9OA 3OYYA 3SWNB 3JB9H 2YRCA 1G3TA 1S1NA 1GBRA 4M75G 3ASKA 3MPUB 1GRIA 4LDWA 1WHLA 3HP9A 4LUDA 2LQKA 3VV0A 1I81A 1WJSA 2GNCA 2NLUA 1WJRA 1T0JA 5CKEA 2XDDA 3QIIA 1KC8U 3CPWA 5FU6B 2LJ3A 2OAWA 2QA4Q 3PVQA 1OV3A 1EZZB 1VQ9A 3QPHA 3OW2P 3VS7A 5GAMe 2X4WA 1KFZA 2HEQA 2P0PA 4F17A 1AEYA 3S3OA 1Q86C 1ZUKA 2FZKB 2CREA 2EYXA 4C92E 2KGTA 4J83A 2O88A 3UT1A 2XDBA 2KYMA 3HPWA 2GFUA 3UA7A 2O9VA 2YDLA 1X2KA 1U06A 1I5LA 1MMAA 4Y28E 2QASA 3HSBA 2L8DA 4EIKA 1PNJA 4C5HA 2AK5A 3G71T 4CC7A 4QVCA 2P4TA 2CP2A 2LVMA 4LD6A 1Q7YU 3MP1A 1G3WA 1Y96A 4M77A 3EGUA 2DLPA 2EQMA 2RN8A 2ZGWA 3G6EA 4OMOA 2JM8A 1RADB 4DBFA 2XU8A 1ZBXA 3ME9A 3A8LB 3TQ7P 1H8KA 1VQ8A 4M4ZA 2HBWA 2PUOB 1UDLA 2EW3A 1Y07A 5CQXA 1YCYA 1WLPB 4JJDA 3VRZA 4C92A 1M2OA 3QSUA 2VB6A 4XTYA 1MNDA 3V7CA 2DILA 4HCKA 3H6ZA 1TS9A 3A8HB 4KH1B 3HFNA 1X6BA 4AMCA 1OX9A 2RK1A 2E6ZA 4LUEA 2YUPA 1OU8A 3E1SA 2J6FA 1UE9A 3RMQA 3G71A 4HCZA 1G2BA 4Y91A 4M75D 2EQUA 1VQPA 3OYAA 4RTVA 3A8MB 4C92B 3ULRB 1B34B 1AWOA 1UGVA 2VC8A 2LT4A 4HCBA 2RJEA 1UGQB 1YIJA 4RG8A 5D7UA 3UWNA 3MCAB 4J9IA 1JB0E 1RI9A 1BCMA 1Q81U 2CH4W 2CSIA 2EIFA 1UJ0A 4AG1C 5GAN5 3UATA 2MPXC 3HRTA 3H9NA 1ACMB 1VUBA 2KY9A 5FW9A 5KE3A 4PFZA 2DD4A 2DERA 3WVEB 3G4SQ 1KQ1A 3PE0A 4A4EA 2LRQA 1J3TA 1ABOA 2MOXA 2HL5C 4M77D 2HSEB 1N9RA 1AWXA 4E7KA 1MUZA 3VRYA 5FRNA 1X01A 3M56A 1NEBA 5GANd 4XU0A 4IKFA 1Y7XA 4AT1B 4OMMA 4D8KA 3CCET 1OU9A 1NJIC 3KFVA 1W1FA 1M2VB 2M16A 3QHSA 3GNGA 1IHVA 4NOYA 4QVDA 1G3SA 4QVZA 2R58A 3CCEQ 3M54A 5KE2A 1YN8A 4HXJA 4M7AD 4KGXB 5FRMA 1Y0MA 2EJ9A 2YT6A 1WXBA 1YJ9Q 1WGSA 5EC7A 2KI7A 2RHZA 3HRUA 4JRPA 2F1LA 4ZGEB 3CXCS 4OGEA 5FU7C 3VS0A 2RH2A 2HDAA 3DLMA 1K8AC 1HYOA 1YJNT 3JB9I 2BE7D 4R55A 1Q7YC 1U1SA 4A4HA 1LPLA 1PD1A 2BTTA 3ER0A 3RKWA 4EMHA 1SHGA 4J9DA 3CPWP 2DFUA 3CCRA 2L3PA 4AFZC 2AKKA 4XTWA 2JZ2A 1VYUA 1UB4A 2DJQA 2O4XA 3MP6A 3I9QA 3OBWA 2DPPB 4ME7A 2RQUA 4Q5WA 3NPFA 2ATCB 1X2QA 3EHQA 3SD4A 3M53A 2RPNA 1OPKA 3H0HA 5DLOA 1V29B 2O01E 5GANf 1YJWQ 5KH6A 1QP3A 2JN0A 2X4YA 3RBBB 1ZQ1A 2PVDB 5LJ3e 2D0NA 2D8JA
chains in the Genus database with same CATH topology
5GAOp 2EJFA 2EQJA 3CCVA 2HAXA 2VGMA 2CZ0B 1OYXA 4M78B 3GOXA 1OZ2A 2EJGA 3JCMh 4J7FA 4BDZA 5GAMh 3CD6A 3V8KA 2RHYA 5CO7A 1BI1A 1K73U 2V8KA 4M77E 4RCCA 3NTHA 3CMAA 3O8VA 1TH7A 3MEWA 1VQKA 3C4SA 1ZHIA 4QQGA 3OYIA 5LJ5f 5LL6S 4C92C 2LDMA 3PGGA 3SB2A 2V8JA 4O6JA 2E10A 3S3NA 2OAUA 4EDUA 2RK2A 4IUPA 5D6YA 3I55A 4JLIA 2FVUA 5IN1A 3KXTA 3JB9D 3M55A 3LLRA 4J5YA 1VIFA 5GMKh 2OTLT 3CCMT 1U1TA 2MWPA 3UDCA 5A0DA 3DB3A 4N0AC 3CCVT 3J7AF 1FWZA 2DKGA 1KHCA 3MEVA 2ZPBB 3OSSC 1M1GA 5GAN6 2HQXA 3CC7A 3ZEHA 3OB9A 2QQBA 2MWOA 1S72A 1VQ6A 3X26B 3S6WA 3FC3A 2RI5A 3CEYA 2RHIA 2GCXA 4M7AB 1YJWA 3CMET 2K5IA 5LJ5j 2QA4A 3E19A 1X6OA 3JB9G 2RB6A 4C0DB 1VQ7T 1VQLT 1QP2A 3KBGA 4IUQA 3SWNC 2JNGA 3OYCA 4EMKB 3J81E 1XNIA 2XK0A 2DIQA 3GPLA 2QDYB 4PJOF 2QQ9A 5GAN3 2DTIA 3EFRA 4IUTA 5DM7R 4JS4A 3CBMA 3LX7A 4BI8B 1G5VA 2MMPA 2X4XA 3GP8A 3QZ9B 1VQPT 4LDYA 4PJOD 2YLBA 5KCOA 3RKXA 3VKIA 4D6WA 2WSEE 5HKCA 1JRIA 4N4GA 5CKHA 2HQEA 1K9MU 4UC4A 3SWNA 1NZ9A 2VXEA 4IURA 1HK9A 1H3ZA 1M1FA 4PJOB 3OYDA 3TEEA 5DY9A 4C92F 2DVEA 2BKDN 3LW5E 3AHUA 4IUUA 2E64A 1UGSB 1PSFA 2DK3A 4M77B 2RJDA 3BFMA 2HBPA 3LGLA 4J6YA 3URGA 4FU6A 3PNWC 3JCMX 3G4SA 3OA6A 3PIPA 2RA2A 2RM4A 3KUFA 2RO0A 1QVFS 2HD0A 2VGNA 4M77G 2XD0A 2X4JA 4MDWA 2G3RA 3OW2A 2DZ9A 5CKFA 4JS5A 4M75E 3CCUA 2PUKB 4M7DC 4P5NA 4VUBA 4PJOG 1KC8C 2XHCA 4HA8A 1SSFA 1UGRB 4PKCC 1NJIU 4OVAA 2JUFA 3QG1A 4XK8E 5CK9A 2QQAA 3FIFA 5FU7B 4M7DA 2GFAA 4XTVA 4E7LA 4FSXA 3M9QA 3QDRB 3SFMA 1YI2T 3TU4K 4F7UA 3FDRA 3L2ZA 5LJ3f 2XDPA 3GIBA 4M7AA 4ZTFA 3L42A 5LJ3g 2L89A 2VXFA 2QTXA 4L59A 1VQNA 2LTOA 3X28B 2BIVA 3CPWS 4X9CA 3HFOA 5L8RE 5D6WA 3L2WA 3LGFA 4A54A 2WSCE 5CKBA 2EQKA 2AHJB 1VQNT 4C8QF 3META 4M75C 1VQOT 2QQSA 2RJCA 1BYMA 5C6SA 1YI2A 3GLXA 3OYNA 1Q81C 1VQLA 5GANh 3CC2A 1X75C 4DA4A 2K4YA 5GAOl 1UGPB 4E7IA 3CBPA 1FX7A 1EIFA 1NPPA 2Y4XA 3OMCA 1W2BS 2I2LA 2KVQG 3OYJA 1YJNA 1Q86U 1VQ5A 1YBYA 5GAOm 5FROA 4HCCA 4N0AA 4A53A 2XICA 4BE2A 1O9SA 1UEBA 4M7DF 2LCLA 4N4HA 2YRVA 3MEAA 4PJOC 2QI2A 3JCMP 5A0LA 4C8QC 1W4SA 4OB2B 4KT0E 4M7DE 2CZ1B 2RHXA 3A8OB 4XU2A 3LH0A 5LJ5h 1GXIE 4OGCA 3QYHB 2LQ8A 2XG8D 4PNOA 4YTLA 4M7AE 3CC4T 4GLKA 3G4ST 5AYFA 3ZBDA 5IAYA 2DO3A 3Q1JA 1JBMA 2RD1A 3DKMA 4DOWA 5LJ5g 4F7UG 3QZ5B 2YLCA 1K73C 3NFCA 3QJYA 3QYGB 1BI2A 2V8IA 3CMAT 1VQKT 5CAIA 3UPUA 4J7IA 4HT8A 1PSEA 4XTXA 2PU9B 5GAOq 4XAXB 1M90U 5M9OA 2DXBA 3OYYA 4JRKA 3SWNB 1QVPA 2GQVA 2K5LA 3X25B 1G3TA 4C8QE 3JB9H 2RI3A 4ELZC 5IT9E 1I8FA 5C0MA 5GMKj 4A4KA 1B34A 1YJ9T 5FLXE 4HKEA 5FU6C 4M75G 2DIGA 3JCMW 2CYZB 2E6NA 3ASKA 4RCBA 5HY6A 4PJOE 3VU3C 4MDXA 4LDWA 1BI3A 3R6OA 3HP9A 3HKSA 3CCEA 2LQKA 3VV0A 3CCLA 4C0ZA 1KD1C 4J6WA 1I81A 4LD9K 3JRZA 1WJSA 3ZFJA 2NLUA 1N8RU 2QA4T 2MF2A 1N8RC 2L5QA 1WJRA 3JB9F 4L6V5 3PTAA 2FYKA 5CKEA 3OYFA 2XDDA 3QIIA 1VQOA 3JCMb 3CPWA 1KC8U 1W2BA 5KCHA 4M75B 5FU6B 1H641 3RESA 1WPYA 5I21A 2E41A 3P8DA 3CCMA 1QVGA 4RKUE 4ZTJA 1VQ9A 4C0FA 3QPHA 1VQ9T 1M1KU 4M7DD 4M7AC 2D6FA 3OS2A 2F5KA 5GAMe 2X4WA 3NTIA 1N27A 4M7DB 3JCMc 3WVDB 2EYQA 1M90C 4M78G 4FT4A 1JJ2S 2P0PA 4A4FA 2RI2A 2XI9A 1KQSS 3S3OA 4X9DA 1Q86C 4OB3B 5J26A 2FHDA 5GANg 4C92G 4C92E 2ZPIB 1VQMT 3M57A 4J83A 4PLIA 4C8QB 4ZN3A 4M7AG 1FXXA 4M7AF 3OYKA 2QQRA 1JJ2A 3DB4A 1YJWT 2E1HA 5EG2A 3UT1A 4B9XA 5CR2A 4JRIA 3L2UA 1N9SA 2XDBA 4MZPA 3CCSA 2E12A 3HPWA 2GFUA 1NPRA 2FB7A 2DTHA 4V2SA 3LWHA 2CZ7B 3OYMA 2H3JA 2DAQA 2R5AA 2QEXA 1I5LA 4Y28E 2WSFE 3HSBA 2VUBA 4MZTA 2KAFA 4EPCA 5GMKl 5GANj 2L8DA 5LJ3h 4C5HA 4M77C 2LT1A 5CQYA 4ZGJB 3G71T 3A8GB 4QVCA 2P4TA 2LVMA 3C12A 4LD6A 4ZGDB 3MP1A 1Q7YU 1G3WA 1Y96A 3PMTA 3QXEB 4M77A 3CCJT 2OTJT 3A5ZB 1Y96B 2DD5A 3EAEA 5D6XA 1QVFA 2EWNA 3V7RA 5GAMg 3BDLA 3OYLA 5GAN2 3INZA 2EQMA 3JCMV 4C5EA 3VUBA 2ZGWA 1HXDA 4C8QA 3G6EA 5LJ3d 4L5GA 3OYGA 4XU3A 3FEOA 2DXCA 2A3LA 2XU8A 1ZBXA 3ME9A 3VYHB 2K3YA 1NE8A 3A8LB 1VQ8A 2E70A 1LNXA 1WJQA 3L1AA 4NL3A 3LWIA 2PUOB 4EMKA 2A7YA 3M5AA 1Y07A 3HL8A 4B9WA 1D3BA 1YCYA 5CQXA 1BIBA 2JTFA 5I2MA 4X34A 3FLGA 5GAMd 3MP8A 3JCMd 3S3MA 4O5VA 2LX9A 1WQWA 4C92A 4ATOA 5HK3A 2KMTA 2JVVA 2F5TX 3SDZA 3M59A 2Y4YA 3X24B 1BIAA 1YHQA 3JAME 3RERA 4KULA 3QSUA 2EFIA 5HK0A 3CPFA 1MGQA 4C0GA 3CBOA 2X35A 4ELYC 2EAYA 4XTYA 5A2QE 3CC7T 4C8QD 3OYBA 1M8VA 3VJPA 3MEUA 3RUXA 2OTLA 3V7CA 5GMKe 3G6ET 1XTDA 1I4K1 3I56T 4EMGA 1KHIA 2YHTA 3H6ZA 3C94A 3GF5A 3M4YA 4PLLA 2FL7A 3G7ZA 2K57A 3A8HB 3HFNA 4A4GA 5LJ5e 4R56A 2R57A 2DTOA 2RK1A 3QUIA 4BI4A 2E6ZA 2VV5A 2KQWA 3BDUA 4OB0B 2PVOB 3E1SA 4LDUA 4QQDA 4E47A 4BE0A 3H8ZA 3DLLA 2E5QA 4JLGA 3RMQA 4OF1A 4C92D 3G71A 2LCCA 2GF7A 4HCZA 1RI0A 4HT9A 4Y91A 4M75D 1M1KC 5A0GA 2EQUA 1OZ3A 2JTMA 1VQPA 2DEQA 1M4ZA 2EKOA 3FB9A 1R8OB 4NS5A 3A8MB 3OY9A 3OYAA 2CZ6B 4C92B 1K9MC 1B34B 1XQHA 4M75F 1KG1A 5GMKi 3JCMg 1O75A 2VC8A 3OSVA 3L2QA 1VQ5T 2LT4A 3JCMe 4HCBA 2RJEA 1WQ7A 1UGQB 4J6XA 1YIJA 4RG8A 4M7DG 3V8LA 4M78A 5GAMj 1Y71A 3UWNA 1BKBA 2ZPHB 3MCAB 2BUDA 3QO3A 1JB0E 4FIBA 4CI0C 4MZMA 4XU1A 2ZZDA 3V7SA 3JCMQ 4BUGA 1QW1A 1Q81U 2KK4A 2EIFA 4OMFB 5GAN5 4RMOA 4JJNK 3M58A 5GAN4 3HRTA 3OYEA 1VUBA 4MMLA 3RKYA 3NTKA 2ZPGB 2KY9A 5KE3A 5LJ3j 4F7UB 1KQ2A 4JRQA 2DD4A 2M0OA 3P8BB 3I55T 2Y90A 5CIUA 2ZCFB 3WVEB 3QJ6A 1KQ1A 4DOVA 4A4EA 2LRQA 4QW2A 3TCJA 3JSCA 4FT2A 1IREB 4M77D 4RG2A 4BI3A 4OP0A 5GANe 3RMSA 2CS7A 1QVGS 4M78D 4EMKC 1N9RA 2XKOC 5J3BA 3CCJA 4E7KA 1YHQT 1Q82U 2JOYA 1U8RA 1Q82C 1X01A 4M77F 4BDYA 5FRNA 3P8HA 3M56A 4F7UE 5GAN8 2DZCA 1BI0A 3LYIA 5GANd 4XU0A 3CMEA 4IKFA 3CD6T 1Y7XA 3CCLT 2ZPFB 5GAOn 2E65A 3BY7A 3V8JA 3F70A 3MHXA 1KD1U 3CCET 2QXFA 3PMIA 2C06A 1VIEA 2K5FA 2K3XA 2RHUA 4FL6A 3X20B 1NJIC 3C95A 4BY6C 4C8QG 2M9UA 3JB9J 1VQ4A 4LDXA 2M16A 3QHSA 3CCST 2RJFA 1P92A 1YITA 3HHTB 3GNGA 4CRIA 3PT9A 4E7JA 2DXTA 4PJOA 4II1A 5GAN7 4KBMB 4NOYA 4BE1A 4XTUA 2B8AA 3VUZA 1M9SA 5I2SA 1KQSA 4QVDA 1M5Q1 2HNIA 1G3SA 2IVWA 4QVZA 2R58A 2R5MA 4N4IA 4XTZA 3OBYA 3M54A 4PL6A 3WXMB 5KE2A 4GY5A 4M7AD 4C0DC 1N6AA 4OB1B 2F69A 5FRMA 3M4GA 2EJ9A 3GNFB 4E7HA 3TREA 4Z02A 2D0QB 1WGSA 3EFSA 5DLQE 3RIRA 4KUDK 3QKJA 2M1HA 3CC4A 2RHZA 2K2VA 3HRSA 3HRUA 4JRPA 4ZGEB 3CXCS 4OGEA 5FU7C 3VYGA 1G3YA 4ZN1A 5GMKm 1YIJT 3PIOA 3T9NA 2CKKA 2ZPEB 3CCRT 2O4XB 2PQWA 3OQ5A 3QBYA 4KUIA 3OW2S 2QEXT 1VQ4T 3CCUT 2IG0A 4FM4B 2RH2A 1WNLA 3DLMA 1K8AC 1OI1A 1MHNA 1YJNT 3JB9I 1VQ7A 4JUVA 4R55A 4M78E 3OYHA 1Q7YC 5CCAA 3CC2T 1U1SA 3OMGA 4A4HA 1VQMA 2P0QA 4M78F 5GAOr 4TVRA 3ER0A 1RL2A 2CGHA 3CCQT 3RKWA 3JCMf 4IUVA 4EMHA 5GAMf 3CXCA 4C5IA 1S72T 1VQ6T 3FJPA 3J80E 4MMKA 1XOVA 4XQ3A 3CCRA 4BACA 2VYTA 4J8OA 2L3RA 2PVGB 2JZ2A 4XTWA 4DQ2A 1UB4A 2KDSA 3BW1A 3E9GA 2O4XA 4QQ6A 3I56A 5CKDA 3MO8A 3MP6A 4BD3A 2D9TA 3OBWA 4BY6B 2DPPB 2DJZA 1DJ7B 4ME7A 1IZ6A 4C5GA 2MAMA 2WACA 4Q5WA 2MI6A 3N5BB 4JDSA 2OTJA 3L2VA 3PFSA 4M78C 5CVIA 4NL2A 4F7UF 4BB7A 2LC4A 3SD4A 3M53A 3OS5A 3OS1A 3CCQA 1D3BB 3JCMJ 2LNVA 1AHJB 1LOJA 2DXUA 4LDVA 4M75A 1LJOA 5J39A 5DLOA 5LJ5d 1K8AU 1V29B 3E9FA 1YITT 2O01E 5GANf 3FRNA 2P0KA 3L2RA 5KH6A 3OS0A 1QP3A 2JN0A 2X4YA 2XIDA 1VQ8T 1ZQ1A 2PVDB 5LJ3e 1YJ9A 2KSSA 4WF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A4E A;  2EQJ A;  2LRQ A;  2L8D A;  3MET A;  4QW2 A;  1OYX A;  2QQS A;  4C5H A;  1OZ2 A;  4RG2 A;  3GOX A;  4BDZ A;  2RJC A;  2RHY A;  5C6S A;  4LD6 A;  2LVM A;  3OYN A;  4E7K A;  3MP1 A;  3PMT A;  3NTH A;  5FRN A;  3O8V A;  3MEW A;  3EAE A;  5D6X A;  3C4S A;  3P8H A;  4QQG A;  3OYI A;  4BDY A;  4E7I A;  3BDL A;  3OYL A;  2LDM A;  3LYI A;  3OMC A;  4IKF A;  2EQM A;  3OYJ A;  4C5E A;  3S3N A;  3F70 A;  3PMI A;  5FRO A;  2RHU A;  4EDU A;  2K3X A;  4FL6 A;  4IUP A;  5D6Y A;  5IN1 A;  4BE2 A;  3LLR A;  4N4H A;  2YRV A;  3MEA A;  2MWP A;  3OYG A;  3FEO A;  3DB3 A;  2M16 A;  2RJF A;  1KHC A;  3MEV A;  3ME9 A;  4CRI A;  2K3Y A;  2HQX A;  2RHX A;  3ZEH A;  1WJQ A;  4II1 A;  3LH0 A;  4BE1 A;  3OB9 A;  2B8A A;  2MWO A;  3S6W A;  3FC3 A;  2RI5 A;  3CEY A;  2R58 A;  2R5M A;  4N4I A;  2RHI A;  4PL6 A;  4QVZ A;  4B9W A;  5IAY A;  5KE2 A;  3Q1J A;  4GY5 A;  2JTF A;  4X34 A;  3FLG A;  5FRM A;  3MP8 A;  3S3M A;  4E7H A;  4Z02 A;  1WGS A;  4IUQ A;  3OYC A;  3QKJ A;  1XNI A;  2DIQ A;  2EFI A;  2M1H A;  2RHZ A;  2XK0 A;  5M9O A;  4IUT A;  2RI3 A;  2X35 A;  5C0M A;  3OYB A;  3LX7 A;  2CKK A;  1G5V A;  3MEU A;  2O4X B;  2PQW A;  2X4X A;  3OQ5 A;  3QBY A;  5KCO A;  2DIG A;  2IG0 A;  2E6N A;  3ASK A;  3H6Z A;  3DLM A;  4N4G A;  2HQE A;  4PLL A;  4UC4 A;  1OI1 A;  1MHN A;  4IUR A;  4A4G A;  1H3Z A;  2R57 A;  3OYD A;  2BKD N;  3OYH A;  1WJS A;  2NLU A;  4IUU A;  4BE0 A;  3OMG A;  4QQD A;  4A4H A;  2RJD A;  1WJR A;  3H8Z A;  3LGL A;  2E5Q A;  4FU6 A;  3PNW C;  3OYF A;  3OA6 A;  2LCC A;  2GF7 A;  4HCZ A;  3QII A;  4IUV A;  1RI0 A;  3KUF A;  2RO0 A;  4C5I A;  2EQU A;  1OZ3 A;  5KCH A;  3OYA A;  2EKO A;  4NS5 A;  2VYT A;  3OY9 A;  4BAC A;  2L3R A;  2G3R A;  2JZ2 A;  3P8D A;  3E9G A;  2O4X A;  4QQ6 A;  4ZTJ A;  3MO8 A;  3MP6 A;  3L2Q A;  3OS2 A;  2F5K A;  4BD3 A;  1SSF A;  2D9T A;  2RJE A;  2X4W A;  3NTI A;  1N27 A;  4OVA A;  4C5G A;  3UWN A;  2GFA A;  4E7L A;  2WAC A;  2RI2 A;  4Q5W A;  2BUD A;  4A4F A;  3L2V A;  3M9Q A;  3S3O A;  3PFS A;  5J26 A;  2FHD A;  3SD4 A;  3FDR A;  3OS1 A;  2XDP A;  4PLI A;  4ZTF A;  3L42 A;  2QQR A;  3OYK A;  3DB4 A;  5J39 A;  2L89 A;  4B9X A;  3UT1 A;  3E9F A;  4L59 A;  3L2U A;  3OYE A;  2LTO A;  2BIV A;  2P0K A;  2GFU A;  3NTK A;  5KE3 A;  5KH6 A;  3L2R A;  3OS0 A;  2X4Y A;  2M0O A;  3OYM A;  5D6W A;  3L2W A;  3LGF A;  2DAQ A;  2R5A A;  5CIU A;  3QJ6 A;  2EQK A;  4E7J A; 
#chains in the Genus database with same CATH topology
 4M78 B;  1OZ2 A;  2EJG A;  3JCM h;  2RHY A;  1BI1 A;  2LJ1 A;  1RAC B;  1TH7 A;  2CSQ A;  2KNB B;  1KJW A;  3M0T A;  1JQQ A;  3I5R A;  2E10 A;  1JO8 A;  4EDU A;  2RK2 A;  3CD6 Q;  4J9H A;  5D6Y A;  5IN1 A;  3GBQ A;  3A98 A;  5GMK h;  2JS2 A;  2OTL T;  1U1T A;  5A0D A;  3CCV T;  3DB3 A;  1FWZ A;  2DKG A;  1KHC A;  1KSW A;  2C0T A;  5GAN 6;  2HQX A;  5IHN A;  1S72 Q;  1VQ6 Q;  2QQB A;  3X26 B;  2RI5 A;  2RHI A;  2K79 A;  2QA4 A;  4F14 A;  1X6O A;  1D0X A;  1WHM A;  4C0D B;  1FMK A;  2L2P A;  3EFR A;  4BI8 B;  2I0N A;  4LDY A;  1B7T A;  3RKX A;  1ZSZ A;  3VKI A;  5HKC A;  5KYN A;  1YNZ A;  2VXE A;  4PJO B;  3TEE A;  4C92 F;  2D8H A;  3AHU A;  3BFM A;  2HBP A;  1RAI B;  3PNW C;  4RTW A;  3UA6 A;  3KUF A;  4JJB A;  4FYY B;  2LNH B;  1NLP C;  3OW2 A;  1QKW A;  4M75 E;  2E4H A;  3RR6 A;  3QG1 A;  2QQA A;  5FU7 B;  4M7D A;  2GFA A;  4E7L A;  3M0S A;  1AOJ A;  2KRS A;  3QDR B;  3FDR A;  3L2Z A;  5LJ3 f;  2XDP A;  1R0C B;  5LJ3 g;  1X6G A;  2VKN A;  3EFO B;  2QTX A;  3X28 B;  3I55 Q;  1ZUY A;  3CC2 Q;  1YIT Q;  2WSC E;  2DL5 A;  4M75 C;  1VQO T;  1RAH B;  1D1C A;  5C6S A;  5HCK A;  3GLX A;  5GAN h;  3TSZ A;  1PKS A;  4ANJ A;  1UGP B;  1N8R R;  2AZS A;  1EIF A;  1W6X A;  2KVQ G;  3OYJ A;  1Q86 U;  4OMP A;  5GAO m;  1UHC A;  5FRO A;  2XIC A;  4BE2 A;  1X27 A;  2ECZ A;  4JZ4 A;  4N4H A;  2QI2 A;  2BZX A;  4LXC A;  4KT0 E;  4M7D E;  1UTI A;  3LH0 A;  4OGC A;  2XG8 D;  4YTL A;  5KYW A;  3Q1J A;  4DOW A;  1M2V A;  3NFC A;  1BI2 A;  2V8I A;  1VQK T;  5CAI A;  1PSE A;  2DXB A;  2YSQ A;  4JRK A;  4C8Q E;  2GQV A;  3X25 B;  5IT9 E;  2QGG A;  1I8F A;  1ZSZ C;  4A4K A;  1YJ9 T;  5FU6 C;  2CDT A;  2DIG A;  2E6N A;  4X1V A;  1MV3 A;  1BI3 A;  3HKS A;  1KD1 C;  4J6W A;  4LD9 K;  5I22 A;  2QEX Q;  2KT1 A;  1N8R C;  2L5Q A;  2JXB A;  3PTA A;  2MK5 A;  3M0Q A;  5KCH A;  4D8D A;  2E5K A;  2NUP B;  5I21 A;  2C0I A;  3P8D A;  4RKU E;  1SRL A;  4M7A C;  2D6F A;  1GBQ A;  1N27 A;  1WZO A;  2EYQ A;  4M78 G;  2RI2 A;  4RTZ A;  1KQS S;  2FHD A;  1SSH A;  4C92 G;  1R0B G;  5IHI A;  2ZPI B;  1QKX A;  4ZN3 A;  2D1X A;  1FXX A;  2DE0 X;  2FEI A;  4B9X A;  5CR2 A;  3L2U A;  2CP5 A;  2E12 A;  3M0P A;  4V2S A;  2CZ7 B;  3OYM A;  2DVJ A;  4MZT A;  2KAF A;  3NMZ C;  5GAN j;  1TUC A;  4M77 C;  2LT1 A;  2YUN A;  2V1Q A;  3CCJ T;  3EAE A;  5D6X A;  2EWN A;  4K11 A;  3V7R A;  5GAM g;  3OYL A;  5GAN 2;  1TUG B;  3JCM V;  2DEU A;  3H0I A;  4J9C A;  5LJ3 d;  2PTK A;  4PJL A;  2DXC A;  2ED0 A;  2OJ2 A;  4EMK A;  5ECA A;  2J6K A;  2A7Y A;  4FW2 A;  1FYN A;  1K9A A;  3HL8 A;  4X34 A;  3I56 Q;  1WQW A;  2KMT A;  2JVV A;  2F5T X;  1YIJ Q;  2X3W D;  5HK0 A;  3CPF A;  3CBO A;  5A2Q E;  3OYB A;  3VJP A;  2OTL A;  1I4K 1;  1PHT A;  4EMG A;  1SHF A;  3C94 A;  4PLL A;  4GBQ A;  5LJ5 e;  4R56 A;  2R57 A;  3QUI A;  4BI4 A;  3BDU A;  1OX8 A;  2B86 A;  2E5Q A;  2KXD A;  4HT9 A;  5A0G A;  2JTM A;  1T3L A;  3FB9 A;  1M4Z A;  2P4R A;  3OY9 A;  3CCL Q;  1GCP A;  3JCM g;  1O75 A;  3L2Q A;  1WHK A;  3HTR A;  1Y71 A;  2BUD A;  3QO3 A;  4XU1 A;  2YWW A;  3JCM Q;  1QQJ A;  2GGR A;  4RTX A;  5GAN 4;  3NTK A;  2CP7 A;  4JPB W;  5CIU A;  1BB9 A;  3TCJ A;  1IRE B;  4RG2 A;  1QVG S;  3RMS A;  2CS7 A;  4EMK C;  3CCJ A;  3EHR A;  1YHQ T;  1Q82 U;  1U8R A;  1Q82 C;  4AG2 C;  4F7U E;  3CD6 T;  2DZC A;  3LYI A;  1NLO C;  1K76 A;  1KD1 U;  2DYB A;  1VQ7 Q;  3PMI A;  2C06 A;  1VIE A;  2K5F A;  2RHU A;  3C95 A;  1ZSG A;  4C8Q G;  1SPK A;  4KRT A;  3JB9 J;  3CQT A;  3EH1 A;  2RJF A;  1YIT A;  1UUE A;  4CRI A;  3PT9 A;  5GAN 7;  3REB B;  2B8A A;  3QWX X;  4PFP A;  3VUZ A;  3OBY A;  4PL6 A;  3VS4 A;  4C0D C;  4OB1 B;  3M4G A;  2FZC B;  1X69 A;  4E7H A;  1PCX A;  2JT4 A;  3EFS A;  5DLQ E;  3MKD A;  2K7A A;  1IXD A;  3CC4 A;  2M1H A;  1OQK A;  1M1K R;  2FRW A;  2K6D A;  4ZN1 A;  1U3O A;  1G3Y A;  5GMK m;  1G83 A;  3PIO A;  1CKA A;  3OQ5 A;  4KUI A;  3OW2 S;  3QBY A;  3CCU T;  2W10 A;  4FM4 B;  1WNL A;  5KYW B;  2EBP A;  2J06 A;  1YWP A;  4JUV A;  3OYH A;  3JV3 A;  1F1B B;  3OMG A;  1VQM A;  2P0Q A;  5GAO r;  2RQV A;  3JCM f;  5GAM f;  4FCY A;  3FJP A;  2DYI A;  3J80 E;  4MMK A;  4BAC A;  4DQ2 A;  1WHH A;  2KDS A;  3E9G A;  3I56 A;  1WA7 A;  4FSS A;  4C5G A;  1JXM A;  2DL4 A;  1AZE A;  2MAM A;  2WAC A;  3VS1 A;  2OTJ A;  2EGC A;  3L2V A;  3PFS A;  4M78 C;  5CVI A;  4NL2 A;  1Q81 R;  3JCM J;  4FW1 A;  1AHJ B;  2BZY A;  4AFU C;  2DXU A;  4M75 A;  1M3A A;  4E2F B;  1LJO A;  1AZG B;  5J39 A;  1YIT T;  1ARK A;  2L3Q A;  1BK2 A;  2XID A;  5GAO p;  2EJF A;  2FZG B;  2RF0 A;  2VGM A;  3CD6 A;  2KXC A;  3EG3 A;  3FJ5 A;  2V8K A;  1IGU A;  3CMA A;  2J7I A;  3SB2 A;  2V8J A;  2QG9 B;  3CC4 Q;  1QCO A;  2KT8 A;  3JB9 D;  3KXT A;  3UF4 A;  2FVU A;  1WYX A;  3M55 A;  1KIK A;  4ORZ A;  1VIF A;  3UDC A;  4N0A C;  4HVV A;  2ZPB B;  3OSS C;  1M1G A;  2KBT A;  2RQW A;  3CCV Q;  2L0A A;  2DMO A;  1Z9Z A;  3S6W A;  3FC3 A;  2NWM A;  2GCX A;  1RAF B;  4M7A B;  2QDL A;  1VQ7 T;  1VQL T;  2JTE A;  4IUQ A;  2JNG A;  1XNI A;  2RQT A;  2QDY B;  4PJO F;  1WI7 A;  4IUT A;  4JS4 A;  5DM7 R;  4Z8A A;  3LX7 A;  1NYF A;  2E3I A;  3GP8 A;  3QZ9 B;  1W70 A;  2YLB A;  4N4G A;  2HQE A;  1IHW A;  1TU0 B;  1HK9 A;  1JU5 C;  4AFQ C;  1H3Z A;  3OYD A;  3EG9 A;  1EX4 A;  2DK3 A;  2JM9 A;  2RJD A;  4M77 B;  4FU6 A;  3G4S A;  3PIP A;  2RA2 A;  1RLQ C;  2DL8 A;  2RO0 A;  2FPD A;  8ATC B;  4HVW A;  4M77 G;  2X4J A;  1TXQ A;  5CKF A;  2J05 A;  4M7D C;  4PKC C;  1UGR B;  3I35 A;  4XK8 E;  2DL7 A;  4XTV A;  1QCN A;  3SFM A;  2KRO A;  4F7U A;  4ZTF A;  1RAG B;  3EFO A;  1YJN Q;  2COZ A;  2X3X D;  2HQH A;  5CKB A;  2AHJ B;  1E7O A;  1BYM A;  1YI2 A;  1Q81 C;  1VQL A;  1BCO A;  1Q82 R;  1X75 C;  1NM7 A;  2K4Y A;  1GFC A;  4E7I A;  3CBP A;  1NPP A;  3OMC A;  2I2L A;  4KGZ B;  1UJY A;  1VQ5 A;  5I11 A;  1YJN A;  1M3B A;  4HCC A;  4N0A A;  2JS0 A;  4A53 A;  1CKB A;  2LCL A;  2YRV A;  3JCM P;  4C8Q C;  3A8O B;  3QYH B;  4PNO A;  4ESR A;  4DBH A;  2GTJ A;  2DO3 A;  3DKM A;  1TOV A;  2HMA A;  5LJ5 g;  4F7U G;  1QVF P;  3QZ5 B;  2YLC A;  1WIE A;  4J7I A;  2F2V A;  4XTX A;  2KE9 A;  1M90 U;  2K5L A;  3G6E Q;  3CCR Q;  5GMK j;  1K0S A;  2O2O A;  1K4U S;  2IIM A;  2OI3 A;  3JCM W;  3REA B;  2CYZ B;  4RCB A;  3VU3 C;  4MDX A;  2CT3 A;  3R6O A;  3H41 A;  3JRZ A;  1Q7Y R;  2QA4 T;  2MF2 A;  2DL3 A;  1VQO A;  1LCK A;  1W2B A;  3RES A;  1WPY A;  2E41 A;  1I07 A;  3CCM A;  3H0F A;  1QVG A;  2VVK A;  5KYU A;  1M1K U;  1I1J A;  4M7D D;  3QWY A;  3OS2 A;  2M51 A;  3NTI A;  3JCM c;  3WVD B;  2HZY A;  4FT4 A;  1JJ2 S;  2ESW A;  1MNE A;  5J26 A;  5GAN g;  4ZNX A;  4Z89 A;  1VQM T;  2CP0 A;  3M57 A;  4C8Q B;  4M7A F;  2QQR A;  2H8H A;  2OX7 A;  3DB4 A;  3D7S B;  5EG2 A;  1N9S A;  2EKH A;  1NPR A;  1RLP C;  1VQ4 Q;  2RNA A;  2FPE A;  3LWH A;  2H3J A;  2DAQ A;  2R5A A;  1PG5 B;  2WSF E;  4F04 B;  5LJ3 h;  1A0N B;  2ROT A;  2P84 A;  2EGE A;  5KYX B;  2LX7 A;  2H3E B;  2YUQ A;  4ZGD B;  1GL5 A;  2OTJ T;  2DD5 A;  1QVF A;  2F2X A;  4C5E A;  1HXD A;  2ED1 A;  1KQS P;  4C8Q A;  3MJX A;  4F16 A;  2OTJ Q;  1K9M R;  3OYG A;  3FEO A;  2V26 A;  3U23 A;  2A3L A;  3VYH B;  2K3Y A;  2E70 A;  5GJV B;  1OPL A;  3M5A A;  4B9W A;  1D3B A;  1BIB A;  2JTF A;  1YP5 A;  3MP8 A;  3JCM d;  2LX9 A;  4ATO A;  5HK3 A;  2JMC A;  3SDZ A;  2Y4Y A;  3X24 B;  1BIA A;  2JW4 A;  2YUO A;  1D1B A;  2EFI A;  2EYW A;  3O5Z A;  4FYV B;  4C0G A;  1VQP Q;  1IRX A;  3MEU A;  1I0C A;  3RUX A;  2QK0 A;  2FL7 A;  4IIO A;  2CUD A;  2VV5 A;  4DEY A;  4BE0 A;  4LDU A;  3H8Z A;  4OF1 A;  2LCC A;  4FYW B;  1RAA B;  2KEA A;  1OZ3 A;  2DEQ A;  2EKO A;  3VS6 A;  4NS5 A;  1HSQ A;  2CZ6 B;  2NUT A;  1K9M C;  2PNI A;  1KG1 A;  2K3B A;  4IIM A;  1JXO A;  1K8A R;  1YHQ Q;  4J6X A;  4M7D G;  3V8L A;  4QKU A;  4DBQ A;  3R6N A;  5GAM j;  1U5S A;  1IB8 A;  1V76 A;  4CI0 C;  4MZM A;  3EGX B;  1QW1 A;  1VQO Q;  1CSK A;  4RMO A;  4JJN K;  3M58 A;  1B3Q A;  4OMN A;  4MML A;  3RKY A;  2ZPG B;  5LJ3 j;  1Q95 G;  4F7U B;  2M0O A;  1WFW A;  3P8B B;  3I55 T;  2E3H A;  4DOV A;  1W2B P;  3JSC A;  1X43 A;  5GAN e;  1BU1 A;  4M78 D;  1QMC A;  2EPD A;  1ZA2 B;  2JOY A;  2DM1 A;  4BDY A;  4R0K A;  3P8H A;  1BI0 A;  3CME A;  3CCL T;  2ZPF B;  5GAO n;  2E65 A;  3BY7 A;  3F70 A;  3VS5 A;  3A1P A;  2K3X A;  4FL6 A;  3SEM A;  4BY6 C;  2LQN A;  2FPF A;  3CCS T;  4PK4 A;  1ZLM A;  5AT1 B;  4KBM B;  4BE1 A;  1KQS A;  1M9S A;  5I2S A;  1M5Q 1;  1VQN Q;  2GTO A;  2HNI A;  2IVW A;  3AT1 B;  2R5M A;  4N4I A;  4XTZ A;  3WXM B;  4LE9 A;  2OTL Q;  3LH5 A;  1N6A A;  2F69 A;  2BE9 B;  3GNF B;  4QT7 A;  3TRE A;  4Z02 A;  2D0Q B;  5IXB A;  1TWB A;  3RIR A;  2QTV A;  1WXT A;  4OML A;  4KUD K;  3QKJ A;  1AT1 B;  3C0C A;  1YIJ T;  5IHK A;  1YI2 Q;  2O4X B;  2PQW A;  3CMA Q;  2QEX T;  2IG0 A;  1KC8 R;  1MHN A;  1UG1 A;  3NGP A;  3CC2 T;  4JJC A;  1RL2 A;  3CCQ T;  2HKQ B;  4IUV A;  4C5I A;  1S72 T;  1VQ6 T;  2Z0W A;  1XOV A;  4XQ3 A;  2VYT A;  2PVG B;  3BW1 A;  4QQ6 A;  2CP3 A;  2GBQ A;  2W0Z A;  3MO8 A;  2D9T A;  4BY6 B;  1IZ6 A;  1GCQ A;  1WHJ A;  2MI6 A;  3N5B B;  4JDS A;  2VWF A;  4CC4 B;  4DEX A;  4F7U F;  2LC4 A;  3OS5 A;  3OS1 A;  1D3B B;  2LNV A;  2AKL A;  1LOJ A;  2C0O A;  5LJ5 d;  3EH2 A;  4J9B A;  3E9F A;  3FRN A;  3L2R A;  1WX6 A;  1VQM Q;  1VOM A;  4WF2 A;  4E7J A;  3CC7 Q;  2EQJ A;  2HAX A;  1UEC A;  2CZ0 B;  1OYX A;  1PRM C;  2HCK A;  4J7F A;  2O9S A;  4E6R A;  3CCM Q;  2JMA A;  3C4S A;  4QQG A;  3OYI A;  5LL6 S;  2LQW A;  3PGG A;  2DX1 A;  1C6V X;  1AVZ C;  1NBE B;  4IUP A;  3I55 A;  4JLI A;  3CCM T;  1Z9Q A;  3CC7 A;  3ZEH A;  3OB9 A;  4RUG A;  2MWO A;  2RMO A;  1RAE B;  1ZA1 B;  1VQ9 Q;  3JB9 G;  2HSP A;  4WCI A;  1D0Z A;  1VYT A;  1QP2 A;  3SWN C;  2GQI A;  2DIQ A;  2XK0 A;  3GPL A;  2L3S A;  2QQ9 A;  2DRK A;  2MMP A;  5GJW B;  3SHW A;  2KR3 A;  4LNP A;  1M8M A;  1E6H A;  1K9M U;  4PFO A;  5CKH A;  1NZ9 A;  4FYX B;  1MV0 B;  5KYY A;  1Q86 R;  2DVE A;  2K9G A;  2HKN A;  3LW5 E;  2E64 A;  3JCM X;  4J6Y A;  3LGL A;  3OA6 A;  1T0H A;  1ABQ A;  2HD0 A;  2PZ1 A;  2VGN A;  2G3R A;  2DZ9 A;  4JS5 A;  2JJ9 A;  1I5O B;  3VS3 A;  4PJO G;  4VUB A;  1TTH B;  1KC8 C;  2XHC A;  1NJI U;  4OVA A;  5CK9 A;  4J9F A;  1SEM A;  4JZ3 A;  1ZSZ B;  4FSX A;  3M9Q A;  1YI2 T;  3TU4 K;  1SG5 A;  7AT1 B;  2VAS A;  4M7A A;  1JEG A;  3G1J A;  2VXF A;  2LCS A;  2LTO A;  5IXF A;  2BIV A;  3HFO A;  5D6W A;  4CC2 A;  4A54 A;  2EQK A;  1VQN T;  2O31 A;  1VYV A;  2QQS A;  4J9E A;  2QYZ A;  2RJC A;  3TSW A;  2NYS A;  3RDV A;  1R77 A;  5GAO l;  1FX7 A;  3CME Q;  1YBY A;  2ROL A;  2FO0 A;  1O9S A;  4M7D F;  4PJO C;  3MEA A;  3EG1 A;  5A0L A;  2X51 A;  2CZ1 B;  2RHX A;  1HJD A;  4GLK A;  1M90 R;  5AYF A;  4GLM A;  1ZUU A;  1YFN A;  3CCU Q;  3CMA T;  3UPU A;  4HT8 A;  5KYX A;  2PU9 B;  1QVP A;  1QWF A;  2RI3 A;  4ELZ C;  5C0M A;  3CCJ Q;  1AWW A;  1B34 A;  5FLX E;  4HKE A;  2DET A;  2A0F B;  1C0M A;  2EGA A;  5HY6 A;  4PJO E;  1TUD A;  2COY A;  3CCE A;  3CCL A;  4C0Z A;  3IQL A;  3ZFJ A;  1N8R U;  4OMQ A;  3JB9 F;  4L6V 5;  2FYK A;  3OYF A;  1UFF A;  3JCM b;  4M75 B;  3CCS Q;  1H64 1;  1SRM A;  2DNU A;  4ZTJ A;  4C0F A;  1VQ9 T;  1BBZ A;  2F5K A;  4M7D B;  1M90 C;  4KH0 B;  4A4F A;  2XI9 A;  4X9D A;  4OB3 B;  2A36 A;  4PLI A;  4M7A G;  5L23 A;  3OYK A;  1JJ2 A;  1YJW T;  2E1H A;  4JRI A;  2BZ8 A;  4MZP A;  3CCS A;  2FB7 A;  2DTH A;  1RAB B;  2QEX A;  2VUB A;  4EPC A;  1D0Y A;  5GMK l;  1WXU A;  1FMW A;  1JJ2 P;  5CQY A;  4ZGJ B;  3A8G B;  1KD1 R;  3C12 A;  3PMT A;  3QXE B;  2AZV A;  2LJ0 A;  3A5Z B;  1Y96 B;  4RTT A;  3BDL A;  3EG2 A;  3INZ A;  3VUB A;  1VQ5 Q;  2ENM A;  2K2M A;  2A08 A;  4L5G A;  1B07 A;  4XU3 A;  4A63 B;  2ABL A;  1PWT A;  1NE8 A;  1HD3 A;  1LNX A;  1WJQ A;  3EG0 A;  3L1A A;  4NL3 A;  3LWI A;  2MYS A;  9ATC B;  2DA9 A;  1MMN A;  1VA7 A;  1MMG A;  5I2M A;  2QAZ A;  3FLG A;  5GAM d;  3S3M A;  4O5V A;  3M59 A;  1YHQ A;  3JAM E;  3RER A;  4KUL A;  1NG2 A;  2EQI A;  1MGQ A;  2X35 A;  4ELY C;  2EAY A;  3CC7 T;  1M8V A;  4C8Q D;  4E7Z A;  1GCQ C;  5GMK e;  3G6E T;  3G71 Q;  1XTD A;  3I56 T;  1E6G A;  1KHI A;  2YHT A;  3M4Y A;  3GF5 A;  3G7Z A;  2K57 A;  1KK7 A;  1C1A A;  4A4G A;  1D09 B;  1TSF A;  2DTO A;  1M30 A;  2KQW A;  4OB0 B;  2PVO B;  4QQD A;  4E47 A;  3DLL A;  4JLG A;  4C92 D;  2GF7 A;  1RI0 A;  3RNJ A;  1M1K C;  1QCF A;  4AFS C;  1R8O B;  4M75 F;  1XQH A;  4J9G A;  5GMK i;  3OSV A;  1VQ5 T;  3JCM e;  1WQ7 A;  4M78 A;  2DRM A;  2SEM A;  1BKB A;  2ZPH B;  1OOT A;  4PJM A;  3CCQ Q;  4FIB A;  1SKU B;  2ZZD A;  3V7S A;  2A37 A;  1QLY A;  8AT1 B;  4BUG A;  1TG0 A;  4RTY A;  2KK4 A;  4OMF B;  1OEB A;  4Z88 A;  3OYE A;  5KYU B;  2SRC A;  4JRQ A;  1KQ2 A;  4E7S A;  2Y90 A;  2ZCF B;  1PKT A;  3QJ6 A;  4KGV B;  2CUB A;  3PVL A;  2ZAE A;  4QW2 A;  1YWO A;  4FT2 A;  4BI3 A;  4OP0 A;  2XKO C;  5J3B A;  2DF6 A;  4M77 F;  5GAN 8;  3TVT A;  3V8J A;  3MHX A;  3M0R A;  2QXF A;  3X20 B;  2DBK A;  2M9U A;  1VQ4 A;  1V1C A;  4LDX A;  1P92 A;  3HHT B;  2DXT A;  4PJO A;  3EGD B;  4II1 A;  4XTU A;  1WHG A;  1WDX A;  2LZ6 B;  4GY5 A;  2K2V A;  3HRS A;  4CC3 A;  3VYG A;  1GFD A;  1NEG A;  2KRN A;  3BE3 A;  3T9N A;  2XMF A;  2CKK A;  2ZPE B;  3M0U A;  3ZL7 C;  3CCR T;  1VQK Q;  1NYG A;  1VQ4 T;  1OI1 A;  1VQ7 A;  3EGD A;  4M78 E;  1Y57 A;  5CCA A;  2QGF B;  1IGQ A;  4M78 F;  4TVR A;  1XJW B;  2CGH A;  3CXC A;  6AT1 B;  2MIO A;  1PM3 A;  2IPO B;  4J8O A;  2L3R A;  1QVG P;  1LVK A;  5CKD A;  2RQR A;  4BD3 A;  2EYY A;  2DJZ A;  1DJ7 B;  3E2U A;  3CXC P;  1FMV A;  2AIR B;  2HL3 A;  1RUW A;  4BB7 A;  3CCQ A;  1EFN A;  4LDV A;  1K8A U;  2P0K A;  1T3S A;  3OS0 A;  1VQ8 T;  1YJ9 A;  2FRY A;  2NUT B;  5KYY B;  2KSS A;  5IH2 A;  3CCV A;  3I5S A;  3GOX A;  4BDZ A;  5GAM h;  3V8K A;  1K73 U;  5CO7 A;  2CT4 A;  4M77 E;  4RCC A;  3NTH A;  1VQL Q;  3O8V A;  3MEW A;  1VQK A;  1ZHI A;  1K73 R;  5LJ5 f;  4C92 C;  2LDM A;  2CP6 A;  4O6J A;  1H92 A;  3S3N A;  2OAU A;  3LLR A;  4J5Y A;  2MWP A;  3J7A F;  3MEV A;  3EG9 B;  1PRL C;  1PC0 A;  1S72 A;  1VQ6 A;  4WTO B;  2CH4 A;  1ZX6 A;  4HVU A;  4PJJ A;  3CEY A;  1YJW A;  3CME T;  2K5I A;  1MMD A;  5LJ5 j;  3E19 A;  2RB6 A;  3KBG A;  3OYC A;  4EMK B;  3J81 E;  5GAN 3;  2DTI A;  1NJI R;  3CBM A;  3VS2 A;  1UHF A;  1G5V A;  2A28 A;  2X4X A;  1VQP T;  4PJO D;  2NUP A;  5KCO A;  4DBR A;  4D6W A;  2WSE E;  1JRI A;  5FWB A;  4UC4 A;  3SWN A;  2MCN A;  4IUR A;  1H3H A;  1M1F A;  5DY9 A;  1QWE A;  1YCS B;  5FWC A;  2BKD N;  4IUU A;  1UGS B;  2YRD A;  1PSF A;  1OUL A;  3URG A;  2G6F X;  2RM4 A;  2M0Y A;  3NHN A;  1QVF S;  3THK A;  2XD0 A;  4MDW A;  2EVR A;  2EYZ A;  3CCU A;  3EGX A;  2PUK B;  1SF9 A;  4P5N A;  4HA8 A;  1SSF A;  2JUF A;  2KYB A;  1IO6 A;  2KRM A;  1G8X A;  3FIF A;  4Y92 A;  1M27 C;  2YXY A;  3GIB A;  3L42 A;  2L89 A;  2V1R A;  4PJN A;  4B6M A;  4L59 A;  1VQN A;  1K1Z A;  2LMJ A;  3CPW S;  2COW A;  4X9C A;  5L8R E;  3L2W A;  3LGF A;  1AWJ A;  3QDF A;  2DBM A;  4RTU A;  4C8Q F;  1N5Z A;  3MET A;  2NUZ A;  3OYN A;  3CC2 A;  1K0X A;  4DA4 A;  1ZBJ A;  2J6O A;  1VQ8 Q;  2Y4X A;  1W2B S;  2LP5 A;  2FG0 A;  2M02 A;  1UEB A;  2F2W A;  1W4S A;  4OB2 B;  4XU2 A;  1GXI E;  5LJ5 h;  4LN2 A;  2LQ8 A;  4M7A E;  3CC4 T;  1AD5 A;  3G4S T;  3ZBD A;  5IAY A;  1JBM A;  2RD1 A;  2X9H A;  1K73 C;  3QJY A;  1D1A A;  3QYG B;  1PD0 A;  5GAO q;  1M3C A;  4XAX B;  2AT1 B;  5M9O A;  3OYY A;  3SWN B;  3JB9 H;  2YRC A;  1G3T A;  1S1N A;  1GBR A;  4M75 G;  3ASK A;  3MPU B;  1GRI A;  4LDW A;  1WHL A;  3HP9 A;  4LUD A;  2LQK A;  3VV0 A;  1I81 A;  1WJS A;  2GNC A;  2NLU A;  1WJR A;  1T0J A;  5CKE A;  2XDD A;  3QII A;  1KC8 U;  3CPW A;  5FU6 B;  2LJ3 A;  2OAW A;  2QA4 Q;  3PVQ A;  1OV3 A;  1EZZ B;  1VQ9 A;  3QPH A;  3OW2 P;  3VS7 A;  5GAM e;  2X4W A;  1KFZ A;  2HEQ A;  2P0P A;  4F17 A;  1AEY A;  3S3O A;  1Q86 C;  1ZUK A;  2FZK B;  2CRE A;  2EYX A;  4C92 E;  2KGT A;  4J83 A;  2O88 A;  3UT1 A;  2XDB A;  2KYM A;  3HPW A;  2GFU A;  3UA7 A;  2O9V A;  2YDL A;  1X2K A;  1U06 A;  1I5L A;  1MMA A;  4Y28 E;  2QAS A;  3HSB A;  2L8D A;  4EIK A;  1PNJ A;  4C5H A;  2AK5 A;  3G71 T;  4CC7 A;  4QVC A;  2P4T A;  2CP2 A;  2LVM A;  4LD6 A;  1Q7Y U;  3MP1 A;  1G3W A;  1Y96 A;  4M77 A;  3EGU A;  2DLP A;  2EQM A;  2RN8 A;  2ZGW A;  3G6E A;  4OMO A;  2JM8 A;  1RAD B;  4DBF A;  2XU8 A;  1ZBX A;  3ME9 A;  3A8L B;  3TQ7 P;  1H8K A;  1VQ8 A;  4M4Z A;  2HBW A;  2PUO B;  1UDL A;  2EW3 A;  1Y07 A;  5CQX A;  1YCY A;  1WLP B;  4JJD A;  3VRZ A;  4C92 A;  1M2O A;  3QSU A;  2VB6 A;  4XTY A;  1MND A;  3V7C A;  2DIL A;  4HCK A;  3H6Z A;  1TS9 A;  3A8H B;  4KH1 B;  3HFN A;  1X6B A;  4AMC A;  1OX9 A;  2RK1 A;  2E6Z A;  4LUE A;  2YUP A;  1OU8 A;  3E1S A;  2J6F A;  1UE9 A;  3RMQ A;  3G71 A;  4HCZ A;  1G2B A;  4Y91 A;  4M75 D;  2EQU A;  1VQP A;  3OYA A;  4RTV A;  3A8M B;  4C92 B;  3ULR B;  1B34 B;  1AWO A;  1UGV A;  2VC8 A;  2LT4 A;  4HCB A;  2RJE A;  1UGQ B;  1YIJ A;  4RG8 A;  5D7U A;  3UWN A;  3MCA B;  4J9I A;  1JB0 E;  1RI9 A;  1BCM A;  1Q81 U;  2CH4 W;  2CSI A;  2EIF A;  1UJ0 A;  4AG1 C;  5GAN 5;  3UAT A;  2MPX C;  3HRT A;  3H9N A;  1ACM B;  1VUB A;  2KY9 A;  5FW9 A;  5KE3 A;  4PFZ A;  2DD4 A;  2DER A;  3WVE B;  3G4S Q;  1KQ1 A;  3PE0 A;  4A4E A;  2LRQ A;  1J3T A;  1ABO A;  2MOX A;  2HL5 C;  4M77 D;  2HSE B;  1N9R A;  1AWX A;  4E7K A;  1MUZ A;  3VRY A;  5FRN A;  1X01 A;  3M56 A;  1NEB A;  5GAN d;  4XU0 A;  4IKF A;  1Y7X A;  4AT1 B;  4OMM A;  4D8K A;  3CCE T;  1OU9 A;  1NJI C;  3KFV A;  1W1F A;  1M2V B;  2M16 A;  3QHS A;  3GNG A;  1IHV A;  4NOY A;  4QVD A;  1G3S A;  4QVZ A;  2R58 A;  3CCE Q;  3M54 A;  5KE2 A;  1YN8 A;  4HXJ A;  4M7A D;  4KGX B;  5FRM A;  1Y0M A;  2EJ9 A;  2YT6 A;  1WXB A;  1YJ9 Q;  1WGS A;  5EC7 A;  2KI7 A;  2RHZ A;  3HRU A;  4JRP A;  2F1L A;  4ZGE B;  3CXC S;  4OGE A;  5FU7 C;  3VS0 A;  2RH2 A;  2HDA A;  3DLM A;  1K8A C;  1HYO A;  1YJN T;  3JB9 I;  2BE7 D;  4R55 A;  1Q7Y C;  1U1S A;  4A4H A;  1LPL A;  1PD1 A;  2BTT A;  3ER0 A;  3RKW A;  4EMH A;  1SHG A;  4J9D A;  3CPW P;  2DFU A;  3CCR A;  2L3P A;  4AFZ C;  2AKK A;  4XTW A;  2JZ2 A;  1VYU A;  1UB4 A;  2DJQ A;  2O4X A;  3MP6 A;  3I9Q A;  3OBW A;  2DPP B;  4ME7 A;  2RQU A;  4Q5W A;  3NPF A;  2ATC B;  1X2Q A;  3EHQ A;  3SD4 A;  3M53 A;  2RPN A;  1OPK A;  3H0H A;  5DLO A;  1V29 B;  2O01 E;  5GAN f;  1YJW Q;  5KH6 A;  1QP3 A;  2JN0 A;  2X4Y A;  3RBB B;  1ZQ1 A;  2PVD B;  5LJ3 e;  2D0N A;  2D8J A; 
#chains in the Genus database with same CATH homology
 5GAO p;  2EJF A;  2EQJ A;  3CCV A;  2HAX A;  2VGM A;  2CZ0 B;  1OYX A;  4M78 B;  3GOX A;  1OZ2 A;  2EJG A;  3JCM h;  4J7F A;  4BDZ A;  5GAM h;  3CD6 A;  3V8K A;  2RHY A;  5CO7 A;  1BI1 A;  1K73 U;  2V8K A;  4M77 E;  4RCC A;  3NTH A;  3CMA A;  3O8V A;  1TH7 A;  3MEW A;  1VQK A;  3C4S A;  1ZHI A;  4QQG A;  3OYI A;  5LJ5 f;  5LL6 S;  4C92 C;  2LDM A;  3PGG A;  3SB2 A;  2V8J A;  4O6J A;  2E10 A;  3S3N A;  2OAU A;  4EDU A;  2RK2 A;  4IUP A;  5D6Y A;  3I55 A;  4JLI A;  2FVU A;  5IN1 A;  3KXT A;  3JB9 D;  3M55 A;  3LLR A;  4J5Y A;  1VIF A;  5GMK h;  2OTL T;  3CCM T;  1U1T A;  2MWP A;  3UDC A;  5A0D A;  3DB3 A;  4N0A C;  3CCV T;  3J7A F;  1FWZ A;  2DKG A;  1KHC A;  3MEV A;  2ZPB B;  3OSS C;  1M1G A;  5GAN 6;  2HQX A;  3CC7 A;  3ZEH A;  3OB9 A;  2QQB A;  2MWO A;  1S72 A;  1VQ6 A;  3X26 B;  3S6W A;  3FC3 A;  2RI5 A;  3CEY A;  2RHI A;  2GCX A;  4M7A B;  1YJW A;  3CME T;  2K5I A;  5LJ5 j;  2QA4 A;  3E19 A;  1X6O A;  3JB9 G;  2RB6 A;  4C0D B;  1VQ7 T;  1VQL T;  1QP2 A;  3KBG A;  4IUQ A;  3SWN C;  2JNG A;  3OYC A;  4EMK B;  3J81 E;  1XNI A;  2XK0 A;  2DIQ A;  3GPL A;  2QDY B;  4PJO F;  2QQ9 A;  5GAN 3;  2DTI A;  3EFR A;  4IUT A;  5DM7 R;  4JS4 A;  3CBM A;  3LX7 A;  4BI8 B;  1G5V A;  2MMP A;  2X4X A;  3GP8 A;  3QZ9 B;  1VQP T;  4LDY A;  4PJO D;  2YLB A;  5KCO A;  3RKX A;  3VKI A;  4D6W A;  2WSE E;  5HKC A;  1JRI A;  4N4G A;  5CKH A;  2HQE A;  1K9M U;  4UC4 A;  3SWN A;  1NZ9 A;  2VXE A;  4IUR A;  1HK9 A;  1H3Z A;  1M1F A;  4PJO B;  3OYD A;  3TEE A;  5DY9 A;  4C92 F;  2DVE A;  2BKD N;  3LW5 E;  3AHU A;  4IUU A;  2E64 A;  1UGS B;  1PSF A;  2DK3 A;  4M77 B;  2RJD A;  3BFM A;  2HBP A;  3LGL A;  4J6Y A;  3URG A;  4FU6 A;  3PNW C;  3JCM X;  3G4S A;  3OA6 A;  3PIP A;  2RA2 A;  2RM4 A;  3KUF A;  2RO0 A;  1QVF S;  2HD0 A;  2VGN A;  4M77 G;  2XD0 A;  2X4J A;  4MDW A;  2G3R A;  3OW2 A;  2DZ9 A;  5CKF A;  4JS5 A;  4M75 E;  3CCU A;  2PUK B;  4M7D C;  4P5N A;  4VUB A;  4PJO G;  1KC8 C;  2XHC A;  4HA8 A;  1SSF A;  1UGR B;  4PKC C;  1NJI U;  4OVA A;  2JUF A;  3QG1 A;  4XK8 E;  5CK9 A;  2QQA A;  3FIF A;  5FU7 B;  4M7D A;  2GFA A;  4XTV A;  4E7L A;  4FSX A;  3M9Q A;  3QDR B;  3SFM A;  1YI2 T;  3TU4 K;  4F7U A;  3FDR A;  3L2Z A;  5LJ3 f;  2XDP A;  3GIB A;  4M7A A;  4ZTF A;  3L42 A;  5LJ3 g;  2L89 A;  2VXF A;  2QTX A;  4L59 A;  1VQN A;  2LTO A;  3X28 B;  2BIV A;  3CPW S;  4X9C A;  3HFO A;  5L8R E;  5D6W A;  3L2W A;  3LGF A;  4A54 A;  2WSC E;  5CKB A;  2EQK A;  2AHJ B;  1VQN T;  4C8Q F;  3MET A;  4M75 C;  1VQO T;  2QQS A;  2RJC A;  1BYM A;  5C6S A;  1YI2 A;  3GLX A;  3OYN A;  1Q81 C;  1VQL A;  5GAN h;  3CC2 A;  1X75 C;  4DA4 A;  2K4Y A;  5GAO l;  1UGP B;  4E7I A;  3CBP A;  1FX7 A;  1EIF A;  1NPP A;  2Y4X A;  3OMC A;  1W2B S;  2I2L A;  2KVQ G;  3OYJ A;  1YJN A;  1Q86 U;  1VQ5 A;  1YBY A;  5GAO m;  5FRO A;  4HCC A;  4N0A A;  4A53 A;  2XIC A;  4BE2 A;  1O9S A;  1UEB A;  4M7D F;  2LCL A;  4N4H A;  2YRV A;  3MEA A;  4PJO C;  2QI2 A;  3JCM P;  5A0L A;  4C8Q C;  1W4S A;  4OB2 B;  4KT0 E;  4M7D E;  2CZ1 B;  2RHX A;  3A8O B;  4XU2 A;  3LH0 A;  5LJ5 h;  1GXI E;  4OGC A;  3QYH B;  2LQ8 A;  2XG8 D;  4PNO A;  4YTL A;  4M7A E;  3CC4 T;  4GLK A;  3G4S T;  5AYF A;  3ZBD A;  5IAY A;  2DO3 A;  3Q1J A;  1JBM A;  2RD1 A;  3DKM A;  4DOW A;  5LJ5 g;  4F7U G;  3QZ5 B;  2YLC A;  1K73 C;  3NFC A;  3QJY A;  3QYG B;  1BI2 A;  2V8I A;  3CMA T;  1VQK T;  5CAI A;  3UPU A;  4J7I A;  4HT8 A;  1PSE A;  4XTX A;  2PU9 B;  5GAO q;  4XAX B;  1M90 U;  5M9O A;  2DXB A;  3OYY A;  4JRK A;  3SWN B;  1QVP A;  2GQV A;  2K5L A;  3X25 B;  1G3T A;  4C8Q E;  3JB9 H;  2RI3 A;  4ELZ C;  5IT9 E;  1I8F A;  5C0M A;  5GMK j;  4A4K A;  1B34 A;  1YJ9 T;  5FLX E;  4HKE A;  5FU6 C;  4M75 G;  2DIG A;  3JCM W;  2CYZ B;  2E6N A;  3ASK A;  4RCB A;  5HY6 A;  4PJO E;  3VU3 C;  4MDX A;  4LDW A;  1BI3 A;  3R6O A;  3HP9 A;  3HKS A;  3CCE A;  2LQK A;  3VV0 A;  3CCL A;  4C0Z A;  1KD1 C;  4J6W A;  1I81 A;  4LD9 K;  3JRZ A;  1WJS A;  3ZFJ A;  2NLU A;  1N8R U;  2QA4 T;  2MF2 A;  1N8R C;  2L5Q A;  1WJR A;  3JB9 F;  4L6V 5;  3PTA A;  2FYK A;  5CKE A;  3OYF A;  2XDD A;  3QII A;  1VQO A;  3JCM b;  3CPW A;  1KC8 U;  1W2B A;  5KCH A;  4M75 B;  5FU6 B;  1H64 1;  3RES A;  1WPY A;  5I21 A;  2E41 A;  3P8D A;  3CCM A;  1QVG A;  4RKU E;  4ZTJ A;  1VQ9 A;  4C0F A;  3QPH A;  1VQ9 T;  1M1K U;  4M7D D;  4M7A C;  2D6F A;  3OS2 A;  2F5K A;  5GAM e;  2X4W A;  3NTI A;  1N27 A;  4M7D B;  3JCM c;  3WVD B;  2EYQ A;  1M90 C;  4M78 G;  4FT4 A;  1JJ2 S;  2P0P A;  4A4F A;  2RI2 A;  2XI9 A;  1KQS S;  3S3O A;  4X9D A;  1Q86 C;  4OB3 B;  5J26 A;  2FHD A;  5GAN g;  4C92 G;  4C92 E;  2ZPI B;  1VQM T;  3M57 A;  4J83 A;  4PLI A;  4C8Q B;  4ZN3 A;  4M7A G;  1FXX A;  4M7A F;  3OYK A;  2QQR A;  1JJ2 A;  3DB4 A;  1YJW T;  2E1H A;  5EG2 A;  3UT1 A;  4B9X A;  5CR2 A;  4JRI A;  3L2U A;  1N9S A;  2XDB A;  4MZP A;  3CCS A;  2E12 A;  3HPW A;  2GFU A;  1NPR A;  2FB7 A;  2DTH A;  4V2S A;  3LWH A;  2CZ7 B;  3OYM A;  2H3J A;  2DAQ A;  2R5A A;  2QEX A;  1I5L A;  4Y28 E;  2WSF E;  3HSB A;  2VUB A;  4MZT A;  2KAF A;  4EPC A;  5GMK l;  5GAN j;  2L8D A;  5LJ3 h;  4C5H A;  4M77 C;  2LT1 A;  5CQY A;  4ZGJ B;  3G71 T;  3A8G B;  4QVC A;  2P4T A;  2LVM A;  3C12 A;  4LD6 A;  4ZGD B;  3MP1 A;  1Q7Y U;  1G3W A;  1Y96 A;  3PMT A;  3QXE B;  4M77 A;  3CCJ T;  2OTJ T;  3A5Z B;  1Y96 B;  2DD5 A;  3EAE A;  5D6X A;  1QVF A;  2EWN A;  3V7R A;  5GAM g;  3BDL A;  3OYL A;  5GAN 2;  3INZ A;  2EQM A;  3JCM V;  4C5E A;  3VUB A;  2ZGW A;  1HXD A;  4C8Q A;  3G6E A;  5LJ3 d;  4L5G A;  3OYG A;  4XU3 A;  3FEO A;  2DXC A;  2A3L A;  2XU8 A;  1ZBX A;  3ME9 A;  3VYH B;  2K3Y A;  1NE8 A;  3A8L B;  1VQ8 A;  2E70 A;  1LNX A;  1WJQ A;  3L1A A;  4NL3 A;  3LWI A;  2PUO B;  4EMK A;  2A7Y A;  3M5A A;  1Y07 A;  3HL8 A;  4B9W A;  1D3B A;  1YCY A;  5CQX A;  1BIB A;  2JTF A;  5I2M A;  4X34 A;  3FLG A;  5GAM d;  3MP8 A;  3JCM d;  3S3M A;  4O5V A;  2LX9 A;  1WQW A;  4C92 A;  4ATO A;  5HK3 A;  2KMT A;  2JVV A;  2F5T X;  3SDZ A;  3M59 A;  2Y4Y A;  3X24 B;  1BIA A;  1YHQ A;  3JAM E;  3RER A;  4KUL A;  3QSU A;  2EFI A;  5HK0 A;  3CPF A;  1MGQ A;  4C0G A;  3CBO A;  2X35 A;  4ELY C;  2EAY A;  4XTY A;  5A2Q E;  3CC7 T;  4C8Q D;  3OYB A;  1M8V A;  3VJP A;  3MEU A;  3RUX A;  2OTL A;  3V7C A;  5GMK e;  3G6E T;  1XTD A;  1I4K 1;  3I56 T;  4EMG A;  1KHI A;  2YHT A;  3H6Z A;  3C94 A;  3GF5 A;  3M4Y A;  4PLL A;  2FL7 A;  3G7Z A;  2K57 A;  3A8H B;  3HFN A;  4A4G A;  5LJ5 e;  4R56 A;  2R57 A;  2DTO A;  2RK1 A;  3QUI A;  4BI4 A;  2E6Z A;  2VV5 A;  2KQW A;  3BDU A;  4OB0 B;  2PVO B;  3E1S A;  4LDU A;  4QQD A;  4E47 A;  4BE0 A;  3H8Z A;  3DLL A;  2E5Q A;  4JLG A;  3RMQ A;  4OF1 A;  4C92 D;  3G71 A;  2LCC A;  2GF7 A;  4HCZ A;  1RI0 A;  4HT9 A;  4Y91 A;  4M75 D;  1M1K C;  5A0G A;  2EQU A;  1OZ3 A;  2JTM A;  1VQP A;  2DEQ A;  1M4Z A;  2EKO A;  3FB9 A;  1R8O B;  4NS5 A;  3A8M B;  3OY9 A;  3OYA A;  2CZ6 B;  4C92 B;  1K9M C;  1B34 B;  1XQH A;  4M75 F;  1KG1 A;  5GMK i;  3JCM g;  1O75 A;  2VC8 A;  3OSV A;  3L2Q A;  1VQ5 T;  2LT4 A;  3JCM e;  4HCB A;  2RJE A;  1WQ7 A;  1UGQ B;  4J6X A;  1YIJ A;  4RG8 A;  4M7D G;  3V8L A;  4M78 A;  5GAM j;  1Y71 A;  3UWN A;  1BKB A;  2ZPH B;  3MCA B;  2BUD A;  3QO3 A;  1JB0 E;  4FIB A;  4CI0 C;  4MZM A;  4XU1 A;  2ZZD A;  3V7S A;  3JCM Q;  4BUG A;  1QW1 A;  1Q81 U;  2KK4 A;  2EIF A;  4OMF B;  5GAN 5;  4RMO A;  4JJN K;  3M58 A;  5GAN 4;  3HRT A;  3OYE A;  1VUB A;  4MML A;  3RKY A;  3NTK A;  2ZPG B;  2KY9 A;  5KE3 A;  5LJ3 j;  4F7U B;  1KQ2 A;  4JRQ A;  2DD4 A;  2M0O A;  3P8B B;  3I55 T;  2Y90 A;  5CIU A;  2ZCF B;  3WVE B;  3QJ6 A;  1KQ1 A;  4DOV A;  4A4E A;  2LRQ A;  4QW2 A;  3TCJ A;  3JSC A;  4FT2 A;  1IRE B;  4M77 D;  4RG2 A;  4BI3 A;  4OP0 A;  5GAN e;  3RMS A;  2CS7 A;  1QVG S;  4M78 D;  4EMK C;  1N9R A;  2XKO C;  5J3B A;  3CCJ A;  4E7K A;  1YHQ T;  1Q82 U;  2JOY A;  1U8R A;  1Q82 C;  1X01 A;  4M77 F;  4BDY A;  5FRN A;  3P8H A;  3M56 A;  4F7U E;  5GAN 8;  2DZC A;  1BI0 A;  3LYI A;  5GAN d;  4XU0 A;  3CME A;  4IKF A;  3CD6 T;  1Y7X A;  3CCL T;  2ZPF B;  5GAO n;  2E65 A;  3BY7 A;  3V8J A;  3F70 A;  3MHX A;  1KD1 U;  3CCE T;  2QXF A;  3PMI A;  2C06 A;  1VIE A;  2K5F A;  2K3X A;  2RHU A;  4FL6 A;  3X20 B;  1NJI C;  3C95 A;  4BY6 C;  4C8Q G;  2M9U A;  3JB9 J;  1VQ4 A;  4LDX A;  2M16 A;  3QHS A;  3CCS T;  2RJF A;  1P92 A;  1YIT A;  3HHT B;  3GNG A;  4CRI A;  3PT9 A;  4E7J A;  2DXT A;  4PJO A;  4II1 A;  5GAN 7;  4KBM B;  4NOY A;  4BE1 A;  4XTU A;  2B8A A;  3VUZ A;  1M9S A;  5I2S A;  1KQS A;  4QVD A;  1M5Q 1;  2HNI A;  1G3S A;  2IVW A;  4QVZ A;  2R58 A;  2R5M A;  4N4I A;  4XTZ A;  3OBY A;  3M54 A;  4PL6 A;  3WXM B;  5KE2 A;  4GY5 A;  4M7A D;  4C0D C;  1N6A A;  4OB1 B;  2F69 A;  5FRM A;  3M4G A;  2EJ9 A;  3GNF B;  4E7H A;  3TRE A;  4Z02 A;  2D0Q B;  1WGS A;  3EFS A;  5DLQ E;  3RIR A;  4KUD K;  3QKJ A;  2M1H A;  3CC4 A;  2RHZ A;  2K2V A;  3HRS A;  3HRU A;  4JRP A;  4ZGE B;  3CXC S;  4OGE A;  5FU7 C;  3VYG A;  1G3Y A;  4ZN1 A;  5GMK m;  1YIJ T;  3PIO A;  3T9N A;  2CKK A;  2ZPE B;  3CCR T;  2O4X B;  2PQW A;  3OQ5 A;  3QBY A;  4KUI A;  3OW2 S;  2QEX T;  1VQ4 T;  3CCU T;  2IG0 A;  4FM4 B;  2RH2 A;  1WNL A;  3DLM A;  1K8A C;  1OI1 A;  1MHN A;  1YJN T;  3JB9 I;  1VQ7 A;  4JUV A;  4R55 A;  4M78 E;  3OYH A;  1Q7Y C;  5CCA A;  3CC2 T;  1U1S A;  3OMG A;  4A4H A;  1VQM A;  2P0Q A;  4M78 F;  5GAO r;  4TVR A;  3ER0 A;  1RL2 A;  2CGH A;  3CCQ T;  3RKW A;  3JCM f;  4IUV A;  4EMH A;  5GAM f;  3CXC A;  4C5I A;  1S72 T;  1VQ6 T;  3FJP A;  3J80 E;  4MMK A;  1XOV A;  4XQ3 A;  3CCR A;  4BAC A;  2VYT A;  4J8O A;  2L3R A;  2PVG B;  2JZ2 A;  4XTW A;  4DQ2 A;  1UB4 A;  2KDS A;  3BW1 A;  3E9G A;  2O4X A;  4QQ6 A;  3I56 A;  5CKD A;  3MO8 A;  3MP6 A;  4BD3 A;  2D9T A;  3OBW A;  4BY6 B;  2DPP B;  2DJZ A;  1DJ7 B;  4ME7 A;  1IZ6 A;  4C5G A;  2MAM A;  2WAC A;  4Q5W A;  2MI6 A;  3N5B B;  4JDS A;  2OTJ A;  3L2V A;  3PFS A;  4M78 C;  5CVI A;  4NL2 A;  4F7U F;  4BB7 A;  2LC4 A;  3SD4 A;  3M53 A;  3OS5 A;  3OS1 A;  3CCQ A;  1D3B B;  3JCM J;  2LNV A;  1AHJ B;  1LOJ A;  2DXU A;  4LDV A;  4M75 A;  1LJO A;  5J39 A;  5DLO A;  5LJ5 d;  1K8A U;  1V29 B;  3E9F A;  1YIT T;  2O01 E;  5GAN f;  3FRN A;  2P0K A;  3L2R A;  5KH6 A;  3OS0 A;  1QP3 A;  2JN0 A;  2X4Y A;  2XID A;  1VQ8 T;  1ZQ1 A;  2PVD B;  5LJ3 e;  1YJ9 A;  2KSS A;  4WF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...