2P0KA

Crystal structure of scmh1
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
HFTWDKYLKETCSVPAPVHCFKQSYTPPSNEFKISMKLEAQDPRNTTSTCIATVVGLTGARLRLRLDGSDNKNDFWRLVDSAEIQPIGNCEKNGGMLQPPLGFRLNASSWPMFLLKTLNGAEMAPIRIFHKEPPSPSHNFFKMGMKLEAVDRKNPHFICPATIGEVRGSEVLVTFDGWRGAFDYWCRFDSRDIFPVGWCSLTGDNLQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Polycomb protein SCMH1
publication title Structure of SCMH1
rcsb
source organism Homo sapiens
total genus 52
structure length 209
sequence length 209
ec nomenclature
pdb deposition date 2007-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2p0kA01
3PMIA 4QW2A 3LH0A 5FRNA 4BE2A 3MP8A 3O8VA 2RI5A 4C5GA 2RJCA 1SSFA 3NTIA 3OMGA 2FHDA 2M1HA 3PFSA 3SD4A 3OYIA 3L2VA 4GY5A 3OYHA 4CRIA 2EQJA 2K3XA 3OQ5A 4E7LA 2XK0A 4BD3A 2YRVA 4BDZA 4A4EA 3F70A 3FLGA 3H8ZA 4B9WA 2RJEA 3CEYA 3P8HA 2VYTA 4IUUA 2K3YA 2F5KA 2BIVA 4II1A 4A4FA 4E7KA 4BE0A 3LLRA 3MEUA 2RHUA 5KE3A 3P8DA 2B8AA 3L2WA 3NTKA 4Q5WA 5IN1A 3QKJA 4PLIA 3H6ZA 4PL6A 2RHXA 5KCHA 3OYJA 5FRMA 3OMCA 3S6WA 3FC3A 4IUTA 3OYEA 2E6NA 2GFAA 2QQRA 2DIGA 1MHNA 5J39A 2CKKA 2M16A 4N4IA 3FEOA 3LYIA 2L8DA 4QVZA 3LX7A 2R58A 3OYMA 3OA6A 4IKFA 3MEWA 2R57A 5KE2A 2HQEA 2BKDN 2RHZA 4IUPA 4IUVA 4QQ6A 3DLMA 4IURA 2L3RA 2QQSA 2X4YA 3OB9A 1OZ3A 3OY9A 3NTHA 4QQDA 1N27A 2D9TA 2L89A 4QQGA 2RO0A 4OVAA 5IAYA 4UC4A 2G3RA 2RHIA 3LGLA 3MP6A 5D6WA 4E7HA 2HQXA 4FL6A 3E9FA 3MP1A 1WJSA 1G5VA 2RJFA 3OS0A 3S3OA 2EQMA 5KH6A 3L2RA 3ASKA 3ME9A 2RI2A 2EKOA 3L2UA 2X35A 2XDPA 1OI1A 2IG0A 3BDLA 3KUFA 1OYXA 2JTFA 5CIUA 3UWNA 4B9XA 4C5EA 2R5AA 4Z02A 1WJRA 4E7IA 2O4XB 4LD6A 2LDMA 3M9QA 4A4GA 2LTOA 4ZTFA 3Q1JA 3OS1A 5M9OA 2LRQA 3EAEA 2JZ2A 4A4HA 2BUDA 2NLUA 2X4XA 3E9GA 4EDUA 1WGSA 4N4HA 4NS5A 2WACA 4HCZA 2GF7A 3OYLA 3UT1A 2LVMA 4C5HA 3L42A 2EQUA 4IUQA 3LGFA 5FROA 3QBYA 5J26A 5C0MA 3GOXA 2MWPA 3S3MA 2P0KA 2DIQA 4RG2A 1XNIA 4FU6A 2LCCA 3DB4A 3MO8A 3PNWC 1KHCA 5C6SA 3MEAA 4ZTJA 3META 3FDRA 3DB3A 4N4GA 4C5IA 2RJDA 2X4WA 5D6YA 4BDYA 2R5MA 3OYCA 3C4SA 3PMTA 1H3ZA 2E5QA 4L59A 2PQWA 3QIIA 3QJ6A 3L2QA 2MWOA 1RI0A 3OYDA 2EFIA 5D6XA 3OYGA 4PLLA 3S3NA 1WJQA 4BACA 2RHYA 2GFUA 2DAQA 3OYAA 1OZ2A 5KCOA 2EQKA 2O4XA 3OYKA 3MEVA 3OYBA 4BE1A 4E7JA 2RI3A 3OYFA 3ZEHA 2M0OA 3OS2A 3OYNA 4X34A
chains in the Genus database with same CATH superfamily
2DMOA 1PCXA 1XOVA 3MP8A 1WLPB 2RJCA 4ZNXA 1YIJQ 3EFRA 1KSWA 2K3XA 4OB1B 1SPKA 1JJ2S 3CC2Q 5GAOr 2CP5A 2HL5C 3CD6Q 2ZGWA 3FLGA 4OMOA 4ELYC 3I56Q 3I55Q 2DXBA 2HSEB 4JPBW 5A0GA 3VJPA 2BIVA 2LX9A 4FYYB 4A4FA 4E7KA 4BE0A 2A37A 1QVGA 2MPXC 2CZ7B 1ZSZC 2DTIA 1M1KR 4XU3A 4J9DA 3CCET 1Q82R 2M16A 4J9FA 4M77E 2DJZA 4QQ6A 8AT1B 5CAIA 1K0XA 4OMFB 3X26B 4LD9K 2FYKA 4MZPA 3VUBA 4M75E 1IZ6A 1VQLT 2E10A 3AHUA 2DXCA 5KH6A 1D0YA 2IG0A 2FO0A 1OYXA 3RMSA 2E64A 1KQSS 1SF9A 2LDMA 1M1KC 3VRZA 2JJ9A 1Q82C 4J83A 3E9GA 4DEXA 3G6ET 1VQ9T 4XK8E 3E2UA 3L42A 3FB9A 1S72Q 1ZBXA 2DL3A 3EG2A 3RMQA 4AG2C 3M0TA 1LVKA 1UG1A 1QCFA 2D6FA 1YN8A 4PJOC 1SEMA 1W1FA 1WJQA 2GFUA 4HVVA 3SWNC 2KXDA 5GANf 2EKHA 2DXTA 2HAXA 2CREA 4E7ZA 4A63B 1F1BB 1VQNA 1OU8A 2QEXA 4KRTA 3DLLA 3G4ST 1JEGA 1BI2A 2RQTA 4JS5A 2XICA 4K11A 4BD3A 2G6FX 2ZCFB 2RJEA 4IUUA 4WCIA 1UUEA 1NE8A 2O9SA 3CMEQ 5IN1A 3OYJA 1PD0A 2RQUA 1K9MU 4DBQA 2DIGA 1Q81U 5HK0A 3LX7A 5CK9A 3CCVQ 2JTMA 1VQ8Q 1R77A 3DLMA 2P84A 1M3CA 1E6HA 4M75B 1W2BP 5FU6C 2YUNA 3MP6A 3LGLA 2HQXA 4C8QF 3NGPA 1WJSA 1X01A 3S3OA 2DRKA 3JB9G 1ZUUA 3CCLT 4M78F 2M02A 2RB6A 1WJRA 2O4XB 1N8RC 1AVZC 1YWPA 4A4HA 3A1PA 2QDYB 3DKMA 4LUEA 3HRSA 5IT9E 4OGEA 3J7AF 3M56A 4C5HA 3LGFA 1SG5A 2OTLA 1RAIB 3GOXA 3QSUA 5GAN3 5LJ3e 1TS9A 1YP5A 4C0GA 4XTUA 1QVGP 1G3SA 5L8RE 1VQPT 1FMWA 5HK3A 2D1XA 1PRLC 4OB3B 2DETA 1NLPC 3QJ6A 2P4TA 4BB7A 5IHIA 5D6XA 2HEQA 1RLQC 3RESA 1OULA 1YJNT 1AEYA 3JCMc 4C8QD 3CMEA 1UJYA 2KT1A 3M4GA 4M7DF 3PFSA 2DERA 2B86A 2E1HA 3A98A 2XK0A 3V7RA 3QYGB 1XTDA 3F70A 1MMGA 3JCMg 1IREB 2ECZA 1OX8A 1WNLA 1VQ6T 2ZPEB 2IPOB 2ZPFB 5GAMd 5J3BA 4IUTA 1YJWA 2EWNA 3MHXA 2KVQG 1GFCA 4HVWA 1O9SA 1JRIA 4ZN3A 3ULRB 1KC8U 2X3WD 5A2QE 3M58A 3OY9A 2K3BA 3R6OA 2LJ1A 2DTHA 5LJ3f 5GANd 3BY7A 4E7HA 2DNUA 3EFSA 1M90U 3UATA 3FIFA 2F69A 2DO3A 5CQYA 3L1AA 1MV0B 1QP2A 3INZA 3UWNA 1PSFA 1TH7A 1AOJA 4X1VA 4M7DD 2JUFA 4XTWA 3T9NA 2SRCA 3OYLA 4R56A 3CMAQ 4GLKA 2CGHA 4DBHA 2CP0A 2C0OA 7AT1B 1M1FA 3RKWA 3A8OB 4BI3A 2CS7A 5A0DA 5CKDA 2V26A 3PVQA 1VA7A 3SFMA 1HSQA 1WX6A 2HMAA 2D8HA 1H3ZA 2GTOA 2XU8A 4C92F 3PGGA 2RHYA 3VS4A 4A53A 4PKCC 2DYIA 1VQ4A 2DKGA 2I0NA 4JRPA 1VQ5T 2RI3A 1IHVA 3OS2A 2PUKB 2RQWA 2DL8A 3OS5A 1GBQA 1KK7A 4BE2A 4J8OA 3HFNA 2FHDA 4AFQC 4F7UF 1BK2A 2MOXA 1D1CA 3OQ5A 4CC2A 1EX4A 2BZYA 2QQ9A 1AZGB 1K9MR 1CKBA 1AHJB 1WFWA 1SRMA 5FW9A 5DLOA 2JM9A 1VYVA 2NUTA 2KNBB 2OI3A 5FWBA 4PJLA 5FRMA 4IIOA 2J05A 2VB6A 1YI2T 4M7AF 3GNFB 1QWEA 4IURA 2WSEE 4M78C 3CCRA 3L2ZA 2YRCA 4C92D 1ZHIA 2D9TA 1QWFA 3OYYA 2RO0A 3EGUA 4GLMA 2DPPB 5I2SA 3C12A 3HP9A 1K9MC 1ZSZB 1MUZA 1Q7YR 3JCMV 3CCQQ 1Q95G 3CC7T 1GCQC 3QUIA 1W4SA 2EGCA 4E47A 5IHKA 5FU7B 4Z02A 1EZZB 2JOYA 4PNOA 3M9QA 1X2KA 2YT6A 4FSSA 2DL5A 1WGSA 4HCZA 1PG5B 3VYGA 1PNJA 2LVMA 4FYWB 1JXOA 3M4YA 1AD5A 3RKYA 1X6OA 2XDDA 1K73R 2MMPA 1T0JA 3DB4A 3PNWC 2PVDB 2A08A 4PJMA 4XTZA 5GJVB 1WHGA 4XTXA 4C0ZA 4F17A 2DTOA 1Y0MA 2E5QA 1ABQA 1B34B 2EFIA 2QTVA 2D8JA 3A8LB 4RTTA 1BI3A 1I81A 1GXIE 3OYBA 1X6BA 5AT1B 3H0IA 3REAB 3U23A 3CC4Q 3M0SA 1K73C 2HD0A 3OYHA 3SHWA 1NLOC 3TVTA 3CCSQ 2QDLA 1UGPB 5GAN2 3MKDA 5GAN4 2LQ8A 5KYNA 1KHIA 1N6AA 1M3BA 4PJOF 4ZGEB 3X25B 4FW1A 2QASA 2KROA 4GBQA 2V1QA 3MPUB 3LWHA 4IUVA 1BBZA 1SRLA 1M5Q1 2OTJA 3GIBA 3OB9A 1MNEA 4M77A 4UC4A 1X75C 2QQBA 5D6WA 2GBQA 2ZPGB 4M4ZA 2KRSA 2L3PA 2RJFA 5GAN6 4M75A 1NZ9A 2ROLA 3EG1A 3VS3A 3WVDB 4E7IA 3MCAB 1WYXA 1UGRB 5HKCA 4RTYA 2ZPHB 2LTOA 4A54A 4C8QG 2HCKA 1QP3A 3EAEA 4KUIA 3JCMW 2NLUA 2YRDA 4JRQA 2K2VA 2GF7A 3OW2A 2VGNA 1RLPC 2E65A 4XU1A 1M90C 2YDLA 5KYWA 3CCEA 2E6ZA 2EQUA 3A5ZB 2WSFE 1H92A 4MDXA 4RG2A 2DRMA 4PJOD 3HHTB 3TU4K 1I5LA 2OJ2A 1NG2A 3R6NA 3HSBA 1I0CA 3OYGA 3CCSA 2K6DA 1PSEA 3UPUA 5GAOl 4BE1A 2NWMA 2ED1A 2QG9B 5FRNA 3QDRB 2JVVA 3G6EA 1VQ9A 1KG1A 3JCMh 3CBPA 4C5GA 4EMKB 2JN0A 1K9AA 2H8HA 1FXXA 4GY5A 4NL3A 4D6WA 1VUBA 4BDZA 2XI9A 3P8HA 3O5ZA 3TCJA 1JJ2A 4M7DG 3KBGA 2P4RA 2CSIA 2DX1A 1QVPA 3S6WA 2JXBA 1Q86U 1RL2A 3FEOA 4IKFA 3CCQT 4OB0B 2EJFA 2R57A 5KE2A 3RERA 2I2LA 2QQSA 1N27A 2O2OA 3M53A 2MI6A 1VOMA 3G4SA 5GAOn 1ZQ1A 1TSFA 3M0QA 1ZX6A 1VQNQ 5CR2A 2FRYA 2QEXQ 5I2MA 4C8QE 3JCMX 5CQXA 2GTJA 4BI4A 3WXMB 3V7SA 1T3SA 3QDFA 3CCUQ 3UT1A 1KQSA 1HYOA 3JCMb 2CT3A 2A3LA 2XKOC 5GMKl 5C0MA 2QA4T 3EG9B 3VS6A 2CP2A 2KT8A 1M2VB 3JV3A 3FDRA 3DB3A 1ZUYA 5D6YA 2R5MA 3PMTA 1J3TA 2NUPB 1D0XA 2AT1B 3CCMA 4BACA 4CC7A 3CCLA 2QK0A 2HBWA 4HVUA 3JSCA 2CP3A 4EPCA 4WTOB 1QVFS 1QKWA 3RKXA 5LJ5d 4J6XA 3X24B 1KD1R 3PTAA 4C92G 1DJ7B 2RI5A 5GAOm 1HJDA 5ECAA 2JTEA 4C0DC 4LDWA 3WVEB 1MNDA 3EFOB 2NUZA 5FWCA 4M7DE 1IRXA 1VQPA 1OPKA 5KYXA 1VQ7T 4F7UG 3G71T 4Q5WA 2OTLQ 3FRNA 2RHXA 5KCHA 2E6NA 1NYFA 2CKKA 4L5GA 1YJNA 2L8DA 1U5SA 1YCSB 1KD1C 2HKNA 3QO3A 4OMNA 2K4YA 3GNGA 3E1SA 3CCUA 2CDTA 1PD1A 3SB2A 4RKUE 2O9VA 1OU9A 5GAN5 1VQKT 1I5OB 4M7AG 3JB9I 3PIPA 1N8RR 2DILA 1OV3A 4C8QB 2ESWA 4ZN1A 2YUOA 3H9NA 3RIRA 1ARKA 1VQ6A 4J7IA 4RTWA 2BUDA 3JCMQ 3EGDB 4AFZC 4DA4A 1GFDA 2FVUA 4CI0C 1UE9A 5J26A 1K8AU 3GP8A 4X9CA 1JJ2P 1V29B 2COYA 2KEAA 2VXEA 2IVWA 1YJWQ 2X51A 2VV5A 3C4SA 4Z8AA 2EYQA 3NMZC 1WIEA 4MMLA 1YJ9T 2P0PA 3QXEB 3JCMe 4XTYA 4M77F 4HXJA 4YTLA 1BI1A 4OMPA 2EVRA 2MIOA 4C92E 1B34A 1PM3A 1X6GA 1LJOA 1IXDA 1T3LA 2JS2A 1LPLA 2KSSA 3M0RA 4M7DB 2K5LA 4PFPA 5I22A 1YIJT 2K3YA 4HA8A 1NPRA 1UGSB 4V2SA 4F7UE 3CC2T 1YNZA 1TXQA 3P8DA 4AG1C 1RADB 2LCLA 1KQSP 3CD6T 3I56T 3H6ZA 3I55T 5DY9A 1T0HA 1C0MA 2IIMA 1UTIA 4HT9A 4M78D 1H641 4LE9A 4QVZA 3I9QA 3RNJA 3EGXA 3FJ5A 2HQEA 3EHQA 2RHZA 2V8IA 2VWFA 4IUPA 4BI8B 1VQ5A 2L3RA 2MYSA 2DFUA 1PC0A 2G3RA 4PJOG 1NJIU 1AWOA 2KBTA 1VQ4Q 3UDCA 2Z0WA 4M7AE 1B3QA 2JW4A 3OS0A 1OOTA 2EQMA 3A8HB 2E12A 1UJ0A 2KMTA 3BDLA 4C5EA 3M57A 3CBOA 4LD6A 2E5KA 3JCMf 2JMAA 1M4ZA 4HCKA 5D7UA 2X4XA 2WACA 2QGGA 3JCMJ 3QG1A 2HBPA 3TREA 4RTUA 2A7YA 3C95A 1WHKA 3CPWS 1YI2A 2P0KA 2EYXA 3MO8A 2DEUA 4AT1B 2RMOA 3I5SA 1ZA1B 4J9CA 4DQ2A 1S72T 1EIFA 1BYMA 1H8KA 1JXMA 1IO6A 3V8KA 1R0BG 2KYMA 2LMJA 1WXUA 1KQ2A 3CC7A 3CCRQ 1RAAB 2JS0A 4ME7A 5GAOp 2X3XD 1SSHA 4C92B 1M3AA 4QW2A 2DYBA 1WHJA 3OBYA 3O8VA 2GCXA 2DA9A 4JLGA 4R0KA 2EYZA 2AHJB 3CXCS 1X69A 4OGCA 3ZBDA 4HKEA 2K79A 1ZUKA 1AWXA 4F7UB 4EMKA 5KE3A 1C6VX 3N5BB 3QKJA 4JUVA 4NL2A 2BE7D 3VU3C 1UGQB 3M0UA 1VQOA 2GNCA 4N4IA 2D0NA 2FPFA 1YITQ 3CMET 2QTXA 3MEWA 2FZCB 4HCCA 1Z9ZA 5KYYB 4VUBA 2L89A 4KULA 4PJOE 2EGAA 2KXCA 1RABB 2MAMA 4M7AB 3CCVT 2KY9A 1U3OA 1VQ8T 1WXBA 1Q81R 2CYZB 3E9FA 1G5VA 1JBMA 2F2XA 2DLPA 1M9SA 2XHCA 5GMKe 2CZ0B 3RR6A 2DJQA 4P5NA 1QQJA 1YHQQ 1WHLA 3QBYA 3TSWA 2VVKA 1KHCA 4FYXB 1KQ1A 1GBRA 3CBMA 3HFOA 1Q81C 4M77C 1U1SA 1ZBJA 4D8KA 3QWYA 2LQKA 1Y71A 2L0AA 3HKSA 3QIIA 4Z88A 1PRMC 3CCJA 2MWOA 1JO8A 1U06A 1TUGB 3S3NA 2OTJQ 1X27A 1AT1B 4M75C 2J6OA 5GAMh 2CZ1B 3JCMP 2GQVA 1WHMA 2DEQA 2HZYA 1AWJA 3UA6A 1UHCA 3E19A 4OB2B 1HXDA 5GAMj 1YITA 1NM7A 1D3BB 3HTRA 2DD5A 3GLXA 1M1KU 5EC7A 5GANh 3TSZA 4M7AD 1VQMA 3H8ZA 2WSCE 1QMCA 3HRUA 5LJ3d 5A0LA 3CCEQ 3MEUA 2B8AA 2LJ3A 4XQ3A 4J6YA 3L2WA 1IB8A 2A36A 3EFOA 4RG8A 2RPNA 1X43A 2EJ9A 2J6FA 5J39A 5LJ5e 1VQLQ 1I4K1 4PJOB 2PVGB 1UB4A 2X4YA 2X4JA 1YHQA 4A4KA 3SWNB 3MP1A 3L2RA 1Y96B 1UGVA 2K57A 4J9EA 4B9XA 1KC8R 5FLXE 3G6EQ 1VQ9Q 1JB0E 2LNVA 2CSQA 2EYWA 3Q1JA 4FT2A 4X9DA 3PIOA 1M90R 4JS4A 1VIEA 2H3JA 2P0QA 4TVRA 4C8QA 4JRKA 4IUQA 1FYNA 1QKXA 2YLCA 3CMAT 3PVLA 1IHWA 3EGDA 1TUCA 3META 5LJ5g 2CUDA 2FRWA 2W10A 2YUPA 4BDYA 4FT4A 4EMHA 2DL4A 1KC8C 4DOVA 2VGMA 2V1RA 1TOVA 5FU6B 4N0AC 4JJBA 1R8OB 3G1JA 4M78G 4RCBA 2O4XA 3G4SQ 2QI2A 1N5ZA 2O88A 3OYNA 3IQLA 1UFFA 2E3IA 3OYIA 3EH2A 3VS7A 1VQLA 2QA4A 1NEGA 3A8MB 2CT4A 4B9WA 1QCOA 4IIMA 4F04B 1UECA 4FCYA 2QYZA 4O5VA 2XMFA 2OAUA 4JJCA 1NBEB 4PLIA 1M1GA 4KGZB 3RDVA 4M7DA 1MMNA 1MV3A 4KH0B 4AMCA 4DEYA 4ZGJB 5CKHA 5IH2A 2AZSA 2LP5A 3ER0A 2VASA 3LYIA 3ZFJA 3VYHB 1OQKA 1FWZA 3VS2A 5GAN7 1VYUA 3BFMA 4WF2A 4DBRA 3NFCA 3NTHA 3CCMQ 3CCLQ 2ENMA 1S1NA 1W6XA 3ME9A 4QVCA 2EKOA 1G3YA 2SEMA 5DLQE 2L5QA 4DOWA 4E2FB 4JZ4A 1VQ7A 1BIAA 1FMVA 1NYGA 3G71A 3A8GB 2O01E 3TEEA 2LQWA 2H3EB 2NYSA 1TG0A 2HQHA 1VQPQ 2EGEA 4XAXB 4MZMA 5EG2A 1ZSGA 4BY6C 2KYBA 2DIQA 1W2BS 2LCCA 2VC8A 1BIBA 2DL7A 2C06A 2K2MA 2RJDA 4N0AA 5GAMe 2CH4A 4AFSC 2LT1A 3OYCA 3URGA 1VQKA 1YJNQ 2KQWA 2NUTB 3L2QA 2EAYA 2EW3A 2ZPBB 4M78E 2PU9B 4OMLA 1BB9A 3G7ZA 1Z9QA 4E7JA 2DXUA 3ZL7C 2OX7A 3UF4A 5GANe 4X34A 2RK1A 3C0CA 2CP7A 3H41A 4OF1A 5FU7C 3VS0A 1N9SA 2CZ6B 4LNPA 1SSFA 2DVJA 1QVFA 2EPDA 2RQRA 4C92A 4E7LA 1NEBA 2DE0X 4Y91A 1VQ6Q 3CC4T 1QVGS 2GGRA 2ED0A 2LT4A 4ORZA 3CEYA 1N9RA 3KFVA 2K5IA 4XU2A 1YBYA 2KK4A 1M27C 4J5YA 1R0CB 2RHUA 3NTKA 1G2BA 2M51A 3CCST 4PL6A 1YJ9A 5HCKA 2Y90A 3OMCA 2FEIA 4F7UA 4R55A 2DZ9A 2QXFA 1O75A 5GAMg 1GL5A 1WZOA 2R58A 1CKAA 4LDYA 1VIFA 1MGQA 4D8DA 5GAN8 1WXTA 4JDSA 1LNXA 2JMCA 5GAMf 3OW2P 3V7CA 5GANg 2E3HA 5KYYA 2X35A 2XDPA 2Y4XA 1YIJA 3SDZA 2AIRB 2VXFA 4M7AA 1X2QA 3V8JA 1NPPA 4ATOA 3CC2A 2J6KA 5CKFA 5M9OA 1WA7A 2LRQA 3CD6A 1E7OA 4RTZA 4EDUA 3I56A 3RBBB 2L3SA 3I55A 1XQHA 4RUGA 1PKSA 1B7TA 2KGTA 5FROA 2AZVA 2RK2A 1MMAA 3VRYA 1LCKA 3S3MA 1M8MA 1RAHB 5C6SA 3V8LA 5GMKm 4E7SA 1BKBA 1G8XA 3H0FA 2Y4YA 3UA7A 1FMKA 4F16A 4RTVA 2CUBA 4L59A 2PQWA 1LOJA 1V1CA 2RF0A 1ZSZA 1VQ5Q 1JQQA 3LWIA 4M78B 3OYDA 4PLLA 2YLBA 4OMQA 1K0SA 2RNAA 4LUDA 1GRIA 5LL6S 2EQKA 2KDSA 2HNIA 2M0OA 2FZGB 5GMKh 1RUWA 1WPYA 4M77B 1WDXA 1YFNA 3L2VA 2BE9B 4LN2A 4ZGDB 2COZA 2EQIA 3H0HA 1MMDA 5GMKj 1SHGA 2V8JA 2YRVA 1K1ZA 2ZZDA 3JB9J 5KYUB 3C94A 1P92A 2DBKA 3THKA 2LX7A 1S72A 3M54A 1D3BA 1RAGB 2CP6A 5CCAA 1PKTA 1G83A 3CCMT 3QZ9B 1YI2Q 1D09B 3FC3A 3OSSC 5KYWB 1BCMA 4DBFA 4M75F 3X28B 1Q7YU 1TUDA 1CSKA 3QWXX 4MZTA 3CC7Q 2RHIA 1Q86R 5CO7A 1IGUA 1ZA2B 1EFNA 4JJDA 4PJOA 2RH2A 1M8VA 2A0FB 4LDVA 2A28A 1OI1A 1G3WA 2R5AA 3SWNA 4EMKC 5GMKi 2KR3A 1K73U 3BDUA 4ZTFA 1UHFA 3OS1A 3JRZA 1Y96A 1VQNT 5L23A 3I5RA 1QVFP 4XTVA 2PZ1A 2QEXT 4KH1B 1BCOA 2F1LA 4OMMA 5LJ5h 1XJWB 2MK5A 3EG3A 2ABLA 4CC3A 4M77D 2JNGA 2J06A 1XNIA 1KIKA 3CCUT 1RAFB 2ZPIB 1Q86C 3MEAA 4JZ3A 1UDLA 3AT1B 3CCVA 5LJ5j 3CPWA 1VQ8A 1HD3A 1VQOQ 4M75D 9ATCB 1RACB 4PK4A 2FB7A 3X20B 3SEMA 2HDAA 1AWWA 3EHRA 3NHNA 2QAZA 3D7SB 1OPLA 2PNIA 3OYFA 5LJ3g 1E6GA 2JT4A 3LH0A 5CVIA 2YXYA 3QYHB 3OMGA 2M1HA 2MCNA 4KT0E 2EQJA 1RI9A 4A4EA 4AFUC 2COWA 2M0YA 1YWOA 2VYTA 1A0NB 2F5KA 1TU0B 1OX9A 3CXCA 1D1BA 3OSVA 3LLRA 2LCSA 1C1AA 5CKBA 3HPWA 1AZEA 1BI0A 2L3QA 4FYVB 4FIBA 3PE0A 4JJNK 3OYEA 2QQRA 2GFAA 1MHNA 2AKLA 2CH4W 3OYMA 5IXFA 2OTLT 4KGXB 4LDUA 3VS1A 4HT8A 4JRIA 2PUOB 3RUXA 1OZ3A 3CQTA 3CCJQ 4QQGA 2PTKA 4J9IA 3VV0A 1ABOA 4CC4B 3BW1A 2RI2A 3LH5A 2JTFA 5CIUA 2XG8D 2DZCA 1HK9A 4A4GA 2KRMA 4J9GA 4B6MA 4PJJA 2VKNA 4EIKA 4N4HA 2F5TX 4L6V5 6AT1B 2O31A 1VQMQ 2EJGA 1D0ZA 1M2OA 1PWTA 2KAFA 3CPFA 4QT7A 4J9BA 2LC4A 1WHHA 4QKUA 4J7FA 1Y57A 2LNHB 4ESRA 4C5IA 3EH1A 2X4WA 5KYXB 3VUZA 2DK3A 4Z89A 4KGVB 4O6JA 1RI0A 1K8AR 4LDXA 1YJWT 2K5FA 1WI7A 3OYAA 1ZLMA 2DBMA 1G3TA 2ROTA 4BY6B 2FG0A 1WQ7A 2GQIA 4C8QC 2C0TA 4MDWA 2E4HA 2E41A 5I21A 2FZKB 3SD4A 3I35A 2KI7A 4RCCA 5DM7R 2KE9A 3CMAA 3EG9A 2BZXA 4ELZC 4ANJA 2OAWA 1M2VA 1D1AA 4II1A 2F2WA 1Y7XA 2RA2A 1K8AC 3P8BB 3PT9A 1QLYA 4Y28E 2NUPA 4FW2A 4OP0A 5GAOq 2XIDA 2QQAA 4FM4B 3EG0A 1I07A 4BUGA 3OA6A 2EIFA 2YSQA 3JB9F 2BKDN 5GJWB 3JCMd 3CPWP 2DD4A 2DM1A 2V8KA 1Q82U 4EMGA 2VUBA 2JM8A 2LJ0A 2XD0A 5GANj 3L2UA 1KJWA 1FX7A 2YUQA 2YHTA 1Q7YC 1VQ4T 2DVEA 2RM4A 3JB9H 1VYTA 1NJIR 1YCYA 2JZ2A 4C0DB 4M7DC 1ACMB 2ZAEA 4NS5A 2QA4Q 4F14A 3MJXA 1VQOT 4E6RA 2ATCB 2HL3A 3FJPA 2EBPA 1JU5C 3CXCP 3GBQA 4KUDK 4ZTJA 3QJYA 2EYYA 1W70A 4N4GA 2DF6A 4PFOA 2RD1A 4PFZA 1BU1A 2W0ZA 1I1JA 3JB9D 1KD1U 2RQVA 2AKKA 2BTTA 3HL8A 2MF2A 1NJIC 1OZ2A 4NOYA 5KCOA 4QVDA 3EGXB 1WQWA 3M59A 3CCQA 3ZEHA 4M78A 5IXBA 3CCRT 2J7IA 3PMIA 3J80E 3QZ5B 5I11A 4JLIA 1IGQA 3VKIA 3NTIA 2BZ8A 1TTHB 2K7AA 4CRIA 1KFZA 1TWBA 1VQ7Q 5IHNA 1PHTA 3TQ7P 3G71Q 1GCQA 4MMKA 1K76A 2X9HA 1Y07A 1SHFA 2K9GA 2F2VA 2FPEA 4RMOA 3CCJT 5LJ5f 2E70A 5KYUA 3M0PA 4PJNA 4XU0A 2AK5A 4RTXA 3JAME 3M55A 4J6WA 4J9HA 4FSXA 4M77G 1VQKQ 1N8RU 5IAYA 4QQDA 2QGFB 2C0IA 4OVAA 1H3HA 1YITT 4LXCA 5HY6A 4FL6A 1RAEB 1B07A 1U1TA 2LQNA 4C92C 4M75G 2L2PA 1VQMT 2FL7A 3ASKA 3CC4A 1GCPA 5CKEA 1I8FA 3KUFA 3HRTA 4HCBA 3OW2S 3QHSA 3M5AA 3OBWA 2KRNA 3NPFA 2RN8A 2D0QB 1OEBA 5AYFA 1QW1A 1V76A 1M30A 3LW5E 2M9UA 2MWPA 2PVOB 4KBMB 4FU6A 1QCNA 1YHQT 1SKUB 2HKQB 4C0FA 3J81E 1YJ9Q 2FPDA 3QPHA 3REBB 2XDBA 2YWWA 1W2BA 3BE3A 5LJ3h 3GF5A 1U8RA 4Y92A 3VS5A 2LZ6B 2DAQA 4M7AC 2HSPA 3OYKA 3MEVA 1UEBA 2OTJT 8ATCB 5LJ3j 3KXTA 3GPLA 1K4US
chains in the Genus database with same CATH topology
4QW2A 1WPYA 1XOVA 4M77B 3MP8A 3OBYA 3O8VA 2GCXA 4JLGA 1K73C 2RJCA 2HD0A 3EFRA 3L2VA 2AHJB 3OYHA 3CXCS 2K3XA 4OB1B 4ZGDB 4OGCA 1JJ2S 5GMKj 2V8JA 2YRVA 2ZZDA 3ZBDA 5GAOr 3JB9J 3C94A 1P92A 2ZGWA 3FLGA 4HKEA 4ELYC 4F7UB 2DXBA 1UGPB 5A0GA 4EMKA 3VJPA 5GAN2 1S72A 2BIVA 2LX9A 3M54A 1D3BA 4A4FA 4E7KA 4BE0A 5KE3A 5GAN4 2LQ8A 5CCAA 1QVGA 1KHIA 3N5BB 3CCMT 2CZ7B 3QKJA 1N6AA 3QZ9B 4JUVA 4NL2A 2DTIA 4XU3A 3VU3C 3FC3A 3WXMB 1UGQB 3OSSC 4PJOF 4ZGEB 3CCET 1VQOA 3X25B 2M16A 4N4IA 4M75F 3CMET 4M77E 2QTXA 3X28B 3MEWA 2DJZA 1Q7YU 3LWHA 4IUVA 4QQ6A 4HCCA 1M5Q1 2OTJA 3GIBA 3OB9A 4VUBA 5CAIA 2L89A 4KULA 4OMFB 4PJOE 4M77A 2MAMA 4MZTA 3X26B 2FYKA 4MZPA 4UC4A 4LD9K 1X75C 4M7AB 3VUBA 2KY9A 2QQBA 2RHIA 1IZ6A 4M75E 5D6WA 2ZPGB 3CCVT 5CO7A 1VQ8T 1VQLT 2E10A 2CYZB 3AHUA 3E9FA 1G5VA 2DXCA 2RJFA 1JBMA 5KH6A 4PJOA 2RH2A 1M8VA 5GAN6 4LDVA 4M75A 1OI1A 2IG0A 1NZ9A 1OYXA 3RMSA 1G3WA 2E64A 2R5AA 3SWNA 3WVDB 3MCAB 4EMKC 5GMKi 5HKCA 1UGRB 4E7IA 1KQSS 2LDMA 1M9SA 1K73U 1M1KC 2ZPHB 3BDUA 2LTOA 2XHCA 4ZTFA 4A54A 4C8QG 3OS1A 3JRZA 5GMKe 1QP3A 2CZ0B 3EAEA 4KUIA 3JCMW 2NLUA 1Y96A 1Q82C 4J83A 3E9GA 1VQNT 4JRQA 4P5NA 2K2VA 2GF7A 4XTVA 3G6ET 3OW2A 2VGNA 2QEXT 4XK8E 1VQ9T 2E65A 4XU1A 1M90C 3CCEA 2E6ZA 3L42A 5LJ5h 2EQUA 3FB9A 3A5ZB 3QBYA 2WSFE 1ZBXA 4M77D 4MDXA 2JNGA 3RMQA 4RG2A 1XNIA 3CCUT 1KHCA 1KQ1A 2ZPIB 1Q86C 3MEAA 3CBMA 3HFOA 1Q81C 4M77C 4M7AF 1U1SA 4PJOD 3HHTB 3CCVA 5LJ5j 3CPWA 1VQ8A 3TU4K 2D6FA 4M75D 1I5LA 2LQKA 1Y71A 3HKSA 3QIIA 4PJOC 3HSBA 3CCJA 2MWOA 2FB7A 3OYGA 3CCSA 3S3NA 4M75C 1WJQA 3X20B 1PSEA 3UPUA 2GFUA 5GAMh 2CZ1B 3SWNC 3JCMP 5GANf 4BE1A 2DXTA 2HAXA 2GQVA 3OYFA 2DEQA 5LJ3g 1VQNA 3E19A 5FRNA 3LH0A 3QDRB 4OB2B 1HXDA 2JVVA 5CVIA 3G6EA 1VQ9A 2QEXA 3QYHB 1KG1A 3JCMh 3CBPA 4C5GA 4EMKB 2JN0A 5GAMj 1YITA 3DLLA 3OMGA 1D3BB 2M1HA 3G4ST 1FXXA 4KT0E 4GY5A 1BI2A 2DD5A 4NL3A 4JS5A 2EQJA 2XICA 3GLXA 1M1KU 4BD3A 4D6WA 1VUBA 4BDZA 5GANh 4A4EA 4M7AD 2ZCFB 1VQMA 3H8ZA 2WSCE 2XI9A 2RJEA 3P8HA 4IUUA 2VYTA 2F5KA 3HRUA 3TCJA 3CXCA 5LJ3d 3OSVA 5A0LA 1JJ2A 4M7DG 3KBGA 3LLRA 1NE8A 3MEUA 2B8AA 4XQ3A 4J6YA 3L2WA 5CKBA 3HPWA 5IN1A 1BI0A 3OYJA 4FIBA 3S6WA 1QVPA 4RG8A 4JJNK 1K9MU 2EJ9A 2QQRA 2GFAA 3OYEA 2DIGA 1MHNA 5J39A 5LJ5e 1RL2A 1Q81U 1Q86U 5HK0A 3FEOA 4IKFA 3OYMA 3LX7A 3CCQT 5CK9A 4OB0B 2EJFA 2JTMA 2R57A 5KE2A 2OTLT 4LDUA 4HT8A 3DLMA 1I4K1 3RERA 2I2LA 2PVGB 4JRIA 4PJOB 1UB4A 2PUOB 2QQSA 2X4JA 2X4YA 1OZ3A 3RUXA 4M75B 1N27A 4QQGA 1YHQA 5FU6C 4A4KA 3SWNB 3M53A 3MP6A 3LGLA 2MI6A 2HQXA 3VV0A 4C8QF 3G4SA 5GAOn 3MP1A 1WJSA 1X01A 1ZQ1A 3BW1A 3S3OA 3JB9G 3L2RA 1Y96B 2RI2A 2K57A 4B9XA 3CCLT 2JTFA 4M78F 2XG8D 5CIUA 5FLXE 2RB6A 5CR2A 1WJRA 2O4XB 1JB0E 2DZCA 2LNVA 5I2MA 1HK9A 4C8QE 5CQXA 4A4GA 3JCMX 1N8RC 3Q1JA 4BI4A 4FT2A 4X9DA 3PIOA 4A4HA 4JS4A 1VIEA 2H3JA 2QDYB 2P0QA 4N4HA 2F5TX 3DKMA 4TVRA 4L6V5 3HRSA 3V7SA 5IT9E 3UT1A 4C8QA 1KQSA 4OGEA 2EJGA 4JRKA 3J7AF 3M56A 4C5HA 3JCMb 2KAFA 3CPFA 4IUQA 3LGFA 2A3LA 2XKOC 5GMKl 2OTLA 2LC4A 5C0MA 3GOXA 2YLCA 2QA4T 3QSUA 5GAN3 3CMAT 4J7FA 5LJ3e 4C0GA 4XTUA 3META 3FDRA 3DB3A 1G3SA 5L8RE 4C5IA 5LJ5g 1VQPT 2X4WA 5HK3A 3VUZA 4OB3B 2DK3A 5D6YA 4FT4A 2R5MA 4BDYA 3PMTA 4EMHA 1KC8C 3QJ6A 2P4TA 4BB7A 3CCMA 4O6JA 1RI0A 2VGMA 4DOVA 4LDXA 5D6XA 1YJWT 4BACA 3CCLA 5FU6B 2K5FA 4N0AC 3OYAA 1R8OB 3RESA 1G3TA 4M78G 1YJNT 4RCBA 2O4XA 4BY6B 3JCMc 4C8QD 3JSCA 3CMEA 4EPCA 1QVFS 2QI2A 3RKXA 5LJ5d 4J6XA 3OYNA 3X24B 1WQ7A 3PTAA 4C92G 1DJ7B 4C8QC 3M4GA 4MDWA 2RI5A 4M7DF 5GAOm 2E41A 5I21A 3OYIA 3SD4A 3PFSA 1VQLA 2E1HA 2XK0A 4RCCA 2QA4A 3V7RA 5DM7R 4C0DC 3QYGB 1XTDA 3F70A 3A8MB 4LDWA 3WVEB 3CMAA 4ELZC 4B9WA 3JCMg 1IREB 4M7DE 1VQPA 4II1A 1Y7XA 2RA2A 1K8AC 1WNLA 1VQ7T 4O5VA 3P8BB 3PT9A 1VQ6T 2OAUA 4F7UG 3G71T 4Q5WA 2ZPEB 4Y28E 2ZPFB 5GAMd 3FRNA 1M1GA 4PLIA 5J3BA 2RHXA 4OP0A 2XIDA 2QQAA 5KCHA 5GAOq 4M7DA 4IUTA 4FM4B 1YJWA 2EWNA 5CKHA 4ZGJB 2E6NA 1YI2T 2CKKA 4L5GA 3ER0A 3MHXA 4BUGA 3LYIA 2L8DA 3VYHB 2KVQG 3ZFJA 3OA6A 1FWZA 1YJNA 2EIFA 1KD1C 1O9SA 5GAN7 2BKDN 3JB9F 3BFMA 1JRIA 3QO3A 4ZN3A 2K4YA 3JCMd 3GNGA 4WF2A 1KC8U 3E1SA 5A2QE 2DD4A 3M58A 3OY9A 3CCUA 3NFCA 3NTHA 3R6OA 2V8KA 1Q82U 3SB2A 4EMGA 2DTHA 4RKUE 5LJ3f 5GANd 3BY7A 4E7HA 2VUBA 3EFSA 5GAN5 1M90U 1VQKT 3FIFA 2F69A 2DO3A 4M7AG 3ME9A 3JB9I 2XD0A 3PIPA 5CQYA 2EKOA 3L1AA 4QVCA 3L2UA 1QP2A 1G3YA 5GANj 1FX7A 3INZA 5DLQE 2L5QA 4C8QB 4DOWA 3UWNA 2YHTA 4ZN1A 1PSFA 1Q7YC 1TH7A 1VQ4T 2DVEA 4M7DD 2RM4A 2JUFA 4XTWA 3RIRA 3JB9H 3T9NA 1VQ7A 1VQ6A 4J7IA 1BIAA 3G71A 1YCYA 2JZ2A 2BUDA 3A8GB 2O01E 4C0DB 3JCMQ 4M7DC 4NS5A 3TEEA 3OYLA 4R56A 4GLKA 1VQOT 4DA4A 2FVUA 4CI0C 3FJPA 2CGHA 4XAXB 4MZMA 5EG2A 5J26A 4BY6C 1K8AU 3GP8A 2DIQA 1M1FA 3RKWA 1W2BS 2LCCA 3A8OB 4X9CA 4BI3A 2CS7A 5A0DA 2VC8A 1V29B 4KUDK 1BIBA 5CKDA 4ZTJA 3QJYA 2C06A 4N4GA 2IVWA 2VXEA 3SFMA 2RJDA 4N0AA 5GAMe 2RD1A 2VV5A 2LT1A 3OYCA 3C4SA 1H3ZA 3URGA 1VQKA 2EYQA 2KQWA 3JB9D 1KD1U 4MMLA 3L2QA 2XU8A 1YJ9T 4C92F 2EAYA 2P0PA 3PGGA 3HL8A 2MF2A 2ZPBB 2RHYA 4M78E 3QXEB 1NJIC 2PU9B 4A53A 4PKCC 3JCMe 3G7ZA 1OZ2A 4XTYA 4NOYA 1VQ4A 2DKGA 5KCOA 4M77F 4QVDA 4E7JA 4JRPA 2DXUA 1BI1A 1WQWA 4YTLA 2RI3A 1VQ5T 3M59A 3CCQA 3ZEHA 3OS2A 2PUKB 4M78A 1B34A 4C92E 5GANe 3CCRT 1LJOA 3PMIA 2RK1A 4X34A 3OS5A 3J80E 4BE2A 4OF1A 3QZ5B 5FU7C 4J8OA 1N9SA 2CZ6B 4JLIA 3VKIA 1SSFA 3HFNA 3NTIA 2FHDA 1QVFA 4F7UF 4C92A 4CRIA 4E7LA 3OQ5A 4Y91A 3CC4T 1QVGS 2KSSA 4M7DB 2K5LA 4MMKA 2LT4A 2QQ9A 3CEYA 1N9RA 1YIJT 2K5IA 1AHJB 2K3YA 4HA8A 1Y07A 4XU2A 1YBYA 1NPRA 1UGSB 4V2SA 2KK4A 4F7UE 4J5YA 3CC2T 5DLOA 2RHUA 3P8DA 4RMOA 3NTKA 2LCLA 3CD6T 3CCJT 5LJ5f 2E70A 3I56T 3H6ZA 4PL6A 3I55T 5DY9A 3CCST 1YJ9A 5FRMA 2Y90A 3OMCA 4XU0A 4F7UA 4R55A 2DZ9A 2QXFA 4HT9A 1O75A 5GAMg 4M78D 1H641 3JAME 4QVZA 3M55A 2R58A 4J6WA 1VQ5A 2HQEA 4FSXA 2RHZA 2V8IA 3GNFB 4IUPA 1VIFA 4LDYA 4IURA 4M77G 4BI8B 1MGQA 2WSEE 1N8RU 2L3RA 4M78C 3CCRA 3L2ZA 4C92D 5IAYA 4QQDA 1ZHIA 2D9TA 3OYYA 2RO0A 4OVAA 5GAN8 1YITT 2DPPB 2G3RA 4PJOG 5I2SA 1NJIU 5HY6A 4FL6A 3C12A 1U1TA 4JDSA 4C92C 4M75G 3UDCA 1LNXA 4M7AE 3HP9A 1K9MC 5GAMf 3OS0A 2EQMA 3V7CA 1VQMT 2FL7A 3A8HB 3ASKA 3JCMV 5GANg 3CC4A 5CKEA 2E12A 3CC7T 1I8FA 2X35A 2XDPA 2KMTA 2Y4XA 3BDLA 1W4SA 3KUFA 3M57A 3HRTA 3QUIA 3SDZA 5FU7B 4C5EA 4E47A 1YIJA 4Z02A 2VXFA 4HCBA 4M7AA 3OW2S 3CBOA 3M5AA 3QHSA 4LD6A 2JOYA 1NPPA 3M9QA 4PNOA 3OBWA 3V8JA 4ATOA 3CC2A 5CKFA 5M9OA 3JCMf 2LRQA 3CD6A 1M4ZA 2D0QB 2X4XA 4EDUA 3I56A 3I55A 1WGSA 2WACA 4HCZA 3VYGA 1XQHA 5AYFA 2LVMA 3JCMJ 1QW1A 3QG1A 2HBPA 3LW5E 3M4YA 2M9UA 3RKYA 2A7YA 3TREA 1X6OA 2RK2A 3C95A 5FROA 3CPWS 2XDDA 1YI2A 2MWPA 2MMPA 2PVOB 3S3MA 2P0KA 4KBMB 4FU6A 3PNWC 3DB4A 3MO8A 2PVDB 5C6SA 1YHQT 3V8LA 4C0FA 5GMKm 3J81E 1BKBA 3QPHA 4XTZA 2Y4YA 4DQ2A 1S72T 4XTXA 4C0ZA 1EIFA 2XDBA 1W2BA 2DTOA 2E5QA 4L59A 2PQWA 1LOJA 3V8KA 1BYMA 5LJ3h 3GF5A 4M78B 1B34B 3OYDA 3LWIA 2EFIA 1U8RA 1KQ2A 4PLLA 3CC7A 2YLBA 2DAQA 3A8LB 5GAOp 1BI3A 4ME7A 1I81A 4M7AC 1GXIE 5LL6S 2EQKA 3OYKA 3MEVA 3OYBA 2KDSA 4C92B 2HNIA 1UEBA 2M0OA 5GMKh 2OTJT 5GAOl 5LJ3j 3KXTA 3GPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMI A;  4QW2 A;  3LH0 A;  5FRN A;  4BE2 A;  3MP8 A;  3O8V A;  2RI5 A;  4C5G A;  2RJC A;  1SSF A;  3NTI A;  3OMG A;  2FHD A;  2M1H A;  3PFS A;  3SD4 A;  3OYI A;  3L2V A;  4GY5 A;  3OYH A;  4CRI A;  2EQJ A;  2K3X A;  3OQ5 A;  4E7L A;  2XK0 A;  4BD3 A;  2YRV A;  4BDZ A;  4A4E A;  3F70 A;  3FLG A;  3H8Z A;  4B9W A;  2RJE A;  3CEY A;  3P8H A;  2VYT A;  4IUU A;  2K3Y A;  2F5K A;  2BIV A;  4II1 A;  4A4F A;  4E7K A;  4BE0 A;  3LLR A;  3MEU A;  2RHU A;  5KE3 A;  3P8D A;  2B8A A;  3L2W A;  3NTK A;  4Q5W A;  5IN1 A;  3QKJ A;  4PLI A;  3H6Z A;  4PL6 A;  2RHX A;  5KCH A;  3OYJ A;  5FRM A;  3OMC A;  3S6W A;  3FC3 A;  4IUT A;  3OYE A;  2E6N A;  2GFA A;  2QQR A;  2DIG A;  1MHN A;  5J39 A;  2CKK A;  2M16 A;  4N4I A;  3FEO A;  3LYI A;  2L8D A;  4QVZ A;  3LX7 A;  2R58 A;  3OYM A;  3OA6 A;  4IKF A;  3MEW A;  2R57 A;  5KE2 A;  2HQE A;  2BKD N;  2RHZ A;  4IUP A;  4IUV A;  4QQ6 A;  3DLM A;  4IUR A;  2L3R A;  2QQS A;  2X4Y A;  3OB9 A;  1OZ3 A;  3OY9 A;  3NTH A;  4QQD A;  1N27 A;  2D9T A;  2L89 A;  4QQG A;  2RO0 A;  4OVA A;  5IAY A;  4UC4 A;  2G3R A;  2RHI A;  3LGL A;  3MP6 A;  5D6W A;  4E7H A;  2HQX A;  4FL6 A;  3E9F A;  3MP1 A;  1WJS A;  1G5V A;  2RJF A;  3OS0 A;  3S3O A;  2EQM A;  5KH6 A;  3L2R A;  3ASK A;  3ME9 A;  2RI2 A;  2EKO A;  3L2U A;  2X35 A;  2XDP A;  1OI1 A;  2IG0 A;  3BDL A;  3KUF A;  1OYX A;  2JTF A;  5CIU A;  3UWN A;  4B9X A;  4C5E A;  2R5A A;  4Z02 A;  1WJR A;  4E7I A;  2O4X B;  4LD6 A;  2LDM A;  3M9Q A;  4A4G A;  2LTO A;  4ZTF A;  3Q1J A;  3OS1 A;  5M9O A;  2LRQ A;  3EAE A;  2JZ2 A;  4A4H A;  2BUD A;  2NLU A;  2X4X A;  3E9G A;  4EDU A;  1WGS A;  4N4H A;  4NS5 A;  2WAC A;  4HCZ A;  2GF7 A;  3OYL A;  3UT1 A;  2LVM A;  4C5H A;  3L42 A;  2EQU A;  4IUQ A;  3LGF A;  5FRO A;  3QBY A;  5J26 A;  5C0M A;  3GOX A;  2MWP A;  3S3M A;  2P0K A;  2DIQ A;  4RG2 A;  1XNI A;  4FU6 A;  2LCC A;  3DB4 A;  3MO8 A;  3PNW C;  1KHC A;  5C6S A;  3MEA A;  4ZTJ A;  3MET A;  3FDR A;  3DB3 A;  4N4G A;  4C5I A;  2RJD A;  2X4W A;  5D6Y A;  4BDY A;  2R5M A;  3OYC A;  3C4S A;  3PMT A;  1H3Z A;  2E5Q A;  4L59 A;  2PQW A;  3QII A;  3QJ6 A;  3L2Q A;  2MWO A;  1RI0 A;  3OYD A;  2EFI A;  5D6X A;  3OYG A;  4PLL A;  3S3N A;  1WJQ A;  4BAC A;  2RHY A;  2GFU A;  2DAQ A;  3OYA A;  1OZ2 A;  5KCO A;  2EQK A;  2O4X A;  3OYK A;  3MEV A;  3OYB A;  4BE1 A;  4E7J A;  2RI3 A;  3OYF A;  3ZEH A;  2M0O A;  3OS2 A;  3OYN A;  4X34 A; 
#chains in the Genus database with same CATH topology
 2DMO A;  1PCX A;  1XOV A;  3MP8 A;  1WLP B;  2RJC A;  4ZNX A;  1YIJ Q;  3EFR A;  1KSW A;  2K3X A;  4OB1 B;  1SPK A;  1JJ2 S;  3CC2 Q;  5GAO r;  2CP5 A;  2HL5 C;  3CD6 Q;  2ZGW A;  3FLG A;  4OMO A;  4ELY C;  3I56 Q;  3I55 Q;  2DXB A;  2HSE B;  4JPB W;  5A0G A;  3VJP A;  2BIV A;  2LX9 A;  4FYY B;  4A4F A;  4E7K A;  4BE0 A;  2A37 A;  1QVG A;  2MPX C;  2CZ7 B;  1ZSZ C;  2DTI A;  1M1K R;  4XU3 A;  4J9D A;  3CCE T;  1Q82 R;  2M16 A;  4J9F A;  4M77 E;  2DJZ A;  4QQ6 A;  8AT1 B;  5CAI A;  1K0X A;  4OMF B;  3X26 B;  4LD9 K;  2FYK A;  4MZP A;  3VUB A;  4M75 E;  1IZ6 A;  1VQL T;  2E10 A;  3AHU A;  2DXC A;  5KH6 A;  1D0Y A;  2IG0 A;  2FO0 A;  1OYX A;  3RMS A;  2E64 A;  1KQS S;  1SF9 A;  2LDM A;  1M1K C;  3VRZ A;  2JJ9 A;  1Q82 C;  4J83 A;  3E9G A;  4DEX A;  3G6E T;  1VQ9 T;  4XK8 E;  3E2U A;  3L42 A;  3FB9 A;  1S72 Q;  1ZBX A;  2DL3 A;  3EG2 A;  3RMQ A;  4AG2 C;  3M0T A;  1LVK A;  1UG1 A;  1QCF A;  2D6F A;  1YN8 A;  4PJO C;  1SEM A;  1W1F A;  1WJQ A;  2GFU A;  4HVV A;  3SWN C;  2KXD A;  5GAN f;  2EKH A;  2DXT A;  2HAX A;  2CRE A;  4E7Z A;  4A63 B;  1F1B B;  1VQN A;  1OU8 A;  2QEX A;  4KRT A;  3DLL A;  3G4S T;  1JEG A;  1BI2 A;  2RQT A;  4JS5 A;  2XIC A;  4K11 A;  4BD3 A;  2G6F X;  2ZCF B;  2RJE A;  4IUU A;  4WCI A;  1UUE A;  1NE8 A;  2O9S A;  3CME Q;  5IN1 A;  3OYJ A;  1PD0 A;  2RQU A;  1K9M U;  4DBQ A;  2DIG A;  1Q81 U;  5HK0 A;  3LX7 A;  5CK9 A;  3CCV Q;  2JTM A;  1VQ8 Q;  1R77 A;  3DLM A;  2P84 A;  1M3C A;  1E6H A;  4M75 B;  1W2B P;  5FU6 C;  2YUN A;  3MP6 A;  3LGL A;  2HQX A;  4C8Q F;  3NGP A;  1WJS A;  1X01 A;  3S3O A;  2DRK A;  3JB9 G;  1ZUU A;  3CCL T;  4M78 F;  2M02 A;  2RB6 A;  1WJR A;  2O4X B;  1N8R C;  1AVZ C;  1YWP A;  4A4H A;  3A1P A;  2QDY B;  3DKM A;  4LUE A;  3HRS A;  5IT9 E;  4OGE A;  3J7A F;  3M56 A;  4C5H A;  3LGF A;  1SG5 A;  2OTL A;  1RAI B;  3GOX A;  3QSU A;  5GAN 3;  5LJ3 e;  1TS9 A;  1YP5 A;  4C0G A;  4XTU A;  1QVG P;  1G3S A;  5L8R E;  1VQP T;  1FMW A;  5HK3 A;  2D1X A;  1PRL C;  4OB3 B;  2DET A;  1NLP C;  3QJ6 A;  2P4T A;  4BB7 A;  5IHI A;  5D6X A;  2HEQ A;  1RLQ C;  3RES A;  1OUL A;  1YJN T;  1AEY A;  3JCM c;  4C8Q D;  3CME A;  1UJY A;  2KT1 A;  3M4G A;  4M7D F;  3PFS A;  2DER A;  2B86 A;  2E1H A;  3A98 A;  2XK0 A;  3V7R A;  3QYG B;  1XTD A;  3F70 A;  1MMG A;  3JCM g;  1IRE B;  2ECZ A;  1OX8 A;  1WNL A;  1VQ6 T;  2ZPE B;  2IPO B;  2ZPF B;  5GAM d;  5J3B A;  4IUT A;  1YJW A;  2EWN A;  3MHX A;  2KVQ G;  1GFC A;  4HVW A;  1O9S A;  1JRI A;  4ZN3 A;  3ULR B;  1KC8 U;  2X3W D;  5A2Q E;  3M58 A;  3OY9 A;  2K3B A;  3R6O A;  2LJ1 A;  2DTH A;  5LJ3 f;  5GAN d;  3BY7 A;  4E7H A;  2DNU A;  3EFS A;  1M90 U;  3UAT A;  3FIF A;  2F69 A;  2DO3 A;  5CQY A;  3L1A A;  1MV0 B;  1QP2 A;  3INZ A;  3UWN A;  1PSF A;  1TH7 A;  1AOJ A;  4X1V A;  4M7D D;  2JUF A;  4XTW A;  3T9N A;  2SRC A;  3OYL A;  4R56 A;  3CMA Q;  4GLK A;  2CGH A;  4DBH A;  2CP0 A;  2C0O A;  7AT1 B;  1M1F A;  3RKW A;  3A8O B;  4BI3 A;  2CS7 A;  5A0D A;  5CKD A;  2V26 A;  3PVQ A;  1VA7 A;  3SFM A;  1HSQ A;  1WX6 A;  2HMA A;  2D8H A;  1H3Z A;  2GTO A;  2XU8 A;  4C92 F;  3PGG A;  2RHY A;  3VS4 A;  4A53 A;  4PKC C;  2DYI A;  1VQ4 A;  2DKG A;  2I0N A;  4JRP A;  1VQ5 T;  2RI3 A;  1IHV A;  3OS2 A;  2PUK B;  2RQW A;  2DL8 A;  3OS5 A;  1GBQ A;  1KK7 A;  4BE2 A;  4J8O A;  3HFN A;  2FHD A;  4AFQ C;  4F7U F;  1BK2 A;  2MOX A;  1D1C A;  3OQ5 A;  4CC2 A;  1EX4 A;  2BZY A;  2QQ9 A;  1AZG B;  1K9M R;  1CKB A;  1AHJ B;  1WFW A;  1SRM A;  5FW9 A;  5DLO A;  2JM9 A;  1VYV A;  2NUT A;  2KNB B;  2OI3 A;  5FWB A;  4PJL A;  5FRM A;  4IIO A;  2J05 A;  2VB6 A;  1YI2 T;  4M7A F;  3GNF B;  1QWE A;  4IUR A;  2WSE E;  4M78 C;  3CCR A;  3L2Z A;  2YRC A;  4C92 D;  1ZHI A;  2D9T A;  1QWF A;  3OYY A;  2RO0 A;  3EGU A;  4GLM A;  2DPP B;  5I2S A;  3C12 A;  3HP9 A;  1K9M C;  1ZSZ B;  1MUZ A;  1Q7Y R;  3JCM V;  3CCQ Q;  1Q95 G;  3CC7 T;  1GCQ C;  3QUI A;  1W4S A;  2EGC A;  4E47 A;  5IHK A;  5FU7 B;  4Z02 A;  1EZZ B;  2JOY A;  4PNO A;  3M9Q A;  1X2K A;  2YT6 A;  4FSS A;  2DL5 A;  1WGS A;  4HCZ A;  1PG5 B;  3VYG A;  1PNJ A;  2LVM A;  4FYW B;  1JXO A;  3M4Y A;  1AD5 A;  3RKY A;  1X6O A;  2XDD A;  1K73 R;  2MMP A;  1T0J A;  3DB4 A;  3PNW C;  2PVD B;  2A08 A;  4PJM A;  4XTZ A;  5GJV B;  1WHG A;  4XTX A;  4C0Z A;  4F17 A;  2DTO A;  1Y0M A;  2E5Q A;  1ABQ A;  1B34 B;  2EFI A;  2QTV A;  2D8J A;  3A8L B;  4RTT A;  1BI3 A;  1I81 A;  1GXI E;  3OYB A;  1X6B A;  5AT1 B;  3H0I A;  3REA B;  3U23 A;  3CC4 Q;  3M0S A;  1K73 C;  2HD0 A;  3OYH A;  3SHW A;  1NLO C;  3TVT A;  3CCS Q;  2QDL A;  1UGP B;  5GAN 2;  3MKD A;  5GAN 4;  2LQ8 A;  5KYN A;  1KHI A;  1N6A A;  1M3B A;  4PJO F;  4ZGE B;  3X25 B;  4FW1 A;  2QAS A;  2KRO A;  4GBQ A;  2V1Q A;  3MPU B;  3LWH A;  4IUV A;  1BBZ A;  1SRL A;  1M5Q 1;  2OTJ A;  3GIB A;  3OB9 A;  1MNE A;  4M77 A;  4UC4 A;  1X75 C;  2QQB A;  5D6W A;  2GBQ A;  2ZPG B;  4M4Z A;  2KRS A;  2L3P A;  2RJF A;  5GAN 6;  4M75 A;  1NZ9 A;  2ROL A;  3EG1 A;  3VS3 A;  3WVD B;  4E7I A;  3MCA B;  1WYX A;  1UGR B;  5HKC A;  4RTY A;  2ZPH B;  2LTO A;  4A54 A;  4C8Q G;  2HCK A;  1QP3 A;  3EAE A;  4KUI A;  3JCM W;  2NLU A;  2YRD A;  4JRQ A;  2K2V A;  2GF7 A;  3OW2 A;  2VGN A;  1RLP C;  2E65 A;  4XU1 A;  1M90 C;  2YDL A;  5KYW A;  3CCE A;  2E6Z A;  2EQU A;  3A5Z B;  2WSF E;  1H92 A;  4MDX A;  4RG2 A;  2DRM A;  4PJO D;  3HHT B;  3TU4 K;  1I5L A;  2OJ2 A;  1NG2 A;  3R6N A;  3HSB A;  1I0C A;  3OYG A;  3CCS A;  2K6D A;  1PSE A;  3UPU A;  5GAO l;  4BE1 A;  2NWM A;  2ED1 A;  2QG9 B;  5FRN A;  3QDR B;  2JVV A;  3G6E A;  1VQ9 A;  1KG1 A;  3JCM h;  3CBP A;  4C5G A;  4EMK B;  2JN0 A;  1K9A A;  2H8H A;  1FXX A;  4GY5 A;  4NL3 A;  4D6W A;  1VUB A;  4BDZ A;  2XI9 A;  3P8H A;  3O5Z A;  3TCJ A;  1JJ2 A;  4M7D G;  3KBG A;  2P4R A;  2CSI A;  2DX1 A;  1QVP A;  3S6W A;  2JXB A;  1Q86 U;  1RL2 A;  3FEO A;  4IKF A;  3CCQ T;  4OB0 B;  2EJF A;  2R57 A;  5KE2 A;  3RER A;  2I2L A;  2QQS A;  1N27 A;  2O2O A;  3M53 A;  2MI6 A;  1VOM A;  3G4S A;  5GAO n;  1ZQ1 A;  1TSF A;  3M0Q A;  1ZX6 A;  1VQN Q;  5CR2 A;  2FRY A;  2QEX Q;  5I2M A;  4C8Q E;  3JCM X;  5CQX A;  2GTJ A;  4BI4 A;  3WXM B;  3V7S A;  1T3S A;  3QDF A;  3CCU Q;  3UT1 A;  1KQS A;  1HYO A;  3JCM b;  2CT3 A;  2A3L A;  2XKO C;  5GMK l;  5C0M A;  2QA4 T;  3EG9 B;  3VS6 A;  2CP2 A;  2KT8 A;  1M2V B;  3JV3 A;  3FDR A;  3DB3 A;  1ZUY A;  5D6Y A;  2R5M A;  3PMT A;  1J3T A;  2NUP B;  1D0X A;  2AT1 B;  3CCM A;  4BAC A;  4CC7 A;  3CCL A;  2QK0 A;  2HBW A;  4HVU A;  3JSC A;  2CP3 A;  4EPC A;  4WTO B;  1QVF S;  1QKW A;  3RKX A;  5LJ5 d;  4J6X A;  3X24 B;  1KD1 R;  3PTA A;  4C92 G;  1DJ7 B;  2RI5 A;  5GAO m;  1HJD A;  5ECA A;  2JTE A;  4C0D C;  4LDW A;  3WVE B;  1MND A;  3EFO B;  2NUZ A;  5FWC A;  4M7D E;  1IRX A;  1VQP A;  1OPK A;  5KYX A;  1VQ7 T;  4F7U G;  3G71 T;  4Q5W A;  2OTL Q;  3FRN A;  2RHX A;  5KCH A;  2E6N A;  1NYF A;  2CKK A;  4L5G A;  1YJN A;  2L8D A;  1U5S A;  1YCS B;  1KD1 C;  2HKN A;  3QO3 A;  4OMN A;  2K4Y A;  3GNG A;  3E1S A;  3CCU A;  2CDT A;  1PD1 A;  3SB2 A;  4RKU E;  2O9V A;  1OU9 A;  5GAN 5;  1VQK T;  1I5O B;  4M7A G;  3JB9 I;  3PIP A;  1N8R R;  2DIL A;  1OV3 A;  4C8Q B;  2ESW A;  4ZN1 A;  2YUO A;  3H9N A;  3RIR A;  1ARK A;  1VQ6 A;  4J7I A;  4RTW A;  2BUD A;  3JCM Q;  3EGD B;  4AFZ C;  4DA4 A;  1GFD A;  2FVU A;  4CI0 C;  1UE9 A;  5J26 A;  1K8A U;  3GP8 A;  4X9C A;  1JJ2 P;  1V29 B;  2COY A;  2KEA A;  2VXE A;  2IVW A;  1YJW Q;  2X51 A;  2VV5 A;  3C4S A;  4Z8A A;  2EYQ A;  3NMZ C;  1WIE A;  4MML A;  1YJ9 T;  2P0P A;  3QXE B;  3JCM e;  4XTY A;  4M77 F;  4HXJ A;  4YTL A;  1BI1 A;  4OMP A;  2EVR A;  2MIO A;  4C92 E;  1B34 A;  1PM3 A;  1X6G A;  1LJO A;  1IXD A;  1T3L A;  2JS2 A;  1LPL A;  2KSS A;  3M0R A;  4M7D B;  2K5L A;  4PFP A;  5I22 A;  1YIJ T;  2K3Y A;  4HA8 A;  1NPR A;  1UGS B;  4V2S A;  4F7U E;  3CC2 T;  1YNZ A;  1TXQ A;  3P8D A;  4AG1 C;  1RAD B;  2LCL A;  1KQS P;  3CD6 T;  3I56 T;  3H6Z A;  3I55 T;  5DY9 A;  1T0H A;  1C0M A;  2IIM A;  1UTI A;  4HT9 A;  4M78 D;  1H64 1;  4LE9 A;  4QVZ A;  3I9Q A;  3RNJ A;  3EGX A;  3FJ5 A;  2HQE A;  3EHQ A;  2RHZ A;  2V8I A;  2VWF A;  4IUP A;  4BI8 B;  1VQ5 A;  2L3R A;  2MYS A;  2DFU A;  1PC0 A;  2G3R A;  4PJO G;  1NJI U;  1AWO A;  2KBT A;  1VQ4 Q;  3UDC A;  2Z0W A;  4M7A E;  1B3Q A;  2JW4 A;  3OS0 A;  1OOT A;  2EQM A;  3A8H B;  2E12 A;  1UJ0 A;  2KMT A;  3BDL A;  4C5E A;  3M57 A;  3CBO A;  4LD6 A;  2E5K A;  3JCM f;  2JMA A;  1M4Z A;  4HCK A;  5D7U A;  2X4X A;  2WAC A;  2QGG A;  3JCM J;  3QG1 A;  2HBP A;  3TRE A;  4RTU A;  2A7Y A;  3C95 A;  1WHK A;  3CPW S;  1YI2 A;  2P0K A;  2EYX A;  3MO8 A;  2DEU A;  4AT1 B;  2RMO A;  3I5S A;  1ZA1 B;  4J9C A;  4DQ2 A;  1S72 T;  1EIF A;  1BYM A;  1H8K A;  1JXM A;  1IO6 A;  3V8K A;  1R0B G;  2KYM A;  2LMJ A;  1WXU A;  1KQ2 A;  3CC7 A;  3CCR Q;  1RAA B;  2JS0 A;  4ME7 A;  5GAO p;  2X3X D;  1SSH A;  4C92 B;  1M3A A;  4QW2 A;  2DYB A;  1WHJ A;  3OBY A;  3O8V A;  2GCX A;  2DA9 A;  4JLG A;  4R0K A;  2EYZ A;  2AHJ B;  3CXC S;  1X69 A;  4OGC A;  3ZBD A;  4HKE A;  2K79 A;  1ZUK A;  1AWX A;  4F7U B;  4EMK A;  5KE3 A;  1C6V X;  3N5B B;  3QKJ A;  4JUV A;  4NL2 A;  2BE7 D;  3VU3 C;  1UGQ B;  3M0U A;  1VQO A;  2GNC A;  4N4I A;  2D0N A;  2FPF A;  1YIT Q;  3CME T;  2QTX A;  3MEW A;  2FZC B;  4HCC A;  1Z9Z A;  5KYY B;  4VUB A;  2L89 A;  4KUL A;  4PJO E;  2EGA A;  2KXC A;  1RAB B;  2MAM A;  4M7A B;  3CCV T;  2KY9 A;  1U3O A;  1VQ8 T;  1WXB A;  1Q81 R;  2CYZ B;  3E9F A;  1G5V A;  1JBM A;  2F2X A;  2DLP A;  1M9S A;  2XHC A;  5GMK e;  2CZ0 B;  3RR6 A;  2DJQ A;  4P5N A;  1QQJ A;  1YHQ Q;  1WHL A;  3QBY A;  3TSW A;  2VVK A;  1KHC A;  4FYX B;  1KQ1 A;  1GBR A;  3CBM A;  3HFO A;  1Q81 C;  4M77 C;  1U1S A;  1ZBJ A;  4D8K A;  3QWY A;  2LQK A;  1Y71 A;  2L0A A;  3HKS A;  3QII A;  4Z88 A;  1PRM C;  3CCJ A;  2MWO A;  1JO8 A;  1U06 A;  1TUG B;  3S3N A;  2OTJ Q;  1X27 A;  1AT1 B;  4M75 C;  2J6O A;  5GAM h;  2CZ1 B;  3JCM P;  2GQV A;  1WHM A;  2DEQ A;  2HZY A;  1AWJ A;  3UA6 A;  1UHC A;  3E19 A;  4OB2 B;  1HXD A;  5GAM j;  1YIT A;  1NM7 A;  1D3B B;  3HTR A;  2DD5 A;  3GLX A;  1M1K U;  5EC7 A;  5GAN h;  3TSZ A;  4M7A D;  1VQM A;  3H8Z A;  2WSC E;  1QMC A;  3HRU A;  5LJ3 d;  5A0L A;  3CCE Q;  3MEU A;  2B8A A;  2LJ3 A;  4XQ3 A;  4J6Y A;  3L2W A;  1IB8 A;  2A36 A;  3EFO A;  4RG8 A;  2RPN A;  1X43 A;  2EJ9 A;  2J6F A;  5J39 A;  5LJ5 e;  1VQL Q;  1I4K 1;  4PJO B;  2PVG B;  1UB4 A;  2X4Y A;  2X4J A;  1YHQ A;  4A4K A;  3SWN B;  3MP1 A;  3L2R A;  1Y96 B;  1UGV A;  2K57 A;  4J9E A;  4B9X A;  1KC8 R;  5FLX E;  3G6E Q;  1VQ9 Q;  1JB0 E;  2LNV A;  2CSQ A;  2EYW A;  3Q1J A;  4FT2 A;  4X9D A;  3PIO A;  1M90 R;  4JS4 A;  1VIE A;  2H3J A;  2P0Q A;  4TVR A;  4C8Q A;  4JRK A;  4IUQ A;  1FYN A;  1QKX A;  2YLC A;  3CMA T;  3PVL A;  1IHW A;  3EGD A;  1TUC A;  3MET A;  5LJ5 g;  2CUD A;  2FRW A;  2W10 A;  2YUP A;  4BDY A;  4FT4 A;  4EMH A;  2DL4 A;  1KC8 C;  4DOV A;  2VGM A;  2V1R A;  1TOV A;  5FU6 B;  4N0A C;  4JJB A;  1R8O B;  3G1J A;  4M78 G;  4RCB A;  2O4X A;  3G4S Q;  2QI2 A;  1N5Z A;  2O88 A;  3OYN A;  3IQL A;  1UFF A;  2E3I A;  3OYI A;  3EH2 A;  3VS7 A;  1VQL A;  2QA4 A;  1NEG A;  3A8M B;  2CT4 A;  4B9W A;  1QCO A;  4IIM A;  4F04 B;  1UEC A;  4FCY A;  2QYZ A;  4O5V A;  2XMF A;  2OAU A;  4JJC A;  1NBE B;  4PLI A;  1M1G A;  4KGZ B;  3RDV A;  4M7D A;  1MMN A;  1MV3 A;  4KH0 B;  4AMC A;  4DEY A;  4ZGJ B;  5CKH A;  5IH2 A;  2AZS A;  2LP5 A;  3ER0 A;  2VAS A;  3LYI A;  3ZFJ A;  3VYH B;  1OQK A;  1FWZ A;  3VS2 A;  5GAN 7;  1VYU A;  3BFM A;  4WF2 A;  4DBR A;  3NFC A;  3NTH A;  3CCM Q;  3CCL Q;  2ENM A;  1S1N A;  1W6X A;  3ME9 A;  4QVC A;  2EKO A;  1G3Y A;  2SEM A;  5DLQ E;  2L5Q A;  4DOW A;  4E2F B;  4JZ4 A;  1VQ7 A;  1BIA A;  1FMV A;  1NYG A;  3G71 A;  3A8G B;  2O01 E;  3TEE A;  2LQW A;  2H3E B;  2NYS A;  1TG0 A;  2HQH A;  1VQP Q;  2EGE A;  4XAX B;  4MZM A;  5EG2 A;  1ZSG A;  4BY6 C;  2KYB A;  2DIQ A;  1W2B S;  2LCC A;  2VC8 A;  1BIB A;  2DL7 A;  2C06 A;  2K2M A;  2RJD A;  4N0A A;  5GAM e;  2CH4 A;  4AFS C;  2LT1 A;  3OYC A;  3URG A;  1VQK A;  1YJN Q;  2KQW A;  2NUT B;  3L2Q A;  2EAY A;  2EW3 A;  2ZPB B;  4M78 E;  2PU9 B;  4OML A;  1BB9 A;  3G7Z A;  1Z9Q A;  4E7J A;  2DXU A;  3ZL7 C;  2OX7 A;  3UF4 A;  5GAN e;  4X34 A;  2RK1 A;  3C0C A;  2CP7 A;  3H41 A;  4OF1 A;  5FU7 C;  3VS0 A;  1N9S A;  2CZ6 B;  4LNP A;  1SSF A;  2DVJ A;  1QVF A;  2EPD A;  2RQR A;  4C92 A;  4E7L A;  1NEB A;  2DE0 X;  4Y91 A;  1VQ6 Q;  3CC4 T;  1QVG S;  2GGR A;  2ED0 A;  2LT4 A;  4ORZ A;  3CEY A;  1N9R A;  3KFV A;  2K5I A;  4XU2 A;  1YBY A;  2KK4 A;  1M27 C;  4J5Y A;  1R0C B;  2RHU A;  3NTK A;  1G2B A;  2M51 A;  3CCS T;  4PL6 A;  1YJ9 A;  5HCK A;  2Y90 A;  3OMC A;  2FEI A;  4F7U A;  4R55 A;  2DZ9 A;  2QXF A;  1O75 A;  5GAM g;  1GL5 A;  1WZO A;  2R58 A;  1CKA A;  4LDY A;  1VIF A;  1MGQ A;  4D8D A;  5GAN 8;  1WXT A;  4JDS A;  1LNX A;  2JMC A;  5GAM f;  3OW2 P;  3V7C A;  5GAN g;  2E3H A;  5KYY A;  2X35 A;  2XDP A;  2Y4X A;  1YIJ A;  3SDZ A;  2AIR B;  2VXF A;  4M7A A;  1X2Q A;  3V8J A;  1NPP A;  4ATO A;  3CC2 A;  2J6K A;  5CKF A;  5M9O A;  1WA7 A;  2LRQ A;  3CD6 A;  1E7O A;  4RTZ A;  4EDU A;  3I56 A;  3RBB B;  2L3S A;  3I55 A;  1XQH A;  4RUG A;  1PKS A;  1B7T A;  2KGT A;  5FRO A;  2AZV A;  2RK2 A;  1MMA A;  3VRY A;  1LCK A;  3S3M A;  1M8M A;  1RAH B;  5C6S A;  3V8L A;  5GMK m;  4E7S A;  1BKB A;  1G8X A;  3H0F A;  2Y4Y A;  3UA7 A;  1FMK A;  4F16 A;  4RTV A;  2CUB A;  4L59 A;  2PQW A;  1LOJ A;  1V1C A;  2RF0 A;  1ZSZ A;  1VQ5 Q;  1JQQ A;  3LWI A;  4M78 B;  3OYD A;  4PLL A;  2YLB A;  4OMQ A;  1K0S A;  2RNA A;  4LUD A;  1GRI A;  5LL6 S;  2EQK A;  2KDS A;  2HNI A;  2M0O A;  2FZG B;  5GMK h;  1RUW A;  1WPY A;  4M77 B;  1WDX A;  1YFN A;  3L2V A;  2BE9 B;  4LN2 A;  4ZGD B;  2COZ A;  2EQI A;  3H0H A;  1MMD A;  5GMK j;  1SHG A;  2V8J A;  2YRV A;  1K1Z A;  2ZZD A;  3JB9 J;  5KYU B;  3C94 A;  1P92 A;  2DBK A;  3THK A;  2LX7 A;  1S72 A;  3M54 A;  1D3B A;  1RAG B;  2CP6 A;  5CCA A;  1PKT A;  1G83 A;  3CCM T;  3QZ9 B;  1YI2 Q;  1D09 B;  3FC3 A;  3OSS C;  5KYW B;  1BCM A;  4DBF A;  4M75 F;  3X28 B;  1Q7Y U;  1TUD A;  1CSK A;  3QWX X;  4MZT A;  3CC7 Q;  2RHI A;  1Q86 R;  5CO7 A;  1IGU A;  1ZA2 B;  1EFN A;  4JJD A;  4PJO A;  2RH2 A;  1M8V A;  2A0F B;  4LDV A;  2A28 A;  1OI1 A;  1G3W A;  2R5A A;  3SWN A;  4EMK C;  5GMK i;  2KR3 A;  1K73 U;  3BDU A;  4ZTF A;  1UHF A;  3OS1 A;  3JRZ A;  1Y96 A;  1VQN T;  5L23 A;  3I5R A;  1QVF P;  4XTV A;  2PZ1 A;  2QEX T;  4KH1 B;  1BCO A;  2F1L A;  4OMM A;  5LJ5 h;  1XJW B;  2MK5 A;  3EG3 A;  2ABL A;  4CC3 A;  4M77 D;  2JNG A;  2J06 A;  1XNI A;  1KIK A;  3CCU T;  1RAF B;  2ZPI B;  1Q86 C;  3MEA A;  4JZ3 A;  1UDL A;  3AT1 B;  3CCV A;  5LJ5 j;  3CPW A;  1VQ8 A;  1HD3 A;  1VQO Q;  4M75 D;  9ATC B;  1RAC B;  4PK4 A;  2FB7 A;  3X20 B;  3SEM A;  2HDA A;  1AWW A;  3EHR A;  3NHN A;  2QAZ A;  3D7S B;  1OPL A;  2PNI A;  3OYF A;  5LJ3 g;  1E6G A;  2JT4 A;  3LH0 A;  5CVI A;  2YXY A;  3QYH B;  3OMG A;  2M1H A;  2MCN A;  4KT0 E;  2EQJ A;  1RI9 A;  4A4E A;  4AFU C;  2COW A;  2M0Y A;  1YWO A;  2VYT A;  1A0N B;  2F5K A;  1TU0 B;  1OX9 A;  3CXC A;  1D1B A;  3OSV A;  3LLR A;  2LCS A;  1C1A A;  5CKB A;  3HPW A;  1AZE A;  1BI0 A;  2L3Q A;  4FYV B;  4FIB A;  3PE0 A;  4JJN K;  3OYE A;  2QQR A;  2GFA A;  1MHN A;  2AKL A;  2CH4 W;  3OYM A;  5IXF A;  2OTL T;  4KGX B;  4LDU A;  3VS1 A;  4HT8 A;  4JRI A;  2PUO B;  3RUX A;  1OZ3 A;  3CQT A;  3CCJ Q;  4QQG A;  2PTK A;  4J9I A;  3VV0 A;  1ABO A;  4CC4 B;  3BW1 A;  2RI2 A;  3LH5 A;  2JTF A;  5CIU A;  2XG8 D;  2DZC A;  1HK9 A;  4A4G A;  2KRM A;  4J9G A;  4B6M A;  4PJJ A;  2VKN A;  4EIK A;  4N4H A;  2F5T X;  4L6V 5;  6AT1 B;  2O31 A;  1VQM Q;  2EJG A;  1D0Z A;  1M2O A;  1PWT A;  2KAF A;  3CPF A;  4QT7 A;  4J9B A;  2LC4 A;  1WHH A;  4QKU A;  4J7F A;  1Y57 A;  2LNH B;  4ESR A;  4C5I A;  3EH1 A;  2X4W A;  5KYX B;  3VUZ A;  2DK3 A;  4Z89 A;  4KGV B;  4O6J A;  1RI0 A;  1K8A R;  4LDX A;  1YJW T;  2K5F A;  1WI7 A;  3OYA A;  1ZLM A;  2DBM A;  1G3T A;  2ROT A;  4BY6 B;  2FG0 A;  1WQ7 A;  2GQI A;  4C8Q C;  2C0T A;  4MDW A;  2E4H A;  2E41 A;  5I21 A;  2FZK B;  3SD4 A;  3I35 A;  2KI7 A;  4RCC A;  5DM7 R;  2KE9 A;  3CMA A;  3EG9 A;  2BZX A;  4ELZ C;  4ANJ A;  2OAW A;  1M2V A;  1D1A A;  4II1 A;  2F2W A;  1Y7X A;  2RA2 A;  1K8A C;  3P8B B;  3PT9 A;  1QLY A;  4Y28 E;  2NUP A;  4FW2 A;  4OP0 A;  5GAO q;  2XID A;  2QQA A;  4FM4 B;  3EG0 A;  1I07 A;  4BUG A;  3OA6 A;  2EIF A;  2YSQ A;  3JB9 F;  2BKD N;  5GJW B;  3JCM d;  3CPW P;  2DD4 A;  2DM1 A;  2V8K A;  1Q82 U;  4EMG A;  2VUB A;  2JM8 A;  2LJ0 A;  2XD0 A;  5GAN j;  3L2U A;  1KJW A;  1FX7 A;  2YUQ A;  2YHT A;  1Q7Y C;  1VQ4 T;  2DVE A;  2RM4 A;  3JB9 H;  1VYT A;  1NJI R;  1YCY A;  2JZ2 A;  4C0D B;  4M7D C;  1ACM B;  2ZAE A;  4NS5 A;  2QA4 Q;  4F14 A;  3MJX A;  1VQO T;  4E6R A;  2ATC B;  2HL3 A;  3FJP A;  2EBP A;  1JU5 C;  3CXC P;  3GBQ A;  4KUD K;  4ZTJ A;  3QJY A;  2EYY A;  1W70 A;  4N4G A;  2DF6 A;  4PFO A;  2RD1 A;  4PFZ A;  1BU1 A;  2W0Z A;  1I1J A;  3JB9 D;  1KD1 U;  2RQV A;  2AKK A;  2BTT A;  3HL8 A;  2MF2 A;  1NJI C;  1OZ2 A;  4NOY A;  5KCO A;  4QVD A;  3EGX B;  1WQW A;  3M59 A;  3CCQ A;  3ZEH A;  4M78 A;  5IXB A;  3CCR T;  2J7I A;  3PMI A;  3J80 E;  3QZ5 B;  5I11 A;  4JLI A;  1IGQ A;  3VKI A;  3NTI A;  2BZ8 A;  1TTH B;  2K7A A;  4CRI A;  1KFZ A;  1TWB A;  1VQ7 Q;  5IHN A;  1PHT A;  3TQ7 P;  3G71 Q;  1GCQ A;  4MMK A;  1K76 A;  2X9H A;  1Y07 A;  1SHF A;  2K9G A;  2F2V A;  2FPE A;  4RMO A;  3CCJ T;  5LJ5 f;  2E70 A;  5KYU A;  3M0P A;  4PJN A;  4XU0 A;  2AK5 A;  4RTX A;  3JAM E;  3M55 A;  4J6W A;  4J9H A;  4FSX A;  4M77 G;  1VQK Q;  1N8R U;  5IAY A;  4QQD A;  2QGF B;  2C0I A;  4OVA A;  1H3H A;  1YIT T;  4LXC A;  5HY6 A;  4FL6 A;  1RAE B;  1B07 A;  1U1T A;  2LQN A;  4C92 C;  4M75 G;  2L2P A;  1VQM T;  2FL7 A;  3ASK A;  3CC4 A;  1GCP A;  5CKE A;  1I8F A;  3KUF A;  3HRT A;  4HCB A;  3OW2 S;  3QHS A;  3M5A A;  3OBW A;  2KRN A;  3NPF A;  2RN8 A;  2D0Q B;  1OEB A;  5AYF A;  1QW1 A;  1V76 A;  1M30 A;  3LW5 E;  2M9U A;  2MWP A;  2PVO B;  4KBM B;  4FU6 A;  1QCN A;  1YHQ T;  1SKU B;  2HKQ B;  4C0F A;  3J81 E;  1YJ9 Q;  2FPD A;  3QPH A;  3REB B;  2XDB A;  2YWW A;  1W2B A;  3BE3 A;  5LJ3 h;  3GF5 A;  1U8R A;  4Y92 A;  3VS5 A;  2LZ6 B;  2DAQ A;  4M7A C;  2HSP A;  3OYK A;  3MEV A;  1UEB A;  2OTJ T;  8ATC B;  5LJ3 j;  3KXT A;  3GPL A;  1K4U S; 
#chains in the Genus database with same CATH homology
 4QW2 A;  1WPY A;  1XOV A;  4M77 B;  3MP8 A;  3OBY A;  3O8V A;  2GCX A;  4JLG A;  1K73 C;  2RJC A;  2HD0 A;  3EFR A;  3L2V A;  2AHJ B;  3OYH A;  3CXC S;  2K3X A;  4OB1 B;  4ZGD B;  4OGC A;  1JJ2 S;  5GMK j;  2V8J A;  2YRV A;  2ZZD A;  3ZBD A;  5GAO r;  3JB9 J;  3C94 A;  1P92 A;  2ZGW A;  3FLG A;  4HKE A;  4ELY C;  4F7U B;  2DXB A;  1UGP B;  5A0G A;  4EMK A;  3VJP A;  5GAN 2;  1S72 A;  2BIV A;  2LX9 A;  3M54 A;  1D3B A;  4A4F A;  4E7K A;  4BE0 A;  5KE3 A;  5GAN 4;  2LQ8 A;  5CCA A;  1QVG A;  1KHI A;  3N5B B;  3CCM T;  2CZ7 B;  3QKJ A;  1N6A A;  3QZ9 B;  4JUV A;  4NL2 A;  2DTI A;  4XU3 A;  3VU3 C;  3FC3 A;  3WXM B;  1UGQ B;  3OSS C;  4PJO F;  4ZGE B;  3CCE T;  1VQO A;  3X25 B;  2M16 A;  4N4I A;  4M75 F;  3CME T;  4M77 E;  2QTX A;  3X28 B;  3MEW A;  2DJZ A;  1Q7Y U;  3LWH A;  4IUV A;  4QQ6 A;  4HCC A;  1M5Q 1;  2OTJ A;  3GIB A;  3OB9 A;  4VUB A;  5CAI A;  2L89 A;  4KUL A;  4OMF B;  4PJO E;  4M77 A;  2MAM A;  4MZT A;  3X26 B;  2FYK A;  4MZP A;  4UC4 A;  4LD9 K;  1X75 C;  4M7A B;  3VUB A;  2KY9 A;  2QQB A;  2RHI A;  1IZ6 A;  4M75 E;  5D6W A;  2ZPG B;  3CCV T;  5CO7 A;  1VQ8 T;  1VQL T;  2E10 A;  2CYZ B;  3AHU A;  3E9F A;  1G5V A;  2DXC A;  2RJF A;  1JBM A;  5KH6 A;  4PJO A;  2RH2 A;  1M8V A;  5GAN 6;  4LDV A;  4M75 A;  1OI1 A;  2IG0 A;  1NZ9 A;  1OYX A;  3RMS A;  1G3W A;  2E64 A;  2R5A A;  3SWN A;  3WVD B;  3MCA B;  4EMK C;  5GMK i;  5HKC A;  1UGR B;  4E7I A;  1KQS S;  2LDM A;  1M9S A;  1K73 U;  1M1K C;  2ZPH B;  3BDU A;  2LTO A;  2XHC A;  4ZTF A;  4A54 A;  4C8Q G;  3OS1 A;  3JRZ A;  5GMK e;  1QP3 A;  2CZ0 B;  3EAE A;  4KUI A;  3JCM W;  2NLU A;  1Y96 A;  1Q82 C;  4J83 A;  3E9G A;  1VQN T;  4JRQ A;  4P5N A;  2K2V A;  2GF7 A;  4XTV A;  3G6E T;  3OW2 A;  2VGN A;  2QEX T;  4XK8 E;  1VQ9 T;  2E65 A;  4XU1 A;  1M90 C;  3CCE A;  2E6Z A;  3L42 A;  5LJ5 h;  2EQU A;  3FB9 A;  3A5Z B;  3QBY A;  2WSF E;  1ZBX A;  4M77 D;  4MDX A;  2JNG A;  3RMQ A;  4RG2 A;  1XNI A;  3CCU T;  1KHC A;  1KQ1 A;  2ZPI B;  1Q86 C;  3MEA A;  3CBM A;  3HFO A;  1Q81 C;  4M77 C;  4M7A F;  1U1S A;  4PJO D;  3HHT B;  3CCV A;  5LJ5 j;  3CPW A;  1VQ8 A;  3TU4 K;  2D6F A;  4M75 D;  1I5L A;  2LQK A;  1Y71 A;  3HKS A;  3QII A;  4PJO C;  3HSB A;  3CCJ A;  2MWO A;  2FB7 A;  3OYG A;  3CCS A;  3S3N A;  4M75 C;  1WJQ A;  3X20 B;  1PSE A;  3UPU A;  2GFU A;  5GAM h;  2CZ1 B;  3SWN C;  3JCM P;  5GAN f;  4BE1 A;  2DXT A;  2HAX A;  2GQV A;  3OYF A;  2DEQ A;  5LJ3 g;  1VQN A;  3E19 A;  5FRN A;  3LH0 A;  3QDR B;  4OB2 B;  1HXD A;  2JVV A;  5CVI A;  3G6E A;  1VQ9 A;  2QEX A;  3QYH B;  1KG1 A;  3JCM h;  3CBP A;  4C5G A;  4EMK B;  2JN0 A;  5GAM j;  1YIT A;  3DLL A;  3OMG A;  1D3B B;  2M1H A;  3G4S T;  1FXX A;  4KT0 E;  4GY5 A;  1BI2 A;  2DD5 A;  4NL3 A;  4JS5 A;  2EQJ A;  2XIC A;  3GLX A;  1M1K U;  4BD3 A;  4D6W A;  1VUB A;  4BDZ A;  5GAN h;  4A4E A;  4M7A D;  2ZCF B;  1VQM A;  3H8Z A;  2WSC E;  2XI9 A;  2RJE A;  3P8H A;  4IUU A;  2VYT A;  2F5K A;  3HRU A;  3TCJ A;  3CXC A;  5LJ3 d;  3OSV A;  5A0L A;  1JJ2 A;  4M7D G;  3KBG A;  3LLR A;  1NE8 A;  3MEU A;  2B8A A;  4XQ3 A;  4J6Y A;  3L2W A;  5CKB A;  3HPW A;  5IN1 A;  1BI0 A;  3OYJ A;  4FIB A;  3S6W A;  1QVP A;  4RG8 A;  4JJN K;  1K9M U;  2EJ9 A;  2QQR A;  2GFA A;  3OYE A;  2DIG A;  1MHN A;  5J39 A;  5LJ5 e;  1RL2 A;  1Q81 U;  1Q86 U;  5HK0 A;  3FEO A;  4IKF A;  3OYM A;  3LX7 A;  3CCQ T;  5CK9 A;  4OB0 B;  2EJF A;  2JTM A;  2R57 A;  5KE2 A;  2OTL T;  4LDU A;  4HT8 A;  3DLM A;  1I4K 1;  3RER A;  2I2L A;  2PVG B;  4JRI A;  4PJO B;  1UB4 A;  2PUO B;  2QQS A;  2X4J A;  2X4Y A;  1OZ3 A;  3RUX A;  4M75 B;  1N27 A;  4QQG A;  1YHQ A;  5FU6 C;  4A4K A;  3SWN B;  3M53 A;  3MP6 A;  3LGL A;  2MI6 A;  2HQX A;  3VV0 A;  4C8Q F;  3G4S A;  5GAO n;  3MP1 A;  1WJS A;  1X01 A;  1ZQ1 A;  3BW1 A;  3S3O A;  3JB9 G;  3L2R A;  1Y96 B;  2RI2 A;  2K57 A;  4B9X A;  3CCL T;  2JTF A;  4M78 F;  2XG8 D;  5CIU A;  5FLX E;  2RB6 A;  5CR2 A;  1WJR A;  2O4X B;  1JB0 E;  2DZC A;  2LNV A;  5I2M A;  1HK9 A;  4C8Q E;  5CQX A;  4A4G A;  3JCM X;  1N8R C;  3Q1J A;  4BI4 A;  4FT2 A;  4X9D A;  3PIO A;  4A4H A;  4JS4 A;  1VIE A;  2H3J A;  2QDY B;  2P0Q A;  4N4H A;  2F5T X;  3DKM A;  4TVR A;  4L6V 5;  3HRS A;  3V7S A;  5IT9 E;  3UT1 A;  4C8Q A;  1KQS A;  4OGE A;  2EJG A;  4JRK A;  3J7A F;  3M56 A;  4C5H A;  3JCM b;  2KAF A;  3CPF A;  4IUQ A;  3LGF A;  2A3L A;  2XKO C;  5GMK l;  2OTL A;  2LC4 A;  5C0M A;  3GOX A;  2YLC A;  2QA4 T;  3QSU A;  5GAN 3;  3CMA T;  4J7F A;  5LJ3 e;  4C0G A;  4XTU A;  3MET A;  3FDR A;  3DB3 A;  1G3S A;  5L8R E;  4C5I A;  5LJ5 g;  1VQP T;  2X4W A;  5HK3 A;  3VUZ A;  4OB3 B;  2DK3 A;  5D6Y A;  4FT4 A;  2R5M A;  4BDY A;  3PMT A;  4EMH A;  1KC8 C;  3QJ6 A;  2P4T A;  4BB7 A;  3CCM A;  4O6J A;  1RI0 A;  2VGM A;  4DOV A;  4LDX A;  5D6X A;  1YJW T;  4BAC A;  3CCL A;  5FU6 B;  2K5F A;  4N0A C;  3OYA A;  1R8O B;  3RES A;  1G3T A;  4M78 G;  1YJN T;  4RCB A;  2O4X A;  4BY6 B;  3JCM c;  4C8Q D;  3JSC A;  3CME A;  4EPC A;  1QVF S;  2QI2 A;  3RKX A;  5LJ5 d;  4J6X A;  3OYN A;  3X24 B;  1WQ7 A;  3PTA A;  4C92 G;  1DJ7 B;  4C8Q C;  3M4G A;  4MDW A;  2RI5 A;  4M7D F;  5GAO m;  2E41 A;  5I21 A;  3OYI A;  3SD4 A;  3PFS A;  1VQL A;  2E1H A;  2XK0 A;  4RCC A;  2QA4 A;  3V7R A;  5DM7 R;  4C0D C;  3QYG B;  1XTD A;  3F70 A;  3A8M B;  4LDW A;  3WVE B;  3CMA A;  4ELZ C;  4B9W A;  3JCM g;  1IRE B;  4M7D E;  1VQP A;  4II1 A;  1Y7X A;  2RA2 A;  1K8A C;  1WNL A;  1VQ7 T;  4O5V A;  3P8B B;  3PT9 A;  1VQ6 T;  2OAU A;  4F7U G;  3G71 T;  4Q5W A;  2ZPE B;  4Y28 E;  2ZPF B;  5GAM d;  3FRN A;  1M1G A;  4PLI A;  5J3B A;  2RHX A;  4OP0 A;  2XID A;  2QQA A;  5KCH A;  5GAO q;  4M7D A;  4IUT A;  4FM4 B;  1YJW A;  2EWN A;  5CKH A;  4ZGJ B;  2E6N A;  1YI2 T;  2CKK A;  4L5G A;  3ER0 A;  3MHX A;  4BUG A;  3LYI A;  2L8D A;  3VYH B;  2KVQ G;  3ZFJ A;  3OA6 A;  1FWZ A;  1YJN A;  2EIF A;  1KD1 C;  1O9S A;  5GAN 7;  2BKD N;  3JB9 F;  3BFM A;  1JRI A;  3QO3 A;  4ZN3 A;  2K4Y A;  3JCM d;  3GNG A;  4WF2 A;  1KC8 U;  3E1S A;  5A2Q E;  2DD4 A;  3M58 A;  3OY9 A;  3CCU A;  3NFC A;  3NTH A;  3R6O A;  2V8K A;  1Q82 U;  3SB2 A;  4EMG A;  2DTH A;  4RKU E;  5LJ3 f;  5GAN d;  3BY7 A;  4E7H A;  2VUB A;  3EFS A;  5GAN 5;  1M90 U;  1VQK T;  3FIF A;  2F69 A;  2DO3 A;  4M7A G;  3ME9 A;  3JB9 I;  2XD0 A;  3PIP A;  5CQY A;  2EKO A;  3L1A A;  4QVC A;  3L2U A;  1QP2 A;  1G3Y A;  5GAN j;  1FX7 A;  3INZ A;  5DLQ E;  2L5Q A;  4C8Q B;  4DOW A;  3UWN A;  2YHT A;  4ZN1 A;  1PSF A;  1Q7Y C;  1TH7 A;  1VQ4 T;  2DVE A;  4M7D D;  2RM4 A;  2JUF A;  4XTW A;  3RIR A;  3JB9 H;  3T9N A;  1VQ7 A;  1VQ6 A;  4J7I A;  1BIA A;  3G71 A;  1YCY A;  2JZ2 A;  2BUD A;  3A8G B;  2O01 E;  4C0D B;  3JCM Q;  4M7D C;  4NS5 A;  3TEE A;  3OYL A;  4R56 A;  4GLK A;  1VQO T;  4DA4 A;  2FVU A;  4CI0 C;  3FJP A;  2CGH A;  4XAX B;  4MZM A;  5EG2 A;  5J26 A;  4BY6 C;  1K8A U;  3GP8 A;  2DIQ A;  1M1F A;  3RKW A;  1W2B S;  2LCC A;  3A8O B;  4X9C A;  4BI3 A;  2CS7 A;  5A0D A;  2VC8 A;  1V29 B;  4KUD K;  1BIB A;  5CKD A;  4ZTJ A;  3QJY A;  2C06 A;  4N4G A;  2IVW A;  2VXE A;  3SFM A;  2RJD A;  4N0A A;  5GAM e;  2RD1 A;  2VV5 A;  2LT1 A;  3OYC A;  3C4S A;  1H3Z A;  3URG A;  1VQK A;  2EYQ A;  2KQW A;  3JB9 D;  1KD1 U;  4MML A;  3L2Q A;  2XU8 A;  1YJ9 T;  4C92 F;  2EAY A;  2P0P A;  3PGG A;  3HL8 A;  2MF2 A;  2ZPB B;  2RHY A;  4M78 E;  3QXE B;  1NJI C;  2PU9 B;  4A53 A;  4PKC C;  3JCM e;  3G7Z A;  1OZ2 A;  4XTY A;  4NOY A;  1VQ4 A;  2DKG A;  5KCO A;  4M77 F;  4QVD A;  4E7J A;  4JRP A;  2DXU A;  1BI1 A;  1WQW A;  4YTL A;  2RI3 A;  1VQ5 T;  3M59 A;  3CCQ A;  3ZEH A;  3OS2 A;  2PUK B;  4M78 A;  1B34 A;  4C92 E;  5GAN e;  3CCR T;  1LJO A;  3PMI A;  2RK1 A;  4X34 A;  3OS5 A;  3J80 E;  4BE2 A;  4OF1 A;  3QZ5 B;  5FU7 C;  4J8O A;  1N9S A;  2CZ6 B;  4JLI A;  3VKI A;  1SSF A;  3HFN A;  3NTI A;  2FHD A;  1QVF A;  4F7U F;  4C92 A;  4CRI A;  4E7L A;  3OQ5 A;  4Y91 A;  3CC4 T;  1QVG S;  2KSS A;  4M7D B;  2K5L A;  4MMK A;  2LT4 A;  2QQ9 A;  3CEY A;  1N9R A;  1YIJ T;  2K5I A;  1AHJ B;  2K3Y A;  4HA8 A;  1Y07 A;  4XU2 A;  1YBY A;  1NPR A;  1UGS B;  4V2S A;  2KK4 A;  4F7U E;  4J5Y A;  3CC2 T;  5DLO A;  2RHU A;  3P8D A;  4RMO A;  3NTK A;  2LCL A;  3CD6 T;  3CCJ T;  5LJ5 f;  2E70 A;  3I56 T;  3H6Z A;  4PL6 A;  3I55 T;  5DY9 A;  3CCS T;  1YJ9 A;  5FRM A;  2Y90 A;  3OMC A;  4XU0 A;  4F7U A;  4R55 A;  2DZ9 A;  2QXF A;  4HT9 A;  1O75 A;  5GAM g;  4M78 D;  1H64 1;  3JAM E;  4QVZ A;  3M55 A;  2R58 A;  4J6W A;  1VQ5 A;  2HQE A;  4FSX A;  2RHZ A;  2V8I A;  3GNF B;  4IUP A;  1VIF A;  4LDY A;  4IUR A;  4M77 G;  4BI8 B;  1MGQ A;  2WSE E;  1N8R U;  2L3R A;  4M78 C;  3CCR A;  3L2Z A;  4C92 D;  5IAY A;  4QQD A;  1ZHI A;  2D9T A;  3OYY A;  2RO0 A;  4OVA A;  5GAN 8;  1YIT T;  2DPP B;  2G3R A;  4PJO G;  5I2S A;  1NJI U;  5HY6 A;  4FL6 A;  3C12 A;  1U1T A;  4JDS A;  4C92 C;  4M75 G;  3UDC A;  1LNX A;  4M7A E;  3HP9 A;  1K9M C;  5GAM f;  3OS0 A;  2EQM A;  3V7C A;  1VQM T;  2FL7 A;  3A8H B;  3ASK A;  3JCM V;  5GAN g;  3CC4 A;  5CKE A;  2E12 A;  3CC7 T;  1I8F A;  2X35 A;  2XDP A;  2KMT A;  2Y4X A;  3BDL A;  1W4S A;  3KUF A;  3M57 A;  3HRT A;  3QUI A;  3SDZ A;  5FU7 B;  4C5E A;  4E47 A;  1YIJ A;  4Z02 A;  2VXF A;  4HCB A;  4M7A A;  3OW2 S;  3CBO A;  3M5A A;  3QHS A;  4LD6 A;  2JOY A;  1NPP A;  3M9Q A;  4PNO A;  3OBW A;  3V8J A;  4ATO A;  3CC2 A;  5CKF A;  5M9O A;  3JCM f;  2LRQ A;  3CD6 A;  1M4Z A;  2D0Q B;  2X4X A;  4EDU A;  3I56 A;  3I55 A;  1WGS A;  2WAC A;  4HCZ A;  3VYG A;  1XQH A;  5AYF A;  2LVM A;  3JCM J;  1QW1 A;  3QG1 A;  2HBP A;  3LW5 E;  3M4Y A;  2M9U A;  3RKY A;  2A7Y A;  3TRE A;  1X6O A;  2RK2 A;  3C95 A;  5FRO A;  3CPW S;  2XDD A;  1YI2 A;  2MWP A;  2MMP A;  2PVO B;  3S3M A;  2P0K A;  4KBM B;  4FU6 A;  3PNW C;  3DB4 A;  3MO8 A;  2PVD B;  5C6S A;  1YHQ T;  3V8L A;  4C0F A;  5GMK m;  3J81 E;  1BKB A;  3QPH A;  4XTZ A;  2Y4Y A;  4DQ2 A;  1S72 T;  4XTX A;  4C0Z A;  1EIF A;  2XDB A;  1W2B A;  2DTO A;  2E5Q A;  4L59 A;  2PQW A;  1LOJ A;  3V8K A;  1BYM A;  5LJ3 h;  3GF5 A;  4M78 B;  1B34 B;  3OYD A;  3LWI A;  2EFI A;  1U8R A;  1KQ2 A;  4PLL A;  3CC7 A;  2YLB A;  2DAQ A;  3A8L B;  5GAO p;  1BI3 A;  4ME7 A;  1I81 A;  4M7A C;  1GXI E;  5LL6 S;  2EQK A;  3OYK A;  3MEV A;  3OYB A;  2KDS A;  4C92 B;  2HNI A;  1UEB A;  2M0O A;  5GMK h;  2OTJ T;  5GAO l;  5LJ3 j;  3KXT A;  3GPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...