5GMKh

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
70
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
total genus 8
structure length 70
sequence length 72
chains with identical sequence w
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkh00
2E10A 3RESA 3JCMQ 4EMKB 5GAOp 4RCCA 4M7AB 5DY9A 3JB9J 1Y96A 2DZCA 5GANg 5GANh 1YCYA 3HFOA 4F7UE 5GANj 3RERA 2RA2A 3QSUA 4EMKC 1Y96B 3FB9A 5I21A 1WPYA 2YLBA 2EJ9A 5LJ5g 4F7UG 5LJ3e 5LJ5h 3JCMc 1N9RA 3V7SA 4Y91A 3QHSA 3JCMX 3QO3A 2DTOA 3RKYA 2JN0A 4M75F 4XTZA 2DXTA 1X01A 4C92F 4PJOB 4JRKA 4M78E 4QVCA 4XU0A 3JCMJ 1JRIA 4F7UA 5GMKm 4N0AA 2RM4A 1B34A 1N9SA 4M75A 1I8FA 1WNLA 2RD1A 4XU3A 2DKGA 4C92A 5GAN5 5GAOr 5GAOl 3JB9D 3HFNA 4N0AC 4J6XA 2DXUA 3V8LA 3JCMb 1WQ7A 2EAYA 4PJOD 5GMKl 3FIFA 2EWNA 2YHTA 2EJGA 5LJ3f 3JB9I 4M78D 4M75G 4XTVA 1U1TA 3VU3C 1M5Q1 4C92G 1D3BA 2E1HA 3M4GA 4M77B 5GMKe 1JBMA 2VXEA 4C8QB 4C8QD 3EFRA 5GAN7 4C8QE 4V2SA 2VXFA 3JB9G 5GMKi 4X9CA 3AHUA 4M77A 3V8JA 5GAN6 4HT9A 3JCMf 5GANe 4XU1A 4A53A 3BW1A 4C8QG 5GAOq 2E65A 4PJOC 4NL3A 4PJOG 5GAN8 4M7DA 5GAMh 5GAMg 1H641 2RB6A 4M7AC 1BIBA 1D3BB 2DEQA 4JLIA 4XTWA 4F7UF 5GAN4 4M7AG 5GAMf 1M8VA 3HSBA 4M77G 4OP0A 1LJOA 4J6WA 4M77C 4M78B 4MMLA 1KQ2A 4M75D 4C92D 1B34B 2ZGWA 4M75B 4M75C 3V7CA 4C92C 4C92B 4C8QF 1U1SA 4J5YA 4QVDA 3JCMW 3EFSA 1LOJA 4M77F 3V8KA 3BDUA 4XQ3A 1MGQA 4MMKA 4X9DA 3L1AA 3JB9F 5LJ5j 3PGGA 3GIBA 4M7DD 5GANd 2QTXA 3SWNA 3JCMg 1BIAA 2FYKA 4HA8A 5GANf 4F7UB 2K57A 4M7DC 3JCMV 4M75E 2FB7A 2E64A 3RKXA 3SWNC 4C92E 5GAMe 5GMKh 3JCMP 2YLCA 3JB9H 5LJ5d 3L2ZA 4M7AE 2DTIA 3FJPA 4M7DF 3JCMd 4HT8A 4NL2A 5LJ3d 2E41A 3RUXA 2I2LA 4EMGA 4M78F 4M77D 4DQ2A 2DVEA 5GAMd 5LJ5f 4J6YA 2Y90A 4XTXA 5GAOn 4M7AD 4PJOE 3V7RA 1I81A 3SB2A 3JCMh 4XTYA 4M7AA 3RIRA 3QUIA 4EMHA 4RCBA 3SWNB 4M7DB 1TH7A 2EJFA 1WQWA 3BY7A 4XU2A 4M7AF 4JRIA 4M7DE 4M77E 3RKWA 4JUVA 1HK9A 5LJ3h 5LJ3g 4C8QA 5LJ5e 1HXDA 4PJOF 3JCMe 2VC8A 4M7DG 1LNXA 4C8QC 4EMKA 5GAMj 1KQ1A 4A54A 4M78A 5GMKj 2DTHA 4NOYA 5CAIA 5GAOm 4PJOA 2CGHA 3INZA 2DJZA 4M78C 4PNOA 4WF2A 5LJ3j 4M78G 4XTUA 5GAN2 1I4K1 1I5LA 5GAN3 3BFMA 2DZ9A 2HNIA
chains in the Genus database with same CATH superfamily
2E10A 3LGFA 2RQVA 4PLLA 2HSPA 4A63B 5HCKA 3PVLA 5A0GA 1M1KU 1QVGA 2L89A 3JCMX 3X24B 1WX6A 2CH4W 4JRKA 3TU4K 1K4US 2Y4XA 3G1JA 4FSSA 2M51A 3EG9A 1BK2A 2D6FA 2MK5A 1U3OA 4RG8A 5KE3A 5GMKl 2F2VA 1GBQA 1I07A 3KBGA 2HEQA 1G3SA 2LVMA 2HL5C 1GFCA 3EFRA 3Q1JA 1G8XA 3MEAA 4BI3A 3CCVA 2K3YA 2E65A 1K73U 2HDAA 4JZ4A 2KVQG 2RQUA 2JS0A 3CCLT 1BCOA 4M75C 3G4ST 2OAWA 3EG9B 1K9AA 2EYZA 4DBQA 2BUDA 2QTXA 2M1HA 1LPLA 1IRXA 2BTTA 1UFFA 3BDLA 4M7AE 2XICA 2FRYA 2NUTA 1OOTA 2LJ3A 2RHUA 2VWFA 1T0HA 2LJ1A 1M1GA 4E7LA 1YJWQ 3CCMQ 3S3MA 2RJEA 4PFZA 1RAIB 3CD6Q 2C0IA 5L23A 2GNCA 1QKXA 2JZ2A 3BE3A 4J9GA 3CMAT 1HXDA 3LWIA 2VB6A 4DBHA 5CKEA 3M59A 3SEMA 1AVZC 3OYDA 3CCUT 4N4HA 3JCMQ 2A08A 4M7AB 2FZGB 3O5ZA 2EGCA 1NJIR 3A8OB 4EMKC 4IKFA 5A0DA 4E2FB 2DL4A 4FYWB 5LJ3e 4D6WA 3LH0A 1ZBJA 3QO3A 1SF9A 4C92F 2DXTA 2K9GA 2KSSA 3JCMJ 2RJDA 4F7UA 3OY9A 4A4EA 2F69A 2XDDA 4N0AC 4J6XA 3CCST 1ZSZA 1YJ9A 1VYUA 4FM4B 2QI2A 2YHTA 1C0MA 1Z9QA 5GAN7 5KYUB 4N4IA 3UA6A 3VS6A 4RTUA 1GCQA 4XU1A 4PJOC 2CZ7B 1VQ5T 3OYCA 1WHMA 2X4WA 3CMEQ 3ME9A 5CKHA 5CKFA 2YT6A 2HCKA 3HL8A 4J83A 1KQ2A 1SG5A 1U1SA 4M77F 2IVWA 3BDUA 3HKSA 4AG2C 1YITA 1ZX6A 3OYMA 1PSEA 1K73R 1W2BP 1JXMA 4HA8A 2KBTA 3LX7A 3UF4A 5I11A 3G4SQ 1X75C 2E64A 2ZZDA 3CCUA 2A36A 4M78F 2PVDB 3KFVA 1HSQA 3SWNB 1YIJT 2RHZA 3R6OA 5IAYA 4KGXB 3C12A 2VC8A 3ZEHA 1BI0A 4QQGA 4MZPA 5LJ5j 2AK5A 3OYJA 5DY9A 2KT8A 3CMEA 1AWOA 2H3JA 4RTZA 1VQ6Q 5CQXA 2RA2A 4PKCC 3VS4A 3FB9A 5CR2A 2K2VA 1AZEA 2CUBA 2KY9A 3F70A 2WSFE 5IHNA 4N4GA 1OI1A 3REBB 1K9MC 3QWYA 2RK1A 4HVVA 2X9HA 3OW2P 4EIKA 3CD6A 2OTLT 4C92G 4GLKA 3CQTA 1YIJA 1GBRA 2CP0A 3N5BB 1X27A 2XKOC 3L2VA 1WHLA 2FL7A 1PRLC 2E5KA 3BW1A 4OMMA 1CKAA 5GJWB 1V1CA 1IHVA 4JLIA 1QQJA 1WXUA 3QDRB 2YUQA 4E6RA 4B9WA 1VQPQ 2KYBA 4J7FA 1H3ZA 2QA4A 5FRMA 3MEWA 4OB1B 3UWNA 1YP5A 2DYBA 1JEGA 1JU5C 2KI7A 1M30A 4K11A 1N5ZA 2YLCA 1WYXA 3MO8A 3FJPA 2KXDA 3NTIA 1I0CA 1TUDA 2O9VA 3HRTA 1TUCA 4ZNXA 2VGMA 4FW1A 2RK2A 5FU7C 2D9TA 3NTKA 2X4XA 3E9GA 1TH7A 2EJFA 1WHKA 3PVQA 5DLOA 2RHYA 3CCJT 2HAXA 1GFDA 2ROLA 2V26A 2IG0A 4UC4A 4VUBA 1YJ9T 1MHNA 3DLMA 1AWJA 2MMPA 3EG0A 3BFMA 3GOXA 4GY5A 3T9NA 1VQPA 2EGEA 2NUPA 1UE9A 1Q86R 3JSCA 3RERA 1Y71A 2JS2A 3QZ9B 2EW3A 2J6OA 2RI5A 1OX8A 3HHTB 2GFUA 4E47A 3QJYA 1M90R 2FPFA 2DO3A 3RKYA 4AMCA 2YWWA 1VQ7A 1ZQ1A 2O4XB 1JRIA 3CEYA 2QA4T 1QVGS 2DXUA 4QKUA 3EHQA 2ECZA 2HKNA 1K9MR 2EWNA 2KE9A 1U1TA 1D3BA 4QQ6A 1J3TA 1YI2A 2RPNA 4J9EA 1UHCA 2EYQA 3E1SA 3OA6A 2QG9B 1YNZA 2FRWA 3TSWA 5FU6B 3VUZA 3PTAA 4RTXA 1WFWA 3I56A 2KXCA 2MAMA 1JQQA 4JDSA 3NGPA 4Z88A 3HRSA 2LC4A 3OMGA 3H6ZA 2ESWA 2L3QA 4JRPA 4M75D 4PJOE 3RR6A 2ABLA 4OMLA 2CUDA 4ORZA 3QPHA 3VUBA 1VQ4Q 4F14A 2YDLA 3TSZA 3P8BB 2FHDA 3SWNC 4LDWA 4C92E 1TUGB 1YJWT 3L2ZA 1TOVA 1T3LA 1SSHA 1D1AA 3CBMA 2GFAA 5FW9A 3VS5A 4BB7A 3VYHB 2DXBA 3OW2S 2JJ9A 5GAOn 2LCCA 1MV0B 1KC8U 4RCBA 4R56A 3L2RA 3CCSQ 4HXJA 4OVAA 5CQYA 3M0TA 1IREB 4GBQA 2XDBA 1WGSA 2DILA 3VS3A 4WCIA 3JCMe 3C0CA 2LT4A 2QAZA 1OZ3A 4P5NA 3VS7A 5LJ3j 1KD1R 1B07A 2DL7A 1I5OB 1UTIA 4ZN3A 4CC3A 3EGDA 1HYOA 1Q86C 3OYGA 3P8DA 1YFNA 3OS2A 5KCHA 1Q7YR 3QHSA 2BKDN 2X35A 1K1ZA 2KQWA 1N9SA 3M53A 1JXOA 4OMQA 1WI7A 1VQ5A 4BD3A 2CYZB 4FSXA 2GCXA 3UATA 1UJYA 4XTVA 3M56A 1K0XA 2O9SA 4M77B 1MMAA 4C8QD 2VXFA 2LCSA 3V8JA 2XDPA 3VS1A 3X28B 3CCQT 4A53A 1W2BS 1R0BG 2RNAA 2QDLA 1WXBA 2DAQA 1VQNQ 2P84A 2GTJA 1YITT 1UDLA 5GAMf 1KHIA 3FRNA 3TVTA 4CC2A 1AWXA 2OJ2A 2CZ6B 5KYNA 1W70A 1IXDA 3D7SB 4JPBW 4X9DA 4IIOA 1EZZB 4DBRA 1YHQA 4OMOA 3PGGA 1K9MU 4J9CA 2P0PA 1PKTA 4F7UB 3CPWP 4FYYB 2CP2A 4C0DC 2RO0A 5IXFA 1BYMA 2JM9A 5LJ3d 2YSQA 1VQMA 3CPFA 2I2LA 4EMGA 1GCPA 3H9NA 4FU6A 3OYBA 4M7AA 2EYXA 2EFIA 4Z02A 1D0ZA 2YRDA 1WQWA 3H0IA 3MCAB 3EH2A 1V76A 5LJ5e 1PHTA 3VS0A 1VQ8A 1OU9A 1KJWA 2RH2A 4PL6A 1BBZA 5KYXB 4Z8AA 4DEXA 3H8ZA 1M27C 3WVDB 3CD6T 3JCMg 3CBOA 4PJMA 2AKLA 1JJ2S 1S72Q 4RCCA 4KUDK 4KH1B 3H0FA 1VA7A 3HFOA 3E19A 5IHIA 3CCRT 2Z0WA 5LJ5h 1ZUYA 3JCMc 5CK9A 5IH2A 4BUGA 4M75F 1D1CA 4IIMA 3L2UA 3O8VA 2DYIA 1WNLA 4J9FA 3JB9D 5GAOl 1D09B 3EGDB 3CBPA 2JOYA 3DLLA 1OPLA 2WSCE 3GNFB 2DF6A 1KD1U 1SSFA 1M5Q1 3UPUA 2F1LA 3G7ZA 4Y92A 3TREA 1KQSS 4AFSC 4Q5WA 4FIBA 2F2WA 2QEXQ 3IQLA 1IO6A 5GAMg 2GQIA 1QLYA 3RBBB 1FMWA 1M8MA 1XTDA 3R6NA 1VQKQ 4M77G 2BZXA 3A98A 2L8DA 2L5QA 3NPFA 4PLIA 1Q95G 1ABQA 1QVGP 1AZGB 4LDUA 2XD0A 3L1AA 4HVUA 2DX1A 4J9DA 3SWNA 5CO7A 5M9OA 1KFZA 3TQ7P 3JCMV 3GPLA 3OYAA 3JCMd 1XQHA 3CC7A 1WHHA 2PZ1A 2K5FA 1RAGB 1NM7A 2LP5A 4KRTA 2DM1A 1PSFA 1YJNA 1H3HA 1RI9A 2QK0A 3EG1A 5HK3A 1WXTA 1D0YA 2LNVA 4CRIA 3M58A 3G6EQ 4L59A 4F17A 5CAIA 1WLPB 2C0TA 1JB0E 1MMDA 1UGSB 2DPPB 3CC2A 1W1FA 1QP3A 3VJPA 1M1FA 3QSUA 2A0FB 2YLBA 5KH6A 1S1NA 2MWPA 3U23A 1NJIC 1RACB 2YUNA 2OTJT 3OYKA 1QW1A 4PJOB 4BY6C 4N0AA 1QCFA 1I8FA 2DKGA 1I1JA 1VQ6T 2VVKA 4OF1A 1ZUUA 4J9IA 4KUIA 2M16A 1SRMA 2LQKA 3DKMA 4M78D 1C1AA 3A8MB 2EGAA 1WA7A 3CC2Q 4X9CA 1U06A 1EIFA 1VQ7Q 2M0OA 2WSEE 3CXCA 4FT4A 4KGVB 4RTVA 4JS4A 4A4HA 1G5VA 1WIEA 4LDXA 2BZYA 3MJXA 1M90U 1IHWA 3EGUA 2COYA 4DEYA 1RAAB 5GAN6 2CH4A 1Y7XA 1NEGA 3CMAQ 1VQ8Q 3M0UA 5KE2A 3V8KA 4HCKA 1VQKA 3E9FA 3OYYA 2QQAA 1QMCA 1VQ4A 3A5ZB 1RLQC 2MIOA 2FZKB 5GJVB 5LJ5d 2DTIA 2PNIA 3M9QA 3DB3A 2COZA 3PIPA 1TWBA 2J6KA 5J26A 4IUPA 3MEUA 3QUIA 2LNHB 3SHWA 2OI3A 1VQOA 4M7AF 2CSQA 6AT1B 4RMOA 2XMFA 1G2BA 2YRCA 4M77E 3PNWC 3ZFJA 1YIJQ 4CI0C 3M57A 3VV0A 4C8QC 1KQ1A 5GMKj 4RTWA 4E7JA 1K8AC 1QVFP 3JB9J 3QJ6A 3THKA 1W4SA 2DXCA 1PM3A 1KIKA 2X3XD 4E7IA 5I21A 1WPYA 3QBYA 4BE0A 1N9RA 3A8HB 2MOXA 3PFSA 1FMKA 3VYGA 1KQSP 1PG5B 4M75A 2V8KA 3QYHB 2EBPA 2RQTA 1W6XA 1R77A 2CP3A 3NTHA 3MP1A 3CCUQ 1WJQA 2VV5A 1WDXA 2L3SA 3JB9G 4IURA 5KYYA 3HP9A 4HT9A 5GANe 3J80E 2ROTA 3G71T 5DM7R 2CP7A 3CC4T 1BIBA 1D3BB 2LDMA 4KT0E 2RJFA 4M78B 1KD1C 4C92D 2J7IA 3V7CA 4CC4B 3RNJA 1NPRA 4J5YA 4QVDA 1PC0A 5I2SA 2HL3A 4ZGJB 1S72T 2YUOA 2FYKA 2R5MA 2JTEA 3GF5A 1VQNA 1YHQT 4R0KA 4HT8A 3MHXA 4E7SA 4ELYC 2CDTA 4BI8B 1E7OA 4J6YA 1WHJA 2RI2A 3KUFA 1VUBA 3BY7A 3G71A 2HQXA 2EQJA 4PJOF 2QQ9A 1CKBA 4ANJA 1TXQA 2JTMA 2ZAEA 1BB9A 3INZA 1Y0MA 3CCRQ 1I4K1 3M55A 5GAN3 2DZ9A 1VQNT 4IUTA 3WXMB 1N27A 1Y96A 1UGVA 2FEIA 2LX7A 2ENMA 4JJBA 1R0CB 2NUTB 2G3RA 1QWEA 2DTOA 2HBPA 2MYSA 1G3YA 3CPWS 4M78E 1PCXA 4J8OA 1ZHIA 4LDVA 4XU3A 2FVUA 3G4SA 1MV3A 3JCMb 2FPDA 1UECA 2KRNA 2KMTA 2VGNA 5C6SA 2CP6A 3OYEA 5CCAA 4E7ZA 4C0GA 4PJJA 2L0AA 3C95A 2DBKA 2XU8A 3FDRA 1VQLT 5J3BA 3HSBA 3L2WA 2D1XA 1W2BA 2JW4A 4QW2A 3CCQQ 2DD4A 3QXEB 2HKQB 3CCLA 1NG2A 1ZBXA 3CMET 2KRSA 2F2XA 5IHKA 3CCVT 7AT1B 1UEBA 1OZ2A 4PJLA 1X2QA 2OTJQ 4OMNA 2ED0A 1KK7A 2XG8D 2A3LA 3SB2A 5KYWA 3MP6A 4M4ZA 4HVWA 3CC7Q 4JRIA 3PMIA 5LJ3h 1E6GA 1G83A 2W0ZA 2QQBA 2MF2A 5FROA 1R8OB 3OBYA 3RMSA 5GAOm 3FEOA 4RG2A 4PJOA 1MUZA 2HD0A 1WZOA 3GNGA 4QQDA 2QQRA 4YTLA 2QYZA 3CCEQ 1BI2A 5GANg 2O88A 1BCMA 1Y07A 2K6DA 2EQUA 1RLPC 2EJ9A 3V7SA 3EHRA 4Y91A 3LWHA 1X2KA 2X3WD 5LL6S 1IGQA 1GRIA 1VQ8T 4ZGDB 1Q7YC 2RM4A 1B34A 5CVIA 3OW2A 2B86A 3AT1B 2JMAA 3CCJQ 3GBQA 2EIFA 4LD9K 2QGFB 1NYGA 1D0XA 2R5AA 3X25B 1QP2A 1WQ7A 3HPWA 2E3IA 3OS1A 2E1HA 4FW2A 4V2SA 5KYYB 2JT4A 3OYNA 2AZSA 5CKBA 5A0LA 1N8RR 2X4YA 1M3CA 1WJRA 1T3SA 8AT1B 4ZN1A 4AFQC 3QIIA 1B34B 1S72A 4C8QF 3JCMW 2MI6A 2YXYA 2AKKA 4MMKA 3WVEB 4MZTA 4NS5A 3I55Q 1PNJA 4M7DD 4JJDA 1AT1B 1AOJA 1CSKA 2EVRA 5J39A 2EKOA 3JCMP 3CCQA 5FWBA 4BE2A 4IUUA 3QZ5B 3URGA 2E41A 3RUXA 1B7TA 2CS7A 4B6MA 4BDYA 1ACMB 2V1RA 3CMAA 2C0OA 4AFUC 1QVFS 2NYSA 2E6NA 1FXXA 2DRMA 3EFOA 1NPPA 4IUQA 1QVPA 1TU0B 1HK9A 5HK0A 2HZYA 1VQ9A 1QCNA 5KCOA 4JLGA 4R55A 3C94A 2DTHA 3OS0A 4O6JA 3KXTA 3CC7T 1AD5A 4OMPA 3VS2A 3V7RA 1YI2Q 3CCMA 2E5QA 4FYXB 3G71Q 2O31A 3EFOB 1OULA 2R58A 2AT1B 2DA9A 5AT1B 4A4KA 1YJWA 3OYLA 3FC3A 1ABOA 2GGRA 3JAME 2DIGA 4MDXA 4PJNA 4QVCA 2GBQA 2RF0A 4O5VA 5GMKm 2QASA 2KYMA 2J6FA 1FX7A 5D7UA 3V8LA 2EYYA 2EAYA 3A1PA 1N6AA 2EJGA 3FJ5A 4C5IA 1SHGA 3M54A 1VQOT 4HCZA 1Q81U 3DB4A 5CKDA 3I56T 3SD4A 4OMFB 1JJ2A 2FG0A 4JJCA 4EDUA 1DJ7B 2BZ8A 1O75A 3ER0A 2RQRA 3PIOA 1YI2T 3LGLA 5I22A 2KT1A 2P4TA 4F7UF 2X51A 4M7AG 2DK3A 5D6YA 2RHXA 3SDZA 3LYIA 3P8HA 1VQKT 2E12A 4ME7A 3CXCS 4AT1B 1VQMT 3HTRA 4ELZC 2NUPB 3FLGA 1BIAA 2BE9B 1AEYA 1M3BA 4J7IA 1NJIU 3JB9H 1U5SA 2O01E 2LQ8A 2ED1A 2DVEA 4XTXA 2V8IA 2EKHA 2PQWA 1NLPC 4B9XA 4XTYA 5DLQE 1X43A 4EMHA 2DD5A 1SRLA 2KRMA 2KROA 4M7DE 1WJSA 3MKDA 2LQWA 2RN8A 1KG1A 2NUZA 1VQ6A 3X26B 1RAFB 3G6ET 3JCMh 1HD3A 4FYVB 4EMKB 4PFPA 5EG2A 2XIDA 3JRZA 3VRYA 4D8KA 4HCCA 2JM8A 1AHJB 2D8HA 1YCYA 2KEAA 4LNPA 3RMQA 2LJ0A 1BU1A 2LTOA 2OTLQ 2Y4YA 4RTYA 5LJ5g 2F5TX 4KBMB 2KAFA 3LW5E 1RUWA 1EX4A 1ZLMA 2H8HA 2JN0A 1NLOC 4PK4A 1TG0A 4KULA 4QT7A 5FU7B 4C92A 2DRKA 5EC7A 2RD1A 2QDYB 1HJDA 1RL2A 4DOWA 3ZBDA 3OYIA 3UT1A 3JB9I 2L3RA 4OB3B 1M4ZA 5D6WA 5GMKe 3OYFA 2L3PA 2W10A 1K0SA 4Y28E 1XNIA 4M77A 4JZ3A 1VQOQ 5FWCA 1MNEA 1M2OA 2DL5A 5GAMh 2F5KA 1C6VX 2RJCA 2OTLA 1PD0A 5GAN4 2QGGA 1Q81C 3REAB 4J6WA 1SKUB 2HQHA 2ZGWA 4M75B 1LOJA 1X6OA 4LE9A 1MGQA 2KK4A 5KYWB 4JS5A 1VYVA 2NWMA 3CC4Q 2JVVA 2ZCFB 5GANf 2K57A 1SEMA 3PE0A 3M0PA 5FU6C 2HMAA 1Q82U 4M7DF 1Q86U 2G6FX 3S3OA 4M77D 2Y90A 4D8DA 1Q82R 4WTOB 4KH0B 4XAXB 1X6GA 2KR3A 3NFCA 3E2UA 4F04B 5AYFA 2LMJA 1QWFA 4HKEA 4C8QA 3PT9A 4TVRA 1RAHB 2NLUA 1M1KC 3CCET 1Q81R 4NOYA 2LZ6B 4PNOA 2DJZA 1M2VA 4M78G 2DFUA 2QA4Q 1PKSA 1PD1A 2DZCA 1K8AR 3A8GB 1EFNA 5A2QE 4C0FA 1YWPA 3RDVA 3J7AF 4ZTFA 1V29B 2D8JA 2DJQA 4LXCA 1A0NB 4LN2A 3CPWA 3NMZC 1IZ6A 2MPXC 3QDFA 2KDSA 2E3HA 5ECAA 4A4GA 2XK0A 5HKCA 3VRZA 3I5RA 2O4XA 2ZPEB 1VOMA 2DETA 5LJ3f 3M0RA 4OB0B 2JUFA 2E6ZA 1JBMA 4C8QB 3GP8A 5GMKi 2A7YA 2FZCB 3OBWA 5KYXA 2L2PA 4PJOG 1IGUA 3TCJA 4MZMA 2CKKA 2GF7A 4C92C 2CZ1B 1T0JA 1NBEB 2CZ0B 4XQ3A 2K79A 1KQSA 2AZVA 4IUVA 2EQIA 1VYTA 2M0YA 2DE0X 1ARKA 3SFMA 4C0DB 3CC2T 3X20B 3CC4A 4LD6A 2DL3A 2PTKA 2R57A 2SEMA 4DBFA 2PU9B 1Q82C 5FLXE 3HRUA 1N8RU 4E7HA 2CREA 1TS9A 3OQ5A 5C0MA 1YJNQ 1SHFA 2EQKA 3JV3A 4XTUA 4OB2B 1I5LA 1AWWA 1OPKA 1KC8R 3LLRA 5GAOp 1FMVA 2FO0A 4FL6A 2ATCB 2VASA 4F7UE 4BE1A 3A8LB 2BE7D 1BI3A 2CT3A 1RI0A 3GLXA 2JMCA 2FPEA 3S6WA 1X01A 5CIUA 4XU0A 2M02A 2HSEB 2QTVA 5GAN5 1YJ9Q 2ZPHB 3M4YA 4C0ZA 2DL8A 1OV3A 1VIFA 2J05A 2QXFA 3LH5A 3L2QA 3VU3C 5IXBA 3MEVA 3QKJA 3H41A 2YUPA 3M4GA 2VXEA 4C8QE 1XOVA 1VQ9T 8ATCB 2CP5A 1NYFA 2JNGA 1TSFA 2D0NA 3EGXB 3VKIA 2WACA 1GL5A 2I0NA 4DA4A 1UB4A 4MDWA 2DEQA 4XTWA 2DMOA 4C5EA 1M8VA 1JO8A 3QWXX 4FT2A 3CCMT 4J9HA 3CCRA 2LT1A 2KGTA 3OB9A 4OGEA 1BKBA 2BIVA 3JB9F 1VQ7T 5GANd 1G3TA 2PUKB 2LCLA 2LQNA 4M7DC 1FWZA 2CSIA 3ASKA 2OAUA 2E70A 3EG2A 1ZUKA 2KNBB 2ZPFB 4F16A 2IIMA 4Z89A 1MMGA 1UGPB 3I9QA 1KHCA 1I81A 4C5GA 3QYGB 4BACA 2M9UA 1FYNA 4GLMA 4JUVA 1PWTA 1UGQB 1GXIE 3I56Q 1YBYA 1LNXA 4EMKA 5GAMj 3CCLQ 4A54A 4C5HA 1VQ4T 2XHCA 2K7AA 1QVFA 2CGHA 2JTFA 3MPUB 4M78C 5GAN2 3CXCP 1O9SA 4JRQA 3MP8A 2OTJA 4ESRA 3CCSA 2PUOB 1K76A 3H0HA 1K73C 4L5GA 1KC8C 1M90C 1BI1A 1RADB 3G6EA 4ATOA 2ZPIB 4F7UG 2A37A 4OGCA 4X34A 2H3EB 1NE8A 2P0QA 2V8JA 4II1A 4XTZA 4L6V5 3UA7A 2LRQA 3TEEA 9ATCB 1M9SA 1Q7YU 3HFNA 1ZSGA 2ZPBB 1F1BB 3M5AA 3FIFA 3NHNA 4M75G 1JJ2P 1NEBA 1UGRB 1M3AA 4ZGEB 1YJNT 3OSSC 5D6XA 2J06A 4PFOA 2DVJA 1ZSZB 2COWA 3M0QA 3JCMf 4C8QG 1WHGA 5GAOq 3CCVQ 1QCOA 4NL3A 1VQ9Q 2IPOB 4A4FA 2VYTA 2XI9A 4X1VA 4M7AC 2K2MA 4RKUE 1N8RC 1TTHB 2K5LA 4OP0A 1LCKA 4FCYA 4M77C 3EG3A 1VQ5Q 5GAMe 4XK8E 2V1QA 3C4SA 2YRVA 2DNUA 3EFSA 4BY6B 5IT9E 1B3QA 3ULRB 3EGXA 2VKNA 5I2MA 4JJNK 3GIBA 2PVGB 4BI4A 2FB7A 1YCSB 5GMKh 3OSVA 3I55T 1G3WA 1UJ0A 1P92A 1UUEA 4RUGA 2K4YA 3J81E 3CCEA 4DQ2A 4J9BA 5GAMd 1XJWB 1M2VB 1H8KA 1OX9A 2HBWA 1Y57A 3OS5A 2C06A 2RQWA 1YN8A 1Z9ZA 2EYWA 4M7DB 4DOVA 4XU2A 5LJ3g 2DERA 2DLPA 1E6HA 2VUBA 2AIRB 2QQSA 1OQKA 2RI3A 3OYHA 4WF2A 1RABB 4M7DA 2HNIA 3RESA 3ZL7C 1U8RA 5GANh 5GANj 1NZ9A 1Y96B 2SRCA 3PMTA 1VQLA 2MCNA 3I5SA 2GTOA 4AFZC 2PVOB 4LUDA 5IN1A 5GAOr 1OU8A 4CC7A 1X69A 2DEUA 1X6BA 2X4JA 2K3XA 2EQMA 4BDZA 2B8AA 4QVZA 1RAEB 2OX7A 3AHUA 2HQEA 2ZPGB 5KYUA 2A28A 3I55A 1K8AU 1YITQ 1GCQC 5GAN8 3EAEA 1UHFA 1H641 2RB6A 4E7KA 2D0QB 2MWOA 3I35A 1M1KR 2RMOA 3META 1YHQQ 4MMLA 1LJOA 2P4RA 3OMCA 1D1BA 4C92B 1ZA1B 4RTTA 1QKWA 2AHJB 2E4HA 1ZSZC 2K3BA 3S3NA 1MNDA 3L42A 1VQMQ 2K5IA 2LX9A 4KGZB 5HY6A 1VQPT 4AG1C 1OEBA 4M75E 3RKXA 4PJOD 1PRMC 2GQVA 1UG1A 4ZTJA 1VQLQ 1VIEA 4NL2A 1IB8A 2RHIA 1LVKA 5L8RE 2DBMA 4HCBA 2QEXT 5LJ5f 1ZA2B 4M7AD 3CCJA 2P0KA 1YWOA 2CT4A 3RIRA 3EH1A 2O2OA 1MMNA 2EPDA 3RKWA 1KSWA 1OYXA 3M0SA 3UDCA 2QEXA 4M7DG 1SPKA 2JXBA 4M78A 4LUEA 2DIQA 5FRNA 4LDYA 4EPCA 1H92A 3QG1A
chains in the Genus database with same CATH topology
4IUTA 2E10A 3WXMB 1N27A 1Y96A 3LGFA 2DZCA 4ZN3A 3A8GB 5A2QE 4C0FA 4PLLA 1Q86C 3OYGA 3P8DA 5A0GA 2G3RA 3J7AF 3OS2A 4ZTFA 1M1KU 1V29B 5KCHA 1QVGA 2L89A 3QHSA 3X24B 3JCMX 2DTOA 2HBPA 2BKDN 1G3YA 3CPWS 4JRKA 4M78E 3TU4K 2X35A 2Y4XA 4J8OA 1ZHIA 1N9SA 2KQWA 4LDVA 3M53A 4XU3A 3CPWA 2FVUA 1IZ6A 2D6FA 3G4SA 2KDSA 1VQ5A 4A4GA 2XK0A 4BD3A 2CYZB 5HKCA 3JCMb 4FSXA 2GCXA 4RG8A 2O4XA 5KE3A 5GMKl 2ZPEB 5LJ3f 2KMTA 2VGNA 4XTVA 4OB0B 3M56A 2JUFA 3KBGA 4M77B 1G3SA 2LVMA 2E6ZA 1JBMA 4C8QB 4C8QD 3EFRA 5C6SA 3GP8A 3Q1JA 2VXFA 5CCAA 3OYEA 5GMKi 4C0GA 2A7YA 3MEAA 3V8JA 4BI3A 3OBWA 3CCVA 2XDPA 2K3YA 3X28B 3CCQT 1H3ZA 4A53A 1W2BS 2E65A 3C95A 4PJOG 2DAQA 3TCJA 4MZMA 1K73U 2XU8A 3FDRA 1VQLT 2CKKA 1YITT 2KVQG 5GAMf 1KHIA 5J3BA 3HSBA 3CCLT 3FRNA 2GF7A 4M75C 4C92C 2CZ1B 3G4ST 3L2WA 2CZ6B 1W2BA 4QW2A 2CZ0B 4XQ3A 4X9DA 2DD4A 3QXEB 1YHQA 1KQSA 4IUVA 3PGGA 1K9MU 2BUDA 2QTXA 2M1HA 2P0PA 3CCLA 4F7UB 1ZBXA 3CMET 3BDLA 4C0DC 4M7AE 2XICA 3SFMA 2RO0A 4C0DB 3CCVT 1BYMA 1UEBA 3CC2T 1OZ2A 3X20B 5LJ3d 1VQMA 3CC4A 3CPFA 4LD6A 2I2LA 4EMGA 2RHUA 1VQNT 1M1GA 4E7LA 3S3MA 2R57A 2XG8D 2RJEA 2A3LA 4FU6A 3SB2A 3OYBA 4M7AA 2PU9B 2EFIA 3MP6A 4Z02A 1Q82C 5FLXE 1WQWA 3HRUA 3MCAB 1N8RU 4JRIA 2JZ2A 4E7HA 3PMIA 5LJ3h 3CMAT 5LJ5e 1HXDA 2QQBA 2MF2A 3OQ5A 5FROA 3LWIA 1VQ8A 2RH2A 4PL6A 5CKEA 5C0MA 3M59A 1R8OB 3OBYA 3H8ZA 3RMSA 3FEOA 4RG2A 5GAOm 4PJOA 2EQKA 3OYDA 3CCUT 4XTUA 4N4HA 3WVDB 4OB2B 1I5LA 3CD6T 2HD0A 3JCMg 3CBOA 3GNGA 2QQRA 4QQDA 3LLRA 3JCMQ 1JJ2S 4YTLA 5GAOp 4RCCA 4M7AB 4KUDK 1BI2A 5GANg 4FL6A 1Y07A 3HFOA 4F7UE 4BE1A 3E19A 3A8LB 3A8OB 4EMKC 4IKFA 5A0DA 3CCRT 2EQUA 1BI3A 2EJ9A 5LJ5h 1RI0A 5LJ3e 3GLXA 4D6WA 3JCMc 5CK9A 3V7SA 3LH0A 4Y91A 3LWHA 4BUGA 3S6WA 5LL6S 3QO3A 4M75F 4C92F 1VQ8T 2DXTA 1X01A 5CIUA 2KSSA 3O8VA 3L2UA 4XU0A 3JCMJ 2RJDA 4F7UA 4ZGDB 1Q7YC 2RM4A 1B34A 5CVIA 5GAN5 1WNLA 3OY9A 4A4EA 3OW2A 3JB9D 2F69A 5GAOl 2XDDA 4N0AC 2EIFA 4J6XA 3CCST 2ZPHB 4LD9K 3M4YA 3CBPA 2R5AA 3X25B 4C0ZA 1YJ9A 1QP2A 1WQ7A 2JOYA 3DLLA 4PJOD 2WSCE 3GNFB 1VIFA 2QXFA 4FM4B 3HPWA 2QI2A 2YHTA 3L2QA 3VU3C 3MEVA 3QKJA 1SSFA 1M5Q1 3OS1A 3UPUA 1KD1U 2E1HA 3M4GA 3G7ZA 2VXEA 5GAN7 4V2SA 4C8QE 4N4IA 1XOVA 1KQSS 3TREA 3OYNA 1VQ9T 5CKBA 2JNGA 4XU1A 4Q5WA 4FIBA 5A0LA 4PJOC 2CZ7B 1VQ5T 3OYCA 2X4WA 2X4YA 2WACA 3VKIA 3ME9A 5GAMg 5CKHA 4DA4A 1UB4A 4MDWA 5CKFA 1WJRA 2DEQA 4XTWA 1XTDA 4C5EA 1M8VA 3HL8A 4M77G 4ZN1A 4J83A 2L8DA 1KQ2A 2L5QA 3QIIA 1B34B 1S72A 4PLIA 4C8QF 1U1SA 3JCMW 2MI6A 4FT2A 3CCMT 4M77F 2IVWA 3BDUA 3CCRA 2LT1A 4LDUA 3OB9A 3HKSA 4MMKA 3WVEB 3L1AA 4OGEA 1YITA 1BKBA 2BIVA 2XD0A 3OYMA 4MZTA 1VQ7T 3JB9F 4NS5A 4M7DD 1PSEA 5GANd 1G3TA 3SWNA 5CO7A 2PUKB 4HA8A 5M9OA 3LX7A 2LCLA 5J39A 3JCMV 1X75C 4M7DC 1FWZA 2E64A 2EKOA 2ZZDA 3ASKA 2OAUA 3OYAA 3GPLA 3CCQA 4BE2A 3JCMP 2E70A 3JCMd 1XQHA 4IUUA 3QZ5B 3URGA 3CC7A 3CCUA 2E41A 2ZPFB 3RUXA 4M78F 2PVDB 2CS7A 4BDYA 2K5FA 1UGPB 3CMAA 1QVFS 1KHCA 1I81A 4C5GA 2E6NA 1FXXA 1PSFA 3SWNB 1YIJT 2RHZA 1NPPA 3QYGB 4BACA 2M9UA 4IUQA 1YJNA 1QVPA 3R6OA 5IAYA 5HK3A 4JUVA 1HK9A 5HK0A 3C12A 1UGQB 1VQ9A 1GXIE 2LNVA 5KCOA 2VC8A 1YBYA 1LNXA 4CRIA 3M58A 4JLGA 4EMKA 5GAMj 4A54A 4C5HA 4L59A 4R55A 3C94A 1VQ4T 2DTHA 2XHCA 5CAIA 3OS0A 3ZEHA 1QVFA 2CGHA 4O6JA 3KXTA 1JB0E 2JTFA 2DPPB 1UGSB 1BI0A 4M78C 5GAN2 3CC2A 4QQGA 4MZPA 1O9SA 3V7RA 5LJ5j 3OYJA 4JRQA 3CCMA 2E5QA 5DY9A 3MP8A 3CMEA 2OTJA 2H3JA 1QP3A 3CCSA 3VJPA 2PUOB 1M1FA 1KC8C 5CQXA 4L5GA 1K73C 2R58A 2RA2A 4PKCC 1M90C 3QSUA 1BI1A 3FB9A 3G6EA 4ATOA 2YLBA 5KH6A 2ZPIB 4A4KA 4F7UG 4OGCA 2MWPA 4X34A 5CR2A 3OYLA 3FC3A 2K2VA 1YJWA 1NJIC 2P0QA 1NE8A 3JAME 2OTJT 2V8JA 3OYKA 1QW1A 2DIGA 4II1A 4L6V5 4XTZA 4MDXA 4PJOB 2LRQA 3TEEA 4QVCA 4BY6C 1M9SA 2KY9A 3F70A 4N0AA 4O5VA 5GMKm 1I8FA 2WSFE 4N4GA 2DKGA 1OI1A 1Q7YU 1K9MC 3HFNA 4OF1A 1FX7A 2RK1A 1VQ6T 4KUIA 3V8LA 2ZPBB 2EAYA 2M16A 3M5AA 3FIFA 3CD6A 1N6AA 2EJGA 2OTLT 2LQKA 3DKMA 4M75G 4M78D 4C5IA 1UGRB 3M54A 4C92G 4GLKA 1VQOT 3A8MB 4HCZA 1Q81U 3DB4A 4ZGEB 1YJNT 5CKDA 3I56T 1YIJA 3SD4A 3OSSC 4OMFB 3N5BB 1JJ2A 4X9CA 5D6XA 2XKOC 3L2VA 1EIFA 2FL7A 2M0OA 2WSEE 3JCMf 4C8QG 4EDUA 3BW1A 4FT4A 5GAOq 3CXCA 1DJ7B 4NL3A 1O75A 3ER0A 3PIOA 4JS4A 1YI2T 4A4HA 1G5VA 4LDXA 3LGLA 2VYTA 2XI9A 4A4FA 4M7AC 4RKUE 2P4TA 3QDRB 4JLIA 4F7UF 1N8RC 1M90U 4M7AG 2DK3A 5D6YA 2RHXA 3SDZA 3LYIA 2K5LA 3P8HA 4OP0A 4M77C 5GAN6 5GAMe 4B9WA 1Y7XA 4XK8E 4J7FA 1VQKT 3C4SA 3EFSA 2E12A 2YRVA 4ME7A 3V8KA 5KE2A 4BY6B 3CXCS 2QA4A 5IT9E 1VQMT 5FRMA 4ELZC 5I2MA 1VQKA 4JJNK 3MEWA 4OB1B 3E9FA 3OYYA 3GIBA 3UWNA 3FLGA 2QQAA 1BIAA 2PVGB 1VQ4A 3A5ZB 4BI4A 4J7IA 2FB7A 5GMKh 3OSVA 3I55T 2YLCA 3MO8A 5LJ5d 1NJIU 3JB9H 2DTIA 3FJPA 3M9QA 3DB3A 1G3WA 3NTIA 1P92A 3PIPA 3J81E 2O01E 2K4YA 2LQ8A 3CCEA 4DQ2A 2DVEA 4IUPA 3HRTA 5J26A 5GAMd 4XTXA 2V8IA 2VGMA 3MEUA 2PQWA 2RK2A 5FU7C 4B9XA 3OS5A 4XTYA 2C06A 5DLQE 2D9TA 3QUIA 4EMHA 2X4XA 3NTKA 2DD5A 4M7DB 3E9GA 1TH7A 2EJFA 4DOVA 1VQOA 4XU2A 4M7AF 4M7DE 4RMOA 5DLOA 1WJSA 4M77E 2RHYA 3PNWC 3ZFJA 5LJ3g 3CCJT 2HAXA 4CI0C 3M57A 3VV0A 4C8QC 2IG0A 1KQ1A 4UC4A 4VUBA 1YJ9T 5GMKj 2VUBA 1KG1A 2QQSA 1VQ6A 1MHNA 2RI3A 3OYHA 4WF2A 3X26B 3DLMA 2MMPA 3G6ET 1K8AC 4E7JA 3BFMA 3JCMh 2HNIA 4M7DA 3RESA 4EMKB 3GOXA 4GY5A 3T9NA 1VQPA 5EG2A 2XIDA 3JRZA 1U8RA 3JB9J 3QJ6A 4HCCA 1W4SA 5GANh 1AHJB 1YCYA 2DXCA 3JSCA 3RMQA 5GANj 3RERA 1NZ9A 2LTOA 1Y71A 4E7IA 1Y96B 5I21A 1WPYA 3QZ9B 3PMTA 3QBYA 2Y4YA 2RI5A 1VQLA 5LJ5g 2F5TX 4KBMB 2KAFA 2GFUA 3HHTB 1N9RA 3QJYA 3LW5E 4E47A 4BE0A 3A8HB 2DO3A 3PFSA 3RKYA 2JN0A 3VYGA 1VQ7A 1ZQ1A 2PVOB 4KULA 2O4XB 1JRIA 3CEYA 5FU7B 4M75A 4C92A 5IN1A 2QA4T 2RD1A 2V8KA 5GAOr 3QYHB 2QDYB 1QVGS 2DXUA 1RL2A 3NTHA 3MP1A 4DOWA 3ZBDA 2X4JA 2K3XA 2EWNA 3OYIA 3UT1A 3JB9I 1U1TA 2L3RA 4OB3B 1D3BA 4QQ6A 1M4ZA 1WJQA 5D6WA 5GMKe 2EQMA 2VV5A 1YI2A 3OYFA 4BDZA 2B8AA 4QVZA 4Y28E 3JB9G 1XNIA 3AHUA 4M77A 4IURA 2EYQA 2HQEA 2ZPGB 3HP9A 1K8AU 3E1SA 3OA6A 5GANe 3I55A 4HT9A 3J80E 3VUZA 5FU6B 3PTAA 3G71T 5DM7R 3I56A 2MAMA 5GAN8 3EAEA 4JDSA 3CC4T 5GAMh 2F5KA 1H641 2RB6A 3HRSA 2D0QB 4E7KA 2LC4A 1BIBA 1D3BB 2MWOA 2RJCA 3H6ZA 3OMGA 5GAN4 2OTLA 1Q81C 3META 4JRPA 2LDMA 4KT0E 1LJOA 2RJFA 4J6WA 4M78B 4MMLA 1KD1C 3OMCA 4M75D 2ZGWA 4M75B 4C92D 3V7CA 4C92B 4PJOE 1NPRA 4J5YA 4QVDA 1LOJA 1X6OA 2AHJB 1MGQA 3S3NA 3QPHA 5I2SA 2KK4A 3VUBA 4ZGJB 4JS5A 3L42A 1S72T 2JVVA 2K5IA 2LX9A 2ZCFB 2FYKA 2R5MA 5GANf 5HY6A 3P8BB 2K57A 3GF5A 1VQPT 2FHDA 4M75E 4LDWA 3RKXA 3SWNC 2GQVA 5FU6C 4C92E 1YJWT 1Q82U 1VQNA 4M7DF 3L2ZA 4ZTJA 1YHQT 1Q86U 4HT8A 1VIEA 4NL2A 3MHXA 3CBMA 4ELYC 2RHIA 2GFAA 3S3OA 5L8RE 4BI8B 4M77D 4BB7A 4HCBA 3VYHB 2QEXT 5LJ5f 4J6YA 2Y90A 2DXBA 2RI2A 3OW2S 5GAOn 3KUFA 3CC7T 4M7AD 3CCJA 2P0KA 4XAXB 3RIRA 2LCCA 3NFCA 1VUBA 4RCBA 4R56A 3L2RA 1KC8U 3BY7A 4OVAA 5AYFA 3G71A 5CQYA 3RKWA 1IREB 4HKEA 2XDBA 2HQXA 1OYXA 4C8QA 3PT9A 2EQJA 4TVRA 1WGSA 4PJOF 3UDCA 3JCMe 2QEXA 4M7DG 2LT4A 2NLUA 2QQ9A 1M1KC 1OZ3A 4M78A 3CCET 2DIQA 4P5NA 5FRNA 4LDYA 4NOYA 2JTMA 4EPCA 3INZA 2DJZA 4PNOA 5LJ3j 4M78G 1I4K1 3M55A 5GAN3 2DZ9A 3QG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E10 A;  3RES A;  3JCM Q;  4EMK B;  5GAO p;  4RCC A;  4M7A B;  5DY9 A;  3JB9 J;  1Y96 A;  2DZC A;  5GAN g;  5GAN h;  1YCY A;  3HFO A;  4F7U E;  5GAN j;  3RER A;  2RA2 A;  3QSU A;  4EMK C;  1Y96 B;  3FB9 A;  5I21 A;  1WPY A;  2YLB A;  2EJ9 A;  5LJ5 g;  4F7U G;  5LJ3 e;  5LJ5 h;  3JCM c;  1N9R A;  3V7S A;  4Y91 A;  3QHS A;  3JCM X;  3QO3 A;  2DTO A;  3RKY A;  2JN0 A;  4M75 F;  4XTZ A;  2DXT A;  1X01 A;  4C92 F;  4PJO B;  4JRK A;  4M78 E;  4QVC A;  4XU0 A;  3JCM J;  1JRI A;  4F7U A;  5GMK m;  4N0A A;  2RM4 A;  1B34 A;  1N9S A;  4M75 A;  1I8F A;  1WNL A;  2RD1 A;  4XU3 A;  2DKG A;  4C92 A;  5GAN 5;  5GAO r;  5GAO l;  3JB9 D;  3HFN A;  4N0A C;  4J6X A;  2DXU A;  3V8L A;  3JCM b;  1WQ7 A;  2EAY A;  4PJO D;  5GMK l;  3FIF A;  2EWN A;  2YHT A;  2EJG A;  5LJ3 f;  3JB9 I;  4M78 D;  4M75 G;  4XTV A;  1U1T A;  3VU3 C;  1M5Q 1;  4C92 G;  1D3B A;  2E1H A;  3M4G A;  4M77 B;  5GMK e;  1JBM A;  2VXE A;  4C8Q B;  4C8Q D;  3EFR A;  5GAN 7;  4C8Q E;  4V2S A;  2VXF A;  3JB9 G;  5GMK i;  4X9C A;  3AHU A;  4M77 A;  3V8J A;  5GAN 6;  4HT9 A;  3JCM f;  5GAN e;  4XU1 A;  4A53 A;  3BW1 A;  4C8Q G;  5GAO q;  2E65 A;  4PJO C;  4NL3 A;  4PJO G;  5GAN 8;  4M7D A;  5GAM h;  5GAM g;  1H64 1;  2RB6 A;  4M7A C;  1BIB A;  1D3B B;  2DEQ A;  4JLI A;  4XTW A;  4F7U F;  5GAN 4;  4M7A G;  5GAM f;  1M8V A;  3HSB A;  4M77 G;  4OP0 A;  1LJO A;  4J6W A;  4M77 C;  4M78 B;  4MML A;  1KQ2 A;  4M75 D;  4C92 D;  1B34 B;  2ZGW A;  4M75 B;  4M75 C;  3V7C A;  4C92 C;  4C92 B;  4C8Q F;  1U1S A;  4J5Y A;  4QVD A;  3JCM W;  3EFS A;  1LOJ A;  4M77 F;  3V8K A;  3BDU A;  4XQ3 A;  1MGQ A;  4MMK A;  4X9D A;  3L1A A;  3JB9 F;  5LJ5 j;  3PGG A;  3GIB A;  4M7D D;  5GAN d;  2QTX A;  3SWN A;  3JCM g;  1BIA A;  2FYK A;  4HA8 A;  5GAN f;  4F7U B;  2K57 A;  4M7D C;  3JCM V;  4M75 E;  2FB7 A;  2E64 A;  3RKX A;  3SWN C;  4C92 E;  5GAM e;  5GMK h;  3JCM P;  2YLC A;  3JB9 H;  5LJ5 d;  3L2Z A;  4M7A E;  2DTI A;  3FJP A;  4M7D F;  3JCM d;  4HT8 A;  4NL2 A;  5LJ3 d;  2E41 A;  3RUX A;  2I2L A;  4EMG A;  4M78 F;  4M77 D;  4DQ2 A;  2DVE A;  5GAM d;  5LJ5 f;  4J6Y A;  2Y90 A;  4XTX A;  5GAO n;  4M7A D;  4PJO E;  3V7R A;  1I81 A;  3SB2 A;  3JCM h;  4XTY A;  4M7A A;  3RIR A;  3QUI A;  4EMH A;  4RCB A;  3SWN B;  4M7D B;  1TH7 A;  2EJF A;  1WQW A;  3BY7 A;  4XU2 A;  4M7A F;  4JRI A;  4M7D E;  4M77 E;  3RKW A;  4JUV A;  1HK9 A;  5LJ3 h;  5LJ3 g;  4C8Q A;  5LJ5 e;  1HXD A;  4PJO F;  3JCM e;  2VC8 A;  4M7D G;  1LNX A;  4C8Q C;  4EMK A;  5GAM j;  1KQ1 A;  4A54 A;  4M78 A;  5GMK j;  2DTH A;  4NOY A;  5CAI A;  5GAO m;  4PJO A;  2CGH A;  3INZ A;  2DJZ A;  4M78 C;  4PNO A;  4WF2 A;  5LJ3 j;  4M78 G;  4XTU A;  5GAN 2;  1I4K 1;  1I5L A;  5GAN 3;  3BFM A;  2DZ9 A;  2HNI A; 
#chains in the Genus database with same CATH topology
 2E10 A;  3LGF A;  2RQV A;  4PLL A;  2HSP A;  4A63 B;  5HCK A;  3PVL A;  5A0G A;  1M1K U;  1QVG A;  2L89 A;  3JCM X;  3X24 B;  1WX6 A;  2CH4 W;  4JRK A;  3TU4 K;  1K4U S;  2Y4X A;  3G1J A;  4FSS A;  2M51 A;  3EG9 A;  1BK2 A;  2D6F A;  2MK5 A;  1U3O A;  4RG8 A;  5KE3 A;  5GMK l;  2F2V A;  1GBQ A;  1I07 A;  3KBG A;  2HEQ A;  1G3S A;  2LVM A;  2HL5 C;  1GFC A;  3EFR A;  3Q1J A;  1G8X A;  3MEA A;  4BI3 A;  3CCV A;  2K3Y A;  2E65 A;  1K73 U;  2HDA A;  4JZ4 A;  2KVQ G;  2RQU A;  2JS0 A;  3CCL T;  1BCO A;  4M75 C;  3G4S T;  2OAW A;  3EG9 B;  1K9A A;  2EYZ A;  4DBQ A;  2BUD A;  2QTX A;  2M1H A;  1LPL A;  1IRX A;  2BTT A;  1UFF A;  3BDL A;  4M7A E;  2XIC A;  2FRY A;  2NUT A;  1OOT A;  2LJ3 A;  2RHU A;  2VWF A;  1T0H A;  2LJ1 A;  1M1G A;  4E7L A;  1YJW Q;  3CCM Q;  3S3M A;  2RJE A;  4PFZ A;  1RAI B;  3CD6 Q;  2C0I A;  5L23 A;  2GNC A;  1QKX A;  2JZ2 A;  3BE3 A;  4J9G A;  3CMA T;  1HXD A;  3LWI A;  2VB6 A;  4DBH A;  5CKE A;  3M59 A;  3SEM A;  1AVZ C;  3OYD A;  3CCU T;  4N4H A;  3JCM Q;  2A08 A;  4M7A B;  2FZG B;  3O5Z A;  2EGC A;  1NJI R;  3A8O B;  4EMK C;  4IKF A;  5A0D A;  4E2F B;  2DL4 A;  4FYW B;  5LJ3 e;  4D6W A;  3LH0 A;  1ZBJ A;  3QO3 A;  1SF9 A;  4C92 F;  2DXT A;  2K9G A;  2KSS A;  3JCM J;  2RJD A;  4F7U A;  3OY9 A;  4A4E A;  2F69 A;  2XDD A;  4N0A C;  4J6X A;  3CCS T;  1ZSZ A;  1YJ9 A;  1VYU A;  4FM4 B;  2QI2 A;  2YHT A;  1C0M A;  1Z9Q A;  5GAN 7;  5KYU B;  4N4I A;  3UA6 A;  3VS6 A;  4RTU A;  1GCQ A;  4XU1 A;  4PJO C;  2CZ7 B;  1VQ5 T;  3OYC A;  1WHM A;  2X4W A;  3CME Q;  3ME9 A;  5CKH A;  5CKF A;  2YT6 A;  2HCK A;  3HL8 A;  4J83 A;  1KQ2 A;  1SG5 A;  1U1S A;  4M77 F;  2IVW A;  3BDU A;  3HKS A;  4AG2 C;  1YIT A;  1ZX6 A;  3OYM A;  1PSE A;  1K73 R;  1W2B P;  1JXM A;  4HA8 A;  2KBT A;  3LX7 A;  3UF4 A;  5I11 A;  3G4S Q;  1X75 C;  2E64 A;  2ZZD A;  3CCU A;  2A36 A;  4M78 F;  2PVD B;  3KFV A;  1HSQ A;  3SWN B;  1YIJ T;  2RHZ A;  3R6O A;  5IAY A;  4KGX B;  3C12 A;  2VC8 A;  3ZEH A;  1BI0 A;  4QQG A;  4MZP A;  5LJ5 j;  2AK5 A;  3OYJ A;  5DY9 A;  2KT8 A;  3CME A;  1AWO A;  2H3J A;  4RTZ A;  1VQ6 Q;  5CQX A;  2RA2 A;  4PKC C;  3VS4 A;  3FB9 A;  5CR2 A;  2K2V A;  1AZE A;  2CUB A;  2KY9 A;  3F70 A;  2WSF E;  5IHN A;  4N4G A;  1OI1 A;  3REB B;  1K9M C;  3QWY A;  2RK1 A;  4HVV A;  2X9H A;  3OW2 P;  4EIK A;  3CD6 A;  2OTL T;  4C92 G;  4GLK A;  3CQT A;  1YIJ A;  1GBR A;  2CP0 A;  3N5B B;  1X27 A;  2XKO C;  3L2V A;  1WHL A;  2FL7 A;  1PRL C;  2E5K A;  3BW1 A;  4OMM A;  1CKA A;  5GJW B;  1V1C A;  1IHV A;  4JLI A;  1QQJ A;  1WXU A;  3QDR B;  2YUQ A;  4E6R A;  4B9W A;  1VQP Q;  2KYB A;  4J7F A;  1H3Z A;  2QA4 A;  5FRM A;  3MEW A;  4OB1 B;  3UWN A;  1YP5 A;  2DYB A;  1JEG A;  1JU5 C;  2KI7 A;  1M30 A;  4K11 A;  1N5Z A;  2YLC A;  1WYX A;  3MO8 A;  3FJP A;  2KXD A;  3NTI A;  1I0C A;  1TUD A;  2O9V A;  3HRT A;  1TUC A;  4ZNX A;  2VGM A;  4FW1 A;  2RK2 A;  5FU7 C;  2D9T A;  3NTK A;  2X4X A;  3E9G A;  1TH7 A;  2EJF A;  1WHK A;  3PVQ A;  5DLO A;  2RHY A;  3CCJ T;  2HAX A;  1GFD A;  2ROL A;  2V26 A;  2IG0 A;  4UC4 A;  4VUB A;  1YJ9 T;  1MHN A;  3DLM A;  1AWJ A;  2MMP A;  3EG0 A;  3BFM A;  3GOX A;  4GY5 A;  3T9N A;  1VQP A;  2EGE A;  2NUP A;  1UE9 A;  1Q86 R;  3JSC A;  3RER A;  1Y71 A;  2JS2 A;  3QZ9 B;  2EW3 A;  2J6O A;  2RI5 A;  1OX8 A;  3HHT B;  2GFU A;  4E47 A;  3QJY A;  1M90 R;  2FPF A;  2DO3 A;  3RKY A;  4AMC A;  2YWW A;  1VQ7 A;  1ZQ1 A;  2O4X B;  1JRI A;  3CEY A;  2QA4 T;  1QVG S;  2DXU A;  4QKU A;  3EHQ A;  2ECZ A;  2HKN A;  1K9M R;  2EWN A;  2KE9 A;  1U1T A;  1D3B A;  4QQ6 A;  1J3T A;  1YI2 A;  2RPN A;  4J9E A;  1UHC A;  2EYQ A;  3E1S A;  3OA6 A;  2QG9 B;  1YNZ A;  2FRW A;  3TSW A;  5FU6 B;  3VUZ A;  3PTA A;  4RTX A;  1WFW A;  3I56 A;  2KXC A;  2MAM A;  1JQQ A;  4JDS A;  3NGP A;  4Z88 A;  3HRS A;  2LC4 A;  3OMG A;  3H6Z A;  2ESW A;  2L3Q A;  4JRP A;  4M75 D;  4PJO E;  3RR6 A;  2ABL A;  4OML A;  2CUD A;  4ORZ A;  3QPH A;  3VUB A;  1VQ4 Q;  4F14 A;  2YDL A;  3TSZ A;  3P8B B;  2FHD A;  3SWN C;  4LDW A;  4C92 E;  1TUG B;  1YJW T;  3L2Z A;  1TOV A;  1T3L A;  1SSH A;  1D1A A;  3CBM A;  2GFA A;  5FW9 A;  3VS5 A;  4BB7 A;  3VYH B;  2DXB A;  3OW2 S;  2JJ9 A;  5GAO n;  2LCC A;  1MV0 B;  1KC8 U;  4RCB A;  4R56 A;  3L2R A;  3CCS Q;  4HXJ A;  4OVA A;  5CQY A;  3M0T A;  1IRE B;  4GBQ A;  2XDB A;  1WGS A;  2DIL A;  3VS3 A;  4WCI A;  3JCM e;  3C0C A;  2LT4 A;  2QAZ A;  1OZ3 A;  4P5N A;  3VS7 A;  5LJ3 j;  1KD1 R;  1B07 A;  2DL7 A;  1I5O B;  1UTI A;  4ZN3 A;  4CC3 A;  3EGD A;  1HYO A;  1Q86 C;  3OYG A;  3P8D A;  1YFN A;  3OS2 A;  5KCH A;  1Q7Y R;  3QHS A;  2BKD N;  2X35 A;  1K1Z A;  2KQW A;  1N9S A;  3M53 A;  1JXO A;  4OMQ A;  1WI7 A;  1VQ5 A;  4BD3 A;  2CYZ B;  4FSX A;  2GCX A;  3UAT A;  1UJY A;  4XTV A;  3M56 A;  1K0X A;  2O9S A;  4M77 B;  1MMA A;  4C8Q D;  2VXF A;  2LCS A;  3V8J A;  2XDP A;  3VS1 A;  3X28 B;  3CCQ T;  4A53 A;  1W2B S;  1R0B G;  2RNA A;  2QDL A;  1WXB A;  2DAQ A;  1VQN Q;  2P84 A;  2GTJ A;  1YIT T;  1UDL A;  5GAM f;  1KHI A;  3FRN A;  3TVT A;  4CC2 A;  1AWX A;  2OJ2 A;  2CZ6 B;  5KYN A;  1W70 A;  1IXD A;  3D7S B;  4JPB W;  4X9D A;  4IIO A;  1EZZ B;  4DBR A;  1YHQ A;  4OMO A;  3PGG A;  1K9M U;  4J9C A;  2P0P A;  1PKT A;  4F7U B;  3CPW P;  4FYY B;  2CP2 A;  4C0D C;  2RO0 A;  5IXF A;  1BYM A;  2JM9 A;  5LJ3 d;  2YSQ A;  1VQM A;  3CPF A;  2I2L A;  4EMG A;  1GCP A;  3H9N A;  4FU6 A;  3OYB A;  4M7A A;  2EYX A;  2EFI A;  4Z02 A;  1D0Z A;  2YRD A;  1WQW A;  3H0I A;  3MCA B;  3EH2 A;  1V76 A;  5LJ5 e;  1PHT A;  3VS0 A;  1VQ8 A;  1OU9 A;  1KJW A;  2RH2 A;  4PL6 A;  1BBZ A;  5KYX B;  4Z8A A;  4DEX A;  3H8Z A;  1M27 C;  3WVD B;  3CD6 T;  3JCM g;  3CBO A;  4PJM A;  2AKL A;  1JJ2 S;  1S72 Q;  4RCC A;  4KUD K;  4KH1 B;  3H0F A;  1VA7 A;  3HFO A;  3E19 A;  5IHI A;  3CCR T;  2Z0W A;  5LJ5 h;  1ZUY A;  3JCM c;  5CK9 A;  5IH2 A;  4BUG A;  4M75 F;  1D1C A;  4IIM A;  3L2U A;  3O8V A;  2DYI A;  1WNL A;  4J9F A;  3JB9 D;  5GAO l;  1D09 B;  3EGD B;  3CBP A;  2JOY A;  3DLL A;  1OPL A;  2WSC E;  3GNF B;  2DF6 A;  1KD1 U;  1SSF A;  1M5Q 1;  3UPU A;  2F1L A;  3G7Z A;  4Y92 A;  3TRE A;  1KQS S;  4AFS C;  4Q5W A;  4FIB A;  2F2W A;  2QEX Q;  3IQL A;  1IO6 A;  5GAM g;  2GQI A;  1QLY A;  3RBB B;  1FMW A;  1M8M A;  1XTD A;  3R6N A;  1VQK Q;  4M77 G;  2BZX A;  3A98 A;  2L8D A;  2L5Q A;  3NPF A;  4PLI A;  1Q95 G;  1ABQ A;  1QVG P;  1AZG B;  4LDU A;  2XD0 A;  3L1A A;  4HVU A;  2DX1 A;  4J9D A;  3SWN A;  5CO7 A;  5M9O A;  1KFZ A;  3TQ7 P;  3JCM V;  3GPL A;  3OYA A;  3JCM d;  1XQH A;  3CC7 A;  1WHH A;  2PZ1 A;  2K5F A;  1RAG B;  1NM7 A;  2LP5 A;  4KRT A;  2DM1 A;  1PSF A;  1YJN A;  1H3H A;  1RI9 A;  2QK0 A;  3EG1 A;  5HK3 A;  1WXT A;  1D0Y A;  2LNV A;  4CRI A;  3M58 A;  3G6E Q;  4L59 A;  4F17 A;  5CAI A;  1WLP B;  2C0T A;  1JB0 E;  1MMD A;  1UGS B;  2DPP B;  3CC2 A;  1W1F A;  1QP3 A;  3VJP A;  1M1F A;  3QSU A;  2A0F B;  2YLB A;  5KH6 A;  1S1N A;  2MWP A;  3U23 A;  1NJI C;  1RAC B;  2YUN A;  2OTJ T;  3OYK A;  1QW1 A;  4PJO B;  4BY6 C;  4N0A A;  1QCF A;  1I8F A;  2DKG A;  1I1J A;  1VQ6 T;  2VVK A;  4OF1 A;  1ZUU A;  4J9I A;  4KUI A;  2M16 A;  1SRM A;  2LQK A;  3DKM A;  4M78 D;  1C1A A;  3A8M B;  2EGA A;  1WA7 A;  3CC2 Q;  4X9C A;  1U06 A;  1EIF A;  1VQ7 Q;  2M0O A;  2WSE E;  3CXC A;  4FT4 A;  4KGV B;  4RTV A;  4JS4 A;  4A4H A;  1G5V A;  1WIE A;  4LDX A;  2BZY A;  3MJX A;  1M90 U;  1IHW A;  3EGU A;  2COY A;  4DEY A;  1RAA B;  5GAN 6;  2CH4 A;  1Y7X A;  1NEG A;  3CMA Q;  1VQ8 Q;  3M0U A;  5KE2 A;  3V8K A;  4HCK A;  1VQK A;  3E9F A;  3OYY A;  2QQA A;  1QMC A;  1VQ4 A;  3A5Z B;  1RLQ C;  2MIO A;  2FZK B;  5GJV B;  5LJ5 d;  2DTI A;  2PNI A;  3M9Q A;  3DB3 A;  2COZ A;  3PIP A;  1TWB A;  2J6K A;  5J26 A;  4IUP A;  3MEU A;  3QUI A;  2LNH B;  3SHW A;  2OI3 A;  1VQO A;  4M7A F;  2CSQ A;  6AT1 B;  4RMO A;  2XMF A;  1G2B A;  2YRC A;  4M77 E;  3PNW C;  3ZFJ A;  1YIJ Q;  4CI0 C;  3M57 A;  3VV0 A;  4C8Q C;  1KQ1 A;  5GMK j;  4RTW A;  4E7J A;  1K8A C;  1QVF P;  3JB9 J;  3QJ6 A;  3THK A;  1W4S A;  2DXC A;  1PM3 A;  1KIK A;  2X3X D;  4E7I A;  5I21 A;  1WPY A;  3QBY A;  4BE0 A;  1N9R A;  3A8H B;  2MOX A;  3PFS A;  1FMK A;  3VYG A;  1KQS P;  1PG5 B;  4M75 A;  2V8K A;  3QYH B;  2EBP A;  2RQT A;  1W6X A;  1R77 A;  2CP3 A;  3NTH A;  3MP1 A;  3CCU Q;  1WJQ A;  2VV5 A;  1WDX A;  2L3S A;  3JB9 G;  4IUR A;  5KYY A;  3HP9 A;  4HT9 A;  5GAN e;  3J80 E;  2ROT A;  3G71 T;  5DM7 R;  2CP7 A;  3CC4 T;  1BIB A;  1D3B B;  2LDM A;  4KT0 E;  2RJF A;  4M78 B;  1KD1 C;  4C92 D;  2J7I A;  3V7C A;  4CC4 B;  3RNJ A;  1NPR A;  4J5Y A;  4QVD A;  1PC0 A;  5I2S A;  2HL3 A;  4ZGJ B;  1S72 T;  2YUO A;  2FYK A;  2R5M A;  2JTE A;  3GF5 A;  1VQN A;  1YHQ T;  4R0K A;  4HT8 A;  3MHX A;  4E7S A;  4ELY C;  2CDT A;  4BI8 B;  1E7O A;  4J6Y A;  1WHJ A;  2RI2 A;  3KUF A;  1VUB A;  3BY7 A;  3G71 A;  2HQX A;  2EQJ A;  4PJO F;  2QQ9 A;  1CKB A;  4ANJ A;  1TXQ A;  2JTM A;  2ZAE A;  1BB9 A;  3INZ A;  1Y0M A;  3CCR Q;  1I4K 1;  3M55 A;  5GAN 3;  2DZ9 A;  1VQN T;  4IUT A;  3WXM B;  1N27 A;  1Y96 A;  1UGV A;  2FEI A;  2LX7 A;  2ENM A;  4JJB A;  1R0C B;  2NUT B;  2G3R A;  1QWE A;  2DTO A;  2HBP A;  2MYS A;  1G3Y A;  3CPW S;  4M78 E;  1PCX A;  4J8O A;  1ZHI A;  4LDV A;  4XU3 A;  2FVU A;  3G4S A;  1MV3 A;  3JCM b;  2FPD A;  1UEC A;  2KRN A;  2KMT A;  2VGN A;  5C6S A;  2CP6 A;  3OYE A;  5CCA A;  4E7Z A;  4C0G A;  4PJJ A;  2L0A A;  3C95 A;  2DBK A;  2XU8 A;  3FDR A;  1VQL T;  5J3B A;  3HSB A;  3L2W A;  2D1X A;  1W2B A;  2JW4 A;  4QW2 A;  3CCQ Q;  2DD4 A;  3QXE B;  2HKQ B;  3CCL A;  1NG2 A;  1ZBX A;  3CME T;  2KRS A;  2F2X A;  5IHK A;  3CCV T;  7AT1 B;  1UEB A;  1OZ2 A;  4PJL A;  1X2Q A;  2OTJ Q;  4OMN A;  2ED0 A;  1KK7 A;  2XG8 D;  2A3L A;  3SB2 A;  5KYW A;  3MP6 A;  4M4Z A;  4HVW A;  3CC7 Q;  4JRI A;  3PMI A;  5LJ3 h;  1E6G A;  1G83 A;  2W0Z A;  2QQB A;  2MF2 A;  5FRO A;  1R8O B;  3OBY A;  3RMS A;  5GAO m;  3FEO A;  4RG2 A;  4PJO A;  1MUZ A;  2HD0 A;  1WZO A;  3GNG A;  4QQD A;  2QQR A;  4YTL A;  2QYZ A;  3CCE Q;  1BI2 A;  5GAN g;  2O88 A;  1BCM A;  1Y07 A;  2K6D A;  2EQU A;  1RLP C;  2EJ9 A;  3V7S A;  3EHR A;  4Y91 A;  3LWH A;  1X2K A;  2X3W D;  5LL6 S;  1IGQ A;  1GRI A;  1VQ8 T;  4ZGD B;  1Q7Y C;  2RM4 A;  1B34 A;  5CVI A;  3OW2 A;  2B86 A;  3AT1 B;  2JMA A;  3CCJ Q;  3GBQ A;  2EIF A;  4LD9 K;  2QGF B;  1NYG A;  1D0X A;  2R5A A;  3X25 B;  1QP2 A;  1WQ7 A;  3HPW A;  2E3I A;  3OS1 A;  2E1H A;  4FW2 A;  4V2S A;  5KYY B;  2JT4 A;  3OYN A;  2AZS A;  5CKB A;  5A0L A;  1N8R R;  2X4Y A;  1M3C A;  1WJR A;  1T3S A;  8AT1 B;  4ZN1 A;  4AFQ C;  3QII A;  1B34 B;  1S72 A;  4C8Q F;  3JCM W;  2MI6 A;  2YXY A;  2AKK A;  4MMK A;  3WVE B;  4MZT A;  4NS5 A;  3I55 Q;  1PNJ A;  4M7D D;  4JJD A;  1AT1 B;  1AOJ A;  1CSK A;  2EVR A;  5J39 A;  2EKO A;  3JCM P;  3CCQ A;  5FWB A;  4BE2 A;  4IUU A;  3QZ5 B;  3URG A;  2E41 A;  3RUX A;  1B7T A;  2CS7 A;  4B6M A;  4BDY A;  1ACM B;  2V1R A;  3CMA A;  2C0O A;  4AFU C;  1QVF S;  2NYS A;  2E6N A;  1FXX A;  2DRM A;  3EFO A;  1NPP A;  4IUQ A;  1QVP A;  1TU0 B;  1HK9 A;  5HK0 A;  2HZY A;  1VQ9 A;  1QCN A;  5KCO A;  4JLG A;  4R55 A;  3C94 A;  2DTH A;  3OS0 A;  4O6J A;  3KXT A;  3CC7 T;  1AD5 A;  4OMP A;  3VS2 A;  3V7R A;  1YI2 Q;  3CCM A;  2E5Q A;  4FYX B;  3G71 Q;  2O31 A;  3EFO B;  1OUL A;  2R58 A;  2AT1 B;  2DA9 A;  5AT1 B;  4A4K A;  1YJW A;  3OYL A;  3FC3 A;  1ABO A;  2GGR A;  3JAM E;  2DIG A;  4MDX A;  4PJN A;  4QVC A;  2GBQ A;  2RF0 A;  4O5V A;  5GMK m;  2QAS A;  2KYM A;  2J6F A;  1FX7 A;  5D7U A;  3V8L A;  2EYY A;  2EAY A;  3A1P A;  1N6A A;  2EJG A;  3FJ5 A;  4C5I A;  1SHG A;  3M54 A;  1VQO T;  4HCZ A;  1Q81 U;  3DB4 A;  5CKD A;  3I56 T;  3SD4 A;  4OMF B;  1JJ2 A;  2FG0 A;  4JJC A;  4EDU A;  1DJ7 B;  2BZ8 A;  1O75 A;  3ER0 A;  2RQR A;  3PIO A;  1YI2 T;  3LGL A;  5I22 A;  2KT1 A;  2P4T A;  4F7U F;  2X51 A;  4M7A G;  2DK3 A;  5D6Y A;  2RHX A;  3SDZ A;  3LYI A;  3P8H A;  1VQK T;  2E12 A;  4ME7 A;  3CXC S;  4AT1 B;  1VQM T;  3HTR A;  4ELZ C;  2NUP B;  3FLG A;  1BIA A;  2BE9 B;  1AEY A;  1M3B A;  4J7I A;  1NJI U;  3JB9 H;  1U5S A;  2O01 E;  2LQ8 A;  2ED1 A;  2DVE A;  4XTX A;  2V8I A;  2EKH A;  2PQW A;  1NLP C;  4B9X A;  4XTY A;  5DLQ E;  1X43 A;  4EMH A;  2DD5 A;  1SRL A;  2KRM A;  2KRO A;  4M7D E;  1WJS A;  3MKD A;  2LQW A;  2RN8 A;  1KG1 A;  2NUZ A;  1VQ6 A;  3X26 B;  1RAF B;  3G6E T;  3JCM h;  1HD3 A;  4FYV B;  4EMK B;  4PFP A;  5EG2 A;  2XID A;  3JRZ A;  3VRY A;  4D8K A;  4HCC A;  2JM8 A;  1AHJ B;  2D8H A;  1YCY A;  2KEA A;  4LNP A;  3RMQ A;  2LJ0 A;  1BU1 A;  2LTO A;  2OTL Q;  2Y4Y A;  4RTY A;  5LJ5 g;  2F5T X;  4KBM B;  2KAF A;  3LW5 E;  1RUW A;  1EX4 A;  1ZLM A;  2H8H A;  2JN0 A;  1NLO C;  4PK4 A;  1TG0 A;  4KUL A;  4QT7 A;  5FU7 B;  4C92 A;  2DRK A;  5EC7 A;  2RD1 A;  2QDY B;  1HJD A;  1RL2 A;  4DOW A;  3ZBD A;  3OYI A;  3UT1 A;  3JB9 I;  2L3R A;  4OB3 B;  1M4Z A;  5D6W A;  5GMK e;  3OYF A;  2L3P A;  2W10 A;  1K0S A;  4Y28 E;  1XNI A;  4M77 A;  4JZ3 A;  1VQO Q;  5FWC A;  1MNE A;  1M2O A;  2DL5 A;  5GAM h;  2F5K A;  1C6V X;  2RJC A;  2OTL A;  1PD0 A;  5GAN 4;  2QGG A;  1Q81 C;  3REA B;  4J6W A;  1SKU B;  2HQH A;  2ZGW A;  4M75 B;  1LOJ A;  1X6O A;  4LE9 A;  1MGQ A;  2KK4 A;  5KYW B;  4JS5 A;  1VYV A;  2NWM A;  3CC4 Q;  2JVV A;  2ZCF B;  5GAN f;  2K57 A;  1SEM A;  3PE0 A;  3M0P A;  5FU6 C;  2HMA A;  1Q82 U;  4M7D F;  1Q86 U;  2G6F X;  3S3O A;  4M77 D;  2Y90 A;  4D8D A;  1Q82 R;  4WTO B;  4KH0 B;  4XAX B;  1X6G A;  2KR3 A;  3NFC A;  3E2U A;  4F04 B;  5AYF A;  2LMJ A;  1QWF A;  4HKE A;  4C8Q A;  3PT9 A;  4TVR A;  1RAH B;  2NLU A;  1M1K C;  3CCE T;  1Q81 R;  4NOY A;  2LZ6 B;  4PNO A;  2DJZ A;  1M2V A;  4M78 G;  2DFU A;  2QA4 Q;  1PKS A;  1PD1 A;  2DZC A;  1K8A R;  3A8G B;  1EFN A;  5A2Q E;  4C0F A;  1YWP A;  3RDV A;  3J7A F;  4ZTF A;  1V29 B;  2D8J A;  2DJQ A;  4LXC A;  1A0N B;  4LN2 A;  3CPW A;  3NMZ C;  1IZ6 A;  2MPX C;  3QDF A;  2KDS A;  2E3H A;  5ECA A;  4A4G A;  2XK0 A;  5HKC A;  3VRZ A;  3I5R A;  2O4X A;  2ZPE B;  1VOM A;  2DET A;  5LJ3 f;  3M0R A;  4OB0 B;  2JUF A;  2E6Z A;  1JBM A;  4C8Q B;  3GP8 A;  5GMK i;  2A7Y A;  2FZC B;  3OBW A;  5KYX A;  2L2P A;  4PJO G;  1IGU A;  3TCJ A;  4MZM A;  2CKK A;  2GF7 A;  4C92 C;  2CZ1 B;  1T0J A;  1NBE B;  2CZ0 B;  4XQ3 A;  2K79 A;  1KQS A;  2AZV A;  4IUV A;  2EQI A;  1VYT A;  2M0Y A;  2DE0 X;  1ARK A;  3SFM A;  4C0D B;  3CC2 T;  3X20 B;  3CC4 A;  4LD6 A;  2DL3 A;  2PTK A;  2R57 A;  2SEM A;  4DBF A;  2PU9 B;  1Q82 C;  5FLX E;  3HRU A;  1N8R U;  4E7H A;  2CRE A;  1TS9 A;  3OQ5 A;  5C0M A;  1YJN Q;  1SHF A;  2EQK A;  3JV3 A;  4XTU A;  4OB2 B;  1I5L A;  1AWW A;  1OPK A;  1KC8 R;  3LLR A;  5GAO p;  1FMV A;  2FO0 A;  4FL6 A;  2ATC B;  2VAS A;  4F7U E;  4BE1 A;  3A8L B;  2BE7 D;  1BI3 A;  2CT3 A;  1RI0 A;  3GLX A;  2JMC A;  2FPE A;  3S6W A;  1X01 A;  5CIU A;  4XU0 A;  2M02 A;  2HSE B;  2QTV A;  5GAN 5;  1YJ9 Q;  2ZPH B;  3M4Y A;  4C0Z A;  2DL8 A;  1OV3 A;  1VIF A;  2J05 A;  2QXF A;  3LH5 A;  3L2Q A;  3VU3 C;  5IXB A;  3MEV A;  3QKJ A;  3H41 A;  2YUP A;  3M4G A;  2VXE A;  4C8Q E;  1XOV A;  1VQ9 T;  8ATC B;  2CP5 A;  1NYF A;  2JNG A;  1TSF A;  2D0N A;  3EGX B;  3VKI A;  2WAC A;  1GL5 A;  2I0N A;  4DA4 A;  1UB4 A;  4MDW A;  2DEQ A;  4XTW A;  2DMO A;  4C5E A;  1M8V A;  1JO8 A;  3QWX X;  4FT2 A;  3CCM T;  4J9H A;  3CCR A;  2LT1 A;  2KGT A;  3OB9 A;  4OGE A;  1BKB A;  2BIV A;  3JB9 F;  1VQ7 T;  5GAN d;  1G3T A;  2PUK B;  2LCL A;  2LQN A;  4M7D C;  1FWZ A;  2CSI A;  3ASK A;  2OAU A;  2E70 A;  3EG2 A;  1ZUK A;  2KNB B;  2ZPF B;  4F16 A;  2IIM A;  4Z89 A;  1MMG A;  1UGP B;  3I9Q A;  1KHC A;  1I81 A;  4C5G A;  3QYG B;  4BAC A;  2M9U A;  1FYN A;  4GLM A;  4JUV A;  1PWT A;  1UGQ B;  1GXI E;  3I56 Q;  1YBY A;  1LNX A;  4EMK A;  5GAM j;  3CCL Q;  4A54 A;  4C5H A;  1VQ4 T;  2XHC A;  2K7A A;  1QVF A;  2CGH A;  2JTF A;  3MPU B;  4M78 C;  5GAN 2;  3CXC P;  1O9S A;  4JRQ A;  3MP8 A;  2OTJ A;  4ESR A;  3CCS A;  2PUO B;  1K76 A;  3H0H A;  1K73 C;  4L5G A;  1KC8 C;  1M90 C;  1BI1 A;  1RAD B;  3G6E A;  4ATO A;  2ZPI B;  4F7U G;  2A37 A;  4OGC A;  4X34 A;  2H3E B;  1NE8 A;  2P0Q A;  2V8J A;  4II1 A;  4XTZ A;  4L6V 5;  3UA7 A;  2LRQ A;  3TEE A;  9ATC B;  1M9S A;  1Q7Y U;  3HFN A;  1ZSG A;  2ZPB B;  1F1B B;  3M5A A;  3FIF A;  3NHN A;  4M75 G;  1JJ2 P;  1NEB A;  1UGR B;  1M3A A;  4ZGE B;  1YJN T;  3OSS C;  5D6X A;  2J06 A;  4PFO A;  2DVJ A;  1ZSZ B;  2COW A;  3M0Q A;  3JCM f;  4C8Q G;  1WHG A;  5GAO q;  3CCV Q;  1QCO A;  4NL3 A;  1VQ9 Q;  2IPO B;  4A4F A;  2VYT A;  2XI9 A;  4X1V A;  4M7A C;  2K2M A;  4RKU E;  1N8R C;  1TTH B;  2K5L A;  4OP0 A;  1LCK A;  4FCY A;  4M77 C;  3EG3 A;  1VQ5 Q;  5GAM e;  4XK8 E;  2V1Q A;  3C4S A;  2YRV A;  2DNU A;  3EFS A;  4BY6 B;  5IT9 E;  1B3Q A;  3ULR B;  3EGX A;  2VKN A;  5I2M A;  4JJN K;  3GIB A;  2PVG B;  4BI4 A;  2FB7 A;  1YCS B;  5GMK h;  3OSV A;  3I55 T;  1G3W A;  1UJ0 A;  1P92 A;  1UUE A;  4RUG A;  2K4Y A;  3J81 E;  3CCE A;  4DQ2 A;  4J9B A;  5GAM d;  1XJW B;  1M2V B;  1H8K A;  1OX9 A;  2HBW A;  1Y57 A;  3OS5 A;  2C06 A;  2RQW A;  1YN8 A;  1Z9Z A;  2EYW A;  4M7D B;  4DOV A;  4XU2 A;  5LJ3 g;  2DER A;  2DLP A;  1E6H A;  2VUB A;  2AIR B;  2QQS A;  1OQK A;  2RI3 A;  3OYH A;  4WF2 A;  1RAB B;  4M7D A;  2HNI A;  3RES A;  3ZL7 C;  1U8R A;  5GAN h;  5GAN j;  1NZ9 A;  1Y96 B;  2SRC A;  3PMT A;  1VQL A;  2MCN A;  3I5S A;  2GTO A;  4AFZ C;  2PVO B;  4LUD A;  5IN1 A;  5GAO r;  1OU8 A;  4CC7 A;  1X69 A;  2DEU A;  1X6B A;  2X4J A;  2K3X A;  2EQM A;  4BDZ A;  2B8A A;  4QVZ A;  1RAE B;  2OX7 A;  3AHU A;  2HQE A;  2ZPG B;  5KYU A;  2A28 A;  3I55 A;  1K8A U;  1YIT Q;  1GCQ C;  5GAN 8;  3EAE A;  1UHF A;  1H64 1;  2RB6 A;  4E7K A;  2D0Q B;  2MWO A;  3I35 A;  1M1K R;  2RMO A;  3MET A;  1YHQ Q;  4MML A;  1LJO A;  2P4R A;  3OMC A;  1D1B A;  4C92 B;  1ZA1 B;  4RTT A;  1QKW A;  2AHJ B;  2E4H A;  1ZSZ C;  2K3B A;  3S3N A;  1MND A;  3L42 A;  1VQM Q;  2K5I A;  2LX9 A;  4KGZ B;  5HY6 A;  1VQP T;  4AG1 C;  1OEB A;  4M75 E;  3RKX A;  4PJO D;  1PRM C;  2GQV A;  1UG1 A;  4ZTJ A;  1VQL Q;  1VIE A;  4NL2 A;  1IB8 A;  2RHI A;  1LVK A;  5L8R E;  2DBM A;  4HCB A;  2QEX T;  5LJ5 f;  1ZA2 B;  4M7A D;  3CCJ A;  2P0K A;  1YWO A;  2CT4 A;  3RIR A;  3EH1 A;  2O2O A;  1MMN A;  2EPD A;  3RKW A;  1KSW A;  1OYX A;  3M0S A;  3UDC A;  2QEX A;  4M7D G;  1SPK A;  2JXB A;  4M78 A;  4LUE A;  2DIQ A;  5FRN A;  4LDY A;  4EPC A;  1H92 A;  3QG1 A; 
#chains in the Genus database with same CATH homology
 4IUT A;  2E10 A;  3WXM B;  1N27 A;  1Y96 A;  3LGF A;  2DZC A;  4ZN3 A;  3A8G B;  5A2Q E;  4C0F A;  4PLL A;  1Q86 C;  3OYG A;  3P8D A;  5A0G A;  2G3R A;  3J7A F;  3OS2 A;  4ZTF A;  1M1K U;  1V29 B;  5KCH A;  1QVG A;  2L89 A;  3QHS A;  3X24 B;  3JCM X;  2DTO A;  2HBP A;  2BKD N;  1G3Y A;  3CPW S;  4JRK A;  4M78 E;  3TU4 K;  2X35 A;  2Y4X A;  4J8O A;  1ZHI A;  1N9S A;  2KQW A;  4LDV A;  3M53 A;  4XU3 A;  3CPW A;  2FVU A;  1IZ6 A;  2D6F A;  3G4S A;  2KDS A;  1VQ5 A;  4A4G A;  2XK0 A;  4BD3 A;  2CYZ B;  5HKC A;  3JCM b;  4FSX A;  2GCX A;  4RG8 A;  2O4X A;  5KE3 A;  5GMK l;  2ZPE B;  5LJ3 f;  2KMT A;  2VGN A;  4XTV A;  4OB0 B;  3M56 A;  2JUF A;  3KBG A;  4M77 B;  1G3S A;  2LVM A;  2E6Z A;  1JBM A;  4C8Q B;  4C8Q D;  3EFR A;  5C6S A;  3GP8 A;  3Q1J A;  2VXF A;  5CCA A;  3OYE A;  5GMK i;  4C0G A;  2A7Y A;  3MEA A;  3V8J A;  4BI3 A;  3OBW A;  3CCV A;  2XDP A;  2K3Y A;  3X28 B;  3CCQ T;  1H3Z A;  4A53 A;  1W2B S;  2E65 A;  3C95 A;  4PJO G;  2DAQ A;  3TCJ A;  4MZM A;  1K73 U;  2XU8 A;  3FDR A;  1VQL T;  2CKK A;  1YIT T;  2KVQ G;  5GAM f;  1KHI A;  5J3B A;  3HSB A;  3CCL T;  3FRN A;  2GF7 A;  4M75 C;  4C92 C;  2CZ1 B;  3G4S T;  3L2W A;  2CZ6 B;  1W2B A;  4QW2 A;  2CZ0 B;  4XQ3 A;  4X9D A;  2DD4 A;  3QXE B;  1YHQ A;  1KQS A;  4IUV A;  3PGG A;  1K9M U;  2BUD A;  2QTX A;  2M1H A;  2P0P A;  3CCL A;  4F7U B;  1ZBX A;  3CME T;  3BDL A;  4C0D C;  4M7A E;  2XIC A;  3SFM A;  2RO0 A;  4C0D B;  3CCV T;  1BYM A;  1UEB A;  3CC2 T;  1OZ2 A;  3X20 B;  5LJ3 d;  1VQM A;  3CC4 A;  3CPF A;  4LD6 A;  2I2L A;  4EMG A;  2RHU A;  1VQN T;  1M1G A;  4E7L A;  3S3M A;  2R57 A;  2XG8 D;  2RJE A;  2A3L A;  4FU6 A;  3SB2 A;  3OYB A;  4M7A A;  2PU9 B;  2EFI A;  3MP6 A;  4Z02 A;  1Q82 C;  5FLX E;  1WQW A;  3HRU A;  3MCA B;  1N8R U;  4JRI A;  2JZ2 A;  4E7H A;  3PMI A;  5LJ3 h;  3CMA T;  5LJ5 e;  1HXD A;  2QQB A;  2MF2 A;  3OQ5 A;  5FRO A;  3LWI A;  1VQ8 A;  2RH2 A;  4PL6 A;  5CKE A;  5C0M A;  3M59 A;  1R8O B;  3OBY A;  3H8Z A;  3RMS A;  3FEO A;  4RG2 A;  5GAO m;  4PJO A;  2EQK A;  3OYD A;  3CCU T;  4XTU A;  4N4H A;  3WVD B;  4OB2 B;  1I5L A;  3CD6 T;  2HD0 A;  3JCM g;  3CBO A;  3GNG A;  2QQR A;  4QQD A;  3LLR A;  3JCM Q;  1JJ2 S;  4YTL A;  5GAO p;  4RCC A;  4M7A B;  4KUD K;  1BI2 A;  5GAN g;  4FL6 A;  1Y07 A;  3HFO A;  4F7U E;  4BE1 A;  3E19 A;  3A8L B;  3A8O B;  4EMK C;  4IKF A;  5A0D A;  3CCR T;  2EQU A;  1BI3 A;  2EJ9 A;  5LJ5 h;  1RI0 A;  5LJ3 e;  3GLX A;  4D6W A;  3JCM c;  5CK9 A;  3V7S A;  3LH0 A;  4Y91 A;  3LWH A;  4BUG A;  3S6W A;  5LL6 S;  3QO3 A;  4M75 F;  4C92 F;  1VQ8 T;  2DXT A;  1X01 A;  5CIU A;  2KSS A;  3O8V A;  3L2U A;  4XU0 A;  3JCM J;  2RJD A;  4F7U A;  4ZGD B;  1Q7Y C;  2RM4 A;  1B34 A;  5CVI A;  5GAN 5;  1WNL A;  3OY9 A;  4A4E A;  3OW2 A;  3JB9 D;  2F69 A;  5GAO l;  2XDD A;  4N0A C;  2EIF A;  4J6X A;  3CCS T;  2ZPH B;  4LD9 K;  3M4Y A;  3CBP A;  2R5A A;  3X25 B;  4C0Z A;  1YJ9 A;  1QP2 A;  1WQ7 A;  2JOY A;  3DLL A;  4PJO D;  2WSC E;  3GNF B;  1VIF A;  2QXF A;  4FM4 B;  3HPW A;  2QI2 A;  2YHT A;  3L2Q A;  3VU3 C;  3MEV A;  3QKJ A;  1SSF A;  1M5Q 1;  3OS1 A;  3UPU A;  1KD1 U;  2E1H A;  3M4G A;  3G7Z A;  2VXE A;  5GAN 7;  4V2S A;  4C8Q E;  4N4I A;  1XOV A;  1KQS S;  3TRE A;  3OYN A;  1VQ9 T;  5CKB A;  2JNG A;  4XU1 A;  4Q5W A;  4FIB A;  5A0L A;  4PJO C;  2CZ7 B;  1VQ5 T;  3OYC A;  2X4W A;  2X4Y A;  2WAC A;  3VKI A;  3ME9 A;  5GAM g;  5CKH A;  4DA4 A;  1UB4 A;  4MDW A;  5CKF A;  1WJR A;  2DEQ A;  4XTW A;  1XTD A;  4C5E A;  1M8V A;  3HL8 A;  4M77 G;  4ZN1 A;  4J83 A;  2L8D A;  1KQ2 A;  2L5Q A;  3QII A;  1B34 B;  1S72 A;  4PLI A;  4C8Q F;  1U1S A;  3JCM W;  2MI6 A;  4FT2 A;  3CCM T;  4M77 F;  2IVW A;  3BDU A;  3CCR A;  2LT1 A;  4LDU A;  3OB9 A;  3HKS A;  4MMK A;  3WVE B;  3L1A A;  4OGE A;  1YIT A;  1BKB A;  2BIV A;  2XD0 A;  3OYM A;  4MZT A;  1VQ7 T;  3JB9 F;  4NS5 A;  4M7D D;  1PSE A;  5GAN d;  1G3T A;  3SWN A;  5CO7 A;  2PUK B;  4HA8 A;  5M9O A;  3LX7 A;  2LCL A;  5J39 A;  3JCM V;  1X75 C;  4M7D C;  1FWZ A;  2E64 A;  2EKO A;  2ZZD A;  3ASK A;  2OAU A;  3OYA A;  3GPL A;  3CCQ A;  4BE2 A;  3JCM P;  2E70 A;  3JCM d;  1XQH A;  4IUU A;  3QZ5 B;  3URG A;  3CC7 A;  3CCU A;  2E41 A;  2ZPF B;  3RUX A;  4M78 F;  2PVD B;  2CS7 A;  4BDY A;  2K5F A;  1UGP B;  3CMA A;  1QVF S;  1KHC A;  1I81 A;  4C5G A;  2E6N A;  1FXX A;  1PSF A;  3SWN B;  1YIJ T;  2RHZ A;  1NPP A;  3QYG B;  4BAC A;  2M9U A;  4IUQ A;  1YJN A;  1QVP A;  3R6O A;  5IAY A;  5HK3 A;  4JUV A;  1HK9 A;  5HK0 A;  3C12 A;  1UGQ B;  1VQ9 A;  1GXI E;  2LNV A;  5KCO A;  2VC8 A;  1YBY A;  1LNX A;  4CRI A;  3M58 A;  4JLG A;  4EMK A;  5GAM j;  4A54 A;  4C5H A;  4L59 A;  4R55 A;  3C94 A;  1VQ4 T;  2DTH A;  2XHC A;  5CAI A;  3OS0 A;  3ZEH A;  1QVF A;  2CGH A;  4O6J A;  3KXT A;  1JB0 E;  2JTF A;  2DPP B;  1UGS B;  1BI0 A;  4M78 C;  5GAN 2;  3CC2 A;  4QQG A;  4MZP A;  1O9S A;  3V7R A;  5LJ5 j;  3OYJ A;  4JRQ A;  3CCM A;  2E5Q A;  5DY9 A;  3MP8 A;  3CME A;  2OTJ A;  2H3J A;  1QP3 A;  3CCS A;  3VJP A;  2PUO B;  1M1F A;  1KC8 C;  5CQX A;  4L5G A;  1K73 C;  2R58 A;  2RA2 A;  4PKC C;  1M90 C;  3QSU A;  1BI1 A;  3FB9 A;  3G6E A;  4ATO A;  2YLB A;  5KH6 A;  2ZPI B;  4A4K A;  4F7U G;  4OGC A;  2MWP A;  4X34 A;  5CR2 A;  3OYL A;  3FC3 A;  2K2V A;  1YJW A;  1NJI C;  2P0Q A;  1NE8 A;  3JAM E;  2OTJ T;  2V8J A;  3OYK A;  1QW1 A;  2DIG A;  4II1 A;  4L6V 5;  4XTZ A;  4MDX A;  4PJO B;  2LRQ A;  3TEE A;  4QVC A;  4BY6 C;  1M9S A;  2KY9 A;  3F70 A;  4N0A A;  4O5V A;  5GMK m;  1I8F A;  2WSF E;  4N4G A;  2DKG A;  1OI1 A;  1Q7Y U;  1K9M C;  3HFN A;  4OF1 A;  1FX7 A;  2RK1 A;  1VQ6 T;  4KUI A;  3V8L A;  2ZPB B;  2EAY A;  2M16 A;  3M5A A;  3FIF A;  3CD6 A;  1N6A A;  2EJG A;  2OTL T;  2LQK A;  3DKM A;  4M75 G;  4M78 D;  4C5I A;  1UGR B;  3M54 A;  4C92 G;  4GLK A;  1VQO T;  3A8M B;  4HCZ A;  1Q81 U;  3DB4 A;  4ZGE B;  1YJN T;  5CKD A;  3I56 T;  1YIJ A;  3SD4 A;  3OSS C;  4OMF B;  3N5B B;  1JJ2 A;  4X9C A;  5D6X A;  2XKO C;  3L2V A;  1EIF A;  2FL7 A;  2M0O A;  2WSE E;  3JCM f;  4C8Q G;  4EDU A;  3BW1 A;  4FT4 A;  5GAO q;  3CXC A;  1DJ7 B;  4NL3 A;  1O75 A;  3ER0 A;  3PIO A;  4JS4 A;  1YI2 T;  4A4H A;  1G5V A;  4LDX A;  3LGL A;  2VYT A;  2XI9 A;  4A4F A;  4M7A C;  4RKU E;  2P4T A;  3QDR B;  4JLI A;  4F7U F;  1N8R C;  1M90 U;  4M7A G;  2DK3 A;  5D6Y A;  2RHX A;  3SDZ A;  3LYI A;  2K5L A;  3P8H A;  4OP0 A;  4M77 C;  5GAN 6;  5GAM e;  4B9W A;  1Y7X A;  4XK8 E;  4J7F A;  1VQK T;  3C4S A;  3EFS A;  2E12 A;  2YRV A;  4ME7 A;  3V8K A;  5KE2 A;  4BY6 B;  3CXC S;  2QA4 A;  5IT9 E;  1VQM T;  5FRM A;  4ELZ C;  5I2M A;  1VQK A;  4JJN K;  3MEW A;  4OB1 B;  3E9F A;  3OYY A;  3GIB A;  3UWN A;  3FLG A;  2QQA A;  1BIA A;  2PVG B;  1VQ4 A;  3A5Z B;  4BI4 A;  4J7I A;  2FB7 A;  5GMK h;  3OSV A;  3I55 T;  2YLC A;  3MO8 A;  5LJ5 d;  1NJI U;  3JB9 H;  2DTI A;  3FJP A;  3M9Q A;  3DB3 A;  1G3W A;  3NTI A;  1P92 A;  3PIP A;  3J81 E;  2O01 E;  2K4Y A;  2LQ8 A;  3CCE A;  4DQ2 A;  2DVE A;  4IUP A;  3HRT A;  5J26 A;  5GAM d;  4XTX A;  2V8I A;  2VGM A;  3MEU A;  2PQW A;  2RK2 A;  5FU7 C;  4B9X A;  3OS5 A;  4XTY A;  2C06 A;  5DLQ E;  2D9T A;  3QUI A;  4EMH A;  2X4X A;  3NTK A;  2DD5 A;  4M7D B;  3E9G A;  1TH7 A;  2EJF A;  4DOV A;  1VQO A;  4XU2 A;  4M7A F;  4M7D E;  4RMO A;  5DLO A;  1WJS A;  4M77 E;  2RHY A;  3PNW C;  3ZFJ A;  5LJ3 g;  3CCJ T;  2HAX A;  4CI0 C;  3M57 A;  3VV0 A;  4C8Q C;  2IG0 A;  1KQ1 A;  4UC4 A;  4VUB A;  1YJ9 T;  5GMK j;  2VUB A;  1KG1 A;  2QQS A;  1VQ6 A;  1MHN A;  2RI3 A;  3OYH A;  4WF2 A;  3X26 B;  3DLM A;  2MMP A;  3G6E T;  1K8A C;  4E7J A;  3BFM A;  3JCM h;  2HNI A;  4M7D A;  3RES A;  4EMK B;  3GOX A;  4GY5 A;  3T9N A;  1VQP A;  5EG2 A;  2XID A;  3JRZ A;  1U8R A;  3JB9 J;  3QJ6 A;  4HCC A;  1W4S A;  5GAN h;  1AHJ B;  1YCY A;  2DXC A;  3JSC A;  3RMQ A;  5GAN j;  3RER A;  1NZ9 A;  2LTO A;  1Y71 A;  4E7I A;  1Y96 B;  5I21 A;  1WPY A;  3QZ9 B;  3PMT A;  3QBY A;  2Y4Y A;  2RI5 A;  1VQL A;  5LJ5 g;  2F5T X;  4KBM B;  2KAF A;  2GFU A;  3HHT B;  1N9R A;  3QJY A;  3LW5 E;  4E47 A;  4BE0 A;  3A8H B;  2DO3 A;  3PFS A;  3RKY A;  2JN0 A;  3VYG A;  1VQ7 A;  1ZQ1 A;  2PVO B;  4KUL A;  2O4X B;  1JRI A;  3CEY A;  5FU7 B;  4M75 A;  4C92 A;  5IN1 A;  2QA4 T;  2RD1 A;  2V8K A;  5GAO r;  3QYH B;  2QDY B;  1QVG S;  2DXU A;  1RL2 A;  3NTH A;  3MP1 A;  4DOW A;  3ZBD A;  2X4J A;  2K3X A;  2EWN A;  3OYI A;  3UT1 A;  3JB9 I;  1U1T A;  2L3R A;  4OB3 B;  1D3B A;  4QQ6 A;  1M4Z A;  1WJQ A;  5D6W A;  5GMK e;  2EQM A;  2VV5 A;  1YI2 A;  3OYF A;  4BDZ A;  2B8A A;  4QVZ A;  4Y28 E;  3JB9 G;  1XNI A;  3AHU A;  4M77 A;  4IUR A;  2EYQ A;  2HQE A;  2ZPG B;  3HP9 A;  1K8A U;  3E1S A;  3OA6 A;  5GAN e;  3I55 A;  4HT9 A;  3J80 E;  3VUZ A;  5FU6 B;  3PTA A;  3G71 T;  5DM7 R;  3I56 A;  2MAM A;  5GAN 8;  3EAE A;  4JDS A;  3CC4 T;  5GAM h;  2F5K A;  1H64 1;  2RB6 A;  3HRS A;  2D0Q B;  4E7K A;  2LC4 A;  1BIB A;  1D3B B;  2MWO A;  2RJC A;  3H6Z A;  3OMG A;  5GAN 4;  2OTL A;  1Q81 C;  3MET A;  4JRP A;  2LDM A;  4KT0 E;  1LJO A;  2RJF A;  4J6W A;  4M78 B;  4MML A;  1KD1 C;  3OMC A;  4M75 D;  2ZGW A;  4M75 B;  4C92 D;  3V7C A;  4C92 B;  4PJO E;  1NPR A;  4J5Y A;  4QVD A;  1LOJ A;  1X6O A;  2AHJ B;  1MGQ A;  3S3N A;  3QPH A;  5I2S A;  2KK4 A;  3VUB A;  4ZGJ B;  4JS5 A;  3L42 A;  1S72 T;  2JVV A;  2K5I A;  2LX9 A;  2ZCF B;  2FYK A;  2R5M A;  5GAN f;  5HY6 A;  3P8B B;  2K57 A;  3GF5 A;  1VQP T;  2FHD A;  4M75 E;  4LDW A;  3RKX A;  3SWN C;  2GQV A;  5FU6 C;  4C92 E;  1YJW T;  1Q82 U;  1VQN A;  4M7D F;  3L2Z A;  4ZTJ A;  1YHQ T;  1Q86 U;  4HT8 A;  1VIE A;  4NL2 A;  3MHX A;  3CBM A;  4ELY C;  2RHI A;  2GFA A;  3S3O A;  5L8R E;  4BI8 B;  4M77 D;  4BB7 A;  4HCB A;  3VYH B;  2QEX T;  5LJ5 f;  4J6Y A;  2Y90 A;  2DXB A;  2RI2 A;  3OW2 S;  5GAO n;  3KUF A;  3CC7 T;  4M7A D;  3CCJ A;  2P0K A;  4XAX B;  3RIR A;  2LCC A;  3NFC A;  1VUB A;  4RCB A;  4R56 A;  3L2R A;  1KC8 U;  3BY7 A;  4OVA A;  5AYF A;  3G71 A;  5CQY A;  3RKW A;  1IRE B;  4HKE A;  2XDB A;  2HQX A;  1OYX A;  4C8Q A;  3PT9 A;  2EQJ A;  4TVR A;  1WGS A;  4PJO F;  3UDC A;  3JCM e;  2QEX A;  4M7D G;  2LT4 A;  2NLU A;  2QQ9 A;  1M1K C;  1OZ3 A;  4M78 A;  3CCE T;  2DIQ A;  4P5N A;  5FRN A;  4LDY A;  4NOY A;  2JTM A;  4EPC A;  3INZ A;  2DJZ A;  4PNO A;  5LJ3 j;  4M78 G;  1I4K 1;  3M55 A;  5GAN 3;  2DZ9 A;  3QG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...