5GMKh

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
70
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 8
structure length 70
sequence length 72
chains with identical sequence w
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkh00
3BDUA 2QTXA 2DEQA 2RM4A 4EMKB 2RB6A 1D3BB 2DXTA 3JCMX 4JRIA 3JB9D 4PNOA 4QVDA 1M8VA 1KQ1A 4M75D 3QSUA 4M7AA 4X9CA 3JB9H 4PJOB 4C8QB 2YLBA 3JCMP 5GAOr 5GAMd 3INZA 3FB9A 4HT9A 3JB9G 4EMKA 4M7DD 1D3BA 1B34B 4M75G 3BW1A 2K57A 3FIFA 4JRKA 3V7RA 3RERA 3EFSA 4M7AC 4PJOA 4C8QA 1LNXA 4XU1A 5GMKl 4NL3A 2FYKA 1H641 4X9DA 1M5Q1 4M7DG 3V7CA 2FB7A 5LJ5e 5LJ5g 1B34A 4M77B 4XTXA 1X01A 4F7UG 5GAMj 1I8FA 2DTHA 3JB9F 2DJZA 3QUIA 4M75F 4M75E 1WNLA 3JCMd 4C92B 1I81A 4M7AD 4XTWA 3JCMW 5GAOn 5GANe 5GMKj 5GANg 4M78C 4M77A 4NL2A 2E1HA 5LJ3e 5LJ3g 1BIBA 1U1TA 3SWNA 4M7DF 5GAN3 5I21A 4M7DB 4RCCA 4F7UF 4C92A 5GANj 4F7UE 2EJGA 2Y90A 3JCMV 3BY7A 1N9RA 3RKYA 4M7AG 3FJPA 4N0AC 4A53A 3RKXA 1N9SA 2E65A 2E41A 2DZ9A 3GIBA 3HSBA 5DY9A 3V7SA 3EFRA 4XQ3A 3SWNC 3SB2A 2YLCA 2DKGA 3HFOA 5GAOm 4M78D 5LJ5h 1WPYA 4J5YA 4XU2A 4J6XA 4A54A 4M7AE 1U1SA 5GAOq 4EMKC 3L2ZA 4M78G 4XTVA 5LJ5f 3JCMb 2E10A 4PJOC 2E64A 1BIAA 4C8QC 4V2SA 4HA8A 2ZGWA 4M75B 5GAMe 5LJ3h 4Y91A 2I2LA 5GAMg 5GANh 3JB9I 4MMKA 1I4K1 1LOJA 2VC8A 2EJ9A 5GANf 5GAN2 5LJ3f 2VXEA 3JCMQ 4M78F 5GMKe 4M78E 4M75A 3RESA 4MMLA 2RA2A 3RKWA 4F7UB 4PJOD 4XU0A 2EAYA 4XTZA 4C8QD 3M4GA 4M77C 4NOYA 2DTOA 3JCMJ 4M7DA 3JCMe 3JCMg 4OP0A 4C92C 4PJOG 4EMHA 2EJFA 2VXFA 4F7UA 4C8QG 4M7DE 1JBMA 4M7AF 3HFNA 2DZCA 4EMGA 1HXDA 4JLIA 4PJOE 4M7AB 4DQ2A 3JCMc 5GAOl 4M7DC 2EWNA 5GAMh 5GMKi 3QO3A 4M77D 4XTYA 5LJ5d 5GAN6 1Y96B 4PJOF 3L1AA 4WF2A 3PGGA 4C92D 3VU3C 4C8QF 5GAMf 2HNIA 4C8QE 5CAIA 5GAOp 3JB9J 5GMKh 4XTUA 1WQWA 2JN0A 4M77G 1TH7A 1HK9A 1I5LA 1KQ2A 2DXUA 5GMKm 4RCBA 3RIRA 3V8LA 4C92G 3QHSA 1Y96A 4M78B 4QVCA 5GANd 5LJ3d 2DTIA 5GAN4 2DVEA 4J6WA 3JCMh 2RD1A 5GAN8 5LJ5j 3AHUA 4HT8A 4M77F 4JUVA 3JCMf 4M77E 1JRIA 1MGQA 4M75C 4M78A 3SWNB 2CGHA 3V8KA 3BFMA 1YCYA 4C92F 1LJOA 4C92E 1WQ7A 5GAN7 4XU3A 3RUXA 2YHTA 4J6YA 3V8JA 5LJ3j 5GAN5 4N0AA
chains in the Genus database with same CATH superfamily
2A0FB 2RM4A 4LNPA 4PNOA 1M8VA 1S72A 2XIDA 2IPOB 5CIUA 4J8OA 3TEEA 3BW1A 3V7RA 3F70A 5GMKl 3CCVA 1LVKA 4JZ3A 1OX9A 1YJ9T 3G1JA 3TQ7P 1ZUYA 1WJRA 4ELYC 3JB9F 2CDTA 3QUIA 1JQQA 2WACA 2M02A 3CCMA 1YIJQ 2YDLA 4D6WA 2COZA 4J9DA 3GLXA 1VYUA 2MWPA 5GMKj 4M78C 2JXBA 3C0CA 4F7UE 1W1FA 2V8IA 2KT1A 4N4IA 5KYUA 7AT1B 2KE9A 5FW9A 1I0CA 2QDLA 3M59A 3M5AA 4C5HA 2IVWA 3E2UA 5DM7R 3KXTA 2DRMA 1YFNA 2K2VA 2LQWA 4HA8A 3A8HB 2I2LA 2QG9B 5DLQE 2D8JA 2DAQA 3VRZA 3M55A 1VQOA 4DBRA 5GMKe 1BI0A 4M75A 1YHQA 4IIMA 4E7ZA 2RA2A 2MMPA 2RO0A 4HCCA 2FG0A 3SHWA 1XNIA 1SHFA 2M1HA 2HAXA 1D0ZA 3RDVA 3OYGA 2VXFA 3EG1A 2ROTA 2EQUA 1HD3A 3EH2A 2YUPA 3PNWC 1VQ9A 3OYLA 4OMQA 1Q86U 1MMAA 2DFUA 4XTUA 2OJ2A 3DB4A 3SFMA 2D1XA 3QHSA 1ZLMA 4JLGA 3L2WA 1E6GA 1YJ9A 1A0NB 4L59A 2CP7A 4FYVB 4Z8AA 4J9BA 3E9FA 4IUUA 4M7DE 2CP6A 1NBEB 4OMPA 3PVQA 3CCQT 2YSQA 2PQWA 1B7TA 1QQJA 3PMIA 4FL6A 1PD0A 1VQNA 3HPWA 3C12A 3TSWA 1UG1A 1M27C 4OMOA 4J9GA 1VQ5T 4BE1A 1AWXA 2DTHA 1PWTA 4O6JA 1KJWA 5J39A 5GAOn 4NL2A 1ZSZC 2K6DA 4EIKA 3KFVA 1NEGA 2K5IA 4C5EA 2RQWA 2O4XB 4KGXB 2DZ9A 5C0MA 2L8DA 5CR2A 3A8GB 1YITQ 2ZPGB 4BDZA 1PSEA 5I2SA 4KRTA 3VV0A 4XTVA 1Q82R 3M58A 1M1GA 1PC0A 4V2SA 3H9NA 3LH5A 5LJ3h 4M4ZA 3UATA 4OMNA 1RI9A 2PNIA 1T3SA 5GAN2 3U23A 2ZPFB 2J6OA 1VYTA 1SSHA 4MMLA 1WHKA 4R55A 2EAYA 2RJFA 3JCMg 4RTXA 1CKAA 2F5TX 1YI2T 1OQKA 3CMET 4M7AF 3HFNA 1O75A 4LUDA 2DK3A 2RK2A 2KSSA 2HL5C 3LW5E 1QP2A 2DBMA 5IXFA 1D1BA 4C8QF 3OA6A 5GAOp 1TH7A 2QYZA 4Q5WA 5IHIA 1WXUA 4QVCA 3ZFJA 1I1JA 4HVUA 5J3BA 2CT4A 5GJWB 3C95A 3CPWA 1R0CB 1H3HA 1VQKA 5LJ3j 2KGTA 4N0AA 2CSQA 3LX7A 5HKCA 2ZPEB 4C0DC 2M9UA 5FU7C 1D3BB 1W70A 3JB9D 1QCOA 3CMAQ 1Q81U 1MMGA 4NS5A 4MDWA 2DBKA 2PTKA 1I5OB 2GFUA 2WSEE 3PVLA 3OSSC 4FW1A 2KR3A 2GBQA 4C92B 4A4FA 3CC2Q 3NFCA 4F14A 5LJ3e 3P8HA 2HSPA 2EJGA 2J06A 4DEYA 1VQPQ 1KSWA 5CQXA 3J7AF 4FW2A 1ACMB 4KUDK 3G6EQ 4JS5A 4OMFB 2QA4T 4A4HA 2RNAA 2B86A 1VQMQ 3L2ZA 5LJ5f 1XJWB 3PMTA 3TREA 4PJOC 2ZGWA 4Y91A 3C94A 2HD0A 3SEMA 1PRMC 4LE9A 3I55Q 2FZCB 4XAXB 1EX4A 1R77A 4HXJA 4Y92A 4M7DA 1JEGA 1EIFA 2LZ6B 4JZ4A 3FLGA 1IHVA 3H6ZA 4M7AB 1H8KA 2VB6A 2DL4A 2D0NA 3EHRA 1VQ4Q 1RACB 4ZNXA 3KBGA 5GAMf 1K73C 4C8QE 4MZTA 2DERA 2RHUA 1WQWA 2JN0A 2EGCA 5FU6B 3CC4A 4RCBA 4PJNA 2K7AA 1Q86R 4C92G 5LJ3d 4DBHA 2AKLA 1X75C 1VUBA 2JJ9A 3MP6A 3OYEA 2MOXA 2E5QA 4M78A 3CCUA 1ZA2B 3SWNB 1U5SA 1YCYA 2BIVA 1H92A 2NUTA 2YHTA 4KGZB 3MEAA 2L3PA 4QW2A 5HK3A 1PHTA 4EMKB 1B07A 1K8AU 2E4HA 4PJMA 3OYKA 4A63B 3ME9A 4ZTJA 1G3TA 4AFQC 3M4YA 4J9HA 2FYKA 4X9DA 1M5Q1 2EQMA 1B34A 4M77B 5KYXA 2EQKA 2KNBB 4M75F 1UE9A 1WNLA 3EGDB 1TUGB 3CXCA 3WVEB 3EH1A 5CKDA 3R6OA 2R57A 3X24B 3EFOB 4M7AG 3X20B 3RKYA 3MKDA 3A8OB 3FJPA 3CPWP 3RKXA 2E6ZA 2RH2A 3SB2A 2YLCA 2YUNA 2NUPA 1WHMA 1MMDA 2CZ1B 4B9WA 4PFPA 1N8RU 2R58A 3ASKA 3MEVA 1BIAA 3HTRA 1YJWT 1OEBA 3WVDB 3I56Q 2KT8A 1Q7YC 1M1KC 3WXMB 3E1SA 1RL2A 3ZL7C 4JRPA 1KIKA 3RKWA 4O5VA 3UDCA 3EGXA 4C8QD 2E3HA 3R6NA 3N5BB 4NOYA 2DF6A 1VQ6A 2YRVA 1G83A 1KQSA 1K9MC 2DYIA 1NYFA 2DZCA 1HXDA 4KBMB 4RTUA 5HCKA 2BZXA 4KT0E 3OBYA 4IUTA 2QQBA 1M30A 2KRMA 4M77G 1YJ9Q 3V8LA 4QQGA 1M3CA 3ULRB 4DBQA 3OYHA 2DVEA 2RD1A 3OYMA 4PK4A 3UF4A 2CT3A 2XHCA 2EVRA 4ZGDB 2QEXT 1G2BA 1ZSZA 3D7SB 3M54A 1MUZA 3CBOA 2CZ7B 1CSKA 2B8AA 3OQ5A 3GP8A 2HEQA 5IT9E 1KQ1A 1VQMT 2RI5A 5KYYA 2C0IA 5KCHA 1SG5A 2P0QA 3M56A 4AT1B 1WX6A 1Q81R 4KUIA 1KHIA 2YWWA 1PCXA 1WYXA 5LJ5g 3OS1A 3JAME 1WHHA 2NLUA 5LL6S 2G3RA 3G71A 2OAUA 3EGUA 4M75E 2RJDA 5ECAA 3NTIA 3G4ST 3TVTA 2K2MA 3H41A 4BD3A 1GCPA 3A98A 5GAN3 4LDXA 4A53A 2K5FA 3EHQA 2AKKA 1PNJA 2LDMA 4QKUA 1Y71A 4OMMA 3LGLA 2ZZDA 3CCLA 1D09B 2GF7A 2M51A 2XDDA 2AZSA 1Z9QA 1OZ3A 4PLIA 5GAMg 1GXIE 1UGSB 1S72T 5GANf 3PT9A 2VXEA 2E3IA 2LT1A 2O2OA 4XU0A 1GFDA 3CXCP 4TVRA 3CCVT 4BACA 1NEBA 2JTFA 2QEXA 1IXDA 1WJSA 3CCMT 2PVOB 1RABB 1Y96B 1NJIC 2JNGA 1W4SA 1X43A 1KFZA 2HSEB 3RBBB 1OYXA 2R5MA 1VQ5Q 1BKBA 2DTIA 1IRXA 1C6VX 3M0UA 2CREA 4AG1C 1R0BG 2VKNA 2CGHA 4QT7A 1SHGA 1QLYA 5DLOA 2AHJB 3BDUA 3LLRA 2X4WA 4BI3A 3G4SA 1LCKA 1VQOT 1NE8A 3JV3A 4M75D 1M2VB 1IZ6A 1K1ZA 1XTDA 1K4US 1YHQT 4OGEA 1VQ8T 1G3SA 2K57A 1K8AR 4PJOA 1LNXA 3J80E 1ABOA 1D1AA 3X28B 1K0SA 1QVPA 3MCAB 4XTXA 3O8VA 2NUZA 4E7SA 1YWOA 2DLPA 1WHGA 1VQ9T 1AVZC 2XKOC 1I81A 3CQTA 1LPLA 2RHZA 4M7DF 1D0XA 3QDRB 1YNZA 1VQLA 5IHNA 2RI2A 2DRKA 3E9GA 1FX7A 5KE2A 3OY9A 1YI2Q 3CMEQ 3GIBA 2X3XD 1MMNA 3VS0A 1K9MU 2CUDA 1X2KA 1GBQA 4J5YA 4JJBA 2KXDA 1ZUUA 2XD0A 1SRLA 2V8JA 4PKCC 3H8ZA 1VOMA 1N8RR 2DE0X 3HHTB 1RAHB 3I9QA 2VC8A 3GBQA 2L0AA 4ZGEB 3S3NA 4M78F 4RTTA 4JJDA 2HKNA 4F7UB 1FMKA 3OYDA 1MNEA 3OMCA 4B6MA 1VQNT 6AT1B 2EQJA 3CCET 3QZ5B 2RJEA 3JRZA 3QJ6A 4RG2A 1X69A 3A1PA 2W10A 3CCJT 1VQ7A 2F69A 2BE7D 1AOJA 1M90C 2JM8A 4XTYA 4KH1B 2COWA 3VU3C 2A7YA 2X3WD 3VKIA 3VYHB 5C6SA 4BY6B 2ENMA 5GMKm 3CPFA 2CSIA 1VQ8A 2ATCB 1Y57A 2ZAEA 2EIFA 3HP9A 1QMCA 2GNCA 1QVFA 2GFAA 2YUOA 1SSFA 2JM9A 1ARKA 1X6GA 1PKTA 2DILA 4XU3A 4BI4A 4J6YA 1UHFA 1G3WA 1TU0B 4QVDA 2V1QA 1GRIA 2I0NA 2PUOB 2LT4A 2QA4Q 3FB9A 2KK4A 2L89A 2LCLA 3CCSA 4PJJA 4CC7A 1SF9A 3VS1A 2JTMA 3QJYA 4F7UG 1ZSGA 2DJZA 1HYOA 2KRSA 2VUBA 1KD1C 5GANg 2E1HA 3GOXA 1M3AA 1E6HA 3M0SA 4M7DB 2JOYA 3BY7A 2HDAA 2HQHA 3S6WA 5DY9A 3V7SA 1KC8C 1V1CA 2YRCA 4J9CA 3CCEA 1XOVA 3GNFB 2D0QB 2O88A 1E7OA 5KYWA 2GTJA 4JDSA 3CCRA 3FC3A 2KYMA 1VQKT 3H0HA 1BI1A 4J9IA 3CCJA 2OAWA 1LOJA 4OVAA 5D6WA 1O9SA 4CRIA 4M78E 4FYWB 1UTIA 2LJ3A 2DTOA 3JCMJ 1BBZA 4C92C 2FL7A 3MEUA 4EMGA 2QI2A 2QTVA 5D6YA 1JB0E 1W2BA 2D8HA 2QGGA 5GAOr 2QXFA 3L1AA 1UUEA 2JZ2A 4WTOB 2FO0A 1DJ7B 3CBMA 1G5VA 2KBTA 2X51A 4GLMA 5EG2A 3TCJA 5KYXB 1PKSA 1P92A 1TUDA 2QQRA 4QVZA 3CC7A 4R0KA 4LUEA 2DVJA 2EYXA 1NZ9A 2DPPB 3CPWS 2FZGB 2BZYA 2DXTA 4FYYB 2NUPB 3M0TA 4KH0B 1TG0A 2FRYA 8ATCB 3I35A 3JB9G 2A36A 4M7DD 3J81E 3FIFA 2EGAA 4M7AC 4E7LA 1JXOA 5KH6A 1YJWQ 1BB9A 3HRTA 3V7CA 1VYVA 2YXYA 3OS0A 3NPFA 5CKEA 5KCOA 3LWHA 2MIOA 5FU6C 4X34A 1M8MA 2DA9A 2FHDA 3DB3A 4K11A 3FDRA 1QVFP 3CC4T 4C5GA 2E41A 4HCBA 3SWNC 4RTZA 2DKGA 2EYZA 4M78D 1YP5A 1QVGA 3E19A 2ABLA 4J6XA 4ORZA 3CCUT 5GAOq 4EMKC 2P0PA 2VV5A 2QGFB 1K9MR 1OU8A 2E10A 2JS0A 3CD6A 2KY9A 2CS7A 3EG0A 3GF5A 2W0ZA 4C0ZA 2H3EB 3RESA 4LDVA 2BKDN 3UA7A 2QEXQ 4FM4B 3P8BB 1UHCA 2BZ8A 4M77C 2DIGA 2FEIA 3FJ5A 4Z89A 3VRYA 3OYAA 2GQVA 2CP0A 3TSZA 2JMAA 2KROA 1WI7A 3JCMc 2X4YA 3OB9A 3TU4K 4PJOF 1G8XA 1TXQA 2DYBA 1KQ2A 1I5LA 2DXUA 4ZN1A 4QQDA 5KYNA 3OYBA 2X35A 5FWCA 4J6WA 3JCMh 5GAN8 1FYNA 2MAMA 3LYIA 3G4SQ 4L5GA 2JVVA 1QP3A 4RTVA 4HVVA 4GBQA 2KEAA 4J7FA 2FPEA 2L2PA 2DL3A 2HBWA 3JB9H 1QCFA 4C8QB 1D0YA 2LQNA 4AFZC 3QYHB 4HVWA 4DA4A 4ATOA 4FIBA 1W2BP 4IIOA 1AD5A 1VQ6T 4FYXB 3EG9B 4QQ6A 1UGPB 1H641 4XK8E 5IH2A 4ELZC 1S72Q 1VQLQ 4PL6A 2RQUA 2V1RA 3I5SA 1AZGB 2RI3A 2AZVA 3QG1A 2LRQA 1R8OB 1JJ2A 3PIPA 5I11A 3X25B 3QZ9B 3CXCS 3CCVQ 2L3RA 3VS6A 4VUBA 3HSBA 1AHJB 2FVUA 3MJXA 3EFRA 3NHNA 3CCMQ 3PIOA 2MYSA 3UPUA 2O4XA 1Q82C 4XU2A 3L2QA 3OYNA 2LMJA 5IN1A 5I22A 4J7IA 4YTLA 4KULA 4E7IA 1K76A 2J6FA 2EJ9A 3A8LB 3OW2A 4IUVA 2ECZA 1QW1A 3I5RA 4XTZA 4HCZA 3M4GA 1Y7XA 3JCMe 3UWNA 1OU9A 4AMCA 3VUBA 4C8QG 2P84A 1VQOQ 4JLIA 3G71T 1YHQQ 1VQ8Q 4JRQA 4PJOE 3C4SA 3RMSA 4ME7A 3VS5A 1QVGP 2BUDA 1U3OA 1U8RA 1Y0MA 2KRNA 2JUFA 4JJNK 4LN2A 2HZYA 2KVQG 2XI9A 3AT1B 5A0DA 4GLKA 1VQ9Q 2PZ1A 1MV3A 3CCLT 5GAN7 4B9XA 3RUXA 3V8JA 2FZKB 5CQYA 2RQRA 1WDXA 3OYFA 5CKFA 1J3TA 2O01E 2LCCA 1D3BA 1B3QA 2RHYA 5HK0A 4OB2B 2LC4A 4CI0C 4HKEA 2EPDA 1EZZB 1X01A 1RAAB 3JCMd 2ZPIB 2VGMA 2CP2A 4XTWA 1TWBA 2EYWA 2QQSA 4PLLA 1VQNQ 4LXCA 2Z0WA 5KYUB 2DIQA 3CCEQ 1GFCA 2XDPA 4MZPA 4C92A 3META 2LX7A 3CCRQ 2E65A 1NLPC 1QKXA 3HFOA 3CCJQ 2JT4A 2K4YA 1U1SA 4LDUA 1RUWA 4OGCA 1TOVA 1RADB 9ATCB 1NPRA 4Z88A 2M16A 4M75B 1KHCA 2RHIA 2MF2A 1UGVA 2DL8A 2K5LA 2VASA 1WIEA 5LJ3f 2XU8A 1MNDA 2KXCA 3HL8A 2F2VA 2X9HA 4PJOD 4A4KA 1IGUA 5A2QE 2EYQA 1JJ2P 2NYSA 5EC7A 1ZUKA 4P5NA 2OX7A 5GAOl 2RN8A 1YJNA 1K73U 2R5AA 4NL3A 3OYYA 3EAEA 5GAN6 4WF2A 1TS9A 3PGGA 4E6RA 5CAIA 2OTLT 1Q86C 4A4GA 1VQLT 4F16A 1HK9A 1BYMA 1HSQA 2VVKA 2LQ8A 2DL5A 2GCXA 3CMAA 1JRIA 1MGQA 3H0FA 3OW2P 1WQ7A 2L5QA 4BI8B 4BDYA 3JCMX 2RPNA 3L2VA 1PD1A 2FPFA 4E7JA 1WFWA 4EDUA 1C1AA 1JO8A 1WXTA 3CC2A 4HT9A 3SDZA 4EMKA 2DJQA 4M75G 1VQKQ 1VA7A 2KI7A 5IHKA 2DXCA 4E7KA 1XQHA 2X4XA 4C0FA 1GL5A 4J83A 4Y28E 2PU9B 1VQ7T 3EG2A 1IO6A 3G6EA 4BY6C 3O5ZA 4M77A 1BIBA 1U1TA 2C0OA 5D6XA 3EGDA 3RR6A 1KQSP 1N9RA 4EPCA 1V76A 2EYYA 2CUBA 1X6OA 2X4JA 3EFOA 5LJ5h 1WPYA 3DLLA 3I55A 2DM1A 1SPKA 2A08A 2NWMA 5CK9A 5HY6A 1Q7YU 1M1KU 1QWEA 2FRWA 2OTLA 5CO7A 5I2MA 4F17A 1N27A 1VQ4A 3CCST 4ZN3A 4PFZA 4OP0A 4LD6A 2HQEA 1OZ2A 4M7DC 5GAMh 3MP1A 5GMKi 4CC2A 3OYIA 1SEMA 1W6XA 2F2WA 4C0GA 2DL7A 3VS3A 3P8DA 5LJ5j 4ZTFA 3CCRT 1T3LA 3Q1JA 2C06A 1QVFS 2M0OA 3CC4Q 2D9TA 3FRNA 1BU1A 3NTKA 1X6BA 3QSUA 3M53A 2KMTA 3CCUQ 1Q81C 2E12A 3A8MB 2K3YA 3DLMA 2HMAA 2K3XA 1ABQA 1YCSB 4XU1A 1WJQA 4E7HA 5LJ5e 1QWFA 3JSCA 5GAMj 2QK0A 3HRUA 3LWIA 1Z9ZA 1M9SA 5LJ3g 2AT1B 1N5ZA 1WHJA 2HKQB 4RG8A 1VIFA 2VYTA 1I07A 1HJDA 1AWWA 3I56A 2O31A 5D7UA 3CC7T 1QCNA 4LD9K 4FU6A 2OTJT 5GAMe 2QQAA 1TSFA 2L3QA 1AT1B 1OX8A 1RAEB 4Z02A 4OB3B 3VS2A 2RMOA 4JJCA 2KQWA 4IUPA 3M57A 2K9GA 2IG0A 4RKUE 3OMGA 2EGEA 1NJIU 2RQVA 2K79A 1PSFA 3VUZA 2P4RA 4MDXA 4BB7A 5LJ5d 2H8HA 2RK1A 4CC3A 1W2BS 3ER0A 1VQ6Q 3M0RA 1VIEA 1MV0B 1K73R 1N6AA 2F5KA 4M78B 1Y96A 5GAN4 1FMWA 3PFSA 2NUTB 4HCKA 2QAZA 1WA7A 1YBYA 3VS4A 1RLQC 2EBPA 1UJ0A 2DO3A 4OB1B 4C92F 1LJOA 1OPKA 4AFSC 3CD6T 2DEQA 2Y4YA 2EKOA 1IGQA 1SRMA 4UC4A 4J9FA 1K8AC 1T0HA 4L6V5 5GAMd 2SEMA 1B34B 4DBFA 4JRKA 3RERA 1M2VA 3CBPA 4M7DG 1K0XA 2ED1A 2FPDA 1ZHIA 4FSXA 2GGRA 1YN8A 2GTOA 3QYGB 2OTJA 3JCMW 3LH0A 1WZOA 4RCCA 2DEUA 2Y90A 2LQKA 1BI3A 2O9SA 3VYGA 1QKWA 3MEWA 1T0JA 3G71Q 5FRNA 3S3MA 1GCQC 2PVGB 1RLPC 3THKA 4MZMA 2BE9B 4M78G 5FLXE 1N8RC 1QVGS 3JCMb 1OV3A 2EFIA 1M2OA 3QWXX 4C8QC 5GANh 1FMVA 4MMKA 2DD5A 3EGXB 2M0YA 3PTAA 2HQXA 2JMCA 2EW3A 3CCQA 1YIJT 1Q7YR 2A37A 2KAFA 2YRDA 1M1KR 3CCLQ 2WSFE 1YJNQ 4AG2C 4EMHA 3VJPA 4F7UA 1VQ5A 3IQLA 4DOVA 1M90U 2JTEA 2EWNA 3QWYA 2VGNA 2DETA 4RUGA 2PVDB 5KE3A 4JS4A 3LGFA 3NTHA 2CYZB 4RTYA 3SD4A 1ZSZB 2E6NA 4KGVB 4ZGJB 2LJ1A 4II1A 5CVIA 2KYBA 4M77F 4JUVA 2HL3A 4HT8A 2PUKB 4IUQA 4C92E 5GANj 1M1FA 2CH4A 2RQTA 3QDFA 5KYYB 4IKFA 3OS5A 4J9EA 4JPBW 3REAB 5CCAA 1UEBA 2IIMA 3JCMP 1PG5B 3UA6A 2G6FX 3EFSA 2HCKA 4OMLA 1KG1A 1YI2A 2XG8D 1AZEA 2FB7A 3CMEA 3UT1A 3RNJA 1KD1U 3PE0A 2J05A 2P0KA 2DMOA 2MPXC 5GANe 1ZQ1A 3QKJA 2Y4XA 5I21A 2XICA 4X1VA 1KC8U 3L42A 1YIJA 1N9SA 1JJ2S 1OOTA 3GNGA 3T9NA 2LNVA 1Q95G 8AT1B 3X26B 3L2UA 4M7AE 2CZ0B 2OTLQ 2EQIA 1KK7A 2V26A 2L3SA 1NPPA 1I4K1 3NMZC 4RMOA 1SKUB 4F04B 1RAFB 2CH4W 4C0DB 5FU7B 5IXBA 2J6KA 1WLPB 3OW2S 2DXBA 1TTHB 1ZBJA 2EJFA 1FXXA 4BE0A 1IB8A 4DQ2A 1U06A 4AFUC 2YUQA 1YITT 1RAIB 3MP8A 4GY5A 3OSVA 4C92D 1UB4A 3EG3A 3JB9J 1UGRB 1FWZA 4LDYA 3VS7A 1NJIR 1TUCA 5GANd 2XMFA 2RJCA 1JXMA 3DKMA 2KDSA 3G7ZA 1VQ7Q 1BCOA 4M77E 4M75C 2QA4A 3V8KA 4ESRA 1KQSS 1NYGA 2VWFA 4JRIA 2AK5A 1GBRA 1WGSA 2SRCA 4PJOB 1JU5C 5CKHA 1MHNA 3INZA 2RHXA 1BK2A 1UFFA 3HRSA 1WXBA 5FWBA 1RAGB 4BUGA 1BCMA 5J26A 2A3LA 1I8FA 1YJNT 4R56A 4M7AD 2F2XA 2LX9A 3CCSQ 2WSCE 3S3OA 1BI2A 5GJVB 2MK5A 3CEYA 3ZBDA 3CMAT 4IURA 5FROA 5M9OA 1AWOA 4A54A 5FRMA 2MCNA 3GPLA 2E64A 1YITA 2XK0A 1M4ZA 2QQ9A 3FEOA 2XDBA 4N4HA 4LDWA 3JCMQ 3CC2T 2F1LA 3H0IA 1PM3A 1G3YA 2RF0A 2CP3A 1OI1A 4PJOG 3KUFA 1JBMA 1EFNA 1VQPT 2HBPA 4RTWA 3MHXA 5CKBA 1YWPA 2LVMA 4ANJA 2J7IA 3G6ET 4M77D 2CKKA 2MI6A 4FSSA 3QPHA 3MPUB 1M90R 1NLOC 3M0QA 1UECA 1M3BA 1S1NA 3RIRA 2BTTA 1RI0A 3M0PA 4N4GA 3URGA 4CC4B 3AHUA 1OULA 2MWOA 4FT2A 3M9QA 3I55T 4E2FB 3BFMA 4PFOA 2LCSA 2V8KA 5IAYA 1K9AA 1YJWA 2QTXA 2RB6A 2CZ6B 2COYA 1GCQA 2E70A 2LJ0A 4M7AA 1OPLA 4X9CA 4FT4A 3CC7Q 2YLBA 1NM7A 1CKBA 2QDYB 4A4EA 3REBB 4C5IA 4OF1A 1VQ4T 2CP5A 1IREB 2LP5A 4C8QA 5A0LA 1V29B 4E47A 2OTJQ 2A28A 2ESWA 1IHWA 3MO8A 5L8RE 3QXEB 1UDLA 2H3JA 3EG9A 1X27A 1ZX6A 3SWNA 1WHLA 1X2QA 2JW4A 4WCIA 1F1BB 4F7UF 2DNUA 1KD1R 3JCMV 4N0AC 1NG2A 2EKHA 2GQIA 5KYWB 2ZPHB 4XQ3A 3OS2A 2YT6A 2LNHB 1Q82U 5GAOm 1ZA1B 1KC8R 3L2RA 4DOWA 1UJYA 2OI3A 3OYCA 3CCQQ 2JS2A 1VQPA 2C0TA 5AYFA 2DX1A 3JB9I 1D1CA 3A5ZB 3NGPA 1UGQB 2ZPBB 1VQMA 2DD4A 2QASA 4D8KA 3QBYA 5L23A 1ZBXA 2K3BA 2ED0A 1PRLC 2D6FA 3ZEHA 2ROLA 2E5KA 3OYJA 3CD6Q 1AWJA 4DEXA 3QIIA 3HKSA 2LTOA 5AT1B 3QO3A 4BE2A 4OB0B 1Y07A 2O9VA 4PJLA 3RMQA 2HNIA 2AIRB 5GMKh 1C0MA 3BE3A 3BDLA 3I56T 2ZCFB 2P4TA 3JCMf 5A0GA 4D8DA 1AEYA 4FCYA 1H3ZA 5GAN5 3OBWA
chains in the Genus database with same CATH topology
2CZ7B 3OQ5A 2B8AA 3CD6T 2DEQA 2RM4A 2Y4YA 4J7FA 2EKOA 4PNOA 3GP8A 1KQ1A 5IT9E 1S72A 1M8VA 1VQMT 2XIDA 3JB9H 4C8QB 4UC4A 2RI5A 1K8AC 4L6V5 5GAMd 3QYHB 5CIUA 4J8OA 1B34B 3TEEA 5KCHA 4DA4A 3BW1A 4FIBA 3V7RA 4JRKA 2P0QA 3M56A 3RERA 3CBPA 4ATOA 4KUIA 1VQ6T 3F70A 5GMKl 4QQ6A 1KHIA 1UGPB 3CCVA 1YJ9T 1H641 4XK8E 4M7DG 3OS1A 4ELZC 5LJ5g 3JAME 1WJRA 4ELYC 2NLUA 3JB9F 5LL6S 2G3RA 3G71A 3QUIA 4PL6A 2OAUA 2WACA 4M75E 3CCMA 1ZHIA 4FSXA 2RJDA 3NTIA 4D6WA 2RI3A 3G4ST 3GLXA 3QG1A 3QYGB 2OTJA 3JCMW 2LRQA 2MWPA 1R8OB 4M78C 3LH0A 4BD3A 5GMKj 3PIPA 1JJ2A 5GAN3 4LDXA 3X25B 4RCCA 3QZ9B 3CXCS 4F7UE 2L3RA 2LQKA 2Y90A 4VUBA 1BI3A 4A53A 2V8IA 3VYGA 3HSBA 1AHJB 2FVUA 3MEWA 2K5FA 5FRNA 3EFRA 4N4IA 3S3MA 3PIOA 3UPUA 2LDMA 2O4XA 1Y71A 1Q82C 4XU2A 2PVGB 3LGLA 2ZZDA 3L2QA 3M59A 3M5AA 4C5HA 2IVWA 4MZMA 5DM7R 3OYNA 3KXTA 1N8RC 4M78G 2GF7A 5FLXE 1QVGS 3JCMb 2EFIA 5IN1A 2XDDA 2K2VA 4C8QC 4J7IA 4HA8A 4YTLA 5GANh 1OZ3A 3A8HB 4PLIA 2I2LA 4KULA 5GAMg 4E7IA 5DLQE 4MMKA 2DD5A 1GXIE 2DAQA 1UGSB 3M55A 1VQOA 2EJ9A 5GANf 1S72T 3PT9A 3A8LB 3PTAA 2HQXA 3OW2A 2VXEA 4IUVA 5GMKe 1BI0A 3CCQA 1YIJT 4M75A 1QW1A 2KAFA 1YHQA 2RA2A 2LT1A 2MMPA 2RO0A 4XU0A 4HCZA 4XTZA 3M4GA 2WSFE 4HCCA 1Y7XA 1XNIA 3JCMe 2M1HA 3UWNA 4TVRA 3CCVT 3VUBA 2HAXA 3OYGA 4EMHA 2VXFA 3VJPA 4F7UA 4C8QG 4BACA 2JTFA 1VQ5A 2QEXA 2EQUA 4JLIA 3G71T 1WJSA 4DOVA 1M90U 3CCMT 2EWNA 3PNWC 4JRQA 2PVOB 1VQ9A 3OYLA 2VGNA 1Q86U 1Y96B 1NJIC 2PVDB 2JNGA 5KE3A 3C4SA 3RMSA 1W4SA 4ME7A 4PJOE 2BUDA 4JS4A 4XTUA 3LGFA 3DB4A 3NTHA 1U8RA 2CYZB 2JUFA 4JJNK 1OYXA 2R5MA 3SD4A 3SFMA 3QHSA 1BKBA 2E6NA 2KVQG 2DTIA 2XI9A 4ZGJB 5A0DA 4GLKA 4II1A 5CVIA 4JLGA 3JB9J 3L2WA 4HT8A 4M77F 4JUVA 2PUKB 4IUQA 1YJ9A 3CCLT 2CGHA 5GAN7 4C92E 4B9XA 3RUXA 5GANj 4L59A 3V8JA 1M1FA 5CQYA 5DLOA 2AHJB 3BDUA 3E9FA 4IUUA 3LLRA 2X4WA 4BI3A 3G4SA 3OS5A 4IKFA 4M7DE 3OYFA 1VQOT 1NE8A 5CKFA 4M75D 1IZ6A 2O01E 1XTDA 5CCAA 1UEBA 3CCQT 3JCMP 4OGEA 2PQWA 1YHQT 1G3SA 1VQ8T 2LCCA 3PMIA 4FL6A 1D3BA 2K57A 1VQNA 2RHYA 3EFSA 3HPWA 4PJOA 5HK0A 3C12A 1LNXA 4OB2B 2LC4A 4CI0C 3J80E 1KG1A 4HKEA 3X28B 1QVPA 4NL3A 1YI2A 2XG8D 2FB7A 1VQ5T 3CMEA 3MCAB 4XTXA 4BE1A 1X01A 3O8VA 2DTHA 3UT1A 3JCMd 2ZPIB 1VQ9T 2VGMA 1KD1U 2XKOC 1I81A 2OTLT 4XTWA 2P0KA 4O6JA 5J39A 5GANe 2RHZA 1ZQ1A 2QQSA 4NL2A 4PLLA 3QKJA 5GAOn 4M7DF 2DIQA 2Y4XA 3QDRB 4MZPA 2XDPA 5I21A 1VQLA 2K5IA 4C92A 2RI2A 3E9GA 3META 1FX7A 2O4XB 2XICA 4C5EA 5KE2A 3OY9A 3L42A 1YIJA 1KC8U 1N9SA 2E65A 1JJ2S 2DZ9A 3GIBA 5C0MA 2L8DA 3GNGA 3T9NA 5CR2A 2LNVA 3HFOA 1K9MU 3A8GB 2ZPGB 4J5YA 4BDZA 3CCLA 2K4YA 3X26B 3L2UA 4M7AE 1PSEA 1U1SA 4LDUA 2CZ0B 5I2SA 4OGCA 3VV0A 4XTVA 2XD0A 2V8JA 4PKCC 3H8ZA 1NPRA 3M58A 1M1GA 4V2SA 2M16A 4M75B 5LJ3h 1KHCA 2RHIA 1NPPA 1I4K1 3HHTB 2VC8A 2MF2A 4RMOA 4ZGEB 5GAN2 2K5LA 5LJ3f 2XU8A 2ZPFB 3S3NA 4M78F 3HL8A 4C0DB 4MMLA 4F7UB 5FU7B 4PJOD 4R55A 4A4KA 2EAYA 3OYDA 3OMCA 1VQNT 3OW2S 2DXBA 2RJFA 5A2QE 2EQJA 3CCET 3QZ5B 2RJEA 3JCMg 2EYQA 2F5TX 1YI2T 3JRZA 2EJFA 3QJ6A 4RG2A 3CMET 1FXXA 4P5NA 3HFNA 1O75A 4BE0A 4M7AF 2DK3A 2RK2A 4DQ2A 5GAOl 3CCJT 2KSSA 1VQ7A 2F69A 1YITT 1YJNA 1M90C 3LW5E 2R5AA 1K73U 1QP2A 4XTYA 3OYYA 3EAEA 3MP8A 4GY5A 4WF2A 3OSVA 3PGGA 4C92D 3VU3C 1UB4A 4C8QF 5CAIA 2A7YA 3OA6A 5GAOp 4A4GA 3VKIA 3VYHB 1UGRB 5C6SA 1FWZA 4LDYA 1Q86C 1VQLT 1TH7A 1HK9A 4BY6B 5GMKm 1BYMA 3CPFA 4Q5WA 1VQ8A 4QVCA 5GANd 3ZFJA 2LQ8A 2RJCA 5J3BA 3DKMA 2KDSA 3G7ZA 2EIFA 2GCXA 3CMAA 3HP9A 1QVFA 2GFAA 3C95A 1SSFA 4M77E 1JRIA 1MGQA 4M75C 2QA4A 3CPWA 3V8KA 1WQ7A 2L5QA 4XU3A 1VQKA 4BI4A 4J6YA 5LJ3j 4BI8B 4N0AA 3LX7A 1KQSS 5HKCA 4BDYA 2ZPEB 1G3WA 4C0DC 2M9UA 5FU7C 3JCMX 1D3BB 3JB9D 4JRIA 3L2VA 4E7JA 4QVDA 1WGSA 4PJOB 1Q81U 2PUOB 2LT4A 4NS5A 5CKHA 4EDUA 1MHNA 3INZA 3FB9A 2KK4A 4MDWA 3CC2A 4HT9A 3SDZA 4EMKA 2RHXA 4M75G 2L89A 2LCLA 3CCSA 3HRSA 2GFUA 2DXCA 2WSEE 4BUGA 4E7KA 5J26A 2JTMA 2A3LA 3OSSC 1XQHA 2X4XA 3QJYA 4C0FA 4F7UG 1I8FA 2DJZA 4J83A 4Y28E 2PU9B 1VQ7T 4C92B 4A4FA 1YJNT 3NFCA 4R56A 3G6EA 4M7AD 4BY6C 2VUBA 2LX9A 5GANg 1KD1C 5LJ3e 4M77A 2E1HA 3GOXA 1BIBA 1U1TA 5D6XA 2WSCE 4M7DB 2JOYA 3S3OA 3P8HA 2EJGA 1BI2A 1N9RA 3BY7A 4EPCA 3S6WA 5DY9A 5CQXA 3V7SA 1KC8C 3J7AF 1X6OA 2X4JA 3CEYA 3ZBDA 3CMAT 4KUDK 3CCEA 1XOVA 3GNFB 2D0QB 4IURA 5FROA 5LJ5h 1WPYA 4OMFB 2QA4T 4A4HA 4JS5A 5M9OA 3DLLA 4A54A 5FRMA 3I55A 4JDSA 3CCRA 3L2ZA 5LJ5f 3FC3A 3GPLA 1VQKT 3PMTA 3TREA 4PJOC 1BI1A 2E64A 5CK9A 3CCJA 2ZGWA 5HY6A 1Q7YU 1YITA 4Y91A 1M1KU 2XK0A 1M4ZA 2QQ9A 3FEOA 2XDBA 1LOJA 4N4HA 4OVAA 3C94A 4LDWA 2HD0A 5D6WA 2OTLA 1O9SA 5CO7A 3JCMQ 4CRIA 5I2MA 4M78E 3CC2T 1N27A 4XAXB 1VQ4A 1G3YA 3CCST 2DTOA 4ZN3A 3JCMJ 4M7DA 4OP0A 4LD6A 2HQEA 1EIFA 4C92C 1OI1A 4PJOG 3KUFA 3FLGA 2FL7A 3MEUA 1JBMA 4EMGA 1VQPT 2HBPA 2QI2A 3H6ZA 1OZ2A 3MHXA 1JB0E 5CKBA 5D6YA 4M7AB 4M7DC 2LVMA 5GAMh 1W2BA 3MP1A 5GMKi 3G6ET 4M77D 2CKKA 2MI6A 3OYIA 2QXFA 3QPHA 5GAOr 3L1AA 3KBGA 2JZ2A 5GAMf 1K73C 4C0GA 4C8QE 4MZTA 1DJ7B 2RHUA 1WQWA 2JN0A 3CBMA 5FU6B 3CC4A 1G5VA 4RCBA 3RIRA 4C92G 1RI0A 5LJ3d 3TCJA 5EG2A 1X75C 4N4GA 3URGA 3P8DA 1P92A 5LJ5j 1VUBA 3AHUA 3MP6A 4FT2A 2MWOA 2QQRA 4QVZA 3M9QA 3OYEA 3CC7A 4M78A 2E5QA 3CCUA 4ZTFA 3I55T 3SWNB 3CCRT 3BFMA 3Q1JA 1YCYA 2C06A 2BIVA 2V8KA 1NZ9A 2YHTA 1QVFS 2M0OA 3MEAA 2DPPB 5IAYA 1YJWA 2D9TA 3FRNA 3CPWS 4QW2A 2QTXA 3NTKA 5HK3A 4EMKB 2RB6A 2DXTA 2CZ6B 2E70A 1K8AU 3QSUA 4X9CA 4M7AA 3M53A 2KMTA 4FT4A 2YLBA 3OYKA 2QDYB 1Q81C 2E12A 4A4EA 3A8MB 3JB9G 4C5IA 4OF1A 3ME9A 3J81E 4ZTJA 1VQ4T 4M7DD 2K3YA 3DLMA 3FIFA 1IREB 2K3XA 1G3TA 4M7AC 4E7LA 4C8QA 5A0LA 5KH6A 1V29B 4XU1A 3M4YA 4E47A 1WJQA 2FYKA 3HRTA 1M5Q1 4X9DA 2EQMA 3V7CA 5GAN6 5LJ5e 4E7HA 1B34A 3MO8A 4M77B 3JSCA 3QXEB 5L8RE 5GAMj 3OS0A 2EQKA 2H3JA 4M75F 5KCOA 5CKEA 1WNLA 3LWHA 3HRUA 3CXCA 3LWIA 5FU6C 3WVEB 4X34A 1M9SA 3R6OA 5CKDA 5LJ3g 2FHDA 3DB3A 3SWNA 3FDRA 2R57A 3X24B 4RG8A 4F7UF 1VIFA 2VYTA 4M7AG 3JCMV 3X20B 3CC4T 3RKYA 3A8OB 3FJPA 4N0AC 4C5GA 3RKXA 2E6ZA 2E41A 4HCBA 3I56A 2RH2A 2ZPHB 4XQ3A 3SWNC 3SB2A 3OS2A 2YLCA 2DKGA 1Q82U 5GAOm 4M78D 1QVGA 3CC7T 2CZ1B 4B9WA 3E19A 4J6XA 4DOWA 3L2RA 3CCUT 1N8RU 2R58A 5GAOq 4EMKC 2P0PA 2VV5A 4LD9K 3OYCA 1VQPA 3ASKA 2E10A 4FU6A 3MEVA 1BIAA 1YJWT 2OTJT 5AYFA 5GAMe 2QQAA 3WVDB 3JB9I 2KY9A 3CD6A 1Q7YC 2CS7A 3A5ZB 3GF5A 1M1KC 1UGQB 2ZPBB 4C0ZA 3WXMB 1VQMA 2DD4A 3E1SA 1RL2A 3QBYA 3RESA 4LDVA 2BKDN 4Z02A 4JRPA 4FM4B 3P8BB 4OB3B 3RKWA 4O5VA 3UDCA 1ZBXA 4C8QD 2D6FA 2KQWA 3N5BB 2DIGA 4IUPA 4M77C 4NOYA 3M57A 3ZEHA 2GQVA 3OYAA 1VQ6A 3OYJA 2YRVA 1KQSA 1K9MC 3QIIA 2DZCA 1HXDA 3HKSA 4KBMB 2IG0A 3JCMc 4KT0E 4RKUE 2LTOA 3OMGA 2X4YA 3OB9A 3QO3A 1NJIU 3TU4K 1PSFA 3VUZA 3OBYA 4BE2A 4OB0B 4BB7A 5LJ5d 4MDXA 4PJOF 1Y07A 3RMQA 2HNIA 4IUTA 2RK1A 5GMKh 1W2BS 2QQBA 3ER0A 4M77G 1VIEA 1I5LA 1KQ2A 3BDLA 2DXUA 4ZN1A 4QQDA 3OYBA 1N6AA 2F5KA 3V8LA 4QQGA 4M78B 1Y96A 2X35A 5GAN4 3OYHA 3I56T 2DVEA 2ZCFB 4J6WA 3JCMh 2RD1A 3PFSA 5GAN8 3OYMA 2MAMA 3LYIA 2XHCA 1YBYA 2P4TA 4L5GA 4ZGDB 3JCMf 2QEXT 5A0GA 2JVVA 2DO3A 4OB1B 3M54A 4C92F 1LJOA 1QP3A 3CBOA 1H3ZA 5GAN5 3OBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BDU A;  2QTX A;  2DEQ A;  2RM4 A;  4EMK B;  2RB6 A;  1D3B B;  2DXT A;  3JCM X;  4JRI A;  3JB9 D;  4PNO A;  4QVD A;  1M8V A;  1KQ1 A;  4M75 D;  3QSU A;  4M7A A;  4X9C A;  3JB9 H;  4PJO B;  4C8Q B;  2YLB A;  3JCM P;  5GAO r;  5GAM d;  3INZ A;  3FB9 A;  4HT9 A;  3JB9 G;  4EMK A;  4M7D D;  1D3B A;  1B34 B;  4M75 G;  3BW1 A;  2K57 A;  3FIF A;  4JRK A;  3V7R A;  3RER A;  3EFS A;  4M7A C;  4PJO A;  4C8Q A;  1LNX A;  4XU1 A;  5GMK l;  4NL3 A;  2FYK A;  1H64 1;  4X9D A;  1M5Q 1;  4M7D G;  3V7C A;  2FB7 A;  5LJ5 e;  5LJ5 g;  1B34 A;  4M77 B;  4XTX A;  1X01 A;  4F7U G;  5GAM j;  1I8F A;  2DTH A;  3JB9 F;  2DJZ A;  3QUI A;  4M75 F;  4M75 E;  1WNL A;  3JCM d;  4C92 B;  1I81 A;  4M7A D;  4XTW A;  3JCM W;  5GAO n;  5GAN e;  5GMK j;  5GAN g;  4M78 C;  4M77 A;  4NL2 A;  2E1H A;  5LJ3 e;  5LJ3 g;  1BIB A;  1U1T A;  3SWN A;  4M7D F;  5GAN 3;  5I21 A;  4M7D B;  4RCC A;  4F7U F;  4C92 A;  5GAN j;  4F7U E;  2EJG A;  2Y90 A;  3JCM V;  3BY7 A;  1N9R A;  3RKY A;  4M7A G;  3FJP A;  4N0A C;  4A53 A;  3RKX A;  1N9S A;  2E65 A;  2E41 A;  2DZ9 A;  3GIB A;  3HSB A;  5DY9 A;  3V7S A;  3EFR A;  4XQ3 A;  3SWN C;  3SB2 A;  2YLC A;  2DKG A;  3HFO A;  5GAO m;  4M78 D;  5LJ5 h;  1WPY A;  4J5Y A;  4XU2 A;  4J6X A;  4A54 A;  4M7A E;  1U1S A;  5GAO q;  4EMK C;  3L2Z A;  4M78 G;  4XTV A;  5LJ5 f;  3JCM b;  2E10 A;  4PJO C;  2E64 A;  1BIA A;  4C8Q C;  4V2S A;  4HA8 A;  2ZGW A;  4M75 B;  5GAM e;  5LJ3 h;  4Y91 A;  2I2L A;  5GAM g;  5GAN h;  3JB9 I;  4MMK A;  1I4K 1;  1LOJ A;  2VC8 A;  2EJ9 A;  5GAN f;  5GAN 2;  5LJ3 f;  2VXE A;  3JCM Q;  4M78 F;  5GMK e;  4M78 E;  4M75 A;  3RES A;  4MML A;  2RA2 A;  3RKW A;  4F7U B;  4PJO D;  4XU0 A;  2EAY A;  4XTZ A;  4C8Q D;  3M4G A;  4M77 C;  4NOY A;  2DTO A;  3JCM J;  4M7D A;  3JCM e;  3JCM g;  4OP0 A;  4C92 C;  4PJO G;  4EMH A;  2EJF A;  2VXF A;  4F7U A;  4C8Q G;  4M7D E;  1JBM A;  4M7A F;  3HFN A;  2DZC A;  4EMG A;  1HXD A;  4JLI A;  4PJO E;  4M7A B;  4DQ2 A;  3JCM c;  5GAO l;  4M7D C;  2EWN A;  5GAM h;  5GMK i;  3QO3 A;  4M77 D;  4XTY A;  5LJ5 d;  5GAN 6;  1Y96 B;  4PJO F;  3L1A A;  4WF2 A;  3PGG A;  4C92 D;  3VU3 C;  4C8Q F;  5GAM f;  2HNI A;  4C8Q E;  5CAI A;  5GAO p;  3JB9 J;  5GMK h;  4XTU A;  1WQW A;  2JN0 A;  4M77 G;  1TH7 A;  1HK9 A;  1I5L A;  1KQ2 A;  2DXU A;  5GMK m;  4RCB A;  3RIR A;  3V8L A;  4C92 G;  3QHS A;  1Y96 A;  4M78 B;  4QVC A;  5GAN d;  5LJ3 d;  2DTI A;  5GAN 4;  2DVE A;  4J6W A;  3JCM h;  2RD1 A;  5GAN 8;  5LJ5 j;  3AHU A;  4HT8 A;  4M77 F;  4JUV A;  3JCM f;  4M77 E;  1JRI A;  1MGQ A;  4M75 C;  4M78 A;  3SWN B;  2CGH A;  3V8K A;  3BFM A;  1YCY A;  4C92 F;  1LJO A;  4C92 E;  1WQ7 A;  5GAN 7;  4XU3 A;  3RUX A;  2YHT A;  4J6Y A;  3V8J A;  5LJ3 j;  5GAN 5;  4N0A A; 
#chains in the Genus database with same CATH topology
 2A0F B;  2RM4 A;  4LNP A;  4PNO A;  1M8V A;  1S72 A;  2XID A;  2IPO B;  5CIU A;  4J8O A;  3TEE A;  3BW1 A;  3V7R A;  3F70 A;  5GMK l;  3CCV A;  1LVK A;  4JZ3 A;  1OX9 A;  1YJ9 T;  3G1J A;  3TQ7 P;  1ZUY A;  1WJR A;  4ELY C;  3JB9 F;  2CDT A;  3QUI A;  1JQQ A;  2WAC A;  2M02 A;  3CCM A;  1YIJ Q;  2YDL A;  4D6W A;  2COZ A;  4J9D A;  3GLX A;  1VYU A;  2MWP A;  5GMK j;  4M78 C;  2JXB A;  3C0C A;  4F7U E;  1W1F A;  2V8I A;  2KT1 A;  4N4I A;  5KYU A;  7AT1 B;  2KE9 A;  5FW9 A;  1I0C A;  2QDL A;  3M59 A;  3M5A A;  4C5H A;  2IVW A;  3E2U A;  5DM7 R;  3KXT A;  2DRM A;  1YFN A;  2K2V A;  2LQW A;  4HA8 A;  3A8H B;  2I2L A;  2QG9 B;  5DLQ E;  2D8J A;  2DAQ A;  3VRZ A;  3M55 A;  1VQO A;  4DBR A;  5GMK e;  1BI0 A;  4M75 A;  1YHQ A;  4IIM A;  4E7Z A;  2RA2 A;  2MMP A;  2RO0 A;  4HCC A;  2FG0 A;  3SHW A;  1XNI A;  1SHF A;  2M1H A;  2HAX A;  1D0Z A;  3RDV A;  3OYG A;  2VXF A;  3EG1 A;  2ROT A;  2EQU A;  1HD3 A;  3EH2 A;  2YUP A;  3PNW C;  1VQ9 A;  3OYL A;  4OMQ A;  1Q86 U;  1MMA A;  2DFU A;  4XTU A;  2OJ2 A;  3DB4 A;  3SFM A;  2D1X A;  3QHS A;  1ZLM A;  4JLG A;  3L2W A;  1E6G A;  1YJ9 A;  1A0N B;  4L59 A;  2CP7 A;  4FYV B;  4Z8A A;  4J9B A;  3E9F A;  4IUU A;  4M7D E;  2CP6 A;  1NBE B;  4OMP A;  3PVQ A;  3CCQ T;  2YSQ A;  2PQW A;  1B7T A;  1QQJ A;  3PMI A;  4FL6 A;  1PD0 A;  1VQN A;  3HPW A;  3C12 A;  3TSW A;  1UG1 A;  1M27 C;  4OMO A;  4J9G A;  1VQ5 T;  4BE1 A;  1AWX A;  2DTH A;  1PWT A;  4O6J A;  1KJW A;  5J39 A;  5GAO n;  4NL2 A;  1ZSZ C;  2K6D A;  4EIK A;  3KFV A;  1NEG A;  2K5I A;  4C5E A;  2RQW A;  2O4X B;  4KGX B;  2DZ9 A;  5C0M A;  2L8D A;  5CR2 A;  3A8G B;  1YIT Q;  2ZPG B;  4BDZ A;  1PSE A;  5I2S A;  4KRT A;  3VV0 A;  4XTV A;  1Q82 R;  3M58 A;  1M1G A;  1PC0 A;  4V2S A;  3H9N A;  3LH5 A;  5LJ3 h;  4M4Z A;  3UAT A;  4OMN A;  1RI9 A;  2PNI A;  1T3S A;  5GAN 2;  3U23 A;  2ZPF B;  2J6O A;  1VYT A;  1SSH A;  4MML A;  1WHK A;  4R55 A;  2EAY A;  2RJF A;  3JCM g;  4RTX A;  1CKA A;  2F5T X;  1YI2 T;  1OQK A;  3CME T;  4M7A F;  3HFN A;  1O75 A;  4LUD A;  2DK3 A;  2RK2 A;  2KSS A;  2HL5 C;  3LW5 E;  1QP2 A;  2DBM A;  5IXF A;  1D1B A;  4C8Q F;  3OA6 A;  5GAO p;  1TH7 A;  2QYZ A;  4Q5W A;  5IHI A;  1WXU A;  4QVC A;  3ZFJ A;  1I1J A;  4HVU A;  5J3B A;  2CT4 A;  5GJW B;  3C95 A;  3CPW A;  1R0C B;  1H3H A;  1VQK A;  5LJ3 j;  2KGT A;  4N0A A;  2CSQ A;  3LX7 A;  5HKC A;  2ZPE B;  4C0D C;  2M9U A;  5FU7 C;  1D3B B;  1W70 A;  3JB9 D;  1QCO A;  3CMA Q;  1Q81 U;  1MMG A;  4NS5 A;  4MDW A;  2DBK A;  2PTK A;  1I5O B;  2GFU A;  2WSE E;  3PVL A;  3OSS C;  4FW1 A;  2KR3 A;  2GBQ A;  4C92 B;  4A4F A;  3CC2 Q;  3NFC A;  4F14 A;  5LJ3 e;  3P8H A;  2HSP A;  2EJG A;  2J06 A;  4DEY A;  1VQP Q;  1KSW A;  5CQX A;  3J7A F;  4FW2 A;  1ACM B;  4KUD K;  3G6E Q;  4JS5 A;  4OMF B;  2QA4 T;  4A4H A;  2RNA A;  2B86 A;  1VQM Q;  3L2Z A;  5LJ5 f;  1XJW B;  3PMT A;  3TRE A;  4PJO C;  2ZGW A;  4Y91 A;  3C94 A;  2HD0 A;  3SEM A;  1PRM C;  4LE9 A;  3I55 Q;  2FZC B;  4XAX B;  1EX4 A;  1R77 A;  4HXJ A;  4Y92 A;  4M7D A;  1JEG A;  1EIF A;  2LZ6 B;  4JZ4 A;  3FLG A;  1IHV A;  3H6Z A;  4M7A B;  1H8K A;  2VB6 A;  2DL4 A;  2D0N A;  3EHR A;  1VQ4 Q;  1RAC B;  4ZNX A;  3KBG A;  5GAM f;  1K73 C;  4C8Q E;  4MZT A;  2DER A;  2RHU A;  1WQW A;  2JN0 A;  2EGC A;  5FU6 B;  3CC4 A;  4RCB A;  4PJN A;  2K7A A;  1Q86 R;  4C92 G;  5LJ3 d;  4DBH A;  2AKL A;  1X75 C;  1VUB A;  2JJ9 A;  3MP6 A;  3OYE A;  2MOX A;  2E5Q A;  4M78 A;  3CCU A;  1ZA2 B;  3SWN B;  1U5S A;  1YCY A;  2BIV A;  1H92 A;  2NUT A;  2YHT A;  4KGZ B;  3MEA A;  2L3P A;  4QW2 A;  5HK3 A;  1PHT A;  4EMK B;  1B07 A;  1K8A U;  2E4H A;  4PJM A;  3OYK A;  4A63 B;  3ME9 A;  4ZTJ A;  1G3T A;  4AFQ C;  3M4Y A;  4J9H A;  2FYK A;  4X9D A;  1M5Q 1;  2EQM A;  1B34 A;  4M77 B;  5KYX A;  2EQK A;  2KNB B;  4M75 F;  1UE9 A;  1WNL A;  3EGD B;  1TUG B;  3CXC A;  3WVE B;  3EH1 A;  5CKD A;  3R6O A;  2R57 A;  3X24 B;  3EFO B;  4M7A G;  3X20 B;  3RKY A;  3MKD A;  3A8O B;  3FJP A;  3CPW P;  3RKX A;  2E6Z A;  2RH2 A;  3SB2 A;  2YLC A;  2YUN A;  2NUP A;  1WHM A;  1MMD A;  2CZ1 B;  4B9W A;  4PFP A;  1N8R U;  2R58 A;  3ASK A;  3MEV A;  1BIA A;  3HTR A;  1YJW T;  1OEB A;  3WVD B;  3I56 Q;  2KT8 A;  1Q7Y C;  1M1K C;  3WXM B;  3E1S A;  1RL2 A;  3ZL7 C;  4JRP A;  1KIK A;  3RKW A;  4O5V A;  3UDC A;  3EGX A;  4C8Q D;  2E3H A;  3R6N A;  3N5B B;  4NOY A;  2DF6 A;  1VQ6 A;  2YRV A;  1G83 A;  1KQS A;  1K9M C;  2DYI A;  1NYF A;  2DZC A;  1HXD A;  4KBM B;  4RTU A;  5HCK A;  2BZX A;  4KT0 E;  3OBY A;  4IUT A;  2QQB A;  1M30 A;  2KRM A;  4M77 G;  1YJ9 Q;  3V8L A;  4QQG A;  1M3C A;  3ULR B;  4DBQ A;  3OYH A;  2DVE A;  2RD1 A;  3OYM A;  4PK4 A;  3UF4 A;  2CT3 A;  2XHC A;  2EVR A;  4ZGD B;  2QEX T;  1G2B A;  1ZSZ A;  3D7S B;  3M54 A;  1MUZ A;  3CBO A;  2CZ7 B;  1CSK A;  2B8A A;  3OQ5 A;  3GP8 A;  2HEQ A;  5IT9 E;  1KQ1 A;  1VQM T;  2RI5 A;  5KYY A;  2C0I A;  5KCH A;  1SG5 A;  2P0Q A;  3M56 A;  4AT1 B;  1WX6 A;  1Q81 R;  4KUI A;  1KHI A;  2YWW A;  1PCX A;  1WYX A;  5LJ5 g;  3OS1 A;  3JAM E;  1WHH A;  2NLU A;  5LL6 S;  2G3R A;  3G71 A;  2OAU A;  3EGU A;  4M75 E;  2RJD A;  5ECA A;  3NTI A;  3G4S T;  3TVT A;  2K2M A;  3H41 A;  4BD3 A;  1GCP A;  3A98 A;  5GAN 3;  4LDX A;  4A53 A;  2K5F A;  3EHQ A;  2AKK A;  1PNJ A;  2LDM A;  4QKU A;  1Y71 A;  4OMM A;  3LGL A;  2ZZD A;  3CCL A;  1D09 B;  2GF7 A;  2M51 A;  2XDD A;  2AZS A;  1Z9Q A;  1OZ3 A;  4PLI A;  5GAM g;  1GXI E;  1UGS B;  1S72 T;  5GAN f;  3PT9 A;  2VXE A;  2E3I A;  2LT1 A;  2O2O A;  4XU0 A;  1GFD A;  3CXC P;  4TVR A;  3CCV T;  4BAC A;  1NEB A;  2JTF A;  2QEX A;  1IXD A;  1WJS A;  3CCM T;  2PVO B;  1RAB B;  1Y96 B;  1NJI C;  2JNG A;  1W4S A;  1X43 A;  1KFZ A;  2HSE B;  3RBB B;  1OYX A;  2R5M A;  1VQ5 Q;  1BKB A;  2DTI A;  1IRX A;  1C6V X;  3M0U A;  2CRE A;  4AG1 C;  1R0B G;  2VKN A;  2CGH A;  4QT7 A;  1SHG A;  1QLY A;  5DLO A;  2AHJ B;  3BDU A;  3LLR A;  2X4W A;  4BI3 A;  3G4S A;  1LCK A;  1VQO T;  1NE8 A;  3JV3 A;  4M75 D;  1M2V B;  1IZ6 A;  1K1Z A;  1XTD A;  1K4U S;  1YHQ T;  4OGE A;  1VQ8 T;  1G3S A;  2K57 A;  1K8A R;  4PJO A;  1LNX A;  3J80 E;  1ABO A;  1D1A A;  3X28 B;  1K0S A;  1QVP A;  3MCA B;  4XTX A;  3O8V A;  2NUZ A;  4E7S A;  1YWO A;  2DLP A;  1WHG A;  1VQ9 T;  1AVZ C;  2XKO C;  1I81 A;  3CQT A;  1LPL A;  2RHZ A;  4M7D F;  1D0X A;  3QDR B;  1YNZ A;  1VQL A;  5IHN A;  2RI2 A;  2DRK A;  3E9G A;  1FX7 A;  5KE2 A;  3OY9 A;  1YI2 Q;  3CME Q;  3GIB A;  2X3X D;  1MMN A;  3VS0 A;  1K9M U;  2CUD A;  1X2K A;  1GBQ A;  4J5Y A;  4JJB A;  2KXD A;  1ZUU A;  2XD0 A;  1SRL A;  2V8J A;  4PKC C;  3H8Z A;  1VOM A;  1N8R R;  2DE0 X;  3HHT B;  1RAH B;  3I9Q A;  2VC8 A;  3GBQ A;  2L0A A;  4ZGE B;  3S3N A;  4M78 F;  4RTT A;  4JJD A;  2HKN A;  4F7U B;  1FMK A;  3OYD A;  1MNE A;  3OMC A;  4B6M A;  1VQN T;  6AT1 B;  2EQJ A;  3CCE T;  3QZ5 B;  2RJE A;  3JRZ A;  3QJ6 A;  4RG2 A;  1X69 A;  3A1P A;  2W10 A;  3CCJ T;  1VQ7 A;  2F69 A;  2BE7 D;  1AOJ A;  1M90 C;  2JM8 A;  4XTY A;  4KH1 B;  2COW A;  3VU3 C;  2A7Y A;  2X3W D;  3VKI A;  3VYH B;  5C6S A;  4BY6 B;  2ENM A;  5GMK m;  3CPF A;  2CSI A;  1VQ8 A;  2ATC B;  1Y57 A;  2ZAE A;  2EIF A;  3HP9 A;  1QMC A;  2GNC A;  1QVF A;  2GFA A;  2YUO A;  1SSF A;  2JM9 A;  1ARK A;  1X6G A;  1PKT A;  2DIL A;  4XU3 A;  4BI4 A;  4J6Y A;  1UHF A;  1G3W A;  1TU0 B;  4QVD A;  2V1Q A;  1GRI A;  2I0N A;  2PUO B;  2LT4 A;  2QA4 Q;  3FB9 A;  2KK4 A;  2L89 A;  2LCL A;  3CCS A;  4PJJ A;  4CC7 A;  1SF9 A;  3VS1 A;  2JTM A;  3QJY A;  4F7U G;  1ZSG A;  2DJZ A;  1HYO A;  2KRS A;  2VUB A;  1KD1 C;  5GAN g;  2E1H A;  3GOX A;  1M3A A;  1E6H A;  3M0S A;  4M7D B;  2JOY A;  3BY7 A;  2HDA A;  2HQH A;  3S6W A;  5DY9 A;  3V7S A;  1KC8 C;  1V1C A;  2YRC A;  4J9C A;  3CCE A;  1XOV A;  3GNF B;  2D0Q B;  2O88 A;  1E7O A;  5KYW A;  2GTJ A;  4JDS A;  3CCR A;  3FC3 A;  2KYM A;  1VQK T;  3H0H A;  1BI1 A;  4J9I A;  3CCJ A;  2OAW A;  1LOJ A;  4OVA A;  5D6W A;  1O9S A;  4CRI A;  4M78 E;  4FYW B;  1UTI A;  2LJ3 A;  2DTO A;  3JCM J;  1BBZ A;  4C92 C;  2FL7 A;  3MEU A;  4EMG A;  2QI2 A;  2QTV A;  5D6Y A;  1JB0 E;  1W2B A;  2D8H A;  2QGG A;  5GAO r;  2QXF A;  3L1A A;  1UUE A;  2JZ2 A;  4WTO B;  2FO0 A;  1DJ7 B;  3CBM A;  1G5V A;  2KBT A;  2X51 A;  4GLM A;  5EG2 A;  3TCJ A;  5KYX B;  1PKS A;  1P92 A;  1TUD A;  2QQR A;  4QVZ A;  3CC7 A;  4R0K A;  4LUE A;  2DVJ A;  2EYX A;  1NZ9 A;  2DPP B;  3CPW S;  2FZG B;  2BZY A;  2DXT A;  4FYY B;  2NUP B;  3M0T A;  4KH0 B;  1TG0 A;  2FRY A;  8ATC B;  3I35 A;  3JB9 G;  2A36 A;  4M7D D;  3J81 E;  3FIF A;  2EGA A;  4M7A C;  4E7L A;  1JXO A;  5KH6 A;  1YJW Q;  1BB9 A;  3HRT A;  3V7C A;  1VYV A;  2YXY A;  3OS0 A;  3NPF A;  5CKE A;  5KCO A;  3LWH A;  2MIO A;  5FU6 C;  4X34 A;  1M8M A;  2DA9 A;  2FHD A;  3DB3 A;  4K11 A;  3FDR A;  1QVF P;  3CC4 T;  4C5G A;  2E41 A;  4HCB A;  3SWN C;  4RTZ A;  2DKG A;  2EYZ A;  4M78 D;  1YP5 A;  1QVG A;  3E19 A;  2ABL A;  4J6X A;  4ORZ A;  3CCU T;  5GAO q;  4EMK C;  2P0P A;  2VV5 A;  2QGF B;  1K9M R;  1OU8 A;  2E10 A;  2JS0 A;  3CD6 A;  2KY9 A;  2CS7 A;  3EG0 A;  3GF5 A;  2W0Z A;  4C0Z A;  2H3E B;  3RES A;  4LDV A;  2BKD N;  3UA7 A;  2QEX Q;  4FM4 B;  3P8B B;  1UHC A;  2BZ8 A;  4M77 C;  2DIG A;  2FEI A;  3FJ5 A;  4Z89 A;  3VRY A;  3OYA A;  2GQV A;  2CP0 A;  3TSZ A;  2JMA A;  2KRO A;  1WI7 A;  3JCM c;  2X4Y A;  3OB9 A;  3TU4 K;  4PJO F;  1G8X A;  1TXQ A;  2DYB A;  1KQ2 A;  1I5L A;  2DXU A;  4ZN1 A;  4QQD A;  5KYN A;  3OYB A;  2X35 A;  5FWC A;  4J6W A;  3JCM h;  5GAN 8;  1FYN A;  2MAM A;  3LYI A;  3G4S Q;  4L5G A;  2JVV A;  1QP3 A;  4RTV A;  4HVV A;  4GBQ A;  2KEA A;  4J7F A;  2FPE A;  2L2P A;  2DL3 A;  2HBW A;  3JB9 H;  1QCF A;  4C8Q B;  1D0Y A;  2LQN A;  4AFZ C;  3QYH B;  4HVW A;  4DA4 A;  4ATO A;  4FIB A;  1W2B P;  4IIO A;  1AD5 A;  1VQ6 T;  4FYX B;  3EG9 B;  4QQ6 A;  1UGP B;  1H64 1;  4XK8 E;  5IH2 A;  4ELZ C;  1S72 Q;  1VQL Q;  4PL6 A;  2RQU A;  2V1R A;  3I5S A;  1AZG B;  2RI3 A;  2AZV A;  3QG1 A;  2LRQ A;  1R8O B;  1JJ2 A;  3PIP A;  5I11 A;  3X25 B;  3QZ9 B;  3CXC S;  3CCV Q;  2L3R A;  3VS6 A;  4VUB A;  3HSB A;  1AHJ B;  2FVU A;  3MJX A;  3EFR A;  3NHN A;  3CCM Q;  3PIO A;  2MYS A;  3UPU A;  2O4X A;  1Q82 C;  4XU2 A;  3L2Q A;  3OYN A;  2LMJ A;  5IN1 A;  5I22 A;  4J7I A;  4YTL A;  4KUL A;  4E7I A;  1K76 A;  2J6F A;  2EJ9 A;  3A8L B;  3OW2 A;  4IUV A;  2ECZ A;  1QW1 A;  3I5R A;  4XTZ A;  4HCZ A;  3M4G A;  1Y7X A;  3JCM e;  3UWN A;  1OU9 A;  4AMC A;  3VUB A;  4C8Q G;  2P84 A;  1VQO Q;  4JLI A;  3G71 T;  1YHQ Q;  1VQ8 Q;  4JRQ A;  4PJO E;  3C4S A;  3RMS A;  4ME7 A;  3VS5 A;  1QVG P;  2BUD A;  1U3O A;  1U8R A;  1Y0M A;  2KRN A;  2JUF A;  4JJN K;  4LN2 A;  2HZY A;  2KVQ G;  2XI9 A;  3AT1 B;  5A0D A;  4GLK A;  1VQ9 Q;  2PZ1 A;  1MV3 A;  3CCL T;  5GAN 7;  4B9X A;  3RUX A;  3V8J A;  2FZK B;  5CQY A;  2RQR A;  1WDX A;  3OYF A;  5CKF A;  1J3T A;  2O01 E;  2LCC A;  1D3B A;  1B3Q A;  2RHY A;  5HK0 A;  4OB2 B;  2LC4 A;  4CI0 C;  4HKE A;  2EPD A;  1EZZ B;  1X01 A;  1RAA B;  3JCM d;  2ZPI B;  2VGM A;  2CP2 A;  4XTW A;  1TWB A;  2EYW A;  2QQS A;  4PLL A;  1VQN Q;  4LXC A;  2Z0W A;  5KYU B;  2DIQ A;  3CCE Q;  1GFC A;  2XDP A;  4MZP A;  4C92 A;  3MET A;  2LX7 A;  3CCR Q;  2E65 A;  1NLP C;  1QKX A;  3HFO A;  3CCJ Q;  2JT4 A;  2K4Y A;  1U1S A;  4LDU A;  1RUW A;  4OGC A;  1TOV A;  1RAD B;  9ATC B;  1NPR A;  4Z88 A;  2M16 A;  4M75 B;  1KHC A;  2RHI A;  2MF2 A;  1UGV A;  2DL8 A;  2K5L A;  2VAS A;  1WIE A;  5LJ3 f;  2XU8 A;  1MND A;  2KXC A;  3HL8 A;  2F2V A;  2X9H A;  4PJO D;  4A4K A;  1IGU A;  5A2Q E;  2EYQ A;  1JJ2 P;  2NYS A;  5EC7 A;  1ZUK A;  4P5N A;  2OX7 A;  5GAO l;  2RN8 A;  1YJN A;  1K73 U;  2R5A A;  4NL3 A;  3OYY A;  3EAE A;  5GAN 6;  4WF2 A;  1TS9 A;  3PGG A;  4E6R A;  5CAI A;  2OTL T;  1Q86 C;  4A4G A;  1VQL T;  4F16 A;  1HK9 A;  1BYM A;  1HSQ A;  2VVK A;  2LQ8 A;  2DL5 A;  2GCX A;  3CMA A;  1JRI A;  1MGQ A;  3H0F A;  3OW2 P;  1WQ7 A;  2L5Q A;  4BI8 B;  4BDY A;  3JCM X;  2RPN A;  3L2V A;  1PD1 A;  2FPF A;  4E7J A;  1WFW A;  4EDU A;  1C1A A;  1JO8 A;  1WXT A;  3CC2 A;  4HT9 A;  3SDZ A;  4EMK A;  2DJQ A;  4M75 G;  1VQK Q;  1VA7 A;  2KI7 A;  5IHK A;  2DXC A;  4E7K A;  1XQH A;  2X4X A;  4C0F A;  1GL5 A;  4J83 A;  4Y28 E;  2PU9 B;  1VQ7 T;  3EG2 A;  1IO6 A;  3G6E A;  4BY6 C;  3O5Z A;  4M77 A;  1BIB A;  1U1T A;  2C0O A;  5D6X A;  3EGD A;  3RR6 A;  1KQS P;  1N9R A;  4EPC A;  1V76 A;  2EYY A;  2CUB A;  1X6O A;  2X4J A;  3EFO A;  5LJ5 h;  1WPY A;  3DLL A;  3I55 A;  2DM1 A;  1SPK A;  2A08 A;  2NWM A;  5CK9 A;  5HY6 A;  1Q7Y U;  1M1K U;  1QWE A;  2FRW A;  2OTL A;  5CO7 A;  5I2M A;  4F17 A;  1N27 A;  1VQ4 A;  3CCS T;  4ZN3 A;  4PFZ A;  4OP0 A;  4LD6 A;  2HQE A;  1OZ2 A;  4M7D C;  5GAM h;  3MP1 A;  5GMK i;  4CC2 A;  3OYI A;  1SEM A;  1W6X A;  2F2W A;  4C0G A;  2DL7 A;  3VS3 A;  3P8D A;  5LJ5 j;  4ZTF A;  3CCR T;  1T3L A;  3Q1J A;  2C06 A;  1QVF S;  2M0O A;  3CC4 Q;  2D9T A;  3FRN A;  1BU1 A;  3NTK A;  1X6B A;  3QSU A;  3M53 A;  2KMT A;  3CCU Q;  1Q81 C;  2E12 A;  3A8M B;  2K3Y A;  3DLM A;  2HMA A;  2K3X A;  1ABQ A;  1YCS B;  4XU1 A;  1WJQ A;  4E7H A;  5LJ5 e;  1QWF A;  3JSC A;  5GAM j;  2QK0 A;  3HRU A;  3LWI A;  1Z9Z A;  1M9S A;  5LJ3 g;  2AT1 B;  1N5Z A;  1WHJ A;  2HKQ B;  4RG8 A;  1VIF A;  2VYT A;  1I07 A;  1HJD A;  1AWW A;  3I56 A;  2O31 A;  5D7U A;  3CC7 T;  1QCN A;  4LD9 K;  4FU6 A;  2OTJ T;  5GAM e;  2QQA A;  1TSF A;  2L3Q A;  1AT1 B;  1OX8 A;  1RAE B;  4Z02 A;  4OB3 B;  3VS2 A;  2RMO A;  4JJC A;  2KQW A;  4IUP A;  3M57 A;  2K9G A;  2IG0 A;  4RKU E;  3OMG A;  2EGE A;  1NJI U;  2RQV A;  2K79 A;  1PSF A;  3VUZ A;  2P4R A;  4MDX A;  4BB7 A;  5LJ5 d;  2H8H A;  2RK1 A;  4CC3 A;  1W2B S;  3ER0 A;  1VQ6 Q;  3M0R A;  1VIE A;  1MV0 B;  1K73 R;  1N6A A;  2F5K A;  4M78 B;  1Y96 A;  5GAN 4;  1FMW A;  3PFS A;  2NUT B;  4HCK A;  2QAZ A;  1WA7 A;  1YBY A;  3VS4 A;  1RLQ C;  2EBP A;  1UJ0 A;  2DO3 A;  4OB1 B;  4C92 F;  1LJO A;  1OPK A;  4AFS C;  3CD6 T;  2DEQ A;  2Y4Y A;  2EKO A;  1IGQ A;  1SRM A;  4UC4 A;  4J9F A;  1K8A C;  1T0H A;  4L6V 5;  5GAM d;  2SEM A;  1B34 B;  4DBF A;  4JRK A;  3RER A;  1M2V A;  3CBP A;  4M7D G;  1K0X A;  2ED1 A;  2FPD A;  1ZHI A;  4FSX A;  2GGR A;  1YN8 A;  2GTO A;  3QYG B;  2OTJ A;  3JCM W;  3LH0 A;  1WZO A;  4RCC A;  2DEU A;  2Y90 A;  2LQK A;  1BI3 A;  2O9S A;  3VYG A;  1QKW A;  3MEW A;  1T0J A;  3G71 Q;  5FRN A;  3S3M A;  1GCQ C;  2PVG B;  1RLP C;  3THK A;  4MZM A;  2BE9 B;  4M78 G;  5FLX E;  1N8R C;  1QVG S;  3JCM b;  1OV3 A;  2EFI A;  1M2O A;  3QWX X;  4C8Q C;  5GAN h;  1FMV A;  4MMK A;  2DD5 A;  3EGX B;  2M0Y A;  3PTA A;  2HQX A;  2JMC A;  2EW3 A;  3CCQ A;  1YIJ T;  1Q7Y R;  2A37 A;  2KAF A;  2YRD A;  1M1K R;  3CCL Q;  2WSF E;  1YJN Q;  4AG2 C;  4EMH A;  3VJP A;  4F7U A;  1VQ5 A;  3IQL A;  4DOV A;  1M90 U;  2JTE A;  2EWN A;  3QWY A;  2VGN A;  2DET A;  4RUG A;  2PVD B;  5KE3 A;  4JS4 A;  3LGF A;  3NTH A;  2CYZ B;  4RTY A;  3SD4 A;  1ZSZ B;  2E6N A;  4KGV B;  4ZGJ B;  2LJ1 A;  4II1 A;  5CVI A;  2KYB A;  4M77 F;  4JUV A;  2HL3 A;  4HT8 A;  2PUK B;  4IUQ A;  4C92 E;  5GAN j;  1M1F A;  2CH4 A;  2RQT A;  3QDF A;  5KYY B;  4IKF A;  3OS5 A;  4J9E A;  4JPB W;  3REA B;  5CCA A;  1UEB A;  2IIM A;  3JCM P;  1PG5 B;  3UA6 A;  2G6F X;  3EFS A;  2HCK A;  4OML A;  1KG1 A;  1YI2 A;  2XG8 D;  1AZE A;  2FB7 A;  3CME A;  3UT1 A;  3RNJ A;  1KD1 U;  3PE0 A;  2J05 A;  2P0K A;  2DMO A;  2MPX C;  5GAN e;  1ZQ1 A;  3QKJ A;  2Y4X A;  5I21 A;  2XIC A;  4X1V A;  1KC8 U;  3L42 A;  1YIJ A;  1N9S A;  1JJ2 S;  1OOT A;  3GNG A;  3T9N A;  2LNV A;  1Q95 G;  8AT1 B;  3X26 B;  3L2U A;  4M7A E;  2CZ0 B;  2OTL Q;  2EQI A;  1KK7 A;  2V26 A;  2L3S A;  1NPP A;  1I4K 1;  3NMZ C;  4RMO A;  1SKU B;  4F04 B;  1RAF B;  2CH4 W;  4C0D B;  5FU7 B;  5IXB A;  2J6K A;  1WLP B;  3OW2 S;  2DXB A;  1TTH B;  1ZBJ A;  2EJF A;  1FXX A;  4BE0 A;  1IB8 A;  4DQ2 A;  1U06 A;  4AFU C;  2YUQ A;  1YIT T;  1RAI B;  3MP8 A;  4GY5 A;  3OSV A;  4C92 D;  1UB4 A;  3EG3 A;  3JB9 J;  1UGR B;  1FWZ A;  4LDY A;  3VS7 A;  1NJI R;  1TUC A;  5GAN d;  2XMF A;  2RJC A;  1JXM A;  3DKM A;  2KDS A;  3G7Z A;  1VQ7 Q;  1BCO A;  4M77 E;  4M75 C;  2QA4 A;  3V8K A;  4ESR A;  1KQS S;  1NYG A;  2VWF A;  4JRI A;  2AK5 A;  1GBR A;  1WGS A;  2SRC A;  4PJO B;  1JU5 C;  5CKH A;  1MHN A;  3INZ A;  2RHX A;  1BK2 A;  1UFF A;  3HRS A;  1WXB A;  5FWB A;  1RAG B;  4BUG A;  1BCM A;  5J26 A;  2A3L A;  1I8F A;  1YJN T;  4R56 A;  4M7A D;  2F2X A;  2LX9 A;  3CCS Q;  2WSC E;  3S3O A;  1BI2 A;  5GJV B;  2MK5 A;  3CEY A;  3ZBD A;  3CMA T;  4IUR A;  5FRO A;  5M9O A;  1AWO A;  4A54 A;  5FRM A;  2MCN A;  3GPL A;  2E64 A;  1YIT A;  2XK0 A;  1M4Z A;  2QQ9 A;  3FEO A;  2XDB A;  4N4H A;  4LDW A;  3JCM Q;  3CC2 T;  2F1L A;  3H0I A;  1PM3 A;  1G3Y A;  2RF0 A;  2CP3 A;  1OI1 A;  4PJO G;  3KUF A;  1JBM A;  1EFN A;  1VQP T;  2HBP A;  4RTW A;  3MHX A;  5CKB A;  1YWP A;  2LVM A;  4ANJ A;  2J7I A;  3G6E T;  4M77 D;  2CKK A;  2MI6 A;  4FSS A;  3QPH A;  3MPU B;  1M90 R;  1NLO C;  3M0Q A;  1UEC A;  1M3B A;  1S1N A;  3RIR A;  2BTT A;  1RI0 A;  3M0P A;  4N4G A;  3URG A;  4CC4 B;  3AHU A;  1OUL A;  2MWO A;  4FT2 A;  3M9Q A;  3I55 T;  4E2F B;  3BFM A;  4PFO A;  2LCS A;  2V8K A;  5IAY A;  1K9A A;  1YJW A;  2QTX A;  2RB6 A;  2CZ6 B;  2COY A;  1GCQ A;  2E70 A;  2LJ0 A;  4M7A A;  1OPL A;  4X9C A;  4FT4 A;  3CC7 Q;  2YLB A;  1NM7 A;  1CKB A;  2QDY B;  4A4E A;  3REB B;  4C5I A;  4OF1 A;  1VQ4 T;  2CP5 A;  1IRE B;  2LP5 A;  4C8Q A;  5A0L A;  1V29 B;  4E47 A;  2OTJ Q;  2A28 A;  2ESW A;  1IHW A;  3MO8 A;  5L8R E;  3QXE B;  1UDL A;  2H3J A;  3EG9 A;  1X27 A;  1ZX6 A;  3SWN A;  1WHL A;  1X2Q A;  2JW4 A;  4WCI A;  1F1B B;  4F7U F;  2DNU A;  1KD1 R;  3JCM V;  4N0A C;  1NG2 A;  2EKH A;  2GQI A;  5KYW B;  2ZPH B;  4XQ3 A;  3OS2 A;  2YT6 A;  2LNH B;  1Q82 U;  5GAO m;  1ZA1 B;  1KC8 R;  3L2R A;  4DOW A;  1UJY A;  2OI3 A;  3OYC A;  3CCQ Q;  2JS2 A;  1VQP A;  2C0T A;  5AYF A;  2DX1 A;  3JB9 I;  1D1C A;  3A5Z B;  3NGP A;  1UGQ B;  2ZPB B;  1VQM A;  2DD4 A;  2QAS A;  4D8K A;  3QBY A;  5L23 A;  1ZBX A;  2K3B A;  2ED0 A;  1PRL C;  2D6F A;  3ZEH A;  2ROL A;  2E5K A;  3OYJ A;  3CD6 Q;  1AWJ A;  4DEX A;  3QII A;  3HKS A;  2LTO A;  5AT1 B;  3QO3 A;  4BE2 A;  4OB0 B;  1Y07 A;  2O9V A;  4PJL A;  3RMQ A;  2HNI A;  2AIR B;  5GMK h;  1C0M A;  3BE3 A;  3BDL A;  3I56 T;  2ZCF B;  2P4T A;  3JCM f;  5A0G A;  4D8D A;  1AEY A;  4FCY A;  1H3Z A;  5GAN 5;  3OBW A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  3OQ5 A;  2B8A A;  3CD6 T;  2DEQ A;  2RM4 A;  2Y4Y A;  4J7F A;  2EKO A;  4PNO A;  3GP8 A;  1KQ1 A;  5IT9 E;  1S72 A;  1M8V A;  1VQM T;  2XID A;  3JB9 H;  4C8Q B;  4UC4 A;  2RI5 A;  1K8A C;  4L6V 5;  5GAM d;  3QYH B;  5CIU A;  4J8O A;  1B34 B;  3TEE A;  5KCH A;  4DA4 A;  3BW1 A;  4FIB A;  3V7R A;  4JRK A;  2P0Q A;  3M56 A;  3RER A;  3CBP A;  4ATO A;  4KUI A;  1VQ6 T;  3F70 A;  5GMK l;  4QQ6 A;  1KHI A;  1UGP B;  3CCV A;  1YJ9 T;  1H64 1;  4XK8 E;  4M7D G;  3OS1 A;  4ELZ C;  5LJ5 g;  3JAM E;  1WJR A;  4ELY C;  2NLU A;  3JB9 F;  5LL6 S;  2G3R A;  3G71 A;  3QUI A;  4PL6 A;  2OAU A;  2WAC A;  4M75 E;  3CCM A;  1ZHI A;  4FSX A;  2RJD A;  3NTI A;  4D6W A;  2RI3 A;  3G4S T;  3GLX A;  3QG1 A;  3QYG B;  2OTJ A;  3JCM W;  2LRQ A;  2MWP A;  1R8O B;  4M78 C;  3LH0 A;  4BD3 A;  5GMK j;  3PIP A;  1JJ2 A;  5GAN 3;  4LDX A;  3X25 B;  4RCC A;  3QZ9 B;  3CXC S;  4F7U E;  2L3R A;  2LQK A;  2Y90 A;  4VUB A;  1BI3 A;  4A53 A;  2V8I A;  3VYG A;  3HSB A;  1AHJ B;  2FVU A;  3MEW A;  2K5F A;  5FRN A;  3EFR A;  4N4I A;  3S3M A;  3PIO A;  3UPU A;  2LDM A;  2O4X A;  1Y71 A;  1Q82 C;  4XU2 A;  2PVG B;  3LGL A;  2ZZD A;  3L2Q A;  3M59 A;  3M5A A;  4C5H A;  2IVW A;  4MZM A;  5DM7 R;  3OYN A;  3KXT A;  1N8R C;  4M78 G;  2GF7 A;  5FLX E;  1QVG S;  3JCM b;  2EFI A;  5IN1 A;  2XDD A;  2K2V A;  4C8Q C;  4J7I A;  4HA8 A;  4YTL A;  5GAN h;  1OZ3 A;  3A8H B;  4PLI A;  2I2L A;  4KUL A;  5GAM g;  4E7I A;  5DLQ E;  4MMK A;  2DD5 A;  1GXI E;  2DAQ A;  1UGS B;  3M55 A;  1VQO A;  2EJ9 A;  5GAN f;  1S72 T;  3PT9 A;  3A8L B;  3PTA A;  2HQX A;  3OW2 A;  2VXE A;  4IUV A;  5GMK e;  1BI0 A;  3CCQ A;  1YIJ T;  4M75 A;  1QW1 A;  2KAF A;  1YHQ A;  2RA2 A;  2LT1 A;  2MMP A;  2RO0 A;  4XU0 A;  4HCZ A;  4XTZ A;  3M4G A;  2WSF E;  4HCC A;  1Y7X A;  1XNI A;  3JCM e;  2M1H A;  3UWN A;  4TVR A;  3CCV T;  3VUB A;  2HAX A;  3OYG A;  4EMH A;  2VXF A;  3VJP A;  4F7U A;  4C8Q G;  4BAC A;  2JTF A;  1VQ5 A;  2QEX A;  2EQU A;  4JLI A;  3G71 T;  1WJS A;  4DOV A;  1M90 U;  3CCM T;  2EWN A;  3PNW C;  4JRQ A;  2PVO B;  1VQ9 A;  3OYL A;  2VGN A;  1Q86 U;  1Y96 B;  1NJI C;  2PVD B;  2JNG A;  5KE3 A;  3C4S A;  3RMS A;  1W4S A;  4ME7 A;  4PJO E;  2BUD A;  4JS4 A;  4XTU A;  3LGF A;  3DB4 A;  3NTH A;  1U8R A;  2CYZ B;  2JUF A;  4JJN K;  1OYX A;  2R5M A;  3SD4 A;  3SFM A;  3QHS A;  1BKB A;  2E6N A;  2KVQ G;  2DTI A;  2XI9 A;  4ZGJ B;  5A0D A;  4GLK A;  4II1 A;  5CVI A;  4JLG A;  3JB9 J;  3L2W A;  4HT8 A;  4M77 F;  4JUV A;  2PUK B;  4IUQ A;  1YJ9 A;  3CCL T;  2CGH A;  5GAN 7;  4C92 E;  4B9X A;  3RUX A;  5GAN j;  4L59 A;  3V8J A;  1M1F A;  5CQY A;  5DLO A;  2AHJ B;  3BDU A;  3E9F A;  4IUU A;  3LLR A;  2X4W A;  4BI3 A;  3G4S A;  3OS5 A;  4IKF A;  4M7D E;  3OYF A;  1VQO T;  1NE8 A;  5CKF A;  4M75 D;  1IZ6 A;  2O01 E;  1XTD A;  5CCA A;  1UEB A;  3CCQ T;  3JCM P;  4OGE A;  2PQW A;  1YHQ T;  1G3S A;  1VQ8 T;  2LCC A;  3PMI A;  4FL6 A;  1D3B A;  2K57 A;  1VQN A;  2RHY A;  3EFS A;  3HPW A;  4PJO A;  5HK0 A;  3C12 A;  1LNX A;  4OB2 B;  2LC4 A;  4CI0 C;  3J80 E;  1KG1 A;  4HKE A;  3X28 B;  1QVP A;  4NL3 A;  1YI2 A;  2XG8 D;  2FB7 A;  1VQ5 T;  3CME A;  3MCA B;  4XTX A;  4BE1 A;  1X01 A;  3O8V A;  2DTH A;  3UT1 A;  3JCM d;  2ZPI B;  1VQ9 T;  2VGM A;  1KD1 U;  2XKO C;  1I81 A;  2OTL T;  4XTW A;  2P0K A;  4O6J A;  5J39 A;  5GAN e;  2RHZ A;  1ZQ1 A;  2QQS A;  4NL2 A;  4PLL A;  3QKJ A;  5GAO n;  4M7D F;  2DIQ A;  2Y4X A;  3QDR B;  4MZP A;  2XDP A;  5I21 A;  1VQL A;  2K5I A;  4C92 A;  2RI2 A;  3E9G A;  3MET A;  1FX7 A;  2O4X B;  2XIC A;  4C5E A;  5KE2 A;  3OY9 A;  3L42 A;  1YIJ A;  1KC8 U;  1N9S A;  2E65 A;  1JJ2 S;  2DZ9 A;  3GIB A;  5C0M A;  2L8D A;  3GNG A;  3T9N A;  5CR2 A;  2LNV A;  3HFO A;  1K9M U;  3A8G B;  2ZPG B;  4J5Y A;  4BDZ A;  3CCL A;  2K4Y A;  3X26 B;  3L2U A;  4M7A E;  1PSE A;  1U1S A;  4LDU A;  2CZ0 B;  5I2S A;  4OGC A;  3VV0 A;  4XTV A;  2XD0 A;  2V8J A;  4PKC C;  3H8Z A;  1NPR A;  3M58 A;  1M1G A;  4V2S A;  2M16 A;  4M75 B;  5LJ3 h;  1KHC A;  2RHI A;  1NPP A;  1I4K 1;  3HHT B;  2VC8 A;  2MF2 A;  4RMO A;  4ZGE B;  5GAN 2;  2K5L A;  5LJ3 f;  2XU8 A;  2ZPF B;  3S3N A;  4M78 F;  3HL8 A;  4C0D B;  4MML A;  4F7U B;  5FU7 B;  4PJO D;  4R55 A;  4A4K A;  2EAY A;  3OYD A;  3OMC A;  1VQN T;  3OW2 S;  2DXB A;  2RJF A;  5A2Q E;  2EQJ A;  3CCE T;  3QZ5 B;  2RJE A;  3JCM g;  2EYQ A;  2F5T X;  1YI2 T;  3JRZ A;  2EJF A;  3QJ6 A;  4RG2 A;  3CME T;  1FXX A;  4P5N A;  3HFN A;  1O75 A;  4BE0 A;  4M7A F;  2DK3 A;  2RK2 A;  4DQ2 A;  5GAO l;  3CCJ T;  2KSS A;  1VQ7 A;  2F69 A;  1YIT T;  1YJN A;  1M90 C;  3LW5 E;  2R5A A;  1K73 U;  1QP2 A;  4XTY A;  3OYY A;  3EAE A;  3MP8 A;  4GY5 A;  4WF2 A;  3OSV A;  3PGG A;  4C92 D;  3VU3 C;  1UB4 A;  4C8Q F;  5CAI A;  2A7Y A;  3OA6 A;  5GAO p;  4A4G A;  3VKI A;  3VYH B;  1UGR B;  5C6S A;  1FWZ A;  4LDY A;  1Q86 C;  1VQL T;  1TH7 A;  1HK9 A;  4BY6 B;  5GMK m;  1BYM A;  3CPF A;  4Q5W A;  1VQ8 A;  4QVC A;  5GAN d;  3ZFJ A;  2LQ8 A;  2RJC A;  5J3B A;  3DKM A;  2KDS A;  3G7Z A;  2EIF A;  2GCX A;  3CMA A;  3HP9 A;  1QVF A;  2GFA A;  3C95 A;  1SSF A;  4M77 E;  1JRI A;  1MGQ A;  4M75 C;  2QA4 A;  3CPW A;  3V8K A;  1WQ7 A;  2L5Q A;  4XU3 A;  1VQK A;  4BI4 A;  4J6Y A;  5LJ3 j;  4BI8 B;  4N0A A;  3LX7 A;  1KQS S;  5HKC A;  4BDY A;  2ZPE B;  1G3W A;  4C0D C;  2M9U A;  5FU7 C;  3JCM X;  1D3B B;  3JB9 D;  4JRI A;  3L2V A;  4E7J A;  4QVD A;  1WGS A;  4PJO B;  1Q81 U;  2PUO B;  2LT4 A;  4NS5 A;  5CKH A;  4EDU A;  1MHN A;  3INZ A;  3FB9 A;  2KK4 A;  4MDW A;  3CC2 A;  4HT9 A;  3SDZ A;  4EMK A;  2RHX A;  4M75 G;  2L89 A;  2LCL A;  3CCS A;  3HRS A;  2GFU A;  2DXC A;  2WSE E;  4BUG A;  4E7K A;  5J26 A;  2JTM A;  2A3L A;  3OSS C;  1XQH A;  2X4X A;  3QJY A;  4C0F A;  4F7U G;  1I8F A;  2DJZ A;  4J83 A;  4Y28 E;  2PU9 B;  1VQ7 T;  4C92 B;  4A4F A;  1YJN T;  3NFC A;  4R56 A;  3G6E A;  4M7A D;  4BY6 C;  2VUB A;  2LX9 A;  5GAN g;  1KD1 C;  5LJ3 e;  4M77 A;  2E1H A;  3GOX A;  1BIB A;  1U1T A;  5D6X A;  2WSC E;  4M7D B;  2JOY A;  3S3O A;  3P8H A;  2EJG A;  1BI2 A;  1N9R A;  3BY7 A;  4EPC A;  3S6W A;  5DY9 A;  5CQX A;  3V7S A;  1KC8 C;  3J7A F;  1X6O A;  2X4J A;  3CEY A;  3ZBD A;  3CMA T;  4KUD K;  3CCE A;  1XOV A;  3GNF B;  2D0Q B;  4IUR A;  5FRO A;  5LJ5 h;  1WPY A;  4OMF B;  2QA4 T;  4A4H A;  4JS5 A;  5M9O A;  3DLL A;  4A54 A;  5FRM A;  3I55 A;  4JDS A;  3CCR A;  3L2Z A;  5LJ5 f;  3FC3 A;  3GPL A;  1VQK T;  3PMT A;  3TRE A;  4PJO C;  1BI1 A;  2E64 A;  5CK9 A;  3CCJ A;  2ZGW A;  5HY6 A;  1Q7Y U;  1YIT A;  4Y91 A;  1M1K U;  2XK0 A;  1M4Z A;  2QQ9 A;  3FEO A;  2XDB A;  1LOJ A;  4N4H A;  4OVA A;  3C94 A;  4LDW A;  2HD0 A;  5D6W A;  2OTL A;  1O9S A;  5CO7 A;  3JCM Q;  4CRI A;  5I2M A;  4M78 E;  3CC2 T;  1N27 A;  4XAX B;  1VQ4 A;  1G3Y A;  3CCS T;  2DTO A;  4ZN3 A;  3JCM J;  4M7D A;  4OP0 A;  4LD6 A;  2HQE A;  1EIF A;  4C92 C;  1OI1 A;  4PJO G;  3KUF A;  3FLG A;  2FL7 A;  3MEU A;  1JBM A;  4EMG A;  1VQP T;  2HBP A;  2QI2 A;  3H6Z A;  1OZ2 A;  3MHX A;  1JB0 E;  5CKB A;  5D6Y A;  4M7A B;  4M7D C;  2LVM A;  5GAM h;  1W2B A;  3MP1 A;  5GMK i;  3G6E T;  4M77 D;  2CKK A;  2MI6 A;  3OYI A;  2QXF A;  3QPH A;  5GAO r;  3L1A A;  3KBG A;  2JZ2 A;  5GAM f;  1K73 C;  4C0G A;  4C8Q E;  4MZT A;  1DJ7 B;  2RHU A;  1WQW A;  2JN0 A;  3CBM A;  5FU6 B;  3CC4 A;  1G5V A;  4RCB A;  3RIR A;  4C92 G;  1RI0 A;  5LJ3 d;  3TCJ A;  5EG2 A;  1X75 C;  4N4G A;  3URG A;  3P8D A;  1P92 A;  5LJ5 j;  1VUB A;  3AHU A;  3MP6 A;  4FT2 A;  2MWO A;  2QQR A;  4QVZ A;  3M9Q A;  3OYE A;  3CC7 A;  4M78 A;  2E5Q A;  3CCU A;  4ZTF A;  3I55 T;  3SWN B;  3CCR T;  3BFM A;  3Q1J A;  1YCY A;  2C06 A;  2BIV A;  2V8K A;  1NZ9 A;  2YHT A;  1QVF S;  2M0O A;  3MEA A;  2DPP B;  5IAY A;  1YJW A;  2D9T A;  3FRN A;  3CPW S;  4QW2 A;  2QTX A;  3NTK A;  5HK3 A;  4EMK B;  2RB6 A;  2DXT A;  2CZ6 B;  2E70 A;  1K8A U;  3QSU A;  4X9C A;  4M7A A;  3M53 A;  2KMT A;  4FT4 A;  2YLB A;  3OYK A;  2QDY B;  1Q81 C;  2E12 A;  4A4E A;  3A8M B;  3JB9 G;  4C5I A;  4OF1 A;  3ME9 A;  3J81 E;  4ZTJ A;  1VQ4 T;  4M7D D;  2K3Y A;  3DLM A;  3FIF A;  1IRE B;  2K3X A;  1G3T A;  4M7A C;  4E7L A;  4C8Q A;  5A0L A;  5KH6 A;  1V29 B;  4XU1 A;  3M4Y A;  4E47 A;  1WJQ A;  2FYK A;  3HRT A;  1M5Q 1;  4X9D A;  2EQM A;  3V7C A;  5GAN 6;  5LJ5 e;  4E7H A;  1B34 A;  3MO8 A;  4M77 B;  3JSC A;  3QXE B;  5L8R E;  5GAM j;  3OS0 A;  2EQK A;  2H3J A;  4M75 F;  5KCO A;  5CKE A;  1WNL A;  3LWH A;  3HRU A;  3CXC A;  3LWI A;  5FU6 C;  3WVE B;  4X34 A;  1M9S A;  3R6O A;  5CKD A;  5LJ3 g;  2FHD A;  3DB3 A;  3SWN A;  3FDR A;  2R57 A;  3X24 B;  4RG8 A;  4F7U F;  1VIF A;  2VYT A;  4M7A G;  3JCM V;  3X20 B;  3CC4 T;  3RKY A;  3A8O B;  3FJP A;  4N0A C;  4C5G A;  3RKX A;  2E6Z A;  2E41 A;  4HCB A;  3I56 A;  2RH2 A;  2ZPH B;  4XQ3 A;  3SWN C;  3SB2 A;  3OS2 A;  2YLC A;  2DKG A;  1Q82 U;  5GAO m;  4M78 D;  1QVG A;  3CC7 T;  2CZ1 B;  4B9W A;  3E19 A;  4J6X A;  4DOW A;  3L2R A;  3CCU T;  1N8R U;  2R58 A;  5GAO q;  4EMK C;  2P0P A;  2VV5 A;  4LD9 K;  3OYC A;  1VQP A;  3ASK A;  2E10 A;  4FU6 A;  3MEV A;  1BIA A;  1YJW T;  2OTJ T;  5AYF A;  5GAM e;  2QQA A;  3WVD B;  3JB9 I;  2KY9 A;  3CD6 A;  1Q7Y C;  2CS7 A;  3A5Z B;  3GF5 A;  1M1K C;  1UGQ B;  2ZPB B;  4C0Z A;  3WXM B;  1VQM A;  2DD4 A;  3E1S A;  1RL2 A;  3QBY A;  3RES A;  4LDV A;  2BKD N;  4Z02 A;  4JRP A;  4FM4 B;  3P8B B;  4OB3 B;  3RKW A;  4O5V A;  3UDC A;  1ZBX A;  4C8Q D;  2D6F A;  2KQW A;  3N5B B;  2DIG A;  4IUP A;  4M77 C;  4NOY A;  3M57 A;  3ZEH A;  2GQV A;  3OYA A;  1VQ6 A;  3OYJ A;  2YRV A;  1KQS A;  1K9M C;  3QII A;  2DZC A;  1HXD A;  3HKS A;  4KBM B;  2IG0 A;  3JCM c;  4KT0 E;  4RKU E;  2LTO A;  3OMG A;  2X4Y A;  3OB9 A;  3QO3 A;  1NJI U;  3TU4 K;  1PSF A;  3VUZ A;  3OBY A;  4BE2 A;  4OB0 B;  4BB7 A;  5LJ5 d;  4MDX A;  4PJO F;  1Y07 A;  3RMQ A;  2HNI A;  4IUT A;  2RK1 A;  5GMK h;  1W2B S;  2QQB A;  3ER0 A;  4M77 G;  1VIE A;  1I5L A;  1KQ2 A;  3BDL A;  2DXU A;  4ZN1 A;  4QQD A;  3OYB A;  1N6A A;  2F5K A;  3V8L A;  4QQG A;  4M78 B;  1Y96 A;  2X35 A;  5GAN 4;  3OYH A;  3I56 T;  2DVE A;  2ZCF B;  4J6W A;  3JCM h;  2RD1 A;  3PFS A;  5GAN 8;  3OYM A;  2MAM A;  3LYI A;  2XHC A;  1YBY A;  2P4T A;  4L5G A;  4ZGD B;  3JCM f;  2QEX T;  5A0G A;  2JVV A;  2DO3 A;  4OB1 B;  3M54 A;  4C92 F;  1LJO A;  1QP3 A;  3CBO A;  1H3Z A;  5GAN 5;  3OBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...