5GMKh

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
70
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
molecule tags Rna binding protein/rna
total genus 8
structure length 70
sequence length 72
chains with identical sequence w
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkh00
4C8QA 1M5Q1 5CAIA 2RD1A 5GANf 5GAOn 3V8KA 4DQ2A 2E1HA 5LJ3h 3V7SA 4QVCA 5GAN7 4M7AA 1M8VA 4C92E 4M77G 4M77B 1U1SA 4A54A 4XTYA 1JBMA 3GIBA 5LJ3f 3V8LA 2E65A 4EMKB 2CGHA 4C8QF 1Y96A 3BY7A 4M77E 3EFRA 4JLIA 5GAMg 4M7DC 4HT9A 4M7AF 3V7RA 3JCMV 4X9CA 4C92A 5GAMj 3JB9J 1I8FA 4M78D 4M75C 2DKGA 4XU3A 4XU1A 1LJOA 4PJOD 1B34B 2YLCA 4HA8A 1LOJA 5GMKe 3FIFA 5GAMe 3RKXA 3JB9F 1U1TA 2K57A 2RA2A 3SWNC 4M77A 2YLBA 3QO3A 3PGGA 5GAN4 5GMKh 4C92F 4C92C 5LJ5h 4N0AA 3JCMd 2EJFA 4XQ3A 4XTXA 2DJZA 3VU3C 4EMKA 3RERA 4J5YA 4JRIA 5GANd 4XU0A 1JRIA 5GAN5 4M7DB 4J6XA 4QVDA 3L1AA 4M7DG 2VC8A 5GAN3 4X9DA 5GMKi 1KQ1A 3JCMb 3JCMf 5GAOl 4M7DD 5I21A 5LJ5f 1B34A 2ZGWA 3JCMc 4M75D 1WPYA 3BDUA 4C8QC 5LJ3d 1HXDA 2DVEA 2HNIA 3JB9D 2YHTA 4J6YA 4HT8A 4M7AC 4M78G 4PJOG 2JN0A 2DTOA 4M78B 4PJOB 2FB7A 4V2SA 4XTVA 4C92D 3V8JA 4EMGA 4PJOE 3QHSA 4MMLA 3RUXA 3JCMg 4F7UG 3V7CA 5GAMh 4F7UB 3JCMJ 5GAN6 4OP0A 1I5LA 5GAOm 1KQ2A 3QSUA 3JCMX 2DTIA 2E10A 4NOYA 1N9SA 4WF2A 3JCMe 5GAOp 4C8QD 2DEQA 4XTZA 1YCYA 2VXEA 4PNOA 4XU2A 4F7UE 2EJGA 5GMKl 3FJPA 5DY9A 1I4K1 4M7AG 4PJOA 4M7AD 4M77F 2DXTA 4M75G 3M4GA 2E41A 3INZA 4JRKA 4M77C 4M75B 5GAMf 3JB9I 5LJ5d 1WQ7A 1X01A 2RM4A 3BW1A 1LNXA 5LJ3j 3JB9G 4N0AC 4M7DE 2VXFA 2QTXA 4RCCA 4EMHA 4XTUA 2DXUA 4EMKC 5GAN8 3JCMW 3HFOA 2EWNA 2EJ9A 3SWNB 4A53A 4M75E 4J6WA 1Y96B 5LJ3e 4F7UA 1H641 1HK9A 4C92G 3EFSA 4PJOF 4C92B 3JB9H 1D3BB 4MMKA 3JCMQ 3QUIA 4NL2A 1WQWA 4XTWA 4M7DA 1N9RA 4M78E 4Y91A 2FYKA 5GAOr 1TH7A 2E64A 1BIAA 4M75A 5GMKm 5GANg 2DZCA 4M77D 1I81A 4F7UF 5GANj 4C8QG 3L2ZA 2Y90A 3RKWA 4C8QB 1MGQA 2I2LA 3SWNA 5GANe 4M78A 4M7AB 3RESA 3SB2A 5LJ5g 4M7DF 4RCBA 5GMKj 3FB9A 3BFMA 3HFNA 1D3BA 5LJ3g 5LJ5j 5GAMd 4C8QE 2DTHA 4NL3A 3JCMh 3JCMP 4M75F 3AHUA 5GANh 4M7AE 1BIBA 5GAN2 5LJ5e 4JUVA 3RIRA 2DZ9A 2EAYA 4M78F 4M78C 4PJOC 3RKYA 3HSBA 1WNLA 2RB6A 5GAOq
chains in the Genus database with same CATH superfamily
3TREA 5FU7C 2XKOC 3V7SA 2CDTA 1QQJA 3DKMA 3CD6T 2EQJA 1W2BS 4DEYA 3G6EA 2E5KA 2A3LA 3ZL7C 4JLIA 1M30A 5FLXE 2CKKA 3P8BB 2YUOA 1C1AA 1N5ZA 4XU1A 4DBHA 1LJOA 1KK7A 1MUZA 2RQTA 4M77A 4RTUA 4OB3B 4BE2A 1M2OA 3PGGA 2LQKA 1N8RC 2H3JA 1GCQC 2DL3A 1PSFA 1JRIA 4DOVA 4QVDA 4BDZA 1TUGB 2FRWA 1KQ1A 2RJDA 5I21A 3AT1B 1ZQ1A 1BKBA 2FB7A 4Y92A 1D1CA 5GAMh 1WHKA 1QP3A 1RACB 3MO8A 3OS2A 3E9FA 5GMKl 5J3BA 4M77C 5GAMf 2EVRA 1S72A 3JSCA 2SRCA 5D6YA 2FG0A 3KFVA 4J6WA 3EFSA 3P8HA 4PJOF 2HSEB 1QKXA 3PT9A 4MZMA 2P84A 2GTJA 3QYGB 3CXCA 4F7UF 2NYSA 3CMAA 2LTOA 4KUIA 4OMNA 5KH6A 1VQ6T 3A8MB 5GANe 5LJ5g 2FPDA 3BFMA 3CCJA 1K73R 1M3AA 3JCMh 4J7IA 5KYYB 2ZPGB 4M7AE 2ZAEA 2YRCA 1Y57A 2B86A 5KCOA 2ROLA 2DFUA 2KT8A 1XQHA 3JCMf 5GAOq 1WFWA 1UDLA 1WHGA 4DQ2A 3FC3A 2LQWA 5A0LA 1Q95G 3GIBA 1YI2T 3O5ZA 3EFRA 4HVVA 2HCKA 2F5KA 2BUDA 5GMKe 1SSFA 4MDWA 2DXCA 1VIFA 3G4ST 2FO0A 2DL4A 3CCRT 4CC3A 4KUDK 5D6WA 1Y7XA 2H3EB 1FX7A 2CZ0B 5GANd 1EFNA 2Y4YA 2LC4A 3CCUT 4F17A 1JU5C 5GMKi 4QT7A 4RTZA 2OAUA 2OI3A 3N5BB 1ZBJA 1I1JA 4DBQA 4EPCA 2WSEE 2K3YA 2XDPA 3EG9B 2E3IA 2KROA 4M78B 1Q81R 4JS5A 1VQNT 5AT1B 4FYWB 1VQ4Q 1N6AA 5CK9A 2MOXA 1D1BA 2NWMA 1YITA 4PKCC 2I0NA 3JCMX 5IHKA 3I9QA 2VGNA 3UATA 3L2UA 3G6ET 1TU0B 2CP0A 3A1PA 3QPHA 4PJLA 5IH2A 3EHRA 3E2UA 1NEBA 5LJ3j 1KQSA 1Q82C 4HCCA 3RMQA 1OEBA 1HK9A 4GY5A 4JZ4A 1WXUA 2LCLA 2YSQA 2QQSA 4NL2A 4M7DA 2EW3A 4OB2B 1NYFA 3OA6A 3X25B 3MP8A 1R77A 2ATCB 4ZGDB 3MKDA 4P5NA 1OI1A 2CZ7B 2R5MA 2Y90A 4C8QB 2CZ1B 2C0TA 1TUCA 2BIVA 3NGPA 2KGTA 1E6GA 4AG2C 1TS9A 4YTLA 5IAYA 4IIMA 2KE9A 2DZ9A 1ZSZA 4C5HA 2YRVA 2E1HA 1YBYA 3M0SA 2KDSA 5EC7A 4A63B 2HDAA 2A28A 2JNGA 2KAFA 3SHWA 1CKBA 2ZPIB 2DM1A 2E65A 3VS7A 4M7DC 4HT9A 1NJIU 3EG3A 4M78D 3M56A 3X20B 5IT9E 3FIFA 3TU4K 3JB9F 1YJWA 2RK1A 1H3HA 2YLBA 2EKHA 1U8RA 3CMAT 2QDYB 4C92C 5M9OA 3OYIA 4FYVB 3Q1JA 3GP8A 2RJCA 2OTLA 1KHIA 1X2KA 3CCJT 3OS1A 3X24B 1QVFS 4M78G 2DJQA 4QQGA 1IZ6A 1VQ9A 4ME7A 5KYXB 9ATCB 1M8MA 4ZTFA 4A4HA 2LZ6B 2LCCA 1JQQA 2V1QA 5FROA 3M9QA 2RPNA 4C8QD 3LWIA 2ZPFB 5DY9A 2ENMA 4FM4B 3CD6Q 2MWOA 2VXFA 1QCFA 4VUBA 2DXUA 5GJVB 3VS1A 3TSWA 2EWNA 5LJ3e 1Y96B 2D0NA 1XNIA 4CC7A 4HVWA 2KNBB 2X51A 2GBQA 1BIAA 4M75A 4C8QG 2P0QA 2E12A 1GCPA 2GTOA 4LDXA 4KGXB 3RESA 3MP6A 3OBYA 5A2QE 5LJ5j 2K2VA 1WXTA 4Y28E 1X6OA 5GANh 4O6JA 4JUVA 1N8RU 3M54A 3U23A 4NS5A 4OP0A 1YITT 1WX6A 3CC2A 5GANf 3C4SA 5IXBA 2DBMA 1K9AA 2HBWA 4LN2A 2QQAA 2DYIA 1VYTA 3LH5A 4E7JA 1VQKQ 3M4YA 3BY7A 4HVUA 5GJWB 5CQXA 3QBYA 4M75C 2AHJB 1IB8A 1CSKA 1YIJA 1UG1A 3EFOA 2RN8A 4C5EA 5GMKh 2RMOA 1OX9A 1YN8A 2LX9A 4BUGA 4J83A 1YWPA 4X9DA 3QJ6A 3M55A 3BE3A 1B7TA 2DPPB 2HNIA 2RQUA 5EG2A 2EYZA 4PL6A 2GF7A 3VS0A 3FJ5A 2E3HA 2VB6A 2RK2A 1VQ7A 2O4XB 2BE7D 2OJ2A 1QVGS 2KYMA 4XTZA 3HTRA 1BBZA 3NFCA 2MCNA 4CC2A 1N27A 2EIFA 3QKJA 2CZ6B 3JCMW 2G3RA 2NUPA 2ZCFB 4GLMA 1YJWT 2K2MA 1YI2Q 1G3WA 2E4HA 3JRZA 2RQWA 1M1KC 1ZUKA 2XICA 2ZZDA 2EQUA 2GFUA 4M78E 4B6MA 2OTLT 1VQ8A 2E64A 2QGGA 4KULA 3NPFA 3SWNA 3CMEQ 4PLIA 2PNIA 2HMAA 4M7AB 1D09B 3PIPA 4M7DF 4JPBW 1WYXA 2JW4A 1VQ9T 4E7IA 1QMCA 1AZGB 1QKWA 2D9TA 5LJ5e 1ZA1B 1VQLQ 4FW2A 1WNLA 1VQNQ 1NZ9A 1UB4A 2KQWA 5HK0A 3LH0A 4E2FB 3EGUA 2D8HA 1YJ9A 1JXMA 3C95A 3G6EQ 2LNHB 5C6SA 3I55A 4X9CA 2BZXA 3MEAA 1ZHIA 1JJ2S 8AT1B 5FU7B 1VQPQ 3QWXX 3UT1A 2RA2A 3JAME 3SWNC 2QEXA 2DLPA 3URGA 2MI6A 3CCMQ 5GAN3 1FYNA 2V8JA 1Q82U 2KK4A 3C0CA 2KR3A 2JTEA 1W70A 3QIIA 4OVAA 5KYWA 4E7KA 3CC2T 4XTVA 3C94A 3OYLA 2JS2A 1K76A 2VWFA 3CCQA 4RTVA 2LJ3A 4MMLA 5CKEA 2RF0A 4L6V5 2P4RA 3DLMA 2VGMA 2DTIA 5HY6A 3EG1A 4M7AD 3LW5E 4JRKA 2YXYA 1S72Q 1WQ7A 4XTUA 2XK0A 1RAGB 4A53A 3L2QA 1FMVA 4UC4A 1M3CA 1D3BB 1I5OB 1P92A 2CSIA 3EGXB 1OQKA 4X1VA 5IN1A 1T0JA 2NUTB 1AHJB 2HL3A 2I2LA 3PVLA 2R57A 1Q7YC 5LJ3g 3CCJQ 4M75F 2QGFB 3WXMB 1IXDA 2RI5A 1FMKA 2EYYA 1MMGA 2LT4A 2DF6A 5FWCA 2XG8D 3D7SB 2CP3A 4HCBA 5CAIA 2RD1A 1RADB 3V8KA 1AWOA 4WCIA 1X75C 4QVCA 2XHCA 3J7AF 3RNJA 1YHQA 2E6NA 1QCOA 3CBMA 2L89A 4QVZA 2F1LA 4JJBA 2PU9B 2AIRB 4J9GA 2D0QB 2FZGB 3OB9A 2KMTA 4HKEA 2O9VA 1B34B 1LOJA 4AFSC 4BI8B 1VQ8T 2PVGB 4N0AA 5AYFA 2LJ0A 1U06A 4XU0A 3OYGA 3CCVA 2CS7A 1AT1B 3JCMb 3ZBDA 4JJNK 1Q82R 1VYVA 4WTOB 2PUKB 3CCEQ 2RI3A 3H6ZA 3JB9D 2K4YA 2YHTA 2FHDA 3CC4A 2D1XA 1K9MR 2DD5A 2QQBA 1M90C 4PJOE 3CXCP 3HRUA 1X6GA 3A5ZB 1G5VA 1YJ9T 5KE3A 2E6ZA 3QSUA 1YITQ 3LGLA 4J7FA 4WF2A 2ED0A 1NPRA 4F7UE 2KRSA 3I55T 1M4ZA 1OYXA 1WHHA 3BW1A 3JB9G 4N0AC 2QEXT 4IUTA 3BDLA 1E7OA 2YUPA 5D6XA 1TTHB 3I56A 2LX7A 1VUBA 2RHYA 3L2RA 1K1ZA 3ULRB 1GFCA 3OW2S 1UFFA 4ELYC 1OPKA 3VUBA 4JS4A 2COZA 4NL3A 1X2QA 3CCQT 2E70A 2DNUA 4IUUA 2M51A 3HL8A 3EGDB 1MMDA 1M5Q1 1RAEB 1YJNT 2CUDA 1BI3A 5J26A 3ASKA 1UEBA 3OYEA 4EMKB 2MK5A 1D0ZA 5GAMg 1AWXA 1VIEA 1MMNA 4BI3A 2C0OA 1TWBA 1G8XA 3CC7Q 2J05A 4II1A 3OYKA 2HD0A 3OYNA 3CCSQ 1KQSP 3WVEB 4QQDA 2LNVA 2W0ZA 2LCSA 1RAIB 1M1KU 3BDUA 4DOWA 4Q5WA 3FLGA 4J6YA 5CR2A 1FMWA 2CT3A 2JN0A 1VQ5Q 3EH1A 1OOTA 2V1RA 1MV0B 2PTKA 7AT1B 2JT4A 2NLUA 1YHQT 1IRXA 3JCMg 1TXQA 4PJJA 1ZSZB 2A0FB 1KC8C 2E10A 3A98A 4A4FA 1YCYA 2IPOB 2DVJA 1X01A 2OTJT 4E7ZA 2EBPA 3O8VA 1IGQA 1MNEA 3OYCA 4ATOA 1PG5B 1BI2A 4KBMB 2PUOB 2LJ1A 3JCMQ 1KD1C 1UGPB 4XTWA 3CCVT 3G71Q 1TUDA 1UGRB 5CKHA 1G83A 2QTVA 3NTIA 1MGQA 3CCLT 3UWNA 1WJQA 1UHCA 1RABB 3FB9A 3OSSC 2RJEA 2KRMA 1VQOQ 4J9IA 3CC4T 1UUEA 2JUFA 2L3QA 4BY6B 3QG1A 2RO0A 2F2XA 2RB6A 2G6FX 1KIKA 3CC2Q 4LDYA 2M0YA 1Y07A 1WA7A 2DERA 1OZ3A 2QASA 3FRNA 1ZA2B 3L42A 5KYYA 4F14A 3OYAA 4M77E 3M0TA 2GQVA 4C92A 4QQ6A 2DKGA 1BK2A 1YIJQ 3I56T 2LP5A 1WHJA 3OYFA 4J5YA 3OY9A 2J7IA 4M7DG 3GOXA 2F2VA 2L3PA 2ZPEB 1Y71A 1M1KR 4AG1C 3FDRA 2FRYA 1MNDA 2RHXA 2K7AA 3M0RA 1YCSB 5FU6B 4HT8A 2QA4Q 4R0KA 5ECAA 4ZN1A 1Q86C 4FSXA 2FL7A 4PJNA 3V8JA 1PM3A 2YWWA 2RI2A 3RUXA 3M57A 4RTYA 2V26A 3JCMJ 4C0GA 5GAOm 1E6HA 1VQ7Q 2SEMA 1JB0E 4B9WA 4OMOA 1XTDA 1M2VA 2MPXC 2WACA 4M77F 3JB9I 2L0AA 4D8DA 2XD0A 1H92A 2Y4XA 4FYXB 3DB3A 1H3ZA 3MJXA 3HHTB 3CEYA 2JTFA 2EYQA 6AT1B 1V29B 4Y91A 3GNFB 3CPWP 2DBKA 2KT1A 2KXDA 1RI0A 2DL7A 3T9NA 5KE2A 2PVDB 3MHXA 1VYUA 1W1FA 2M0OA 1BIBA 4L59A 1B3QA 2EPDA 2DD4A 2HL5C 1K73C 2EAYA 2LVMA 3HKSA 4M78C 2EYWA 4C8QA 3OBWA 1X6BA 5GAOn 2DL8A 4CRIA 4Z02A 1TSFA 1T3SA 4RTTA 1HSQA 2VKNA 4N4GA 4A54A 2X3WD 2ZPBB 3VKIA 2AZVA 2DRMA 2DX1A 3QDRB 3MCAB 1SHGA 1TG0A 3QDFA 3F70A 2CP5A 2X4YA 5GAMj 4K11A 1GL5A 3PTAA 3M53A 2P0PA 4HA8A 1NBEB 1UJYA 2ABLA 1AZEA 1WDXA 1YNZA 3OMCA 2DJZA 2X4WA 4BE0A 1RL2A 5KYUB 2VVKA 2KRNA 2ED1A 2VC8A 4E47A 5KCHA 2JTMA 2JJ9A 3NHNA 3CPWA 1UJ0A 3JCMc 1BCMA 1PD0A 4C8QC 1ZX6A 5LJ3d 3EH2A 1FWZA 4A4GA 1NJIR 2AK5A 4PJOB 3QJYA 2A7YA 2VASA 2VYTA 1PRLC 1Q81C 1RI9A 1QVFP 1HD3A 4PFOA 4F7UB 1AVZC 1SRMA 5FRMA 4NOYA 4D8KA 4JDSA 1VQMA 1SG5A 5KYXA 2M9UA 4N4IA 2MF2A 5IXFA 2MAMA 2HEQA 4M7DE 1VQ6Q 2L3SA 3LX7A 3REBB 1H641 4OGEA 3VYHB 2RNAA 4ZN3A 1UGVA 3E9GA 2EQMA 2L2PA 4KH0B 5GAOr 1NEGA 2COYA 3G7ZA 3VUZA 3ZFJA 3RKWA 3UPUA 2LMJA 3SB2A 1T3LA 1WHMA 5CCAA 2DTHA 1NPPA 3KBGA 4RKUE 4CI0C 2XDBA 2O01E 3RDVA 1Z9QA 5LL6S 2X9HA 2QYZA 3TQ7P 4Z88A 2A08A 4FU6A 3H9NA 5FW9A 3G4SQ 1ZUUA 1SEMA 4AMCA 3CCRQ 1QVFA 1IHVA 4TVRA 4ZGJB 2CGHA 2KY9A 3CCUQ 2HAXA 4C0DB 1YWOA 4PJOD 5GAMe 1N8RR 3QYHB 1QWFA 2DIQA 3QO3A 1AD5A 2DAQA 2P0KA 4C92F 5DLOA 3ZEHA 3SEMA 1RLQC 4PFZA 4J6XA 4FIBA 3MPUB 1ZBXA 4E6RA 4GLKA 1HXDA 3OYJA 1KD1U 1I0CA 4PJOG 2X35A 3PE0A 2IG0A 3CC4Q 2DILA 4AFUC 4BB7A 4IUQA 5KYNA 2MYSA 2QQ9A 3OYYA 4F7UG 1RUWA 2DEUA 2X4XA 3S3OA 3JCMe 3MP1A 4XU2A 2RQVA 1I4K1 1LPLA 2E41A 3CBPA 1MV3A 5LJ5d 4RCCA 5CKDA 5GAN8 1VQ4T 2EJ9A 1IHWA 4M75E 1U3OA 2RJFA 2JM8A 2EYXA 3OYBA 1D0XA 3HP9A 2X3XD 3I56Q 1TH7A 3TEEA 5GMKm 3OYDA 3OQ5A 2D8JA 1VQKA 2YRDA 3VJPA 1YJNA 1BB9A 2EQIA 2GFAA 3NMZC 4F16A 2MIOA 1KSWA 1G2BA 3OS5A 5IHIA 2QDLA 3H0HA 2RHIA 4XAXB 2PVOB 2XIDA 4J9DA 2GNCA 1M27C 4PFPA 5LJ3h 4M7AA 1JO8A 1VQMT 2WSCE 3GNGA 4M77B 2L5QA 3CMAQ 4LXCA 3CXCS 5LJ3f 2XI9A 4C8QF 1Q86U 4IURA 3V7RA 3JB9J 2JS0A 1WGSA 4XU3A 2K57A 4RG2A 1ARKA 2EJFA 1PCXA 1A0NB 2DXBA 5CKFA 3L1AA 4KH1B 2QI2A 2J6FA 2DL5A 1BI1A 1U5SA 2DVEA 2DIGA 2KVQG 2WSFE 1KD1R 4M7AC 1JEGA 3PIOA 5FWBA 4N4HA 2CREA 2CP2A 2OTJA 4FT2A 1RAFB 3OMGA 2KBTA 4ORZA 3X26B 1C0MA 2W10A 5GAN6 2HQHA 4LD6A 4C5GA 2XU8A 4R56A 3H0FA 3PFSA 5GAOp 3CMEA 2J6KA 3M4GA 3WVDB 1W6XA 2HZYA 3DLLA 3CCLA 4RG8A 2Z0WA 1VQLA 3LYIA 4PJMA 1F1BB 2EQKA 3QZ5B 3CPFA 1G3YA 2V8IA 3S3MA 2FYKA 3VRYA 5J39A 4M77D 1H8KA 3UA7A 3PMTA 3VYGA 3M0PA 5GMKj 5I2SA 3EG2A 1D3BA 2PZ1A 1JJ2A 3UA6A 3EGXA 1KQSS 1VQPA 1RLPC 1IO6A 4Z8AA 5A0GA 1IREB 3VRZA 2R5AA 1XOVA 4AFZC 4GBQA 2NUTA 1X27A 4J9BA 2VUBA 3CCMA 5HK3A 4DBFA 4M77G 4AFQC 3LLRA 1BI0A 2HSPA 1EZZB 2O88A 1DJ7B 1GRIA 1Q86R 2QK0A 4J9FA 1NE8A 3VS3A 1Q81U 1WXBA 2CH4W 2KYBA 4KGVB 3J80E 1UTIA 2YLCA 1WJRA 1TOVA 1V1CA 2DYBA 2P4TA 1UE9A 5LJ5h 1VQKT 5GAN5 4C0ZA 2FVUA 1W4SA 3TSZA 5LJ5f 1B34A 3OYMA 1IGUA 2QQRA 4PK4A 1ZLMA 4HXJA 1OULA 2BTTA 2DK3A 3J81E 1YJWQ 4BE1A 3QHSA 2PQWA 1W2BP 3V7CA 2DO3A 4AT1B 2AZSA 2JMCA 1D1AA 5CIUA 2OTLQ 1M9SA 4PNOA 4M7DB 2ECZA 2A36A 2EKOA 2J6OA 3A8HB 4LDVA 2D6FA 1UHFA 2CP7A 2RM4A 2K5IA 2QTXA 3HRSA 1FXXA 3HRTA 2K3XA 3META 1VQ9Q 4C92B 3JB9H 2K3BA 4C5IA 4QW2A 3I5RA 1OPLA 2FZKB 2F2WA 2LDMA 1BYMA 4LNPA 2DETA 1I81A 4FW1A 3IQLA 4ZTJA 2IIMA 3VV0A 3HFNA 1ZUYA 4JJCA 1K8AC 2MWPA 4MZTA 1PC0A 1EX4A 1PKSA 4R55A 2E5QA 4OF1A 1R0BG 2XMFA 2DE0X 3UF4A 3OW2P 1LCKA 5GAN7 3CMET 5D7UA 2LQ8A 3OS0A 1U1SA 4XTYA 1JBMA 4HCKA 1W2BA 1OV3A 1QLYA 3V8LA 3CCEA 1ABOA 4FL6A 4LE9A 4M7AF 2F5TX 1VQLT 3EGDA 2RQRA 1M2VB 1K4US 1QP2A 2C0IA 3RKXA 3E19A 3HPWA 2M1HA 4Z89A 4JZ3A 4X34A 2O31A 3VS4A 4BI4A 4RMOA 3GF5A 2K5LA 2K5FA 4EMKA 1UECA 4BD3A 4M7DD 2HKNA 5IHNA 3M58A 4JJDA 3VS2A 5FRNA 3RR6A 2EGAA 3SFMA 3A8GB 2DA9A 3CPWS 1VQPT 3VS6A 3LWHA 2AKLA 3SDZA 2L8DA 1OX8A 1G3SA 1QVPA 2YUNA 2ZPHB 4OB0B 4KT0E 4C92D 2L3RA 3CCMT 1KJWA 3M0QA 4EMGA 1C6VX 2LT1A 1K9MC 3OW2A 4RUGA 1O75A 2ESWA 3FJPA 1VQMQ 8ATCB 4M75B 4O5VA 2BE9B 2RH2A 2CYZB 2KEAA 4EMKC 2RHZA 4JRQA 3H41A 3H0IA 2CSQA 3I5SA 4C92G 1PHTA 3S3NA 1PKTA 5HCKA 3M59A 3GPLA 3RMSA 2R58A 5A0DA 2DZCA 1Q7YU 1S72T 1OZ2A 2K79A 3EG9A 4M78A 4RCBA 3JCMP 3I35A 5DLQE 5GAN2 2DRKA 4DEXA 3RIRA 3CC7A 3G1JA 1M1GA 4DBRA 1UGSB 4DA4A 4ZGEB 1WJSA 1VA7A 2RHUA 1JXOA 3EFOB 1VQ8Q 3CCSA 3CQTA 3THKA 1ZSZC 2FPEA 4OMPA 4KRTA 3A8LB 5CO7A 2EGCA 3MEUA 3JCMV 1VQ5A 1I8FA 2DMOA 2F69A 3R6NA 4BDYA 1GBQA 5GAN4 2YUQA 4XTXA 1BU1A 3RERA 4JRIA 4A4EA 4L5GA 1LVKA 1ACMB 3RBBB 3M0UA 1PRMC 1AWWA 2H8HA 4MDXA 3GBQA 3R6OA 1YJ9Q 5I2MA 1SPKA 2VV5A 4M75D 3EAEA 1WI7A 1YP5A 3I55Q 2DTOA 1M90U 4IKFA 4ESRA 4V2SA 3VS5A 1Y0MA 2FZCB 2NUPB 1VQ4A 3G71A 1RAHB 2EGEA 3KUFA 4XK8E 2QEXQ 1K0SA 4BY6C 3CCET 4MZPA 2EJGA 1NLOC 3C12A 4M75G 1VQOA 3INZA 5DM7R 4EDUA 3SD4A 1PWTA 2X4JA 4BACA 1KG1A 1LNXA 2COWA 2JOYA 1J3TA 3SWNB 2XDDA 1XJWB 4E7HA 3E1SA 1SRLA 2JVVA 2CP6A 1N9RA 3CCQQ 3L2WA 3L2VA 1YFNA 4LUDA 5GANg 1Q7YR 4ANJA 4ZNXA 4LD9K 4LUEA 1YJNQ 1SSHA 1SKUB 4B9XA 3JV3A 1KFZA 1X69A 2IVWA 4J9HA 3MEWA 4OMFB 1X43A 4LDWA 5FU6C 1B07A 3X28B 1PD1A 2FEIA 3M5AA 4E7SA 2BKDN 1WHLA 1M8VA 2NUZA 4C92E 4EIKA 1GBRA 2M02A 1MMAA 2V8KA 1I07A 1Y96A 4FSSA 2FPFA 2KSSA 1QW1A 2QA4A 1S1NA 4ELZC 5C0MA 1SF9A 2CUBA 2J06A 1U1TA 2ROTA 2GCXA 3EHQA 5KYWB 4RTXA 1ABQA 3H8ZA 3GLXA 2EFIA 4FYYB 1YHQQ 1PSEA 5GAOl 4FCYA 1MHNA 2LQNA 3TVTA 3CC7T 3FEOA 1M90R 1GFDA 2OTJQ 5KYUA 1KC8U 1R8OB 4QKUA 3CCST 3KXTA 2O2OA 3LGFA 1K8AU 3CCVQ 4F04B 4PJOA 2MMPA 2JZ2A 2DXTA 1VQ5T 1PNJA 3CD6A 4HCZA 3A8OB 1AEYA 1CKAA 3HFOA 3CCLQ 1NLPC 4F7UA 4CC4B 5CKBA 4MMKA 2AKKA 2OAWA 2YDLA 1KHCA 2HQXA 4J9CA 1BCOA 1WIEA 2CT4A 4OMMA 1SHFA 1R0CB 3S6WA 5GAMd 4C8QE 2AT1B 2KXCA 2QXFA 3AHUA 4JRPA 3TCJA 2GQIA 3NTKA 4J9EA 3G71T 1QWEA 5L8RE 1QVGP 4M78F 4PJOC 2O4XA 1UGQB 1NG2A 1HJDA 1V76A 1NM7A 1VQOT 3EG0A 3PVQA 1NYGA 2K9GA 2HKQB 4M4ZA 4A4KA 2GGRA 4D6WA 1OU8A 2B8AA 3PMIA 1K0XA 4IUVA 2YT6A 2A37A 3MEVA 2JXBA 1K9MU 4JLGA 4OGCA 1VOMA 1D0YA 1EIFA 5CQYA 2BZYA 2QG9B 3JCMd 4XQ3A 3VU3C 4OMLA 2JMAA 4FT4A 1WLPB 3QWYA 3PNWC 2ZGWA 3REAB 3ME9A 1WPYA 1T0HA 2O9SA 1YIJT 1VQ6A 5L23A 4KGZB 5I22A 3HSBA 4LDUA 1M1FA 2M16A 3CBOA 2BZ8A 2HBPA 4E7LA 1NJIC 1GXIE 4OMQA 1Z9ZA 2KI7A 1KC8R 5CVIA 4J8OA 2LRQA 3QXEB 4RTWA 1QVGA 1I5LA 2OX7A 1KQ2A 2HQEA 1N9SA 2JM9A 1K8AR 2DEQA 1RAAB 2VXEA 4M7AG 1HYOA 1JJ2P 2QA4T 1AOJA 1AWJA 1O9SA 3OSVA 3OYHA 1WZOA 1YI2A 4EMHA 4IUPA 4C0DC 2C06A 2K6DA 2CH4A 4PLLA 1M3BA 1ZSGA 3QUIA 1VQ7T 1WQWA 4C0FA 3G4SA 1QCNA 3CCRA 3P8DA 3UDCA 5GANj 2QAZA 3L2ZA 1OU9A 3CCUA 3NTHA 1G3TA 3ER0A 1K73U 3DB4A 1GCQA 5I11A 5HKCA 3QZ9B 4OB1B 3RKYA 4IIOA 1VQNA
chains in the Genus database with same CATH topology
3TREA 4C8QA 3OBWA 1NZ9A 5GAOn 1UB4A 2KQWA 5FU7C 4CRIA 5HK0A 2XKOC 4Z02A 3V7SA 5GAN7 3CMET 2LQ8A 4N4GA 3LH0A 3OS0A 1U1SA 4A54A 4XTYA 3DKMA 2ZPBB 1JBMA 1YJ9A 1W2BA 3VKIA 3CD6T 3QDRB 2EQJA 3C95A 3CCEA 3MCAB 3V8LA 1W2BS 3G6EA 2A3LA 4JLIA 3F70A 4FL6A 5FLXE 5C6SA 2F5TX 2X4YA 4X9CA 5GAMj 2CKKA 3MEAA 3I55A 1VQLT 4M7AF 3P8BB 1ZHIA 4XU1A 3PTAA 1LJOA 3M53A 2P0PA 4HA8A 1JJ2S 1QP2A 5FU7B 3RKXA 3UT1A 3E19A 2RA2A 3HPWA 3JAME 3SWNC 4M77A 2QEXA 4OB3B 2M1HA 4BE2A 3PGGA 4X34A 2LQKA 3URGA 4BI4A 2MI6A 1N8RC 3OMCA 3GF5A 2H3JA 4RMOA 2DJZA 2X4WA 2K5LA 2K5FA 4EMKA 4BE0A 1PSFA 1JRIA 1RL2A 4DOVA 4BD3A 4QVDA 2VC8A 4E47A 5GAN3 4BDZA 4M7DD 1KQ1A 3M58A 2JTMA 2RJDA 2V8JA 5KCHA 5I21A 1Q82U 5FRNA 3SFMA 3CPWA 3A8GB 3JCMc 2KK4A 3CPWS 4C8QC 5LJ3d 1VQPT 1ZQ1A 3LWHA 1FWZA 3QIIA 4OVAA 3SDZA 3RKYA 4A4GA 2L8DA 1G3SA 1BKBA 1QVPA 4PJOB 2ZPHB 2FB7A 4E7KA 4OB0B 4KT0E 3QJYA 3CC2T 2A7YA 2VYTA 3C94A 4XTVA 4C92D 3OYLA 2L3RA 3CCMT 1Q81C 3CCQA 4EMGA 4MMLA 2LT1A 5CKEA 4L6V5 5GAMh 4F7UB 1K9MC 3DLMA 1QP3A 2DTIA 2VGMA 3MO8A 3OS2A 3E9FA 4NOYA 3OW2A 5FRMA 1O75A 5GMKl 4JDSA 5J3BA 3FJPA 5HY6A 1VQMA 4M7AD 4M77C 5GAMf 3LW5E 4JRKA 1S72A 2M9UA 4M75B 2MF2A 3JSCA 4N4IA 1WQ7A 2MAMA 4O5VA 4M7DE 2RH2A 5D6YA 2CYZB 4XTUA 4EMKC 2RHZA 4JRQA 2XK0A 4A53A 3L2QA 4J6WA 3LX7A 1H641 4C92G 4OGEA 3EFSA 3P8HA 4UC4A 3PT9A 4MZMA 1D3BB 4PJOF 3VYHB 3S3NA 1P92A 4ZN3A 3M59A 3E9GA 2EQMA 3GPLA 3RMSA 5IN1A 2R58A 5A0DA 5GAOr 2DZCA 3G7ZA 3QYGB 1Q7YU 1S72T 3CXCA 4F7UF 3CMAA 2LTOA 4KUIA 1OZ2A 3VUZA 3ZFJA 3RKWA 1AHJB 2I2LA 5KH6A 3UPUA 1VQ6T 3A8MB 5GANe 2R57A 4M78A 1Q7YC 3SB2A 5LJ5g 4RCBA 3BFMA 3CCJA 5CCAA 5LJ3g 3JCMP 2DTHA 1NPPA 3KBGA 4RKUE 3JCMh 4J7IA 4M75F 3WXMB 4CI0C 2ZPGB 2XDBA 5DLQE 5GAN2 2RI5A 4M7AE 2O01E 3RIRA 2LT4A 5LL6S 3CC7A 2XG8D 1M1GA 5KCOA 1UGSB 4DA4A 4ZGEB 1WJSA 4HCBA 3JCMf 1XQHA 5GAOq 5CAIA 2RD1A 3V8KA 4DQ2A 4FU6A 1X75C 4QVCA 2RHUA 2XHCA 3J7AF 3FC3A 1YHQA 3CCSA 2XD0A 2E6NA 1QVFA 3CBMA 2L89A 4QVZA 5A0LA 4TVRA 2PU9B 4ZGJB 3GIBA 1YI2T 2CGHA 2KY9A 3A8LB 2D0QB 5CO7A 3EFRA 3MEUA 2HAXA 3OB9A 4C0DB 2KMTA 3JCMV 4HKEA 1VQ5A 1I8FA 2F69A 2F5KA 4PJOD 1B34B 2BUDA 5GMKe 1LOJA 4BDYA 1SSFA 4MDWA 5GAMe 4BI8B 2DXCA 1VIFA 3QYHB 3G4ST 2DIQA 1VQ8T 3QO3A 3CCRT 4KUDK 5GAN4 2DAQA 5D6WA 2P0KA 2PVGB 1Y7XA 4C92F 5DLOA 4N0AA 4XTXA 3ZEHA 5AYFA 1FX7A 2CZ0B 3RERA 4JRIA 4A4EA 4XU0A 2Y4YA 4L5GA 5GANd 4J6XA 2LC4A 4FIBA 3OYGA 3CCUT 2CS7A 3CCVA 4MDXA 5GMKi 3JCMb 3R6OA 3ZBDA 4JJNK 2OAUA 5I2MA 3N5BB 1ZBXA 2VV5A 4M75D 2PUKB 4EPCA 4GLKA 2WSEE 3EAEA 2RI3A 2K3YA 1HXDA 3H6ZA 3OYJA 3JB9D 2K4YA 2XDPA 2YHTA 1KD1U 4PJOG 2FHDA 2DTOA 2X35A 4M78B 1M90U 4JS5A 1VQNT 3CC4A 4IKFA 2IG0A 4V2SA 4BB7A 4IUQA 2DD5A 1VQ4A 2QQBA 3G71A 1M90C 4PJOE 2QQ9A 3KUFA 3HRUA 4XK8E 3OYYA 4F7UG 4BY6C 1N6AA 3A5ZB 5CK9A 1G5VA 1YJ9T 5KE3A 1YITA 2E6ZA 4PKCC 3QSUA 2X4XA 3JCMX 3LGLA 3CCET 2VGNA 3G6ET 4J7FA 3MP1A 4MZPA 4WF2A 3JCMe 3L2UA 3S3OA 4XU2A 1NPRA 2EJGA 4F7UE 3I55T 1I4K1 3C12A 1M4ZA 4M75G 2E41A 3INZA 1VQOA 3QPHA 1OYXA 3CBPA 3SD4A 2X4JA 4EDUA 5LJ5d 5DM7R 4BACA 3BW1A 1LNXA 5LJ3j 3JB9G 4N0AC 1KQSA 4RCCA 5CKDA 2JOYA 5GAN8 1Q82C 4HCCA 3RMQA 2EJ9A 3SWNB 2QEXT 4IUTA 4M75E 1VQ4T 3BDLA 2RJFA 2XDDA 1HK9A 4GY5A 4E7HA 3E1SA 3OYBA 2LCLA 4NL2A 2JVVA 2QQSA 5D6XA 4M7DA 1N9RA 4OB2B 3HP9A 3L2WA 3I56A 3OA6A 3L2VA 1TH7A 3X25B 1VUBA 3MP8A 3TEEA 5GMKm 4ZGDB 5GANg 2RHYA 4P5NA 3OYDA 1OI1A 3OQ5A 3L2RA 2CZ7B 2R5MA 1VQKA 4LD9K 2Y90A 3VJPA 2CZ1B 4C8QB 1YJNA 2GFAA 3OW2S 2BIVA 4ELYC 3VUBA 4B9XA 4JS4A 4NL3A 2IVWA 4YTLA 3OS5A 5IAYA 3MEWA 4OMFB 2RHIA 2E70A 3CCQT 4XAXB 2PVOB 4LDWA 4IUUA 2XIDA 5FU6C 2DZ9A 3X28B 3HL8A 4C5HA 1M5Q1 3M5AA 2YRVA 2E1HA 1YBYA 2BKDN 5LJ3h 1YJNT 4M7AA 2KDSA 1M8VA 1BI3A 5J26A 4C92E 1VQMT 2WSCE 3GNGA 4M77B 2JNGA 2L5QA 2KAFA 2V8KA 2ZPIB 3ASKA 1UEBA 3OYEA 3CXCS 5LJ3f 2XI9A 2E65A 4EMKB 4C8QF 1Y96A 1Q86U 5GAMg 4M7DC 4IURA 2KSSA 1VIEA 4HT9A 1QW1A 3V7RA 2QA4A 1NJIU 3JB9J 1WGSA 4M78D 4XU3A 4ELZC 5C0MA 3M56A 3X20B 5IT9E 3FIFA 4BI3A 3TU4K 3JB9F 1YJWA 1U1TA 2K57A 2RK1A 2GCXA 2YLBA 1U8RA 3CMAT 2QDYB 3H8ZA 4II1A 4RG2A 2EJFA 4C92C 5M9OA 3OYIA 3Q1JA 3GP8A 2RJCA 2DXBA 3OYKA 5CKFA 3GLXA 3L1AA 2OTLA 1KHIA 2EFIA 2HD0A 3OYNA 2QI2A 1PSEA 3CCJT 3WVEB 5GAOl 4QQDA 3OS1A 2LNVA 3X24B 1QVFS 1M1KU 1BI1A 3BDUA 1MHNA 4DOWA 4Q5WA 2DVEA 2DIGA 3FLGA 2KVQG 2WSFE 4J6YA 5CR2A 4M7AC 3CC7T 4M78G 3FEOA 3PIOA 2JN0A 4QQGA 4N4HA 1IZ6A 1VQ9A 4ME7A 2OTJA 4FT2A 4ZTFA 4A4HA 1KC8U 1R8OB 3OMGA 2NLUA 1YHQT 3JCMg 2LCCA 3KXTA 3CCST 3X26B 5FROA 5GAN6 3M9QA 4LD6A 4C5GA 2XU8A 4R56A 1KC8C 3PFSA 2E10A 3LGFA 5GAOp 4C8QD 4A4FA 3CMEA 1YCYA 1K8AU 1KG1A 3LWIA 4PJOA 2ZPFB 2MMPA 5DY9A 2JZ2A 2DXTA 1VQ5T 3M4GA 3WVDB 3CD6A 1X01A 4FM4B 3DLLA 2OTJT 2MWOA 2VXFA 4HCZA 4VUBA 2DXUA 3A8OB 3O8VA 3CCLA 3HFOA 2EWNA 3OYCA 4RG8A 5LJ3e 1Y96B 4ATOA 4F7UA 1VQLA 1BI2A 3LYIA 4KBMB 1XNIA 2PUOB 2EQKA 5CKBA 3QZ5B 4MMKA 3CPFA 1G3YA 3JCMQ 1UGPB 1KD1C 4XTWA 2V8IA 3S3MA 3CCVT 1UGRB 2FYKA 1BIAA 4M75A 5J39A 4M77D 5CKHA 4C8QG 1KHCA 2HQXA 2P0QA 3NTIA 1MGQA 2E12A 3PMTA 3CCLT 4LDXA 3UWNA 3VYGA 1WJQA 3RESA 3MP6A 3OBYA 5A2QE 5GMKj 3FB9A 3S6WA 3OSSC 1D3BA 2K2VA 2RJEA 5I2SA 4C8QE 5LJ5j 5GAMd 3CC4T 1JJ2A 2QXFA 4Y28E 3AHUA 4JRPA 1X6OA 3TCJA 5GANh 4O6JA 1KQSS 3NTKA 4JUVA 1VQPA 3M54A 3G71T 1N8RU 2JUFA 5L8RE 5A0GA 1IREB 2R5AA 3QG1A 4M78F 1XOVA 4NS5A 4BY6B 4PJOC 2O4XA 2RO0A 2RB6A 4OP0A 1YITT 1UGQB 3CC2A 5GANf 4LDYA 2VUBA 1Y07A 3C4SA 3CCMA 5HK3A 4M77G 1OZ3A 3FRNA 3LLRA 2QQAA 1VQOT 3L42A 1BI0A 4E7JA 3M4YA 3OYAA 1DJ7B 3BY7A 4M77E 1NE8A 4A4KA 2GQVA 4D6WA 4C92A 5CQXA 1Q81U 3QBYA 4QQ6A 2B8AA 2DKGA 4M75C 3PMIA 2AHJB 2YLCA 3J80E 1WJRA 4IUVA 1YIJA 3MEVA 3I56T 1K9MU 4JLGA 4OGCA 4C5EA 1EIFA 2P4TA 5CQYA 5GMKh 5LJ5h 3JCMd 4XQ3A 1VQKT 3OYFA 3VU3C 4J5YA 5GAN5 4C0ZA 3OY9A 2FVUA 4FT4A 4M7DG 1W4SA 3GOXA 2LX9A 4BUGA 2ZPEB 4J83A 4X9DA 3PNWC 3QJ6A 5LJ5f 1B34A 2ZGWA 3OYMA 1Y71A 3ME9A 3FDRA 3M55A 1WPYA 2QQRA 2DPPB 1YIJT 1VQ6A 2HNIA 2RHXA 4HT8A 5FU6B 5EG2A 4LDUA 4ZN1A 1Q86C 1M1FA 4FSXA 4PL6A 2M16A 3CBOA 2FL7A 2DK3A 2HBPA 3V8JA 2GF7A 3J81E 4E7LA 1NJIC 1GXIE 4BE1A 2RI2A 2PQWA 3QHSA 3M57A 3RUXA 2RK2A 5CVIA 4J8OA 3V7CA 2DO3A 2LRQA 3JCMJ 3QXEB 4C0GA 1QVGA 1I5LA 5GAOm 1VQ7A 1KQ2A 2O4XB 2HQEA 1JB0E 1N9SA 5CIUA 1QVGS 2DEQA 4XTZA 4B9WA 1M9SA 2VXEA 4PNOA 4M7AG 3NFCA 4M7DB 1XTDA 2QA4T 2WACA 2EKOA 3A8HB 4M77F 4LDVA 3JB9I 1N27A 1O9SA 2EIFA 3QKJA 2D6FA 3OSVA 2CZ6B 3OYHA 2RM4A 2K5IA 3JCMW 2G3RA 2QTXA 2ZCFB 3HRSA 1FXXA 4IUPA 4EMHA 2Y4XA 1YI2A 1YJWT 3DB3A 2K3XA 1G3WA 3HRTA 3JRZA 1H3ZA 4C0DC 1M1KC 2C06A 3HHTB 3CEYA 3META 4PLLA 4C92B 3JB9H 2XICA 2JTFA 2ZZDA 4C5IA 4QW2A 3QUIA 2EQUA 1VQ7T 2GFUA 1WQWA 2EYQA 2LDMA 4M78E 1V29B 2OTLT 4C0FA 3G4SA 4Y91A 1BYMA 3GNFB 1VQ8A 2E64A 4KULA 3CCRA 3P8DA 3UDCA 1I81A 5GANj 3L2ZA 4ZTJA 1RI0A 3SWNA 4PLIA 3CCUA 4M7AB 3T9NA 3NTHA 5KE2A 3VV0A 3PIPA 4M7DF 2PVDB 1G3TA 3ER0A 3HFNA 3MHXA 1K73U 1VQ9T 3DB4A 4E7IA 1K8AC 5HKCA 2M0OA 2MWPA 1BIBA 2D9TA 4L59A 5LJ5e 4MZTA 2DD4A 1K73C 3QZ9B 2EAYA 2LVMA 2E5QA 4OB1B 4R55A 3HKSA 4M78C 4OF1A 3HSBA 1WNLA 1VQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q A;  1M5Q 1;  5CAI A;  2RD1 A;  5GAN f;  5GAO n;  3V8K A;  4DQ2 A;  2E1H A;  5LJ3 h;  3V7S A;  4QVC A;  5GAN 7;  4M7A A;  1M8V A;  4C92 E;  4M77 G;  4M77 B;  1U1S A;  4A54 A;  4XTY A;  1JBM A;  3GIB A;  5LJ3 f;  3V8L A;  2E65 A;  4EMK B;  2CGH A;  4C8Q F;  1Y96 A;  3BY7 A;  4M77 E;  3EFR A;  4JLI A;  5GAM g;  4M7D C;  4HT9 A;  4M7A F;  3V7R A;  3JCM V;  4X9C A;  4C92 A;  5GAM j;  3JB9 J;  1I8F A;  4M78 D;  4M75 C;  2DKG A;  4XU3 A;  4XU1 A;  1LJO A;  4PJO D;  1B34 B;  2YLC A;  4HA8 A;  1LOJ A;  5GMK e;  3FIF A;  5GAM e;  3RKX A;  3JB9 F;  1U1T A;  2K57 A;  2RA2 A;  3SWN C;  4M77 A;  2YLB A;  3QO3 A;  3PGG A;  5GAN 4;  5GMK h;  4C92 F;  4C92 C;  5LJ5 h;  4N0A A;  3JCM d;  2EJF A;  4XQ3 A;  4XTX A;  2DJZ A;  3VU3 C;  4EMK A;  3RER A;  4J5Y A;  4JRI A;  5GAN d;  4XU0 A;  1JRI A;  5GAN 5;  4M7D B;  4J6X A;  4QVD A;  3L1A A;  4M7D G;  2VC8 A;  5GAN 3;  4X9D A;  5GMK i;  1KQ1 A;  3JCM b;  3JCM f;  5GAO l;  4M7D D;  5I21 A;  5LJ5 f;  1B34 A;  2ZGW A;  3JCM c;  4M75 D;  1WPY A;  3BDU A;  4C8Q C;  5LJ3 d;  1HXD A;  2DVE A;  2HNI A;  3JB9 D;  2YHT A;  4J6Y A;  4HT8 A;  4M7A C;  4M78 G;  4PJO G;  2JN0 A;  2DTO A;  4M78 B;  4PJO B;  2FB7 A;  4V2S A;  4XTV A;  4C92 D;  3V8J A;  4EMG A;  4PJO E;  3QHS A;  4MML A;  3RUX A;  3JCM g;  4F7U G;  3V7C A;  5GAM h;  4F7U B;  3JCM J;  5GAN 6;  4OP0 A;  1I5L A;  5GAO m;  1KQ2 A;  3QSU A;  3JCM X;  2DTI A;  2E10 A;  4NOY A;  1N9S A;  4WF2 A;  3JCM e;  5GAO p;  4C8Q D;  2DEQ A;  4XTZ A;  1YCY A;  2VXE A;  4PNO A;  4XU2 A;  4F7U E;  2EJG A;  5GMK l;  3FJP A;  5DY9 A;  1I4K 1;  4M7A G;  4PJO A;  4M7A D;  4M77 F;  2DXT A;  4M75 G;  3M4G A;  2E41 A;  3INZ A;  4JRK A;  4M77 C;  4M75 B;  5GAM f;  3JB9 I;  5LJ5 d;  1WQ7 A;  1X01 A;  2RM4 A;  3BW1 A;  1LNX A;  5LJ3 j;  3JB9 G;  4N0A C;  4M7D E;  2VXF A;  2QTX A;  4RCC A;  4EMH A;  4XTU A;  2DXU A;  4EMK C;  5GAN 8;  3JCM W;  3HFO A;  2EWN A;  2EJ9 A;  3SWN B;  4A53 A;  4M75 E;  4J6W A;  1Y96 B;  5LJ3 e;  4F7U A;  1H64 1;  1HK9 A;  4C92 G;  3EFS A;  4PJO F;  4C92 B;  3JB9 H;  1D3B B;  4MMK A;  3JCM Q;  3QUI A;  4NL2 A;  1WQW A;  4XTW A;  4M7D A;  1N9R A;  4M78 E;  4Y91 A;  2FYK A;  5GAO r;  1TH7 A;  2E64 A;  1BIA A;  4M75 A;  5GMK m;  5GAN g;  2DZC A;  4M77 D;  1I81 A;  4F7U F;  5GAN j;  4C8Q G;  3L2Z A;  2Y90 A;  3RKW A;  4C8Q B;  1MGQ A;  2I2L A;  3SWN A;  5GAN e;  4M78 A;  4M7A B;  3RES A;  3SB2 A;  5LJ5 g;  4M7D F;  4RCB A;  5GMK j;  3FB9 A;  3BFM A;  3HFN A;  1D3B A;  5LJ3 g;  5LJ5 j;  5GAM d;  4C8Q E;  2DTH A;  4NL3 A;  3JCM h;  3JCM P;  4M75 F;  3AHU A;  5GAN h;  4M7A E;  1BIB A;  5GAN 2;  5LJ5 e;  4JUV A;  3RIR A;  2DZ9 A;  2EAY A;  4M78 F;  4M78 C;  4PJO C;  3RKY A;  3HSB A;  1WNL A;  2RB6 A;  5GAO q; 
#chains in the Genus database with same CATH topology
 3TRE A;  5FU7 C;  2XKO C;  3V7S A;  2CDT A;  1QQJ A;  3DKM A;  3CD6 T;  2EQJ A;  1W2B S;  4DEY A;  3G6E A;  2E5K A;  2A3L A;  3ZL7 C;  4JLI A;  1M30 A;  5FLX E;  2CKK A;  3P8B B;  2YUO A;  1C1A A;  1N5Z A;  4XU1 A;  4DBH A;  1LJO A;  1KK7 A;  1MUZ A;  2RQT A;  4M77 A;  4RTU A;  4OB3 B;  4BE2 A;  1M2O A;  3PGG A;  2LQK A;  1N8R C;  2H3J A;  1GCQ C;  2DL3 A;  1PSF A;  1JRI A;  4DOV A;  4QVD A;  4BDZ A;  1TUG B;  2FRW A;  1KQ1 A;  2RJD A;  5I21 A;  3AT1 B;  1ZQ1 A;  1BKB A;  2FB7 A;  4Y92 A;  1D1C A;  5GAM h;  1WHK A;  1QP3 A;  1RAC B;  3MO8 A;  3OS2 A;  3E9F A;  5GMK l;  5J3B A;  4M77 C;  5GAM f;  2EVR A;  1S72 A;  3JSC A;  2SRC A;  5D6Y A;  2FG0 A;  3KFV A;  4J6W A;  3EFS A;  3P8H A;  4PJO F;  2HSE B;  1QKX A;  3PT9 A;  4MZM A;  2P84 A;  2GTJ A;  3QYG B;  3CXC A;  4F7U F;  2NYS A;  3CMA A;  2LTO A;  4KUI A;  4OMN A;  5KH6 A;  1VQ6 T;  3A8M B;  5GAN e;  5LJ5 g;  2FPD A;  3BFM A;  3CCJ A;  1K73 R;  1M3A A;  3JCM h;  4J7I A;  5KYY B;  2ZPG B;  4M7A E;  2ZAE A;  2YRC A;  1Y57 A;  2B86 A;  5KCO A;  2ROL A;  2DFU A;  2KT8 A;  1XQH A;  3JCM f;  5GAO q;  1WFW A;  1UDL A;  1WHG A;  4DQ2 A;  3FC3 A;  2LQW A;  5A0L A;  1Q95 G;  3GIB A;  1YI2 T;  3O5Z A;  3EFR A;  4HVV A;  2HCK A;  2F5K A;  2BUD A;  5GMK e;  1SSF A;  4MDW A;  2DXC A;  1VIF A;  3G4S T;  2FO0 A;  2DL4 A;  3CCR T;  4CC3 A;  4KUD K;  5D6W A;  1Y7X A;  2H3E B;  1FX7 A;  2CZ0 B;  5GAN d;  1EFN A;  2Y4Y A;  2LC4 A;  3CCU T;  4F17 A;  1JU5 C;  5GMK i;  4QT7 A;  4RTZ A;  2OAU A;  2OI3 A;  3N5B B;  1ZBJ A;  1I1J A;  4DBQ A;  4EPC A;  2WSE E;  2K3Y A;  2XDP A;  3EG9 B;  2E3I A;  2KRO A;  4M78 B;  1Q81 R;  4JS5 A;  1VQN T;  5AT1 B;  4FYW B;  1VQ4 Q;  1N6A A;  5CK9 A;  2MOX A;  1D1B A;  2NWM A;  1YIT A;  4PKC C;  2I0N A;  3JCM X;  5IHK A;  3I9Q A;  2VGN A;  3UAT A;  3L2U A;  3G6E T;  1TU0 B;  2CP0 A;  3A1P A;  3QPH A;  4PJL A;  5IH2 A;  3EHR A;  3E2U A;  1NEB A;  5LJ3 j;  1KQS A;  1Q82 C;  4HCC A;  3RMQ A;  1OEB A;  1HK9 A;  4GY5 A;  4JZ4 A;  1WXU A;  2LCL A;  2YSQ A;  2QQS A;  4NL2 A;  4M7D A;  2EW3 A;  4OB2 B;  1NYF A;  3OA6 A;  3X25 B;  3MP8 A;  1R77 A;  2ATC B;  4ZGD B;  3MKD A;  4P5N A;  1OI1 A;  2CZ7 B;  2R5M A;  2Y90 A;  4C8Q B;  2CZ1 B;  2C0T A;  1TUC A;  2BIV A;  3NGP A;  2KGT A;  1E6G A;  4AG2 C;  1TS9 A;  4YTL A;  5IAY A;  4IIM A;  2KE9 A;  2DZ9 A;  1ZSZ A;  4C5H A;  2YRV A;  2E1H A;  1YBY A;  3M0S A;  2KDS A;  5EC7 A;  4A63 B;  2HDA A;  2A28 A;  2JNG A;  2KAF A;  3SHW A;  1CKB A;  2ZPI B;  2DM1 A;  2E65 A;  3VS7 A;  4M7D C;  4HT9 A;  1NJI U;  3EG3 A;  4M78 D;  3M56 A;  3X20 B;  5IT9 E;  3FIF A;  3TU4 K;  3JB9 F;  1YJW A;  2RK1 A;  1H3H A;  2YLB A;  2EKH A;  1U8R A;  3CMA T;  2QDY B;  4C92 C;  5M9O A;  3OYI A;  4FYV B;  3Q1J A;  3GP8 A;  2RJC A;  2OTL A;  1KHI A;  1X2K A;  3CCJ T;  3OS1 A;  3X24 B;  1QVF S;  4M78 G;  2DJQ A;  4QQG A;  1IZ6 A;  1VQ9 A;  4ME7 A;  5KYX B;  9ATC B;  1M8M A;  4ZTF A;  4A4H A;  2LZ6 B;  2LCC A;  1JQQ A;  2V1Q A;  5FRO A;  3M9Q A;  2RPN A;  4C8Q D;  3LWI A;  2ZPF B;  5DY9 A;  2ENM A;  4FM4 B;  3CD6 Q;  2MWO A;  2VXF A;  1QCF A;  4VUB A;  2DXU A;  5GJV B;  3VS1 A;  3TSW A;  2EWN A;  5LJ3 e;  1Y96 B;  2D0N A;  1XNI A;  4CC7 A;  4HVW A;  2KNB B;  2X51 A;  2GBQ A;  1BIA A;  4M75 A;  4C8Q G;  2P0Q A;  2E12 A;  1GCP A;  2GTO A;  4LDX A;  4KGX B;  3RES A;  3MP6 A;  3OBY A;  5A2Q E;  5LJ5 j;  2K2V A;  1WXT A;  4Y28 E;  1X6O A;  5GAN h;  4O6J A;  4JUV A;  1N8R U;  3M54 A;  3U23 A;  4NS5 A;  4OP0 A;  1YIT T;  1WX6 A;  3CC2 A;  5GAN f;  3C4S A;  5IXB A;  2DBM A;  1K9A A;  2HBW A;  4LN2 A;  2QQA A;  2DYI A;  1VYT A;  3LH5 A;  4E7J A;  1VQK Q;  3M4Y A;  3BY7 A;  4HVU A;  5GJW B;  5CQX A;  3QBY A;  4M75 C;  2AHJ B;  1IB8 A;  1CSK A;  1YIJ A;  1UG1 A;  3EFO A;  2RN8 A;  4C5E A;  5GMK h;  2RMO A;  1OX9 A;  1YN8 A;  2LX9 A;  4BUG A;  4J83 A;  1YWP A;  4X9D A;  3QJ6 A;  3M55 A;  3BE3 A;  1B7T A;  2DPP B;  2HNI A;  2RQU A;  5EG2 A;  2EYZ A;  4PL6 A;  2GF7 A;  3VS0 A;  3FJ5 A;  2E3H A;  2VB6 A;  2RK2 A;  1VQ7 A;  2O4X B;  2BE7 D;  2OJ2 A;  1QVG S;  2KYM A;  4XTZ A;  3HTR A;  1BBZ A;  3NFC A;  2MCN A;  4CC2 A;  1N27 A;  2EIF A;  3QKJ A;  2CZ6 B;  3JCM W;  2G3R A;  2NUP A;  2ZCF B;  4GLM A;  1YJW T;  2K2M A;  1YI2 Q;  1G3W A;  2E4H A;  3JRZ A;  2RQW A;  1M1K C;  1ZUK A;  2XIC A;  2ZZD A;  2EQU A;  2GFU A;  4M78 E;  4B6M A;  2OTL T;  1VQ8 A;  2E64 A;  2QGG A;  4KUL A;  3NPF A;  3SWN A;  3CME Q;  4PLI A;  2PNI A;  2HMA A;  4M7A B;  1D09 B;  3PIP A;  4M7D F;  4JPB W;  1WYX A;  2JW4 A;  1VQ9 T;  4E7I A;  1QMC A;  1AZG B;  1QKW A;  2D9T A;  5LJ5 e;  1ZA1 B;  1VQL Q;  4FW2 A;  1WNL A;  1VQN Q;  1NZ9 A;  1UB4 A;  2KQW A;  5HK0 A;  3LH0 A;  4E2F B;  3EGU A;  2D8H A;  1YJ9 A;  1JXM A;  3C95 A;  3G6E Q;  2LNH B;  5C6S A;  3I55 A;  4X9C A;  2BZX A;  3MEA A;  1ZHI A;  1JJ2 S;  8AT1 B;  5FU7 B;  1VQP Q;  3QWX X;  3UT1 A;  2RA2 A;  3JAM E;  3SWN C;  2QEX A;  2DLP A;  3URG A;  2MI6 A;  3CCM Q;  5GAN 3;  1FYN A;  2V8J A;  1Q82 U;  2KK4 A;  3C0C A;  2KR3 A;  2JTE A;  1W70 A;  3QII A;  4OVA A;  5KYW A;  4E7K A;  3CC2 T;  4XTV A;  3C94 A;  3OYL A;  2JS2 A;  1K76 A;  2VWF A;  3CCQ A;  4RTV A;  2LJ3 A;  4MML A;  5CKE A;  2RF0 A;  4L6V 5;  2P4R A;  3DLM A;  2VGM A;  2DTI A;  5HY6 A;  3EG1 A;  4M7A D;  3LW5 E;  4JRK A;  2YXY A;  1S72 Q;  1WQ7 A;  4XTU A;  2XK0 A;  1RAG B;  4A53 A;  3L2Q A;  1FMV A;  4UC4 A;  1M3C A;  1D3B B;  1I5O B;  1P92 A;  2CSI A;  3EGX B;  1OQK A;  4X1V A;  5IN1 A;  1T0J A;  2NUT B;  1AHJ B;  2HL3 A;  2I2L A;  3PVL A;  2R57 A;  1Q7Y C;  5LJ3 g;  3CCJ Q;  4M75 F;  2QGF B;  3WXM B;  1IXD A;  2RI5 A;  1FMK A;  2EYY A;  1MMG A;  2LT4 A;  2DF6 A;  5FWC A;  2XG8 D;  3D7S B;  2CP3 A;  4HCB A;  5CAI A;  2RD1 A;  1RAD B;  3V8K A;  1AWO A;  4WCI A;  1X75 C;  4QVC A;  2XHC A;  3J7A F;  3RNJ A;  1YHQ A;  2E6N A;  1QCO A;  3CBM A;  2L89 A;  4QVZ A;  2F1L A;  4JJB A;  2PU9 B;  2AIR B;  4J9G A;  2D0Q B;  2FZG B;  3OB9 A;  2KMT A;  4HKE A;  2O9V A;  1B34 B;  1LOJ A;  4AFS C;  4BI8 B;  1VQ8 T;  2PVG B;  4N0A A;  5AYF A;  2LJ0 A;  1U06 A;  4XU0 A;  3OYG A;  3CCV A;  2CS7 A;  1AT1 B;  3JCM b;  3ZBD A;  4JJN K;  1Q82 R;  1VYV A;  4WTO B;  2PUK B;  3CCE Q;  2RI3 A;  3H6Z A;  3JB9 D;  2K4Y A;  2YHT A;  2FHD A;  3CC4 A;  2D1X A;  1K9M R;  2DD5 A;  2QQB A;  1M90 C;  4PJO E;  3CXC P;  3HRU A;  1X6G A;  3A5Z B;  1G5V A;  1YJ9 T;  5KE3 A;  2E6Z A;  3QSU A;  1YIT Q;  3LGL A;  4J7F A;  4WF2 A;  2ED0 A;  1NPR A;  4F7U E;  2KRS A;  3I55 T;  1M4Z A;  1OYX A;  1WHH A;  3BW1 A;  3JB9 G;  4N0A C;  2QEX T;  4IUT A;  3BDL A;  1E7O A;  2YUP A;  5D6X A;  1TTH B;  3I56 A;  2LX7 A;  1VUB A;  2RHY A;  3L2R A;  1K1Z A;  3ULR B;  1GFC A;  3OW2 S;  1UFF A;  4ELY C;  1OPK A;  3VUB A;  4JS4 A;  2COZ A;  4NL3 A;  1X2Q A;  3CCQ T;  2E70 A;  2DNU A;  4IUU A;  2M51 A;  3HL8 A;  3EGD B;  1MMD A;  1M5Q 1;  1RAE B;  1YJN T;  2CUD A;  1BI3 A;  5J26 A;  3ASK A;  1UEB A;  3OYE A;  4EMK B;  2MK5 A;  1D0Z A;  5GAM g;  1AWX A;  1VIE A;  1MMN A;  4BI3 A;  2C0O A;  1TWB A;  1G8X A;  3CC7 Q;  2J05 A;  4II1 A;  3OYK A;  2HD0 A;  3OYN A;  3CCS Q;  1KQS P;  3WVE B;  4QQD A;  2LNV A;  2W0Z A;  2LCS A;  1RAI B;  1M1K U;  3BDU A;  4DOW A;  4Q5W A;  3FLG A;  4J6Y A;  5CR2 A;  1FMW A;  2CT3 A;  2JN0 A;  1VQ5 Q;  3EH1 A;  1OOT A;  2V1R A;  1MV0 B;  2PTK A;  7AT1 B;  2JT4 A;  2NLU A;  1YHQ T;  1IRX A;  3JCM g;  1TXQ A;  4PJJ A;  1ZSZ B;  2A0F B;  1KC8 C;  2E10 A;  3A98 A;  4A4F A;  1YCY A;  2IPO B;  2DVJ A;  1X01 A;  2OTJ T;  4E7Z A;  2EBP A;  3O8V A;  1IGQ A;  1MNE A;  3OYC A;  4ATO A;  1PG5 B;  1BI2 A;  4KBM B;  2PUO B;  2LJ1 A;  3JCM Q;  1KD1 C;  1UGP B;  4XTW A;  3CCV T;  3G71 Q;  1TUD A;  1UGR B;  5CKH A;  1G83 A;  2QTV A;  3NTI A;  1MGQ A;  3CCL T;  3UWN A;  1WJQ A;  1UHC A;  1RAB B;  3FB9 A;  3OSS C;  2RJE A;  2KRM A;  1VQO Q;  4J9I A;  3CC4 T;  1UUE A;  2JUF A;  2L3Q A;  4BY6 B;  3QG1 A;  2RO0 A;  2F2X A;  2RB6 A;  2G6F X;  1KIK A;  3CC2 Q;  4LDY A;  2M0Y A;  1Y07 A;  1WA7 A;  2DER A;  1OZ3 A;  2QAS A;  3FRN A;  1ZA2 B;  3L42 A;  5KYY A;  4F14 A;  3OYA A;  4M77 E;  3M0T A;  2GQV A;  4C92 A;  4QQ6 A;  2DKG A;  1BK2 A;  1YIJ Q;  3I56 T;  2LP5 A;  1WHJ A;  3OYF A;  4J5Y A;  3OY9 A;  2J7I A;  4M7D G;  3GOX A;  2F2V A;  2L3P A;  2ZPE B;  1Y71 A;  1M1K R;  4AG1 C;  3FDR A;  2FRY A;  1MND A;  2RHX A;  2K7A A;  3M0R A;  1YCS B;  5FU6 B;  4HT8 A;  2QA4 Q;  4R0K A;  5ECA A;  4ZN1 A;  1Q86 C;  4FSX A;  2FL7 A;  4PJN A;  3V8J A;  1PM3 A;  2YWW A;  2RI2 A;  3RUX A;  3M57 A;  4RTY A;  2V26 A;  3JCM J;  4C0G A;  5GAO m;  1E6H A;  1VQ7 Q;  2SEM A;  1JB0 E;  4B9W A;  4OMO A;  1XTD A;  1M2V A;  2MPX C;  2WAC A;  4M77 F;  3JB9 I;  2L0A A;  4D8D A;  2XD0 A;  1H92 A;  2Y4X A;  4FYX B;  3DB3 A;  1H3Z A;  3MJX A;  3HHT B;  3CEY A;  2JTF A;  2EYQ A;  6AT1 B;  1V29 B;  4Y91 A;  3GNF B;  3CPW P;  2DBK A;  2KT1 A;  2KXD A;  1RI0 A;  2DL7 A;  3T9N A;  5KE2 A;  2PVD B;  3MHX A;  1VYU A;  1W1F A;  2M0O A;  1BIB A;  4L59 A;  1B3Q A;  2EPD A;  2DD4 A;  2HL5 C;  1K73 C;  2EAY A;  2LVM A;  3HKS A;  4M78 C;  2EYW A;  4C8Q A;  3OBW A;  1X6B A;  5GAO n;  2DL8 A;  4CRI A;  4Z02 A;  1TSF A;  1T3S A;  4RTT A;  1HSQ A;  2VKN A;  4N4G A;  4A54 A;  2X3W D;  2ZPB B;  3VKI A;  2AZV A;  2DRM A;  2DX1 A;  3QDR B;  3MCA B;  1SHG A;  1TG0 A;  3QDF A;  3F70 A;  2CP5 A;  2X4Y A;  5GAM j;  4K11 A;  1GL5 A;  3PTA A;  3M53 A;  2P0P A;  4HA8 A;  1NBE B;  1UJY A;  2ABL A;  1AZE A;  1WDX A;  1YNZ A;  3OMC A;  2DJZ A;  2X4W A;  4BE0 A;  1RL2 A;  5KYU B;  2VVK A;  2KRN A;  2ED1 A;  2VC8 A;  4E47 A;  5KCH A;  2JTM A;  2JJ9 A;  3NHN A;  3CPW A;  1UJ0 A;  3JCM c;  1BCM A;  1PD0 A;  4C8Q C;  1ZX6 A;  5LJ3 d;  3EH2 A;  1FWZ A;  4A4G A;  1NJI R;  2AK5 A;  4PJO B;  3QJY A;  2A7Y A;  2VAS A;  2VYT A;  1PRL C;  1Q81 C;  1RI9 A;  1QVF P;  1HD3 A;  4PFO A;  4F7U B;  1AVZ C;  1SRM A;  5FRM A;  4NOY A;  4D8K A;  4JDS A;  1VQM A;  1SG5 A;  5KYX A;  2M9U A;  4N4I A;  2MF2 A;  5IXF A;  2MAM A;  2HEQ A;  4M7D E;  1VQ6 Q;  2L3S A;  3LX7 A;  3REB B;  1H64 1;  4OGE A;  3VYH B;  2RNA A;  4ZN3 A;  1UGV A;  3E9G A;  2EQM A;  2L2P A;  4KH0 B;  5GAO r;  1NEG A;  2COY A;  3G7Z A;  3VUZ A;  3ZFJ A;  3RKW A;  3UPU A;  2LMJ A;  3SB2 A;  1T3L A;  1WHM A;  5CCA A;  2DTH A;  1NPP A;  3KBG A;  4RKU E;  4CI0 C;  2XDB A;  2O01 E;  3RDV A;  1Z9Q A;  5LL6 S;  2X9H A;  2QYZ A;  3TQ7 P;  4Z88 A;  2A08 A;  4FU6 A;  3H9N A;  5FW9 A;  3G4S Q;  1ZUU A;  1SEM A;  4AMC A;  3CCR Q;  1QVF A;  1IHV A;  4TVR A;  4ZGJ B;  2CGH A;  2KY9 A;  3CCU Q;  2HAX A;  4C0D B;  1YWO A;  4PJO D;  5GAM e;  1N8R R;  3QYH B;  1QWF A;  2DIQ A;  3QO3 A;  1AD5 A;  2DAQ A;  2P0K A;  4C92 F;  5DLO A;  3ZEH A;  3SEM A;  1RLQ C;  4PFZ A;  4J6X A;  4FIB A;  3MPU B;  1ZBX A;  4E6R A;  4GLK A;  1HXD A;  3OYJ A;  1KD1 U;  1I0C A;  4PJO G;  2X35 A;  3PE0 A;  2IG0 A;  3CC4 Q;  2DIL A;  4AFU C;  4BB7 A;  4IUQ A;  5KYN A;  2MYS A;  2QQ9 A;  3OYY A;  4F7U G;  1RUW A;  2DEU A;  2X4X A;  3S3O A;  3JCM e;  3MP1 A;  4XU2 A;  2RQV A;  1I4K 1;  1LPL A;  2E41 A;  3CBP A;  1MV3 A;  5LJ5 d;  4RCC A;  5CKD A;  5GAN 8;  1VQ4 T;  2EJ9 A;  1IHW A;  4M75 E;  1U3O A;  2RJF A;  2JM8 A;  2EYX A;  3OYB A;  1D0X A;  3HP9 A;  2X3X D;  3I56 Q;  1TH7 A;  3TEE A;  5GMK m;  3OYD A;  3OQ5 A;  2D8J A;  1VQK A;  2YRD A;  3VJP A;  1YJN A;  1BB9 A;  2EQI A;  2GFA A;  3NMZ C;  4F16 A;  2MIO A;  1KSW A;  1G2B A;  3OS5 A;  5IHI A;  2QDL A;  3H0H A;  2RHI A;  4XAX B;  2PVO B;  2XID A;  4J9D A;  2GNC A;  1M27 C;  4PFP A;  5LJ3 h;  4M7A A;  1JO8 A;  1VQM T;  2WSC E;  3GNG A;  4M77 B;  2L5Q A;  3CMA Q;  4LXC A;  3CXC S;  5LJ3 f;  2XI9 A;  4C8Q F;  1Q86 U;  4IUR A;  3V7R A;  3JB9 J;  2JS0 A;  1WGS A;  4XU3 A;  2K57 A;  4RG2 A;  1ARK A;  2EJF A;  1PCX A;  1A0N B;  2DXB A;  5CKF A;  3L1A A;  4KH1 B;  2QI2 A;  2J6F A;  2DL5 A;  1BI1 A;  1U5S A;  2DVE A;  2DIG A;  2KVQ G;  2WSF E;  1KD1 R;  4M7A C;  1JEG A;  3PIO A;  5FWB A;  4N4H A;  2CRE A;  2CP2 A;  2OTJ A;  4FT2 A;  1RAF B;  3OMG A;  2KBT A;  4ORZ A;  3X26 B;  1C0M A;  2W10 A;  5GAN 6;  2HQH A;  4LD6 A;  4C5G A;  2XU8 A;  4R56 A;  3H0F A;  3PFS A;  5GAO p;  3CME A;  2J6K A;  3M4G A;  3WVD B;  1W6X A;  2HZY A;  3DLL A;  3CCL A;  4RG8 A;  2Z0W A;  1VQL A;  3LYI A;  4PJM A;  1F1B B;  2EQK A;  3QZ5 B;  3CPF A;  1G3Y A;  2V8I A;  3S3M A;  2FYK A;  3VRY A;  5J39 A;  4M77 D;  1H8K A;  3UA7 A;  3PMT A;  3VYG A;  3M0P A;  5GMK j;  5I2S A;  3EG2 A;  1D3B A;  2PZ1 A;  1JJ2 A;  3UA6 A;  3EGX A;  1KQS S;  1VQP A;  1RLP C;  1IO6 A;  4Z8A A;  5A0G A;  1IRE B;  3VRZ A;  2R5A A;  1XOV A;  4AFZ C;  4GBQ A;  2NUT A;  1X27 A;  4J9B A;  2VUB A;  3CCM A;  5HK3 A;  4DBF A;  4M77 G;  4AFQ C;  3LLR A;  1BI0 A;  2HSP A;  1EZZ B;  2O88 A;  1DJ7 B;  1GRI A;  1Q86 R;  2QK0 A;  4J9F A;  1NE8 A;  3VS3 A;  1Q81 U;  1WXB A;  2CH4 W;  2KYB A;  4KGV B;  3J80 E;  1UTI A;  2YLC A;  1WJR A;  1TOV A;  1V1C A;  2DYB A;  2P4T A;  1UE9 A;  5LJ5 h;  1VQK T;  5GAN 5;  4C0Z A;  2FVU A;  1W4S A;  3TSZ A;  5LJ5 f;  1B34 A;  3OYM A;  1IGU A;  2QQR A;  4PK4 A;  1ZLM A;  4HXJ A;  1OUL A;  2BTT A;  2DK3 A;  3J81 E;  1YJW Q;  4BE1 A;  3QHS A;  2PQW A;  1W2B P;  3V7C A;  2DO3 A;  4AT1 B;  2AZS A;  2JMC A;  1D1A A;  5CIU A;  2OTL Q;  1M9S A;  4PNO A;  4M7D B;  2ECZ A;  2A36 A;  2EKO A;  2J6O A;  3A8H B;  4LDV A;  2D6F A;  1UHF A;  2CP7 A;  2RM4 A;  2K5I A;  2QTX A;  3HRS A;  1FXX A;  3HRT A;  2K3X A;  3MET A;  1VQ9 Q;  4C92 B;  3JB9 H;  2K3B A;  4C5I A;  4QW2 A;  3I5R A;  1OPL A;  2FZK B;  2F2W A;  2LDM A;  1BYM A;  4LNP A;  2DET A;  1I81 A;  4FW1 A;  3IQL A;  4ZTJ A;  2IIM A;  3VV0 A;  3HFN A;  1ZUY A;  4JJC A;  1K8A C;  2MWP A;  4MZT A;  1PC0 A;  1EX4 A;  1PKS A;  4R55 A;  2E5Q A;  4OF1 A;  1R0B G;  2XMF A;  2DE0 X;  3UF4 A;  3OW2 P;  1LCK A;  5GAN 7;  3CME T;  5D7U A;  2LQ8 A;  3OS0 A;  1U1S A;  4XTY A;  1JBM A;  4HCK A;  1W2B A;  1OV3 A;  1QLY A;  3V8L A;  3CCE A;  1ABO A;  4FL6 A;  4LE9 A;  4M7A F;  2F5T X;  1VQL T;  3EGD A;  2RQR A;  1M2V B;  1K4U S;  1QP2 A;  2C0I A;  3RKX A;  3E19 A;  3HPW A;  2M1H A;  4Z89 A;  4JZ3 A;  4X34 A;  2O31 A;  3VS4 A;  4BI4 A;  4RMO A;  3GF5 A;  2K5L A;  2K5F A;  4EMK A;  1UEC A;  4BD3 A;  4M7D D;  2HKN A;  5IHN A;  3M58 A;  4JJD A;  3VS2 A;  5FRN A;  3RR6 A;  2EGA A;  3SFM A;  3A8G B;  2DA9 A;  3CPW S;  1VQP T;  3VS6 A;  3LWH A;  2AKL A;  3SDZ A;  2L8D A;  1OX8 A;  1G3S A;  1QVP A;  2YUN A;  2ZPH B;  4OB0 B;  4KT0 E;  4C92 D;  2L3R A;  3CCM T;  1KJW A;  3M0Q A;  4EMG A;  1C6V X;  2LT1 A;  1K9M C;  3OW2 A;  4RUG A;  1O75 A;  2ESW A;  3FJP A;  1VQM Q;  8ATC B;  4M75 B;  4O5V A;  2BE9 B;  2RH2 A;  2CYZ B;  2KEA A;  4EMK C;  2RHZ A;  4JRQ A;  3H41 A;  3H0I A;  2CSQ A;  3I5S A;  4C92 G;  1PHT A;  3S3N A;  1PKT A;  5HCK A;  3M59 A;  3GPL A;  3RMS A;  2R58 A;  5A0D A;  2DZC A;  1Q7Y U;  1S72 T;  1OZ2 A;  2K79 A;  3EG9 A;  4M78 A;  4RCB A;  3JCM P;  3I35 A;  5DLQ E;  5GAN 2;  2DRK A;  4DEX A;  3RIR A;  3CC7 A;  3G1J A;  1M1G A;  4DBR A;  1UGS B;  4DA4 A;  4ZGE B;  1WJS A;  1VA7 A;  2RHU A;  1JXO A;  3EFO B;  1VQ8 Q;  3CCS A;  3CQT A;  3THK A;  1ZSZ C;  2FPE A;  4OMP A;  4KRT A;  3A8L B;  5CO7 A;  2EGC A;  3MEU A;  3JCM V;  1VQ5 A;  1I8F A;  2DMO A;  2F69 A;  3R6N A;  4BDY A;  1GBQ A;  5GAN 4;  2YUQ A;  4XTX A;  1BU1 A;  3RER A;  4JRI A;  4A4E A;  4L5G A;  1LVK A;  1ACM B;  3RBB B;  3M0U A;  1PRM C;  1AWW A;  2H8H A;  4MDX A;  3GBQ A;  3R6O A;  1YJ9 Q;  5I2M A;  1SPK A;  2VV5 A;  4M75 D;  3EAE A;  1WI7 A;  1YP5 A;  3I55 Q;  2DTO A;  1M90 U;  4IKF A;  4ESR A;  4V2S A;  3VS5 A;  1Y0M A;  2FZC B;  2NUP B;  1VQ4 A;  3G71 A;  1RAH B;  2EGE A;  3KUF A;  4XK8 E;  2QEX Q;  1K0S A;  4BY6 C;  3CCE T;  4MZP A;  2EJG A;  1NLO C;  3C12 A;  4M75 G;  1VQO A;  3INZ A;  5DM7 R;  4EDU A;  3SD4 A;  1PWT A;  2X4J A;  4BAC A;  1KG1 A;  1LNX A;  2COW A;  2JOY A;  1J3T A;  3SWN B;  2XDD A;  1XJW B;  4E7H A;  3E1S A;  1SRL A;  2JVV A;  2CP6 A;  1N9R A;  3CCQ Q;  3L2W A;  3L2V A;  1YFN A;  4LUD A;  5GAN g;  1Q7Y R;  4ANJ A;  4ZNX A;  4LD9 K;  4LUE A;  1YJN Q;  1SSH A;  1SKU B;  4B9X A;  3JV3 A;  1KFZ A;  1X69 A;  2IVW A;  4J9H A;  3MEW A;  4OMF B;  1X43 A;  4LDW A;  5FU6 C;  1B07 A;  3X28 B;  1PD1 A;  2FEI A;  3M5A A;  4E7S A;  2BKD N;  1WHL A;  1M8V A;  2NUZ A;  4C92 E;  4EIK A;  1GBR A;  2M02 A;  1MMA A;  2V8K A;  1I07 A;  1Y96 A;  4FSS A;  2FPF A;  2KSS A;  1QW1 A;  2QA4 A;  1S1N A;  4ELZ C;  5C0M A;  1SF9 A;  2CUB A;  2J06 A;  1U1T A;  2ROT A;  2GCX A;  3EHQ A;  5KYW B;  4RTX A;  1ABQ A;  3H8Z A;  3GLX A;  2EFI A;  4FYY B;  1YHQ Q;  1PSE A;  5GAO l;  4FCY A;  1MHN A;  2LQN A;  3TVT A;  3CC7 T;  3FEO A;  1M90 R;  1GFD A;  2OTJ Q;  5KYU A;  1KC8 U;  1R8O B;  4QKU A;  3CCS T;  3KXT A;  2O2O A;  3LGF A;  1K8A U;  3CCV Q;  4F04 B;  4PJO A;  2MMP A;  2JZ2 A;  2DXT A;  1VQ5 T;  1PNJ A;  3CD6 A;  4HCZ A;  3A8O B;  1AEY A;  1CKA A;  3HFO A;  3CCL Q;  1NLP C;  4F7U A;  4CC4 B;  5CKB A;  4MMK A;  2AKK A;  2OAW A;  2YDL A;  1KHC A;  2HQX A;  4J9C A;  1BCO A;  1WIE A;  2CT4 A;  4OMM A;  1SHF A;  1R0C B;  3S6W A;  5GAM d;  4C8Q E;  2AT1 B;  2KXC A;  2QXF A;  3AHU A;  4JRP A;  3TCJ A;  2GQI A;  3NTK A;  4J9E A;  3G71 T;  1QWE A;  5L8R E;  1QVG P;  4M78 F;  4PJO C;  2O4X A;  1UGQ B;  1NG2 A;  1HJD A;  1V76 A;  1NM7 A;  1VQO T;  3EG0 A;  3PVQ A;  1NYG A;  2K9G A;  2HKQ B;  4M4Z A;  4A4K A;  2GGR A;  4D6W A;  1OU8 A;  2B8A A;  3PMI A;  1K0X A;  4IUV A;  2YT6 A;  2A37 A;  3MEV A;  2JXB A;  1K9M U;  4JLG A;  4OGC A;  1VOM A;  1D0Y A;  1EIF A;  5CQY A;  2BZY A;  2QG9 B;  3JCM d;  4XQ3 A;  3VU3 C;  4OML A;  2JMA A;  4FT4 A;  1WLP B;  3QWY A;  3PNW C;  2ZGW A;  3REA B;  3ME9 A;  1WPY A;  1T0H A;  2O9S A;  1YIJ T;  1VQ6 A;  5L23 A;  4KGZ B;  5I22 A;  3HSB A;  4LDU A;  1M1F A;  2M16 A;  3CBO A;  2BZ8 A;  2HBP A;  4E7L A;  1NJI C;  1GXI E;  4OMQ A;  1Z9Z A;  2KI7 A;  1KC8 R;  5CVI A;  4J8O A;  2LRQ A;  3QXE B;  4RTW A;  1QVG A;  1I5L A;  2OX7 A;  1KQ2 A;  2HQE A;  1N9S A;  2JM9 A;  1K8A R;  2DEQ A;  1RAA B;  2VXE A;  4M7A G;  1HYO A;  1JJ2 P;  2QA4 T;  1AOJ A;  1AWJ A;  1O9S A;  3OSV A;  3OYH A;  1WZO A;  1YI2 A;  4EMH A;  4IUP A;  4C0D C;  2C06 A;  2K6D A;  2CH4 A;  4PLL A;  1M3B A;  1ZSG A;  3QUI A;  1VQ7 T;  1WQW A;  4C0F A;  3G4S A;  1QCN A;  3CCR A;  3P8D A;  3UDC A;  5GAN j;  2QAZ A;  3L2Z A;  1OU9 A;  3CCU A;  3NTH A;  1G3T A;  3ER0 A;  1K73 U;  3DB4 A;  1GCQ A;  5I11 A;  5HKC A;  3QZ9 B;  4OB1 B;  3RKY A;  4IIO A;  1VQN A; 
#chains in the Genus database with same CATH homology
 3TRE A;  4C8Q A;  3OBW A;  1NZ9 A;  5GAO n;  1UB4 A;  2KQW A;  5FU7 C;  4CRI A;  5HK0 A;  2XKO C;  4Z02 A;  3V7S A;  5GAN 7;  3CME T;  2LQ8 A;  4N4G A;  3LH0 A;  3OS0 A;  1U1S A;  4A54 A;  4XTY A;  3DKM A;  2ZPB B;  1JBM A;  1YJ9 A;  1W2B A;  3VKI A;  3CD6 T;  3QDR B;  2EQJ A;  3C95 A;  3CCE A;  3MCA B;  3V8L A;  1W2B S;  3G6E A;  2A3L A;  4JLI A;  3F70 A;  4FL6 A;  5FLX E;  5C6S A;  2F5T X;  2X4Y A;  4X9C A;  5GAM j;  2CKK A;  3MEA A;  3I55 A;  1VQL T;  4M7A F;  3P8B B;  1ZHI A;  4XU1 A;  3PTA A;  1LJO A;  3M53 A;  2P0P A;  4HA8 A;  1JJ2 S;  1QP2 A;  5FU7 B;  3RKX A;  3UT1 A;  3E19 A;  2RA2 A;  3HPW A;  3JAM E;  3SWN C;  4M77 A;  2QEX A;  4OB3 B;  2M1H A;  4BE2 A;  3PGG A;  4X34 A;  2LQK A;  3URG A;  4BI4 A;  2MI6 A;  1N8R C;  3OMC A;  3GF5 A;  2H3J A;  4RMO A;  2DJZ A;  2X4W A;  2K5L A;  2K5F A;  4EMK A;  4BE0 A;  1PSF A;  1JRI A;  1RL2 A;  4DOV A;  4BD3 A;  4QVD A;  2VC8 A;  4E47 A;  5GAN 3;  4BDZ A;  4M7D D;  1KQ1 A;  3M58 A;  2JTM A;  2RJD A;  2V8J A;  5KCH A;  5I21 A;  1Q82 U;  5FRN A;  3SFM A;  3CPW A;  3A8G B;  3JCM c;  2KK4 A;  3CPW S;  4C8Q C;  5LJ3 d;  1VQP T;  1ZQ1 A;  3LWH A;  1FWZ A;  3QII A;  4OVA A;  3SDZ A;  3RKY A;  4A4G A;  2L8D A;  1G3S A;  1BKB A;  1QVP A;  4PJO B;  2ZPH B;  2FB7 A;  4E7K A;  4OB0 B;  4KT0 E;  3QJY A;  3CC2 T;  2A7Y A;  2VYT A;  3C94 A;  4XTV A;  4C92 D;  3OYL A;  2L3R A;  3CCM T;  1Q81 C;  3CCQ A;  4EMG A;  4MML A;  2LT1 A;  5CKE A;  4L6V 5;  5GAM h;  4F7U B;  1K9M C;  3DLM A;  1QP3 A;  2DTI A;  2VGM A;  3MO8 A;  3OS2 A;  3E9F A;  4NOY A;  3OW2 A;  5FRM A;  1O75 A;  5GMK l;  4JDS A;  5J3B A;  3FJP A;  5HY6 A;  1VQM A;  4M7A D;  4M77 C;  5GAM f;  3LW5 E;  4JRK A;  1S72 A;  2M9U A;  4M75 B;  2MF2 A;  3JSC A;  4N4I A;  1WQ7 A;  2MAM A;  4O5V A;  4M7D E;  2RH2 A;  5D6Y A;  2CYZ B;  4XTU A;  4EMK C;  2RHZ A;  4JRQ A;  2XK0 A;  4A53 A;  3L2Q A;  4J6W A;  3LX7 A;  1H64 1;  4C92 G;  4OGE A;  3EFS A;  3P8H A;  4UC4 A;  3PT9 A;  4MZM A;  1D3B B;  4PJO F;  3VYH B;  3S3N A;  1P92 A;  4ZN3 A;  3M59 A;  3E9G A;  2EQM A;  3GPL A;  3RMS A;  5IN1 A;  2R58 A;  5A0D A;  5GAO r;  2DZC A;  3G7Z A;  3QYG B;  1Q7Y U;  1S72 T;  3CXC A;  4F7U F;  3CMA A;  2LTO A;  4KUI A;  1OZ2 A;  3VUZ A;  3ZFJ A;  3RKW A;  1AHJ B;  2I2L A;  5KH6 A;  3UPU A;  1VQ6 T;  3A8M B;  5GAN e;  2R57 A;  4M78 A;  1Q7Y C;  3SB2 A;  5LJ5 g;  4RCB A;  3BFM A;  3CCJ A;  5CCA A;  5LJ3 g;  3JCM P;  2DTH A;  1NPP A;  3KBG A;  4RKU E;  3JCM h;  4J7I A;  4M75 F;  3WXM B;  4CI0 C;  2ZPG B;  2XDB A;  5DLQ E;  5GAN 2;  2RI5 A;  4M7A E;  2O01 E;  3RIR A;  2LT4 A;  5LL6 S;  3CC7 A;  2XG8 D;  1M1G A;  5KCO A;  1UGS B;  4DA4 A;  4ZGE B;  1WJS A;  4HCB A;  3JCM f;  1XQH A;  5GAO q;  5CAI A;  2RD1 A;  3V8K A;  4DQ2 A;  4FU6 A;  1X75 C;  4QVC A;  2RHU A;  2XHC A;  3J7A F;  3FC3 A;  1YHQ A;  3CCS A;  2XD0 A;  2E6N A;  1QVF A;  3CBM A;  2L89 A;  4QVZ A;  5A0L A;  4TVR A;  2PU9 B;  4ZGJ B;  3GIB A;  1YI2 T;  2CGH A;  2KY9 A;  3A8L B;  2D0Q B;  5CO7 A;  3EFR A;  3MEU A;  2HAX A;  3OB9 A;  4C0D B;  2KMT A;  3JCM V;  4HKE A;  1VQ5 A;  1I8F A;  2F69 A;  2F5K A;  4PJO D;  1B34 B;  2BUD A;  5GMK e;  1LOJ A;  4BDY A;  1SSF A;  4MDW A;  5GAM e;  4BI8 B;  2DXC A;  1VIF A;  3QYH B;  3G4S T;  2DIQ A;  1VQ8 T;  3QO3 A;  3CCR T;  4KUD K;  5GAN 4;  2DAQ A;  5D6W A;  2P0K A;  2PVG B;  1Y7X A;  4C92 F;  5DLO A;  4N0A A;  4XTX A;  3ZEH A;  5AYF A;  1FX7 A;  2CZ0 B;  3RER A;  4JRI A;  4A4E A;  4XU0 A;  2Y4Y A;  4L5G A;  5GAN d;  4J6X A;  2LC4 A;  4FIB A;  3OYG A;  3CCU T;  2CS7 A;  3CCV A;  4MDX A;  5GMK i;  3JCM b;  3R6O A;  3ZBD A;  4JJN K;  2OAU A;  5I2M A;  3N5B B;  1ZBX A;  2VV5 A;  4M75 D;  2PUK B;  4EPC A;  4GLK A;  2WSE E;  3EAE A;  2RI3 A;  2K3Y A;  1HXD A;  3H6Z A;  3OYJ A;  3JB9 D;  2K4Y A;  2XDP A;  2YHT A;  1KD1 U;  4PJO G;  2FHD A;  2DTO A;  2X35 A;  4M78 B;  1M90 U;  4JS5 A;  1VQN T;  3CC4 A;  4IKF A;  2IG0 A;  4V2S A;  4BB7 A;  4IUQ A;  2DD5 A;  1VQ4 A;  2QQB A;  3G71 A;  1M90 C;  4PJO E;  2QQ9 A;  3KUF A;  3HRU A;  4XK8 E;  3OYY A;  4F7U G;  4BY6 C;  1N6A A;  3A5Z B;  5CK9 A;  1G5V A;  1YJ9 T;  5KE3 A;  1YIT A;  2E6Z A;  4PKC C;  3QSU A;  2X4X A;  3JCM X;  3LGL A;  3CCE T;  2VGN A;  3G6E T;  4J7F A;  3MP1 A;  4MZP A;  4WF2 A;  3JCM e;  3L2U A;  3S3O A;  4XU2 A;  1NPR A;  2EJG A;  4F7U E;  3I55 T;  1I4K 1;  3C12 A;  1M4Z A;  4M75 G;  2E41 A;  3INZ A;  1VQO A;  3QPH A;  1OYX A;  3CBP A;  3SD4 A;  2X4J A;  4EDU A;  5LJ5 d;  5DM7 R;  4BAC A;  3BW1 A;  1LNX A;  5LJ3 j;  3JB9 G;  4N0A C;  1KQS A;  4RCC A;  5CKD A;  2JOY A;  5GAN 8;  1Q82 C;  4HCC A;  3RMQ A;  2EJ9 A;  3SWN B;  2QEX T;  4IUT A;  4M75 E;  1VQ4 T;  3BDL A;  2RJF A;  2XDD A;  1HK9 A;  4GY5 A;  4E7H A;  3E1S A;  3OYB A;  2LCL A;  4NL2 A;  2JVV A;  2QQS A;  5D6X A;  4M7D A;  1N9R A;  4OB2 B;  3HP9 A;  3L2W A;  3I56 A;  3OA6 A;  3L2V A;  1TH7 A;  3X25 B;  1VUB A;  3MP8 A;  3TEE A;  5GMK m;  4ZGD B;  5GAN g;  2RHY A;  4P5N A;  3OYD A;  1OI1 A;  3OQ5 A;  3L2R A;  2CZ7 B;  2R5M A;  1VQK A;  4LD9 K;  2Y90 A;  3VJP A;  2CZ1 B;  4C8Q B;  1YJN A;  2GFA A;  3OW2 S;  2BIV A;  4ELY C;  3VUB A;  4B9X A;  4JS4 A;  4NL3 A;  2IVW A;  4YTL A;  3OS5 A;  5IAY A;  3MEW A;  4OMF B;  2RHI A;  2E70 A;  3CCQ T;  4XAX B;  2PVO B;  4LDW A;  4IUU A;  2XID A;  5FU6 C;  2DZ9 A;  3X28 B;  3HL8 A;  4C5H A;  1M5Q 1;  3M5A A;  2YRV A;  2E1H A;  1YBY A;  2BKD N;  5LJ3 h;  1YJN T;  4M7A A;  2KDS A;  1M8V A;  1BI3 A;  5J26 A;  4C92 E;  1VQM T;  2WSC E;  3GNG A;  4M77 B;  2JNG A;  2L5Q A;  2KAF A;  2V8K A;  2ZPI B;  3ASK A;  1UEB A;  3OYE A;  3CXC S;  5LJ3 f;  2XI9 A;  2E65 A;  4EMK B;  4C8Q F;  1Y96 A;  1Q86 U;  5GAM g;  4M7D C;  4IUR A;  2KSS A;  1VIE A;  4HT9 A;  1QW1 A;  3V7R A;  2QA4 A;  1NJI U;  3JB9 J;  1WGS A;  4M78 D;  4XU3 A;  4ELZ C;  5C0M A;  3M56 A;  3X20 B;  5IT9 E;  3FIF A;  4BI3 A;  3TU4 K;  3JB9 F;  1YJW A;  1U1T A;  2K57 A;  2RK1 A;  2GCX A;  2YLB A;  1U8R A;  3CMA T;  2QDY B;  3H8Z A;  4II1 A;  4RG2 A;  2EJF A;  4C92 C;  5M9O A;  3OYI A;  3Q1J A;  3GP8 A;  2RJC A;  2DXB A;  3OYK A;  5CKF A;  3GLX A;  3L1A A;  2OTL A;  1KHI A;  2EFI A;  2HD0 A;  3OYN A;  2QI2 A;  1PSE A;  3CCJ T;  3WVE B;  5GAO l;  4QQD A;  3OS1 A;  2LNV A;  3X24 B;  1QVF S;  1M1K U;  1BI1 A;  3BDU A;  1MHN A;  4DOW A;  4Q5W A;  2DVE A;  2DIG A;  3FLG A;  2KVQ G;  2WSF E;  4J6Y A;  5CR2 A;  4M7A C;  3CC7 T;  4M78 G;  3FEO A;  3PIO A;  2JN0 A;  4QQG A;  4N4H A;  1IZ6 A;  1VQ9 A;  4ME7 A;  2OTJ A;  4FT2 A;  4ZTF A;  4A4H A;  1KC8 U;  1R8O B;  3OMG A;  2NLU A;  1YHQ T;  3JCM g;  2LCC A;  3KXT A;  3CCS T;  3X26 B;  5FRO A;  5GAN 6;  3M9Q A;  4LD6 A;  4C5G A;  2XU8 A;  4R56 A;  1KC8 C;  3PFS A;  2E10 A;  3LGF A;  5GAO p;  4C8Q D;  4A4F A;  3CME A;  1YCY A;  1K8A U;  1KG1 A;  3LWI A;  4PJO A;  2ZPF B;  2MMP A;  5DY9 A;  2JZ2 A;  2DXT A;  1VQ5 T;  3M4G A;  3WVD B;  3CD6 A;  1X01 A;  4FM4 B;  3DLL A;  2OTJ T;  2MWO A;  2VXF A;  4HCZ A;  4VUB A;  2DXU A;  3A8O B;  3O8V A;  3CCL A;  3HFO A;  2EWN A;  3OYC A;  4RG8 A;  5LJ3 e;  1Y96 B;  4ATO A;  4F7U A;  1VQL A;  1BI2 A;  3LYI A;  4KBM B;  1XNI A;  2PUO B;  2EQK A;  5CKB A;  3QZ5 B;  4MMK A;  3CPF A;  1G3Y A;  3JCM Q;  1UGP B;  1KD1 C;  4XTW A;  2V8I A;  3S3M A;  3CCV T;  1UGR B;  2FYK A;  1BIA A;  4M75 A;  5J39 A;  4M77 D;  5CKH A;  4C8Q G;  1KHC A;  2HQX A;  2P0Q A;  3NTI A;  1MGQ A;  2E12 A;  3PMT A;  3CCL T;  4LDX A;  3UWN A;  3VYG A;  1WJQ A;  3RES A;  3MP6 A;  3OBY A;  5A2Q E;  5GMK j;  3FB9 A;  3S6W A;  3OSS C;  1D3B A;  2K2V A;  2RJE A;  5I2S A;  4C8Q E;  5LJ5 j;  5GAM d;  3CC4 T;  1JJ2 A;  2QXF A;  4Y28 E;  3AHU A;  4JRP A;  1X6O A;  3TCJ A;  5GAN h;  4O6J A;  1KQS S;  3NTK A;  4JUV A;  1VQP A;  3M54 A;  3G71 T;  1N8R U;  2JUF A;  5L8R E;  5A0G A;  1IRE B;  2R5A A;  3QG1 A;  4M78 F;  1XOV A;  4NS5 A;  4BY6 B;  4PJO C;  2O4X A;  2RO0 A;  2RB6 A;  4OP0 A;  1YIT T;  1UGQ B;  3CC2 A;  5GAN f;  4LDY A;  2VUB A;  1Y07 A;  3C4S A;  3CCM A;  5HK3 A;  4M77 G;  1OZ3 A;  3FRN A;  3LLR A;  2QQA A;  1VQO T;  3L42 A;  1BI0 A;  4E7J A;  3M4Y A;  3OYA A;  1DJ7 B;  3BY7 A;  4M77 E;  1NE8 A;  4A4K A;  2GQV A;  4D6W A;  4C92 A;  5CQX A;  1Q81 U;  3QBY A;  4QQ6 A;  2B8A A;  2DKG A;  4M75 C;  3PMI A;  2AHJ B;  2YLC A;  3J80 E;  1WJR A;  4IUV A;  1YIJ A;  3MEV A;  3I56 T;  1K9M U;  4JLG A;  4OGC A;  4C5E A;  1EIF A;  2P4T A;  5CQY A;  5GMK h;  5LJ5 h;  3JCM d;  4XQ3 A;  1VQK T;  3OYF A;  3VU3 C;  4J5Y A;  5GAN 5;  4C0Z A;  3OY9 A;  2FVU A;  4FT4 A;  4M7D G;  1W4S A;  3GOX A;  2LX9 A;  4BUG A;  2ZPE B;  4J83 A;  4X9D A;  3PNW C;  3QJ6 A;  5LJ5 f;  1B34 A;  2ZGW A;  3OYM A;  1Y71 A;  3ME9 A;  3FDR A;  3M55 A;  1WPY A;  2QQR A;  2DPP B;  1YIJ T;  1VQ6 A;  2HNI A;  2RHX A;  4HT8 A;  5FU6 B;  5EG2 A;  4LDU A;  4ZN1 A;  1Q86 C;  1M1F A;  4FSX A;  4PL6 A;  2M16 A;  3CBO A;  2FL7 A;  2DK3 A;  2HBP A;  3V8J A;  2GF7 A;  3J81 E;  4E7L A;  1NJI C;  1GXI E;  4BE1 A;  2RI2 A;  2PQW A;  3QHS A;  3M57 A;  3RUX A;  2RK2 A;  5CVI A;  4J8O A;  3V7C A;  2DO3 A;  2LRQ A;  3JCM J;  3QXE B;  4C0G A;  1QVG A;  1I5L A;  5GAO m;  1VQ7 A;  1KQ2 A;  2O4X B;  2HQE A;  1JB0 E;  1N9S A;  5CIU A;  1QVG S;  2DEQ A;  4XTZ A;  4B9W A;  1M9S A;  2VXE A;  4PNO A;  4M7A G;  3NFC A;  4M7D B;  1XTD A;  2QA4 T;  2WAC A;  2EKO A;  3A8H B;  4M77 F;  4LDV A;  3JB9 I;  1N27 A;  1O9S A;  2EIF A;  3QKJ A;  2D6F A;  3OSV A;  2CZ6 B;  3OYH A;  2RM4 A;  2K5I A;  3JCM W;  2G3R A;  2QTX A;  2ZCF B;  3HRS A;  1FXX A;  4IUP A;  4EMH A;  2Y4X A;  1YI2 A;  1YJW T;  3DB3 A;  2K3X A;  1G3W A;  3HRT A;  3JRZ A;  1H3Z A;  4C0D C;  1M1K C;  2C06 A;  3HHT B;  3CEY A;  3MET A;  4PLL A;  4C92 B;  3JB9 H;  2XIC A;  2JTF A;  2ZZD A;  4C5I A;  4QW2 A;  3QUI A;  2EQU A;  1VQ7 T;  2GFU A;  1WQW A;  2EYQ A;  2LDM A;  4M78 E;  1V29 B;  2OTL T;  4C0F A;  3G4S A;  4Y91 A;  1BYM A;  3GNF B;  1VQ8 A;  2E64 A;  4KUL A;  3CCR A;  3P8D A;  3UDC A;  1I81 A;  5GAN j;  3L2Z A;  4ZTJ A;  1RI0 A;  3SWN A;  4PLI A;  3CCU A;  4M7A B;  3T9N A;  3NTH A;  5KE2 A;  3VV0 A;  3PIP A;  4M7D F;  2PVD B;  1G3T A;  3ER0 A;  3HFN A;  3MHX A;  1K73 U;  1VQ9 T;  3DB4 A;  4E7I A;  1K8A C;  5HKC A;  2M0O A;  2MWP A;  1BIB A;  2D9T A;  4L59 A;  5LJ5 e;  4MZT A;  2DD4 A;  1K73 C;  3QZ9 B;  2EAY A;  2LVM A;  2E5Q A;  4OB1 B;  4R55 A;  3HKS A;  4M78 C;  4OF1 A;  3HSB A;  1WNL A;  1VQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...