5GMKh

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
70
Chain Sequence
b'PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pre-mRNA-splicing factor 8
molecule tags Rna binding protein/rna
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 8
structure length 70
sequence length 72
chains with identical sequence w
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkh00
4PJOG 4J6YA 2VXEA 4XTYA 3RIRA 5I21A 5LJ5e 5GAOm 1I5LA 4F7UE 4M7DF 2YLBA 4JRKA 4X9CA 4XU3A 5GANh 4HA8A 1M8VA 5GAMh 5GAN2 1KQ2A 4M7DG 4M75G 2Y90A 5GAN6 5GMKj 4J5YA 4M75E 4C8QE 2DTOA 4M78C 3QSUA 4XTXA 4C92E 4MMLA 3JCMQ 3V8KA 3V8LA 2DJZA 4JLIA 4WF2A 4C8QG 1I8FA 4PJOE 2RA2A 4M77A 4N0AA 5GAN8 5GAN3 5GAOl 4M7AC 2EJGA 5DY9A 4M7AB 3FIFA 5LJ3h 5GAN5 4M7AA 4RCCA 2VC8A 3M4GA 3L2ZA 3V7CA 5GANd 1LOJA 4XU2A 5GAMe 1MGQA 4M7DB 4M77G 4M7DC 1Y96A 2E64A 5LJ5f 3QUIA 3V8JA 3JCMX 1N9SA 3HSBA 3JB9F 4M77C 1D3BB 4M78B 4OP0A 2E41A 3JCMJ 4QVCA 3BDUA 5GAN4 4M77B 4PJOC 5GANf 4C92D 3AHUA 4C8QD 5LJ3f 1I81A 5CAIA 5GMKi 4EMKB 2RB6A 5GMKl 4M7AG 4PJOA 5GAOr 3V7SA 4A53A 5LJ3e 3BFMA 3RKYA 3SB2A 5GMKh 4M7AF 4C8QB 3GIBA 5GAMj 4C92B 2DTIA 4EMHA 3JB9I 5GANj 1U1SA 4M75A 3RERA 2DXTA 2DXUA 4M78D 3RUXA 1KQ1A 3V7RA 4XQ3A 1WPYA 3BY7A 4XU0A 3EFSA 2DZCA 2EWNA 1H641 3QO3A 4XU1A 4XTVA 4F7UA 2K57A 3JCMe 3JB9J 4XTUA 5LJ5j 4A54A 1N9RA 1BIBA 4JRIA 4F7UF 4M7AD 4M7DE 4XTZA 3JB9D 3RKXA 2RM4A 4F7UG 4EMKC 4M7DD 5LJ5d 1JBMA 4J6WA 4XTWA 3JB9G 3EFRA 4M78F 3VU3C 4PNOA 4M75F 4C8QF 5GAOq 2DKGA 4M77E 2DTHA 4NOYA 3JCMd 4X9DA 1B34B 1WQ7A 1WNLA 1I4K1 4NL3A 3JB9H 4V2SA 2DVEA 4PJOF 3RESA 5LJ3g 3RKWA 1TH7A 1B34A 2VXFA 3FJPA 4M78G 4M77D 3HFNA 2EAYA 5GMKe 4EMKA 4C92F 2CGHA 4HT8A 5GAN7 3INZA 1LJOA 1D3BA 2DZ9A 4M78A 5GANe 2RD1A 5GAMd 5GAMg 3JCMh 4J6XA 5GANg 1HK9A 4C92G 1X01A 3JCMb 1M5Q1 2YLCA 3PGGA 2EJFA 4F7UB 4HT9A 2EJ9A 3BW1A 4RCBA 3JCMV 2E65A 4DQ2A 2YHTA 3JCMW 2QTXA 2DEQA 5GAMf 2E1HA 2I2LA 5GMKm 4C92A 5GAOn 2FB7A 4M75B 4C8QA 1U1TA 2ZGWA 4M75C 5LJ3d 3JCMc 4PJOD 1YCYA 4JUVA 2E10A 3FB9A 4EMGA 1BIAA 4MMKA 4QVDA 5LJ3j 5LJ5h 3JCMg 4PJOB 2JN0A 1WQWA 4M7AE 4M75D 5LJ5g 1HXDA 3HFOA 4NL2A 3JCMP 2HNIA 4Y91A 3JCMf 1LNXA 1Y96B 2FYKA 3L1AA 3SWNB 5GAOp 4C8QC 1JRIA 4C92C 3SWNC 4M78E 3QHSA 3SWNA 4M7DA 4M77F 4N0AC
chains in the Genus database with same CATH superfamily
1I5LA 4J6YA 4XTYA 4ANJA 2DERA 4DBQA 2DM1A 1YJ9A 1WDXA 4QVZA 3UDCA 2KQWA 3QKJA 4M78C 3QSUA 4EPCA 2ROLA 2ZZDA 4C5GA 1W2BP 1ZA1B 5GAOl 2DF6A 5DY9A 1S72T 3H6ZA 1G3SA 1WXUA 1O9SA 1PG5B 3CBOA 5GANd 1K73R 4M7DC 2VASA 1WX6A 1MMNA 1RAAB 4TVRA 4EMKB 3CBMA 5CIUA 2DL5A 3RUXA 1PKTA 1KQ1A 4B9WA 1U5SA 3VS2A 4DBRA 4IUTA 1N5ZA 2RH2A 1OULA 1JJ2S 1UGQB 2FPFA 2GBQA 1VQPQ 4L59A 2LQ8A 2FG0A 1UEBA 2JOYA 1JB0E 2RM4A 2L3PA 1VQOA 4Y28E 1MHNA 5GJWB 1GFDA 2AHJB 2JTEA 1PC0A 3M4YA 1M90R 1WJSA 2VXFA 3MHXA 4A4KA 3DKMA 3M58A 5FLXE 4C92F 4E7JA 4CC7A 1SRLA 2K3BA 3OMCA 2QQAA 2CH4A 2EYYA 5C0MA 1QKWA 1OQKA 2RD1A 1M30A 1VQ5T 1X75C 1NM7A 3I55A 1QLYA 4QT7A 2O4XA 4N4IA 2HKNA 3MKDA 4QQ6A 4JPBW 2DD4A 2OTJA 3EFOB 2J06A 1FMVA 2RI3A 4EMGA 2PVOB 4QVDA 2YUPA 4PJLA 3NPFA 1NPPA 3CPWA 2KBTA 1TUDA 1TSFA 1WYXA 1BI3A 4PLLA 3UA6A 4M78E 5A2QE 2O2OA 1F1BB 3OY9A 1WXTA 2GNCA 5L23A 3CC4T 1KQ2A 1Y57A 3C94A 2CUBA 1ACMB 1PD1A 4ZNXA 2DEUA 1MUZA 3A8OB 2F1LA 7AT1B 3EGXA 3A8LB 2AT1B 2RO0A 2K2VA 1IB8A 3EH2A 3JB9F 3JAME 5EC7A 5IXFA 4M77C 2CP5A 2PNIA 1TS9A 3WVEB 1KD1U 5GMKi 4IUVA 4M7AG 2JMCA 3E1SA 4HCZA 4F14A 2EBPA 3G4SQ 4C8QB 4HCKA 4JS4A 3G1JA 4P5NA 1FMWA 2O9SA 1UGRB 1ZSGA 4OB2B 5CQYA 1TWBA 3RMQA 4DEYA 2QDLA 5J26A 2GCXA 1AWJA 2M0YA 4DA4A 2HKQB 3X24B 3FJPA 3BE3A 1K9MR 2EVRA 4PJNA 2CDTA 1B07A 2KYMA 1R0CB 3VYHB 2YWWA 1W2BS 2HQEA 1ZBXA 1MMDA 3PGGA 3C95A 3JCMV 2E3IA 2DEQA 2NUTB 3CCMT 4LDYA 2LCCA 3URGA 1YCYA 5KYUB 3P8HA 1JXOA 4Y92A 1AWWA 1M27C 3G6EA 3CCUQ 1WLPB 2CSQA 3RNJA 1XOVA 3VS6A 4JS5A 3OYJA 5I2MA 2YSQA 4AFQC 1XJWB 3NMZC 1WFWA 1RAFB 2COZA 2QI2A 1PCXA 4OMPA 2M02A 4X34A 2WSEE 2HSEB 3V8LA 2KXDA 1K8AU 3QYHB 2KI7A 1EFNA 2ZPGB 1KQSP 1VOMA 4GLKA 5LJ3h 4J9EA 1VQ9Q 3NGPA 4F16A 2PUKB 1X6OA 1Q86R 2L3RA 4C5IA 2CZ1B 3M0TA 1M3CA 2K3YA 5CAIA 1U06A 4PFOA 1XNIA 2BIVA 2PQWA 4HXJA 1LPLA 1WHMA 2RF0A 2DXTA 2L0AA 2GTJA 3TU4K 1QP3A 2HCKA 4XU0A 4ZN3A 2GFAA 2K57A 4F04B 4JJNK 2J05A 5LJ5j 4M7DE 2DXBA 2F5TX 3GLXA 4Z88A 2MPXC 4BI3A 4J6WA 4CRIA 3VU3C 3VJPA 5FWCA 2KAFA 1K1ZA 4FYXB 2DILA 2RQTA 3JB9H 4PJOF 1KD1R 4LDUA 1KHIA 3MP6A 1Q82C 3C4SA 2XDBA 1YITA 4GBQA 4PK4A 3DLMA 3QDRB 4KUDK 1ZX6A 4RTWA 5KYXB 1M90U 2OTJQ 1UFFA 2DIGA 5DLQE 3I55Q 3GNFB 5FU7C 1SHGA 3SDZA 1VQ5A 1IRXA 5D6YA 1H3HA 3PMIA 4JDSA 1YITQ 4RTZA 3C12A 1OYXA 5FU6B 1VQKT 2LJ3A 5IHNA 4Y91A 4FYYB 4BI8B 1VQ8T 5GAOp 4C8QC 4ME7A 2PUOB 1KC8R 4N0AC 1HSQA 3KXTA 5GAOm 2OTLT 1BCOA 1BKBA 4X9CA 4AG1C 5FW9A 5GAMh 1JU5C 4M75G 5ECAA 3LX7A 2CZ0B 1J3TA 2B86A 2LT1A 4XTXA 1UUEA 3PTAA 1SEMA 4BE2A 4DOWA 1Y71A 1NLOC 4R56A 4FSXA 5HKCA 3FJ5A 2CP3A 5KYWB 3CC4A 2LDMA 2V26A 1SF9A 2A0FB 3WVDB 2E64A 5LJ5f 4R55A 2GGRA 3J7AF 1VQ4Q 1VQ8A 3EHQA 3MO8A 2K5IA 1IZ6A 3D7SB 5CK9A 1GCQA 3HL8A 1K4US 1D1CA 2X4WA 4F17A 2CSIA 3MP1A 1WI7A 1K76A 4J8OA 2QA4T 1CSKA 2RI5A 2LVMA 3CCJA 2YUQA 3JB9G 4PNOA 4M75F 3HRSA 2K2MA 2VVKA 1QQJA 4X9DA 2ZPFB 1I4K1 3P8DA 2LX7A 4HCBA 2RHYA 2FEIA 2RHXA 3IQLA 4KH0B 4M77D 2E5QA 1YP5A 3TEEA 3CCQQ 1OPLA 3I56Q 2ED1A 2YRDA 1ZQ1A 2QASA 2KE9A 3VV0A 2LMJA 3CCSQ 2YLCA 1RI0A 4FM4B 2CT4A 5GAMf 5FU7B 2PVGB 4RG8A 2PVDB 1VQMA 2ZPIB 5KYYA 1QWFA 4HVUA 3EG0A 4LDVA 4MMKA 2JM9A 4LN2A 2RQUA 3JCMf 3RR6A 3S3OA 2XICA 2A08A 3SWNC 4OMOA 2RI2A 4R0KA 3SWNA 2YT6A 5FWBA 3OYCA 2YXYA 3REBB 1T3LA 4PLIA 1VQMQ 1PD0A 2KYBA 2DFUA 5GMKj 4J5YA 3O8VA 3LH5A 2CP0A 1UJ0A 3CCSA 1VQLT 4PJOE 3HP9A 1M1KC 1PSFA 1IHVA 2VC8A 1VQNT 1C1AA 5GAMe 1CKAA 3OS2A 1AD5A 2RHIA 4IUUA 4C92D 4C8QD 3PIPA 2X3WD 4EIKA 4JLGA 4Z8AA 4A53A 1YJWQ 4FL6A 2QTVA 2XG8D 4LXCA 4MZPA 2EW3A 3TSZA 2JZ2A 2RHUA 4RMOA 4FIBA 2DRMA 9ATCB 4A54A 1ZHIA 3RBBB 4FU6A 1JQQA 1N6AA 4NOYA 2K5LA 1H8KA 2I0NA 1WNLA 4PKCC 5LJ3g 3S3MA 3JRZA 1BI0A 1XQHA 2EQUA 3HFNA 2X35A 3INZA 1M4ZA 2AKKA 3E19A 1IHWA 4J6XA 5HK3A 2DE0X 2EJFA 2MWOA 2JTFA 2KROA 5CKDA 4DOVA 4J9BA 1W70A 1YWPA 2COYA 2JXBA 4D6WA 3DB3A 4LD6A 3QXEB 4KBMB 2XU8A 1QVPA 2FRYA 4L5GA 1VQLQ 2AZVA 1RLPC 2JN0A 4BE1A 1KK7A 1OX9A 4M75D 4Z89A 3LWIA 2A37A 4E47A 3SWNB 3HKSA 3TVTA 2KT1A 1X6GA 1OZ3A 2ZAEA 1VIEA 1VQLA 2M1HA 3CC7A 1TUCA 2BKDN 2OAWA 1FXXA 1SSHA 3NTKA 5CR2A 1G3YA 2X3XD 4E6RA 4D8DA 1N8RR 2FPDA 2Y90A 2FVUA 4M75E 4PFPA 2DTOA 1U8RA 2DYIA 2MF2A 3PNWC 4HVWA 1WHGA 2LZ6B 1U3OA 5C6SA 3JSCA 4CI0C 3GP8A 1EIFA 3G4ST 1JJ2A 3OYAA 4ZTJA 3CC2Q 3V8JA 3TQ7P 2DX1A 3TREA 1V29B 5GANf 4AFSC 3MEWA 2D8JA 4QQDA 4A4EA 3ASKA 4KULA 1PWTA 4PJOA 5GAOr 3AT1B 2EIFA 4CC2A 4RKUE 5GAMj 2E3HA 5CKFA 2LTOA 3CCEQ 1K9AA 2V8IA 2VKNA 2D0NA 4XU1A 2O9VA 4FT2A 2H3JA 4M7AD 1MV0B 4PL6A 3MEUA 1NEGA 4EMKC 3REAB 5A0LA 3PVLA 3OW2A 4V2SA 3N5BB 3OYGA 1G83A 3M54A 1ZUUA 4NS5A 3OYKA 1M9SA 5HK0A 3A8MB 1HK9A 3GBQA 1JO8A 2HL5C 4HT9A 2DK3A 3CMEQ 2RQWA 5LJ3d 4PJOD 1GXIE 1C6VX 3CCVQ 4M7AE 1VQ7T 2KY9A 2QGFB 2DLPA 3VS5A 4C0DB 4MDXA 1Y0MA 1OPKA 3VYGA 4OB0B 2F69A 3OBWA 1VQNQ 1YITT 2E6NA 4M7AA 2NWMA 4II1A 4F7UE 4QQGA 2MYSA 3PVQA 5GAN2 1WHHA 1KHCA 1HD3A 5EG2A 4C8QG 1YBYA 2DPPB 1I1JA 1TXQA 4LDWA 2LCLA 2A3LA 4UC4A 2EFIA 3L2ZA 2QEXQ 5LL6S 4AMCA 2YDLA 4BB7A 1VQKA 1Y96A 4FW2A 3LH0A 3VUBA 3HSBA 1I0CA 2MWPA 4HVVA 1MV3A 5IHIA 3JCMJ 3CC2A 4M77B 3L2RA 1KC8U 4BI4A 5DLOA 1YJNA 2G6FX 3OSSC 1KJWA 2KT8A 4OGEA 5CKHA 1KFZA 3JB9I 5GANj 4B6MA 2GF7A 3CCMQ 2EYQA 4XTVA 1UB4A 4BACA 1LVKA 1TOVA 1UHCA 2RQRA 3LGLA 3KBGA 4A4FA 2ED0A 3AHUA 4ATOA 1NLPC 4BDYA 4C5EA 2RJEA 3JCMd 1ZA2B 1WJRA 3OYFA 2ZPHB 3I55T 1YCSB 2O4XB 5IXBA 4OMLA 1QVGS 3EGDA 2QDYB 2JS2A 1Q7YU 2BZ8A 1Q81C 5KCOA 2XD0A 5IHKA 5GAMd 1YIJA 2COWA 1LCKA 5KCHA 4IUQA 3CCVT 1X6BA 2KVQG 3GF5A 2R58A 4JJBA 1Q7YR 3BDLA 2KRMA 1YNZA 4LNPA 1K8AR 5I22A 2EGAA 4FYVB 4IURA 1BU1A 1RAIB 1H3ZA 2DO3A 2ENMA 5LJ5g 2NLUA 4DEXA 2EYXA 1X2QA 2A7YA 3HTRA 1Q82U 4C0DC 3OYIA 2B8AA 3G71A 4M7DA 3A8GB 4BDZA 2XI9A 1G2BA 1D1BA 2EQKA 2YLBA 2P84A 2L8DA 2HQHA 4M7DG 2EKOA 4C8QE 4C92E 2K5FA 1KD1C 2D0QB 2DBMA 1T0JA 2JM8A 3UPUA 1YJWA 1X27A 3CC2T 1OX8A 5AT1B 1RABB 5GAN5 3CPFA 1M1FA 3JV3A 2V1QA 1K8AC 2LNVA 4M78B 3SFMA 3BDUA 3CPWS 1Q7YC 1GBRA 4K11A 2K79A 2A28A 2E6ZA 4BD3A 3H41A 1YHQT 3ZEHA 2XKOC 2DL4A 2F2WA 2CH4W 2JTMA 2JVVA 1ABOA 2JS0A 3RERA 2DNUA 4XQ3A 5FRMA 3BY7A 2DZCA 2EPDA 4JZ3A 5D7UA 4Q5WA 5A0DA 2LX9A 4JRIA 1YJWT 4HCCA 5CQXA 5I11A 4M7DD 2XIDA 4M4ZA 3VS0A 3H9NA 2LRQA 4C0ZA 1D0XA 1B34B 3QWXX 1RAGB 3CD6A 5M9OA 3S3NA 8ATCB 1YHQA 3OMGA 1MNEA 4AT1B 1W4SA 1GRIA 4IIOA 4J9FA 2LQNA 3LYIA 5KYWA 5FRNA 3JCMW 3G6ET 1Q81R 1K73C 1YJ9Q 4KGXB 1U1TA 3CCQA 2MCNA 3FEOA 4JUVA 1SSFA 4RTXA 3EG3A 4YTLA 1ABQA 4J9GA 2K4YA 4ELYC 2O88A 4NL2A 2VWFA 2CZ7B 3QZ9B 4JZ4A 1VQ6Q 3G6EQ 3CCUA 4OF1A 3QHSA 3RIRA 3MJXA 3NFCA 2V8KA 1VQ7A 4KRTA 2KEAA 4QKUA 1PHTA 2DAQA 5GAN6 4N4GA 3ZL7C 2HBPA 3JCMQ 3CCLT 1GBQA 4JLIA 4M7AC 4A4HA 1ARKA 4J7IA 4RTYA 3QYGB 4RCCA 3OW2P 2MI6A 1YHQQ 1LOJA 2K7AA 4XU2A 3X20B 4ZGEB 2KDSA 3EG1A 3KFVA 2OJ2A 1E7OA 2O31A 5KYUA 1K9MU 2MOXA 2DTIA 1QVFA 1N8RU 2KR3A 3QG1A 4C0FA 3VS3A 1QKXA 1RAHB 1OI1A 2RQVA 1S1NA 2CUDA 2OAUA 4LUDA 3G4SA 1Z9ZA 1S72A 5GAOq 2H8HA 1PM3A 3L42A 3M5AA 4ESRA 1T0HA 2EYWA 1TH7A 1AWOA 3M57A 3VRZA 4EMKA 2KRSA 3Q1JA 4FSSA 3L2VA 3GOXA 4HT8A 5D6XA 2AIRB 5CKBA 1PKSA 1VQ5Q 2D8HA 5KYNA 2FPEA 2ECZA 2DZ9A 3QDFA 3I9QA 3FLGA 1FWZA 3JCMb 2HD0A 3SEMA 1EZZB 5HY6A 2E12A 1G8XA 2NUZA 2ZGWA 8AT1B 2KNBB 2DRKA 4FCYA 5FROA 2ATCB 2CYZB 2EGEA 1BB9A 1HXDA 2FHDA 2W10A 3HFOA 2HNIA 4JJDA 3UA7A 1N8RC 3ZBDA 1H92A 3PMTA 2F5KA 2L2PA 2EQJA 1OU9A 1RACB 1VQPT 1FYNA 3X26B 4ZTFA 2MK5A 2ROTA 1M90C 1X43A 3ME9A 1O75A 2C0TA 2BE9B 5GAN8 2EJGA 1WZOA 3T9NA 2VGNA 1IREB 1D3BB 1G3TA 4C5HA 1BI1A 3MEAA 1WGSA 2BUDA 4PJJA 3PIOA 3QBYA 2RB6A 1V76A 3OYYA 1VQOQ 1BBZA 2HBWA 3RKYA 4B9XA 2IIMA 3OQ5A 2SRCA 1VQPA 2LP5A 2QK0A 3OBYA 5CCAA 1BYMA 1AVZC 3EHRA 2DBKA 3M0RA 2MMPA 1M1KR 1DJ7B 1NZ9A 2EYZA 3CCMA 4QW2A 3E9GA 1K73U 3I5SA 2JNGA 1AZGB 2SEMA 2ESWA 1ZBJA 4J83A 2P4RA 5CKEA 4M78G 3FC3A 5GAN7 4M78A 5GANe 3A98A 2FL7A 1IGUA 1MMAA 3J80E 5KYXA 2GFUA 1YN8A 2YRVA 1OU8A 2RHZA 3LGFA 2GQVA 4A63B 3A8HB 1M8MA 3CCLQ 1KC8C 3MP8A 1UGSB 1Q81U 1VYUA 2V8JA 1LNXA 1Y96B 1KQSA 1VA7A 1JEGA 1AWXA 3H0HA 2GQIA 1JJ2P 2HL3A 4PJOG 2HEQA 1D0ZA 2QQ9A 1YI2A 5GANh 1YIJT 3CCUT 1W6XA 3A5ZB 3V8KA 4BY6C 2W0ZA 3X25B 2OTLA 2ABLA 1B3QA 3CCET 1K0SA 2EQIA 2ZCFB 2K3XA 4GY5A 3FIFA 1YJ9T 3V7CA 3CMAT 3OA6A 2CKKA 3CD6Q 1I5OB 4RTVA 2P0KA 1NYFA 3OSVA 1G3WA 1I81A 4OMNA 1C0MA 3EFOA 5IN1A 4C92B 3L2UA 2QQSA 4M75A 3FDRA 2J6KA 2DXUA 4M78D 4J9DA 1AHJB 1UHFA 2EWNA 3RDVA 3NTHA 1VUBA 3CCEA 3UATA 2LCSA 4E7KA 2RNAA 4XTZA 4BE0A 1MNDA 3MCAB 1AT1B 5HCKA 4J9CA 4KH1B 4M78F 1QMCA 3SD4A 1SRMA 4JJCA 2QA4A 4C0GA 1RUWA 2DVEA 2ZPEB 3VKIA 4ZGJB 1SKUB 1M2VA 3G7ZA 2PTKA 1ZLMA 3QJYA 1VQ6T 1LJOA 1ZSZB 1AOJA 2V1RA 2YRCA 5GJVB 1UE9A 1QWEA 1G5VA 1RADB 5GANg 1X01A 1M5Q1 2QYZA 2HZYA 1UGVA 4J9IA 2LJ0A 2J6OA 3JCMc 4Z02A 2E10A 5LJ3j 1JXMA 3EH1A 1NJIC 3G71Q 3R6NA 3MPUB 1BK2A 2LQKA 2WSFE 3LW5E 1GCPA 2FYKA 3LLRA 4M77F 3EGXB 3ZFJA 4JRKA 4HA8A 1M8VA 2BE7D 2P0QA 1FX7A 4IKFA 2DVJA 3OS1A 2HMAA 3CBPA 2RA2A 5GAN3 4N0AA 3CCRT 4FT4A 1KG1A 3ER0A 1WHJA 3DLLA 2E41A 5GAN4 1AZEA 2MAMA 1VQ9A 4OMMA 1TG0A 5GMKl 4DBHA 3DB4A 3TCJA 3BFMA 2X51A 3S6WA 1A0NB 3GIBA 1Q86C 3PE0A 2Z0WA 3QPHA 1QVGA 2RK1A 4MZMA 3EFSA 3QO3A 2J6FA 4F7UA 3E2UA 2VGMA 1VQMT 2L3SA 4X1VA 1WA7A 3CCRA 1VQ6A 1VIFA 1NEBA 1NYGA 2DTHA 2HAXA 2KGTA 3CXCP 2CREA 3L2WA 3WXMB 1W1FA 4OMQA 2XMFA 4O6JA 2QEXA 1KQSS 2P0PA 1D3BA 2WSCE 2DXCA 4XAXB 4J9HA 5IT9E 1KSWA 2HQXA 4F7UB 2EJ9A 3BW1A 4RCBA 2R57A 3CCST 5GMKm 2E1HA 4MDWA 2P4TA 4RG2A 3I56T 2AZSA 2FZCB 2RPNA 1VQOT 1UECA 1QP2A 4BY6B 4E7LA 2JMAA 1NJIR 4RUGA 2R5MA 3M9QA 3SB2A 2BZXA 5I21A 1PSEA 4M7DF 1WHKA 2RJDA 3L2QA 3M0SA 2C0IA 3CMEA 3M0PA 2OTJT 4M77A 2L89A 4M7AB 4FYWB 1PRLC 3I56A 4M7DB 1MGQA 4M77G 3OW2S 1TTHB 3M0UA 1M1GA 3C0CA 3JCMX 3ULRB 4MZTA 3OYMA 3VRYA 3CD6T 2D1XA 2JUFA 2M16A 1BI2A 3EG9A 2CT3A 5LJ3e 4M7AF 3CCJQ 1RL2A 3VS7A 1U1SA 2QGGA 2QG9B 1IGQA 4LE9A 3CCJT 1VYVA 2KK4A 4KUIA 4A4GA 1WPYA 5AYFA 2L3QA 3E9FA 4KGVB 3CXCS 4VUBA 2M0OA 2LJ1A 2LQWA 4F7UF 2BTTA 2IPOB 1I07A 1M3BA 5KE3A 2LC4A 3EFRA 5J3BA 4M77E 1QVGP 2QEXT 1RI9A 3HRUA 1VQ8Q 4NL3A 5GMKe 3EG9B 3OYHA 4E7ZA 5CVIA 2DL8A 3QZ5B 1UTIA 3JCMh 2FZKB 4C92G 3M59A 1Y07A 3EGDB 2IVWA 1BCMA 1GFCA 1QW1A 4RTTA 4DQ2A 2JW4A 1ZUYA 1TU0B 4C92A 4M75C 4O5VA 1K9MC 1ZSZC 3UT1A 2OX7A 1WHLA 2C06A 3RMSA 1WQWA 3M53A 3JCMP 2MIOA 4LUEA 3NHNA 4C92C 3QJ6A 1OV3A 4E7IA 3P8BB 4JRPA 4E7HA 2M51A 4WF2A 1M3AA 3HRTA 4IUPA 4AFUC 1YJNQ 1UJYA 4RTUA 5D6WA 1RLQC 4ORZA 4XK8E 1N9SA 1SG5A 4OP0A 1VQKQ 2RN8A 1SHFA 1UGPB 1NJIU 4AFZC 4KGZB 2NUPB 2E70A 3V7SA 5KYYB 2X9HA 3VS1A 3J81E 4EMHA 3EG2A 1E6GA 2CS7A 3V7RA 4ZGDB 1VQ9T 4OVAA 2LT4A 2WACA 3OB9A 3JB9J 2XDDA 4XTUA 1N9RA 5IH2A 2CZ6B 3JB9D 5KE2A 3PFSA 3M0QA 5LJ5d 1D09B 4XTWA 3CMAA 2YUOA 4C8QF 4JRQA 1YFNA 3OYDA 2D9TA 1K0XA 3VUZA 2JJ9A 2F2XA 2NUPA 2CP2A 1GCQC 4PFZA 4PJMA 1R77A 3A1PA 1XTDA 1R8OB 4LD9K 4GLMA 5GAMg 2QXFA 2DIQA 2K9GA 3GNGA 3CPWP 2E4HA 2E65A 4ELZC 2X4JA 1V1CA 4M75B 3M55A 5A0GA 1YI2Q 2ZPBB 3FB9A 2FZGB 1BIAA 5LJ5h 3JCMg 4PJOB 2LNHB 3CC7T 2H3EB 1Q95G 1FMKA 2DL3A 4E2FB 1R0BG 5J39A 2DA9A 3M56A 4DBFA 3CCLA 2FO0A 2VXEA 2XDPA 3THKA 2BZYA 4XU3A 1NBEB 3KUFA 5FU6C 2O01E 1OOTA 1M2OA 3G71T 1QCFA 3X28B 4FW1A 2QQRA 1QVFP 3MEVA 3UF4A 1IO6A 2KSSA 2F2VA 2R5AA 1M1KU 3CXCA 1KIKA 2Y4YA 3SHWA 3NTIA 1RAEB 3QUIA 2X4XA 1NE8A 4QVCA 4PJOC 2CP6A 3OYBA 3CEYA 3PT9A 5LJ3f 2DYBA 1B7TA 2VUBA 1HJDA 1UDLA 1WJQA 1SPKA 4OB3B 2L5QA 1Z9QA 2VYTA 3CCRQ 3I5RA 1P92A 2FRWA 2X4YA 1H641 1HYOA 2PZ1A 2RJFA 3CQTA 2E5KA 4KT0E 3CC7Q 1BIBA 4N4HA 3I35A 2AKLA 1D0YA 1JBMA 3F70A 1AEYA 3QIIA 4WTOB 1WXBA 3HHTB 2DKGA 1UG1A 5IAYA 1WQ7A 3H0IA 1VQ4A 1IXDA 2HSPA 3RKWA 2QAZA 1B34A 2RJCA 4OMFB 1YWOA 1MMGA 2C0OA 1YJNT 1NG2A 2KMTA 4CC4B 1PRMC 3CC4Q 1YI2T 3LWHA 2HDAA 4ZN1A 2DD5A 2EKHA 3H0FA 1ZSZA 4EDUA 2DL7A 5L8RE 2YHTA 1YIJQ 5GAOn 2FB7A 4C8QA 2NYSA 2DETA 2Y4XA 4L6V5 2G3RA 4OB1B 1X69A 2RMOA 1Q86U 2XK0A 4OGCA 4J7FA 5DM7R 3TSWA 5LJ5e 1D1AA 1QVFS 3VS4A 1Q82R 1PNJA 4HKEA 4E7SA 3GPLA 4WCIA 1QCNA 4MMLA 2QQBA 1X2KA 2DJZA 1I8FA 1GL5A 3META 3M4GA 5I2SA 2KXCA 1VYTA 2K6DA 2A36A 2QA4Q 3OS0A 4D8KA 4LDXA 3OYNA 1S72Q 2DMOA 5GMKh 2VB6A 2EGCA 2AK5A 2NUTA 2M9UA 2D6FA 5CO7A 3CMET 1EX4A 3R6OA 3UWNA 3HPWA 3JCMe 1E6HA 2KRNA 1VQ4T 3CCQT 2YUNA 3RKXA 4F7UG 3OS5A 2VV5A 1VQNA 3H8ZA 2EQMA 2JT4A 1M2VB 3U23A 3FRNA 1OEBA 1ZUKA 3RESA 3OYLA 1N27A 3CCVA 3EGUA 2EAYA 3QWYA 2CGHA 4IIMA 2OI3A 2IG0A 4CC3A 2PU9B 1T3SA 2OTLQ 1NPRA 4AG2C 2XHCA 2QTXA 2I2LA 1CKBA 1OZ2A 2CP7A 2J7IA 1QCOA 1VQ7Q 1TUGB 1Y7XA 2DJQA 2GTOA 3OYEA 2RK2A 3O5ZA 3L1AA 3EAEA 3CMAQ 1W2BA 1JRIA 4BUGA 1WIEA 5KH6A 6AT1B
chains in the Genus database with same CATH topology
1I5LA 4J6YA 4XTYA 3RIRA 3NFCA 5I21A 1PSEA 2V8KA 4M7DF 3OYCA 1VQ7A 2RJDA 4PLIA 3L2QA 1YJ9A 2DAQA 4QVZA 3UDCA 4N4GA 4J5YA 5GAN6 2KQWA 3O8VA 3QKJA 4M78C 5GMKj 3QSUA 2HBPA 4EPCA 3JCMQ 3CCLT 4JLIA 2ZZDA 4C5GA 3CCSA 1VQLT 4PJOE 2OTJT 4M77A 3HP9A 5GAOl 4M7AC 4A4HA 2L89A 1M1KC 1PSFA 5DY9A 4J7IA 4M7AB 3QYGB 4RCCA 2VC8A 1VQNT 3I56A 2MI6A 1S72T 3H6ZA 1G3SA 1LOJA 1O9SA 3CBOA 1MGQA 4XU2A 5GAMe 5GANd 4M77G 3OW2S 4M7DB 4M7DC 3OS2A 1M1GA 3JCMX 2RHIA 4IUUA 3X20B 4ZGEB 2KDSA 4MZTA 4C92D 4TVRA 3OYMA 4C8QD 3PIPA 3CD6T 4EMKB 2JUFA 2M16A 1BI2A 4JLGA 4A53A 5LJ3e 1K9MU 4M7AF 4FL6A 3CBMA 1RL2A 2DTIA 1QVFA 1N8RU 2XG8D 1U1SA 5CIUA 3QG1A 4C0FA 3RUXA 3CCJT 4MZPA 2KK4A 1KQ1A 4KUIA 4A4GA 4B9WA 1WPYA 5AYFA 2JZ2A 2RHUA 4RMOA 4IUTA 3E9FA 4FIBA 1OI1A 3CXCS 4VUBA 2M0OA 2RH2A 1JJ2S 1UGQB 4A54A 4F7UF 4L59A 1ZHIA 2LQ8A 2OAUA 1UEBA 2JOYA 1JB0E 2RM4A 5KE3A 3G4SA 2LC4A 4FU6A 3EFRA 5J3BA 1VQOA 1S72A 5GAOq 1N6AA 4M77E 4NOYA 2K5LA 4Y28E 2QEXT 1MHNA 3HRUA 3L42A 4PKCC 1WNLA 2AHJB 4NL3A 3M5AA 5LJ3g 3M4YA 3S3MA 3JRZA 1TH7A 1BI0A 1XQHA 1WJSA 5GMKe 2VXFA 3MHXA 3OYHA 2EQUA 3DKMA 3HFNA 3M57A 3M58A 3Q1JA 4A4KA 4C92F 5FLXE 4EMKA 3L2VA 5D6XA 2X35A 5CVIA 3INZA 3GOXA 4E7JA 4HT8A 5CKBA 1M4ZA 3QZ5B 3E19A 3OMCA 2QQAA 2DZ9A 5C0MA 2RD1A 1VQ5T 3JCMh 3FLGA 4J6XA 1X75C 1FWZA 4C92G 3M59A 3JCMb 2HD0A 5HK3A 3I55A 1Y07A 2EJFA 2MWOA 2IVWA 1QW1A 4DQ2A 2JTFA 2O4XA 5CKDA 4DOVA 4N4IA 4QQ6A 5HY6A 2DD4A 2E12A 4C92A 4D6WA 3DB3A 2OTJA 4LD6A 3QXEB 4KBMB 2ZGWA 4M75C 2XU8A 1QVPA 4O5VA 2RI3A 4EMGA 4L5GA 3UT1A 2PVOB 4QVDA 1K9MC 5FROA 2JN0A 2CYZB 2C06A 3RMSA 1WQWA 4BE1A 3M53A 4M75D 1NPPA 1HXDA 3LWIA 2FHDA 3HFOA 3CPWA 3JCMP 2HNIA 4E47A 1BI3A 4PLLA 3SWNB 1N8RC 3HKSA 3ZBDA 4C92C 5KH6A 4M78E 1OZ3A 3PMTA 5A2QE 2F5KA 1VIEA 3QJ6A 2EQJA 1VQLA 4E7IA 2M1HA 3CC7A 2BKDN 3OY9A 1FXXA 3NTKA 3P8BB 5CR2A 1G3YA 4JRPA 1VQPT 3CC4T 3X26B 1KQ2A 4ZTFA 2Y90A 3C94A 2FVUA 4M75E 2DTOA 1U8RA 2MF2A 4E7HA 1M90C 3PNWC 3ME9A 1O75A 4WF2A 3A8OB 5C6SA 3HRTA 3JSCA 5GAN8 4CI0C 3GP8A 1EIFA 2EJGA 4IUPA 3A8LB 3G4ST 2RO0A 5D6WA 2K2VA 1JJ2A 3OYAA 4ZTJA 3T9NA 4XK8E 2VGNA 3V8JA 3JAME 1IREB 1N9SA 3JB9F 4M77C 1D3BB 4OP0A 1G3TA 4C5HA 1BI1A 3TREA 1UGPB 1V29B 5GANf 3WVEB 3MEAA 1WGSA 2BUDA 1NJIU 1KD1U 3MEWA 5GMKi 4IUVA 4QQDA 3QBYA 4A4EA 2RB6A 3ASKA 4KULA 3PIOA 4M7AG 4PJOA 3E1SA 3OYYA 2E70A 3V7SA 4HCZA 5GAOr 4B9XA 3RKYA 2EIFA 4RKUE 4C8QB 3J81E 5GAMj 4EMHA 4JS4A 3OQ5A 1VQPA 3OBYA 5CKFA 2LTOA 2CS7A 4P5NA 3V7RA 2V8IA 4ZGDB 5CCAA 1VQ9T 1BYMA 4OVAA 2WACA 2LT4A 4XU1A 3OB9A 3JB9J 2XDDA 2MMPA 2H3JA 4FT2A 1UGRB 1DJ7B 1N9RA 1NZ9A 4XTUA 3CCMA 4QW2A 4M7AD 2CZ6B 4OB2B 4PL6A 3E9GA 3JB9D 5CQYA 5KE2A 3PFSA 3MEUA 4EMKC 5LJ5d 4XTWA 3RMQA 1K73U 3CMAA 4C8QF 5A0LA 4JRQA 2JNGA 5J26A 2GCXA 3OYDA 3OW2A 4V2SA 3N5BB 3OYGA 4DA4A 2D9TA 4J83A 3VUZA 3X24B 5CKEA 4M78G 3FJPA 3FC3A 3M54A 5GAN7 4NS5A 3OYKA 4M78A 5GANe 1XTDA 1M9SA 1R8OB 3VYHB 5HK0A 4LD9K 2FL7A 2HQEA 1ZBXA 1W2BS 3A8MB 5GAMg 3CMEA 3J80E 2QXFA 1HK9A 2DIQA 3GNGA 3PGGA 2GFUA 4HT9A 3C95A 3JCMV 2E65A 2DK3A 4ELZC 2YRVA 2DEQA 2RHZA 2X4JA 4M75B 3CCMT 4LDYA 3M55A 5A0GA 5LJ3d 2LCCA 3URGA 3LGFA 4PJOD 1YCYA 2ZPBB 1GXIE 3P8HA 2GQVA 3FB9A 1BIAA 3A8HB 5LJ5h 3JCMg 4PJOB 1KC8C 3MP8A 1UGSB 1Q81U 4M7AE 3G6EA 3CC7T 1VQ7T 2KY9A 1XOVA 4MDXA 4C0DB 2V8JA 1LNXA 1Y96B 1KQSA 3VYGA 4OB0B 2F69A 3OBWA 4JS5A 3OYJA 5J39A 3M56A 1YITT 5I2MA 2E6NA 3CCLA 4M7AA 4PJOG 2VXEA 4II1A 2XDPA 2QQ9A 4F7UE 4QQGA 1YI2A 2QI2A 4XU3A 5GANh 3KUFA 5FU6C 1YIJT 5GAN2 4X34A 2O01E 3CCUT 2WSEE 3A5ZB 3G71T 3V8KA 3V8LA 3X28B 4BY6C 3X25B 1KHCA 3QYHB 5EG2A 4C8QG 2QQRA 1K8AU 2OTLA 1YBYA 2DPPB 3CCET 3MEVA 2ZCFB 2K3XA 2KSSA 1M1KU 2R5AA 2ZPGB 2LCLA 4GY5A 2A3LA 4GLKA 3FIFA 4LDWA 4UC4A 2EFIA 5LJ3h 1YJ9T 3CXCA 3V7CA 3L2ZA 3CMAT 2Y4YA 5LL6S 3OA6A 4BB7A 1VQKA 1Y96A 2CKKA 3NTIA 2PUKB 1X6OA 3LH0A 2P0KA 3QUIA 3VUBA 3HSBA 2X4XA 1NE8A 2MWPA 3JCMJ 4QVCA 2L3RA 3CC2A 4M77B 4PJOC 4C5IA 3OYBA 2CZ1B 3L2RA 3OSVA 2K3YA 3CEYA 1KC8U 3PT9A 1G3WA 1I81A 5LJ3f 5CAIA 4BI4A 5DLOA 1YJNA 2VUBA 3OSSC 1XNIA 1WJQA 4OB3B 2L5QA 4OGEA 2BIVA 5CKHA 2PQWA 5IN1A 2VYTA 4C92B 3JB9I 3L2UA 5GANj 2QQSA 4M75A 2GF7A 3FDRA 2DXTA 2DXUA 4M78D 1P92A 1AHJB 3TU4K 1QP3A 4XU0A 4ZN3A 2EWNA 2X4YA 1H641 3NTHA 2EYQA 4XTVA 1UB4A 1VUBA 2GFAA 2K57A 4JJNK 2RJFA 4BACA 5LJ5j 3CCEA 4KT0E 3LGLA 1BIBA 3KBGA 4M7DE 2DXBA 2F5TX 3GLXA 4N4HA 4XTZA 4BE0A 4E7KA 3MCAB 4A4FA 4BI3A 1JBMA 3F70A 4J6WA 4CRIA 3QIIA 4M78F 3VU3C 3VJPA 3AHUA 3HHTB 3SWNA 2DKGA 2KAFA 4ATOA 4BDYA 5IAYA 3SD4A 4C5EA 2RJEA 3JCMd 1WQ7A 3JB9H 2QA4A 1VQ4A 4C0GA 2DVEA 4PJOF 3RKWA 4LDUA 1KHIA 2ZPEB 3VKIA 1B34A 4ZGJB 1WJRA 2RJCA 3MP6A 2ZPHB 3C4SA 4OMFB 3G7ZA 3OYFA 3I55T 3QJYA 1YITA 1Q82C 2O4XB 1VQ6T 2XDBA 1YJNT 1QVGS 3DLMA 2QDYB 2KMTA 1LJOA 3QDRB 1Q7YU 4KUDK 1M90U 1YI2T 2XD0A 1Q81C 5KCOA 3LWHA 5GAMd 4ZN1A 2DD5A 1YIJA 1G5VA 2DIGA 5KCHA 4IUQA 5GANg 5DLQE 3CCVT 1X01A 1M5Q1 2KVQG 3GF5A 2R58A 4EDUA 3BDLA 5L8RE 2YHTA 3GNFB 5FU7C 5GAOn 3SDZA 2FB7A 4C8QA 1VQ5A 3JCMc 4Z02A 5D6YA 3PMIA 2E10A 4JDSA 3C12A 5LJ3j 1OYXA 4IURA 1H3ZA 1NJIC 5FU6B 2DO3A 2Y4XA 1VQKT 4L6V5 5LJ5g 2NLUA 2LQKA 2G3RA 2WSFE 3LW5E 4OB1B 4Y91A 2FYKA 2A7YA 1Q82U 3LLRA 4BI8B 4C0DC 1Q86U 2XK0A 4OGCA 4C8QC 4J7FA 5GAOp 3OYIA 4ME7A 1VQ8T 2PUOB 5DM7R 2B8AA 3G71A 4M7DA 3A8GB 4M77F 4N0AC 3ZFJA 3KXTA 5GAOm 5LJ5e 2XI9A 4BDZA 2OTLT 1QVFS 2EQKA 2YLBA 1BKBA 4JRKA 4X9CA 2L8DA 4HKEA 4HA8A 1M8VA 5GAMh 4M7DG 2EKOA 2P0QA 1FX7A 2CZ0B 3LX7A 4M75G 3GPLA 4C8QE 2LT1A 4XTXA 4C92E 4IKFA 4MMLA 2QQBA 3OS1A 2K5FA 3PTAA 2D0QB 2DJZA 4DOWA 1Y71A 4BE2A 1KD1C 3CBPA 1I8FA 4R56A 3UPUA 1YJWA 2RA2A 5GAN3 4N0AA 4FSXA 3CC2T 3CCRT 4FT4A 5HKCA 3CC4A 5GAN5 3META 2LDMA 3CPFA 3M4GA 1M1FA 5I2SA 1K8AC 3WVDB 1KG1A 2E64A 2LNVA 3ER0A 5LJ5f 4R55A 3DLLA 4M78B 2E41A 3SFMA 5GAN4 3BDUA 3CPWS 1Q7YC 3J7AF 2MAMA 3OS0A 1VQ9A 1VQ8A 3MO8A 2K5IA 5GMKl 2E6ZA 4BD3A 3DB4A 3OYNA 4LDXA 3TCJA 1YHQT 1IZ6A 3ZEHA 3BFMA 5GMKh 2XKOC 3S6WA 3GIBA 2JTMA 2JVVA 1Q86C 5CK9A 2M9UA 3HL8A 2D6FA 3QPHA 5CO7A 3RERA 1QVGA 2RK1A 4XQ3A 3CMET 5FRMA 3BY7A 3R6OA 4MZMA 2DZCA 3EFSA 2X4WA 3QO3A 3UWNA 3MP1A 4F7UA 3HPWA 3JCMe 5A0DA 4Q5WA 4J8OA 2QA4T 1VQ4T 2VGMA 2LX9A 4JRIA 2RI5A 1VQMT 1YJWT 3CCQT 4HCCA 5CQXA 3CCRA 2LVMA 3RKXA 4F7UG 3CCJA 2XIDA 4M7DD 3OS5A 3JB9G 2VV5A 1VQNA 3H8ZA 4M75F 4PNOA 2EQMA 1VIFA 3HRSA 2LRQA 1VQ6A 2DTHA 4C0ZA 2HAXA 4X9DA 1B34B 2ZPFB 3FRNA 1I4K1 3P8DA 3L2WA 4HCBA 2RHYA 3WXMB 3RESA 2RHXA 3OYLA 1N27A 3CCVA 4M77D 2E5QA 2EAYA 3CD6A 2CGHA 5M9OA 3S3NA 3TEEA 1YHQA 4O6JA 3OMGA 2QEXA 1KQSS 2P0PA 1D3BA 1W4SA 2WSCE 2DXCA 4XAXB 2IG0A 1ZQ1A 2PU9B 5IT9E 3VV0A 2YLCA 1NPRA 2HQXA 4F7UB 2EJ9A 1RI0A 3BW1A 3LYIA 4RCBA 5FRNA 2R57A 4FM4B 2XHCA 3CCST 3JCMW 2QTXA 3G6ET 5GAMf 5GMKm 2E1HA 2I2LA 4MDWA 5FU7B 1K73C 2PVGB 4RG8A 2PVDB 1VQMA 1U1TA 2ZPIB 3CCQA 1OZ2A 2P4TA 3FEOA 4JUVA 4RG2A 3I56T 1SSFA 4LDVA 1Y7XA 4MMKA 1VQOT 1QP2A 4YTLA 3OYEA 2RK2A 4BY6B 2K4YA 4ELYC 4NL2A 4E7LA 3JCMf 2CZ7B 3S3OA 3L1AA 2XICA 3EAEA 3QZ9B 3CCUA 1W2BA 1JRIA 3SWNC 4OF1A 4BUGA 3QHSA 2RI2A 2R5MA 3M9QA 3SB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PJO G;  4J6Y A;  2VXE A;  4XTY A;  3RIR A;  5I21 A;  5LJ5 e;  5GAO m;  1I5L A;  4F7U E;  4M7D F;  2YLB A;  4JRK A;  4X9C A;  4XU3 A;  5GAN h;  4HA8 A;  1M8V A;  5GAM h;  5GAN 2;  1KQ2 A;  4M7D G;  4M75 G;  2Y90 A;  5GAN 6;  5GMK j;  4J5Y A;  4M75 E;  4C8Q E;  2DTO A;  4M78 C;  3QSU A;  4XTX A;  4C92 E;  4MML A;  3JCM Q;  3V8K A;  3V8L A;  2DJZ A;  4JLI A;  4WF2 A;  4C8Q G;  1I8F A;  4PJO E;  2RA2 A;  4M77 A;  4N0A A;  5GAN 8;  5GAN 3;  5GAO l;  4M7A C;  2EJG A;  5DY9 A;  4M7A B;  3FIF A;  5LJ3 h;  5GAN 5;  4M7A A;  4RCC A;  2VC8 A;  3M4G A;  3L2Z A;  3V7C A;  5GAN d;  1LOJ A;  4XU2 A;  5GAM e;  1MGQ A;  4M7D B;  4M77 G;  4M7D C;  1Y96 A;  2E64 A;  5LJ5 f;  3QUI A;  3V8J A;  3JCM X;  1N9S A;  3HSB A;  3JB9 F;  4M77 C;  1D3B B;  4M78 B;  4OP0 A;  2E41 A;  3JCM J;  4QVC A;  3BDU A;  5GAN 4;  4M77 B;  4PJO C;  5GAN f;  4C92 D;  3AHU A;  4C8Q D;  5LJ3 f;  1I81 A;  5CAI A;  5GMK i;  4EMK B;  2RB6 A;  5GMK l;  4M7A G;  4PJO A;  5GAO r;  3V7S A;  4A53 A;  5LJ3 e;  3BFM A;  3RKY A;  3SB2 A;  5GMK h;  4M7A F;  4C8Q B;  3GIB A;  5GAM j;  4C92 B;  2DTI A;  4EMH A;  3JB9 I;  5GAN j;  1U1S A;  4M75 A;  3RER A;  2DXT A;  2DXU A;  4M78 D;  3RUX A;  1KQ1 A;  3V7R A;  4XQ3 A;  1WPY A;  3BY7 A;  4XU0 A;  3EFS A;  2DZC A;  2EWN A;  1H64 1;  3QO3 A;  4XU1 A;  4XTV A;  4F7U A;  2K57 A;  3JCM e;  3JB9 J;  4XTU A;  5LJ5 j;  4A54 A;  1N9R A;  1BIB A;  4JRI A;  4F7U F;  4M7A D;  4M7D E;  4XTZ A;  3JB9 D;  3RKX A;  2RM4 A;  4F7U G;  4EMK C;  4M7D D;  5LJ5 d;  1JBM A;  4J6W A;  4XTW A;  3JB9 G;  3EFR A;  4M78 F;  3VU3 C;  4PNO A;  4M75 F;  4C8Q F;  5GAO q;  2DKG A;  4M77 E;  2DTH A;  4NOY A;  3JCM d;  4X9D A;  1B34 B;  1WQ7 A;  1WNL A;  1I4K 1;  4NL3 A;  3JB9 H;  4V2S A;  2DVE A;  4PJO F;  3RES A;  5LJ3 g;  3RKW A;  1TH7 A;  1B34 A;  2VXF A;  3FJP A;  4M78 G;  4M77 D;  3HFN A;  2EAY A;  5GMK e;  4EMK A;  4C92 F;  2CGH A;  4HT8 A;  5GAN 7;  3INZ A;  1LJO A;  1D3B A;  2DZ9 A;  4M78 A;  5GAN e;  2RD1 A;  5GAM d;  5GAM g;  3JCM h;  4J6X A;  5GAN g;  1HK9 A;  4C92 G;  1X01 A;  3JCM b;  1M5Q 1;  2YLC A;  3PGG A;  2EJF A;  4F7U B;  4HT9 A;  2EJ9 A;  3BW1 A;  4RCB A;  3JCM V;  2E65 A;  4DQ2 A;  2YHT A;  3JCM W;  2QTX A;  2DEQ A;  5GAM f;  2E1H A;  2I2L A;  5GMK m;  4C92 A;  5GAO n;  2FB7 A;  4M75 B;  4C8Q A;  1U1T A;  2ZGW A;  4M75 C;  5LJ3 d;  3JCM c;  4PJO D;  1YCY A;  4JUV A;  2E10 A;  3FB9 A;  4EMG A;  1BIA A;  4MMK A;  4QVD A;  5LJ3 j;  5LJ5 h;  3JCM g;  4PJO B;  2JN0 A;  1WQW A;  4M7A E;  4M75 D;  5LJ5 g;  1HXD A;  3HFO A;  4NL2 A;  3JCM P;  2HNI A;  4Y91 A;  3JCM f;  1LNX A;  1Y96 B;  2FYK A;  3L1A A;  3SWN B;  5GAO p;  4C8Q C;  1JRI A;  4C92 C;  3SWN C;  4M78 E;  3QHS A;  3SWN A;  4M7D A;  4M77 F;  4N0A C; 
#chains in the Genus database with same CATH topology
 1I5L A;  4J6Y A;  4XTY A;  4ANJ A;  2DER A;  4DBQ A;  2DM1 A;  1YJ9 A;  1WDX A;  4QVZ A;  3UDC A;  2KQW A;  3QKJ A;  4M78 C;  3QSU A;  4EPC A;  2ROL A;  2ZZD A;  4C5G A;  1W2B P;  1ZA1 B;  5GAO l;  2DF6 A;  5DY9 A;  1S72 T;  3H6Z A;  1G3S A;  1WXU A;  1O9S A;  1PG5 B;  3CBO A;  5GAN d;  1K73 R;  4M7D C;  2VAS A;  1WX6 A;  1MMN A;  1RAA B;  4TVR A;  4EMK B;  3CBM A;  5CIU A;  2DL5 A;  3RUX A;  1PKT A;  1KQ1 A;  4B9W A;  1U5S A;  3VS2 A;  4DBR A;  4IUT A;  1N5Z A;  2RH2 A;  1OUL A;  1JJ2 S;  1UGQ B;  2FPF A;  2GBQ A;  1VQP Q;  4L59 A;  2LQ8 A;  2FG0 A;  1UEB A;  2JOY A;  1JB0 E;  2RM4 A;  2L3P A;  1VQO A;  4Y28 E;  1MHN A;  5GJW B;  1GFD A;  2AHJ B;  2JTE A;  1PC0 A;  3M4Y A;  1M90 R;  1WJS A;  2VXF A;  3MHX A;  4A4K A;  3DKM A;  3M58 A;  5FLX E;  4C92 F;  4E7J A;  4CC7 A;  1SRL A;  2K3B A;  3OMC A;  2QQA A;  2CH4 A;  2EYY A;  5C0M A;  1QKW A;  1OQK A;  2RD1 A;  1M30 A;  1VQ5 T;  1X75 C;  1NM7 A;  3I55 A;  1QLY A;  4QT7 A;  2O4X A;  4N4I A;  2HKN A;  3MKD A;  4QQ6 A;  4JPB W;  2DD4 A;  2OTJ A;  3EFO B;  2J06 A;  1FMV A;  2RI3 A;  4EMG A;  2PVO B;  4QVD A;  2YUP A;  4PJL A;  3NPF A;  1NPP A;  3CPW A;  2KBT A;  1TUD A;  1TSF A;  1WYX A;  1BI3 A;  4PLL A;  3UA6 A;  4M78 E;  5A2Q E;  2O2O A;  1F1B B;  3OY9 A;  1WXT A;  2GNC A;  5L23 A;  3CC4 T;  1KQ2 A;  1Y57 A;  3C94 A;  2CUB A;  1ACM B;  1PD1 A;  4ZNX A;  2DEU A;  1MUZ A;  3A8O B;  2F1L A;  7AT1 B;  3EGX A;  3A8L B;  2AT1 B;  2RO0 A;  2K2V A;  1IB8 A;  3EH2 A;  3JB9 F;  3JAM E;  5EC7 A;  5IXF A;  4M77 C;  2CP5 A;  2PNI A;  1TS9 A;  3WVE B;  1KD1 U;  5GMK i;  4IUV A;  4M7A G;  2JMC A;  3E1S A;  4HCZ A;  4F14 A;  2EBP A;  3G4S Q;  4C8Q B;  4HCK A;  4JS4 A;  3G1J A;  4P5N A;  1FMW A;  2O9S A;  1UGR B;  1ZSG A;  4OB2 B;  5CQY A;  1TWB A;  3RMQ A;  4DEY A;  2QDL A;  5J26 A;  2GCX A;  1AWJ A;  2M0Y A;  4DA4 A;  2HKQ B;  3X24 B;  3FJP A;  3BE3 A;  1K9M R;  2EVR A;  4PJN A;  2CDT A;  1B07 A;  2KYM A;  1R0C B;  3VYH B;  2YWW A;  1W2B S;  2HQE A;  1ZBX A;  1MMD A;  3PGG A;  3C95 A;  3JCM V;  2E3I A;  2DEQ A;  2NUT B;  3CCM T;  4LDY A;  2LCC A;  3URG A;  1YCY A;  5KYU B;  3P8H A;  1JXO A;  4Y92 A;  1AWW A;  1M27 C;  3G6E A;  3CCU Q;  1WLP B;  2CSQ A;  3RNJ A;  1XOV A;  3VS6 A;  4JS5 A;  3OYJ A;  5I2M A;  2YSQ A;  4AFQ C;  1XJW B;  3NMZ C;  1WFW A;  1RAF B;  2COZ A;  2QI2 A;  1PCX A;  4OMP A;  2M02 A;  4X34 A;  2WSE E;  2HSE B;  3V8L A;  2KXD A;  1K8A U;  3QYH B;  2KI7 A;  1EFN A;  2ZPG B;  1KQS P;  1VOM A;  4GLK A;  5LJ3 h;  4J9E A;  1VQ9 Q;  3NGP A;  4F16 A;  2PUK B;  1X6O A;  1Q86 R;  2L3R A;  4C5I A;  2CZ1 B;  3M0T A;  1M3C A;  2K3Y A;  5CAI A;  1U06 A;  4PFO A;  1XNI A;  2BIV A;  2PQW A;  4HXJ A;  1LPL A;  1WHM A;  2RF0 A;  2DXT A;  2L0A A;  2GTJ A;  3TU4 K;  1QP3 A;  2HCK A;  4XU0 A;  4ZN3 A;  2GFA A;  2K57 A;  4F04 B;  4JJN K;  2J05 A;  5LJ5 j;  4M7D E;  2DXB A;  2F5T X;  3GLX A;  4Z88 A;  2MPX C;  4BI3 A;  4J6W A;  4CRI A;  3VU3 C;  3VJP A;  5FWC A;  2KAF A;  1K1Z A;  4FYX B;  2DIL A;  2RQT A;  3JB9 H;  4PJO F;  1KD1 R;  4LDU A;  1KHI A;  3MP6 A;  1Q82 C;  3C4S A;  2XDB A;  1YIT A;  4GBQ A;  4PK4 A;  3DLM A;  3QDR B;  4KUD K;  1ZX6 A;  4RTW A;  5KYX B;  1M90 U;  2OTJ Q;  1UFF A;  2DIG A;  5DLQ E;  3I55 Q;  3GNF B;  5FU7 C;  1SHG A;  3SDZ A;  1VQ5 A;  1IRX A;  5D6Y A;  1H3H A;  3PMI A;  4JDS A;  1YIT Q;  4RTZ A;  3C12 A;  1OYX A;  5FU6 B;  1VQK T;  2LJ3 A;  5IHN A;  4Y91 A;  4FYY B;  4BI8 B;  1VQ8 T;  5GAO p;  4C8Q C;  4ME7 A;  2PUO B;  1KC8 R;  4N0A C;  1HSQ A;  3KXT A;  5GAO m;  2OTL T;  1BCO A;  1BKB A;  4X9C A;  4AG1 C;  5FW9 A;  5GAM h;  1JU5 C;  4M75 G;  5ECA A;  3LX7 A;  2CZ0 B;  1J3T A;  2B86 A;  2LT1 A;  4XTX A;  1UUE A;  3PTA A;  1SEM A;  4BE2 A;  4DOW A;  1Y71 A;  1NLO C;  4R56 A;  4FSX A;  5HKC A;  3FJ5 A;  2CP3 A;  5KYW B;  3CC4 A;  2LDM A;  2V26 A;  1SF9 A;  2A0F B;  3WVD B;  2E64 A;  5LJ5 f;  4R55 A;  2GGR A;  3J7A F;  1VQ4 Q;  1VQ8 A;  3EHQ A;  3MO8 A;  2K5I A;  1IZ6 A;  3D7S B;  5CK9 A;  1GCQ A;  3HL8 A;  1K4U S;  1D1C A;  2X4W A;  4F17 A;  2CSI A;  3MP1 A;  1WI7 A;  1K76 A;  4J8O A;  2QA4 T;  1CSK A;  2RI5 A;  2LVM A;  3CCJ A;  2YUQ A;  3JB9 G;  4PNO A;  4M75 F;  3HRS A;  2K2M A;  2VVK A;  1QQJ A;  4X9D A;  2ZPF B;  1I4K 1;  3P8D A;  2LX7 A;  4HCB A;  2RHY A;  2FEI A;  2RHX A;  3IQL A;  4KH0 B;  4M77 D;  2E5Q A;  1YP5 A;  3TEE A;  3CCQ Q;  1OPL A;  3I56 Q;  2ED1 A;  2YRD A;  1ZQ1 A;  2QAS A;  2KE9 A;  3VV0 A;  2LMJ A;  3CCS Q;  2YLC A;  1RI0 A;  4FM4 B;  2CT4 A;  5GAM f;  5FU7 B;  2PVG B;  4RG8 A;  2PVD B;  1VQM A;  2ZPI B;  5KYY A;  1QWF A;  4HVU A;  3EG0 A;  4LDV A;  4MMK A;  2JM9 A;  4LN2 A;  2RQU A;  3JCM f;  3RR6 A;  3S3O A;  2XIC A;  2A08 A;  3SWN C;  4OMO A;  2RI2 A;  4R0K A;  3SWN A;  2YT6 A;  5FWB A;  3OYC A;  2YXY A;  3REB B;  1T3L A;  4PLI A;  1VQM Q;  1PD0 A;  2KYB A;  2DFU A;  5GMK j;  4J5Y A;  3O8V A;  3LH5 A;  2CP0 A;  1UJ0 A;  3CCS A;  1VQL T;  4PJO E;  3HP9 A;  1M1K C;  1PSF A;  1IHV A;  2VC8 A;  1VQN T;  1C1A A;  5GAM e;  1CKA A;  3OS2 A;  1AD5 A;  2RHI A;  4IUU A;  4C92 D;  4C8Q D;  3PIP A;  2X3W D;  4EIK A;  4JLG A;  4Z8A A;  4A53 A;  1YJW Q;  4FL6 A;  2QTV A;  2XG8 D;  4LXC A;  4MZP A;  2EW3 A;  3TSZ A;  2JZ2 A;  2RHU A;  4RMO A;  4FIB A;  2DRM A;  9ATC B;  4A54 A;  1ZHI A;  3RBB B;  4FU6 A;  1JQQ A;  1N6A A;  4NOY A;  2K5L A;  1H8K A;  2I0N A;  1WNL A;  4PKC C;  5LJ3 g;  3S3M A;  3JRZ A;  1BI0 A;  1XQH A;  2EQU A;  3HFN A;  2X35 A;  3INZ A;  1M4Z A;  2AKK A;  3E19 A;  1IHW A;  4J6X A;  5HK3 A;  2DE0 X;  2EJF A;  2MWO A;  2JTF A;  2KRO A;  5CKD A;  4DOV A;  4J9B A;  1W70 A;  1YWP A;  2COY A;  2JXB A;  4D6W A;  3DB3 A;  4LD6 A;  3QXE B;  4KBM B;  2XU8 A;  1QVP A;  2FRY A;  4L5G A;  1VQL Q;  2AZV A;  1RLP C;  2JN0 A;  4BE1 A;  1KK7 A;  1OX9 A;  4M75 D;  4Z89 A;  3LWI A;  2A37 A;  4E47 A;  3SWN B;  3HKS A;  3TVT A;  2KT1 A;  1X6G A;  1OZ3 A;  2ZAE A;  1VIE A;  1VQL A;  2M1H A;  3CC7 A;  1TUC A;  2BKD N;  2OAW A;  1FXX A;  1SSH A;  3NTK A;  5CR2 A;  1G3Y A;  2X3X D;  4E6R A;  4D8D A;  1N8R R;  2FPD A;  2Y90 A;  2FVU A;  4M75 E;  4PFP A;  2DTO A;  1U8R A;  2DYI A;  2MF2 A;  3PNW C;  4HVW A;  1WHG A;  2LZ6 B;  1U3O A;  5C6S A;  3JSC A;  4CI0 C;  3GP8 A;  1EIF A;  3G4S T;  1JJ2 A;  3OYA A;  4ZTJ A;  3CC2 Q;  3V8J A;  3TQ7 P;  2DX1 A;  3TRE A;  1V29 B;  5GAN f;  4AFS C;  3MEW A;  2D8J A;  4QQD A;  4A4E A;  3ASK A;  4KUL A;  1PWT A;  4PJO A;  5GAO r;  3AT1 B;  2EIF A;  4CC2 A;  4RKU E;  5GAM j;  2E3H A;  5CKF A;  2LTO A;  3CCE Q;  1K9A A;  2V8I A;  2VKN A;  2D0N A;  4XU1 A;  2O9V A;  4FT2 A;  2H3J A;  4M7A D;  1MV0 B;  4PL6 A;  3MEU A;  1NEG A;  4EMK C;  3REA B;  5A0L A;  3PVL A;  3OW2 A;  4V2S A;  3N5B B;  3OYG A;  1G83 A;  3M54 A;  1ZUU A;  4NS5 A;  3OYK A;  1M9S A;  5HK0 A;  3A8M B;  1HK9 A;  3GBQ A;  1JO8 A;  2HL5 C;  4HT9 A;  2DK3 A;  3CME Q;  2RQW A;  5LJ3 d;  4PJO D;  1GXI E;  1C6V X;  3CCV Q;  4M7A E;  1VQ7 T;  2KY9 A;  2QGF B;  2DLP A;  3VS5 A;  4C0D B;  4MDX A;  1Y0M A;  1OPK A;  3VYG A;  4OB0 B;  2F69 A;  3OBW A;  1VQN Q;  1YIT T;  2E6N A;  4M7A A;  2NWM A;  4II1 A;  4F7U E;  4QQG A;  2MYS A;  3PVQ A;  5GAN 2;  1WHH A;  1KHC A;  1HD3 A;  5EG2 A;  4C8Q G;  1YBY A;  2DPP B;  1I1J A;  1TXQ A;  4LDW A;  2LCL A;  2A3L A;  4UC4 A;  2EFI A;  3L2Z A;  2QEX Q;  5LL6 S;  4AMC A;  2YDL A;  4BB7 A;  1VQK A;  1Y96 A;  4FW2 A;  3LH0 A;  3VUB A;  3HSB A;  1I0C A;  2MWP A;  4HVV A;  1MV3 A;  5IHI A;  3JCM J;  3CC2 A;  4M77 B;  3L2R A;  1KC8 U;  4BI4 A;  5DLO A;  1YJN A;  2G6F X;  3OSS C;  1KJW A;  2KT8 A;  4OGE A;  5CKH A;  1KFZ A;  3JB9 I;  5GAN j;  4B6M A;  2GF7 A;  3CCM Q;  2EYQ A;  4XTV A;  1UB4 A;  4BAC A;  1LVK A;  1TOV A;  1UHC A;  2RQR A;  3LGL A;  3KBG A;  4A4F A;  2ED0 A;  3AHU A;  4ATO A;  1NLP C;  4BDY A;  4C5E A;  2RJE A;  3JCM d;  1ZA2 B;  1WJR A;  3OYF A;  2ZPH B;  3I55 T;  1YCS B;  2O4X B;  5IXB A;  4OML A;  1QVG S;  3EGD A;  2QDY B;  2JS2 A;  1Q7Y U;  2BZ8 A;  1Q81 C;  5KCO A;  2XD0 A;  5IHK A;  5GAM d;  1YIJ A;  2COW A;  1LCK A;  5KCH A;  4IUQ A;  3CCV T;  1X6B A;  2KVQ G;  3GF5 A;  2R58 A;  4JJB A;  1Q7Y R;  3BDL A;  2KRM A;  1YNZ A;  4LNP A;  1K8A R;  5I22 A;  2EGA A;  4FYV B;  4IUR A;  1BU1 A;  1RAI B;  1H3Z A;  2DO3 A;  2ENM A;  5LJ5 g;  2NLU A;  4DEX A;  2EYX A;  1X2Q A;  2A7Y A;  3HTR A;  1Q82 U;  4C0D C;  3OYI A;  2B8A A;  3G71 A;  4M7D A;  3A8G B;  4BDZ A;  2XI9 A;  1G2B A;  1D1B A;  2EQK A;  2YLB A;  2P84 A;  2L8D A;  2HQH A;  4M7D G;  2EKO A;  4C8Q E;  4C92 E;  2K5F A;  1KD1 C;  2D0Q B;  2DBM A;  1T0J A;  2JM8 A;  3UPU A;  1YJW A;  1X27 A;  3CC2 T;  1OX8 A;  5AT1 B;  1RAB B;  5GAN 5;  3CPF A;  1M1F A;  3JV3 A;  2V1Q A;  1K8A C;  2LNV A;  4M78 B;  3SFM A;  3BDU A;  3CPW S;  1Q7Y C;  1GBR A;  4K11 A;  2K79 A;  2A28 A;  2E6Z A;  4BD3 A;  3H41 A;  1YHQ T;  3ZEH A;  2XKO C;  2DL4 A;  2F2W A;  2CH4 W;  2JTM A;  2JVV A;  1ABO A;  2JS0 A;  3RER A;  2DNU A;  4XQ3 A;  5FRM A;  3BY7 A;  2DZC A;  2EPD A;  4JZ3 A;  5D7U A;  4Q5W A;  5A0D A;  2LX9 A;  4JRI A;  1YJW T;  4HCC A;  5CQX A;  5I11 A;  4M7D D;  2XID A;  4M4Z A;  3VS0 A;  3H9N A;  2LRQ A;  4C0Z A;  1D0X A;  1B34 B;  3QWX X;  1RAG B;  3CD6 A;  5M9O A;  3S3N A;  8ATC B;  1YHQ A;  3OMG A;  1MNE A;  4AT1 B;  1W4S A;  1GRI A;  4IIO A;  4J9F A;  2LQN A;  3LYI A;  5KYW A;  5FRN A;  3JCM W;  3G6E T;  1Q81 R;  1K73 C;  1YJ9 Q;  4KGX B;  1U1T A;  3CCQ A;  2MCN A;  3FEO A;  4JUV A;  1SSF A;  4RTX A;  3EG3 A;  4YTL A;  1ABQ A;  4J9G A;  2K4Y A;  4ELY C;  2O88 A;  4NL2 A;  2VWF A;  2CZ7 B;  3QZ9 B;  4JZ4 A;  1VQ6 Q;  3G6E Q;  3CCU A;  4OF1 A;  3QHS A;  3RIR A;  3MJX A;  3NFC A;  2V8K A;  1VQ7 A;  4KRT A;  2KEA A;  4QKU A;  1PHT A;  2DAQ A;  5GAN 6;  4N4G A;  3ZL7 C;  2HBP A;  3JCM Q;  3CCL T;  1GBQ A;  4JLI A;  4M7A C;  4A4H A;  1ARK A;  4J7I A;  4RTY A;  3QYG B;  4RCC A;  3OW2 P;  2MI6 A;  1YHQ Q;  1LOJ A;  2K7A A;  4XU2 A;  3X20 B;  4ZGE B;  2KDS A;  3EG1 A;  3KFV A;  2OJ2 A;  1E7O A;  2O31 A;  5KYU A;  1K9M U;  2MOX A;  2DTI A;  1QVF A;  1N8R U;  2KR3 A;  3QG1 A;  4C0F A;  3VS3 A;  1QKX A;  1RAH B;  1OI1 A;  2RQV A;  1S1N A;  2CUD A;  2OAU A;  4LUD A;  3G4S A;  1Z9Z A;  1S72 A;  5GAO q;  2H8H A;  1PM3 A;  3L42 A;  3M5A A;  4ESR A;  1T0H A;  2EYW A;  1TH7 A;  1AWO A;  3M57 A;  3VRZ A;  4EMK A;  2KRS A;  3Q1J A;  4FSS A;  3L2V A;  3GOX A;  4HT8 A;  5D6X A;  2AIR B;  5CKB A;  1PKS A;  1VQ5 Q;  2D8H A;  5KYN A;  2FPE A;  2ECZ A;  2DZ9 A;  3QDF A;  3I9Q A;  3FLG A;  1FWZ A;  3JCM b;  2HD0 A;  3SEM A;  1EZZ B;  5HY6 A;  2E12 A;  1G8X A;  2NUZ A;  2ZGW A;  8AT1 B;  2KNB B;  2DRK A;  4FCY A;  5FRO A;  2ATC B;  2CYZ B;  2EGE A;  1BB9 A;  1HXD A;  2FHD A;  2W10 A;  3HFO A;  2HNI A;  4JJD A;  3UA7 A;  1N8R C;  3ZBD A;  1H92 A;  3PMT A;  2F5K A;  2L2P A;  2EQJ A;  1OU9 A;  1RAC B;  1VQP T;  1FYN A;  3X26 B;  4ZTF A;  2MK5 A;  2ROT A;  1M90 C;  1X43 A;  3ME9 A;  1O75 A;  2C0T A;  2BE9 B;  5GAN 8;  2EJG A;  1WZO A;  3T9N A;  2VGN A;  1IRE B;  1D3B B;  1G3T A;  4C5H A;  1BI1 A;  3MEA A;  1WGS A;  2BUD A;  4PJJ A;  3PIO A;  3QBY A;  2RB6 A;  1V76 A;  3OYY A;  1VQO Q;  1BBZ A;  2HBW A;  3RKY A;  4B9X A;  2IIM A;  3OQ5 A;  2SRC A;  1VQP A;  2LP5 A;  2QK0 A;  3OBY A;  5CCA A;  1BYM A;  1AVZ C;  3EHR A;  2DBK A;  3M0R A;  2MMP A;  1M1K R;  1DJ7 B;  1NZ9 A;  2EYZ A;  3CCM A;  4QW2 A;  3E9G A;  1K73 U;  3I5S A;  2JNG A;  1AZG B;  2SEM A;  2ESW A;  1ZBJ A;  4J83 A;  2P4R A;  5CKE A;  4M78 G;  3FC3 A;  5GAN 7;  4M78 A;  5GAN e;  3A98 A;  2FL7 A;  1IGU A;  1MMA A;  3J80 E;  5KYX A;  2GFU A;  1YN8 A;  2YRV A;  1OU8 A;  2RHZ A;  3LGF A;  2GQV A;  4A63 B;  3A8H B;  1M8M A;  3CCL Q;  1KC8 C;  3MP8 A;  1UGS B;  1Q81 U;  1VYU A;  2V8J A;  1LNX A;  1Y96 B;  1KQS A;  1VA7 A;  1JEG A;  1AWX A;  3H0H A;  2GQI A;  1JJ2 P;  2HL3 A;  4PJO G;  2HEQ A;  1D0Z A;  2QQ9 A;  1YI2 A;  5GAN h;  1YIJ T;  3CCU T;  1W6X A;  3A5Z B;  3V8K A;  4BY6 C;  2W0Z A;  3X25 B;  2OTL A;  2ABL A;  1B3Q A;  3CCE T;  1K0S A;  2EQI A;  2ZCF B;  2K3X A;  4GY5 A;  3FIF A;  1YJ9 T;  3V7C A;  3CMA T;  3OA6 A;  2CKK A;  3CD6 Q;  1I5O B;  4RTV A;  2P0K A;  1NYF A;  3OSV A;  1G3W A;  1I81 A;  4OMN A;  1C0M A;  3EFO A;  5IN1 A;  4C92 B;  3L2U A;  2QQS A;  4M75 A;  3FDR A;  2J6K A;  2DXU A;  4M78 D;  4J9D A;  1AHJ B;  1UHF A;  2EWN A;  3RDV A;  3NTH A;  1VUB A;  3CCE A;  3UAT A;  2LCS A;  4E7K A;  2RNA A;  4XTZ A;  4BE0 A;  1MND A;  3MCA B;  1AT1 B;  5HCK A;  4J9C A;  4KH1 B;  4M78 F;  1QMC A;  3SD4 A;  1SRM A;  4JJC A;  2QA4 A;  4C0G A;  1RUW A;  2DVE A;  2ZPE B;  3VKI A;  4ZGJ B;  1SKU B;  1M2V A;  3G7Z A;  2PTK A;  1ZLM A;  3QJY A;  1VQ6 T;  1LJO A;  1ZSZ B;  1AOJ A;  2V1R A;  2YRC A;  5GJV B;  1UE9 A;  1QWE A;  1G5V A;  1RAD B;  5GAN g;  1X01 A;  1M5Q 1;  2QYZ A;  2HZY A;  1UGV A;  4J9I A;  2LJ0 A;  2J6O A;  3JCM c;  4Z02 A;  2E10 A;  5LJ3 j;  1JXM A;  3EH1 A;  1NJI C;  3G71 Q;  3R6N A;  3MPU B;  1BK2 A;  2LQK A;  2WSF E;  3LW5 E;  1GCP A;  2FYK A;  3LLR A;  4M77 F;  3EGX B;  3ZFJ A;  4JRK A;  4HA8 A;  1M8V A;  2BE7 D;  2P0Q A;  1FX7 A;  4IKF A;  2DVJ A;  3OS1 A;  2HMA A;  3CBP A;  2RA2 A;  5GAN 3;  4N0A A;  3CCR T;  4FT4 A;  1KG1 A;  3ER0 A;  1WHJ A;  3DLL A;  2E41 A;  5GAN 4;  1AZE A;  2MAM A;  1VQ9 A;  4OMM A;  1TG0 A;  5GMK l;  4DBH A;  3DB4 A;  3TCJ A;  3BFM A;  2X51 A;  3S6W A;  1A0N B;  3GIB A;  1Q86 C;  3PE0 A;  2Z0W A;  3QPH A;  1QVG A;  2RK1 A;  4MZM A;  3EFS A;  3QO3 A;  2J6F A;  4F7U A;  3E2U A;  2VGM A;  1VQM T;  2L3S A;  4X1V A;  1WA7 A;  3CCR A;  1VQ6 A;  1VIF A;  1NEB A;  1NYG A;  2DTH A;  2HAX A;  2KGT A;  3CXC P;  2CRE A;  3L2W A;  3WXM B;  1W1F A;  4OMQ A;  2XMF A;  4O6J A;  2QEX A;  1KQS S;  2P0P A;  1D3B A;  2WSC E;  2DXC A;  4XAX B;  4J9H A;  5IT9 E;  1KSW A;  2HQX A;  4F7U B;  2EJ9 A;  3BW1 A;  4RCB A;  2R57 A;  3CCS T;  5GMK m;  2E1H A;  4MDW A;  2P4T A;  4RG2 A;  3I56 T;  2AZS A;  2FZC B;  2RPN A;  1VQO T;  1UEC A;  1QP2 A;  4BY6 B;  4E7L A;  2JMA A;  1NJI R;  4RUG A;  2R5M A;  3M9Q A;  3SB2 A;  2BZX A;  5I21 A;  1PSE A;  4M7D F;  1WHK A;  2RJD A;  3L2Q A;  3M0S A;  2C0I A;  3CME A;  3M0P A;  2OTJ T;  4M77 A;  2L89 A;  4M7A B;  4FYW B;  1PRL C;  3I56 A;  4M7D B;  1MGQ A;  4M77 G;  3OW2 S;  1TTH B;  3M0U A;  1M1G A;  3C0C A;  3JCM X;  3ULR B;  4MZT A;  3OYM A;  3VRY A;  3CD6 T;  2D1X A;  2JUF A;  2M16 A;  1BI2 A;  3EG9 A;  2CT3 A;  5LJ3 e;  4M7A F;  3CCJ Q;  1RL2 A;  3VS7 A;  1U1S A;  2QGG A;  2QG9 B;  1IGQ A;  4LE9 A;  3CCJ T;  1VYV A;  2KK4 A;  4KUI A;  4A4G A;  1WPY A;  5AYF A;  2L3Q A;  3E9F A;  4KGV B;  3CXC S;  4VUB A;  2M0O A;  2LJ1 A;  2LQW A;  4F7U F;  2BTT A;  2IPO B;  1I07 A;  1M3B A;  5KE3 A;  2LC4 A;  3EFR A;  5J3B A;  4M77 E;  1QVG P;  2QEX T;  1RI9 A;  3HRU A;  1VQ8 Q;  4NL3 A;  5GMK e;  3EG9 B;  3OYH A;  4E7Z A;  5CVI A;  2DL8 A;  3QZ5 B;  1UTI A;  3JCM h;  2FZK B;  4C92 G;  3M59 A;  1Y07 A;  3EGD B;  2IVW A;  1BCM A;  1GFC A;  1QW1 A;  4RTT A;  4DQ2 A;  2JW4 A;  1ZUY A;  1TU0 B;  4C92 A;  4M75 C;  4O5V A;  1K9M C;  1ZSZ C;  3UT1 A;  2OX7 A;  1WHL A;  2C06 A;  3RMS A;  1WQW A;  3M53 A;  3JCM P;  2MIO A;  4LUE A;  3NHN A;  4C92 C;  3QJ6 A;  1OV3 A;  4E7I A;  3P8B B;  4JRP A;  4E7H A;  2M51 A;  4WF2 A;  1M3A A;  3HRT A;  4IUP A;  4AFU C;  1YJN Q;  1UJY A;  4RTU A;  5D6W A;  1RLQ C;  4ORZ A;  4XK8 E;  1N9S A;  1SG5 A;  4OP0 A;  1VQK Q;  2RN8 A;  1SHF A;  1UGP B;  1NJI U;  4AFZ C;  4KGZ B;  2NUP B;  2E70 A;  3V7S A;  5KYY B;  2X9H A;  3VS1 A;  3J81 E;  4EMH A;  3EG2 A;  1E6G A;  2CS7 A;  3V7R A;  4ZGD B;  1VQ9 T;  4OVA A;  2LT4 A;  2WAC A;  3OB9 A;  3JB9 J;  2XDD A;  4XTU A;  1N9R A;  5IH2 A;  2CZ6 B;  3JB9 D;  5KE2 A;  3PFS A;  3M0Q A;  5LJ5 d;  1D09 B;  4XTW A;  3CMA A;  2YUO A;  4C8Q F;  4JRQ A;  1YFN A;  3OYD A;  2D9T A;  1K0X A;  3VUZ A;  2JJ9 A;  2F2X A;  2NUP A;  2CP2 A;  1GCQ C;  4PFZ A;  4PJM A;  1R77 A;  3A1P A;  1XTD A;  1R8O B;  4LD9 K;  4GLM A;  5GAM g;  2QXF A;  2DIQ A;  2K9G A;  3GNG A;  3CPW P;  2E4H A;  2E65 A;  4ELZ C;  2X4J A;  1V1C A;  4M75 B;  3M55 A;  5A0G A;  1YI2 Q;  2ZPB B;  3FB9 A;  2FZG B;  1BIA A;  5LJ5 h;  3JCM g;  4PJO B;  2LNH B;  3CC7 T;  2H3E B;  1Q95 G;  1FMK A;  2DL3 A;  4E2F B;  1R0B G;  5J39 A;  2DA9 A;  3M56 A;  4DBF A;  3CCL A;  2FO0 A;  2VXE A;  2XDP A;  3THK A;  2BZY A;  4XU3 A;  1NBE B;  3KUF A;  5FU6 C;  2O01 E;  1OOT A;  1M2O A;  3G71 T;  1QCF A;  3X28 B;  4FW1 A;  2QQR A;  1QVF P;  3MEV A;  3UF4 A;  1IO6 A;  2KSS A;  2F2V A;  2R5A A;  1M1K U;  3CXC A;  1KIK A;  2Y4Y A;  3SHW A;  3NTI A;  1RAE B;  3QUI A;  2X4X A;  1NE8 A;  4QVC A;  4PJO C;  2CP6 A;  3OYB A;  3CEY A;  3PT9 A;  5LJ3 f;  2DYB A;  1B7T A;  2VUB A;  1HJD A;  1UDL A;  1WJQ A;  1SPK A;  4OB3 B;  2L5Q A;  1Z9Q A;  2VYT A;  3CCR Q;  3I5R A;  1P92 A;  2FRW A;  2X4Y A;  1H64 1;  1HYO A;  2PZ1 A;  2RJF A;  3CQT A;  2E5K A;  4KT0 E;  3CC7 Q;  1BIB A;  4N4H A;  3I35 A;  2AKL A;  1D0Y A;  1JBM A;  3F70 A;  1AEY A;  3QII A;  4WTO B;  1WXB A;  3HHT B;  2DKG A;  1UG1 A;  5IAY A;  1WQ7 A;  3H0I A;  1VQ4 A;  1IXD A;  2HSP A;  3RKW A;  2QAZ A;  1B34 A;  2RJC A;  4OMF B;  1YWO A;  1MMG A;  2C0O A;  1YJN T;  1NG2 A;  2KMT A;  4CC4 B;  1PRM C;  3CC4 Q;  1YI2 T;  3LWH A;  2HDA A;  4ZN1 A;  2DD5 A;  2EKH A;  3H0F A;  1ZSZ A;  4EDU A;  2DL7 A;  5L8R E;  2YHT A;  1YIJ Q;  5GAO n;  2FB7 A;  4C8Q A;  2NYS A;  2DET A;  2Y4X A;  4L6V 5;  2G3R A;  4OB1 B;  1X69 A;  2RMO A;  1Q86 U;  2XK0 A;  4OGC A;  4J7F A;  5DM7 R;  3TSW A;  5LJ5 e;  1D1A A;  1QVF S;  3VS4 A;  1Q82 R;  1PNJ A;  4HKE A;  4E7S A;  3GPL A;  4WCI A;  1QCN A;  4MML A;  2QQB A;  1X2K A;  2DJZ A;  1I8F A;  1GL5 A;  3MET A;  3M4G A;  5I2S A;  2KXC A;  1VYT A;  2K6D A;  2A36 A;  2QA4 Q;  3OS0 A;  4D8K A;  4LDX A;  3OYN A;  1S72 Q;  2DMO A;  5GMK h;  2VB6 A;  2EGC A;  2AK5 A;  2NUT A;  2M9U A;  2D6F A;  5CO7 A;  3CME T;  1EX4 A;  3R6O A;  3UWN A;  3HPW A;  3JCM e;  1E6H A;  2KRN A;  1VQ4 T;  3CCQ T;  2YUN A;  3RKX A;  4F7U G;  3OS5 A;  2VV5 A;  1VQN A;  3H8Z A;  2EQM A;  2JT4 A;  1M2V B;  3U23 A;  3FRN A;  1OEB A;  1ZUK A;  3RES A;  3OYL A;  1N27 A;  3CCV A;  3EGU A;  2EAY A;  3QWY A;  2CGH A;  4IIM A;  2OI3 A;  2IG0 A;  4CC3 A;  2PU9 B;  1T3S A;  2OTL Q;  1NPR A;  4AG2 C;  2XHC A;  2QTX A;  2I2L A;  1CKB A;  1OZ2 A;  2CP7 A;  2J7I A;  1QCO A;  1VQ7 Q;  1TUG B;  1Y7X A;  2DJQ A;  2GTO A;  3OYE A;  2RK2 A;  3O5Z A;  3L1A A;  3EAE A;  3CMA Q;  1W2B A;  1JRI A;  4BUG A;  1WIE A;  5KH6 A;  6AT1 B; 
#chains in the Genus database with same CATH homology
 1I5L A;  4J6Y A;  4XTY A;  3RIR A;  3NFC A;  5I21 A;  1PSE A;  2V8K A;  4M7D F;  3OYC A;  1VQ7 A;  2RJD A;  4PLI A;  3L2Q A;  1YJ9 A;  2DAQ A;  4QVZ A;  3UDC A;  4N4G A;  4J5Y A;  5GAN 6;  2KQW A;  3O8V A;  3QKJ A;  4M78 C;  5GMK j;  3QSU A;  2HBP A;  4EPC A;  3JCM Q;  3CCL T;  4JLI A;  2ZZD A;  4C5G A;  3CCS A;  1VQL T;  4PJO E;  2OTJ T;  4M77 A;  3HP9 A;  5GAO l;  4M7A C;  4A4H A;  2L89 A;  1M1K C;  1PSF A;  5DY9 A;  4J7I A;  4M7A B;  3QYG B;  4RCC A;  2VC8 A;  1VQN T;  3I56 A;  2MI6 A;  1S72 T;  3H6Z A;  1G3S A;  1LOJ A;  1O9S A;  3CBO A;  1MGQ A;  4XU2 A;  5GAM e;  5GAN d;  4M77 G;  3OW2 S;  4M7D B;  4M7D C;  3OS2 A;  1M1G A;  3JCM X;  2RHI A;  4IUU A;  3X20 B;  4ZGE B;  2KDS A;  4MZT A;  4C92 D;  4TVR A;  3OYM A;  4C8Q D;  3PIP A;  3CD6 T;  4EMK B;  2JUF A;  2M16 A;  1BI2 A;  4JLG A;  4A53 A;  5LJ3 e;  1K9M U;  4M7A F;  4FL6 A;  3CBM A;  1RL2 A;  2DTI A;  1QVF A;  1N8R U;  2XG8 D;  1U1S A;  5CIU A;  3QG1 A;  4C0F A;  3RUX A;  3CCJ T;  4MZP A;  2KK4 A;  1KQ1 A;  4KUI A;  4A4G A;  4B9W A;  1WPY A;  5AYF A;  2JZ2 A;  2RHU A;  4RMO A;  4IUT A;  3E9F A;  4FIB A;  1OI1 A;  3CXC S;  4VUB A;  2M0O A;  2RH2 A;  1JJ2 S;  1UGQ B;  4A54 A;  4F7U F;  4L59 A;  1ZHI A;  2LQ8 A;  2OAU A;  1UEB A;  2JOY A;  1JB0 E;  2RM4 A;  5KE3 A;  3G4S A;  2LC4 A;  4FU6 A;  3EFR A;  5J3B A;  1VQO A;  1S72 A;  5GAO q;  1N6A A;  4M77 E;  4NOY A;  2K5L A;  4Y28 E;  2QEX T;  1MHN A;  3HRU A;  3L42 A;  4PKC C;  1WNL A;  2AHJ B;  4NL3 A;  3M5A A;  5LJ3 g;  3M4Y A;  3S3M A;  3JRZ A;  1TH7 A;  1BI0 A;  1XQH A;  1WJS A;  5GMK e;  2VXF A;  3MHX A;  3OYH A;  2EQU A;  3DKM A;  3HFN A;  3M57 A;  3M58 A;  3Q1J A;  4A4K A;  4C92 F;  5FLX E;  4EMK A;  3L2V A;  5D6X A;  2X35 A;  5CVI A;  3INZ A;  3GOX A;  4E7J A;  4HT8 A;  5CKB A;  1M4Z A;  3QZ5 B;  3E19 A;  3OMC A;  2QQA A;  2DZ9 A;  5C0M A;  2RD1 A;  1VQ5 T;  3JCM h;  3FLG A;  4J6X A;  1X75 C;  1FWZ A;  4C92 G;  3M59 A;  3JCM b;  2HD0 A;  5HK3 A;  3I55 A;  1Y07 A;  2EJF A;  2MWO A;  2IVW A;  1QW1 A;  4DQ2 A;  2JTF A;  2O4X A;  5CKD A;  4DOV A;  4N4I A;  4QQ6 A;  5HY6 A;  2DD4 A;  2E12 A;  4C92 A;  4D6W A;  3DB3 A;  2OTJ A;  4LD6 A;  3QXE B;  4KBM B;  2ZGW A;  4M75 C;  2XU8 A;  1QVP A;  4O5V A;  2RI3 A;  4EMG A;  4L5G A;  3UT1 A;  2PVO B;  4QVD A;  1K9M C;  5FRO A;  2JN0 A;  2CYZ B;  2C06 A;  3RMS A;  1WQW A;  4BE1 A;  3M53 A;  4M75 D;  1NPP A;  1HXD A;  3LWI A;  2FHD A;  3HFO A;  3CPW A;  3JCM P;  2HNI A;  4E47 A;  1BI3 A;  4PLL A;  3SWN B;  1N8R C;  3HKS A;  3ZBD A;  4C92 C;  5KH6 A;  4M78 E;  1OZ3 A;  3PMT A;  5A2Q E;  2F5K A;  1VIE A;  3QJ6 A;  2EQJ A;  1VQL A;  4E7I A;  2M1H A;  3CC7 A;  2BKD N;  3OY9 A;  1FXX A;  3NTK A;  3P8B B;  5CR2 A;  1G3Y A;  4JRP A;  1VQP T;  3CC4 T;  3X26 B;  1KQ2 A;  4ZTF A;  2Y90 A;  3C94 A;  2FVU A;  4M75 E;  2DTO A;  1U8R A;  2MF2 A;  4E7H A;  1M90 C;  3PNW C;  3ME9 A;  1O75 A;  4WF2 A;  3A8O B;  5C6S A;  3HRT A;  3JSC A;  5GAN 8;  4CI0 C;  3GP8 A;  1EIF A;  2EJG A;  4IUP A;  3A8L B;  3G4S T;  2RO0 A;  5D6W A;  2K2V A;  1JJ2 A;  3OYA A;  4ZTJ A;  3T9N A;  4XK8 E;  2VGN A;  3V8J A;  3JAM E;  1IRE B;  1N9S A;  3JB9 F;  4M77 C;  1D3B B;  4OP0 A;  1G3T A;  4C5H A;  1BI1 A;  3TRE A;  1UGP B;  1V29 B;  5GAN f;  3WVE B;  3MEA A;  1WGS A;  2BUD A;  1NJI U;  1KD1 U;  3MEW A;  5GMK i;  4IUV A;  4QQD A;  3QBY A;  4A4E A;  2RB6 A;  3ASK A;  4KUL A;  3PIO A;  4M7A G;  4PJO A;  3E1S A;  3OYY A;  2E70 A;  3V7S A;  4HCZ A;  5GAO r;  4B9X A;  3RKY A;  2EIF A;  4RKU E;  4C8Q B;  3J81 E;  5GAM j;  4EMH A;  4JS4 A;  3OQ5 A;  1VQP A;  3OBY A;  5CKF A;  2LTO A;  2CS7 A;  4P5N A;  3V7R A;  2V8I A;  4ZGD B;  5CCA A;  1VQ9 T;  1BYM A;  4OVA A;  2WAC A;  2LT4 A;  4XU1 A;  3OB9 A;  3JB9 J;  2XDD A;  2MMP A;  2H3J A;  4FT2 A;  1UGR B;  1DJ7 B;  1N9R A;  1NZ9 A;  4XTU A;  3CCM A;  4QW2 A;  4M7A D;  2CZ6 B;  4OB2 B;  4PL6 A;  3E9G A;  3JB9 D;  5CQY A;  5KE2 A;  3PFS A;  3MEU A;  4EMK C;  5LJ5 d;  4XTW A;  3RMQ A;  1K73 U;  3CMA A;  4C8Q F;  5A0L A;  4JRQ A;  2JNG A;  5J26 A;  2GCX A;  3OYD A;  3OW2 A;  4V2S A;  3N5B B;  3OYG A;  4DA4 A;  2D9T A;  4J83 A;  3VUZ A;  3X24 B;  5CKE A;  4M78 G;  3FJP A;  3FC3 A;  3M54 A;  5GAN 7;  4NS5 A;  3OYK A;  4M78 A;  5GAN e;  1XTD A;  1M9S A;  1R8O B;  3VYH B;  5HK0 A;  4LD9 K;  2FL7 A;  2HQE A;  1ZBX A;  1W2B S;  3A8M B;  5GAM g;  3CME A;  3J80 E;  2QXF A;  1HK9 A;  2DIQ A;  3GNG A;  3PGG A;  2GFU A;  4HT9 A;  3C95 A;  3JCM V;  2E65 A;  2DK3 A;  4ELZ C;  2YRV A;  2DEQ A;  2RHZ A;  2X4J A;  4M75 B;  3CCM T;  4LDY A;  3M55 A;  5A0G A;  5LJ3 d;  2LCC A;  3URG A;  3LGF A;  4PJO D;  1YCY A;  2ZPB B;  1GXI E;  3P8H A;  2GQV A;  3FB9 A;  1BIA A;  3A8H B;  5LJ5 h;  3JCM g;  4PJO B;  1KC8 C;  3MP8 A;  1UGS B;  1Q81 U;  4M7A E;  3G6E A;  3CC7 T;  1VQ7 T;  2KY9 A;  1XOV A;  4MDX A;  4C0D B;  2V8J A;  1LNX A;  1Y96 B;  1KQS A;  3VYG A;  4OB0 B;  2F69 A;  3OBW A;  4JS5 A;  3OYJ A;  5J39 A;  3M56 A;  1YIT T;  5I2M A;  2E6N A;  3CCL A;  4M7A A;  4PJO G;  2VXE A;  4II1 A;  2XDP A;  2QQ9 A;  4F7U E;  4QQG A;  1YI2 A;  2QI2 A;  4XU3 A;  5GAN h;  3KUF A;  5FU6 C;  1YIJ T;  5GAN 2;  4X34 A;  2O01 E;  3CCU T;  2WSE E;  3A5Z B;  3G71 T;  3V8K A;  3V8L A;  3X28 B;  4BY6 C;  3X25 B;  1KHC A;  3QYH B;  5EG2 A;  4C8Q G;  2QQR A;  1K8A U;  2OTL A;  1YBY A;  2DPP B;  3CCE T;  3MEV A;  2ZCF B;  2K3X A;  2KSS A;  1M1K U;  2R5A A;  2ZPG B;  2LCL A;  4GY5 A;  2A3L A;  4GLK A;  3FIF A;  4LDW A;  4UC4 A;  2EFI A;  5LJ3 h;  1YJ9 T;  3CXC A;  3V7C A;  3L2Z A;  3CMA T;  2Y4Y A;  5LL6 S;  3OA6 A;  4BB7 A;  1VQK A;  1Y96 A;  2CKK A;  3NTI A;  2PUK B;  1X6O A;  3LH0 A;  2P0K A;  3QUI A;  3VUB A;  3HSB A;  2X4X A;  1NE8 A;  2MWP A;  3JCM J;  4QVC A;  2L3R A;  3CC2 A;  4M77 B;  4PJO C;  4C5I A;  3OYB A;  2CZ1 B;  3L2R A;  3OSV A;  2K3Y A;  3CEY A;  1KC8 U;  3PT9 A;  1G3W A;  1I81 A;  5LJ3 f;  5CAI A;  4BI4 A;  5DLO A;  1YJN A;  2VUB A;  3OSS C;  1XNI A;  1WJQ A;  4OB3 B;  2L5Q A;  4OGE A;  2BIV A;  5CKH A;  2PQW A;  5IN1 A;  2VYT A;  4C92 B;  3JB9 I;  3L2U A;  5GAN j;  2QQS A;  4M75 A;  2GF7 A;  3FDR A;  2DXT A;  2DXU A;  4M78 D;  1P92 A;  1AHJ B;  3TU4 K;  1QP3 A;  4XU0 A;  4ZN3 A;  2EWN A;  2X4Y A;  1H64 1;  3NTH A;  2EYQ A;  4XTV A;  1UB4 A;  1VUB A;  2GFA A;  2K57 A;  4JJN K;  2RJF A;  4BAC A;  5LJ5 j;  3CCE A;  4KT0 E;  3LGL A;  1BIB A;  3KBG A;  4M7D E;  2DXB A;  2F5T X;  3GLX A;  4N4H A;  4XTZ A;  4BE0 A;  4E7K A;  3MCA B;  4A4F A;  4BI3 A;  1JBM A;  3F70 A;  4J6W A;  4CRI A;  3QII A;  4M78 F;  3VU3 C;  3VJP A;  3AHU A;  3HHT B;  3SWN A;  2DKG A;  2KAF A;  4ATO A;  4BDY A;  5IAY A;  3SD4 A;  4C5E A;  2RJE A;  3JCM d;  1WQ7 A;  3JB9 H;  2QA4 A;  1VQ4 A;  4C0G A;  2DVE A;  4PJO F;  3RKW A;  4LDU A;  1KHI A;  2ZPE B;  3VKI A;  1B34 A;  4ZGJ B;  1WJR A;  2RJC A;  3MP6 A;  2ZPH B;  3C4S A;  4OMF B;  3G7Z A;  3OYF A;  3I55 T;  3QJY A;  1YIT A;  1Q82 C;  2O4X B;  1VQ6 T;  2XDB A;  1YJN T;  1QVG S;  3DLM A;  2QDY B;  2KMT A;  1LJO A;  3QDR B;  1Q7Y U;  4KUD K;  1M90 U;  1YI2 T;  2XD0 A;  1Q81 C;  5KCO A;  3LWH A;  5GAM d;  4ZN1 A;  2DD5 A;  1YIJ A;  1G5V A;  2DIG A;  5KCH A;  4IUQ A;  5GAN g;  5DLQ E;  3CCV T;  1X01 A;  1M5Q 1;  2KVQ G;  3GF5 A;  2R58 A;  4EDU A;  3BDL A;  5L8R E;  2YHT A;  3GNF B;  5FU7 C;  5GAO n;  3SDZ A;  2FB7 A;  4C8Q A;  1VQ5 A;  3JCM c;  4Z02 A;  5D6Y A;  3PMI A;  2E10 A;  4JDS A;  3C12 A;  5LJ3 j;  1OYX A;  4IUR A;  1H3Z A;  1NJI C;  5FU6 B;  2DO3 A;  2Y4X A;  1VQK T;  4L6V 5;  5LJ5 g;  2NLU A;  2LQK A;  2G3R A;  2WSF E;  3LW5 E;  4OB1 B;  4Y91 A;  2FYK A;  2A7Y A;  1Q82 U;  3LLR A;  4BI8 B;  4C0D C;  1Q86 U;  2XK0 A;  4OGC A;  4C8Q C;  4J7F A;  5GAO p;  3OYI A;  4ME7 A;  1VQ8 T;  2PUO B;  5DM7 R;  2B8A A;  3G71 A;  4M7D A;  3A8G B;  4M77 F;  4N0A C;  3ZFJ A;  3KXT A;  5GAO m;  5LJ5 e;  2XI9 A;  4BDZ A;  2OTL T;  1QVF S;  2EQK A;  2YLB A;  1BKB A;  4JRK A;  4X9C A;  2L8D A;  4HKE A;  4HA8 A;  1M8V A;  5GAM h;  4M7D G;  2EKO A;  2P0Q A;  1FX7 A;  2CZ0 B;  3LX7 A;  4M75 G;  3GPL A;  4C8Q E;  2LT1 A;  4XTX A;  4C92 E;  4IKF A;  4MML A;  2QQB A;  3OS1 A;  2K5F A;  3PTA A;  2D0Q B;  2DJZ A;  4DOW A;  1Y71 A;  4BE2 A;  1KD1 C;  3CBP A;  1I8F A;  4R56 A;  3UPU A;  1YJW A;  2RA2 A;  5GAN 3;  4N0A A;  4FSX A;  3CC2 T;  3CCR T;  4FT4 A;  5HKC A;  3CC4 A;  5GAN 5;  3MET A;  2LDM A;  3CPF A;  3M4G A;  1M1F A;  5I2S A;  1K8A C;  3WVD B;  1KG1 A;  2E64 A;  2LNV A;  3ER0 A;  5LJ5 f;  4R55 A;  3DLL A;  4M78 B;  2E41 A;  3SFM A;  5GAN 4;  3BDU A;  3CPW S;  1Q7Y C;  3J7A F;  2MAM A;  3OS0 A;  1VQ9 A;  1VQ8 A;  3MO8 A;  2K5I A;  5GMK l;  2E6Z A;  4BD3 A;  3DB4 A;  3OYN A;  4LDX A;  3TCJ A;  1YHQ T;  1IZ6 A;  3ZEH A;  3BFM A;  5GMK h;  2XKO C;  3S6W A;  3GIB A;  2JTM A;  2JVV A;  1Q86 C;  5CK9 A;  2M9U A;  3HL8 A;  2D6F A;  3QPH A;  5CO7 A;  3RER A;  1QVG A;  2RK1 A;  4XQ3 A;  3CME T;  5FRM A;  3BY7 A;  3R6O A;  4MZM A;  2DZC A;  3EFS A;  2X4W A;  3QO3 A;  3UWN A;  3MP1 A;  4F7U A;  3HPW A;  3JCM e;  5A0D A;  4Q5W A;  4J8O A;  2QA4 T;  1VQ4 T;  2VGM A;  2LX9 A;  4JRI A;  2RI5 A;  1VQM T;  1YJW T;  3CCQ T;  4HCC A;  5CQX A;  3CCR A;  2LVM A;  3RKX A;  4F7U G;  3CCJ A;  2XID A;  4M7D D;  3OS5 A;  3JB9 G;  2VV5 A;  1VQN A;  3H8Z A;  4M75 F;  4PNO A;  2EQM A;  1VIF A;  3HRS A;  2LRQ A;  1VQ6 A;  2DTH A;  4C0Z A;  2HAX A;  4X9D A;  1B34 B;  2ZPF B;  3FRN A;  1I4K 1;  3P8D A;  3L2W A;  4HCB A;  2RHY A;  3WXM B;  3RES A;  2RHX A;  3OYL A;  1N27 A;  3CCV A;  4M77 D;  2E5Q A;  2EAY A;  3CD6 A;  2CGH A;  5M9O A;  3S3N A;  3TEE A;  1YHQ A;  4O6J A;  3OMG A;  2QEX A;  1KQS S;  2P0P A;  1D3B A;  1W4S A;  2WSC E;  2DXC A;  4XAX B;  2IG0 A;  1ZQ1 A;  2PU9 B;  5IT9 E;  3VV0 A;  2YLC A;  1NPR A;  2HQX A;  4F7U B;  2EJ9 A;  1RI0 A;  3BW1 A;  3LYI A;  4RCB A;  5FRN A;  2R57 A;  4FM4 B;  2XHC A;  3CCS T;  3JCM W;  2QTX A;  3G6E T;  5GAM f;  5GMK m;  2E1H A;  2I2L A;  4MDW A;  5FU7 B;  1K73 C;  2PVG B;  4RG8 A;  2PVD B;  1VQM A;  1U1T A;  2ZPI B;  3CCQ A;  1OZ2 A;  2P4T A;  3FEO A;  4JUV A;  4RG2 A;  3I56 T;  1SSF A;  4LDV A;  1Y7X A;  4MMK A;  1VQO T;  1QP2 A;  4YTL A;  3OYE A;  2RK2 A;  4BY6 B;  2K4Y A;  4ELY C;  4NL2 A;  4E7L A;  3JCM f;  2CZ7 B;  3S3O A;  3L1A A;  2XIC A;  3EAE A;  3QZ9 B;  3CCU A;  1W2B A;  1JRI A;  3SWN C;  4OF1 A;  4BUG A;  3QHS A;  2RI2 A;  2R5M A;  3M9Q A;  3SB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...