5GMKh

Cryo-em structure of the catalytic step i spliceosome (c complex) at 3.4 angstrom resolution
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
72
structure length
70
Chain Sequence
PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGVSHGTLGEIFIRCNNVLYIRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/rna
molecule keywords Pre-mRNA-splicing factor 8
publication title Structure of a yeast catalytic step I spliceosome at 3.4 angstrom resolution
pubmed doi rcsb
total genus 8
structure length 70
sequence length 72
chains with identical sequence w
ec nomenclature
pdb deposition date 2016-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
h PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5gmkh00
4MMKA 3JCMf 3QUIA 4MMLA 5DY9A 4EMKA 4M7AA 4C92B 2YLBA 1U1SA 4NL2A 5GAN4 2ZGWA 4M7AD 2QTXA 3JB9F 3M4GA 5GAN8 3SWNC 3BDUA 4JUVA 4M78G 5LJ3j 2E1HA 5LJ3d 5GAOp 4F7UG 2DTOA 5GAN2 2DZCA 4M75A 4C8QE 3V8LA 4M75F 2JN0A 4M75D 2DJZA 2FYKA 5GAOm 5GANj 5LJ3g 5GANd 2DTIA 5GAMd 5GAN5 2DXTA 5LJ5h 4M7DC 4XTXA 1BIAA 3PGGA 5I21A 1B34A 3JCMQ 4C8QB 1U1TA 5CAIA 4EMKC 4M7AC 1D3BA 4J6XA 4J6WA 3JCMg 3RERA 3FB9A 4M7DA 2RD1A 4HT8A 4M7DF 4M77G 4M7DD 4A53A 3QHSA 5GMKh 4M7AE 4M7AF 3AHUA 1JBMA 4PJOG 5GAOr 4M75C 4XU1A 4C92G 3FIFA 2YHTA 2EWNA 5GAN7 4M7AB 4NOYA 5LJ5e 1N9SA 4XTZA 1LJOA 4M75E 5GMKm 1MGQA 5GANg 4JLIA 4PNOA 4J5YA 5LJ3h 4M78A 5GAMe 5GAN3 5GAOn 2EAYA 3JCMW 4M78F 4WF2A 2I2LA 3V7SA 5LJ5f 4M78D 4F7UA 3JCMd 4Y91A 4NL3A 3JB9G 1Y96A 4F7UF 5GMKi 2FB7A 2CGHA 3SWNB 3QO3A 4V2SA 1WQWA 4M75B 3JB9J 2HNIA 5GMKe 3VU3C 5GAMh 5GANh 3JB9H 1M8VA 2K57A 4M7DE 1BIBA 2VXEA 1WNLA 4C8QG 3BFMA 4XU2A 4M77C 4XTWA 3RESA 1B34B 1TH7A 1WQ7A 1I81A 2YLCA 3V8KA 5GAOq 1D3BB 4QVCA 2VC8A 4DQ2A 2VXFA 4JRKA 4M7DB 4C8QA 2EJFA 4M77A 3V8JA 5LJ3e 4XTUA 4M77F 2E64A 4JRIA 4M77D 4M78C 4EMKB 3JCMV 3QSUA 4HT9A 5GMKl 4PJOA 1I8FA 1LNXA 4J6YA 3RKXA 1M5Q1 5LJ5g 5GANe 4C92A 5GAOl 4PJOD 2DTHA 3JCMc 3HFOA 4M78E 4M7AG 4C92D 1H641 5GAN6 4F7UE 4XQ3A 2E41A 5GANf 5GAMf 3L1AA 2Y90A 3JCMh 4EMGA 4X9DA 4N0AA 4M78B 3SB2A 3RUXA 2DEQA 4M75G 4C8QC 4F7UB 3JB9D 3EFRA 2RA2A 3L2ZA 1Y96B 3RKWA 3RIRA 3JCMJ 2E10A 2RB6A 1LOJA 3FJPA 4XU0A 4RCCA 1KQ2A 3JCMX 2DXUA 4PJOC 3SWNA 5LJ5j 4M77E 4X9CA 2E65A 4C8QF 5LJ5d 1KQ1A 4C92C 4C8QD 3JCMb 3JB9I 3HSBA 4RCBA 3V7CA 1YCYA 5GAMj 1X01A 2RM4A 3BW1A 3JCMP 1N9RA 3V7RA 4M7DG 1JRIA 2EJGA 4OP0A 2DVEA 1HXDA 1HK9A 4PJOF 1I5LA 4PJOE 2DKGA 5LJ3f 3RKYA 4EMHA 4M77B 4C92E 4A54A 3JCMe 4C92F 4XU3A 3BY7A 3GIBA 1WPYA 1I4K1 2DZ9A 2EJ9A 3HFNA 3EFSA 3INZA 4HA8A 4N0AC 5GMKj 4QVDA 5GAMg 4XTYA 4PJOB 4XTVA
chains in the Genus database with same CATH superfamily
1I5OB 2W0ZA 1IREB 3ER0A 2F2WA 2JVVA 3OQ5A 4AFUC 1UFFA 2KMTA 1RAAB 2GFAA 2JS0A 2NLUA 4M75F 1KSWA 5KYUA 1ZUYA 3VKIA 5GAN5 3CC7Q 1UTIA 3QDFA 2KQWA 1WXBA 1PC0A 3LWIA 4OMFB 3PVQA 1N6AA 3AHUA 1GBQA 4M75C 4C0GA 1KC8U 1VQOT 2DPPB 1FMVA 1U3OA 4JLIA 4PNOA 4PJMA 2COWA 4M78F 2BUDA 3H0HA 2CH4A 2H8HA 5IXBA 2HSEB 2DBKA 2GQVA 2HNIA 2MOXA 4IUUA 4ANJA 1LCKA 3CC4Q 5CKHA 1S72T 4QW2A 4B9XA 2FPDA 3BFMA 4DBQA 3QKJA 4J9CA 2VB6A 4M77C 1WHHA 1BB9A 1TH7A 2K3YA 2MAMA 3OYCA 2W10A 1D3BB 3M9QA 2WACA 2E64A 2V8JA 4M78C 3I35A 1VQPT 1I8FA 1K73U 1IHVA 5GJWB 3L2QA 1NZ9A 3LWHA 3MEWA 5IHKA 4F7UE 2RHZA 3EGXB 2K2VA 2WSEE 4EMGA 1VYVA 1S72Q 1RAFB 4F17A 4JS4A 4R56A 3CCLT 1WHMA 3H9NA 1GXIE 3J81E 1SSFA 1QVGS 4HKEA 4PJOC 2EQJA 5D6XA 3VS1A 4IIMA 1Y71A 4BE0A 1M1KR 1VIEA 2DVEA 3E1SA 2B86A 5HKCA 3U23A 2O9VA 1ACMB 2X4YA 3INZA 3SFMA 1KQSS 4CC4B 1VA7A 2DL8A 4BI3A 2YLBA 5I22A 1YJ9T 1KIKA 3CCLQ 1MV3A 1WGSA 1ZBXA 2OAUA 2R5MA 4BACA 1VQMT 1HD3A 1QLYA 1TUGB 1GRIA 2DETA 3NTHA 3CMAT 1GFDA 3A5ZB 5LJ3g 1PKTA 2RQTA 4QQGA 2XI9A 3CPWS 1PM3A 4J6WA 4DEYA 2RD1A 4M7DF 1VQOA 4F16A 2L0AA 1YJ9Q 1W2BP 2KGTA 4M7AF 1AZEA 1OX8A 3L2WA 4LDYA 3HP9A 4C92G 1PKSA 3X28B 4M7AB 5LJ5e 1NJIR 4L5GA 3SEMA 3G6ET 1S72A 1NEBA 3GNGA 5KYWA 1W1FA 3TSZA 3X25B 3QIIA 1M8VA 2JMAA 2C0TA 2AK5A 2V26A 1YWOA 1VQPA 2O2OA 1X2KA 3RESA 1QVFS 4JDSA 4HVWA 2PUOB 1OPLA 3RR6A 3CCEQ 3V8JA 2D8JA 4FW2A 2K5FA 3CCQQ 2E5KA 1VQ9T 3PFSA 2L3PA 5GANe 2JXBA 2AHJB 4BI4A 4EDUA 4IUPA 2LTOA 2ZPFB 1TS9A 5D6WA 5J3BA 3CXCS 1G2BA 2EYXA 2KEAA 3QWXX 5FWBA 8AT1B 1K8AC 2FEIA 3R6OA 4LUDA 4M75G 3EG9A 2X3XD 2PU9B 3JCMX 3L2RA 4J9DA 3BW1A 3VS7A 2MIOA 1RADB 4OP0A 2SRCA 1HSQA 3ASKA 4MZMA 4EMHA 4A54A 4KH0B 4PJJA 1NEGA 3M53A 4N0AC 1VQMA 2XIDA 2NUPB 4A4HA 2OTJA 4AFSC 4RG2A 1BBZA 1JB0E 3CMAA 3OS2A 1AWJA 2Y4XA 6AT1B 2L3QA 3M4GA 3I55Q 1RAEB 2ZPHB 3M59A 3EH2A 4M78G 3UDCA 2PVDB 2XK0A 1XTDA 1NPRA 2A7YA 2ESWA 2DJZA 3S3OA 3RDVA 4D8DA 1MMAA 4E6RA 3CCRT 1SPKA 3MKDA 4C8QB 1LPLA 2CYZB 4ZTJA 5AT1B 3DB4A 1YN8A 1MNDA 2CREA 3UF4A 3CCUT 2K4YA 1TWBA 3G6EA 1AD5A 1D1AA 2X4WA 4PJOG 2ZPBB 2YUNA 1H3HA 5GAN7 2EWNA 2RQWA 2NWMA 2RJDA 1Q81U 3OYNA 2KRMA 3NPFA 5GAN3 2HD0A 3JB9G 3A1PA 3PMTA 2FZKB 1B3QA 1WQWA 3EFOA 1YHQQ 3UA7A 4AMCA 3FRNA 3CCUQ 1VQ9A 2E12A 3CCVT 1U5SA 1K9MR 1K0SA 5GAOq 2JUFA 3DLMA 2HDAA 4ME7A 4M77A 5J39A 2CP0A 1JXMA 4CC7A 2FRYA 5LJ5g 1QP3A 5GAOl 1T0JA 1Q7YR 2AIRB 1ZSZB 4E2FB 4ZGEB 5GAMf 9ATCB 2V1QA 2RJCA 3OSVA 1QCFA 3QBYA 3KFVA 3RNJA 2M0OA 3EFRA 3RKWA 2M0YA 1E6HA 2DO3A 5LJ5d 3HRUA 3VS4A 3JCMP 4M7DG 3VS0A 2KRSA 1HXDA 3I9QA 2E4HA 1KFZA 5GANg 3DB3A 3HFNA 1UJ0A 4XTYA 4KGXB 1VQ5T 5KYYA 3OA6A 2RHUA 1AT1B 2ROLA 3CCRA 1RI0A 1C1AA 3GOXA 1FWZA 4KBMB 3KUFA 5GAN2 2DZCA 3EGXA 3VS2A 1OZ2A 5CQXA 3REBB 2JN0A 1EFNA 5IHNA 5GANd 5I11A 3M58A 2FHDA 3M0TA 3J7AF 2JTEA 1QKWA 4RTVA 2QK0A 2RI2A 1M27C 2QG9B 1CKAA 3PNWC 2RHYA 1R8OB 1OV3A 2DRMA 3O8VA 2QA4T 1VQ5Q 2IPOB 4PJLA 4LN2A 2GTOA 3G7ZA 2ROTA 3CD6Q 2EGAA 3CPFA 1VYTA 3EGDB 2RJFA 1WI7A 2DBMA 1M90U 1ZBJA 2BZYA 2IIMA 2KXDA 5GMKm 2EGCA 3NTKA 2EAYA 3CCVA 1Y0MA 4F7UA 1O9SA 1YITA 2CT3A 1Z9ZA 3JB9J 1CSKA 1WXTA 1TUCA 2DK3A 3HRTA 1B34B 3CXCA 1UUEA 5FRNA 4KGVB 2XHCA 4FYYB 3PIOA 4J6YA 5GJVB 1C0MA 1G3SA 1GFCA 3RBBB 3L2VA 2CS7A 3A98A 1N8RC 4EIKA 2RMOA 2DEQA 3MP1A 2QQ9A 1OX9A 1Y96B 2LJ1A 3L2ZA 2PUKB 2AZVA 1NJIC 1OQKA 4E7SA 1M1KU 3PMIA 2JJ9A 1Q86U 4J9FA 3VS6A 1WLPB 2E65A 1KD1U 1YNZA 1N9RA 3PT9A 2DYBA 4RG8A 3BY7A 5GMKj 4OVAA 2AZSA 1Y07A 3ME9A 3D7SB 1NE8A 3OYJA 1YJWQ 1GL5A 2RPNA 4M7AD 4E7IA 1LVKA 2KNBB 1G3WA 2A0FB 2P84A 5LJ3j 2RO0A 3OMCA 4E7HA 3CC2T 2QA4A 1RI9A 2FYKA 3OYYA 3OMGA 1VQLQ 1VQ7T 1WFWA 4DOWA 2L89A 2VYTA 5CAIA 4HCBA 2P0QA 5I2SA 3EG0A 2BE9B 2QQRA 2QASA 2JTMA 1YP5A 4BUGA 1M3CA 2DILA 1DJ7B 3E9GA 2I0NA 4HCZA 3CC2Q 4QQDA 4FYWB 4ZN1A 3JCMW 4Z8AA 1VQ7Q 4WF2A 2CP6A 2ZPEB 3OS1A 2VV5A 1G8XA 1VYUA 2PVGB 2VXEA 1QVPA 5ECAA 3THKA 1K8AR 3UATA 4C8QA 3NTIA 4FSSA 2HEQA 2PNIA 3SDZA 4JRPA 3HPWA 5IHIA 4EMKB 2LJ0A 1LNXA 2CDTA 4ZGJB 4CC3A 4PFOA 3LW5E 1WHJA 1H641 4QQ6A 2X9HA 4XQ3A 1RL2A 5L23A 1PD0A 5FU6B 4RTZA 2CH4W 4PKCC 3SB2A 4ZGDB 4XAXB 2E10A 4II1A 4X34A 3OBWA 4XU0A 3HHTB 1NLPC 2VVKA 3MP6A 1UGSB 2FL7A 4C8QD 5FW9A 2O4XB 2FG0A 1MMDA 3QYHB 2EJGA 1VOMA 2CT4A 3OW2S 4C92F 4KGZB 1Z9QA 1I1JA 3FC3A 3C95A 4XTVA 3CC2A 1ZUUA 4C92B 2J06A 2A36A 3I56A 2ZGWA 1V76A 2KXCA 5IH2A 3A8HB 2A08A 4JUVA 3IQLA 1A0NB 2GBQA 4OB1B 3VUZA 2JTFA 1Q7YC 4BD3A 1K1ZA 3CC7T 2SEMA 4HT8A 4YTLA 3SHWA 5GMKh 4KT0E 4JJNK 2DF6A 2LCCA 4LDUA 4QKUA 3VYHB 2C0OA 1ZUKA 4JJDA 2HL5C 4B6MA 4CC2A 2LVMA 5LJ3h 4ELZC 4IUVA 2M16A 3QZ9B 2FB7A 3LYIA 4M75B 3TCJA 4OGEA 2RK2A 1K9MU 3CC4T 2EQUA 5DLOA 2BIVA 5CVIA 1B7TA 1H92A 4C5IA 4LUEA 2GF7A 3LH5A 1QW1A 2CSQA 4M77F 1WX6A 3CCJT 4JRIA 1N5ZA 1BI3A 1R77A 2J6FA 2LCLA 1BKBA 3CBOA 1C6VX 1M5Q1 1SF9A 1F1BB 1ABOA 1QCOA 3PE0A 1GBRA 1O75A 2KY9A 1M3BA 4BI8B 1SG5A 3JCMh 4X9DA 4CRIA 4M78B 3RUXA 2OTLQ 4RTUA 3QYGB 3JCMJ 2RB6A 3E9FA 4RTWA 1W4SA 1OOTA 2CZ7B 4GY5A 3CCJQ 3KXTA 3PVLA 2CUBA 1JJ2A 2HBWA 2MMPA 2X4JA 2ZCFB 4B9WA 1EX4A 1K4US 4PJOF 1PRLC 4F14A 2LZ6B 5GAMg 3EFSA 3CCMQ 4E47A 3I5RA 2PQWA 4PJOB 1PSFA 3BDLA 1PSEA 4DEXA 4E7KA 1ZHIA 3JB9F 3EAEA 3RMQA 1S1NA 4J9GA 3GPLA 4FYVB 4X1VA 3CC7A 2E5QA 5CIUA 3V8LA 8ATCB 1PHTA 2L3SA 5GAMd 4RTYA 2LDMA 4Q5WA 2DL4A 5HK0A 2ENMA 4HVUA 4GLKA 4C5HA 1H3ZA 3C94A 1IGUA 4FYXB 1KG1A 1WHKA 3EG1A 4M7AE 4DA4A 2XKOC 5IAYA 2A3LA 2QQBA 4J8OA 2HQEA 3OS0A 3JRZA 1TSFA 2DL5A 3CC4A 4BDYA 2JT4A 4O5VA 3M56A 5KE3A 2YT6A 5FU7C 4F7UF 3PTAA 1NLOC 2K57A 1BIBA 4XU2A 1M2VA 4LE9A 2HCKA 5CK9A 2EIFA 1N8RR 3P8HA 3MEVA 4KULA 4DQ2A 4M7DB 3CCET 4PL6A 3SD4A 3CCQT 3QSUA 2DL3A 2EYQA 1NM7A 3JCMc 1UECA 1FX7A 2LQNA 4IIOA 4DBRA 1I07A 3GBQA 3GF5A 1HYOA 2LQ8A 2VGNA 5DM7R 1YIJQ 2AT1B 1AZGB 3H0IA 2KI7A 5KCHA 3LGLA 1I5LA 1WHGA 2ED1A 3CCLA 1J3TA 1UB4A 2EYZA 4MDWA 2O9SA 2QYZA 4QVDA 2DERA 2WSCE 4MMKA 5A2QE 4EMKA 2EKOA 2HMAA 4NL2A 4FIBA 2O01E 5GAN8 2VKNA 3I55T 2RQRA 1T3SA 3DLLA 5EC7A 3TQ7P 4C8QE 4Z89A 4A4KA 5CCAA 2DVJA 4D6WA 2CZ6B 1YJ9A 1BIAA 1VQ4Q 3G1JA 1MUZA 3RERA 2M51A 2X51A 2ECZA 1WA7A 4K11A 4M77G 1ZQ1A 3QHSA 5CKDA 2V8KA 5CKEA 1QQJA 4JLGA 3G71Q 4PK4A 2JW4A 2PVOB 1G5VA 2XICA 1W2BS 4WCIA 1YI2T 2WSFE 2OX7A 4V2SA 3CCEA 1YHQT 1WIEA 1K8AU 3CCQA 4RUGA 1UHCA 2NUTB 3V8KA 2CP2A 2KRNA 2HQXA 2VXFA 3CMET 1T0HA 2ATCB 2RNAA 2M1HA 3JCMV 2DL7A 1YI2Q 2MK5A 4C92D 2YDLA 1AHJB 1GCPA 3A8MB 3EHQA 4FCYA 4Z88A 3R6NA 5M9OA 4NS5A 4Y28E 4C8QC 2HSPA 2R5AA 1YBYA 2HKQB 2K79A 1G83A 3VV0A 2K6DA 3CMEQ 4AG2C 3HSBA 2KT8A 1FMWA 3OYAA 1QVGA 2DRKA 2HBPA 1SHGA 1D0ZA 3I55A 2ZPIB 2K3XA 3S3MA 3META 2XDDA 4Y92A 1AEYA 1M1FA 2JS2A 3X24B 1KQSA 3BDUA 1PWTA 1SEMA 2KAFA 4F7UG 2YUOA 1RABB 3CCSQ 4M75D 1U06A 5GAOm 2X4XA 1KC8R 2EFIA 4LD9K 4RTTA 1XJWB 5I21A 3J80E 3S3NA 1D3BA 5KYNA 2P4RA 2CP3A 4J6XA 3OYFA 3M55A 3CPWA 1YI2A 1MNEA 4M4ZA 3CD6T 1CKBA 3FDRA 1VQ6Q 2EGEA 2YHTA 4C0DC 1M2OA 1YHQA 3OYIA 4JPBW 4L6V5 1D1CA 3CCUA 4D8KA 3V7SA 4M78D 3QJ6A 2BZXA 1K73R 4IURA 2BKDN 3E2UA 2M02A 2LQKA 1WQ7A 1X6OA 3MPUB 1I81A 3S6WA 2GFUA 1QVFA 2LMJA 2JMCA 5GMKl 4N4HA 4R55A 4PJOD 3MCAB 1AWOA 2RHIA 1JJ2P 2PZ1A 2LC4A 4A4EA 1Y7XA 2A28A 2F5TX 2E41A 1IXDA 2E3HA 3JB9D 2QXFA 2COYA 4RKUE 1LOJA 2DMOA 3L2UA 3LGFA 2QEXQ 4DBFA 2K5LA 2F5KA 5GAMj 1KJWA 2E6NA 1NBEB 1D0YA 4XU3A 3EGUA 1I4K1 1VQKT 2J6OA 1JXOA 4A4GA 3JCMf 1YJWT 3PIPA 3REAB 4M7AA 5GAN4 2QTXA 4BY6B 2EW3A 4FW1A 4JZ3A 2L8DA 1UHFA 2QI2A 2QQAA 1VQ5A 1BYMA 1VQLT 1AVZC 1BI0A 4XTXA 1VQNQ 3GNFB 3OYKA 3CD6A 2QDLA 3G4SQ 2K5IA 2IVWA 1VQKQ 3ZL7C 3FB9A 2LX7A 4M7DD 1G3YA 3NHNA 1IB8A 1YJNQ 2C0IA 2J05A 3LX7A 1WJSA 3FIFA 3OYHA 4F04B 2F1LA 2VASA 5IN1A 3VUBA 2D1XA 2E3IA 4VUBA 2I2LA 1RLPC 3SWNB 1PRMC 1N8RU 3C0CA 5HK3A 3CBPA 3C4SA 3EG3A 1M3AA 3M4YA 2M9UA 1NJIU 1VUBA 1UG1A 2C06A 1YCSB 5CO7A 2NUPA 4ZN3A 2D6FA 4HT9A 1VQ8T 4LDVA 3URGA 1TOVA 4HCCA 3GP8A 5KYWB 1XNIA 4OMLA 2KDSA 1ARKA 4JZ4A 1Q82C 3JB9I 1YCYA 3RMSA 3GLXA 1YJWA 1SSHA 4C92E 4CI0C 1VQ8Q 3CBMA 2RI5A 1W6XA 4A4FA 2K3BA 4MMLA 5KE2A 4C5GA 1EZZB 2KYMA 2ZPGB 1VQLA 1X2QA 2KK4A 1X27A 2XG8D 5GAOp 2DTOA 2DIQA 4FM4B 1UGPB 3EG9B 5D7UA 1Q81R 2YUQA 3A8GB 3PGGA 3JCMQ 1U1TA 2NYSA 4EMKC 3E19A 3JV3A 4C5EA 2RN8A 1NYFA 4A53A 4OB2B 3OYMA 3VRYA 1VQ7A 2CP7A 1ZSZA 3WVEB 4ZTFA 3A8OB 4NOYA 2K2MA 3C12A 2YRVA 2FPEA 4M75E 1QWEA 5L8RE 3HTRA 3EG2A 2KVQG 2Z0WA 5GMKe 3H41A 3FJ5A 3OBYA 2K9GA 3WVDB 1M30A 4PLLA 2G6FX 1X75C 5LJ3e 3MJXA 1KC8C 3M54A 1D1BA 5KCOA 2R58A 2V8IA 2XU8A 4M78E 2FZGB 1QVGP 3OYEA 2DLPA 1X6GA 2LP5A 2FZCB 3MHXA 4MDXA 2E70A 2KE9A 2OTLT 4C0FA 1GCQA 4OMMA 3EFOB 3FJPA 5C0MA 2O31A 3ULRB 3VJPA 1KQSP 2DJQA 5LJ5j 2CUDA 1TU0B 1IRXA 1Q7YU 3L42A 3JSCA 1OZ3A 3V7RA 4PJOE 1AWXA 1K73C 3JCMe 4M77B 3GIBA 2E6ZA 2EJ9A 1RAGB 5J26A 4LNPA 1Q95G 3CCMT 2NUZA 2F69A 3EGDA 1KQ2A 1NYGA 4JJCA 3QUIA 5DY9A 2KSSA 2YXYA 3X26B 5IXFA 1WXUA 1FMKA 1D09B 1OI1A 3CPWP 4Z02A 4LDWA 3A8LB 1UGVA 1ZSGA 4PLIA 1X43A 4AFQC 5GANj 1M90R 1WJRA 1B34A 2EYWA 3QZ5B 4J83A 4PFPA 3QXEB 3VRZA 4LDXA 1T3LA 1K0XA 5A0LA 3M0SA 1M4ZA 4XU1A 2EQMA 3UPUA 1VQOQ 5KYYB 1N9SA 2IG0A 2D0QB 2GGRA 2FPFA 1QVFP 3QWYA 1D0XA 1PD1A 1Y96A 2VWFA 3VU3C 1BK2A 1V29B 4M7DE 2LNVA 2CKKA 3ZEHA 2MYSA 2EJFA 4KUIA 5FWCA 5FU7B 2MF2A 3CXCP 1WDXA 1VQPQ 3NGPA 1ZA2B 1Q86R 1TTHB 2DX1A 1KD1R 1WHLA 2OTLA 2LT4A 4FT4A 2FRWA 2L2PA 4N4GA 2CSIA 5CQYA 3CCJA 4JS5A 4F7UB 2QTVA 2LJ3A 2OTJT 2RJEA 1YIJT 3SWNA 3TSWA 2MPXC 4IUTA 4X9CA 3JCMb 3CCMA 5KH6A 4RCBA 4OMPA 1X01A 2YSQA 2EPDA 2GTJA 4AT1B 5CKFA 2JOYA 2DD4A 4ZNXA 4J9HA 3OW2A 2X3WD 1M8MA 1XOVA 2L3RA 4J7IA 1VQMQ 1HJDA 2OTJQ 5LJ3d 2DE0X 3CMAQ 3H0FA 2CZ0B 3ZBDA 2GNCA 1BI1A 3BE3A 2DM1A 2P0KA 2Y4YA 2DXTA 5LJ5h 4M7DC 1VQ4T 2EQKA 2DD5A 1SHFA 4M7AC 1WJQA 3JCMg 5FLXE 1UGQB 5IT9E 1M9SA 4HCKA 1VIFA 1UDLA 4KRTA 3M0PA 1WYXA 2MCNA 2PTKA 2XD0A 3G71T 2K7AA 1SRLA 4PJNA 3OYGA 1V1CA 3QDRB 4XTZA 3G6EQ 4KUDK 1FXXA 2JM9A 1IGQA 3QPHA 2JNGA 4J7FA 3JCMd 2RH2A 4NL3A 2XDPA 2YUPA 5GANh 1SRMA 2H3EB 5AYFA 3OYBA 1WNLA 5HCKA 1IHWA 3FEOA 4XTWA 4C0ZA 2O4XA 2DYIA 2AKKA 2X35A 1VQ9Q 1Q81C 2AKLA 1Q82R 3AT1B 4C92A 2A37A 5D6YA 5GAN6 2ZAEA 1Y57A 2QGGA 1YIJA 2Y90A 1OPKA 3HKSA 2QDYB 2V1RA 2QAZA 3VYGA 2DXUA 4OMNA 4C8QF 3HRSA 3OB9A 1JRIA 4QVZA 4DBHA 2LX9A 3MP8A 4LD6A 2RK1A 2L5QA 2DZ9A 2OJ2A 2LNHB 1TG0A 1ZX6A 1PG5B 4FSXA 1U1SA 2KR3A 1UJYA 1VQ4A 1NG2A 2E1HA 2G3RA 3M0RA 3MEAA 4E7JA 4HVVA 4M75A 5HY6A 3CCST 1OU8A 3Q1JA 2DTIA 5LL6S 5KYXB 1JO8A 3CCRQ 2MWPA 3H8ZA 3JAME 2XMFA 3G71A 2DAQA 2RI3A 1FYNA 4RTXA 1YITT 2D0NA 3OS5A 1MMGA 2KROA 1VQ6T 1I0CA 2EQIA 1LJOA 1MGQA 2RQUA 4M78A 4J9EA 3UT1A 1OU9A 3M0UA 4Y91A 1KHIA 2CGHA 4O6JA 4MZPA 2LT1A 4E7ZA 1IZ6A 4OMQA 4C0DB 1QMCA 2DXBA 3CCVQ 3WXMB 1YITQ 5A0DA 1ZSZC 4IKFA 1OEBA 4OF1A 4QVCA 7AT1B 3DKMA 1QP2A 4XTUA 4IUQA 4M77D 2DA9A 1M90C 4DOVA 2RQVA 4PJOA 5I2MA 3RKXA 4M7AG 3M5AA 4ESRA 1YWPA 4FT2A 3F70A 3CMEA 5KYUB 3QJYA 3RIRA 2DFUA 1QKXA 1N27A 2QEXT 1KQ1A 4A63B 3MEUA 1HK9A 4OGCA 2DKGA 3N5BB 5LJ3f 4N4IA 3M57A 4QT7A 4ELYC 2MI6A 3CCSA 1GCQC 3P8DA 2ED0A 5DLQE 2DXCA 1MHNA 1ABQA 1M1KC 1Q86C 2RF0A 2BTTA 1X6BA 2LQWA 1KD1C 3P8BB 1U8RA 1AOJA 1VQNT 3M0QA 3G4ST 2BE7D 2QA4Q 1VQ6A 4M7DA 1E7OA 4OB0B 1P92A 4EPCA 1YJNT 2CP5A 5GAOr 2HL3A 1MV0B 4MZTA 3X20B 1QCNA 3LH0A 3H6ZA 2D9TA 1H8KA 1IO6A 4J5YA 1UEBA 2F2XA 5GAOn 2D8HA 3O5ZA 2DIGA 4ATOA 5GMKi 2DNUA 2HZYA 1W2BA 3JB9H 2EVRA 4HXJA 2P4TA 4C8QG 1UGRB 4BE2A 4JRQA 2J7IA 2VC8A 1TXQA 3TREA 3QG1A 2XDBA 1PNJA 4BY6C 1XQHA 4PFZA 3ZFJA 2P0PA 1K9AA 5A0GA 2COZA 2EKHA 4UC4A 3L1AA 2QEXA 2YRDA 4N0AA 1B07A 4AG1C 1KK7A 1JJ2S 3FLGA 3OW2P 1PCXA 2H3JA 4TVRA 4RCCA 1BU1A 1M2VB 3I56T 1BCMA 2RM4A 2O88A 1ZA1B 1OULA 2LRQA 1ZLMA 2OI3A 3RKYA 1W70A 3EHRA 4AFZC 1JQQA 2RHXA 3SWNC 3UA6A 1AWWA 4BE1A 4OB3B 1VQNA 3I5SA 2FO0A 3MO8A 4P5NA 1JU5C 3G4SA 1QWFA 1VQKA 4LXCA 3I56Q 5FRMA 1RACB 1MMNA 1G3TA 1YJNA 2HAXA 2NUTA 3VS5A 1JEGA 4BDZA 1RLQC 1NPPA 2HKNA 3KBGA 4J9IA 4J9BA 3UWNA 1JBMA 2VGMA 1R0CB 2OAWA 4FU6A 1OYXA 2DEUA 1RUWA 2F2VA 2JZ2A 4WTOB 2QQSA 1RAIB 5GAMe 2J6KA 1YFNA 1BI2A 5LJ5f 3VS3A 4E7LA 3QO3A 1KHCA 4FL6A 5GAMh 4GLMA 3CQTA 3HL8A 4R0KA 4XK8E 3NMZC 2YLCA 2ZZDA 2KT1A 4GBQA 5KYXA 4L59A 4JRKA 2JM8A 1Q82U 5FU6C 5C6SA 3OSSC 4ORZA 3TVTA 2MWOA 2KYBA 3TU4K 3OY9A 2FVUA 2LCSA 3CEYA 1TUDA 2R57A 2DTHA 3HFOA 2EYYA 2YRCA 5CKBA 5CR2A 4KH1B 3T9NA 1E6GA 5GANf 1K9MC 1UE9A 3NFCA 4JJBA 2RA2A 1SKUB 2GCXA 3OYLA 1VQ8A 1EIFA 4OMOA 3EH1A 2ABLA 2YWWA 2VUBA 4M77E 5EG2A 1RAHB 2EBPA 4C92C 3V7CA 2HQHA 1WZOA 2CZ1B 3OYDA 2QGFB 3TEEA 2GQIA 1BCOA 5FROA 1WPYA 4HA8A 4RMOA 1M1GA 1X69A 1K76A 4BB7A 1R0BG 2B8AA 2BZ8A 2KBTA 3LLRA
chains in the Genus database with same CATH topology
1IREB 3OW2A 3META 2XDDA 1XOVA 3ER0A 1M1FA 2JVVA 3X24B 4M7AD 1KQSA 4E7IA 3OQ5A 1G3WA 2L3RA 4J7IA 3BDUA 2KMTA 5LJ3j 5LJ3d 2KAFA 2GFAA 4F7UG 2RO0A 3OMCA 4E7HA 3CC2T 2CZ0B 2NLUA 3ZBDA 4M75F 2QA4A 4M75D 2FYKA 5GAOm 1BI1A 2X4XA 3OMGA 3OYYA 2P0KA 2Y4YA 2EFIA 3VKIA 2DXTA 5LJ5h 4DOWA 5GAN5 1VQ7T 4LD9K 4M7DC 2L89A 2VYTA 5I21A 3J80E 1VQ4T 2EQKA 2DD5A 5CAIA 2KQWA 3S3NA 4M7AC 1D3BA 1WJQA 4J6XA 3JCMg 5FLXE 2P0QA 1UGQB 5I2SA 5IT9E 3LWIA 1M9SA 4HCBA 3OYFA 1VIFA 2QQRA 4OMFB 2JTMA 3M55A 3CPWA 4BUGA 1N6AA 3AHUA 1YI2A 3CD6T 4M75C 3FDRA 4C0GA 2XD0A 1DJ7B 2YHTA 3E9GA 3G71T 3X25B 4C0DC 1KC8U 4HCZA 3OYGA 3QDRB 1VQOT 1YHQA 4XTZA 4KUDK 1FXXA 2DPPB 3OYIA 4L6V5 4JLIA 4PNOA 4QQDA 3CCUA 3QPHA 4ZN1A 2JNGA 3JCMW 4J7FA 4M78F 4WF2A 3V7SA 2BUDA 3JCMd 2RH2A 4M78D 4NL3A 2XDPA 3QJ6A 2GQVA 2ZPEB 2HNIA 2VV5A 5GANh 4IUUA 3OS1A 5CKHA 4IURA 1S72T 2BKDN 2PVGB 2VXEA 1WNLA 4QW2A 3BFMA 5AYFA 4B9XA 3QKJA 3FEOA 4M77C 4XTWA 4C0ZA 2LQKA 1TH7A 2K3YA 2O4XA 1WQ7A 2MAMA 1QVPA 1X6OA 3OYCA 1I81A 1D3BB 2GFUA 3S6WA 4C8QA 3M9QA 3NTIA 1GXIE 4JRPA 2WACA 2X35A 2E64A 2V8JA 3HPWA 3SDZA 4M78C 1QVFA 4EMKB 1Q81C 1VQPT 5GMKl 4N4HA 1I8FA 1LNXA 4R55A 4ZGJB 1K73U 4PJOD 4C92A 3MCAB 3L2QA 3LW5E 1NZ9A 2RHIA 3LWHA 1H641 4QQ6A 2LC4A 3MEWA 5D6YA 4A4EA 4F7UE 5GAN6 4XQ3A 1RL2A 1Y7XA 2RHZA 2F5TX 2E41A 2K2VA 2WSEE 1YIJA 2Y90A 4EMGA 5FU6B 3HKSA 3SB2A 4PKCC 2QDYB 4JS4A 4ZGDB 4R56A 3CCLT 3JB9D 2QXFA 2E10A 4II1A 4RKUE 1LOJA 4X34A 4XAXB 3J81E 1SSFA 3OBWA 4XU0A 3L2UA 1QVGS 3HHTB 3VYGA 3LGFA 2DXUA 4HKEA 4PJOC 2EQJA 2K5LA 5D6XA 3MP6A 1UGSB 2F5KA 2FL7A 4C8QF 4C8QD 3HRSA 1Y71A 4BE0A 2O4XB 5GAMj 3OB9A 3QYHB 1VIEA 1JRIA 2EJGA 2E6NA 2DVEA 3E1SA 2LX9A 4QVZA 3OW2S 3MP8A 5HKCA 4LD6A 4C92F 2RK1A 4XU3A 2L5QA 1I4K1 2DZ9A 2X4YA 3INZA 3SFMA 1KQSS 1VQKT 4A4GA 3FC3A 3C95A 4XTVA 3CC2A 3JCMf 1YJWT 3PIPA 4FSXA 2YLBA 1U1SA 4BI3A 4C92B 5GAN4 1YJ9T 4M7AA 3I56A 2ZGWA 2QTXA 4BY6B 1WGSA 1ZBXA 3A8HB 2OAUA 2R5MA 4BACA 1VQMT 4JUVA 1VQ4A 2E1HA 4OB1B 2G3RA 3MEAA 2L8DA 3NTHA 4E7JA 4M75A 3CMAT 5HY6A 3VUZA 3CCST 2QI2A 2JTFA 3A5ZB 1Q7YC 2QQAA 1VQ5A 1BYMA 5LJ3g 4BD3A 3Q1JA 2DTIA 1VQLT 5LL6S 1BI0A 4XTXA 4QQGA 2XI9A 3GNFB 3CC7T 2MWPA 3OYKA 3H8ZA 3CPWS 3CD6A 2K5IA 2IVWA 4J6WA 3JAME 3G71A 3FB9A 2DAQA 2RD1A 4HT8A 2RI3A 1VQOA 4M7DF 4YTLA 4M7DD 1G3YA 5GMKh 1YITT 4M7AF 4KT0E 3L2WA 4JJNK 4LDYA 3LX7A 3OS5A 2LCCA 3HP9A 1WJSA 4C92G 3FIFA 3OYHA 1VQ6T 4LDUA 3X28B 4M7AB 3VYHB 5LJ5e 5IN1A 4L5GA 3VUBA 1LJOA 3G6ET 1S72A 1MGQA 2LVMA 5LJ3h 3GNGA 4M78A 4IUVA 4ELZC 2M16A 3UT1A 4VUBA 3QZ9B 2I2LA 4Y91A 1KHIA 2FB7A 2CGHA 3LYIA 3QIIA 4O6JA 4M75B 2LT1A 4MZPA 4OGEA 3SWNB 3TCJA 1N8RU 1M8VA 1IZ6A 1K9MU 3CC4T 2EQUA 5HK3A 4C0DB 5DLOA 2DXBA 3C4SA 2BIVA 3CBPA 5CVIA 1VQPA 3WXMB 3RESA 1QVFS 5A0DA 4JDSA 4IKFA 2PUOB 3M4YA 2M9UA 4C5IA 1NJIU 4OF1A 2GF7A 4QVCA 3DKMA 1QW1A 1VUBA 1QP2A 3V8JA 2C06A 4XTUA 4M77F 3CCJT 2K5FA 4JRIA 4IUQA 4M77D 1M90C 1BI3A 5CO7A 4DOVA 4ZN3A 1VQ9T 2D6FA 3PFSA 4HT9A 2LCLA 1BKBA 4PJOA 3CBOA 5I2MA 3RKXA 1M5Q1 5GANe 4M7AG 3M5AA 1VQ8T 2AHJB 4LDVA 3URGA 4BI4A 4EDUA 4IUPA 4HCCA 2LTOA 2ZPFB 1O75A 2KY9A 5D6WA 4BI8B 5J3BA 3CXCS 4FT2A 3F70A 3JCMh 3CMEA 3GP8A 4X9DA 4CRIA 4M78B 3RUXA 1K8AC 1XNIA 3R6OA 3QYGB 4M75G 3JCMJ 3QJYA 3RIRA 2RB6A 3E9FA 1W4SA 2KDSA 2PU9B 3JCMX 1N27A 2CZ7B 3L2RA 4GY5A 2QEXT 1Q82C 3KXTA 1KQ1A 3JB9I 1JJ2A 1YCYA 2MMPA 2X4JA 2ZCFB 3GLXA 3BW1A 3MEUA 3RMSA 4B9WA 1YJWA 4OP0A 1HK9A 4PJOF 3ASKA 2DKGA 3N5BB 4MZMA 4OGCA 5LJ3f 4EMHA 4C92E 4CI0C 4A54A 4N4IA 3CBMA 2RI5A 3M53A 4N0AC 5GAMg 3EFSA 2XIDA 4A4FA 1VQMA 4A4HA 2OTJA 4E47A 3M57A 4RG2A 2PQWA 4PJOB 4ELYC 1JB0E 1PSFA 2MI6A 3BDLA 4MMLA 5KE2A 3OS2A 1PSEA 3CMAA 3CCSA 3P8DA 4C5GA 2Y4XA 4E7KA 1ZHIA 3JB9F 3EAEA 3M4GA 3RMQA 2ZPGB 1VQLA 2ZPHB 2KK4A 3M59A 3GPLA 3OYJA 5DLQE 4M78G 2DXCA 1MHNA 3UDCA 3CC7A 2XG8D 5GAOp 2PVDB 1M1KC 2XK0A 2DTOA 1XTDA 2DIQA 2E5QA 5CIUA 1Q86C 1NPRA 3V8LA 4FM4B 2A7YA 1UGPB 1KD1C 2DJZA 3S3OA 3P8BB 5GAMd 1U8RA 2LDMA 3CCRT 3A8GB 3PGGA 1VQNT 3JCMQ 4C8QB 1U1TA 4Q5WA 2CYZB 4EMKC 5HK0A 4ZTJA 3E19A 3G4ST 4GLKA 4C5HA 1H3ZA 1VQ6A 4M7DA 3DB4A 4C5EA 3C94A 3CCUT 4A53A 2K4YA 4OB0B 4OB2B 1KG1A 3G6EA 4M7AE 4DA4A 2XKOC 1P92A 4EPCA 2A3LA 2X4WA 2QQBA 5IAYA 4PJOG 2ZPBB 4J8OA 3OYMA 5GAOr 1YJNT 2HQEA 1VQ7A 5GAN7 2EWNA 3OS0A 4MZTA 3X20B 3LH0A 2RJDA 3WVEB 4ZTFA 3A8OB 3JRZA 4NOYA 1Q81U 3C12A 3H6ZA 3OYNA 2YRVA 3CC4A 2D9TA 4M75E 4BDYA 5GAN3 4J5YA 3M56A 1UEBA 2HD0A 4O5VA 5KE3A 5L8RE 5GAOn 3JB9G 3PMTA 5FU7C 2DIGA 4F7UF 5GMKi 4ATOA 2KVQG 1WQWA 3OYBA 5GMKe 1W2BA 3JB9H 3PTAA 3OBYA 2P4TA 2K57A 1BIBA 3FRNA 1VQ9A 4C8QG 3WVDB 4XU2A 5CK9A 2E12A 1UGRB 3CCVT 2EIFA 4BE2A 4JRQA 3P8HA 3MEVA 4PLLA 5GAOq 2JUFA 4KULA 3DLMA 2VC8A 1X75C 4DQ2A 4M7DB 4ME7A 4M77A 5J39A 3CCET 5LJ3e 4PL6A 3TREA 1KC8C 3QG1A 3M54A 3SD4A 3CCQT 2XDBA 4BY6C 3QSUA 5KCOA 1XQHA 2R58A 2EYQA 2V8IA 3ZFJA 1QP3A 2XU8A 5LJ5g 5GAOl 3JCMc 4M78E 2P0PA 1FX7A 5A0GA 3OYEA 4ZGEB 3GF5A 3L1AA 4UC4A 3OSVA 2RJCA 5GAMf 2QEXA 3MHXA 2LQ8A 2VGNA 3QBYA 4N0AA 4MDXA 2E70A 2OTLT 2M0OA 3EFRA 3RKWA 4C0FA 1JJ2S 3FLGA 5DM7R 2H3JA 3FJPA 4RCCA 4TVRA 5C0MA 3VJPA 2DO3A 5LJ5j 5LJ5d 3HRUA 3I56T 1Q7YU 3L42A 3JSCA 2RM4A 5KCHA 1OZ3A 3V7RA 3JCMP 4M7DG 3LGLA 1I5LA 2LRQA 4PJOE 1HXDA 1K73C 3RKYA 3JCMe 3CCLA 4M77B 3GIBA 2E6ZA 1UB4A 2EJ9A 5GANg 3DB3A 3HFNA 4MDWA 5J26A 4QVDA 3CCMT 4XTYA 2F69A 1KQ2A 1VQ5T 2WSCE 4MMKA 3QUIA 5DY9A 5A2QE 4EMKA 2EKOA 2KSSA 3OA6A 4NL2A 2RHUA 2RHXA 3X26B 4FIBA 2O01E 5GAN8 3SWNC 3I55T 1OI1A 1RI0A 3GOXA 4OB3B 3DLLA 3CCRA 4BE1A 1VQNA 3MO8A 4P5NA 1FWZA 4LDWA 4KBMB 4Z02A 3A8LB 3KUFA 2DZCA 5GAN2 3G4SA 4PLIA 1OZ2A 4C8QE 5CQXA 1VQKA 2JN0A 4A4KA 5FRMA 5CCAA 5GANj 1WJRA 5GANd 4D6WA 3M58A 2CZ6B 1YJ9A 1BIAA 1G3TA 2FHDA 1B34A 1YJNA 2HAXA 3J7AF 3QZ5B 4J83A 2RI2A 3QXEB 3RERA 3PNWC 2RHYA 1R8OB 4BDZA 3O8VA 2QA4T 1NPPA 4M77G 1ZQ1A 3KBGA 4LDXA 3QHSA 5CKDA 5A0LA 2V8KA 3UWNA 3G7ZA 5CKEA 1JBMA 2VGMA 3CPFA 4JLGA 1M4ZA 4FU6A 4XU1A 2EQMA 3UPUA 2RJFA 1M90U 2PVOB 1OYXA 1N9SA 2IG0A 2JZ2A 2QQSA 1G5VA 2XICA 2D0QB 5GMKm 1W2BS 5GAMe 3NTKA 1YI2T 1BI2A 2EAYA 3CCVA 5LJ5f 2WSFE 4F7UA 1O9SA 1YITA 1Y96A 4E7LA 3QO3A 4V2SA 1KHCA 3JB9J 4FL6A 3LLRA 3VU3C 5GAMh 3CCEA 1YHQT 1V29B 4M7DE 1K8AU 2DK3A 3HL8A 3CCQA 2LNVA 3HRTA 1B34B 4XK8E 3CXCA 2YLCA 2ZZDA 3V8KA 2CKKA 5FRNA 2HQXA 2VXFA 4JRKA 4L59A 3ZEHA 3CMET 2EJFA 1Q82U 4KUIA 5FU7B 2XHCA 5FU6C 5C6SA 3PIOA 2MF2A 3OSSC 2MWOA 2M1HA 3JCMV 3TU4K 3OY9A 2FVUA 4J6YA 3CEYA 2R57A 1G3SA 2OTLA 2DTHA 2LT4A 3HFOA 3L2VA 4C92D 2CS7A 5CKBA 5CR2A 1AHJB 4FT4A 3A8MB 3T9NA 4N4GA 5GANf 5CQYA 1N8RC 1K9MC 3CCJA 4JS5A 5M9OA 4NS5A 3NFCA 2DEQA 3MP1A 2QQ9A 4Y28E 4C8QC 4F7UB 2RA2A 3L2ZA 1Y96B 2R5AA 1YBYA 2GCXA 2PUKB 3OYLA 2OTJT 2RJEA 3VV0A 1NJIC 1M1KU 1EIFA 1VQ8A 1YIJT 3PMIA 3SWNA 1Q86U 2VUBA 4IUTA 4M77E 2E65A 4X9CA 5EG2A 4C92C 3JCMb 5KH6A 3CCMA 1KD1U 3HSBA 4RCBA 3V7CA 1X01A 1N9RA 2CZ1B 3PT9A 3OYAA 1QVGA 2HBPA 3OYDA 3TEEA 5CKFA 5FROA 2JOYA 4RG8A 2DD4A 3BY7A 3I55A 1WPYA 4HA8A 5GMKj 4RMOA 1M1GA 2ZPIB 4OVAA 4BB7A 2B8AA 2K3XA 1Y07A 3ME9A 3S3MA 2RK2A 1NE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMK A;  3JCM f;  3QUI A;  4MML A;  5DY9 A;  4EMK A;  4M7A A;  4C92 B;  2YLB A;  1U1S A;  4NL2 A;  5GAN 4;  2ZGW A;  4M7A D;  2QTX A;  3JB9 F;  3M4G A;  5GAN 8;  3SWN C;  3BDU A;  4JUV A;  4M78 G;  5LJ3 j;  2E1H A;  5LJ3 d;  5GAO p;  4F7U G;  2DTO A;  5GAN 2;  2DZC A;  4M75 A;  4C8Q E;  3V8L A;  4M75 F;  2JN0 A;  4M75 D;  2DJZ A;  2FYK A;  5GAO m;  5GAN j;  5LJ3 g;  5GAN d;  2DTI A;  5GAM d;  5GAN 5;  2DXT A;  5LJ5 h;  4M7D C;  4XTX A;  1BIA A;  3PGG A;  5I21 A;  1B34 A;  3JCM Q;  4C8Q B;  1U1T A;  5CAI A;  4EMK C;  4M7A C;  1D3B A;  4J6X A;  4J6W A;  3JCM g;  3RER A;  3FB9 A;  4M7D A;  2RD1 A;  4HT8 A;  4M7D F;  4M77 G;  4M7D D;  4A53 A;  3QHS A;  5GMK h;  4M7A E;  4M7A F;  3AHU A;  1JBM A;  4PJO G;  5GAO r;  4M75 C;  4XU1 A;  4C92 G;  3FIF A;  2YHT A;  2EWN A;  5GAN 7;  4M7A B;  4NOY A;  5LJ5 e;  1N9S A;  4XTZ A;  1LJO A;  4M75 E;  5GMK m;  1MGQ A;  5GAN g;  4JLI A;  4PNO A;  4J5Y A;  5LJ3 h;  4M78 A;  5GAM e;  5GAN 3;  5GAO n;  2EAY A;  3JCM W;  4M78 F;  4WF2 A;  2I2L A;  3V7S A;  5LJ5 f;  4M78 D;  4F7U A;  3JCM d;  4Y91 A;  4NL3 A;  3JB9 G;  1Y96 A;  4F7U F;  5GMK i;  2FB7 A;  2CGH A;  3SWN B;  3QO3 A;  4V2S A;  1WQW A;  4M75 B;  3JB9 J;  2HNI A;  5GMK e;  3VU3 C;  5GAM h;  5GAN h;  3JB9 H;  1M8V A;  2K57 A;  4M7D E;  1BIB A;  2VXE A;  1WNL A;  4C8Q G;  3BFM A;  4XU2 A;  4M77 C;  4XTW A;  3RES A;  1B34 B;  1TH7 A;  1WQ7 A;  1I81 A;  2YLC A;  3V8K A;  5GAO q;  1D3B B;  4QVC A;  2VC8 A;  4DQ2 A;  2VXF A;  4JRK A;  4M7D B;  4C8Q A;  2EJF A;  4M77 A;  3V8J A;  5LJ3 e;  4XTU A;  4M77 F;  2E64 A;  4JRI A;  4M77 D;  4M78 C;  4EMK B;  3JCM V;  3QSU A;  4HT9 A;  5GMK l;  4PJO A;  1I8F A;  1LNX A;  4J6Y A;  3RKX A;  1M5Q 1;  5LJ5 g;  5GAN e;  4C92 A;  5GAO l;  4PJO D;  2DTH A;  3JCM c;  3HFO A;  4M78 E;  4M7A G;  4C92 D;  1H64 1;  5GAN 6;  4F7U E;  4XQ3 A;  2E41 A;  5GAN f;  5GAM f;  3L1A A;  2Y90 A;  3JCM h;  4EMG A;  4X9D A;  4N0A A;  4M78 B;  3SB2 A;  3RUX A;  2DEQ A;  4M75 G;  4C8Q C;  4F7U B;  3JB9 D;  3EFR A;  2RA2 A;  3L2Z A;  1Y96 B;  3RKW A;  3RIR A;  3JCM J;  2E10 A;  2RB6 A;  1LOJ A;  3FJP A;  4XU0 A;  4RCC A;  1KQ2 A;  3JCM X;  2DXU A;  4PJO C;  3SWN A;  5LJ5 j;  4M77 E;  4X9C A;  2E65 A;  4C8Q F;  5LJ5 d;  1KQ1 A;  4C92 C;  4C8Q D;  3JCM b;  3JB9 I;  3HSB A;  4RCB A;  3V7C A;  1YCY A;  5GAM j;  1X01 A;  2RM4 A;  3BW1 A;  3JCM P;  1N9R A;  3V7R A;  4M7D G;  1JRI A;  2EJG A;  4OP0 A;  2DVE A;  1HXD A;  1HK9 A;  4PJO F;  1I5L A;  4PJO E;  2DKG A;  5LJ3 f;  3RKY A;  4EMH A;  4M77 B;  4C92 E;  4A54 A;  3JCM e;  4C92 F;  4XU3 A;  3BY7 A;  3GIB A;  1WPY A;  1I4K 1;  2DZ9 A;  2EJ9 A;  3HFN A;  3EFS A;  3INZ A;  4HA8 A;  4N0A C;  5GMK j;  4QVD A;  5GAM g;  4XTY A;  4PJO B;  4XTV A; 
#chains in the Genus database with same CATH topology
 1I5O B;  2W0Z A;  1IRE B;  3ER0 A;  2F2W A;  2JVV A;  3OQ5 A;  4AFU C;  1UFF A;  2KMT A;  1RAA B;  2GFA A;  2JS0 A;  2NLU A;  4M75 F;  1KSW A;  5KYU A;  1ZUY A;  3VKI A;  5GAN 5;  3CC7 Q;  1UTI A;  3QDF A;  2KQW A;  1WXB A;  1PC0 A;  3LWI A;  4OMF B;  3PVQ A;  1N6A A;  3AHU A;  1GBQ A;  4M75 C;  4C0G A;  1KC8 U;  1VQO T;  2DPP B;  1FMV A;  1U3O A;  4JLI A;  4PNO A;  4PJM A;  2COW A;  4M78 F;  2BUD A;  3H0H A;  2CH4 A;  2H8H A;  5IXB A;  2HSE B;  2DBK A;  2GQV A;  2HNI A;  2MOX A;  4IUU A;  4ANJ A;  1LCK A;  3CC4 Q;  5CKH A;  1S72 T;  4QW2 A;  4B9X A;  2FPD A;  3BFM A;  4DBQ A;  3QKJ A;  4J9C A;  2VB6 A;  4M77 C;  1WHH A;  1BB9 A;  1TH7 A;  2K3Y A;  2MAM A;  3OYC A;  2W10 A;  1D3B B;  3M9Q A;  2WAC A;  2E64 A;  2V8J A;  4M78 C;  3I35 A;  1VQP T;  1I8F A;  1K73 U;  1IHV A;  5GJW B;  3L2Q A;  1NZ9 A;  3LWH A;  3MEW A;  5IHK A;  4F7U E;  2RHZ A;  3EGX B;  2K2V A;  2WSE E;  4EMG A;  1VYV A;  1S72 Q;  1RAF B;  4F17 A;  4JS4 A;  4R56 A;  3CCL T;  1WHM A;  3H9N A;  1GXI E;  3J81 E;  1SSF A;  1QVG S;  4HKE A;  4PJO C;  2EQJ A;  5D6X A;  3VS1 A;  4IIM A;  1Y71 A;  4BE0 A;  1M1K R;  1VIE A;  2DVE A;  3E1S A;  2B86 A;  5HKC A;  3U23 A;  2O9V A;  1ACM B;  2X4Y A;  3INZ A;  3SFM A;  1KQS S;  4CC4 B;  1VA7 A;  2DL8 A;  4BI3 A;  2YLB A;  5I22 A;  1YJ9 T;  1KIK A;  3CCL Q;  1MV3 A;  1WGS A;  1ZBX A;  2OAU A;  2R5M A;  4BAC A;  1VQM T;  1HD3 A;  1QLY A;  1TUG B;  1GRI A;  2DET A;  3NTH A;  3CMA T;  1GFD A;  3A5Z B;  5LJ3 g;  1PKT A;  2RQT A;  4QQG A;  2XI9 A;  3CPW S;  1PM3 A;  4J6W A;  4DEY A;  2RD1 A;  4M7D F;  1VQO A;  4F16 A;  2L0A A;  1YJ9 Q;  1W2B P;  2KGT A;  4M7A F;  1AZE A;  1OX8 A;  3L2W A;  4LDY A;  3HP9 A;  4C92 G;  1PKS A;  3X28 B;  4M7A B;  5LJ5 e;  1NJI R;  4L5G A;  3SEM A;  3G6E T;  1S72 A;  1NEB A;  3GNG A;  5KYW A;  1W1F A;  3TSZ A;  3X25 B;  3QII A;  1M8V A;  2JMA A;  2C0T A;  2AK5 A;  2V26 A;  1YWO A;  1VQP A;  2O2O A;  1X2K A;  3RES A;  1QVF S;  4JDS A;  4HVW A;  2PUO B;  1OPL A;  3RR6 A;  3CCE Q;  3V8J A;  2D8J A;  4FW2 A;  2K5F A;  3CCQ Q;  2E5K A;  1VQ9 T;  3PFS A;  2L3P A;  5GAN e;  2JXB A;  2AHJ B;  4BI4 A;  4EDU A;  4IUP A;  2LTO A;  2ZPF B;  1TS9 A;  5D6W A;  5J3B A;  3CXC S;  1G2B A;  2EYX A;  2KEA A;  3QWX X;  5FWB A;  8AT1 B;  1K8A C;  2FEI A;  3R6O A;  4LUD A;  4M75 G;  3EG9 A;  2X3X D;  2PU9 B;  3JCM X;  3L2R A;  4J9D A;  3BW1 A;  3VS7 A;  2MIO A;  1RAD B;  4OP0 A;  2SRC A;  1HSQ A;  3ASK A;  4MZM A;  4EMH A;  4A54 A;  4KH0 B;  4PJJ A;  1NEG A;  3M53 A;  4N0A C;  1VQM A;  2XID A;  2NUP B;  4A4H A;  2OTJ A;  4AFS C;  4RG2 A;  1BBZ A;  1JB0 E;  3CMA A;  3OS2 A;  1AWJ A;  2Y4X A;  6AT1 B;  2L3Q A;  3M4G A;  3I55 Q;  1RAE B;  2ZPH B;  3M59 A;  3EH2 A;  4M78 G;  3UDC A;  2PVD B;  2XK0 A;  1XTD A;  1NPR A;  2A7Y A;  2ESW A;  2DJZ A;  3S3O A;  3RDV A;  4D8D A;  1MMA A;  4E6R A;  3CCR T;  1SPK A;  3MKD A;  4C8Q B;  1LPL A;  2CYZ B;  4ZTJ A;  5AT1 B;  3DB4 A;  1YN8 A;  1MND A;  2CRE A;  3UF4 A;  3CCU T;  2K4Y A;  1TWB A;  3G6E A;  1AD5 A;  1D1A A;  2X4W A;  4PJO G;  2ZPB B;  2YUN A;  1H3H A;  5GAN 7;  2EWN A;  2RQW A;  2NWM A;  2RJD A;  1Q81 U;  3OYN A;  2KRM A;  3NPF A;  5GAN 3;  2HD0 A;  3JB9 G;  3A1P A;  3PMT A;  2FZK B;  1B3Q A;  1WQW A;  3EFO A;  1YHQ Q;  3UA7 A;  4AMC A;  3FRN A;  3CCU Q;  1VQ9 A;  2E12 A;  3CCV T;  1U5S A;  1K9M R;  1K0S A;  5GAO q;  2JUF A;  3DLM A;  2HDA A;  4ME7 A;  4M77 A;  5J39 A;  2CP0 A;  1JXM A;  4CC7 A;  2FRY A;  5LJ5 g;  1QP3 A;  5GAO l;  1T0J A;  1Q7Y R;  2AIR B;  1ZSZ B;  4E2F B;  4ZGE B;  5GAM f;  9ATC B;  2V1Q A;  2RJC A;  3OSV A;  1QCF A;  3QBY A;  3KFV A;  3RNJ A;  2M0O A;  3EFR A;  3RKW A;  2M0Y A;  1E6H A;  2DO3 A;  5LJ5 d;  3HRU A;  3VS4 A;  3JCM P;  4M7D G;  3VS0 A;  2KRS A;  1HXD A;  3I9Q A;  2E4H A;  1KFZ A;  5GAN g;  3DB3 A;  3HFN A;  1UJ0 A;  4XTY A;  4KGX B;  1VQ5 T;  5KYY A;  3OA6 A;  2RHU A;  1AT1 B;  2ROL A;  3CCR A;  1RI0 A;  1C1A A;  3GOX A;  1FWZ A;  4KBM B;  3KUF A;  5GAN 2;  2DZC A;  3EGX A;  3VS2 A;  1OZ2 A;  5CQX A;  3REB B;  2JN0 A;  1EFN A;  5IHN A;  5GAN d;  5I11 A;  3M58 A;  2FHD A;  3M0T A;  3J7A F;  2JTE A;  1QKW A;  4RTV A;  2QK0 A;  2RI2 A;  1M27 C;  2QG9 B;  1CKA A;  3PNW C;  2RHY A;  1R8O B;  1OV3 A;  2DRM A;  3O8V A;  2QA4 T;  1VQ5 Q;  2IPO B;  4PJL A;  4LN2 A;  2GTO A;  3G7Z A;  2ROT A;  3CD6 Q;  2EGA A;  3CPF A;  1VYT A;  3EGD B;  2RJF A;  1WI7 A;  2DBM A;  1M90 U;  1ZBJ A;  2BZY A;  2IIM A;  2KXD A;  5GMK m;  2EGC A;  3NTK A;  2EAY A;  3CCV A;  1Y0M A;  4F7U A;  1O9S A;  1YIT A;  2CT3 A;  1Z9Z A;  3JB9 J;  1CSK A;  1WXT A;  1TUC A;  2DK3 A;  3HRT A;  1B34 B;  3CXC A;  1UUE A;  5FRN A;  4KGV B;  2XHC A;  4FYY B;  3PIO A;  4J6Y A;  5GJV B;  1C0M A;  1G3S A;  1GFC A;  3RBB B;  3L2V A;  2CS7 A;  3A98 A;  1N8R C;  4EIK A;  2RMO A;  2DEQ A;  3MP1 A;  2QQ9 A;  1OX9 A;  1Y96 B;  2LJ1 A;  3L2Z A;  2PUK B;  2AZV A;  1NJI C;  1OQK A;  4E7S A;  1M1K U;  3PMI A;  2JJ9 A;  1Q86 U;  4J9F A;  3VS6 A;  1WLP B;  2E65 A;  1KD1 U;  1YNZ A;  1N9R A;  3PT9 A;  2DYB A;  4RG8 A;  3BY7 A;  5GMK j;  4OVA A;  2AZS A;  1Y07 A;  3ME9 A;  3D7S B;  1NE8 A;  3OYJ A;  1YJW Q;  1GL5 A;  2RPN A;  4M7A D;  4E7I A;  1LVK A;  2KNB B;  1G3W A;  2A0F B;  2P84 A;  5LJ3 j;  2RO0 A;  3OMC A;  4E7H A;  3CC2 T;  2QA4 A;  1RI9 A;  2FYK A;  3OYY A;  3OMG A;  1VQL Q;  1VQ7 T;  1WFW A;  4DOW A;  2L89 A;  2VYT A;  5CAI A;  4HCB A;  2P0Q A;  5I2S A;  3EG0 A;  2BE9 B;  2QQR A;  2QAS A;  2JTM A;  1YP5 A;  4BUG A;  1M3C A;  2DIL A;  1DJ7 B;  3E9G A;  2I0N A;  4HCZ A;  3CC2 Q;  4QQD A;  4FYW B;  4ZN1 A;  3JCM W;  4Z8A A;  1VQ7 Q;  4WF2 A;  2CP6 A;  2ZPE B;  3OS1 A;  2VV5 A;  1G8X A;  1VYU A;  2PVG B;  2VXE A;  1QVP A;  5ECA A;  3THK A;  1K8A R;  3UAT A;  4C8Q A;  3NTI A;  4FSS A;  2HEQ A;  2PNI A;  3SDZ A;  4JRP A;  3HPW A;  5IHI A;  4EMK B;  2LJ0 A;  1LNX A;  2CDT A;  4ZGJ B;  4CC3 A;  4PFO A;  3LW5 E;  1WHJ A;  1H64 1;  4QQ6 A;  2X9H A;  4XQ3 A;  1RL2 A;  5L23 A;  1PD0 A;  5FU6 B;  4RTZ A;  2CH4 W;  4PKC C;  3SB2 A;  4ZGD B;  4XAX B;  2E10 A;  4II1 A;  4X34 A;  3OBW A;  4XU0 A;  3HHT B;  1NLP C;  2VVK A;  3MP6 A;  1UGS B;  2FL7 A;  4C8Q D;  5FW9 A;  2O4X B;  2FG0 A;  1MMD A;  3QYH B;  2EJG A;  1VOM A;  2CT4 A;  3OW2 S;  4C92 F;  4KGZ B;  1Z9Q A;  1I1J A;  3FC3 A;  3C95 A;  4XTV A;  3CC2 A;  1ZUU A;  4C92 B;  2J06 A;  2A36 A;  3I56 A;  2ZGW A;  1V76 A;  2KXC A;  5IH2 A;  3A8H B;  2A08 A;  4JUV A;  3IQL A;  1A0N B;  2GBQ A;  4OB1 B;  3VUZ A;  2JTF A;  1Q7Y C;  4BD3 A;  1K1Z A;  3CC7 T;  2SEM A;  4HT8 A;  4YTL A;  3SHW A;  5GMK h;  4KT0 E;  4JJN K;  2DF6 A;  2LCC A;  4LDU A;  4QKU A;  3VYH B;  2C0O A;  1ZUK A;  4JJD A;  2HL5 C;  4B6M A;  4CC2 A;  2LVM A;  5LJ3 h;  4ELZ C;  4IUV A;  2M16 A;  3QZ9 B;  2FB7 A;  3LYI A;  4M75 B;  3TCJ A;  4OGE A;  2RK2 A;  1K9M U;  3CC4 T;  2EQU A;  5DLO A;  2BIV A;  5CVI A;  1B7T A;  1H92 A;  4C5I A;  4LUE A;  2GF7 A;  3LH5 A;  1QW1 A;  2CSQ A;  4M77 F;  1WX6 A;  3CCJ T;  4JRI A;  1N5Z A;  1BI3 A;  1R77 A;  2J6F A;  2LCL A;  1BKB A;  3CBO A;  1C6V X;  1M5Q 1;  1SF9 A;  1F1B B;  1ABO A;  1QCO A;  3PE0 A;  1GBR A;  1O75 A;  2KY9 A;  1M3B A;  4BI8 B;  1SG5 A;  3JCM h;  4X9D A;  4CRI A;  4M78 B;  3RUX A;  2OTL Q;  4RTU A;  3QYG B;  3JCM J;  2RB6 A;  3E9F A;  4RTW A;  1W4S A;  1OOT A;  2CZ7 B;  4GY5 A;  3CCJ Q;  3KXT A;  3PVL A;  2CUB A;  1JJ2 A;  2HBW A;  2MMP A;  2X4J A;  2ZCF B;  4B9W A;  1EX4 A;  1K4U S;  4PJO F;  1PRL C;  4F14 A;  2LZ6 B;  5GAM g;  3EFS A;  3CCM Q;  4E47 A;  3I5R A;  2PQW A;  4PJO B;  1PSF A;  3BDL A;  1PSE A;  4DEX A;  4E7K A;  1ZHI A;  3JB9 F;  3EAE A;  3RMQ A;  1S1N A;  4J9G A;  3GPL A;  4FYV B;  4X1V A;  3CC7 A;  2E5Q A;  5CIU A;  3V8L A;  8ATC B;  1PHT A;  2L3S A;  5GAM d;  4RTY A;  2LDM A;  4Q5W A;  2DL4 A;  5HK0 A;  2ENM A;  4HVU A;  4GLK A;  4C5H A;  1H3Z A;  3C94 A;  1IGU A;  4FYX B;  1KG1 A;  1WHK A;  3EG1 A;  4M7A E;  4DA4 A;  2XKO C;  5IAY A;  2A3L A;  2QQB A;  4J8O A;  2HQE A;  3OS0 A;  3JRZ A;  1TSF A;  2DL5 A;  3CC4 A;  4BDY A;  2JT4 A;  4O5V A;  3M56 A;  5KE3 A;  2YT6 A;  5FU7 C;  4F7U F;  3PTA A;  1NLO C;  2K57 A;  1BIB A;  4XU2 A;  1M2V A;  4LE9 A;  2HCK A;  5CK9 A;  2EIF A;  1N8R R;  3P8H A;  3MEV A;  4KUL A;  4DQ2 A;  4M7D B;  3CCE T;  4PL6 A;  3SD4 A;  3CCQ T;  3QSU A;  2DL3 A;  2EYQ A;  1NM7 A;  3JCM c;  1UEC A;  1FX7 A;  2LQN A;  4IIO A;  4DBR A;  1I07 A;  3GBQ A;  3GF5 A;  1HYO A;  2LQ8 A;  2VGN A;  5DM7 R;  1YIJ Q;  2AT1 B;  1AZG B;  3H0I A;  2KI7 A;  5KCH A;  3LGL A;  1I5L A;  1WHG A;  2ED1 A;  3CCL A;  1J3T A;  1UB4 A;  2EYZ A;  4MDW A;  2O9S A;  2QYZ A;  4QVD A;  2DER A;  2WSC E;  4MMK A;  5A2Q E;  4EMK A;  2EKO A;  2HMA A;  4NL2 A;  4FIB A;  2O01 E;  5GAN 8;  2VKN A;  3I55 T;  2RQR A;  1T3S A;  3DLL A;  5EC7 A;  3TQ7 P;  4C8Q E;  4Z89 A;  4A4K A;  5CCA A;  2DVJ A;  4D6W A;  2CZ6 B;  1YJ9 A;  1BIA A;  1VQ4 Q;  3G1J A;  1MUZ A;  3RER A;  2M51 A;  2X51 A;  2ECZ A;  1WA7 A;  4K11 A;  4M77 G;  1ZQ1 A;  3QHS A;  5CKD A;  2V8K A;  5CKE A;  1QQJ A;  4JLG A;  3G71 Q;  4PK4 A;  2JW4 A;  2PVO B;  1G5V A;  2XIC A;  1W2B S;  4WCI A;  1YI2 T;  2WSF E;  2OX7 A;  4V2S A;  3CCE A;  1YHQ T;  1WIE A;  1K8A U;  3CCQ A;  4RUG A;  1UHC A;  2NUT B;  3V8K A;  2CP2 A;  2KRN A;  2HQX A;  2VXF A;  3CME T;  1T0H A;  2ATC B;  2RNA A;  2M1H A;  3JCM V;  2DL7 A;  1YI2 Q;  2MK5 A;  4C92 D;  2YDL A;  1AHJ B;  1GCP A;  3A8M B;  3EHQ A;  4FCY A;  4Z88 A;  3R6N A;  5M9O A;  4NS5 A;  4Y28 E;  4C8Q C;  2HSP A;  2R5A A;  1YBY A;  2HKQ B;  2K79 A;  1G83 A;  3VV0 A;  2K6D A;  3CME Q;  4AG2 C;  3HSB A;  2KT8 A;  1FMW A;  3OYA A;  1QVG A;  2DRK A;  2HBP A;  1SHG A;  1D0Z A;  3I55 A;  2ZPI B;  2K3X A;  3S3M A;  3MET A;  2XDD A;  4Y92 A;  1AEY A;  1M1F A;  2JS2 A;  3X24 B;  1KQS A;  3BDU A;  1PWT A;  1SEM A;  2KAF A;  4F7U G;  2YUO A;  1RAB B;  3CCS Q;  4M75 D;  1U06 A;  5GAO m;  2X4X A;  1KC8 R;  2EFI A;  4LD9 K;  4RTT A;  1XJW B;  5I21 A;  3J80 E;  3S3N A;  1D3B A;  5KYN A;  2P4R A;  2CP3 A;  4J6X A;  3OYF A;  3M55 A;  3CPW A;  1YI2 A;  1MNE A;  4M4Z A;  3CD6 T;  1CKB A;  3FDR A;  1VQ6 Q;  2EGE A;  2YHT A;  4C0D C;  1M2O A;  1YHQ A;  3OYI A;  4JPB W;  4L6V 5;  1D1C A;  3CCU A;  4D8K A;  3V7S A;  4M78 D;  3QJ6 A;  2BZX A;  1K73 R;  4IUR A;  2BKD N;  3E2U A;  2M02 A;  2LQK A;  1WQ7 A;  1X6O A;  3MPU B;  1I81 A;  3S6W A;  2GFU A;  1QVF A;  2LMJ A;  2JMC A;  5GMK l;  4N4H A;  4R55 A;  4PJO D;  3MCA B;  1AWO A;  2RHI A;  1JJ2 P;  2PZ1 A;  2LC4 A;  4A4E A;  1Y7X A;  2A28 A;  2F5T X;  2E41 A;  1IXD A;  2E3H A;  3JB9 D;  2QXF A;  2COY A;  4RKU E;  1LOJ A;  2DMO A;  3L2U A;  3LGF A;  2QEX Q;  4DBF A;  2K5L A;  2F5K A;  5GAM j;  1KJW A;  2E6N A;  1NBE B;  1D0Y A;  4XU3 A;  3EGU A;  1I4K 1;  1VQK T;  2J6O A;  1JXO A;  4A4G A;  3JCM f;  1YJW T;  3PIP A;  3REA B;  4M7A A;  5GAN 4;  2QTX A;  4BY6 B;  2EW3 A;  4FW1 A;  4JZ3 A;  2L8D A;  1UHF A;  2QI2 A;  2QQA A;  1VQ5 A;  1BYM A;  1VQL T;  1AVZ C;  1BI0 A;  4XTX A;  1VQN Q;  3GNF B;  3OYK A;  3CD6 A;  2QDL A;  3G4S Q;  2K5I A;  2IVW A;  1VQK Q;  3ZL7 C;  3FB9 A;  2LX7 A;  4M7D D;  1G3Y A;  3NHN A;  1IB8 A;  1YJN Q;  2C0I A;  2J05 A;  3LX7 A;  1WJS A;  3FIF A;  3OYH A;  4F04 B;  2F1L A;  2VAS A;  5IN1 A;  3VUB A;  2D1X A;  2E3I A;  4VUB A;  2I2L A;  1RLP C;  3SWN B;  1PRM C;  1N8R U;  3C0C A;  5HK3 A;  3CBP A;  3C4S A;  3EG3 A;  1M3A A;  3M4Y A;  2M9U A;  1NJI U;  1VUB A;  1UG1 A;  2C06 A;  1YCS B;  5CO7 A;  2NUP A;  4ZN3 A;  2D6F A;  4HT9 A;  1VQ8 T;  4LDV A;  3URG A;  1TOV A;  4HCC A;  3GP8 A;  5KYW B;  1XNI A;  4OML A;  2KDS A;  1ARK A;  4JZ4 A;  1Q82 C;  3JB9 I;  1YCY A;  3RMS A;  3GLX A;  1YJW A;  1SSH A;  4C92 E;  4CI0 C;  1VQ8 Q;  3CBM A;  2RI5 A;  1W6X A;  4A4F A;  2K3B A;  4MML A;  5KE2 A;  4C5G A;  1EZZ B;  2KYM A;  2ZPG B;  1VQL A;  1X2Q A;  2KK4 A;  1X27 A;  2XG8 D;  5GAO p;  2DTO A;  2DIQ A;  4FM4 B;  1UGP B;  3EG9 B;  5D7U A;  1Q81 R;  2YUQ A;  3A8G B;  3PGG A;  3JCM Q;  1U1T A;  2NYS A;  4EMK C;  3E19 A;  3JV3 A;  4C5E A;  2RN8 A;  1NYF A;  4A53 A;  4OB2 B;  3OYM A;  3VRY A;  1VQ7 A;  2CP7 A;  1ZSZ A;  3WVE B;  4ZTF A;  3A8O B;  4NOY A;  2K2M A;  3C12 A;  2YRV A;  2FPE A;  4M75 E;  1QWE A;  5L8R E;  3HTR A;  3EG2 A;  2KVQ G;  2Z0W A;  5GMK e;  3H41 A;  3FJ5 A;  3OBY A;  2K9G A;  3WVD B;  1M30 A;  4PLL A;  2G6F X;  1X75 C;  5LJ3 e;  3MJX A;  1KC8 C;  3M54 A;  1D1B A;  5KCO A;  2R58 A;  2V8I A;  2XU8 A;  4M78 E;  2FZG B;  1QVG P;  3OYE A;  2DLP A;  1X6G A;  2LP5 A;  2FZC B;  3MHX A;  4MDX A;  2E70 A;  2KE9 A;  2OTL T;  4C0F A;  1GCQ A;  4OMM A;  3EFO B;  3FJP A;  5C0M A;  2O31 A;  3ULR B;  3VJP A;  1KQS P;  2DJQ A;  5LJ5 j;  2CUD A;  1TU0 B;  1IRX A;  1Q7Y U;  3L42 A;  3JSC A;  1OZ3 A;  3V7R A;  4PJO E;  1AWX A;  1K73 C;  3JCM e;  4M77 B;  3GIB A;  2E6Z A;  2EJ9 A;  1RAG B;  5J26 A;  4LNP A;  1Q95 G;  3CCM T;  2NUZ A;  2F69 A;  3EGD A;  1KQ2 A;  1NYG A;  4JJC A;  3QUI A;  5DY9 A;  2KSS A;  2YXY A;  3X26 B;  5IXF A;  1WXU A;  1FMK A;  1D09 B;  1OI1 A;  3CPW P;  4Z02 A;  4LDW A;  3A8L B;  1UGV A;  1ZSG A;  4PLI A;  1X43 A;  4AFQ C;  5GAN j;  1M90 R;  1WJR A;  1B34 A;  2EYW A;  3QZ5 B;  4J83 A;  4PFP A;  3QXE B;  3VRZ A;  4LDX A;  1T3L A;  1K0X A;  5A0L A;  3M0S A;  1M4Z A;  4XU1 A;  2EQM A;  3UPU A;  1VQO Q;  5KYY B;  1N9S A;  2IG0 A;  2D0Q B;  2GGR A;  2FPF A;  1QVF P;  3QWY A;  1D0X A;  1PD1 A;  1Y96 A;  2VWF A;  3VU3 C;  1BK2 A;  1V29 B;  4M7D E;  2LNV A;  2CKK A;  3ZEH A;  2MYS A;  2EJF A;  4KUI A;  5FWC A;  5FU7 B;  2MF2 A;  3CXC P;  1WDX A;  1VQP Q;  3NGP A;  1ZA2 B;  1Q86 R;  1TTH B;  2DX1 A;  1KD1 R;  1WHL A;  2OTL A;  2LT4 A;  4FT4 A;  2FRW A;  2L2P A;  4N4G A;  2CSI A;  5CQY A;  3CCJ A;  4JS5 A;  4F7U B;  2QTV A;  2LJ3 A;  2OTJ T;  2RJE A;  1YIJ T;  3SWN A;  3TSW A;  2MPX C;  4IUT A;  4X9C A;  3JCM b;  3CCM A;  5KH6 A;  4RCB A;  4OMP A;  1X01 A;  2YSQ A;  2EPD A;  2GTJ A;  4AT1 B;  5CKF A;  2JOY A;  2DD4 A;  4ZNX A;  4J9H A;  3OW2 A;  2X3W D;  1M8M A;  1XOV A;  2L3R A;  4J7I A;  1VQM Q;  1HJD A;  2OTJ Q;  5LJ3 d;  2DE0 X;  3CMA Q;  3H0F A;  2CZ0 B;  3ZBD A;  2GNC A;  1BI1 A;  3BE3 A;  2DM1 A;  2P0K A;  2Y4Y A;  2DXT A;  5LJ5 h;  4M7D C;  1VQ4 T;  2EQK A;  2DD5 A;  1SHF A;  4M7A C;  1WJQ A;  3JCM g;  5FLX E;  1UGQ B;  5IT9 E;  1M9S A;  4HCK A;  1VIF A;  1UDL A;  4KRT A;  3M0P A;  1WYX A;  2MCN A;  2PTK A;  2XD0 A;  3G71 T;  2K7A A;  1SRL A;  4PJN A;  3OYG A;  1V1C A;  3QDR B;  4XTZ A;  3G6E Q;  4KUD K;  1FXX A;  2JM9 A;  1IGQ A;  3QPH A;  2JNG A;  4J7F A;  3JCM d;  2RH2 A;  4NL3 A;  2XDP A;  2YUP A;  5GAN h;  1SRM A;  2H3E B;  5AYF A;  3OYB A;  1WNL A;  5HCK A;  1IHW A;  3FEO A;  4XTW A;  4C0Z A;  2O4X A;  2DYI A;  2AKK A;  2X35 A;  1VQ9 Q;  1Q81 C;  2AKL A;  1Q82 R;  3AT1 B;  4C92 A;  2A37 A;  5D6Y A;  5GAN 6;  2ZAE A;  1Y57 A;  2QGG A;  1YIJ A;  2Y90 A;  1OPK A;  3HKS A;  2QDY B;  2V1R A;  2QAZ A;  3VYG A;  2DXU A;  4OMN A;  4C8Q F;  3HRS A;  3OB9 A;  1JRI A;  4QVZ A;  4DBH A;  2LX9 A;  3MP8 A;  4LD6 A;  2RK1 A;  2L5Q A;  2DZ9 A;  2OJ2 A;  2LNH B;  1TG0 A;  1ZX6 A;  1PG5 B;  4FSX A;  1U1S A;  2KR3 A;  1UJY A;  1VQ4 A;  1NG2 A;  2E1H A;  2G3R A;  3M0R A;  3MEA A;  4E7J A;  4HVV A;  4M75 A;  5HY6 A;  3CCS T;  1OU8 A;  3Q1J A;  2DTI A;  5LL6 S;  5KYX B;  1JO8 A;  3CCR Q;  2MWP A;  3H8Z A;  3JAM E;  2XMF A;  3G71 A;  2DAQ A;  2RI3 A;  1FYN A;  4RTX A;  1YIT T;  2D0N A;  3OS5 A;  1MMG A;  2KRO A;  1VQ6 T;  1I0C A;  2EQI A;  1LJO A;  1MGQ A;  2RQU A;  4M78 A;  4J9E A;  3UT1 A;  1OU9 A;  3M0U A;  4Y91 A;  1KHI A;  2CGH A;  4O6J A;  4MZP A;  2LT1 A;  4E7Z A;  1IZ6 A;  4OMQ A;  4C0D B;  1QMC A;  2DXB A;  3CCV Q;  3WXM B;  1YIT Q;  5A0D A;  1ZSZ C;  4IKF A;  1OEB A;  4OF1 A;  4QVC A;  7AT1 B;  3DKM A;  1QP2 A;  4XTU A;  4IUQ A;  4M77 D;  2DA9 A;  1M90 C;  4DOV A;  2RQV A;  4PJO A;  5I2M A;  3RKX A;  4M7A G;  3M5A A;  4ESR A;  1YWP A;  4FT2 A;  3F70 A;  3CME A;  5KYU B;  3QJY A;  3RIR A;  2DFU A;  1QKX A;  1N27 A;  2QEX T;  1KQ1 A;  4A63 B;  3MEU A;  1HK9 A;  4OGC A;  2DKG A;  3N5B B;  5LJ3 f;  4N4I A;  3M57 A;  4QT7 A;  4ELY C;  2MI6 A;  3CCS A;  1GCQ C;  3P8D A;  2ED0 A;  5DLQ E;  2DXC A;  1MHN A;  1ABQ A;  1M1K C;  1Q86 C;  2RF0 A;  2BTT A;  1X6B A;  2LQW A;  1KD1 C;  3P8B B;  1U8R A;  1AOJ A;  1VQN T;  3M0Q A;  3G4S T;  2BE7 D;  2QA4 Q;  1VQ6 A;  4M7D A;  1E7O A;  4OB0 B;  1P92 A;  4EPC A;  1YJN T;  2CP5 A;  5GAO r;  2HL3 A;  1MV0 B;  4MZT A;  3X20 B;  1QCN A;  3LH0 A;  3H6Z A;  2D9T A;  1H8K A;  1IO6 A;  4J5Y A;  1UEB A;  2F2X A;  5GAO n;  2D8H A;  3O5Z A;  2DIG A;  4ATO A;  5GMK i;  2DNU A;  2HZY A;  1W2B A;  3JB9 H;  2EVR A;  4HXJ A;  2P4T A;  4C8Q G;  1UGR B;  4BE2 A;  4JRQ A;  2J7I A;  2VC8 A;  1TXQ A;  3TRE A;  3QG1 A;  2XDB A;  1PNJ A;  4BY6 C;  1XQH A;  4PFZ A;  3ZFJ A;  2P0P A;  1K9A A;  5A0G A;  2COZ A;  2EKH A;  4UC4 A;  3L1A A;  2QEX A;  2YRD A;  4N0A A;  1B07 A;  4AG1 C;  1KK7 A;  1JJ2 S;  3FLG A;  3OW2 P;  1PCX A;  2H3J A;  4TVR A;  4RCC A;  1BU1 A;  1M2V B;  3I56 T;  1BCM A;  2RM4 A;  2O88 A;  1ZA1 B;  1OUL A;  2LRQ A;  1ZLM A;  2OI3 A;  3RKY A;  1W70 A;  3EHR A;  4AFZ C;  1JQQ A;  2RHX A;  3SWN C;  3UA6 A;  1AWW A;  4BE1 A;  4OB3 B;  1VQN A;  3I5S A;  2FO0 A;  3MO8 A;  4P5N A;  1JU5 C;  3G4S A;  1QWF A;  1VQK A;  4LXC A;  3I56 Q;  5FRM A;  1RAC B;  1MMN A;  1G3T A;  1YJN A;  2HAX A;  2NUT A;  3VS5 A;  1JEG A;  4BDZ A;  1RLQ C;  1NPP A;  2HKN A;  3KBG A;  4J9I A;  4J9B A;  3UWN A;  1JBM A;  2VGM A;  1R0C B;  2OAW A;  4FU6 A;  1OYX A;  2DEU A;  1RUW A;  2F2V A;  2JZ2 A;  4WTO B;  2QQS A;  1RAI B;  5GAM e;  2J6K A;  1YFN A;  1BI2 A;  5LJ5 f;  3VS3 A;  4E7L A;  3QO3 A;  1KHC A;  4FL6 A;  5GAM h;  4GLM A;  3CQT A;  3HL8 A;  4R0K A;  4XK8 E;  3NMZ C;  2YLC A;  2ZZD A;  2KT1 A;  4GBQ A;  5KYX A;  4L59 A;  4JRK A;  2JM8 A;  1Q82 U;  5FU6 C;  5C6S A;  3OSS C;  4ORZ A;  3TVT A;  2MWO A;  2KYB A;  3TU4 K;  3OY9 A;  2FVU A;  2LCS A;  3CEY A;  1TUD A;  2R57 A;  2DTH A;  3HFO A;  2EYY A;  2YRC A;  5CKB A;  5CR2 A;  4KH1 B;  3T9N A;  1E6G A;  5GAN f;  1K9M C;  1UE9 A;  3NFC A;  4JJB A;  2RA2 A;  1SKU B;  2GCX A;  3OYL A;  1VQ8 A;  1EIF A;  4OMO A;  3EH1 A;  2ABL A;  2YWW A;  2VUB A;  4M77 E;  5EG2 A;  1RAH B;  2EBP A;  4C92 C;  3V7C A;  2HQH A;  1WZO A;  2CZ1 B;  3OYD A;  2QGF B;  3TEE A;  2GQI A;  1BCO A;  5FRO A;  1WPY A;  4HA8 A;  4RMO A;  1M1G A;  1X69 A;  1K76 A;  4BB7 A;  1R0B G;  2B8A A;  2BZ8 A;  2KBT A;  3LLR A; 
#chains in the Genus database with same CATH homology
 1IRE B;  3OW2 A;  3MET A;  2XDD A;  1XOV A;  3ER0 A;  1M1F A;  2JVV A;  3X24 B;  4M7A D;  1KQS A;  4E7I A;  3OQ5 A;  1G3W A;  2L3R A;  4J7I A;  3BDU A;  2KMT A;  5LJ3 j;  5LJ3 d;  2KAF A;  2GFA A;  4F7U G;  2RO0 A;  3OMC A;  4E7H A;  3CC2 T;  2CZ0 B;  2NLU A;  3ZBD A;  4M75 F;  2QA4 A;  4M75 D;  2FYK A;  5GAO m;  1BI1 A;  2X4X A;  3OMG A;  3OYY A;  2P0K A;  2Y4Y A;  2EFI A;  3VKI A;  2DXT A;  5LJ5 h;  4DOW A;  5GAN 5;  1VQ7 T;  4LD9 K;  4M7D C;  2L89 A;  2VYT A;  5I21 A;  3J80 E;  1VQ4 T;  2EQK A;  2DD5 A;  5CAI A;  2KQW A;  3S3N A;  4M7A C;  1D3B A;  1WJQ A;  4J6X A;  3JCM g;  5FLX E;  2P0Q A;  1UGQ B;  5I2S A;  5IT9 E;  3LWI A;  1M9S A;  4HCB A;  3OYF A;  1VIF A;  2QQR A;  4OMF B;  2JTM A;  3M55 A;  3CPW A;  4BUG A;  1N6A A;  3AHU A;  1YI2 A;  3CD6 T;  4M75 C;  3FDR A;  4C0G A;  2XD0 A;  1DJ7 B;  2YHT A;  3E9G A;  3G71 T;  3X25 B;  4C0D C;  1KC8 U;  4HCZ A;  3OYG A;  3QDR B;  1VQO T;  1YHQ A;  4XTZ A;  4KUD K;  1FXX A;  2DPP B;  3OYI A;  4L6V 5;  4JLI A;  4PNO A;  4QQD A;  3CCU A;  3QPH A;  4ZN1 A;  2JNG A;  3JCM W;  4J7F A;  4M78 F;  4WF2 A;  3V7S A;  2BUD A;  3JCM d;  2RH2 A;  4M78 D;  4NL3 A;  2XDP A;  3QJ6 A;  2GQV A;  2ZPE B;  2HNI A;  2VV5 A;  5GAN h;  4IUU A;  3OS1 A;  5CKH A;  4IUR A;  1S72 T;  2BKD N;  2PVG B;  2VXE A;  1WNL A;  4QW2 A;  3BFM A;  5AYF A;  4B9X A;  3QKJ A;  3FEO A;  4M77 C;  4XTW A;  4C0Z A;  2LQK A;  1TH7 A;  2K3Y A;  2O4X A;  1WQ7 A;  2MAM A;  1QVP A;  1X6O A;  3OYC A;  1I81 A;  1D3B B;  2GFU A;  3S6W A;  4C8Q A;  3M9Q A;  3NTI A;  1GXI E;  4JRP A;  2WAC A;  2X35 A;  2E64 A;  2V8J A;  3HPW A;  3SDZ A;  4M78 C;  1QVF A;  4EMK B;  1Q81 C;  1VQP T;  5GMK l;  4N4H A;  1I8F A;  1LNX A;  4R55 A;  4ZGJ B;  1K73 U;  4PJO D;  4C92 A;  3MCA B;  3L2Q A;  3LW5 E;  1NZ9 A;  2RHI A;  3LWH A;  1H64 1;  4QQ6 A;  2LC4 A;  3MEW A;  5D6Y A;  4A4E A;  4F7U E;  5GAN 6;  4XQ3 A;  1RL2 A;  1Y7X A;  2RHZ A;  2F5T X;  2E41 A;  2K2V A;  2WSE E;  1YIJ A;  2Y90 A;  4EMG A;  5FU6 B;  3HKS A;  3SB2 A;  4PKC C;  2QDY B;  4JS4 A;  4ZGD B;  4R56 A;  3CCL T;  3JB9 D;  2QXF A;  2E10 A;  4II1 A;  4RKU E;  1LOJ A;  4X34 A;  4XAX B;  3J81 E;  1SSF A;  3OBW A;  4XU0 A;  3L2U A;  1QVG S;  3HHT B;  3VYG A;  3LGF A;  2DXU A;  4HKE A;  4PJO C;  2EQJ A;  2K5L A;  5D6X A;  3MP6 A;  1UGS B;  2F5K A;  2FL7 A;  4C8Q F;  4C8Q D;  3HRS A;  1Y71 A;  4BE0 A;  2O4X B;  5GAM j;  3OB9 A;  3QYH B;  1VIE A;  1JRI A;  2EJG A;  2E6N A;  2DVE A;  3E1S A;  2LX9 A;  4QVZ A;  3OW2 S;  3MP8 A;  5HKC A;  4LD6 A;  4C92 F;  2RK1 A;  4XU3 A;  2L5Q A;  1I4K 1;  2DZ9 A;  2X4Y A;  3INZ A;  3SFM A;  1KQS S;  1VQK T;  4A4G A;  3FC3 A;  3C95 A;  4XTV A;  3CC2 A;  3JCM f;  1YJW T;  3PIP A;  4FSX A;  2YLB A;  1U1S A;  4BI3 A;  4C92 B;  5GAN 4;  1YJ9 T;  4M7A A;  3I56 A;  2ZGW A;  2QTX A;  4BY6 B;  1WGS A;  1ZBX A;  3A8H B;  2OAU A;  2R5M A;  4BAC A;  1VQM T;  4JUV A;  1VQ4 A;  2E1H A;  4OB1 B;  2G3R A;  3MEA A;  2L8D A;  3NTH A;  4E7J A;  4M75 A;  3CMA T;  5HY6 A;  3VUZ A;  3CCS T;  2QI2 A;  2JTF A;  3A5Z B;  1Q7Y C;  2QQA A;  1VQ5 A;  1BYM A;  5LJ3 g;  4BD3 A;  3Q1J A;  2DTI A;  1VQL T;  5LL6 S;  1BI0 A;  4XTX A;  4QQG A;  2XI9 A;  3GNF B;  3CC7 T;  2MWP A;  3OYK A;  3H8Z A;  3CPW S;  3CD6 A;  2K5I A;  2IVW A;  4J6W A;  3JAM E;  3G71 A;  3FB9 A;  2DAQ A;  2RD1 A;  4HT8 A;  2RI3 A;  1VQO A;  4M7D F;  4YTL A;  4M7D D;  1G3Y A;  5GMK h;  1YIT T;  4M7A F;  4KT0 E;  3L2W A;  4JJN K;  4LDY A;  3LX7 A;  3OS5 A;  2LCC A;  3HP9 A;  1WJS A;  4C92 G;  3FIF A;  3OYH A;  1VQ6 T;  4LDU A;  3X28 B;  4M7A B;  3VYH B;  5LJ5 e;  5IN1 A;  4L5G A;  3VUB A;  1LJO A;  3G6E T;  1S72 A;  1MGQ A;  2LVM A;  5LJ3 h;  3GNG A;  4M78 A;  4IUV A;  4ELZ C;  2M16 A;  3UT1 A;  4VUB A;  3QZ9 B;  2I2L A;  4Y91 A;  1KHI A;  2FB7 A;  2CGH A;  3LYI A;  3QII A;  4O6J A;  4M75 B;  2LT1 A;  4MZP A;  4OGE A;  3SWN B;  3TCJ A;  1N8R U;  1M8V A;  1IZ6 A;  1K9M U;  3CC4 T;  2EQU A;  5HK3 A;  4C0D B;  5DLO A;  2DXB A;  3C4S A;  2BIV A;  3CBP A;  5CVI A;  1VQP A;  3WXM B;  3RES A;  1QVF S;  5A0D A;  4JDS A;  4IKF A;  2PUO B;  3M4Y A;  2M9U A;  4C5I A;  1NJI U;  4OF1 A;  2GF7 A;  4QVC A;  3DKM A;  1QW1 A;  1VUB A;  1QP2 A;  3V8J A;  2C06 A;  4XTU A;  4M77 F;  3CCJ T;  2K5F A;  4JRI A;  4IUQ A;  4M77 D;  1M90 C;  1BI3 A;  5CO7 A;  4DOV A;  4ZN3 A;  1VQ9 T;  2D6F A;  3PFS A;  4HT9 A;  2LCL A;  1BKB A;  4PJO A;  3CBO A;  5I2M A;  3RKX A;  1M5Q 1;  5GAN e;  4M7A G;  3M5A A;  1VQ8 T;  2AHJ B;  4LDV A;  3URG A;  4BI4 A;  4EDU A;  4IUP A;  4HCC A;  2LTO A;  2ZPF B;  1O75 A;  2KY9 A;  5D6W A;  4BI8 B;  5J3B A;  3CXC S;  4FT2 A;  3F70 A;  3JCM h;  3CME A;  3GP8 A;  4X9D A;  4CRI A;  4M78 B;  3RUX A;  1K8A C;  1XNI A;  3R6O A;  3QYG B;  4M75 G;  3JCM J;  3QJY A;  3RIR A;  2RB6 A;  3E9F A;  1W4S A;  2KDS A;  2PU9 B;  3JCM X;  1N27 A;  2CZ7 B;  3L2R A;  4GY5 A;  2QEX T;  1Q82 C;  3KXT A;  1KQ1 A;  3JB9 I;  1JJ2 A;  1YCY A;  2MMP A;  2X4J A;  2ZCF B;  3GLX A;  3BW1 A;  3MEU A;  3RMS A;  4B9W A;  1YJW A;  4OP0 A;  1HK9 A;  4PJO F;  3ASK A;  2DKG A;  3N5B B;  4MZM A;  4OGC A;  5LJ3 f;  4EMH A;  4C92 E;  4CI0 C;  4A54 A;  4N4I A;  3CBM A;  2RI5 A;  3M53 A;  4N0A C;  5GAM g;  3EFS A;  2XID A;  4A4F A;  1VQM A;  4A4H A;  2OTJ A;  4E47 A;  3M57 A;  4RG2 A;  2PQW A;  4PJO B;  4ELY C;  1JB0 E;  1PSF A;  2MI6 A;  3BDL A;  4MML A;  5KE2 A;  3OS2 A;  1PSE A;  3CMA A;  3CCS A;  3P8D A;  4C5G A;  2Y4X A;  4E7K A;  1ZHI A;  3JB9 F;  3EAE A;  3M4G A;  3RMQ A;  2ZPG B;  1VQL A;  2ZPH B;  2KK4 A;  3M59 A;  3GPL A;  3OYJ A;  5DLQ E;  4M78 G;  2DXC A;  1MHN A;  3UDC A;  3CC7 A;  2XG8 D;  5GAO p;  2PVD B;  1M1K C;  2XK0 A;  2DTO A;  1XTD A;  2DIQ A;  2E5Q A;  5CIU A;  1Q86 C;  1NPR A;  3V8L A;  4FM4 B;  2A7Y A;  1UGP B;  1KD1 C;  2DJZ A;  3S3O A;  3P8B B;  5GAM d;  1U8R A;  2LDM A;  3CCR T;  3A8G B;  3PGG A;  1VQN T;  3JCM Q;  4C8Q B;  1U1T A;  4Q5W A;  2CYZ B;  4EMK C;  5HK0 A;  4ZTJ A;  3E19 A;  3G4S T;  4GLK A;  4C5H A;  1H3Z A;  1VQ6 A;  4M7D A;  3DB4 A;  4C5E A;  3C94 A;  3CCU T;  4A53 A;  2K4Y A;  4OB0 B;  4OB2 B;  1KG1 A;  3G6E A;  4M7A E;  4DA4 A;  2XKO C;  1P92 A;  4EPC A;  2A3L A;  2X4W A;  2QQB A;  5IAY A;  4PJO G;  2ZPB B;  4J8O A;  3OYM A;  5GAO r;  1YJN T;  2HQE A;  1VQ7 A;  5GAN 7;  2EWN A;  3OS0 A;  4MZT A;  3X20 B;  3LH0 A;  2RJD A;  3WVE B;  4ZTF A;  3A8O B;  3JRZ A;  4NOY A;  1Q81 U;  3C12 A;  3H6Z A;  3OYN A;  2YRV A;  3CC4 A;  2D9T A;  4M75 E;  4BDY A;  5GAN 3;  4J5Y A;  3M56 A;  1UEB A;  2HD0 A;  4O5V A;  5KE3 A;  5L8R E;  5GAO n;  3JB9 G;  3PMT A;  5FU7 C;  2DIG A;  4F7U F;  5GMK i;  4ATO A;  2KVQ G;  1WQW A;  3OYB A;  5GMK e;  1W2B A;  3JB9 H;  3PTA A;  3OBY A;  2P4T A;  2K57 A;  1BIB A;  3FRN A;  1VQ9 A;  4C8Q G;  3WVD B;  4XU2 A;  5CK9 A;  2E12 A;  1UGR B;  3CCV T;  2EIF A;  4BE2 A;  4JRQ A;  3P8H A;  3MEV A;  4PLL A;  5GAO q;  2JUF A;  4KUL A;  3DLM A;  2VC8 A;  1X75 C;  4DQ2 A;  4M7D B;  4ME7 A;  4M77 A;  5J39 A;  3CCE T;  5LJ3 e;  4PL6 A;  3TRE A;  1KC8 C;  3QG1 A;  3M54 A;  3SD4 A;  3CCQ T;  2XDB A;  4BY6 C;  3QSU A;  5KCO A;  1XQH A;  2R58 A;  2EYQ A;  2V8I A;  3ZFJ A;  1QP3 A;  2XU8 A;  5LJ5 g;  5GAO l;  3JCM c;  4M78 E;  2P0P A;  1FX7 A;  5A0G A;  3OYE A;  4ZGE B;  3GF5 A;  3L1A A;  4UC4 A;  3OSV A;  2RJC A;  5GAM f;  2QEX A;  3MHX A;  2LQ8 A;  2VGN A;  3QBY A;  4N0A A;  4MDX A;  2E70 A;  2OTL T;  2M0O A;  3EFR A;  3RKW A;  4C0F A;  1JJ2 S;  3FLG A;  5DM7 R;  2H3J A;  3FJP A;  4RCC A;  4TVR A;  5C0M A;  3VJP A;  2DO3 A;  5LJ5 j;  5LJ5 d;  3HRU A;  3I56 T;  1Q7Y U;  3L42 A;  3JSC A;  2RM4 A;  5KCH A;  1OZ3 A;  3V7R A;  3JCM P;  4M7D G;  3LGL A;  1I5L A;  2LRQ A;  4PJO E;  1HXD A;  1K73 C;  3RKY A;  3JCM e;  3CCL A;  4M77 B;  3GIB A;  2E6Z A;  1UB4 A;  2EJ9 A;  5GAN g;  3DB3 A;  3HFN A;  4MDW A;  5J26 A;  4QVD A;  3CCM T;  4XTY A;  2F69 A;  1KQ2 A;  1VQ5 T;  2WSC E;  4MMK A;  3QUI A;  5DY9 A;  5A2Q E;  4EMK A;  2EKO A;  2KSS A;  3OA6 A;  4NL2 A;  2RHU A;  2RHX A;  3X26 B;  4FIB A;  2O01 E;  5GAN 8;  3SWN C;  3I55 T;  1OI1 A;  1RI0 A;  3GOX A;  4OB3 B;  3DLL A;  3CCR A;  4BE1 A;  1VQN A;  3MO8 A;  4P5N A;  1FWZ A;  4LDW A;  4KBM B;  4Z02 A;  3A8L B;  3KUF A;  2DZC A;  5GAN 2;  3G4S A;  4PLI A;  1OZ2 A;  4C8Q E;  5CQX A;  1VQK A;  2JN0 A;  4A4K A;  5FRM A;  5CCA A;  5GAN j;  1WJR A;  5GAN d;  4D6W A;  3M58 A;  2CZ6 B;  1YJ9 A;  1BIA A;  1G3T A;  2FHD A;  1B34 A;  1YJN A;  2HAX A;  3J7A F;  3QZ5 B;  4J83 A;  2RI2 A;  3QXE B;  3RER A;  3PNW C;  2RHY A;  1R8O B;  4BDZ A;  3O8V A;  2QA4 T;  1NPP A;  4M77 G;  1ZQ1 A;  3KBG A;  4LDX A;  3QHS A;  5CKD A;  5A0L A;  2V8K A;  3UWN A;  3G7Z A;  5CKE A;  1JBM A;  2VGM A;  3CPF A;  4JLG A;  1M4Z A;  4FU6 A;  4XU1 A;  2EQM A;  3UPU A;  2RJF A;  1M90 U;  2PVO B;  1OYX A;  1N9S A;  2IG0 A;  2JZ2 A;  2QQS A;  1G5V A;  2XIC A;  2D0Q B;  5GMK m;  1W2B S;  5GAM e;  3NTK A;  1YI2 T;  1BI2 A;  2EAY A;  3CCV A;  5LJ5 f;  2WSF E;  4F7U A;  1O9S A;  1YIT A;  1Y96 A;  4E7L A;  3QO3 A;  4V2S A;  1KHC A;  3JB9 J;  4FL6 A;  3LLR A;  3VU3 C;  5GAM h;  3CCE A;  1YHQ T;  1V29 B;  4M7D E;  1K8A U;  2DK3 A;  3HL8 A;  3CCQ A;  2LNV A;  3HRT A;  1B34 B;  4XK8 E;  3CXC A;  2YLC A;  2ZZD A;  3V8K A;  2CKK A;  5FRN A;  2HQX A;  2VXF A;  4JRK A;  4L59 A;  3ZEH A;  3CME T;  2EJF A;  1Q82 U;  4KUI A;  5FU7 B;  2XHC A;  5FU6 C;  5C6S A;  3PIO A;  2MF2 A;  3OSS C;  2MWO A;  2M1H A;  3JCM V;  3TU4 K;  3OY9 A;  2FVU A;  4J6Y A;  3CEY A;  2R57 A;  1G3S A;  2OTL A;  2DTH A;  2LT4 A;  3HFO A;  3L2V A;  4C92 D;  2CS7 A;  5CKB A;  5CR2 A;  1AHJ B;  4FT4 A;  3A8M B;  3T9N A;  4N4G A;  5GAN f;  5CQY A;  1N8R C;  1K9M C;  3CCJ A;  4JS5 A;  5M9O A;  4NS5 A;  3NFC A;  2DEQ A;  3MP1 A;  2QQ9 A;  4Y28 E;  4C8Q C;  4F7U B;  2RA2 A;  3L2Z A;  1Y96 B;  2R5A A;  1YBY A;  2GCX A;  2PUK B;  3OYL A;  2OTJ T;  2RJE A;  3VV0 A;  1NJI C;  1M1K U;  1EIF A;  1VQ8 A;  1YIJ T;  3PMI A;  3SWN A;  1Q86 U;  2VUB A;  4IUT A;  4M77 E;  2E65 A;  4X9C A;  5EG2 A;  4C92 C;  3JCM b;  5KH6 A;  3CCM A;  1KD1 U;  3HSB A;  4RCB A;  3V7C A;  1X01 A;  1N9R A;  2CZ1 B;  3PT9 A;  3OYA A;  1QVG A;  2HBP A;  3OYD A;  3TEE A;  5CKF A;  5FRO A;  2JOY A;  4RG8 A;  2DD4 A;  3BY7 A;  3I55 A;  1WPY A;  4HA8 A;  5GMK j;  4RMO A;  1M1G A;  2ZPI B;  4OVA A;  4BB7 A;  2B8A A;  2K3X A;  1Y07 A;  3ME9 A;  3S3M A;  2RK2 A;  1NE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...