4F7UB

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
80
Chain Sequence
EEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVNKDRYISKMFLRGDSVIVVLRNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Splicing
total genus 17
structure length 80
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uB00
2DTHA 2EWNA 2ZGWA 4PJOE 5GAN6 1TH7A 4C92C 4XTWA 1X01A 5GANf 4C92B 5GAMj 2E41A 3JCMP 3JCMd 4M78E 4PJOF 3SWNB 5GAOm 3SWNA 4M7DG 1I5LA 3PGGA 4M7AG 1B34A 4EMGA 5GMKi 4JRIA 1I4K1 4XQ3A 2DVEA 5LJ5g 4XTVA 3HSBA 5CAIA 2JN0A 2FB7A 2RB6A 4M75C 5GAN5 4M75B 1MGQA 4F7UE 2K57A 2RD1A 1JBMA 5GAOr 4HT9A 2E64A 2VC8A 5LJ3j 4J6XA 4V2SA 2RM4A 4M77E 2RA2A 1BIAA 3JCMh 4QVCA 3JCMe 4J6WA 4PJOG 2YHTA 4F7UF 5GMKl 5LJ3g 5GAMf 1WPYA 5GANe 3BDUA 4JRKA 2E1HA 4M77F 3HFOA 4M78G 4C92E 3JB9F 4PJOD 1M5Q1 4JUVA 5GAMd 2HNIA 2E65A 4NOYA 3RERA 4XU2A 3JB9H 5GAOq 4C8QA 4M78D 4C92F 4RCCA 4XU3A 3BFMA 2VXFA 2DZCA 2E10A 1H641 4F7UG 3SWNC 4M75E 1YCYA 3JCMV 3RKWA 3BW1A 3QSUA 4M77G 1I8FA 3JCMc 1B34B 3V7RA 2QTXA 5LJ5j 3JB9G 3HFNA 5LJ3d 1U1TA 2YLCA 4WF2A 4HT8A 4M75F 4PNOA 5GAMe 3FIFA 5GAMh 1KQ2A 5GANg 4M7DD 3V8KA 4XU1A 4C92G 3JB9D 4M7AD 4XU0A 4XTUA 3VU3C 5I21A 4A54A 3RESA 4QVDA 3RKYA 3V7SA 4HA8A 4EMKB 4M7DA 4EMKA 3FJPA 5GAN4 4M7AA 5LJ3h 1N9SA 4X9CA 1D3BB 1KQ1A 4M75G 1D3BA 4NL2A 5LJ5f 2EJ9A 5GAN8 5GMKm 2CGHA 4C8QC 4C8QB 4NL3A 2DZ9A 4M75D 5LJ5d 2FYKA 5GAOp 2DTOA 3JCMb 3RIRA 3L2ZA 4X9DA 4MMKA 4J5YA 5LJ3f 4PJOB 1JRIA 4PJOA 4EMHA 4N0AA 1HXDA 4M78B 5GANj 4M78A 2YLBA 3M4GA 3JCMg 2DKGA 3EFSA 5GAN7 4OP0A 4M77D 1WQ7A 3JCMX 4XTYA 2I2LA 2EAYA 5DY9A 1WQWA 1Y96A 3EFRA 3V7CA 3QHSA 4DQ2A 5GMKj 5LJ5h 3JCMJ 3V8JA 4F7UA 4C92D 4RCBA 4EMKC 4C8QE 4M7DC 4M7AC 3JCMQ 4M7DB 3QUIA 4M77A 4M7AB 5GAN3 3JB9I 2DEQA 5GAOn 4XTXA 5LJ3e 5GAOl 2EJGA 4C8QF 5GAN2 4C92A 1LNXA 3RUXA 5GANd 5GAMg 1U1SA 4PJOC 3QO3A 4N0AC 4M78F 1LOJA 1M8VA 3RKXA 4MMLA 3JCMW 4M78C 3INZA 3BY7A 3AHUA 2DXUA 4Y91A 4M75A 4C8QG 3JB9J 2Y90A 4J6YA 1HK9A 4XTZA 4M7DE 4M7AE 2EJFA 2DJZA 1Y96B 5LJ5e 4C8QD 5GANh 4JLIA 4M7DF 1BIBA 4F7UB 3SB2A 4A53A 4M7AF 1I81A 1LJOA 4M77C 3V8LA 3GIBA 4M77B 2DXTA 1N9RA 2DTIA 5GMKh 2VXEA 5GMKe 1WNLA 3L1AA 3FB9A 3JCMf
chains in the Genus database with same CATH superfamily
4VUBA 2QAZA 1GL5A 1VQ4T 3SWNB 5GJWB 2F2VA 3VV0A 3M4YA 2FB7A 1WJSA 1Q7YC 3Q1JA 4ZN3A 1GCPA 5FROA 3P8DA 4C5HA 1H3HA 2JW4A 5FU6C 3QJYA 2QG9B 2COZA 2V8IA 3DLLA 1G2BA 1Q86U 4TVRA 3ZEHA 4FYWB 2X4JA 3QSUA 2ROTA 2G3RA 2QTXA 3I56Q 3QZ9B 4M7DD 3I35A 2L2PA 1M1KR 1QVGP 3I55Q 4ORZA 1R77A 3EG9B 4AG2C 3OYNA 3CXCA 1IZ6A 2CT3A 2XK0A 2FHDA 2KAFA 5KYUB 1YJNA 4A4HA 3HPWA 1JB0E 2FYKA 4RTWA 1Q7YR 1JO8A 1S72T 4FYYB 1JRIA 2EVRA 2HL3A 4C0ZA 1UGQB 2XIDA 2YLBA 2DKGA 1ZBXA 3EFSA 3CMAQ 1OU9A 4PFPA 1WJRA 1YBYA 1G3YA 3LGLA 1PM3A 3PVLA 1YJ9Q 3QKJA 4EMKC 5L23A 1QCOA 1UUEA 1RAGB 2H3EB 3CBPA 3OBWA 2ZPFB 3VS7A 4LUEA 3ZBDA 1YWPA 5GAMg 4BI4A 1PRMC 3GF5A 4M78F 3URGA 2HAXA 1G3SA 2DM1A 3E2UA 2L5QA 1E6HA 4KGXB 2DF6A 1JXOA 2ZCFB 1B3QA 2X3WD 2RI2A 1I07A 3PT9A 5GANh 1TG0A 2QQRA 1M3AA 3NPFA 3GLXA 4RTVA 1QVGS 4M7AG 5IAYA 3PMTA 1MMNA 2MAMA 2VC8A 2QEXT 3SDZA 4J6XA 1T3LA 2LDMA 3RMSA 2GQVA 2E70A 5GANe 4E7IA 4M4ZA 4PJOD 2FZCB 4RKUE 5J39A 2VUBA 1K8AU 2G6FX 3HRUA 2JXBA 5AYFA 2KR3A 1SF9A 2DD5A 2OTLQ 3OYJA 2KSSA 2OAUA 4F17A 2D6FA 2CUBA 1X2QA 3OMGA 1KQ2A 4C92G 2NUPA 3G71Q 2K9GA 3CCVQ 1AWOA 4LE9A 3EH1A 2DIGA 1SRMA 2DZ9A 2LQ8A 1M4ZA 4KGZB 2YUPA 3RIRA 4MMKA 4QQ6A 4ZGEB 4OMOA 1VQKQ 1PC0A 5DM7R 5KYYA 1KHIA 4LN2A 1M90C 2FL7A 4J83A 1UJ0A 2EKHA 3KUFA 4B9WA 4RG8A 3E9FA 3MPUB 2MPXC 3MHXA 5FU7C 1KSWA 1Q81U 1WIEA 5A0LA 4Y91A 2PUOB 2CS7A 2Y90A 1HK9A 4JDSA 4M7DE 3J7AF 3A8HB 2CP6A 3HRSA 1NZ9A 3V8LA 1AOJA 3MEAA 2E3IA 5GMKe 1JQQA 2OTJQ 3A8MB 1RAIB 5IXBA 3CC4Q 5GANf 3EGXB 1PKSA 4PJNA 5IN1A 4E47A 3F70A 4RTTA 4MDWA 1AWWA 3EHRA 3CCUA 3GOXA 2JN0A 4M75C 1M90R 2RD1A 2ZPHB 1JBMA 4RG2A 1H3ZA 2JTFA 4KT0E 5A2QE 4BD3A 3G7ZA 1TXQA 3HTRA 5FWCA 2K7AA 2LCCA 2P4RA 1ZUKA 1YJNT 1EZZB 7AT1B 1LCKA 3BFMA 1RUWA 1H641 2LP5A 2CSQA 1JU5C 2J05A 4M77G 2LX7A 2LCLA 4PJLA 5GAMe 1OQKA 1AT1B 4OMMA 2FRYA 1R0CB 2YRVA 1KC8U 2F69A 3PE0A 2JJ9A 2DEUA 2GTJA 4JJBA 2CGHA 2DILA 2HKQB 1VQ9Q 2PZ1A 2WSEE 3A8OB 2CREA 3JCMg 2JS0A 2L0AA 4N4HA 2A3LA 3QPHA 5KCOA 4ZGJB 1QVFP 2LCSA 2NWMA 5GAOl 3FDRA 2JM9A 2EJGA 1VQMA 1QQJA 2K5IA 4DBQA 2DO3A 2EYZA 2X4XA 5GANd 1IB8A 3PTAA 2LRQA 4N0AC 4O6JA 4MMLA 3LH5A 4C8QG 1PKTA 3KXTA 3S3NA 2O01E 3VS0A 5IH2A 2C0OA 1RAEB 2LQNA 3GNFB 3X24B 2DTHA 4FYXB 1ZUYA 2L3SA 4M78E 2A0FB 4AFUC 1I5LA 3QYGB 2DETA 4XQ3A 5LJ5g 3NFCA 1K73R 1OI1A 3SD4A 1BIAA 2X51A 1AZEA 5GAMf 1Q86C 2E12A 2EIFA 3JB9H 1Y7XA 5HY6A 2HL5C 4WTOB 2AKKA 3V7RA 2K3BA 1ZX6A 4PJJA 1QVFS 1FMKA 1WGSA 2V8KA 2CZ6B 2XKOC 1WXUA 4M7DA 4J7FA 3L42A 4BE1A 1YWOA 3DKMA 3LWIA 3TQ7P 1BI0A 4RTZA 5J26A 1EIFA 1RL2A 3JCMb 1D09B 1WJQA 3VKIA 2YRCA 1FWZA 4AFZC 3GPLA 2DYBA 5GANj 1Q86R 1VQ6A 5KYYB 1PG5B 5EG2A 4JS4A 3QHSA 2OJ2A 1OZ2A 4M7AB 3VJPA 1FXXA 2R5AA 5GAOn 3L2QA 1K1ZA 3M5AA 2K3XA 5HK3A 3WXMB 2CH4W 4LNPA 3CCUT 2ESWA 2CP2A 4XTZA 3VYHB 5LL6S 1Y96B 1TSFA 2MCNA 1XJWB 2LMJA 1KHCA 4JJNK 3CCLQ 1D0ZA 1VYUA 2I0NA 2HSPA 2ZGWA 2CZ7B 1RAHB 4C92B 1M90U 2DA9A 1XTDA 1B34A 1SRLA 1YITA 3I5RA 3RNJA 3UT1A 4KH1B 2YWWA 3U23A 3TSZA 3G6EA 2PUKB 3JCMe 1VQPA 1VQ5Q 5D6YA 3EG3A 3NTIA 2QQSA 3R6NA 4XU2A 3QDRB 2A28A 4IKFA 2RI3A 1IHWA 3HRTA 2M16A 1ZSZA 2GQIA 3UDCA 1YIJA 1VQ8Q 3M0QA 1K76A 3OYYA 1YFNA 3RKYA 1VQ7Q 2JUFA 3CC7A 2QASA 4PJMA 2YDLA 1VQMT 3QWYA 4C5IA 2AKLA 4IUVA 5HCKA 5HK0A 3S6WA 4M78A 3EG0A 2HMAA 2SEMA 3X26B 3MEVA 1FYNA 3JCMX 3CD6A 1RADB 3EFRA 4UC4A 5IHIA 2DL4A 4HCKA 1NYFA 3OS5A 3T9NA 4BY6B 1V29B 1Q81C 1NLOC 3CMEQ 4PJOC 2M51A 3S3MA 1M8VA 1K4US 1B07A 4OVAA 2RJEA 1VQOQ 3META 4M7DF 4K11A 3I5SA 2V1RA 2FVUA 4M77B 4KRTA 4C0DB 3JCMf 2IG0A 3E9GA 1VQNQ 1M3BA 2JMAA 1CKBA 1RLQC 4IURA 2RH2A 4ELZC 1ZLMA 2KROA 4F7UE 2JZ2A 4XK8E 2HZYA 4RTUA 3ZL7C 3OYAA 3WVDB 3CCMA 1Q81R 2GF7A 4DOWA 3N5BB 2M1HA 4IUTA 2LQWA 1O9SA 2DXCA 4ZTJA 3OYIA 3OYFA 4XU3A 1MMGA 1R8OB 1Z9QA 2FPFA 5IT9E 4M75E 3RKWA 1UTIA 1KC8C 3LGFA 4XU0A 3ULRB 1WHGA 1VQ6T 3CCQQ 2DLPA 3QG1A 1W6XA 4HA8A 4EMKA 1VQLT 2CP3A 2FRWA 2LT4A 2MIOA 1D3BA 2KRMA 5LJ5f 3OW2A 4X34A 1VA7A 4C8QB 3QWXX 4DBRA 2O31A 4GLKA 1T0JA 4JPBW 4DOVA 1JEGA 2M02A 4HCBA 1G8XA 4OP0A 1N6AA 1M1GA 4XTYA 2I2LA 3LW5E 1MV3A 3EFOA 2JMCA 1MHNA 1X6OA 4R56A 1AWXA 1F1BB 1M9SA 3H0IA 2XU8A 5CVIA 3M55A 4WCIA 2F2WA 3EG2A 1RI0A 3HL8A 3CCEA 1KC8R 3SFMA 1QP2A 2RQVA 3RUXA 1Y57A 3QBYA 5CCAA 3UPUA 2D9TA 3CPWA 2XD0A 1ZHIA 2AZVA 1YITT 2DXUA 1X75C 2OI3A 2QA4Q 1AHJB 2K2MA 4C8QD 3G6ET 1VQPT 4II1A 2H8HA 4GBQA 3OYHA 2RJFA 1BCMA 1ZSGA 2EWNA 1SHGA 3EAEA 2E41A 3CC2Q 4CC3A 5CKHA 1C0MA 2PU9B 5CKBA 3VYGA 1C1AA 1MGQA 3OYKA 1YIJT 5A0DA 1D1CA 3I56A 5C6SA 2R5MA 3BDUA 1LVKA 3I55A 2VYTA 5L8RE 3EGUA 1BI1A 3UA7A 1U06A 2RHIA 3RMQA 4CC7A 5KYXA 3JCMV 2GNCA 4J9IA 1ZSZB 2LTOA 5IXFA 2LVMA 5I2MA 2IPOB 2V8JA 3EH2A 4RTYA 4OGEA 8AT1B 3CD6T 2JOYA 3D7SB 2YUOA 4A54A 3CMAA 1KQSP 4HVVA 1N9SA 1RI9A 1KQ1A 2LNVA 2LT1A 1YJ9A 1RAAB 3SEMA 5GAN8 5GMKm 3M54A 1JJ2A 3GBQA 2GCXA 1SSHA 3O5ZA 4EIKA 4J7IA 4M78B 3QZ5B 4OB1B 4E7ZA 2BZ8A 1H8KA 2RHUA 3E1SA 4BE0A 3CCJQ 4DQ2A 2E6NA 3V8JA 4F7UA 2RNAA 3QUIA 3PVQA 4Z8AA 2EQJA 3L2VA 3M0TA 1Z9ZA 3OY9A 2D0NA 4Q5WA 1LOJA 4KGVB 4F16A 2XDDA 4M75A 2PQWA 4C0GA 3SB2A 5FU6B 3GIBA 3CCMT 1N5ZA 5GMKh 1YI2A 1WNLA 1G3WA 1X2KA 1D0XA 2ZAEA 2X3XD 4HKEA 2DL5A 1YHQQ 3PGGA 4EMGA 1KQSS 1UGPB 3TVTA 5CAIA 2RB6A 2D8HA 2OTLA 1AEYA 4DBHA 4ZGDB 3KBGA 2LZ6B 4ESRA 3HFOA 1WDXA 3G71A 4FL6A 3CCVA 2F1LA 4A4KA 1BI2A 2ZPBB 2LC4A 4BI3A 3TEEA 1SKUB 3R6OA 4FT4A 5GAMh 3CCSQ 3ASKA 2AHJB 3VU3C 1WFWA 2AK5A 4DBFA 1VQKA 1OZ3A 2LNHB 3V7SA 4EMKB 3TREA 2DJQA 1D3BB 1QWFA 2Z0WA 1SPKA 5GAOp 3CCET 2CP0A 2RHYA 2EQKA 3DB3A 4BUGA 4N0AA 5FRMA 2FPDA 4OMNA 4HCCA 3M4GA 1QVGA 1WHKA 3EFOB 5GJVB 3REAB 4M7AC 2MF2A 4AMCA 5J3BA 1ARKA 1GFDA 4FW2A 2EGAA 2OTJA 1K0SA 4GLMA 1SSFA 3CC4A 3QO3A 3AHUA 1GFCA 3J81E 3CQTA 1M8MA 3WVEB 1W2BP 3A1PA 2CYZB 3I56T 5CKFA 2GFAA 3MP1A 1BIBA 1MMAA 3I55T 5CKDA 3RBBB 4XAXB 3OS1A 3L1AA 2D0QB 4N4GA 4PJOE 4FT2A 4C92C 1X01A 2CUDA 4N4IA 1BI3A 1OPKA 1VYTA 4M7DG 2XDBA 1K9AA 2AZSA 2F2XA 2DVEA 4BACA 5GAN5 2QQBA 3ZFJA 5KE3A 4DA4A 4MZMA 4IIMA 1MV0B 4QVCA 1NPRA 1W70A 1YJWA 4OGCA 4F7UF 3CMAT 4ATOA 3OYBA 2BE7D 1OULA 5FRNA 1IXDA 4Y28E 1YJ9T 5DLQE 2W0ZA 3VS4A 5KYWA 2RO0A 1UECA 3CCRQ 3BDLA 2E6ZA 2EGCA 1VQ9A 2DMOA 1UJYA 4MZPA 3LYIA 4M75F 1O75A 3VS1A 3O8VA 2XMFA 4XTUA 3TSWA 5I21A 2RJDA 2K4YA 2FZGB 1JXMA 2K3YA 3UF4A 1R0BG 4D6WA 5C0MA 1VQ4Q 1UGVA 1M2VA 2K2VA 2X4YA 1YCSB 2EJ9A 2YUNA 2WSCE 2ZPEB 2BZXA 4FM4B 1W2BS 3L2ZA 1VUBA 2K5LA 3MO8A 2GTOA 5FU7B 2YSQA 1SEMA 1HXDA 1U3OA 2O9SA 5M9OA 3NTKA 3H8ZA 1VQLQ 2D8JA 2NUTA 1ABOA 1BKBA 2NUPB 2DRKA 2BIVA 1NJIU 1YI2T 4BY6C 1M1FA 1U1SA 3FLGA 1AD5A 1T3SA 3RKXA 4JJCA 2ENMA 2JS2A 2CZ1B 2HQEA 2V26A 3M57A 2OTLT 4OB3B 4ZN1A 2RQTA 3M0UA 1N8RU 5IHKA 1LPLA 1TUCA 2VGNA 4M77C 4MZTA 4PK4A 3G71T 2VXEA 4C0DC 1MNDA 1S72Q 2YRDA 4CI0C 3CCVT 1S1NA 3OW2P 1M2OA 2CSIA 4A63B 2GBQA 3JCMP 3G4SA 1I5OB 3OYEA 3G1JA 1I4K1 4JLGA 2KBTA 1EX4A 2HQHA 4XTVA 4YTLA 4IUPA 2RM4A 2HBWA 1KIKA 1VQKT 3JCMh 3EG9A 4M78G 3JB9F 3CXCP 4LUDA 5GAMd 2HNIA 1X69A 1I0CA 2KVQG 3SWNC 2LJ0A 1YCYA 4LXCA 4F14A 2WSFE 2FEIA 1WLPB 2QQAA 1E7OA 4M7AD 3ER0A 2VGMA 4OB0B 2DE0X 2GGRA 1TU0B 5CIUA 1A0NB 4ME7A 2KEAA 4C8QC 4NL3A 3MP6A 3KFVA 2EBPA 2DTOA 4J9EA 2OTJT 3OSVA 5CK9A 1YP5A 4PJOA 2QEXQ 2COWA 3CC4T 3CD6Q 1QVPA 1TOVA 3JSCA 1M3CA 4A4FA 1QCFA 4JJDA 3I9QA 2KXCA 2LQKA 5GMKj 5LJ5h 3MJXA 3OW2S 1SHFA 2AT1B 3OBYA 3NHNA 4C92D 4RCBA 4ANJA 4PKCC 4IUUA 3ME9A 4E7JA 4NS5A 3MEUA 1OOTA 2DL8A 3A98A 1VIFA 2O4XA 2IIMA 3CCLA 2RN8A 2J7IA 2JTEA 4X1VA 3FC3A 4FIBA 3JAME 3UATA 2BE9B 1NBEB 3M58A 1RACB 3CXCS 4E7LA 5LJ5e 3FJ5A 1YJWT 1QVFA 2HKNA 2Y4YA 1I81A 1RLPC 1Q82U 2ZZDA 1N9RA 1VQ5A 4AFSC 3C0CA 2FZKB 4JRPA 2K6DA 1TH7A 5GAMj 3VRZA 3FEOA 1TTHB 2MOXA 1VQ9T 4FYVB 5GMKi 3HSBA 3C95A 4J8OA 1XOVA 1VIEA 1FMVA 4E6RA 1WA7A 2YHTA 2EQUA 1VQ8A 1TS9A 2E1HA 1WX6A 1UEBA 3DLMA 5FLXE 2E65A 4NOYA 1VQ7A 2RK1A 3E19A 4FU6A 5KYWB 1DJ7B 5D6XA 4ZTFA 2VXFA 5CO7A 4D8KA 1TUDA 4QQGA 3VS5A 4QW2A 2RJCA 4E7SA 3JCMc 3HFNA 4PLIA 3MEWA 3FIFA 2YUQA 2J6OA 2WACA 5GANg 3V8KA 3HHTB 4XU1A 2CP7A 3PFSA 2A36A 1WHLA 2VB6A 3TCJA 1N27A 2RMOA 1Q95G 5GAN4 2QQ9A 1XQHA 1ZUUA 4X9CA 1M2VB 2KT1A 4JRQA 2W10A 2ZPGB 4HVUA 1E6GA 2COYA 2KYBA 2HQXA 2CKKA 1KG1A 2DIQA 1BU1A 4B6MA 3CMEA 2DPPB 2Y4XA 3MP8A 5GAN7 1QLYA 2NUTB 4M77D 4F04B 3JCMJ 4PFZA 1VQOA 1YJNQ 4JS5A 4M7DB 3CCEQ 2VVKA 2RQWA 3OS2A 1PD1A 5GAN2 2RHXA 3EGXA 2PTKA 2RPNA 4HVWA 2DL3A 2P4TA 3G4ST 1VQNA 4R55A 1IGQA 1CSKA 4AG1C 1OYXA 2B8AA 3A8GB 1PHTA 1GCQC 4M7AE 2DL7A 1OX9A 1W1FA 1PD0A 4CRIA 3IQLA 1M27C 3QYHB 1MNEA 2ROLA 3FRNA 3JCMd 4PJOF 5GAOm 2EGEA 2QDYB 1HD3A 3L2WA 1OPLA 1YN8A 2RI5A 4IIOA 1PSEA 3PMIA 1V1CA 4LD6A 2ECZA 1ZQ1A 5LJ3g 3OYGA 1ZA2B 4C92E 3CCQA 4JUVA 5GAOq 4QKUA 2O2OA 1NG2A 1G5VA 2DZCA 4F7UG 4BB7A 2DK3A 3BW1A 1B34B 3M59A 4PLLA 2BUDA 2KK4A 3A8LB 2D1XA 1VYVA 1IHVA 2QYZA 3C4SA 1NE8A 1K0XA 1NYGA 1QKWA 4M75G 2KYMA 3EGDA 4FCYA 3CC7T 1FMWA 4KH0B 1WZOA 3CCLT 5LJ5d 2QXFA 4X9DA 4PJOB 2VASA 4J5YA 2XDPA 4E7KA 4DEYA 5A0GA 1ACMB 4AT1B 4Z89A 4EPCA 1PWTA 2LJ3A 5DY9A 4V2SA 1WQWA 1NJIC 4BI8B 1U8RA 4OMPA 1MMDA 2LJ1A 1Y07A 2QA4A 2YXYA 2F5TX 4FW1A 6AT1B 1VQ5T 2O4XB 3TU4K 4QT7A 3X20B 1BCOA 4RUGA 1IGUA 8ATCB 3JCMW 1UG1A 3INZA 3BY7A 3CC2A 1N8RC 4OF1A 2QK0A 1ZBJA 2KT8A 2HEQA 2KY9A 2DJZA 5D6WA 1YI2Q 2X9HA 3P8HA 4JLIA 1VQ8T 4LDYA 4A53A 2FO0A 1LJOA 3X25B 2DXTA 2DTIA 4BE2A 2DNUA 1VQ7T 3M0SA 4XTWA 5I22A 1X6GA 3JV3A 2P0QA 1GBQA 2EW3A 2L3QA 3OSSC 3PNWC 1NJIR 2JNGA 3M9QA 3OMCA 3EG1A 3P8BB 3H0HA 5EC7A 2HSEB 2E64A 4M77E 2JVVA 2J6KA 1OX8A 3RR6A 1WPYA 1X27A 2M9UA 4KBMB 1AZGB 2EYXA 3UA6A 2PNIA 5FW9A 1VOMA 1J3TA 4M78D 2XI9A 1UGSB 2DBKA 3CCUQ 1BB9A 1N8RR 1W4SA 1EFNA 2KRSA 5LJ5j 1I8FA 1ABQA 3JB9G 1X43A 2R57A 1WHHA 4PNOA 3CMET 2M0YA 2RQUA 2DAQA 4HXJA 4IUQA 3RESA 4BDYA 1VQOT 3CCJA 4M7AA 2L3PA 5LJ3h 4ELYC 1KD1C 4NL2A 1K9MU 2DFUA 2X35A 2CT4A 1H92A 1VQNT 1WI7A 2AIRB 5DLOA 2ED0A 4LD9K 1CKAA 1Y96A 3M0RA 3V7CA 4A4EA 1D1AA 4C8QE 1AWJA 1AVZC 4XTXA 5LJ3e 3NGPA 3H9NA 4C92A 4J9HA 3S3OA 4R0KA 3CBOA 2FG0A 3JB9J 1YHQA 4KUDK 2OAWA 5HKCA 3OYDA 1Q82C 3THKA 1KD1R 4L5GA 3NTHA 1VQMQ 3CCQT 4PFOA 2ABLA 4RMOA 3OYCA 1M1KU 1D0YA 1Y0MA 4O5VA 4LDUA 1YJWQ 1D1BA 4P5NA 1UFFA 5GAOr 2CDTA 4FSSA 4A4GA 3CCSA 2B86A 4J6WA 3OA6A 1Q7YU 4JRKA 2DXBA 4Z02A 2E5QA 1GXIE 2XG8D 5CKEA 3BE3A 2P84A 4E2FB 1FX7A 2A37A 2RHZA 1OEBA 4CC4B 2QTVA 3HKSA 3SHWA 1QKXA 2J6FA 4PL6A 1Q82R 2QDLA 2OX7A 3LWHA 4C0FA 1IREB 1IRXA 4QQDA 2QI2A 2CP5A 2KRNA 1K73C 2QA4T 2VWFA 2KNBB 2MWOA 2C0IA 2KXDA 4L59A 2CH4A 3EGDB 2KDSA 5LJ3f 1G3TA 5KYXB 4J9GA 3C94A 4EMHA 3J80E 2EYQA 4ZNXA 4OMQA 3CC2T 1QP3A 1UDLA 3MKDA 5CQXA 1KQSA 5I11A 3H41A 5CR2A 4M77A 3JB9I 2L8DA 2HD0A 3CPFA 3CEYA 2JM8A 2KE9A 2P0KA 2EKOA 1QCNA 2O9VA 2MMPA 2VKNA 2QGGA 2MI6A 1VQ6Q 3OB9A 4C5EA 1U5SA 3QXEB 4J6YA 1IO6A 3QJ6A 2K79A 5KCHA 4F7UB 4M7AF 2IVWA 2NUZA 3REBB 3G4SQ 4MDXA 3FB9A 2L3RA 1T0HA 5GAN6 2L89A 3NMZC 1M30A 2DVJA 3H0FA 2DBMA 4LDVA 3LLRA 3SWNA 5FWBA 1HJDA 4JRIA 1X6BA 1V76A 2V1QA 3VRYA 1NEGA 1WXTA 2KQWA 3CCRA 1G83A 1OV3A 4M75B 2ED1A 4JZ3A 9ATCB 2RA2A 3OYMA 4PJOG 5GMKl 2E3HA 3CCJT 4FSXA 2EQMA 2HCKA 4C8QA 4C92F 3L2UA 4RCCA 1VQ4A 1YITQ 2SRCA 1TWBA 1YNZA 2F5KA 2QGFB 3HP9A 2HDAA 2GFUA 5LJ3d 4EDUA 1U1TA 4WF2A 3EHQA 2O88A 3G6EQ 1VQPQ 2PVGB 4HT8A 4BDZA 1Y71A 1UB4A 1NPPA 1RABB 3M53A 3PIOA 1UHCA 1VQLA 1WXBA 1NEBA 2RK2A 2PVDB 2KI7A 5KYUA 2KGTA 4M75D 2E4HA 4J9BA 3H6ZA 3DB4A 1QWEA 1YIJQ 2RQRA 3GNGA 2A08A 3CPWP 3VUBA 2P0PA 1YHQT 1ZA1B 3RDVA 2A7YA 2NLUA 1B7TA 2XICA 1MUZA 2MK5A 2BTTA 3CC7Q 4AFQC 1PCXA 4M7DC 2DX1A 1QW1A 5GAN3 2DEQA 4HCZA 3VS2A 4OB2B 3VS6A 2ATCB 2BKDN 2EPDA 1PSFA 1KJWA 1PNJA 1UHFA 1BYMA 2MYSA 1S72A 1UGRB 5D7UA 1KD1U 1GBRA 3LH0A 3QDFA 4DEXA 2X4WA 3OS0A 2DYIA 3M56A 1K8AC 3CCST 2YT6A 5I2SA 4OMFB 1NM7A 3CBMA 1BK2A 4J9DA 4L6V5 3L2RA 1WHJA 1XNIA 2C0TA 2XHCA 2EQIA 3LX7A 1W2BA 1C6VX 1NLPC 3AT1B 2K57A 4HT9A 1P92A 5LJ3j 1RAFB 4M77F 4D8DA 1HSQA 2C06A 1M5Q1 3RERA 1QMCA 1BBZA 3A5ZB 3CPWS 4OMLA 3QIIA 5KE2A 2E10A 1JJ2P 4J9FA 3GP8A 5AT1B 2CZ0B 1KK7A 2YLCA 2J06A 1K8AR 5ECAA 1OU8A 3C12A 2DERA 3JB9D 4KUIA 1GRIA 2QEXA 2EYYA 5KYNA 2R58A 3CCMQ 1I1JA 2LX9A 4J9CA 1K9MC 3JRZA 4QVDA 4Y92A 2KMTA 3FJPA 1SG5A 1WYXA 2DRMA 2H3JA 2EFIA 3OYLA 1KFZA 3M0PA 4LDWA 4LDXA 3X28B 1ZSZC 3UWNA 1WHMA 2BZYA 1UE9A 1PRLC 2MWPA 2HBPA 4GY5A 3OQ5A 1WQ7A 2EAYA 1GCQA 3JCMQ 2JTMA 3MCAB 2M0OA 4Z88A 2JT4A 4C8QF 3VUZA 4B9XA 2EYWA 1K73U 1LNXA 3PIPA 4C5GA 5KH6A 4KULA 5IHNA 4M78C 2E5KA 1K9MR 5CQYA 2VV5A 3CCRT 4RTXA 2EJFA 1TUGB 4JZ4A 4E7HA 2ZPIB 2RF0A 2NYSA 4CC2A 1M1KC 1JJ2S 1HYOA 3VS3A 2K5FA 4QVZA 2PVOB 2DD4A 2FPEA
chains in the Genus database with same CATH topology
4N4GA 2ZGWA 4PJOE 2CZ7B 4FT2A 4VUBA 1VQ7T 4C92C 4XTWA 1X01A 4N4IA 4C92B 1M90U 1VQ4T 1BI3A 1XTDA 2P0QA 3SWNB 4M7DG 2XDBA 3OSSC 1B34A 3VV0A 3PNWC 2DVEA 1YITA 2JNGA 3M4YA 2FB7A 3M9QA 1WJSA 3OMCA 3P8BB 2QQBA 3Q1JA 3UT1A 3ZFJA 4ZN3A 5KE3A 5GAN5 4BACA 1Q7YC 2E64A 4DA4A 4MZMA 5FROA 4M77E 2JVVA 3G6EA 2PUKB 3P8DA 1NPRA 4QVCA 3JCMe 4C5HA 1VQPA 4OGCA 4F7UF 1YJWA 5D6YA 1WPYA 3CMAT 4ATOA 5FU6C 2M9UA 3OYBA 3QJYA 4KBMB 5FRNA 3NTIA 2V8IA 4Y28E 2QQSA 5DLQE 4XU2A 1YJ9T 3QDRB 4M78D 2XI9A 3DLLA 4IKFA 1Q86U 2RI3A 4TVRA 1UGSB 2RO0A 3ZEHA 3BDLA 2E6ZA 1W4SA 2X4JA 1VQ9A 3HRTA 3QSUA 2M16A 1I8FA 5LJ5j 4MZPA 2G3RA 2QTXA 3JB9G 3LYIA 2R57A 3UDCA 4M75F 4PNOA 3QZ9B 3CMET 1O75A 4M7DD 1YIJA 3O8VA 4XTUA 5I21A 2RJDA 2K4YA 2DAQA 3OYYA 2K3YA 4IUQA 3RESA 3RKYA 3OYNA 4D6WA 3CXCA 5C0MA 1IZ6A 4BDYA 1VQOT 3CCJA 4M7AA 2JUFA 4ELYC 5LJ3h 2XK0A 1KD1C 2K2VA 2X4YA 4NL2A 2FHDA 2EJ9A 3CC7A 1K9MU 2KAFA 2WSCE 1YJNA 1VQMT 4A4HA 2ZPEB 3HPWA 1JB0E 2FYKA 4FM4B 1W2BS 2X35A 1S72T 4C5IA 3L2ZA 1VUBA 2K5LA 3MO8A 1JRIA 4IUVA 1VQNT 4C0ZA 5FU7B 1HXDA 5HK0A 3S6WA 1UGQB 2XIDA 2YLBA 4M78A 5DLOA 5M9OA 2DKGA 1ZBXA 3EFSA 3NTKA 3H8ZA 3X26B 1BKBA 3MEVA 3JCMX 4LD9K 3CD6A 1WJRA 1Y96A 3EFRA 3V7CA 1YBYA 4A4EA 1G3YA 3LGLA 4UC4A 3QKJA 2BIVA 4C8QE 4EMKC 4XTXA 5LJ3e 1NJIU 3OS5A 1YI2T 3CBPA 3T9NA 4BY6C 3OBWA 2ZPFB 4BY6B 4C92A 1V29B 1Q81C 3S3OA 1M1FA 3ZBDA 5GAMg 1U1SA 3FLGA 4PJOC 4BI4A 3S3MA 3GF5A 4M78F 1M8VA 3RKXA 3URGA 2HAXA 3CBOA 1G3SA 4OVAA 2RJEA 2L5QA 3JB9J 1YHQA 2CZ1B 2HQEA 2OTLT 3M57A 5HKCA 3OYDA 1Q82C 4KUDK 3META 2ZCFB 4OB3B 2RI2A 3PT9A 5GANh 4ZN1A 4M7DF 4L5GA 3NTHA 1N8RU 2FVUA 2VGNA 4M77C 4MZTA 2QQRA 4M77B 3G71T 3CCQT 2VXEA 4C0DC 4CI0C 3CCVT 4C0DB 3JCMf 2IG0A 3E9GA 4RMOA 3OYCA 1M1KU 3JCMP 3GLXA 1QVGS 3G4SA 4M7AG 4IURA 4O5VA 5IAYA 3OYEA 1I4K1 2RH2A 4JLGA 3PMTA 4ELZC 4LDUA 4XTVA 4P5NA 5GAOr 4F7UE 2MAMA 2JZ2A 4YTLA 2VC8A 4IUPA 3SDZA 4J6XA 4XK8E 2QEXT 2LDMA 2RM4A 1VQKT 4A4GA 3RMSA 2GQVA 2E70A 3JCMh 3OYAA 4J6WA 3OA6A 3CCSA 3WVDB 5GANe 1Q7YU 4E7IA 4JRKA 3CCMA 2DXBA 4M78G 4Z02A 2GF7A 4DOWA 3JB9F 4PJOD 3N5BB 2M1HA 5GAMd 2E5QA 4IUTA 2HNIA 2XG8D 4RKUE 5J39A 2VUBA 1O9SA 1GXIE 5CKEA 1K8AU 2DXCA 4ZTJA 3HRUA 3OYIA 3OYFA 4XU3A 5AYFA 1FX7A 1R8OB 2RHZA 2KVQG 3FC3A 2DD5A 3HKSA 3SWNC 4M75E 5IT9E 1YCYA 3RKWA 2WSFE 4PL6A 3OYJA 2KSSA 2OAUA 2D6FA 1KC8C 1KQ2A 3OMGA 2QQAA 3LWHA 4M7AD 4C92G 3ER0A 3LGFA 4XU0A 4C0FA 1IREB 4QQDA 2QI2A 1VQ6T 2VGMA 4OB0B 3QG1A 4HA8A 1K73C 4EMKA 2QA4T 1VQLT 2LT4A 5CIUA 2MWOA 1D3BA 5LJ5f 4L59A 4ME7A 3OW2A 2DIGA 4C8QC 4X34A 4C8QB 3MP6A 2DZ9A 4NL3A 2LQ8A 1M4ZA 2KDSA 4GLKA 2DTOA 2OTJT 3OSVA 3RIRA 5CK9A 4MMKA 1G3TA 4QQ6A 5LJ3f 4ZGEB 4PJOA 3C94A 4DOVA 4EMHA 3J80E 2EYQA 3CC4T 1QVPA 3JSCA 4A4FA 3CC2T 1QP3A 4HCBA 4OP0A 1N6AA 1M1GA 5CQXA 5DM7R 2LQKA 4XTYA 2I2LA 5GMKj 5LJ5h 1KQSA 3LW5E 3OW2S 1KHIA 5CR2A 1MHNA 3OBYA 1X6OA 4C92D 4RCBA 4R56A 1M90C 4PKCC 4IUUA 4M77A 1M9SA 3ME9A 2FL7A 3JB9I 4E7JA 2XU8A 2L8DA 3MEUA 4J83A 2HD0A 3CEYA 3CPFA 2P0KA 4NS5A 3M55A 5CVIA 1VIFA 2EKOA 2O4XA 3CCLA 3CCEA 1RI0A 3HL8A 3KUFA 4B9WA 3SFMA 1QP2A 2MMPA 4RG8A 3RUXA 3QBYA 5CCAA 4FIBA 3JAME 3E9FA 3UPUA 2D9TA 3CPWA 2MI6A 2XD0A 3MHXA 1ZHIA 5FU7C 1Q81U 3OB9A 4C5EA 5A0LA 3M58A 2DXUA 4Y91A 2PUOB 1YITT 2CS7A 1X75C 3QXEB 3CXCS 2Y90A 4J6YA 1HK9A 4JDSA 4E7LA 4M7DE 3J7AF 1AHJB 3QJ6A 4C8QD 3A8HB 5LJ5e 3G6ET 1YJWT 1VQPT 1QVFA 5KCHA 4F7UB 4M7AF 2Y4YA 1NZ9A 1I81A 2IVWA 3HRSA 3V8LA 4II1A 1Q82U 3MEAA 2ZZDA 1N9RA 5GMKe 1VQ5A 4MDXA 3OYHA 2RJFA 2L3RA 3FB9A 2EWNA 3A8MB 4JRPA 3EAEA 5GAN6 1TH7A 2L89A 5GANf 5GAMj 2E41A 4LDVA 3LLRA 3FEOA 5IN1A 3SWNA 4E47A 3F70A 1VQ9T 5GMKi 5CKHA 4JRIA 4MDWA 2PU9B 3CCUA 3HSBA 3C95A 4J8OA 3GOXA 2JN0A 2KQWA 1XOVA 4M75C 5CKBA 3VYGA 3CCRA 1VIEA 4M75B 1MGQA 2RD1A 2ZPHB 1JBMA 3OYKA 4RG2A 5A0DA 1YIJT 1H3ZA 3I56A 5C6SA 2JTFA 2RA2A 3OYMA 2R5MA 4KT0E 4PJOG 2YHTA 2EQUA 5GMKl 5A2QE 4BD3A 3G7ZA 1VQ8A 3BDUA 2E1HA 3I55A 2D0QB 2VYTA 3CCJT 4FSXA 1UEBA 2EQMA 3DLMA 5L8RE 2E65A 5FLXE 1BI1A 4NOYA 1VQ7A 2LCCA 2RK1A 3E19A 4FU6A 4C8QA 4C92F 3L2UA 4RCCA 1YJNT 1DJ7B 3BFMA 2RHIA 5D6XA 4ZTFA 2VXFA 3RMQA 1VQ4A 1H641 5CO7A 4QQGA 2F5KA 3JCMV 3HP9A 4QW2A 2RJCA 4M77G 3JCMc 2LTOA 2GFUA 2LCLA 2LVMA 1U1TA 3HFNA 4WF2A 4PLIA 5I2MA 5LJ3d 2PVGB 3MEWA 3FIFA 5GAMe 2WACA 2V8JA 5GANg 3V8KA 1Y71A 4BDZA 1UB4A 3HHTB 4XU1A 3PFSA 4OGEA 3TCJA 3CD6T 1N27A 2JOYA 1NPPA 2YRVA 4A54A 1KC8U 3M53A 3PIOA 3CMAA 1VQLA 5GAN4 2F69A 2QQ9A 1XQHA 1N9SA 4X9CA 2RK2A 2LT1A 1KQ1A 2LNVA 1YJ9A 2PVDB 5GAN8 5GMKm 4JRQA 2ZPGB 2CGHA 3M54A 1JJ2A 4M75D 2HQXA 2GCXA 3H6ZA 3DB4A 2CKKA 1KG1A 2DIQA 4J7IA 2WSEE 3GNGA 3A8OB 4M78B 3CMEA 2DPPB 3QZ5B 2Y4XA 4OB1B 3JCMg 3MP8A 3VUBA 5GAN7 2P0PA 2RHUA 3E1SA 4M77D 4N4HA 1YHQT 2A7YA 2NLUA 4BE0A 2A3LA 2XICA 4DQ2A 3JCMJ 2E6NA 3V8JA 3QPHA 4F7UA 5KCOA 1VQOA 4M7DC 4ZGJB 4JS5A 4M7DB 1QW1A 3QUIA 5GAN3 2DEQA 4HCZA 4OB2B 3FDRA 5GAOl 3OS2A 2EJGA 2BKDN 1VQMA 5GAN2 2K5IA 1PSFA 2EQJA 2RHXA 3L2VA 2DO3A 1BYMA 3OY9A 2X4XA 1S72A 1UGRB 5GANd 1KD1U 2P4TA 3G4ST 3PTAA 2LRQA 4BE2A 1VQNA 4N0AC 4O6JA 4Q5WA 1LOJA 4R55A 4MMLA 3LH0A 2XDDA 1OYXA 2X4WA 4M75A 4C8QG 2PQWA 3KXTA 2B8AA 3S3NA 3OS0A 2O01E 3A8GB 4M7AE 3M56A 4C0GA 1K8AC 3CCST 5I2SA 4OMFB 3SB2A 5FU6B 3GNFB 3GIBA 3CBMA 3X24B 4CRIA 3CCMT 5GMKh 1YI2A 1WNLA 3QYHB 1G3WA 4L6V5 3L2RA 2DTHA 4HKEA 3FRNA 1XNIA 3JCMd 4M78E 4PJOF 2XHCA 5GAOm 1I5LA 2QDYB 3PGGA 3QYGB 4EMGA 3L2WA 1KQSS 4XQ3A 5LJ5g 1UGPB 3LX7A 5CAIA 1W2BA 2RB6A 2RI5A 1PSEA 3NFCA 3PMIA 2K57A 2OTLA 1P92A 4HT9A 5LJ3j 4PJOB 1OI1A 4ZGDB 4LD6A 3SD4A 1BIAA 1ZQ1A 4EDUA 5LJ3g 5GAMf 3KBGA 3OYGA 4HT8A 4M77F 3HFOA 1Q86C 2E12A 4C92E 3G71A 4FL6A 3CCQA 2C06A 1M5Q1 4JUVA 3CCVA 3RERA 2EIFA 3JB9H 5GAOq 3A5ZB 3CPWS 4A4KA 1Y7XA 5HY6A 1G5VA 2DZCA 3QIIA 1BI2A 2E10A 2ZPBB 2LC4A 4F7UG 5KE2A 4BB7A 4BI3A 3TEEA 2DK3A 3BW1A 3GP8A 1B34B 2CZ0B 3V7RA 2YLCA 3M59A 4PLLA 3R6OA 5GAMh 4FT4A 2BUDA 3C12A 1QVFS 2KK4A 3JB9D 4KUIA 2AHJB 3A8LB 3ASKA 2QEXA 1WGSA 3VU3C 2R58A 2V8KA 1VQKA 2CZ6B 2LX9A 3C4SA 2XKOC 1K9MC 1OZ3A 1NE8A 3JRZA 4QVDA 3V7SA 4EMKB 4M7DA 2KMTA 3FJPA 4J7FA 3TREA 3L42A 4BE1A 1D3BB 4M75G 3DKMA 2H3JA 3LWIA 1BI0A 3CC7T 5J26A 2EFIA 3OYLA 3CCLT 5LJ5d 1EIFA 2QXFA 1RL2A 3CCET 5GAOp 3JCMb 1WJQA 3VKIA 2RHYA 2EQKA 4X9DA 4J5YA 2XDPA 3DB3A 4LDWA 4BUGA 1FWZA 3GPLA 4N0AA 3X28B 5A0GA 4E7KA 4LDXA 3UWNA 5FRMA 4EPCA 5GANj 4HCCA 3M4GA 1QVGA 2MWPA 2HBPA 4GY5A 3OQ5A 1WQ7A 1VQ6A 5DY9A 2EAYA 4V2SA 1WQWA 5EG2A 4JS4A 1NJIC 3QHSA 4BI8B 1U8RA 3OS1A 1Y07A 2QA4A 1OZ2A 4M7AC 2F5TX 3JCMQ 2JTMA 4M7AB 3MCAB 1FXXA 3VJPA 2R5AA 2MF2A 2M0OA 5GAOn 3L2QA 1VQ5T 5J3BA 2O4XB 4C8QF 3M5AA 2K3XA 3VUZA 4B9XA 3TU4K 5HK3A 1K73U 3WXMB 1LNXA 2OTJA 3PIPA 3X20B 4C5GA 1SSFA 5KH6A 3CC4A 3QO3A 4KULA 3JCMW 4M78C 3INZA 3BY7A 3CC2A 3CCUT 3AHUA 5CQYA 3J81E 2VV5A 3CCRT 1N8RC 4OF1A 4XTZA 3VYHB 3WVEB 2EJFA 2KY9A 2CYZB 5LL6S 2DJZA 3I56T 5CKFA 5D6WA 1Y96B 2GFAA 4E7HA 3MP1A 3P8HA 2ZPIB 4JLIA 1KHCA 1BIBA 4JJNK 4LDYA 4A53A 1VQ8T 1LJOA 1M1KC 1JJ2S 3X25B 3I55T 5CKDA 2DXTA 2K5FA 2DTIA 4QVZA 4XAXB 2PVOB 3L1AA 2DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DTH A;  2EWN A;  2ZGW A;  4PJO E;  5GAN 6;  1TH7 A;  4C92 C;  4XTW A;  1X01 A;  5GAN f;  4C92 B;  5GAM j;  2E41 A;  3JCM P;  3JCM d;  4M78 E;  4PJO F;  3SWN B;  5GAO m;  3SWN A;  4M7D G;  1I5L A;  3PGG A;  4M7A G;  1B34 A;  4EMG A;  5GMK i;  4JRI A;  1I4K 1;  4XQ3 A;  2DVE A;  5LJ5 g;  4XTV A;  3HSB A;  5CAI A;  2JN0 A;  2FB7 A;  2RB6 A;  4M75 C;  5GAN 5;  4M75 B;  1MGQ A;  4F7U E;  2K57 A;  2RD1 A;  1JBM A;  5GAO r;  4HT9 A;  2E64 A;  2VC8 A;  5LJ3 j;  4J6X A;  4V2S A;  2RM4 A;  4M77 E;  2RA2 A;  1BIA A;  3JCM h;  4QVC A;  3JCM e;  4J6W A;  4PJO G;  2YHT A;  4F7U F;  5GMK l;  5LJ3 g;  5GAM f;  1WPY A;  5GAN e;  3BDU A;  4JRK A;  2E1H A;  4M77 F;  3HFO A;  4M78 G;  4C92 E;  3JB9 F;  4PJO D;  1M5Q 1;  4JUV A;  5GAM d;  2HNI A;  2E65 A;  4NOY A;  3RER A;  4XU2 A;  3JB9 H;  5GAO q;  4C8Q A;  4M78 D;  4C92 F;  4RCC A;  4XU3 A;  3BFM A;  2VXF A;  2DZC A;  2E10 A;  1H64 1;  4F7U G;  3SWN C;  4M75 E;  1YCY A;  3JCM V;  3RKW A;  3BW1 A;  3QSU A;  4M77 G;  1I8F A;  3JCM c;  1B34 B;  3V7R A;  2QTX A;  5LJ5 j;  3JB9 G;  3HFN A;  5LJ3 d;  1U1T A;  2YLC A;  4WF2 A;  4HT8 A;  4M75 F;  4PNO A;  5GAM e;  3FIF A;  5GAM h;  1KQ2 A;  5GAN g;  4M7D D;  3V8K A;  4XU1 A;  4C92 G;  3JB9 D;  4M7A D;  4XU0 A;  4XTU A;  3VU3 C;  5I21 A;  4A54 A;  3RES A;  4QVD A;  3RKY A;  3V7S A;  4HA8 A;  4EMK B;  4M7D A;  4EMK A;  3FJP A;  5GAN 4;  4M7A A;  5LJ3 h;  1N9S A;  4X9C A;  1D3B B;  1KQ1 A;  4M75 G;  1D3B A;  4NL2 A;  5LJ5 f;  2EJ9 A;  5GAN 8;  5GMK m;  2CGH A;  4C8Q C;  4C8Q B;  4NL3 A;  2DZ9 A;  4M75 D;  5LJ5 d;  2FYK A;  5GAO p;  2DTO A;  3JCM b;  3RIR A;  3L2Z A;  4X9D A;  4MMK A;  4J5Y A;  5LJ3 f;  4PJO B;  1JRI A;  4PJO A;  4EMH A;  4N0A A;  1HXD A;  4M78 B;  5GAN j;  4M78 A;  2YLB A;  3M4G A;  3JCM g;  2DKG A;  3EFS A;  5GAN 7;  4OP0 A;  4M77 D;  1WQ7 A;  3JCM X;  4XTY A;  2I2L A;  2EAY A;  5DY9 A;  1WQW A;  1Y96 A;  3EFR A;  3V7C A;  3QHS A;  4DQ2 A;  5GMK j;  5LJ5 h;  3JCM J;  3V8J A;  4F7U A;  4C92 D;  4RCB A;  4EMK C;  4C8Q E;  4M7D C;  4M7A C;  3JCM Q;  4M7D B;  3QUI A;  4M77 A;  4M7A B;  5GAN 3;  3JB9 I;  2DEQ A;  5GAO n;  4XTX A;  5LJ3 e;  5GAO l;  2EJG A;  4C8Q F;  5GAN 2;  4C92 A;  1LNX A;  3RUX A;  5GAN d;  5GAM g;  1U1S A;  4PJO C;  3QO3 A;  4N0A C;  4M78 F;  1LOJ A;  1M8V A;  3RKX A;  4MML A;  3JCM W;  4M78 C;  3INZ A;  3BY7 A;  3AHU A;  2DXU A;  4Y91 A;  4M75 A;  4C8Q G;  3JB9 J;  2Y90 A;  4J6Y A;  1HK9 A;  4XTZ A;  4M7D E;  4M7A E;  2EJF A;  2DJZ A;  1Y96 B;  5LJ5 e;  4C8Q D;  5GAN h;  4JLI A;  4M7D F;  1BIB A;  4F7U B;  3SB2 A;  4A53 A;  4M7A F;  1I81 A;  1LJO A;  4M77 C;  3V8L A;  3GIB A;  4M77 B;  2DXT A;  1N9R A;  2DTI A;  5GMK h;  2VXE A;  5GMK e;  1WNL A;  3L1A A;  3FB9 A;  3JCM f; 
#chains in the Genus database with same CATH topology
 4VUB A;  2QAZ A;  1GL5 A;  1VQ4 T;  3SWN B;  5GJW B;  2F2V A;  3VV0 A;  3M4Y A;  2FB7 A;  1WJS A;  1Q7Y C;  3Q1J A;  4ZN3 A;  1GCP A;  5FRO A;  3P8D A;  4C5H A;  1H3H A;  2JW4 A;  5FU6 C;  3QJY A;  2QG9 B;  2COZ A;  2V8I A;  3DLL A;  1G2B A;  1Q86 U;  4TVR A;  3ZEH A;  4FYW B;  2X4J A;  3QSU A;  2ROT A;  2G3R A;  2QTX A;  3I56 Q;  3QZ9 B;  4M7D D;  3I35 A;  2L2P A;  1M1K R;  1QVG P;  3I55 Q;  4ORZ A;  1R77 A;  3EG9 B;  4AG2 C;  3OYN A;  3CXC A;  1IZ6 A;  2CT3 A;  2XK0 A;  2FHD A;  2KAF A;  5KYU B;  1YJN A;  4A4H A;  3HPW A;  1JB0 E;  2FYK A;  4RTW A;  1Q7Y R;  1JO8 A;  1S72 T;  4FYY B;  1JRI A;  2EVR A;  2HL3 A;  4C0Z A;  1UGQ B;  2XID A;  2YLB A;  2DKG A;  1ZBX A;  3EFS A;  3CMA Q;  1OU9 A;  4PFP A;  1WJR A;  1YBY A;  1G3Y A;  3LGL A;  1PM3 A;  3PVL A;  1YJ9 Q;  3QKJ A;  4EMK C;  5L23 A;  1QCO A;  1UUE A;  1RAG B;  2H3E B;  3CBP A;  3OBW A;  2ZPF B;  3VS7 A;  4LUE A;  3ZBD A;  1YWP A;  5GAM g;  4BI4 A;  1PRM C;  3GF5 A;  4M78 F;  3URG A;  2HAX A;  1G3S A;  2DM1 A;  3E2U A;  2L5Q A;  1E6H A;  4KGX B;  2DF6 A;  1JXO A;  2ZCF B;  1B3Q A;  2X3W D;  2RI2 A;  1I07 A;  3PT9 A;  5GAN h;  1TG0 A;  2QQR A;  1M3A A;  3NPF A;  3GLX A;  4RTV A;  1QVG S;  4M7A G;  5IAY A;  3PMT A;  1MMN A;  2MAM A;  2VC8 A;  2QEX T;  3SDZ A;  4J6X A;  1T3L A;  2LDM A;  3RMS A;  2GQV A;  2E70 A;  5GAN e;  4E7I A;  4M4Z A;  4PJO D;  2FZC B;  4RKU E;  5J39 A;  2VUB A;  1K8A U;  2G6F X;  3HRU A;  2JXB A;  5AYF A;  2KR3 A;  1SF9 A;  2DD5 A;  2OTL Q;  3OYJ A;  2KSS A;  2OAU A;  4F17 A;  2D6F A;  2CUB A;  1X2Q A;  3OMG A;  1KQ2 A;  4C92 G;  2NUP A;  3G71 Q;  2K9G A;  3CCV Q;  1AWO A;  4LE9 A;  3EH1 A;  2DIG A;  1SRM A;  2DZ9 A;  2LQ8 A;  1M4Z A;  4KGZ B;  2YUP A;  3RIR A;  4MMK A;  4QQ6 A;  4ZGE B;  4OMO A;  1VQK Q;  1PC0 A;  5DM7 R;  5KYY A;  1KHI A;  4LN2 A;  1M90 C;  2FL7 A;  4J83 A;  1UJ0 A;  2EKH A;  3KUF A;  4B9W A;  4RG8 A;  3E9F A;  3MPU B;  2MPX C;  3MHX A;  5FU7 C;  1KSW A;  1Q81 U;  1WIE A;  5A0L A;  4Y91 A;  2PUO B;  2CS7 A;  2Y90 A;  1HK9 A;  4JDS A;  4M7D E;  3J7A F;  3A8H B;  2CP6 A;  3HRS A;  1NZ9 A;  3V8L A;  1AOJ A;  3MEA A;  2E3I A;  5GMK e;  1JQQ A;  2OTJ Q;  3A8M B;  1RAI B;  5IXB A;  3CC4 Q;  5GAN f;  3EGX B;  1PKS A;  4PJN A;  5IN1 A;  4E47 A;  3F70 A;  4RTT A;  4MDW A;  1AWW A;  3EHR A;  3CCU A;  3GOX A;  2JN0 A;  4M75 C;  1M90 R;  2RD1 A;  2ZPH B;  1JBM A;  4RG2 A;  1H3Z A;  2JTF A;  4KT0 E;  5A2Q E;  4BD3 A;  3G7Z A;  1TXQ A;  3HTR A;  5FWC A;  2K7A A;  2LCC A;  2P4R A;  1ZUK A;  1YJN T;  1EZZ B;  7AT1 B;  1LCK A;  3BFM A;  1RUW A;  1H64 1;  2LP5 A;  2CSQ A;  1JU5 C;  2J05 A;  4M77 G;  2LX7 A;  2LCL A;  4PJL A;  5GAM e;  1OQK A;  1AT1 B;  4OMM A;  2FRY A;  1R0C B;  2YRV A;  1KC8 U;  2F69 A;  3PE0 A;  2JJ9 A;  2DEU A;  2GTJ A;  4JJB A;  2CGH A;  2DIL A;  2HKQ B;  1VQ9 Q;  2PZ1 A;  2WSE E;  3A8O B;  2CRE A;  3JCM g;  2JS0 A;  2L0A A;  4N4H A;  2A3L A;  3QPH A;  5KCO A;  4ZGJ B;  1QVF P;  2LCS A;  2NWM A;  5GAO l;  3FDR A;  2JM9 A;  2EJG A;  1VQM A;  1QQJ A;  2K5I A;  4DBQ A;  2DO3 A;  2EYZ A;  2X4X A;  5GAN d;  1IB8 A;  3PTA A;  2LRQ A;  4N0A C;  4O6J A;  4MML A;  3LH5 A;  4C8Q G;  1PKT A;  3KXT A;  3S3N A;  2O01 E;  3VS0 A;  5IH2 A;  2C0O A;  1RAE B;  2LQN A;  3GNF B;  3X24 B;  2DTH A;  4FYX B;  1ZUY A;  2L3S A;  4M78 E;  2A0F B;  4AFU C;  1I5L A;  3QYG B;  2DET A;  4XQ3 A;  5LJ5 g;  3NFC A;  1K73 R;  1OI1 A;  3SD4 A;  1BIA A;  2X51 A;  1AZE A;  5GAM f;  1Q86 C;  2E12 A;  2EIF A;  3JB9 H;  1Y7X A;  5HY6 A;  2HL5 C;  4WTO B;  2AKK A;  3V7R A;  2K3B A;  1ZX6 A;  4PJJ A;  1QVF S;  1FMK A;  1WGS A;  2V8K A;  2CZ6 B;  2XKO C;  1WXU A;  4M7D A;  4J7F A;  3L42 A;  4BE1 A;  1YWO A;  3DKM A;  3LWI A;  3TQ7 P;  1BI0 A;  4RTZ A;  5J26 A;  1EIF A;  1RL2 A;  3JCM b;  1D09 B;  1WJQ A;  3VKI A;  2YRC A;  1FWZ A;  4AFZ C;  3GPL A;  2DYB A;  5GAN j;  1Q86 R;  1VQ6 A;  5KYY B;  1PG5 B;  5EG2 A;  4JS4 A;  3QHS A;  2OJ2 A;  1OZ2 A;  4M7A B;  3VJP A;  1FXX A;  2R5A A;  5GAO n;  3L2Q A;  1K1Z A;  3M5A A;  2K3X A;  5HK3 A;  3WXM B;  2CH4 W;  4LNP A;  3CCU T;  2ESW A;  2CP2 A;  4XTZ A;  3VYH B;  5LL6 S;  1Y96 B;  1TSF A;  2MCN A;  1XJW B;  2LMJ A;  1KHC A;  4JJN K;  3CCL Q;  1D0Z A;  1VYU A;  2I0N A;  2HSP A;  2ZGW A;  2CZ7 B;  1RAH B;  4C92 B;  1M90 U;  2DA9 A;  1XTD A;  1B34 A;  1SRL A;  1YIT A;  3I5R A;  3RNJ A;  3UT1 A;  4KH1 B;  2YWW A;  3U23 A;  3TSZ A;  3G6E A;  2PUK B;  3JCM e;  1VQP A;  1VQ5 Q;  5D6Y A;  3EG3 A;  3NTI A;  2QQS A;  3R6N A;  4XU2 A;  3QDR B;  2A28 A;  4IKF A;  2RI3 A;  1IHW A;  3HRT A;  2M16 A;  1ZSZ A;  2GQI A;  3UDC A;  1YIJ A;  1VQ8 Q;  3M0Q A;  1K76 A;  3OYY A;  1YFN A;  3RKY A;  1VQ7 Q;  2JUF A;  3CC7 A;  2QAS A;  4PJM A;  2YDL A;  1VQM T;  3QWY A;  4C5I A;  2AKL A;  4IUV A;  5HCK A;  5HK0 A;  3S6W A;  4M78 A;  3EG0 A;  2HMA A;  2SEM A;  3X26 B;  3MEV A;  1FYN A;  3JCM X;  3CD6 A;  1RAD B;  3EFR A;  4UC4 A;  5IHI A;  2DL4 A;  4HCK A;  1NYF A;  3OS5 A;  3T9N A;  4BY6 B;  1V29 B;  1Q81 C;  1NLO C;  3CME Q;  4PJO C;  2M51 A;  3S3M A;  1M8V A;  1K4U S;  1B07 A;  4OVA A;  2RJE A;  1VQO Q;  3MET A;  4M7D F;  4K11 A;  3I5S A;  2V1R A;  2FVU A;  4M77 B;  4KRT A;  4C0D B;  3JCM f;  2IG0 A;  3E9G A;  1VQN Q;  1M3B A;  2JMA A;  1CKB A;  1RLQ C;  4IUR A;  2RH2 A;  4ELZ C;  1ZLM A;  2KRO A;  4F7U E;  2JZ2 A;  4XK8 E;  2HZY A;  4RTU A;  3ZL7 C;  3OYA A;  3WVD B;  3CCM A;  1Q81 R;  2GF7 A;  4DOW A;  3N5B B;  2M1H A;  4IUT A;  2LQW A;  1O9S A;  2DXC A;  4ZTJ A;  3OYI A;  3OYF A;  4XU3 A;  1MMG A;  1R8O B;  1Z9Q A;  2FPF A;  5IT9 E;  4M75 E;  3RKW A;  1UTI A;  1KC8 C;  3LGF A;  4XU0 A;  3ULR B;  1WHG A;  1VQ6 T;  3CCQ Q;  2DLP A;  3QG1 A;  1W6X A;  4HA8 A;  4EMK A;  1VQL T;  2CP3 A;  2FRW A;  2LT4 A;  2MIO A;  1D3B A;  2KRM A;  5LJ5 f;  3OW2 A;  4X34 A;  1VA7 A;  4C8Q B;  3QWX X;  4DBR A;  2O31 A;  4GLK A;  1T0J A;  4JPB W;  4DOV A;  1JEG A;  2M02 A;  4HCB A;  1G8X A;  4OP0 A;  1N6A A;  1M1G A;  4XTY A;  2I2L A;  3LW5 E;  1MV3 A;  3EFO A;  2JMC A;  1MHN A;  1X6O A;  4R56 A;  1AWX A;  1F1B B;  1M9S A;  3H0I A;  2XU8 A;  5CVI A;  3M55 A;  4WCI A;  2F2W A;  3EG2 A;  1RI0 A;  3HL8 A;  3CCE A;  1KC8 R;  3SFM A;  1QP2 A;  2RQV A;  3RUX A;  1Y57 A;  3QBY A;  5CCA A;  3UPU A;  2D9T A;  3CPW A;  2XD0 A;  1ZHI A;  2AZV A;  1YIT T;  2DXU A;  1X75 C;  2OI3 A;  2QA4 Q;  1AHJ B;  2K2M A;  4C8Q D;  3G6E T;  1VQP T;  4II1 A;  2H8H A;  4GBQ A;  3OYH A;  2RJF A;  1BCM A;  1ZSG A;  2EWN A;  1SHG A;  3EAE A;  2E41 A;  3CC2 Q;  4CC3 A;  5CKH A;  1C0M A;  2PU9 B;  5CKB A;  3VYG A;  1C1A A;  1MGQ A;  3OYK A;  1YIJ T;  5A0D A;  1D1C A;  3I56 A;  5C6S A;  2R5M A;  3BDU A;  1LVK A;  3I55 A;  2VYT A;  5L8R E;  3EGU A;  1BI1 A;  3UA7 A;  1U06 A;  2RHI A;  3RMQ A;  4CC7 A;  5KYX A;  3JCM V;  2GNC A;  4J9I A;  1ZSZ B;  2LTO A;  5IXF A;  2LVM A;  5I2M A;  2IPO B;  2V8J A;  3EH2 A;  4RTY A;  4OGE A;  8AT1 B;  3CD6 T;  2JOY A;  3D7S B;  2YUO A;  4A54 A;  3CMA A;  1KQS P;  4HVV A;  1N9S A;  1RI9 A;  1KQ1 A;  2LNV A;  2LT1 A;  1YJ9 A;  1RAA B;  3SEM A;  5GAN 8;  5GMK m;  3M54 A;  1JJ2 A;  3GBQ A;  2GCX A;  1SSH A;  3O5Z A;  4EIK A;  4J7I A;  4M78 B;  3QZ5 B;  4OB1 B;  4E7Z A;  2BZ8 A;  1H8K A;  2RHU A;  3E1S A;  4BE0 A;  3CCJ Q;  4DQ2 A;  2E6N A;  3V8J A;  4F7U A;  2RNA A;  3QUI A;  3PVQ A;  4Z8A A;  2EQJ A;  3L2V A;  3M0T A;  1Z9Z A;  3OY9 A;  2D0N A;  4Q5W A;  1LOJ A;  4KGV B;  4F16 A;  2XDD A;  4M75 A;  2PQW A;  4C0G A;  3SB2 A;  5FU6 B;  3GIB A;  3CCM T;  1N5Z A;  5GMK h;  1YI2 A;  1WNL A;  1G3W A;  1X2K A;  1D0X A;  2ZAE A;  2X3X D;  4HKE A;  2DL5 A;  1YHQ Q;  3PGG A;  4EMG A;  1KQS S;  1UGP B;  3TVT A;  5CAI A;  2RB6 A;  2D8H A;  2OTL A;  1AEY A;  4DBH A;  4ZGD B;  3KBG A;  2LZ6 B;  4ESR A;  3HFO A;  1WDX A;  3G71 A;  4FL6 A;  3CCV A;  2F1L A;  4A4K A;  1BI2 A;  2ZPB B;  2LC4 A;  4BI3 A;  3TEE A;  1SKU B;  3R6O A;  4FT4 A;  5GAM h;  3CCS Q;  3ASK A;  2AHJ B;  3VU3 C;  1WFW A;  2AK5 A;  4DBF A;  1VQK A;  1OZ3 A;  2LNH B;  3V7S A;  4EMK B;  3TRE A;  2DJQ A;  1D3B B;  1QWF A;  2Z0W A;  1SPK A;  5GAO p;  3CCE T;  2CP0 A;  2RHY A;  2EQK A;  3DB3 A;  4BUG A;  4N0A A;  5FRM A;  2FPD A;  4OMN A;  4HCC A;  3M4G A;  1QVG A;  1WHK A;  3EFO B;  5GJV B;  3REA B;  4M7A C;  2MF2 A;  4AMC A;  5J3B A;  1ARK A;  1GFD A;  4FW2 A;  2EGA A;  2OTJ A;  1K0S A;  4GLM A;  1SSF A;  3CC4 A;  3QO3 A;  3AHU A;  1GFC A;  3J81 E;  3CQT A;  1M8M A;  3WVE B;  1W2B P;  3A1P A;  2CYZ B;  3I56 T;  5CKF A;  2GFA A;  3MP1 A;  1BIB A;  1MMA A;  3I55 T;  5CKD A;  3RBB B;  4XAX B;  3OS1 A;  3L1A A;  2D0Q B;  4N4G A;  4PJO E;  4FT2 A;  4C92 C;  1X01 A;  2CUD A;  4N4I A;  1BI3 A;  1OPK A;  1VYT A;  4M7D G;  2XDB A;  1K9A A;  2AZS A;  2F2X A;  2DVE A;  4BAC A;  5GAN 5;  2QQB A;  3ZFJ A;  5KE3 A;  4DA4 A;  4MZM A;  4IIM A;  1MV0 B;  4QVC A;  1NPR A;  1W70 A;  1YJW A;  4OGC A;  4F7U F;  3CMA T;  4ATO A;  3OYB A;  2BE7 D;  1OUL A;  5FRN A;  1IXD A;  4Y28 E;  1YJ9 T;  5DLQ E;  2W0Z A;  3VS4 A;  5KYW A;  2RO0 A;  1UEC A;  3CCR Q;  3BDL A;  2E6Z A;  2EGC A;  1VQ9 A;  2DMO A;  1UJY A;  4MZP A;  3LYI A;  4M75 F;  1O75 A;  3VS1 A;  3O8V A;  2XMF A;  4XTU A;  3TSW A;  5I21 A;  2RJD A;  2K4Y A;  2FZG B;  1JXM A;  2K3Y A;  3UF4 A;  1R0B G;  4D6W A;  5C0M A;  1VQ4 Q;  1UGV A;  1M2V A;  2K2V A;  2X4Y A;  1YCS B;  2EJ9 A;  2YUN A;  2WSC E;  2ZPE B;  2BZX A;  4FM4 B;  1W2B S;  3L2Z A;  1VUB A;  2K5L A;  3MO8 A;  2GTO A;  5FU7 B;  2YSQ A;  1SEM A;  1HXD A;  1U3O A;  2O9S A;  5M9O A;  3NTK A;  3H8Z A;  1VQL Q;  2D8J A;  2NUT A;  1ABO A;  1BKB A;  2NUP B;  2DRK A;  2BIV A;  1NJI U;  1YI2 T;  4BY6 C;  1M1F A;  1U1S A;  3FLG A;  1AD5 A;  1T3S A;  3RKX A;  4JJC A;  2ENM A;  2JS2 A;  2CZ1 B;  2HQE A;  2V26 A;  3M57 A;  2OTL T;  4OB3 B;  4ZN1 A;  2RQT A;  3M0U A;  1N8R U;  5IHK A;  1LPL A;  1TUC A;  2VGN A;  4M77 C;  4MZT A;  4PK4 A;  3G71 T;  2VXE A;  4C0D C;  1MND A;  1S72 Q;  2YRD A;  4CI0 C;  3CCV T;  1S1N A;  3OW2 P;  1M2O A;  2CSI A;  4A63 B;  2GBQ A;  3JCM P;  3G4S A;  1I5O B;  3OYE A;  3G1J A;  1I4K 1;  4JLG A;  2KBT A;  1EX4 A;  2HQH A;  4XTV A;  4YTL A;  4IUP A;  2RM4 A;  2HBW A;  1KIK A;  1VQK T;  3JCM h;  3EG9 A;  4M78 G;  3JB9 F;  3CXC P;  4LUD A;  5GAM d;  2HNI A;  1X69 A;  1I0C A;  2KVQ G;  3SWN C;  2LJ0 A;  1YCY A;  4LXC A;  4F14 A;  2WSF E;  2FEI A;  1WLP B;  2QQA A;  1E7O A;  4M7A D;  3ER0 A;  2VGM A;  4OB0 B;  2DE0 X;  2GGR A;  1TU0 B;  5CIU A;  1A0N B;  4ME7 A;  2KEA A;  4C8Q C;  4NL3 A;  3MP6 A;  3KFV A;  2EBP A;  2DTO A;  4J9E A;  2OTJ T;  3OSV A;  5CK9 A;  1YP5 A;  4PJO A;  2QEX Q;  2COW A;  3CC4 T;  3CD6 Q;  1QVP A;  1TOV A;  3JSC A;  1M3C A;  4A4F A;  1QCF A;  4JJD A;  3I9Q A;  2KXC A;  2LQK A;  5GMK j;  5LJ5 h;  3MJX A;  3OW2 S;  1SHF A;  2AT1 B;  3OBY A;  3NHN A;  4C92 D;  4RCB A;  4ANJ A;  4PKC C;  4IUU A;  3ME9 A;  4E7J A;  4NS5 A;  3MEU A;  1OOT A;  2DL8 A;  3A98 A;  1VIF A;  2O4X A;  2IIM A;  3CCL A;  2RN8 A;  2J7I A;  2JTE A;  4X1V A;  3FC3 A;  4FIB A;  3JAM E;  3UAT A;  2BE9 B;  1NBE B;  3M58 A;  1RAC B;  3CXC S;  4E7L A;  5LJ5 e;  3FJ5 A;  1YJW T;  1QVF A;  2HKN A;  2Y4Y A;  1I81 A;  1RLP C;  1Q82 U;  2ZZD A;  1N9R A;  1VQ5 A;  4AFS C;  3C0C A;  2FZK B;  4JRP A;  2K6D A;  1TH7 A;  5GAM j;  3VRZ A;  3FEO A;  1TTH B;  2MOX A;  1VQ9 T;  4FYV B;  5GMK i;  3HSB A;  3C95 A;  4J8O A;  1XOV A;  1VIE A;  1FMV A;  4E6R A;  1WA7 A;  2YHT A;  2EQU A;  1VQ8 A;  1TS9 A;  2E1H A;  1WX6 A;  1UEB A;  3DLM A;  5FLX E;  2E65 A;  4NOY A;  1VQ7 A;  2RK1 A;  3E19 A;  4FU6 A;  5KYW B;  1DJ7 B;  5D6X A;  4ZTF A;  2VXF A;  5CO7 A;  4D8K A;  1TUD A;  4QQG A;  3VS5 A;  4QW2 A;  2RJC A;  4E7S A;  3JCM c;  3HFN A;  4PLI A;  3MEW A;  3FIF A;  2YUQ A;  2J6O A;  2WAC A;  5GAN g;  3V8K A;  3HHT B;  4XU1 A;  2CP7 A;  3PFS A;  2A36 A;  1WHL A;  2VB6 A;  3TCJ A;  1N27 A;  2RMO A;  1Q95 G;  5GAN 4;  2QQ9 A;  1XQH A;  1ZUU A;  4X9C A;  1M2V B;  2KT1 A;  4JRQ A;  2W10 A;  2ZPG B;  4HVU A;  1E6G A;  2COY A;  2KYB A;  2HQX A;  2CKK A;  1KG1 A;  2DIQ A;  1BU1 A;  4B6M A;  3CME A;  2DPP B;  2Y4X A;  3MP8 A;  5GAN 7;  1QLY A;  2NUT B;  4M77 D;  4F04 B;  3JCM J;  4PFZ A;  1VQO A;  1YJN Q;  4JS5 A;  4M7D B;  3CCE Q;  2VVK A;  2RQW A;  3OS2 A;  1PD1 A;  5GAN 2;  2RHX A;  3EGX A;  2PTK A;  2RPN A;  4HVW A;  2DL3 A;  2P4T A;  3G4S T;  1VQN A;  4R55 A;  1IGQ A;  1CSK A;  4AG1 C;  1OYX A;  2B8A A;  3A8G B;  1PHT A;  1GCQ C;  4M7A E;  2DL7 A;  1OX9 A;  1W1F A;  1PD0 A;  4CRI A;  3IQL A;  1M27 C;  3QYH B;  1MNE A;  2ROL A;  3FRN A;  3JCM d;  4PJO F;  5GAO m;  2EGE A;  2QDY B;  1HD3 A;  3L2W A;  1OPL A;  1YN8 A;  2RI5 A;  4IIO A;  1PSE A;  3PMI A;  1V1C A;  4LD6 A;  2ECZ A;  1ZQ1 A;  5LJ3 g;  3OYG A;  1ZA2 B;  4C92 E;  3CCQ A;  4JUV A;  5GAO q;  4QKU A;  2O2O A;  1NG2 A;  1G5V A;  2DZC A;  4F7U G;  4BB7 A;  2DK3 A;  3BW1 A;  1B34 B;  3M59 A;  4PLL A;  2BUD A;  2KK4 A;  3A8L B;  2D1X A;  1VYV A;  1IHV A;  2QYZ A;  3C4S A;  1NE8 A;  1K0X A;  1NYG A;  1QKW A;  4M75 G;  2KYM A;  3EGD A;  4FCY A;  3CC7 T;  1FMW A;  4KH0 B;  1WZO A;  3CCL T;  5LJ5 d;  2QXF A;  4X9D A;  4PJO B;  2VAS A;  4J5Y A;  2XDP A;  4E7K A;  4DEY A;  5A0G A;  1ACM B;  4AT1 B;  4Z89 A;  4EPC A;  1PWT A;  2LJ3 A;  5DY9 A;  4V2S A;  1WQW A;  1NJI C;  4BI8 B;  1U8R A;  4OMP A;  1MMD A;  2LJ1 A;  1Y07 A;  2QA4 A;  2YXY A;  2F5T X;  4FW1 A;  6AT1 B;  1VQ5 T;  2O4X B;  3TU4 K;  4QT7 A;  3X20 B;  1BCO A;  4RUG A;  1IGU A;  8ATC B;  3JCM W;  1UG1 A;  3INZ A;  3BY7 A;  3CC2 A;  1N8R C;  4OF1 A;  2QK0 A;  1ZBJ A;  2KT8 A;  2HEQ A;  2KY9 A;  2DJZ A;  5D6W A;  1YI2 Q;  2X9H A;  3P8H A;  4JLI A;  1VQ8 T;  4LDY A;  4A53 A;  2FO0 A;  1LJO A;  3X25 B;  2DXT A;  2DTI A;  4BE2 A;  2DNU A;  1VQ7 T;  3M0S A;  4XTW A;  5I22 A;  1X6G A;  3JV3 A;  2P0Q A;  1GBQ A;  2EW3 A;  2L3Q A;  3OSS C;  3PNW C;  1NJI R;  2JNG A;  3M9Q A;  3OMC A;  3EG1 A;  3P8B B;  3H0H A;  5EC7 A;  2HSE B;  2E64 A;  4M77 E;  2JVV A;  2J6K A;  1OX8 A;  3RR6 A;  1WPY A;  1X27 A;  2M9U A;  4KBM B;  1AZG B;  2EYX A;  3UA6 A;  2PNI A;  5FW9 A;  1VOM A;  1J3T A;  4M78 D;  2XI9 A;  1UGS B;  2DBK A;  3CCU Q;  1BB9 A;  1N8R R;  1W4S A;  1EFN A;  2KRS A;  5LJ5 j;  1I8F A;  1ABQ A;  3JB9 G;  1X43 A;  2R57 A;  1WHH A;  4PNO A;  3CME T;  2M0Y A;  2RQU A;  2DAQ A;  4HXJ A;  4IUQ A;  3RES A;  4BDY A;  1VQO T;  3CCJ A;  4M7A A;  2L3P A;  5LJ3 h;  4ELY C;  1KD1 C;  4NL2 A;  1K9M U;  2DFU A;  2X35 A;  2CT4 A;  1H92 A;  1VQN T;  1WI7 A;  2AIR B;  5DLO A;  2ED0 A;  4LD9 K;  1CKA A;  1Y96 A;  3M0R A;  3V7C A;  4A4E A;  1D1A A;  4C8Q E;  1AWJ A;  1AVZ C;  4XTX A;  5LJ3 e;  3NGP A;  3H9N A;  4C92 A;  4J9H A;  3S3O A;  4R0K A;  3CBO A;  2FG0 A;  3JB9 J;  1YHQ A;  4KUD K;  2OAW A;  5HKC A;  3OYD A;  1Q82 C;  3THK A;  1KD1 R;  4L5G A;  3NTH A;  1VQM Q;  3CCQ T;  4PFO A;  2ABL A;  4RMO A;  3OYC A;  1M1K U;  1D0Y A;  1Y0M A;  4O5V A;  4LDU A;  1YJW Q;  1D1B A;  4P5N A;  1UFF A;  5GAO r;  2CDT A;  4FSS A;  4A4G A;  3CCS A;  2B86 A;  4J6W A;  3OA6 A;  1Q7Y U;  4JRK A;  2DXB A;  4Z02 A;  2E5Q A;  1GXI E;  2XG8 D;  5CKE A;  3BE3 A;  2P84 A;  4E2F B;  1FX7 A;  2A37 A;  2RHZ A;  1OEB A;  4CC4 B;  2QTV A;  3HKS A;  3SHW A;  1QKX A;  2J6F A;  4PL6 A;  1Q82 R;  2QDL A;  2OX7 A;  3LWH A;  4C0F A;  1IRE B;  1IRX A;  4QQD A;  2QI2 A;  2CP5 A;  2KRN A;  1K73 C;  2QA4 T;  2VWF A;  2KNB B;  2MWO A;  2C0I A;  2KXD A;  4L59 A;  2CH4 A;  3EGD B;  2KDS A;  5LJ3 f;  1G3T A;  5KYX B;  4J9G A;  3C94 A;  4EMH A;  3J80 E;  2EYQ A;  4ZNX A;  4OMQ A;  3CC2 T;  1QP3 A;  1UDL A;  3MKD A;  5CQX A;  1KQS A;  5I11 A;  3H41 A;  5CR2 A;  4M77 A;  3JB9 I;  2L8D A;  2HD0 A;  3CPF A;  3CEY A;  2JM8 A;  2KE9 A;  2P0K A;  2EKO A;  1QCN A;  2O9V A;  2MMP A;  2VKN A;  2QGG A;  2MI6 A;  1VQ6 Q;  3OB9 A;  4C5E A;  1U5S A;  3QXE B;  4J6Y A;  1IO6 A;  3QJ6 A;  2K79 A;  5KCH A;  4F7U B;  4M7A F;  2IVW A;  2NUZ A;  3REB B;  3G4S Q;  4MDX A;  3FB9 A;  2L3R A;  1T0H A;  5GAN 6;  2L89 A;  3NMZ C;  1M30 A;  2DVJ A;  3H0F A;  2DBM A;  4LDV A;  3LLR A;  3SWN A;  5FWB A;  1HJD A;  4JRI A;  1X6B A;  1V76 A;  2V1Q A;  3VRY A;  1NEG A;  1WXT A;  2KQW A;  3CCR A;  1G83 A;  1OV3 A;  4M75 B;  2ED1 A;  4JZ3 A;  9ATC B;  2RA2 A;  3OYM A;  4PJO G;  5GMK l;  2E3H A;  3CCJ T;  4FSX A;  2EQM A;  2HCK A;  4C8Q A;  4C92 F;  3L2U A;  4RCC A;  1VQ4 A;  1YIT Q;  2SRC A;  1TWB A;  1YNZ A;  2F5K A;  2QGF B;  3HP9 A;  2HDA A;  2GFU A;  5LJ3 d;  4EDU A;  1U1T A;  4WF2 A;  3EHQ A;  2O88 A;  3G6E Q;  1VQP Q;  2PVG B;  4HT8 A;  4BDZ A;  1Y71 A;  1UB4 A;  1NPP A;  1RAB B;  3M53 A;  3PIO A;  1UHC A;  1VQL A;  1WXB A;  1NEB A;  2RK2 A;  2PVD B;  2KI7 A;  5KYU A;  2KGT A;  4M75 D;  2E4H A;  4J9B A;  3H6Z A;  3DB4 A;  1QWE A;  1YIJ Q;  2RQR A;  3GNG A;  2A08 A;  3CPW P;  3VUB A;  2P0P A;  1YHQ T;  1ZA1 B;  3RDV A;  2A7Y A;  2NLU A;  1B7T A;  2XIC A;  1MUZ A;  2MK5 A;  2BTT A;  3CC7 Q;  4AFQ C;  1PCX A;  4M7D C;  2DX1 A;  1QW1 A;  5GAN 3;  2DEQ A;  4HCZ A;  3VS2 A;  4OB2 B;  3VS6 A;  2ATC B;  2BKD N;  2EPD A;  1PSF A;  1KJW A;  1PNJ A;  1UHF A;  1BYM A;  2MYS A;  1S72 A;  1UGR B;  5D7U A;  1KD1 U;  1GBR A;  3LH0 A;  3QDF A;  4DEX A;  2X4W A;  3OS0 A;  2DYI A;  3M56 A;  1K8A C;  3CCS T;  2YT6 A;  5I2S A;  4OMF B;  1NM7 A;  3CBM A;  1BK2 A;  4J9D A;  4L6V 5;  3L2R A;  1WHJ A;  1XNI A;  2C0T A;  2XHC A;  2EQI A;  3LX7 A;  1W2B A;  1C6V X;  1NLP C;  3AT1 B;  2K57 A;  4HT9 A;  1P92 A;  5LJ3 j;  1RAF B;  4M77 F;  4D8D A;  1HSQ A;  2C06 A;  1M5Q 1;  3RER A;  1QMC A;  1BBZ A;  3A5Z B;  3CPW S;  4OML A;  3QII A;  5KE2 A;  2E10 A;  1JJ2 P;  4J9F A;  3GP8 A;  5AT1 B;  2CZ0 B;  1KK7 A;  2YLC A;  2J06 A;  1K8A R;  5ECA A;  1OU8 A;  3C12 A;  2DER A;  3JB9 D;  4KUI A;  1GRI A;  2QEX A;  2EYY A;  5KYN A;  2R58 A;  3CCM Q;  1I1J A;  2LX9 A;  4J9C A;  1K9M C;  3JRZ A;  4QVD A;  4Y92 A;  2KMT A;  3FJP A;  1SG5 A;  1WYX A;  2DRM A;  2H3J A;  2EFI A;  3OYL A;  1KFZ A;  3M0P A;  4LDW A;  4LDX A;  3X28 B;  1ZSZ C;  3UWN A;  1WHM A;  2BZY A;  1UE9 A;  1PRL C;  2MWP A;  2HBP A;  4GY5 A;  3OQ5 A;  1WQ7 A;  2EAY A;  1GCQ A;  3JCM Q;  2JTM A;  3MCA B;  2M0O A;  4Z88 A;  2JT4 A;  4C8Q F;  3VUZ A;  4B9X A;  2EYW A;  1K73 U;  1LNX A;  3PIP A;  4C5G A;  5KH6 A;  4KUL A;  5IHN A;  4M78 C;  2E5K A;  1K9M R;  5CQY A;  2VV5 A;  3CCR T;  4RTX A;  2EJF A;  1TUG B;  4JZ4 A;  4E7H A;  2ZPI B;  2RF0 A;  2NYS A;  4CC2 A;  1M1K C;  1JJ2 S;  1HYO A;  3VS3 A;  2K5F A;  4QVZ A;  2PVO B;  2DD4 A;  2FPE A; 
#chains in the Genus database with same CATH homology
 4N4G A;  2ZGW A;  4PJO E;  2CZ7 B;  4FT2 A;  4VUB A;  1VQ7 T;  4C92 C;  4XTW A;  1X01 A;  4N4I A;  4C92 B;  1M90 U;  1VQ4 T;  1BI3 A;  1XTD A;  2P0Q A;  3SWN B;  4M7D G;  2XDB A;  3OSS C;  1B34 A;  3VV0 A;  3PNW C;  2DVE A;  1YIT A;  2JNG A;  3M4Y A;  2FB7 A;  3M9Q A;  1WJS A;  3OMC A;  3P8B B;  2QQB A;  3Q1J A;  3UT1 A;  3ZFJ A;  4ZN3 A;  5KE3 A;  5GAN 5;  4BAC A;  1Q7Y C;  2E64 A;  4DA4 A;  4MZM A;  5FRO A;  4M77 E;  2JVV A;  3G6E A;  2PUK B;  3P8D A;  1NPR A;  4QVC A;  3JCM e;  4C5H A;  1VQP A;  4OGC A;  4F7U F;  1YJW A;  5D6Y A;  1WPY A;  3CMA T;  4ATO A;  5FU6 C;  2M9U A;  3OYB A;  3QJY A;  4KBM B;  5FRN A;  3NTI A;  2V8I A;  4Y28 E;  2QQS A;  5DLQ E;  4XU2 A;  1YJ9 T;  3QDR B;  4M78 D;  2XI9 A;  3DLL A;  4IKF A;  1Q86 U;  2RI3 A;  4TVR A;  1UGS B;  2RO0 A;  3ZEH A;  3BDL A;  2E6Z A;  1W4S A;  2X4J A;  1VQ9 A;  3HRT A;  3QSU A;  2M16 A;  1I8F A;  5LJ5 j;  4MZP A;  2G3R A;  2QTX A;  3JB9 G;  3LYI A;  2R57 A;  3UDC A;  4M75 F;  4PNO A;  3QZ9 B;  3CME T;  1O75 A;  4M7D D;  1YIJ A;  3O8V A;  4XTU A;  5I21 A;  2RJD A;  2K4Y A;  2DAQ A;  3OYY A;  2K3Y A;  4IUQ A;  3RES A;  3RKY A;  3OYN A;  4D6W A;  3CXC A;  5C0M A;  1IZ6 A;  4BDY A;  1VQO T;  3CCJ A;  4M7A A;  2JUF A;  4ELY C;  5LJ3 h;  2XK0 A;  1KD1 C;  2K2V A;  2X4Y A;  4NL2 A;  2FHD A;  2EJ9 A;  3CC7 A;  1K9M U;  2KAF A;  2WSC E;  1YJN A;  1VQM T;  4A4H A;  2ZPE B;  3HPW A;  1JB0 E;  2FYK A;  4FM4 B;  1W2B S;  2X35 A;  1S72 T;  4C5I A;  3L2Z A;  1VUB A;  2K5L A;  3MO8 A;  1JRI A;  4IUV A;  1VQN T;  4C0Z A;  5FU7 B;  1HXD A;  5HK0 A;  3S6W A;  1UGQ B;  2XID A;  2YLB A;  4M78 A;  5DLO A;  5M9O A;  2DKG A;  1ZBX A;  3EFS A;  3NTK A;  3H8Z A;  3X26 B;  1BKB A;  3MEV A;  3JCM X;  4LD9 K;  3CD6 A;  1WJR A;  1Y96 A;  3EFR A;  3V7C A;  1YBY A;  4A4E A;  1G3Y A;  3LGL A;  4UC4 A;  3QKJ A;  2BIV A;  4C8Q E;  4EMK C;  4XTX A;  5LJ3 e;  1NJI U;  3OS5 A;  1YI2 T;  3CBP A;  3T9N A;  4BY6 C;  3OBW A;  2ZPF B;  4BY6 B;  4C92 A;  1V29 B;  1Q81 C;  3S3O A;  1M1F A;  3ZBD A;  5GAM g;  1U1S A;  3FLG A;  4PJO C;  4BI4 A;  3S3M A;  3GF5 A;  4M78 F;  1M8V A;  3RKX A;  3URG A;  2HAX A;  3CBO A;  1G3S A;  4OVA A;  2RJE A;  2L5Q A;  3JB9 J;  1YHQ A;  2CZ1 B;  2HQE A;  2OTL T;  3M57 A;  5HKC A;  3OYD A;  1Q82 C;  4KUD K;  3MET A;  2ZCF B;  4OB3 B;  2RI2 A;  3PT9 A;  5GAN h;  4ZN1 A;  4M7D F;  4L5G A;  3NTH A;  1N8R U;  2FVU A;  2VGN A;  4M77 C;  4MZT A;  2QQR A;  4M77 B;  3G71 T;  3CCQ T;  2VXE A;  4C0D C;  4CI0 C;  3CCV T;  4C0D B;  3JCM f;  2IG0 A;  3E9G A;  4RMO A;  3OYC A;  1M1K U;  3JCM P;  3GLX A;  1QVG S;  3G4S A;  4M7A G;  4IUR A;  4O5V A;  5IAY A;  3OYE A;  1I4K 1;  2RH2 A;  4JLG A;  3PMT A;  4ELZ C;  4LDU A;  4XTV A;  4P5N A;  5GAO r;  4F7U E;  2MAM A;  2JZ2 A;  4YTL A;  2VC8 A;  4IUP A;  3SDZ A;  4J6X A;  4XK8 E;  2QEX T;  2LDM A;  2RM4 A;  1VQK T;  4A4G A;  3RMS A;  2GQV A;  2E70 A;  3JCM h;  3OYA A;  4J6W A;  3OA6 A;  3CCS A;  3WVD B;  5GAN e;  1Q7Y U;  4E7I A;  4JRK A;  3CCM A;  2DXB A;  4M78 G;  4Z02 A;  2GF7 A;  4DOW A;  3JB9 F;  4PJO D;  3N5B B;  2M1H A;  5GAM d;  2E5Q A;  4IUT A;  2HNI A;  2XG8 D;  4RKU E;  5J39 A;  2VUB A;  1O9S A;  1GXI E;  5CKE A;  1K8A U;  2DXC A;  4ZTJ A;  3HRU A;  3OYI A;  3OYF A;  4XU3 A;  5AYF A;  1FX7 A;  1R8O B;  2RHZ A;  2KVQ G;  3FC3 A;  2DD5 A;  3HKS A;  3SWN C;  4M75 E;  5IT9 E;  1YCY A;  3RKW A;  2WSF E;  4PL6 A;  3OYJ A;  2KSS A;  2OAU A;  2D6F A;  1KC8 C;  1KQ2 A;  3OMG A;  2QQA A;  3LWH A;  4M7A D;  4C92 G;  3ER0 A;  3LGF A;  4XU0 A;  4C0F A;  1IRE B;  4QQD A;  2QI2 A;  1VQ6 T;  2VGM A;  4OB0 B;  3QG1 A;  4HA8 A;  1K73 C;  4EMK A;  2QA4 T;  1VQL T;  2LT4 A;  5CIU A;  2MWO A;  1D3B A;  5LJ5 f;  4L59 A;  4ME7 A;  3OW2 A;  2DIG A;  4C8Q C;  4X34 A;  4C8Q B;  3MP6 A;  2DZ9 A;  4NL3 A;  2LQ8 A;  1M4Z A;  2KDS A;  4GLK A;  2DTO A;  2OTJ T;  3OSV A;  3RIR A;  5CK9 A;  4MMK A;  1G3T A;  4QQ6 A;  5LJ3 f;  4ZGE B;  4PJO A;  3C94 A;  4DOV A;  4EMH A;  3J80 E;  2EYQ A;  3CC4 T;  1QVP A;  3JSC A;  4A4F A;  3CC2 T;  1QP3 A;  4HCB A;  4OP0 A;  1N6A A;  1M1G A;  5CQX A;  5DM7 R;  2LQK A;  4XTY A;  2I2L A;  5GMK j;  5LJ5 h;  1KQS A;  3LW5 E;  3OW2 S;  1KHI A;  5CR2 A;  1MHN A;  3OBY A;  1X6O A;  4C92 D;  4RCB A;  4R56 A;  1M90 C;  4PKC C;  4IUU A;  4M77 A;  1M9S A;  3ME9 A;  2FL7 A;  3JB9 I;  4E7J A;  2XU8 A;  2L8D A;  3MEU A;  4J83 A;  2HD0 A;  3CEY A;  3CPF A;  2P0K A;  4NS5 A;  3M55 A;  5CVI A;  1VIF A;  2EKO A;  2O4X A;  3CCL A;  3CCE A;  1RI0 A;  3HL8 A;  3KUF A;  4B9W A;  3SFM A;  1QP2 A;  2MMP A;  4RG8 A;  3RUX A;  3QBY A;  5CCA A;  4FIB A;  3JAM E;  3E9F A;  3UPU A;  2D9T A;  3CPW A;  2MI6 A;  2XD0 A;  3MHX A;  1ZHI A;  5FU7 C;  1Q81 U;  3OB9 A;  4C5E A;  5A0L A;  3M58 A;  2DXU A;  4Y91 A;  2PUO B;  1YIT T;  2CS7 A;  1X75 C;  3QXE B;  3CXC S;  2Y90 A;  4J6Y A;  1HK9 A;  4JDS A;  4E7L A;  4M7D E;  3J7A F;  1AHJ B;  3QJ6 A;  4C8Q D;  3A8H B;  5LJ5 e;  3G6E T;  1YJW T;  1VQP T;  1QVF A;  5KCH A;  4F7U B;  4M7A F;  2Y4Y A;  1NZ9 A;  1I81 A;  2IVW A;  3HRS A;  3V8L A;  4II1 A;  1Q82 U;  3MEA A;  2ZZD A;  1N9R A;  5GMK e;  1VQ5 A;  4MDX A;  3OYH A;  2RJF A;  2L3R A;  3FB9 A;  2EWN A;  3A8M B;  4JRP A;  3EAE A;  5GAN 6;  1TH7 A;  2L89 A;  5GAN f;  5GAM j;  2E41 A;  4LDV A;  3LLR A;  3FEO A;  5IN1 A;  3SWN A;  4E47 A;  3F70 A;  1VQ9 T;  5GMK i;  5CKH A;  4JRI A;  4MDW A;  2PU9 B;  3CCU A;  3HSB A;  3C95 A;  4J8O A;  3GOX A;  2JN0 A;  2KQW A;  1XOV A;  4M75 C;  5CKB A;  3VYG A;  3CCR A;  1VIE A;  4M75 B;  1MGQ A;  2RD1 A;  2ZPH B;  1JBM A;  3OYK A;  4RG2 A;  5A0D A;  1YIJ T;  1H3Z A;  3I56 A;  5C6S A;  2JTF A;  2RA2 A;  3OYM A;  2R5M A;  4KT0 E;  4PJO G;  2YHT A;  2EQU A;  5GMK l;  5A2Q E;  4BD3 A;  3G7Z A;  1VQ8 A;  3BDU A;  2E1H A;  3I55 A;  2D0Q B;  2VYT A;  3CCJ T;  4FSX A;  1UEB A;  2EQM A;  3DLM A;  5L8R E;  2E65 A;  5FLX E;  1BI1 A;  4NOY A;  1VQ7 A;  2LCC A;  2RK1 A;  3E19 A;  4FU6 A;  4C8Q A;  4C92 F;  3L2U A;  4RCC A;  1YJN T;  1DJ7 B;  3BFM A;  2RHI A;  5D6X A;  4ZTF A;  2VXF A;  3RMQ A;  1VQ4 A;  1H64 1;  5CO7 A;  4QQG A;  2F5K A;  3JCM V;  3HP9 A;  4QW2 A;  2RJC A;  4M77 G;  3JCM c;  2LTO A;  2GFU A;  2LCL A;  2LVM A;  1U1T A;  3HFN A;  4WF2 A;  4PLI A;  5I2M A;  5LJ3 d;  2PVG B;  3MEW A;  3FIF A;  5GAM e;  2WAC A;  2V8J A;  5GAN g;  3V8K A;  1Y71 A;  4BDZ A;  1UB4 A;  3HHT B;  4XU1 A;  3PFS A;  4OGE A;  3TCJ A;  3CD6 T;  1N27 A;  2JOY A;  1NPP A;  2YRV A;  4A54 A;  1KC8 U;  3M53 A;  3PIO A;  3CMA A;  1VQL A;  5GAN 4;  2F69 A;  2QQ9 A;  1XQH A;  1N9S A;  4X9C A;  2RK2 A;  2LT1 A;  1KQ1 A;  2LNV A;  1YJ9 A;  2PVD B;  5GAN 8;  5GMK m;  4JRQ A;  2ZPG B;  2CGH A;  3M54 A;  1JJ2 A;  4M75 D;  2HQX A;  2GCX A;  3H6Z A;  3DB4 A;  2CKK A;  1KG1 A;  2DIQ A;  4J7I A;  2WSE E;  3GNG A;  3A8O B;  4M78 B;  3CME A;  2DPP B;  3QZ5 B;  2Y4X A;  4OB1 B;  3JCM g;  3MP8 A;  3VUB A;  5GAN 7;  2P0P A;  2RHU A;  3E1S A;  4M77 D;  4N4H A;  1YHQ T;  2A7Y A;  2NLU A;  4BE0 A;  2A3L A;  2XIC A;  4DQ2 A;  3JCM J;  2E6N A;  3V8J A;  3QPH A;  4F7U A;  5KCO A;  1VQO A;  4M7D C;  4ZGJ B;  4JS5 A;  4M7D B;  1QW1 A;  3QUI A;  5GAN 3;  2DEQ A;  4HCZ A;  4OB2 B;  3FDR A;  5GAO l;  3OS2 A;  2EJG A;  2BKD N;  1VQM A;  5GAN 2;  2K5I A;  1PSF A;  2EQJ A;  2RHX A;  3L2V A;  2DO3 A;  1BYM A;  3OY9 A;  2X4X A;  1S72 A;  1UGR B;  5GAN d;  1KD1 U;  2P4T A;  3G4S T;  3PTA A;  2LRQ A;  4BE2 A;  1VQN A;  4N0A C;  4O6J A;  4Q5W A;  1LOJ A;  4R55 A;  4MML A;  3LH0 A;  2XDD A;  1OYX A;  2X4W A;  4M75 A;  4C8Q G;  2PQW A;  3KXT A;  2B8A A;  3S3N A;  3OS0 A;  2O01 E;  3A8G B;  4M7A E;  3M56 A;  4C0G A;  1K8A C;  3CCS T;  5I2S A;  4OMF B;  3SB2 A;  5FU6 B;  3GNF B;  3GIB A;  3CBM A;  3X24 B;  4CRI A;  3CCM T;  5GMK h;  1YI2 A;  1WNL A;  3QYH B;  1G3W A;  4L6V 5;  3L2R A;  2DTH A;  4HKE A;  3FRN A;  1XNI A;  3JCM d;  4M78 E;  4PJO F;  2XHC A;  5GAO m;  1I5L A;  2QDY B;  3PGG A;  3QYG B;  4EMG A;  3L2W A;  1KQS S;  4XQ3 A;  5LJ5 g;  1UGP B;  3LX7 A;  5CAI A;  1W2B A;  2RB6 A;  2RI5 A;  1PSE A;  3NFC A;  3PMI A;  2K57 A;  2OTL A;  1P92 A;  4HT9 A;  5LJ3 j;  4PJO B;  1OI1 A;  4ZGD B;  4LD6 A;  3SD4 A;  1BIA A;  1ZQ1 A;  4EDU A;  5LJ3 g;  5GAM f;  3KBG A;  3OYG A;  4HT8 A;  4M77 F;  3HFO A;  1Q86 C;  2E12 A;  4C92 E;  3G71 A;  4FL6 A;  3CCQ A;  2C06 A;  1M5Q 1;  4JUV A;  3CCV A;  3RER A;  2EIF A;  3JB9 H;  5GAO q;  3A5Z B;  3CPW S;  4A4K A;  1Y7X A;  5HY6 A;  1G5V A;  2DZC A;  3QII A;  1BI2 A;  2E10 A;  2ZPB B;  2LC4 A;  4F7U G;  5KE2 A;  4BB7 A;  4BI3 A;  3TEE A;  2DK3 A;  3BW1 A;  3GP8 A;  1B34 B;  2CZ0 B;  3V7R A;  2YLC A;  3M59 A;  4PLL A;  3R6O A;  5GAM h;  4FT4 A;  2BUD A;  3C12 A;  1QVF S;  2KK4 A;  3JB9 D;  4KUI A;  2AHJ B;  3A8L B;  3ASK A;  2QEX A;  1WGS A;  3VU3 C;  2R58 A;  2V8K A;  1VQK A;  2CZ6 B;  2LX9 A;  3C4S A;  2XKO C;  1K9M C;  1OZ3 A;  1NE8 A;  3JRZ A;  4QVD A;  3V7S A;  4EMK B;  4M7D A;  2KMT A;  3FJP A;  4J7F A;  3TRE A;  3L42 A;  4BE1 A;  1D3B B;  4M75 G;  3DKM A;  2H3J A;  3LWI A;  1BI0 A;  3CC7 T;  5J26 A;  2EFI A;  3OYL A;  3CCL T;  5LJ5 d;  1EIF A;  2QXF A;  1RL2 A;  3CCE T;  5GAO p;  3JCM b;  1WJQ A;  3VKI A;  2RHY A;  2EQK A;  4X9D A;  4J5Y A;  2XDP A;  3DB3 A;  4LDW A;  4BUG A;  1FWZ A;  3GPL A;  4N0A A;  3X28 B;  5A0G A;  4E7K A;  4LDX A;  3UWN A;  5FRM A;  4EPC A;  5GAN j;  4HCC A;  3M4G A;  1QVG A;  2MWP A;  2HBP A;  4GY5 A;  3OQ5 A;  1WQ7 A;  1VQ6 A;  5DY9 A;  2EAY A;  4V2S A;  1WQW A;  5EG2 A;  4JS4 A;  1NJI C;  3QHS A;  4BI8 B;  1U8R A;  3OS1 A;  1Y07 A;  2QA4 A;  1OZ2 A;  4M7A C;  2F5T X;  3JCM Q;  2JTM A;  4M7A B;  3MCA B;  1FXX A;  3VJP A;  2R5A A;  2MF2 A;  2M0O A;  5GAO n;  3L2Q A;  1VQ5 T;  5J3B A;  2O4X B;  4C8Q F;  3M5A A;  2K3X A;  3VUZ A;  4B9X A;  3TU4 K;  5HK3 A;  1K73 U;  3WXM B;  1LNX A;  2OTJ A;  3PIP A;  3X20 B;  4C5G A;  1SSF A;  5KH6 A;  3CC4 A;  3QO3 A;  4KUL A;  3JCM W;  4M78 C;  3INZ A;  3BY7 A;  3CC2 A;  3CCU T;  3AHU A;  5CQY A;  3J81 E;  2VV5 A;  3CCR T;  1N8R C;  4OF1 A;  4XTZ A;  3VYH B;  3WVE B;  2EJF A;  2KY9 A;  2CYZ B;  5LL6 S;  2DJZ A;  3I56 T;  5CKF A;  5D6W A;  1Y96 B;  2GFA A;  4E7H A;  3MP1 A;  3P8H A;  2ZPI B;  4JLI A;  1KHC A;  1BIB A;  4JJN K;  4LDY A;  4A53 A;  1VQ8 T;  1LJO A;  1M1K C;  1JJ2 S;  3X25 B;  3I55 T;  5CKD A;  2DXT A;  2K5F A;  2DTI A;  4QVZ A;  4XAX B;  2PVO B;  3L1A A;  2DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...