4F7UB

The 6s snrnp assembly intermediate
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
93
structure length
80
Chain Sequence
b'EEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVNKDRYISKMFLRGDSVIVVLRNPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Small nuclear ribonucleoprotein Sm D1
molecule tags Splicing
source organism Mus musculus
publication title Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
pubmed doi rcsb
total genus 17
structure length 80
sequence length 93
chains with identical sequence D
ec nomenclature
pdb deposition date 2012-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4f7uB00
1JRIA 1WPYA 5GAN2 4WF2A 3JCMW 2VC8A 4C8QF 4X9DA 1I4K1 2EAYA 4F7UG 3JB9I 2RA2A 4M78F 4PJOG 1BIBA 2DZCA 2RB6A 3JCMh 4M77B 4A53A 2E65A 1KQ2A 4M75D 3V8KA 4JRIA 4F7UF 2YLBA 2RM4A 3INZA 3V7CA 3VU3C 4M7AC 4M77G 4XTZA 3BY7A 4M78E 1LNXA 4JLIA 4C8QD 4PJOB 3RIRA 4V2SA 5GMKe 2DXTA 2DKGA 2DZ9A 5GAMg 4M7AA 1YCYA 3SWNB 5GMKj 4HT8A 2FYKA 3JCMf 4M7DF 5CAIA 4C8QE 4M75F 4RCCA 5GAOl 3EFRA 1I5LA 3RKWA 4QVDA 5GMKi 5GAOn 5GANj 4MMKA 1D3BB 2EJFA 1Y96A 1WQ7A 5LJ3d 1TH7A 4MMLA 4M7DD 1M8VA 5LJ3h 4M77F 5GAN7 5GANh 1N9RA 3GIBA 5GAMd 5GAOq 1B34A 2E1HA 4J6XA 4PJOA 1I8FA 4M78C 5GAMh 2DJZA 4M78G 4HA8A 1H641 4PJOF 5LJ5e 5GMKl 3JB9G 5GMKh 3JCMV 4C92B 2E10A 3RKXA 3FB9A 4PJOC 4M77D 2K57A 4XU2A 4M77A 5GAN5 4QVCA 4C8QC 5GAN8 5GAOp 5GANf 3PGGA 3QSUA 4EMKB 4C92C 2JN0A 4PJOD 5GAOm 2DTIA 5LJ3f 4DQ2A 2DXUA 3M4GA 2ZGWA 3SWNC 1LJOA 2DTOA 2Y90A 4X9CA 4M75A 4M7DA 5LJ3e 3JCMc 4M78B 4OP0A 4HT9A 4M7AD 1HK9A 3RUXA 4M7DG 4F7UB 3HSBA 1MGQA 2E41A 4M7DC 2EWNA 3L2ZA 4XTUA 3BDUA 3FIFA 5GAOr 2VXEA 2VXFA 2DTHA 3V8LA 3SB2A 5GAMj 4M75E 3HFOA 4F7UA 3JCMX 3JCMQ 5GANd 2E64A 2HNIA 2YLCA 5GAMe 1BIAA 5GMKm 4JRKA 5GAN4 3JCMP 4M78A 3V8JA 3JB9D 4M7AF 1Y96B 4M75B 4EMGA 4C8QB 4C8QA 5LJ3j 5LJ5j 3JCMd 3JB9J 4C92E 4XTYA 4J5YA 4PNOA 4XQ3A 3QHSA 1U1SA 4XTVA 4PJOE 1LOJA 4EMKA 4C92D 3RKYA 5LJ5f 3JB9F 3V7SA 4J6WA 4M75C 1WQWA 4M77E 5GAMf 4XU1A 4Y91A 3EFSA 3QUIA 5I21A 2RD1A 4XU0A 5GAN3 3QO3A 4C92F 3HFNA 4XU3A 4M7AB 1I81A 1N9SA 4XTXA 1U1TA 2YHTA 2CGHA 2DEQA 4J6YA 5LJ5g 4M7AE 3JCMe 4M7DE 2FB7A 2I2LA 4EMHA 4A54A 3JCMb 3JCMg 5GANe 2QTXA 4NL3A 4N0AA 3BW1A 5LJ5d 4M7AG 4C8QG 3RESA 5GANg 1M5Q1 1JBMA 3FJPA 4RCBA 4EMKC 3JB9H 5GAN6 1X01A 3BFMA 2EJGA 4NOYA 4N0AC 5DY9A 4F7UE 4NL2A 3SWNA 4M77C 5LJ5h 3JCMJ 1HXDA 4C92G 1KQ1A 3AHUA 2EJ9A 5LJ3g 1WNLA 4M75G 4M78D 4C92A 3RERA 4M7DB 4XTWA 1D3BA 3L1AA 4JUVA 2DVEA 3V7RA 1B34B
chains in the Genus database with same CATH superfamily
1YFNA 1IRXA 1YN8A 2GTJA 2OX7A 4JRPA 3OBWA 3CQTA 1YJWA 2LTOA 1AWOA 3MEAA 1VUBA 1ZHIA 1M1GA 1YI2T 2OTLT 2H3EB 5FU7B 5GANj 1KHIA 2AZVA 1GRIA 1QVGS 4A4HA 1MMNA 1TS9A 3QZ5B 3LGFA 2OTJT 2I0NA 1ZUUA 1S72Q 1WXUA 5GAN5 2C0TA 4QQGA 4JLGA 3D7SB 2PQWA 1LJOA 3MKDA 1VQ4Q 2EGCA 1KHCA 3URGA 1SPKA 2Y4YA 4J8OA 3A8OB 3MPUB 3WXMB 3JCMQ 1YHQT 2V8IA 1D09B 2F69A 4J9HA 2X4WA 5GMKm 1HSQA 1VQ5A 1UHFA 4N4GA 4M75B 1VQ7T 1VQ6Q 2BE9B 1MNEA 3DLLA 1VQKT 1F1BB 3PMTA 2K3XA 2A36A 2RHXA 1NJIC 2DNUA 3C95A 5GAMf 2FPEA 1SG5A 2V8JA 3UF4A 1AWJA 1KQSP 1R0BG 2YHTA 3PFSA 5GANe 2QTXA 3VRYA 1VQOT 1E6HA 2RQTA 2KBTA 2X9HA 4NOYA 2NUPA 2D8HA 4E7SA 1WHJA 1VIEA 2BZ8A 2KRSA 3CC2Q 1WNLA 3M0SA 1P92A 2VV5A 1D3BA 5LL6S 1B34B 2JMCA 2O9VA 2DYBA 2FVUA 1YIJQ 3CCJQ 2H3JA 2NWMA 3HRTA 2BIVA 2AKKA 3FLGA 2A7YA 4KGZB 4Z8AA 1H3ZA 3QIIA 3ASKA 2RI3A 2EJFA 1AOJA 1WQ7A 2ATCB 4LD6A 5LJ3h 5HK3A 3L2VA 4ATOA 1M2VB 1W2BS 1IB8A 4KH0B 5GMKl 5I22A 1EFNA 4IURA 1KD1R 1QVPA 4RTWA 1T3SA 5GAOp 4EMKB 2QXFA 3NTIA 2JNGA 2QK0A 1VQOA 2HQXA 4IIMA 1PKSA 2YUPA 5FU7C 1BCMA 3EGDA 1WHHA 2HMAA 3OQ5A 3G71T 2DMOA 4B9WA 1OU8A 4HXJA 3QSUA 4JRKA 2DAQA 2PUOB 3JB9D 3VS0A 4EMGA 1M1FA 2R5MA 1U06A 2E3IA 1Y07A 5EG2A 3OYEA 1UGPB 3OSVA 2QI2A 3MP8A 2RMOA 1O9SA 2BZYA 3C12A 2MOXA 4Y91A 5D6YA 3EGXA 1SRLA 2O01E 2PTKA 2F2WA 1PCXA 1K76A 4XTXA 2XD0A 2LX7A 1RAEB 4PK4A 5FW9A 1SEMA 4OMLA 1B3QA 1Z9QA 1TU0B 1KFZA 1QVGP 2HCKA 2EQMA 2QEXQ 1K73C 3MP6A 2DD5A 4Z02A 4FIBA 1VQ8Q 1AWWA 4RMOA 1N5ZA 3CXCS 2GFAA 1JXOA 2DETA 2XDPA 3INZA 1RAAB 4OMNA 1TG0A 1V29B 1PHTA 1M1KU 4FYVB 4BE2A 1KSWA 4Z88A 1ZUYA 2CZ7B 2Y4XA 1ZQ1A 2ZZDA 5GAOn 1X6OA 1NJIR 3C0CA 3HHTB 1XQHA 1YITA 2HKNA 2LX9A 5FROA 2A08A 1N9RA 2RN8A 1T0HA 5GAOq 2ROLA 2ESWA 3QYHB 1WXBA 4QVCA 4C5IA 5CKFA 2FO0A 2Y90A 1VQ5T 4OP0A 1HK9A 1UGRB 2J6FA 4M7DC 2ECZA 5GAMj 5FU6C 2QDLA 4PKCC 2V1QA 4LD9K 3TU4K 4J5YA 2R58A 8AT1B 1SF9A 3ZL7C 2LT1A 4A4GA 4LUEA 1PSEA 3CCJT 3VS4A 1WIEA 4ZNXA 5KYWB 1HD3A 8ATCB 1UFFA 1TUDA 1H3HA 5GAN3 3EGXB 4XU3A 1RAFB 2CGHA 2I2LA 2CZ0B 3S3MA 4HKEA 3G6EA 2DD4A 1OOTA 1WJQA 3P8HA 2RQWA 2AT1B 4RKUE 1KK7A 4L6V5 1NEGA 3LYIA 4OVAA 3HL8A 1V76A 2M51A 2K7AA 2KROA 4GY5A 2D6FA 4OB0B 1KD1C 4M78F 1YIJA 1Q82C 2K6DA 2D0NA 4JRIA 2RK1A 1CSKA 1WHKA 4ZN1A 5GMKe 4OMQA 3G71A 2E12A 4CC3A 1E6GA 3OS5A 3JCMf 3IQLA 1VQPA 4YTLA 1ZLMA 2L5QA 2VUBA 3CCLA 4CC7A 2YT6A 2VKNA 1QVFP 3I35A 5FLXE 3CCQA 2DVJA 2M02A 1UECA 3NTKA 2K5LA 2DJZA 1H641 2HSEB 4PJOC 4HVVA 5J3BA 2JZ2A 3QWYA 2O31A 1G3YA 1JJ2S 4PJOD 2A0FB 4J9CA 3CC4Q 4AFUC 5LJ3e 2DBKA 3I55A 4QQ6A 4FW1A 3I56T 2WSEE 4AFZC 3CCUA 4PL6A 2PVOB 1BIAA 4M78A 2F2XA 1WI7A 3X25B 4RTYA 3UPUA 4XQ3A 3QHSA 4XTVA 4BI8B 2WSCE 1X2KA 1WQWA 4Q5WA 1KJWA 3OYKA 4B6MA 4C5HA 2RI2A 4FYXB 1BCOA 1VQLA 4J6YA 4RG2A 3CC4T 3JCMe 2EGAA 1PSFA 1U3OA 5EC7A 1VQLT 3VS5A 2RO0A 4GLKA 1KQ1A 1VA7A 3X20B 3N5BB 3RERA 4IIOA 3SD4A 4M75E 1UJYA 2NUTA 1VQ8A 1M8MA 2BE7D 1BU1A 1QMCA 3HRSA 3JCMh 1D0YA 2DM1A 1KD1U 1YJ9Q 1W4SA 3CC7T 2CKKA 1VQ5Q 4M78E 4C8QD 4LDWA 3RIRA 2QASA 3SDZA 3GLXA 3TSWA 2FYKA 4E7IA 2FRYA 2BTTA 1M8VA 4M7DD 4DEYA 2A28A 3CEYA 5GANh 3GIBA 3X28B 3CXCA 1WZOA 3CPWS 1B34A 4C5EA 1VQNA 2KRNA 1JJ2P 1GBRA 1MMGA 1LCKA 3MP1A 3MHXA 2DTIA 1FYNA 1I5OB 3A1PA 1K4US 5HCKA 2XU8A 2HD0A 2JS0A 1VQPT 4M7AD 2CZ1B 1OULA 1YI2A 2ROTA 4PJLA 3H0FA 1GXIE 4X1VA 2F2VA 3JCMX 1GCPA 1ZX6A 1K1ZA 2K4YA 4J9EA 2LQWA 1QQJA 4C8QB 1GFDA 2W10A 2G3RA 2QGGA 1U1SA 2CP2A 1VQ8T 3HP9A 3I9QA 2HQEA 2FG0A 2LNVA 1VQNT 1QKXA 1WXTA 4L5GA 1D0ZA 1ZA1B 2DILA 4E7ZA 4JS4A 3A8HB 3J81E 1N9SA 2BZXA 3M0UA 2LP5A 2DO3A 3FDRA 5L23A 2KMTA 4FYWB 4NL3A 2FPDA 4PJMA 3RESA 5GANg 1M5Q1 4BB7A 5D6WA 2E5KA 2EYZA 2YUOA 4B9XA 3L1AA 3V7RA 1QP2A 5AT1B 1AVZC 1GBQA 3EG1A 4A53A 3LLRA 3GP8A 3CCVQ 4M75D 2YRVA 4C0FA 2WACA 4XTZA 4JLIA 4PJOB 1X6BA 2DXTA 3I56Q 3CCUT 4HT8A 1RAHB 1WDXA 3T9NA 1K9MR 3CCLQ 5A0LA 5GAMd 2GTOA 3EH2A 4E7LA 3LX7A 3REBB 2LCLA 4M78C 4PJOF 5LJ5e 1Y0MA 5KE2A 1UJ0A 5GMKh 1WGSA 1MHNA 4QKUA 5CK9A 1G5VA 1FWZA 2BUDA 2KXDA 3NMZC 4KUIA 1HYOA 3OYNA 1IGUA 2JJ9A 4JJNK 3UATA 3OYBA 4HT9A 4ORZA 3CD6T 4QW2A 5KYUB 2BKDN 2VXFA 2DTHA 3SB2A 2K3YA 4EDUA 5LJ5j 1VYUA 4C8QA 4KUDK 4C0DC 4PNOA 1Q82U 1LOJA 3OYHA 3GF5A 3H41A 3NGPA 4C92D 1AHJB 2RPNA 5D6XA 2DXCA 2K9GA 2RJDA 2HQHA 2VVKA 2P4TA 3CXCP 4JJDA 3CC7Q 3DLMA 3VS7A 2OAUA 4C92F 1QVFA 2XHCA 3M0PA 1TTHB 4QQDA 2SRCA 2EFIA 2K2MA 3EFOA 3KFVA 3CBOA 2CUDA 3M0RA 5CKEA 5LJ5d 2AKLA 1JU5C 5HY6A 4K11A 1MV0B 2QQRA 1OX9A 2F1LA 3FC3A 3S3NA 3JRZA 4M7DB 2RJEA 4N4HA 2ED1A 2J05A 4JUVA 1J3TA 2EYQA 2XI9A 1BKBA 3VJPA 3O5ZA 1R0CB 1Q86U 3M57A 1PNJA 2KI7A 1FMWA 1TUGB 2QQ9A 4M77B 3OW2A 2RM4A 4O5VA 2MWPA 2QA4T 5FRNA 1LNXA 2QQAA 1M2OA 3CMAT 2MMPA 1ZSZC 4IUQA 4KBMB 4L59A 4M7DF 5CQYA 4OB2B 2QG9B 2QA4A 3QJYA 3EFRA 4ELYC 5GMKi 3VYGA 3PMIA 2KYBA 2CS7A 2DL4A 1TH7A 2KY9A 4M77F 2ZPGB 4OGCA 2V8KA 4N4IA 3JCMV 4AT1B 3FB9A 1VQNQ 5GANf 2XK0A 2MPXC 3CBMA 1Q86R 1VQ4A 1W2BP 4DEXA 3JAME 3OYFA 1OYXA 5KYYA 1N6AA 4M78B 4UC4A 5I11A 1JO8A 1NLOC 1X69A 2JT4A 1WHGA 4LDUA 4AFQC 2JTFA 1ZUKA 1RLPC 2NYSA 3M54A 3EG2A 4C92E 2VGNA 1EZZB 1JB0E 1OX8A 1ARKA 4E7JA 4M77E 1VQPQ 4J9GA 4JRQA 2DL7A 4PLLA 1GCQC 3EHRA 3PVQA 4A63B 4D8DA 2GFUA 4D8KA 4JJBA 2PNIA 1I81A 2WSFE 3OYAA 3REAB 4AG2C 4N0AA 4KGVB 3TCJA 4EMKC 5GAN6 2K5IA 3H6ZA 2KYMA 2GGRA 4EPCA 2QYZA 4Z89A 3G4SQ 2EJ9A 1Q95G 1BK2A 2RJCA 3TREA 2RHUA 3H0IA 3CCJA 1VQ9A 3SFMA 2RA2A 5M9OA 1SHFA 1WJSA 2HSPA 1WJRA 2RB6A 5DM7R 5KYXA 3M56A 3ZFJA 3LW5E 4M77G 4X34A 4V2SA 1QKWA 1PD1A 3CD6Q 4M7AA 3I56A 4M75F 3R6NA 3PIOA 1VQKQ 2K3BA 2DXBA 2L2PA 1I8FA 3CCSQ 4JZ3A 1X43A 2LCCA 2RQRA 2EQKA 2CH4A 1Q81U 3VUZA 1VQOQ 2LMJA 2JN0A 5GAOm 5LJ3f 2DXUA 1Q81R 3CCLT 1M90U 5FRMA 1M4ZA 3PTAA 2CSQA 1UDLA 2M16A 4BDZA 1IHVA 3O8VA 3S6WA 1R77A 2EYXA 2LQKA 1V1CA 3HFOA 3DB3A 2X4YA 3OYYA 5GANd 1YJNT 3HPWA 3RDVA 2QAZA 1TSFA 3JB9J 5HK0A 2EGEA 3UT1A 1WA7A 3V7SA 1K9AA 4Y92A 2D8JA 4XU1A 1M1KR 2DERA 2KT8A 3HFNA 2YRCA 2GNCA 3VV0A 1U1TA 5I2SA 4CC2A 1O75A 1ZSZA 4AG1C 6AT1B 2OTJQ 2QEXA 4KT0E 1QCNA 1NPPA 3I55Q 4J83A 4DOVA 1NM7A 1JJ2A 1DJ7B 4WF2A 4PJOG 1QCFA 3VKIA 4ZN3A 3EG9A 5KH6A 1PWTA 1TUCA 1YBYA 2YRDA 4R0KA 1RAIB 2DKGA 5GAMg 1YHQQ 4F14A 4RTXA 4C8QE 4RCCA 2MI6A 5GAOl 1HJDA 3M53A 2C0OA 1YITQ 2W0ZA 1S1NA 2HZYA 4J7IA 1QWEA 1B7TA 4ZGEB 2X3XD 2FL7A 2E6NA 2YUQA 2GQVA 3MO8A 2PVDB 1E7OA 3RKXA 3QBYA 3QKJA 2EKOA 2JTMA 2PU9B 7AT1B 4C92C 1VIFA 1SKUB 4DQ2A 4PFZA 1YNZA 2J7IA 2C0IA 3HSBA 3BE3A 3L2ZA 4OB3B 3FIFA 5GAOr 4HCZA 3Q1JA 1PRMC 3CMAA 2GF7A 2IVWA 1K73U 1M90C 5IH2A 2ZPFB 4BDYA 1YIJT 2DA9A 1FMKA 2ZCFB 2LDMA 1PC0A 1SRMA 1C6VX 1I1JA 3NPFA 2XDDA 1OQKA 1NG2A 3EFSA 4XU0A 2ZPHB 2KEAA 4MZPA 3J7AF 3GOXA 1M3CA 2DEQA 2B86A 4FT2A 4A4KA 3JCMb 1C1AA 4F16A 1M3AA 2EPDA 2J6OA 3BW1A 1VQ4T 3NFCA 1XJWB 4RCBA 1PKTA 2GCXA 1AD5A 4M77C 2L0AA 2JXBA 3LH5A 2M1HA 5LJ3g 3CCST 3G4SA 2DEUA 1YWPA 1ZSZB 1KC8U 4J9IA 2B8AA 4J9BA 3HKSA 3SHWA 3WVEB 1M27C 1VQ9Q 1KQ2A 4F7UF 1K8AC 3V7CA 1ZBXA 4F04B 2DIQA 3BY7A 2J06A 1TXQA 4IKFA 3G71Q 1Y71A 4CI0C 3MEUA 2NUPB 3CD6A 4BI3A 2EYYA 3JSCA 1H92A 1ZSGA 2FZCB 1D3BB 4C0ZA 2CP0A 2IIMA 1K73R 2IPOB 3PNWC 1UHCA 3CCEA 3META 5CQXA 1UTIA 1Z9ZA 3CPWP 3G7ZA 2LQ8A 3CCSA 2R5AA 2CT3A 1KG1A 2MWOA 3A98A 3PGGA 2ZPEB 3I5RA 3M58A 2D1XA 3QDFA 5J26A 4C5GA 1KIKA 5CO7A 3EH1A 5HKCA 5A2QE 5J39A 1OEBA 1AEYA 3S3OA 2DRKA 2VWFA 3KBGA 2M0YA 2LZ6B 2HNIA 3I55T 2KXCA 2HKQB 3CCVT 2C06A 2E5QA 5KCHA 1JEGA 2XICA 1D1AA 3JB9F 4LDVA 3VS1A 1UGQB 1SSFA 1PG5B 2HBPA 4CRIA 1VYTA 5CKBA 4J9DA 1RL2A 1UEBA 3L42A 5ECAA 1AZEA 2RQVA 1KC8C 2AIRB 1VYVA 3BFMA 3CCRQ 4A4FA 3M59A 1LVKA 1SHGA 3RR6A 2FPFA 3NHNA 3QXEB 2P0QA 5GAN2 3M0QA 4LDYA 2VASA 4X9DA 2ZPIB 4PFPA 1BIBA 4HVWA 2JM8A 3V8KA 3VU3C 4M7AC 1YJNA 2FRWA 2K2VA 1G8XA 5AYFA 2JVVA 3SWNB 4C0GA 2XDBA 2PUKB 3OSSC 2D0QB 4P5NA 4DA4A 3CC7A 3TSZA 2EYWA 1I5LA 5C6SA 2LJ3A 2DE0X 3L2RA 1NEBA 2COYA 4BI4A 3A8MB 3CCRT 4A4EA 4ZGJB 2ENMA 1GCQA 1U5SA 3VS2A 4KRTA 4M78G 3CMEQ 2L8DA 1M90R 4XU2A 1QVFS 4C8QC 2KAFA 1UGVA 3P8BB 3OYCA 1OZ2A 2E6ZA 1IGQA 1YITT 1BBZA 4GLMA 3RUXA 2IG0A 1MGQA 1X75C 5IAYA 2EWNA 3GNGA 4XTUA 2VXEA 2NUTB 1X2QA 4RG8A 1KC8R 2DK3A 1RI9A 5GAN4 4M7AF 3RMSA 1MMAA 2JM9A 3TQ7P 1VQ6A 1I07A 2L89A 1Q7YC 4IUTA 3ULRB 2QA4Q 2KVQG 3RKYA 4M75C 2XMFA 4GBQA 2MCNA 2CP5A 4DBFA 4DBHA 1WHMA 3A8LB 3ME9A 4M7AB 4CC4B 4ZTFA 4R55A 2EQUA 3JCMg 4KULA 3LH0A 2JW4A 4E6RA 3FJPA 3JB9H 2COZA 1HXDA 1G83A 3JV3A 2XIDA 3OB9A 3CPFA 1JRIA 1RI0A 3EFOB 3QG1A 3U23A 3JB9I 2EAYA 3CCVA 3CCQT 2EBPA 1OV3A 3QYGB 1QLYA 2HL3A 2OI3A 3FEOA 4WCIA 5KYNA 1BB9A 1XTDA 1NPRA 2DZ9A 1WHLA 1YCYA 1M1KC 5CAIA 2LRQA 4LN2A 2EKHA 1UE9A 4QVDA 1QW1A 5GJWB 3CCMT 2KR3A 3DB4A 1WLPB 1Y96A 5CCAA 2LJ1A 1VQ9T 1OPKA 3R6OA 1QWFA 1EX4A 2FZKB 1QVGA 1K8AR 2DPPB 3KUFA 5IN1A 2DFUA 3VS3A 2CSIA 2DX1A 2KT1A 1M30A 4MZTA 3VYHB 3G1JA 3M5AA 1A0NB 3SWNC 1NE8A 9ATCB 1Q81C 5I2MA 2KE9A 4BD3A 3EGDB 1K8AU 1BI0A 2EIFA 1Y96B 2A3LA 1QP3A 2OTLQ 4OMOA 2F5KA 4EIKA 2P84A 4EMKA 1VQKA 1PM3A 2KK4A 3OYLA 1YJ9T 4J6WA 3RMQA 3WVDB 1X6GA 2EQIA 1JXMA 2CZ6B 4J9FA 4ELZC 3LWIA 2KGTA 1S72T 1X27A 2CP7A 3M0TA 4EMHA 5KYWA 5A0DA 1IXDA 3C4SA 5DLOA 2JMAA 3GBQA 1RACB 1JBMA 2MAMA 2NLUA 1S72A 4RTVA 5DY9A 4N0AC 4M4ZA 4C92G 4DBRA 3E1SA 3ER0A 4C92A 3OYJA 2KRMA 4E2FB 1R8OB 2O9SA 3L2QA 1VQ7Q 2L3SA 1VQ6T 2YDLA 2CYZB 1VQMT 4FSSA 4XAXB 1MV3A 4E7KA 2HAXA 3LGLA 5KCOA 4FYYB 2EW3A 5KYXB 2DRMA 1YJNQ 4AMCA 1D1BA 2LNHB 2CH4W 4MZMA 4OF1A 1M3BA 2Z0WA 2PZ1A 1MMDA 1VQMA 2EQJA 4MMLA 2K5FA 1NBEB 3J80E 4J6XA 2DF6A 3JB9G 4C92B 3OYGA 4M77D 5GAN8 5FWBA 2OTJA 4MDXA 1B07A 2DJQA 3FJ5A 3M4GA 2X3WD 2COWA 2DTOA 2ZPBB 1ABOA 3EAEA 1Q86C 4VUBA 4F7UB 3A5ZB 2HBWA 4ME7A 2O4XA 1NZ9A 2E64A 1YJWQ 4PFOA 5A0GA 3M4YA 1NJIU 1UB4A 4XTYA 3FRNA 3OYMA 3A8GB 1RAGB 1N8RR 4LXCA 2X51A 5LJ5f 3X24B 2JS2A 4ANJA 3E19A 3MJXA 4BUGA 2RQUA 1U8RA 3CBPA 3CCEQ 1BI3A 4MDWA 1KQSS 5FWCA 2J6KA 3M55A 1ZA2B 3G6EQ 1ACMB 3H8ZA 1X01A 2CT4A 2EJGA 3JCMJ 2KSSA 2L3PA 3PT9A 4LE9A 4XTWA 2AK5A 4JJCA 1WPYA 5L8RE 2HDAA 1OPLA 2FHDA 4QVZA 2VC8A 3JCMW 4ZTJA 1G2BA 4JS5A 4F7UG 2DZCA 3PVLA 2LJ0A 2KDSA 2FZGB 2RHIA 1I0CA 3DKMA 1YWOA 1ABQA 3QDRB 3G6ET 2QQSA 5IHNA 2EVRA 1UGSB 3HRUA 2KQWA 3CCQQ 5GAN7 2CDTA 1G3SA 3I5SA 1M9SA 1RUWA 1TOVA 2O2OA 5IT9E 3EG3A 2OAWA 2H8HA 4M77A 2NUZA 2E70A 1RADB 2QEXT 1Q7YU 4PJNA 3CC2A 3CCRA 1K0SA 2LT4A 3CCMQ 4IUUA 4RTZA 2ZGWA 2D9TA 4M7DA 3JCMc 3CC4A 3OY9A 1W1FA 4M7DG 3EHQA 2E41A 3VUBA 1CKBA 3SEMA 3TVTA 3L2WA 1IZ6A 2QGFB 3CCUQ 2LQNA 4F7UA 4DOWA 3V8JA 2MK5A 5GJVB 2M0OA 3PIPA 4PJJA 1YP5A 4QT7A 4HVUA 3OW2S 2RNAA 2GQIA 1K9MC 5IXBA 2DL3A 5I21A 2RD1A 2LVMA 3QO3A 2LCSA 1WX6A 3MEWA 4M7AE 2SEMA 3VRZA 2X35A 4A54A 3ZBDA 1NYGA 3EG0A 1Y7XA 2M9UA 3THKA 3OS2A 2XKOC 2E3HA 3OYIA 1Q82R 5KYUA 1CKAA 4BACA 3UA6A 3AHUA 3UDCA 2E4HA 4BY6B 4IUPA 3VS6A 2X4XA 3UWNA 4E7HA 2VB6A 5IXFA 4NS5A 4C8QF 4FCYA 2JTEA 3UA7A 3RBBB 1JQQA 1VQ7A 4OGEA 4HCKA 3OBYA 3E2UA 1YHQA 2RF0A 1NLPC 4OB1B 3C94A 3QPHA 4F17A 1K0XA 1VOMA 4C0DB 3E9GA 2CP3A 2JOYA 1AWXA 1MUZA 4OMFB 1LPLA 3OMGA 5KE3A 1YJWT 4J7FA 4RUGA 2DL8A 5LJ3d 3CC2T 1XOVA 1VQMQ 4ZGDB 1BI1A 3E9FA 4PJOA 1EIFA 2CREA 5GAMh 2O88A 2RH2A 2MYSA 4FSXA 2K57A 1H8KA 5IHKA 5D7UA 1UUEA 3CCET 4D6WA 2VYTA 5CR2A 3NTHA 2GBQA 1T0JA 1YCSB 3M9QA 1AT1B 2AHJB 4RTTA 4X9CA 2XG8D 4KH1B 3AT1B 2AZSA 3HTRA 4XK8E 3KXTA 3CMAQ 3BDUA 2PVGB 1N8RC 1YI2Q 4LDXA 4FL6A 5GAMe 3JCMP 2HL5C 3JCMd 1AZGB 2P0KA 2DBMA 4AFSC 1W2BA 2QQBA 5CVIA 2P0PA 3H9NA 3OYDA 1G3WA 2QDYB 4IUVA 1M2VA 2X4JA 1N8RU 4JPBW 3CPWA 3QWXX 3CMEA 4M7DE 1OI1A 2V1RA 2ED0A 2YUNA 5KYYB 2L3RA 4O6JA 1RLQC 2A37A 4C8QG 2LC4A 4KGXB 4RTUA 5CKDA 3CMET 2RHYA 5LJ5h 3OS0A 5CKHA 1IO6A 1FMVA 5CIUA 1WFWA 1W70A 4PLIA 1N27A 4M75G 4M78D 2CUBA 3EG9B 2DIGA 2DVEA 3RNJA 3QZ9B 3H0HA 2JUFA 3OA6A 4E47A 1I4K1 1SSHA 1D0XA 2QTVA 2YXYA 2E65A 2DL5A 2YLBA 2MIOA 2F5TX 3OMCA 4LUDA 5FU6B 5IHIA 4BY6C 5DLQE 2OTLA 3GPLA 4II1A 1MNDA 5GMKj 1TWBA 2ZAEA 1XNIA 3RKWA 1PD0A 2DLPA 4MMKA 2RI5A 4HCBA 3PE0A 3LWHA 1G3TA 4JDSA 1WYXA 4JZ4A 1FXXA 1UG1A 3TEEA 3P8DA 2G6FX 2E1HA 1VQLQ 4HA8A 1RABB 2R57A 4BE1A 3G4ST 2E10A 2L3QA 4Y28E 3MEVA 3ZEHA 1Y57A 4OMMA 2O4XB 1FX7A 2RHZA 2P4RA 2YSQA 1C0MA 2VGMA 4M75A 3CCMA 1IREB 2K79A 1OZ3A 1BYMA 1KQSA 4FU6A 1PRLC 4HCCA 1Q7YR 2HEQA 4OMPA 3V8LA 4DBQA 2V26A 1T3LA 4R56A 2YLCA 2OJ2A 1IHWA 3OS1A 2KNBB 2CP6A 3GNFB 5LJ3j 1K9MU 1YJ9A 4LNPA 4TVRA 1BI2A 4PJOE 4FT4A 2FEIA 2MF2A 4ESRA 3EGUA 1NYFA 3MCAB 2YWWA 2DYIA 2RK2A 3F70A 3QUIA 4BE0A 2ABLA 5LJ5g 3QJ6A 2FB7A 4WTOB 3L2UA 1W6XA 4M7AG 3X26B 1GL5A 1QCOA 4F7UE 1ZBJA 4NL2A 3SWNA 1GFCA 3OW2P 1OU9A 4FM4B 2RJFA 4FW2A 1D1CA 5C0MA 3BDLA
chains in the Genus database with same CATH topology
1VQ8A 1DJ7B 1R8OB 4WF2A 3L2QA 4PJOG 1VQ6T 3HRSA 2CYZB 3VKIA 1VQMT 4XAXB 3JCMh 4ZN3A 4JRPA 1KD1U 3OBWA 4E7KA 1W4SA 2HAXA 3LGLA 1YJWA 3CC7T 5KCOA 2CKKA 2LTOA 5KH6A 4M78E 1YBYA 3MEAA 4C8QD 4LDWA 3RIRA 1VUBA 1ZHIA 2DKGA 3SDZA 5GAMg 3GLXA 1M1GA 2FYKA 1YI2T 2OTLT 4C8QE 4E7IA 4RCCA 5FU7B 2MI6A 5GAOl 4MZMA 4OF1A 5GANj 1KHIA 3M53A 1VQMA 2EQJA 4J7IA 4MMLA 2K5FA 4ZGEB 4M7DD 1M8VA 3CEYA 1QVGS 2FL7A 5GANh 2E6NA 3X28B 4A4HA 3CXCA 3GIBA 3QZ5B 3LGFA 3CPWS 1B34A 2OTJT 3J80E 4J6XA 3CC7A 2GQVA 4C5EA 3MO8A 3JB9G 1VQNA 2PVDB 4C92B 3RKXA 3OYGA 4M77D 3QBYA 5GAN5 3QKJA 5GAN8 2EKOA 2JTMA 2OTJA 2PU9B 3MP1A 4QQGA 4C92C 4JLGA 1VIFA 3MHXA 4MDXA 2PQWA 2DTIA 4DQ2A 3M4GA 1LJOA 2DTOA 2ZPBB 1KHCA 2XU8A 3URGA 3EAEA 2Y4YA 2HD0A 1VQPT 4VUBA 1Q86C 4M7AD 2CZ1B 4F7UB 4J8OA 3HSBA 3A5ZB 1YI2A 3L2ZA 4OB3B 3FIFA 2O4XA 3A8OB 4ME7A 4HCZA 5GAOr 1NZ9A 1GXIE 3Q1JA 3WXMB 3JCMX 3JCMQ 2V8IA 3CMAA 1YHQT 2F69A 2GF7A 2IVWA 2E64A 2X4WA 5GMKm 1K73U 1M90C 1VQ5A 2K4YA 4N4GA 2ZPFB 4M75B 4C8QB 3M4YA 5A0GA 1NJIU 1VQ7T 1UB4A 4BDYA 2G3RA 3FRNA 4XTYA 1YIJT 3DLLA 2QA4A 3OYMA 1U1SA 1VQKT 2ZCFB 3A8GB 2LDMA 1VQ8T 3HP9A 5LJ5f 3PMTA 3X24B 2HQEA 2K3XA 2RHXA 2LNVA 1NJIC 3C95A 5GAMf 3E19A 2XDDA 1VQNT 4BUGA 3EFSA 4L5GA 2V8JA 4XU0A 2ZPHB 4MZPA 3J7AF 1U8RA 3GOXA 3CBPA 4JS4A 3A8HB 3J81E 1N9SA 1BI3A 2DEQA 2YHTA 1KD1C 4FT2A 4A4KA 2DO3A 4MDWA 3FDRA 3JCMb 1KQSS 3PFSA 2KMTA 2QTXA 3M55A 5GANe 4NL3A 3BW1A 1VQ4T 3NFCA 3RESA 1M5Q1 4BB7A 5GANg 1VQOT 4RCBA 5D6WA 3H8ZA 1X01A 4NOYA 2EJGA 3JCMJ 2GCXA 2KSSA 4M77C 1VIEA 3PT9A 2M1HA 5LJ3g 1WNLA 3CCST 3G4SA 4XTWA 4B9XA 1P92A 2VV5A 1D3BA 3L1AA 5LL6S 1KC8U 2B8AA 3V7RA 1B34B 1QP2A 1WPYA 5L8RE 2FHDA 3HKSA 2FVUA 2VC8A 4QVZA 3JCMW 4ZTJA 4JS5A 3WVEB 4F7UG 2DZCA 3LLRA 4A53A 3GP8A 1KQ2A 4M75D 2YRVA 2H3JA 4C0FA 4F7UF 3HRTA 1ZBXA 3V7CA 1K8AC 2WACA 2DIQA 4XTZA 2KDSA 3BY7A 2RHIA 4JLIA 4IKFA 4PJOB 1Y71A 2DXTA 2BIVA 4CI0C 3DKMA 3CCUT 3MEUA 4HT8A 3CD6A 4BI3A 3FLGA 2A7YA 3JSCA 1H3ZA 3QIIA 3ASKA 3QDRB 3T9NA 3G6ET 2RI3A 1D3BB 2EJFA 2QQSA 4C0ZA 1WQ7A 5A0LA 3PNWC 4LD6A 1UGSB 3HRUA 5LJ3h 3META 2KQWA 3CCEA 5GAN7 5CQXA 5GAMd 5HK3A 3L2VA 4E7LA 4ATOA 3G7ZA 1W2BS 3LX7A 2LCLA 4M78C 1G3SA 2LQ8A 4PJOF 5LJ5e 1M9SA 5GMKl 5KE2A 5GMKh 1I5LA 1WGSA 1MHNA 3CCSA 2R5AA 5CK9A 1G5VA 5IT9E 4IURA 4M77A 1KG1A 2E70A 1QVPA 2MWOA 5GAOp 2QEXT 3PGGA 1FWZA 2ZPEB 2BUDA 1Q7YU 4EMKB 2QXFA 3M58A 3NTIA 2JNGA 4KUIA 3CC2A 5J26A 1VQOA 3CCRA 2HQXA 2LT4A 3OYNA 4IUUA 2ZGWA 4JJNK 2D9TA 4M7DA 3JCMc 4C5GA 3OYBA 5CO7A 5FU7C 4HT9A 3CC4A 5HKCA 5A2QE 3OY9A 4M7DG 5J39A 3VUBA 2E41A 3CD6T 3OQ5A 4QW2A 3G71T 2BKDN 3S3OA 2VXFA 3L2WA 2DTHA 1IZ6A 3SB2A 4F7UA 3KBGA 4B9WA 4DOWA 2HNIA 3QSUA 4JRKA 3I55T 2DAQA 2K3YA 2PUOB 3V8JA 4EDUA 3JB9D 2M0OA 5LJ5j 4EMGA 3PIPA 4C8QA 4KUDK 1M1FA 4C0DC 4PNOA 2R5MA 3CCVT 2C06A 2E5QA 1Y07A 5EG2A 1Q82U 5KCHA 1LOJA 2XICA 1UGPB 3OYEA 3OYHA 3OSVA 3GF5A 2QI2A 4C92D 3OW2S 3JB9F 1AHJB 3MP8A 5D6XA 2DXCA 4LDVA 2RJDA 1K9MC 1O9SA 1UGQB 1SSFA 2P4TA 3C12A 2HBPA 3DLMA 4Y91A 4CRIA 5D6YA 5I21A 5CKBA 2RD1A 2OAUA 2LVMA 3QO3A 4C92F 1QVFA 2XHCA 2O01E 3MEWA 1RL2A 4QQDA 1UEBA 4XTXA 2XD0A 4M7AE 2EFIA 2X35A 4A54A 3ZBDA 3L42A 3CBOA 5CKEA 1Y7XA 5LJ5d 2M9UA 1KC8C 5HY6A 3OS2A 2XKOC 3OYIA 3BFMA 2QQRA 4A4FA 4BACA 3M59A 3AHUA 3UDCA 3FC3A 2EQMA 3S3NA 1YJWT 1K73C 3MP6A 2DD5A 4BY6B 3JRZA 4IUPA 4M7DB 2RJEA 2X4XA 4N4HA 4Z02A 4FIBA 3UWNA 4JUVA 4E7HA 2EYQA 2XI9A 3QXEB 2P0QA 1BKBA 3VJPA 5GAN2 4NS5A 4RMOA 1Q86U 3M57A 4LDYA 4C8QF 4X9DA 3CXCS 2GFAA 2ZPIB 1BIBA 2QQ9A 4M77B 1VQ7A 4OGEA 3V8KA 3OW2A 2XDPA 2RM4A 3INZA 3VU3C 4O5VA 4M7AC 1YJNA 2MWPA 2QA4T 5FRNA 1LNXA 2QQAA 3OBYA 1VQLA 1YHQA 3CMAT 2MMPA 4IUQA 1V29B 2K2VA 4OB1B 3C94A 4KBMB 5AYFA 3QPHA 2JVVA 3SWNB 4L59A 1M1KU 4C0GA 4BE2A 5CQYA 4OB2B 4C0DB 3E9GA 2XDBA 2PUKB 4M7DF 3OSSC 2CZ7B 2D0QB 2JOYA 3EFRA 3QJYA 2Y4XA 4P5NA 4OMFB 4ELYC 5KE3A 1ZQ1A 2ZZDA 3OMGA 1X6OA 5GMKi 5GAOn 4J7FA 3PMIA 3HHTB 3VYGA 5C6SA 3L2RA 2CS7A 1XQHA 1YITA 5LJ3d 3A8MB 1TH7A 4BI4A 2LX9A 5FROA 4A4EA 1XOVA 2KY9A 4M77F 4ZGJB 3CCRT 1N9RA 4ZGDB 5GAOq 1BI1A 3E9FA 2ZPGB 4PJOA 1EIFA 4OGCA 5GAMh 4M78G 2V8KA 2L8DA 4N4IA 2RH2A 3JCMV 4FSXA 3FB9A 4XU2A 2K57A 3QYHB 1QVFS 4QVCA 4C8QC 2KAFA 5GANf 2XK0A 3P8BB 4C5IA 3OYCA 4D6WA 2VYTA 3CCET 3CBMA 1OZ2A 5CR2A 3NTHA 2E6ZA 1VQ4A 1YITT 3M9QA 5CKFA 2Y90A 2AHJB 4X9CA 3JAME 3OYFA 1OYXA 1N6AA 2XG8D 4M78B 1VQ5T 4UC4A 4OP0A 1HK9A 3RUXA 2IG0A 4XK8E 1UGRB 1MGQA 4M7DC 1X75C 5IAYA 2EWNA 3KXTA 3GNGA 4XTUA 1N8RC 3BDUA 2PVGB 4LDXA 2VXEA 4FL6A 5GAMj 4RG8A 2DK3A 4LDUA 5FU6C 5GAMe 5GAN4 3JCMP 2JTFA 4M7AF 3RMSA 4PKCC 3JCMd 2P0KA 3M54A 4C92E 4LD9K 3TU4K 4J5YA 2R58A 1VQ6A 2VGNA 1W2BA 2QQBA 2L89A 5CVIA 2LT1A 1JB0E 2P0PA 4IUTA 1PSEA 4A4GA 3CCJT 2KVQG 3RKYA 4M75C 4E7JA 3CC2T 4M77E 4JRQA 3OYDA 4PLLA 1G3WA 2QDYB 4IUVA 2GFUA 5GAN3 2X4JA 3A8LB 4XU3A 3ME9A 4M7AB 1N8RU 1I81A 3CPWA 2CGHA 3CMEA 4ZTFA 4M7DE 4R55A 2WSFE 1OI1A 2I2LA 3OYAA 2CZ0B 2EQUA 3S3MA 2L3RA 4HKEA 4O6JA 3JCMg 3G6EA 4KULA 4N0AA 2DD4A 3LH0A 4C8QG 3TCJA 2LC4A 1WJQA 3FJPA 3P8HA 4RKUE 4EMKC 2RHYA 5CKDA 5GAN6 3CMET 5LJ5h 2K5IA 3H6ZA 3OS0A 5CKHA 3JB9H 1HXDA 5CIUA 4EPCA 4PLIA 2XIDA 2EJ9A 1N27A 4L6V5 3LYIA 4M75G 4M78D 4OVAA 3HL8A 2RJCA 3OB9A 2DIGA 2DVEA 3TREA 2RHUA 3CPFA 3QZ9B 1JRIA 1RI0A 3CCJA 3QG1A 2JUFA 4GY5A 3SFMA 3OA6A 1VQ9A 4E47A 1I4K1 2EAYA 4OB0B 3JB9I 2RA2A 4M78F 3CCVA 3CCQT 5M9OA 1YIJA 1WJSA 1Q82C 1WJRA 2RB6A 5DM7R 2E65A 3QYGB 4JRIA 2YLBA 3M56A 2RK1A 2F5TX 3FEOA 3LW5E 3OMCA 4M77G 4X34A 5FU6B 3ZFJA 4BY6C 5DLQE 4ZN1A 4V2SA 1XTDA 1NPRA 5GMKe 2OTLA 2DZ9A 4M7AA 3GPLA 4II1A 3G71A 1YCYA 5GMKj 2E12A 1M1KC 3OS5A 3JCMf 3I56A 5CAIA 2LRQA 4M75F 3PIOA 1XNIA 1VQPA 2DXBA 4YTLA 2L5QA 2VUBA 3RKWA 4QVDA 1QW1A 3CCLA 3CCMT 4MMKA 3DB4A 1Y96A 2RI5A 5FLXE 3CCQA 1JJ2A 3LWHA 1G3TA 4JDSA 4HCBA 5CCAA 1VQ9T 1FXXA 3NTKA 3TEEA 3P8DA 3R6OA 2E1HA 2K5LA 1I8FA 1QVGA 2DJZA 4HA8A 2R57A 1H641 2LCCA 2DPPB 2EQKA 3G4ST 4BE1A 2E10A 3KUFA 4PJOC 4Y28E 3MEVA 5IN1A 3ZEHA 5J3BA 1Q81U 2JZ2A 2O4XB 1FX7A 3VUZA 2RHZA 4MZTA 1G3YA 1JJ2S 2JN0A 4PJOD 5GAOm 3VYHB 5LJ3f 2DXUA 3M5AA 3SWNC 2VGMA 3CCLT 4M75A 1NE8A 3CCMA 1IREB 5LJ3e 1Q81C 3I55A 1OZ3A 4QQ6A 1M90U 1BYMA 1KQSA 1M4ZA 5FRMA 3PTAA 4FU6A 2M16A 3I56T 4BDZA 2WSEE 5I2MA 4HCCA 3O8VA 3CCUA 3S6WA 3V8LA 2LQKA 3HFOA 4BD3A 3DB3A 4PL6A 2X4YA 3OYYA 2PVOB 2YLCA 5GANd 1BIAA 3HPWA 4R56A 1YJNT 3OS1A 4M78A 1BI0A 1Q7YC 2EIFA 1K8AU 1Y96B 2A3LA 1QP3A 3GNFB 5LJ3j 3JB9J 1K9MU 3X25B 1YJ9A 3UPUA 2F5KA 4XQ3A 3QHSA 5HK0A 4TVRA 4XTVA 1BI2A 3UT1A 4PJOE 4EMKA 4FT4A 2MF2A 1VQKA 2KK4A 4BI8B 3OYLA 2WSCE 3V7SA 4J6WA 1YJ9T 1WQWA 3RMQA 4Q5WA 3WVDB 3MCAB 3OYKA 4XU1A 4C5HA 2RK2A 3F70A 3QUIA 2CZ6B 2RI2A 2D6FA 4BE0A 4ELZC 3LWIA 3HFNA 3VV0A 1U1TA 4J6YA 5LJ5g 1S72T 4RG2A 3QJ6A 5I2SA 3JCMe 3CC4T 2FB7A 4EMHA 4DA4A 5A0DA 3L2UA 1O75A 1PSFA 3C4SA 5DLOA 4M7AG 3X26B 1JBMA 2MAMA 2NLUA 1S72A 1VQLT 5DY9A 4F7UE 4N0AC 4NL2A 3SWNA 2QEXA 2RO0A 4GLKA 4KT0E 4C92G 1KQ1A 3X20B 3E1SA 3ER0A 4FM4B 1NPPA 3N5BB 4J83A 4C92A 2RJFA 3OYJA 3RERA 3SD4A 4DOVA 4M75E 5C0MA 3BDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JRI A;  1WPY A;  5GAN 2;  4WF2 A;  3JCM W;  2VC8 A;  4C8Q F;  4X9D A;  1I4K 1;  2EAY A;  4F7U G;  3JB9 I;  2RA2 A;  4M78 F;  4PJO G;  1BIB A;  2DZC A;  2RB6 A;  3JCM h;  4M77 B;  4A53 A;  2E65 A;  1KQ2 A;  4M75 D;  3V8K A;  4JRI A;  4F7U F;  2YLB A;  2RM4 A;  3INZ A;  3V7C A;  3VU3 C;  4M7A C;  4M77 G;  4XTZ A;  3BY7 A;  4M78 E;  1LNX A;  4JLI A;  4C8Q D;  4PJO B;  3RIR A;  4V2S A;  5GMK e;  2DXT A;  2DKG A;  2DZ9 A;  5GAM g;  4M7A A;  1YCY A;  3SWN B;  5GMK j;  4HT8 A;  2FYK A;  3JCM f;  4M7D F;  5CAI A;  4C8Q E;  4M75 F;  4RCC A;  5GAO l;  3EFR A;  1I5L A;  3RKW A;  4QVD A;  5GMK i;  5GAO n;  5GAN j;  4MMK A;  1D3B B;  2EJF A;  1Y96 A;  1WQ7 A;  5LJ3 d;  1TH7 A;  4MML A;  4M7D D;  1M8V A;  5LJ3 h;  4M77 F;  5GAN 7;  5GAN h;  1N9R A;  3GIB A;  5GAM d;  5GAO q;  1B34 A;  2E1H A;  4J6X A;  4PJO A;  1I8F A;  4M78 C;  5GAM h;  2DJZ A;  4M78 G;  4HA8 A;  1H64 1;  4PJO F;  5LJ5 e;  5GMK l;  3JB9 G;  5GMK h;  3JCM V;  4C92 B;  2E10 A;  3RKX A;  3FB9 A;  4PJO C;  4M77 D;  2K57 A;  4XU2 A;  4M77 A;  5GAN 5;  4QVC A;  4C8Q C;  5GAN 8;  5GAO p;  5GAN f;  3PGG A;  3QSU A;  4EMK B;  4C92 C;  2JN0 A;  4PJO D;  5GAO m;  2DTI A;  5LJ3 f;  4DQ2 A;  2DXU A;  3M4G A;  2ZGW A;  3SWN C;  1LJO A;  2DTO A;  2Y90 A;  4X9C A;  4M75 A;  4M7D A;  5LJ3 e;  3JCM c;  4M78 B;  4OP0 A;  4HT9 A;  4M7A D;  1HK9 A;  3RUX A;  4M7D G;  4F7U B;  3HSB A;  1MGQ A;  2E41 A;  4M7D C;  2EWN A;  3L2Z A;  4XTU A;  3BDU A;  3FIF A;  5GAO r;  2VXE A;  2VXF A;  2DTH A;  3V8L A;  3SB2 A;  5GAM j;  4M75 E;  3HFO A;  4F7U A;  3JCM X;  3JCM Q;  5GAN d;  2E64 A;  2HNI A;  2YLC A;  5GAM e;  1BIA A;  5GMK m;  4JRK A;  5GAN 4;  3JCM P;  4M78 A;  3V8J A;  3JB9 D;  4M7A F;  1Y96 B;  4M75 B;  4EMG A;  4C8Q B;  4C8Q A;  5LJ3 j;  5LJ5 j;  3JCM d;  3JB9 J;  4C92 E;  4XTY A;  4J5Y A;  4PNO A;  4XQ3 A;  3QHS A;  1U1S A;  4XTV A;  4PJO E;  1LOJ A;  4EMK A;  4C92 D;  3RKY A;  5LJ5 f;  3JB9 F;  3V7S A;  4J6W A;  4M75 C;  1WQW A;  4M77 E;  5GAM f;  4XU1 A;  4Y91 A;  3EFS A;  3QUI A;  5I21 A;  2RD1 A;  4XU0 A;  5GAN 3;  3QO3 A;  4C92 F;  3HFN A;  4XU3 A;  4M7A B;  1I81 A;  1N9S A;  4XTX A;  1U1T A;  2YHT A;  2CGH A;  2DEQ A;  4J6Y A;  5LJ5 g;  4M7A E;  3JCM e;  4M7D E;  2FB7 A;  2I2L A;  4EMH A;  4A54 A;  3JCM b;  3JCM g;  5GAN e;  2QTX A;  4NL3 A;  4N0A A;  3BW1 A;  5LJ5 d;  4M7A G;  4C8Q G;  3RES A;  5GAN g;  1M5Q 1;  1JBM A;  3FJP A;  4RCB A;  4EMK C;  3JB9 H;  5GAN 6;  1X01 A;  3BFM A;  2EJG A;  4NOY A;  4N0A C;  5DY9 A;  4F7U E;  4NL2 A;  3SWN A;  4M77 C;  5LJ5 h;  3JCM J;  1HXD A;  4C92 G;  1KQ1 A;  3AHU A;  2EJ9 A;  5LJ3 g;  1WNL A;  4M75 G;  4M78 D;  4C92 A;  3RER A;  4M7D B;  4XTW A;  1D3B A;  3L1A A;  4JUV A;  2DVE A;  3V7R A;  1B34 B; 
#chains in the Genus database with same CATH topology
 1YFN A;  1IRX A;  1YN8 A;  2GTJ A;  2OX7 A;  4JRP A;  3OBW A;  3CQT A;  1YJW A;  2LTO A;  1AWO A;  3MEA A;  1VUB A;  1ZHI A;  1M1G A;  1YI2 T;  2OTL T;  2H3E B;  5FU7 B;  5GAN j;  1KHI A;  2AZV A;  1GRI A;  1QVG S;  4A4H A;  1MMN A;  1TS9 A;  3QZ5 B;  3LGF A;  2OTJ T;  2I0N A;  1ZUU A;  1S72 Q;  1WXU A;  5GAN 5;  2C0T A;  4QQG A;  4JLG A;  3D7S B;  2PQW A;  1LJO A;  3MKD A;  1VQ4 Q;  2EGC A;  1KHC A;  3URG A;  1SPK A;  2Y4Y A;  4J8O A;  3A8O B;  3MPU B;  3WXM B;  3JCM Q;  1YHQ T;  2V8I A;  1D09 B;  2F69 A;  4J9H A;  2X4W A;  5GMK m;  1HSQ A;  1VQ5 A;  1UHF A;  4N4G A;  4M75 B;  1VQ7 T;  1VQ6 Q;  2BE9 B;  1MNE A;  3DLL A;  1VQK T;  1F1B B;  3PMT A;  2K3X A;  2A36 A;  2RHX A;  1NJI C;  2DNU A;  3C95 A;  5GAM f;  2FPE A;  1SG5 A;  2V8J A;  3UF4 A;  1AWJ A;  1KQS P;  1R0B G;  2YHT A;  3PFS A;  5GAN e;  2QTX A;  3VRY A;  1VQO T;  1E6H A;  2RQT A;  2KBT A;  2X9H A;  4NOY A;  2NUP A;  2D8H A;  4E7S A;  1WHJ A;  1VIE A;  2BZ8 A;  2KRS A;  3CC2 Q;  1WNL A;  3M0S A;  1P92 A;  2VV5 A;  1D3B A;  5LL6 S;  1B34 B;  2JMC A;  2O9V A;  2DYB A;  2FVU A;  1YIJ Q;  3CCJ Q;  2H3J A;  2NWM A;  3HRT A;  2BIV A;  2AKK A;  3FLG A;  2A7Y A;  4KGZ B;  4Z8A A;  1H3Z A;  3QII A;  3ASK A;  2RI3 A;  2EJF A;  1AOJ A;  1WQ7 A;  2ATC B;  4LD6 A;  5LJ3 h;  5HK3 A;  3L2V A;  4ATO A;  1M2V B;  1W2B S;  1IB8 A;  4KH0 B;  5GMK l;  5I22 A;  1EFN A;  4IUR A;  1KD1 R;  1QVP A;  4RTW A;  1T3S A;  5GAO p;  4EMK B;  2QXF A;  3NTI A;  2JNG A;  2QK0 A;  1VQO A;  2HQX A;  4IIM A;  1PKS A;  2YUP A;  5FU7 C;  1BCM A;  3EGD A;  1WHH A;  2HMA A;  3OQ5 A;  3G71 T;  2DMO A;  4B9W A;  1OU8 A;  4HXJ A;  3QSU A;  4JRK A;  2DAQ A;  2PUO B;  3JB9 D;  3VS0 A;  4EMG A;  1M1F A;  2R5M A;  1U06 A;  2E3I A;  1Y07 A;  5EG2 A;  3OYE A;  1UGP B;  3OSV A;  2QI2 A;  3MP8 A;  2RMO A;  1O9S A;  2BZY A;  3C12 A;  2MOX A;  4Y91 A;  5D6Y A;  3EGX A;  1SRL A;  2O01 E;  2PTK A;  2F2W A;  1PCX A;  1K76 A;  4XTX A;  2XD0 A;  2LX7 A;  1RAE B;  4PK4 A;  5FW9 A;  1SEM A;  4OML A;  1B3Q A;  1Z9Q A;  1TU0 B;  1KFZ A;  1QVG P;  2HCK A;  2EQM A;  2QEX Q;  1K73 C;  3MP6 A;  2DD5 A;  4Z02 A;  4FIB A;  1VQ8 Q;  1AWW A;  4RMO A;  1N5Z A;  3CXC S;  2GFA A;  1JXO A;  2DET A;  2XDP A;  3INZ A;  1RAA B;  4OMN A;  1TG0 A;  1V29 B;  1PHT A;  1M1K U;  4FYV B;  4BE2 A;  1KSW A;  4Z88 A;  1ZUY A;  2CZ7 B;  2Y4X A;  1ZQ1 A;  2ZZD A;  5GAO n;  1X6O A;  1NJI R;  3C0C A;  3HHT B;  1XQH A;  1YIT A;  2HKN A;  2LX9 A;  5FRO A;  2A08 A;  1N9R A;  2RN8 A;  1T0H A;  5GAO q;  2ROL A;  2ESW A;  3QYH B;  1WXB A;  4QVC A;  4C5I A;  5CKF A;  2FO0 A;  2Y90 A;  1VQ5 T;  4OP0 A;  1HK9 A;  1UGR B;  2J6F A;  4M7D C;  2ECZ A;  5GAM j;  5FU6 C;  2QDL A;  4PKC C;  2V1Q A;  4LD9 K;  3TU4 K;  4J5Y A;  2R58 A;  8AT1 B;  1SF9 A;  3ZL7 C;  2LT1 A;  4A4G A;  4LUE A;  1PSE A;  3CCJ T;  3VS4 A;  1WIE A;  4ZNX A;  5KYW B;  1HD3 A;  8ATC B;  1UFF A;  1TUD A;  1H3H A;  5GAN 3;  3EGX B;  4XU3 A;  1RAF B;  2CGH A;  2I2L A;  2CZ0 B;  3S3M A;  4HKE A;  3G6E A;  2DD4 A;  1OOT A;  1WJQ A;  3P8H A;  2RQW A;  2AT1 B;  4RKU E;  1KK7 A;  4L6V 5;  1NEG A;  3LYI A;  4OVA A;  3HL8 A;  1V76 A;  2M51 A;  2K7A A;  2KRO A;  4GY5 A;  2D6F A;  4OB0 B;  1KD1 C;  4M78 F;  1YIJ A;  1Q82 C;  2K6D A;  2D0N A;  4JRI A;  2RK1 A;  1CSK A;  1WHK A;  4ZN1 A;  5GMK e;  4OMQ A;  3G71 A;  2E12 A;  4CC3 A;  1E6G A;  3OS5 A;  3JCM f;  3IQL A;  1VQP A;  4YTL A;  1ZLM A;  2L5Q A;  2VUB A;  3CCL A;  4CC7 A;  2YT6 A;  2VKN A;  1QVF P;  3I35 A;  5FLX E;  3CCQ A;  2DVJ A;  2M02 A;  1UEC A;  3NTK A;  2K5L A;  2DJZ A;  1H64 1;  2HSE B;  4PJO C;  4HVV A;  5J3B A;  2JZ2 A;  3QWY A;  2O31 A;  1G3Y A;  1JJ2 S;  4PJO D;  2A0F B;  4J9C A;  3CC4 Q;  4AFU C;  5LJ3 e;  2DBK A;  3I55 A;  4QQ6 A;  4FW1 A;  3I56 T;  2WSE E;  4AFZ C;  3CCU A;  4PL6 A;  2PVO B;  1BIA A;  4M78 A;  2F2X A;  1WI7 A;  3X25 B;  4RTY A;  3UPU A;  4XQ3 A;  3QHS A;  4XTV A;  4BI8 B;  2WSC E;  1X2K A;  1WQW A;  4Q5W A;  1KJW A;  3OYK A;  4B6M A;  4C5H A;  2RI2 A;  4FYX B;  1BCO A;  1VQL A;  4J6Y A;  4RG2 A;  3CC4 T;  3JCM e;  2EGA A;  1PSF A;  1U3O A;  5EC7 A;  1VQL T;  3VS5 A;  2RO0 A;  4GLK A;  1KQ1 A;  1VA7 A;  3X20 B;  3N5B B;  3RER A;  4IIO A;  3SD4 A;  4M75 E;  1UJY A;  2NUT A;  1VQ8 A;  1M8M A;  2BE7 D;  1BU1 A;  1QMC A;  3HRS A;  3JCM h;  1D0Y A;  2DM1 A;  1KD1 U;  1YJ9 Q;  1W4S A;  3CC7 T;  2CKK A;  1VQ5 Q;  4M78 E;  4C8Q D;  4LDW A;  3RIR A;  2QAS A;  3SDZ A;  3GLX A;  3TSW A;  2FYK A;  4E7I A;  2FRY A;  2BTT A;  1M8V A;  4M7D D;  4DEY A;  2A28 A;  3CEY A;  5GAN h;  3GIB A;  3X28 B;  3CXC A;  1WZO A;  3CPW S;  1B34 A;  4C5E A;  1VQN A;  2KRN A;  1JJ2 P;  1GBR A;  1MMG A;  1LCK A;  3MP1 A;  3MHX A;  2DTI A;  1FYN A;  1I5O B;  3A1P A;  1K4U S;  5HCK A;  2XU8 A;  2HD0 A;  2JS0 A;  1VQP T;  4M7A D;  2CZ1 B;  1OUL A;  1YI2 A;  2ROT A;  4PJL A;  3H0F A;  1GXI E;  4X1V A;  2F2V A;  3JCM X;  1GCP A;  1ZX6 A;  1K1Z A;  2K4Y A;  4J9E A;  2LQW A;  1QQJ A;  4C8Q B;  1GFD A;  2W10 A;  2G3R A;  2QGG A;  1U1S A;  2CP2 A;  1VQ8 T;  3HP9 A;  3I9Q A;  2HQE A;  2FG0 A;  2LNV A;  1VQN T;  1QKX A;  1WXT A;  4L5G A;  1D0Z A;  1ZA1 B;  2DIL A;  4E7Z A;  4JS4 A;  3A8H B;  3J81 E;  1N9S A;  2BZX A;  3M0U A;  2LP5 A;  2DO3 A;  3FDR A;  5L23 A;  2KMT A;  4FYW B;  4NL3 A;  2FPD A;  4PJM A;  3RES A;  5GAN g;  1M5Q 1;  4BB7 A;  5D6W A;  2E5K A;  2EYZ A;  2YUO A;  4B9X A;  3L1A A;  3V7R A;  1QP2 A;  5AT1 B;  1AVZ C;  1GBQ A;  3EG1 A;  4A53 A;  3LLR A;  3GP8 A;  3CCV Q;  4M75 D;  2YRV A;  4C0F A;  2WAC A;  4XTZ A;  4JLI A;  4PJO B;  1X6B A;  2DXT A;  3I56 Q;  3CCU T;  4HT8 A;  1RAH B;  1WDX A;  3T9N A;  1K9M R;  3CCL Q;  5A0L A;  5GAM d;  2GTO A;  3EH2 A;  4E7L A;  3LX7 A;  3REB B;  2LCL A;  4M78 C;  4PJO F;  5LJ5 e;  1Y0M A;  5KE2 A;  1UJ0 A;  5GMK h;  1WGS A;  1MHN A;  4QKU A;  5CK9 A;  1G5V A;  1FWZ A;  2BUD A;  2KXD A;  3NMZ C;  4KUI A;  1HYO A;  3OYN A;  1IGU A;  2JJ9 A;  4JJN K;  3UAT A;  3OYB A;  4HT9 A;  4ORZ A;  3CD6 T;  4QW2 A;  5KYU B;  2BKD N;  2VXF A;  2DTH A;  3SB2 A;  2K3Y A;  4EDU A;  5LJ5 j;  1VYU A;  4C8Q A;  4KUD K;  4C0D C;  4PNO A;  1Q82 U;  1LOJ A;  3OYH A;  3GF5 A;  3H41 A;  3NGP A;  4C92 D;  1AHJ B;  2RPN A;  5D6X A;  2DXC A;  2K9G A;  2RJD A;  2HQH A;  2VVK A;  2P4T A;  3CXC P;  4JJD A;  3CC7 Q;  3DLM A;  3VS7 A;  2OAU A;  4C92 F;  1QVF A;  2XHC A;  3M0P A;  1TTH B;  4QQD A;  2SRC A;  2EFI A;  2K2M A;  3EFO A;  3KFV A;  3CBO A;  2CUD A;  3M0R A;  5CKE A;  5LJ5 d;  2AKL A;  1JU5 C;  5HY6 A;  4K11 A;  1MV0 B;  2QQR A;  1OX9 A;  2F1L A;  3FC3 A;  3S3N A;  3JRZ A;  4M7D B;  2RJE A;  4N4H A;  2ED1 A;  2J05 A;  4JUV A;  1J3T A;  2EYQ A;  2XI9 A;  1BKB A;  3VJP A;  3O5Z A;  1R0C B;  1Q86 U;  3M57 A;  1PNJ A;  2KI7 A;  1FMW A;  1TUG B;  2QQ9 A;  4M77 B;  3OW2 A;  2RM4 A;  4O5V A;  2MWP A;  2QA4 T;  5FRN A;  1LNX A;  2QQA A;  1M2O A;  3CMA T;  2MMP A;  1ZSZ C;  4IUQ A;  4KBM B;  4L59 A;  4M7D F;  5CQY A;  4OB2 B;  2QG9 B;  2QA4 A;  3QJY A;  3EFR A;  4ELY C;  5GMK i;  3VYG A;  3PMI A;  2KYB A;  2CS7 A;  2DL4 A;  1TH7 A;  2KY9 A;  4M77 F;  2ZPG B;  4OGC A;  2V8K A;  4N4I A;  3JCM V;  4AT1 B;  3FB9 A;  1VQN Q;  5GAN f;  2XK0 A;  2MPX C;  3CBM A;  1Q86 R;  1VQ4 A;  1W2B P;  4DEX A;  3JAM E;  3OYF A;  1OYX A;  5KYY A;  1N6A A;  4M78 B;  4UC4 A;  5I11 A;  1JO8 A;  1NLO C;  1X69 A;  2JT4 A;  1WHG A;  4LDU A;  4AFQ C;  2JTF A;  1ZUK A;  1RLP C;  2NYS A;  3M54 A;  3EG2 A;  4C92 E;  2VGN A;  1EZZ B;  1JB0 E;  1OX8 A;  1ARK A;  4E7J A;  4M77 E;  1VQP Q;  4J9G A;  4JRQ A;  2DL7 A;  4PLL A;  1GCQ C;  3EHR A;  3PVQ A;  4A63 B;  4D8D A;  2GFU A;  4D8K A;  4JJB A;  2PNI A;  1I81 A;  2WSF E;  3OYA A;  3REA B;  4AG2 C;  4N0A A;  4KGV B;  3TCJ A;  4EMK C;  5GAN 6;  2K5I A;  3H6Z A;  2KYM A;  2GGR A;  4EPC A;  2QYZ A;  4Z89 A;  3G4S Q;  2EJ9 A;  1Q95 G;  1BK2 A;  2RJC A;  3TRE A;  2RHU A;  3H0I A;  3CCJ A;  1VQ9 A;  3SFM A;  2RA2 A;  5M9O A;  1SHF A;  1WJS A;  2HSP A;  1WJR A;  2RB6 A;  5DM7 R;  5KYX A;  3M56 A;  3ZFJ A;  3LW5 E;  4M77 G;  4X34 A;  4V2S A;  1QKW A;  1PD1 A;  3CD6 Q;  4M7A A;  3I56 A;  4M75 F;  3R6N A;  3PIO A;  1VQK Q;  2K3B A;  2DXB A;  2L2P A;  1I8F A;  3CCS Q;  4JZ3 A;  1X43 A;  2LCC A;  2RQR A;  2EQK A;  2CH4 A;  1Q81 U;  3VUZ A;  1VQO Q;  2LMJ A;  2JN0 A;  5GAO m;  5LJ3 f;  2DXU A;  1Q81 R;  3CCL T;  1M90 U;  5FRM A;  1M4Z A;  3PTA A;  2CSQ A;  1UDL A;  2M16 A;  4BDZ A;  1IHV A;  3O8V A;  3S6W A;  1R77 A;  2EYX A;  2LQK A;  1V1C A;  3HFO A;  3DB3 A;  2X4Y A;  3OYY A;  5GAN d;  1YJN T;  3HPW A;  3RDV A;  2QAZ A;  1TSF A;  3JB9 J;  5HK0 A;  2EGE A;  3UT1 A;  1WA7 A;  3V7S A;  1K9A A;  4Y92 A;  2D8J A;  4XU1 A;  1M1K R;  2DER A;  2KT8 A;  3HFN A;  2YRC A;  2GNC A;  3VV0 A;  1U1T A;  5I2S A;  4CC2 A;  1O75 A;  1ZSZ A;  4AG1 C;  6AT1 B;  2OTJ Q;  2QEX A;  4KT0 E;  1QCN A;  1NPP A;  3I55 Q;  4J83 A;  4DOV A;  1NM7 A;  1JJ2 A;  1DJ7 B;  4WF2 A;  4PJO G;  1QCF A;  3VKI A;  4ZN3 A;  3EG9 A;  5KH6 A;  1PWT A;  1TUC A;  1YBY A;  2YRD A;  4R0K A;  1RAI B;  2DKG A;  5GAM g;  1YHQ Q;  4F14 A;  4RTX A;  4C8Q E;  4RCC A;  2MI6 A;  5GAO l;  1HJD A;  3M53 A;  2C0O A;  1YIT Q;  2W0Z A;  1S1N A;  2HZY A;  4J7I A;  1QWE A;  1B7T A;  4ZGE B;  2X3X D;  2FL7 A;  2E6N A;  2YUQ A;  2GQV A;  3MO8 A;  2PVD B;  1E7O A;  3RKX A;  3QBY A;  3QKJ A;  2EKO A;  2JTM A;  2PU9 B;  7AT1 B;  4C92 C;  1VIF A;  1SKU B;  4DQ2 A;  4PFZ A;  1YNZ A;  2J7I A;  2C0I A;  3HSB A;  3BE3 A;  3L2Z A;  4OB3 B;  3FIF A;  5GAO r;  4HCZ A;  3Q1J A;  1PRM C;  3CMA A;  2GF7 A;  2IVW A;  1K73 U;  1M90 C;  5IH2 A;  2ZPF B;  4BDY A;  1YIJ T;  2DA9 A;  1FMK A;  2ZCF B;  2LDM A;  1PC0 A;  1SRM A;  1C6V X;  1I1J A;  3NPF A;  2XDD A;  1OQK A;  1NG2 A;  3EFS A;  4XU0 A;  2ZPH B;  2KEA A;  4MZP A;  3J7A F;  3GOX A;  1M3C A;  2DEQ A;  2B86 A;  4FT2 A;  4A4K A;  3JCM b;  1C1A A;  4F16 A;  1M3A A;  2EPD A;  2J6O A;  3BW1 A;  1VQ4 T;  3NFC A;  1XJW B;  4RCB A;  1PKT A;  2GCX A;  1AD5 A;  4M77 C;  2L0A A;  2JXB A;  3LH5 A;  2M1H A;  5LJ3 g;  3CCS T;  3G4S A;  2DEU A;  1YWP A;  1ZSZ B;  1KC8 U;  4J9I A;  2B8A A;  4J9B A;  3HKS A;  3SHW A;  3WVE B;  1M27 C;  1VQ9 Q;  1KQ2 A;  4F7U F;  1K8A C;  3V7C A;  1ZBX A;  4F04 B;  2DIQ A;  3BY7 A;  2J06 A;  1TXQ A;  4IKF A;  3G71 Q;  1Y71 A;  4CI0 C;  3MEU A;  2NUP B;  3CD6 A;  4BI3 A;  2EYY A;  3JSC A;  1H92 A;  1ZSG A;  2FZC B;  1D3B B;  4C0Z A;  2CP0 A;  2IIM A;  1K73 R;  2IPO B;  3PNW C;  1UHC A;  3CCE A;  3MET A;  5CQX A;  1UTI A;  1Z9Z A;  3CPW P;  3G7Z A;  2LQ8 A;  3CCS A;  2R5A A;  2CT3 A;  1KG1 A;  2MWO A;  3A98 A;  3PGG A;  2ZPE B;  3I5R A;  3M58 A;  2D1X A;  3QDF A;  5J26 A;  4C5G A;  1KIK A;  5CO7 A;  3EH1 A;  5HKC A;  5A2Q E;  5J39 A;  1OEB A;  1AEY A;  3S3O A;  2DRK A;  2VWF A;  3KBG A;  2M0Y A;  2LZ6 B;  2HNI A;  3I55 T;  2KXC A;  2HKQ B;  3CCV T;  2C06 A;  2E5Q A;  5KCH A;  1JEG A;  2XIC A;  1D1A A;  3JB9 F;  4LDV A;  3VS1 A;  1UGQ B;  1SSF A;  1PG5 B;  2HBP A;  4CRI A;  1VYT A;  5CKB A;  4J9D A;  1RL2 A;  1UEB A;  3L42 A;  5ECA A;  1AZE A;  2RQV A;  1KC8 C;  2AIR B;  1VYV A;  3BFM A;  3CCR Q;  4A4F A;  3M59 A;  1LVK A;  1SHG A;  3RR6 A;  2FPF A;  3NHN A;  3QXE B;  2P0Q A;  5GAN 2;  3M0Q A;  4LDY A;  2VAS A;  4X9D A;  2ZPI B;  4PFP A;  1BIB A;  4HVW A;  2JM8 A;  3V8K A;  3VU3 C;  4M7A C;  1YJN A;  2FRW A;  2K2V A;  1G8X A;  5AYF A;  2JVV A;  3SWN B;  4C0G A;  2XDB A;  2PUK B;  3OSS C;  2D0Q B;  4P5N A;  4DA4 A;  3CC7 A;  3TSZ A;  2EYW A;  1I5L A;  5C6S A;  2LJ3 A;  2DE0 X;  3L2R A;  1NEB A;  2COY A;  4BI4 A;  3A8M B;  3CCR T;  4A4E A;  4ZGJ B;  2ENM A;  1GCQ A;  1U5S A;  3VS2 A;  4KRT A;  4M78 G;  3CME Q;  2L8D A;  1M90 R;  4XU2 A;  1QVF S;  4C8Q C;  2KAF A;  1UGV A;  3P8B B;  3OYC A;  1OZ2 A;  2E6Z A;  1IGQ A;  1YIT T;  1BBZ A;  4GLM A;  3RUX A;  2IG0 A;  1MGQ A;  1X75 C;  5IAY A;  2EWN A;  3GNG A;  4XTU A;  2VXE A;  2NUT B;  1X2Q A;  4RG8 A;  1KC8 R;  2DK3 A;  1RI9 A;  5GAN 4;  4M7A F;  3RMS A;  1MMA A;  2JM9 A;  3TQ7 P;  1VQ6 A;  1I07 A;  2L89 A;  1Q7Y C;  4IUT A;  3ULR B;  2QA4 Q;  2KVQ G;  3RKY A;  4M75 C;  2XMF A;  4GBQ A;  2MCN A;  2CP5 A;  4DBF A;  4DBH A;  1WHM A;  3A8L B;  3ME9 A;  4M7A B;  4CC4 B;  4ZTF A;  4R55 A;  2EQU A;  3JCM g;  4KUL A;  3LH0 A;  2JW4 A;  4E6R A;  3FJP A;  3JB9 H;  2COZ A;  1HXD A;  1G83 A;  3JV3 A;  2XID A;  3OB9 A;  3CPF A;  1JRI A;  1RI0 A;  3EFO B;  3QG1 A;  3U23 A;  3JB9 I;  2EAY A;  3CCV A;  3CCQ T;  2EBP A;  1OV3 A;  3QYG B;  1QLY A;  2HL3 A;  2OI3 A;  3FEO A;  4WCI A;  5KYN A;  1BB9 A;  1XTD A;  1NPR A;  2DZ9 A;  1WHL A;  1YCY A;  1M1K C;  5CAI A;  2LRQ A;  4LN2 A;  2EKH A;  1UE9 A;  4QVD A;  1QW1 A;  5GJW B;  3CCM T;  2KR3 A;  3DB4 A;  1WLP B;  1Y96 A;  5CCA A;  2LJ1 A;  1VQ9 T;  1OPK A;  3R6O A;  1QWF A;  1EX4 A;  2FZK B;  1QVG A;  1K8A R;  2DPP B;  3KUF A;  5IN1 A;  2DFU A;  3VS3 A;  2CSI A;  2DX1 A;  2KT1 A;  1M30 A;  4MZT A;  3VYH B;  3G1J A;  3M5A A;  1A0N B;  3SWN C;  1NE8 A;  9ATC B;  1Q81 C;  5I2M A;  2KE9 A;  4BD3 A;  3EGD B;  1K8A U;  1BI0 A;  2EIF A;  1Y96 B;  2A3L A;  1QP3 A;  2OTL Q;  4OMO A;  2F5K A;  4EIK A;  2P84 A;  4EMK A;  1VQK A;  1PM3 A;  2KK4 A;  3OYL A;  1YJ9 T;  4J6W A;  3RMQ A;  3WVD B;  1X6G A;  2EQI A;  1JXM A;  2CZ6 B;  4J9F A;  4ELZ C;  3LWI A;  2KGT A;  1S72 T;  1X27 A;  2CP7 A;  3M0T A;  4EMH A;  5KYW A;  5A0D A;  1IXD A;  3C4S A;  5DLO A;  2JMA A;  3GBQ A;  1RAC B;  1JBM A;  2MAM A;  2NLU A;  1S72 A;  4RTV A;  5DY9 A;  4N0A C;  4M4Z A;  4C92 G;  4DBR A;  3E1S A;  3ER0 A;  4C92 A;  3OYJ A;  2KRM A;  4E2F B;  1R8O B;  2O9S A;  3L2Q A;  1VQ7 Q;  2L3S A;  1VQ6 T;  2YDL A;  2CYZ B;  1VQM T;  4FSS A;  4XAX B;  1MV3 A;  4E7K A;  2HAX A;  3LGL A;  5KCO A;  4FYY B;  2EW3 A;  5KYX B;  2DRM A;  1YJN Q;  4AMC A;  1D1B A;  2LNH B;  2CH4 W;  4MZM A;  4OF1 A;  1M3B A;  2Z0W A;  2PZ1 A;  1MMD A;  1VQM A;  2EQJ A;  4MML A;  2K5F A;  1NBE B;  3J80 E;  4J6X A;  2DF6 A;  3JB9 G;  4C92 B;  3OYG A;  4M77 D;  5GAN 8;  5FWB A;  2OTJ A;  4MDX A;  1B07 A;  2DJQ A;  3FJ5 A;  3M4G A;  2X3W D;  2COW A;  2DTO A;  2ZPB B;  1ABO A;  3EAE A;  1Q86 C;  4VUB A;  4F7U B;  3A5Z B;  2HBW A;  4ME7 A;  2O4X A;  1NZ9 A;  2E64 A;  1YJW Q;  4PFO A;  5A0G A;  3M4Y A;  1NJI U;  1UB4 A;  4XTY A;  3FRN A;  3OYM A;  3A8G B;  1RAG B;  1N8R R;  4LXC A;  2X51 A;  5LJ5 f;  3X24 B;  2JS2 A;  4ANJ A;  3E19 A;  3MJX A;  4BUG A;  2RQU A;  1U8R A;  3CBP A;  3CCE Q;  1BI3 A;  4MDW A;  1KQS S;  5FWC A;  2J6K A;  3M55 A;  1ZA2 B;  3G6E Q;  1ACM B;  3H8Z A;  1X01 A;  2CT4 A;  2EJG A;  3JCM J;  2KSS A;  2L3P A;  3PT9 A;  4LE9 A;  4XTW A;  2AK5 A;  4JJC A;  1WPY A;  5L8R E;  2HDA A;  1OPL A;  2FHD A;  4QVZ A;  2VC8 A;  3JCM W;  4ZTJ A;  1G2B A;  4JS5 A;  4F7U G;  2DZC A;  3PVL A;  2LJ0 A;  2KDS A;  2FZG B;  2RHI A;  1I0C A;  3DKM A;  1YWO A;  1ABQ A;  3QDR B;  3G6E T;  2QQS A;  5IHN A;  2EVR A;  1UGS B;  3HRU A;  2KQW A;  3CCQ Q;  5GAN 7;  2CDT A;  1G3S A;  3I5S A;  1M9S A;  1RUW A;  1TOV A;  2O2O A;  5IT9 E;  3EG3 A;  2OAW A;  2H8H A;  4M77 A;  2NUZ A;  2E70 A;  1RAD B;  2QEX T;  1Q7Y U;  4PJN A;  3CC2 A;  3CCR A;  1K0S A;  2LT4 A;  3CCM Q;  4IUU A;  4RTZ A;  2ZGW A;  2D9T A;  4M7D A;  3JCM c;  3CC4 A;  3OY9 A;  1W1F A;  4M7D G;  3EHQ A;  2E41 A;  3VUB A;  1CKB A;  3SEM A;  3TVT A;  3L2W A;  1IZ6 A;  2QGF B;  3CCU Q;  2LQN A;  4F7U A;  4DOW A;  3V8J A;  2MK5 A;  5GJV B;  2M0O A;  3PIP A;  4PJJ A;  1YP5 A;  4QT7 A;  4HVU A;  3OW2 S;  2RNA A;  2GQI A;  1K9M C;  5IXB A;  2DL3 A;  5I21 A;  2RD1 A;  2LVM A;  3QO3 A;  2LCS A;  1WX6 A;  3MEW A;  4M7A E;  2SEM A;  3VRZ A;  2X35 A;  4A54 A;  3ZBD A;  1NYG A;  3EG0 A;  1Y7X A;  2M9U A;  3THK A;  3OS2 A;  2XKO C;  2E3H A;  3OYI A;  1Q82 R;  5KYU A;  1CKA A;  4BAC A;  3UA6 A;  3AHU A;  3UDC A;  2E4H A;  4BY6 B;  4IUP A;  3VS6 A;  2X4X A;  3UWN A;  4E7H A;  2VB6 A;  5IXF A;  4NS5 A;  4C8Q F;  4FCY A;  2JTE A;  3UA7 A;  3RBB B;  1JQQ A;  1VQ7 A;  4OGE A;  4HCK A;  3OBY A;  3E2U A;  1YHQ A;  2RF0 A;  1NLP C;  4OB1 B;  3C94 A;  3QPH A;  4F17 A;  1K0X A;  1VOM A;  4C0D B;  3E9G A;  2CP3 A;  2JOY A;  1AWX A;  1MUZ A;  4OMF B;  1LPL A;  3OMG A;  5KE3 A;  1YJW T;  4J7F A;  4RUG A;  2DL8 A;  5LJ3 d;  3CC2 T;  1XOV A;  1VQM Q;  4ZGD B;  1BI1 A;  3E9F A;  4PJO A;  1EIF A;  2CRE A;  5GAM h;  2O88 A;  2RH2 A;  2MYS A;  4FSX A;  2K57 A;  1H8K A;  5IHK A;  5D7U A;  1UUE A;  3CCE T;  4D6W A;  2VYT A;  5CR2 A;  3NTH A;  2GBQ A;  1T0J A;  1YCS B;  3M9Q A;  1AT1 B;  2AHJ B;  4RTT A;  4X9C A;  2XG8 D;  4KH1 B;  3AT1 B;  2AZS A;  3HTR A;  4XK8 E;  3KXT A;  3CMA Q;  3BDU A;  2PVG B;  1N8R C;  1YI2 Q;  4LDX A;  4FL6 A;  5GAM e;  3JCM P;  2HL5 C;  3JCM d;  1AZG B;  2P0K A;  2DBM A;  4AFS C;  1W2B A;  2QQB A;  5CVI A;  2P0P A;  3H9N A;  3OYD A;  1G3W A;  2QDY B;  4IUV A;  1M2V A;  2X4J A;  1N8R U;  4JPB W;  3CPW A;  3QWX X;  3CME A;  4M7D E;  1OI1 A;  2V1R A;  2ED0 A;  2YUN A;  5KYY B;  2L3R A;  4O6J A;  1RLQ C;  2A37 A;  4C8Q G;  2LC4 A;  4KGX B;  4RTU A;  5CKD A;  3CME T;  2RHY A;  5LJ5 h;  3OS0 A;  5CKH A;  1IO6 A;  1FMV A;  5CIU A;  1WFW A;  1W70 A;  4PLI A;  1N27 A;  4M75 G;  4M78 D;  2CUB A;  3EG9 B;  2DIG A;  2DVE A;  3RNJ A;  3QZ9 B;  3H0H A;  2JUF A;  3OA6 A;  4E47 A;  1I4K 1;  1SSH A;  1D0X A;  2QTV A;  2YXY A;  2E65 A;  2DL5 A;  2YLB A;  2MIO A;  2F5T X;  3OMC A;  4LUD A;  5FU6 B;  5IHI A;  4BY6 C;  5DLQ E;  2OTL A;  3GPL A;  4II1 A;  1MND A;  5GMK j;  1TWB A;  2ZAE A;  1XNI A;  3RKW A;  1PD0 A;  2DLP A;  4MMK A;  2RI5 A;  4HCB A;  3PE0 A;  3LWH A;  1G3T A;  4JDS A;  1WYX A;  4JZ4 A;  1FXX A;  1UG1 A;  3TEE A;  3P8D A;  2G6F X;  2E1H A;  1VQL Q;  4HA8 A;  1RAB B;  2R57 A;  4BE1 A;  3G4S T;  2E10 A;  2L3Q A;  4Y28 E;  3MEV A;  3ZEH A;  1Y57 A;  4OMM A;  2O4X B;  1FX7 A;  2RHZ A;  2P4R A;  2YSQ A;  1C0M A;  2VGM A;  4M75 A;  3CCM A;  1IRE B;  2K79 A;  1OZ3 A;  1BYM A;  1KQS A;  4FU6 A;  1PRL C;  4HCC A;  1Q7Y R;  2HEQ A;  4OMP A;  3V8L A;  4DBQ A;  2V26 A;  1T3L A;  4R56 A;  2YLC A;  2OJ2 A;  1IHW A;  3OS1 A;  2KNB B;  2CP6 A;  3GNF B;  5LJ3 j;  1K9M U;  1YJ9 A;  4LNP A;  4TVR A;  1BI2 A;  4PJO E;  4FT4 A;  2FEI A;  2MF2 A;  4ESR A;  3EGU A;  1NYF A;  3MCA B;  2YWW A;  2DYI A;  2RK2 A;  3F70 A;  3QUI A;  4BE0 A;  2ABL A;  5LJ5 g;  3QJ6 A;  2FB7 A;  4WTO B;  3L2U A;  1W6X A;  4M7A G;  3X26 B;  1GL5 A;  1QCO A;  4F7U E;  1ZBJ A;  4NL2 A;  3SWN A;  1GFC A;  3OW2 P;  1OU9 A;  4FM4 B;  2RJF A;  4FW2 A;  1D1C A;  5C0M A;  3BDL A; 
#chains in the Genus database with same CATH homology
 1VQ8 A;  1DJ7 B;  1R8O B;  4WF2 A;  3L2Q A;  4PJO G;  1VQ6 T;  3HRS A;  2CYZ B;  3VKI A;  1VQM T;  4XAX B;  3JCM h;  4ZN3 A;  4JRP A;  1KD1 U;  3OBW A;  4E7K A;  1W4S A;  2HAX A;  3LGL A;  1YJW A;  3CC7 T;  5KCO A;  2CKK A;  2LTO A;  5KH6 A;  4M78 E;  1YBY A;  3MEA A;  4C8Q D;  4LDW A;  3RIR A;  1VUB A;  1ZHI A;  2DKG A;  3SDZ A;  5GAM g;  3GLX A;  1M1G A;  2FYK A;  1YI2 T;  2OTL T;  4C8Q E;  4E7I A;  4RCC A;  5FU7 B;  2MI6 A;  5GAO l;  4MZM A;  4OF1 A;  5GAN j;  1KHI A;  3M53 A;  1VQM A;  2EQJ A;  4J7I A;  4MML A;  2K5F A;  4ZGE B;  4M7D D;  1M8V A;  3CEY A;  1QVG S;  2FL7 A;  5GAN h;  2E6N A;  3X28 B;  4A4H A;  3CXC A;  3GIB A;  3QZ5 B;  3LGF A;  3CPW S;  1B34 A;  2OTJ T;  3J80 E;  4J6X A;  3CC7 A;  2GQV A;  4C5E A;  3MO8 A;  3JB9 G;  1VQN A;  2PVD B;  4C92 B;  3RKX A;  3OYG A;  4M77 D;  3QBY A;  5GAN 5;  3QKJ A;  5GAN 8;  2EKO A;  2JTM A;  2OTJ A;  2PU9 B;  3MP1 A;  4QQG A;  4C92 C;  4JLG A;  1VIF A;  3MHX A;  4MDX A;  2PQW A;  2DTI A;  4DQ2 A;  3M4G A;  1LJO A;  2DTO A;  2ZPB B;  1KHC A;  2XU8 A;  3URG A;  3EAE A;  2Y4Y A;  2HD0 A;  1VQP T;  4VUB A;  1Q86 C;  4M7A D;  2CZ1 B;  4F7U B;  4J8O A;  3HSB A;  3A5Z B;  1YI2 A;  3L2Z A;  4OB3 B;  3FIF A;  2O4X A;  3A8O B;  4ME7 A;  4HCZ A;  5GAO r;  1NZ9 A;  1GXI E;  3Q1J A;  3WXM B;  3JCM X;  3JCM Q;  2V8I A;  3CMA A;  1YHQ T;  2F69 A;  2GF7 A;  2IVW A;  2E64 A;  2X4W A;  5GMK m;  1K73 U;  1M90 C;  1VQ5 A;  2K4Y A;  4N4G A;  2ZPF B;  4M75 B;  4C8Q B;  3M4Y A;  5A0G A;  1NJI U;  1VQ7 T;  1UB4 A;  4BDY A;  2G3R A;  3FRN A;  4XTY A;  1YIJ T;  3DLL A;  2QA4 A;  3OYM A;  1U1S A;  1VQK T;  2ZCF B;  3A8G B;  2LDM A;  1VQ8 T;  3HP9 A;  5LJ5 f;  3PMT A;  3X24 B;  2HQE A;  2K3X A;  2RHX A;  2LNV A;  1NJI C;  3C95 A;  5GAM f;  3E19 A;  2XDD A;  1VQN T;  4BUG A;  3EFS A;  4L5G A;  2V8J A;  4XU0 A;  2ZPH B;  4MZP A;  3J7A F;  1U8R A;  3GOX A;  3CBP A;  4JS4 A;  3A8H B;  3J81 E;  1N9S A;  1BI3 A;  2DEQ A;  2YHT A;  1KD1 C;  4FT2 A;  4A4K A;  2DO3 A;  4MDW A;  3FDR A;  3JCM b;  1KQS S;  3PFS A;  2KMT A;  2QTX A;  3M55 A;  5GAN e;  4NL3 A;  3BW1 A;  1VQ4 T;  3NFC A;  3RES A;  1M5Q 1;  4BB7 A;  5GAN g;  1VQO T;  4RCB A;  5D6W A;  3H8Z A;  1X01 A;  4NOY A;  2EJG A;  3JCM J;  2GCX A;  2KSS A;  4M77 C;  1VIE A;  3PT9 A;  2M1H A;  5LJ3 g;  1WNL A;  3CCS T;  3G4S A;  4XTW A;  4B9X A;  1P92 A;  2VV5 A;  1D3B A;  3L1A A;  5LL6 S;  1KC8 U;  2B8A A;  3V7R A;  1B34 B;  1QP2 A;  1WPY A;  5L8R E;  2FHD A;  3HKS A;  2FVU A;  2VC8 A;  4QVZ A;  3JCM W;  4ZTJ A;  4JS5 A;  3WVE B;  4F7U G;  2DZC A;  3LLR A;  4A53 A;  3GP8 A;  1KQ2 A;  4M75 D;  2YRV A;  2H3J A;  4C0F A;  4F7U F;  3HRT A;  1ZBX A;  3V7C A;  1K8A C;  2WAC A;  2DIQ A;  4XTZ A;  2KDS A;  3BY7 A;  2RHI A;  4JLI A;  4IKF A;  4PJO B;  1Y71 A;  2DXT A;  2BIV A;  4CI0 C;  3DKM A;  3CCU T;  3MEU A;  4HT8 A;  3CD6 A;  4BI3 A;  3FLG A;  2A7Y A;  3JSC A;  1H3Z A;  3QII A;  3ASK A;  3QDR B;  3T9N A;  3G6E T;  2RI3 A;  1D3B B;  2EJF A;  2QQS A;  4C0Z A;  1WQ7 A;  5A0L A;  3PNW C;  4LD6 A;  1UGS B;  3HRU A;  5LJ3 h;  3MET A;  2KQW A;  3CCE A;  5GAN 7;  5CQX A;  5GAM d;  5HK3 A;  3L2V A;  4E7L A;  4ATO A;  3G7Z A;  1W2B S;  3LX7 A;  2LCL A;  4M78 C;  1G3S A;  2LQ8 A;  4PJO F;  5LJ5 e;  1M9S A;  5GMK l;  5KE2 A;  5GMK h;  1I5L A;  1WGS A;  1MHN A;  3CCS A;  2R5A A;  5CK9 A;  1G5V A;  5IT9 E;  4IUR A;  4M77 A;  1KG1 A;  2E70 A;  1QVP A;  2MWO A;  5GAO p;  2QEX T;  3PGG A;  1FWZ A;  2ZPE B;  2BUD A;  1Q7Y U;  4EMK B;  2QXF A;  3M58 A;  3NTI A;  2JNG A;  4KUI A;  3CC2 A;  5J26 A;  1VQO A;  3CCR A;  2HQX A;  2LT4 A;  3OYN A;  4IUU A;  2ZGW A;  4JJN K;  2D9T A;  4M7D A;  3JCM c;  4C5G A;  3OYB A;  5CO7 A;  5FU7 C;  4HT9 A;  3CC4 A;  5HKC A;  5A2Q E;  3OY9 A;  4M7D G;  5J39 A;  3VUB A;  2E41 A;  3CD6 T;  3OQ5 A;  4QW2 A;  3G71 T;  2BKD N;  3S3O A;  2VXF A;  3L2W A;  2DTH A;  1IZ6 A;  3SB2 A;  4F7U A;  3KBG A;  4B9W A;  4DOW A;  2HNI A;  3QSU A;  4JRK A;  3I55 T;  2DAQ A;  2K3Y A;  2PUO B;  3V8J A;  4EDU A;  3JB9 D;  2M0O A;  5LJ5 j;  4EMG A;  3PIP A;  4C8Q A;  4KUD K;  1M1F A;  4C0D C;  4PNO A;  2R5M A;  3CCV T;  2C06 A;  2E5Q A;  1Y07 A;  5EG2 A;  1Q82 U;  5KCH A;  1LOJ A;  2XIC A;  1UGP B;  3OYE A;  3OYH A;  3OSV A;  3GF5 A;  2QI2 A;  4C92 D;  3OW2 S;  3JB9 F;  1AHJ B;  3MP8 A;  5D6X A;  2DXC A;  4LDV A;  2RJD A;  1K9M C;  1O9S A;  1UGQ B;  1SSF A;  2P4T A;  3C12 A;  2HBP A;  3DLM A;  4Y91 A;  4CRI A;  5D6Y A;  5I21 A;  5CKB A;  2RD1 A;  2OAU A;  2LVM A;  3QO3 A;  4C92 F;  1QVF A;  2XHC A;  2O01 E;  3MEW A;  1RL2 A;  4QQD A;  1UEB A;  4XTX A;  2XD0 A;  4M7A E;  2EFI A;  2X35 A;  4A54 A;  3ZBD A;  3L42 A;  3CBO A;  5CKE A;  1Y7X A;  5LJ5 d;  2M9U A;  1KC8 C;  5HY6 A;  3OS2 A;  2XKO C;  3OYI A;  3BFM A;  2QQR A;  4A4F A;  4BAC A;  3M59 A;  3AHU A;  3UDC A;  3FC3 A;  2EQM A;  3S3N A;  1YJW T;  1K73 C;  3MP6 A;  2DD5 A;  4BY6 B;  3JRZ A;  4IUP A;  4M7D B;  2RJE A;  2X4X A;  4N4H A;  4Z02 A;  4FIB A;  3UWN A;  4JUV A;  4E7H A;  2EYQ A;  2XI9 A;  3QXE B;  2P0Q A;  1BKB A;  3VJP A;  5GAN 2;  4NS5 A;  4RMO A;  1Q86 U;  3M57 A;  4LDY A;  4C8Q F;  4X9D A;  3CXC S;  2GFA A;  2ZPI B;  1BIB A;  2QQ9 A;  4M77 B;  1VQ7 A;  4OGE A;  3V8K A;  3OW2 A;  2XDP A;  2RM4 A;  3INZ A;  3VU3 C;  4O5V A;  4M7A C;  1YJN A;  2MWP A;  2QA4 T;  5FRN A;  1LNX A;  2QQA A;  3OBY A;  1VQL A;  1YHQ A;  3CMA T;  2MMP A;  4IUQ A;  1V29 B;  2K2V A;  4OB1 B;  3C94 A;  4KBM B;  5AYF A;  3QPH A;  2JVV A;  3SWN B;  4L59 A;  1M1K U;  4C0G A;  4BE2 A;  5CQY A;  4OB2 B;  4C0D B;  3E9G A;  2XDB A;  2PUK B;  4M7D F;  3OSS C;  2CZ7 B;  2D0Q B;  2JOY A;  3EFR A;  3QJY A;  2Y4X A;  4P5N A;  4OMF B;  4ELY C;  5KE3 A;  1ZQ1 A;  2ZZD A;  3OMG A;  1X6O A;  5GMK i;  5GAO n;  4J7F A;  3PMI A;  3HHT B;  3VYG A;  5C6S A;  3L2R A;  2CS7 A;  1XQH A;  1YIT A;  5LJ3 d;  3A8M B;  1TH7 A;  4BI4 A;  2LX9 A;  5FRO A;  4A4E A;  1XOV A;  2KY9 A;  4M77 F;  4ZGJ B;  3CCR T;  1N9R A;  4ZGD B;  5GAO q;  1BI1 A;  3E9F A;  2ZPG B;  4PJO A;  1EIF A;  4OGC A;  5GAM h;  4M78 G;  2V8K A;  2L8D A;  4N4I A;  2RH2 A;  3JCM V;  4FSX A;  3FB9 A;  4XU2 A;  2K57 A;  3QYH B;  1QVF S;  4QVC A;  4C8Q C;  2KAF A;  5GAN f;  2XK0 A;  3P8B B;  4C5I A;  3OYC A;  4D6W A;  2VYT A;  3CCE T;  3CBM A;  1OZ2 A;  5CR2 A;  3NTH A;  2E6Z A;  1VQ4 A;  1YIT T;  3M9Q A;  5CKF A;  2Y90 A;  2AHJ B;  4X9C A;  3JAM E;  3OYF A;  1OYX A;  1N6A A;  2XG8 D;  4M78 B;  1VQ5 T;  4UC4 A;  4OP0 A;  1HK9 A;  3RUX A;  2IG0 A;  4XK8 E;  1UGR B;  1MGQ A;  4M7D C;  1X75 C;  5IAY A;  2EWN A;  3KXT A;  3GNG A;  4XTU A;  1N8R C;  3BDU A;  2PVG B;  4LDX A;  2VXE A;  4FL6 A;  5GAM j;  4RG8 A;  2DK3 A;  4LDU A;  5FU6 C;  5GAM e;  5GAN 4;  3JCM P;  2JTF A;  4M7A F;  3RMS A;  4PKC C;  3JCM d;  2P0K A;  3M54 A;  4C92 E;  4LD9 K;  3TU4 K;  4J5Y A;  2R58 A;  1VQ6 A;  2VGN A;  1W2B A;  2QQB A;  2L89 A;  5CVI A;  2LT1 A;  1JB0 E;  2P0P A;  4IUT A;  1PSE A;  4A4G A;  3CCJ T;  2KVQ G;  3RKY A;  4M75 C;  4E7J A;  3CC2 T;  4M77 E;  4JRQ A;  3OYD A;  4PLL A;  1G3W A;  2QDY B;  4IUV A;  2GFU A;  5GAN 3;  2X4J A;  3A8L B;  4XU3 A;  3ME9 A;  4M7A B;  1N8R U;  1I81 A;  3CPW A;  2CGH A;  3CME A;  4ZTF A;  4M7D E;  4R55 A;  2WSF E;  1OI1 A;  2I2L A;  3OYA A;  2CZ0 B;  2EQU A;  3S3M A;  2L3R A;  4HKE A;  4O6J A;  3JCM g;  3G6E A;  4KUL A;  4N0A A;  2DD4 A;  3LH0 A;  4C8Q G;  3TCJ A;  2LC4 A;  1WJQ A;  3FJP A;  3P8H A;  4RKU E;  4EMK C;  2RHY A;  5CKD A;  5GAN 6;  3CME T;  5LJ5 h;  2K5I A;  3H6Z A;  3OS0 A;  5CKH A;  3JB9 H;  1HXD A;  5CIU A;  4EPC A;  4PLI A;  2XID A;  2EJ9 A;  1N27 A;  4L6V 5;  3LYI A;  4M75 G;  4M78 D;  4OVA A;  3HL8 A;  2RJC A;  3OB9 A;  2DIG A;  2DVE A;  3TRE A;  2RHU A;  3CPF A;  3QZ9 B;  1JRI A;  1RI0 A;  3CCJ A;  3QG1 A;  2JUF A;  4GY5 A;  3SFM A;  3OA6 A;  1VQ9 A;  4E47 A;  1I4K 1;  2EAY A;  4OB0 B;  3JB9 I;  2RA2 A;  4M78 F;  3CCV A;  3CCQ T;  5M9O A;  1YIJ A;  1WJS A;  1Q82 C;  1WJR A;  2RB6 A;  5DM7 R;  2E65 A;  3QYG B;  4JRI A;  2YLB A;  3M56 A;  2RK1 A;  2F5T X;  3FEO A;  3LW5 E;  3OMC A;  4M77 G;  4X34 A;  5FU6 B;  3ZFJ A;  4BY6 C;  5DLQ E;  4ZN1 A;  4V2S A;  1XTD A;  1NPR A;  5GMK e;  2OTL A;  2DZ9 A;  4M7A A;  3GPL A;  4II1 A;  3G71 A;  1YCY A;  5GMK j;  2E12 A;  1M1K C;  3OS5 A;  3JCM f;  3I56 A;  5CAI A;  2LRQ A;  4M75 F;  3PIO A;  1XNI A;  1VQP A;  2DXB A;  4YTL A;  2L5Q A;  2VUB A;  3RKW A;  4QVD A;  1QW1 A;  3CCL A;  3CCM T;  4MMK A;  3DB4 A;  1Y96 A;  2RI5 A;  5FLX E;  3CCQ A;  1JJ2 A;  3LWH A;  1G3T A;  4JDS A;  4HCB A;  5CCA A;  1VQ9 T;  1FXX A;  3NTK A;  3TEE A;  3P8D A;  3R6O A;  2E1H A;  2K5L A;  1I8F A;  1QVG A;  2DJZ A;  4HA8 A;  2R57 A;  1H64 1;  2LCC A;  2DPP B;  2EQK A;  3G4S T;  4BE1 A;  2E10 A;  3KUF A;  4PJO C;  4Y28 E;  3MEV A;  5IN1 A;  3ZEH A;  5J3B A;  1Q81 U;  2JZ2 A;  2O4X B;  1FX7 A;  3VUZ A;  2RHZ A;  4MZT A;  1G3Y A;  1JJ2 S;  2JN0 A;  4PJO D;  5GAO m;  3VYH B;  5LJ3 f;  2DXU A;  3M5A A;  3SWN C;  2VGM A;  3CCL T;  4M75 A;  1NE8 A;  3CCM A;  1IRE B;  5LJ3 e;  1Q81 C;  3I55 A;  1OZ3 A;  4QQ6 A;  1M90 U;  1BYM A;  1KQS A;  1M4Z A;  5FRM A;  3PTA A;  4FU6 A;  2M16 A;  3I56 T;  4BDZ A;  2WSE E;  5I2M A;  4HCC A;  3O8V A;  3CCU A;  3S6W A;  3V8L A;  2LQK A;  3HFO A;  4BD3 A;  3DB3 A;  4PL6 A;  2X4Y A;  3OYY A;  2PVO B;  2YLC A;  5GAN d;  1BIA A;  3HPW A;  4R56 A;  1YJN T;  3OS1 A;  4M78 A;  1BI0 A;  1Q7Y C;  2EIF A;  1K8A U;  1Y96 B;  2A3L A;  1QP3 A;  3GNF B;  5LJ3 j;  3JB9 J;  1K9M U;  3X25 B;  1YJ9 A;  3UPU A;  2F5K A;  4XQ3 A;  3QHS A;  5HK0 A;  4TVR A;  4XTV A;  1BI2 A;  3UT1 A;  4PJO E;  4EMK A;  4FT4 A;  2MF2 A;  1VQK A;  2KK4 A;  4BI8 B;  3OYL A;  2WSC E;  3V7S A;  4J6W A;  1YJ9 T;  1WQW A;  3RMQ A;  4Q5W A;  3WVD B;  3MCA B;  3OYK A;  4XU1 A;  4C5H A;  2RK2 A;  3F70 A;  3QUI A;  2CZ6 B;  2RI2 A;  2D6F A;  4BE0 A;  4ELZ C;  3LWI A;  3HFN A;  3VV0 A;  1U1T A;  4J6Y A;  5LJ5 g;  1S72 T;  4RG2 A;  3QJ6 A;  5I2S A;  3JCM e;  3CC4 T;  2FB7 A;  4EMH A;  4DA4 A;  5A0D A;  3L2U A;  1O75 A;  1PSF A;  3C4S A;  5DLO A;  4M7A G;  3X26 B;  1JBM A;  2MAM A;  2NLU A;  1S72 A;  1VQL T;  5DY9 A;  4F7U E;  4N0A C;  4NL2 A;  3SWN A;  2QEX A;  2RO0 A;  4GLK A;  4KT0 E;  4C92 G;  1KQ1 A;  3X20 B;  3E1S A;  3ER0 A;  4FM4 B;  1NPP A;  3N5B B;  4J83 A;  4C92 A;  2RJF A;  3OYJ A;  3RER A;  3SD4 A;  4DOV A;  4M75 E;  5C0M A;  3BDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...