2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Neutrophil cytosol factor 2
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
4GBQA 2GTOA 4LUDA 1WXUA 1U06A 4HXJA 1UG1A 1BBZA 4J9HA 1T3SA 1AVZC 1WDXA 2MIOA 2ROLA 2BZYA 2DMOA 1GCQC 2DRMA 3QWXX 3UATA 1RLPC 2LZ6B 2DM1A 4JPBW 2L2PA 3EG1A 3R6NA 2BZXA 2F2WA 2O2OA 2J06A 4JZ4A 1GL5A 1UGVA 2D0NA 2CUBA 1NM7A 2CREA 4OMPA 4HVUA 1VYVA 2KRSA 1J3TA 2K7AA 4WCIA 4OMQA 2JMCA 4RUGA 1T0JA 4CC4B 4CC3A 4LE9A 3H0FA 1SSHA 4J9BA 1I0CA 1KSWA 3TSWA 1FYNA 2DILA 4JJBA 2HEQA 4JJCA 4AFSC 5IXBA 2AZSA 4HVVA 2KRMA 4Z89A 1ZUKA 2A28A 2LQWA 3IQLA 2XMFA 5FW9A 2AZVA 3NPFA 2DL8A 2KNBB 2V1RA 1X6BA 2I0NA 2FG0A 5FWCA 2JT4A 1JU5C 4DEXA 3LH5A 1X43A 2L0AA 1HSQA 2C0IA 2KT8A 3VS4A 4RTUA 1RUWA 2EGCA 3UA6A 1K76A 1M30A 4RTVA 3VRZA 2BZ8A 2EGEA 2RN8A 1SRMA 1NLOC 2CSIA 3EG2A 1UFFA 1TUDA 4LUEA 4DEYA 1WA7A 3TVTA 2YUQA 2EBPA 4R0KA 1CKBA 2KYMA 2HBWA 4F17A 1T0HA 2EKHA 1UJYA 1PHTA 1BB9A 2FPFA 2C0OA 3RNJA 1S1NA 1YP5A 2VKNA 4CC7A 3SHWA 1K4US 2KROA 2QDLA 2ENMA 1GBRA 3A98A 2DJQA 2F2VA 2V1QA 5IXFA 2EW3A 1B3QA 1BK2A 4OMLA 1JQQA 2ABLA 1H8KA 4AFZC 1K9AA 1QLYA 4CC2A 3NGPA 1M3AA 2EYXA 1K0XA 2DX1A 1BU1A 1PRLC 1NEGA 2J7IA 3H41A 2EYWA 1VYTA 2KEAA 5ECAA 2RMOA 4A63B 1M8MA 1UE9A 4X1VA 1Z9ZA 1E6GA 1W1FA 3M0PA 3M0TA 1OPLA 2LMJA 2RF0A 2OJ2A 1UJ0A 5IHNA 2DL5A 1T3LA 2EQIA 3VS3A 1AWXA 3M0UA 3VS6A 4ZNXA 2OAWA 1H3HA 1WLPB 2FPDA 1Y57A 2KT1A 2VWFA 1OEBA 4K11A 1MUZA 2CH4W 2GNCA 2ED1A 2AKLA 2JMAA 2KBTA 5GJWB 2YUPA 2PNIA 1X2QA 3ZL7C 2LNHB 1YWOA 3CQTA 1ABQA 2DBKA 1TG0A 1UTIA 2J6KA 2DYBA 4F14A 1X27A 1PWTA 1YWPA 2EGAA 1IO6A 3THKA 2KRNA 3KFVA 2ESWA 3REBB 3EHQA 2KYBA 1WX6A 2AKKA 3REAB 1G2BA 1GFDA 2FRYA 4F16A 2JS0A 1V1CA 4KRTA 5FWBA 2K79A 1E7OA 4Z88A 1A0NB 2FPEA 1JO8A 2GBQA 2HDAA 3VRYA 2YUOA 2O88A 3EHRA 1AZGB 2JTEA 2RQWA 1ZUUA 2FEIA 2VVKA 1K1ZA 2A37A 2ED0A 2NWMA 3I9QA 1NYFA 1FMKA 1JEGA 1EFNA 1OV3A 3VS2A 1SRLA 1PNJA 4JZ3A 2PTKA 2C0TA 2HCKA 2D8JA 2E5KA 2KXCA 1ZUYA 2L3PA 2DL4A 1QCFA 1UHFA 1E6HA 3PVQA 2JM8A 1HD3A 4D8KA 1PKSA 1M3BA 1I1JA 1GBQA 1KIKA 4RTYA 1Y0MA 1KJWA 2DRKA 1M3CA 3JV3A 1VA7A 4E6RA 3M0QA 1YN8A 1NLPC 1UECA 2K6DA 3SEMA 1X2KA 1MV0B 2W10A 4LNPA 1XOVA 2ECZA 1LCKA 1AEYA 4FSSA 4M4ZA 1UUEA 3I5SA 4JJDA 2JM9A 2MOXA 1ZBJA 1GFCA 1AWJA 2JXBA 2L3SA 1WFWA 2M51A 1AWOA 3VS5A 2D1XA 4HCKA 3PVLA 1GCQA 2W0ZA 1QKXA 2X3WD 1NEBA 2L3QA 2J6OA 2LP5A 2RPNA 4QT7A 1K0SA 4GLMA 1ZSGA 2F2XA 2DVJA 2K9GA 4OMNA 1H92A 1WYXA 1AWWA 1WI7A 2YSQA 2EYYA 4ESRA 1NG2A 3NHNA 4AG2C 4Z8AA 2LJ1A 1SHFA 2JS2A 1SHGA 2MCNA 1MV3A 2SRCA 2NUZA 4IIMA 1JXOA 5GJVB 5IHIA 1RI9A 2KR3A 2EYZA 2G6FX 2A08A 5I22A 2KE9A 2KXDA 5I11A 3QWYA 1X69A 1VYUA 2DLPA 2LX7A 3H0HA 1ZX6A 4RTXA 1CSKA 2GGRA 2K3BA 3NMZC 1ZLMA 1Z9QA 2H8HA 2CT4A 2DL3A 2KGTA 1X6GA 5IHKA 2K2MA 1WIEA 1GRIA 2CH4A 1KFZA 2CDTA 1UHCA 2LCSA 3C0CA 1B07A 5EC7A 4AFUC 5HCKA 2HSPA 2RQTA 2D8HA 1YCSB 2GTJA 3FJ5A 4Y92A 2A36A 2J05A 2DF6A 2RNAA 4D8DA 2DBMA 5IH2A 1OOTA 2YUNA 4RTZA 1W6XA 3EG3A 2P4RA 2ROTA 4RTTA 4J9CA 3RBBB 3PE0A 2DE0X 2OI3A 2O9SA 3TSZA 4AG1C 1G83A 1PRMC 3ULRB 1SEMA 3VS1A 1JXMA 3I35A 4OMOA 4J9GA 2B86A 1AZEA 1AOJA 4RTWA 2DNUA 1NYGA 4J9DA 2GQIA 1RLQC 1HJDA 2RQRA 2YDLA 3GBQA 1SPKA 3I5RA 2O9VA 1M27C 2EPDA 1UDLA 2LJ3A 2JW4A 2IIMA 3UF4A 1WXBA 2LJ0A 3M0RA 1TUCA 1N5ZA 3EGUA 3VS7A 1WXTA 1ABOA 1AD5A 2FO0A 4J9FA 2PZ1A 2O31A 2CUDA 1I07A 1QWFA 1YNZA 4J9EA 3VS0A 3O5ZA 1CKAA 2AK5A 4HVWA 2DA9A 4IIOA 4LN2A 2J6FA 1QKWA 2DL7A 2RQVA 2RQUA 1U5SA 3EG0A 3H0IA 2M0YA 4AFQC 1OPKA 1PKTA 1W70A 3U23A 2EVRA 3UA7A 5L23A 1U3OA 4ORZA 4OMMA 2X3XD 2LQNA 2CT3A 1ARKA 4EIKA 2FRWA 1GCPA 2CSQA 2YT6A 3M0SA 1QWEA 2BTTA 4J9IA 2SEMA
chains in the Genus database with same CATH superfamily
4M7DA 4C92C 1WXUA 3LGFA 4HXJA 1JJ2A 3CCUT 2HZYA 4OB2B 3VYHB 1MMNA 2MIOA 3HTRA 1GCQC 2DRMA 2OTLA 3UATA 5HY6A 2LZ6B 3SB2A 2LTOA 2BZXA 3CPWA 2J06A 4C0ZA 2D0NA 3JCMX 1VQOQ 2CUBA 1NM7A 5GMKm 2QASA 3JCMJ 4E7JA 1VYVA 3AT1B 4OMQA 4RUGA 5GANj 4XU2A 4LE9A 3A8HB 4A4GA 2JTMA 1I8FA 1SSHA 4J9BA 2MAMA 1N27A 4JLGA 5GAN8 1I0CA 5HK3A 2DILA 4JJBA 1K73C 2HEQA 1AT1B 4KUIA 5IXBA 1WJSA 2CYZB 4IUQA 4HVVA 3OSSC 1W4SA 4BI8B 2KRMA 1ZUKA 4OF1A 3EG9A 2AZVA 3NPFA 4M78A 1VIFA 2EAYA 2V1RA 5GMKe 5LJ5d 1WQWA 2JT4A 3HFOA 4FT2A 1VQ9Q 2HAXA 1MNDA 3VJPA 1VQ5Q 2K2VA 4RTUA 3UA6A 1PC0A 3VRZA 3CCJA 5FU6B 1ACMB 1TUDA 4LUEA 4DEYA 1G8XA 1DJ7B 1CKBA 2X4JA 3QHSA 2EKHA 2F5KA 4ELZC 1PHTA 1BB9A 4EMKA 2FPFA 3JSCA 1MMGA 2VKNA 3H9NA 3KUFA 1K4US 3LGLA 2DZCA 2XD0A 4PNOA 2V1QA 5IXFA 1VQ8A 4BB7A 1QVFP 3H6ZA 1W2BP 2EQUA 3MP1A 3ME9A 3PIPA 3X20B 1K9AA 1K73R 4B9WA 1M3AA 2EYXA 2OTLT 2DX1A 4E7SA 4OMFB 1VQKQ 2JVVA 2J7IA 4C0GA 3CMAA 1NE8A 3M0PA 5FU7B 3M0TA 2LMJA 3OYAA 3G4SA 1RL2A 3RESA 3VS3A 4M7AD 1SG5A 2OAWA 1AHJB 2HNIA 2D0QB 3JCMf 3M4GA 2AKLA 1HK9A 3CXCS 2MK5A 1MGQA 2DVEA 2DAQA 1X2QA 3ZL7C 2LNHB 1ABQA 2DBKA 2RI3A 2O01E 4EMGA 3C4SA 3L2RA 3G71A 2EGAA 3THKA 1QMCA 2KRNA 4ZN1A 4PKCC 3FC3A 2DEQA 1XTDA 3REAB 2AIRB 4F16A 5I21A 3CCJT 5CAIA 1V1CA 5FWBA 3JCMQ 4F7UE 2JJ9A 3JCMe 1JO8A 2GBQA 2JUFA 2WSEE 2XKOC 3EHRA 1QVFA 1W2BA 2FEIA 2VVKA 2DYIA 3OYLA 2DTIA 3V7RA 1I5LA 4IKFA 2ZPGB 3X26B 1PNJA 1VQ8T 3TEEA 2PVGB 2PTKA 3MEUA 1IGQA 1ZUYA 4M75E 1UHFA 3CD6A 4LDYA 1PSEA 2FB7A 2E6ZA 3PVQA 1HD3A 3CEYA 4ME7A 3MO8A 4RTYA 4C8QD 1EIFA 3EFOA 1D0YA 4BY6C 1Q86U 4PFZA 3G4ST 3CCMQ 3VV0A 1PM3A 4NL3A 1GXIE 2ZPIB 1X2KA 1MV0B 3MEVA 2R5MA 1PD0A 3LX7A 1AEYA 1Y7XA 3RDVA 2JM9A 2E12A 1ZBJA 2MI6A 5GAOq 2EIFA 2GCXA 6AT1B 2XDBA 3CPFA 5I2SA 4PJOC 1AWOA 3OMCA 2D1XA 4M7AA 3CCQQ 3HSBA 4MMKA 2J6OA 4ELYC 3G71T 3CBPA 4M77F 3CCLA 4QT7A 1K0SA 4BE1A 4R55A 4GLMA 1K9MC 3OYEA 2CP6A 3L2UA 2EQMA 3I56A 5KYUA 4ZN3A 3RKWA 1TSFA 2RA2A 9ATCB 4HA8A 4IIMA 5CR2A 1JXOA 1G3TA 3M4YA 5GJVB 5KYNA 4IUVA 1RI9A 2CP0A 4KH0B 1PSFA 2CP5A 1FXXA 2K4YA 5LJ5f 3HKSA 4HT9A 3CC4A 2YWWA 3HRUA 1MNEA 5A0DA 2RK2A 4OGCA 5IT9E 2L5QA 1NPRA 3CD6T 2K5IA 2XK0A 4KT0E 1M2VB 2CH4A 5CKHA 1KFZA 2JZ2A 3JB9F 5J26A 1RADB 4KGZB 3CCSA 4FU6A 2RQTA 2GTJA 3FJ5A 1HXDA 1QVGA 2J05A 2V8KA 2KI7A 5GAN5 5LJ5e 2YUNA 5LJ3g 2E3IA 4KGXB 2MF2A 1TU0B 1K9MR 3ER0A 4RTTA 4J9CA 4C8QA 3SWNA 2M16A 3TSZA 2RB6A 2RO0A 3LLRA 1H3ZA 1G83A 5FRMA 1VQMQ 1RAIB 4L5GA 2XIDA 4J9GA 4B9XA 2NUTB 2DNUA 3CCLT 1EX4A 1OYXA 1FWZA 1IRXA 1R77A 3GBQA 5GANg 3CMEQ 1SPKA 1NBEB 1YI2A 4QVDA 2CS7A 1ZSZA 2LQKA 3OYJA 1TUCA 3EGUA 3VS7A 3DLLA 1WHLA 1WXTA 2FO0A 5A0GA 3L42A 3BE3A 4F7UG 5GMKh 2D6FA 1O9SA 3P8HA 4FYYB 4XTUA 3O5ZA 3VUZA 3OS5A 1CKAA 2AK5A 2QA4A 3CC4T 1FMVA 3CCVQ 2CZ1B 3QZ9B 2H3EB 2J6FA 2Y4XA 1UEBA 2RJDA 2RQUA 1MHNA 4TVRA 4C5HA 4M7DG 3CCST 1M9SA 1U3OA 4ORZA 4M77A 2X3XD 4OMMA 5KYWA 4EIKA 3QUIA 1Q81U 4PLLA 2VV5A 1U06A 4MDWA 4C0DC 1BBZA 4J9HA 1T3SA 1OZ2A 1WDXA 4B6MA 3DKMA 1RLPC 2LQ8A 3J81E 1M90C 2L89A 1M1KU 5KCOA 2QAZA 4JPBW 2L2PA 4JRPA 3R6NA 2O2OA 4KH1B 4M75D 4JZ4A 4BI4A 1YHQQ 2QQBA 1D3BA 1PD1A 3EFSA 2KRSA 4M78G 2PVOB 3CC7Q 4CC3A 4RCCA 4ZTJA 5GMKj 3SD4A 4N4GA 1YFNA 4X9CA 1YI2T 5IAYA 3M59A 5CIUA 2QEXA 3JB9H 3TCJA 5GAOp 2HL5C 3DB3A 1VQ4A 3EAEA 2LQWA 3JCMW 1VQPA 1UB4A 4PJOF 3HP9A 5LJ3h 2KNBB 1X6OA 3S3NA 3NTIA 3QIIA 4ATOA 1JU5C 2LNVA 4RMOA 1X43A 2QA4T 1HSQA 3VS4A 1QCNA 1V76A 2EGCA 3ZBDA 1K76A 3QYGB 4QKUA 1M30A 4M78D 4MZPA 4RTVA 4J6WA 2QXFA 2BZ8A 3QJYA 1SRMA 1OZ3A 2EJ9A 2CSIA 3JCMh 3EG2A 5GANd 1UFFA 3TVTA 1K8AU 4A4FA 3OYKA 3CMAQ 4RKUE 2HBWA 3GOXA 1T0HA 2ZPHB 1H641 1Q95G 2EQKA 4R56A 1M90R 4A4KA 1TS9A 4AMCA 1Q81R 4DBFA 2V26A 2MPXC 4C92B 3SHWA 2KROA 1K8AC 1GBRA 3FDRA 4PFPA 3A98A 2XU8A 2DJQA 2YLBA 1S72A 2OTJQ 3META 5CQXA 4HCBA 1BK2A 1PG5B 4OMLA 3V8LA 1JQQA 5CKDA 4CC2A 1K0XA 2HL3A 1KQ1A 3L2WA 1BU1A 2ZPEB 1NEGA 2E65A 3H41A 1Q7YU 2EFIA 2EYWA 2KEAA 2M9UA 5AYFA 3MP8A 1UE9A 3VKIA 1BKBA 4X1VA 1B34A 1OPLA 1LPLA 4FYWB 1UJ0A 5IHNA 4XTXA 2DL5A 1JRIA 4E2FB 5LJ3j 1AWXA 1VQ6A 3M0UA 3VS6A 4ZNXA 3S3MA 1H3HA 3G6EQ 3PGGA 4M75A 4EPCA 2KT1A 5IN1A 2QEXT 4D6WA 3L2QA 3MKDA 5KYYB 2QGGA 2GNCA 2XI9A 1VQ4T 1G3WA 2KK4A 1VQPT 2PNIA 2PQWA 5GAN7 3CQTA 3CC2A 2DYBA 1X27A 1YWPA 1IO6A 3KFVA 1WGSA 2G3RA 3PIOA 4DA4A 2AKKA 1K8AR 5DLQE 1G2BA 5CCAA 4C92E 2JS0A 3OW2S 1E7OA 4IURA 1A0NB 2RM4A 3OS2A 2HDAA 1ZHIA 1WHGA 3RKYA 3CCEQ 2RQWA 4II1A 1ZUUA 3G1JA 2LT4A 4M77E 2NWMA 3I9QA 4JRKA 1NYFA 4XTZA 2CKKA 1EFNA 2RHXA 3BFMA 3DB4A 4WTOB 3EGDB 1S72T 2C0TA 2HCKA 2KXCA 2QDYB 2E5KA 2X9HA 3M57A 3MCAB 4BE2A 5GAN3 5CO7A 5I2MA 1PKSA 3OB9A 4E47A 1M3BA 2LRQA 1GBQA 2FZCB 4O5VA 3CXCP 1KJWA 4J8OA 1M3CA 2RK1A 4E7ZA 2V8IA 4HCZA 5LJ5h 2K57A 1RI0A 2RHUA 4M7AG 1RAGB 1YN8A 2BE7D 2P0QA 4J83A 4N0AC 2K6DA 3SEMA 1VQ6T 3FJPA 3I56Q 1YJ9A 3I55Q 3RIRA 1OX8A 2MMPA 5DM7R 3MP6A 4DBHA 1AWJA 2WACA 2WSCE 5GAN4 2VC8A 3OSVA 2GF7A 2HD0A 2HQEA 3CC2T 1WHKA 1OU8A 1KQSS 4A53A 3E2UA 2L3QA 3BDUA 3V7SA 2LP5A 1R0CB 1VQ7Q 1RAHB 2F2XA 1BIBA 2K9GA 1H92A 1D1AA 1WYXA 4JDSA 3DLMA 1YIJA 3ASKA 1N9SA 4WF2A 2EYYA 4ESRA 4Z8AA 2JS2A 4XQ3A 1SHGA 4L6V5 1MV3A 4QQ6A 4OGEA 3OS1A 4KBMB 1RAAB 2RHIA 5IHIA 1D1CA 1KHCA 2VYTA 3CCRQ 1VQLA 2EYZA 2G6FX 1BYMA 2A08A 5I22A 4AT1B 3GF5A 2KXDA 5A0LA 3QWYA 1X69A 4QVCA 2DLPA 2A7YA 1D0ZA 3H0HA 1ZX6A 3TREA 2FZKB 3CXCA 1Z9QA 3OY9A 1C0MA 4J7FA 3OYNA 2KGTA 5LJ5j 4E7KA 5GAMh 5KYXB 4BY6B 1GRIA 5GANf 2CDTA 3C0CA 4C8QG 4FT4A 1B07A 2PVDB 5EC7A 2ZAEA 3BY7A 4RG2A 5HCKA 2DIQA 2R5AA 3E9FA 3E1SA 4Y92A 2DF6A 2RNAA 3C95A 1OOTA 3RERA 1W6XA 4M7DC 3EG3A 1YJNQ 1YJWQ 1YJ9T 1RAFB 5KE2A 4PJOB 3J80E 2QG9B 4O6JA 2DE0X 4LXCA 4MZTA 1P92A 1PRMC 1SEMA 2QQ9A 2O4XB 5GANe 1JXMA 2OX7A 1R0BG 4J9DA 2GQIA 1RLQC 2ZZDA 2COYA 5CK9A 2E64A 3GPLA 3I5RA 1F1BB 1YIJT 2EPDA 2LJ3A 3C94A 3UF4A 3QKJA 4F04B 2LJ0A 3M0RA 1JBMA 2NUTA 1Q86C 4C92F 2GQVA 4KGVB 1D1BA 4M78C 1MMDA 1VQLT 1KC8U 2CUDA 1I07A 5GAMj 5KE3A 1YNZA 4J9EA 3VS0A 2L8DA 4FSXA 1D09B 2YRDA 2KY9A 3EGXA 2HQXA 1VQ9A 1VQ5A 3O8VA 2QTVA 3TQ7P 1Q82U 4C5IA 1IGUA 3QDRB 5AT1B 1OU9A 4P5NA 1U5SA 1N8RU 1WHMA 3HRTA 5GAN6 1OPKA 3KBGA 4EMKC 1OI1A 3U23A 1KD1U 4PJOE 2A3LA 2LQNA 3CBMA 2DEUA 2E5QA 1N8RC 2KMTA 4ZGJB 2CSQA 3JCMP 1QWEA 4LUDA 2P4TA 5KCHA 1QCOA 1BI3A 3CCUQ 4M77D 1AVZC 4PK4A 1VQ4Q 2ROLA 4NS5A 2BZYA 2DMOA 1TOVA 3FEOA 1SSFA 1Q86R 3JB9G 3GNFB 1RAEB 1GL5A 1UGVA 3WVDB 2QYZA 4HVUA 4PJMA 4Z02A 4FIBA 1T0JA 3H0FA 2CP3A 2WSFE 3TSWA 3OYHA 2PUKB 1FYNA 3PMTA 1KC8R 4LD9K 2AZSA 2LC4A 3FIFA 5CKBA 2RD1A 2MWOA 4Z89A 1IZ6A 2A28A 3IQLA 5FW9A 3CBOA 2DL8A 3M56A 3OYYA 4FYVB 2DZ9A 1Q82R 1X6BA 2I0NA 2FG0A 3JCMg 5J3BA 4XTYA 3JB9D 1VQ9T 3LH5A 1VQ5T 2L0AA 1YITA 1N8RR 3JB9I 3EFOB 3HFNA 4JUVA 1WHHA 1M4ZA 1KD1R 2COWA 3WXMB 1WA7A 1I4K1 2HKQB 2VB6A 4R0KA 2KYMA 1I5OB 4F17A 2NUPA 2HQHA 1VQNA 4OB0B 2C06A 2BKDN 1S1NA 1YP5A 3JRZA 4PFOA 3OYMA 4CC7A 3AHUA 4DBQA 4C0DB 1M5Q1 3S6WA 3UDCA 2PUOB 2EJFA 3R6OA 4M7AB 2EW3A 3QBYA 1FMWA 1MMAA 1B3QA 2KQWA 4Y91A 2ABLA 4C92A 1H8KA 4AFZC 3FB9A 2OTLQ 2EYQA 4M75G 1G3YA 1YCYA 1PRLC 2DIGA 3EFRA 2RMOA 4A63B 4CI0C 1Z9ZA 1E6GA 1W1FA 4OB1B 1N9RA 2X51A 2FYKA 2RF0A 2OJ2A 1UGRB 2NYSA 3T9NA 1T3LA 4M7DF 4E7LA 1XQHA 2E70A 3V8JA 1Y57A 1BCOA 2HBPA 1OEBA 5FLXE 1MUZA 2CH4W 4Y28E 1U1SA 2KBTA 2VXFA 5GJWB 2KVQG 4DBRA 4ZGDB 1QVPA 2YUPA 4M7AC 4PL6A 5J39A 1Y96B 1YWOA 1Q81C 1TG0A 3CCQA 4RG8A 4F14A 2E3HA 5KYYA 3REBB 1G5VA 1WX6A 1YITT 1SF9A 1WZOA 2E1HA 2E10A 1M1KC 2X4WA 2FRYA 4PJNA 1GFDA 1KG1A 3CCJQ 1B7TA 2K5FA 4IUUA 3MEWA 4OVAA 4HT8A 4Z88A 4NOYA 2CP2A 2FPEA 5LJ3d 4JLIA 5GAOl 4LDWA 2M0OA 1VQNT 4C8QB 3VRYA 2VUBA 3OYFA 2A37A 1ZQ1A 1OQKA 1FMKA 1JEGA 2LX9A 3VS2A 1VQ8Q 2F1LA 3M58A 3BW1A 2L3PA 1QCFA 5D6YA 2JN0A 2PU9B 5LJ5g 1E6HA 2CZ6B 3QXEB 2LT1A 2L3RA 3RR6A 4XK8E 5GAOr 2RJFA 1KIKA 1Y0MA 2DRKA 3F70A 4BI3A 3JV3A 1VA7A 3PTAA 4E6RA 3A8MB 3G4SQ 1BI0A 3GIBA 2JOYA 3M0QA 4RCBA 4J6XA 4DOVA 4C8QC 4PJOD 2W10A 1TWBA 5LL6S 3SWNC 2ECZA 3QO3A 4FSSA 2ZPFB 4M4ZA 1M1KR 3I5SA 1GFCA 3LWHA 4HKEA 2NLUA 3FRNA 2JXBA 3OW2P 1VQMA 1WFWA 2M51A 3VS5A 3PT9A 4HCKA 4J5YA 2QQSA 2X3WD 2W0ZA 3CCQT 3G71Q 3HPWA 4CRIA 1TXQA 1ZSGA 2DVJA 4OMNA 3CMEA 1AWWA 1WI7A 1ZSZC 3E9GA 1NG2A 1OX9A 3NHNA 5DY9A 3X24B 2LJ1A 1SHFA 4AG2C 5KYWB 1Q7YC 2MCNA 2SRCA 4JRIA 2NUZA 3HL8A 2P84A 2X4YA 2I2LA 1JJ2S 2FHDA 5GAMg 3Q1JA 3A8GB 1OULA 2LX7A 4J7IA 4A4HA 2P0PA 3CPWS 3SDZA 3CCVA 1CSKA 2DJZA 1XNIA 2DXCA 1D3BB 3NMZC 3V7CA 3PNWC 1ZLMA 1PCXA 2CT4A 3CD6Q 1IXDA 5CQYA 4FL6A 4LDXA 1BIAA 1WIEA 1UHCA 2BE9B 2YHTA 4V2SA 3PMIA 3EH1A 1K73U 1YCSB 4M77C 3RMQA 2A36A 5KYXA 4D8DA 2DBMA 1KQSP 2V8JA 3OW2A 2X4XA 1HYOA 2P4RA 2RJEA 2ROTA 3RBBB 1NJIU 2RI5A 3VYGA 1YBYA 2O9SA 4FCYA 1Q7YR 3ULRB 3VS1A 1VQMT 2GFAA 3I35A 2MYSA 3PFSA 4OMOA 2B86A 2BIVA 4PJOA 1AZEA 1U8RA 1YHQA 1AOJA 1WQ7A 4RTWA 1NJIC 3CCLQ 3LYIA 3M55A 3RKXA 3CC7A 2RQRA 2O4XA 3CMET 5EG2A 4BE0A 1M27C 3VU3C 3ZEHA 1UDLA 2E6NA 3RUXA 3P8DA 1WXBA 5GAOn 2QI2A 1LJOA 1N5ZA 4MMLA 4A4EA 4XTWA 1AD5A 1QW1A 2ATCB 2ZPBB 5D6WA 4J9FA 4E7HA 3C12A 1RABB 2D9TA 2LCCA 4FW2A 3URGA 2O31A 4M7AF 2JTFA 3P8BB 2DXBA 3QJ6A 3QG1A 1KQ2A 3V8KA 1Y71A 2B8AA 1LNXA 4OB3B 4F7UB 1ZA2B 1IB8A 3CC4Q 7AT1B 4BD3A 4HVWA 3CCVT 2DA9A 4FYXB 5GAOm 1B34B 4DQ2A 3OMGA 3OYBA 5GAN2 2DL7A 4UC4A 1KQSA 3EG0A 2M0YA 3QPHA 1G3SA 1PKTA 3CCSQ 1W70A 5LJ3f 4LDVA 2YLCA 2EVRA 4M75B 5FU6C 3UA7A 5L23A 3LWIA 4M7DB 5FRNA 3JB9J 2YRVA 1Y07A 2CT3A 2FRWA 1GCPA 2YT6A 1NJIR 1FX7A 5CVIA 2SEMA 5GAMd 4GBQA 2GTOA 2DKGA 3UWNA 2OTJA 1WJRA 2DTOA 1UG1A 3LW5E 2VGNA 3OBWA 2XDDA 3QWXX 2DM1A 1IHVA 3EG1A 2F2WA 2YRCA 5LJ3e 1YHQT 4YTLA 2H3JA 5DLOA 3G7ZA 2CREA 4OMPA 5C6SA 1J3TA 2LVMA 1YITQ 2K7AA 3HHTB 4WCIA 3CC7T 1M2VA 2LCLA 2JMCA 4CC4B 1QVFS 1W2BS 2Z0WA 4IUPA 1YI2Q 4M75C 5C0MA 3EG9B 4M78B 2DERA 1KSWA 4C8QF 5FU7C 3OYIA 3G6EA 4JJCA 4AFSC 3JCMV 2DPPB 3OYCA 2A0FB 2XICA 2EQJA 2ZGWA 2DETA 1VQNQ 4XU0A 4EMHA 2Y90A 2XMFA 2QTXA 1ZBXA 4JS4A 1UGSB 3OBYA 2QQRA 3L2VA 2FL7A 5FWCA 1VQOA 4DEXA 2QA4Q 2C0IA 2KT8A 1RUWA 2DTHA 3QYHB 3GP8A 2DD5A 4E7IA 4M7DE 1WNLA 2VGMA 5CKEA 4EMKB 2RN8A 2EGEA 5KH6A 1NLOC 1NPPA 2YUQA 2EBPA 3UPUA 3CMAT 4C92G 3FLGA 2OAUA 1SKUB 4BACA 1IHWA 1UJYA 2C0OA 3RNJA 3CCEA 4VUBA 2E41A 2QDLA 4BUGA 2ENMA 2VXEA 2F2VA 4FW1A 1QVGP 4M77G 2OTJT 3OQ5A 3M53A 1KC8C 2LDMA 5HK0A 4NL2A 3D7SB 1QLYA 1K9MU 2R58A 3NGPA 4PJJA 4C5GA 4DOWA 4M78E 1IREB 2IPOB 5ECAA 1VYTA 1M8MA 1Q82C 4N4IA 4BDYA 4C92D 4MDXA 1R8OB 2CZ7B 3NFCA 1RACB 2RH2A 2BUDA 2EQIA 1QP3A 4KULA 1VOMA 3N5BB 1WLPB 2FPDA 3I55A 3G6ET 1KD1C 2VWFA 2HSEB 2XDPA 2QEXQ 4K11A 2ED1A 3GLXA 2JMAA 1VQPQ 3KXTA 4XU3A 1VQKA 3NTKA 1UTIA 2J6KA 1PWTA 4HCCA 5M9OA 1VQOT 2YXYA 2ESWA 1LOJA 3EHQA 2KYBA 1VQ7A 4QVZA 1U1TA 2KSSA 1QVGS 1Y96A 2E4HA 3A1PA 2GFUA 4JJNK 4C5EA 2IVWA 2RHZA 1N6AA 8ATCB 4KRTA 2K79A 1ZA1B 5D6XA 3EH2A 4JRQA 3CCRA 2K3XA 3JCMb 2YUOA 2O88A 3NTHA 3CCET 1AZGB 2JTEA 1K1ZA 5D7UA 2ED0A 1OV3A 1BI2A 1SRLA 5FROA 3INZA 1S72Q 4JZ3A 2HKNA 1O75A 2D8JA 5HKCA 2JNGA 2DL4A 2EJGA 1EZZB 1WHJA 2EKOA 2IG0A 2JM8A 4N4HA 2M02A 4D8KA 2QQAA 1I1JA 5A2QE 2ZCFB 4QW2A 3L1AA 4FM4B 1NLPC 1UECA 1VQ6Q 2XG8D 4PJLA 5GAMf 1YJWA 1YJNA 1M8VA 3I56T 3MHXA 4LNPA 5GMKl 1XOVA 1LCKA 4C0FA 3S3OA 3I55T 3ZFJA 1UUEA 2CGHA 3EGXB 1M1FA 2Y4YA 4JJDA 2MOXA 1VIEA 2HMAA 2F5TX 4F7UF 3OYGA 2L3SA 4IUTA 4XAXB 2KDSA 4BDZA 1VQKT 3CC2Q 3PVLA 1GCQA 1QKXA 1TH7A 1NEBA 4GY5A 1NZ9A 1XJWB 2X35A 5KYUB 2RPNA 1M2OA 3QDFA 3JAME 2KAFA 1WJQA 1VQ7T 2AHJB 2M1HA 3CCMA 2XHCA 2P0KA 2YSQA 2QK0A 4M75F 5GAMe 3RMSA 3M9QA 1D0XA 2KR3A 4LDUA 4X34A 3CCRT 1WPYA 3GNGA 2KE9A 5L8RE 3L2ZA 5I11A 3OS0A 3OYDA 3TU4K 2RHYA 4PLIA 1UGPB 2DXTA 1VYUA 1M90U 1KK7A 3X28B 4RTXA 2GGRA 3OA6A 2DD4A 3MJXA 2K3BA 4EDUA 3H8ZA 2K5LA 2H8HA 2DL3A 5CKFA 1X6GA 5IHKA 2K2MA 4KUDK 4A54A 2LCSA 4AFUC 4M7DD 2HSPA 4MZMA 4M7AE 2D8HA 4M78F 4XU1A 3LH0A 1C6VX 3BDLA 3SWNB 5IH2A 1LVKA 2R57A 4PJOG 2VASA 4RTZA 1BI1A 2F69A 2K3YA 1YJ9Q 4N0AA 1YJNT 1YJWT 2EWNA 3JCMd 2RJCA 4GLKA 3PE0A 4ANJA 1UGQB 3CCUA 2OI3A 4AG1C 4LD6A 3J7AF 1X01A 1I81A 3EGDA 1M1GA 1JB0E 1JJ2P 1ZSZB 2DXUA 1NYGA 3QZ5B 4QQDA 1HJDA 2FZGB 3MEAA 2NUPB 2CP7A 2YDLA 3MPUB 3CCMT 1YIJQ 2O9VA 3HRSA 3CPWP 3A5ZB 2JW4A 2IIMA 4J6YA 3M5AA 1V29B 1X75C 1QP2A 3E19A 4X9DA 4XTVA 3X25B 1ABOA 2AT1B 3JCMc 2DO3A 2RI2A 3SFMA 2MWPA 5GANh 1VQLQ 3UT1A 2PZ1A 1TUGB 4ZTFA 1QWFA 1VUBA 4Q5WA 8AT1B 1TTHB 3VUBA 3M54A 4JS5A 1BCMA 4IIOA 4LN2A 3A8OB 4C8QE 4ZGEB 3WVEB 2FVUA 1QKWA 4M77B 2RQVA 1C1AA 4F7UA 3H0IA 1QQJA 2CZ0B 2DK3A 4AFQC 1KHIA 3A8LB 4L59A 4QQGA 1ARKA 2QGFB 3QSUA 2DFUA 2COZA 3M0SA 4OP0A 2BTTA 5GMKi 4J9IA
chains in the Genus database with same CATH topology
4GBQA 2GTOA 4LUDA 1WXUA 1U06A 4HXJA 1UG1A 1BBZA 4J9HA 1T3SA 1AVZC 1WDXA 2MIOA 2ROLA 2BZYA 2DMOA 1GCQC 2DRMA 3QWXX 3UATA 1RLPC 2LZ6B 2DM1A 4JPBW 2L2PA 3EG1A 3R6NA 2BZXA 2F2WA 2O2OA 2J06A 4JZ4A 1GL5A 1UGVA 2D0NA 2CUBA 1NM7A 2CREA 4OMPA 4HVUA 1VYVA 2KRSA 1J3TA 2K7AA 4WCIA 4OMQA 2JMCA 4RUGA 1T0JA 4CC4B 4CC3A 4LE9A 3H0FA 1SSHA 4J9BA 1I0CA 1KSWA 3TSWA 1FYNA 2DILA 4JJBA 2HEQA 4JJCA 4AFSC 5IXBA 2AZSA 4HVVA 2KRMA 4Z89A 1ZUKA 2A28A 2LQWA 3IQLA 2XMFA 5FW9A 2AZVA 3NPFA 2DL8A 2KNBB 2V1RA 1X6BA 2I0NA 2FG0A 5FWCA 2JT4A 1JU5C 4DEXA 3LH5A 1X43A 2L0AA 1HSQA 2C0IA 2KT8A 3VS4A 4RTUA 1RUWA 2EGCA 3UA6A 1K76A 1M30A 4RTVA 3VRZA 2BZ8A 2EGEA 2RN8A 1SRMA 1NLOC 2CSIA 3EG2A 1UFFA 1TUDA 4LUEA 4DEYA 1WA7A 3TVTA 2YUQA 2EBPA 4R0KA 1CKBA 2KYMA 2HBWA 4F17A 1T0HA 2EKHA 1UJYA 1PHTA 1BB9A 2FPFA 2C0OA 3RNJA 1S1NA 1YP5A 2VKNA 4CC7A 3SHWA 1K4US 2KROA 2QDLA 2ENMA 1GBRA 3A98A 2DJQA 2F2VA 2V1QA 5IXFA 2EW3A 1B3QA 1BK2A 4OMLA 1JQQA 2ABLA 1H8KA 4AFZC 1K9AA 1QLYA 4CC2A 3NGPA 1M3AA 2EYXA 1K0XA 2DX1A 1BU1A 1PRLC 1NEGA 2J7IA 3H41A 2EYWA 1VYTA 2KEAA 5ECAA 2RMOA 4A63B 1M8MA 1UE9A 4X1VA 1Z9ZA 1E6GA 1W1FA 3M0PA 3M0TA 1OPLA 2LMJA 2RF0A 2OJ2A 1UJ0A 5IHNA 2DL5A 1T3LA 2EQIA 3VS3A 1AWXA 3M0UA 3VS6A 4ZNXA 2OAWA 1H3HA 1WLPB 2FPDA 1Y57A 2KT1A 2VWFA 1OEBA 4K11A 1MUZA 2CH4W 2GNCA 2ED1A 2AKLA 2JMAA 2KBTA 5GJWB 2YUPA 2PNIA 1X2QA 3ZL7C 2LNHB 1YWOA 3CQTA 1ABQA 2DBKA 1TG0A 1UTIA 2J6KA 2DYBA 4F14A 1X27A 1PWTA 1YWPA 2EGAA 1IO6A 3THKA 2KRNA 3KFVA 2ESWA 3REBB 3EHQA 2KYBA 1WX6A 2AKKA 3REAB 1G2BA 1GFDA 2FRYA 4F16A 2JS0A 1V1CA 4KRTA 5FWBA 2K79A 1E7OA 4Z88A 1A0NB 2FPEA 1JO8A 2GBQA 2HDAA 3VRYA 2YUOA 2O88A 3EHRA 1AZGB 2JTEA 2RQWA 1ZUUA 2FEIA 2VVKA 1K1ZA 2A37A 2ED0A 2NWMA 3I9QA 1NYFA 1FMKA 1JEGA 1EFNA 1OV3A 3VS2A 1SRLA 1PNJA 4JZ3A 2PTKA 2C0TA 2HCKA 2D8JA 2E5KA 2KXCA 1ZUYA 2L3PA 2DL4A 1QCFA 1UHFA 1E6HA 3PVQA 2JM8A 1HD3A 4D8KA 1PKSA 1M3BA 1I1JA 1GBQA 1KIKA 4RTYA 1Y0MA 1KJWA 2DRKA 1M3CA 3JV3A 1VA7A 4E6RA 3M0QA 1YN8A 1NLPC 1UECA 2K6DA 3SEMA 1X2KA 1MV0B 2W10A 4LNPA 1XOVA 2ECZA 1LCKA 1AEYA 4FSSA 4M4ZA 1UUEA 3I5SA 4JJDA 2JM9A 2MOXA 1ZBJA 1GFCA 1AWJA 2JXBA 2L3SA 1WFWA 2M51A 1AWOA 3VS5A 2D1XA 4HCKA 3PVLA 1GCQA 2W0ZA 1QKXA 2X3WD 1NEBA 2L3QA 2J6OA 2LP5A 2RPNA 4QT7A 1K0SA 4GLMA 1ZSGA 2F2XA 2DVJA 2K9GA 4OMNA 1H92A 1WYXA 1AWWA 1WI7A 2YSQA 2EYYA 4ESRA 1NG2A 3NHNA 4AG2C 4Z8AA 2LJ1A 1SHFA 2JS2A 1SHGA 2MCNA 1MV3A 2SRCA 2NUZA 4IIMA 1JXOA 5GJVB 5IHIA 1RI9A 2KR3A 2EYZA 2G6FX 2A08A 5I22A 2KE9A 2KXDA 5I11A 3QWYA 1X69A 1VYUA 2DLPA 2LX7A 3H0HA 1ZX6A 4RTXA 1CSKA 2GGRA 2K3BA 3NMZC 1ZLMA 1Z9QA 2H8HA 2CT4A 2DL3A 2KGTA 1X6GA 5IHKA 2K2MA 1WIEA 1GRIA 2CH4A 1KFZA 2CDTA 1UHCA 2LCSA 3C0CA 1B07A 5EC7A 4AFUC 5HCKA 2HSPA 2RQTA 2D8HA 1YCSB 2GTJA 3FJ5A 4Y92A 2A36A 2J05A 2DF6A 2RNAA 4D8DA 2DBMA 5IH2A 1OOTA 2YUNA 4RTZA 1W6XA 3EG3A 2P4RA 2ROTA 4RTTA 4J9CA 3RBBB 3PE0A 2DE0X 2OI3A 2O9SA 3TSZA 4AG1C 1G83A 1PRMC 3ULRB 1SEMA 3VS1A 1JXMA 3I35A 4OMOA 4J9GA 2B86A 1AZEA 1AOJA 4RTWA 2DNUA 1NYGA 4J9DA 2GQIA 1RLQC 1HJDA 2RQRA 2YDLA 3GBQA 1SPKA 3I5RA 2O9VA 1M27C 2EPDA 1UDLA 2LJ3A 2JW4A 2IIMA 3UF4A 1WXBA 2LJ0A 3M0RA 1TUCA 1N5ZA 3EGUA 3VS7A 1WXTA 1ABOA 1AD5A 2FO0A 4J9FA 2PZ1A 2O31A 2CUDA 1I07A 1QWFA 1YNZA 4J9EA 3VS0A 3O5ZA 1CKAA 2AK5A 4HVWA 2DA9A 4IIOA 4LN2A 2J6FA 1QKWA 2DL7A 2RQVA 2RQUA 1U5SA 3EG0A 3H0IA 2M0YA 4AFQC 1OPKA 1PKTA 1W70A 3U23A 2EVRA 3UA7A 5L23A 1U3OA 4ORZA 4OMMA 2X3XD 2LQNA 2CT3A 1ARKA 4EIKA 2FRWA 1GCPA 2CSQA 2YT6A 3M0SA 1QWEA 2BTTA 4J9IA 2SEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GBQ A;  2GTO A;  4LUD A;  1WXU A;  1U06 A;  4HXJ A;  1UG1 A;  1BBZ A;  4J9H A;  1T3S A;  1AVZ C;  1WDX A;  2MIO A;  2ROL A;  2BZY A;  2DMO A;  1GCQ C;  2DRM A;  3QWX X;  3UAT A;  1RLP C;  2LZ6 B;  2DM1 A;  4JPB W;  2L2P A;  3EG1 A;  3R6N A;  2BZX A;  2F2W A;  2O2O A;  2J06 A;  4JZ4 A;  1GL5 A;  1UGV A;  2D0N A;  2CUB A;  1NM7 A;  2CRE A;  4OMP A;  4HVU A;  1VYV A;  2KRS A;  1J3T A;  2K7A A;  4WCI A;  4OMQ A;  2JMC A;  4RUG A;  1T0J A;  4CC4 B;  4CC3 A;  4LE9 A;  3H0F A;  1SSH A;  4J9B A;  1I0C A;  1KSW A;  3TSW A;  1FYN A;  2DIL A;  4JJB A;  2HEQ A;  4JJC A;  4AFS C;  5IXB A;  2AZS A;  4HVV A;  2KRM A;  4Z89 A;  1ZUK A;  2A28 A;  2LQW A;  3IQL A;  2XMF A;  5FW9 A;  2AZV A;  3NPF A;  2DL8 A;  2KNB B;  2V1R A;  1X6B A;  2I0N A;  2FG0 A;  5FWC A;  2JT4 A;  1JU5 C;  4DEX A;  3LH5 A;  1X43 A;  2L0A A;  1HSQ A;  2C0I A;  2KT8 A;  3VS4 A;  4RTU A;  1RUW A;  2EGC A;  3UA6 A;  1K76 A;  1M30 A;  4RTV A;  3VRZ A;  2BZ8 A;  2EGE A;  2RN8 A;  1SRM A;  1NLO C;  2CSI A;  3EG2 A;  1UFF A;  1TUD A;  4LUE A;  4DEY A;  1WA7 A;  3TVT A;  2YUQ A;  2EBP A;  4R0K A;  1CKB A;  2KYM A;  2HBW A;  4F17 A;  1T0H A;  2EKH A;  1UJY A;  1PHT A;  1BB9 A;  2FPF A;  2C0O A;  3RNJ A;  1S1N A;  1YP5 A;  2VKN A;  4CC7 A;  3SHW A;  1K4U S;  2KRO A;  2QDL A;  2ENM A;  1GBR A;  3A98 A;  2DJQ A;  2F2V A;  2V1Q A;  5IXF A;  2EW3 A;  1B3Q A;  1BK2 A;  4OML A;  1JQQ A;  2ABL A;  1H8K A;  4AFZ C;  1K9A A;  1QLY A;  4CC2 A;  3NGP A;  1M3A A;  2EYX A;  1K0X A;  2DX1 A;  1BU1 A;  1PRL C;  1NEG A;  2J7I A;  3H41 A;  2EYW A;  1VYT A;  2KEA A;  5ECA A;  2RMO A;  4A63 B;  1M8M A;  1UE9 A;  4X1V A;  1Z9Z A;  1E6G A;  1W1F A;  3M0P A;  3M0T A;  1OPL A;  2LMJ A;  2RF0 A;  2OJ2 A;  1UJ0 A;  5IHN A;  2DL5 A;  1T3L A;  2EQI A;  3VS3 A;  1AWX A;  3M0U A;  3VS6 A;  4ZNX A;  2OAW A;  1H3H A;  1WLP B;  2FPD A;  1Y57 A;  2KT1 A;  2VWF A;  1OEB A;  4K11 A;  1MUZ A;  2CH4 W;  2GNC A;  2ED1 A;  2AKL A;  2JMA A;  2KBT A;  5GJW B;  2YUP A;  2PNI A;  1X2Q A;  3ZL7 C;  2LNH B;  1YWO A;  3CQT A;  1ABQ A;  2DBK A;  1TG0 A;  1UTI A;  2J6K A;  2DYB A;  4F14 A;  1X27 A;  1PWT A;  1YWP A;  2EGA A;  1IO6 A;  3THK A;  2KRN A;  3KFV A;  2ESW A;  3REB B;  3EHQ A;  2KYB A;  1WX6 A;  2AKK A;  3REA B;  1G2B A;  1GFD A;  2FRY A;  4F16 A;  2JS0 A;  1V1C A;  4KRT A;  5FWB A;  2K79 A;  1E7O A;  4Z88 A;  1A0N B;  2FPE A;  1JO8 A;  2GBQ A;  2HDA A;  3VRY A;  2YUO A;  2O88 A;  3EHR A;  1AZG B;  2JTE A;  2RQW A;  1ZUU A;  2FEI A;  2VVK A;  1K1Z A;  2A37 A;  2ED0 A;  2NWM A;  3I9Q A;  1NYF A;  1FMK A;  1JEG A;  1EFN A;  1OV3 A;  3VS2 A;  1SRL A;  1PNJ A;  4JZ3 A;  2PTK A;  2C0T A;  2HCK A;  2D8J A;  2E5K A;  2KXC A;  1ZUY A;  2L3P A;  2DL4 A;  1QCF A;  1UHF A;  1E6H A;  3PVQ A;  2JM8 A;  1HD3 A;  4D8K A;  1PKS A;  1M3B A;  1I1J A;  1GBQ A;  1KIK A;  4RTY A;  1Y0M A;  1KJW A;  2DRK A;  1M3C A;  3JV3 A;  1VA7 A;  4E6R A;  3M0Q A;  1YN8 A;  1NLP C;  1UEC A;  2K6D A;  3SEM A;  1X2K A;  1MV0 B;  2W10 A;  4LNP A;  1XOV A;  2ECZ A;  1LCK A;  1AEY A;  4FSS A;  4M4Z A;  1UUE A;  3I5S A;  4JJD A;  2JM9 A;  2MOX A;  1ZBJ A;  1GFC A;  1AWJ A;  2JXB A;  2L3S A;  1WFW A;  2M51 A;  1AWO A;  3VS5 A;  2D1X A;  4HCK A;  3PVL A;  1GCQ A;  2W0Z A;  1QKX A;  2X3W D;  1NEB A;  2L3Q A;  2J6O A;  2LP5 A;  2RPN A;  4QT7 A;  1K0S A;  4GLM A;  1ZSG A;  2F2X A;  2DVJ A;  2K9G A;  4OMN A;  1H92 A;  1WYX A;  1AWW A;  1WI7 A;  2YSQ A;  2EYY A;  4ESR A;  1NG2 A;  3NHN A;  4AG2 C;  4Z8A A;  2LJ1 A;  1SHF A;  2JS2 A;  1SHG A;  2MCN A;  1MV3 A;  2SRC A;  2NUZ A;  4IIM A;  1JXO A;  5GJV B;  5IHI A;  1RI9 A;  2KR3 A;  2EYZ A;  2G6F X;  2A08 A;  5I22 A;  2KE9 A;  2KXD A;  5I11 A;  3QWY A;  1X69 A;  1VYU A;  2DLP A;  2LX7 A;  3H0H A;  1ZX6 A;  4RTX A;  1CSK A;  2GGR A;  2K3B A;  3NMZ C;  1ZLM A;  1Z9Q A;  2H8H A;  2CT4 A;  2DL3 A;  2KGT A;  1X6G A;  5IHK A;  2K2M A;  1WIE A;  1GRI A;  2CH4 A;  1KFZ A;  2CDT A;  1UHC A;  2LCS A;  3C0C A;  1B07 A;  5EC7 A;  4AFU C;  5HCK A;  2HSP A;  2RQT A;  2D8H A;  1YCS B;  2GTJ A;  3FJ5 A;  4Y92 A;  2A36 A;  2J05 A;  2DF6 A;  2RNA A;  4D8D A;  2DBM A;  5IH2 A;  1OOT A;  2YUN A;  4RTZ A;  1W6X A;  3EG3 A;  2P4R A;  2ROT A;  4RTT A;  4J9C A;  3RBB B;  3PE0 A;  2DE0 X;  2OI3 A;  2O9S A;  3TSZ A;  4AG1 C;  1G83 A;  1PRM C;  3ULR B;  1SEM A;  3VS1 A;  1JXM A;  3I35 A;  4OMO A;  4J9G A;  2B86 A;  1AZE A;  1AOJ A;  4RTW A;  2DNU A;  1NYG A;  4J9D A;  2GQI A;  1RLQ C;  1HJD A;  2RQR A;  2YDL A;  3GBQ A;  1SPK A;  3I5R A;  2O9V A;  1M27 C;  2EPD A;  1UDL A;  2LJ3 A;  2JW4 A;  2IIM A;  3UF4 A;  1WXB A;  2LJ0 A;  3M0R A;  1TUC A;  1N5Z A;  3EGU A;  3VS7 A;  1WXT A;  1ABO A;  1AD5 A;  2FO0 A;  4J9F A;  2PZ1 A;  2O31 A;  2CUD A;  1I07 A;  1QWF A;  1YNZ A;  4J9E A;  3VS0 A;  3O5Z A;  1CKA A;  2AK5 A;  4HVW A;  2DA9 A;  4IIO A;  4LN2 A;  2J6F A;  1QKW A;  2DL7 A;  2RQV A;  2RQU A;  1U5S A;  3EG0 A;  3H0I A;  2M0Y A;  4AFQ C;  1OPK A;  1PKT A;  1W70 A;  3U23 A;  2EVR A;  3UA7 A;  5L23 A;  1U3O A;  4ORZ A;  4OMM A;  2X3X D;  2LQN A;  2CT3 A;  1ARK A;  4EIK A;  2FRW A;  1GCP A;  2CSQ A;  2YT6 A;  3M0S A;  1QWE A;  2BTT A;  4J9I A;  2SEM A; 
#chains in the Genus database with same CATH topology
 4M7D A;  4C92 C;  1WXU A;  3LGF A;  4HXJ A;  1JJ2 A;  3CCU T;  2HZY A;  4OB2 B;  3VYH B;  1MMN A;  2MIO A;  3HTR A;  1GCQ C;  2DRM A;  2OTL A;  3UAT A;  5HY6 A;  2LZ6 B;  3SB2 A;  2LTO A;  2BZX A;  3CPW A;  2J06 A;  4C0Z A;  2D0N A;  3JCM X;  1VQO Q;  2CUB A;  1NM7 A;  5GMK m;  2QAS A;  3JCM J;  4E7J A;  1VYV A;  3AT1 B;  4OMQ A;  4RUG A;  5GAN j;  4XU2 A;  4LE9 A;  3A8H B;  4A4G A;  2JTM A;  1I8F A;  1SSH A;  4J9B A;  2MAM A;  1N27 A;  4JLG A;  5GAN 8;  1I0C A;  5HK3 A;  2DIL A;  4JJB A;  1K73 C;  2HEQ A;  1AT1 B;  4KUI A;  5IXB A;  1WJS A;  2CYZ B;  4IUQ A;  4HVV A;  3OSS C;  1W4S A;  4BI8 B;  2KRM A;  1ZUK A;  4OF1 A;  3EG9 A;  2AZV A;  3NPF A;  4M78 A;  1VIF A;  2EAY A;  2V1R A;  5GMK e;  5LJ5 d;  1WQW A;  2JT4 A;  3HFO A;  4FT2 A;  1VQ9 Q;  2HAX A;  1MND A;  3VJP A;  1VQ5 Q;  2K2V A;  4RTU A;  3UA6 A;  1PC0 A;  3VRZ A;  3CCJ A;  5FU6 B;  1ACM B;  1TUD A;  4LUE A;  4DEY A;  1G8X A;  1DJ7 B;  1CKB A;  2X4J A;  3QHS A;  2EKH A;  2F5K A;  4ELZ C;  1PHT A;  1BB9 A;  4EMK A;  2FPF A;  3JSC A;  1MMG A;  2VKN A;  3H9N A;  3KUF A;  1K4U S;  3LGL A;  2DZC A;  2XD0 A;  4PNO A;  2V1Q A;  5IXF A;  1VQ8 A;  4BB7 A;  1QVF P;  3H6Z A;  1W2B P;  2EQU A;  3MP1 A;  3ME9 A;  3PIP A;  3X20 B;  1K9A A;  1K73 R;  4B9W A;  1M3A A;  2EYX A;  2OTL T;  2DX1 A;  4E7S A;  4OMF B;  1VQK Q;  2JVV A;  2J7I A;  4C0G A;  3CMA A;  1NE8 A;  3M0P A;  5FU7 B;  3M0T A;  2LMJ A;  3OYA A;  3G4S A;  1RL2 A;  3RES A;  3VS3 A;  4M7A D;  1SG5 A;  2OAW A;  1AHJ B;  2HNI A;  2D0Q B;  3JCM f;  3M4G A;  2AKL A;  1HK9 A;  3CXC S;  2MK5 A;  1MGQ A;  2DVE A;  2DAQ A;  1X2Q A;  3ZL7 C;  2LNH B;  1ABQ A;  2DBK A;  2RI3 A;  2O01 E;  4EMG A;  3C4S A;  3L2R A;  3G71 A;  2EGA A;  3THK A;  1QMC A;  2KRN A;  4ZN1 A;  4PKC C;  3FC3 A;  2DEQ A;  1XTD A;  3REA B;  2AIR B;  4F16 A;  5I21 A;  3CCJ T;  5CAI A;  1V1C A;  5FWB A;  3JCM Q;  4F7U E;  2JJ9 A;  3JCM e;  1JO8 A;  2GBQ A;  2JUF A;  2WSE E;  2XKO C;  3EHR A;  1QVF A;  1W2B A;  2FEI A;  2VVK A;  2DYI A;  3OYL A;  2DTI A;  3V7R A;  1I5L A;  4IKF A;  2ZPG B;  3X26 B;  1PNJ A;  1VQ8 T;  3TEE A;  2PVG B;  2PTK A;  3MEU A;  1IGQ A;  1ZUY A;  4M75 E;  1UHF A;  3CD6 A;  4LDY A;  1PSE A;  2FB7 A;  2E6Z A;  3PVQ A;  1HD3 A;  3CEY A;  4ME7 A;  3MO8 A;  4RTY A;  4C8Q D;  1EIF A;  3EFO A;  1D0Y A;  4BY6 C;  1Q86 U;  4PFZ A;  3G4S T;  3CCM Q;  3VV0 A;  1PM3 A;  4NL3 A;  1GXI E;  2ZPI B;  1X2K A;  1MV0 B;  3MEV A;  2R5M A;  1PD0 A;  3LX7 A;  1AEY A;  1Y7X A;  3RDV A;  2JM9 A;  2E12 A;  1ZBJ A;  2MI6 A;  5GAO q;  2EIF A;  2GCX A;  6AT1 B;  2XDB A;  3CPF A;  5I2S A;  4PJO C;  1AWO A;  3OMC A;  2D1X A;  4M7A A;  3CCQ Q;  3HSB A;  4MMK A;  2J6O A;  4ELY C;  3G71 T;  3CBP A;  4M77 F;  3CCL A;  4QT7 A;  1K0S A;  4BE1 A;  4R55 A;  4GLM A;  1K9M C;  3OYE A;  2CP6 A;  3L2U A;  2EQM A;  3I56 A;  5KYU A;  4ZN3 A;  3RKW A;  1TSF A;  2RA2 A;  9ATC B;  4HA8 A;  4IIM A;  5CR2 A;  1JXO A;  1G3T A;  3M4Y A;  5GJV B;  5KYN A;  4IUV A;  1RI9 A;  2CP0 A;  4KH0 B;  1PSF A;  2CP5 A;  1FXX A;  2K4Y A;  5LJ5 f;  3HKS A;  4HT9 A;  3CC4 A;  2YWW A;  3HRU A;  1MNE A;  5A0D A;  2RK2 A;  4OGC A;  5IT9 E;  2L5Q A;  1NPR A;  3CD6 T;  2K5I A;  2XK0 A;  4KT0 E;  1M2V B;  2CH4 A;  5CKH A;  1KFZ A;  2JZ2 A;  3JB9 F;  5J26 A;  1RAD B;  4KGZ B;  3CCS A;  4FU6 A;  2RQT A;  2GTJ A;  3FJ5 A;  1HXD A;  1QVG A;  2J05 A;  2V8K A;  2KI7 A;  5GAN 5;  5LJ5 e;  2YUN A;  5LJ3 g;  2E3I A;  4KGX B;  2MF2 A;  1TU0 B;  1K9M R;  3ER0 A;  4RTT A;  4J9C A;  4C8Q A;  3SWN A;  2M16 A;  3TSZ A;  2RB6 A;  2RO0 A;  3LLR A;  1H3Z A;  1G83 A;  5FRM A;  1VQM Q;  1RAI B;  4L5G A;  2XID A;  4J9G A;  4B9X A;  2NUT B;  2DNU A;  3CCL T;  1EX4 A;  1OYX A;  1FWZ A;  1IRX A;  1R77 A;  3GBQ A;  5GAN g;  3CME Q;  1SPK A;  1NBE B;  1YI2 A;  4QVD A;  2CS7 A;  1ZSZ A;  2LQK A;  3OYJ A;  1TUC A;  3EGU A;  3VS7 A;  3DLL A;  1WHL A;  1WXT A;  2FO0 A;  5A0G A;  3L42 A;  3BE3 A;  4F7U G;  5GMK h;  2D6F A;  1O9S A;  3P8H A;  4FYY B;  4XTU A;  3O5Z A;  3VUZ A;  3OS5 A;  1CKA A;  2AK5 A;  2QA4 A;  3CC4 T;  1FMV A;  3CCV Q;  2CZ1 B;  3QZ9 B;  2H3E B;  2J6F A;  2Y4X A;  1UEB A;  2RJD A;  2RQU A;  1MHN A;  4TVR A;  4C5H A;  4M7D G;  3CCS T;  1M9S A;  1U3O A;  4ORZ A;  4M77 A;  2X3X D;  4OMM A;  5KYW A;  4EIK A;  3QUI A;  1Q81 U;  4PLL A;  2VV5 A;  1U06 A;  4MDW A;  4C0D C;  1BBZ A;  4J9H A;  1T3S A;  1OZ2 A;  1WDX A;  4B6M A;  3DKM A;  1RLP C;  2LQ8 A;  3J81 E;  1M90 C;  2L89 A;  1M1K U;  5KCO A;  2QAZ A;  4JPB W;  2L2P A;  4JRP A;  3R6N A;  2O2O A;  4KH1 B;  4M75 D;  4JZ4 A;  4BI4 A;  1YHQ Q;  2QQB A;  1D3B A;  1PD1 A;  3EFS A;  2KRS A;  4M78 G;  2PVO B;  3CC7 Q;  4CC3 A;  4RCC A;  4ZTJ A;  5GMK j;  3SD4 A;  4N4G A;  1YFN A;  4X9C A;  1YI2 T;  5IAY A;  3M59 A;  5CIU A;  2QEX A;  3JB9 H;  3TCJ A;  5GAO p;  2HL5 C;  3DB3 A;  1VQ4 A;  3EAE A;  2LQW A;  3JCM W;  1VQP A;  1UB4 A;  4PJO F;  3HP9 A;  5LJ3 h;  2KNB B;  1X6O A;  3S3N A;  3NTI A;  3QII A;  4ATO A;  1JU5 C;  2LNV A;  4RMO A;  1X43 A;  2QA4 T;  1HSQ A;  3VS4 A;  1QCN A;  1V76 A;  2EGC A;  3ZBD A;  1K76 A;  3QYG B;  4QKU A;  1M30 A;  4M78 D;  4MZP A;  4RTV A;  4J6W A;  2QXF A;  2BZ8 A;  3QJY A;  1SRM A;  1OZ3 A;  2EJ9 A;  2CSI A;  3JCM h;  3EG2 A;  5GAN d;  1UFF A;  3TVT A;  1K8A U;  4A4F A;  3OYK A;  3CMA Q;  4RKU E;  2HBW A;  3GOX A;  1T0H A;  2ZPH B;  1H64 1;  1Q95 G;  2EQK A;  4R56 A;  1M90 R;  4A4K A;  1TS9 A;  4AMC A;  1Q81 R;  4DBF A;  2V26 A;  2MPX C;  4C92 B;  3SHW A;  2KRO A;  1K8A C;  1GBR A;  3FDR A;  4PFP A;  3A98 A;  2XU8 A;  2DJQ A;  2YLB A;  1S72 A;  2OTJ Q;  3MET A;  5CQX A;  4HCB A;  1BK2 A;  1PG5 B;  4OML A;  3V8L A;  1JQQ A;  5CKD A;  4CC2 A;  1K0X A;  2HL3 A;  1KQ1 A;  3L2W A;  1BU1 A;  2ZPE B;  1NEG A;  2E65 A;  3H41 A;  1Q7Y U;  2EFI A;  2EYW A;  2KEA A;  2M9U A;  5AYF A;  3MP8 A;  1UE9 A;  3VKI A;  1BKB A;  4X1V A;  1B34 A;  1OPL A;  1LPL A;  4FYW B;  1UJ0 A;  5IHN A;  4XTX A;  2DL5 A;  1JRI A;  4E2F B;  5LJ3 j;  1AWX A;  1VQ6 A;  3M0U A;  3VS6 A;  4ZNX A;  3S3M A;  1H3H A;  3G6E Q;  3PGG A;  4M75 A;  4EPC A;  2KT1 A;  5IN1 A;  2QEX T;  4D6W A;  3L2Q A;  3MKD A;  5KYY B;  2QGG A;  2GNC A;  2XI9 A;  1VQ4 T;  1G3W A;  2KK4 A;  1VQP T;  2PNI A;  2PQW A;  5GAN 7;  3CQT A;  3CC2 A;  2DYB A;  1X27 A;  1YWP A;  1IO6 A;  3KFV A;  1WGS A;  2G3R A;  3PIO A;  4DA4 A;  2AKK A;  1K8A R;  5DLQ E;  1G2B A;  5CCA A;  4C92 E;  2JS0 A;  3OW2 S;  1E7O A;  4IUR A;  1A0N B;  2RM4 A;  3OS2 A;  2HDA A;  1ZHI A;  1WHG A;  3RKY A;  3CCE Q;  2RQW A;  4II1 A;  1ZUU A;  3G1J A;  2LT4 A;  4M77 E;  2NWM A;  3I9Q A;  4JRK A;  1NYF A;  4XTZ A;  2CKK A;  1EFN A;  2RHX A;  3BFM A;  3DB4 A;  4WTO B;  3EGD B;  1S72 T;  2C0T A;  2HCK A;  2KXC A;  2QDY B;  2E5K A;  2X9H A;  3M57 A;  3MCA B;  4BE2 A;  5GAN 3;  5CO7 A;  5I2M A;  1PKS A;  3OB9 A;  4E47 A;  1M3B A;  2LRQ A;  1GBQ A;  2FZC B;  4O5V A;  3CXC P;  1KJW A;  4J8O A;  1M3C A;  2RK1 A;  4E7Z A;  2V8I A;  4HCZ A;  5LJ5 h;  2K57 A;  1RI0 A;  2RHU A;  4M7A G;  1RAG B;  1YN8 A;  2BE7 D;  2P0Q A;  4J83 A;  4N0A C;  2K6D A;  3SEM A;  1VQ6 T;  3FJP A;  3I56 Q;  1YJ9 A;  3I55 Q;  3RIR A;  1OX8 A;  2MMP A;  5DM7 R;  3MP6 A;  4DBH A;  1AWJ A;  2WAC A;  2WSC E;  5GAN 4;  2VC8 A;  3OSV A;  2GF7 A;  2HD0 A;  2HQE A;  3CC2 T;  1WHK A;  1OU8 A;  1KQS S;  4A53 A;  3E2U A;  2L3Q A;  3BDU A;  3V7S A;  2LP5 A;  1R0C B;  1VQ7 Q;  1RAH B;  2F2X A;  1BIB A;  2K9G A;  1H92 A;  1D1A A;  1WYX A;  4JDS A;  3DLM A;  1YIJ A;  3ASK A;  1N9S A;  4WF2 A;  2EYY A;  4ESR A;  4Z8A A;  2JS2 A;  4XQ3 A;  1SHG A;  4L6V 5;  1MV3 A;  4QQ6 A;  4OGE A;  3OS1 A;  4KBM B;  1RAA B;  2RHI A;  5IHI A;  1D1C A;  1KHC A;  2VYT A;  3CCR Q;  1VQL A;  2EYZ A;  2G6F X;  1BYM A;  2A08 A;  5I22 A;  4AT1 B;  3GF5 A;  2KXD A;  5A0L A;  3QWY A;  1X69 A;  4QVC A;  2DLP A;  2A7Y A;  1D0Z A;  3H0H A;  1ZX6 A;  3TRE A;  2FZK B;  3CXC A;  1Z9Q A;  3OY9 A;  1C0M A;  4J7F A;  3OYN A;  2KGT A;  5LJ5 j;  4E7K A;  5GAM h;  5KYX B;  4BY6 B;  1GRI A;  5GAN f;  2CDT A;  3C0C A;  4C8Q G;  4FT4 A;  1B07 A;  2PVD B;  5EC7 A;  2ZAE A;  3BY7 A;  4RG2 A;  5HCK A;  2DIQ A;  2R5A A;  3E9F A;  3E1S A;  4Y92 A;  2DF6 A;  2RNA A;  3C95 A;  1OOT A;  3RER A;  1W6X A;  4M7D C;  3EG3 A;  1YJN Q;  1YJW Q;  1YJ9 T;  1RAF B;  5KE2 A;  4PJO B;  3J80 E;  2QG9 B;  4O6J A;  2DE0 X;  4LXC A;  4MZT A;  1P92 A;  1PRM C;  1SEM A;  2QQ9 A;  2O4X B;  5GAN e;  1JXM A;  2OX7 A;  1R0B G;  4J9D A;  2GQI A;  1RLQ C;  2ZZD A;  2COY A;  5CK9 A;  2E64 A;  3GPL A;  3I5R A;  1F1B B;  1YIJ T;  2EPD A;  2LJ3 A;  3C94 A;  3UF4 A;  3QKJ A;  4F04 B;  2LJ0 A;  3M0R A;  1JBM A;  2NUT A;  1Q86 C;  4C92 F;  2GQV A;  4KGV B;  1D1B A;  4M78 C;  1MMD A;  1VQL T;  1KC8 U;  2CUD A;  1I07 A;  5GAM j;  5KE3 A;  1YNZ A;  4J9E A;  3VS0 A;  2L8D A;  4FSX A;  1D09 B;  2YRD A;  2KY9 A;  3EGX A;  2HQX A;  1VQ9 A;  1VQ5 A;  3O8V A;  2QTV A;  3TQ7 P;  1Q82 U;  4C5I A;  1IGU A;  3QDR B;  5AT1 B;  1OU9 A;  4P5N A;  1U5S A;  1N8R U;  1WHM A;  3HRT A;  5GAN 6;  1OPK A;  3KBG A;  4EMK C;  1OI1 A;  3U23 A;  1KD1 U;  4PJO E;  2A3L A;  2LQN A;  3CBM A;  2DEU A;  2E5Q A;  1N8R C;  2KMT A;  4ZGJ B;  2CSQ A;  3JCM P;  1QWE A;  4LUD A;  2P4T A;  5KCH A;  1QCO A;  1BI3 A;  3CCU Q;  4M77 D;  1AVZ C;  4PK4 A;  1VQ4 Q;  2ROL A;  4NS5 A;  2BZY A;  2DMO A;  1TOV A;  3FEO A;  1SSF A;  1Q86 R;  3JB9 G;  3GNF B;  1RAE B;  1GL5 A;  1UGV A;  3WVD B;  2QYZ A;  4HVU A;  4PJM A;  4Z02 A;  4FIB A;  1T0J A;  3H0F A;  2CP3 A;  2WSF E;  3TSW A;  3OYH A;  2PUK B;  1FYN A;  3PMT A;  1KC8 R;  4LD9 K;  2AZS A;  2LC4 A;  3FIF A;  5CKB A;  2RD1 A;  2MWO A;  4Z89 A;  1IZ6 A;  2A28 A;  3IQL A;  5FW9 A;  3CBO A;  2DL8 A;  3M56 A;  3OYY A;  4FYV B;  2DZ9 A;  1Q82 R;  1X6B A;  2I0N A;  2FG0 A;  3JCM g;  5J3B A;  4XTY A;  3JB9 D;  1VQ9 T;  3LH5 A;  1VQ5 T;  2L0A A;  1YIT A;  1N8R R;  3JB9 I;  3EFO B;  3HFN A;  4JUV A;  1WHH A;  1M4Z A;  1KD1 R;  2COW A;  3WXM B;  1WA7 A;  1I4K 1;  2HKQ B;  2VB6 A;  4R0K A;  2KYM A;  1I5O B;  4F17 A;  2NUP A;  2HQH A;  1VQN A;  4OB0 B;  2C06 A;  2BKD N;  1S1N A;  1YP5 A;  3JRZ A;  4PFO A;  3OYM A;  4CC7 A;  3AHU A;  4DBQ A;  4C0D B;  1M5Q 1;  3S6W A;  3UDC A;  2PUO B;  2EJF A;  3R6O A;  4M7A B;  2EW3 A;  3QBY A;  1FMW A;  1MMA A;  1B3Q A;  2KQW A;  4Y91 A;  2ABL A;  4C92 A;  1H8K A;  4AFZ C;  3FB9 A;  2OTL Q;  2EYQ A;  4M75 G;  1G3Y A;  1YCY A;  1PRL C;  2DIG A;  3EFR A;  2RMO A;  4A63 B;  4CI0 C;  1Z9Z A;  1E6G A;  1W1F A;  4OB1 B;  1N9R A;  2X51 A;  2FYK A;  2RF0 A;  2OJ2 A;  1UGR B;  2NYS A;  3T9N A;  1T3L A;  4M7D F;  4E7L A;  1XQH A;  2E70 A;  3V8J A;  1Y57 A;  1BCO A;  2HBP A;  1OEB A;  5FLX E;  1MUZ A;  2CH4 W;  4Y28 E;  1U1S A;  2KBT A;  2VXF A;  5GJW B;  2KVQ G;  4DBR A;  4ZGD B;  1QVP A;  2YUP A;  4M7A C;  4PL6 A;  5J39 A;  1Y96 B;  1YWO A;  1Q81 C;  1TG0 A;  3CCQ A;  4RG8 A;  4F14 A;  2E3H A;  5KYY A;  3REB B;  1G5V A;  1WX6 A;  1YIT T;  1SF9 A;  1WZO A;  2E1H A;  2E10 A;  1M1K C;  2X4W A;  2FRY A;  4PJN A;  1GFD A;  1KG1 A;  3CCJ Q;  1B7T A;  2K5F A;  4IUU A;  3MEW A;  4OVA A;  4HT8 A;  4Z88 A;  4NOY A;  2CP2 A;  2FPE A;  5LJ3 d;  4JLI A;  5GAO l;  4LDW A;  2M0O A;  1VQN T;  4C8Q B;  3VRY A;  2VUB A;  3OYF A;  2A37 A;  1ZQ1 A;  1OQK A;  1FMK A;  1JEG A;  2LX9 A;  3VS2 A;  1VQ8 Q;  2F1L A;  3M58 A;  3BW1 A;  2L3P A;  1QCF A;  5D6Y A;  2JN0 A;  2PU9 B;  5LJ5 g;  1E6H A;  2CZ6 B;  3QXE B;  2LT1 A;  2L3R A;  3RR6 A;  4XK8 E;  5GAO r;  2RJF A;  1KIK A;  1Y0M A;  2DRK A;  3F70 A;  4BI3 A;  3JV3 A;  1VA7 A;  3PTA A;  4E6R A;  3A8M B;  3G4S Q;  1BI0 A;  3GIB A;  2JOY A;  3M0Q A;  4RCB A;  4J6X A;  4DOV A;  4C8Q C;  4PJO D;  2W10 A;  1TWB A;  5LL6 S;  3SWN C;  2ECZ A;  3QO3 A;  4FSS A;  2ZPF B;  4M4Z A;  1M1K R;  3I5S A;  1GFC A;  3LWH A;  4HKE A;  2NLU A;  3FRN A;  2JXB A;  3OW2 P;  1VQM A;  1WFW A;  2M51 A;  3VS5 A;  3PT9 A;  4HCK A;  4J5Y A;  2QQS A;  2X3W D;  2W0Z A;  3CCQ T;  3G71 Q;  3HPW A;  4CRI A;  1TXQ A;  1ZSG A;  2DVJ A;  4OMN A;  3CME A;  1AWW A;  1WI7 A;  1ZSZ C;  3E9G A;  1NG2 A;  1OX9 A;  3NHN A;  5DY9 A;  3X24 B;  2LJ1 A;  1SHF A;  4AG2 C;  5KYW B;  1Q7Y C;  2MCN A;  2SRC A;  4JRI A;  2NUZ A;  3HL8 A;  2P84 A;  2X4Y A;  2I2L A;  1JJ2 S;  2FHD A;  5GAM g;  3Q1J A;  3A8G B;  1OUL A;  2LX7 A;  4J7I A;  4A4H A;  2P0P A;  3CPW S;  3SDZ A;  3CCV A;  1CSK A;  2DJZ A;  1XNI A;  2DXC A;  1D3B B;  3NMZ C;  3V7C A;  3PNW C;  1ZLM A;  1PCX A;  2CT4 A;  3CD6 Q;  1IXD A;  5CQY A;  4FL6 A;  4LDX A;  1BIA A;  1WIE A;  1UHC A;  2BE9 B;  2YHT A;  4V2S A;  3PMI A;  3EH1 A;  1K73 U;  1YCS B;  4M77 C;  3RMQ A;  2A36 A;  5KYX A;  4D8D A;  2DBM A;  1KQS P;  2V8J A;  3OW2 A;  2X4X A;  1HYO A;  2P4R A;  2RJE A;  2ROT A;  3RBB B;  1NJI U;  2RI5 A;  3VYG A;  1YBY A;  2O9S A;  4FCY A;  1Q7Y R;  3ULR B;  3VS1 A;  1VQM T;  2GFA A;  3I35 A;  2MYS A;  3PFS A;  4OMO A;  2B86 A;  2BIV A;  4PJO A;  1AZE A;  1U8R A;  1YHQ A;  1AOJ A;  1WQ7 A;  4RTW A;  1NJI C;  3CCL Q;  3LYI A;  3M55 A;  3RKX A;  3CC7 A;  2RQR A;  2O4X A;  3CME T;  5EG2 A;  4BE0 A;  1M27 C;  3VU3 C;  3ZEH A;  1UDL A;  2E6N A;  3RUX A;  3P8D A;  1WXB A;  5GAO n;  2QI2 A;  1LJO A;  1N5Z A;  4MML A;  4A4E A;  4XTW A;  1AD5 A;  1QW1 A;  2ATC B;  2ZPB B;  5D6W A;  4J9F A;  4E7H A;  3C12 A;  1RAB B;  2D9T A;  2LCC A;  4FW2 A;  3URG A;  2O31 A;  4M7A F;  2JTF A;  3P8B B;  2DXB A;  3QJ6 A;  3QG1 A;  1KQ2 A;  3V8K A;  1Y71 A;  2B8A A;  1LNX A;  4OB3 B;  4F7U B;  1ZA2 B;  1IB8 A;  3CC4 Q;  7AT1 B;  4BD3 A;  4HVW A;  3CCV T;  2DA9 A;  4FYX B;  5GAO m;  1B34 B;  4DQ2 A;  3OMG A;  3OYB A;  5GAN 2;  2DL7 A;  4UC4 A;  1KQS A;  3EG0 A;  2M0Y A;  3QPH A;  1G3S A;  1PKT A;  3CCS Q;  1W70 A;  5LJ3 f;  4LDV A;  2YLC A;  2EVR A;  4M75 B;  5FU6 C;  3UA7 A;  5L23 A;  3LWI A;  4M7D B;  5FRN A;  3JB9 J;  2YRV A;  1Y07 A;  2CT3 A;  2FRW A;  1GCP A;  2YT6 A;  1NJI R;  1FX7 A;  5CVI A;  2SEM A;  5GAM d;  4GBQ A;  2GTO A;  2DKG A;  3UWN A;  2OTJ A;  1WJR A;  2DTO A;  1UG1 A;  3LW5 E;  2VGN A;  3OBW A;  2XDD A;  3QWX X;  2DM1 A;  1IHV A;  3EG1 A;  2F2W A;  2YRC A;  5LJ3 e;  1YHQ T;  4YTL A;  2H3J A;  5DLO A;  3G7Z A;  2CRE A;  4OMP A;  5C6S A;  1J3T A;  2LVM A;  1YIT Q;  2K7A A;  3HHT B;  4WCI A;  3CC7 T;  1M2V A;  2LCL A;  2JMC A;  4CC4 B;  1QVF S;  1W2B S;  2Z0W A;  4IUP A;  1YI2 Q;  4M75 C;  5C0M A;  3EG9 B;  4M78 B;  2DER A;  1KSW A;  4C8Q F;  5FU7 C;  3OYI A;  3G6E A;  4JJC A;  4AFS C;  3JCM V;  2DPP B;  3OYC A;  2A0F B;  2XIC A;  2EQJ A;  2ZGW A;  2DET A;  1VQN Q;  4XU0 A;  4EMH A;  2Y90 A;  2XMF A;  2QTX A;  1ZBX A;  4JS4 A;  1UGS B;  3OBY A;  2QQR A;  3L2V A;  2FL7 A;  5FWC A;  1VQO A;  4DEX A;  2QA4 Q;  2C0I A;  2KT8 A;  1RUW A;  2DTH A;  3QYH B;  3GP8 A;  2DD5 A;  4E7I A;  4M7D E;  1WNL A;  2VGM A;  5CKE A;  4EMK B;  2RN8 A;  2EGE A;  5KH6 A;  1NLO C;  1NPP A;  2YUQ A;  2EBP A;  3UPU A;  3CMA T;  4C92 G;  3FLG A;  2OAU A;  1SKU B;  4BAC A;  1IHW A;  1UJY A;  2C0O A;  3RNJ A;  3CCE A;  4VUB A;  2E41 A;  2QDL A;  4BUG A;  2ENM A;  2VXE A;  2F2V A;  4FW1 A;  1QVG P;  4M77 G;  2OTJ T;  3OQ5 A;  3M53 A;  1KC8 C;  2LDM A;  5HK0 A;  4NL2 A;  3D7S B;  1QLY A;  1K9M U;  2R58 A;  3NGP A;  4PJJ A;  4C5G A;  4DOW A;  4M78 E;  1IRE B;  2IPO B;  5ECA A;  1VYT A;  1M8M A;  1Q82 C;  4N4I A;  4BDY A;  4C92 D;  4MDX A;  1R8O B;  2CZ7 B;  3NFC A;  1RAC B;  2RH2 A;  2BUD A;  2EQI A;  1QP3 A;  4KUL A;  1VOM A;  3N5B B;  1WLP B;  2FPD A;  3I55 A;  3G6E T;  1KD1 C;  2VWF A;  2HSE B;  2XDP A;  2QEX Q;  4K11 A;  2ED1 A;  3GLX A;  2JMA A;  1VQP Q;  3KXT A;  4XU3 A;  1VQK A;  3NTK A;  1UTI A;  2J6K A;  1PWT A;  4HCC A;  5M9O A;  1VQO T;  2YXY A;  2ESW A;  1LOJ A;  3EHQ A;  2KYB A;  1VQ7 A;  4QVZ A;  1U1T A;  2KSS A;  1QVG S;  1Y96 A;  2E4H A;  3A1P A;  2GFU A;  4JJN K;  4C5E A;  2IVW A;  2RHZ A;  1N6A A;  8ATC B;  4KRT A;  2K79 A;  1ZA1 B;  5D6X A;  3EH2 A;  4JRQ A;  3CCR A;  2K3X A;  3JCM b;  2YUO A;  2O88 A;  3NTH A;  3CCE T;  1AZG B;  2JTE A;  1K1Z A;  5D7U A;  2ED0 A;  1OV3 A;  1BI2 A;  1SRL A;  5FRO A;  3INZ A;  1S72 Q;  4JZ3 A;  2HKN A;  1O75 A;  2D8J A;  5HKC A;  2JNG A;  2DL4 A;  2EJG A;  1EZZ B;  1WHJ A;  2EKO A;  2IG0 A;  2JM8 A;  4N4H A;  2M02 A;  4D8K A;  2QQA A;  1I1J A;  5A2Q E;  2ZCF B;  4QW2 A;  3L1A A;  4FM4 B;  1NLP C;  1UEC A;  1VQ6 Q;  2XG8 D;  4PJL A;  5GAM f;  1YJW A;  1YJN A;  1M8V A;  3I56 T;  3MHX A;  4LNP A;  5GMK l;  1XOV A;  1LCK A;  4C0F A;  3S3O A;  3I55 T;  3ZFJ A;  1UUE A;  2CGH A;  3EGX B;  1M1F A;  2Y4Y A;  4JJD A;  2MOX A;  1VIE A;  2HMA A;  2F5T X;  4F7U F;  3OYG A;  2L3S A;  4IUT A;  4XAX B;  2KDS A;  4BDZ A;  1VQK T;  3CC2 Q;  3PVL A;  1GCQ A;  1QKX A;  1TH7 A;  1NEB A;  4GY5 A;  1NZ9 A;  1XJW B;  2X35 A;  5KYU B;  2RPN A;  1M2O A;  3QDF A;  3JAM E;  2KAF A;  1WJQ A;  1VQ7 T;  2AHJ B;  2M1H A;  3CCM A;  2XHC A;  2P0K A;  2YSQ A;  2QK0 A;  4M75 F;  5GAM e;  3RMS A;  3M9Q A;  1D0X A;  2KR3 A;  4LDU A;  4X34 A;  3CCR T;  1WPY A;  3GNG A;  2KE9 A;  5L8R E;  3L2Z A;  5I11 A;  3OS0 A;  3OYD A;  3TU4 K;  2RHY A;  4PLI A;  1UGP B;  2DXT A;  1VYU A;  1M90 U;  1KK7 A;  3X28 B;  4RTX A;  2GGR A;  3OA6 A;  2DD4 A;  3MJX A;  2K3B A;  4EDU A;  3H8Z A;  2K5L A;  2H8H A;  2DL3 A;  5CKF A;  1X6G A;  5IHK A;  2K2M A;  4KUD K;  4A54 A;  2LCS A;  4AFU C;  4M7D D;  2HSP A;  4MZM A;  4M7A E;  2D8H A;  4M78 F;  4XU1 A;  3LH0 A;  1C6V X;  3BDL A;  3SWN B;  5IH2 A;  1LVK A;  2R57 A;  4PJO G;  2VAS A;  4RTZ A;  1BI1 A;  2F69 A;  2K3Y A;  1YJ9 Q;  4N0A A;  1YJN T;  1YJW T;  2EWN A;  3JCM d;  2RJC A;  4GLK A;  3PE0 A;  4ANJ A;  1UGQ B;  3CCU A;  2OI3 A;  4AG1 C;  4LD6 A;  3J7A F;  1X01 A;  1I81 A;  3EGD A;  1M1G A;  1JB0 E;  1JJ2 P;  1ZSZ B;  2DXU A;  1NYG A;  3QZ5 B;  4QQD A;  1HJD A;  2FZG B;  3MEA A;  2NUP B;  2CP7 A;  2YDL A;  3MPU B;  3CCM T;  1YIJ Q;  2O9V A;  3HRS A;  3CPW P;  3A5Z B;  2JW4 A;  2IIM A;  4J6Y A;  3M5A A;  1V29 B;  1X75 C;  1QP2 A;  3E19 A;  4X9D A;  4XTV A;  3X25 B;  1ABO A;  2AT1 B;  3JCM c;  2DO3 A;  2RI2 A;  3SFM A;  2MWP A;  5GAN h;  1VQL Q;  3UT1 A;  2PZ1 A;  1TUG B;  4ZTF A;  1QWF A;  1VUB A;  4Q5W A;  8AT1 B;  1TTH B;  3VUB A;  3M54 A;  4JS5 A;  1BCM A;  4IIO A;  4LN2 A;  3A8O B;  4C8Q E;  4ZGE B;  3WVE B;  2FVU A;  1QKW A;  4M77 B;  2RQV A;  1C1A A;  4F7U A;  3H0I A;  1QQJ A;  2CZ0 B;  2DK3 A;  4AFQ C;  1KHI A;  3A8L B;  4L59 A;  4QQG A;  1ARK A;  2QGF B;  3QSU A;  2DFU A;  2COZ A;  3M0S A;  4OP0 A;  2BTT A;  5GMK i;  4J9I A; 
#chains in the Genus database with same CATH homology
 4GBQ A;  2GTO A;  4LUD A;  1WXU A;  1U06 A;  4HXJ A;  1UG1 A;  1BBZ A;  4J9H A;  1T3S A;  1AVZ C;  1WDX A;  2MIO A;  2ROL A;  2BZY A;  2DMO A;  1GCQ C;  2DRM A;  3QWX X;  3UAT A;  1RLP C;  2LZ6 B;  2DM1 A;  4JPB W;  2L2P A;  3EG1 A;  3R6N A;  2BZX A;  2F2W A;  2O2O A;  2J06 A;  4JZ4 A;  1GL5 A;  1UGV A;  2D0N A;  2CUB A;  1NM7 A;  2CRE A;  4OMP A;  4HVU A;  1VYV A;  2KRS A;  1J3T A;  2K7A A;  4WCI A;  4OMQ A;  2JMC A;  4RUG A;  1T0J A;  4CC4 B;  4CC3 A;  4LE9 A;  3H0F A;  1SSH A;  4J9B A;  1I0C A;  1KSW A;  3TSW A;  1FYN A;  2DIL A;  4JJB A;  2HEQ A;  4JJC A;  4AFS C;  5IXB A;  2AZS A;  4HVV A;  2KRM A;  4Z89 A;  1ZUK A;  2A28 A;  2LQW A;  3IQL A;  2XMF A;  5FW9 A;  2AZV A;  3NPF A;  2DL8 A;  2KNB B;  2V1R A;  1X6B A;  2I0N A;  2FG0 A;  5FWC A;  2JT4 A;  1JU5 C;  4DEX A;  3LH5 A;  1X43 A;  2L0A A;  1HSQ A;  2C0I A;  2KT8 A;  3VS4 A;  4RTU A;  1RUW A;  2EGC A;  3UA6 A;  1K76 A;  1M30 A;  4RTV A;  3VRZ A;  2BZ8 A;  2EGE A;  2RN8 A;  1SRM A;  1NLO C;  2CSI A;  3EG2 A;  1UFF A;  1TUD A;  4LUE A;  4DEY A;  1WA7 A;  3TVT A;  2YUQ A;  2EBP A;  4R0K A;  1CKB A;  2KYM A;  2HBW A;  4F17 A;  1T0H A;  2EKH A;  1UJY A;  1PHT A;  1BB9 A;  2FPF A;  2C0O A;  3RNJ A;  1S1N A;  1YP5 A;  2VKN A;  4CC7 A;  3SHW A;  1K4U S;  2KRO A;  2QDL A;  2ENM A;  1GBR A;  3A98 A;  2DJQ A;  2F2V A;  2V1Q A;  5IXF A;  2EW3 A;  1B3Q A;  1BK2 A;  4OML A;  1JQQ A;  2ABL A;  1H8K A;  4AFZ C;  1K9A A;  1QLY A;  4CC2 A;  3NGP A;  1M3A A;  2EYX A;  1K0X A;  2DX1 A;  1BU1 A;  1PRL C;  1NEG A;  2J7I A;  3H41 A;  2EYW A;  1VYT A;  2KEA A;  5ECA A;  2RMO A;  4A63 B;  1M8M A;  1UE9 A;  4X1V A;  1Z9Z A;  1E6G A;  1W1F A;  3M0P A;  3M0T A;  1OPL A;  2LMJ A;  2RF0 A;  2OJ2 A;  1UJ0 A;  5IHN A;  2DL5 A;  1T3L A;  2EQI A;  3VS3 A;  1AWX A;  3M0U A;  3VS6 A;  4ZNX A;  2OAW A;  1H3H A;  1WLP B;  2FPD A;  1Y57 A;  2KT1 A;  2VWF A;  1OEB A;  4K11 A;  1MUZ A;  2CH4 W;  2GNC A;  2ED1 A;  2AKL A;  2JMA A;  2KBT A;  5GJW B;  2YUP A;  2PNI A;  1X2Q A;  3ZL7 C;  2LNH B;  1YWO A;  3CQT A;  1ABQ A;  2DBK A;  1TG0 A;  1UTI A;  2J6K A;  2DYB A;  4F14 A;  1X27 A;  1PWT A;  1YWP A;  2EGA A;  1IO6 A;  3THK A;  2KRN A;  3KFV A;  2ESW A;  3REB B;  3EHQ A;  2KYB A;  1WX6 A;  2AKK A;  3REA B;  1G2B A;  1GFD A;  2FRY A;  4F16 A;  2JS0 A;  1V1C A;  4KRT A;  5FWB A;  2K79 A;  1E7O A;  4Z88 A;  1A0N B;  2FPE A;  1JO8 A;  2GBQ A;  2HDA A;  3VRY A;  2YUO A;  2O88 A;  3EHR A;  1AZG B;  2JTE A;  2RQW A;  1ZUU A;  2FEI A;  2VVK A;  1K1Z A;  2A37 A;  2ED0 A;  2NWM A;  3I9Q A;  1NYF A;  1FMK A;  1JEG A;  1EFN A;  1OV3 A;  3VS2 A;  1SRL A;  1PNJ A;  4JZ3 A;  2PTK A;  2C0T A;  2HCK A;  2D8J A;  2E5K A;  2KXC A;  1ZUY A;  2L3P A;  2DL4 A;  1QCF A;  1UHF A;  1E6H A;  3PVQ A;  2JM8 A;  1HD3 A;  4D8K A;  1PKS A;  1M3B A;  1I1J A;  1GBQ A;  1KIK A;  4RTY A;  1Y0M A;  1KJW A;  2DRK A;  1M3C A;  3JV3 A;  1VA7 A;  4E6R A;  3M0Q A;  1YN8 A;  1NLP C;  1UEC A;  2K6D A;  3SEM A;  1X2K A;  1MV0 B;  2W10 A;  4LNP A;  1XOV A;  2ECZ A;  1LCK A;  1AEY A;  4FSS A;  4M4Z A;  1UUE A;  3I5S A;  4JJD A;  2JM9 A;  2MOX A;  1ZBJ A;  1GFC A;  1AWJ A;  2JXB A;  2L3S A;  1WFW A;  2M51 A;  1AWO A;  3VS5 A;  2D1X A;  4HCK A;  3PVL A;  1GCQ A;  2W0Z A;  1QKX A;  2X3W D;  1NEB A;  2L3Q A;  2J6O A;  2LP5 A;  2RPN A;  4QT7 A;  1K0S A;  4GLM A;  1ZSG A;  2F2X A;  2DVJ A;  2K9G A;  4OMN A;  1H92 A;  1WYX A;  1AWW A;  1WI7 A;  2YSQ A;  2EYY A;  4ESR A;  1NG2 A;  3NHN A;  4AG2 C;  4Z8A A;  2LJ1 A;  1SHF A;  2JS2 A;  1SHG A;  2MCN A;  1MV3 A;  2SRC A;  2NUZ A;  4IIM A;  1JXO A;  5GJV B;  5IHI A;  1RI9 A;  2KR3 A;  2EYZ A;  2G6F X;  2A08 A;  5I22 A;  2KE9 A;  2KXD A;  5I11 A;  3QWY A;  1X69 A;  1VYU A;  2DLP A;  2LX7 A;  3H0H A;  1ZX6 A;  4RTX A;  1CSK A;  2GGR A;  2K3B A;  3NMZ C;  1ZLM A;  1Z9Q A;  2H8H A;  2CT4 A;  2DL3 A;  2KGT A;  1X6G A;  5IHK A;  2K2M A;  1WIE A;  1GRI A;  2CH4 A;  1KFZ A;  2CDT A;  1UHC A;  2LCS A;  3C0C A;  1B07 A;  5EC7 A;  4AFU C;  5HCK A;  2HSP A;  2RQT A;  2D8H A;  1YCS B;  2GTJ A;  3FJ5 A;  4Y92 A;  2A36 A;  2J05 A;  2DF6 A;  2RNA A;  4D8D A;  2DBM A;  5IH2 A;  1OOT A;  2YUN A;  4RTZ A;  1W6X A;  3EG3 A;  2P4R A;  2ROT A;  4RTT A;  4J9C A;  3RBB B;  3PE0 A;  2DE0 X;  2OI3 A;  2O9S A;  3TSZ A;  4AG1 C;  1G83 A;  1PRM C;  3ULR B;  1SEM A;  3VS1 A;  1JXM A;  3I35 A;  4OMO A;  4J9G A;  2B86 A;  1AZE A;  1AOJ A;  4RTW A;  2DNU A;  1NYG A;  4J9D A;  2GQI A;  1RLQ C;  1HJD A;  2RQR A;  2YDL A;  3GBQ A;  1SPK A;  3I5R A;  2O9V A;  1M27 C;  2EPD A;  1UDL A;  2LJ3 A;  2JW4 A;  2IIM A;  3UF4 A;  1WXB A;  2LJ0 A;  3M0R A;  1TUC A;  1N5Z A;  3EGU A;  3VS7 A;  1WXT A;  1ABO A;  1AD5 A;  2FO0 A;  4J9F A;  2PZ1 A;  2O31 A;  2CUD A;  1I07 A;  1QWF A;  1YNZ A;  4J9E A;  3VS0 A;  3O5Z A;  1CKA A;  2AK5 A;  4HVW A;  2DA9 A;  4IIO A;  4LN2 A;  2J6F A;  1QKW A;  2DL7 A;  2RQV A;  2RQU A;  1U5S A;  3EG0 A;  3H0I A;  2M0Y A;  4AFQ C;  1OPK A;  1PKT A;  1W70 A;  3U23 A;  2EVR A;  3UA7 A;  5L23 A;  1U3O A;  4ORZ A;  4OMM A;  2X3X D;  2LQN A;  2CT3 A;  1ARK A;  4EIK A;  2FRW A;  1GCP A;  2CSQ A;  2YT6 A;  3M0S A;  1QWE A;  2BTT A;  4J9I A;  2SEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...