2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
b'GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 2
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
3EG1A 2L0AA 2O9SA 4AFQC 3O5ZA 2HEQA 4RUGA 3VS7A 2KR3A 1CKAA 5IXBA 1AEYA 4JZ3A 1YN8A 1KIKA 1T0JA 4FSSA 1OPLA 1U5SA 1UUEA 2YUPA 2EQIA 2DL4A 2CSQA 1A0NB 1UG1A 1X27A 2V1QA 1M3AA 3R6NA 1HJDA 2W10A 2ROTA 2LMJA 1WDXA 2J6FA 1PKSA 1UHCA 2CH4W 2FEIA 1YWOA 1OOTA 3EGUA 2RMOA 1UECA 1SRLA 2EVRA 2KRSA 1AWJA 2BTTA 1OPKA 1VYUA 2CUBA 2GGRA 2EKHA 1M27C 2O31A 3UA7A 4J9GA 3PVLA 2DE0X 3M0QA 4JJCA 4CC7A 3VS1A 2BZXA 3EG2A 2BZYA 4HVVA 2JM8A 5FWBA 4RTVA 4JJDA 2LJ0A 4AG2C 3UATA 1X2KA 1G2BA 3NHNA 1X69A 4X1VA 1M3BA 5ECAA 2KXDA 1J3TA 1AOJA 2JXBA 2YUNA 4J9CA 1WLPB 1WFWA 5FWCA 1G83A 2DRKA 1RI9A 2F2WA 2JS2A 1PRLC 2HSPA 1UGVA 2LZ6B 2YUOA 2LNHB 2RQTA 1RLQC 3SEMA 4HVUA 1B3QA 2OI3A 2SRCA 1BB9A 1GCPA 1W1FA 3A98A 4Z8AA 2DMOA 1Y0MA 1ZUYA 2YT6A 3C0CA 2KROA 2J6KA 2D0NA 1AZGB 1HSQA 1T0HA 2HBWA 2MIOA 2DVJA 1I0CA 2E5KA 3RBBB 1SEMA 1NLPC 4OMOA 1QWFA 3VS6A 3M0PA 2DYBA 3QWYA 1JO8A 3RNJA 4A63B 3TVTA 4WCIA 2O9VA 1QCFA 1E6HA 4JJBA 5IHNA 1T3SA 4D8KA 3TSWA 1WXBA 1TUDA 2MOXA 1PHTA 1NEBA 1VYVA 1I1JA 2RPNA 2X3WD 2CH4A 2KYMA 1UDLA 2AKKA 2BZ8A 2C0OA 2GQIA 2SEMA 4OMLA 1S1NA 3VS4A 2IIMA 5FW9A 2ROLA 1GL5A 1Z9ZA 2NWMA 1WA7A 1E7OA 2CREA 4ZNXA 2DRMA 2DLPA 2A08A 2DL5A 1AVZC 1I07A 2AKLA 2CUDA 1FMKA 2K2MA 4OMNA 1NLOC 2RQVA 4IIOA 4LUDA 1PKTA 2HDAA 3EG0A 1QWEA 3CQTA 4OMQA 3EHRA 4GBQA 3LH5A 2F2XA 2HCKA 5IHKA 2DJQA 1HD3A 3I5SA 1M8MA 1K4US 1GCQA 1AD5A 5GJWB 2VKNA 3VRZA 2JMCA 2K79A 1UJ0A 2CDTA 2KE9A 2QDLA 4AFSC 1X6GA 2C0IA 4QT7A 2AZSA 1OEBA 2CT4A 3IQLA 2P4RA 1MV3A 2JW4A 2DF6A 4RTTA 2JTEA 2L2PA 3SHWA 2J6OA 2W0ZA 2G6FX 2PTKA 1JXOA 1ZUUA 1K1ZA 1YWPA 2YUQA 3FJ5A 2CSIA 4AFZC 3GBQA 2DM1A 4R0KA 4E6RA 4D8DA 2A37A 3H41A 3QWXX 3TSZA 2F2VA 1K76A 1U06A 1QKXA 3REBB 2KT1A 3EHQA 3I9QA 1WX6A 1ABOA 1UFFA 3NGPA 2EGCA 2LJ3A 1UJYA 1AWWA 2EBPA 1UHFA 1YCSB 3ULRB 2EGEA 1ZLMA 1JEGA 1E6GA 1WXTA 1SHGA 2RQRA 2ESWA 2RN8A 1GBRA 3VS2A 1RUWA 2L3PA 4CC4B 4Z88A 3H0IA 1ZBJA 2PZ1A 4RTZA 3H0FA 4Z89A 1H8KA 2AZVA 4RTXA 2J7IA 4CC3A 1WI7A 3REAB 2LQWA 4J9IA 2LJ1A 2M0YA 4LE9A 1ABQA 4EIKA 2DA9A 4F14A 2FG0A 1TUCA 3M0TA 1YP5A 1VYTA 2LCSA 5I22A 4M4ZA 3UF4A 1XOVA 1SHFA 2JM9A 1ZX6A 2RNAA 4DEYA 2GTOA 1VA7A 4JZ4A 4LUEA 1GCQC 2FPFA 2FO0A 2J06A 2D1XA 3VS0A 1GBQA 4J9BA 1WIEA 4OMPA 3I35A 2KEAA 3VRYA 5EC7A 1UTIA 1GFCA 1W6XA 3PE0A 2K9GA 2JT4A 1MV0B 2ED1A 1JU5C 1ZUKA 2ED0A 4RTYA 3U23A 1JQQA 4OMMA 1K9AA 3VS3A 2DL8A 2KT8A 1V1CA 2I0NA 4JPBW 5GJVB 2L3SA 2XMFA 1JXMA 2A36A 4CC2A 1NG2A 1K0SA 5I11A 2M51A 2D8JA 2DILA 1WXUA 2DBMA 1NM7A 2K7AA 3THKA 2ABLA 2EYZA 1CSKA 4F16A 1LCKA 1Z9QA 3ZL7C 2KYBA 2EYYA 4ESRA 3NMZC 1K0XA 1NYGA 3PVQA 2JS0A 1TG0A 2NUZA 1N5ZA 4RTUA 5IXFA 1BBZA 2O88A 3H0HA 5IHIA 2GTJA 4HXJA 2K3BA 1ARKA 1KSWA 4GLMA 5HCKA 1MUZA 1SPKA 1CKBA 2LX7A 2KBTA 2EW3A 2FPDA 2DL3A 2O2OA 4LNPA 1PWTA 2C0TA 2DL7A 4RTWA 2LQNA 3NPFA 1PNJA 2OJ2A 4AG1C 1M30A 2KRMA 1GFDA 2YSQA 3M0SA 1AWOA 2DX1A 4AFUC 3VS5A 1NYFA 2D8HA 1B07A 1Y57A 2OAWA 2B86A 1BU1A 1NEGA 2EYXA 1YNZA 1X6BA 1SSHA 5IH2A 4J9HA 2DNUA 2H8HA 1QKWA 2DBKA 2EGAA 4DEXA 4F17A 4LN2A 2RF0A 2JMAA 2RQWA 2CT3A 2RQUA 1AZEA 2K6DA 4K11A 2A28A 4J9EA 1AWXA 4Y92A 4IIMA 1H92A 2J05A 3M0UA 3I5RA 1BK2A 2VWFA 1WYXA 3JV3A 1FYNA 1QLYA 2X3XD 4HVWA 4J9DA 4KRTA 1KFZA 1SRMA 1RLPC 2FRWA 2EYWA 2ECZA 2FPEA 1KJWA 2GBQA 2KNBB 2PNIA 3EG3A 2AK5A 2EPDA 3KFVA 2LP5A 2FRYA 2KRNA 1PRMC 3UA6A 4J9FA 1IO6A 1GRIA 1X43A 1H3HA 4HCKA 1UE9A 2KXCA 1M3CA 2V1RA 1ZSGA 5L23A 2L3QA 2GNCA 1U3OA 1X2QA 4ORZA 1T3LA 2ENMA 1EFNA 1W70A 2MCNA 1OV3A 2VVKA 3M0RA 2YDLA 2KGTA
chains in the Genus database with same CATH superfamily
1YBYA 3G6EA 2FL7A 4MZTA 2QEXT 3JCMd 2HEQA 2RJDA 3OYNA 1YN8A 4R56A 1UUEA 2RHZA 3G71T 4CRIA 5KYNA 1X27A 2W10A 3CCQT 1WHLA 3X20B 4Y28E 2FHDA 4XQ3A 5KCHA 4NS5A 2RO0A 4HCZA 4E2FB 2EVRA 1MNDA 3AHUA 5FU7C 1VYUA 2GGRA 1S72A 3JCMV 2XU8A 2O31A 4F7UA 3EFRA 2DE0X 3G7ZA 2MK5A 5GANf 3E1SA 4CC7A 5GAOl 4M77F 1YIJQ 3HRSA 2MF2A 4HVVA 2JM8A 2DD4A 1VQNQ 4M7AB 2RM4A 2V8KA 2COZA 4JJDA 1VQ9T 3UATA 3NTIA 1SKUB 1M3BA 1QVFP 1J3TA 3TU4K 4RG8A 1D1BA 4M7AF 4BI8B 3GNGA 3OMGA 1OYXA 2HSPA 3PNWC 4PJOE 1QQJA 1ZA2B 4PNOA 3OYMA 1RLQC 2V8JA 2YT6A 3RESA 1TH7A 2J6KA 1N27A 2QTVA 3GF5A 1AZGB 1T0HA 4ZTFA 1I0CA 1SEMA 2DYBA 1JO8A 4LDXA 4DBHA 1LOJA 5KE3A 1WJQA 3RNJA 2KI7A 2RK1A 3UT1A 5A0LA 4WCIA 2YRCA 4MZPA 2V8IA 4PJOC 1WGSA 3OYYA 2IVWA 2HAXA 1WXBA 1TUDA 1NJIR 2NLUA 2D6FA 3M59A 3HTRA 2C0OA 1AHJB 1JBMA 3VYHB 3HKSA 2RHYA 2QK0A 2IIMA 1M90R 3LLRA 1WA7A 5CKHA 1Q86C 4ZNXA 3WVDB 2Y4XA 2LQ8A 2DLPA 1Q86U 3JCMg 1KQ1A 1I07A 5GMKj 3M55A 3OYGA 4OMNA 4C5EA 4Z02A 4M7DG 1K9MC 3OBYA 5CCAA 2HDAA 1VIFA 5LJ3f 1D1AA 4XU1A 5LJ3d 4C8QE 2PUOB 1FX7A 3L2WA 1ZSZB 2PVDB 2VXFA 4XU2A 3LH5A 1VQOA 2WACA 1M8MA 3HP9A 4BB7A 1GCQA 5GAOm 1TU0B 2HZYA 2MI6A 2JOYA 1MMGA 1SF9A 4A4FA 3MP1A 2CDTA 2KE9A 3DKMA 1OEBA 1D0ZA 2P4RA 3GOXA 2QYZA 2KMTA 2P0QA 5GANg 2JTEA 2J6OA 4KULA 1JXOA 1DJ7B 1YWPA 2LRQA 1R0CB 3GBQA 3UDCA 2DXUA 3H41A 3TSZA 5KYUA 4LXCA 1K76A 2RHXA 1U06A 1QKXA 1VQLQ 2F69A 4RCCA 3RIRA 5CVIA 3OYFA 4MDWA 2EBPA 1UHFA 2E64A 3ULRB 2VYTA 1WXTA 2RQRA 4C92A 4M7AE 1YJ9T 5GANe 5L8RE 4LD9K 3VS2A 1N6AA 1RUWA 3TQ7P 2VGMA 1VQ4Q 3V8JA 5GMKe 2K5IA 1WJSA 1R77A 2E6ZA 1KG1A 2CGHA 2AZVA 2J7IA 3REAB 3SWNA 3CD6T 4BE1A 3FLGA 1QP3A 1YIJA 5CK9A 4PLIA 3QO3A 2GQVA 2FG0A 4L5GA 2QQRA 1VQNA 2GFAA 3A8HB 1VYTA 5I22A 1W4SA 4M4ZA 5KYXA 3OY9A 3JB9J 3ME9A 2DAQA 2YLCA 5GAN2 2RNAA 2GTOA 3META 2FPFA 4M7AC 2FO0A 3PMIA 2D1XA 2K3XA 3MP6A 2QEXQ 1RAHB 3E9FA 4KGZB 3OYEA 3CMAT 1QVGP 2CKKA 2ED1A 3G71Q 1ZUKA 4J8OA 3QKJA 1MMNA 3U23A 1NPPA 4OMMA 3VS3A 1V1CA 1C1AA 4JPBW 5CQXA 4JUVA 1WHMA 4OB0B 3E9GA 1VQ6T 3S6WA 1G8XA 4L59A 2RJEA 3EFOA 1WXUA 4EMKA 2XICA 3P8HA 3THKA 1U8RA 2CZ0B 4X9DA 1F1BB 4C5GA 2WSEE 2KYBA 5LJ3g 1VQMT 4XU3A 1NYGA 1VQ9Q 3PVQA 3QSUA 1BIBA 2DXCA 1N5ZA 4QVCA 3CC7T 4JJNK 2LVMA 5HCKA 1U1SA 1WJRA 1MUZA 1Y96B 1QVFS 4XK8E 1M2VA 1D3BA 3E19A 4A4GA 3G4ST 2FPDA 2P0PA 4OF1A 2DL3A 1YI2T 2PVGB 5LJ3e 2A0FB 1M30A 2DX1A 3VS5A 5FU6C 1G3TA 2B86A 5A0GA 2RI3A 2LX9A 1VQ7T 2HD0A 4M75G 3DB3A 1PSFA 4DQ2A 5DY9A 4L6V5 1HXDA 1OU8A 1QW1A 2JMAA 2RQUA 3KBGA 2K6DA 2E6NA 1AWXA 3J80E 1ZSZC 2CP0A 4IIMA 1Q7YR 3GIBA 2RA2A 1X75C 2VWFA 1FYNA 2X3XD 4J9DA 2QG9B 4MZMA 1JRIA 1SRMA 2A7YA 4C8QG 2EYWA 2GBQA 1MMDA 1VOMA 3EG3A 3EGDB 4A4EA 4C92B 1OX9A 2AK5A 3RDVA 1YITT 3MJXA 3V8LA 2KRNA 3QG1A 1PRMC 4O6JA 1K73C 3UA6A 1K9MR 3E2UA 2P4TA 4BD3A 2L3RA 1VQLA 3M58A 1C6VX 4BDZA 1OX8A 2KXCA 3CCLT 3QYHB 2L3QA 2E10A 4M78A 2JTFA 1BI3A 1U3OA 4N0AC 1X2QA 2R58A 3CC4A 1T3LA 4GY5A 3ZBDA 1OV3A 3JCMW 3S3NA 2KGTA 3M53A 3EG1A 3LGFA 2QQSA 1B7TA 2B8AA 2L0AA 1VQ4A 2OTLT 2Y4YA 4OGEA 2KDSA 2KR3A 1CKAA 1QCOA 4JZ3A 3QDFA 9ATCB 1OPLA 3H6ZA 2MPXC 3OW2P 1PM3A 2CSQA 4M77A 3R6NA 1M3AA 1Q95G 2LMJA 1NJIU 2J6FA 4M77D 3HFNA 1KK7A 2CH4W 4KGVB 3EGUA 1SRLA 4JDSA 1AWJA 2BTTA 2CUBA 2QEXA 1M90U 2FZCB 3UA7A 3MPUB 4J9GA 1SG5A 5GAN3 3VS1A 2BZXA 4N4HA 2X35A 4RKUE 3G71A 2EIFA 5LJ5j 4J83A 4RTVA 3OYJA 3NTKA 3CCQA 2DO3A 4AG2C 4OGCA 5CQYA 2OAUA 3NHNA 1FXXA 1YJ9Q 1X69A 1XJWB 2KXDA 2EWNA 1AOJA 2YUNA 4J9CA 1WLPB 5DLQE 5FWCA 3CPWP 2KQWA 2DRKA 1RI9A 2JS2A 3VUZA 1PRLC 2DIGA 1UGVA 3OYIA 2ATCB 2YUOA 2KSSA 3OA6A 3CD6Q 4XU0A 2RQTA 4GLKA 1O75A 4A53A 1XQHA 2OI3A 1BB9A 3PIPA 1W1FA 1VQKT 1UGRB 2E5QA 1VQ9A 4DBQA 1QVGA 2D0NA 4QW2A 4E7ZA 3S3MA 4OMFB 3BY7A 4HKEA 2MIOA 2DVJA 2E5KA 3RBBB 2JUFA 4M75B 4OMOA 3VS6A 4OB3B 3M57A 3QWYA 4JS4A 4A54A 3CMAQ 4A63B 3V7SA 1IGQA 3VJPA 2M0OA 4M75F 1QVGS 1E6HA 4X9CA 3M4GA 2X4JA 3G1JA 2RH2A 4PLLA 1PHTA 2XDBA 4C8QB 1NEBA 1VYVA 2M02A 4B6MA 2RPNA 2V26A 2X3WD 2NUPA 1VQ6Q 2Z0WA 2AKKA 2BZ8A 2GQIA 2X4XA 1S1NA 3FJPA 4C92E 3QJ6A 1ZA1B 2O4XA 5KYWA 1G3SA 5FW9A 2ROLA 4C8QF 1MGQA 1HYOA 3M5AA 4PFOA 1BI2A 4XTXA 1YJWT 2I2LA 4C0DB 2QASA 2MWOA 1NLOC 4BY6B 2DEUA 4LUDA 1PKTA 1LJOA 1AT1B 4OMQA 3BFMA 3ZFJA 8ATCB 2HL3A 3FIFA 2F2XA 2HCKA 1HD3A 1NBEB 4OB2B 1WHHA 4F7UG 5KE2A 3G4SQ 5GJWB 5GANd 1YI2Q 2K79A 1FMWA 5GAMh 1WNLA 4ZGDB 2AZSA 3JRZA 1MV3A 3CBOA 5M9OA 4RTTA 1VUBA 1VQ7Q 5C0MA 1IRXA 2W0ZA 1K8AR 2PTKA 1K1ZA 2F5TX 4AFZC 2DM1A 4R0KA 1MNEA 2LQKA 2XKOC 3CC2T 2K5FA 2H3EB 2CP3A 4KGXB 4LD6A 1WX6A 2JZ2A 2X9HA 5AT1B 1JJ2P 1AWWA 1K73R 3HL8A 3SFMA 1R8OB 4E7IA 2KY9A 1QVPA 3CCST 2BKDN 1KC8R 2HMAA 1GBRA 3QYGB 2L3PA 2DERA 1ZBJA 1YITQ 4RTZA 3RKWA 4Z89A 1WHJA 4RMOA 3OQ5A 1WI7A 2M16A 2CP7A 2DK3A 3DLLA 3URGA 2QA4T 2M0YA 3T9NA 4EIKA 5D7UA 2FVUA 3CCLQ 1TUCA 1JB0E 3M0TA 1YP5A 2LCSA 1XOVA 3FB9A 2JM9A 4WF2A 1ZX6A 1YJ9A 3OW2A 2K5LA 3ER0A 2JNGA 2MWPA 1D0XA 4IUQA 2OTLQ 4XAXB 4OP0A 3CCRT 1YHQT 4DOWA 4FU6A 4J9BA 1Q7YC 1Q7YU 5EC7A 4M75E 1W6XA 3PE0A 1TUGB 3OYBA 1RAAB 1MV0B 3CD6A 1JU5C 2FYKA 2QQBA 2JN0A 1C0MA 4TVRA 2GFUA 5GANj 2BE7D 3KXTA 2COWA 2DD5A 2F5KA 2E41A 1QP2A 2L3SA 3V7CA 2A36A 4CC2A 1K0SA 1UGQB 5I11A 2M51A 3L2UA 2DILA 2CZ1B 4NL3A 1ACMB 5GAOn 1K9MU 2DBMA 3M54A 2HNIA 1QCNA 1WZOA 2K7AA 3CMAA 2CYZB 5A0DA 2AIRB 1B34A 4M75C 3ZL7C 2HKNA 1KD1C 5DLOA 4M7DA 2YRDA 4C0FA 3NMZC 3EH1A 2HBPA 3OBWA 3CPWA 1I81A 2AT1B 3O8VA 4M7DD 5KYYA 2O88A 3H0HA 4M78E 2HQXA 4HXJA 1VQ6A 1PC0A 4ZGEB 4GLMA 4C0ZA 2YXYA 3MEAA 3OSSC 1SPKA 2VV5A 4C8QC 1Q81C 2VC8A 2LX7A 2EFIA 2KBTA 3OS2A 1YFNA 3OYHA 4F7UB 2DL7A 5GMKi 3NPFA 2OJ2A 1BI1A 2KRMA 1R0BG 2YSQA 1WHGA 4JRPA 1VQMA 4E7LA 3WVEB 1VQKQ 2M9UA 2COYA 4IUVA 3CC4Q 5DM7R 1KQSP 2K2VA 3CC7A 4F7UF 4LDYA 5IH2A 2RD1A 4C92G 1G5VA 2DBKA 3OYDA 4J7FA 3JAME 4JS5A 1LPLA 2RQWA 4BY6C 4HA8A 4K11A 2A28A 4J9EA 4R55A 4Y92A 3FRNA 4KUIA 3OYAA 3G4SA 3CCMT 1YI2A 2EJGA 4KBMB 1RLPC 2FRWA 1XNIA 4QVDA 1VQ7A 3CEYA 1N9RA 1M9SA 3FDRA 2EPDA 2LP5A 2EJ9A 3QHSA 4FYYB 3LGLA 3LH0A 1EZZB 5LJ3j 1X6OA 3MO8A 4BI3A 1BYMA 1ZHIA 2GNCA 1BCMA 3JCMb 1VQPT 4ORZA 3RKYA 3CCQQ 1W70A 3BDLA 3PMTA 2VVKA 3M0RA 2YDLA 2OTJT 2WSFE 3S3OA 1PCXA 3NFCA 2O9SA 2XIDA 3O5ZA 2PUKB 3JCMh 1YITA 1IXDA 2RHUA 5IXBA 2YHTA 5GMKl 2NUTA 1KIKA 4FSSA 2YUPA 3GLXA 2EQIA 2DL4A 2K57A 2L5QA 1A0NB 1UG1A 2XHCA 2V1QA 1HJDA 2LC4A 2ROTA 3CCLA 1EIFA 1WDXA 3NTHA 4B9XA 2L89A 2FEIA 3L2RA 2NYSA 1YWOA 4RG2A 5HY6A 1SSFA 5CR2A 2RMOA 4PJOA 4PJNA 1TSFA 1JJ2A 1OPKA 2OTLA 2EKHA 1M27C 4PJOD 2XDPA 3CC2Q 4JLGA 4FT4A 3FEOA 4JJCA 2GCXA 3EG2A 5GAMf 5GAMd 4BE2A 2QAZA 5GMKh 5FWBA 3EGXA 4QVZA 4XTVA 2LJ0A 2R57A 2JVVA 4YTLA 1X2KA 3X24B 2DYIA 2JXBA 2VB6A 4QKUA 4Y91A 1WFWA 1G83A 1PD1A 1UGSB 4HCBA 3EG9A 2LZ6B 1IZ6A 3RKXA 4B9WA 2L8DA 2QA4Q 5KYUB 4V2SA 2JTMA 2RB6A 1B3QA 2SRCA 5I2MA 1GCPA 4F7UE 1Y0MA 3H9NA 1BI0A 2KROA 1K8AC 3HRTA 4PFPA 1K8AU 4OVAA 2PVOB 3SD4A 1VQ8T 3RUXA 3KUFA 4JRIA 3J81E 1NLPC 2R5AA 3CCRQ 1YHQQ 2QGFB 1PSEA 3ZEHA 5GAN7 2GF7A 3TVTA 3INZA 1VIEA 1K73U 3VYGA 3L2ZA 4C92F 1KC8C 2ZPFB 3SWNB 5IHNA 1T3SA 3M56A 4C8QD 4D8KA 3TSWA 2E12A 1KC8U 1ZBXA 5IN1A 1VQKA 4M78G 1D09B 1KD1R 3N5BB 5GAN5 1I1JA 4ZGJB 2CH4A 2MMPA 5KYXB 4C5HA 3RERA 4OMLA 4FYXB 2DZCA 3VS4A 5GMKm 2XK0A 4J6XA 1OZ2A 4N4GA 2BUDA 1GL5A 5GAN6 2DRMA 5J39A 1Q81R 4JRKA 2A08A 4BDYA 2DXTA 1AVZC 1WHKA 1I5OB 2AKLA 2C06A 1BIAA 3LWIA 3EG0A 4UC4A 5LJ3h 3ASKA 3CQTA 1M1GA 3EHRA 5KCOA 2ZPEB 4GBQA 2DJQA 1KQSA 3PIOA 3GP8A 1K4US 2A3LA 4M7AA 3EFOB 2VKNA 2JMCA 1YCYA 4EMKB 1UJ0A 4M7AD 1BCOA 4CI0C 1KHIA 4AFSC 4PJLA 1QMCA 2X4WA 1OQKA 1YJWA 2JW4A 2DF6A 3I55T 1M8VA 3SHWA 5GAMg 1RL2A 1IB8A 2ZPGB 3HPWA 1ZUUA 2HKQB 3FJ5A 2YUQA 2CSIA 5D6WA 4DBRA 1KQSS 2QI2A 1RADB 1YJNT 4E6RA 4D8DA 2A37A 4O5VA 4E7HA 3CCUT 2KT1A 3EHQA 1Q82R 1BKBA 3EH2A 2O01E 3I9QA 1KQ2A 2JJ9A 3CCET 1ABOA 3CCMQ 2EGCA 1M2VB 1D3BB 2YLBA 1UJYA 3LX7A 2BIVA 1O9SA 1E6GA 3MHXA 2ZCFB 2ESWA 3OSVA 2RN8A 4FM4B 5GAMe 1PD0A 4CC4B 3H0IA 1V76A 4ME7A 4P5NA 7AT1B 2E3HA 4ANJA 3CC2A 2P0KA 3JB9G 3CCJT 2LQWA 2CP5A 5IAYA 4LE9A 1ABQA 2EQMA 2DA9A 4F14A 3JB9H 3PT9A 1VQPQ 1WQ7A 2DJZA 3CXCA 3UF4A 2OTJQ 3CCSA 4DEYA 4LUEA 1GCQC 2H3JA 4LDVA 3VS0A 1UB4A 5EG2A 4OMPA 3CCVT 2KEAA 3QZ5B 1UTIA 1GFCA 4D6WA 2HQEA 3Q1JA 3TEEA 2G3RA 2CZ7B 3LWHA 1OULA 3HHTB 4RTYA 2QA4A 4FIBA 1JQQA 5FRNA 3QUIA 1VQMQ 1ZSZA 2I0NA 2X51A 1KHCA 5GJVB 4M78B 1OU9A 2XMFA 1JXMA 4HT9A 3CBMA 2E3IA 3CC7Q 3JCMf 1NG2A 2QQAA 4ATOA 2Y90A 1TS9A 3CCRA 1YHQA 2EKOA 1M1FA 4F16A 5FLXE 4M78F 1Z9QA 1GXIE 4C92C 2VGNA 2XI9A 4IUTA 2LTOA 3OS1A 2EYYA 1K0XA 3CMET 1VQ5T 2JS0A 4M77B 2NUZA 4ZN3A 3RR6A 1BBZA 3P8DA 4N0AA 3SWNC 3CPFA 1ARKA 1TWBA 4FCYA 2DVEA 1P92A 3PFSA 2LT4A 4ZN1A 1CKBA 4FSXA 5CKBA 2RHIA 2O2OA 4LNPA 2LQNA 4JLIA 1PNJA 5I21A 1GFDA 3M0SA 2IPOB 1AWOA 4AFUC 2XD0A 1NYFA 2D8HA 1B07A 2FB7A 1Y57A 2OAWA 1NEGA 2EYXA 2M1HA 1YNZA 1X6BA 1VQ8Q 2LNVA 4J9HA 2H8HA 1QKWA 3VU3C 2QDYB 3AT1B 4FL6A 4DEXA 4F17A 2ZPHB 5J3BA 5LJ5h 1W2BP 1AZEA 4PJMA 2LCLA 3L1AA 2J05A 3M0UA 3HFOA 1BK2A 1WYXA 3JV3A 2XDDA 1QLYA 4J6WA 1RAFB 3I56T 3JCMJ 4EDUA 5GAN8 1LNXA 2FPEA 2KAFA 4EMKC 1KJWA 2KNBB 1RAEB 3G6ET 2ZZDA 3QIIA 3KFVA 2QQ9A 4KH0B 3C4SA 4X34A 2E70A 5CKDA 4XTZA 1H3HA 1OI1A 2E1HA 3CCMA 1NPRA 5L23A 3JCMP 2R5MA 4E7KA 1EFNA 2MCNA 5J26A 3JB9I 3OW2S 1N9SA 4LDUA 3JB9F 4ELYC 3F70A 1WPYA 4HT8A 4AFQC 4IUPA 1S72T 3OYCA 4RUGA 3VS7A 3CBPA 5FU6B 1AEYA 2NUPB 3RMQA 1T0JA 1U5SA 2DFUA 1M2OA 3X26B 4A4HA 3BW1A 2O4XB 5KYWB 1N8RR 2DXBA 3JCMX 1KD1U 1VQPA 1PKSA 1UHCA 4JRQA 3I55Q 1OOTA 3RMSA 2OTJA 1Y96A 1UECA 1H3ZA 3J7AF 3LYIA 5HK3A 1M5Q1 2KRSA 5D6YA 3JCMQ 4IUUA 1YJNQ 3PVLA 1PG5B 4PL6A 3M0QA 1UGPB 3WXMB 3LW5E 5A2QE 3CCUQ 2EJFA 1Q81U 3CCEQ 3A8LB 2BZYA 3JCMe 1D0YA 3OB9A 3DB4A 1M1KR 3OS0A 1D1CA 3CPWS 1HK9A 2KVQG 1G2BA 1TTHB 4PKCC 4X1VA 5ECAA 4M77E 4RCBA 5CAIA 2MAMA 4C0DC 4J7IA 3HSBA 1X01A 1M4ZA 4M78C 2F2WA 3SB2A 1UEBA 3CCJQ 6AT1B 4A4KA 1RAGB 2LNHB 4AT1B 4BE0A 3SEMA 4HVUA 4MMKA 3A98A 4Z8AA 2DMOA 1ZUYA 3C0CA 3EGDA 4MMLA 3EAEA 2VUBA 3QXEB 1HSQA 2DETA 4C92D 2HBWA 4XTWA 1QWFA 3M0PA 1Q82C 4M77C 3OYKA 1Q82U 3CCVQ 2DPPB 2LCCA 4PK4A 5GAOp 3A1PA 2O9VA 1RAIB 4NL2A 1FMVA 3GNFB 1NZ9A 4NOYA 1QCFA 4JJBA 4C5IA 1V29B 3EFSA 2MOXA 1YJWQ 4C0GA 1IREB 1VQ8A 2KYMA 4BI4A 1UDLA 2LT1A 2SEMA 1VQOT 4MDXA 2QTXA 4E7JA 1EX4A 2RI2A 1Z9ZA 2NWMA 3CXCP 1NE8A 1E7OA 3BE3A 2CREA 4FT2A 3QZ9B 2E4HA 3CMEQ 2DL5A 1Y07A 1VQ5Q 5FRMA 2CUDA 1FMKA 1RABB 2K2MA 2D0QB 2HSEB 5KH6A 2RQVA 4IIOA 5I2SA 5HK0A 2VXEA 4XTYA 1QWEA 4ELZC 3MEUA 4PJOG 1IGUA 4BUGA 2PQWA 4EPCA 5IHKA 3I5SA 4II1A 2FZKB 1QVFA 5CKEA 3H8ZA 3R6OA 1AD5A 2QXFA 3QBYA 3VUBA 3VRZA 5GANh 3X28B 2QDLA 2BE9B 1X6GA 1B34B 1U1TA 2C0IA 4QT7A 3DLMA 2CT4A 3IQLA 1W2BA 2QGGA 1G3YA 5IT9E 4M7DB 2L2PA 3QJYA 3A8GB 3CCSQ 4FW2A 3HRUA 1JJ2S 1IHWA 2G6FX 5C6SA 3MEVA 1MHNA 2WSCE 2EQJA 5KYYB 3BDUA 5GAOr 3QWXX 2F2VA 2HQHA 2VASA 3PTAA 3REBB 4M7DF 1YIJT 4DOVA 3A8OB 3NGPA 1UFFA 2KK4A 3TREA 2LJ3A 3M9QA 1VQNT 1W2BS 1YCSB 2EGEA 3UWNA 1XTDA 3I56Q 1ZLMA 1JEGA 3UPUA 4M75A 1RI0A 4IKFA 1SHGA 3OYLA 4EMGA 3C95A 3I55A 3L2VA 3X25B 3G6EQ 4EMHA 4M75D 4Z88A 1I4K1 2PZ1A 2ZAEA 2ZPBB 3H0FA 5LJ5f 3MCAB 4E47A 5LJ5d 4FYWB 1TOVA 4DBFA 1H8KA 1YJNA 2DTOA 2PU9B 5CIUA 1I5LA 4RTXA 2CP2A 4CC3A 4J9IA 3CCUA 4IURA 2LJ1A 5GAOq 3CCEA 3D7SB 4WTOB 4C8QA 4QQ6A 2YRVA 5HKCA 2DZ9A 3OMCA 2X4YA 5FU7B 4OB1B 2D9TA 4FW1A 1Q86R 1G3WA 1SHFA 8AT1B 3PGGA 1Y7XA 1VA7A 4JZ4A 1IHVA 2J06A 2DKGA 1S72Q 1GBQA 2ZGWA 1WIEA 3I35A 3FC3A 1MMAA 3VRYA 3A5ZB 4Q5WA 3VKIA 2K9GA 3JCMc 2JT4A 3CCJA 5FROA 1TXQA 2RK2A 2ED0A 2IG0A 2K3YA 3MKDA 1K9AA 4M78D 5CO7A 2DL8A 2KT8A 3V8KA 4M77G 5GAMj 4PFZA 1RACB 2ZPIB 3MP8A 4N4IA 4LDWA 4AMCA 2D8JA 2RJCA 1NM7A 2HL5C 2LDMA 3CCVA 2ABLA 2EYZA 1CSKA 3GPLA 1LCKA 2OX7A 3QPHA 2DIQA 3A8MB 1ZQ1A 1NJIC 4PJJA 4M7AG 2NUTB 4XTUA 2CP6A 3P8BB 4ESRA 4KUDK 4HCCA 1WQWA 2P84A 1TG0A 4RTUA 5IXFA 3C94A 2EQKA 5IHIA 2GTJA 3V7RA 1M90C 2K3BA 1KSWA 2EQUA 3L2QA 4PJOB 3VV0A 2EW3A 1N8RC 5D6XA 1PWTA 2F1LA 1N8RU 2C0TA 4KH1B 4RTWA 4E7SA 4F04B 4AG1C 3JSCA 3L42A 4VUBA 3SDZA 2DTIA 4PJOF 3CMEA 1BU1A 1VQ5A 5CKFA 3EGXB 4DA4A 2RI5A 1SSHA 2DNUA 4M7DE 2XG8D 2EGAA 1FWZA 4LN2A 2RF0A 2YWWA 3QDRB 2DEQA 3C12A 2CT3A 4J6YA 2EAYA 1VQLT 5AYFA 1M1KC 5LL6S 1H92A 2K4YA 3M4YA 4BACA 1Y71A 1M1KU 3I5RA 3EG9B 4HVWA 3CC4T 4ZTJA 4KRTA 2DTHA 1KFZA 5LJ5g 3MEWA 2ECZA 2AHJB 2CS7A 2PNIA 1LVKA 2CZ6B 1VQ4T 4QQDA 2MYSA 2EYQA 2FRYA 1VQOQ 3JB9D 4M7DC 1I8FA 4J9FA 1IO6A 1GRIA 1X43A 4QQGA 4HCKA 2E65A 4FYVB 1UE9A 5GAN4 1H641 1M3CA 2V1RA 1ZSGA 2RJFA 4KT0E 1OZ3A 5LJ5e 2ENMA 3I56A 3CXCS 4J5YA 3TCJA 3OS5A 2FZGB
chains in the Genus database with same CATH topology
3EG1A 2L0AA 2O9SA 4AFQC 3O5ZA 2HEQA 4RUGA 3VS7A 2KR3A 1CKAA 5IXBA 1AEYA 4JZ3A 1YN8A 1KIKA 1T0JA 4FSSA 1OPLA 1U5SA 1UUEA 2YUPA 2EQIA 2DL4A 2CSQA 1A0NB 1UG1A 1X27A 2V1QA 1M3AA 3R6NA 1HJDA 2W10A 2ROTA 2LMJA 1WDXA 2J6FA 1PKSA 1UHCA 2CH4W 2FEIA 1YWOA 1OOTA 3EGUA 2RMOA 1UECA 1SRLA 2EVRA 2KRSA 1AWJA 2BTTA 1OPKA 1VYUA 2CUBA 2GGRA 2EKHA 1M27C 2O31A 3UA7A 4J9GA 3PVLA 2DE0X 3M0QA 4JJCA 4CC7A 3VS1A 2BZXA 3EG2A 2BZYA 4HVVA 2JM8A 5FWBA 4RTVA 4JJDA 2LJ0A 4AG2C 3UATA 1X2KA 1G2BA 3NHNA 1X69A 4X1VA 1M3BA 5ECAA 2KXDA 1J3TA 1AOJA 2JXBA 2YUNA 4J9CA 1WLPB 1WFWA 5FWCA 1G83A 2DRKA 1RI9A 2F2WA 2JS2A 1PRLC 2HSPA 1UGVA 2LZ6B 2YUOA 2LNHB 2RQTA 1RLQC 3SEMA 4HVUA 1B3QA 2OI3A 2SRCA 1BB9A 1GCPA 1W1FA 3A98A 4Z8AA 2DMOA 1Y0MA 1ZUYA 2YT6A 3C0CA 2KROA 2J6KA 2D0NA 1AZGB 1HSQA 1T0HA 2HBWA 2MIOA 2DVJA 1I0CA 2E5KA 3RBBB 1SEMA 1NLPC 4OMOA 1QWFA 3VS6A 3M0PA 2DYBA 3QWYA 1JO8A 3RNJA 4A63B 3TVTA 4WCIA 2O9VA 1QCFA 1E6HA 4JJBA 5IHNA 1T3SA 4D8KA 3TSWA 1WXBA 1TUDA 2MOXA 1PHTA 1NEBA 1VYVA 1I1JA 2RPNA 2X3WD 2CH4A 2KYMA 1UDLA 2AKKA 2BZ8A 2C0OA 2GQIA 2SEMA 4OMLA 1S1NA 3VS4A 2IIMA 5FW9A 2ROLA 1GL5A 1Z9ZA 2NWMA 1WA7A 1E7OA 2CREA 4ZNXA 2DRMA 2DLPA 2A08A 2DL5A 1AVZC 1I07A 2AKLA 2CUDA 1FMKA 2K2MA 4OMNA 1NLOC 2RQVA 4IIOA 4LUDA 1PKTA 2HDAA 3EG0A 1QWEA 3CQTA 4OMQA 3EHRA 4GBQA 3LH5A 2F2XA 2HCKA 5IHKA 2DJQA 1HD3A 3I5SA 1M8MA 1K4US 1GCQA 1AD5A 5GJWB 2VKNA 3VRZA 2JMCA 2K79A 1UJ0A 2CDTA 2KE9A 2QDLA 4AFSC 1X6GA 2C0IA 4QT7A 2AZSA 1OEBA 2CT4A 3IQLA 2P4RA 1MV3A 2JW4A 2DF6A 4RTTA 2JTEA 2L2PA 3SHWA 2J6OA 2W0ZA 2G6FX 2PTKA 1JXOA 1ZUUA 1K1ZA 1YWPA 2YUQA 3FJ5A 2CSIA 4AFZC 3GBQA 2DM1A 4R0KA 4E6RA 4D8DA 2A37A 3H41A 3QWXX 3TSZA 2F2VA 1K76A 1U06A 1QKXA 3REBB 2KT1A 3EHQA 3I9QA 1WX6A 1ABOA 1UFFA 3NGPA 2EGCA 2LJ3A 1UJYA 1AWWA 2EBPA 1UHFA 1YCSB 3ULRB 2EGEA 1ZLMA 1JEGA 1E6GA 1WXTA 1SHGA 2RQRA 2ESWA 2RN8A 1GBRA 3VS2A 1RUWA 2L3PA 4CC4B 4Z88A 3H0IA 1ZBJA 2PZ1A 4RTZA 3H0FA 4Z89A 1H8KA 2AZVA 4RTXA 2J7IA 4CC3A 1WI7A 3REAB 2LQWA 4J9IA 2LJ1A 2M0YA 4LE9A 1ABQA 4EIKA 2DA9A 4F14A 2FG0A 1TUCA 3M0TA 1YP5A 1VYTA 2LCSA 5I22A 4M4ZA 3UF4A 1XOVA 1SHFA 2JM9A 1ZX6A 2RNAA 4DEYA 2GTOA 1VA7A 4JZ4A 4LUEA 1GCQC 2FPFA 2FO0A 2J06A 2D1XA 3VS0A 1GBQA 4J9BA 1WIEA 4OMPA 3I35A 2KEAA 3VRYA 5EC7A 1UTIA 1GFCA 1W6XA 3PE0A 2K9GA 2JT4A 1MV0B 2ED1A 1JU5C 1ZUKA 2ED0A 4RTYA 3U23A 1JQQA 4OMMA 1K9AA 3VS3A 2DL8A 2KT8A 1V1CA 2I0NA 4JPBW 5GJVB 2L3SA 2XMFA 1JXMA 2A36A 4CC2A 1NG2A 1K0SA 5I11A 2M51A 2D8JA 2DILA 1WXUA 2DBMA 1NM7A 2K7AA 3THKA 2ABLA 2EYZA 1CSKA 4F16A 1LCKA 1Z9QA 3ZL7C 2KYBA 2EYYA 4ESRA 3NMZC 1K0XA 1NYGA 3PVQA 2JS0A 1TG0A 2NUZA 1N5ZA 4RTUA 5IXFA 1BBZA 2O88A 3H0HA 5IHIA 2GTJA 4HXJA 2K3BA 1ARKA 1KSWA 4GLMA 5HCKA 1MUZA 1SPKA 1CKBA 2LX7A 2KBTA 2EW3A 2FPDA 2DL3A 2O2OA 4LNPA 1PWTA 2C0TA 2DL7A 4RTWA 2LQNA 3NPFA 1PNJA 2OJ2A 4AG1C 1M30A 2KRMA 1GFDA 2YSQA 3M0SA 1AWOA 2DX1A 4AFUC 3VS5A 1NYFA 2D8HA 1B07A 1Y57A 2OAWA 2B86A 1BU1A 1NEGA 2EYXA 1YNZA 1X6BA 1SSHA 5IH2A 4J9HA 2DNUA 2H8HA 1QKWA 2DBKA 2EGAA 4DEXA 4F17A 4LN2A 2RF0A 2JMAA 2RQWA 2CT3A 2RQUA 1AZEA 2K6DA 4K11A 2A28A 4J9EA 1AWXA 4Y92A 4IIMA 1H92A 2J05A 3M0UA 3I5RA 1BK2A 2VWFA 1WYXA 3JV3A 1FYNA 1QLYA 2X3XD 4HVWA 4J9DA 4KRTA 1KFZA 1SRMA 1RLPC 2FRWA 2EYWA 2ECZA 2FPEA 1KJWA 2GBQA 2KNBB 2PNIA 3EG3A 2AK5A 2EPDA 3KFVA 2LP5A 2FRYA 2KRNA 1PRMC 3UA6A 4J9FA 1IO6A 1GRIA 1X43A 1H3HA 4HCKA 1UE9A 2KXCA 1M3CA 2V1RA 1ZSGA 5L23A 2L3QA 2GNCA 1U3OA 1X2QA 4ORZA 1T3LA 2ENMA 1EFNA 1W70A 2MCNA 1OV3A 2VVKA 3M0RA 2YDLA 2KGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG1 A;  2L0A A;  2O9S A;  4AFQ C;  3O5Z A;  2HEQ A;  4RUG A;  3VS7 A;  2KR3 A;  1CKA A;  5IXB A;  1AEY A;  4JZ3 A;  1YN8 A;  1KIK A;  1T0J A;  4FSS A;  1OPL A;  1U5S A;  1UUE A;  2YUP A;  2EQI A;  2DL4 A;  2CSQ A;  1A0N B;  1UG1 A;  1X27 A;  2V1Q A;  1M3A A;  3R6N A;  1HJD A;  2W10 A;  2ROT A;  2LMJ A;  1WDX A;  2J6F A;  1PKS A;  1UHC A;  2CH4 W;  2FEI A;  1YWO A;  1OOT A;  3EGU A;  2RMO A;  1UEC A;  1SRL A;  2EVR A;  2KRS A;  1AWJ A;  2BTT A;  1OPK A;  1VYU A;  2CUB A;  2GGR A;  2EKH A;  1M27 C;  2O31 A;  3UA7 A;  4J9G A;  3PVL A;  2DE0 X;  3M0Q A;  4JJC A;  4CC7 A;  3VS1 A;  2BZX A;  3EG2 A;  2BZY A;  4HVV A;  2JM8 A;  5FWB A;  4RTV A;  4JJD A;  2LJ0 A;  4AG2 C;  3UAT A;  1X2K A;  1G2B A;  3NHN A;  1X69 A;  4X1V A;  1M3B A;  5ECA A;  2KXD A;  1J3T A;  1AOJ A;  2JXB A;  2YUN A;  4J9C A;  1WLP B;  1WFW A;  5FWC A;  1G83 A;  2DRK A;  1RI9 A;  2F2W A;  2JS2 A;  1PRL C;  2HSP A;  1UGV A;  2LZ6 B;  2YUO A;  2LNH B;  2RQT A;  1RLQ C;  3SEM A;  4HVU A;  1B3Q A;  2OI3 A;  2SRC A;  1BB9 A;  1GCP A;  1W1F A;  3A98 A;  4Z8A A;  2DMO A;  1Y0M A;  1ZUY A;  2YT6 A;  3C0C A;  2KRO A;  2J6K A;  2D0N A;  1AZG B;  1HSQ A;  1T0H A;  2HBW A;  2MIO A;  2DVJ A;  1I0C A;  2E5K A;  3RBB B;  1SEM A;  1NLP C;  4OMO A;  1QWF A;  3VS6 A;  3M0P A;  2DYB A;  3QWY A;  1JO8 A;  3RNJ A;  4A63 B;  3TVT A;  4WCI A;  2O9V A;  1QCF A;  1E6H A;  4JJB A;  5IHN A;  1T3S A;  4D8K A;  3TSW A;  1WXB A;  1TUD A;  2MOX A;  1PHT A;  1NEB A;  1VYV A;  1I1J A;  2RPN A;  2X3W D;  2CH4 A;  2KYM A;  1UDL A;  2AKK A;  2BZ8 A;  2C0O A;  2GQI A;  2SEM A;  4OML A;  1S1N A;  3VS4 A;  2IIM A;  5FW9 A;  2ROL A;  1GL5 A;  1Z9Z A;  2NWM A;  1WA7 A;  1E7O A;  2CRE A;  4ZNX A;  2DRM A;  2DLP A;  2A08 A;  2DL5 A;  1AVZ C;  1I07 A;  2AKL A;  2CUD A;  1FMK A;  2K2M A;  4OMN A;  1NLO C;  2RQV A;  4IIO A;  4LUD A;  1PKT A;  2HDA A;  3EG0 A;  1QWE A;  3CQT A;  4OMQ A;  3EHR A;  4GBQ A;  3LH5 A;  2F2X A;  2HCK A;  5IHK A;  2DJQ A;  1HD3 A;  3I5S A;  1M8M A;  1K4U S;  1GCQ A;  1AD5 A;  5GJW B;  2VKN A;  3VRZ A;  2JMC A;  2K79 A;  1UJ0 A;  2CDT A;  2KE9 A;  2QDL A;  4AFS C;  1X6G A;  2C0I A;  4QT7 A;  2AZS A;  1OEB A;  2CT4 A;  3IQL A;  2P4R A;  1MV3 A;  2JW4 A;  2DF6 A;  4RTT A;  2JTE A;  2L2P A;  3SHW A;  2J6O A;  2W0Z A;  2G6F X;  2PTK A;  1JXO A;  1ZUU A;  1K1Z A;  1YWP A;  2YUQ A;  3FJ5 A;  2CSI A;  4AFZ C;  3GBQ A;  2DM1 A;  4R0K A;  4E6R A;  4D8D A;  2A37 A;  3H41 A;  3QWX X;  3TSZ A;  2F2V A;  1K76 A;  1U06 A;  1QKX A;  3REB B;  2KT1 A;  3EHQ A;  3I9Q A;  1WX6 A;  1ABO A;  1UFF A;  3NGP A;  2EGC A;  2LJ3 A;  1UJY A;  1AWW A;  2EBP A;  1UHF A;  1YCS B;  3ULR B;  2EGE A;  1ZLM A;  1JEG A;  1E6G A;  1WXT A;  1SHG A;  2RQR A;  2ESW A;  2RN8 A;  1GBR A;  3VS2 A;  1RUW A;  2L3P A;  4CC4 B;  4Z88 A;  3H0I A;  1ZBJ A;  2PZ1 A;  4RTZ A;  3H0F A;  4Z89 A;  1H8K A;  2AZV A;  4RTX A;  2J7I A;  4CC3 A;  1WI7 A;  3REA B;  2LQW A;  4J9I A;  2LJ1 A;  2M0Y A;  4LE9 A;  1ABQ A;  4EIK A;  2DA9 A;  4F14 A;  2FG0 A;  1TUC A;  3M0T A;  1YP5 A;  1VYT A;  2LCS A;  5I22 A;  4M4Z A;  3UF4 A;  1XOV A;  1SHF A;  2JM9 A;  1ZX6 A;  2RNA A;  4DEY A;  2GTO A;  1VA7 A;  4JZ4 A;  4LUE A;  1GCQ C;  2FPF A;  2FO0 A;  2J06 A;  2D1X A;  3VS0 A;  1GBQ A;  4J9B A;  1WIE A;  4OMP A;  3I35 A;  2KEA A;  3VRY A;  5EC7 A;  1UTI A;  1GFC A;  1W6X A;  3PE0 A;  2K9G A;  2JT4 A;  1MV0 B;  2ED1 A;  1JU5 C;  1ZUK A;  2ED0 A;  4RTY A;  3U23 A;  1JQQ A;  4OMM A;  1K9A A;  3VS3 A;  2DL8 A;  2KT8 A;  1V1C A;  2I0N A;  4JPB W;  5GJV B;  2L3S A;  2XMF A;  1JXM A;  2A36 A;  4CC2 A;  1NG2 A;  1K0S A;  5I11 A;  2M51 A;  2D8J A;  2DIL A;  1WXU A;  2DBM A;  1NM7 A;  2K7A A;  3THK A;  2ABL A;  2EYZ A;  1CSK A;  4F16 A;  1LCK A;  1Z9Q A;  3ZL7 C;  2KYB A;  2EYY A;  4ESR A;  3NMZ C;  1K0X A;  1NYG A;  3PVQ A;  2JS0 A;  1TG0 A;  2NUZ A;  1N5Z A;  4RTU A;  5IXF A;  1BBZ A;  2O88 A;  3H0H A;  5IHI A;  2GTJ A;  4HXJ A;  2K3B A;  1ARK A;  1KSW A;  4GLM A;  5HCK A;  1MUZ A;  1SPK A;  1CKB A;  2LX7 A;  2KBT A;  2EW3 A;  2FPD A;  2DL3 A;  2O2O A;  4LNP A;  1PWT A;  2C0T A;  2DL7 A;  4RTW A;  2LQN A;  3NPF A;  1PNJ A;  2OJ2 A;  4AG1 C;  1M30 A;  2KRM A;  1GFD A;  2YSQ A;  3M0S A;  1AWO A;  2DX1 A;  4AFU C;  3VS5 A;  1NYF A;  2D8H A;  1B07 A;  1Y57 A;  2OAW A;  2B86 A;  1BU1 A;  1NEG A;  2EYX A;  1YNZ A;  1X6B A;  1SSH A;  5IH2 A;  4J9H A;  2DNU A;  2H8H A;  1QKW A;  2DBK A;  2EGA A;  4DEX A;  4F17 A;  4LN2 A;  2RF0 A;  2JMA A;  2RQW A;  2CT3 A;  2RQU A;  1AZE A;  2K6D A;  4K11 A;  2A28 A;  4J9E A;  1AWX A;  4Y92 A;  4IIM A;  1H92 A;  2J05 A;  3M0U A;  3I5R A;  1BK2 A;  2VWF A;  1WYX A;  3JV3 A;  1FYN A;  1QLY A;  2X3X D;  4HVW A;  4J9D A;  4KRT A;  1KFZ A;  1SRM A;  1RLP C;  2FRW A;  2EYW A;  2ECZ A;  2FPE A;  1KJW A;  2GBQ A;  2KNB B;  2PNI A;  3EG3 A;  2AK5 A;  2EPD A;  3KFV A;  2LP5 A;  2FRY A;  2KRN A;  1PRM C;  3UA6 A;  4J9F A;  1IO6 A;  1GRI A;  1X43 A;  1H3H A;  4HCK A;  1UE9 A;  2KXC A;  1M3C A;  2V1R A;  1ZSG A;  5L23 A;  2L3Q A;  2GNC A;  1U3O A;  1X2Q A;  4ORZ A;  1T3L A;  2ENM A;  1EFN A;  1W70 A;  2MCN A;  1OV3 A;  2VVK A;  3M0R A;  2YDL A;  2KGT A; 
#chains in the Genus database with same CATH topology
 1YBY A;  3G6E A;  2FL7 A;  4MZT A;  2QEX T;  3JCM d;  2HEQ A;  2RJD A;  3OYN A;  1YN8 A;  4R56 A;  1UUE A;  2RHZ A;  3G71 T;  4CRI A;  5KYN A;  1X27 A;  2W10 A;  3CCQ T;  1WHL A;  3X20 B;  4Y28 E;  2FHD A;  4XQ3 A;  5KCH A;  4NS5 A;  2RO0 A;  4HCZ A;  4E2F B;  2EVR A;  1MND A;  3AHU A;  5FU7 C;  1VYU A;  2GGR A;  1S72 A;  3JCM V;  2XU8 A;  2O31 A;  4F7U A;  3EFR A;  2DE0 X;  3G7Z A;  2MK5 A;  5GAN f;  3E1S A;  4CC7 A;  5GAO l;  4M77 F;  1YIJ Q;  3HRS A;  2MF2 A;  4HVV A;  2JM8 A;  2DD4 A;  1VQN Q;  4M7A B;  2RM4 A;  2V8K A;  2COZ A;  4JJD A;  1VQ9 T;  3UAT A;  3NTI A;  1SKU B;  1M3B A;  1QVF P;  1J3T A;  3TU4 K;  4RG8 A;  1D1B A;  4M7A F;  4BI8 B;  3GNG A;  3OMG A;  1OYX A;  2HSP A;  3PNW C;  4PJO E;  1QQJ A;  1ZA2 B;  4PNO A;  3OYM A;  1RLQ C;  2V8J A;  2YT6 A;  3RES A;  1TH7 A;  2J6K A;  1N27 A;  2QTV A;  3GF5 A;  1AZG B;  1T0H A;  4ZTF A;  1I0C A;  1SEM A;  2DYB A;  1JO8 A;  4LDX A;  4DBH A;  1LOJ A;  5KE3 A;  1WJQ A;  3RNJ A;  2KI7 A;  2RK1 A;  3UT1 A;  5A0L A;  4WCI A;  2YRC A;  4MZP A;  2V8I A;  4PJO C;  1WGS A;  3OYY A;  2IVW A;  2HAX A;  1WXB A;  1TUD A;  1NJI R;  2NLU A;  2D6F A;  3M59 A;  3HTR A;  2C0O A;  1AHJ B;  1JBM A;  3VYH B;  3HKS A;  2RHY A;  2QK0 A;  2IIM A;  1M90 R;  3LLR A;  1WA7 A;  5CKH A;  1Q86 C;  4ZNX A;  3WVD B;  2Y4X A;  2LQ8 A;  2DLP A;  1Q86 U;  3JCM g;  1KQ1 A;  1I07 A;  5GMK j;  3M55 A;  3OYG A;  4OMN A;  4C5E A;  4Z02 A;  4M7D G;  1K9M C;  3OBY A;  5CCA A;  2HDA A;  1VIF A;  5LJ3 f;  1D1A A;  4XU1 A;  5LJ3 d;  4C8Q E;  2PUO B;  1FX7 A;  3L2W A;  1ZSZ B;  2PVD B;  2VXF A;  4XU2 A;  3LH5 A;  1VQO A;  2WAC A;  1M8M A;  3HP9 A;  4BB7 A;  1GCQ A;  5GAO m;  1TU0 B;  2HZY A;  2MI6 A;  2JOY A;  1MMG A;  1SF9 A;  4A4F A;  3MP1 A;  2CDT A;  2KE9 A;  3DKM A;  1OEB A;  1D0Z A;  2P4R A;  3GOX A;  2QYZ A;  2KMT A;  2P0Q A;  5GAN g;  2JTE A;  2J6O A;  4KUL A;  1JXO A;  1DJ7 B;  1YWP A;  2LRQ A;  1R0C B;  3GBQ A;  3UDC A;  2DXU A;  3H41 A;  3TSZ A;  5KYU A;  4LXC A;  1K76 A;  2RHX A;  1U06 A;  1QKX A;  1VQL Q;  2F69 A;  4RCC A;  3RIR A;  5CVI A;  3OYF A;  4MDW A;  2EBP A;  1UHF A;  2E64 A;  3ULR B;  2VYT A;  1WXT A;  2RQR A;  4C92 A;  4M7A E;  1YJ9 T;  5GAN e;  5L8R E;  4LD9 K;  3VS2 A;  1N6A A;  1RUW A;  3TQ7 P;  2VGM A;  1VQ4 Q;  3V8J A;  5GMK e;  2K5I A;  1WJS A;  1R77 A;  2E6Z A;  1KG1 A;  2CGH A;  2AZV A;  2J7I A;  3REA B;  3SWN A;  3CD6 T;  4BE1 A;  3FLG A;  1QP3 A;  1YIJ A;  5CK9 A;  4PLI A;  3QO3 A;  2GQV A;  2FG0 A;  4L5G A;  2QQR A;  1VQN A;  2GFA A;  3A8H B;  1VYT A;  5I22 A;  1W4S A;  4M4Z A;  5KYX A;  3OY9 A;  3JB9 J;  3ME9 A;  2DAQ A;  2YLC A;  5GAN 2;  2RNA A;  2GTO A;  3MET A;  2FPF A;  4M7A C;  2FO0 A;  3PMI A;  2D1X A;  2K3X A;  3MP6 A;  2QEX Q;  1RAH B;  3E9F A;  4KGZ B;  3OYE A;  3CMA T;  1QVG P;  2CKK A;  2ED1 A;  3G71 Q;  1ZUK A;  4J8O A;  3QKJ A;  1MMN A;  3U23 A;  1NPP A;  4OMM A;  3VS3 A;  1V1C A;  1C1A A;  4JPB W;  5CQX A;  4JUV A;  1WHM A;  4OB0 B;  3E9G A;  1VQ6 T;  3S6W A;  1G8X A;  4L59 A;  2RJE A;  3EFO A;  1WXU A;  4EMK A;  2XIC A;  3P8H A;  3THK A;  1U8R A;  2CZ0 B;  4X9D A;  1F1B B;  4C5G A;  2WSE E;  2KYB A;  5LJ3 g;  1VQM T;  4XU3 A;  1NYG A;  1VQ9 Q;  3PVQ A;  3QSU A;  1BIB A;  2DXC A;  1N5Z A;  4QVC A;  3CC7 T;  4JJN K;  2LVM A;  5HCK A;  1U1S A;  1WJR A;  1MUZ A;  1Y96 B;  1QVF S;  4XK8 E;  1M2V A;  1D3B A;  3E19 A;  4A4G A;  3G4S T;  2FPD A;  2P0P A;  4OF1 A;  2DL3 A;  1YI2 T;  2PVG B;  5LJ3 e;  2A0F B;  1M30 A;  2DX1 A;  3VS5 A;  5FU6 C;  1G3T A;  2B86 A;  5A0G A;  2RI3 A;  2LX9 A;  1VQ7 T;  2HD0 A;  4M75 G;  3DB3 A;  1PSF A;  4DQ2 A;  5DY9 A;  4L6V 5;  1HXD A;  1OU8 A;  1QW1 A;  2JMA A;  2RQU A;  3KBG A;  2K6D A;  2E6N A;  1AWX A;  3J80 E;  1ZSZ C;  2CP0 A;  4IIM A;  1Q7Y R;  3GIB A;  2RA2 A;  1X75 C;  2VWF A;  1FYN A;  2X3X D;  4J9D A;  2QG9 B;  4MZM A;  1JRI A;  1SRM A;  2A7Y A;  4C8Q G;  2EYW A;  2GBQ A;  1MMD A;  1VOM A;  3EG3 A;  3EGD B;  4A4E A;  4C92 B;  1OX9 A;  2AK5 A;  3RDV A;  1YIT T;  3MJX A;  3V8L A;  2KRN A;  3QG1 A;  1PRM C;  4O6J A;  1K73 C;  3UA6 A;  1K9M R;  3E2U A;  2P4T A;  4BD3 A;  2L3R A;  1VQL A;  3M58 A;  1C6V X;  4BDZ A;  1OX8 A;  2KXC A;  3CCL T;  3QYH B;  2L3Q A;  2E10 A;  4M78 A;  2JTF A;  1BI3 A;  1U3O A;  4N0A C;  1X2Q A;  2R58 A;  3CC4 A;  1T3L A;  4GY5 A;  3ZBD A;  1OV3 A;  3JCM W;  3S3N A;  2KGT A;  3M53 A;  3EG1 A;  3LGF A;  2QQS A;  1B7T A;  2B8A A;  2L0A A;  1VQ4 A;  2OTL T;  2Y4Y A;  4OGE A;  2KDS A;  2KR3 A;  1CKA A;  1QCO A;  4JZ3 A;  3QDF A;  9ATC B;  1OPL A;  3H6Z A;  2MPX C;  3OW2 P;  1PM3 A;  2CSQ A;  4M77 A;  3R6N A;  1M3A A;  1Q95 G;  2LMJ A;  1NJI U;  2J6F A;  4M77 D;  3HFN A;  1KK7 A;  2CH4 W;  4KGV B;  3EGU A;  1SRL A;  4JDS A;  1AWJ A;  2BTT A;  2CUB A;  2QEX A;  1M90 U;  2FZC B;  3UA7 A;  3MPU B;  4J9G A;  1SG5 A;  5GAN 3;  3VS1 A;  2BZX A;  4N4H A;  2X35 A;  4RKU E;  3G71 A;  2EIF A;  5LJ5 j;  4J83 A;  4RTV A;  3OYJ A;  3NTK A;  3CCQ A;  2DO3 A;  4AG2 C;  4OGC A;  5CQY A;  2OAU A;  3NHN A;  1FXX A;  1YJ9 Q;  1X69 A;  1XJW B;  2KXD A;  2EWN A;  1AOJ A;  2YUN A;  4J9C A;  1WLP B;  5DLQ E;  5FWC A;  3CPW P;  2KQW A;  2DRK A;  1RI9 A;  2JS2 A;  3VUZ A;  1PRL C;  2DIG A;  1UGV A;  3OYI A;  2ATC B;  2YUO A;  2KSS A;  3OA6 A;  3CD6 Q;  4XU0 A;  2RQT A;  4GLK A;  1O75 A;  4A53 A;  1XQH A;  2OI3 A;  1BB9 A;  3PIP A;  1W1F A;  1VQK T;  1UGR B;  2E5Q A;  1VQ9 A;  4DBQ A;  1QVG A;  2D0N A;  4QW2 A;  4E7Z A;  3S3M A;  4OMF B;  3BY7 A;  4HKE A;  2MIO A;  2DVJ A;  2E5K A;  3RBB B;  2JUF A;  4M75 B;  4OMO A;  3VS6 A;  4OB3 B;  3M57 A;  3QWY A;  4JS4 A;  4A54 A;  3CMA Q;  4A63 B;  3V7S A;  1IGQ A;  3VJP A;  2M0O A;  4M75 F;  1QVG S;  1E6H A;  4X9C A;  3M4G A;  2X4J A;  3G1J A;  2RH2 A;  4PLL A;  1PHT A;  2XDB A;  4C8Q B;  1NEB A;  1VYV A;  2M02 A;  4B6M A;  2RPN A;  2V26 A;  2X3W D;  2NUP A;  1VQ6 Q;  2Z0W A;  2AKK A;  2BZ8 A;  2GQI A;  2X4X A;  1S1N A;  3FJP A;  4C92 E;  3QJ6 A;  1ZA1 B;  2O4X A;  5KYW A;  1G3S A;  5FW9 A;  2ROL A;  4C8Q F;  1MGQ A;  1HYO A;  3M5A A;  4PFO A;  1BI2 A;  4XTX A;  1YJW T;  2I2L A;  4C0D B;  2QAS A;  2MWO A;  1NLO C;  4BY6 B;  2DEU A;  4LUD A;  1PKT A;  1LJO A;  1AT1 B;  4OMQ A;  3BFM A;  3ZFJ A;  8ATC B;  2HL3 A;  3FIF A;  2F2X A;  2HCK A;  1HD3 A;  1NBE B;  4OB2 B;  1WHH A;  4F7U G;  5KE2 A;  3G4S Q;  5GJW B;  5GAN d;  1YI2 Q;  2K79 A;  1FMW A;  5GAM h;  1WNL A;  4ZGD B;  2AZS A;  3JRZ A;  1MV3 A;  3CBO A;  5M9O A;  4RTT A;  1VUB A;  1VQ7 Q;  5C0M A;  1IRX A;  2W0Z A;  1K8A R;  2PTK A;  1K1Z A;  2F5T X;  4AFZ C;  2DM1 A;  4R0K A;  1MNE A;  2LQK A;  2XKO C;  3CC2 T;  2K5F A;  2H3E B;  2CP3 A;  4KGX B;  4LD6 A;  1WX6 A;  2JZ2 A;  2X9H A;  5AT1 B;  1JJ2 P;  1AWW A;  1K73 R;  3HL8 A;  3SFM A;  1R8O B;  4E7I A;  2KY9 A;  1QVP A;  3CCS T;  2BKD N;  1KC8 R;  2HMA A;  1GBR A;  3QYG B;  2L3P A;  2DER A;  1ZBJ A;  1YIT Q;  4RTZ A;  3RKW A;  4Z89 A;  1WHJ A;  4RMO A;  3OQ5 A;  1WI7 A;  2M16 A;  2CP7 A;  2DK3 A;  3DLL A;  3URG A;  2QA4 T;  2M0Y A;  3T9N A;  4EIK A;  5D7U A;  2FVU A;  3CCL Q;  1TUC A;  1JB0 E;  3M0T A;  1YP5 A;  2LCS A;  1XOV A;  3FB9 A;  2JM9 A;  4WF2 A;  1ZX6 A;  1YJ9 A;  3OW2 A;  2K5L A;  3ER0 A;  2JNG A;  2MWP A;  1D0X A;  4IUQ A;  2OTL Q;  4XAX B;  4OP0 A;  3CCR T;  1YHQ T;  4DOW A;  4FU6 A;  4J9B A;  1Q7Y C;  1Q7Y U;  5EC7 A;  4M75 E;  1W6X A;  3PE0 A;  1TUG B;  3OYB A;  1RAA B;  1MV0 B;  3CD6 A;  1JU5 C;  2FYK A;  2QQB A;  2JN0 A;  1C0M A;  4TVR A;  2GFU A;  5GAN j;  2BE7 D;  3KXT A;  2COW A;  2DD5 A;  2F5K A;  2E41 A;  1QP2 A;  2L3S A;  3V7C A;  2A36 A;  4CC2 A;  1K0S A;  1UGQ B;  5I11 A;  2M51 A;  3L2U A;  2DIL A;  2CZ1 B;  4NL3 A;  1ACM B;  5GAO n;  1K9M U;  2DBM A;  3M54 A;  2HNI A;  1QCN A;  1WZO A;  2K7A A;  3CMA A;  2CYZ B;  5A0D A;  2AIR B;  1B34 A;  4M75 C;  3ZL7 C;  2HKN A;  1KD1 C;  5DLO A;  4M7D A;  2YRD A;  4C0F A;  3NMZ C;  3EH1 A;  2HBP A;  3OBW A;  3CPW A;  1I81 A;  2AT1 B;  3O8V A;  4M7D D;  5KYY A;  2O88 A;  3H0H A;  4M78 E;  2HQX A;  4HXJ A;  1VQ6 A;  1PC0 A;  4ZGE B;  4GLM A;  4C0Z A;  2YXY A;  3MEA A;  3OSS C;  1SPK A;  2VV5 A;  4C8Q C;  1Q81 C;  2VC8 A;  2LX7 A;  2EFI A;  2KBT A;  3OS2 A;  1YFN A;  3OYH A;  4F7U B;  2DL7 A;  5GMK i;  3NPF A;  2OJ2 A;  1BI1 A;  2KRM A;  1R0B G;  2YSQ A;  1WHG A;  4JRP A;  1VQM A;  4E7L A;  3WVE B;  1VQK Q;  2M9U A;  2COY A;  4IUV A;  3CC4 Q;  5DM7 R;  1KQS P;  2K2V A;  3CC7 A;  4F7U F;  4LDY A;  5IH2 A;  2RD1 A;  4C92 G;  1G5V A;  2DBK A;  3OYD A;  4J7F A;  3JAM E;  4JS5 A;  1LPL A;  2RQW A;  4BY6 C;  4HA8 A;  4K11 A;  2A28 A;  4J9E A;  4R55 A;  4Y92 A;  3FRN A;  4KUI A;  3OYA A;  3G4S A;  3CCM T;  1YI2 A;  2EJG A;  4KBM B;  1RLP C;  2FRW A;  1XNI A;  4QVD A;  1VQ7 A;  3CEY A;  1N9R A;  1M9S A;  3FDR A;  2EPD A;  2LP5 A;  2EJ9 A;  3QHS A;  4FYY B;  3LGL A;  3LH0 A;  1EZZ B;  5LJ3 j;  1X6O A;  3MO8 A;  4BI3 A;  1BYM A;  1ZHI A;  2GNC A;  1BCM A;  3JCM b;  1VQP T;  4ORZ A;  3RKY A;  3CCQ Q;  1W70 A;  3BDL A;  3PMT A;  2VVK A;  3M0R A;  2YDL A;  2OTJ T;  2WSF E;  3S3O A;  1PCX A;  3NFC A;  2O9S A;  2XID A;  3O5Z A;  2PUK B;  3JCM h;  1YIT A;  1IXD A;  2RHU A;  5IXB A;  2YHT A;  5GMK l;  2NUT A;  1KIK A;  4FSS A;  2YUP A;  3GLX A;  2EQI A;  2DL4 A;  2K57 A;  2L5Q A;  1A0N B;  1UG1 A;  2XHC A;  2V1Q A;  1HJD A;  2LC4 A;  2ROT A;  3CCL A;  1EIF A;  1WDX A;  3NTH A;  4B9X A;  2L89 A;  2FEI A;  3L2R A;  2NYS A;  1YWO A;  4RG2 A;  5HY6 A;  1SSF A;  5CR2 A;  2RMO A;  4PJO A;  4PJN A;  1TSF A;  1JJ2 A;  1OPK A;  2OTL A;  2EKH A;  1M27 C;  4PJO D;  2XDP A;  3CC2 Q;  4JLG A;  4FT4 A;  3FEO A;  4JJC A;  2GCX A;  3EG2 A;  5GAM f;  5GAM d;  4BE2 A;  2QAZ A;  5GMK h;  5FWB A;  3EGX A;  4QVZ A;  4XTV A;  2LJ0 A;  2R57 A;  2JVV A;  4YTL A;  1X2K A;  3X24 B;  2DYI A;  2JXB A;  2VB6 A;  4QKU A;  4Y91 A;  1WFW A;  1G83 A;  1PD1 A;  1UGS B;  4HCB A;  3EG9 A;  2LZ6 B;  1IZ6 A;  3RKX A;  4B9W A;  2L8D A;  2QA4 Q;  5KYU B;  4V2S A;  2JTM A;  2RB6 A;  1B3Q A;  2SRC A;  5I2M A;  1GCP A;  4F7U E;  1Y0M A;  3H9N A;  1BI0 A;  2KRO A;  1K8A C;  3HRT A;  4PFP A;  1K8A U;  4OVA A;  2PVO B;  3SD4 A;  1VQ8 T;  3RUX A;  3KUF A;  4JRI A;  3J81 E;  1NLP C;  2R5A A;  3CCR Q;  1YHQ Q;  2QGF B;  1PSE A;  3ZEH A;  5GAN 7;  2GF7 A;  3TVT A;  3INZ A;  1VIE A;  1K73 U;  3VYG A;  3L2Z A;  4C92 F;  1KC8 C;  2ZPF B;  3SWN B;  5IHN A;  1T3S A;  3M56 A;  4C8Q D;  4D8K A;  3TSW A;  2E12 A;  1KC8 U;  1ZBX A;  5IN1 A;  1VQK A;  4M78 G;  1D09 B;  1KD1 R;  3N5B B;  5GAN 5;  1I1J A;  4ZGJ B;  2CH4 A;  2MMP A;  5KYX B;  4C5H A;  3RER A;  4OML A;  4FYX B;  2DZC A;  3VS4 A;  5GMK m;  2XK0 A;  4J6X A;  1OZ2 A;  4N4G A;  2BUD A;  1GL5 A;  5GAN 6;  2DRM A;  5J39 A;  1Q81 R;  4JRK A;  2A08 A;  4BDY A;  2DXT A;  1AVZ C;  1WHK A;  1I5O B;  2AKL A;  2C06 A;  1BIA A;  3LWI A;  3EG0 A;  4UC4 A;  5LJ3 h;  3ASK A;  3CQT A;  1M1G A;  3EHR A;  5KCO A;  2ZPE B;  4GBQ A;  2DJQ A;  1KQS A;  3PIO A;  3GP8 A;  1K4U S;  2A3L A;  4M7A A;  3EFO B;  2VKN A;  2JMC A;  1YCY A;  4EMK B;  1UJ0 A;  4M7A D;  1BCO A;  4CI0 C;  1KHI A;  4AFS C;  4PJL A;  1QMC A;  2X4W A;  1OQK A;  1YJW A;  2JW4 A;  2DF6 A;  3I55 T;  1M8V A;  3SHW A;  5GAM g;  1RL2 A;  1IB8 A;  2ZPG B;  3HPW A;  1ZUU A;  2HKQ B;  3FJ5 A;  2YUQ A;  2CSI A;  5D6W A;  4DBR A;  1KQS S;  2QI2 A;  1RAD B;  1YJN T;  4E6R A;  4D8D A;  2A37 A;  4O5V A;  4E7H A;  3CCU T;  2KT1 A;  3EHQ A;  1Q82 R;  1BKB A;  3EH2 A;  2O01 E;  3I9Q A;  1KQ2 A;  2JJ9 A;  3CCE T;  1ABO A;  3CCM Q;  2EGC A;  1M2V B;  1D3B B;  2YLB A;  1UJY A;  3LX7 A;  2BIV A;  1O9S A;  1E6G A;  3MHX A;  2ZCF B;  2ESW A;  3OSV A;  2RN8 A;  4FM4 B;  5GAM e;  1PD0 A;  4CC4 B;  3H0I A;  1V76 A;  4ME7 A;  4P5N A;  7AT1 B;  2E3H A;  4ANJ A;  3CC2 A;  2P0K A;  3JB9 G;  3CCJ T;  2LQW A;  2CP5 A;  5IAY A;  4LE9 A;  1ABQ A;  2EQM A;  2DA9 A;  4F14 A;  3JB9 H;  3PT9 A;  1VQP Q;  1WQ7 A;  2DJZ A;  3CXC A;  3UF4 A;  2OTJ Q;  3CCS A;  4DEY A;  4LUE A;  1GCQ C;  2H3J A;  4LDV A;  3VS0 A;  1UB4 A;  5EG2 A;  4OMP A;  3CCV T;  2KEA A;  3QZ5 B;  1UTI A;  1GFC A;  4D6W A;  2HQE A;  3Q1J A;  3TEE A;  2G3R A;  2CZ7 B;  3LWH A;  1OUL A;  3HHT B;  4RTY A;  2QA4 A;  4FIB A;  1JQQ A;  5FRN A;  3QUI A;  1VQM Q;  1ZSZ A;  2I0N A;  2X51 A;  1KHC A;  5GJV B;  4M78 B;  1OU9 A;  2XMF A;  1JXM A;  4HT9 A;  3CBM A;  2E3I A;  3CC7 Q;  3JCM f;  1NG2 A;  2QQA A;  4ATO A;  2Y90 A;  1TS9 A;  3CCR A;  1YHQ A;  2EKO A;  1M1F A;  4F16 A;  5FLX E;  4M78 F;  1Z9Q A;  1GXI E;  4C92 C;  2VGN A;  2XI9 A;  4IUT A;  2LTO A;  3OS1 A;  2EYY A;  1K0X A;  3CME T;  1VQ5 T;  2JS0 A;  4M77 B;  2NUZ A;  4ZN3 A;  3RR6 A;  1BBZ A;  3P8D A;  4N0A A;  3SWN C;  3CPF A;  1ARK A;  1TWB A;  4FCY A;  2DVE A;  1P92 A;  3PFS A;  2LT4 A;  4ZN1 A;  1CKB A;  4FSX A;  5CKB A;  2RHI A;  2O2O A;  4LNP A;  2LQN A;  4JLI A;  1PNJ A;  5I21 A;  1GFD A;  3M0S A;  2IPO B;  1AWO A;  4AFU C;  2XD0 A;  1NYF A;  2D8H A;  1B07 A;  2FB7 A;  1Y57 A;  2OAW A;  1NEG A;  2EYX A;  2M1H A;  1YNZ A;  1X6B A;  1VQ8 Q;  2LNV A;  4J9H A;  2H8H A;  1QKW A;  3VU3 C;  2QDY B;  3AT1 B;  4FL6 A;  4DEX A;  4F17 A;  2ZPH B;  5J3B A;  5LJ5 h;  1W2B P;  1AZE A;  4PJM A;  2LCL A;  3L1A A;  2J05 A;  3M0U A;  3HFO A;  1BK2 A;  1WYX A;  3JV3 A;  2XDD A;  1QLY A;  4J6W A;  1RAF B;  3I56 T;  3JCM J;  4EDU A;  5GAN 8;  1LNX A;  2FPE A;  2KAF A;  4EMK C;  1KJW A;  2KNB B;  1RAE B;  3G6E T;  2ZZD A;  3QII A;  3KFV A;  2QQ9 A;  4KH0 B;  3C4S A;  4X34 A;  2E70 A;  5CKD A;  4XTZ A;  1H3H A;  1OI1 A;  2E1H A;  3CCM A;  1NPR A;  5L23 A;  3JCM P;  2R5M A;  4E7K A;  1EFN A;  2MCN A;  5J26 A;  3JB9 I;  3OW2 S;  1N9S A;  4LDU A;  3JB9 F;  4ELY C;  3F70 A;  1WPY A;  4HT8 A;  4AFQ C;  4IUP A;  1S72 T;  3OYC A;  4RUG A;  3VS7 A;  3CBP A;  5FU6 B;  1AEY A;  2NUP B;  3RMQ A;  1T0J A;  1U5S A;  2DFU A;  1M2O A;  3X26 B;  4A4H A;  3BW1 A;  2O4X B;  5KYW B;  1N8R R;  2DXB A;  3JCM X;  1KD1 U;  1VQP A;  1PKS A;  1UHC A;  4JRQ A;  3I55 Q;  1OOT A;  3RMS A;  2OTJ A;  1Y96 A;  1UEC A;  1H3Z A;  3J7A F;  3LYI A;  5HK3 A;  1M5Q 1;  2KRS A;  5D6Y A;  3JCM Q;  4IUU A;  1YJN Q;  3PVL A;  1PG5 B;  4PL6 A;  3M0Q A;  1UGP B;  3WXM B;  3LW5 E;  5A2Q E;  3CCU Q;  2EJF A;  1Q81 U;  3CCE Q;  3A8L B;  2BZY A;  3JCM e;  1D0Y A;  3OB9 A;  3DB4 A;  1M1K R;  3OS0 A;  1D1C A;  3CPW S;  1HK9 A;  2KVQ G;  1G2B A;  1TTH B;  4PKC C;  4X1V A;  5ECA A;  4M77 E;  4RCB A;  5CAI A;  2MAM A;  4C0D C;  4J7I A;  3HSB A;  1X01 A;  1M4Z A;  4M78 C;  2F2W A;  3SB2 A;  1UEB A;  3CCJ Q;  6AT1 B;  4A4K A;  1RAG B;  2LNH B;  4AT1 B;  4BE0 A;  3SEM A;  4HVU A;  4MMK A;  3A98 A;  4Z8A A;  2DMO A;  1ZUY A;  3C0C A;  3EGD A;  4MML A;  3EAE A;  2VUB A;  3QXE B;  1HSQ A;  2DET A;  4C92 D;  2HBW A;  4XTW A;  1QWF A;  3M0P A;  1Q82 C;  4M77 C;  3OYK A;  1Q82 U;  3CCV Q;  2DPP B;  2LCC A;  4PK4 A;  5GAO p;  3A1P A;  2O9V A;  1RAI B;  4NL2 A;  1FMV A;  3GNF B;  1NZ9 A;  4NOY A;  1QCF A;  4JJB A;  4C5I A;  1V29 B;  3EFS A;  2MOX A;  1YJW Q;  4C0G A;  1IRE B;  1VQ8 A;  2KYM A;  4BI4 A;  1UDL A;  2LT1 A;  2SEM A;  1VQO T;  4MDX A;  2QTX A;  4E7J A;  1EX4 A;  2RI2 A;  1Z9Z A;  2NWM A;  3CXC P;  1NE8 A;  1E7O A;  3BE3 A;  2CRE A;  4FT2 A;  3QZ9 B;  2E4H A;  3CME Q;  2DL5 A;  1Y07 A;  1VQ5 Q;  5FRM A;  2CUD A;  1FMK A;  1RAB B;  2K2M A;  2D0Q B;  2HSE B;  5KH6 A;  2RQV A;  4IIO A;  5I2S A;  5HK0 A;  2VXE A;  4XTY A;  1QWE A;  4ELZ C;  3MEU A;  4PJO G;  1IGU A;  4BUG A;  2PQW A;  4EPC A;  5IHK A;  3I5S A;  4II1 A;  2FZK B;  1QVF A;  5CKE A;  3H8Z A;  3R6O A;  1AD5 A;  2QXF A;  3QBY A;  3VUB A;  3VRZ A;  5GAN h;  3X28 B;  2QDL A;  2BE9 B;  1X6G A;  1B34 B;  1U1T A;  2C0I A;  4QT7 A;  3DLM A;  2CT4 A;  3IQL A;  1W2B A;  2QGG A;  1G3Y A;  5IT9 E;  4M7D B;  2L2P A;  3QJY A;  3A8G B;  3CCS Q;  4FW2 A;  3HRU A;  1JJ2 S;  1IHW A;  2G6F X;  5C6S A;  3MEV A;  1MHN A;  2WSC E;  2EQJ A;  5KYY B;  3BDU A;  5GAO r;  3QWX X;  2F2V A;  2HQH A;  2VAS A;  3PTA A;  3REB B;  4M7D F;  1YIJ T;  4DOV A;  3A8O B;  3NGP A;  1UFF A;  2KK4 A;  3TRE A;  2LJ3 A;  3M9Q A;  1VQN T;  1W2B S;  1YCS B;  2EGE A;  3UWN A;  1XTD A;  3I56 Q;  1ZLM A;  1JEG A;  3UPU A;  4M75 A;  1RI0 A;  4IKF A;  1SHG A;  3OYL A;  4EMG A;  3C95 A;  3I55 A;  3L2V A;  3X25 B;  3G6E Q;  4EMH A;  4M75 D;  4Z88 A;  1I4K 1;  2PZ1 A;  2ZAE A;  2ZPB B;  3H0F A;  5LJ5 f;  3MCA B;  4E47 A;  5LJ5 d;  4FYW B;  1TOV A;  4DBF A;  1H8K A;  1YJN A;  2DTO A;  2PU9 B;  5CIU A;  1I5L A;  4RTX A;  2CP2 A;  4CC3 A;  4J9I A;  3CCU A;  4IUR A;  2LJ1 A;  5GAO q;  3CCE A;  3D7S B;  4WTO B;  4C8Q A;  4QQ6 A;  2YRV A;  5HKC A;  2DZ9 A;  3OMC A;  2X4Y A;  5FU7 B;  4OB1 B;  2D9T A;  4FW1 A;  1Q86 R;  1G3W A;  1SHF A;  8AT1 B;  3PGG A;  1Y7X A;  1VA7 A;  4JZ4 A;  1IHV A;  2J06 A;  2DKG A;  1S72 Q;  1GBQ A;  2ZGW A;  1WIE A;  3I35 A;  3FC3 A;  1MMA A;  3VRY A;  3A5Z B;  4Q5W A;  3VKI A;  2K9G A;  3JCM c;  2JT4 A;  3CCJ A;  5FRO A;  1TXQ A;  2RK2 A;  2ED0 A;  2IG0 A;  2K3Y A;  3MKD A;  1K9A A;  4M78 D;  5CO7 A;  2DL8 A;  2KT8 A;  3V8K A;  4M77 G;  5GAM j;  4PFZ A;  1RAC B;  2ZPI B;  3MP8 A;  4N4I A;  4LDW A;  4AMC A;  2D8J A;  2RJC A;  1NM7 A;  2HL5 C;  2LDM A;  3CCV A;  2ABL A;  2EYZ A;  1CSK A;  3GPL A;  1LCK A;  2OX7 A;  3QPH A;  2DIQ A;  3A8M B;  1ZQ1 A;  1NJI C;  4PJJ A;  4M7A G;  2NUT B;  4XTU A;  2CP6 A;  3P8B B;  4ESR A;  4KUD K;  4HCC A;  1WQW A;  2P84 A;  1TG0 A;  4RTU A;  5IXF A;  3C94 A;  2EQK A;  5IHI A;  2GTJ A;  3V7R A;  1M90 C;  2K3B A;  1KSW A;  2EQU A;  3L2Q A;  4PJO B;  3VV0 A;  2EW3 A;  1N8R C;  5D6X A;  1PWT A;  2F1L A;  1N8R U;  2C0T A;  4KH1 B;  4RTW A;  4E7S A;  4F04 B;  4AG1 C;  3JSC A;  3L42 A;  4VUB A;  3SDZ A;  2DTI A;  4PJO F;  3CME A;  1BU1 A;  1VQ5 A;  5CKF A;  3EGX B;  4DA4 A;  2RI5 A;  1SSH A;  2DNU A;  4M7D E;  2XG8 D;  2EGA A;  1FWZ A;  4LN2 A;  2RF0 A;  2YWW A;  3QDR B;  2DEQ A;  3C12 A;  2CT3 A;  4J6Y A;  2EAY A;  1VQL T;  5AYF A;  1M1K C;  5LL6 S;  1H92 A;  2K4Y A;  3M4Y A;  4BAC A;  1Y71 A;  1M1K U;  3I5R A;  3EG9 B;  4HVW A;  3CC4 T;  4ZTJ A;  4KRT A;  2DTH A;  1KFZ A;  5LJ5 g;  3MEW A;  2ECZ A;  2AHJ B;  2CS7 A;  2PNI A;  1LVK A;  2CZ6 B;  1VQ4 T;  4QQD A;  2MYS A;  2EYQ A;  2FRY A;  1VQO Q;  3JB9 D;  4M7D C;  1I8F A;  4J9F A;  1IO6 A;  1GRI A;  1X43 A;  4QQG A;  4HCK A;  2E65 A;  4FYV B;  1UE9 A;  5GAN 4;  1H64 1;  1M3C A;  2V1R A;  1ZSG A;  2RJF A;  4KT0 E;  1OZ3 A;  5LJ5 e;  2ENM A;  3I56 A;  3CXC S;  4J5Y A;  3TCJ A;  3OS5 A;  2FZG B; 
#chains in the Genus database with same CATH homology
 3EG1 A;  2L0A A;  2O9S A;  4AFQ C;  3O5Z A;  2HEQ A;  4RUG A;  3VS7 A;  2KR3 A;  1CKA A;  5IXB A;  1AEY A;  4JZ3 A;  1YN8 A;  1KIK A;  1T0J A;  4FSS A;  1OPL A;  1U5S A;  1UUE A;  2YUP A;  2EQI A;  2DL4 A;  2CSQ A;  1A0N B;  1UG1 A;  1X27 A;  2V1Q A;  1M3A A;  3R6N A;  1HJD A;  2W10 A;  2ROT A;  2LMJ A;  1WDX A;  2J6F A;  1PKS A;  1UHC A;  2CH4 W;  2FEI A;  1YWO A;  1OOT A;  3EGU A;  2RMO A;  1UEC A;  1SRL A;  2EVR A;  2KRS A;  1AWJ A;  2BTT A;  1OPK A;  1VYU A;  2CUB A;  2GGR A;  2EKH A;  1M27 C;  2O31 A;  3UA7 A;  4J9G A;  3PVL A;  2DE0 X;  3M0Q A;  4JJC A;  4CC7 A;  3VS1 A;  2BZX A;  3EG2 A;  2BZY A;  4HVV A;  2JM8 A;  5FWB A;  4RTV A;  4JJD A;  2LJ0 A;  4AG2 C;  3UAT A;  1X2K A;  1G2B A;  3NHN A;  1X69 A;  4X1V A;  1M3B A;  5ECA A;  2KXD A;  1J3T A;  1AOJ A;  2JXB A;  2YUN A;  4J9C A;  1WLP B;  1WFW A;  5FWC A;  1G83 A;  2DRK A;  1RI9 A;  2F2W A;  2JS2 A;  1PRL C;  2HSP A;  1UGV A;  2LZ6 B;  2YUO A;  2LNH B;  2RQT A;  1RLQ C;  3SEM A;  4HVU A;  1B3Q A;  2OI3 A;  2SRC A;  1BB9 A;  1GCP A;  1W1F A;  3A98 A;  4Z8A A;  2DMO A;  1Y0M A;  1ZUY A;  2YT6 A;  3C0C A;  2KRO A;  2J6K A;  2D0N A;  1AZG B;  1HSQ A;  1T0H A;  2HBW A;  2MIO A;  2DVJ A;  1I0C A;  2E5K A;  3RBB B;  1SEM A;  1NLP C;  4OMO A;  1QWF A;  3VS6 A;  3M0P A;  2DYB A;  3QWY A;  1JO8 A;  3RNJ A;  4A63 B;  3TVT A;  4WCI A;  2O9V A;  1QCF A;  1E6H A;  4JJB A;  5IHN A;  1T3S A;  4D8K A;  3TSW A;  1WXB A;  1TUD A;  2MOX A;  1PHT A;  1NEB A;  1VYV A;  1I1J A;  2RPN A;  2X3W D;  2CH4 A;  2KYM A;  1UDL A;  2AKK A;  2BZ8 A;  2C0O A;  2GQI A;  2SEM A;  4OML A;  1S1N A;  3VS4 A;  2IIM A;  5FW9 A;  2ROL A;  1GL5 A;  1Z9Z A;  2NWM A;  1WA7 A;  1E7O A;  2CRE A;  4ZNX A;  2DRM A;  2DLP A;  2A08 A;  2DL5 A;  1AVZ C;  1I07 A;  2AKL A;  2CUD A;  1FMK A;  2K2M A;  4OMN A;  1NLO C;  2RQV A;  4IIO A;  4LUD A;  1PKT A;  2HDA A;  3EG0 A;  1QWE A;  3CQT A;  4OMQ A;  3EHR A;  4GBQ A;  3LH5 A;  2F2X A;  2HCK A;  5IHK A;  2DJQ A;  1HD3 A;  3I5S A;  1M8M A;  1K4U S;  1GCQ A;  1AD5 A;  5GJW B;  2VKN A;  3VRZ A;  2JMC A;  2K79 A;  1UJ0 A;  2CDT A;  2KE9 A;  2QDL A;  4AFS C;  1X6G A;  2C0I A;  4QT7 A;  2AZS A;  1OEB A;  2CT4 A;  3IQL A;  2P4R A;  1MV3 A;  2JW4 A;  2DF6 A;  4RTT A;  2JTE A;  2L2P A;  3SHW A;  2J6O A;  2W0Z A;  2G6F X;  2PTK A;  1JXO A;  1ZUU A;  1K1Z A;  1YWP A;  2YUQ A;  3FJ5 A;  2CSI A;  4AFZ C;  3GBQ A;  2DM1 A;  4R0K A;  4E6R A;  4D8D A;  2A37 A;  3H41 A;  3QWX X;  3TSZ A;  2F2V A;  1K76 A;  1U06 A;  1QKX A;  3REB B;  2KT1 A;  3EHQ A;  3I9Q A;  1WX6 A;  1ABO A;  1UFF A;  3NGP A;  2EGC A;  2LJ3 A;  1UJY A;  1AWW A;  2EBP A;  1UHF A;  1YCS B;  3ULR B;  2EGE A;  1ZLM A;  1JEG A;  1E6G A;  1WXT A;  1SHG A;  2RQR A;  2ESW A;  2RN8 A;  1GBR A;  3VS2 A;  1RUW A;  2L3P A;  4CC4 B;  4Z88 A;  3H0I A;  1ZBJ A;  2PZ1 A;  4RTZ A;  3H0F A;  4Z89 A;  1H8K A;  2AZV A;  4RTX A;  2J7I A;  4CC3 A;  1WI7 A;  3REA B;  2LQW A;  4J9I A;  2LJ1 A;  2M0Y A;  4LE9 A;  1ABQ A;  4EIK A;  2DA9 A;  4F14 A;  2FG0 A;  1TUC A;  3M0T A;  1YP5 A;  1VYT A;  2LCS A;  5I22 A;  4M4Z A;  3UF4 A;  1XOV A;  1SHF A;  2JM9 A;  1ZX6 A;  2RNA A;  4DEY A;  2GTO A;  1VA7 A;  4JZ4 A;  4LUE A;  1GCQ C;  2FPF A;  2FO0 A;  2J06 A;  2D1X A;  3VS0 A;  1GBQ A;  4J9B A;  1WIE A;  4OMP A;  3I35 A;  2KEA A;  3VRY A;  5EC7 A;  1UTI A;  1GFC A;  1W6X A;  3PE0 A;  2K9G A;  2JT4 A;  1MV0 B;  2ED1 A;  1JU5 C;  1ZUK A;  2ED0 A;  4RTY A;  3U23 A;  1JQQ A;  4OMM A;  1K9A A;  3VS3 A;  2DL8 A;  2KT8 A;  1V1C A;  2I0N A;  4JPB W;  5GJV B;  2L3S A;  2XMF A;  1JXM A;  2A36 A;  4CC2 A;  1NG2 A;  1K0S A;  5I11 A;  2M51 A;  2D8J A;  2DIL A;  1WXU A;  2DBM A;  1NM7 A;  2K7A A;  3THK A;  2ABL A;  2EYZ A;  1CSK A;  4F16 A;  1LCK A;  1Z9Q A;  3ZL7 C;  2KYB A;  2EYY A;  4ESR A;  3NMZ C;  1K0X A;  1NYG A;  3PVQ A;  2JS0 A;  1TG0 A;  2NUZ A;  1N5Z A;  4RTU A;  5IXF A;  1BBZ A;  2O88 A;  3H0H A;  5IHI A;  2GTJ A;  4HXJ A;  2K3B A;  1ARK A;  1KSW A;  4GLM A;  5HCK A;  1MUZ A;  1SPK A;  1CKB A;  2LX7 A;  2KBT A;  2EW3 A;  2FPD A;  2DL3 A;  2O2O A;  4LNP A;  1PWT A;  2C0T A;  2DL7 A;  4RTW A;  2LQN A;  3NPF A;  1PNJ A;  2OJ2 A;  4AG1 C;  1M30 A;  2KRM A;  1GFD A;  2YSQ A;  3M0S A;  1AWO A;  2DX1 A;  4AFU C;  3VS5 A;  1NYF A;  2D8H A;  1B07 A;  1Y57 A;  2OAW A;  2B86 A;  1BU1 A;  1NEG A;  2EYX A;  1YNZ A;  1X6B A;  1SSH A;  5IH2 A;  4J9H A;  2DNU A;  2H8H A;  1QKW A;  2DBK A;  2EGA A;  4DEX A;  4F17 A;  4LN2 A;  2RF0 A;  2JMA A;  2RQW A;  2CT3 A;  2RQU A;  1AZE A;  2K6D A;  4K11 A;  2A28 A;  4J9E A;  1AWX A;  4Y92 A;  4IIM A;  1H92 A;  2J05 A;  3M0U A;  3I5R A;  1BK2 A;  2VWF A;  1WYX A;  3JV3 A;  1FYN A;  1QLY A;  2X3X D;  4HVW A;  4J9D A;  4KRT A;  1KFZ A;  1SRM A;  1RLP C;  2FRW A;  2EYW A;  2ECZ A;  2FPE A;  1KJW A;  2GBQ A;  2KNB B;  2PNI A;  3EG3 A;  2AK5 A;  2EPD A;  3KFV A;  2LP5 A;  2FRY A;  2KRN A;  1PRM C;  3UA6 A;  4J9F A;  1IO6 A;  1GRI A;  1X43 A;  1H3H A;  4HCK A;  1UE9 A;  2KXC A;  1M3C A;  2V1R A;  1ZSG A;  5L23 A;  2L3Q A;  2GNC A;  1U3O A;  1X2Q A;  4ORZ A;  1T3L A;  2ENM A;  1EFN A;  1W70 A;  2MCN A;  1OV3 A;  2VVK A;  3M0R A;  2YDL A;  2KGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...