2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neutrophil cytosol factor 2
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
3A98A 4RTUA 1VYTA 2D1XA 2BZXA 2YT6A 2HBWA 3VS6A 1B07A 4LE9A 2KRMA 1ZBJA 2C0IA 3I35A 2M51A 4RTWA 1T3SA 1M8MA 1X69A 5GJWB 5FW9A 1UJYA 2ESWA 2K2MA 1Z9ZA 3EG3A 4AFSC 2KT1A 2BTTA 2L3SA 3NPFA 4AFQC 2H8HA 2I0NA 2KR3A 2L3QA 1UJ0A 4IIOA 1JEGA 4K11A 4J9BA 4WCIA 1CSKA 1GFDA 1XOVA 4HXJA 2OI3A 2ROTA 1SRLA 3UF4A 3TSZA 3VS2A 2O31A 4OMLA 1ABQA 4J9IA 2PTKA 1UTIA 3UATA 1U3OA 1GCQA 4X1VA 5IXFA 2JTEA 2HDAA 1AZEA 2ED0A 2CUBA 4D8KA 2A37A 3H0HA 1SHFA 2DE0X 2FEIA 2CSIA 2YDLA 2J06A 2EYXA 2B86A 2DBMA 5IH2A 4M4ZA 3LH5A 2GTOA 1UDLA 2DL5A 2EGCA 3VS4A 2DILA 2K7AA 2D8JA 2LP5A 5IHNA 1BU1A 1OPKA 3TVTA 1SSHA 4LN2A 2DNUA 4JJDA 3M0TA 4ZNXA 4ESRA 2CREA 3FJ5A 3PVLA 3I9QA 2MOXA 2RPNA 2JM9A 1QCFA 1YN8A 5I11A 3NGPA 1X43A 3M0UA 2GNCA 2ABLA 1H3HA 2DM1A 2FRYA 2YUNA 4HVVA 1X2QA 2KGTA 4HVUA 2MIOA 1AVZC 3M0QA 3M0RA 2KYMA 2EQIA 5IHKA 2PNIA 2J7IA 1V1CA 2KRSA 1WIEA 3EG1A 1J3TA 1HD3A 5EC7A 1K76A 1HSQA 1WA7A 2HCKA 3KFVA 1UUEA 2JS0A 2YUQA 1W1FA 2DL8A 2XMFA 1UECA 1M30A 1PWTA 2D8HA 1LCKA 2EPDA 4ORZA 2YSQA 1EFNA 1SHGA 3H0IA 5FWBA 2DLPA 2W0ZA 1UG1A 2OAWA 1Z9QA 1KFZA 2RF0A 1B3QA 1NYFA 4FSSA 2P4RA 4KRTA 2LCSA 2KBTA 1CKBA 5GJVB 1QWFA 2O9SA 1I1JA 1NYGA 2K3BA 1ZUYA 2RQWA 2CT4A 2O2OA 4F14A 1X6BA 3QWYA 2LZ6B 1E6HA 2A36A 2LQWA 2JS2A 3SEMA 4F17A 1PHTA 2EKHA 2LMJA 1OOTA 4J9EA 1U06A 5L23A 2RQRA 2DX1A 1QLYA 4AFZC 2EYWA 1WX6A 2JW4A 2NUZA 1WXBA 1JXMA 4Y92A 1RLPC 2RQTA 1WXTA 1AWJA 3SHWA 3M0SA 1PKSA 2AKLA 2DVJA 2FPDA 4CC4B 2M0YA 2KXCA 2VWFA 1ZSGA 2DL7A 1SRMA 2KROA 3EHRA 1YWOA 4CC7A 3PVQA 1W6XA 2CDTA 1WFWA 1U5SA 3VS3A 2BZYA 3ZL7C 1VA7A 1CKAA 2JM8A 3TSWA 2KXDA 2DYBA 2PZ1A 1GL5A 2VVKA 1VYUA 1WLPB 1A0NB 1NM7A 1NG2A 1JXOA 2LX7A 1K0SA 5FWCA 1GCPA 1MUZA 1SEMA 2BZ8A 4Z8AA 4JJCA 1PKTA 1AWWA 1ZLMA 3NHNA 3M0PA 2IIMA 2X3XD 2K6DA 3REAB 2C0TA 3VRZA 2K9GA 3EG2A 3VS7A 2GTJA 4GLMA 2AZSA 1QWEA 2LJ0A 1WYXA 1M3CA 1I0CA 4OMQA 1WI7A 4DEYA 2F2VA 3I5SA 2DL3A 2EYYA 1BBZA 2RNAA 2KYBA 2DRMA 2JT4A 4AG1C 1T0JA 1ZUKA 4OMPA 2O9VA 5ECAA 1PNJA 4RTTA 2LNHB 1ABOA 2DL4A 3EG0A 2RMOA 1Y57A 1ZUUA 2DBKA 1FYNA 3REBB 3I5RA 2DRKA 2W10A 2EGEA 4EIKA 1AD5A 1QKWA 3CQTA 1AWXA 3H0FA 2SRCA 4JPBW 1T3LA 2EYZA 2E5KA 1H8KA 2FRWA 1UGVA 1KJWA 1TUCA 1NLPC 2RQVA 3EGUA 2FPEA 4QT7A 2HSPA 1OPLA 2AK5A 2K79A 2F2XA 3VRYA 1I07A 3JV3A 4OMOA 4J9DA 1AEYA 2VKNA 4LNPA 3THKA 4LUDA 2CUDA 3RNJA 1JQQA 2ROLA 1G2BA 3R6NA 1BK2A 4J9GA 1M27C 1S1NA 2ENMA 1TG0A 3C0CA 1NEBA 4JZ3A 2CH4W 1KSWA 2EVRA 1UHFA 2KEAA 2J05A 1UE9A 2MCNA 2ED1A 2O88A 3VS0A 1RI9A 1FMKA 3VS5A 2LJ1A 1T0HA 1PRMC 1GRIA 1K4US 2LQNA 3ULRB 3U23A 2C0OA 1K1ZA 4J9FA 4CC3A 4A63B 3O5ZA 1GCQC 2L3PA 4RTZA 1WXUA 3PE0A 1HJDA 1WDXA 4E6RA 2A08A 3EHQA 1E7OA 2OJ2A 5IXBA 1GBRA 4RTXA 1RLQC 1W70A 4R0KA 2D0NA 1X6GA 4GBQA 3IQLA 2KE9A 2AKKA 2CSQA 1YWPA 5HCKA 1M3BA 4J9CA 2AZVA 1Y0MA 2LJ3A 2YUOA 1ZX6A 2A28A 1UFFA 2DA9A 2SEMA 1X2KA 2RQUA 4OMNA 2J6FA 2GBQA 2JMCA 2HEQA 2QDLA 4HCKA 2X3WD 1E6GA 1G83A 2V1QA 4LUEA 1UHCA 5I22A 2RN8A 4D8DA 1X27A 2FG0A 1YNZA 2KNBB 1NEGA 2ECZA 1N5ZA 1JU5C 1YP5A 4AG2C 2JXBA 1JO8A 1GFCA 2DF6A 4F16A 2EGAA 4RTYA 2DJQA 2G6FX 1QKXA 2EW3A 3H41A 2DMOA 2EBPA 1K0XA 1AOJA 2FO0A 4HVWA 3VS1A 2V1RA 2YUPA 5IHIA 3GBQA 2CT3A 2KT8A 1AWOA 3RBBB 4AFUC 3NMZC 1AZGB 3UA6A 1H92A 1OEBA 2NWMA 4DEXA 1MV0B 1NLOC 1IO6A 2L0AA 2L2PA 4JZ4A 2KRNA 4RUGA 1BB9A 1M3AA 1ARKA 1SPKA 2FPFA 4Z88A 1YCSB 1RUWA 4IIMA 3UA7A 2J6KA 1MV3A 1K9AA 2CH4A 4RTVA 2GGRA 4CC2A 4Z89A 2GQIA 1PRLC 2JMAA 2J6OA 1OV3A 3QWXX 4J9HA 1TUDA 4JJBA 4OMMA 1VYVA 2F2WA 1GBQA 1KIKA
chains in the Genus database with same CATH superfamily
5LJ3f 4M7DF 5HKCA 1BIBA 4LE9A 2BE7D 4IURA 3CPFA 5GJWB 1X69A 4FYVB 3CCQQ 2YRVA 2K2MA 1Z9ZA 3CCLQ 2BTTA 1VQKT 3PFSA 1KHIA 3JB9D 5GANf 4KH0B 1NJIU 4M7DE 1JEGA 3JCMe 1KQSS 2E41A 2VGMA 3OS5A 1CSKA 1GFDA 1XOVA 4PFZA 4C0ZA 2ROTA 2K5FA 8AT1B 4X34A 4LDXA 4OMLA 3OMGA 4PLLA 4J9IA 2HQEA 3J80E 2PTKA 3FC3A 1UTIA 4C5IA 5IXFA 4OVAA 1ZA2B 1RAFB 1VIFA 3JCMQ 2O01E 3CCQA 3GF5A 2V8JA 4J7FA 2B86A 5IH2A 1FMWA 3V8LA 2DKGA 2EGCA 2B8AA 2D8JA 1Q7YC 3TVTA 1SSHA 3DB3A 4JJDA 3M0TA 3OS1A 1QCNA 3RKWA 1VQLT 1VIEA 3I55A 2JM9A 2Y90A 2JZ2A 1VQMA 3NGPA 4JUVA 1UB4A 1X43A 3FJPA 1X2QA 1M4ZA 2KY9A 5GANe 3A8LB 2EQIA 4F7UG 3GNFB 1V1CA 1N27A 4ELZC 1HD3A 5EC7A 3LW5E 2Y4XA 5GMKh 2XKOC 3G1JA 3G6ET 4J6YA 2HCKA 4PJOE 1W1FA 2DL8A 2XMFA 4ZTJA 4FCYA 1VQ9T 4BE1A 1LCKA 2R5AA 1NJIR 2OTJA 3OBWA 1SHGA 2IG0A 2GQVA 4IKFA 2K3YA 1KFZA 4MMKA 1ZSZC 3CPWS 4KRTA 3X20B 3QO3A 2LCSA 3JCMh 1CKBA 5GJVB 5GMKj 1I1JA 2ZPHB 1BI2A 1R8OB 5HY6A 2LZ6B 2JS2A 1PHTA 3CC4T 1OOTA 1ZBXA 1MNEA 4F7UB 2DX1A 1BI0A 1QLYA 3E1SA 4AFZC 4PJLA 2NUZA 3CEYA 3CMAA 1VQ6Q 1VQOA 5I2SA 1QVGA 1WXTA 1AWJA 4ME7A 3SHWA 1ACMB 1PKSA 3M53A 1XTDA 2FL7A 3CCMT 2F69A 3BE3A 4CC4B 2M0YA 5GAOq 3PGGA 2KXCA 1D1AA 4MMLA 4YTLA 2CP5A 2VWFA 1BI1A 4ZGJB 1WFWA 2XG8D 3KUFA 1VA7A 2PUOB 3TSWA 3CXCS 4E7KA 3OW2S 2DZCA 4M75F 4PK4A 5CAIA 1A0NB 1VQMQ 1K8AC 2GF7A 3QJYA 4Z02A 1YJNA 1MUZA 2BZ8A 4JJCA 3C12A 1ZLMA 3M0PA 4M77B 1UGSB 2K6DA 4O6JA 4BACA 5IT9E 3EG2A 2AZSA 5GAOr 1YJWT 2KK4A 2P0QA 4E7SA 1QVGS 2K57A 4IUVA 1I81A 5LJ5j 4WTOB 4FM4B 2DL3A 4ZTFA 3OYFA 2DFUA 3LGLA 2KYBA 2ZPBB 2DRMA 1YJNT 3MP8A 4M78B 4XTYA 4A54A 5CVIA 5ECAA 2EYQA 5GAN4 4ZGDB 2KI7A 4M7AC 4B9XA 1G5VA 2RHYA 3RERA 1N8RC 2XK0A 3EG0A 3GP8A 2RMOA 1ZUUA 3H8ZA 2DBKA 5J39A 2DXUA 1EX4A 2KMTA 1Q82U 1BCMA 1Q86U 4FSXA 1VQ5T 2WSFE 3CQTA 1AWXA 3EGDB 3CCST 1T3LA 4XQ3A 1I5OB 1U8RA 1YCYA 1KJWA 3QZ9B 4M78A 1KD1U 2K79A 5DLOA 1B34B 1JB0E 4N0AA 3JV3A 4NOYA 4MZTA 5CCAA 4EMKB 2YRCA 4OB2B 2KQWA 1D3BA 4LNPA 2CUDA 2QASA 3VUZA 2RHXA 3R6NA 5FU6C 1ZA1B 5FU6B 1I5LA 5LJ5f 5GMKe 2ENMA 1WJQA 1KSWA 3CD6T 2EVRA 2J05A 1UE9A 3FDRA 2MCNA 2ED1A 3G4SA 1RI9A 4E2FB 2QK0A 4CRIA 1D0XA 3OYCA 1QVFS 4C92E 1GRIA 2ATCB 2DZ9A 2PQWA 1IB8A 3OYJA 1K1ZA 4XTUA 4KUIA 4A63B 3O5ZA 2OTLT 5HK0A 1K73R 1TUGB 2MWOA 1YJ9T 3L1AA 3L42A 2K5IA 2A3LA 3V7CA 4M7AA 1VQNT 1WDXA 4A4GA 3L2WA 1VQOT 3D7SB 2OTLQ 1M2VA 3JSCA 3JCMJ 4AMCA 2K2VA 2D0NA 3CMET 3IQLA 3RIRA 3EFOB 2RM4A 1Q82C 1Q86C 2QQAA 2V8IA 3EFRA 4MZPA 2EQJA 2EQKA 5GAN6 3X28B 2WACA 2JMCA 2HEQA 2DXBA 2WSEE 5FRNA 4HCKA 1C0MA 5FRMA 2X3WD 3JCMf 4BI8B 1WHLA 1Q82R 1Q86R 5GAOm 1VQ9Q 2COWA 3PIPA 1N5ZA 1JU5C 4NL3A 1YP5A 3R6OA 3J7AF 2JXBA 4F04B 1M1KR 2PVDB 1VQ4T 3CCSA 1QKXA 4Q5WA 3H41A 2X4XA 2ZCFB 3OYMA 2V1RA 3OSVA 2M02A 2KT8A 4OB0B 3BFMA 1AWOA 4BI3A 3OYDA 2ZPEB 1D1BA 1AZGB 3UA6A 4IUUA 1OEBA 2CZ6B 2NWMA 4HCZA 4JZ4A 1BB9A 3JRZA 2R5MA 4BB7A 3QYHB 1RUWA 3F70A 2RJDA 3ER0A 4C92F 1KC8U 2RA2A 3ZFJA 5D7UA 4Z89A 2GQIA 3RESA 4M77C 2COZA 4J9HA 1TUDA 4KULA 4DBQA 3HFNA 1VYVA 4LDWA 4RTUA 1VYTA 2YT6A 4PJJA 3VS6A 2YHTA 2KRMA 3SWNA 3E9GA 1ZBJA 2RHIA 2C0IA 3I35A 4FW1A 4AFSC 2AIRB 2HAXA 3CCRT 1MMGA 3SWNC 4AFQC 2KR3A 4IIOA 2DTOA 4N0AC 3JB9F 3CBMA 2HZYA 2RJCA 2K5LA 3OYGA 2YRDA 1SRLA 2E12A 5I21A 3A1PA 3OYIA 3X26B 1FXXA 1VQLA 3E19A 1M5Q1 2O31A 1M90C 2LC4A 3UATA 2R58A 3KBGA 2MMPA 3T9NA 2IPOB 1PD1A 1SHFA 4FT4A 3RMQA 5KYYB 2FEIA 2CSIA 1YJ9A 3SDZA 2FZCB 1UDLA 2MPXC 3G7ZA 1WQ7A 4BE2A 2QYZA 1VQLQ 2K7AA 1PM3A 1OPKA 2LT4A 4QVDA 1VQ9A 1R77A 1PG5B 2E5QA 2RD1A 3I9QA 3NFCA 3JAME 2QGFB 2X4WA 5CK9A 4JRKA 2LCLA 1YN8A 2XHCA 5DM7R 5I11A 2X9HA 2X35A 3M0UA 2QTVA 4M75A 3CC7T 4JJNK 2X51A 2RHUA 2E6NA 2HQXA 3QSUA 1VQPA 3GLXA 4NL2A 2KRSA 5GMKm 1WIEA 2LT1A 3EG1A 2XIDA 1KD1C 1J3TA 2RHZA 1K76A 2CS7A 1HSQA 3JCMd 2EKOA 3CCEA 2GCXA 4JRIA 2JS0A 4PJOC 3CCET 3TQ7P 5D6YA 4PJOB 2V26A 1M30A 4FYYB 6AT1B 1YBYA 5GAOn 2EPDA 2QEXA 1VQ7Q 3INZA 1S72T 4TVRA 1RI0A 3VYHB 1YHQQ 5KCHA 4M77F 2OAWA 4QW2A 2L8DA 2RF0A 3X25B 1NYFA 1UGRB 5DY9A 1S72Q 4C5GA 4M7AD 2QAZA 3H9NA 1OYXA 2DXTA 2MK5A 1NYGA 5L8RE 2CT4A 2O2OA 1X6BA 3QWYA 1E6HA 2A36A 2LQWA 4LD6A 3RKYA 3SEMA 4F17A 3LGFA 2PVGB 1MMNA 2DIGA 2EKHA 3WXMB 3AT1B 1NZ9A 1TWBA 2RQRA 1M90R 2JW4A 4M75G 5D6WA 1KC8R 2VXEA 2GFAA 1K8AR 4Y92A 3OA6A 4B6MA 3CMEQ 2EQMA 2CP6A 1OI1A 3HFOA 3X24B 2DVJA 5FU7B 5KYXA 2QQSA 3META 2DL7A 2KROA 3SD4A 3I56Q 1W6XA 1U5SA 4J5YA 2ZPGB 1YJWA 3Q1JA 3CCLA 2DYBA 1Y96A 4M7AF 4HCBA 4A4EA 1WNLA 1BIAA 4PJOF 4M78C 1K0SA 5FWCA 2LQ8A 4II1A 2O4XA 3QIIA 4ELYC 2X3XD 1TSFA 2COYA 3MHXA 2GTJA 4GLMA 2MAMA 4MZMA 2VC8A 4C92D 3PNWC 1D0ZA 5AYFA 4FYXB 2AHJB 4LDVA 4PKCC 1UEBA 4J8OA 3OBYA 3L2VA 2X4YA 2FHDA 3O8VA 1ZUKA 1LOJA 1TXQA 2VV5A 4CI0C 2O9VA 4RTTA 2LNHB 4RG8A 4C0DC 4LDUA 4M77D 2QA4A 3QHSA 2BKDN 4M78G 1WGSA 4XU3A 2Z0WA 2DPPB 2QA4T 1IRXA 1Y57A 2WSCE 3SFMA 2CYZB 3OW2P 4JRPA 3OYHA 1FYNA 1AD5A 5LJ3j 3RDVA 3OYAA 1K73U 2RJEA 3HTRA 5GAOp 4JRQA 4HCCA 2JOYA 1TTHB 3M5AA 4FT2A 1IZ6A 1NLPC 1KQ1A 2FPEA 4JLGA 4M75C 2VASA 2JN0A 2F2XA 5D6XA 3LLRA 2JTMA 2VUBA 4C92B 1C6VX 1YI2T 3CBOA 5J3BA 2JTFA 3CD6Q 1JQQA 1G2BA 4RKUE 2VGNA 1HXDA 2QTXA 1ZSZA 5LJ3g 1TG0A 1YITT 5HK3A 1Q7YU 2O88A 3CCQT 2XICA 3QKJA 3CCLT 1KD1R 1OX9A 2E10A 1T0HA 1Q81R 5C6SA 1SKUB 1K4US 1OX8A 5GANj 3ULRB 1VQNQ 1LVKA 3MPUB 2KDSA 1DJ7B 4CC3A 2L3PA 1V29B 4PJOG 1Y7XA 4JLIA 2XD0A 5FU7C 3C95A 2E4HA 2CP2A 4E6RA 2A08A 3L2UA 3I56A 3EHQA 2MF2A 1VQMT 3MP6A 1E7OA 3CC4A 2OJ2A 3GNGA 3S6WA 2NLUA 1VQKQ 4RTXA 3EG9A 1C1AA 1RLQC 2M1HA 2ZPFB 3HRUA 4GBQA 2JVVA 1WHHA 3CCMA 1Y0MA 2YUOA 3EGXA 1ZX6A 2V8KA 2CZ7B 1X2KA 4OMNA 3VUBA 2GBQA 1P92A 5GAMf 1M1KC 2F5KA 1ZHIA 1VQ8Q 1QW1A 1WZOA 2RI2A 3N5BB 1G3WA 2E3IA 1G83A 4M78E 1WHJA 2RN8A 4D8DA 2QI2A 2HL3A 3JCMX 5CKBA 2FG0A 1JJ2A 3UWNA 5A0GA 5LJ3e 4PNOA 2E3HA 2P4TA 3CCJA 3FIFA 3NTKA 1QP2A 3QXEB 3KXTA 1KG1A 2HD0A 4PFPA 1Q81C 3OS0A 2DJQA 5IAYA 1RAIB 1MHNA 4M7DA 3G6EQ 4BDZA 2XDDA 2YUPA 2YLCA 2K4YA 3GBQA 1JJ2S 2XU8A 4AFUC 2RH2A 3EGXB 3NMZC 3M58A 5A0DA 4C5HA 3ZEHA 5GAOl 4GLKA 3OYNA 3CCJT 2CZ1B 1K73C 2OTJQ 1ARKA 3UPUA 2FPFA 4Z88A 3SWNB 4OB3B 3OYBA 1RAAB 4X9CA 2BE9B 1QCOA 2J6KA 2X4JA 2FZKB 3HKSA 2JUFA 2NUPB 1NPPA 2JMAA 5KYUA 1OV3A 3QWXX 2KSSA 3TU4K 4JJBA 3A8OB 1XJWB 2DTIA 5A2QE 2HBWA 4IUTA 4QQ6A 4WF2A 2M51A 3LWIA 1VQ6T 4C8QD 1RADB 5KYYA 5FW9A 1WJSA 1UJYA 2EFIA 2ESWA 2NYSA 4E7ZA 2KT1A 3P8HA 3MCAB 2EWNA 1VQNA 2EJ9A 2L3QA 1UJ0A 1JRIA 2D9TA 2VXFA 1QVFP 4WCIA 1G8XA 3CPWA 4OF1A 2NUPA 1IGUA 5GANh 2H3EB 3M9QA 3M54A 4IUPA 3UF4A 3VS2A 1VQOQ 1ABQA 2HSEB 3OMCA 5GAN3 1U3OA 1GCQA 4LXCA 2JTEA 2DIQA 1IHVA 1VQ7A 1AZEA 2ED0A 2CUBA 4D8KA 4ATOA 2A37A 2DTHA 3L2ZA 4V2SA 2DE0X 1SSFA 3MEUA 3LH5A 1N6AA 3QBYA 1BU1A 1HK9A 1UGPB 2PU9B 2DNUA 1MMAA 4ESRA 1O75A 2CREA 3PVLA 1YIJA 1XNIA 5CKDA 4KGVB 3ME9A 1WPYA 1QCFA 2C06A 4R56A 3P8BB 4Y28E 1VQ8A 3MEAA 3CXCP 2GNCA 2ABLA 1H3HA 2DM1A 3QDFA 2FRYA 2M0OA 4HVVA 4AT1B 2EJFA 4HVUA 2L89A 2MIOA 2RJFA 1AVZC 4KUDK 2KYMA 2M16A 2LDMA 3TREA 2PNIA 2J7IA 4C8QA 1ZSZB 2LX9A 1WQWA 3ZBDA 1UUEA 1G3YA 2YUQA 3CMAQ 3L2RA 3CCSQ 1NJIC 3TEEA 1KK7A 1TH7A 2P0KA 4ORZA 1YFNA 3LYIA 3G4ST 2YSQA 4J7IA 4M77E 1EFNA 5CQXA 3NTIA 3EG9B 1UG1A 1RACB 2FB7A 3OSSC 1QVGP 2DERA 3CPWP 2P4RA 3G4SQ 1VQ4A 4DBFA 2KBTA 1QWFA 1V76A 1Y96B 4C8QC 4FU6A 5GAMg 2RQWA 3CBPA 1YJ9Q 2LMJA 2F1LA 5GAMh 4KGXB 4J9EA 1U06A 5L23A 3OW2A 2E70A 1B34A 1WX6A 3UDCA 1WXBA 1JXMA 3OYEA 2RI3A 2JJ9A 1X75C 5KYWB 3I56T 2RK2A 3M0SA 2BUDA 3OYYA 1QQJA 3WVEB 4E7HA 1N8RU 1VQ5A 4C8QF 4ANJA 2ZGWA 1ZSGA 3EHRA 1YWOA 2DVEA 2CDTA 2E64A 3FLGA 3DB4A 5AT1B 3VS3A 2BZYA 2JM8A 1CKAA 2KXDA 4M75D 3GOXA 2PZ1A 1VQPT 4PJMA 1JXOA 2XDPA 3JB9I 4C0GA 5GAN5 4Y91A 1SEMA 4Z8AA 2FYKA 3CCUQ 1PKTA 1AWWA 2HL5C 1VOMA 2QGGA 2C0TA 2AT1B 3VRZA 2FVUA 1N9SA 1QMCA 2QEXT 3DLMA 1QWEA 2LJ0A 4M77G 1I0CA 1WI7A 4C0FA 2QEXQ 3I5SA 1BBZA 2RNAA 4EPCA 3PMTA 4BE0A 4AG1C 5CKFA 1NE8A 1PNJA 4RCCA 1YI2A 2QG9B 4QQGA 1OZ2A 4E47A 2DL4A 4PL6A 2ZAEA 4DOWA 8ATCB 2RK1A 4C92C 4EDUA 1KQ2A 2HMAA 4L59A 5M9OA 1N9RA 4XU2A 3CD6A 1YITA 4J83A 3REBB 2DRKA 2W10A 3FEOA 3PT9A 4EIKA 1QKWA 2H3JA 2EYZA 2E5KA 3JCMb 2FRWA 1TUCA 2XI9A 2RQVA 4EMHA 3EGUA 3CC4Q 4QT7A 2HSPA 2AK5A 4KT0E 4F7UE 4E7IA 3L2QA 3VRYA 2QQRA 1NPRA 1VQ6A 4J9DA 2DETA 4HT9A 5GAMd 3M57A 1LNXA 1AEYA 2VKNA 3LH0A 3THKA 4LUDA 3RNJA 3CCMQ 2ROLA 5IN1A 2R57A 1IHWA 4M7DC 2YXYA 1NEBA 5GMKi 2CH4W 2E65A 5A0LA 4XTWA 4NS5A 1SG5A 5CKEA 3VS0A 3CCRQ 3M4YA 4EMKC 1FMKA 2LJ1A 1PRMC 3M59A 1KQSP 4OB1B 4GY5A 2LQNA 1M1FA 1M2OA 4DA4A 1G3TA 2L5QA 2C0OA 3A5ZB 4XAXB 4C92A 1GCQC 3JB9J 3HPWA 2VB6A 1HJDA 1QP3A 2KAFA 5IXBA 1PCXA 3NTHA 3VKIA 4R0KA 1X6GA 4PJOD 2HQHA 4QVZA 1UGQB 2CSQA 5LJ5d 1VQ8T 5GAN7 1YJNQ 5HCKA 1M3BA 4RMOA 2LJ3A 9ATCB 2A28A 1UFFA 1ZQ1A 2O4XB 2DA9A 3BDUA 4XTVA 1YJWQ 3JCMV 2V1QA 3CMAT 1PSEA 4B9WA 1VQKA 4L5GA 2M9UA 3EFOA 4XK8E 4M78F 1YNZA 2KNBB 2ECZA 1M2VB 4AG2C 2LTOA 4QQDA 2D6FA 4HKEA 1FX7A 4RTYA 2NUTA 3G71A 2EW3A 2DMOA 2EBPA 3VJPA 3G71T 4HVWA 3VS1A 1K9MC 5IHIA 3RBBB 1MGQA 3CC7Q 1WHGA 1H92A 1MMDA 2MYSA 3GIBA 3RUXA 4DEXA 1MV0B 3OY9A 1NLOC 1IO6A 2L0AA 2L2PA 1WHKA 3TCJA 1M3AA 1RL2A 1SPKA 1YCSB 3QUIA 2CZ0B 4IIMA 3PTAA 2HKQB 4C8QG 1K8AU 1MV3A 2DAQA 3UT1A 2GGRA 1D1CA 1PRLC 5LJ3h 2LQKA 1KC8C 2J6OA 5FROA 4HT8A 4OMMA 3CC2A 1KIKA 2QQBA 3A8GB 3A98A 4L6V5 2D1XA 2BZXA 4FIBA 1B07A 5LL6S 4RTWA 4XTZA 1T3SA 1M9SA 1M8MA 5LJ5g 4JS5A 1QVPA 3EG3A 1IXDA 2RI5A 2G3RA 2DYIA 2L3SA 3V7SA 4OP0A 3NPFA 2H8HA 2I0NA 3HRTA 4KGZB 1R0BG 4K11A 3HRSA 4J9BA 4HXJA 4DQ2A 2OI3A 1NBEB 3EH1A 4J6XA 1VUBA 1M1KU 1AHJB 1RAGB 3TSZA 1M1GA 3JCMW 3S3OA 1MNDA 5EG2A 4C8QB 2FZGB 4XU0A 4KBMB 4X1VA 1WJRA 3OB9A 1HYOA 2HDAA 5KYWA 3H0HA 1K9MU 1RABB 3CXCA 2YLBA 2YDLA 2J06A 1BYMA 3JCMc 2EYXA 3RR6A 2DBMA 2QDYB 4M4ZA 1D3BB 2GTOA 2DL5A 3VS4A 2DILA 3HHTB 2LP5A 5IHNA 3S3NA 4LN2A 1PC0A 4M7DG 4ZNXA 3FJ5A 2E1HA 2MOXA 2RPNA 3C94A 3ASKA 4M77A 4DBRA 2YWWA 2NUTB 3P8DA 3I55T 2LVMA 1WHMA 4C5EA 3CCVQ 2YUNA 2EJGA 2KGTA 4OGCA 4X9DA 3M0QA 3M0RA 3MKDA 3I55Q 4A4HA 1H641 5IHKA 4P5NA 2P84A 3BDLA 3V7RA 2QA4Q 2EAYA 1EZZB 1XQHA 1WA7A 2DEQA 2ZPIB 3KFVA 3DLLA 3RMSA 3MO8A 3M56A 1RAEB 2HKNA 1UECA 4N4GA 1RAHB 1PWTA 1Y07A 2D8HA 3BY7A 1W4SA 4JDSA 3QJ6A 1M8VA 3H0IA 4F7UA 3CCJQ 3GPLA 5FWBA 2DLPA 2W0ZA 2OTJT 1Z9QA 4FYWB 3OS2A 5LJ3d 5CQYA 1B3QA 4FSSA 4HA8A 1VQ4Q 3EH2A 2QXFA 3S3MA 2O9SA 2K3BA 1ZUYA 3G6EA 3C4SA 4F14A 1X6OA 2CP7A 1Q81U 4M7AE 1BI3A 3JCMg 1OULA 2EYWA 1YITQ 2CP0A 1RLPC 2P0PA 2RQTA 1PD0A 2PUKB 4KH1B 4N4HA 4LD9K 4OGEA 3VV0A 2AKLA 5GMKl 1D0YA 1OU8A 2FPDA 4FW2A 1VQPQ 1SRMA 4CC7A 3PVQA 1H3ZA 3MP1A 1LPLA 3ZL7C 5KE2A 4M75E 4MDWA 2EIFA 1GL5A 2VVKA 1PSFA 3CCUT 1VYUA 1WLPB 1FWZA 1NM7A 1NG2A 4D6WA 2LX7A 1GCPA 2L3RA 3WVDB 5FLXE 3QG1A 1QVFA 3NHNA 2IIMA 5KCOA 3RKXA 3V8KA 3BW1A 3E9FA 3REAB 4BI4A 2K9GA 3VS7A 5KYXB 4C0DB 2IVWA 2BIVA 1BCOA 1AT1B 1WYXA 1M3CA 3G71Q 1FMVA 4ZGEB 2VYTA 2HBPA 3M55A 4OMQA 4XTXA 4M7AG 4DEYA 2F2VA 5CIUA 3EGDA 2EYYA 4A53A 4BY6B 2JT4A 4FL6A 1T0JA 3VU3C 2GFUA 1BKBA 2ZZDA 4OMPA 4EMGA 5CKHA 3HL8A 4JS4A 3CCEQ 2DJZA 4IUQA 1ABOA 2DO3A 2D0QB 3A8MB 2CKKA 1IREB 1D09B 5KYNA 3QYGB 1TS9A 4M7DB 4ZN3A 3LWHA 2DD5A 1G3SA 3QDRB 3I5RA 1YIJT 2EGEA 4PJOA 5CR2A 3H0FA 2DK3A 2OX7A 2SRCA 4JPBW 1I4K1 1H8KA 4A4FA 4M78D 1UGVA 1YIJQ 4OMFB 4QVCA 1VQ5Q 2CP3A 1OPLA 4LDYA 4UC4A 4M7AB 4DOVA 5I2MA 4F7UF 1KQSA 4J6WA 1I07A 4OMOA 5GANg 2XDBA 1IGQA 5KYUB 3VYGA 5GAMe 1BK2A 4J9GA 3SB2A 5C0MA 1JBMA 1Q95G 4RG2A 3H6ZA 3MEWA 1M27C 1S1NA 3OYKA 4C92G 4BDYA 4PLIA 2CGHA 3C0CA 4JZ3A 2DXCA 1OQKA 1UHFA 1VQ7T 3HP9A 2KEAA 5LJ5h 1S72A 3URGA 1YHQT 3QZ5B 4DBHA 1M90U 2DD4A 4ZN1A 3VS5A 1I8FA 1OZ3A 1YHQA 4PFOA 3JCMP 3OYLA 2DEUA 4BD3A 3U23A 4J9FA 5GAN2 4EMKA 1Q7YR 4RTZA 5LJ5e 1TU0B 5KH6A 3CCRA 1WXUA 3PE0A 4VUBA 2LCCA 5J26A 2MI6A 7AT1B 1W2BP 1W2BS 1GBRA 1KHCA 1JJ2P 1W70A 4A4KA 3LX7A 1SF9A 2KE9A 3CCVT 2AKKA 5GAMj 3J81E 5DLQE 1YWPA 3PMIA 5CO7A 1Y71A 3CMEA 4J9CA 2AZVA 3CCVA 4RCBA 3FB9A 2SEMA 2RQUA 2J6FA 4QKUA 2QDLA 2I2LA 3DKMA 3V8JA 2JNGA 2F5TX 1E6GA 4LUEA 1UHCA 5I22A 2OTLA 3MJXA 2KVQG 3M4GA 1X27A 3PIOA 1GXIE 2RO0A 3OQ5A 2HNIA 3JB9G 1NEGA 4O5VA 1X01A 1U1SA 5GANd 4M7DD 1EIFA 3MEVA 3E2UA 4C8QE 1JO8A 1GFCA 1OU9A 2DF6A 4BY6C 4F16A 2EGAA 3HSBA 2RB6A 2G6FX 3CC2T 3QPHA 3JB9H 3A8HB 3EAEA 1K0XA 2A7YA 1AOJA 2FO0A 2CT3A 1YI2Q 1R0CB 2A0FB 3CC2Q 4MDXA 2Y4YA 3AHUA 1LJOA 2OAUA 2QQ9A 4M75B 3CCUA 1W2BA 1K9MR 2E6ZA 3FRNA 4E7JA 1N8RR 2LNVA 2PVOB 2KRNA 4RUGA 5KE3A 1TOVA 2LRQA 4E7LA 3UA7A 1K9AA 1U1TA 5GAN8 2CH4A 4RTVA 1B7TA 4CC2A 4PJNA 2EQUA 3EFSA 1F1BB 2K3XA 4N4IA 4BUGA 3CC7A 4XU1A 2F2WA 1GBQA 4R55A 2MWPA 1O9SA
chains in the Genus database with same CATH topology
3A98A 4RTUA 1VYTA 2D1XA 2BZXA 2YT6A 2HBWA 3VS6A 1B07A 4LE9A 2KRMA 1ZBJA 2C0IA 3I35A 2M51A 4RTWA 1T3SA 1M8MA 1X69A 5GJWB 5FW9A 1UJYA 2ESWA 2K2MA 1Z9ZA 3EG3A 4AFSC 2KT1A 2BTTA 2L3SA 3NPFA 4AFQC 2H8HA 2I0NA 2KR3A 2L3QA 1UJ0A 4IIOA 1JEGA 4K11A 4J9BA 4WCIA 1CSKA 1GFDA 1XOVA 4HXJA 2OI3A 2ROTA 1SRLA 3UF4A 3TSZA 3VS2A 2O31A 4OMLA 1ABQA 4J9IA 2PTKA 1UTIA 3UATA 1U3OA 1GCQA 4X1VA 5IXFA 2JTEA 2HDAA 1AZEA 2ED0A 2CUBA 4D8KA 2A37A 3H0HA 1SHFA 2DE0X 2FEIA 2CSIA 2YDLA 2J06A 2EYXA 2B86A 2DBMA 5IH2A 4M4ZA 3LH5A 2GTOA 1UDLA 2DL5A 2EGCA 3VS4A 2DILA 2K7AA 2D8JA 2LP5A 5IHNA 1BU1A 1OPKA 3TVTA 1SSHA 4LN2A 2DNUA 4JJDA 3M0TA 4ZNXA 4ESRA 2CREA 3FJ5A 3PVLA 3I9QA 2MOXA 2RPNA 2JM9A 1QCFA 1YN8A 5I11A 3NGPA 1X43A 3M0UA 2GNCA 2ABLA 1H3HA 2DM1A 2FRYA 2YUNA 4HVVA 1X2QA 2KGTA 4HVUA 2MIOA 1AVZC 3M0QA 3M0RA 2KYMA 2EQIA 5IHKA 2PNIA 2J7IA 1V1CA 2KRSA 1WIEA 3EG1A 1J3TA 1HD3A 5EC7A 1K76A 1HSQA 1WA7A 2HCKA 3KFVA 1UUEA 2JS0A 2YUQA 1W1FA 2DL8A 2XMFA 1UECA 1M30A 1PWTA 2D8HA 1LCKA 2EPDA 4ORZA 2YSQA 1EFNA 1SHGA 3H0IA 5FWBA 2DLPA 2W0ZA 1UG1A 2OAWA 1Z9QA 1KFZA 2RF0A 1B3QA 1NYFA 4FSSA 2P4RA 4KRTA 2LCSA 2KBTA 1CKBA 5GJVB 1QWFA 2O9SA 1I1JA 1NYGA 2K3BA 1ZUYA 2RQWA 2CT4A 2O2OA 4F14A 1X6BA 3QWYA 2LZ6B 1E6HA 2A36A 2LQWA 2JS2A 3SEMA 4F17A 1PHTA 2EKHA 2LMJA 1OOTA 4J9EA 1U06A 5L23A 2RQRA 2DX1A 1QLYA 4AFZC 2EYWA 1WX6A 2JW4A 2NUZA 1WXBA 1JXMA 4Y92A 1RLPC 2RQTA 1WXTA 1AWJA 3SHWA 3M0SA 1PKSA 2AKLA 2DVJA 2FPDA 4CC4B 2M0YA 2KXCA 2VWFA 1ZSGA 2DL7A 1SRMA 2KROA 3EHRA 1YWOA 4CC7A 3PVQA 1W6XA 2CDTA 1WFWA 1U5SA 3VS3A 2BZYA 3ZL7C 1VA7A 1CKAA 2JM8A 3TSWA 2KXDA 2DYBA 2PZ1A 1GL5A 2VVKA 1VYUA 1WLPB 1A0NB 1NM7A 1NG2A 1JXOA 2LX7A 1K0SA 5FWCA 1GCPA 1MUZA 1SEMA 2BZ8A 4Z8AA 4JJCA 1PKTA 1AWWA 1ZLMA 3NHNA 3M0PA 2IIMA 2X3XD 2K6DA 3REAB 2C0TA 3VRZA 2K9GA 3EG2A 3VS7A 2GTJA 4GLMA 2AZSA 1QWEA 2LJ0A 1WYXA 1M3CA 1I0CA 4OMQA 1WI7A 4DEYA 2F2VA 3I5SA 2DL3A 2EYYA 1BBZA 2RNAA 2KYBA 2DRMA 2JT4A 4AG1C 1T0JA 1ZUKA 4OMPA 2O9VA 5ECAA 1PNJA 4RTTA 2LNHB 1ABOA 2DL4A 3EG0A 2RMOA 1Y57A 1ZUUA 2DBKA 1FYNA 3REBB 3I5RA 2DRKA 2W10A 2EGEA 4EIKA 1AD5A 1QKWA 3CQTA 1AWXA 3H0FA 2SRCA 4JPBW 1T3LA 2EYZA 2E5KA 1H8KA 2FRWA 1UGVA 1KJWA 1TUCA 1NLPC 2RQVA 3EGUA 2FPEA 4QT7A 2HSPA 1OPLA 2AK5A 2K79A 2F2XA 3VRYA 1I07A 3JV3A 4OMOA 4J9DA 1AEYA 2VKNA 4LNPA 3THKA 4LUDA 2CUDA 3RNJA 1JQQA 2ROLA 1G2BA 3R6NA 1BK2A 4J9GA 1M27C 1S1NA 2ENMA 1TG0A 3C0CA 1NEBA 4JZ3A 2CH4W 1KSWA 2EVRA 1UHFA 2KEAA 2J05A 1UE9A 2MCNA 2ED1A 2O88A 3VS0A 1RI9A 1FMKA 3VS5A 2LJ1A 1T0HA 1PRMC 1GRIA 1K4US 2LQNA 3ULRB 3U23A 2C0OA 1K1ZA 4J9FA 4CC3A 4A63B 3O5ZA 1GCQC 2L3PA 4RTZA 1WXUA 3PE0A 1HJDA 1WDXA 4E6RA 2A08A 3EHQA 1E7OA 2OJ2A 5IXBA 1GBRA 4RTXA 1RLQC 1W70A 4R0KA 2D0NA 1X6GA 4GBQA 3IQLA 2KE9A 2AKKA 2CSQA 1YWPA 5HCKA 1M3BA 4J9CA 2AZVA 1Y0MA 2LJ3A 2YUOA 1ZX6A 2A28A 1UFFA 2DA9A 2SEMA 1X2KA 2RQUA 4OMNA 2J6FA 2GBQA 2JMCA 2HEQA 2QDLA 4HCKA 2X3WD 1E6GA 1G83A 2V1QA 4LUEA 1UHCA 5I22A 2RN8A 4D8DA 1X27A 2FG0A 1YNZA 2KNBB 1NEGA 2ECZA 1N5ZA 1JU5C 1YP5A 4AG2C 2JXBA 1JO8A 1GFCA 2DF6A 4F16A 2EGAA 4RTYA 2DJQA 2G6FX 1QKXA 2EW3A 3H41A 2DMOA 2EBPA 1K0XA 1AOJA 2FO0A 4HVWA 3VS1A 2V1RA 2YUPA 5IHIA 3GBQA 2CT3A 2KT8A 1AWOA 3RBBB 4AFUC 3NMZC 1AZGB 3UA6A 1H92A 1OEBA 2NWMA 4DEXA 1MV0B 1NLOC 1IO6A 2L0AA 2L2PA 4JZ4A 2KRNA 4RUGA 1BB9A 1M3AA 1ARKA 1SPKA 2FPFA 4Z88A 1YCSB 1RUWA 4IIMA 3UA7A 2J6KA 1MV3A 1K9AA 2CH4A 4RTVA 2GGRA 4CC2A 4Z89A 2GQIA 1PRLC 2JMAA 2J6OA 1OV3A 3QWXX 4J9HA 1TUDA 4JJBA 4OMMA 1VYVA 2F2WA 1GBQA 1KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A98 A;  4RTU A;  1VYT A;  2D1X A;  2BZX A;  2YT6 A;  2HBW A;  3VS6 A;  1B07 A;  4LE9 A;  2KRM A;  1ZBJ A;  2C0I A;  3I35 A;  2M51 A;  4RTW A;  1T3S A;  1M8M A;  1X69 A;  5GJW B;  5FW9 A;  1UJY A;  2ESW A;  2K2M A;  1Z9Z A;  3EG3 A;  4AFS C;  2KT1 A;  2BTT A;  2L3S A;  3NPF A;  4AFQ C;  2H8H A;  2I0N A;  2KR3 A;  2L3Q A;  1UJ0 A;  4IIO A;  1JEG A;  4K11 A;  4J9B A;  4WCI A;  1CSK A;  1GFD A;  1XOV A;  4HXJ A;  2OI3 A;  2ROT A;  1SRL A;  3UF4 A;  3TSZ A;  3VS2 A;  2O31 A;  4OML A;  1ABQ A;  4J9I A;  2PTK A;  1UTI A;  3UAT A;  1U3O A;  1GCQ A;  4X1V A;  5IXF A;  2JTE A;  2HDA A;  1AZE A;  2ED0 A;  2CUB A;  4D8K A;  2A37 A;  3H0H A;  1SHF A;  2DE0 X;  2FEI A;  2CSI A;  2YDL A;  2J06 A;  2EYX A;  2B86 A;  2DBM A;  5IH2 A;  4M4Z A;  3LH5 A;  2GTO A;  1UDL A;  2DL5 A;  2EGC A;  3VS4 A;  2DIL A;  2K7A A;  2D8J A;  2LP5 A;  5IHN A;  1BU1 A;  1OPK A;  3TVT A;  1SSH A;  4LN2 A;  2DNU A;  4JJD A;  3M0T A;  4ZNX A;  4ESR A;  2CRE A;  3FJ5 A;  3PVL A;  3I9Q A;  2MOX A;  2RPN A;  2JM9 A;  1QCF A;  1YN8 A;  5I11 A;  3NGP A;  1X43 A;  3M0U A;  2GNC A;  2ABL A;  1H3H A;  2DM1 A;  2FRY A;  2YUN A;  4HVV A;  1X2Q A;  2KGT A;  4HVU A;  2MIO A;  1AVZ C;  3M0Q A;  3M0R A;  2KYM A;  2EQI A;  5IHK A;  2PNI A;  2J7I A;  1V1C A;  2KRS A;  1WIE A;  3EG1 A;  1J3T A;  1HD3 A;  5EC7 A;  1K76 A;  1HSQ A;  1WA7 A;  2HCK A;  3KFV A;  1UUE A;  2JS0 A;  2YUQ A;  1W1F A;  2DL8 A;  2XMF A;  1UEC A;  1M30 A;  1PWT A;  2D8H A;  1LCK A;  2EPD A;  4ORZ A;  2YSQ A;  1EFN A;  1SHG A;  3H0I A;  5FWB A;  2DLP A;  2W0Z A;  1UG1 A;  2OAW A;  1Z9Q A;  1KFZ A;  2RF0 A;  1B3Q A;  1NYF A;  4FSS A;  2P4R A;  4KRT A;  2LCS A;  2KBT A;  1CKB A;  5GJV B;  1QWF A;  2O9S A;  1I1J A;  1NYG A;  2K3B A;  1ZUY A;  2RQW A;  2CT4 A;  2O2O A;  4F14 A;  1X6B A;  3QWY A;  2LZ6 B;  1E6H A;  2A36 A;  2LQW A;  2JS2 A;  3SEM A;  4F17 A;  1PHT A;  2EKH A;  2LMJ A;  1OOT A;  4J9E A;  1U06 A;  5L23 A;  2RQR A;  2DX1 A;  1QLY A;  4AFZ C;  2EYW A;  1WX6 A;  2JW4 A;  2NUZ A;  1WXB A;  1JXM A;  4Y92 A;  1RLP C;  2RQT A;  1WXT A;  1AWJ A;  3SHW A;  3M0S A;  1PKS A;  2AKL A;  2DVJ A;  2FPD A;  4CC4 B;  2M0Y A;  2KXC A;  2VWF A;  1ZSG A;  2DL7 A;  1SRM A;  2KRO A;  3EHR A;  1YWO A;  4CC7 A;  3PVQ A;  1W6X A;  2CDT A;  1WFW A;  1U5S A;  3VS3 A;  2BZY A;  3ZL7 C;  1VA7 A;  1CKA A;  2JM8 A;  3TSW A;  2KXD A;  2DYB A;  2PZ1 A;  1GL5 A;  2VVK A;  1VYU A;  1WLP B;  1A0N B;  1NM7 A;  1NG2 A;  1JXO A;  2LX7 A;  1K0S A;  5FWC A;  1GCP A;  1MUZ A;  1SEM A;  2BZ8 A;  4Z8A A;  4JJC A;  1PKT A;  1AWW A;  1ZLM A;  3NHN A;  3M0P A;  2IIM A;  2X3X D;  2K6D A;  3REA B;  2C0T A;  3VRZ A;  2K9G A;  3EG2 A;  3VS7 A;  2GTJ A;  4GLM A;  2AZS A;  1QWE A;  2LJ0 A;  1WYX A;  1M3C A;  1I0C A;  4OMQ A;  1WI7 A;  4DEY A;  2F2V A;  3I5S A;  2DL3 A;  2EYY A;  1BBZ A;  2RNA A;  2KYB A;  2DRM A;  2JT4 A;  4AG1 C;  1T0J A;  1ZUK A;  4OMP A;  2O9V A;  5ECA A;  1PNJ A;  4RTT A;  2LNH B;  1ABO A;  2DL4 A;  3EG0 A;  2RMO A;  1Y57 A;  1ZUU A;  2DBK A;  1FYN A;  3REB B;  3I5R A;  2DRK A;  2W10 A;  2EGE A;  4EIK A;  1AD5 A;  1QKW A;  3CQT A;  1AWX A;  3H0F A;  2SRC A;  4JPB W;  1T3L A;  2EYZ A;  2E5K A;  1H8K A;  2FRW A;  1UGV A;  1KJW A;  1TUC A;  1NLP C;  2RQV A;  3EGU A;  2FPE A;  4QT7 A;  2HSP A;  1OPL A;  2AK5 A;  2K79 A;  2F2X A;  3VRY A;  1I07 A;  3JV3 A;  4OMO A;  4J9D A;  1AEY A;  2VKN A;  4LNP A;  3THK A;  4LUD A;  2CUD A;  3RNJ A;  1JQQ A;  2ROL A;  1G2B A;  3R6N A;  1BK2 A;  4J9G A;  1M27 C;  1S1N A;  2ENM A;  1TG0 A;  3C0C A;  1NEB A;  4JZ3 A;  2CH4 W;  1KSW A;  2EVR A;  1UHF A;  2KEA A;  2J05 A;  1UE9 A;  2MCN A;  2ED1 A;  2O88 A;  3VS0 A;  1RI9 A;  1FMK A;  3VS5 A;  2LJ1 A;  1T0H A;  1PRM C;  1GRI A;  1K4U S;  2LQN A;  3ULR B;  3U23 A;  2C0O A;  1K1Z A;  4J9F A;  4CC3 A;  4A63 B;  3O5Z A;  1GCQ C;  2L3P A;  4RTZ A;  1WXU A;  3PE0 A;  1HJD A;  1WDX A;  4E6R A;  2A08 A;  3EHQ A;  1E7O A;  2OJ2 A;  5IXB A;  1GBR A;  4RTX A;  1RLQ C;  1W70 A;  4R0K A;  2D0N A;  1X6G A;  4GBQ A;  3IQL A;  2KE9 A;  2AKK A;  2CSQ A;  1YWP A;  5HCK A;  1M3B A;  4J9C A;  2AZV A;  1Y0M A;  2LJ3 A;  2YUO A;  1ZX6 A;  2A28 A;  1UFF A;  2DA9 A;  2SEM A;  1X2K A;  2RQU A;  4OMN A;  2J6F A;  2GBQ A;  2JMC A;  2HEQ A;  2QDL A;  4HCK A;  2X3W D;  1E6G A;  1G83 A;  2V1Q A;  4LUE A;  1UHC A;  5I22 A;  2RN8 A;  4D8D A;  1X27 A;  2FG0 A;  1YNZ A;  2KNB B;  1NEG A;  2ECZ A;  1N5Z A;  1JU5 C;  1YP5 A;  4AG2 C;  2JXB A;  1JO8 A;  1GFC A;  2DF6 A;  4F16 A;  2EGA A;  4RTY A;  2DJQ A;  2G6F X;  1QKX A;  2EW3 A;  3H41 A;  2DMO A;  2EBP A;  1K0X A;  1AOJ A;  2FO0 A;  4HVW A;  3VS1 A;  2V1R A;  2YUP A;  5IHI A;  3GBQ A;  2CT3 A;  2KT8 A;  1AWO A;  3RBB B;  4AFU C;  3NMZ C;  1AZG B;  3UA6 A;  1H92 A;  1OEB A;  2NWM A;  4DEX A;  1MV0 B;  1NLO C;  1IO6 A;  2L0A A;  2L2P A;  4JZ4 A;  2KRN A;  4RUG A;  1BB9 A;  1M3A A;  1ARK A;  1SPK A;  2FPF A;  4Z88 A;  1YCS B;  1RUW A;  4IIM A;  3UA7 A;  2J6K A;  1MV3 A;  1K9A A;  2CH4 A;  4RTV A;  2GGR A;  4CC2 A;  4Z89 A;  2GQI A;  1PRL C;  2JMA A;  2J6O A;  1OV3 A;  3QWX X;  4J9H A;  1TUD A;  4JJB A;  4OMM A;  1VYV A;  2F2W A;  1GBQ A;  1KIK A; 
#chains in the Genus database with same CATH topology
 5LJ3 f;  4M7D F;  5HKC A;  1BIB A;  4LE9 A;  2BE7 D;  4IUR A;  3CPF A;  5GJW B;  1X69 A;  4FYV B;  3CCQ Q;  2YRV A;  2K2M A;  1Z9Z A;  3CCL Q;  2BTT A;  1VQK T;  3PFS A;  1KHI A;  3JB9 D;  5GAN f;  4KH0 B;  1NJI U;  4M7D E;  1JEG A;  3JCM e;  1KQS S;  2E41 A;  2VGM A;  3OS5 A;  1CSK A;  1GFD A;  1XOV A;  4PFZ A;  4C0Z A;  2ROT A;  2K5F A;  8AT1 B;  4X34 A;  4LDX A;  4OML A;  3OMG A;  4PLL A;  4J9I A;  2HQE A;  3J80 E;  2PTK A;  3FC3 A;  1UTI A;  4C5I A;  5IXF A;  4OVA A;  1ZA2 B;  1RAF B;  1VIF A;  3JCM Q;  2O01 E;  3CCQ A;  3GF5 A;  2V8J A;  4J7F A;  2B86 A;  5IH2 A;  1FMW A;  3V8L A;  2DKG A;  2EGC A;  2B8A A;  2D8J A;  1Q7Y C;  3TVT A;  1SSH A;  3DB3 A;  4JJD A;  3M0T A;  3OS1 A;  1QCN A;  3RKW A;  1VQL T;  1VIE A;  3I55 A;  2JM9 A;  2Y90 A;  2JZ2 A;  1VQM A;  3NGP A;  4JUV A;  1UB4 A;  1X43 A;  3FJP A;  1X2Q A;  1M4Z A;  2KY9 A;  5GAN e;  3A8L B;  2EQI A;  4F7U G;  3GNF B;  1V1C A;  1N27 A;  4ELZ C;  1HD3 A;  5EC7 A;  3LW5 E;  2Y4X A;  5GMK h;  2XKO C;  3G1J A;  3G6E T;  4J6Y A;  2HCK A;  4PJO E;  1W1F A;  2DL8 A;  2XMF A;  4ZTJ A;  4FCY A;  1VQ9 T;  4BE1 A;  1LCK A;  2R5A A;  1NJI R;  2OTJ A;  3OBW A;  1SHG A;  2IG0 A;  2GQV A;  4IKF A;  2K3Y A;  1KFZ A;  4MMK A;  1ZSZ C;  3CPW S;  4KRT A;  3X20 B;  3QO3 A;  2LCS A;  3JCM h;  1CKB A;  5GJV B;  5GMK j;  1I1J A;  2ZPH B;  1BI2 A;  1R8O B;  5HY6 A;  2LZ6 B;  2JS2 A;  1PHT A;  3CC4 T;  1OOT A;  1ZBX A;  1MNE A;  4F7U B;  2DX1 A;  1BI0 A;  1QLY A;  3E1S A;  4AFZ C;  4PJL A;  2NUZ A;  3CEY A;  3CMA A;  1VQ6 Q;  1VQO A;  5I2S A;  1QVG A;  1WXT A;  1AWJ A;  4ME7 A;  3SHW A;  1ACM B;  1PKS A;  3M53 A;  1XTD A;  2FL7 A;  3CCM T;  2F69 A;  3BE3 A;  4CC4 B;  2M0Y A;  5GAO q;  3PGG A;  2KXC A;  1D1A A;  4MML A;  4YTL A;  2CP5 A;  2VWF A;  1BI1 A;  4ZGJ B;  1WFW A;  2XG8 D;  3KUF A;  1VA7 A;  2PUO B;  3TSW A;  3CXC S;  4E7K A;  3OW2 S;  2DZC A;  4M75 F;  4PK4 A;  5CAI A;  1A0N B;  1VQM Q;  1K8A C;  2GF7 A;  3QJY A;  4Z02 A;  1YJN A;  1MUZ A;  2BZ8 A;  4JJC A;  3C12 A;  1ZLM A;  3M0P A;  4M77 B;  1UGS B;  2K6D A;  4O6J A;  4BAC A;  5IT9 E;  3EG2 A;  2AZS A;  5GAO r;  1YJW T;  2KK4 A;  2P0Q A;  4E7S A;  1QVG S;  2K57 A;  4IUV A;  1I81 A;  5LJ5 j;  4WTO B;  4FM4 B;  2DL3 A;  4ZTF A;  3OYF A;  2DFU A;  3LGL A;  2KYB A;  2ZPB B;  2DRM A;  1YJN T;  3MP8 A;  4M78 B;  4XTY A;  4A54 A;  5CVI A;  5ECA A;  2EYQ A;  5GAN 4;  4ZGD B;  2KI7 A;  4M7A C;  4B9X A;  1G5V A;  2RHY A;  3RER A;  1N8R C;  2XK0 A;  3EG0 A;  3GP8 A;  2RMO A;  1ZUU A;  3H8Z A;  2DBK A;  5J39 A;  2DXU A;  1EX4 A;  2KMT A;  1Q82 U;  1BCM A;  1Q86 U;  4FSX A;  1VQ5 T;  2WSF E;  3CQT A;  1AWX A;  3EGD B;  3CCS T;  1T3L A;  4XQ3 A;  1I5O B;  1U8R A;  1YCY A;  1KJW A;  3QZ9 B;  4M78 A;  1KD1 U;  2K79 A;  5DLO A;  1B34 B;  1JB0 E;  4N0A A;  3JV3 A;  4NOY A;  4MZT A;  5CCA A;  4EMK B;  2YRC A;  4OB2 B;  2KQW A;  1D3B A;  4LNP A;  2CUD A;  2QAS A;  3VUZ A;  2RHX A;  3R6N A;  5FU6 C;  1ZA1 B;  5FU6 B;  1I5L A;  5LJ5 f;  5GMK e;  2ENM A;  1WJQ A;  1KSW A;  3CD6 T;  2EVR A;  2J05 A;  1UE9 A;  3FDR A;  2MCN A;  2ED1 A;  3G4S A;  1RI9 A;  4E2F B;  2QK0 A;  4CRI A;  1D0X A;  3OYC A;  1QVF S;  4C92 E;  1GRI A;  2ATC B;  2DZ9 A;  2PQW A;  1IB8 A;  3OYJ A;  1K1Z A;  4XTU A;  4KUI A;  4A63 B;  3O5Z A;  2OTL T;  5HK0 A;  1K73 R;  1TUG B;  2MWO A;  1YJ9 T;  3L1A A;  3L42 A;  2K5I A;  2A3L A;  3V7C A;  4M7A A;  1VQN T;  1WDX A;  4A4G A;  3L2W A;  1VQO T;  3D7S B;  2OTL Q;  1M2V A;  3JSC A;  3JCM J;  4AMC A;  2K2V A;  2D0N A;  3CME T;  3IQL A;  3RIR A;  3EFO B;  2RM4 A;  1Q82 C;  1Q86 C;  2QQA A;  2V8I A;  3EFR A;  4MZP A;  2EQJ A;  2EQK A;  5GAN 6;  3X28 B;  2WAC A;  2JMC A;  2HEQ A;  2DXB A;  2WSE E;  5FRN A;  4HCK A;  1C0M A;  5FRM A;  2X3W D;  3JCM f;  4BI8 B;  1WHL A;  1Q82 R;  1Q86 R;  5GAO m;  1VQ9 Q;  2COW A;  3PIP A;  1N5Z A;  1JU5 C;  4NL3 A;  1YP5 A;  3R6O A;  3J7A F;  2JXB A;  4F04 B;  1M1K R;  2PVD B;  1VQ4 T;  3CCS A;  1QKX A;  4Q5W A;  3H41 A;  2X4X A;  2ZCF B;  3OYM A;  2V1R A;  3OSV A;  2M02 A;  2KT8 A;  4OB0 B;  3BFM A;  1AWO A;  4BI3 A;  3OYD A;  2ZPE B;  1D1B A;  1AZG B;  3UA6 A;  4IUU A;  1OEB A;  2CZ6 B;  2NWM A;  4HCZ A;  4JZ4 A;  1BB9 A;  3JRZ A;  2R5M A;  4BB7 A;  3QYH B;  1RUW A;  3F70 A;  2RJD A;  3ER0 A;  4C92 F;  1KC8 U;  2RA2 A;  3ZFJ A;  5D7U A;  4Z89 A;  2GQI A;  3RES A;  4M77 C;  2COZ A;  4J9H A;  1TUD A;  4KUL A;  4DBQ A;  3HFN A;  1VYV A;  4LDW A;  4RTU A;  1VYT A;  2YT6 A;  4PJJ A;  3VS6 A;  2YHT A;  2KRM A;  3SWN A;  3E9G A;  1ZBJ A;  2RHI A;  2C0I A;  3I35 A;  4FW1 A;  4AFS C;  2AIR B;  2HAX A;  3CCR T;  1MMG A;  3SWN C;  4AFQ C;  2KR3 A;  4IIO A;  2DTO A;  4N0A C;  3JB9 F;  3CBM A;  2HZY A;  2RJC A;  2K5L A;  3OYG A;  2YRD A;  1SRL A;  2E12 A;  5I21 A;  3A1P A;  3OYI A;  3X26 B;  1FXX A;  1VQL A;  3E19 A;  1M5Q 1;  2O31 A;  1M90 C;  2LC4 A;  3UAT A;  2R58 A;  3KBG A;  2MMP A;  3T9N A;  2IPO B;  1PD1 A;  1SHF A;  4FT4 A;  3RMQ A;  5KYY B;  2FEI A;  2CSI A;  1YJ9 A;  3SDZ A;  2FZC B;  1UDL A;  2MPX C;  3G7Z A;  1WQ7 A;  4BE2 A;  2QYZ A;  1VQL Q;  2K7A A;  1PM3 A;  1OPK A;  2LT4 A;  4QVD A;  1VQ9 A;  1R77 A;  1PG5 B;  2E5Q A;  2RD1 A;  3I9Q A;  3NFC A;  3JAM E;  2QGF B;  2X4W A;  5CK9 A;  4JRK A;  2LCL A;  1YN8 A;  2XHC A;  5DM7 R;  5I11 A;  2X9H A;  2X35 A;  3M0U A;  2QTV A;  4M75 A;  3CC7 T;  4JJN K;  2X51 A;  2RHU A;  2E6N A;  2HQX A;  3QSU A;  1VQP A;  3GLX A;  4NL2 A;  2KRS A;  5GMK m;  1WIE A;  2LT1 A;  3EG1 A;  2XID A;  1KD1 C;  1J3T A;  2RHZ A;  1K76 A;  2CS7 A;  1HSQ A;  3JCM d;  2EKO A;  3CCE A;  2GCX A;  4JRI A;  2JS0 A;  4PJO C;  3CCE T;  3TQ7 P;  5D6Y A;  4PJO B;  2V26 A;  1M30 A;  4FYY B;  6AT1 B;  1YBY A;  5GAO n;  2EPD A;  2QEX A;  1VQ7 Q;  3INZ A;  1S72 T;  4TVR A;  1RI0 A;  3VYH B;  1YHQ Q;  5KCH A;  4M77 F;  2OAW A;  4QW2 A;  2L8D A;  2RF0 A;  3X25 B;  1NYF A;  1UGR B;  5DY9 A;  1S72 Q;  4C5G A;  4M7A D;  2QAZ A;  3H9N A;  1OYX A;  2DXT A;  2MK5 A;  1NYG A;  5L8R E;  2CT4 A;  2O2O A;  1X6B A;  3QWY A;  1E6H A;  2A36 A;  2LQW A;  4LD6 A;  3RKY A;  3SEM A;  4F17 A;  3LGF A;  2PVG B;  1MMN A;  2DIG A;  2EKH A;  3WXM B;  3AT1 B;  1NZ9 A;  1TWB A;  2RQR A;  1M90 R;  2JW4 A;  4M75 G;  5D6W A;  1KC8 R;  2VXE A;  2GFA A;  1K8A R;  4Y92 A;  3OA6 A;  4B6M A;  3CME Q;  2EQM A;  2CP6 A;  1OI1 A;  3HFO A;  3X24 B;  2DVJ A;  5FU7 B;  5KYX A;  2QQS A;  3MET A;  2DL7 A;  2KRO A;  3SD4 A;  3I56 Q;  1W6X A;  1U5S A;  4J5Y A;  2ZPG B;  1YJW A;  3Q1J A;  3CCL A;  2DYB A;  1Y96 A;  4M7A F;  4HCB A;  4A4E A;  1WNL A;  1BIA A;  4PJO F;  4M78 C;  1K0S A;  5FWC A;  2LQ8 A;  4II1 A;  2O4X A;  3QII A;  4ELY C;  2X3X D;  1TSF A;  2COY A;  3MHX A;  2GTJ A;  4GLM A;  2MAM A;  4MZM A;  2VC8 A;  4C92 D;  3PNW C;  1D0Z A;  5AYF A;  4FYX B;  2AHJ B;  4LDV A;  4PKC C;  1UEB A;  4J8O A;  3OBY A;  3L2V A;  2X4Y A;  2FHD A;  3O8V A;  1ZUK A;  1LOJ A;  1TXQ A;  2VV5 A;  4CI0 C;  2O9V A;  4RTT A;  2LNH B;  4RG8 A;  4C0D C;  4LDU A;  4M77 D;  2QA4 A;  3QHS A;  2BKD N;  4M78 G;  1WGS A;  4XU3 A;  2Z0W A;  2DPP B;  2QA4 T;  1IRX A;  1Y57 A;  2WSC E;  3SFM A;  2CYZ B;  3OW2 P;  4JRP A;  3OYH A;  1FYN A;  1AD5 A;  5LJ3 j;  3RDV A;  3OYA A;  1K73 U;  2RJE A;  3HTR A;  5GAO p;  4JRQ A;  4HCC A;  2JOY A;  1TTH B;  3M5A A;  4FT2 A;  1IZ6 A;  1NLP C;  1KQ1 A;  2FPE A;  4JLG A;  4M75 C;  2VAS A;  2JN0 A;  2F2X A;  5D6X A;  3LLR A;  2JTM A;  2VUB A;  4C92 B;  1C6V X;  1YI2 T;  3CBO A;  5J3B A;  2JTF A;  3CD6 Q;  1JQQ A;  1G2B A;  4RKU E;  2VGN A;  1HXD A;  2QTX A;  1ZSZ A;  5LJ3 g;  1TG0 A;  1YIT T;  5HK3 A;  1Q7Y U;  2O88 A;  3CCQ T;  2XIC A;  3QKJ A;  3CCL T;  1KD1 R;  1OX9 A;  2E10 A;  1T0H A;  1Q81 R;  5C6S A;  1SKU B;  1K4U S;  1OX8 A;  5GAN j;  3ULR B;  1VQN Q;  1LVK A;  3MPU B;  2KDS A;  1DJ7 B;  4CC3 A;  2L3P A;  1V29 B;  4PJO G;  1Y7X A;  4JLI A;  2XD0 A;  5FU7 C;  3C95 A;  2E4H A;  2CP2 A;  4E6R A;  2A08 A;  3L2U A;  3I56 A;  3EHQ A;  2MF2 A;  1VQM T;  3MP6 A;  1E7O A;  3CC4 A;  2OJ2 A;  3GNG A;  3S6W A;  2NLU A;  1VQK Q;  4RTX A;  3EG9 A;  1C1A A;  1RLQ C;  2M1H A;  2ZPF B;  3HRU A;  4GBQ A;  2JVV A;  1WHH A;  3CCM A;  1Y0M A;  2YUO A;  3EGX A;  1ZX6 A;  2V8K A;  2CZ7 B;  1X2K A;  4OMN A;  3VUB A;  2GBQ A;  1P92 A;  5GAM f;  1M1K C;  2F5K A;  1ZHI A;  1VQ8 Q;  1QW1 A;  1WZO A;  2RI2 A;  3N5B B;  1G3W A;  2E3I A;  1G83 A;  4M78 E;  1WHJ A;  2RN8 A;  4D8D A;  2QI2 A;  2HL3 A;  3JCM X;  5CKB A;  2FG0 A;  1JJ2 A;  3UWN A;  5A0G A;  5LJ3 e;  4PNO A;  2E3H A;  2P4T A;  3CCJ A;  3FIF A;  3NTK A;  1QP2 A;  3QXE B;  3KXT A;  1KG1 A;  2HD0 A;  4PFP A;  1Q81 C;  3OS0 A;  2DJQ A;  5IAY A;  1RAI B;  1MHN A;  4M7D A;  3G6E Q;  4BDZ A;  2XDD A;  2YUP A;  2YLC A;  2K4Y A;  3GBQ A;  1JJ2 S;  2XU8 A;  4AFU C;  2RH2 A;  3EGX B;  3NMZ C;  3M58 A;  5A0D A;  4C5H A;  3ZEH A;  5GAO l;  4GLK A;  3OYN A;  3CCJ T;  2CZ1 B;  1K73 C;  2OTJ Q;  1ARK A;  3UPU A;  2FPF A;  4Z88 A;  3SWN B;  4OB3 B;  3OYB A;  1RAA B;  4X9C A;  2BE9 B;  1QCO A;  2J6K A;  2X4J A;  2FZK B;  3HKS A;  2JUF A;  2NUP B;  1NPP A;  2JMA A;  5KYU A;  1OV3 A;  3QWX X;  2KSS A;  3TU4 K;  4JJB A;  3A8O B;  1XJW B;  2DTI A;  5A2Q E;  2HBW A;  4IUT A;  4QQ6 A;  4WF2 A;  2M51 A;  3LWI A;  1VQ6 T;  4C8Q D;  1RAD B;  5KYY A;  5FW9 A;  1WJS A;  1UJY A;  2EFI A;  2ESW A;  2NYS A;  4E7Z A;  2KT1 A;  3P8H A;  3MCA B;  2EWN A;  1VQN A;  2EJ9 A;  2L3Q A;  1UJ0 A;  1JRI A;  2D9T A;  2VXF A;  1QVF P;  4WCI A;  1G8X A;  3CPW A;  4OF1 A;  2NUP A;  1IGU A;  5GAN h;  2H3E B;  3M9Q A;  3M54 A;  4IUP A;  3UF4 A;  3VS2 A;  1VQO Q;  1ABQ A;  2HSE B;  3OMC A;  5GAN 3;  1U3O A;  1GCQ A;  4LXC A;  2JTE A;  2DIQ A;  1IHV A;  1VQ7 A;  1AZE A;  2ED0 A;  2CUB A;  4D8K A;  4ATO A;  2A37 A;  2DTH A;  3L2Z A;  4V2S A;  2DE0 X;  1SSF A;  3MEU A;  3LH5 A;  1N6A A;  3QBY A;  1BU1 A;  1HK9 A;  1UGP B;  2PU9 B;  2DNU A;  1MMA A;  4ESR A;  1O75 A;  2CRE A;  3PVL A;  1YIJ A;  1XNI A;  5CKD A;  4KGV B;  3ME9 A;  1WPY A;  1QCF A;  2C06 A;  4R56 A;  3P8B B;  4Y28 E;  1VQ8 A;  3MEA A;  3CXC P;  2GNC A;  2ABL A;  1H3H A;  2DM1 A;  3QDF A;  2FRY A;  2M0O A;  4HVV A;  4AT1 B;  2EJF A;  4HVU A;  2L89 A;  2MIO A;  2RJF A;  1AVZ C;  4KUD K;  2KYM A;  2M16 A;  2LDM A;  3TRE A;  2PNI A;  2J7I A;  4C8Q A;  1ZSZ B;  2LX9 A;  1WQW A;  3ZBD A;  1UUE A;  1G3Y A;  2YUQ A;  3CMA Q;  3L2R A;  3CCS Q;  1NJI C;  3TEE A;  1KK7 A;  1TH7 A;  2P0K A;  4ORZ A;  1YFN A;  3LYI A;  3G4S T;  2YSQ A;  4J7I A;  4M77 E;  1EFN A;  5CQX A;  3NTI A;  3EG9 B;  1UG1 A;  1RAC B;  2FB7 A;  3OSS C;  1QVG P;  2DER A;  3CPW P;  2P4R A;  3G4S Q;  1VQ4 A;  4DBF A;  2KBT A;  1QWF A;  1V76 A;  1Y96 B;  4C8Q C;  4FU6 A;  5GAM g;  2RQW A;  3CBP A;  1YJ9 Q;  2LMJ A;  2F1L A;  5GAM h;  4KGX B;  4J9E A;  1U06 A;  5L23 A;  3OW2 A;  2E70 A;  1B34 A;  1WX6 A;  3UDC A;  1WXB A;  1JXM A;  3OYE A;  2RI3 A;  2JJ9 A;  1X75 C;  5KYW B;  3I56 T;  2RK2 A;  3M0S A;  2BUD A;  3OYY A;  1QQJ A;  3WVE B;  4E7H A;  1N8R U;  1VQ5 A;  4C8Q F;  4ANJ A;  2ZGW A;  1ZSG A;  3EHR A;  1YWO A;  2DVE A;  2CDT A;  2E64 A;  3FLG A;  3DB4 A;  5AT1 B;  3VS3 A;  2BZY A;  2JM8 A;  1CKA A;  2KXD A;  4M75 D;  3GOX A;  2PZ1 A;  1VQP T;  4PJM A;  1JXO A;  2XDP A;  3JB9 I;  4C0G A;  5GAN 5;  4Y91 A;  1SEM A;  4Z8A A;  2FYK A;  3CCU Q;  1PKT A;  1AWW A;  2HL5 C;  1VOM A;  2QGG A;  2C0T A;  2AT1 B;  3VRZ A;  2FVU A;  1N9S A;  1QMC A;  2QEX T;  3DLM A;  1QWE A;  2LJ0 A;  4M77 G;  1I0C A;  1WI7 A;  4C0F A;  2QEX Q;  3I5S A;  1BBZ A;  2RNA A;  4EPC A;  3PMT A;  4BE0 A;  4AG1 C;  5CKF A;  1NE8 A;  1PNJ A;  4RCC A;  1YI2 A;  2QG9 B;  4QQG A;  1OZ2 A;  4E47 A;  2DL4 A;  4PL6 A;  2ZAE A;  4DOW A;  8ATC B;  2RK1 A;  4C92 C;  4EDU A;  1KQ2 A;  2HMA A;  4L59 A;  5M9O A;  1N9R A;  4XU2 A;  3CD6 A;  1YIT A;  4J83 A;  3REB B;  2DRK A;  2W10 A;  3FEO A;  3PT9 A;  4EIK A;  1QKW A;  2H3J A;  2EYZ A;  2E5K A;  3JCM b;  2FRW A;  1TUC A;  2XI9 A;  2RQV A;  4EMH A;  3EGU A;  3CC4 Q;  4QT7 A;  2HSP A;  2AK5 A;  4KT0 E;  4F7U E;  4E7I A;  3L2Q A;  3VRY A;  2QQR A;  1NPR A;  1VQ6 A;  4J9D A;  2DET A;  4HT9 A;  5GAM d;  3M57 A;  1LNX A;  1AEY A;  2VKN A;  3LH0 A;  3THK A;  4LUD A;  3RNJ A;  3CCM Q;  2ROL A;  5IN1 A;  2R57 A;  1IHW A;  4M7D C;  2YXY A;  1NEB A;  5GMK i;  2CH4 W;  2E65 A;  5A0L A;  4XTW A;  4NS5 A;  1SG5 A;  5CKE A;  3VS0 A;  3CCR Q;  3M4Y A;  4EMK C;  1FMK A;  2LJ1 A;  1PRM C;  3M59 A;  1KQS P;  4OB1 B;  4GY5 A;  2LQN A;  1M1F A;  1M2O A;  4DA4 A;  1G3T A;  2L5Q A;  2C0O A;  3A5Z B;  4XAX B;  4C92 A;  1GCQ C;  3JB9 J;  3HPW A;  2VB6 A;  1HJD A;  1QP3 A;  2KAF A;  5IXB A;  1PCX A;  3NTH A;  3VKI A;  4R0K A;  1X6G A;  4PJO D;  2HQH A;  4QVZ A;  1UGQ B;  2CSQ A;  5LJ5 d;  1VQ8 T;  5GAN 7;  1YJN Q;  5HCK A;  1M3B A;  4RMO A;  2LJ3 A;  9ATC B;  2A28 A;  1UFF A;  1ZQ1 A;  2O4X B;  2DA9 A;  3BDU A;  4XTV A;  1YJW Q;  3JCM V;  2V1Q A;  3CMA T;  1PSE A;  4B9W A;  1VQK A;  4L5G A;  2M9U A;  3EFO A;  4XK8 E;  4M78 F;  1YNZ A;  2KNB B;  2ECZ A;  1M2V B;  4AG2 C;  2LTO A;  4QQD A;  2D6F A;  4HKE A;  1FX7 A;  4RTY A;  2NUT A;  3G71 A;  2EW3 A;  2DMO A;  2EBP A;  3VJP A;  3G71 T;  4HVW A;  3VS1 A;  1K9M C;  5IHI A;  3RBB B;  1MGQ A;  3CC7 Q;  1WHG A;  1H92 A;  1MMD A;  2MYS A;  3GIB A;  3RUX A;  4DEX A;  1MV0 B;  3OY9 A;  1NLO C;  1IO6 A;  2L0A A;  2L2P A;  1WHK A;  3TCJ A;  1M3A A;  1RL2 A;  1SPK A;  1YCS B;  3QUI A;  2CZ0 B;  4IIM A;  3PTA A;  2HKQ B;  4C8Q G;  1K8A U;  1MV3 A;  2DAQ A;  3UT1 A;  2GGR A;  1D1C A;  1PRL C;  5LJ3 h;  2LQK A;  1KC8 C;  2J6O A;  5FRO A;  4HT8 A;  4OMM A;  3CC2 A;  1KIK A;  2QQB A;  3A8G B;  3A98 A;  4L6V 5;  2D1X A;  2BZX A;  4FIB A;  1B07 A;  5LL6 S;  4RTW A;  4XTZ A;  1T3S A;  1M9S A;  1M8M A;  5LJ5 g;  4JS5 A;  1QVP A;  3EG3 A;  1IXD A;  2RI5 A;  2G3R A;  2DYI A;  2L3S A;  3V7S A;  4OP0 A;  3NPF A;  2H8H A;  2I0N A;  3HRT A;  4KGZ B;  1R0B G;  4K11 A;  3HRS A;  4J9B A;  4HXJ A;  4DQ2 A;  2OI3 A;  1NBE B;  3EH1 A;  4J6X A;  1VUB A;  1M1K U;  1AHJ B;  1RAG B;  3TSZ A;  1M1G A;  3JCM W;  3S3O A;  1MND A;  5EG2 A;  4C8Q B;  2FZG B;  4XU0 A;  4KBM B;  4X1V A;  1WJR A;  3OB9 A;  1HYO A;  2HDA A;  5KYW A;  3H0H A;  1K9M U;  1RAB B;  3CXC A;  2YLB A;  2YDL A;  2J06 A;  1BYM A;  3JCM c;  2EYX A;  3RR6 A;  2DBM A;  2QDY B;  4M4Z A;  1D3B B;  2GTO A;  2DL5 A;  3VS4 A;  2DIL A;  3HHT B;  2LP5 A;  5IHN A;  3S3N A;  4LN2 A;  1PC0 A;  4M7D G;  4ZNX A;  3FJ5 A;  2E1H A;  2MOX A;  2RPN A;  3C94 A;  3ASK A;  4M77 A;  4DBR A;  2YWW A;  2NUT B;  3P8D A;  3I55 T;  2LVM A;  1WHM A;  4C5E A;  3CCV Q;  2YUN A;  2EJG A;  2KGT A;  4OGC A;  4X9D A;  3M0Q A;  3M0R A;  3MKD A;  3I55 Q;  4A4H A;  1H64 1;  5IHK A;  4P5N A;  2P84 A;  3BDL A;  3V7R A;  2QA4 Q;  2EAY A;  1EZZ B;  1XQH A;  1WA7 A;  2DEQ A;  2ZPI B;  3KFV A;  3DLL A;  3RMS A;  3MO8 A;  3M56 A;  1RAE B;  2HKN A;  1UEC A;  4N4G A;  1RAH B;  1PWT A;  1Y07 A;  2D8H A;  3BY7 A;  1W4S A;  4JDS A;  3QJ6 A;  1M8V A;  3H0I A;  4F7U A;  3CCJ Q;  3GPL A;  5FWB A;  2DLP A;  2W0Z A;  2OTJ T;  1Z9Q A;  4FYW B;  3OS2 A;  5LJ3 d;  5CQY A;  1B3Q A;  4FSS A;  4HA8 A;  1VQ4 Q;  3EH2 A;  2QXF A;  3S3M A;  2O9S A;  2K3B A;  1ZUY A;  3G6E A;  3C4S A;  4F14 A;  1X6O A;  2CP7 A;  1Q81 U;  4M7A E;  1BI3 A;  3JCM g;  1OUL A;  2EYW A;  1YIT Q;  2CP0 A;  1RLP C;  2P0P A;  2RQT A;  1PD0 A;  2PUK B;  4KH1 B;  4N4H A;  4LD9 K;  4OGE A;  3VV0 A;  2AKL A;  5GMK l;  1D0Y A;  1OU8 A;  2FPD A;  4FW2 A;  1VQP Q;  1SRM A;  4CC7 A;  3PVQ A;  1H3Z A;  3MP1 A;  1LPL A;  3ZL7 C;  5KE2 A;  4M75 E;  4MDW A;  2EIF A;  1GL5 A;  2VVK A;  1PSF A;  3CCU T;  1VYU A;  1WLP B;  1FWZ A;  1NM7 A;  1NG2 A;  4D6W A;  2LX7 A;  1GCP A;  2L3R A;  3WVD B;  5FLX E;  3QG1 A;  1QVF A;  3NHN A;  2IIM A;  5KCO A;  3RKX A;  3V8K A;  3BW1 A;  3E9F A;  3REA B;  4BI4 A;  2K9G A;  3VS7 A;  5KYX B;  4C0D B;  2IVW A;  2BIV A;  1BCO A;  1AT1 B;  1WYX A;  1M3C A;  3G71 Q;  1FMV A;  4ZGE B;  2VYT A;  2HBP A;  3M55 A;  4OMQ A;  4XTX A;  4M7A G;  4DEY A;  2F2V A;  5CIU A;  3EGD A;  2EYY A;  4A53 A;  4BY6 B;  2JT4 A;  4FL6 A;  1T0J A;  3VU3 C;  2GFU A;  1BKB A;  2ZZD A;  4OMP A;  4EMG A;  5CKH A;  3HL8 A;  4JS4 A;  3CCE Q;  2DJZ A;  4IUQ A;  1ABO A;  2DO3 A;  2D0Q B;  3A8M B;  2CKK A;  1IRE B;  1D09 B;  5KYN A;  3QYG B;  1TS9 A;  4M7D B;  4ZN3 A;  3LWH A;  2DD5 A;  1G3S A;  3QDR B;  3I5R A;  1YIJ T;  2EGE A;  4PJO A;  5CR2 A;  3H0F A;  2DK3 A;  2OX7 A;  2SRC A;  4JPB W;  1I4K 1;  1H8K A;  4A4F A;  4M78 D;  1UGV A;  1YIJ Q;  4OMF B;  4QVC A;  1VQ5 Q;  2CP3 A;  1OPL A;  4LDY A;  4UC4 A;  4M7A B;  4DOV A;  5I2M A;  4F7U F;  1KQS A;  4J6W A;  1I07 A;  4OMO A;  5GAN g;  2XDB A;  1IGQ A;  5KYU B;  3VYG A;  5GAM e;  1BK2 A;  4J9G A;  3SB2 A;  5C0M A;  1JBM A;  1Q95 G;  4RG2 A;  3H6Z A;  3MEW A;  1M27 C;  1S1N A;  3OYK A;  4C92 G;  4BDY A;  4PLI A;  2CGH A;  3C0C A;  4JZ3 A;  2DXC A;  1OQK A;  1UHF A;  1VQ7 T;  3HP9 A;  2KEA A;  5LJ5 h;  1S72 A;  3URG A;  1YHQ T;  3QZ5 B;  4DBH A;  1M90 U;  2DD4 A;  4ZN1 A;  3VS5 A;  1I8F A;  1OZ3 A;  1YHQ A;  4PFO A;  3JCM P;  3OYL A;  2DEU A;  4BD3 A;  3U23 A;  4J9F A;  5GAN 2;  4EMK A;  1Q7Y R;  4RTZ A;  5LJ5 e;  1TU0 B;  5KH6 A;  3CCR A;  1WXU A;  3PE0 A;  4VUB A;  2LCC A;  5J26 A;  2MI6 A;  7AT1 B;  1W2B P;  1W2B S;  1GBR A;  1KHC A;  1JJ2 P;  1W70 A;  4A4K A;  3LX7 A;  1SF9 A;  2KE9 A;  3CCV T;  2AKK A;  5GAM j;  3J81 E;  5DLQ E;  1YWP A;  3PMI A;  5CO7 A;  1Y71 A;  3CME A;  4J9C A;  2AZV A;  3CCV A;  4RCB A;  3FB9 A;  2SEM A;  2RQU A;  2J6F A;  4QKU A;  2QDL A;  2I2L A;  3DKM A;  3V8J A;  2JNG A;  2F5T X;  1E6G A;  4LUE A;  1UHC A;  5I22 A;  2OTL A;  3MJX A;  2KVQ G;  3M4G A;  1X27 A;  3PIO A;  1GXI E;  2RO0 A;  3OQ5 A;  2HNI A;  3JB9 G;  1NEG A;  4O5V A;  1X01 A;  1U1S A;  5GAN d;  4M7D D;  1EIF A;  3MEV A;  3E2U A;  4C8Q E;  1JO8 A;  1GFC A;  1OU9 A;  2DF6 A;  4BY6 C;  4F16 A;  2EGA A;  3HSB A;  2RB6 A;  2G6F X;  3CC2 T;  3QPH A;  3JB9 H;  3A8H B;  3EAE A;  1K0X A;  2A7Y A;  1AOJ A;  2FO0 A;  2CT3 A;  1YI2 Q;  1R0C B;  2A0F B;  3CC2 Q;  4MDX A;  2Y4Y A;  3AHU A;  1LJO A;  2OAU A;  2QQ9 A;  4M75 B;  3CCU A;  1W2B A;  1K9M R;  2E6Z A;  3FRN A;  4E7J A;  1N8R R;  2LNV A;  2PVO B;  2KRN A;  4RUG A;  5KE3 A;  1TOV A;  2LRQ A;  4E7L A;  3UA7 A;  1K9A A;  1U1T A;  5GAN 8;  2CH4 A;  4RTV A;  1B7T A;  4CC2 A;  4PJN A;  2EQU A;  3EFS A;  1F1B B;  2K3X A;  4N4I A;  4BUG A;  3CC7 A;  4XU1 A;  2F2W A;  1GBQ A;  4R55 A;  2MWP A;  1O9S A; 
#chains in the Genus database with same CATH homology
 3A98 A;  4RTU A;  1VYT A;  2D1X A;  2BZX A;  2YT6 A;  2HBW A;  3VS6 A;  1B07 A;  4LE9 A;  2KRM A;  1ZBJ A;  2C0I A;  3I35 A;  2M51 A;  4RTW A;  1T3S A;  1M8M A;  1X69 A;  5GJW B;  5FW9 A;  1UJY A;  2ESW A;  2K2M A;  1Z9Z A;  3EG3 A;  4AFS C;  2KT1 A;  2BTT A;  2L3S A;  3NPF A;  4AFQ C;  2H8H A;  2I0N A;  2KR3 A;  2L3Q A;  1UJ0 A;  4IIO A;  1JEG A;  4K11 A;  4J9B A;  4WCI A;  1CSK A;  1GFD A;  1XOV A;  4HXJ A;  2OI3 A;  2ROT A;  1SRL A;  3UF4 A;  3TSZ A;  3VS2 A;  2O31 A;  4OML A;  1ABQ A;  4J9I A;  2PTK A;  1UTI A;  3UAT A;  1U3O A;  1GCQ A;  4X1V A;  5IXF A;  2JTE A;  2HDA A;  1AZE A;  2ED0 A;  2CUB A;  4D8K A;  2A37 A;  3H0H A;  1SHF A;  2DE0 X;  2FEI A;  2CSI A;  2YDL A;  2J06 A;  2EYX A;  2B86 A;  2DBM A;  5IH2 A;  4M4Z A;  3LH5 A;  2GTO A;  1UDL A;  2DL5 A;  2EGC A;  3VS4 A;  2DIL A;  2K7A A;  2D8J A;  2LP5 A;  5IHN A;  1BU1 A;  1OPK A;  3TVT A;  1SSH A;  4LN2 A;  2DNU A;  4JJD A;  3M0T A;  4ZNX A;  4ESR A;  2CRE A;  3FJ5 A;  3PVL A;  3I9Q A;  2MOX A;  2RPN A;  2JM9 A;  1QCF A;  1YN8 A;  5I11 A;  3NGP A;  1X43 A;  3M0U A;  2GNC A;  2ABL A;  1H3H A;  2DM1 A;  2FRY A;  2YUN A;  4HVV A;  1X2Q A;  2KGT A;  4HVU A;  2MIO A;  1AVZ C;  3M0Q A;  3M0R A;  2KYM A;  2EQI A;  5IHK A;  2PNI A;  2J7I A;  1V1C A;  2KRS A;  1WIE A;  3EG1 A;  1J3T A;  1HD3 A;  5EC7 A;  1K76 A;  1HSQ A;  1WA7 A;  2HCK A;  3KFV A;  1UUE A;  2JS0 A;  2YUQ A;  1W1F A;  2DL8 A;  2XMF A;  1UEC A;  1M30 A;  1PWT A;  2D8H A;  1LCK A;  2EPD A;  4ORZ A;  2YSQ A;  1EFN A;  1SHG A;  3H0I A;  5FWB A;  2DLP A;  2W0Z A;  1UG1 A;  2OAW A;  1Z9Q A;  1KFZ A;  2RF0 A;  1B3Q A;  1NYF A;  4FSS A;  2P4R A;  4KRT A;  2LCS A;  2KBT A;  1CKB A;  5GJV B;  1QWF A;  2O9S A;  1I1J A;  1NYG A;  2K3B A;  1ZUY A;  2RQW A;  2CT4 A;  2O2O A;  4F14 A;  1X6B A;  3QWY A;  2LZ6 B;  1E6H A;  2A36 A;  2LQW A;  2JS2 A;  3SEM A;  4F17 A;  1PHT A;  2EKH A;  2LMJ A;  1OOT A;  4J9E A;  1U06 A;  5L23 A;  2RQR A;  2DX1 A;  1QLY A;  4AFZ C;  2EYW A;  1WX6 A;  2JW4 A;  2NUZ A;  1WXB A;  1JXM A;  4Y92 A;  1RLP C;  2RQT A;  1WXT A;  1AWJ A;  3SHW A;  3M0S A;  1PKS A;  2AKL A;  2DVJ A;  2FPD A;  4CC4 B;  2M0Y A;  2KXC A;  2VWF A;  1ZSG A;  2DL7 A;  1SRM A;  2KRO A;  3EHR A;  1YWO A;  4CC7 A;  3PVQ A;  1W6X A;  2CDT A;  1WFW A;  1U5S A;  3VS3 A;  2BZY A;  3ZL7 C;  1VA7 A;  1CKA A;  2JM8 A;  3TSW A;  2KXD A;  2DYB A;  2PZ1 A;  1GL5 A;  2VVK A;  1VYU A;  1WLP B;  1A0N B;  1NM7 A;  1NG2 A;  1JXO A;  2LX7 A;  1K0S A;  5FWC A;  1GCP A;  1MUZ A;  1SEM A;  2BZ8 A;  4Z8A A;  4JJC A;  1PKT A;  1AWW A;  1ZLM A;  3NHN A;  3M0P A;  2IIM A;  2X3X D;  2K6D A;  3REA B;  2C0T A;  3VRZ A;  2K9G A;  3EG2 A;  3VS7 A;  2GTJ A;  4GLM A;  2AZS A;  1QWE A;  2LJ0 A;  1WYX A;  1M3C A;  1I0C A;  4OMQ A;  1WI7 A;  4DEY A;  2F2V A;  3I5S A;  2DL3 A;  2EYY A;  1BBZ A;  2RNA A;  2KYB A;  2DRM A;  2JT4 A;  4AG1 C;  1T0J A;  1ZUK A;  4OMP A;  2O9V A;  5ECA A;  1PNJ A;  4RTT A;  2LNH B;  1ABO A;  2DL4 A;  3EG0 A;  2RMO A;  1Y57 A;  1ZUU A;  2DBK A;  1FYN A;  3REB B;  3I5R A;  2DRK A;  2W10 A;  2EGE A;  4EIK A;  1AD5 A;  1QKW A;  3CQT A;  1AWX A;  3H0F A;  2SRC A;  4JPB W;  1T3L A;  2EYZ A;  2E5K A;  1H8K A;  2FRW A;  1UGV A;  1KJW A;  1TUC A;  1NLP C;  2RQV A;  3EGU A;  2FPE A;  4QT7 A;  2HSP A;  1OPL A;  2AK5 A;  2K79 A;  2F2X A;  3VRY A;  1I07 A;  3JV3 A;  4OMO A;  4J9D A;  1AEY A;  2VKN A;  4LNP A;  3THK A;  4LUD A;  2CUD A;  3RNJ A;  1JQQ A;  2ROL A;  1G2B A;  3R6N A;  1BK2 A;  4J9G A;  1M27 C;  1S1N A;  2ENM A;  1TG0 A;  3C0C A;  1NEB A;  4JZ3 A;  2CH4 W;  1KSW A;  2EVR A;  1UHF A;  2KEA A;  2J05 A;  1UE9 A;  2MCN A;  2ED1 A;  2O88 A;  3VS0 A;  1RI9 A;  1FMK A;  3VS5 A;  2LJ1 A;  1T0H A;  1PRM C;  1GRI A;  1K4U S;  2LQN A;  3ULR B;  3U23 A;  2C0O A;  1K1Z A;  4J9F A;  4CC3 A;  4A63 B;  3O5Z A;  1GCQ C;  2L3P A;  4RTZ A;  1WXU A;  3PE0 A;  1HJD A;  1WDX A;  4E6R A;  2A08 A;  3EHQ A;  1E7O A;  2OJ2 A;  5IXB A;  1GBR A;  4RTX A;  1RLQ C;  1W70 A;  4R0K A;  2D0N A;  1X6G A;  4GBQ A;  3IQL A;  2KE9 A;  2AKK A;  2CSQ A;  1YWP A;  5HCK A;  1M3B A;  4J9C A;  2AZV A;  1Y0M A;  2LJ3 A;  2YUO A;  1ZX6 A;  2A28 A;  1UFF A;  2DA9 A;  2SEM A;  1X2K A;  2RQU A;  4OMN A;  2J6F A;  2GBQ A;  2JMC A;  2HEQ A;  2QDL A;  4HCK A;  2X3W D;  1E6G A;  1G83 A;  2V1Q A;  4LUE A;  1UHC A;  5I22 A;  2RN8 A;  4D8D A;  1X27 A;  2FG0 A;  1YNZ A;  2KNB B;  1NEG A;  2ECZ A;  1N5Z A;  1JU5 C;  1YP5 A;  4AG2 C;  2JXB A;  1JO8 A;  1GFC A;  2DF6 A;  4F16 A;  2EGA A;  4RTY A;  2DJQ A;  2G6F X;  1QKX A;  2EW3 A;  3H41 A;  2DMO A;  2EBP A;  1K0X A;  1AOJ A;  2FO0 A;  4HVW A;  3VS1 A;  2V1R A;  2YUP A;  5IHI A;  3GBQ A;  2CT3 A;  2KT8 A;  1AWO A;  3RBB B;  4AFU C;  3NMZ C;  1AZG B;  3UA6 A;  1H92 A;  1OEB A;  2NWM A;  4DEX A;  1MV0 B;  1NLO C;  1IO6 A;  2L0A A;  2L2P A;  4JZ4 A;  2KRN A;  4RUG A;  1BB9 A;  1M3A A;  1ARK A;  1SPK A;  2FPF A;  4Z88 A;  1YCS B;  1RUW A;  4IIM A;  3UA7 A;  2J6K A;  1MV3 A;  1K9A A;  2CH4 A;  4RTV A;  2GGR A;  4CC2 A;  4Z89 A;  2GQI A;  1PRL C;  2JMA A;  2J6O A;  1OV3 A;  3QWX X;  4J9H A;  1TUD A;  4JJB A;  4OMM A;  1VYV A;  2F2W A;  1GBQ A;  1KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...