2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 2
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
2VKNA 1PRLC 2L2PA 1Z9ZA 2KGTA 2KYMA 3NMZC 4Z89A 2YSQA 1WDXA 1T0JA 2GNCA 1NEGA 1W70A 2EYWA 4JJBA 3VS5A 2GTOA 1QKXA 3M0QA 2RQVA 1PKTA 2FO0A 1GBQA 4JPBW 4LUEA 2DBMA 1LCKA 4LNPA 2RQTA 2AKLA 2DM1A 2PNIA 5IXBA 1Y57A 4GBQA 2DRKA 4R0KA 4CC2A 4D8DA 2A08A 4E6RA 2ED0A 2CSIA 3TSWA 1K0XA 2K3BA 1E6HA 2DL4A 1UDLA 1B3QA 1OOTA 4DEYA 2EYZA 4J9GA 2PTKA 1GFDA 3EHQA 2DNUA 2DILA 2DBKA 4RTVA 3H0HA 3M0SA 1AZEA 4J9BA 4EIKA 1JQQA 3VS2A 2HCKA 4F14A 4RTYA 1JU5C 1GFCA 1PRMC 1ARKA 1BBZA 1CSKA 1UGVA 2YDLA 1FMKA 3KFVA 1NLOC 2AK5A 1WYXA 2L0AA 1QLYA 2KNBB 4OMQA 4ESRA 2DE0X 2K2MA 2GQIA 5L23A 2D1XA 2ROLA 3NGPA 2I0NA 2LQNA 2K6DA 1K4US 4A63B 1KSWA 3VS3A 1U06A 5I22A 2F2XA 2RPNA 3REBB 5GJWB 1ZX6A 4JZ3A 3EG3A 4AFSC 3ULRB 2OI3A 1GCPA 2DL3A 2JS0A 1ZLMA 1SRLA 3A98A 2GBQA 1G2BA 2MOXA 1UJYA 5FWCA 2M0YA 2HSPA 3UATA 4M4ZA 1VA7A 1KIKA 3REAB 1MV3A 1WX6A 3TVTA 2O88A 1HD3A 1WXBA 4AFQC 2DL8A 1GCQA 1WXTA 2FRWA 3C0CA 2ECZA 1T3SA 1M30A 2RQWA 3EHRA 2J05A 1YNZA 3I9QA 3VS6A 5IXFA 1OEBA 5ECAA 3VS4A 3H0IA 5IHIA 3NPFA 2KRSA 4HVVA 2JS2A 1RUWA 1AWWA 2KXDA 1XOVA 2KYBA 2KT1A 1X43A 1UHFA 1MUZA 1EFNA 1H8KA 2KE9A 2L3SA 2RQRA 1YP5A 2KT8A 2YUOA 3I5SA 4RTXA 4RTZA 2CUDA 4AG2C 3I5RA 2EW3A 1WXUA 3H41A 2DVJA 2F2WA 3CQTA 1E6GA 1WA7A 2YUNA 2CDTA 2BTTA 1SPKA 2D8JA 3M0RA 1SSHA 2MIOA 2EBPA 1Y0MA 2HBWA 3H0FA 1I1JA 2LQWA 2LJ0A 2X3XD 1PKSA 1N5ZA 2KXCA 3VS1A 2DL5A 1B07A 1K76A 2V1QA 2X3WD 1WI7A 1KFZA 4QT7A 1T3LA 1IO6A 1RI9A 3TSZA 3SEMA 1QKWA 1SHGA 1X2KA 1X27A 2FEIA 2MCNA 3UA6A 1HSQA 2A37A 4OMLA 2ENMA 2NUZA 1NYFA 1AD5A 2JT4A 2GTJA 2BZ8A 2O9SA 2G6FX 4GLMA 4Z8AA 3M0PA 4J9DA 2FG0A 4OMMA 1WIEA 2KRMA 4J9CA 2RF0A 2O31A 3I35A 1RLPC 1BU1A 1X6BA 1ZBJA 3SHWA 2RQUA 1YWPA 2LZ6B 4LUDA 4Z88A 2HEQA 1NYGA 2D0NA 1K1ZA 4JZ4A 3GBQA 3VRYA 2JW4A 2LX7A 2DLPA 3LH5A 4OMOA 2KEAA 1ZUKA 4RTTA 3QWYA 4OMPA 3PE0A 2SRCA 1AWXA 2YT6A 2KRNA 3THKA 2DJQA 1H92A 1BK2A 1AZGB 2DYBA 4Y92A 1M3AA 2B86A 2RN8A 4D8KA 2DL7A 2J6FA 1X2QA 4WCIA 1OPKA 5IHNA 1YN8A 1M8MA 2EYXA 1VYTA 1M3BA 2CH4A 2NWMA 3UA7A 2KBTA 2J6KA 5EC7A 4HVUA 4FSSA 1QCFA 4LE9A 1NEBA 1U5SA 2DMOA 2EPDA 1TG0A 2EGAA 4IIMA 1X6GA 2AKKA 4JJDA 2K7AA 2DA9A 3QWXX 5IH2A 1SRMA 2OAWA 2YUPA 4JJCA 3ZL7C 1PWTA 4ZNXA 2BZXA 1VYVA 2JM9A 3M0UA 1AWOA 3IQLA 2GGRA 2FPDA 2LMJA 1H3HA 1QWEA 2O2OA 2ROTA 1AWJA 2XMFA 1UECA 2J6OA 2V1RA 3EG2A 2ESWA 3VS0A 2C0OA 1JXMA 1M27C 2W0ZA 1X69A 1J3TA 4IIOA 4J9IA 1UHCA 4ORZA 2KR3A 2EGCA 2BZYA 1NLPC 1JEGA 1QWFA 2C0TA 1V1CA 3EG1A 2RMOA 5GJVB 2AZSA 2LJ1A 2K79A 2A28A 2C0IA 3PVLA 4F16A 3EG0A 2JTEA 2RNAA 2SEMA 2LJ3A 1NM7A 2IIMA 2PZ1A 2L3QA 2CH4W 1GBRA 1YCSB 1UJ0A 1GCQC 1I0CA 1TUDA 2K9GA 2E5KA 2DX1A 1ZSGA 2JM8A 3O5ZA 2QDLA 1K9AA 4AFUC 1WFWA 2EYYA 1G83A 4RTUA 2F2VA 2ED1A 5HCKA 1PHTA 4AFZC 2AZVA 3PVQA 4DEXA 1K0SA 2L3PA 5IHKA 1BB9A 1SHFA 1AOJA 2D8HA 4CC3A 1PNJA 3VS7A 2CUBA 1RLQC 2J7IA 4J9HA 1AEYA 4CC7A 1I07A 4K11A 3UF4A 1FYNA 4J9EA 1S1NA 1GL5A 1UTIA 4CC4B 3JV3A 2A36A 4OMNA 1MV0B 1NG2A 4HCKA 1WLPB 1E7OA 1U3OA 4F17A 2CT3A 4RTWA 1UUEA 2CSQA 3U23A 2JMCA 2EQIA 1CKBA 1OV3A 1ZUYA 1HJDA 5FWBA 2CREA 2M51A 4KRTA 2EGEA 2DRMA 2ABLA 3RBBB 1TUCA 2FPEA 3M0TA 1ZUUA 2CT4A 2O9VA 2VVKA 4AG1C 5FW9A 1Z9QA 2J06A 2YUQA 3NHNA 4J9FA 2FPFA 5I11A 1JO8A 2JXBA 1JXOA 2LNHB 3RNJA 1GRIA 2H8HA 3VRZA 3EGUA 4LN2A 2VWFA 2HDAA 1CKAA 2FRYA 2KROA 2JMAA 2LP5A 1UE9A 1YWOA 2DF6A 2EVRA 4X1VA 2OJ2A 1VYUA 2P4RA 1OPLA 1W1FA 4HXJA 1ABOA 1UFFA 1SEMA 1ABQA 3FJ5A 4RUGA 1T0HA 3R6NA 1AVZC 1A0NB 1UG1A 2EKHA 2LCSA 1M3CA 4HVWA 1KJWA 1W6XA 2W10A
chains in the Genus database with same CATH superfamily
2KGTA 4M75C 4OF1A 3LWIA 2P0KA 4PKCC 4M7DC 5EG2A 2RJEA 1D3BA 3CCUQ 3VS5A 2QQ9A 2GTOA 3GPLA 1PD0A 5GANd 3KBGA 3ZEHA 4Y28E 4LUEA 1D0YA 1LCKA 2HZYA 3QHSA 2RQTA 2AKLA 1D1AA 1VQLA 2A08A 1YI2Q 3TSWA 2K3BA 2DL4A 3VYHB 1UDLA 4C5IA 1B3QA 4YTLA 2HBPA 3JCMV 2DBKA 1N9RA 4EIKA 4F14A 5LJ3d 1GFCA 4OVAA 2PU9B 4DA4A 1BBZA 2KAFA 1UGVA 2VGMA 2YDLA 2HQXA 2EJGA 5GMKh 1G8XA 1YJ9Q 3CCVQ 3OYCA 3CMAA 2LQNA 2QQBA 2LRQA 2Z0WA 3OYDA 1RAFB 3VS3A 1M1KU 2F2XA 3REBB 5GJWB 3DB4A 1ZX6A 2AHJB 3EG3A 4BE1A 1WHJA 3ULRB 3QXEB 4LD9K 1ZLMA 3CCMQ 2R5AA 4OGEA 3JB9J 2MOXA 1UJYA 5FWCA 5GMKe 5A0GA 2M0YA 1C6VX 3G71Q 1VA7A 1JB0E 3REAB 2RHYA 3RESA 3TVTA 4C8QF 4EMKB 1Q86R 2RI3A 2QEXT 1UGSB 2EYQA 3PMIA 4PFZA 1N8RC 2EJ9A 3PMTA 2FRWA 3ZBDA 5CQYA 3RMQA 4IUUA 3QDFA 1ZHIA 4EMKC 2J05A 2OTJA 4JRIA 4L5GA 1VQPA 4HVVA 3FRNA 3S3MA 3A1PA 4M77F 1RUWA 3UDCA 2MWPA 1Q82U 4BD3A 1UHFA 3V7RA 1I81A 4E7HA 3M55A 3TU4K 3I5SA 4RTXA 2ATCB 4RTZA 5M9OA 4MMKA 2EJFA 3OW2S 1IGUA 2HQHA 4OP0A 2DVJA 2X9HA 1E6GA 5FLXE 1VQKQ 2VASA 1QP3A 1BCMA 2HD0A 2BTTA 3X25B 1I5OB 1SPKA 1WPYA 4M7AA 4J8OA 4QQ6A 1YI2T 2EBPA 2BUDA 1ZSZA 2P0QA 2X3XD 2HL3A 3CMAQ 3MJXA 2KXCA 3VS1A 1SKUB 4A4FA 2QA4T 3OYAA 1B07A 2V1QA 2X3WD 1WQWA 4XTWA 4PJOA 1S72T 1T3LA 3OBWA 1WNLA 4XTVA 3SEMA 2PVDB 1JJ2P 2JT4A 2DAQA 5GANg 1QVFP 3JCMW 1WIEA 1YJ9T 2COWA 3C94A 4D6WA 3OBYA 3I35A 5GAMe 1BU1A 1NBEB 1ZBJA 2RQUA 1YWPA 1K9MC 3EFSA 1Y96B 2D0NA 2XU8A 2JW4A 2LX7A 2DLPA 3NTHA 1BI3A 3SD4A 1TWBA 1M2OA 4RTTA 3QWYA 4OMPA 2SRCA 4MZMA 3THKA 2DJQA 1LVKA 5FU6B 1AZGB 2DYBA 2OTJQ 2AT1B 3MHXA 1UEBA 3NFCA 2XICA 1D0XA 3G71T 1QVGP 2B86A 2NUPB 1IGQA 1VQPQ 1KHCA 2YLCA 4IUTA 1QVGS 3OSVA 5GAOr 5IHNA 1LNXA 2DIQA 4LXCA 2CH4A 2NWMA 4M78B 1TU0B 2KBTA 3HRUA 3L2VA 2A0FB 2J6KA 4FSSA 2OAUA 4RMOA 1QCFA 4LE9A 1NEBA 4VUBA 2DMOA 3CCLQ 1IZ6A 2EPDA 3DB3A 2NUTB 1X6GA 2K7AA 3CC4A 5IH2A 2EKOA 3OYBA 2YUPA 1W4SA 2YRCA 4ZNXA 5GANj 2RK1A 2QQSA 1VYVA 3CPWS 3MEWA 1YJWA 2GGRA 3M58A 4LDUA 1VQLT 2RM4A 2CZ0B 2O2OA 4DBQA 1AWJA 3VJPA 5I21A 1K73U 4FT4A 1M1FA 4M75F 2YHTA 1PCXA 2V1RA 4QKUA 3LWHA 3N5BB 1BYMA 1VIEA 2COZA 2CP6A 4C92G 4R56A 4M7DF 5GAN3 1DJ7B 4B6MA 4HCZA 1OQKA 1Q7YR 4OB2B 3GIBA 2DD5A 4PJJA 3GOXA 2V26A 1UGPB 2MMPA 4PFPA 1M8VA 1MHNA 2C0TA 2CP3A 4HT8A 2GFAA 2LX9A 2A28A 1KD1R 2XIDA 1QP2A 2DFUA 2DERA 3LGLA 2VB6A 1RAIB 3EG0A 2JTEA 4PJOG 1N27A 3FDRA 3FJPA 3L2UA 5HK3A 2DD4A 2EQUA 1ZSGA 1TXQA 1MMNA 2VXEA 3EGDB 4RCBA 3RIRA 4AFUC 5I2SA 1K8AR 3CC7A 2VYTA 4A54A 2EYYA 1G83A 3M5AA 3LLRA 5HCKA 1PHTA 2K2VA 2CZ6B 4OB1B 2EFIA 2CZ1B 1RACB 3CMEA 1RAHB 2DXBA 2J7IA 1I07A 4K11A 1FWZA 5KYWA 4QW2A 3CCET 1I8FA 1WJRA 4OMNA 3OB9A 2OTJT 3A8MB 4M7AE 4FSXA 4HCKA 3CC4Q 1D09B 3CC2A 1VQPT 2YRDA 3QPHA 2E64A 1X6OA 3E1SA 4F17A 1OZ3A 2CT3A 4ZGJB 2CSQA 3H8ZA 1MMGA 4PJOE 3PIPA 2PUKB 2CREA 3S3NA 2M51A 2PVGB 1WHLA 4FW2A 4J6YA 1WGSA 2DRMA 2ABLA 3RBBB 1EX4A 1TUCA 5KYNA 2O9VA 2VVKA 3OMGA 2CP0A 2HL5C 4HKEA 4FU6A 3RNJA 1GRIA 3OA6A 3VRZA 1SG5A 5LJ5d 2R57A 1NJIU 5KCHA 5CO7A 1CKAA 2KROA 2JMAA 1XTDA 2LP5A 1VQ6Q 1UE9A 3CXCP 2X35A 3CD6Q 2LT1A 2FYKA 1VYUA 3CCJA 1OPLA 3JAME 3CXCS 4GY5A 4XTUA 2RHUA 1B34A 4MZPA 1ABOA 2QXFA 1SEMA 2L89A 4BI3A 3CCQA 1ABQA 3R6NA 1BIAA 2GF7A 3QSUA 2VKNA 4QVZA 3CC7Q 2QQRA 1G3YA 3V8KA 4E7KA 2KYMA 2YSQA 3QG1A 5CIUA 2E12A 5C6SA 1W70A 3AT1B 4JJBA 3CMEQ 3M0QA 2RQVA 2FO0A 1GBQA 4F7UA 2DBMA 2LNVA 5CK9A 2ZPFB 2M0OA 1MGQA 2DRKA 3GF5A 4CC2A 3CC2Q 2P0PA 1K0XA 2CSIA 1M2VB 1E6HA 2D6FA 2V8KA 2CZ7B 1NPRA 2Y90A 1I5LA 4BDYA 1GFDA 3EHQA 5CKFA 2DNUA 4ME7A 4RTVA 3H0HA 2X4WA 3FC3A 4J9BA 1OULA 3VS2A 4RTYA 4XU3A 2X51A 2K4YA 1PRMC 2M9UA 4X34A 4C8QA 5D6YA 1QLYA 4GLKA 3OYGA 4OMQA 2GQIA 4MDXA 2A7YA 2KQWA 4BI4A 1YJWT 1K4US 5GANh 5KCOA 1KSWA 2DXTA 1VQ5Q 2RK2A 1VQ8A 4RCCA 3QKJA 4C0FA 2OI3A 1GCPA 2JS0A 2DXUA 4M77A 5CVIA 1Q81C 1Y07A 3FLGA 4KGZB 2CP2A 4C5GA 1EZZB 1XJWB 4PFOA 3CCJQ 3J80E 1IHVA 3JB9I 2BE9B 3CCVA 3CCQQ 1WX6A 2RA2A 5GANe 1Q81R 3QUIA 4KUDK 5LJ3h 2MF2A 4XU0A 2O88A 4DBHA 1WXBA 5CKDA 1WXTA 2ECZA 3L42A 4ELZC 1TH7A 3I55T 2IVWA 3I9QA 1X75C 3VS6A 1VQNQ 3M9QA 5KE3A 1OEBA 3VS4A 3H0IA 3NPFA 1XQHA 2KRSA 2JS2A 1M4ZA 2EAYA 3QZ5B 4KULA 2JOYA 3G7ZA 2ZGWA 4M75B 5LJ3e 1IXDA 1BKBA 1MUZA 4M7DB 4BI8B 2L3SA 2E41A 4JLIA 1TOVA 3OYMA 4E2FB 2CUDA 4JRPA 4PLLA 4AG2C 1KC8C 3X28B 2CP7A 3CMET 4HCCA 2KY9A 5LJ5g 1WXUA 4F7UG 2WSFE 5KYXB 3JB9G 3URGA 3MKDA 4Q5WA 2ZZDA 3KXTA 3M0RA 1SSHA 1KC8R 2MIOA 5IN1A 2LQWA 4BE0A 2FZCB 2KK4A 1N5ZA 3EFOA 2DTIA 3CBMA 4QT7A 1IO6A 1Q86U 2A3LA 3G4SQ 1VQ8Q 2MCNA 1VQKA 2ZPHB 4C92D 2A37A 4OMLA 2V8JA 3OYFA 3BDUA 1YIJA 2BZ8A 2G6FX 2KI7A 2KRMA 2M1HA 4DOWA 2QK0A 1RLPC 4EPCA 2KSSA 1X6BA 2LZ6B 3JCMh 3VRYA 3LH5A 4OMOA 3JRZA 2P4TA 1KG1A 5LJ5j 4F7UE 3QO3A 4PJOD 4C92C 4F04B 4ZGDB 3EGXA 1BK2A 3HHTB 1MMAA 4FYWB 1SSFA 1WHHA 1M3AA 2RN8A 3PTAA 4LDXA 2DL7A 3CCQT 3JB9F 1X2QA 1D0ZA 5GAN4 3OYLA 4WCIA 3OS2A 1OPKA 1G3SA 1YN8A 1M8MA 2EYXA 3HL8A 1VYTA 3JCMe 1M3BA 2ZPIB 1ZSZC 3GNGA 5EC7A 4HVUA 2JJ9A 3PIOA 1NE8A 4PJOC 3ER0A 1VQ4A 2AKKA 2E5QA 3QWXX 3F70A 4C8QE 4E7SA 4JJCA 1PWTA 2MAMA 2F69A 2BZXA 4KT0E 4CRIA 2JM9A 3R6OA 1N8RR 4OB0B 2FVUA 4C5EA 3D7SB 4L6V5 3MP6A 5CKHA 1UECA 3EFRA 4J6WA 5D6XA 1M1KC 1VQOQ 4M77E 3CCLA 1IB8A 4JUVA 4A4KA 2C0OA 1JXMA 3CCUT 2F5TX 1M27C 5GAN5 2CKKA 2O4XB 3M59A 2QAZA 4J9IA 1R0BG 3DLMA 1D1CA 1OX9A 1YIJQ 3EG1A 2AZSA 2K79A 4F16A 3OYNA 3PNWC 3JCMP 3EH2A 2OTLQ 2LJ3A 4EDUA 2GCXA 3OS5A 5GAMh 2PZ1A 3V8JA 2CH4W 1GCQC 1QCOA 1VQ8T 2JZ2A 2DX1A 1VOMA 2I2LA 2JM8A 4WF2A 1RABB 1WFWA 3BFMA 5GAMf 2K3YA 1Q82C 2VGNA 5KE2A 2VUBA 1VQMA 2BIVA 2XDBA 2XHCA 4AFZC 1JJ2S 1K0SA 3CCVT 1BB9A 2DETA 1QVFS 3OYKA 4HA8A 3C12A 5J3BA 4V2SA 4EMKA 1M90U 1AEYA 4CC7A 1Q82R 3FIFA 5FROA 4DBRA 4QQDA 4J9EA 3VUBA 1UTIA 4CC4B 2DTOA 3CCMT 2A36A 3OS1A 1NG2A 1VQ4Q 1N9SA 1KQSP 1WLPB 2BKDN 2E6NA 1E7OA 2DTHA 1K9MR 2YRVA 3HRTA 2XDDA 1KQSS 3CEYA 1Q7YU 3U23A 1CKBA 1GXIE 1FXXA 1ZUYA 4MMLA 2VXFA 4ELYC 5FWBA 5J39A 1QCNA 1UB4A 1AT1B 2H3EB 4MDWA 1KD1U 4XTZA 3OW2A 3M0TA 2CT4A 4AG1C 3T9NA 1Y7XA 3CCRA 5FW9A 1RADB 3SDZA 3SWNC 2Y4YA 4J9FA 2FPFA 5I11A 1JO8A 2JXBA 2RD1A 3QYHB 3A8GB 1Y71A 3JSCA 1K8AU 4KH1B 3MCAB 4ZGEB 4HT9A 2FRYA 3OYHA 2MI6A 3WXMB 4IUPA 2DF6A 4J6XA 5CAIA 3M4YA 5AT1B 2C06A 2Y4XA 3DKMA 3BW1A 5GAN2 4HXJA 5DM7R 3JCMb 1UFFA 1VQKT 3FJ5A 3CCSA 1R0CB 1T0HA 1LPLA 1PC0A 4M7AG 1YIJT 1M3CA 4HVWA 1KJWA 2L2PA 1Z9ZA 4E47A 1VQMQ 1VQ6A 1QQJA 2RJCA 3NMZC 4Z89A 3CMAT 2IG0A 3CD6A 1WDXA 4KH0B 1Y96A 2EYWA 3V7CA 3UT1A 1QKXA 2JN0A 4FT2A 1VQ7A 4PLIA 3M4GA 2K5FA 2RHXA 3FEOA 4LNPA 5GAOl 2PNIA 5IXBA 1Y57A 2PVOB 1OI1A 4E6RA 2ED0A 4ZN1A 2NUPA 4XQ3A 3MEAA 4DEYA 1QVGA 3ME9A 1K73C 3RKWA 1KQ1A 4RG2A 5HY6A 4DOVA 4M78A 3M0SA 2DZ9A 5GAN7 4JRQA 7AT1B 1IRXA 2JTFA 1ARKA 1VQ4T 1CSKA 2NUTA 2WSCE 4C92F 5LJ5e 1FMKA 3KFVA 2AK5A 3KUFA 1K73R 2VV5A 4AMCA 1WYXA 2KNBB 4ESRA 2K2MA 4BY6C 3CCRQ 3V8LA 1N6AA 2D1XA 2ROLA 3NGPA 2R5MA 3JB9D 2LDMA 2K6DA 4M7AF 3CPWA 1WQ7A 1H3ZA 3HSBA 3P8DA 1U06A 5I22A 2RPNA 2QTVA 4JZ3A 1BIBA 3E9GA 4AFSC 1MNEA 2DL3A 1SRLA 3CCLT 4PJOF 1BI0A 2K5IA 2H3JA 2GBQA 3MEVA 2RO0A 1G2BA 3EAEA 3UATA 4M4ZA 3L2QA 4LDWA 4BACA 3M54A 3MEUA 3CCSQ 2LC4A 1VQ5A 3UPUA 4N0AC 4AFQC 2FL7A 2LVMA 5FU7B 5GMKj 2YLBA 1M30A 2RQWA 2DK3A 1V29B 1YNZA 3VV0A 2FHDA 3QBYA 5ECAA 5FU7C 4E7ZA 4DBFA 1AWWA 1VQ7Q 1PD1A 1VQ9Q 2DJZA 1XOVA 5J26A 2KYBA 3EGDA 1X43A 5KYUB 1ZQ1A 3A8HB 3TEEA 1VQMT 1X01A 2RQRA 1YP5A 4PJNA 2KT8A 1W2BP 3NTIA 4BB7A 3QIIA 3I5RA 1W2BS 1YHQA 1VQNA 2HNIA 4II1A 2L8DA 4BE2A 2F2WA 3H6ZA 3X24B 1WA7A 3CPFA 3S3OA 1G5VA 4EMHA 2CDTA 2WACA 2DIGA 1FMWA 3G6EQ 4Z02A 5GAOm 3L1AA 1PSEA 2HBWA 4FW1A 9ATCB 1KK7A 2LJ0A 4Y91A 5KYYB 2DEUA 5KH6A 4M78G 4O5VA 1VIFA 1WI7A 1KFZA 4A4GA 2JVVA 1RI9A 2E3IA 1SHGA 1KQ2A 5CKBA 3UA6A 4PL6A 1G3TA 1C0MA 2NUZA 1NYFA 2PUOB 3L2WA 2O9SA 2JUFA 3CC4T 1UGRB 4Z8AA 2B8AA 3M0PA 4J9DA 2FG0A 4R55A 5GAOq 5GAN8 4J9CA 2LT4A 2RF0A 2O31A 2QI2A 1D3BB 2COYA 3HFNA 3GBQA 2RB6A 5FRMA 1M5Q1 3BE3A 5L8RE 3RKYA 3G4SA 1YITA 3PE0A 2YT6A 4MZTA 2KRNA 1IREB 1H92A 2FZGB 2ZPGB 2NYSA 4A4HA 3CXCA 5GANf 2L3RA 4D8KA 2XKOC 3OS0A 5IAYA 1YCYA 3CCST 2MK5A 3PGGA 4JLGA 4OGCA 3OQ5A 3UA7A 4M78E 1S72A 3QDRB 2E3HA 3VYGA 1VQ6T 4C0DB 1TG0A 2YXYA 3CD6T 3G1JA 4IIMA 4QQGA 1HK9A 2CS7A 2OAWA 1YHQQ 2K57A 5LJ3f 2GQVA 3HPWA 4C0DC 1VQ7T 2QYZA 1XNIA 2HMAA 2FPDA 2LMJA 1H3HA 4RKUE 1QWEA 2ROTA 2QEXQ 2XMFA 4LDYA 4J5YA 3CC7T 1M2VA 2D0QB 1OX8A 1WHGA 2J6OA 2ZPBB 2QQAA 3EG2A 2ESWA 3TQ7P 1KHIA 3OYEA 2W0ZA 3J7AF 1X69A 2LCLA 3OYJA 1RAAB 3GP8A 1UHCA 2QGFB 4PJLA 1OZ2A 1O75A 2EGCA 2BZYA 2KR3A 4IKFA 3H9NA 4NOYA 2FZKB 1V1CA 2RMOA 1MMDA 5GJVB 2LJ1A 3CC2T 2C0IA 3HFOA 4JRKA 4OB3B 1VQOA 1LJOA 2SEMA 2DZCA 3META 1IHWA 3OMCA 2QGGA 5GMKi 2L3QA 1YCSB 1ACMB 1I0CA 5A0DA 4NL2A 5DLQE 2E70A 2E5KA 1YJNA 1YITQ 1C1AA 2G3RA 3O5ZA 4A53A 4KGXB 4C8QG 4FYXB 1LOJA 2HKNA 3S6WA 4RTUA 1WJSA 2ED1A 1PSFA 4FCYA 3PVQA 1I4K1 5IHKA 3J81E 4M7AD 1SHFA 1AOJA 4FYVB 2D8HA 2QA4Q 2L5QA 2OTLA 1N8RU 1Q95G 4C92B 1VQ5T 3TREA 1S72Q 4J9HA 5HK0A 4IUQA 1FYNA 1R8OB 1S1NA 4M77G 4QVCA 3JCMX 3QJ6A 3RUXA 4O6JA 3EG9B 2E4HA 1MV0B 4M7AB 3SB2A 2LCCA 2RHZA 3CCJT 4F7UF 3JCMf 2V8IA 1ZSZB 1ZA2B 4RTWA 3HP9A 4A4EA 4M7AC 2LQKA 4JDSA 1V76A 2JMCA 4M75A 2EQIA 1BI2A 4PJOB 1UGQB 4M7DA 1SF9A 2KMTA 3HTRA 1HJDA 1B7TA 2KDSA 2E65A 1M1GA 2EGEA 1OU8A 1Q86C 1BCOA 2X4JA 2FPEA 4DQ2A 1YHQT 1VQNT 1WHMA 1ZUUA 2HQEA 1EIFA 5KYXA 2J06A 1QVPA 2YUQA 3HRSA 3NHNA 4E7IA 3E2UA 5DY9A 2NLUA 2XD0A 1JXOA 2LNHB 2H8HA 4TVRA 4PJMA 3A5ZB 3BY7A 4LN2A 3CCEA 4L59A 5D6WA 1YWOA 3CBOA 2EVRA 4X1VA 4WTOB 2OJ2A 2P4RA 4X9DA 4OMFB 4CI0C 1W1FA 3CBPA 1U1SA 3C4SA 4JS5A 1YJNQ 1AVZC 1A0NB 1UG1A 2EKHA 4C0GA 3AHUA 4XAXB 1M1KR 2JNGA 1VQLQ 2W10A 1PRLC 3OW2P 1K9MU 2LTOA 2RHIA 2XK0A 1U1TA 2QG9B 4C5HA 2RI2A 4FM4B 5D7UA 1T0JA 4C92A 2GNCA 4EMGA 1YFNA 1NEGA 3P8HA 5CR2A 3HKSA 3JCMd 1PKTA 4JPBW 3G4ST 1YITT 3EG9A 4XU2A 2DM1A 4GBQA 5LL6S 2DO3A 4R0KA 4D8DA 5I2MA 3M57A 3VU3C 1TS9A 1OOTA 2EYZA 2JTMA 4J9GA 2PTKA 1QMCA 4P5NA 2XDPA 4ATOA 4KUIA 2DILA 1AZEA 2E1HA 3OY9A 1JQQA 2HCKA 4N4GA 1JU5C 3O8VA 1U8RA 1NLOC 2RJDA 2L0AA 2DE0X 5GAN6 5L23A 2DYIA 4KBMB 4RG8A 2K3XA 4M75G 2I0NA 4UC4A 3L2ZA 4A63B 4M7DG 1TUGB 3QJYA 4IURA 3SFMA 3CCEQ 1HYOA 3RDVA 2O01E 1WZOA 2QDYB 2M16A 3A98A 4M78D 3SWNB 3LGFA 5LJ3g 5GMKl 1MNDA 1PM3A 2HSPA 2O4XA 4B9XA 2ZAEA 3X20B 5FU6C 3VUZA 2LQ8A 1KIKA 1MV3A 4KGVB 3DLLA 3ZFJA 1HD3A 1RAGB 3PFSA 5KYWB 2DL8A 1GCQA 4B9WA 3UWNA 3RERA 2F5KA 3C0CA 4LD6A 1VQOT 1T3SA 4M78C 1M90C 5IT9E 3EHRA 1YBYA 3CPWP 3RMSA 1QW1A 5IXFA 5GAMd 5IHIA 1YJNT 5GAOn 2KXDA 4M75E 3TCJA 1NZ9A 2KT1A 1M90R 3BDLA 1Q7YC 1NPPA 1EFNA 4M7DE 1H8KA 5C0MA 1ZBXA 2KE9A 3I56A 2YUOA 1JJ2A 1ZA1B 3LYIA 2OTLT 1QVFA 4FYYB 1KD1C 2EW3A 1BI1A 4FIBA 3H41A 2OX7A 5LJ3j 3CQTA 2YUNA 1VQ9A 3PT9A 2D8JA 5LJ5h 3E9FA 1Y0MA 1OU9A 3H0FA 3MP1A 1I1JA 1KQSA 1D1BA 1PKSA 3I55A 1K8AC 2HAXA 2DL5A 3MO8A 4HCBA 2K5LA 3MPUB 1K76A 1B34B 5LJ5f 3TSZA 2EQKA 3GNFB 4E7LA 2RJFA 1QKWA 1X2KA 1X27A 2FEIA 2RH2A 2F1LA 2BE7D 1JRIA 3SWNA 4BY6B 1HSQA 6AT1B 4ZTJA 2ENMA 1AD5A 2GTJA 4GLMA 3JCMg 3G6EA 4OMMA 5CKEA 2R58A 4LDVA 1OYXA 5A2QE 3SHWA 4C0ZA 3L2RA 4C92E 2HKQB 4LUDA 4Z88A 2HEQA 1NYGA 1PG5B 1K1ZA 3MP8A 4JZ4A 3OYIA 4IUVA 1RI0A 3JCMc 2KVQG 4J7IA 4AT1B 4N4IA 2KEAA 5CQXA 1ZUKA 4F7UB 1TTHB 1AWXA 3A8LB 2ZCFB 4ZN3A 2EWNA 4Y92A 3LX7A 3JCMQ 2CGHA 4XTXA 5GMKm 2J6FA 4JS4A 2MYSA 2VC8A 1YJWQ 4C8QD 4ZTFA 4JJNK 2X4YA 2ZPEB 1WHKA 4ANJA 1HXDA 4NS5A 3I56Q 3EH1A 1U5SA 2DVEA 4XK8E 2EGAA 4N4HA 3A8OB 2HSEB 4JJDA 3VKIA 2DA9A 4C8QB 1SRMA 3ASKA 3ZL7C 4M77D 3M0UA 1AWOA 2P84A 3IQLA 4C8QC 1RL2A 2XG8D 3LH0A 5CCAA 3OYYA 1FMVA 2DKGA 1O9SA 8ATCB 1F1BB 4M77B 3I55Q 3VS0A 2DEQA 3NTKA 1J3TA 4IIOA 5A0LA 4M77C 4ORZA 1NLPC 1JEGA 1QWFA 3RR6A 5GAMg 1WJQA 1RAEB 2AIRB 2QEXA 3GLXA 3PVLA 5FRNA 8AT1B 2E6ZA 5DLOA 2RNAA 2GFUA 1NM7A 2IIMA 1R77A 1NJIC 1GBRA 1UJ0A 1Q81U 2MPXC 3INZA 1AHJB 3WVEB 3JCMJ 1TUDA 2K9GA 3QYGB 1FX7A 3OSSC 5GAOp 2QDLA 1K9AA 2IPOB 3QZ9B 3RKXA 1NJIR 3V7SA 5HKCA 2F2VA 3CCRT 4DEXA 2AZVA 2XI9A 4N0AA 4PK4A 2QASA 2L3PA 3WVDB 4QVDA 4CC3A 1PNJA 1M9SA 3VS7A 3CCUA 2CUBA 1RLQC 3Q1JA 4FL6A 3UF4A 4BDZA 2D9TA 1GL5A 2EQJA 2YWWA 2CP5A 3JV3A 4J83A 1H641 4J7FA 1YI2A 3LW5E 5GAMj 1U3OA 1UUEA 4E7JA 3EFOB 2WSEE 4X9CA 2QA4A 5KYUA 5AYFA 4BUGA 1OV3A 4PNOA 3M56A 3I56T 1KC8U 3C95A 4KRTA 2EIFA 4M78F 3P8BB 3E19A 1P92A 2DXCA 1W2BA 1YJ9A 2MWOA 1Z9QA 1JBMA 2X4XA 3M53A 2QTXA 2E10A 1VQ9T 1VUBA 2CYZB 3EGUA 3JB9H 4M75D 1TSFA 2VWFA 2HDAA 4XU1A 2DPPB 5KYYA 3CCMA 3FB9A 4M7DD 3EGXB 3G71A 2EQMA 2M02A 2PQWA 4XTYA 3X26B 4RUGA 2FB7A 4NL3A 2LCSA 2RI5A 1W6XA 1G3WA 3G6ET
chains in the Genus database with same CATH topology
2VKNA 1PRLC 2L2PA 1Z9ZA 2KGTA 2KYMA 3NMZC 4Z89A 2YSQA 1WDXA 1T0JA 2GNCA 1NEGA 1W70A 2EYWA 4JJBA 3VS5A 2GTOA 1QKXA 3M0QA 2RQVA 1PKTA 2FO0A 1GBQA 4JPBW 4LUEA 2DBMA 1LCKA 4LNPA 2RQTA 2AKLA 2DM1A 2PNIA 5IXBA 1Y57A 4GBQA 2DRKA 4R0KA 4CC2A 4D8DA 2A08A 4E6RA 2ED0A 2CSIA 3TSWA 1K0XA 2K3BA 1E6HA 2DL4A 1UDLA 1B3QA 1OOTA 4DEYA 2EYZA 4J9GA 2PTKA 1GFDA 3EHQA 2DNUA 2DILA 2DBKA 4RTVA 3H0HA 3M0SA 1AZEA 4J9BA 4EIKA 1JQQA 3VS2A 2HCKA 4F14A 4RTYA 1JU5C 1GFCA 1PRMC 1ARKA 1BBZA 1CSKA 1UGVA 2YDLA 1FMKA 3KFVA 1NLOC 2AK5A 1WYXA 2L0AA 1QLYA 2KNBB 4OMQA 4ESRA 2DE0X 2K2MA 2GQIA 5L23A 2D1XA 2ROLA 3NGPA 2I0NA 2LQNA 2K6DA 1K4US 4A63B 1KSWA 3VS3A 1U06A 5I22A 2F2XA 2RPNA 3REBB 5GJWB 1ZX6A 4JZ3A 3EG3A 4AFSC 3ULRB 2OI3A 1GCPA 2DL3A 2JS0A 1ZLMA 1SRLA 3A98A 2GBQA 1G2BA 2MOXA 1UJYA 5FWCA 2M0YA 2HSPA 3UATA 4M4ZA 1VA7A 1KIKA 3REAB 1MV3A 1WX6A 3TVTA 2O88A 1HD3A 1WXBA 4AFQC 2DL8A 1GCQA 1WXTA 2FRWA 3C0CA 2ECZA 1T3SA 1M30A 2RQWA 3EHRA 2J05A 1YNZA 3I9QA 3VS6A 5IXFA 1OEBA 5ECAA 3VS4A 3H0IA 5IHIA 3NPFA 2KRSA 4HVVA 2JS2A 1RUWA 1AWWA 2KXDA 1XOVA 2KYBA 2KT1A 1X43A 1UHFA 1MUZA 1EFNA 1H8KA 2KE9A 2L3SA 2RQRA 1YP5A 2KT8A 2YUOA 3I5SA 4RTXA 4RTZA 2CUDA 4AG2C 3I5RA 2EW3A 1WXUA 3H41A 2DVJA 2F2WA 3CQTA 1E6GA 1WA7A 2YUNA 2CDTA 2BTTA 1SPKA 2D8JA 3M0RA 1SSHA 2MIOA 2EBPA 1Y0MA 2HBWA 3H0FA 1I1JA 2LQWA 2LJ0A 2X3XD 1PKSA 1N5ZA 2KXCA 3VS1A 2DL5A 1B07A 1K76A 2V1QA 2X3WD 1WI7A 1KFZA 4QT7A 1T3LA 1IO6A 1RI9A 3TSZA 3SEMA 1QKWA 1SHGA 1X2KA 1X27A 2FEIA 2MCNA 3UA6A 1HSQA 2A37A 4OMLA 2ENMA 2NUZA 1NYFA 1AD5A 2JT4A 2GTJA 2BZ8A 2O9SA 2G6FX 4GLMA 4Z8AA 3M0PA 4J9DA 2FG0A 4OMMA 1WIEA 2KRMA 4J9CA 2RF0A 2O31A 3I35A 1RLPC 1BU1A 1X6BA 1ZBJA 3SHWA 2RQUA 1YWPA 2LZ6B 4LUDA 4Z88A 2HEQA 1NYGA 2D0NA 1K1ZA 4JZ4A 3GBQA 3VRYA 2JW4A 2LX7A 2DLPA 3LH5A 4OMOA 2KEAA 1ZUKA 4RTTA 3QWYA 4OMPA 3PE0A 2SRCA 1AWXA 2YT6A 2KRNA 3THKA 2DJQA 1H92A 1BK2A 1AZGB 2DYBA 4Y92A 1M3AA 2B86A 2RN8A 4D8KA 2DL7A 2J6FA 1X2QA 4WCIA 1OPKA 5IHNA 1YN8A 1M8MA 2EYXA 1VYTA 1M3BA 2CH4A 2NWMA 3UA7A 2KBTA 2J6KA 5EC7A 4HVUA 4FSSA 1QCFA 4LE9A 1NEBA 1U5SA 2DMOA 2EPDA 1TG0A 2EGAA 4IIMA 1X6GA 2AKKA 4JJDA 2K7AA 2DA9A 3QWXX 5IH2A 1SRMA 2OAWA 2YUPA 4JJCA 3ZL7C 1PWTA 4ZNXA 2BZXA 1VYVA 2JM9A 3M0UA 1AWOA 3IQLA 2GGRA 2FPDA 2LMJA 1H3HA 1QWEA 2O2OA 2ROTA 1AWJA 2XMFA 1UECA 2J6OA 2V1RA 3EG2A 2ESWA 3VS0A 2C0OA 1JXMA 1M27C 2W0ZA 1X69A 1J3TA 4IIOA 4J9IA 1UHCA 4ORZA 2KR3A 2EGCA 2BZYA 1NLPC 1JEGA 1QWFA 2C0TA 1V1CA 3EG1A 2RMOA 5GJVB 2AZSA 2LJ1A 2K79A 2A28A 2C0IA 3PVLA 4F16A 3EG0A 2JTEA 2RNAA 2SEMA 2LJ3A 1NM7A 2IIMA 2PZ1A 2L3QA 2CH4W 1GBRA 1YCSB 1UJ0A 1GCQC 1I0CA 1TUDA 2K9GA 2E5KA 2DX1A 1ZSGA 2JM8A 3O5ZA 2QDLA 1K9AA 4AFUC 1WFWA 2EYYA 1G83A 4RTUA 2F2VA 2ED1A 5HCKA 1PHTA 4AFZC 2AZVA 3PVQA 4DEXA 1K0SA 2L3PA 5IHKA 1BB9A 1SHFA 1AOJA 2D8HA 4CC3A 1PNJA 3VS7A 2CUBA 1RLQC 2J7IA 4J9HA 1AEYA 4CC7A 1I07A 4K11A 3UF4A 1FYNA 4J9EA 1S1NA 1GL5A 1UTIA 4CC4B 3JV3A 2A36A 4OMNA 1MV0B 1NG2A 4HCKA 1WLPB 1E7OA 1U3OA 4F17A 2CT3A 4RTWA 1UUEA 2CSQA 3U23A 2JMCA 2EQIA 1CKBA 1OV3A 1ZUYA 1HJDA 5FWBA 2CREA 2M51A 4KRTA 2EGEA 2DRMA 2ABLA 3RBBB 1TUCA 2FPEA 3M0TA 1ZUUA 2CT4A 2O9VA 2VVKA 4AG1C 5FW9A 1Z9QA 2J06A 2YUQA 3NHNA 4J9FA 2FPFA 5I11A 1JO8A 2JXBA 1JXOA 2LNHB 3RNJA 1GRIA 2H8HA 3VRZA 3EGUA 4LN2A 2VWFA 2HDAA 1CKAA 2FRYA 2KROA 2JMAA 2LP5A 1UE9A 1YWOA 2DF6A 2EVRA 4X1VA 2OJ2A 1VYUA 2P4RA 1OPLA 1W1FA 4HXJA 1ABOA 1UFFA 1SEMA 1ABQA 3FJ5A 4RUGA 1T0HA 3R6NA 1AVZC 1A0NB 1UG1A 2EKHA 2LCSA 1M3CA 4HVWA 1KJWA 1W6XA 2W10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKN A;  1PRL C;  2L2P A;  1Z9Z A;  2KGT A;  2KYM A;  3NMZ C;  4Z89 A;  2YSQ A;  1WDX A;  1T0J A;  2GNC A;  1NEG A;  1W70 A;  2EYW A;  4JJB A;  3VS5 A;  2GTO A;  1QKX A;  3M0Q A;  2RQV A;  1PKT A;  2FO0 A;  1GBQ A;  4JPB W;  4LUE A;  2DBM A;  1LCK A;  4LNP A;  2RQT A;  2AKL A;  2DM1 A;  2PNI A;  5IXB A;  1Y57 A;  4GBQ A;  2DRK A;  4R0K A;  4CC2 A;  4D8D A;  2A08 A;  4E6R A;  2ED0 A;  2CSI A;  3TSW A;  1K0X A;  2K3B A;  1E6H A;  2DL4 A;  1UDL A;  1B3Q A;  1OOT A;  4DEY A;  2EYZ A;  4J9G A;  2PTK A;  1GFD A;  3EHQ A;  2DNU A;  2DIL A;  2DBK A;  4RTV A;  3H0H A;  3M0S A;  1AZE A;  4J9B A;  4EIK A;  1JQQ A;  3VS2 A;  2HCK A;  4F14 A;  4RTY A;  1JU5 C;  1GFC A;  1PRM C;  1ARK A;  1BBZ A;  1CSK A;  1UGV A;  2YDL A;  1FMK A;  3KFV A;  1NLO C;  2AK5 A;  1WYX A;  2L0A A;  1QLY A;  2KNB B;  4OMQ A;  4ESR A;  2DE0 X;  2K2M A;  2GQI A;  5L23 A;  2D1X A;  2ROL A;  3NGP A;  2I0N A;  2LQN A;  2K6D A;  1K4U S;  4A63 B;  1KSW A;  3VS3 A;  1U06 A;  5I22 A;  2F2X A;  2RPN A;  3REB B;  5GJW B;  1ZX6 A;  4JZ3 A;  3EG3 A;  4AFS C;  3ULR B;  2OI3 A;  1GCP A;  2DL3 A;  2JS0 A;  1ZLM A;  1SRL A;  3A98 A;  2GBQ A;  1G2B A;  2MOX A;  1UJY A;  5FWC A;  2M0Y A;  2HSP A;  3UAT A;  4M4Z A;  1VA7 A;  1KIK A;  3REA B;  1MV3 A;  1WX6 A;  3TVT A;  2O88 A;  1HD3 A;  1WXB A;  4AFQ C;  2DL8 A;  1GCQ A;  1WXT A;  2FRW A;  3C0C A;  2ECZ A;  1T3S A;  1M30 A;  2RQW A;  3EHR A;  2J05 A;  1YNZ A;  3I9Q A;  3VS6 A;  5IXF A;  1OEB A;  5ECA A;  3VS4 A;  3H0I A;  5IHI A;  3NPF A;  2KRS A;  4HVV A;  2JS2 A;  1RUW A;  1AWW A;  2KXD A;  1XOV A;  2KYB A;  2KT1 A;  1X43 A;  1UHF A;  1MUZ A;  1EFN A;  1H8K A;  2KE9 A;  2L3S A;  2RQR A;  1YP5 A;  2KT8 A;  2YUO A;  3I5S A;  4RTX A;  4RTZ A;  2CUD A;  4AG2 C;  3I5R A;  2EW3 A;  1WXU A;  3H41 A;  2DVJ A;  2F2W A;  3CQT A;  1E6G A;  1WA7 A;  2YUN A;  2CDT A;  2BTT A;  1SPK A;  2D8J A;  3M0R A;  1SSH A;  2MIO A;  2EBP A;  1Y0M A;  2HBW A;  3H0F A;  1I1J A;  2LQW A;  2LJ0 A;  2X3X D;  1PKS A;  1N5Z A;  2KXC A;  3VS1 A;  2DL5 A;  1B07 A;  1K76 A;  2V1Q A;  2X3W D;  1WI7 A;  1KFZ A;  4QT7 A;  1T3L A;  1IO6 A;  1RI9 A;  3TSZ A;  3SEM A;  1QKW A;  1SHG A;  1X2K A;  1X27 A;  2FEI A;  2MCN A;  3UA6 A;  1HSQ A;  2A37 A;  4OML A;  2ENM A;  2NUZ A;  1NYF A;  1AD5 A;  2JT4 A;  2GTJ A;  2BZ8 A;  2O9S A;  2G6F X;  4GLM A;  4Z8A A;  3M0P A;  4J9D A;  2FG0 A;  4OMM A;  1WIE A;  2KRM A;  4J9C A;  2RF0 A;  2O31 A;  3I35 A;  1RLP C;  1BU1 A;  1X6B A;  1ZBJ A;  3SHW A;  2RQU A;  1YWP A;  2LZ6 B;  4LUD A;  4Z88 A;  2HEQ A;  1NYG A;  2D0N A;  1K1Z A;  4JZ4 A;  3GBQ A;  3VRY A;  2JW4 A;  2LX7 A;  2DLP A;  3LH5 A;  4OMO A;  2KEA A;  1ZUK A;  4RTT A;  3QWY A;  4OMP A;  3PE0 A;  2SRC A;  1AWX A;  2YT6 A;  2KRN A;  3THK A;  2DJQ A;  1H92 A;  1BK2 A;  1AZG B;  2DYB A;  4Y92 A;  1M3A A;  2B86 A;  2RN8 A;  4D8K A;  2DL7 A;  2J6F A;  1X2Q A;  4WCI A;  1OPK A;  5IHN A;  1YN8 A;  1M8M A;  2EYX A;  1VYT A;  1M3B A;  2CH4 A;  2NWM A;  3UA7 A;  2KBT A;  2J6K A;  5EC7 A;  4HVU A;  4FSS A;  1QCF A;  4LE9 A;  1NEB A;  1U5S A;  2DMO A;  2EPD A;  1TG0 A;  2EGA A;  4IIM A;  1X6G A;  2AKK A;  4JJD A;  2K7A A;  2DA9 A;  3QWX X;  5IH2 A;  1SRM A;  2OAW A;  2YUP A;  4JJC A;  3ZL7 C;  1PWT A;  4ZNX A;  2BZX A;  1VYV A;  2JM9 A;  3M0U A;  1AWO A;  3IQL A;  2GGR A;  2FPD A;  2LMJ A;  1H3H A;  1QWE A;  2O2O A;  2ROT A;  1AWJ A;  2XMF A;  1UEC A;  2J6O A;  2V1R A;  3EG2 A;  2ESW A;  3VS0 A;  2C0O A;  1JXM A;  1M27 C;  2W0Z A;  1X69 A;  1J3T A;  4IIO A;  4J9I A;  1UHC A;  4ORZ A;  2KR3 A;  2EGC A;  2BZY A;  1NLP C;  1JEG A;  1QWF A;  2C0T A;  1V1C A;  3EG1 A;  2RMO A;  5GJV B;  2AZS A;  2LJ1 A;  2K79 A;  2A28 A;  2C0I A;  3PVL A;  4F16 A;  3EG0 A;  2JTE A;  2RNA A;  2SEM A;  2LJ3 A;  1NM7 A;  2IIM A;  2PZ1 A;  2L3Q A;  2CH4 W;  1GBR A;  1YCS B;  1UJ0 A;  1GCQ C;  1I0C A;  1TUD A;  2K9G A;  2E5K A;  2DX1 A;  1ZSG A;  2JM8 A;  3O5Z A;  2QDL A;  1K9A A;  4AFU C;  1WFW A;  2EYY A;  1G83 A;  4RTU A;  2F2V A;  2ED1 A;  5HCK A;  1PHT A;  4AFZ C;  2AZV A;  3PVQ A;  4DEX A;  1K0S A;  2L3P A;  5IHK A;  1BB9 A;  1SHF A;  1AOJ A;  2D8H A;  4CC3 A;  1PNJ A;  3VS7 A;  2CUB A;  1RLQ C;  2J7I A;  4J9H A;  1AEY A;  4CC7 A;  1I07 A;  4K11 A;  3UF4 A;  1FYN A;  4J9E A;  1S1N A;  1GL5 A;  1UTI A;  4CC4 B;  3JV3 A;  2A36 A;  4OMN A;  1MV0 B;  1NG2 A;  4HCK A;  1WLP B;  1E7O A;  1U3O A;  4F17 A;  2CT3 A;  4RTW A;  1UUE A;  2CSQ A;  3U23 A;  2JMC A;  2EQI A;  1CKB A;  1OV3 A;  1ZUY A;  1HJD A;  5FWB A;  2CRE A;  2M51 A;  4KRT A;  2EGE A;  2DRM A;  2ABL A;  3RBB B;  1TUC A;  2FPE A;  3M0T A;  1ZUU A;  2CT4 A;  2O9V A;  2VVK A;  4AG1 C;  5FW9 A;  1Z9Q A;  2J06 A;  2YUQ A;  3NHN A;  4J9F A;  2FPF A;  5I11 A;  1JO8 A;  2JXB A;  1JXO A;  2LNH B;  3RNJ A;  1GRI A;  2H8H A;  3VRZ A;  3EGU A;  4LN2 A;  2VWF A;  2HDA A;  1CKA A;  2FRY A;  2KRO A;  2JMA A;  2LP5 A;  1UE9 A;  1YWO A;  2DF6 A;  2EVR A;  4X1V A;  2OJ2 A;  1VYU A;  2P4R A;  1OPL A;  1W1F A;  4HXJ A;  1ABO A;  1UFF A;  1SEM A;  1ABQ A;  3FJ5 A;  4RUG A;  1T0H A;  3R6N A;  1AVZ C;  1A0N B;  1UG1 A;  2EKH A;  2LCS A;  1M3C A;  4HVW A;  1KJW A;  1W6X A;  2W10 A; 
#chains in the Genus database with same CATH topology
 2KGT A;  4M75 C;  4OF1 A;  3LWI A;  2P0K A;  4PKC C;  4M7D C;  5EG2 A;  2RJE A;  1D3B A;  3CCU Q;  3VS5 A;  2QQ9 A;  2GTO A;  3GPL A;  1PD0 A;  5GAN d;  3KBG A;  3ZEH A;  4Y28 E;  4LUE A;  1D0Y A;  1LCK A;  2HZY A;  3QHS A;  2RQT A;  2AKL A;  1D1A A;  1VQL A;  2A08 A;  1YI2 Q;  3TSW A;  2K3B A;  2DL4 A;  3VYH B;  1UDL A;  4C5I A;  1B3Q A;  4YTL A;  2HBP A;  3JCM V;  2DBK A;  1N9R A;  4EIK A;  4F14 A;  5LJ3 d;  1GFC A;  4OVA A;  2PU9 B;  4DA4 A;  1BBZ A;  2KAF A;  1UGV A;  2VGM A;  2YDL A;  2HQX A;  2EJG A;  5GMK h;  1G8X A;  1YJ9 Q;  3CCV Q;  3OYC A;  3CMA A;  2LQN A;  2QQB A;  2LRQ A;  2Z0W A;  3OYD A;  1RAF B;  3VS3 A;  1M1K U;  2F2X A;  3REB B;  5GJW B;  3DB4 A;  1ZX6 A;  2AHJ B;  3EG3 A;  4BE1 A;  1WHJ A;  3ULR B;  3QXE B;  4LD9 K;  1ZLM A;  3CCM Q;  2R5A A;  4OGE A;  3JB9 J;  2MOX A;  1UJY A;  5FWC A;  5GMK e;  5A0G A;  2M0Y A;  1C6V X;  3G71 Q;  1VA7 A;  1JB0 E;  3REA B;  2RHY A;  3RES A;  3TVT A;  4C8Q F;  4EMK B;  1Q86 R;  2RI3 A;  2QEX T;  1UGS B;  2EYQ A;  3PMI A;  4PFZ A;  1N8R C;  2EJ9 A;  3PMT A;  2FRW A;  3ZBD A;  5CQY A;  3RMQ A;  4IUU A;  3QDF A;  1ZHI A;  4EMK C;  2J05 A;  2OTJ A;  4JRI A;  4L5G A;  1VQP A;  4HVV A;  3FRN A;  3S3M A;  3A1P A;  4M77 F;  1RUW A;  3UDC A;  2MWP A;  1Q82 U;  4BD3 A;  1UHF A;  3V7R A;  1I81 A;  4E7H A;  3M55 A;  3TU4 K;  3I5S A;  4RTX A;  2ATC B;  4RTZ A;  5M9O A;  4MMK A;  2EJF A;  3OW2 S;  1IGU A;  2HQH A;  4OP0 A;  2DVJ A;  2X9H A;  1E6G A;  5FLX E;  1VQK Q;  2VAS A;  1QP3 A;  1BCM A;  2HD0 A;  2BTT A;  3X25 B;  1I5O B;  1SPK A;  1WPY A;  4M7A A;  4J8O A;  4QQ6 A;  1YI2 T;  2EBP A;  2BUD A;  1ZSZ A;  2P0Q A;  2X3X D;  2HL3 A;  3CMA Q;  3MJX A;  2KXC A;  3VS1 A;  1SKU B;  4A4F A;  2QA4 T;  3OYA A;  1B07 A;  2V1Q A;  2X3W D;  1WQW A;  4XTW A;  4PJO A;  1S72 T;  1T3L A;  3OBW A;  1WNL A;  4XTV A;  3SEM A;  2PVD B;  1JJ2 P;  2JT4 A;  2DAQ A;  5GAN g;  1QVF P;  3JCM W;  1WIE A;  1YJ9 T;  2COW A;  3C94 A;  4D6W A;  3OBY A;  3I35 A;  5GAM e;  1BU1 A;  1NBE B;  1ZBJ A;  2RQU A;  1YWP A;  1K9M C;  3EFS A;  1Y96 B;  2D0N A;  2XU8 A;  2JW4 A;  2LX7 A;  2DLP A;  3NTH A;  1BI3 A;  3SD4 A;  1TWB A;  1M2O A;  4RTT A;  3QWY A;  4OMP A;  2SRC A;  4MZM A;  3THK A;  2DJQ A;  1LVK A;  5FU6 B;  1AZG B;  2DYB A;  2OTJ Q;  2AT1 B;  3MHX A;  1UEB A;  3NFC A;  2XIC A;  1D0X A;  3G71 T;  1QVG P;  2B86 A;  2NUP B;  1IGQ A;  1VQP Q;  1KHC A;  2YLC A;  4IUT A;  1QVG S;  3OSV A;  5GAO r;  5IHN A;  1LNX A;  2DIQ A;  4LXC A;  2CH4 A;  2NWM A;  4M78 B;  1TU0 B;  2KBT A;  3HRU A;  3L2V A;  2A0F B;  2J6K A;  4FSS A;  2OAU A;  4RMO A;  1QCF A;  4LE9 A;  1NEB A;  4VUB A;  2DMO A;  3CCL Q;  1IZ6 A;  2EPD A;  3DB3 A;  2NUT B;  1X6G A;  2K7A A;  3CC4 A;  5IH2 A;  2EKO A;  3OYB A;  2YUP A;  1W4S A;  2YRC A;  4ZNX A;  5GAN j;  2RK1 A;  2QQS A;  1VYV A;  3CPW S;  3MEW A;  1YJW A;  2GGR A;  3M58 A;  4LDU A;  1VQL T;  2RM4 A;  2CZ0 B;  2O2O A;  4DBQ A;  1AWJ A;  3VJP A;  5I21 A;  1K73 U;  4FT4 A;  1M1F A;  4M75 F;  2YHT A;  1PCX A;  2V1R A;  4QKU A;  3LWH A;  3N5B B;  1BYM A;  1VIE A;  2COZ A;  2CP6 A;  4C92 G;  4R56 A;  4M7D F;  5GAN 3;  1DJ7 B;  4B6M A;  4HCZ A;  1OQK A;  1Q7Y R;  4OB2 B;  3GIB A;  2DD5 A;  4PJJ A;  3GOX A;  2V26 A;  1UGP B;  2MMP A;  4PFP A;  1M8V A;  1MHN A;  2C0T A;  2CP3 A;  4HT8 A;  2GFA A;  2LX9 A;  2A28 A;  1KD1 R;  2XID A;  1QP2 A;  2DFU A;  2DER A;  3LGL A;  2VB6 A;  1RAI B;  3EG0 A;  2JTE A;  4PJO G;  1N27 A;  3FDR A;  3FJP A;  3L2U A;  5HK3 A;  2DD4 A;  2EQU A;  1ZSG A;  1TXQ A;  1MMN A;  2VXE A;  3EGD B;  4RCB A;  3RIR A;  4AFU C;  5I2S A;  1K8A R;  3CC7 A;  2VYT A;  4A54 A;  2EYY A;  1G83 A;  3M5A A;  3LLR A;  5HCK A;  1PHT A;  2K2V A;  2CZ6 B;  4OB1 B;  2EFI A;  2CZ1 B;  1RAC B;  3CME A;  1RAH B;  2DXB A;  2J7I A;  1I07 A;  4K11 A;  1FWZ A;  5KYW A;  4QW2 A;  3CCE T;  1I8F A;  1WJR A;  4OMN A;  3OB9 A;  2OTJ T;  3A8M B;  4M7A E;  4FSX A;  4HCK A;  3CC4 Q;  1D09 B;  3CC2 A;  1VQP T;  2YRD A;  3QPH A;  2E64 A;  1X6O A;  3E1S A;  4F17 A;  1OZ3 A;  2CT3 A;  4ZGJ B;  2CSQ A;  3H8Z A;  1MMG A;  4PJO E;  3PIP A;  2PUK B;  2CRE A;  3S3N A;  2M51 A;  2PVG B;  1WHL A;  4FW2 A;  4J6Y A;  1WGS A;  2DRM A;  2ABL A;  3RBB B;  1EX4 A;  1TUC A;  5KYN A;  2O9V A;  2VVK A;  3OMG A;  2CP0 A;  2HL5 C;  4HKE A;  4FU6 A;  3RNJ A;  1GRI A;  3OA6 A;  3VRZ A;  1SG5 A;  5LJ5 d;  2R57 A;  1NJI U;  5KCH A;  5CO7 A;  1CKA A;  2KRO A;  2JMA A;  1XTD A;  2LP5 A;  1VQ6 Q;  1UE9 A;  3CXC P;  2X35 A;  3CD6 Q;  2LT1 A;  2FYK A;  1VYU A;  3CCJ A;  1OPL A;  3JAM E;  3CXC S;  4GY5 A;  4XTU A;  2RHU A;  1B34 A;  4MZP A;  1ABO A;  2QXF A;  1SEM A;  2L89 A;  4BI3 A;  3CCQ A;  1ABQ A;  3R6N A;  1BIA A;  2GF7 A;  3QSU A;  2VKN A;  4QVZ A;  3CC7 Q;  2QQR A;  1G3Y A;  3V8K A;  4E7K A;  2KYM A;  2YSQ A;  3QG1 A;  5CIU A;  2E12 A;  5C6S A;  1W70 A;  3AT1 B;  4JJB A;  3CME Q;  3M0Q A;  2RQV A;  2FO0 A;  1GBQ A;  4F7U A;  2DBM A;  2LNV A;  5CK9 A;  2ZPF B;  2M0O A;  1MGQ A;  2DRK A;  3GF5 A;  4CC2 A;  3CC2 Q;  2P0P A;  1K0X A;  2CSI A;  1M2V B;  1E6H A;  2D6F A;  2V8K A;  2CZ7 B;  1NPR A;  2Y90 A;  1I5L A;  4BDY A;  1GFD A;  3EHQ A;  5CKF A;  2DNU A;  4ME7 A;  4RTV A;  3H0H A;  2X4W A;  3FC3 A;  4J9B A;  1OUL A;  3VS2 A;  4RTY A;  4XU3 A;  2X51 A;  2K4Y A;  1PRM C;  2M9U A;  4X34 A;  4C8Q A;  5D6Y A;  1QLY A;  4GLK A;  3OYG A;  4OMQ A;  2GQI A;  4MDX A;  2A7Y A;  2KQW A;  4BI4 A;  1YJW T;  1K4U S;  5GAN h;  5KCO A;  1KSW A;  2DXT A;  1VQ5 Q;  2RK2 A;  1VQ8 A;  4RCC A;  3QKJ A;  4C0F A;  2OI3 A;  1GCP A;  2JS0 A;  2DXU A;  4M77 A;  5CVI A;  1Q81 C;  1Y07 A;  3FLG A;  4KGZ B;  2CP2 A;  4C5G A;  1EZZ B;  1XJW B;  4PFO A;  3CCJ Q;  3J80 E;  1IHV A;  3JB9 I;  2BE9 B;  3CCV A;  3CCQ Q;  1WX6 A;  2RA2 A;  5GAN e;  1Q81 R;  3QUI A;  4KUD K;  5LJ3 h;  2MF2 A;  4XU0 A;  2O88 A;  4DBH A;  1WXB A;  5CKD A;  1WXT A;  2ECZ A;  3L42 A;  4ELZ C;  1TH7 A;  3I55 T;  2IVW A;  3I9Q A;  1X75 C;  3VS6 A;  1VQN Q;  3M9Q A;  5KE3 A;  1OEB A;  3VS4 A;  3H0I A;  3NPF A;  1XQH A;  2KRS A;  2JS2 A;  1M4Z A;  2EAY A;  3QZ5 B;  4KUL A;  2JOY A;  3G7Z A;  2ZGW A;  4M75 B;  5LJ3 e;  1IXD A;  1BKB A;  1MUZ A;  4M7D B;  4BI8 B;  2L3S A;  2E41 A;  4JLI A;  1TOV A;  3OYM A;  4E2F B;  2CUD A;  4JRP A;  4PLL A;  4AG2 C;  1KC8 C;  3X28 B;  2CP7 A;  3CME T;  4HCC A;  2KY9 A;  5LJ5 g;  1WXU A;  4F7U G;  2WSF E;  5KYX B;  3JB9 G;  3URG A;  3MKD A;  4Q5W A;  2ZZD A;  3KXT A;  3M0R A;  1SSH A;  1KC8 R;  2MIO A;  5IN1 A;  2LQW A;  4BE0 A;  2FZC B;  2KK4 A;  1N5Z A;  3EFO A;  2DTI A;  3CBM A;  4QT7 A;  1IO6 A;  1Q86 U;  2A3L A;  3G4S Q;  1VQ8 Q;  2MCN A;  1VQK A;  2ZPH B;  4C92 D;  2A37 A;  4OML A;  2V8J A;  3OYF A;  3BDU A;  1YIJ A;  2BZ8 A;  2G6F X;  2KI7 A;  2KRM A;  2M1H A;  4DOW A;  2QK0 A;  1RLP C;  4EPC A;  2KSS A;  1X6B A;  2LZ6 B;  3JCM h;  3VRY A;  3LH5 A;  4OMO A;  3JRZ A;  2P4T A;  1KG1 A;  5LJ5 j;  4F7U E;  3QO3 A;  4PJO D;  4C92 C;  4F04 B;  4ZGD B;  3EGX A;  1BK2 A;  3HHT B;  1MMA A;  4FYW B;  1SSF A;  1WHH A;  1M3A A;  2RN8 A;  3PTA A;  4LDX A;  2DL7 A;  3CCQ T;  3JB9 F;  1X2Q A;  1D0Z A;  5GAN 4;  3OYL A;  4WCI A;  3OS2 A;  1OPK A;  1G3S A;  1YN8 A;  1M8M A;  2EYX A;  3HL8 A;  1VYT A;  3JCM e;  1M3B A;  2ZPI B;  1ZSZ C;  3GNG A;  5EC7 A;  4HVU A;  2JJ9 A;  3PIO A;  1NE8 A;  4PJO C;  3ER0 A;  1VQ4 A;  2AKK A;  2E5Q A;  3QWX X;  3F70 A;  4C8Q E;  4E7S A;  4JJC A;  1PWT A;  2MAM A;  2F69 A;  2BZX A;  4KT0 E;  4CRI A;  2JM9 A;  3R6O A;  1N8R R;  4OB0 B;  2FVU A;  4C5E A;  3D7S B;  4L6V 5;  3MP6 A;  5CKH A;  1UEC A;  3EFR A;  4J6W A;  5D6X A;  1M1K C;  1VQO Q;  4M77 E;  3CCL A;  1IB8 A;  4JUV A;  4A4K A;  2C0O A;  1JXM A;  3CCU T;  2F5T X;  1M27 C;  5GAN 5;  2CKK A;  2O4X B;  3M59 A;  2QAZ A;  4J9I A;  1R0B G;  3DLM A;  1D1C A;  1OX9 A;  1YIJ Q;  3EG1 A;  2AZS A;  2K79 A;  4F16 A;  3OYN A;  3PNW C;  3JCM P;  3EH2 A;  2OTL Q;  2LJ3 A;  4EDU A;  2GCX A;  3OS5 A;  5GAM h;  2PZ1 A;  3V8J A;  2CH4 W;  1GCQ C;  1QCO A;  1VQ8 T;  2JZ2 A;  2DX1 A;  1VOM A;  2I2L A;  2JM8 A;  4WF2 A;  1RAB B;  1WFW A;  3BFM A;  5GAM f;  2K3Y A;  1Q82 C;  2VGN A;  5KE2 A;  2VUB A;  1VQM A;  2BIV A;  2XDB A;  2XHC A;  4AFZ C;  1JJ2 S;  1K0S A;  3CCV T;  1BB9 A;  2DET A;  1QVF S;  3OYK A;  4HA8 A;  3C12 A;  5J3B A;  4V2S A;  4EMK A;  1M90 U;  1AEY A;  4CC7 A;  1Q82 R;  3FIF A;  5FRO A;  4DBR A;  4QQD A;  4J9E A;  3VUB A;  1UTI A;  4CC4 B;  2DTO A;  3CCM T;  2A36 A;  3OS1 A;  1NG2 A;  1VQ4 Q;  1N9S A;  1KQS P;  1WLP B;  2BKD N;  2E6N A;  1E7O A;  2DTH A;  1K9M R;  2YRV A;  3HRT A;  2XDD A;  1KQS S;  3CEY A;  1Q7Y U;  3U23 A;  1CKB A;  1GXI E;  1FXX A;  1ZUY A;  4MML A;  2VXF A;  4ELY C;  5FWB A;  5J39 A;  1QCN A;  1UB4 A;  1AT1 B;  2H3E B;  4MDW A;  1KD1 U;  4XTZ A;  3OW2 A;  3M0T A;  2CT4 A;  4AG1 C;  3T9N A;  1Y7X A;  3CCR A;  5FW9 A;  1RAD B;  3SDZ A;  3SWN C;  2Y4Y A;  4J9F A;  2FPF A;  5I11 A;  1JO8 A;  2JXB A;  2RD1 A;  3QYH B;  3A8G B;  1Y71 A;  3JSC A;  1K8A U;  4KH1 B;  3MCA B;  4ZGE B;  4HT9 A;  2FRY A;  3OYH A;  2MI6 A;  3WXM B;  4IUP A;  2DF6 A;  4J6X A;  5CAI A;  3M4Y A;  5AT1 B;  2C06 A;  2Y4X A;  3DKM A;  3BW1 A;  5GAN 2;  4HXJ A;  5DM7 R;  3JCM b;  1UFF A;  1VQK T;  3FJ5 A;  3CCS A;  1R0C B;  1T0H A;  1LPL A;  1PC0 A;  4M7A G;  1YIJ T;  1M3C A;  4HVW A;  1KJW A;  2L2P A;  1Z9Z A;  4E47 A;  1VQM Q;  1VQ6 A;  1QQJ A;  2RJC A;  3NMZ C;  4Z89 A;  3CMA T;  2IG0 A;  3CD6 A;  1WDX A;  4KH0 B;  1Y96 A;  2EYW A;  3V7C A;  3UT1 A;  1QKX A;  2JN0 A;  4FT2 A;  1VQ7 A;  4PLI A;  3M4G A;  2K5F A;  2RHX A;  3FEO A;  4LNP A;  5GAO l;  2PNI A;  5IXB A;  1Y57 A;  2PVO B;  1OI1 A;  4E6R A;  2ED0 A;  4ZN1 A;  2NUP A;  4XQ3 A;  3MEA A;  4DEY A;  1QVG A;  3ME9 A;  1K73 C;  3RKW A;  1KQ1 A;  4RG2 A;  5HY6 A;  4DOV A;  4M78 A;  3M0S A;  2DZ9 A;  5GAN 7;  4JRQ A;  7AT1 B;  1IRX A;  2JTF A;  1ARK A;  1VQ4 T;  1CSK A;  2NUT A;  2WSC E;  4C92 F;  5LJ5 e;  1FMK A;  3KFV A;  2AK5 A;  3KUF A;  1K73 R;  2VV5 A;  4AMC A;  1WYX A;  2KNB B;  4ESR A;  2K2M A;  4BY6 C;  3CCR Q;  3V8L A;  1N6A A;  2D1X A;  2ROL A;  3NGP A;  2R5M A;  3JB9 D;  2LDM A;  2K6D A;  4M7A F;  3CPW A;  1WQ7 A;  1H3Z A;  3HSB A;  3P8D A;  1U06 A;  5I22 A;  2RPN A;  2QTV A;  4JZ3 A;  1BIB A;  3E9G A;  4AFS C;  1MNE A;  2DL3 A;  1SRL A;  3CCL T;  4PJO F;  1BI0 A;  2K5I A;  2H3J A;  2GBQ A;  3MEV A;  2RO0 A;  1G2B A;  3EAE A;  3UAT A;  4M4Z A;  3L2Q A;  4LDW A;  4BAC A;  3M54 A;  3MEU A;  3CCS Q;  2LC4 A;  1VQ5 A;  3UPU A;  4N0A C;  4AFQ C;  2FL7 A;  2LVM A;  5FU7 B;  5GMK j;  2YLB A;  1M30 A;  2RQW A;  2DK3 A;  1V29 B;  1YNZ A;  3VV0 A;  2FHD A;  3QBY A;  5ECA A;  5FU7 C;  4E7Z A;  4DBF A;  1AWW A;  1VQ7 Q;  1PD1 A;  1VQ9 Q;  2DJZ A;  1XOV A;  5J26 A;  2KYB A;  3EGD A;  1X43 A;  5KYU B;  1ZQ1 A;  3A8H B;  3TEE A;  1VQM T;  1X01 A;  2RQR A;  1YP5 A;  4PJN A;  2KT8 A;  1W2B P;  3NTI A;  4BB7 A;  3QII A;  3I5R A;  1W2B S;  1YHQ A;  1VQN A;  2HNI A;  4II1 A;  2L8D A;  4BE2 A;  2F2W A;  3H6Z A;  3X24 B;  1WA7 A;  3CPF A;  3S3O A;  1G5V A;  4EMH A;  2CDT A;  2WAC A;  2DIG A;  1FMW A;  3G6E Q;  4Z02 A;  5GAO m;  3L1A A;  1PSE A;  2HBW A;  4FW1 A;  9ATC B;  1KK7 A;  2LJ0 A;  4Y91 A;  5KYY B;  2DEU A;  5KH6 A;  4M78 G;  4O5V A;  1VIF A;  1WI7 A;  1KFZ A;  4A4G A;  2JVV A;  1RI9 A;  2E3I A;  1SHG A;  1KQ2 A;  5CKB A;  3UA6 A;  4PL6 A;  1G3T A;  1C0M A;  2NUZ A;  1NYF A;  2PUO B;  3L2W A;  2O9S A;  2JUF A;  3CC4 T;  1UGR B;  4Z8A A;  2B8A A;  3M0P A;  4J9D A;  2FG0 A;  4R55 A;  5GAO q;  5GAN 8;  4J9C A;  2LT4 A;  2RF0 A;  2O31 A;  2QI2 A;  1D3B B;  2COY A;  3HFN A;  3GBQ A;  2RB6 A;  5FRM A;  1M5Q 1;  3BE3 A;  5L8R E;  3RKY A;  3G4S A;  1YIT A;  3PE0 A;  2YT6 A;  4MZT A;  2KRN A;  1IRE B;  1H92 A;  2FZG B;  2ZPG B;  2NYS A;  4A4H A;  3CXC A;  5GAN f;  2L3R A;  4D8K A;  2XKO C;  3OS0 A;  5IAY A;  1YCY A;  3CCS T;  2MK5 A;  3PGG A;  4JLG A;  4OGC A;  3OQ5 A;  3UA7 A;  4M78 E;  1S72 A;  3QDR B;  2E3H A;  3VYG A;  1VQ6 T;  4C0D B;  1TG0 A;  2YXY A;  3CD6 T;  3G1J A;  4IIM A;  4QQG A;  1HK9 A;  2CS7 A;  2OAW A;  1YHQ Q;  2K57 A;  5LJ3 f;  2GQV A;  3HPW A;  4C0D C;  1VQ7 T;  2QYZ A;  1XNI A;  2HMA A;  2FPD A;  2LMJ A;  1H3H A;  4RKU E;  1QWE A;  2ROT A;  2QEX Q;  2XMF A;  4LDY A;  4J5Y A;  3CC7 T;  1M2V A;  2D0Q B;  1OX8 A;  1WHG A;  2J6O A;  2ZPB B;  2QQA A;  3EG2 A;  2ESW A;  3TQ7 P;  1KHI A;  3OYE A;  2W0Z A;  3J7A F;  1X69 A;  2LCL A;  3OYJ A;  1RAA B;  3GP8 A;  1UHC A;  2QGF B;  4PJL A;  1OZ2 A;  1O75 A;  2EGC A;  2BZY A;  2KR3 A;  4IKF A;  3H9N A;  4NOY A;  2FZK B;  1V1C A;  2RMO A;  1MMD A;  5GJV B;  2LJ1 A;  3CC2 T;  2C0I A;  3HFO A;  4JRK A;  4OB3 B;  1VQO A;  1LJO A;  2SEM A;  2DZC A;  3MET A;  1IHW A;  3OMC A;  2QGG A;  5GMK i;  2L3Q A;  1YCS B;  1ACM B;  1I0C A;  5A0D A;  4NL2 A;  5DLQ E;  2E70 A;  2E5K A;  1YJN A;  1YIT Q;  1C1A A;  2G3R A;  3O5Z A;  4A53 A;  4KGX B;  4C8Q G;  4FYX B;  1LOJ A;  2HKN A;  3S6W A;  4RTU A;  1WJS A;  2ED1 A;  1PSF A;  4FCY A;  3PVQ A;  1I4K 1;  5IHK A;  3J81 E;  4M7A D;  1SHF A;  1AOJ A;  4FYV B;  2D8H A;  2QA4 Q;  2L5Q A;  2OTL A;  1N8R U;  1Q95 G;  4C92 B;  1VQ5 T;  3TRE A;  1S72 Q;  4J9H A;  5HK0 A;  4IUQ A;  1FYN A;  1R8O B;  1S1N A;  4M77 G;  4QVC A;  3JCM X;  3QJ6 A;  3RUX A;  4O6J A;  3EG9 B;  2E4H A;  1MV0 B;  4M7A B;  3SB2 A;  2LCC A;  2RHZ A;  3CCJ T;  4F7U F;  3JCM f;  2V8I A;  1ZSZ B;  1ZA2 B;  4RTW A;  3HP9 A;  4A4E A;  4M7A C;  2LQK A;  4JDS A;  1V76 A;  2JMC A;  4M75 A;  2EQI A;  1BI2 A;  4PJO B;  1UGQ B;  4M7D A;  1SF9 A;  2KMT A;  3HTR A;  1HJD A;  1B7T A;  2KDS A;  2E65 A;  1M1G A;  2EGE A;  1OU8 A;  1Q86 C;  1BCO A;  2X4J A;  2FPE A;  4DQ2 A;  1YHQ T;  1VQN T;  1WHM A;  1ZUU A;  2HQE A;  1EIF A;  5KYX A;  2J06 A;  1QVP A;  2YUQ A;  3HRS A;  3NHN A;  4E7I A;  3E2U A;  5DY9 A;  2NLU A;  2XD0 A;  1JXO A;  2LNH B;  2H8H A;  4TVR A;  4PJM A;  3A5Z B;  3BY7 A;  4LN2 A;  3CCE A;  4L59 A;  5D6W A;  1YWO A;  3CBO A;  2EVR A;  4X1V A;  4WTO B;  2OJ2 A;  2P4R A;  4X9D A;  4OMF B;  4CI0 C;  1W1F A;  3CBP A;  1U1S A;  3C4S A;  4JS5 A;  1YJN Q;  1AVZ C;  1A0N B;  1UG1 A;  2EKH A;  4C0G A;  3AHU A;  4XAX B;  1M1K R;  2JNG A;  1VQL Q;  2W10 A;  1PRL C;  3OW2 P;  1K9M U;  2LTO A;  2RHI A;  2XK0 A;  1U1T A;  2QG9 B;  4C5H A;  2RI2 A;  4FM4 B;  5D7U A;  1T0J A;  4C92 A;  2GNC A;  4EMG A;  1YFN A;  1NEG A;  3P8H A;  5CR2 A;  3HKS A;  3JCM d;  1PKT A;  4JPB W;  3G4S T;  1YIT T;  3EG9 A;  4XU2 A;  2DM1 A;  4GBQ A;  5LL6 S;  2DO3 A;  4R0K A;  4D8D A;  5I2M A;  3M57 A;  3VU3 C;  1TS9 A;  1OOT A;  2EYZ A;  2JTM A;  4J9G A;  2PTK A;  1QMC A;  4P5N A;  2XDP A;  4ATO A;  4KUI A;  2DIL A;  1AZE A;  2E1H A;  3OY9 A;  1JQQ A;  2HCK A;  4N4G A;  1JU5 C;  3O8V A;  1U8R A;  1NLO C;  2RJD A;  2L0A A;  2DE0 X;  5GAN 6;  5L23 A;  2DYI A;  4KBM B;  4RG8 A;  2K3X A;  4M75 G;  2I0N A;  4UC4 A;  3L2Z A;  4A63 B;  4M7D G;  1TUG B;  3QJY A;  4IUR A;  3SFM A;  3CCE Q;  1HYO A;  3RDV A;  2O01 E;  1WZO A;  2QDY B;  2M16 A;  3A98 A;  4M78 D;  3SWN B;  3LGF A;  5LJ3 g;  5GMK l;  1MND A;  1PM3 A;  2HSP A;  2O4X A;  4B9X A;  2ZAE A;  3X20 B;  5FU6 C;  3VUZ A;  2LQ8 A;  1KIK A;  1MV3 A;  4KGV B;  3DLL A;  3ZFJ A;  1HD3 A;  1RAG B;  3PFS A;  5KYW B;  2DL8 A;  1GCQ A;  4B9W A;  3UWN A;  3RER A;  2F5K A;  3C0C A;  4LD6 A;  1VQO T;  1T3S A;  4M78 C;  1M90 C;  5IT9 E;  3EHR A;  1YBY A;  3CPW P;  3RMS A;  1QW1 A;  5IXF A;  5GAM d;  5IHI A;  1YJN T;  5GAO n;  2KXD A;  4M75 E;  3TCJ A;  1NZ9 A;  2KT1 A;  1M90 R;  3BDL A;  1Q7Y C;  1NPP A;  1EFN A;  4M7D E;  1H8K A;  5C0M A;  1ZBX A;  2KE9 A;  3I56 A;  2YUO A;  1JJ2 A;  1ZA1 B;  3LYI A;  2OTL T;  1QVF A;  4FYY B;  1KD1 C;  2EW3 A;  1BI1 A;  4FIB A;  3H41 A;  2OX7 A;  5LJ3 j;  3CQT A;  2YUN A;  1VQ9 A;  3PT9 A;  2D8J A;  5LJ5 h;  3E9F A;  1Y0M A;  1OU9 A;  3H0F A;  3MP1 A;  1I1J A;  1KQS A;  1D1B A;  1PKS A;  3I55 A;  1K8A C;  2HAX A;  2DL5 A;  3MO8 A;  4HCB A;  2K5L A;  3MPU B;  1K76 A;  1B34 B;  5LJ5 f;  3TSZ A;  2EQK A;  3GNF B;  4E7L A;  2RJF A;  1QKW A;  1X2K A;  1X27 A;  2FEI A;  2RH2 A;  2F1L A;  2BE7 D;  1JRI A;  3SWN A;  4BY6 B;  1HSQ A;  6AT1 B;  4ZTJ A;  2ENM A;  1AD5 A;  2GTJ A;  4GLM A;  3JCM g;  3G6E A;  4OMM A;  5CKE A;  2R58 A;  4LDV A;  1OYX A;  5A2Q E;  3SHW A;  4C0Z A;  3L2R A;  4C92 E;  2HKQ B;  4LUD A;  4Z88 A;  2HEQ A;  1NYG A;  1PG5 B;  1K1Z A;  3MP8 A;  4JZ4 A;  3OYI A;  4IUV A;  1RI0 A;  3JCM c;  2KVQ G;  4J7I A;  4AT1 B;  4N4I A;  2KEA A;  5CQX A;  1ZUK A;  4F7U B;  1TTH B;  1AWX A;  3A8L B;  2ZCF B;  4ZN3 A;  2EWN A;  4Y92 A;  3LX7 A;  3JCM Q;  2CGH A;  4XTX A;  5GMK m;  2J6F A;  4JS4 A;  2MYS A;  2VC8 A;  1YJW Q;  4C8Q D;  4ZTF A;  4JJN K;  2X4Y A;  2ZPE B;  1WHK A;  4ANJ A;  1HXD A;  4NS5 A;  3I56 Q;  3EH1 A;  1U5S A;  2DVE A;  4XK8 E;  2EGA A;  4N4H A;  3A8O B;  2HSE B;  4JJD A;  3VKI A;  2DA9 A;  4C8Q B;  1SRM A;  3ASK A;  3ZL7 C;  4M77 D;  3M0U A;  1AWO A;  2P84 A;  3IQL A;  4C8Q C;  1RL2 A;  2XG8 D;  3LH0 A;  5CCA A;  3OYY A;  1FMV A;  2DKG A;  1O9S A;  8ATC B;  1F1B B;  4M77 B;  3I55 Q;  3VS0 A;  2DEQ A;  3NTK A;  1J3T A;  4IIO A;  5A0L A;  4M77 C;  4ORZ A;  1NLP C;  1JEG A;  1QWF A;  3RR6 A;  5GAM g;  1WJQ A;  1RAE B;  2AIR B;  2QEX A;  3GLX A;  3PVL A;  5FRN A;  8AT1 B;  2E6Z A;  5DLO A;  2RNA A;  2GFU A;  1NM7 A;  2IIM A;  1R77 A;  1NJI C;  1GBR A;  1UJ0 A;  1Q81 U;  2MPX C;  3INZ A;  1AHJ B;  3WVE B;  3JCM J;  1TUD A;  2K9G A;  3QYG B;  1FX7 A;  3OSS C;  5GAO p;  2QDL A;  1K9A A;  2IPO B;  3QZ9 B;  3RKX A;  1NJI R;  3V7S A;  5HKC A;  2F2V A;  3CCR T;  4DEX A;  2AZV A;  2XI9 A;  4N0A A;  4PK4 A;  2QAS A;  2L3P A;  3WVD B;  4QVD A;  4CC3 A;  1PNJ A;  1M9S A;  3VS7 A;  3CCU A;  2CUB A;  1RLQ C;  3Q1J A;  4FL6 A;  3UF4 A;  4BDZ A;  2D9T A;  1GL5 A;  2EQJ A;  2YWW A;  2CP5 A;  3JV3 A;  4J83 A;  1H64 1;  4J7F A;  1YI2 A;  3LW5 E;  5GAM j;  1U3O A;  1UUE A;  4E7J A;  3EFO B;  2WSE E;  4X9C A;  2QA4 A;  5KYU A;  5AYF A;  4BUG A;  1OV3 A;  4PNO A;  3M56 A;  3I56 T;  1KC8 U;  3C95 A;  4KRT A;  2EIF A;  4M78 F;  3P8B B;  3E19 A;  1P92 A;  2DXC A;  1W2B A;  1YJ9 A;  2MWO A;  1Z9Q A;  1JBM A;  2X4X A;  3M53 A;  2QTX A;  2E10 A;  1VQ9 T;  1VUB A;  2CYZ B;  3EGU A;  3JB9 H;  4M75 D;  1TSF A;  2VWF A;  2HDA A;  4XU1 A;  2DPP B;  5KYY A;  3CCM A;  3FB9 A;  4M7D D;  3EGX B;  3G71 A;  2EQM A;  2M02 A;  2PQW A;  4XTY A;  3X26 B;  4RUG A;  2FB7 A;  4NL3 A;  2LCS A;  2RI5 A;  1W6X A;  1G3W A;  3G6E T; 
#chains in the Genus database with same CATH homology
 2VKN A;  1PRL C;  2L2P A;  1Z9Z A;  2KGT A;  2KYM A;  3NMZ C;  4Z89 A;  2YSQ A;  1WDX A;  1T0J A;  2GNC A;  1NEG A;  1W70 A;  2EYW A;  4JJB A;  3VS5 A;  2GTO A;  1QKX A;  3M0Q A;  2RQV A;  1PKT A;  2FO0 A;  1GBQ A;  4JPB W;  4LUE A;  2DBM A;  1LCK A;  4LNP A;  2RQT A;  2AKL A;  2DM1 A;  2PNI A;  5IXB A;  1Y57 A;  4GBQ A;  2DRK A;  4R0K A;  4CC2 A;  4D8D A;  2A08 A;  4E6R A;  2ED0 A;  2CSI A;  3TSW A;  1K0X A;  2K3B A;  1E6H A;  2DL4 A;  1UDL A;  1B3Q A;  1OOT A;  4DEY A;  2EYZ A;  4J9G A;  2PTK A;  1GFD A;  3EHQ A;  2DNU A;  2DIL A;  2DBK A;  4RTV A;  3H0H A;  3M0S A;  1AZE A;  4J9B A;  4EIK A;  1JQQ A;  3VS2 A;  2HCK A;  4F14 A;  4RTY A;  1JU5 C;  1GFC A;  1PRM C;  1ARK A;  1BBZ A;  1CSK A;  1UGV A;  2YDL A;  1FMK A;  3KFV A;  1NLO C;  2AK5 A;  1WYX A;  2L0A A;  1QLY A;  2KNB B;  4OMQ A;  4ESR A;  2DE0 X;  2K2M A;  2GQI A;  5L23 A;  2D1X A;  2ROL A;  3NGP A;  2I0N A;  2LQN A;  2K6D A;  1K4U S;  4A63 B;  1KSW A;  3VS3 A;  1U06 A;  5I22 A;  2F2X A;  2RPN A;  3REB B;  5GJW B;  1ZX6 A;  4JZ3 A;  3EG3 A;  4AFS C;  3ULR B;  2OI3 A;  1GCP A;  2DL3 A;  2JS0 A;  1ZLM A;  1SRL A;  3A98 A;  2GBQ A;  1G2B A;  2MOX A;  1UJY A;  5FWC A;  2M0Y A;  2HSP A;  3UAT A;  4M4Z A;  1VA7 A;  1KIK A;  3REA B;  1MV3 A;  1WX6 A;  3TVT A;  2O88 A;  1HD3 A;  1WXB A;  4AFQ C;  2DL8 A;  1GCQ A;  1WXT A;  2FRW A;  3C0C A;  2ECZ A;  1T3S A;  1M30 A;  2RQW A;  3EHR A;  2J05 A;  1YNZ A;  3I9Q A;  3VS6 A;  5IXF A;  1OEB A;  5ECA A;  3VS4 A;  3H0I A;  5IHI A;  3NPF A;  2KRS A;  4HVV A;  2JS2 A;  1RUW A;  1AWW A;  2KXD A;  1XOV A;  2KYB A;  2KT1 A;  1X43 A;  1UHF A;  1MUZ A;  1EFN A;  1H8K A;  2KE9 A;  2L3S A;  2RQR A;  1YP5 A;  2KT8 A;  2YUO A;  3I5S A;  4RTX A;  4RTZ A;  2CUD A;  4AG2 C;  3I5R A;  2EW3 A;  1WXU A;  3H41 A;  2DVJ A;  2F2W A;  3CQT A;  1E6G A;  1WA7 A;  2YUN A;  2CDT A;  2BTT A;  1SPK A;  2D8J A;  3M0R A;  1SSH A;  2MIO A;  2EBP A;  1Y0M A;  2HBW A;  3H0F A;  1I1J A;  2LQW A;  2LJ0 A;  2X3X D;  1PKS A;  1N5Z A;  2KXC A;  3VS1 A;  2DL5 A;  1B07 A;  1K76 A;  2V1Q A;  2X3W D;  1WI7 A;  1KFZ A;  4QT7 A;  1T3L A;  1IO6 A;  1RI9 A;  3TSZ A;  3SEM A;  1QKW A;  1SHG A;  1X2K A;  1X27 A;  2FEI A;  2MCN A;  3UA6 A;  1HSQ A;  2A37 A;  4OML A;  2ENM A;  2NUZ A;  1NYF A;  1AD5 A;  2JT4 A;  2GTJ A;  2BZ8 A;  2O9S A;  2G6F X;  4GLM A;  4Z8A A;  3M0P A;  4J9D A;  2FG0 A;  4OMM A;  1WIE A;  2KRM A;  4J9C A;  2RF0 A;  2O31 A;  3I35 A;  1RLP C;  1BU1 A;  1X6B A;  1ZBJ A;  3SHW A;  2RQU A;  1YWP A;  2LZ6 B;  4LUD A;  4Z88 A;  2HEQ A;  1NYG A;  2D0N A;  1K1Z A;  4JZ4 A;  3GBQ A;  3VRY A;  2JW4 A;  2LX7 A;  2DLP A;  3LH5 A;  4OMO A;  2KEA A;  1ZUK A;  4RTT A;  3QWY A;  4OMP A;  3PE0 A;  2SRC A;  1AWX A;  2YT6 A;  2KRN A;  3THK A;  2DJQ A;  1H92 A;  1BK2 A;  1AZG B;  2DYB A;  4Y92 A;  1M3A A;  2B86 A;  2RN8 A;  4D8K A;  2DL7 A;  2J6F A;  1X2Q A;  4WCI A;  1OPK A;  5IHN A;  1YN8 A;  1M8M A;  2EYX A;  1VYT A;  1M3B A;  2CH4 A;  2NWM A;  3UA7 A;  2KBT A;  2J6K A;  5EC7 A;  4HVU A;  4FSS A;  1QCF A;  4LE9 A;  1NEB A;  1U5S A;  2DMO A;  2EPD A;  1TG0 A;  2EGA A;  4IIM A;  1X6G A;  2AKK A;  4JJD A;  2K7A A;  2DA9 A;  3QWX X;  5IH2 A;  1SRM A;  2OAW A;  2YUP A;  4JJC A;  3ZL7 C;  1PWT A;  4ZNX A;  2BZX A;  1VYV A;  2JM9 A;  3M0U A;  1AWO A;  3IQL A;  2GGR A;  2FPD A;  2LMJ A;  1H3H A;  1QWE A;  2O2O A;  2ROT A;  1AWJ A;  2XMF A;  1UEC A;  2J6O A;  2V1R A;  3EG2 A;  2ESW A;  3VS0 A;  2C0O A;  1JXM A;  1M27 C;  2W0Z A;  1X69 A;  1J3T A;  4IIO A;  4J9I A;  1UHC A;  4ORZ A;  2KR3 A;  2EGC A;  2BZY A;  1NLP C;  1JEG A;  1QWF A;  2C0T A;  1V1C A;  3EG1 A;  2RMO A;  5GJV B;  2AZS A;  2LJ1 A;  2K79 A;  2A28 A;  2C0I A;  3PVL A;  4F16 A;  3EG0 A;  2JTE A;  2RNA A;  2SEM A;  2LJ3 A;  1NM7 A;  2IIM A;  2PZ1 A;  2L3Q A;  2CH4 W;  1GBR A;  1YCS B;  1UJ0 A;  1GCQ C;  1I0C A;  1TUD A;  2K9G A;  2E5K A;  2DX1 A;  1ZSG A;  2JM8 A;  3O5Z A;  2QDL A;  1K9A A;  4AFU C;  1WFW A;  2EYY A;  1G83 A;  4RTU A;  2F2V A;  2ED1 A;  5HCK A;  1PHT A;  4AFZ C;  2AZV A;  3PVQ A;  4DEX A;  1K0S A;  2L3P A;  5IHK A;  1BB9 A;  1SHF A;  1AOJ A;  2D8H A;  4CC3 A;  1PNJ A;  3VS7 A;  2CUB A;  1RLQ C;  2J7I A;  4J9H A;  1AEY A;  4CC7 A;  1I07 A;  4K11 A;  3UF4 A;  1FYN A;  4J9E A;  1S1N A;  1GL5 A;  1UTI A;  4CC4 B;  3JV3 A;  2A36 A;  4OMN A;  1MV0 B;  1NG2 A;  4HCK A;  1WLP B;  1E7O A;  1U3O A;  4F17 A;  2CT3 A;  4RTW A;  1UUE A;  2CSQ A;  3U23 A;  2JMC A;  2EQI A;  1CKB A;  1OV3 A;  1ZUY A;  1HJD A;  5FWB A;  2CRE A;  2M51 A;  4KRT A;  2EGE A;  2DRM A;  2ABL A;  3RBB B;  1TUC A;  2FPE A;  3M0T A;  1ZUU A;  2CT4 A;  2O9V A;  2VVK A;  4AG1 C;  5FW9 A;  1Z9Q A;  2J06 A;  2YUQ A;  3NHN A;  4J9F A;  2FPF A;  5I11 A;  1JO8 A;  2JXB A;  1JXO A;  2LNH B;  3RNJ A;  1GRI A;  2H8H A;  3VRZ A;  3EGU A;  4LN2 A;  2VWF A;  2HDA A;  1CKA A;  2FRY A;  2KRO A;  2JMA A;  2LP5 A;  1UE9 A;  1YWO A;  2DF6 A;  2EVR A;  4X1V A;  2OJ2 A;  1VYU A;  2P4R A;  1OPL A;  1W1F A;  4HXJ A;  1ABO A;  1UFF A;  1SEM A;  1ABQ A;  3FJ5 A;  4RUG A;  1T0H A;  3R6N A;  1AVZ C;  1A0N B;  1UG1 A;  2EKH A;  2LCS A;  1M3C A;  4HVW A;  1KJW A;  1W6X A;  2W10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...