2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Neutrophil cytosol factor 2
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
1CKBA 2YSQA 4LUDA 1SPKA 2RQVA 1NEGA 2EGAA 2KYMA 2M51A 1X27A 2K6DA 4JZ4A 2JT4A 2JW4A 1WXTA 3M0QA 1AWXA 1ZLMA 5IH2A 1GCPA 2CH4W 4FSSA 3VS7A 2RQTA 1T0JA 2DLPA 1ZSGA 3ZL7C 1SRLA 1MV3A 2DNUA 3VS3A 1J3TA 2BZYA 2AK5A 1TUDA 5EC7A 2DVJA 2E5KA 2CUDA 1YNZA 5FW9A 4EIKA 1WXUA 3KFVA 4F16A 2CREA 1I0CA 1UGVA 2A08A 2A37A 1BK2A 1G83A 2HEQA 2JXBA 2KT8A 1HJDA 2ED1A 1X6BA 2JM8A 2DYBA 3UA7A 3C0CA 3SEMA 4K11A 2MOXA 1GBRA 2RMOA 1T3LA 1K4US 1NLPC 2CSIA 2L3SA 3REBB 3VS1A 2LNHB 2LQNA 2C0OA 2L0AA 4RTWA 3EHRA 3VS4A 2AZSA 2GBQA 2CDTA 5GJVB 4J9CA 2CUBA 3H0HA 1JXMA 2J6OA 1AZEA 1MV0B 3PE0A 2DJQA 1UTIA 2ED0A 1NM7A 2SRCA 1PRLC 3EGUA 3VS2A 4RTTA 1FMKA 3RBBB 2CSQA 2DA9A 4F14A 1W6XA 2KNBB 2K3BA 5L23A 2ROTA 1X69A 3TVTA 2DE0X 2G6FX 2O9SA 1AD5A 2KYBA 3NGPA 3I35A 2O2OA 1WFWA 3M0PA 2EYYA 4J9GA 1X2KA 1H8KA 1NG2A 1CKAA 5I22A 1H3HA 2FG0A 4IIMA 3O5ZA 2KROA 3THKA 1JXOA 5ECAA 4JZ3A 1OOTA 1K1ZA 1ABOA 2O9VA 1K0XA 3EG0A 1JO8A 2AKKA 2C0TA 2W0ZA 1JEGA 1M3CA 4CC3A 4CC2A 1T3SA 1H92A 4HVUA 1PHTA 2HDAA 2RF0A 2KR3A 2FEIA 2RQWA 1RUWA 2D1XA 2NUZA 3REAB 1U5SA 4OMOA 1SSHA 2GGRA 4GLMA 1UJYA 1T0HA 2F2VA 1WI7A 2XMFA 1W1FA 1WA7A 2RPNA 1B07A 2OJ2A 2V1RA 1WYXA 2KGTA 2DBKA 4LN2A 2A36A 2YUNA 1E6GA 2KRNA 2PNIA 2RNAA 4D8KA 1GCQC 2OI3A 3VRYA 2CT4A 4Z88A 4LUEA 1AEYA 2DX1A 3M0SA 3UF4A 1RLQC 2VKNA 3NPFA 1V1CA 2DM1A 1UECA 4RTZA 2DL4A 1WLPB 4ZNXA 1FYNA 1UJ0A 1ZUKA 2GTOA 2RQUA 4AFSC 1K0SA 2DRKA 3VS6A 1RI9A 2ENMA 4RTYA 4CC4B 3PVLA 1SRMA 1GCQA 1Z9ZA 3IQLA 4JPBW 2DBMA 4JJDA 2IIMA 2ESWA 4OMMA 1A0NB 1VYUA 2LZ6B 2LJ0A 1PRMC 2V1QA 4CC7A 3EG1A 2C0IA 4X1VA 2D8JA 1I07A 3TSWA 1ZUUA 2EPDA 2FPEA 2GTJA 2BZXA 1ZUYA 2O88A 4HVVA 2KE9A 2EYWA 2JS2A 2LQWA 2X3XD 2DRMA 1WDXA 4AFZC 1Y57A 3R6NA 1ABQA 1UUEA 4J9BA 3ULRB 1K9AA 3M0RA 1ZX6A 1VA7A 2VVKA 1UG1A 1KIKA 1OV3A 2D8HA 2B86A 1AOJA 2QDLA 1QKXA 1QKWA 1PWTA 2X3WD 2YT6A 2JTEA 1IO6A 1NYFA 2JMCA 1NLOC 1MUZA 2DMOA 5IXFA 2HCKA 1JQQA 2YUPA 1I1JA 1HD3A 3VS0A 4Z89A 2OAWA 2F2XA 2LJ3A 4HCKA 1PKTA 1NYGA 4Y92A 1X6GA 1BU1A 3LH5A 2DL3A 2W10A 1KFZA 2AZVA 2A28A 1X43A 5IHKA 2DL5A 2LP5A 3EG3A 2LCSA 4Z8AA 1U3OA 1UE9A 2J7IA 4M4ZA 4A63B 3PVQA 4AG1C 1QLYA 2BTTA 1PKSA 4AG2C 4KRTA 1M27C 2DF6A 1K76A 3FJ5A 1YP5A 1KSWA 1E6HA 1X2QA 2ECZA 5HCKA 4RTXA 1GL5A 1QWFA 1KJWA 3RNJA 1UHCA 1OPLA 4ORZA 1AWJA 2J05A 3M0UA 1WXBA 4J9HA 1UDLA 1ARKA 1QCFA 1U06A 2L2PA 4DEYA 4DEXA 1M3AA 3A98A 4OMLA 2EGEA 2EYXA 4OMPA 4QT7A 1UFFA 2RQRA 3TSZA 2VWFA 2GQIA 2M0YA 4J9DA 1TG0A 1GFCA 1BBZA 1HSQA 4J9FA 1N5ZA 1OEBA 4WCIA 1SHGA 2I0NA 1OPKA 3NMZC 3EG2A 2FPDA 3EHQA 2DL7A 2EW3A 1AWOA 1UHFA 2D0NA 1B3QA 2H8HA 4OMNA 2AKLA 2K9GA 2DILA 2SEMA 3UA6A 4ESRA 2KRMA 1W70A 1LCKA 3UATA 1YCSB 1NEBA 2YDLA 2EVRA 1M3BA 2MIOA 2DL8A 4J9EA 5FWCA 2K2MA 1AWWA 1YWPA 1WX6A 3VS5A 2KT1A 1GRIA 2J06A 2ABLA 2EGCA 1EFNA 2FRYA 5IHIA 3CQTA 4AFUC 5IXBA 2P4RA 1GBQA 2EBPA 4LE9A 4F17A 3I5RA 1Z9QA 1XOVA 3SHWA 1WIEA 2EKHA 2MCNA 1SHFA 2KRSA 1VYTA 2JM9A 1ZBJA 3JV3A 5FWBA 1SEMA 2LJ1A 4E6RA 2L3PA 4OMQA 1YN8A 2KXDA 4RTUA 2JMAA 3I9QA 3M0TA 3QWXX 1M30A 3QWYA 2EQIA 1S1NA 2BZ8A 2F2WA 2O31A 1RLPC 2PTKA 4RTVA 2PZ1A 2YUQA 2GNCA 3I5SA 4HVWA 4J9IA 1CSKA 1M8MA 2CH4A 1AVZC 2FO0A 4GBQA 1JU5C 2NWMA 2ROLA 2HSPA 3VRZA 4JJBA 4AFQC 5IHNA 2K79A 2JS0A 4HXJA 4R0KA 1YWOA 3NHNA 1Y0MA 4RUGA 2FRWA 1BB9A 4D8DA 1VYVA 1GFDA 2J6FA 2HBWA 2L3QA 5I11A 2LMJA 2YUOA 1E7OA 4JJCA 1TUCA 1QWEA 2KEAA 2EYZA 3GBQA 2LX7A 3H0FA 2J6KA 3H41A 1AZGB 5GJWB 4LNPA 2KXCA 3H0IA 2K7AA 2CT3A 1G2BA 3U23A 2RN8A 4IIOA 2KBTA 2FPFA 1PNJA
chains in the Genus database with same CATH superfamily
1CKBA 2YSQA 4PJOA 3ZFJA 3X28B 3L2UA 5AYFA 3JCMd 3AT1B 5GAOl 2DXBA 3WVEB 1KQSA 2EGAA 4BY6C 5IT9E 1VQOT 2X4YA 3PFSA 3MEWA 2QTVA 2CZ0B 1AWXA 5IH2A 1GCPA 2QEXT 1YBYA 4M7AF 2DLPA 4E7HA 3CPWS 1ZSGA 5GANj 2QQRA 4BY6B 2BZYA 5EC7A 1TUDA 2FVUA 2DVJA 2E5KA 2HL5C 3FRNA 4PNOA 2COYA 2MF2A 1YNZA 1VQNT 2I2LA 3L1AA 3BE3A 2EFIA 3VYHB 5FU7C 2ZZDA 4M77E 4IUUA 2A08A 1FXXA 2JXBA 1VQ4A 2PVGB 2ED1A 2NLUA 2CP2A 2JM8A 4K11A 4JRIA 3VV0A 5FU7B 3M4YA 3REBB 2CSIA 3CCUT 1PD1A 3VS1A 2LNHB 2LQNA 3X20B 2XU8A 3H0HA 1JXMA 3MEAA 3PE0A 3LWHA 3E19A 2YRDA 4LDXA 3RBBB 1VQOA 2OTLQ 3KXTA 2YWWA 4C92E 1UGPB 4PK4A 3HSBA 1UEBA 2QEXA 3UWNA 2FL7A 2BKDN 1OU8A 4KULA 2XG8D 4E7JA 2EYQA 2K57A 3JCMP 2LQ8A 2HD0A 1AD5A 4II1A 5CKFA 3I35A 1R8OB 1VQNA 2EYYA 4J9GA 3OY9A 2RHZA 1H8KA 1NG2A 1YJNA 4C92A 2LQKA 5I2SA 3HL8A 2X9HA 5KYWA 3THKA 4EMHA 4FYXB 1JXOA 2RHXA 1ABOA 2DK3A 3CCUA 2EKOA 5J3BA 1N6AA 3OYMA 3EFRA 5GAN3 1HYOA 2W0ZA 2DKGA 1YHQQ 1M3CA 4CC2A 3LGFA 3V8JA 2K5FA 2GF7A 2BUDA 2D1XA 2E5QA 5LJ5d 1SSHA 3V8KA 4EMKC 4GLMA 1RI0A 5GMKj 2GFUA 2EQKA 1UJYA 1WHLA 2CYZB 2XMFA 3M58A 1VQKT 1B07A 4EDUA 1PCXA 1IB8A 2RHUA 1NBEB 2DBKA 1D0ZA 4EMKB 2PNIA 4Y91A 2OI3A 3QDFA 2DZ9A 3PIPA 1SSFA 4LUEA 5KYUB 1AEYA 3M0SA 2JUFA 1VQ7T 3NPFA 3QKJA 1V1CA 1UECA 1MMAA 4A53A 2GTOA 4AFSC 1QW1A 1VQ9T 1IHWA 5CKEA 3PVLA 3GP8A 3GNGA 1GCQA 5FU6C 4JPBW 4XK8E 4FYYB 4OMMA 1MNEA 1VYUA 1WJSA 4KBMB 2D0QB 5KH6A 4Q5WA 1WHMA 1TUGB 5GANg 1K73U 2FPEA 5FU6B 2BZXA 3OMCA 2JS2A 1FMVA 4IUQA 3CCQT 1WDXA 2XDBA 5IAYA 4B9WA 3EH2A 2VV5A 3EH1A 3QHSA 1VQKA 4DBFA 3R6NA 3OS0A 3ULRB 2DFUA 1ZX6A 2VVKA 1YCYA 4OF1A 5LJ3d 3CCLQ 2R58A 4O6JA 1AOJA 4F04B 3LW5E 3MKDA 5DLOA 2FB7A 3OW2A 1IO6A 2ZPEB 1VQ7A 1RADB 1WHHA 1M4ZA 3VS0A 3VKIA 1NYGA 1VQ9A 1OYXA 1SG5A 7AT1B 1RAIB 2NUPA 4WF2A 5GAN2 1K73C 3OYHA 3SFMA 4BE0A 3V7RA 1VQLT 1PM3A 2AZVA 2P84A 3EGDA 4M7DF 3OYYA 2E6ZA 2LNVA 4JLIA 4Z8AA 2HQEA 3JCMJ 1U3OA 1BCMA 1OU9A 1ZSZC 3CCRT 4M4ZA 3PVQA 3CCQA 1M27C 2RH2A 1E6HA 1ZSZB 4X9CA 1U8RA 2ECZA 3M4GA 5GAMh 2EJFA 4RTXA 2PQWA 3URGA 3EGXA 1FWZA 3RNJA 3TEEA 2KVQG 6AT1B 3D7SB 1AWJA 3A8LB 3M53A 1WXBA 2COZA 1ARKA 2ZPFB 1U06A 5CO7A 4LDYA 3HFNA 4DEYA 3PTAA 1M3AA 2DIGA 3JCMV 4MZMA 2ZAEA 2PUOB 2H3JA 1VOMA 4V2SA 2M0YA 1TG0A 1BBZA 2JZ2A 3M56A 1VQLA 4F7UF 1HSQA 1IGQA 2IVWA 3LGLA 2HAXA 1OPKA 3NMZC 3EG2A 3G71T 3EHQA 2DL7A 3LX7A 3DLLA 5FRMA 3PIOA 3CCRA 2H8HA 4M78D 4OMNA 2YLBA 2DILA 3JCMe 4FL6A 1W4SA 5KYNA 2KRMA 4BACA 2JN0A 1C0MA 5HK0A 2EVRA 4XTXA 2MIOA 3VU3C 2K2MA 1NJIU 1NPRA 2ZPHB 2ZPIB 3VS5A 1GRIA 2ABLA 4JS4A 2KQWA 5M9OA 5IHIA 4FYVB 4PJOF 3QYGB 2JVVA 1N8RR 1GBQA 1Z9QA 4PJNA 5I21A 2EKHA 3CCST 1Y96B 2KRSA 2JM9A 4E6RA 5LJ3h 3CCJQ 2RK1A 3ER0A 3RKYA 3A8HB 3G71A 3M0TA 3G4ST 3QWYA 4JUVA 1JRIA 4N4HA 4E7LA 4HCCA 4A4GA 1YIJQ 3CC4Q 1KQ2A 2GNCA 1Q86C 4JRQA 4J9IA 1M8MA 2ZPBB 2RHYA 2ROLA 3A1PA 3VRZA 4JJBA 4BE1A 1WGSA 2WSCE 1VYVA 1N27A 2HBWA 4B6MA 2D6FA 3RIRA 1TUCA 4WTOB 2EYZA 1YFNA 3H6ZA 3H0FA 2J6KA 3CCSA 1VQ4Q 3FB9A 1B34A 5GAMe 3GIBA 1G2BA 3CBOA 4XU0A 2RN8A 2KK4A 3OYFA 4J9CA 1X75C 2FPFA 1PNJA 1X01A 4LUDA 1SPKA 3M59A 1NEGA 1R0BG 3GOXA 2RJCA 2K6DA 4JZ4A 4RMOA 4FT4A 2JT4A 1BCOA 2JW4A 5LJ5e 1WXTA 4C92F 4XAXB 2CH4W 4FSSA 2DVEA 3QBYA 4EMKA 4XU1A 3GPLA 3QDRB 4M75C 1VQOQ 3OYNA 1M90R 2QEXQ 1Q81R 4RG2A 1WXUA 4M75B 5GAMj 4F16A 1SF9A 3J80E 2CREA 5KYXA 1UGVA 2HEQA 1BK2A 1G83A 4PFOA 1HJDA 1X6BA 3CXCS 1VQNQ 3JCMX 4C8QG 3C0CA 3SEMA 1QVFS 2B8AA 1G8XA 2MOXA 2RMOA 1T3LA 4N0AC 1K9MR 1NLPC 2L3SA 2HL3A 2C0OA 3VS4A 3EHRA 2AZSA 4QQDA 4M78C 2XDPA 1OX9A 1MV0B 3SWNA 3CCUQ 2WSFE 5J26A 3DB4A 1UTIA 3CCVT 2ED0A 3JB9G 2E70A 4BD3A 2YRVA 4J6XA 3OB9A 3EG9B 3OYAA 4M78B 3V8LA 2LTOA 1KD1C 4J8OA 5LL6S 1W6XA 1TH7A 5GANf 2KNBB 4M7AC 5L23A 1MMGA 2RJFA 2ROTA 1X69A 2A7YA 2DE0X 4XTWA 2O9SA 2K3YA 2HBPA 2E3HA 3HFOA 3NGPA 3HP9A 4E7SA 5LJ3e 4M7AB 4FYWB 1YJWT 1CKAA 4IIMA 4JLGA 2X51A 1VQ6T 1TTHB 1VIEA 2XIDA 5ECAA 1IXDA 3M57A 3EG0A 3JSCA 2CP5A 1JO8A 4DQ2A 2XHCA 1O75A 2AKKA 2DD5A 3EFOA 3CC7T 3CCJA 2K4YA 1T3SA 4A4KA 3HTRA 4O5VA 3CCVA 1JB0E 2LT4A 2RQWA 4M7DD 1U5SA 3INZA 4FM4B 2O4XB 4EMGA 1WHJA 1G3WA 1WA7A 2MYSA 4M75G 4FCYA 2V1RA 3QSUA 2A36A 2KRNA 2RNAA 4OB0B 2CT4A 1VQKQ 4KUDK 1QVPA 2BE7D 2DX1A 3UF4A 1OULA 5D6WA 3FLGA 2VKNA 1YJWA 1WLPB 1ZUKA 3HHTB 2ENMA 1VQ6A 1VQ7Q 1SRMA 3GF5A 3IQLA 4JJDA 2IIMA 1D1BA 2ESWA 4E47A 3OYKA 3EFSA 1PRMC 2V1QA 1VQ9Q 1RACB 3E9FA 4X1VA 2OTJT 1WJRA 1ZUUA 1SKUB 2EPDA 2GTJA 5GAN5 3FEOA 3CC7A 3H8ZA 1U1TA 2KE9A 3MP6A 2LQWA 3X25B 4TVRA 5A2QE 3RMSA 2JOYA 4DA4A 4M77A 5GAMg 1ZBXA 5CQXA 2DTHA 5CVIA 4M7AG 4CRIA 2KAFA 3M0RA 3CCQQ 1LPLA 1BIAA 1BI0A 4DOVA 4RCBA 4JS5A 1QKWA 2M0OA 2FZGB 2YT6A 1NYFA 4YTLA 3UT1A 1NLOC 3T9NA 1Q82R 3CD6T 1HD3A 4KGVB 2JNGA 4X34A 4C8QE 1N9SA 1K8AR 4Y92A 1X6GA 1BU1A 3LH5A 4PJOD 2DL3A 2W10A 1KC8R 2A28A 1PG5B 1X43A 5IHKA 2K2VA 2LP5A 2X4WA 1R0CB 4C8QA 2OTJA 1YJ9T 1VQLQ 2CZ7B 1QMCA 4A63B 1W2BA 1IHVA 2DAQA 4ZGJB 4Y28E 4KRTA 1EZZB 1R77A 4KUIA 4PJJA 1M2VB 2HKNA 3E1SA 1QVGP 1KSWA 1JJ2P 3CCRQ 3FJPA 2DXCA 2ZPGB 4D6WA 3JCMb 1KJWA 2P4TA 1UHCA 1D3BA 2RI3A 3S6WA 1LNXA 5D7UA 5GAOr 2RJDA 2LT1A 5D6XA 3C94A 3A98A 2X4JA 1UFFA 3TSZA 4J83A 3FIFA 4XU2A 3JCMh 4HA8A 4B9XA 5IN1A 1O9SA 4M7DC 1OEBA 3EAEA 4KT0E 4WCIA 2QK0A 5CAIA 2I0NA 1M5Q1 4XTUA 4ZN1A 1XTDA 2BIVA 1UHFA 2D0NA 1B3QA 4BI4A 3OYLA 4M7DB 3HRUA 4M75E 2SEMA 3QO3A 3UA6A 3G71Q 9ATCB 2FZKB 1LCKA 3H9NA 1NEBA 3J81E 4J9EA 5FWCA 1QVGS 4C92D 1AWWA 1WX6A 1IRXA 3MO8A 4QW2A 2EGCA 4M75A 1I4K1 1EFNA 3DKMA 2FRYA 4ZTJA 1TS9A 5GAOp 3CXCA 4MZTA 2GQVA 1QVFA 2EBPA 3DB3A 2QGFB 3BFMA 4F17A 1Q7YR 1XOVA 3G6ET 1WIEA 2K3XA 3BW1A 1KQSP 1ZBJA 5FWBA 4PJLA 2LJ1A 2VUBA 2KXDA 4QQ6A 2DYIA 3L2RA 3CCET 4FW1A 3CCSQ 3J7AF 3I9QA 4F7UB 1N8RU 4NL2A 4M7AE 3R6OA 2DD4A 4RTVA 4FT2A 3G4SQ 4DBQA 2M1HA 5FRNA 4NL3A 3CMAT 1AVZC 2H3EB 5GANd 4GBQA 2HSEB 1AHJB 2HSPA 4M7AA 4AFQC 5IHNA 2JS0A 2NUTA 5KE3A 1S72T 3NHNA 1GFDA 4P5NA 3CBMA 4PJOC 5CK9A 3A8OB 2CP7A 2LX7A 3WVDB 3G6EA 4PLLA 4PJOB 4LNPA 5LJ5h 2KXCA 4HT9A 3H0IA 1N8RC 1D1CA 3F70A 3U23A 4C0ZA 2KBTA 3MPUB 3NFCA 1M9SA 1RABB 3CCEA 3OSSC 4PLIA 3E9GA 4HCZA 4L59A 2QA4T 2CZ6B 4MMKA 2KYMA 2QYZA 3C12A 2CGHA 2CS7A 1TSFA 1KG1A 1RL2A 3M0QA 1ZLMA 2RO0A 3VS7A 2RQTA 3OBYA 3ZL7C 3VS3A 1MV3A 4JRKA 3RESA 3HPWA 4N4IA 1VQ5T 2CUDA 3CPWA 3TREA 4ELZC 4RG8A 1WNLA 2RB6A 1I0CA 1S72A 2A37A 3LLRA 1Q86U 2E41A 2DYBA 2XD0A 1K4US 3RR6A 4XTYA 2P0PA 2YLCA 4QVCA 4OB3B 4L5GA 1M90U 4RTWA 5KCOA 2FZCB 2GBQA 2CDTA 1Q81U 2CUBA 2J6OA 2G3RA 2KSSA 3NTIA 3BY7A 3RMQA 3G1JA 1HXDA 4PKCC 5I2MA 3L2WA 2QA4A 4RTTA 1FMKA 3ZBDA 2PU9B 1K9MU 1ZHIA 4Z02A 4C92C 1VQPT 3CCVQ 5A0GA 5J39A 2Y4YA 3QXEB 1WHGA 1QQJA 1FX7A 1MNDA 2Y4XA 4KGZB 4JRPA 1KK7A 3TVTA 2VASA 4C92B 3P8HA 2KYBA 5GAMf 1RAHB 1WFWA 5AT1B 5KYWB 1X2KA 2F69A 4DOWA 5I22A 2FG0A 3MP8A 3O5ZA 1DJ7B 2E3IA 5GAN7 4HCBA 1M90C 2PVDB 3QYHB 4C5GA 1FMWA 1Q81C 1X6OA 1M2OA 4JZ3A 4M77F 1YJWQ 1OOTA 1K1ZA 3TQ7P 4A4EA 1U1SA 2O9VA 3C95A 1BKBA 2V26A 1VQ6Q 4MDWA 3LYIA 3LWIA 4OGEA 1K9MC 4NOYA 3QIIA 2KR3A 3REAB 2NUZA 3N5BB 4OMOA 3OYBA 2GGRA 1MHNA 2IPOB 1T0HA 2F2VA 3CC7Q 2RD1A 2RPNA 3JB9H 3OW2P 1VQPA 3G4SA 1TWBA 4LN2A 1E6GA 3MEVA 8AT1B 4PL6A 1GCQC 3VRYA 4Z88A 2YHTA 2EAYA 3BDLA 1XQHA 1YITT 2AHJB 2QQBA 4RTZA 1KD1U 5KYUA 4C8QF 1FYNA 3CMET 2DRKA 3L2ZA 3X24B 4CC4B 1N9RA 2CP0A 1Z9ZA 2DBMA 2V8JA 1NJIR 4AMCA 2LZ6B 1TU0B 2LJ0A 1D0XA 4CC7A 1UGSB 3EG1A 4BI8B 2C0IA 2D8JA 3TSWA 4OMFB 3JB9F 1Y07A 4LXCA 1ZUYA 1YI2T 2O88A 2LDMA 2EIFA 4C0DC 4LD9K 5FLXE 5LJ5j 4MMLA 2X3XD 3A5ZB 3META 4C5IA 2OTJQ 2RM4A 4HT8A 5DLQE 1Y57A 5HK3A 1ABQA 4C0DB 3OS2A 2QDYB 4IURA 5CCAA 1VA7A 5CQYA 3OW2S 1KIKA 4QKUA 3OYDA 4LDUA 3KUFA 1OV3A 1GXIE 2D8HA 4E7ZA 2B86A 1EX4A 1PWTA 1VQ8T 4R56A 2KMTA 2JMCA 1MUZA 2DMOA 5IXFA 3G7ZA 2NUPB 2HCKA 1YITA 1JQQA 2YUPA 4Z89A 3OMGA 1PC0A 3JCMg 2F2XA 2LJ3A 4PJMA 2PUKB 1PKTA 3CMEA 3EGDB 5GMKh 1BYMA 2VC8A 1ZQ1A 4E7KA 1KFZA 1NZ9A 5GAN6 2EJ9A 4VUBA 2LCSA 2O01E 1ACMB 1WHKA 1Q82U 1P92A 3OS5A 1UE9A 2J7IA 2VXEA 1K8AU 2DIQA 1I5OB 2DEUA 1QLYA 3HRSA 2WSEE 2LCLA 2DF6A 1K76A 3FDRA 4C5HA 1YP5A 1KC8U 3EGXB 1PSFA 1KQ1A 5HCKA 1QCOA 5LJ3j 2M16A 2QAZA 1RAFB 2HQXA 4ZGDB 2L5QA 1ZSZA 5GANe 1G5VA 4ORZA 3KBGA 2J05A 3CBPA 1VQ8A 1M1GA 2V8IA 4J9HA 1QCFA 1OZ2A 3RDVA 4DEXA 1VQMT 4OMLA 2EGEA 2EYXA 4KH1B 1M1KR 2VWFA 1I81A 2QI2A 4J9DA 1Q82C 1I8FA 2GFAA 4J9FA 1N5ZA 2MWPA 1K8AC 2F1LA 1WQWA 2M02A 2FPDA 3OQ5A 2EW3A 4M78G 1KC8C 1LVKA 2P0KA 1OZ3A 3LH0A 4KGXB 2K9GA 5CKDA 1D1AA 2XI9A 4ESRA 1W70A 3CEYA 2ZGWA 1YCSB 3RKXA 2YDLA 1YJNT 2DL8A 4RCCA 3GNFB 1H641 3CCMT 2E65A 1V76A 3VUBA 1QP3A 2J06A 5D6YA 2EJGA 3QZ5B 3RUXA 3SB2A 3MEUA 4BB7A 1HK9A 2XICA 3CQTA 8ATCB 2ATCB 2QASA 3OBWA 4BUGA 1VQMA 2P4RA 5LJ5g 1Q95G 4LE9A 2E4HA 2CP3A 3I5RA 3UPUA 1LOJA 4AT1B 1TXQA 3I56T 1SHFA 3CC2T 3JV3A 4BDZA 1SEMA 5A0DA 5GMKi 4RTUA 4QQGA 1Y96A 1M8VA 3G6EQ 4OP0A 2OAUA 1ZA2B 4R55A 2DTIA 1Q7YU 2BZ8A 4GLKA 4JJNK 2PTKA 4J6WA 3SD4A 2BE9B 3CCEQ 2V8KA 2PZ1A 2YUQA 1G3SA 4IKFA 3I5SA 5GMKe 2M9UA 3V7SA 3I55T 1JU5C 3PGGA 1MGQA 3GLXA 4OGCA 5DY9A 3WXMB 4FW2A 2MI6A 3CCMA 4LD6A 2K79A 3CMAQ 2HZYA 1YWOA 3S3OA 1Y0MA 5GAMd 2FRWA 4D8DA 3Q1JA 2J6FA 2L3RA 3MP1A 2QTXA 5CR2A 1B34B 1G3YA 1QWEA 1S72Q 3OYIA 3GBQA 3MCAB 3H41A 5GJWB 1AZGB 3CD6A 1G3TA 3I56A 4FSXA 3CC2A 3VJPA 2C06A 4IIOA 5LJ3g 4M77D 1Q7YC 2DZCA 3QJYA 4J7IA 2CP6A 2RQVA 3S3NA 1PSEA 2K5LA 4PFZA 4PFPA 2M51A 3A8GB 1BI2A 1KHIA 1X27A 1WPYA 1AT1B 4N4GA 4A4HA 2QQSA 1YJ9A 2VGMA 3P8DA 2QA4Q 2IG0A 4OB2B 1T0JA 3OA6A 4ANJA 4A54A 1SRLA 1J3TA 2DNUA 2EQUA 2AK5A 3I55A 3OSVA 5KYXB 5GAN8 4FU6A 5FW9A 4EIKA 3KFVA 1VIFA 1F1BB 3SDZA 1JJ2S 3SWNC 2KT8A 1VQ5Q 1LJOA 2RHIA 3UA7A 2LX9A 1GBRA 4QVDA 4C8QD 3SWNB 2L0AA 1UGQB 5CKBA 5GJVB 5KYYB 4M78E 2OTLT 3UDCA 1AZEA 1UGRB 2DJQA 1NM7A 2SRCA 1PRLC 3EGUA 3VS2A 4GY5A 3JB9D 4N0AA 4FIBA 2CSQA 2DA9A 4F14A 3DLMA 3EG9A 2K3BA 1XNIA 4M78A 5HY6A 1TOVA 2PVOB 2G6FX 1VQPQ 3E2UA 2O2OA 1BI1A 5GMKm 3M0PA 2DETA 5FROA 3MJXA 3VYGA 5KCHA 1H3HA 4NS5A 4ELYC 1V29B 5C0MA 2HMAA 2KROA 1EIFA 4RKUE 1NPPA 1YHQT 4JDSA 5GAOn 2JTMA 3EFOB 3L2QA 1K0XA 5KE2A 4KH0B 4C5EA 2C0TA 3JCMQ 1JEGA 1C6VX 2VB6A 4CC3A 3JCMf 1H92A 4HVUA 1PHTA 4LDVA 3JCMc 4C0FA 1IREB 2HDAA 2OTLA 4M7DG 2NYSA 2RF0A 2DPPB 1OI1A 2FEIA 1RUWA 1I5LA 1RAEB 1WZOA 1Y71A 3OS1A 1KQSS 1WI7A 2RJEA 1W1FA 4QVZA 2OJ2A 1VUBA 3L42A 1WYXA 4J7FA 2KGTA 4CI0C 4E2FB 4XTZA 2YUNA 1B7TA 4M75D 2O4XA 2K5IA 1WQ7A 2WACA 2QGGA 4D8KA 1RLQC 4IUVA 1IZ6A 1K73R 3CMAA 2DM1A 4J6YA 4XU3A 3RERA 3OYJA 5C6SA 2DL4A 2RA2A 4ZNXA 1UJ0A 2LCCA 2RQUA 1K0SA 3VUZA 3VS6A 2EQJA 1KHCA 1RI9A 4RTYA 1YHQA 4M77C 1YITQ 3V7CA 2GCXA 1BIBA 1A0NB 1W2BP 2RI5A 5A0LA 3CMEQ 2X4XA 1I07A 4F7UG 4M77B 1JBMA 1MMDA 2MAMA 5GAOq 2EWNA 4HVVA 2EYWA 3TCJA 2DRMA 5GAOm 4AFZC 2CKKA 3CCLT 1YI2Q 1QP2A 2HNIA 2JJ9A 2XDDA 2Y90A 1UUEA 4J9BA 4M7AD 3OYCA 2DJZA 2RI2A 3NTKA 1K9AA 2FYKA 2CZ1B 2QQ9A 3OYEA 1UG1A 1NE8A 4MDXA 2COWA 2VYTA 2QDLA 1QKXA 4LDWA 1OX8A 2X3WD 2JTEA 2OX7A 5GAN4 1I1JA 4C8QC 1MMNA 2E12A 2OAWA 2LC4A 4HCKA 1VQ5A 3JCMW 1VQ8Q 1QCNA 2HQHA 1IGUA 4PJOG 3C4SA 4C8QB 3QJ6A 2E10A 2X35A 2DL5A 1W2BS 3EG3A 2JTFA 3O8VA 1NJIC 5LJ5f 1ZA1B 4IUTA 1OQKA 2A0FB 5DM7R 2KDSA 2MMPA 4J5YA 5GANh 4AG1C 1C1AA 2BTTA 2YXYA 1PKSA 2XKOC 4AG2C 1M1FA 3CCLA 3M5AA 4BE2A 3FJ5A 5L8RE 1X2QA 2E1HA 1XJWB 2Z0WA 1D3BB 3CXCP 2LVMA 2DO3A 1QVFP 1M2VA 1BI3A 4DBRA 1GL5A 1QWFA 1RAGB 3MHXA 4XTVA 1OPLA 2AT1B 2DTOA 3M0UA 2RK2A 1UDLA 2QG9B 4ATOA 3S3MA 2YRCA 2L2PA 4M77G 4OMPA 3JRZA 4QT7A 2RQRA 2D9TA 2GQIA 4ZN3A 1GFCA 3M9QA 3OYGA 2A3LA 1VQMQ 4BI3A 1D0YA 2DERA 2ZCFB 3QZ9B 2XK0A 4M7DE 1SHGA 4UC4A 4ZTFA 4E7IA 3HKSA 4EPCA 1Q86R 4ZGEB 1AWOA 3L2VA 1M1KU 2HKQB 2AKLA 4BDYA 3QG1A 1RAAB 2KI7A 3JB9I 3UATA 4M7DA 5LJ3f 5HKCA 2MWOA 4C92G 2EQMA 1M3BA 3BDUA 2FHDA 4OVAA 1YWPA 2KT1A 3ZEHA 5GMKl 2AIRB 3QPHA 3M54A 1YJNQ 1QVGA 4IUPA 1JJ2A 2P0QA 2DXUA 3JB9J 4AFUC 3HRTA 5IXBA 3CCMQ 2VGNA 3M55A 2L8DA 4L6V5 4C0GA 3CCJT 3SHWA 4ME7A 3ME9A 2MCNA 1VYTA 5KYYA 2L3PA 4OMQA 4F7UE 1PD0A 1YN8A 1M1KC 3PMTA 1YIJT 3ASKA 2KY9A 3CC4T 3CD6Q 3I56Q 2JMAA 3QWXX 3CC2Q 3RKWA 1M30A 2R5MA 2EQIA 2LRQA 2QXFA 4HKEA 3QUIA 2QQAA 1S1NA 3NTHA 2F2WA 1WJQA 1RLPC 2O31A 2R5AA 5CIUA 3CPWP 1Y7XA 2F5KA 5CKHA 4F7UA 1YI2A 3PMIA 4HVWA 1CSKA 2CH4A 3X26B 3AHUA 2R57A 4M75F 2FO0A 1UB4A 2NUTB 2MK5A 2NWMA 2DEQA 3CPFA 1YJ9Q 4X9DA 3PT9A 2L89A 1D09B 4HXJA 4R0KA 3TU4K 2E6NA 3I55Q 4RUGA 1BB9A 3A8MB 1VQ4T 2F5TX 2L3QA 5I11A 2LMJA 2YUOA 3FC3A 1H3ZA 5EG2A 4PJOE 1E7OA 4JJCA 4DBHA 4MZPA 3P8BB 2KEAA 3PNWC 2E64A 4OB1B 2DXTA 4XQ3A 3JAME 4A4FA 2K7AA 2CT3A 4M78F 1KD1R 1YIJA 2VXFA 2MPXC 3CC4A
chains in the Genus database with same CATH topology
1CKBA 2YSQA 4LUDA 1SPKA 2RQVA 1NEGA 2EGAA 2KYMA 2M51A 1X27A 2K6DA 4JZ4A 2JT4A 2JW4A 1WXTA 3M0QA 1AWXA 1ZLMA 5IH2A 1GCPA 2CH4W 4FSSA 3VS7A 2RQTA 1T0JA 2DLPA 1ZSGA 3ZL7C 1SRLA 1MV3A 2DNUA 3VS3A 1J3TA 2BZYA 2AK5A 1TUDA 5EC7A 2DVJA 2E5KA 2CUDA 1YNZA 5FW9A 4EIKA 1WXUA 3KFVA 4F16A 2CREA 1I0CA 1UGVA 2A08A 2A37A 1BK2A 1G83A 2HEQA 2JXBA 2KT8A 1HJDA 2ED1A 1X6BA 2JM8A 2DYBA 3UA7A 3C0CA 3SEMA 4K11A 2MOXA 1GBRA 2RMOA 1T3LA 1K4US 1NLPC 2CSIA 2L3SA 3REBB 3VS1A 2LNHB 2LQNA 2C0OA 2L0AA 4RTWA 3EHRA 3VS4A 2AZSA 2GBQA 2CDTA 5GJVB 4J9CA 2CUBA 3H0HA 1JXMA 2J6OA 1AZEA 1MV0B 3PE0A 2DJQA 1UTIA 2ED0A 1NM7A 2SRCA 1PRLC 3EGUA 3VS2A 4RTTA 1FMKA 3RBBB 2CSQA 2DA9A 4F14A 1W6XA 2KNBB 2K3BA 5L23A 2ROTA 1X69A 3TVTA 2DE0X 2G6FX 2O9SA 1AD5A 2KYBA 3NGPA 3I35A 2O2OA 1WFWA 3M0PA 2EYYA 4J9GA 1X2KA 1H8KA 1NG2A 1CKAA 5I22A 1H3HA 2FG0A 4IIMA 3O5ZA 2KROA 3THKA 1JXOA 5ECAA 4JZ3A 1OOTA 1K1ZA 1ABOA 2O9VA 1K0XA 3EG0A 1JO8A 2AKKA 2C0TA 2W0ZA 1JEGA 1M3CA 4CC3A 4CC2A 1T3SA 1H92A 4HVUA 1PHTA 2HDAA 2RF0A 2KR3A 2FEIA 2RQWA 1RUWA 2D1XA 2NUZA 3REAB 1U5SA 4OMOA 1SSHA 2GGRA 4GLMA 1UJYA 1T0HA 2F2VA 1WI7A 2XMFA 1W1FA 1WA7A 2RPNA 1B07A 2OJ2A 2V1RA 1WYXA 2KGTA 2DBKA 4LN2A 2A36A 2YUNA 1E6GA 2KRNA 2PNIA 2RNAA 4D8KA 1GCQC 2OI3A 3VRYA 2CT4A 4Z88A 4LUEA 1AEYA 2DX1A 3M0SA 3UF4A 1RLQC 2VKNA 3NPFA 1V1CA 2DM1A 1UECA 4RTZA 2DL4A 1WLPB 4ZNXA 1FYNA 1UJ0A 1ZUKA 2GTOA 2RQUA 4AFSC 1K0SA 2DRKA 3VS6A 1RI9A 2ENMA 4RTYA 4CC4B 3PVLA 1SRMA 1GCQA 1Z9ZA 3IQLA 4JPBW 2DBMA 4JJDA 2IIMA 2ESWA 4OMMA 1A0NB 1VYUA 2LZ6B 2LJ0A 1PRMC 2V1QA 4CC7A 3EG1A 2C0IA 4X1VA 2D8JA 1I07A 3TSWA 1ZUUA 2EPDA 2FPEA 2GTJA 2BZXA 1ZUYA 2O88A 4HVVA 2KE9A 2EYWA 2JS2A 2LQWA 2X3XD 2DRMA 1WDXA 4AFZC 1Y57A 3R6NA 1ABQA 1UUEA 4J9BA 3ULRB 1K9AA 3M0RA 1ZX6A 1VA7A 2VVKA 1UG1A 1KIKA 1OV3A 2D8HA 2B86A 1AOJA 2QDLA 1QKXA 1QKWA 1PWTA 2X3WD 2YT6A 2JTEA 1IO6A 1NYFA 2JMCA 1NLOC 1MUZA 2DMOA 5IXFA 2HCKA 1JQQA 2YUPA 1I1JA 1HD3A 3VS0A 4Z89A 2OAWA 2F2XA 2LJ3A 4HCKA 1PKTA 1NYGA 4Y92A 1X6GA 1BU1A 3LH5A 2DL3A 2W10A 1KFZA 2AZVA 2A28A 1X43A 5IHKA 2DL5A 2LP5A 3EG3A 2LCSA 4Z8AA 1U3OA 1UE9A 2J7IA 4M4ZA 4A63B 3PVQA 4AG1C 1QLYA 2BTTA 1PKSA 4AG2C 4KRTA 1M27C 2DF6A 1K76A 3FJ5A 1YP5A 1KSWA 1E6HA 1X2QA 2ECZA 5HCKA 4RTXA 1GL5A 1QWFA 1KJWA 3RNJA 1UHCA 1OPLA 4ORZA 1AWJA 2J05A 3M0UA 1WXBA 4J9HA 1UDLA 1ARKA 1QCFA 1U06A 2L2PA 4DEYA 4DEXA 1M3AA 3A98A 4OMLA 2EGEA 2EYXA 4OMPA 4QT7A 1UFFA 2RQRA 3TSZA 2VWFA 2GQIA 2M0YA 4J9DA 1TG0A 1GFCA 1BBZA 1HSQA 4J9FA 1N5ZA 1OEBA 4WCIA 1SHGA 2I0NA 1OPKA 3NMZC 3EG2A 2FPDA 3EHQA 2DL7A 2EW3A 1AWOA 1UHFA 2D0NA 1B3QA 2H8HA 4OMNA 2AKLA 2K9GA 2DILA 2SEMA 3UA6A 4ESRA 2KRMA 1W70A 1LCKA 3UATA 1YCSB 1NEBA 2YDLA 2EVRA 1M3BA 2MIOA 2DL8A 4J9EA 5FWCA 2K2MA 1AWWA 1YWPA 1WX6A 3VS5A 2KT1A 1GRIA 2J06A 2ABLA 2EGCA 1EFNA 2FRYA 5IHIA 3CQTA 4AFUC 5IXBA 2P4RA 1GBQA 2EBPA 4LE9A 4F17A 3I5RA 1Z9QA 1XOVA 3SHWA 1WIEA 2EKHA 2MCNA 1SHFA 2KRSA 1VYTA 2JM9A 1ZBJA 3JV3A 5FWBA 1SEMA 2LJ1A 4E6RA 2L3PA 4OMQA 1YN8A 2KXDA 4RTUA 2JMAA 3I9QA 3M0TA 3QWXX 1M30A 3QWYA 2EQIA 1S1NA 2BZ8A 2F2WA 2O31A 1RLPC 2PTKA 4RTVA 2PZ1A 2YUQA 2GNCA 3I5SA 4HVWA 4J9IA 1CSKA 1M8MA 2CH4A 1AVZC 2FO0A 4GBQA 1JU5C 2NWMA 2ROLA 2HSPA 3VRZA 4JJBA 4AFQC 5IHNA 2K79A 2JS0A 4HXJA 4R0KA 1YWOA 3NHNA 1Y0MA 4RUGA 2FRWA 1BB9A 4D8DA 1VYVA 1GFDA 2J6FA 2HBWA 2L3QA 5I11A 2LMJA 2YUOA 1E7OA 4JJCA 1TUCA 1QWEA 2KEAA 2EYZA 3GBQA 2LX7A 3H0FA 2J6KA 3H41A 1AZGB 5GJWB 4LNPA 2KXCA 3H0IA 2K7AA 2CT3A 1G2BA 3U23A 2RN8A 4IIOA 2KBTA 2FPFA 1PNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CKB A;  2YSQ A;  4LUD A;  1SPK A;  2RQV A;  1NEG A;  2EGA A;  2KYM A;  2M51 A;  1X27 A;  2K6D A;  4JZ4 A;  2JT4 A;  2JW4 A;  1WXT A;  3M0Q A;  1AWX A;  1ZLM A;  5IH2 A;  1GCP A;  2CH4 W;  4FSS A;  3VS7 A;  2RQT A;  1T0J A;  2DLP A;  1ZSG A;  3ZL7 C;  1SRL A;  1MV3 A;  2DNU A;  3VS3 A;  1J3T A;  2BZY A;  2AK5 A;  1TUD A;  5EC7 A;  2DVJ A;  2E5K A;  2CUD A;  1YNZ A;  5FW9 A;  4EIK A;  1WXU A;  3KFV A;  4F16 A;  2CRE A;  1I0C A;  1UGV A;  2A08 A;  2A37 A;  1BK2 A;  1G83 A;  2HEQ A;  2JXB A;  2KT8 A;  1HJD A;  2ED1 A;  1X6B A;  2JM8 A;  2DYB A;  3UA7 A;  3C0C A;  3SEM A;  4K11 A;  2MOX A;  1GBR A;  2RMO A;  1T3L A;  1K4U S;  1NLP C;  2CSI A;  2L3S A;  3REB B;  3VS1 A;  2LNH B;  2LQN A;  2C0O A;  2L0A A;  4RTW A;  3EHR A;  3VS4 A;  2AZS A;  2GBQ A;  2CDT A;  5GJV B;  4J9C A;  2CUB A;  3H0H A;  1JXM A;  2J6O A;  1AZE A;  1MV0 B;  3PE0 A;  2DJQ A;  1UTI A;  2ED0 A;  1NM7 A;  2SRC A;  1PRL C;  3EGU A;  3VS2 A;  4RTT A;  1FMK A;  3RBB B;  2CSQ A;  2DA9 A;  4F14 A;  1W6X A;  2KNB B;  2K3B A;  5L23 A;  2ROT A;  1X69 A;  3TVT A;  2DE0 X;  2G6F X;  2O9S A;  1AD5 A;  2KYB A;  3NGP A;  3I35 A;  2O2O A;  1WFW A;  3M0P A;  2EYY A;  4J9G A;  1X2K A;  1H8K A;  1NG2 A;  1CKA A;  5I22 A;  1H3H A;  2FG0 A;  4IIM A;  3O5Z A;  2KRO A;  3THK A;  1JXO A;  5ECA A;  4JZ3 A;  1OOT A;  1K1Z A;  1ABO A;  2O9V A;  1K0X A;  3EG0 A;  1JO8 A;  2AKK A;  2C0T A;  2W0Z A;  1JEG A;  1M3C A;  4CC3 A;  4CC2 A;  1T3S A;  1H92 A;  4HVU A;  1PHT A;  2HDA A;  2RF0 A;  2KR3 A;  2FEI A;  2RQW A;  1RUW A;  2D1X A;  2NUZ A;  3REA B;  1U5S A;  4OMO A;  1SSH A;  2GGR A;  4GLM A;  1UJY A;  1T0H A;  2F2V A;  1WI7 A;  2XMF A;  1W1F A;  1WA7 A;  2RPN A;  1B07 A;  2OJ2 A;  2V1R A;  1WYX A;  2KGT A;  2DBK A;  4LN2 A;  2A36 A;  2YUN A;  1E6G A;  2KRN A;  2PNI A;  2RNA A;  4D8K A;  1GCQ C;  2OI3 A;  3VRY A;  2CT4 A;  4Z88 A;  4LUE A;  1AEY A;  2DX1 A;  3M0S A;  3UF4 A;  1RLQ C;  2VKN A;  3NPF A;  1V1C A;  2DM1 A;  1UEC A;  4RTZ A;  2DL4 A;  1WLP B;  4ZNX A;  1FYN A;  1UJ0 A;  1ZUK A;  2GTO A;  2RQU A;  4AFS C;  1K0S A;  2DRK A;  3VS6 A;  1RI9 A;  2ENM A;  4RTY A;  4CC4 B;  3PVL A;  1SRM A;  1GCQ A;  1Z9Z A;  3IQL A;  4JPB W;  2DBM A;  4JJD A;  2IIM A;  2ESW A;  4OMM A;  1A0N B;  1VYU A;  2LZ6 B;  2LJ0 A;  1PRM C;  2V1Q A;  4CC7 A;  3EG1 A;  2C0I A;  4X1V A;  2D8J A;  1I07 A;  3TSW A;  1ZUU A;  2EPD A;  2FPE A;  2GTJ A;  2BZX A;  1ZUY A;  2O88 A;  4HVV A;  2KE9 A;  2EYW A;  2JS2 A;  2LQW A;  2X3X D;  2DRM A;  1WDX A;  4AFZ C;  1Y57 A;  3R6N A;  1ABQ A;  1UUE A;  4J9B A;  3ULR B;  1K9A A;  3M0R A;  1ZX6 A;  1VA7 A;  2VVK A;  1UG1 A;  1KIK A;  1OV3 A;  2D8H A;  2B86 A;  1AOJ A;  2QDL A;  1QKX A;  1QKW A;  1PWT A;  2X3W D;  2YT6 A;  2JTE A;  1IO6 A;  1NYF A;  2JMC A;  1NLO C;  1MUZ A;  2DMO A;  5IXF A;  2HCK A;  1JQQ A;  2YUP A;  1I1J A;  1HD3 A;  3VS0 A;  4Z89 A;  2OAW A;  2F2X A;  2LJ3 A;  4HCK A;  1PKT A;  1NYG A;  4Y92 A;  1X6G A;  1BU1 A;  3LH5 A;  2DL3 A;  2W10 A;  1KFZ A;  2AZV A;  2A28 A;  1X43 A;  5IHK A;  2DL5 A;  2LP5 A;  3EG3 A;  2LCS A;  4Z8A A;  1U3O A;  1UE9 A;  2J7I A;  4M4Z A;  4A63 B;  3PVQ A;  4AG1 C;  1QLY A;  2BTT A;  1PKS A;  4AG2 C;  4KRT A;  1M27 C;  2DF6 A;  1K76 A;  3FJ5 A;  1YP5 A;  1KSW A;  1E6H A;  1X2Q A;  2ECZ A;  5HCK A;  4RTX A;  1GL5 A;  1QWF A;  1KJW A;  3RNJ A;  1UHC A;  1OPL A;  4ORZ A;  1AWJ A;  2J05 A;  3M0U A;  1WXB A;  4J9H A;  1UDL A;  1ARK A;  1QCF A;  1U06 A;  2L2P A;  4DEY A;  4DEX A;  1M3A A;  3A98 A;  4OML A;  2EGE A;  2EYX A;  4OMP A;  4QT7 A;  1UFF A;  2RQR A;  3TSZ A;  2VWF A;  2GQI A;  2M0Y A;  4J9D A;  1TG0 A;  1GFC A;  1BBZ A;  1HSQ A;  4J9F A;  1N5Z A;  1OEB A;  4WCI A;  1SHG A;  2I0N A;  1OPK A;  3NMZ C;  3EG2 A;  2FPD A;  3EHQ A;  2DL7 A;  2EW3 A;  1AWO A;  1UHF A;  2D0N A;  1B3Q A;  2H8H A;  4OMN A;  2AKL A;  2K9G A;  2DIL A;  2SEM A;  3UA6 A;  4ESR A;  2KRM A;  1W70 A;  1LCK A;  3UAT A;  1YCS B;  1NEB A;  2YDL A;  2EVR A;  1M3B A;  2MIO A;  2DL8 A;  4J9E A;  5FWC A;  2K2M A;  1AWW A;  1YWP A;  1WX6 A;  3VS5 A;  2KT1 A;  1GRI A;  2J06 A;  2ABL A;  2EGC A;  1EFN A;  2FRY A;  5IHI A;  3CQT A;  4AFU C;  5IXB A;  2P4R A;  1GBQ A;  2EBP A;  4LE9 A;  4F17 A;  3I5R A;  1Z9Q A;  1XOV A;  3SHW A;  1WIE A;  2EKH A;  2MCN A;  1SHF A;  2KRS A;  1VYT A;  2JM9 A;  1ZBJ A;  3JV3 A;  5FWB A;  1SEM A;  2LJ1 A;  4E6R A;  2L3P A;  4OMQ A;  1YN8 A;  2KXD A;  4RTU A;  2JMA A;  3I9Q A;  3M0T A;  3QWX X;  1M30 A;  3QWY A;  2EQI A;  1S1N A;  2BZ8 A;  2F2W A;  2O31 A;  1RLP C;  2PTK A;  4RTV A;  2PZ1 A;  2YUQ A;  2GNC A;  3I5S A;  4HVW A;  4J9I A;  1CSK A;  1M8M A;  2CH4 A;  1AVZ C;  2FO0 A;  4GBQ A;  1JU5 C;  2NWM A;  2ROL A;  2HSP A;  3VRZ A;  4JJB A;  4AFQ C;  5IHN A;  2K79 A;  2JS0 A;  4HXJ A;  4R0K A;  1YWO A;  3NHN A;  1Y0M A;  4RUG A;  2FRW A;  1BB9 A;  4D8D A;  1VYV A;  1GFD A;  2J6F A;  2HBW A;  2L3Q A;  5I11 A;  2LMJ A;  2YUO A;  1E7O A;  4JJC A;  1TUC A;  1QWE A;  2KEA A;  2EYZ A;  3GBQ A;  2LX7 A;  3H0F A;  2J6K A;  3H41 A;  1AZG B;  5GJW B;  4LNP A;  2KXC A;  3H0I A;  2K7A A;  2CT3 A;  1G2B A;  3U23 A;  2RN8 A;  4IIO A;  2KBT A;  2FPF A;  1PNJ A; 
#chains in the Genus database with same CATH topology
 1CKB A;  2YSQ A;  4PJO A;  3ZFJ A;  3X28 B;  3L2U A;  5AYF A;  3JCM d;  3AT1 B;  5GAO l;  2DXB A;  3WVE B;  1KQS A;  2EGA A;  4BY6 C;  5IT9 E;  1VQO T;  2X4Y A;  3PFS A;  3MEW A;  2QTV A;  2CZ0 B;  1AWX A;  5IH2 A;  1GCP A;  2QEX T;  1YBY A;  4M7A F;  2DLP A;  4E7H A;  3CPW S;  1ZSG A;  5GAN j;  2QQR A;  4BY6 B;  2BZY A;  5EC7 A;  1TUD A;  2FVU A;  2DVJ A;  2E5K A;  2HL5 C;  3FRN A;  4PNO A;  2COY A;  2MF2 A;  1YNZ A;  1VQN T;  2I2L A;  3L1A A;  3BE3 A;  2EFI A;  3VYH B;  5FU7 C;  2ZZD A;  4M77 E;  4IUU A;  2A08 A;  1FXX A;  2JXB A;  1VQ4 A;  2PVG B;  2ED1 A;  2NLU A;  2CP2 A;  2JM8 A;  4K11 A;  4JRI A;  3VV0 A;  5FU7 B;  3M4Y A;  3REB B;  2CSI A;  3CCU T;  1PD1 A;  3VS1 A;  2LNH B;  2LQN A;  3X20 B;  2XU8 A;  3H0H A;  1JXM A;  3MEA A;  3PE0 A;  3LWH A;  3E19 A;  2YRD A;  4LDX A;  3RBB B;  1VQO A;  2OTL Q;  3KXT A;  2YWW A;  4C92 E;  1UGP B;  4PK4 A;  3HSB A;  1UEB A;  2QEX A;  3UWN A;  2FL7 A;  2BKD N;  1OU8 A;  4KUL A;  2XG8 D;  4E7J A;  2EYQ A;  2K57 A;  3JCM P;  2LQ8 A;  2HD0 A;  1AD5 A;  4II1 A;  5CKF A;  3I35 A;  1R8O B;  1VQN A;  2EYY A;  4J9G A;  3OY9 A;  2RHZ A;  1H8K A;  1NG2 A;  1YJN A;  4C92 A;  2LQK A;  5I2S A;  3HL8 A;  2X9H A;  5KYW A;  3THK A;  4EMH A;  4FYX B;  1JXO A;  2RHX A;  1ABO A;  2DK3 A;  3CCU A;  2EKO A;  5J3B A;  1N6A A;  3OYM A;  3EFR A;  5GAN 3;  1HYO A;  2W0Z A;  2DKG A;  1YHQ Q;  1M3C A;  4CC2 A;  3LGF A;  3V8J A;  2K5F A;  2GF7 A;  2BUD A;  2D1X A;  2E5Q A;  5LJ5 d;  1SSH A;  3V8K A;  4EMK C;  4GLM A;  1RI0 A;  5GMK j;  2GFU A;  2EQK A;  1UJY A;  1WHL A;  2CYZ B;  2XMF A;  3M58 A;  1VQK T;  1B07 A;  4EDU A;  1PCX A;  1IB8 A;  2RHU A;  1NBE B;  2DBK A;  1D0Z A;  4EMK B;  2PNI A;  4Y91 A;  2OI3 A;  3QDF A;  2DZ9 A;  3PIP A;  1SSF A;  4LUE A;  5KYU B;  1AEY A;  3M0S A;  2JUF A;  1VQ7 T;  3NPF A;  3QKJ A;  1V1C A;  1UEC A;  1MMA A;  4A53 A;  2GTO A;  4AFS C;  1QW1 A;  1VQ9 T;  1IHW A;  5CKE A;  3PVL A;  3GP8 A;  3GNG A;  1GCQ A;  5FU6 C;  4JPB W;  4XK8 E;  4FYY B;  4OMM A;  1MNE A;  1VYU A;  1WJS A;  4KBM B;  2D0Q B;  5KH6 A;  4Q5W A;  1WHM A;  1TUG B;  5GAN g;  1K73 U;  2FPE A;  5FU6 B;  2BZX A;  3OMC A;  2JS2 A;  1FMV A;  4IUQ A;  3CCQ T;  1WDX A;  2XDB A;  5IAY A;  4B9W A;  3EH2 A;  2VV5 A;  3EH1 A;  3QHS A;  1VQK A;  4DBF A;  3R6N A;  3OS0 A;  3ULR B;  2DFU A;  1ZX6 A;  2VVK A;  1YCY A;  4OF1 A;  5LJ3 d;  3CCL Q;  2R58 A;  4O6J A;  1AOJ A;  4F04 B;  3LW5 E;  3MKD A;  5DLO A;  2FB7 A;  3OW2 A;  1IO6 A;  2ZPE B;  1VQ7 A;  1RAD B;  1WHH A;  1M4Z A;  3VS0 A;  3VKI A;  1NYG A;  1VQ9 A;  1OYX A;  1SG5 A;  7AT1 B;  1RAI B;  2NUP A;  4WF2 A;  5GAN 2;  1K73 C;  3OYH A;  3SFM A;  4BE0 A;  3V7R A;  1VQL T;  1PM3 A;  2AZV A;  2P84 A;  3EGD A;  4M7D F;  3OYY A;  2E6Z A;  2LNV A;  4JLI A;  4Z8A A;  2HQE A;  3JCM J;  1U3O A;  1BCM A;  1OU9 A;  1ZSZ C;  3CCR T;  4M4Z A;  3PVQ A;  3CCQ A;  1M27 C;  2RH2 A;  1E6H A;  1ZSZ B;  4X9C A;  1U8R A;  2ECZ A;  3M4G A;  5GAM h;  2EJF A;  4RTX A;  2PQW A;  3URG A;  3EGX A;  1FWZ A;  3RNJ A;  3TEE A;  2KVQ G;  6AT1 B;  3D7S B;  1AWJ A;  3A8L B;  3M53 A;  1WXB A;  2COZ A;  1ARK A;  2ZPF B;  1U06 A;  5CO7 A;  4LDY A;  3HFN A;  4DEY A;  3PTA A;  1M3A A;  2DIG A;  3JCM V;  4MZM A;  2ZAE A;  2PUO B;  2H3J A;  1VOM A;  4V2S A;  2M0Y A;  1TG0 A;  1BBZ A;  2JZ2 A;  3M56 A;  1VQL A;  4F7U F;  1HSQ A;  1IGQ A;  2IVW A;  3LGL A;  2HAX A;  1OPK A;  3NMZ C;  3EG2 A;  3G71 T;  3EHQ A;  2DL7 A;  3LX7 A;  3DLL A;  5FRM A;  3PIO A;  3CCR A;  2H8H A;  4M78 D;  4OMN A;  2YLB A;  2DIL A;  3JCM e;  4FL6 A;  1W4S A;  5KYN A;  2KRM A;  4BAC A;  2JN0 A;  1C0M A;  5HK0 A;  2EVR A;  4XTX A;  2MIO A;  3VU3 C;  2K2M A;  1NJI U;  1NPR A;  2ZPH B;  2ZPI B;  3VS5 A;  1GRI A;  2ABL A;  4JS4 A;  2KQW A;  5M9O A;  5IHI A;  4FYV B;  4PJO F;  3QYG B;  2JVV A;  1N8R R;  1GBQ A;  1Z9Q A;  4PJN A;  5I21 A;  2EKH A;  3CCS T;  1Y96 B;  2KRS A;  2JM9 A;  4E6R A;  5LJ3 h;  3CCJ Q;  2RK1 A;  3ER0 A;  3RKY A;  3A8H B;  3G71 A;  3M0T A;  3G4S T;  3QWY A;  4JUV A;  1JRI A;  4N4H A;  4E7L A;  4HCC A;  4A4G A;  1YIJ Q;  3CC4 Q;  1KQ2 A;  2GNC A;  1Q86 C;  4JRQ A;  4J9I A;  1M8M A;  2ZPB B;  2RHY A;  2ROL A;  3A1P A;  3VRZ A;  4JJB A;  4BE1 A;  1WGS A;  2WSC E;  1VYV A;  1N27 A;  2HBW A;  4B6M A;  2D6F A;  3RIR A;  1TUC A;  4WTO B;  2EYZ A;  1YFN A;  3H6Z A;  3H0F A;  2J6K A;  3CCS A;  1VQ4 Q;  3FB9 A;  1B34 A;  5GAM e;  3GIB A;  1G2B A;  3CBO A;  4XU0 A;  2RN8 A;  2KK4 A;  3OYF A;  4J9C A;  1X75 C;  2FPF A;  1PNJ A;  1X01 A;  4LUD A;  1SPK A;  3M59 A;  1NEG A;  1R0B G;  3GOX A;  2RJC A;  2K6D A;  4JZ4 A;  4RMO A;  4FT4 A;  2JT4 A;  1BCO A;  2JW4 A;  5LJ5 e;  1WXT A;  4C92 F;  4XAX B;  2CH4 W;  4FSS A;  2DVE A;  3QBY A;  4EMK A;  4XU1 A;  3GPL A;  3QDR B;  4M75 C;  1VQO Q;  3OYN A;  1M90 R;  2QEX Q;  1Q81 R;  4RG2 A;  1WXU A;  4M75 B;  5GAM j;  4F16 A;  1SF9 A;  3J80 E;  2CRE A;  5KYX A;  1UGV A;  2HEQ A;  1BK2 A;  1G83 A;  4PFO A;  1HJD A;  1X6B A;  3CXC S;  1VQN Q;  3JCM X;  4C8Q G;  3C0C A;  3SEM A;  1QVF S;  2B8A A;  1G8X A;  2MOX A;  2RMO A;  1T3L A;  4N0A C;  1K9M R;  1NLP C;  2L3S A;  2HL3 A;  2C0O A;  3VS4 A;  3EHR A;  2AZS A;  4QQD A;  4M78 C;  2XDP A;  1OX9 A;  1MV0 B;  3SWN A;  3CCU Q;  2WSF E;  5J26 A;  3DB4 A;  1UTI A;  3CCV T;  2ED0 A;  3JB9 G;  2E70 A;  4BD3 A;  2YRV A;  4J6X A;  3OB9 A;  3EG9 B;  3OYA A;  4M78 B;  3V8L A;  2LTO A;  1KD1 C;  4J8O A;  5LL6 S;  1W6X A;  1TH7 A;  5GAN f;  2KNB B;  4M7A C;  5L23 A;  1MMG A;  2RJF A;  2ROT A;  1X69 A;  2A7Y A;  2DE0 X;  4XTW A;  2O9S A;  2K3Y A;  2HBP A;  2E3H A;  3HFO A;  3NGP A;  3HP9 A;  4E7S A;  5LJ3 e;  4M7A B;  4FYW B;  1YJW T;  1CKA A;  4IIM A;  4JLG A;  2X51 A;  1VQ6 T;  1TTH B;  1VIE A;  2XID A;  5ECA A;  1IXD A;  3M57 A;  3EG0 A;  3JSC A;  2CP5 A;  1JO8 A;  4DQ2 A;  2XHC A;  1O75 A;  2AKK A;  2DD5 A;  3EFO A;  3CC7 T;  3CCJ A;  2K4Y A;  1T3S A;  4A4K A;  3HTR A;  4O5V A;  3CCV A;  1JB0 E;  2LT4 A;  2RQW A;  4M7D D;  1U5S A;  3INZ A;  4FM4 B;  2O4X B;  4EMG A;  1WHJ A;  1G3W A;  1WA7 A;  2MYS A;  4M75 G;  4FCY A;  2V1R A;  3QSU A;  2A36 A;  2KRN A;  2RNA A;  4OB0 B;  2CT4 A;  1VQK Q;  4KUD K;  1QVP A;  2BE7 D;  2DX1 A;  3UF4 A;  1OUL A;  5D6W A;  3FLG A;  2VKN A;  1YJW A;  1WLP B;  1ZUK A;  3HHT B;  2ENM A;  1VQ6 A;  1VQ7 Q;  1SRM A;  3GF5 A;  3IQL A;  4JJD A;  2IIM A;  1D1B A;  2ESW A;  4E47 A;  3OYK A;  3EFS A;  1PRM C;  2V1Q A;  1VQ9 Q;  1RAC B;  3E9F A;  4X1V A;  2OTJ T;  1WJR A;  1ZUU A;  1SKU B;  2EPD A;  2GTJ A;  5GAN 5;  3FEO A;  3CC7 A;  3H8Z A;  1U1T A;  2KE9 A;  3MP6 A;  2LQW A;  3X25 B;  4TVR A;  5A2Q E;  3RMS A;  2JOY A;  4DA4 A;  4M77 A;  5GAM g;  1ZBX A;  5CQX A;  2DTH A;  5CVI A;  4M7A G;  4CRI A;  2KAF A;  3M0R A;  3CCQ Q;  1LPL A;  1BIA A;  1BI0 A;  4DOV A;  4RCB A;  4JS5 A;  1QKW A;  2M0O A;  2FZG B;  2YT6 A;  1NYF A;  4YTL A;  3UT1 A;  1NLO C;  3T9N A;  1Q82 R;  3CD6 T;  1HD3 A;  4KGV B;  2JNG A;  4X34 A;  4C8Q E;  1N9S A;  1K8A R;  4Y92 A;  1X6G A;  1BU1 A;  3LH5 A;  4PJO D;  2DL3 A;  2W10 A;  1KC8 R;  2A28 A;  1PG5 B;  1X43 A;  5IHK A;  2K2V A;  2LP5 A;  2X4W A;  1R0C B;  4C8Q A;  2OTJ A;  1YJ9 T;  1VQL Q;  2CZ7 B;  1QMC A;  4A63 B;  1W2B A;  1IHV A;  2DAQ A;  4ZGJ B;  4Y28 E;  4KRT A;  1EZZ B;  1R77 A;  4KUI A;  4PJJ A;  1M2V B;  2HKN A;  3E1S A;  1QVG P;  1KSW A;  1JJ2 P;  3CCR Q;  3FJP A;  2DXC A;  2ZPG B;  4D6W A;  3JCM b;  1KJW A;  2P4T A;  1UHC A;  1D3B A;  2RI3 A;  3S6W A;  1LNX A;  5D7U A;  5GAO r;  2RJD A;  2LT1 A;  5D6X A;  3C94 A;  3A98 A;  2X4J A;  1UFF A;  3TSZ A;  4J83 A;  3FIF A;  4XU2 A;  3JCM h;  4HA8 A;  4B9X A;  5IN1 A;  1O9S A;  4M7D C;  1OEB A;  3EAE A;  4KT0 E;  4WCI A;  2QK0 A;  5CAI A;  2I0N A;  1M5Q 1;  4XTU A;  4ZN1 A;  1XTD A;  2BIV A;  1UHF A;  2D0N A;  1B3Q A;  4BI4 A;  3OYL A;  4M7D B;  3HRU A;  4M75 E;  2SEM A;  3QO3 A;  3UA6 A;  3G71 Q;  9ATC B;  2FZK B;  1LCK A;  3H9N A;  1NEB A;  3J81 E;  4J9E A;  5FWC A;  1QVG S;  4C92 D;  1AWW A;  1WX6 A;  1IRX A;  3MO8 A;  4QW2 A;  2EGC A;  4M75 A;  1I4K 1;  1EFN A;  3DKM A;  2FRY A;  4ZTJ A;  1TS9 A;  5GAO p;  3CXC A;  4MZT A;  2GQV A;  1QVF A;  2EBP A;  3DB3 A;  2QGF B;  3BFM A;  4F17 A;  1Q7Y R;  1XOV A;  3G6E T;  1WIE A;  2K3X A;  3BW1 A;  1KQS P;  1ZBJ A;  5FWB A;  4PJL A;  2LJ1 A;  2VUB A;  2KXD A;  4QQ6 A;  2DYI A;  3L2R A;  3CCE T;  4FW1 A;  3CCS Q;  3J7A F;  3I9Q A;  4F7U B;  1N8R U;  4NL2 A;  4M7A E;  3R6O A;  2DD4 A;  4RTV A;  4FT2 A;  3G4S Q;  4DBQ A;  2M1H A;  5FRN A;  4NL3 A;  3CMA T;  1AVZ C;  2H3E B;  5GAN d;  4GBQ A;  2HSE B;  1AHJ B;  2HSP A;  4M7A A;  4AFQ C;  5IHN A;  2JS0 A;  2NUT A;  5KE3 A;  1S72 T;  3NHN A;  1GFD A;  4P5N A;  3CBM A;  4PJO C;  5CK9 A;  3A8O B;  2CP7 A;  2LX7 A;  3WVD B;  3G6E A;  4PLL A;  4PJO B;  4LNP A;  5LJ5 h;  2KXC A;  4HT9 A;  3H0I A;  1N8R C;  1D1C A;  3F70 A;  3U23 A;  4C0Z A;  2KBT A;  3MPU B;  3NFC A;  1M9S A;  1RAB B;  3CCE A;  3OSS C;  4PLI A;  3E9G A;  4HCZ A;  4L59 A;  2QA4 T;  2CZ6 B;  4MMK A;  2KYM A;  2QYZ A;  3C12 A;  2CGH A;  2CS7 A;  1TSF A;  1KG1 A;  1RL2 A;  3M0Q A;  1ZLM A;  2RO0 A;  3VS7 A;  2RQT A;  3OBY A;  3ZL7 C;  3VS3 A;  1MV3 A;  4JRK A;  3RES A;  3HPW A;  4N4I A;  1VQ5 T;  2CUD A;  3CPW A;  3TRE A;  4ELZ C;  4RG8 A;  1WNL A;  2RB6 A;  1I0C A;  1S72 A;  2A37 A;  3LLR A;  1Q86 U;  2E41 A;  2DYB A;  2XD0 A;  1K4U S;  3RR6 A;  4XTY A;  2P0P A;  2YLC A;  4QVC A;  4OB3 B;  4L5G A;  1M90 U;  4RTW A;  5KCO A;  2FZC B;  2GBQ A;  2CDT A;  1Q81 U;  2CUB A;  2J6O A;  2G3R A;  2KSS A;  3NTI A;  3BY7 A;  3RMQ A;  3G1J A;  1HXD A;  4PKC C;  5I2M A;  3L2W A;  2QA4 A;  4RTT A;  1FMK A;  3ZBD A;  2PU9 B;  1K9M U;  1ZHI A;  4Z02 A;  4C92 C;  1VQP T;  3CCV Q;  5A0G A;  5J39 A;  2Y4Y A;  3QXE B;  1WHG A;  1QQJ A;  1FX7 A;  1MND A;  2Y4X A;  4KGZ B;  4JRP A;  1KK7 A;  3TVT A;  2VAS A;  4C92 B;  3P8H A;  2KYB A;  5GAM f;  1RAH B;  1WFW A;  5AT1 B;  5KYW B;  1X2K A;  2F69 A;  4DOW A;  5I22 A;  2FG0 A;  3MP8 A;  3O5Z A;  1DJ7 B;  2E3I A;  5GAN 7;  4HCB A;  1M90 C;  2PVD B;  3QYH B;  4C5G A;  1FMW A;  1Q81 C;  1X6O A;  1M2O A;  4JZ3 A;  4M77 F;  1YJW Q;  1OOT A;  1K1Z A;  3TQ7 P;  4A4E A;  1U1S A;  2O9V A;  3C95 A;  1BKB A;  2V26 A;  1VQ6 Q;  4MDW A;  3LYI A;  3LWI A;  4OGE A;  1K9M C;  4NOY A;  3QII A;  2KR3 A;  3REA B;  2NUZ A;  3N5B B;  4OMO A;  3OYB A;  2GGR A;  1MHN A;  2IPO B;  1T0H A;  2F2V A;  3CC7 Q;  2RD1 A;  2RPN A;  3JB9 H;  3OW2 P;  1VQP A;  3G4S A;  1TWB A;  4LN2 A;  1E6G A;  3MEV A;  8AT1 B;  4PL6 A;  1GCQ C;  3VRY A;  4Z88 A;  2YHT A;  2EAY A;  3BDL A;  1XQH A;  1YIT T;  2AHJ B;  2QQB A;  4RTZ A;  1KD1 U;  5KYU A;  4C8Q F;  1FYN A;  3CME T;  2DRK A;  3L2Z A;  3X24 B;  4CC4 B;  1N9R A;  2CP0 A;  1Z9Z A;  2DBM A;  2V8J A;  1NJI R;  4AMC A;  2LZ6 B;  1TU0 B;  2LJ0 A;  1D0X A;  4CC7 A;  1UGS B;  3EG1 A;  4BI8 B;  2C0I A;  2D8J A;  3TSW A;  4OMF B;  3JB9 F;  1Y07 A;  4LXC A;  1ZUY A;  1YI2 T;  2O88 A;  2LDM A;  2EIF A;  4C0D C;  4LD9 K;  5FLX E;  5LJ5 j;  4MML A;  2X3X D;  3A5Z B;  3MET A;  4C5I A;  2OTJ Q;  2RM4 A;  4HT8 A;  5DLQ E;  1Y57 A;  5HK3 A;  1ABQ A;  4C0D B;  3OS2 A;  2QDY B;  4IUR A;  5CCA A;  1VA7 A;  5CQY A;  3OW2 S;  1KIK A;  4QKU A;  3OYD A;  4LDU A;  3KUF A;  1OV3 A;  1GXI E;  2D8H A;  4E7Z A;  2B86 A;  1EX4 A;  1PWT A;  1VQ8 T;  4R56 A;  2KMT A;  2JMC A;  1MUZ A;  2DMO A;  5IXF A;  3G7Z A;  2NUP B;  2HCK A;  1YIT A;  1JQQ A;  2YUP A;  4Z89 A;  3OMG A;  1PC0 A;  3JCM g;  2F2X A;  2LJ3 A;  4PJM A;  2PUK B;  1PKT A;  3CME A;  3EGD B;  5GMK h;  1BYM A;  2VC8 A;  1ZQ1 A;  4E7K A;  1KFZ A;  1NZ9 A;  5GAN 6;  2EJ9 A;  4VUB A;  2LCS A;  2O01 E;  1ACM B;  1WHK A;  1Q82 U;  1P92 A;  3OS5 A;  1UE9 A;  2J7I A;  2VXE A;  1K8A U;  2DIQ A;  1I5O B;  2DEU A;  1QLY A;  3HRS A;  2WSE E;  2LCL A;  2DF6 A;  1K76 A;  3FDR A;  4C5H A;  1YP5 A;  1KC8 U;  3EGX B;  1PSF A;  1KQ1 A;  5HCK A;  1QCO A;  5LJ3 j;  2M16 A;  2QAZ A;  1RAF B;  2HQX A;  4ZGD B;  2L5Q A;  1ZSZ A;  5GAN e;  1G5V A;  4ORZ A;  3KBG A;  2J05 A;  3CBP A;  1VQ8 A;  1M1G A;  2V8I A;  4J9H A;  1QCF A;  1OZ2 A;  3RDV A;  4DEX A;  1VQM T;  4OML A;  2EGE A;  2EYX A;  4KH1 B;  1M1K R;  2VWF A;  1I81 A;  2QI2 A;  4J9D A;  1Q82 C;  1I8F A;  2GFA A;  4J9F A;  1N5Z A;  2MWP A;  1K8A C;  2F1L A;  1WQW A;  2M02 A;  2FPD A;  3OQ5 A;  2EW3 A;  4M78 G;  1KC8 C;  1LVK A;  2P0K A;  1OZ3 A;  3LH0 A;  4KGX B;  2K9G A;  5CKD A;  1D1A A;  2XI9 A;  4ESR A;  1W70 A;  3CEY A;  2ZGW A;  1YCS B;  3RKX A;  2YDL A;  1YJN T;  2DL8 A;  4RCC A;  3GNF B;  1H64 1;  3CCM T;  2E65 A;  1V76 A;  3VUB A;  1QP3 A;  2J06 A;  5D6Y A;  2EJG A;  3QZ5 B;  3RUX A;  3SB2 A;  3MEU A;  4BB7 A;  1HK9 A;  2XIC A;  3CQT A;  8ATC B;  2ATC B;  2QAS A;  3OBW A;  4BUG A;  1VQM A;  2P4R A;  5LJ5 g;  1Q95 G;  4LE9 A;  2E4H A;  2CP3 A;  3I5R A;  3UPU A;  1LOJ A;  4AT1 B;  1TXQ A;  3I56 T;  1SHF A;  3CC2 T;  3JV3 A;  4BDZ A;  1SEM A;  5A0D A;  5GMK i;  4RTU A;  4QQG A;  1Y96 A;  1M8V A;  3G6E Q;  4OP0 A;  2OAU A;  1ZA2 B;  4R55 A;  2DTI A;  1Q7Y U;  2BZ8 A;  4GLK A;  4JJN K;  2PTK A;  4J6W A;  3SD4 A;  2BE9 B;  3CCE Q;  2V8K A;  2PZ1 A;  2YUQ A;  1G3S A;  4IKF A;  3I5S A;  5GMK e;  2M9U A;  3V7S A;  3I55 T;  1JU5 C;  3PGG A;  1MGQ A;  3GLX A;  4OGC A;  5DY9 A;  3WXM B;  4FW2 A;  2MI6 A;  3CCM A;  4LD6 A;  2K79 A;  3CMA Q;  2HZY A;  1YWO A;  3S3O A;  1Y0M A;  5GAM d;  2FRW A;  4D8D A;  3Q1J A;  2J6F A;  2L3R A;  3MP1 A;  2QTX A;  5CR2 A;  1B34 B;  1G3Y A;  1QWE A;  1S72 Q;  3OYI A;  3GBQ A;  3MCA B;  3H41 A;  5GJW B;  1AZG B;  3CD6 A;  1G3T A;  3I56 A;  4FSX A;  3CC2 A;  3VJP A;  2C06 A;  4IIO A;  5LJ3 g;  4M77 D;  1Q7Y C;  2DZC A;  3QJY A;  4J7I A;  2CP6 A;  2RQV A;  3S3N A;  1PSE A;  2K5L A;  4PFZ A;  4PFP A;  2M51 A;  3A8G B;  1BI2 A;  1KHI A;  1X27 A;  1WPY A;  1AT1 B;  4N4G A;  4A4H A;  2QQS A;  1YJ9 A;  2VGM A;  3P8D A;  2QA4 Q;  2IG0 A;  4OB2 B;  1T0J A;  3OA6 A;  4ANJ A;  4A54 A;  1SRL A;  1J3T A;  2DNU A;  2EQU A;  2AK5 A;  3I55 A;  3OSV A;  5KYX B;  5GAN 8;  4FU6 A;  5FW9 A;  4EIK A;  3KFV A;  1VIF A;  1F1B B;  3SDZ A;  1JJ2 S;  3SWN C;  2KT8 A;  1VQ5 Q;  1LJO A;  2RHI A;  3UA7 A;  2LX9 A;  1GBR A;  4QVD A;  4C8Q D;  3SWN B;  2L0A A;  1UGQ B;  5CKB A;  5GJV B;  5KYY B;  4M78 E;  2OTL T;  3UDC A;  1AZE A;  1UGR B;  2DJQ A;  1NM7 A;  2SRC A;  1PRL C;  3EGU A;  3VS2 A;  4GY5 A;  3JB9 D;  4N0A A;  4FIB A;  2CSQ A;  2DA9 A;  4F14 A;  3DLM A;  3EG9 A;  2K3B A;  1XNI A;  4M78 A;  5HY6 A;  1TOV A;  2PVO B;  2G6F X;  1VQP Q;  3E2U A;  2O2O A;  1BI1 A;  5GMK m;  3M0P A;  2DET A;  5FRO A;  3MJX A;  3VYG A;  5KCH A;  1H3H A;  4NS5 A;  4ELY C;  1V29 B;  5C0M A;  2HMA A;  2KRO A;  1EIF A;  4RKU E;  1NPP A;  1YHQ T;  4JDS A;  5GAO n;  2JTM A;  3EFO B;  3L2Q A;  1K0X A;  5KE2 A;  4KH0 B;  4C5E A;  2C0T A;  3JCM Q;  1JEG A;  1C6V X;  2VB6 A;  4CC3 A;  3JCM f;  1H92 A;  4HVU A;  1PHT A;  4LDV A;  3JCM c;  4C0F A;  1IRE B;  2HDA A;  2OTL A;  4M7D G;  2NYS A;  2RF0 A;  2DPP B;  1OI1 A;  2FEI A;  1RUW A;  1I5L A;  1RAE B;  1WZO A;  1Y71 A;  3OS1 A;  1KQS S;  1WI7 A;  2RJE A;  1W1F A;  4QVZ A;  2OJ2 A;  1VUB A;  3L42 A;  1WYX A;  4J7F A;  2KGT A;  4CI0 C;  4E2F B;  4XTZ A;  2YUN A;  1B7T A;  4M75 D;  2O4X A;  2K5I A;  1WQ7 A;  2WAC A;  2QGG A;  4D8K A;  1RLQ C;  4IUV A;  1IZ6 A;  1K73 R;  3CMA A;  2DM1 A;  4J6Y A;  4XU3 A;  3RER A;  3OYJ A;  5C6S A;  2DL4 A;  2RA2 A;  4ZNX A;  1UJ0 A;  2LCC A;  2RQU A;  1K0S A;  3VUZ A;  3VS6 A;  2EQJ A;  1KHC A;  1RI9 A;  4RTY A;  1YHQ A;  4M77 C;  1YIT Q;  3V7C A;  2GCX A;  1BIB A;  1A0N B;  1W2B P;  2RI5 A;  5A0L A;  3CME Q;  2X4X A;  1I07 A;  4F7U G;  4M77 B;  1JBM A;  1MMD A;  2MAM A;  5GAO q;  2EWN A;  4HVV A;  2EYW A;  3TCJ A;  2DRM A;  5GAO m;  4AFZ C;  2CKK A;  3CCL T;  1YI2 Q;  1QP2 A;  2HNI A;  2JJ9 A;  2XDD A;  2Y90 A;  1UUE A;  4J9B A;  4M7A D;  3OYC A;  2DJZ A;  2RI2 A;  3NTK A;  1K9A A;  2FYK A;  2CZ1 B;  2QQ9 A;  3OYE A;  1UG1 A;  1NE8 A;  4MDX A;  2COW A;  2VYT A;  2QDL A;  1QKX A;  4LDW A;  1OX8 A;  2X3W D;  2JTE A;  2OX7 A;  5GAN 4;  1I1J A;  4C8Q C;  1MMN A;  2E12 A;  2OAW A;  2LC4 A;  4HCK A;  1VQ5 A;  3JCM W;  1VQ8 Q;  1QCN A;  2HQH A;  1IGU A;  4PJO G;  3C4S A;  4C8Q B;  3QJ6 A;  2E10 A;  2X35 A;  2DL5 A;  1W2B S;  3EG3 A;  2JTF A;  3O8V A;  1NJI C;  5LJ5 f;  1ZA1 B;  4IUT A;  1OQK A;  2A0F B;  5DM7 R;  2KDS A;  2MMP A;  4J5Y A;  5GAN h;  4AG1 C;  1C1A A;  2BTT A;  2YXY A;  1PKS A;  2XKO C;  4AG2 C;  1M1F A;  3CCL A;  3M5A A;  4BE2 A;  3FJ5 A;  5L8R E;  1X2Q A;  2E1H A;  1XJW B;  2Z0W A;  1D3B B;  3CXC P;  2LVM A;  2DO3 A;  1QVF P;  1M2V A;  1BI3 A;  4DBR A;  1GL5 A;  1QWF A;  1RAG B;  3MHX A;  4XTV A;  1OPL A;  2AT1 B;  2DTO A;  3M0U A;  2RK2 A;  1UDL A;  2QG9 B;  4ATO A;  3S3M A;  2YRC A;  2L2P A;  4M77 G;  4OMP A;  3JRZ A;  4QT7 A;  2RQR A;  2D9T A;  2GQI A;  4ZN3 A;  1GFC A;  3M9Q A;  3OYG A;  2A3L A;  1VQM Q;  4BI3 A;  1D0Y A;  2DER A;  2ZCF B;  3QZ9 B;  2XK0 A;  4M7D E;  1SHG A;  4UC4 A;  4ZTF A;  4E7I A;  3HKS A;  4EPC A;  1Q86 R;  4ZGE B;  1AWO A;  3L2V A;  1M1K U;  2HKQ B;  2AKL A;  4BDY A;  3QG1 A;  1RAA B;  2KI7 A;  3JB9 I;  3UAT A;  4M7D A;  5LJ3 f;  5HKC A;  2MWO A;  4C92 G;  2EQM A;  1M3B A;  3BDU A;  2FHD A;  4OVA A;  1YWP A;  2KT1 A;  3ZEH A;  5GMK l;  2AIR B;  3QPH A;  3M54 A;  1YJN Q;  1QVG A;  4IUP A;  1JJ2 A;  2P0Q A;  2DXU A;  3JB9 J;  4AFU C;  3HRT A;  5IXB A;  3CCM Q;  2VGN A;  3M55 A;  2L8D A;  4L6V 5;  4C0G A;  3CCJ T;  3SHW A;  4ME7 A;  3ME9 A;  2MCN A;  1VYT A;  5KYY A;  2L3P A;  4OMQ A;  4F7U E;  1PD0 A;  1YN8 A;  1M1K C;  3PMT A;  1YIJ T;  3ASK A;  2KY9 A;  3CC4 T;  3CD6 Q;  3I56 Q;  2JMA A;  3QWX X;  3CC2 Q;  3RKW A;  1M30 A;  2R5M A;  2EQI A;  2LRQ A;  2QXF A;  4HKE A;  3QUI A;  2QQA A;  1S1N A;  3NTH A;  2F2W A;  1WJQ A;  1RLP C;  2O31 A;  2R5A A;  5CIU A;  3CPW P;  1Y7X A;  2F5K A;  5CKH A;  4F7U A;  1YI2 A;  3PMI A;  4HVW A;  1CSK A;  2CH4 A;  3X26 B;  3AHU A;  2R57 A;  4M75 F;  2FO0 A;  1UB4 A;  2NUT B;  2MK5 A;  2NWM A;  2DEQ A;  3CPF A;  1YJ9 Q;  4X9D A;  3PT9 A;  2L89 A;  1D09 B;  4HXJ A;  4R0K A;  3TU4 K;  2E6N A;  3I55 Q;  4RUG A;  1BB9 A;  3A8M B;  1VQ4 T;  2F5T X;  2L3Q A;  5I11 A;  2LMJ A;  2YUO A;  3FC3 A;  1H3Z A;  5EG2 A;  4PJO E;  1E7O A;  4JJC A;  4DBH A;  4MZP A;  3P8B B;  2KEA A;  3PNW C;  2E64 A;  4OB1 B;  2DXT A;  4XQ3 A;  3JAM E;  4A4F A;  2K7A A;  2CT3 A;  4M78 F;  1KD1 R;  1YIJ A;  2VXF A;  2MPX C;  3CC4 A; 
#chains in the Genus database with same CATH homology
 1CKB A;  2YSQ A;  4LUD A;  1SPK A;  2RQV A;  1NEG A;  2EGA A;  2KYM A;  2M51 A;  1X27 A;  2K6D A;  4JZ4 A;  2JT4 A;  2JW4 A;  1WXT A;  3M0Q A;  1AWX A;  1ZLM A;  5IH2 A;  1GCP A;  2CH4 W;  4FSS A;  3VS7 A;  2RQT A;  1T0J A;  2DLP A;  1ZSG A;  3ZL7 C;  1SRL A;  1MV3 A;  2DNU A;  3VS3 A;  1J3T A;  2BZY A;  2AK5 A;  1TUD A;  5EC7 A;  2DVJ A;  2E5K A;  2CUD A;  1YNZ A;  5FW9 A;  4EIK A;  1WXU A;  3KFV A;  4F16 A;  2CRE A;  1I0C A;  1UGV A;  2A08 A;  2A37 A;  1BK2 A;  1G83 A;  2HEQ A;  2JXB A;  2KT8 A;  1HJD A;  2ED1 A;  1X6B A;  2JM8 A;  2DYB A;  3UA7 A;  3C0C A;  3SEM A;  4K11 A;  2MOX A;  1GBR A;  2RMO A;  1T3L A;  1K4U S;  1NLP C;  2CSI A;  2L3S A;  3REB B;  3VS1 A;  2LNH B;  2LQN A;  2C0O A;  2L0A A;  4RTW A;  3EHR A;  3VS4 A;  2AZS A;  2GBQ A;  2CDT A;  5GJV B;  4J9C A;  2CUB A;  3H0H A;  1JXM A;  2J6O A;  1AZE A;  1MV0 B;  3PE0 A;  2DJQ A;  1UTI A;  2ED0 A;  1NM7 A;  2SRC A;  1PRL C;  3EGU A;  3VS2 A;  4RTT A;  1FMK A;  3RBB B;  2CSQ A;  2DA9 A;  4F14 A;  1W6X A;  2KNB B;  2K3B A;  5L23 A;  2ROT A;  1X69 A;  3TVT A;  2DE0 X;  2G6F X;  2O9S A;  1AD5 A;  2KYB A;  3NGP A;  3I35 A;  2O2O A;  1WFW A;  3M0P A;  2EYY A;  4J9G A;  1X2K A;  1H8K A;  1NG2 A;  1CKA A;  5I22 A;  1H3H A;  2FG0 A;  4IIM A;  3O5Z A;  2KRO A;  3THK A;  1JXO A;  5ECA A;  4JZ3 A;  1OOT A;  1K1Z A;  1ABO A;  2O9V A;  1K0X A;  3EG0 A;  1JO8 A;  2AKK A;  2C0T A;  2W0Z A;  1JEG A;  1M3C A;  4CC3 A;  4CC2 A;  1T3S A;  1H92 A;  4HVU A;  1PHT A;  2HDA A;  2RF0 A;  2KR3 A;  2FEI A;  2RQW A;  1RUW A;  2D1X A;  2NUZ A;  3REA B;  1U5S A;  4OMO A;  1SSH A;  2GGR A;  4GLM A;  1UJY A;  1T0H A;  2F2V A;  1WI7 A;  2XMF A;  1W1F A;  1WA7 A;  2RPN A;  1B07 A;  2OJ2 A;  2V1R A;  1WYX A;  2KGT A;  2DBK A;  4LN2 A;  2A36 A;  2YUN A;  1E6G A;  2KRN A;  2PNI A;  2RNA A;  4D8K A;  1GCQ C;  2OI3 A;  3VRY A;  2CT4 A;  4Z88 A;  4LUE A;  1AEY A;  2DX1 A;  3M0S A;  3UF4 A;  1RLQ C;  2VKN A;  3NPF A;  1V1C A;  2DM1 A;  1UEC A;  4RTZ A;  2DL4 A;  1WLP B;  4ZNX A;  1FYN A;  1UJ0 A;  1ZUK A;  2GTO A;  2RQU A;  4AFS C;  1K0S A;  2DRK A;  3VS6 A;  1RI9 A;  2ENM A;  4RTY A;  4CC4 B;  3PVL A;  1SRM A;  1GCQ A;  1Z9Z A;  3IQL A;  4JPB W;  2DBM A;  4JJD A;  2IIM A;  2ESW A;  4OMM A;  1A0N B;  1VYU A;  2LZ6 B;  2LJ0 A;  1PRM C;  2V1Q A;  4CC7 A;  3EG1 A;  2C0I A;  4X1V A;  2D8J A;  1I07 A;  3TSW A;  1ZUU A;  2EPD A;  2FPE A;  2GTJ A;  2BZX A;  1ZUY A;  2O88 A;  4HVV A;  2KE9 A;  2EYW A;  2JS2 A;  2LQW A;  2X3X D;  2DRM A;  1WDX A;  4AFZ C;  1Y57 A;  3R6N A;  1ABQ A;  1UUE A;  4J9B A;  3ULR B;  1K9A A;  3M0R A;  1ZX6 A;  1VA7 A;  2VVK A;  1UG1 A;  1KIK A;  1OV3 A;  2D8H A;  2B86 A;  1AOJ A;  2QDL A;  1QKX A;  1QKW A;  1PWT A;  2X3W D;  2YT6 A;  2JTE A;  1IO6 A;  1NYF A;  2JMC A;  1NLO C;  1MUZ A;  2DMO A;  5IXF A;  2HCK A;  1JQQ A;  2YUP A;  1I1J A;  1HD3 A;  3VS0 A;  4Z89 A;  2OAW A;  2F2X A;  2LJ3 A;  4HCK A;  1PKT A;  1NYG A;  4Y92 A;  1X6G A;  1BU1 A;  3LH5 A;  2DL3 A;  2W10 A;  1KFZ A;  2AZV A;  2A28 A;  1X43 A;  5IHK A;  2DL5 A;  2LP5 A;  3EG3 A;  2LCS A;  4Z8A A;  1U3O A;  1UE9 A;  2J7I A;  4M4Z A;  4A63 B;  3PVQ A;  4AG1 C;  1QLY A;  2BTT A;  1PKS A;  4AG2 C;  4KRT A;  1M27 C;  2DF6 A;  1K76 A;  3FJ5 A;  1YP5 A;  1KSW A;  1E6H A;  1X2Q A;  2ECZ A;  5HCK A;  4RTX A;  1GL5 A;  1QWF A;  1KJW A;  3RNJ A;  1UHC A;  1OPL A;  4ORZ A;  1AWJ A;  2J05 A;  3M0U A;  1WXB A;  4J9H A;  1UDL A;  1ARK A;  1QCF A;  1U06 A;  2L2P A;  4DEY A;  4DEX A;  1M3A A;  3A98 A;  4OML A;  2EGE A;  2EYX A;  4OMP A;  4QT7 A;  1UFF A;  2RQR A;  3TSZ A;  2VWF A;  2GQI A;  2M0Y A;  4J9D A;  1TG0 A;  1GFC A;  1BBZ A;  1HSQ A;  4J9F A;  1N5Z A;  1OEB A;  4WCI A;  1SHG A;  2I0N A;  1OPK A;  3NMZ C;  3EG2 A;  2FPD A;  3EHQ A;  2DL7 A;  2EW3 A;  1AWO A;  1UHF A;  2D0N A;  1B3Q A;  2H8H A;  4OMN A;  2AKL A;  2K9G A;  2DIL A;  2SEM A;  3UA6 A;  4ESR A;  2KRM A;  1W70 A;  1LCK A;  3UAT A;  1YCS B;  1NEB A;  2YDL A;  2EVR A;  1M3B A;  2MIO A;  2DL8 A;  4J9E A;  5FWC A;  2K2M A;  1AWW A;  1YWP A;  1WX6 A;  3VS5 A;  2KT1 A;  1GRI A;  2J06 A;  2ABL A;  2EGC A;  1EFN A;  2FRY A;  5IHI A;  3CQT A;  4AFU C;  5IXB A;  2P4R A;  1GBQ A;  2EBP A;  4LE9 A;  4F17 A;  3I5R A;  1Z9Q A;  1XOV A;  3SHW A;  1WIE A;  2EKH A;  2MCN A;  1SHF A;  2KRS A;  1VYT A;  2JM9 A;  1ZBJ A;  3JV3 A;  5FWB A;  1SEM A;  2LJ1 A;  4E6R A;  2L3P A;  4OMQ A;  1YN8 A;  2KXD A;  4RTU A;  2JMA A;  3I9Q A;  3M0T A;  3QWX X;  1M30 A;  3QWY A;  2EQI A;  1S1N A;  2BZ8 A;  2F2W A;  2O31 A;  1RLP C;  2PTK A;  4RTV A;  2PZ1 A;  2YUQ A;  2GNC A;  3I5S A;  4HVW A;  4J9I A;  1CSK A;  1M8M A;  2CH4 A;  1AVZ C;  2FO0 A;  4GBQ A;  1JU5 C;  2NWM A;  2ROL A;  2HSP A;  3VRZ A;  4JJB A;  4AFQ C;  5IHN A;  2K79 A;  2JS0 A;  4HXJ A;  4R0K A;  1YWO A;  3NHN A;  1Y0M A;  4RUG A;  2FRW A;  1BB9 A;  4D8D A;  1VYV A;  1GFD A;  2J6F A;  2HBW A;  2L3Q A;  5I11 A;  2LMJ A;  2YUO A;  1E7O A;  4JJC A;  1TUC A;  1QWE A;  2KEA A;  2EYZ A;  3GBQ A;  2LX7 A;  3H0F A;  2J6K A;  3H41 A;  1AZG B;  5GJW B;  4LNP A;  2KXC A;  3H0I A;  2K7A A;  2CT3 A;  1G2B A;  3U23 A;  2RN8 A;  4IIO A;  2KBT A;  2FPF A;  1PNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...