2DMOA

Refined solution structure of the 1st sh3 domain from human neutrophil cytosol factor 2 (ncf-2)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
68
structure length
68
Chain Sequence
GSSGSSGEAHRVLFGFVPETKEELQVMPGNIVFVLKKGNDNWATVMFNGQKGLVPCNYLEPVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 1st SH3 domain from human Neutrophil cytosol factor 2 (NCF-2)
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Neutrophil cytosol factor 2
total genus 6
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 2006-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2dmoA00
1EFNA 3EHQA 3I5SA 3TSWA 2CT3A 2OJ2A 1K9AA 2NWMA 4KRTA 2LMJA 1GBRA 1BB9A 2KT1A 4AG2C 1SEMA 2ECZA 1G83A 4RTWA 3RNJA 1GRIA 1Y0MA 1WIEA 4X1VA 3UA7A 2K9GA 2O9VA 2EPDA 2KBTA 4LNPA 2FPFA 1RLQC 1ZUUA 3UA6A 2MOXA 3QWYA 1OOTA 2K79A 2GBQA 1M3CA 4JJCA 1WXBA 2LQWA 2L2PA 1GL5A 1N5ZA 3R6NA 4J9FA 1U3OA 1VA7A 4LE9A 3ULRB 1A0NB 4EIKA 2HSPA 1NYFA 1U5SA 4HXJA 2FRWA 3NGPA 1J3TA 1SPKA 4R0KA 4JPBW 1QKXA 1GCQC 2LJ3A 2K7AA 5GJWB 1GBQA 1JO8A 4DEYA 1TUCA 2DILA 1PRLC 1PNJA 2EQIA 4Z89A 1PKSA 1WYXA 4ZNXA 2DRMA 1MV0B 4J9GA 2YDLA 1ZUKA 3VRZA 2LZ6B 2J6OA 1ABOA 2KGTA 2ED1A 1K76A 1UTIA 2FG0A 2CSQA 3ZL7C 1YWOA 1SHFA 2FPDA 3H0HA 2DL7A 3EG3A 1CKBA 4LUDA 3GBQA 1GCPA 1YCSB 2JS2A 1FMKA 2LJ0A 1UGVA 3IQLA 1I07A 1AZEA 2A28A 1CSKA 2JM8A 3EHRA 1BBZA 2XMFA 1QWEA 4J9IA 1NM7A 2D8HA 4FSSA 1AZGB 3H0IA 1YN8A 2MIOA 1UJ0A 2CSIA 2KNBB 2RQTA 4AFSC 1X2KA 2JS0A 1VYUA 1B3QA 2AZVA 2CREA 1K4US 2DL8A 2YSQA 2X3WD 4HVUA 2A08A 4J9DA 3NMZC 2LNHB 2RQRA 2DRKA 2RQWA 2JT4A 1UUEA 2GNCA 2K3BA 2BZYA 2J6KA 2QDLA 1U06A 1AWWA 1AWOA 1SRLA 1VYTA 1UE9A 2DX1A 5FW9A 2HEQA 3I9QA 4OMQA 1M3BA 1AD5A 2O9SA 4WCIA 2KXCA 2YUOA 2E5KA 1ZX6A 2ROLA 1X43A 4E6RA 5IH2A 2EYXA 4ESRA 1YP5A 2I0NA 2RPNA 5ECAA 3FJ5A 4Z88A 2SEMA 1HD3A 4JZ3A 1AWJA 2RQVA 2EYWA 4OMOA 4J9EA 4D8KA 2G6FX 4AG1C 2CH4A 2JTEA 2KROA 2KYBA 1YNZA 2EVRA 1JXMA 2F2VA 2DL4A 1H92A 2KRMA 5IHIA 1LCKA 4RUGA 2YUPA 1X2QA 5IHNA 2DL3A 2K2MA 2CDTA 4JJBA 2DNUA 2A36A 4IIOA 1W6XA 4OMNA 2EYZA 3VRYA 1NEBA 5IXBA 2KXDA 2HCKA 1T0JA 4HVWA 1B07A 3NHNA 1V1CA 1QWFA 4JJDA 1K1ZA 3EG0A 2FO0A 2AKKA 1HJDA 1M3AA 4RTYA 1W1FA 1I1JA 2EGAA 2J06A 2L3PA 3M0UA 5GJVB 4HCKA 2B86A 3M0PA 1WX6A 1T0HA 2SRCA 3I35A 1H8KA 2LX7A 2JW4A 1K0SA 3EG2A 1ABQA 4RTUA 3VS6A 4ORZA 1RI9A 2C0IA 2KR3A 4DEXA 1MUZA 5HCKA 2O2OA 2CUBA 2LP5A 1WDXA 4K11A 4OMPA 5IHKA 1JXOA 3REBB 1XOVA 2J05A 3CQTA 4AFUC 1Y57A 3PE0A 4CC2A 2L3SA 3KFVA 1QCFA 2HBWA 3I5RA 1CKAA 2L3QA 4F17A 1UJYA 2D8JA 2OI3A 4GBQA 3JV3A 1T3LA 2W10A 3VS4A 2W0ZA 3C0CA 4RTXA 2EW3A 1PWTA 2FRYA 2J6FA 1NLOC 1UG1A 2LCSA 1S1NA 5FWBA 1UHFA 2KE9A 3VS2A 5L23A 1WFWA 2DBMA 4A63B 2V1RA 2VKNA 1QLYA 1QKWA 2KT8A 2F2WA 4D8DA 3UF4A 3RBBB 2FEIA 5IXFA 3TVTA 1H3HA 1HSQA 1AVZC 2DJQA 2AKLA 3A98A 1M27C 1PHTA 3EGUA 2GTOA 2V1QA 3H41A 2DA9A 3THKA 2DF6A 1JEGA 2A37A 1KFZA 2PNIA 3O5ZA 2EGCA 1KJWA 2K6DA 2ABLA 1NYGA 4F16A 1GFDA 2YT6A 2JMCA 2GQIA 2ED0A 1UFFA 1X6BA 3VS5A 1E6GA 2DE0X 1SRMA 1OEBA 2D1XA 2L0AA 2RN8A 2HDAA 3SEMA 4J9CA 2M51A 2EGEA 1ARKA 1UDLA 4QT7A 2DYBA 5EC7A 4CC3A 2DMOA 1AEYA 2RQUA 1NEGA 3NPFA 2LJ1A 3EG1A 2OAWA 3M0SA 1SHGA 2JXBA 2AZSA 1GFCA 2J7IA 2ENMA 1NLPC 2NUZA 3VS7A 2VWFA 3M0QA 1MV3A 2EYYA 1T3SA 2RNAA 4J9HA 1I0CA 2RF0A 1BU1A 4CC4B 1BK2A 1WLPB 1OPKA 4RTTA 2PZ1A 1OV3A 5I11A 3REAB 2BTTA 1OPLA 4HVVA 1AOJA 1AWXA 3TSZA 4CC7A 1GCQA 2DM1A 4F14A 1WA7A 4JZ4A 1ZSGA 2VVKA 2GGRA 2DVJA 3QWXX 1JQQA 2CUDA 2KRSA 2YUQA 2CH4W 2O88A 2C0OA 1ZUYA 1YWPA 3VS3A 1Z9ZA 4Y92A 4GLMA 4LN2A 1PKTA 1Z9QA 2DL5A 2BZ8A 1ZBJA 2KEAA 1NG2A 2GTJA 5I22A 2FPEA 3VS1A 1RLPC 2H8HA 2MCNA 1X69A 3PVLA 4Z8AA 2P4RA 1FYNA 3SHWA 1WXTA 1JU5C 2LQNA 3H0FA 1KSWA 1M8MA 3VS0A 2JMAA 1UHCA 2KRNA 2DLPA 1TG0A 2EBPA 2CT4A 2ROTA 1X6GA 1M30A 2ESWA 2BZXA 1SSHA 4RTZA 1TUDA 1RUWA 1VYVA 1PRMC 2EKHA 1WI7A 2DBKA 4RTVA 1ZLMA 2D0NA 2X3XD 3PVQA 2IIMA 4M4ZA 2KYMA 5FWCA 1G2BA 3U23A 4OMLA 1E6HA 2C0TA 4J9BA 2RMOA 1UECA 4AFQC 2YUNA 4OMMA 1E7OA 3UATA 1WXUA 4AFZC 1K0XA 2AK5A 3LH5A 2F2XA 1IO6A 1X27A 2PTKA 3M0TA 2JM9A 2M0YA 3M0RA 4LUEA 2O31A 1W70A 4IIMA 1KIKA
chains in the Genus database with same CATH superfamily
3EHQA 2CT3A 3JCMQ 4KRTA 1QW1A 3I56T 4C8QG 3M57A 2LNVA 1NJIU 3WVEB 1TWBA 1VQ8Q 1UGRB 2E4HA 2XICA 2RHZA 3CMET 3OYDA 2K9GA 2O01E 2KBTA 5GMKh 2AHJB 4LNPA 1WQ7A 4QVCA 1RLQC 1W4SA 2QTVA 5M9OA 3F70A 4M77E 3QWYA 4DOWA 2X4WA 4JJCA 2PVDB 2L2PA 1N5ZA 3R6NA 4HCCA 4M7DB 4M7DG 1MMAA 2HMAA 4LE9A 3VYGA 3RR6A 3QDFA 3VU3C 3RERA 2DJZA 4HXJA 1VQ6A 1IHWA 3NGPA 1WHJA 1IHVA 4LDVA 1SPKA 4R0KA 3URGA 4BE2A 4M7AF 4NS5A 4DEYA 2DILA 1PRLC 1Q81C 1PNJA 3CCMT 5AYFA 5CKBA 4OGCA 2E70A 4RCBA 4ZNXA 1M1KU 2M0OA 3G4SQ 1YJ9Q 1N8RC 2QDYB 3VRZA 2LZ6B 3QYGB 3MEUA 3LGFA 4M75B 1VQ5Q 3BDUA 3M58A 2ED1A 3VJPA 4M75D 2LT4A 2YLBA 1QVFA 1VQMA 2EJFA 2CSQA 3QXEB 4EMKB 2FPDA 3H0HA 4M7AD 3CCST 1YCSB 2LJ0A 5GAN6 2MI6A 5LJ3j 2LCLA 2BE7D 2D6FA 4J6XA 4QVDA 3UPUA 2JM8A 5CIUA 4FSSA 1YN8A 3G7ZA 2MIOA 2CSIA 3CCUT 3JCMd 5GAMd 2JS0A 1RABB 4FW1A 2DL8A 2YSQA 3G6EQ 3CMAQ 3CXCA 3NMZC 2LNHB 2YRVA 2RO0A 4B9WA 2RQRA 2JT4A 1UUEA 2GNCA 4PJOA 1YCYA 2K3BA 2J6KA 3SB2A 1FMWA 1Q7YU 2F1LA 3DKMA 1WQWA 5FW9A 1Q81R 3INZA 2YUOA 2E5KA 2ROLA 4E6RA 4L6V5 4J6YA 2I0NA 2XG8D 2SEMA 1HD3A 4JZ3A 2NUPB 5KYWB 4J9EA 5D6YA 4A4EA 2WACA 3CMEA 4AG1C 2JTEA 2EJ9A 4M77F 2KYBA 4OB1B 4M78E 1H92A 2KRMA 2QQAA 4PFZA 1LCKA 4C0ZA 2MYSA 3QG1A 3MCAB 5IHNA 2E12A 2DL3A 2DXUA 4JJBA 4CI0C 1NJIC 2PVGB 1W6XA 2EYZA 2WSCE 5IXBA 3NHNA 3JB9H 5FLXE 4JJDA 1K1ZA 3EG0A 2MMPA 2QG9B 2RHXA 4E7IA 5GAMf 2FO0A 1W1FA 2EGAA 1MHNA 2J06A 2L3PA 3G1JA 3CCLT 4M75F 4HCKA 2F5KA 3M0PA 2OTLT 3CCMA 1C1AA 1H8KA 2LX7A 1K0SA 3EG2A 4FSXA 2DK3A 4ORZA 3EAEA 2C0IA 1IZ6A 4RG8A 4YTLA 2RJFA 3X25B 4ZTJA 1K9MC 2JUFA 2PQWA 1VQNT 2CUBA 1NZ9A 4KUDK 1WDXA 5IHKA 1JXOA 3OYBA 2CZ6B 4AFUC 4ZGEB 8AT1B 4ATOA 3GOXA 1FX7A 4CC2A 5FU7C 1SSFA 2L3SA 4C8QE 3KFVA 2K3XA 1M5Q1 2COYA 1TXQA 3CEYA 5CQYA 4M7DF 2EFIA 3E9GA 3A8HB 1G3SA 1CKAA 4Y28E 3M53A 3MO8A 2GFUA 2H3EB 1OZ2A 3JV3A 5J39A 3CCJT 2W10A 1PWTA 4A4KA 4HA8A 2G3RA 1S1NA 4EPCA 1UGQB 5GAMe 1BI0A 3L2QA 3S6WA 1UHFA 3JB9I 5L23A 3V7CA 4HCBA 3LYIA 3OYMA 4A63B 3GNFB 3CCLQ 2KT8A 3UF4A 3RBBB 1EZZB 1BIBA 1G8XA 3PTAA 1H3HA 2AKLA 3A98A 3CCJA 3OMCA 2ZPGB 3CC4Q 4ELYC 1QVFS 1QP2A 3CCSQ 2V1QA 3H41A 2JOYA 4QVZA 2IVWA 3KBGA 3LW5E 4JS4A 3O5ZA 2EGCA 3X20B 3ZEHA 1TSFA 4M7DA 1NYGA 4BI4A 1GFDA 2E10A 2JMCA 2YXYA 1E6GA 1H641 1SRMA 2L0AA 3RDVA 2QQRA 2WSEE 4BB7A 2EGEA 1RAHB 4QQDA 1KD1R 5LJ3h 4M7DC 2DEUA 4O5VA 1N9SA 2DXBA 1X75C 2L8DA 3NPFA 2MPXC 2OAUA 2OAWA 3OSSC 1QQJA 1QCNA 2DIGA 1K73U 3G71A 2RM4A 2COWA 3M0QA 5A0GA 2XDDA 2RF0A 2VUBA 2CZ7B 1Y71A 1VQ4Q 4RTTA 2GF7A 1OV3A 5I11A 3REAB 4DBQA 2BTTA 2RI5A 1OPLA 1ZSZA 2DETA 4CC7A 2DM1A 5GAOp 2F69A 3OYYA 1D3BB 2OTLQ 2VVKA 1OX9A 2DVJA 1VQLA 5C6SA 4C92G 1VQPT 3G71T 2KRSA 3FIFA 2YRCA 1Z9ZA 3CC7Q 4MDXA 2QGFB 3I55T 4Y92A 2CP6A 3EFOB 3A1PA 3UT1A 3QKJA 1ZBJA 2QASA 2Z0WA 1NG2A 5KE3A 2FPEA 2EYQA 4J8OA 5I21A 1YHQT 3PIPA 1YIJT 1RAAB 3VS1A 2H8HA 2YRDA 1VQPA 1Y07A 3SDZA 2OTJA 1M8MA 2IG0A 2P0KA 3VS0A 4N4HA 4PJOC 3MP6A 3CCEQ 1K8AU 1ZHIA 1MMDA 1TG0A 2DLPA 1ZSZB 3OMGA 1KQSA 4FL6A 1YHQQ 2BZXA 1SSHA 4RTZA 4CRIA 1OQKA 4V2SA 5HK3A 1VYVA 2JNGA 2DBKA 2NUTB 3PVQA 4LXCA 2FYKA 3ASKA 2VB6A 2OTJT 1G2BA 3U23A 5D6WA 4C0DC 2C0TA 1UECA 4AFQC 3JCMg 2RJDA 4OMMA 3RMSA 1E7OA 4AFZC 1YJNQ 1P92A 2AK5A 1WJRA 2KDSA 3MEWA 1IREB 1KD1U 3ZFJA 4MMKA 3M0RA 1N6AA 2DERA 1EFNA 1KC8U 3TSWA 3JCMf 1GBRA 2LMJA 2QQ9A 4AG2C 3AT1B 4M78B 5KH6A 3CCRA 1G83A 3GPLA 4C92E 1BCMA 3JCMh 7AT1B 4M77G 1Q82C 3CD6Q 1WIEA 2VASA 4X1VA 4E47A 4GY5A 2A3LA 4PLIA 3CCET 2O4XA 1M2VA 3GIBA 1TH7A 3EG9B 1D0YA 5CO7A 2P4TA 4QQ6A 2GBQA 4LDXA 3T9NA 3QDRB 2LQWA 4IUTA 1YI2A 2JTMA 3CCUQ 4PJJA 4FT4A 2K2VA 4TVRA 4EIKA 2BKDN 3CBOA 1NYFA 4J83A 3RUXA 2X51A 2LJ3A 3FDRA 4E7JA 2FZKB 2R58A 5GAOn 2EQIA 4Z89A 4MZPA 3CPWS 1PKSA 1WYXA 2V8JA 2DRMA 3M59A 2CYZB 2HZYA 4MMLA 1Y7XA 1OI1A 2YDLA 1VQ8A 3META 5D6XA 1VQOT 2PU9B 1ABOA 2KGTA 1K76A 4E7ZA 1UTIA 1XJWB 2EWNA 1ZA1B 2DKGA 2QK0A 4LUDA 2F5TX 3GBQA 1RADB 4F7UB 1B7TA 5LJ5h 1UGVA 3OYNA 4MZTA 3BW1A 4LD9K 1AZEA 1VQOA 2AIRB 2RHUA 3EHRA 3EG9A 5HK0A 2R5MA 2PUKB 1QWEA 1JJ2P 4NL3A 2D8HA 4BDZA 5GAN3 2C06A 1UJ0A 2KNBB 4AFSC 3P8HA 1Q7YC 1D0XA 2AZVA 1AHJB 3M4YA 1VIFA 2X3WD 2ZZDA 2A08A 3JCMX 2DRKA 2RQWA 4FYWB 5GMKi 2QDLA 3NTIA 2ZAEA 1U06A 4FYXB 2CZ1B 1VYTA 4LDUA 4Q5WA 4PJOB 1M3BA 4WCIA 2KXCA 4JS5A 2M1HA 4M75C 1X43A 2QI2A 3M4GA 1H3ZA 3OS0A 4ESRA 2RJEA 1YP5A 3NFCA 5CK9A 4M7AA 1FMVA 2CP5A 3LWHA 1K8AR 1AWJA 1MMGA 2QGGA 3VYHB 3OB9A 2ATCB 2RK2A 4OGEA 1N8RR 4C92B 4HCZA 4BI8B 5GMKl 1YNZA 3DB4A 5GAOl 1JXMA 2F2VA 1VUBA 4C8QC 2HL5C 2L5QA 2DXCA 1G5VA 5IHIA 3RIRA 1JB0E 5LL6S 2M9UA 4BE0A 2K2MA 1NPPA 3P8DA 5GANh 2A36A 4IIOA 4OMNA 4ANJA 2KXDA 4F04B 1M90R 1QWFA 4LD6A 4M75A 3EGDB 4FM4B 5GMKj 4C92F 4E7SA 3UWNA 3M0UA 1Y96B 2HQHA 1WX6A 1TOVA 3V8JA 1VQNQ 4M78F 2SRCA 3MJXA 5KYYA 3X28B 3FJPA 4PNOA 1M2OA 4IUUA 4RTUA 1PG5B 4FYVB 4XU1A 2CP7A 2KR3A 3OYEA 1MUZA 4BY6C 3QZ5B 1KHCA 2E5QA 1XOVA 3CQTA 1S72T 3H9NA 3QJ6A 4OP0A 1ZA2B 4M7AB 1S72A 2P0PA 1QCFA 2HBWA 2X35A 3I5RA 5CVIA 3CBPA 2XK0A 3OS2A 4C92A 4F17A 3OYKA 3FRNA 4DBHA 4A53A 5CQXA 1BI1A 2EW3A 2FRYA 1KQSS 2J6FA 2X4XA 3SWNB 2QTXA 3CC4T 4N0AA 3CCMQ 3OW2P 1XNIA 5DY9A 2KE9A 2RJCA 4XTYA 4Y91A 4M7AE 1I5OB 4C8QB 1QKWA 3QHSA 1VQ7A 2RI2A 3ZBDA 1AVZC 2DJQA 4C8QD 3EGXB 4XU0A 2DIQA 3ME9A 1XTDA 2V8KA 1KFZA 2PNIA 4QKUA 3CC2A 2CZ0B 2VXEA 1KK7A 4KULA 3CCVT 4AT1B 2QA4A 1VQKQ 4JUVA 2DE0X 1VQMT 2RN8A 1YIJQ 1QMCA 2E3IA 2QYZA 5GAMh 2B8AA 1ARKA 1YJWA 3M5AA 4Z02A 1RACB 2DTOA 5EC7A 3BE3A 1ZQ1A 4MDWA 2RQUA 3EGDA 3EG1A 3CC7T 2JXBA 2LQKA 2HQXA 5DLOA 1O9SA 1VQ9A 3QSUA 2ENMA 4UC4A 3CCLA 1DJ7B 4J6WA 2LC4A 2NUZA 3VS7A 1WPYA 1YITQ 2EYYA 3OQ5A 1T3SA 2RNAA 5GANe 1I0CA 2LCCA 1BK2A 3CCSA 5GAMg 3JCMW 3BFMA 3TSZA 1AWXA 1D0ZA 1GCQA 2HD0A 2NUPA 4XU3A 4RMOA 4F14A 4JZ4A 3S3MA 2RHYA 3JCMP 2RI3A 2QQSA 2GGRA 3QWXX 2E64A 4FCYA 1D1AA 3EH2A 4DBFA 2KVQG 2O88A 4B9XA 5J26A 2ZGWA 3RKWA 4BACA 1PSFA 3PT9A 3E19A 3QJYA 4GLMA 2FZGB 3QO3A 4ZN3A 5LJ5j 2DL5A 1U1TA 2Y4XA 3A8MB 1Q7YR 4M7DD 3A8GB 1X69A 4Z8AA 1JU5C 1IXDA 1RAEB 5KCOA 2OX7A 2EQMA 3OYCA 1JBMA 2R5AA 3PIOA 1B34B 2EBPA 2A0FB 1TUGB 1X01A 2ROTA 2ESWA 2RD1A 1TUDA 4DBRA 4RTVA 1IB8A 2X3XD 2Y90A 3EFRA 5FWCA 1E6HA 2HKQB 2RMOA 3R6OA 2FZCB 2RK1A 2YUNA 2GFAA 5HY6A 5CAIA 4M75G 1RAIB 1WXUA 4PLLA 4F7UG 3GF5A 4OB3B 4PK4A 3DB3A 3C94A 4LUEA 2O31A 1W70A 2QEXQ 1QVFP 4IIMA 1WJQA 4EMGA 4C5GA 5C0MA 3N5BB 2XU8A 3OYJA 2OJ2A 2RH2A 1K9AA 1LNXA 3NTKA 1BB9A 3VV0A 1I81A 1I4K1 2L89A 2VYTA 1NPRA 4BI3A 3S3OA 5LJ3g 3HKSA 3CCVA 3M56A 1YHQA 4C8QF 3RNJA 1GRIA 5D7UA 4PKCC 4A4GA 1M1KC 4LDYA 1OU9A 3G4SA 1YJ9A 3MEVA 4PFOA 1YJWT 2E65A 3DLMA 3UA7A 1M8VA 2O9VA 1X6OA 2EPDA 5GMKe 2MOXA 3OYHA 1OOTA 2K79A 1VQMQ 3G6ET 3CMAT 4BDYA 3GP8A 1GL5A 3E1SA 4J9FA 2JVVA 1U3OA 1N27A 1WNLA 5I2MA 2DVEA 4M77B 5LJ5d 3ULRB 1A0NB 3I55A 3C12A 4FU6A 2EKOA 1J3TA 1ZSZC 4XK8E 4JPBW 1QKXA 2K7AA 1JO8A 1TUCA 4KGXB 3LGLA 3V7RA 1MV0B 1W2BA 1U1SA 4KT0E 4II1A 1PD0A 2O4XB 1QVPA 1ZUKA 2P0QA 4M78G 4X9DA 5CKFA 1MMNA 4C0DB 5GAN7 1YBYA 5IT9E 2J6OA 1MGQA 1AT1B 1YFNA 1FXXA 3P8BB 2FG0A 5FROA 3ZL7C 5LJ3d 1SHFA 2DL7A 1CKBA 1W2BP 3OYAA 4QW2A 2GQVA 4WTOB 3A8OB 4XQ3A 2QQBA 1FMKA 4B6MA 3QUIA 3QZ9B 3IQLA 1NE8A 5KYXA 1Q82U 1VQ6Q 3H8ZA 2Y4YA 1BBZA 2XMFA 1NM7A 1AZGB 2CGHA 2MF2A 4OVAA 1X2KA 1SG5A 2H3JA 1VYUA 2LX9A 1B3QA 2CREA 4XTWA 3GLXA 4J9DA 1WHKA 1OULA 2CP3A 2XIDA 4HT8A 1EIFA 1AWOA 4IUQA 1SRLA 2AT1B 4M7DE 4WF2A 1UE9A 4PJOF 2DFUA 2DX1A 5A0DA 4E7LA 1AD5A 2O9SA 2VV5A 2CKKA 4DOVA 5GAN8 3SD4A 5GANg 5LJ3e 2FB7A 3L2VA 2HQEA 5IH2A 1NBEB 3JB9F 3DLLA 2EAYA 4PL6A 3FJ5A 4PJLA 4KUIA 4Z88A 2RQVA 2EYWA 1N9RA 3O8VA 3OBWA 2VC8A 4ZN1A 1FWZA 1YI2T 2JJ9A 4OB0B 2DL4A 2DPPB 1R8OB 3OYGA 4RUGA 5GAN4 4HT9A 2GCXA 3G6EA 2CDTA 3E9FA 5EG2A 3JRZA 3CMAA 3HFNA 4C0GA 4M77C 2DNUA 3L2UA 1YITT 1NEBA 3CXCS 2DTHA 3J81E 2HAXA 4N4IA 1KHIA 1V1CA 5KCHA 2PUOB 4XTVA 1M3AA 1K8AC 4N0AC 2DAQA 2K5FA 3WXMB 3HRUA 4VUBA 5FU7B 4XU2A 2JW4A 3C4SA 1ABQA 3VS6A 4F7UE 1RI9A 4KGVB 1C6VX 4C8QA 4DEXA 3CMEQ 2LT1A 5HCKA 2O2OA 4ELZC 2DZCA 4XTZA 1XQHA 3AHUA 4K11A 4OMPA 2J05A 4PJOE 3A5ZB 1Y57A 1UGPB 1KC8R 2L3QA 3FEOA 5FU6C 4C92D 1QVGS 1O75A 4GBQA 2YHTA 3OSVA 1RAGB 4X9CA 1WHGA 3VS4A 1G3TA 2WSFE 3ER0A 3Q1JA 3TU4K 1KC8C 2BIVA 3C0CA 4RTXA 3WVDB 4M7AG 1UG1A 2LCSA 3H6ZA 2RB6A 5FWBA 3VS2A 1WFWA 2DBMA 3HHTB 5GANf 1IGQA 3GNGA 3V7SA 8ATCB 3CCQT 2F2WA 2FEIA 4JLIA 3TVTA 1HSQA 3BDLA 4F7UA 1PHTA 2DD5A 2ZPFB 4DQ2A 2XI9A 1GXIE 2GTOA 1VQ4A 2DA9A 3L42A 3THKA 4IUPA 2A37A 5KYUB 2FHDA 1KJWA 2K6DA 4FT2A 2ABLA 2KY9A 1VQLQ 2GQIA 1X6BA 3VS5A 1OEBA 1U8RA 1LVKA 1TTHB 5KYUA 3C95A 1G3YA 1M1GA 1UDLA 2E1HA 2DYBA 4C5IA 1R0BG 3CCQQ 3TREA 2KK4A 4N4GA 1NEGA 4BE1A 1WZOA 3D7SB 2NUTA 2RHIA 1SHGA 4X34A 3FC3A 2DD4A 5CKHA 3SFMA 4XTUA 1GFCA 1JJ2A 2OTJQ 1NLPC 2D0QB 2VWFA 5GMKm 3CCJQ 1M90C 2DTIA 4JRIA 1BI3A 4J9HA 3CC4A 3HTRA 4CC4B 1KG1A 1K9MR 1BI2A 2DEQA 1AOJA 4FIBA 2K57A 5GANd 1WA7A 5IAYA 1ZSGA 4M78C 1VQ7T 1D09B 3CC2Q 1VQKT 1Q95G 3M54A 1JQQA 1VQKA 2QA4Q 2C0OA 4FW2A 1YWPA 3VS3A 3VKIA 1OZ3A 3CD6T 5CCAA 1VQ6T 2EIFA 1PKTA 2K5LA 4XTXA 1BKBA 1K73C 4EMHA 3VUZA 1QCOA 2KEAA 1LPLA 3I56A 5I22A 3L2WA 5IN1A 3JB9G 3SWNA 4KH1B 2A7YA 3OS1A 1QP3A 3PVLA 2P4RA 3EFOA 1WXTA 1N8RU 2LQNA 3G71Q 2HSEB 3CC2T 2KRNA 1WGSA 2BE9B 3OW2A 2CT4A 4LDWA 3J7AF 1M30A 2JZ2A 4QQGA 3JB9J 5GAMj 3CPWA 1D3BA 2COZA 4C0FA 1HYOA 1PRMC 2EKHA 2LRQA 5LJ5f 1WI7A 1VIEA 2OTLA 2R57A 1ZLMA 2E6ZA 1K9MU 4M4ZA 3HRTA 3TEEA 4J9BA 3CC7A 4L59A 5FU6B 1D1BA 1WHHA 1C0MA 4E2FB 4PJNA 1IO6A 1X27A 2PTKA 1VQ4T 2JM9A 2M0YA 3CCUA 2HNIA 2YLCA 4M75E 3PMIA 4ZTFA 4ME7A 3I5SA 3MHXA 3PNWC 2NWMA 1Q82R 2KT1A 4NOYA 1LJOA 4A54A 1SEMA 2JN0A 4EMKA 2ECZA 3SWNC 4RTWA 2VGNA 1YJNT 1Y0MA 3HRSA 3JCMe 2QXFA 2LDMA 2ZPBB 2I2LA 5GAOr 2X4YA 3QPHA 1VQ5A 2FPFA 1ZUUA 5GAOm 3UA6A 4M7AC 3KXTA 1M3CA 4MZMA 2L3RA 1PM3A 4D6WA 1WXBA 1YJNA 3JCMb 4ZGJB 1V29B 2QEXT 4J7FA 1VA7A 3MEAA 4C5EA 4BY6B 2QEXA 2P84A 2HSPA 2RA2A 1U5SA 2LTOA 4IURA 3RMQA 3CPWP 2FRWA 2KAFA 2ZPHB 1GCQC 1EX4A 3UDCA 3CBMA 5GJWB 1GBQA 3CCRQ 4DA4A 2DXTA 3L2ZA 2V8IA 2E6NA 2KI7A 4J9GA 3OYFA 3CD6A 3HFOA 4PJMA 3LWIA 3PGGA 1UB4A 3QIIA 2KQWA 3LX7A 1UGSB 5J3BA 2XHCA 9ATCB 4A4FA 1JJ2S 4OB2B 1RI0A 4RKUE 3L1AA 5CR2A 3S3NA 1YWOA 3BY7A 3EG3A 3PMTA 1R0CB 1GCPA 3J80E 4XAXB 2JS2A 2LQ8A 3LH0A 5LJ5e 3NTHA 3OS5A 3OA6A 2EQUA 1VQ9T 4A4HA 1I07A 3I55Q 3TCJA 3OY9A 2A28A 1RL2A 1PSEA 1CSKA 2QA4T 1M1KR 1QVGA 4J9IA 4J7IA 4O6JA 3H0IA 1Q86C 1M9SA 1G3WA 3V8KA 1BYMA 4M77D 2RQTA 1KQ2A 1K4US 2X9HA 1NJIR 4HVUA 5KYNA 4JRPA 2FVUA 3L2RA 4IKFA 2BZYA 5LJ5g 2M02A 3CXCP 1MNDA 1AWWA 2XD0A 1VQLT 5LJ3f 2HEQA 3I9QA 4OMQA 3M55A 1Q86U 5KYWA 3X26B 2PVOB 5L8RE 5FRNA 1ZX6A 3HSBA 2KMTA 1BIAA 1VQNA 2EYXA 2RPNA 3JAME 5ECAA 3EFSA 3A8LB 1VQOQ 2DYIA 2E41A 4OMOA 4C5HA 4D8KA 2G6FX 3MKDA 4KBMB 5A0LA 1HXDA 2CH4A 2KSSA 3OYIA 2KROA 3RKXA 1VQ5T 2EVRA 2NYSA 3JSCA 1KQ1A 2ZPEB 3MPUB 2YUPA 1X2QA 2EQKA 3VRYA 5DM7R 4C92C 2HCKA 1T0JA 4HVWA 1S72Q 1B07A 2MK5A 1RAFB 5GAN5 1OYXA 1PD1A 1V76A 1UEBA 4ZGDB 1WJSA 2AKKA 1HJDA 3RKYA 4RTYA 2CP0A 1I1JA 1F1BB 3QYHB 4F7UF 2IPOB 2LVMA 5GJVB 2B86A 1B34A 2YWWA 4IUVA 1T0HA 3I35A 2K5IA 1WHMA 2CS7A 1TU0B 1ZBXA 4AMCA 5HKCA 1VQ7Q 1HK9A 4NL2A 2LP5A 4M77A 3G4ST 1YJ9T 3CCRT 2FL7A 3REBB 4E7HA 3PE0A 3JB9D 1LOJA 4OF1A 3QBYA 1KQSP 1WHLA 2HKNA 2M16A 4EDUA 1YIJA 1UJYA 2D8JA 2NLUA 2OI3A 4RCCA 2EQJA 3OW2S 2XDPA 1T3LA 2W0ZA 2VXFA 1MNEA 4GLKA 1NLOC 3MP8A 1Q86R 1OU8A 4EMKC 1VQ8T 2ZCFB 4BD3A 1VQ9Q 2V1RA 2VKNA 1OX8A 1QLYA 4D8DA 5IXFA 3KUFA 1YITA 3V8LA 1M27C 3EGUA 2E3HA 4HKEA 2DF6A 1JEGA 4E7KA 2V26A 1ACMB 4F16A 2YT6A 2ED0A 1UFFA 3E2UA 2D1XA 1JRIA 4KGZB 2HDAA 3SEMA 4J9CA 2M51A 3HP9A 1SF9A 4QT7A 1M2VB 4CC3A 2ZPIB 2DMOA 1AEYA 3OBYA 2LJ1A 5KE2A 1KIKA 3M0SA 1Y96A 1M90U 3PFSA 3EH1A 2AZSA 3HL8A 4PJOD 1VQPQ 2XDBA 2J7IA 4KH0B 1M1FA 2MAMA 4PFPA 4M78A 1MV3A 1KD1C 2XKOC 5AT1B 2HBPA 3CCEA 3VUBA 1QVGP 1BU1A 1WLPB 1OPKA 1W2BS 2PZ1A 4HVVA 4J5YA 3JCMc 2MWPA 4P5NA 3LLRA 1K73R 2D9TA 5GAN2 2CUDA 2YUQA 4PJOG 2CH4W 3OYLA 1ZUYA 4R56A 1VOMA 3EGXA 1YJWQ 5CKDA 1BCOA 4JLGA 2X4JA 4LN2A 5DLQE 1Z9QA 3CCQA 5FRMA 2JTFA 2DZ9A 1Q81U 2BZ8A 4JRQA 2GTJA 3FB9A 1RLPC 2K3YA 2MCNA 3TQ7P 4JRKA 2MWOA 1FYNA 3SHWA 3H0FA 3CPFA 1KSWA 3FLGA 4R55A 2JMAA 1UHCA 4OMFB 3CCVQ 2K4YA 1X6GA 2HL3A 5GANj 6AT1B 1RUWA 5KYXB 4FYYB 4JJNK 2D0NA 1SKUB 3JCMJ 2IIMA 4BUGA 5GAOq 2BUDA 3HPWA 2KYMA 3JCMV 4OMLA 4M78D 4L5GA 1IRXA 1PCXA 1PC0A 2CP2A 3MP1A 4RG2A 2QAZA 1M4ZA 3UATA 1IGUA 1K0XA 1D1CA 3LH5A 2F2XA 5CKEA 3I56Q 1I5LA 1YI2Q 3M0TA 2VGMA 5KYYB 2DO3A 1I8FA 1TS9A 2EJGA 3X24B 1R77A 4JDSA 3M9QA 5I2SA 5A2QE 3RESA
chains in the Genus database with same CATH topology
1EFNA 3EHQA 3I5SA 3TSWA 2CT3A 2OJ2A 1K9AA 2NWMA 4KRTA 2LMJA 1GBRA 1BB9A 2KT1A 4AG2C 1SEMA 2ECZA 1G83A 4RTWA 3RNJA 1GRIA 1Y0MA 1WIEA 4X1VA 3UA7A 2K9GA 2O9VA 2EPDA 2KBTA 4LNPA 2FPFA 1RLQC 1ZUUA 3UA6A 2MOXA 3QWYA 1OOTA 2K79A 2GBQA 1M3CA 4JJCA 1WXBA 2LQWA 2L2PA 1GL5A 1N5ZA 3R6NA 4J9FA 1U3OA 1VA7A 4LE9A 3ULRB 1A0NB 4EIKA 2HSPA 1NYFA 1U5SA 4HXJA 2FRWA 3NGPA 1J3TA 1SPKA 4R0KA 4JPBW 1QKXA 1GCQC 2LJ3A 2K7AA 5GJWB 1GBQA 1JO8A 4DEYA 1TUCA 2DILA 1PRLC 1PNJA 2EQIA 4Z89A 1PKSA 1WYXA 4ZNXA 2DRMA 1MV0B 4J9GA 2YDLA 1ZUKA 3VRZA 2LZ6B 2J6OA 1ABOA 2KGTA 2ED1A 1K76A 1UTIA 2FG0A 2CSQA 3ZL7C 1YWOA 1SHFA 2FPDA 3H0HA 2DL7A 3EG3A 1CKBA 4LUDA 3GBQA 1GCPA 1YCSB 2JS2A 1FMKA 2LJ0A 1UGVA 3IQLA 1I07A 1AZEA 2A28A 1CSKA 2JM8A 3EHRA 1BBZA 2XMFA 1QWEA 4J9IA 1NM7A 2D8HA 4FSSA 1AZGB 3H0IA 1YN8A 2MIOA 1UJ0A 2CSIA 2KNBB 2RQTA 4AFSC 1X2KA 2JS0A 1VYUA 1B3QA 2AZVA 2CREA 1K4US 2DL8A 2YSQA 2X3WD 4HVUA 2A08A 4J9DA 3NMZC 2LNHB 2RQRA 2DRKA 2RQWA 2JT4A 1UUEA 2GNCA 2K3BA 2BZYA 2J6KA 2QDLA 1U06A 1AWWA 1AWOA 1SRLA 1VYTA 1UE9A 2DX1A 5FW9A 2HEQA 3I9QA 4OMQA 1M3BA 1AD5A 2O9SA 4WCIA 2KXCA 2YUOA 2E5KA 1ZX6A 2ROLA 1X43A 4E6RA 5IH2A 2EYXA 4ESRA 1YP5A 2I0NA 2RPNA 5ECAA 3FJ5A 4Z88A 2SEMA 1HD3A 4JZ3A 1AWJA 2RQVA 2EYWA 4OMOA 4J9EA 4D8KA 2G6FX 4AG1C 2CH4A 2JTEA 2KROA 2KYBA 1YNZA 2EVRA 1JXMA 2F2VA 2DL4A 1H92A 2KRMA 5IHIA 1LCKA 4RUGA 2YUPA 1X2QA 5IHNA 2DL3A 2K2MA 2CDTA 4JJBA 2DNUA 2A36A 4IIOA 1W6XA 4OMNA 2EYZA 3VRYA 1NEBA 5IXBA 2KXDA 2HCKA 1T0JA 4HVWA 1B07A 3NHNA 1V1CA 1QWFA 4JJDA 1K1ZA 3EG0A 2FO0A 2AKKA 1HJDA 1M3AA 4RTYA 1W1FA 1I1JA 2EGAA 2J06A 2L3PA 3M0UA 5GJVB 4HCKA 2B86A 3M0PA 1WX6A 1T0HA 2SRCA 3I35A 1H8KA 2LX7A 2JW4A 1K0SA 3EG2A 1ABQA 4RTUA 3VS6A 4ORZA 1RI9A 2C0IA 2KR3A 4DEXA 1MUZA 5HCKA 2O2OA 2CUBA 2LP5A 1WDXA 4K11A 4OMPA 5IHKA 1JXOA 3REBB 1XOVA 2J05A 3CQTA 4AFUC 1Y57A 3PE0A 4CC2A 2L3SA 3KFVA 1QCFA 2HBWA 3I5RA 1CKAA 2L3QA 4F17A 1UJYA 2D8JA 2OI3A 4GBQA 3JV3A 1T3LA 2W10A 3VS4A 2W0ZA 3C0CA 4RTXA 2EW3A 1PWTA 2FRYA 2J6FA 1NLOC 1UG1A 2LCSA 1S1NA 5FWBA 1UHFA 2KE9A 3VS2A 5L23A 1WFWA 2DBMA 4A63B 2V1RA 2VKNA 1QLYA 1QKWA 2KT8A 2F2WA 4D8DA 3UF4A 3RBBB 2FEIA 5IXFA 3TVTA 1H3HA 1HSQA 1AVZC 2DJQA 2AKLA 3A98A 1M27C 1PHTA 3EGUA 2GTOA 2V1QA 3H41A 2DA9A 3THKA 2DF6A 1JEGA 2A37A 1KFZA 2PNIA 3O5ZA 2EGCA 1KJWA 2K6DA 2ABLA 1NYGA 4F16A 1GFDA 2YT6A 2JMCA 2GQIA 2ED0A 1UFFA 1X6BA 3VS5A 1E6GA 2DE0X 1SRMA 1OEBA 2D1XA 2L0AA 2RN8A 2HDAA 3SEMA 4J9CA 2M51A 2EGEA 1ARKA 1UDLA 4QT7A 2DYBA 5EC7A 4CC3A 2DMOA 1AEYA 2RQUA 1NEGA 3NPFA 2LJ1A 3EG1A 2OAWA 3M0SA 1SHGA 2JXBA 2AZSA 1GFCA 2J7IA 2ENMA 1NLPC 2NUZA 3VS7A 2VWFA 3M0QA 1MV3A 2EYYA 1T3SA 2RNAA 4J9HA 1I0CA 2RF0A 1BU1A 4CC4B 1BK2A 1WLPB 1OPKA 4RTTA 2PZ1A 1OV3A 5I11A 3REAB 2BTTA 1OPLA 4HVVA 1AOJA 1AWXA 3TSZA 4CC7A 1GCQA 2DM1A 4F14A 1WA7A 4JZ4A 1ZSGA 2VVKA 2GGRA 2DVJA 3QWXX 1JQQA 2CUDA 2KRSA 2YUQA 2CH4W 2O88A 2C0OA 1ZUYA 1YWPA 3VS3A 1Z9ZA 4Y92A 4GLMA 4LN2A 1PKTA 1Z9QA 2DL5A 2BZ8A 1ZBJA 2KEAA 1NG2A 2GTJA 5I22A 2FPEA 3VS1A 1RLPC 2H8HA 2MCNA 1X69A 3PVLA 4Z8AA 2P4RA 1FYNA 3SHWA 1WXTA 1JU5C 2LQNA 3H0FA 1KSWA 1M8MA 3VS0A 2JMAA 1UHCA 2KRNA 2DLPA 1TG0A 2EBPA 2CT4A 2ROTA 1X6GA 1M30A 2ESWA 2BZXA 1SSHA 4RTZA 1TUDA 1RUWA 1VYVA 1PRMC 2EKHA 1WI7A 2DBKA 4RTVA 1ZLMA 2D0NA 2X3XD 3PVQA 2IIMA 4M4ZA 2KYMA 5FWCA 1G2BA 3U23A 4OMLA 1E6HA 2C0TA 4J9BA 2RMOA 1UECA 4AFQC 2YUNA 4OMMA 1E7OA 3UATA 1WXUA 4AFZC 1K0XA 2AK5A 3LH5A 2F2XA 1IO6A 1X27A 2PTKA 3M0TA 2JM9A 2M0YA 3M0RA 4LUEA 2O31A 1W70A 4IIMA 1KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EFN A;  3EHQ A;  3I5S A;  3TSW A;  2CT3 A;  2OJ2 A;  1K9A A;  2NWM A;  4KRT A;  2LMJ A;  1GBR A;  1BB9 A;  2KT1 A;  4AG2 C;  1SEM A;  2ECZ A;  1G83 A;  4RTW A;  3RNJ A;  1GRI A;  1Y0M A;  1WIE A;  4X1V A;  3UA7 A;  2K9G A;  2O9V A;  2EPD A;  2KBT A;  4LNP A;  2FPF A;  1RLQ C;  1ZUU A;  3UA6 A;  2MOX A;  3QWY A;  1OOT A;  2K79 A;  2GBQ A;  1M3C A;  4JJC A;  1WXB A;  2LQW A;  2L2P A;  1GL5 A;  1N5Z A;  3R6N A;  4J9F A;  1U3O A;  1VA7 A;  4LE9 A;  3ULR B;  1A0N B;  4EIK A;  2HSP A;  1NYF A;  1U5S A;  4HXJ A;  2FRW A;  3NGP A;  1J3T A;  1SPK A;  4R0K A;  4JPB W;  1QKX A;  1GCQ C;  2LJ3 A;  2K7A A;  5GJW B;  1GBQ A;  1JO8 A;  4DEY A;  1TUC A;  2DIL A;  1PRL C;  1PNJ A;  2EQI A;  4Z89 A;  1PKS A;  1WYX A;  4ZNX A;  2DRM A;  1MV0 B;  4J9G A;  2YDL A;  1ZUK A;  3VRZ A;  2LZ6 B;  2J6O A;  1ABO A;  2KGT A;  2ED1 A;  1K76 A;  1UTI A;  2FG0 A;  2CSQ A;  3ZL7 C;  1YWO A;  1SHF A;  2FPD A;  3H0H A;  2DL7 A;  3EG3 A;  1CKB A;  4LUD A;  3GBQ A;  1GCP A;  1YCS B;  2JS2 A;  1FMK A;  2LJ0 A;  1UGV A;  3IQL A;  1I07 A;  1AZE A;  2A28 A;  1CSK A;  2JM8 A;  3EHR A;  1BBZ A;  2XMF A;  1QWE A;  4J9I A;  1NM7 A;  2D8H A;  4FSS A;  1AZG B;  3H0I A;  1YN8 A;  2MIO A;  1UJ0 A;  2CSI A;  2KNB B;  2RQT A;  4AFS C;  1X2K A;  2JS0 A;  1VYU A;  1B3Q A;  2AZV A;  2CRE A;  1K4U S;  2DL8 A;  2YSQ A;  2X3W D;  4HVU A;  2A08 A;  4J9D A;  3NMZ C;  2LNH B;  2RQR A;  2DRK A;  2RQW A;  2JT4 A;  1UUE A;  2GNC A;  2K3B A;  2BZY A;  2J6K A;  2QDL A;  1U06 A;  1AWW A;  1AWO A;  1SRL A;  1VYT A;  1UE9 A;  2DX1 A;  5FW9 A;  2HEQ A;  3I9Q A;  4OMQ A;  1M3B A;  1AD5 A;  2O9S A;  4WCI A;  2KXC A;  2YUO A;  2E5K A;  1ZX6 A;  2ROL A;  1X43 A;  4E6R A;  5IH2 A;  2EYX A;  4ESR A;  1YP5 A;  2I0N A;  2RPN A;  5ECA A;  3FJ5 A;  4Z88 A;  2SEM A;  1HD3 A;  4JZ3 A;  1AWJ A;  2RQV A;  2EYW A;  4OMO A;  4J9E A;  4D8K A;  2G6F X;  4AG1 C;  2CH4 A;  2JTE A;  2KRO A;  2KYB A;  1YNZ A;  2EVR A;  1JXM A;  2F2V A;  2DL4 A;  1H92 A;  2KRM A;  5IHI A;  1LCK A;  4RUG A;  2YUP A;  1X2Q A;  5IHN A;  2DL3 A;  2K2M A;  2CDT A;  4JJB A;  2DNU A;  2A36 A;  4IIO A;  1W6X A;  4OMN A;  2EYZ A;  3VRY A;  1NEB A;  5IXB A;  2KXD A;  2HCK A;  1T0J A;  4HVW A;  1B07 A;  3NHN A;  1V1C A;  1QWF A;  4JJD A;  1K1Z A;  3EG0 A;  2FO0 A;  2AKK A;  1HJD A;  1M3A A;  4RTY A;  1W1F A;  1I1J A;  2EGA A;  2J06 A;  2L3P A;  3M0U A;  5GJV B;  4HCK A;  2B86 A;  3M0P A;  1WX6 A;  1T0H A;  2SRC A;  3I35 A;  1H8K A;  2LX7 A;  2JW4 A;  1K0S A;  3EG2 A;  1ABQ A;  4RTU A;  3VS6 A;  4ORZ A;  1RI9 A;  2C0I A;  2KR3 A;  4DEX A;  1MUZ A;  5HCK A;  2O2O A;  2CUB A;  2LP5 A;  1WDX A;  4K11 A;  4OMP A;  5IHK A;  1JXO A;  3REB B;  1XOV A;  2J05 A;  3CQT A;  4AFU C;  1Y57 A;  3PE0 A;  4CC2 A;  2L3S A;  3KFV A;  1QCF A;  2HBW A;  3I5R A;  1CKA A;  2L3Q A;  4F17 A;  1UJY A;  2D8J A;  2OI3 A;  4GBQ A;  3JV3 A;  1T3L A;  2W10 A;  3VS4 A;  2W0Z A;  3C0C A;  4RTX A;  2EW3 A;  1PWT A;  2FRY A;  2J6F A;  1NLO C;  1UG1 A;  2LCS A;  1S1N A;  5FWB A;  1UHF A;  2KE9 A;  3VS2 A;  5L23 A;  1WFW A;  2DBM A;  4A63 B;  2V1R A;  2VKN A;  1QLY A;  1QKW A;  2KT8 A;  2F2W A;  4D8D A;  3UF4 A;  3RBB B;  2FEI A;  5IXF A;  3TVT A;  1H3H A;  1HSQ A;  1AVZ C;  2DJQ A;  2AKL A;  3A98 A;  1M27 C;  1PHT A;  3EGU A;  2GTO A;  2V1Q A;  3H41 A;  2DA9 A;  3THK A;  2DF6 A;  1JEG A;  2A37 A;  1KFZ A;  2PNI A;  3O5Z A;  2EGC A;  1KJW A;  2K6D A;  2ABL A;  1NYG A;  4F16 A;  1GFD A;  2YT6 A;  2JMC A;  2GQI A;  2ED0 A;  1UFF A;  1X6B A;  3VS5 A;  1E6G A;  2DE0 X;  1SRM A;  1OEB A;  2D1X A;  2L0A A;  2RN8 A;  2HDA A;  3SEM A;  4J9C A;  2M51 A;  2EGE A;  1ARK A;  1UDL A;  4QT7 A;  2DYB A;  5EC7 A;  4CC3 A;  2DMO A;  1AEY A;  2RQU A;  1NEG A;  3NPF A;  2LJ1 A;  3EG1 A;  2OAW A;  3M0S A;  1SHG A;  2JXB A;  2AZS A;  1GFC A;  2J7I A;  2ENM A;  1NLP C;  2NUZ A;  3VS7 A;  2VWF A;  3M0Q A;  1MV3 A;  2EYY A;  1T3S A;  2RNA A;  4J9H A;  1I0C A;  2RF0 A;  1BU1 A;  4CC4 B;  1BK2 A;  1WLP B;  1OPK A;  4RTT A;  2PZ1 A;  1OV3 A;  5I11 A;  3REA B;  2BTT A;  1OPL A;  4HVV A;  1AOJ A;  1AWX A;  3TSZ A;  4CC7 A;  1GCQ A;  2DM1 A;  4F14 A;  1WA7 A;  4JZ4 A;  1ZSG A;  2VVK A;  2GGR A;  2DVJ A;  3QWX X;  1JQQ A;  2CUD A;  2KRS A;  2YUQ A;  2CH4 W;  2O88 A;  2C0O A;  1ZUY A;  1YWP A;  3VS3 A;  1Z9Z A;  4Y92 A;  4GLM A;  4LN2 A;  1PKT A;  1Z9Q A;  2DL5 A;  2BZ8 A;  1ZBJ A;  2KEA A;  1NG2 A;  2GTJ A;  5I22 A;  2FPE A;  3VS1 A;  1RLP C;  2H8H A;  2MCN A;  1X69 A;  3PVL A;  4Z8A A;  2P4R A;  1FYN A;  3SHW A;  1WXT A;  1JU5 C;  2LQN A;  3H0F A;  1KSW A;  1M8M A;  3VS0 A;  2JMA A;  1UHC A;  2KRN A;  2DLP A;  1TG0 A;  2EBP A;  2CT4 A;  2ROT A;  1X6G A;  1M30 A;  2ESW A;  2BZX A;  1SSH A;  4RTZ A;  1TUD A;  1RUW A;  1VYV A;  1PRM C;  2EKH A;  1WI7 A;  2DBK A;  4RTV A;  1ZLM A;  2D0N A;  2X3X D;  3PVQ A;  2IIM A;  4M4Z A;  2KYM A;  5FWC A;  1G2B A;  3U23 A;  4OML A;  1E6H A;  2C0T A;  4J9B A;  2RMO A;  1UEC A;  4AFQ C;  2YUN A;  4OMM A;  1E7O A;  3UAT A;  1WXU A;  4AFZ C;  1K0X A;  2AK5 A;  3LH5 A;  2F2X A;  1IO6 A;  1X27 A;  2PTK A;  3M0T A;  2JM9 A;  2M0Y A;  3M0R A;  4LUE A;  2O31 A;  1W70 A;  4IIM A;  1KIK A; 
#chains in the Genus database with same CATH topology
 3EHQ A;  2CT3 A;  3JCM Q;  4KRT A;  1QW1 A;  3I56 T;  4C8Q G;  3M57 A;  2LNV A;  1NJI U;  3WVE B;  1TWB A;  1VQ8 Q;  1UGR B;  2E4H A;  2XIC A;  2RHZ A;  3CME T;  3OYD A;  2K9G A;  2O01 E;  2KBT A;  5GMK h;  2AHJ B;  4LNP A;  1WQ7 A;  4QVC A;  1RLQ C;  1W4S A;  2QTV A;  5M9O A;  3F70 A;  4M77 E;  3QWY A;  4DOW A;  2X4W A;  4JJC A;  2PVD B;  2L2P A;  1N5Z A;  3R6N A;  4HCC A;  4M7D B;  4M7D G;  1MMA A;  2HMA A;  4LE9 A;  3VYG A;  3RR6 A;  3QDF A;  3VU3 C;  3RER A;  2DJZ A;  4HXJ A;  1VQ6 A;  1IHW A;  3NGP A;  1WHJ A;  1IHV A;  4LDV A;  1SPK A;  4R0K A;  3URG A;  4BE2 A;  4M7A F;  4NS5 A;  4DEY A;  2DIL A;  1PRL C;  1Q81 C;  1PNJ A;  3CCM T;  5AYF A;  5CKB A;  4OGC A;  2E70 A;  4RCB A;  4ZNX A;  1M1K U;  2M0O A;  3G4S Q;  1YJ9 Q;  1N8R C;  2QDY B;  3VRZ A;  2LZ6 B;  3QYG B;  3MEU A;  3LGF A;  4M75 B;  1VQ5 Q;  3BDU A;  3M58 A;  2ED1 A;  3VJP A;  4M75 D;  2LT4 A;  2YLB A;  1QVF A;  1VQM A;  2EJF A;  2CSQ A;  3QXE B;  4EMK B;  2FPD A;  3H0H A;  4M7A D;  3CCS T;  1YCS B;  2LJ0 A;  5GAN 6;  2MI6 A;  5LJ3 j;  2LCL A;  2BE7 D;  2D6F A;  4J6X A;  4QVD A;  3UPU A;  2JM8 A;  5CIU A;  4FSS A;  1YN8 A;  3G7Z A;  2MIO A;  2CSI A;  3CCU T;  3JCM d;  5GAM d;  2JS0 A;  1RAB B;  4FW1 A;  2DL8 A;  2YSQ A;  3G6E Q;  3CMA Q;  3CXC A;  3NMZ C;  2LNH B;  2YRV A;  2RO0 A;  4B9W A;  2RQR A;  2JT4 A;  1UUE A;  2GNC A;  4PJO A;  1YCY A;  2K3B A;  2J6K A;  3SB2 A;  1FMW A;  1Q7Y U;  2F1L A;  3DKM A;  1WQW A;  5FW9 A;  1Q81 R;  3INZ A;  2YUO A;  2E5K A;  2ROL A;  4E6R A;  4L6V 5;  4J6Y A;  2I0N A;  2XG8 D;  2SEM A;  1HD3 A;  4JZ3 A;  2NUP B;  5KYW B;  4J9E A;  5D6Y A;  4A4E A;  2WAC A;  3CME A;  4AG1 C;  2JTE A;  2EJ9 A;  4M77 F;  2KYB A;  4OB1 B;  4M78 E;  1H92 A;  2KRM A;  2QQA A;  4PFZ A;  1LCK A;  4C0Z A;  2MYS A;  3QG1 A;  3MCA B;  5IHN A;  2E12 A;  2DL3 A;  2DXU A;  4JJB A;  4CI0 C;  1NJI C;  2PVG B;  1W6X A;  2EYZ A;  2WSC E;  5IXB A;  3NHN A;  3JB9 H;  5FLX E;  4JJD A;  1K1Z A;  3EG0 A;  2MMP A;  2QG9 B;  2RHX A;  4E7I A;  5GAM f;  2FO0 A;  1W1F A;  2EGA A;  1MHN A;  2J06 A;  2L3P A;  3G1J A;  3CCL T;  4M75 F;  4HCK A;  2F5K A;  3M0P A;  2OTL T;  3CCM A;  1C1A A;  1H8K A;  2LX7 A;  1K0S A;  3EG2 A;  4FSX A;  2DK3 A;  4ORZ A;  3EAE A;  2C0I A;  1IZ6 A;  4RG8 A;  4YTL A;  2RJF A;  3X25 B;  4ZTJ A;  1K9M C;  2JUF A;  2PQW A;  1VQN T;  2CUB A;  1NZ9 A;  4KUD K;  1WDX A;  5IHK A;  1JXO A;  3OYB A;  2CZ6 B;  4AFU C;  4ZGE B;  8AT1 B;  4ATO A;  3GOX A;  1FX7 A;  4CC2 A;  5FU7 C;  1SSF A;  2L3S A;  4C8Q E;  3KFV A;  2K3X A;  1M5Q 1;  2COY A;  1TXQ A;  3CEY A;  5CQY A;  4M7D F;  2EFI A;  3E9G A;  3A8H B;  1G3S A;  1CKA A;  4Y28 E;  3M53 A;  3MO8 A;  2GFU A;  2H3E B;  1OZ2 A;  3JV3 A;  5J39 A;  3CCJ T;  2W10 A;  1PWT A;  4A4K A;  4HA8 A;  2G3R A;  1S1N A;  4EPC A;  1UGQ B;  5GAM e;  1BI0 A;  3L2Q A;  3S6W A;  1UHF A;  3JB9 I;  5L23 A;  3V7C A;  4HCB A;  3LYI A;  3OYM A;  4A63 B;  3GNF B;  3CCL Q;  2KT8 A;  3UF4 A;  3RBB B;  1EZZ B;  1BIB A;  1G8X A;  3PTA A;  1H3H A;  2AKL A;  3A98 A;  3CCJ A;  3OMC A;  2ZPG B;  3CC4 Q;  4ELY C;  1QVF S;  1QP2 A;  3CCS Q;  2V1Q A;  3H41 A;  2JOY A;  4QVZ A;  2IVW A;  3KBG A;  3LW5 E;  4JS4 A;  3O5Z A;  2EGC A;  3X20 B;  3ZEH A;  1TSF A;  4M7D A;  1NYG A;  4BI4 A;  1GFD A;  2E10 A;  2JMC A;  2YXY A;  1E6G A;  1H64 1;  1SRM A;  2L0A A;  3RDV A;  2QQR A;  2WSE E;  4BB7 A;  2EGE A;  1RAH B;  4QQD A;  1KD1 R;  5LJ3 h;  4M7D C;  2DEU A;  4O5V A;  1N9S A;  2DXB A;  1X75 C;  2L8D A;  3NPF A;  2MPX C;  2OAU A;  2OAW A;  3OSS C;  1QQJ A;  1QCN A;  2DIG A;  1K73 U;  3G71 A;  2RM4 A;  2COW A;  3M0Q A;  5A0G A;  2XDD A;  2RF0 A;  2VUB A;  2CZ7 B;  1Y71 A;  1VQ4 Q;  4RTT A;  2GF7 A;  1OV3 A;  5I11 A;  3REA B;  4DBQ A;  2BTT A;  2RI5 A;  1OPL A;  1ZSZ A;  2DET A;  4CC7 A;  2DM1 A;  5GAO p;  2F69 A;  3OYY A;  1D3B B;  2OTL Q;  2VVK A;  1OX9 A;  2DVJ A;  1VQL A;  5C6S A;  4C92 G;  1VQP T;  3G71 T;  2KRS A;  3FIF A;  2YRC A;  1Z9Z A;  3CC7 Q;  4MDX A;  2QGF B;  3I55 T;  4Y92 A;  2CP6 A;  3EFO B;  3A1P A;  3UT1 A;  3QKJ A;  1ZBJ A;  2QAS A;  2Z0W A;  1NG2 A;  5KE3 A;  2FPE A;  2EYQ A;  4J8O A;  5I21 A;  1YHQ T;  3PIP A;  1YIJ T;  1RAA B;  3VS1 A;  2H8H A;  2YRD A;  1VQP A;  1Y07 A;  3SDZ A;  2OTJ A;  1M8M A;  2IG0 A;  2P0K A;  3VS0 A;  4N4H A;  4PJO C;  3MP6 A;  3CCE Q;  1K8A U;  1ZHI A;  1MMD A;  1TG0 A;  2DLP A;  1ZSZ B;  3OMG A;  1KQS A;  4FL6 A;  1YHQ Q;  2BZX A;  1SSH A;  4RTZ A;  4CRI A;  1OQK A;  4V2S A;  5HK3 A;  1VYV A;  2JNG A;  2DBK A;  2NUT B;  3PVQ A;  4LXC A;  2FYK A;  3ASK A;  2VB6 A;  2OTJ T;  1G2B A;  3U23 A;  5D6W A;  4C0D C;  2C0T A;  1UEC A;  4AFQ C;  3JCM g;  2RJD A;  4OMM A;  3RMS A;  1E7O A;  4AFZ C;  1YJN Q;  1P92 A;  2AK5 A;  1WJR A;  2KDS A;  3MEW A;  1IRE B;  1KD1 U;  3ZFJ A;  4MMK A;  3M0R A;  1N6A A;  2DER A;  1EFN A;  1KC8 U;  3TSW A;  3JCM f;  1GBR A;  2LMJ A;  2QQ9 A;  4AG2 C;  3AT1 B;  4M78 B;  5KH6 A;  3CCR A;  1G83 A;  3GPL A;  4C92 E;  1BCM A;  3JCM h;  7AT1 B;  4M77 G;  1Q82 C;  3CD6 Q;  1WIE A;  2VAS A;  4X1V A;  4E47 A;  4GY5 A;  2A3L A;  4PLI A;  3CCE T;  2O4X A;  1M2V A;  3GIB A;  1TH7 A;  3EG9 B;  1D0Y A;  5CO7 A;  2P4T A;  4QQ6 A;  2GBQ A;  4LDX A;  3T9N A;  3QDR B;  2LQW A;  4IUT A;  1YI2 A;  2JTM A;  3CCU Q;  4PJJ A;  4FT4 A;  2K2V A;  4TVR A;  4EIK A;  2BKD N;  3CBO A;  1NYF A;  4J83 A;  3RUX A;  2X51 A;  2LJ3 A;  3FDR A;  4E7J A;  2FZK B;  2R58 A;  5GAO n;  2EQI A;  4Z89 A;  4MZP A;  3CPW S;  1PKS A;  1WYX A;  2V8J A;  2DRM A;  3M59 A;  2CYZ B;  2HZY A;  4MML A;  1Y7X A;  1OI1 A;  2YDL A;  1VQ8 A;  3MET A;  5D6X A;  1VQO T;  2PU9 B;  1ABO A;  2KGT A;  1K76 A;  4E7Z A;  1UTI A;  1XJW B;  2EWN A;  1ZA1 B;  2DKG A;  2QK0 A;  4LUD A;  2F5T X;  3GBQ A;  1RAD B;  4F7U B;  1B7T A;  5LJ5 h;  1UGV A;  3OYN A;  4MZT A;  3BW1 A;  4LD9 K;  1AZE A;  1VQO A;  2AIR B;  2RHU A;  3EHR A;  3EG9 A;  5HK0 A;  2R5M A;  2PUK B;  1QWE A;  1JJ2 P;  4NL3 A;  2D8H A;  4BDZ A;  5GAN 3;  2C06 A;  1UJ0 A;  2KNB B;  4AFS C;  3P8H A;  1Q7Y C;  1D0X A;  2AZV A;  1AHJ B;  3M4Y A;  1VIF A;  2X3W D;  2ZZD A;  2A08 A;  3JCM X;  2DRK A;  2RQW A;  4FYW B;  5GMK i;  2QDL A;  3NTI A;  2ZAE A;  1U06 A;  4FYX B;  2CZ1 B;  1VYT A;  4LDU A;  4Q5W A;  4PJO B;  1M3B A;  4WCI A;  2KXC A;  4JS5 A;  2M1H A;  4M75 C;  1X43 A;  2QI2 A;  3M4G A;  1H3Z A;  3OS0 A;  4ESR A;  2RJE A;  1YP5 A;  3NFC A;  5CK9 A;  4M7A A;  1FMV A;  2CP5 A;  3LWH A;  1K8A R;  1AWJ A;  1MMG A;  2QGG A;  3VYH B;  3OB9 A;  2ATC B;  2RK2 A;  4OGE A;  1N8R R;  4C92 B;  4HCZ A;  4BI8 B;  5GMK l;  1YNZ A;  3DB4 A;  5GAO l;  1JXM A;  2F2V A;  1VUB A;  4C8Q C;  2HL5 C;  2L5Q A;  2DXC A;  1G5V A;  5IHI A;  3RIR A;  1JB0 E;  5LL6 S;  2M9U A;  4BE0 A;  2K2M A;  1NPP A;  3P8D A;  5GAN h;  2A36 A;  4IIO A;  4OMN A;  4ANJ A;  2KXD A;  4F04 B;  1M90 R;  1QWF A;  4LD6 A;  4M75 A;  3EGD B;  4FM4 B;  5GMK j;  4C92 F;  4E7S A;  3UWN A;  3M0U A;  1Y96 B;  2HQH A;  1WX6 A;  1TOV A;  3V8J A;  1VQN Q;  4M78 F;  2SRC A;  3MJX A;  5KYY A;  3X28 B;  3FJP A;  4PNO A;  1M2O A;  4IUU A;  4RTU A;  1PG5 B;  4FYV B;  4XU1 A;  2CP7 A;  2KR3 A;  3OYE A;  1MUZ A;  4BY6 C;  3QZ5 B;  1KHC A;  2E5Q A;  1XOV A;  3CQT A;  1S72 T;  3H9N A;  3QJ6 A;  4OP0 A;  1ZA2 B;  4M7A B;  1S72 A;  2P0P A;  1QCF A;  2HBW A;  2X35 A;  3I5R A;  5CVI A;  3CBP A;  2XK0 A;  3OS2 A;  4C92 A;  4F17 A;  3OYK A;  3FRN A;  4DBH A;  4A53 A;  5CQX A;  1BI1 A;  2EW3 A;  2FRY A;  1KQS S;  2J6F A;  2X4X A;  3SWN B;  2QTX A;  3CC4 T;  4N0A A;  3CCM Q;  3OW2 P;  1XNI A;  5DY9 A;  2KE9 A;  2RJC A;  4XTY A;  4Y91 A;  4M7A E;  1I5O B;  4C8Q B;  1QKW A;  3QHS A;  1VQ7 A;  2RI2 A;  3ZBD A;  1AVZ C;  2DJQ A;  4C8Q D;  3EGX B;  4XU0 A;  2DIQ A;  3ME9 A;  1XTD A;  2V8K A;  1KFZ A;  2PNI A;  4QKU A;  3CC2 A;  2CZ0 B;  2VXE A;  1KK7 A;  4KUL A;  3CCV T;  4AT1 B;  2QA4 A;  1VQK Q;  4JUV A;  2DE0 X;  1VQM T;  2RN8 A;  1YIJ Q;  1QMC A;  2E3I A;  2QYZ A;  5GAM h;  2B8A A;  1ARK A;  1YJW A;  3M5A A;  4Z02 A;  1RAC B;  2DTO A;  5EC7 A;  3BE3 A;  1ZQ1 A;  4MDW A;  2RQU A;  3EGD A;  3EG1 A;  3CC7 T;  2JXB A;  2LQK A;  2HQX A;  5DLO A;  1O9S A;  1VQ9 A;  3QSU A;  2ENM A;  4UC4 A;  3CCL A;  1DJ7 B;  4J6W A;  2LC4 A;  2NUZ A;  3VS7 A;  1WPY A;  1YIT Q;  2EYY A;  3OQ5 A;  1T3S A;  2RNA A;  5GAN e;  1I0C A;  2LCC A;  1BK2 A;  3CCS A;  5GAM g;  3JCM W;  3BFM A;  3TSZ A;  1AWX A;  1D0Z A;  1GCQ A;  2HD0 A;  2NUP A;  4XU3 A;  4RMO A;  4F14 A;  4JZ4 A;  3S3M A;  2RHY A;  3JCM P;  2RI3 A;  2QQS A;  2GGR A;  3QWX X;  2E64 A;  4FCY A;  1D1A A;  3EH2 A;  4DBF A;  2KVQ G;  2O88 A;  4B9X A;  5J26 A;  2ZGW A;  3RKW A;  4BAC A;  1PSF A;  3PT9 A;  3E19 A;  3QJY A;  4GLM A;  2FZG B;  3QO3 A;  4ZN3 A;  5LJ5 j;  2DL5 A;  1U1T A;  2Y4X A;  3A8M B;  1Q7Y R;  4M7D D;  3A8G B;  1X69 A;  4Z8A A;  1JU5 C;  1IXD A;  1RAE B;  5KCO A;  2OX7 A;  2EQM A;  3OYC A;  1JBM A;  2R5A A;  3PIO A;  1B34 B;  2EBP A;  2A0F B;  1TUG B;  1X01 A;  2ROT A;  2ESW A;  2RD1 A;  1TUD A;  4DBR A;  4RTV A;  1IB8 A;  2X3X D;  2Y90 A;  3EFR A;  5FWC A;  1E6H A;  2HKQ B;  2RMO A;  3R6O A;  2FZC B;  2RK1 A;  2YUN A;  2GFA A;  5HY6 A;  5CAI A;  4M75 G;  1RAI B;  1WXU A;  4PLL A;  4F7U G;  3GF5 A;  4OB3 B;  4PK4 A;  3DB3 A;  3C94 A;  4LUE A;  2O31 A;  1W70 A;  2QEX Q;  1QVF P;  4IIM A;  1WJQ A;  4EMG A;  4C5G A;  5C0M A;  3N5B B;  2XU8 A;  3OYJ A;  2OJ2 A;  2RH2 A;  1K9A A;  1LNX A;  3NTK A;  1BB9 A;  3VV0 A;  1I81 A;  1I4K 1;  2L89 A;  2VYT A;  1NPR A;  4BI3 A;  3S3O A;  5LJ3 g;  3HKS A;  3CCV A;  3M56 A;  1YHQ A;  4C8Q F;  3RNJ A;  1GRI A;  5D7U A;  4PKC C;  4A4G A;  1M1K C;  4LDY A;  1OU9 A;  3G4S A;  1YJ9 A;  3MEV A;  4PFO A;  1YJW T;  2E65 A;  3DLM A;  3UA7 A;  1M8V A;  2O9V A;  1X6O A;  2EPD A;  5GMK e;  2MOX A;  3OYH A;  1OOT A;  2K79 A;  1VQM Q;  3G6E T;  3CMA T;  4BDY A;  3GP8 A;  1GL5 A;  3E1S A;  4J9F A;  2JVV A;  1U3O A;  1N27 A;  1WNL A;  5I2M A;  2DVE A;  4M77 B;  5LJ5 d;  3ULR B;  1A0N B;  3I55 A;  3C12 A;  4FU6 A;  2EKO A;  1J3T A;  1ZSZ C;  4XK8 E;  4JPB W;  1QKX A;  2K7A A;  1JO8 A;  1TUC A;  4KGX B;  3LGL A;  3V7R A;  1MV0 B;  1W2B A;  1U1S A;  4KT0 E;  4II1 A;  1PD0 A;  2O4X B;  1QVP A;  1ZUK A;  2P0Q A;  4M78 G;  4X9D A;  5CKF A;  1MMN A;  4C0D B;  5GAN 7;  1YBY A;  5IT9 E;  2J6O A;  1MGQ A;  1AT1 B;  1YFN A;  1FXX A;  3P8B B;  2FG0 A;  5FRO A;  3ZL7 C;  5LJ3 d;  1SHF A;  2DL7 A;  1CKB A;  1W2B P;  3OYA A;  4QW2 A;  2GQV A;  4WTO B;  3A8O B;  4XQ3 A;  2QQB A;  1FMK A;  4B6M A;  3QUI A;  3QZ9 B;  3IQL A;  1NE8 A;  5KYX A;  1Q82 U;  1VQ6 Q;  3H8Z A;  2Y4Y A;  1BBZ A;  2XMF A;  1NM7 A;  1AZG B;  2CGH A;  2MF2 A;  4OVA A;  1X2K A;  1SG5 A;  2H3J A;  1VYU A;  2LX9 A;  1B3Q A;  2CRE A;  4XTW A;  3GLX A;  4J9D A;  1WHK A;  1OUL A;  2CP3 A;  2XID A;  4HT8 A;  1EIF A;  1AWO A;  4IUQ A;  1SRL A;  2AT1 B;  4M7D E;  4WF2 A;  1UE9 A;  4PJO F;  2DFU A;  2DX1 A;  5A0D A;  4E7L A;  1AD5 A;  2O9S A;  2VV5 A;  2CKK A;  4DOV A;  5GAN 8;  3SD4 A;  5GAN g;  5LJ3 e;  2FB7 A;  3L2V A;  2HQE A;  5IH2 A;  1NBE B;  3JB9 F;  3DLL A;  2EAY A;  4PL6 A;  3FJ5 A;  4PJL A;  4KUI A;  4Z88 A;  2RQV A;  2EYW A;  1N9R A;  3O8V A;  3OBW A;  2VC8 A;  4ZN1 A;  1FWZ A;  1YI2 T;  2JJ9 A;  4OB0 B;  2DL4 A;  2DPP B;  1R8O B;  3OYG A;  4RUG A;  5GAN 4;  4HT9 A;  2GCX A;  3G6E A;  2CDT A;  3E9F A;  5EG2 A;  3JRZ A;  3CMA A;  3HFN A;  4C0G A;  4M77 C;  2DNU A;  3L2U A;  1YIT T;  1NEB A;  3CXC S;  2DTH A;  3J81 E;  2HAX A;  4N4I A;  1KHI A;  1V1C A;  5KCH A;  2PUO B;  4XTV A;  1M3A A;  1K8A C;  4N0A C;  2DAQ A;  2K5F A;  3WXM B;  3HRU A;  4VUB A;  5FU7 B;  4XU2 A;  2JW4 A;  3C4S A;  1ABQ A;  3VS6 A;  4F7U E;  1RI9 A;  4KGV B;  1C6V X;  4C8Q A;  4DEX A;  3CME Q;  2LT1 A;  5HCK A;  2O2O A;  4ELZ C;  2DZC A;  4XTZ A;  1XQH A;  3AHU A;  4K11 A;  4OMP A;  2J05 A;  4PJO E;  3A5Z B;  1Y57 A;  1UGP B;  1KC8 R;  2L3Q A;  3FEO A;  5FU6 C;  4C92 D;  1QVG S;  1O75 A;  4GBQ A;  2YHT A;  3OSV A;  1RAG B;  4X9C A;  1WHG A;  3VS4 A;  1G3T A;  2WSF E;  3ER0 A;  3Q1J A;  3TU4 K;  1KC8 C;  2BIV A;  3C0C A;  4RTX A;  3WVD B;  4M7A G;  1UG1 A;  2LCS A;  3H6Z A;  2RB6 A;  5FWB A;  3VS2 A;  1WFW A;  2DBM A;  3HHT B;  5GAN f;  1IGQ A;  3GNG A;  3V7S A;  8ATC B;  3CCQ T;  2F2W A;  2FEI A;  4JLI A;  3TVT A;  1HSQ A;  3BDL A;  4F7U A;  1PHT A;  2DD5 A;  2ZPF B;  4DQ2 A;  2XI9 A;  1GXI E;  2GTO A;  1VQ4 A;  2DA9 A;  3L42 A;  3THK A;  4IUP A;  2A37 A;  5KYU B;  2FHD A;  1KJW A;  2K6D A;  4FT2 A;  2ABL A;  2KY9 A;  1VQL Q;  2GQI A;  1X6B A;  3VS5 A;  1OEB A;  1U8R A;  1LVK A;  1TTH B;  5KYU A;  3C95 A;  1G3Y A;  1M1G A;  1UDL A;  2E1H A;  2DYB A;  4C5I A;  1R0B G;  3CCQ Q;  3TRE A;  2KK4 A;  4N4G A;  1NEG A;  4BE1 A;  1WZO A;  3D7S B;  2NUT A;  2RHI A;  1SHG A;  4X34 A;  3FC3 A;  2DD4 A;  5CKH A;  3SFM A;  4XTU A;  1GFC A;  1JJ2 A;  2OTJ Q;  1NLP C;  2D0Q B;  2VWF A;  5GMK m;  3CCJ Q;  1M90 C;  2DTI A;  4JRI A;  1BI3 A;  4J9H A;  3CC4 A;  3HTR A;  4CC4 B;  1KG1 A;  1K9M R;  1BI2 A;  2DEQ A;  1AOJ A;  4FIB A;  2K57 A;  5GAN d;  1WA7 A;  5IAY A;  1ZSG A;  4M78 C;  1VQ7 T;  1D09 B;  3CC2 Q;  1VQK T;  1Q95 G;  3M54 A;  1JQQ A;  1VQK A;  2QA4 Q;  2C0O A;  4FW2 A;  1YWP A;  3VS3 A;  3VKI A;  1OZ3 A;  3CD6 T;  5CCA A;  1VQ6 T;  2EIF A;  1PKT A;  2K5L A;  4XTX A;  1BKB A;  1K73 C;  4EMH A;  3VUZ A;  1QCO A;  2KEA A;  1LPL A;  3I56 A;  5I22 A;  3L2W A;  5IN1 A;  3JB9 G;  3SWN A;  4KH1 B;  2A7Y A;  3OS1 A;  1QP3 A;  3PVL A;  2P4R A;  3EFO A;  1WXT A;  1N8R U;  2LQN A;  3G71 Q;  2HSE B;  3CC2 T;  2KRN A;  1WGS A;  2BE9 B;  3OW2 A;  2CT4 A;  4LDW A;  3J7A F;  1M30 A;  2JZ2 A;  4QQG A;  3JB9 J;  5GAM j;  3CPW A;  1D3B A;  2COZ A;  4C0F A;  1HYO A;  1PRM C;  2EKH A;  2LRQ A;  5LJ5 f;  1WI7 A;  1VIE A;  2OTL A;  2R57 A;  1ZLM A;  2E6Z A;  1K9M U;  4M4Z A;  3HRT A;  3TEE A;  4J9B A;  3CC7 A;  4L59 A;  5FU6 B;  1D1B A;  1WHH A;  1C0M A;  4E2F B;  4PJN A;  1IO6 A;  1X27 A;  2PTK A;  1VQ4 T;  2JM9 A;  2M0Y A;  3CCU A;  2HNI A;  2YLC A;  4M75 E;  3PMI A;  4ZTF A;  4ME7 A;  3I5S A;  3MHX A;  3PNW C;  2NWM A;  1Q82 R;  2KT1 A;  4NOY A;  1LJO A;  4A54 A;  1SEM A;  2JN0 A;  4EMK A;  2ECZ A;  3SWN C;  4RTW A;  2VGN A;  1YJN T;  1Y0M A;  3HRS A;  3JCM e;  2QXF A;  2LDM A;  2ZPB B;  2I2L A;  5GAO r;  2X4Y A;  3QPH A;  1VQ5 A;  2FPF A;  1ZUU A;  5GAO m;  3UA6 A;  4M7A C;  3KXT A;  1M3C A;  4MZM A;  2L3R A;  1PM3 A;  4D6W A;  1WXB A;  1YJN A;  3JCM b;  4ZGJ B;  1V29 B;  2QEX T;  4J7F A;  1VA7 A;  3MEA A;  4C5E A;  4BY6 B;  2QEX A;  2P84 A;  2HSP A;  2RA2 A;  1U5S A;  2LTO A;  4IUR A;  3RMQ A;  3CPW P;  2FRW A;  2KAF A;  2ZPH B;  1GCQ C;  1EX4 A;  3UDC A;  3CBM A;  5GJW B;  1GBQ A;  3CCR Q;  4DA4 A;  2DXT A;  3L2Z A;  2V8I A;  2E6N A;  2KI7 A;  4J9G A;  3OYF A;  3CD6 A;  3HFO A;  4PJM A;  3LWI A;  3PGG A;  1UB4 A;  3QII A;  2KQW A;  3LX7 A;  1UGS B;  5J3B A;  2XHC A;  9ATC B;  4A4F A;  1JJ2 S;  4OB2 B;  1RI0 A;  4RKU E;  3L1A A;  5CR2 A;  3S3N A;  1YWO A;  3BY7 A;  3EG3 A;  3PMT A;  1R0C B;  1GCP A;  3J80 E;  4XAX B;  2JS2 A;  2LQ8 A;  3LH0 A;  5LJ5 e;  3NTH A;  3OS5 A;  3OA6 A;  2EQU A;  1VQ9 T;  4A4H A;  1I07 A;  3I55 Q;  3TCJ A;  3OY9 A;  2A28 A;  1RL2 A;  1PSE A;  1CSK A;  2QA4 T;  1M1K R;  1QVG A;  4J9I A;  4J7I A;  4O6J A;  3H0I A;  1Q86 C;  1M9S A;  1G3W A;  3V8K A;  1BYM A;  4M77 D;  2RQT A;  1KQ2 A;  1K4U S;  2X9H A;  1NJI R;  4HVU A;  5KYN A;  4JRP A;  2FVU A;  3L2R A;  4IKF A;  2BZY A;  5LJ5 g;  2M02 A;  3CXC P;  1MND A;  1AWW A;  2XD0 A;  1VQL T;  5LJ3 f;  2HEQ A;  3I9Q A;  4OMQ A;  3M55 A;  1Q86 U;  5KYW A;  3X26 B;  2PVO B;  5L8R E;  5FRN A;  1ZX6 A;  3HSB A;  2KMT A;  1BIA A;  1VQN A;  2EYX A;  2RPN A;  3JAM E;  5ECA A;  3EFS A;  3A8L B;  1VQO Q;  2DYI A;  2E41 A;  4OMO A;  4C5H A;  4D8K A;  2G6F X;  3MKD A;  4KBM B;  5A0L A;  1HXD A;  2CH4 A;  2KSS A;  3OYI A;  2KRO A;  3RKX A;  1VQ5 T;  2EVR A;  2NYS A;  3JSC A;  1KQ1 A;  2ZPE B;  3MPU B;  2YUP A;  1X2Q A;  2EQK A;  3VRY A;  5DM7 R;  4C92 C;  2HCK A;  1T0J A;  4HVW A;  1S72 Q;  1B07 A;  2MK5 A;  1RAF B;  5GAN 5;  1OYX A;  1PD1 A;  1V76 A;  1UEB A;  4ZGD B;  1WJS A;  2AKK A;  1HJD A;  3RKY A;  4RTY A;  2CP0 A;  1I1J A;  1F1B B;  3QYH B;  4F7U F;  2IPO B;  2LVM A;  5GJV B;  2B86 A;  1B34 A;  2YWW A;  4IUV A;  1T0H A;  3I35 A;  2K5I A;  1WHM A;  2CS7 A;  1TU0 B;  1ZBX A;  4AMC A;  5HKC A;  1VQ7 Q;  1HK9 A;  4NL2 A;  2LP5 A;  4M77 A;  3G4S T;  1YJ9 T;  3CCR T;  2FL7 A;  3REB B;  4E7H A;  3PE0 A;  3JB9 D;  1LOJ A;  4OF1 A;  3QBY A;  1KQS P;  1WHL A;  2HKN A;  2M16 A;  4EDU A;  1YIJ A;  1UJY A;  2D8J A;  2NLU A;  2OI3 A;  4RCC A;  2EQJ A;  3OW2 S;  2XDP A;  1T3L A;  2W0Z A;  2VXF A;  1MNE A;  4GLK A;  1NLO C;  3MP8 A;  1Q86 R;  1OU8 A;  4EMK C;  1VQ8 T;  2ZCF B;  4BD3 A;  1VQ9 Q;  2V1R A;  2VKN A;  1OX8 A;  1QLY A;  4D8D A;  5IXF A;  3KUF A;  1YIT A;  3V8L A;  1M27 C;  3EGU A;  2E3H A;  4HKE A;  2DF6 A;  1JEG A;  4E7K A;  2V26 A;  1ACM B;  4F16 A;  2YT6 A;  2ED0 A;  1UFF A;  3E2U A;  2D1X A;  1JRI A;  4KGZ B;  2HDA A;  3SEM A;  4J9C A;  2M51 A;  3HP9 A;  1SF9 A;  4QT7 A;  1M2V B;  4CC3 A;  2ZPI B;  2DMO A;  1AEY A;  3OBY A;  2LJ1 A;  5KE2 A;  1KIK A;  3M0S A;  1Y96 A;  1M90 U;  3PFS A;  3EH1 A;  2AZS A;  3HL8 A;  4PJO D;  1VQP Q;  2XDB A;  2J7I A;  4KH0 B;  1M1F A;  2MAM A;  4PFP A;  4M78 A;  1MV3 A;  1KD1 C;  2XKO C;  5AT1 B;  2HBP A;  3CCE A;  3VUB A;  1QVG P;  1BU1 A;  1WLP B;  1OPK A;  1W2B S;  2PZ1 A;  4HVV A;  4J5Y A;  3JCM c;  2MWP A;  4P5N A;  3LLR A;  1K73 R;  2D9T A;  5GAN 2;  2CUD A;  2YUQ A;  4PJO G;  2CH4 W;  3OYL A;  1ZUY A;  4R56 A;  1VOM A;  3EGX A;  1YJW Q;  5CKD A;  1BCO A;  4JLG A;  2X4J A;  4LN2 A;  5DLQ E;  1Z9Q A;  3CCQ A;  5FRM A;  2JTF A;  2DZ9 A;  1Q81 U;  2BZ8 A;  4JRQ A;  2GTJ A;  3FB9 A;  1RLP C;  2K3Y A;  2MCN A;  3TQ7 P;  4JRK A;  2MWO A;  1FYN A;  3SHW A;  3H0F A;  3CPF A;  1KSW A;  3FLG A;  4R55 A;  2JMA A;  1UHC A;  4OMF B;  3CCV Q;  2K4Y A;  1X6G A;  2HL3 A;  5GAN j;  6AT1 B;  1RUW A;  5KYX B;  4FYY B;  4JJN K;  2D0N A;  1SKU B;  3JCM J;  2IIM A;  4BUG A;  5GAO q;  2BUD A;  3HPW A;  2KYM A;  3JCM V;  4OML A;  4M78 D;  4L5G A;  1IRX A;  1PCX A;  1PC0 A;  2CP2 A;  3MP1 A;  4RG2 A;  2QAZ A;  1M4Z A;  3UAT A;  1IGU A;  1K0X A;  1D1C A;  3LH5 A;  2F2X A;  5CKE A;  3I56 Q;  1I5L A;  1YI2 Q;  3M0T A;  2VGM A;  5KYY B;  2DO3 A;  1I8F A;  1TS9 A;  2EJG A;  3X24 B;  1R77 A;  4JDS A;  3M9Q A;  5I2S A;  5A2Q E;  3RES A; 
#chains in the Genus database with same CATH homology
 1EFN A;  3EHQ A;  3I5S A;  3TSW A;  2CT3 A;  2OJ2 A;  1K9A A;  2NWM A;  4KRT A;  2LMJ A;  1GBR A;  1BB9 A;  2KT1 A;  4AG2 C;  1SEM A;  2ECZ A;  1G83 A;  4RTW A;  3RNJ A;  1GRI A;  1Y0M A;  1WIE A;  4X1V A;  3UA7 A;  2K9G A;  2O9V A;  2EPD A;  2KBT A;  4LNP A;  2FPF A;  1RLQ C;  1ZUU A;  3UA6 A;  2MOX A;  3QWY A;  1OOT A;  2K79 A;  2GBQ A;  1M3C A;  4JJC A;  1WXB A;  2LQW A;  2L2P A;  1GL5 A;  1N5Z A;  3R6N A;  4J9F A;  1U3O A;  1VA7 A;  4LE9 A;  3ULR B;  1A0N B;  4EIK A;  2HSP A;  1NYF A;  1U5S A;  4HXJ A;  2FRW A;  3NGP A;  1J3T A;  1SPK A;  4R0K A;  4JPB W;  1QKX A;  1GCQ C;  2LJ3 A;  2K7A A;  5GJW B;  1GBQ A;  1JO8 A;  4DEY A;  1TUC A;  2DIL A;  1PRL C;  1PNJ A;  2EQI A;  4Z89 A;  1PKS A;  1WYX A;  4ZNX A;  2DRM A;  1MV0 B;  4J9G A;  2YDL A;  1ZUK A;  3VRZ A;  2LZ6 B;  2J6O A;  1ABO A;  2KGT A;  2ED1 A;  1K76 A;  1UTI A;  2FG0 A;  2CSQ A;  3ZL7 C;  1YWO A;  1SHF A;  2FPD A;  3H0H A;  2DL7 A;  3EG3 A;  1CKB A;  4LUD A;  3GBQ A;  1GCP A;  1YCS B;  2JS2 A;  1FMK A;  2LJ0 A;  1UGV A;  3IQL A;  1I07 A;  1AZE A;  2A28 A;  1CSK A;  2JM8 A;  3EHR A;  1BBZ A;  2XMF A;  1QWE A;  4J9I A;  1NM7 A;  2D8H A;  4FSS A;  1AZG B;  3H0I A;  1YN8 A;  2MIO A;  1UJ0 A;  2CSI A;  2KNB B;  2RQT A;  4AFS C;  1X2K A;  2JS0 A;  1VYU A;  1B3Q A;  2AZV A;  2CRE A;  1K4U S;  2DL8 A;  2YSQ A;  2X3W D;  4HVU A;  2A08 A;  4J9D A;  3NMZ C;  2LNH B;  2RQR A;  2DRK A;  2RQW A;  2JT4 A;  1UUE A;  2GNC A;  2K3B A;  2BZY A;  2J6K A;  2QDL A;  1U06 A;  1AWW A;  1AWO A;  1SRL A;  1VYT A;  1UE9 A;  2DX1 A;  5FW9 A;  2HEQ A;  3I9Q A;  4OMQ A;  1M3B A;  1AD5 A;  2O9S A;  4WCI A;  2KXC A;  2YUO A;  2E5K A;  1ZX6 A;  2ROL A;  1X43 A;  4E6R A;  5IH2 A;  2EYX A;  4ESR A;  1YP5 A;  2I0N A;  2RPN A;  5ECA A;  3FJ5 A;  4Z88 A;  2SEM A;  1HD3 A;  4JZ3 A;  1AWJ A;  2RQV A;  2EYW A;  4OMO A;  4J9E A;  4D8K A;  2G6F X;  4AG1 C;  2CH4 A;  2JTE A;  2KRO A;  2KYB A;  1YNZ A;  2EVR A;  1JXM A;  2F2V A;  2DL4 A;  1H92 A;  2KRM A;  5IHI A;  1LCK A;  4RUG A;  2YUP A;  1X2Q A;  5IHN A;  2DL3 A;  2K2M A;  2CDT A;  4JJB A;  2DNU A;  2A36 A;  4IIO A;  1W6X A;  4OMN A;  2EYZ A;  3VRY A;  1NEB A;  5IXB A;  2KXD A;  2HCK A;  1T0J A;  4HVW A;  1B07 A;  3NHN A;  1V1C A;  1QWF A;  4JJD A;  1K1Z A;  3EG0 A;  2FO0 A;  2AKK A;  1HJD A;  1M3A A;  4RTY A;  1W1F A;  1I1J A;  2EGA A;  2J06 A;  2L3P A;  3M0U A;  5GJV B;  4HCK A;  2B86 A;  3M0P A;  1WX6 A;  1T0H A;  2SRC A;  3I35 A;  1H8K A;  2LX7 A;  2JW4 A;  1K0S A;  3EG2 A;  1ABQ A;  4RTU A;  3VS6 A;  4ORZ A;  1RI9 A;  2C0I A;  2KR3 A;  4DEX A;  1MUZ A;  5HCK A;  2O2O A;  2CUB A;  2LP5 A;  1WDX A;  4K11 A;  4OMP A;  5IHK A;  1JXO A;  3REB B;  1XOV A;  2J05 A;  3CQT A;  4AFU C;  1Y57 A;  3PE0 A;  4CC2 A;  2L3S A;  3KFV A;  1QCF A;  2HBW A;  3I5R A;  1CKA A;  2L3Q A;  4F17 A;  1UJY A;  2D8J A;  2OI3 A;  4GBQ A;  3JV3 A;  1T3L A;  2W10 A;  3VS4 A;  2W0Z A;  3C0C A;  4RTX A;  2EW3 A;  1PWT A;  2FRY A;  2J6F A;  1NLO C;  1UG1 A;  2LCS A;  1S1N A;  5FWB A;  1UHF A;  2KE9 A;  3VS2 A;  5L23 A;  1WFW A;  2DBM A;  4A63 B;  2V1R A;  2VKN A;  1QLY A;  1QKW A;  2KT8 A;  2F2W A;  4D8D A;  3UF4 A;  3RBB B;  2FEI A;  5IXF A;  3TVT A;  1H3H A;  1HSQ A;  1AVZ C;  2DJQ A;  2AKL A;  3A98 A;  1M27 C;  1PHT A;  3EGU A;  2GTO A;  2V1Q A;  3H41 A;  2DA9 A;  3THK A;  2DF6 A;  1JEG A;  2A37 A;  1KFZ A;  2PNI A;  3O5Z A;  2EGC A;  1KJW A;  2K6D A;  2ABL A;  1NYG A;  4F16 A;  1GFD A;  2YT6 A;  2JMC A;  2GQI A;  2ED0 A;  1UFF A;  1X6B A;  3VS5 A;  1E6G A;  2DE0 X;  1SRM A;  1OEB A;  2D1X A;  2L0A A;  2RN8 A;  2HDA A;  3SEM A;  4J9C A;  2M51 A;  2EGE A;  1ARK A;  1UDL A;  4QT7 A;  2DYB A;  5EC7 A;  4CC3 A;  2DMO A;  1AEY A;  2RQU A;  1NEG A;  3NPF A;  2LJ1 A;  3EG1 A;  2OAW A;  3M0S A;  1SHG A;  2JXB A;  2AZS A;  1GFC A;  2J7I A;  2ENM A;  1NLP C;  2NUZ A;  3VS7 A;  2VWF A;  3M0Q A;  1MV3 A;  2EYY A;  1T3S A;  2RNA A;  4J9H A;  1I0C A;  2RF0 A;  1BU1 A;  4CC4 B;  1BK2 A;  1WLP B;  1OPK A;  4RTT A;  2PZ1 A;  1OV3 A;  5I11 A;  3REA B;  2BTT A;  1OPL A;  4HVV A;  1AOJ A;  1AWX A;  3TSZ A;  4CC7 A;  1GCQ A;  2DM1 A;  4F14 A;  1WA7 A;  4JZ4 A;  1ZSG A;  2VVK A;  2GGR A;  2DVJ A;  3QWX X;  1JQQ A;  2CUD A;  2KRS A;  2YUQ A;  2CH4 W;  2O88 A;  2C0O A;  1ZUY A;  1YWP A;  3VS3 A;  1Z9Z A;  4Y92 A;  4GLM A;  4LN2 A;  1PKT A;  1Z9Q A;  2DL5 A;  2BZ8 A;  1ZBJ A;  2KEA A;  1NG2 A;  2GTJ A;  5I22 A;  2FPE A;  3VS1 A;  1RLP C;  2H8H A;  2MCN A;  1X69 A;  3PVL A;  4Z8A A;  2P4R A;  1FYN A;  3SHW A;  1WXT A;  1JU5 C;  2LQN A;  3H0F A;  1KSW A;  1M8M A;  3VS0 A;  2JMA A;  1UHC A;  2KRN A;  2DLP A;  1TG0 A;  2EBP A;  2CT4 A;  2ROT A;  1X6G A;  1M30 A;  2ESW A;  2BZX A;  1SSH A;  4RTZ A;  1TUD A;  1RUW A;  1VYV A;  1PRM C;  2EKH A;  1WI7 A;  2DBK A;  4RTV A;  1ZLM A;  2D0N A;  2X3X D;  3PVQ A;  2IIM A;  4M4Z A;  2KYM A;  5FWC A;  1G2B A;  3U23 A;  4OML A;  1E6H A;  2C0T A;  4J9B A;  2RMO A;  1UEC A;  4AFQ C;  2YUN A;  4OMM A;  1E7O A;  3UAT A;  1WXU A;  4AFZ C;  1K0X A;  2AK5 A;  3LH5 A;  2F2X A;  1IO6 A;  1X27 A;  2PTK A;  3M0T A;  2JM9 A;  2M0Y A;  3M0R A;  4LUE A;  2O31 A;  1W70 A;  4IIM A;  1KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...