4HXJA

Crystal structure of sh3:rgt complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural framework of c-Src activation by integrin beta 3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hxjA00
4CC3A 1OEBA 2PZ1A 4J9DA 4OMNA 4Y92A 3VS5A 2DBMA 3H41A 1PWTA 1Z9ZA 1X27A 4F14A 2KGTA 1WFWA 4AG2C 2EBPA 1ZLMA 4AFZC 2O31A 3VRZA 1MUZA 1X2QA 4CC2A 4HVWA 3NHNA 2JT4A 5FWBA 2JM8A 3R6NA 4E6RA 1ZUKA 1LCKA 2AKKA 1ZBJA 2ESWA 2DRMA 3VS1A 4DEXA 4RTYA 2L3QA 1JXMA 1GRIA 3EHRA 2FPDA 2X3WD 2L3SA 2AK5A 2J7IA 5FW9A 2XMFA 1QKXA 2YUQA 5IHKA 1OPLA 3KFVA 1YCSB 2F2WA 2JM9A 1GFCA 2FEIA 1YN8A 3M0QA 2HBWA 1NEGA 1UE9A 4LE9A 4J9EA 3VS3A 2DBKA 1RLQC 2M0YA 1UGVA 2M51A 3PVLA 3QWYA 2K2MA 2RQVA 4RTZA 2NWMA 2DYBA 4RTTA 1V1CA 4JPBW 1MV3A 1K1ZA 2HSPA 3UATA 1UDLA 2FRWA 1X69A 2KYMA 3VS4A 1GCQC 2KXCA 3M0UA 2DLPA 1X43A 2DA9A 1HSQA 2C0IA 1E6HA 4AG1C 2JMCA 2O9SA 2DL7A 1NYGA 2GQIA 2KE9A 4F16A 2K9GA 4JJBA 1BB9A 1QWEA 1ZUYA 1FYNA 2ENMA 1TUCA 1CSKA 4HVVA 2JTEA 2VWFA 3CQTA 2KNBB 1NYFA 2KT8A 2K79A 2RPNA 2C0OA 1SHFA 2SRCA 3EG3A 4ESRA 2OAWA 2DJQA 1SRLA 3M0RA 1X2KA 1AWXA 1GCQA 4AFQC 2DL3A 1GL5A 4IIMA 3IQLA 3LH5A 1CKBA 4AFUC 2QDLA 1U06A 2CREA 2JXBA 2PNIA 1HJDA 1M3BA 5IXFA 1QKWA 1ABQA 2YDLA 2J6OA 1A0NB 1JXOA 1RI9A 1KJWA 2P4RA 1IO6A 1GBQA 2W10A 2C0TA 2KEAA 1UHCA 2RMOA 2OI3A 1E6GA 2LX7A 2W0ZA 4WCIA 2AKLA 5I11A 2D1XA 2ED0A 1UTIA 2A37A 1WA7A 3ZL7C 1WXTA 1N5ZA 2RQUA 2JW4A 4R0KA 4AFSC 3I5RA 2EGEA 1AOJA 2OJ2A 5L23A 4QT7A 3VS0A 2HDAA 1W70A 1XOVA 5IHIA 1AWWA 4CC4B 3ULRB 1BK2A 1BBZA 5IXBA 1VA7A 3UA6A 2RQWA 1ZSGA 1GCPA 1W6XA 2LQWA 3PVQA 3H0HA 1YWPA 2LQNA 2LMJA 2EKHA 2V1QA 1RUWA 2G6FX 2KYBA 1UFFA 1PNJA 3JV3A 1NG2A 1UJYA 2LJ3A 1FMKA 1X6GA 1YWOA 5FWCA 3NGPA 4A63B 1UJ0A 1I0CA 4IIOA 3TSWA 4D8KA 2J6KA 1K0SA 3EHQA 1WXBA 1TUDA 2IIMA 1SSHA 2VVKA 2H8HA 1ARKA 2DRKA 4J9HA 1I07A 2VKNA 5EC7A 1WIEA 1CKAA 4RTXA 2ED1A 4M4ZA 2ROLA 2EYWA 2EYXA 2KBTA 1KSWA 2O88A 1H3HA 1K9AA 1B3QA 2K3BA 2L3PA 4OMQA 1VYVA 1AWJA 2YUOA 3UF4A 3M0PA 4Z88A 5HCKA 5IHNA 1K76A 2A08A 2NUZA 1E7OA 1BU1A 2FG0A 1NLPC 2DF6A 4LUEA 3EG2A 4F17A 1B07A 2DNUA 3REAB 1OPKA 1UUEA 1PRMC 4EIKA 2LJ0A 2KRNA 2YT6A 2RQTA 3NMZC 2KT1A 1NEBA 2BZ8A 2YUNA 1S1NA 1UG1A 3PE0A 2V1RA 3EGUA 4OMOA 2CUBA 2DL5A 2DVJA 1G2BA 2KRMA 2K7AA 2MIOA 1JO8A 1U3OA 1MV0B 1TG0A 1GFDA 1M27C 2LP5A 1HD3A 4LUDA 1M8MA 1Y57A 5GJWB 1T0HA 1SHGA 2CH4A 2A28A 2YSQA 2CSQA 4RTUA 1ABOA 5ECAA 2X3XD 2EYYA 2O2OA 2DM1A 2EQIA 1NM7A 2F2VA 2RN8A 2MCNA 1H92A 1I1JA 3VRYA 1M30A 1AVZC 3O5ZA 1OOTA 3A98A 3VS2A 1H8KA 4X1VA 4OMPA 4GLMA 1UECA 2EGAA 2DMOA 2L2PA 4DEYA 1AZGB 1JQQA 3FJ5A 3TVTA 2FO0A 2K6DA 2D8HA 2F2XA 2JS2A 2GNCA 2AZVA 1G83A 1PHTA 4OMLA 1JU5C 4J9CA 3RBBB 3UA7A 1VYTA 4FSSA 1T0JA 2B86A 1AD5A 2RF0A 2DL4A 1SRMA 1K4US 4D8DA 1YP5A 4HVUA 5I22A 3GBQA 2DE0X 4K11A 1QLYA 4KRTA 1KFZA 1WDXA 3VS6A 1NLOC 1WX6A 3M0TA 3REBB 1W1FA 1AWOA 3H0FA 3NPFA 1EFNA 1T3SA 1WI7A 1K0XA 1M3AA 1M3CA 2KROA 3EG1A 2KR3A 1RLPC 2HCKA 2AZSA 2LNHB 4CC7A 1U5SA 1SPKA 2GBQA 2CDTA 4ZNXA 2J05A 2EW3A 2FPFA 2L0AA 3SEMA 2ECZA 4JZ3A 4Z89A 2BTTA 1Y0MA 3I35A 4J9FA 1YNZA 2HEQA 2YUPA 1AZEA 3EG0A 4LN2A 2D8JA 5IH2A 5GJVB 1QCFA 3TSZA 2EVRA 1WXUA 2GTJA 3M0SA 2ABLA 4HXJA 4JJCA 2MOXA 4JZ4A 3THKA 2PTKA 4OMMA 2D0NA 2GGRA 1PKTA 1ZX6A 2E5KA 1QWFA 2LCSA 2KXDA 2BZXA 2ROTA 1GBRA 2LJ1A 2EPDA 3VS7A 3I5SA 1OV3A 4Z8AA 1AEYA 1JEGA 2CT4A 3QWXX 2J06A 3SHWA 2SEMA 1J3TA 1WLPB 2BZYA 1Z9QA 4J9GA 2FPEA 2LZ6B 4RTVA 2J6FA 1VYUA 2GTOA 3RNJA 4GBQA 2I0NA 4JJDA 1X6BA 2CH4W 4LNPA 2EGCA 4ORZA 1PRLC 1WYXA 2DILA 1T3LA 2DL8A 3U23A 2JS0A 2DX1A 1UHFA 1PKSA 1SEMA 4RUGA 3H0IA 2CSIA 1KIKA 2O9VA 1ZUUA 4J9IA 2KRSA 2JMAA 3C0CA 4J9BA 4HCKA 3I9QA 2FRYA 2A36A 2EYZA 4RTWA 2RQRA 2CUDA 2RNAA 2CT3A
chains in the Genus database with same CATH superfamily
3DLMA 3OS5A 2XD0A 3QBYA 1PCXA 1V29B 3VS5A 3OW2P 1PWTA 3L2ZA 1WJSA 2VASA 3CC4Q 3QUIA 1X2QA 4CC2A 3QDRB 5GAOn 2K4YA 5FWBA 3ER0A 3LWIA 5KCHA 4MZPA 3FC3A 3R6NA 3V7RA 1LCKA 2AKKA 1PD0A 4RCCA 1YJNT 3H8ZA 2L3SA 2E10A 3CPFA 4JS5A 5FW9A 3UT1A 5GAOr 4M77C 3KFVA 2JM9A 3M53A 5J3BA 3JCMQ 4FYXB 3MKDA 2DBKA 2XK0A 2EYQA 3OYIA 2M51A 3OYMA 5GANd 1K9MR 4RTZA 2NWMA 3H9NA 1BIAA 1V1CA 4JPBW 4LD9K 1RACB 4M75F 1K1ZA 4X34A 3UATA 3QSUA 1Y7XA 2KYMA 1NBEB 2KVQG 3RKWA 3RIRA 1GCQC 2KXCA 3X28B 1VQKT 1RAGB 5D6WA 2RD1A 3C12A 4M77D 1ZA1B 3LLRA 2DA9A 2YRCA 5CAIA 3TQ7P 4MZTA 2DFUA 2O9SA 1VQ6T 4B9WA 5GAOl 1M2OA 3OS1A 4JJBA 3PFSA 2LT4A 3MP1A 2XI9A 5FU7C 3OBYA 5LL6S 2JTEA 3S6WA 1U1TA 2VWFA 1W2BA 3L1AA 3L2VA 4OGEA 1YCYA 1NYFA 4M77B 3L42A 1FMWA 5A2QE 4M7DA 4KGVB 1GCQA 1VQMA 1RAFB 4AFQC 2DL3A 1GL5A 1QP3A 1X01A 4IIMA 3A8LB 1ZQ1A 2JUFA 2YRVA 3M58A 1U06A 2HQEA 3QJ6A 4ZN3A 4KULA 3UWNA 3FDRA 2RHIA 4XTWA 2CP2A 2RHYA 2JZ2A 4KT0E 2YRDA 3CCUT 5IT9E 2J6OA 2RK1A 2C06A 2LQKA 4BI3A 1QVGA 5LJ5f 1ZSZB 2F69A 4EMHA 5CKDA 2E65A 1UHCA 1RI0A 4MDWA 2LX7A 2W0ZA 3KBGA 9ATCB 4JDSA 1B34A 2RJFA 1UTIA 2WACA 2ZPBB 1N5ZA 2RQUA 4R0KA 3MO8A 3LH0A 4V2SA 2RI5A 4IUPA 1TU0B 1DJ7B 4BDYA 5KYYA 1BK2A 2K2VA 2DTHA 4FIBA 3SB2A 1D1BA 2FVUA 1BBZA 2EQKA 2RQWA 4E47A 2QA4Q 1GCPA 2LQWA 2QQSA 2JJ9A 1LOJA 4NOYA 2LMJA 4DBFA 2FZGB 4QW2A 3META 3MHXA 1PSEA 3OA6A 1NG2A 1WHJA 2OTLA 1D3BA 1RAHB 3CBOA 2KMTA 3GF5A 2CZ0B 3OYYA 3CCQA 4IIOA 4M75D 2NUTB 3BFMA 1QVGS 1UB4A 1G5VA 2E6NA 2DRKA 4KH0B 5EC7A 1WIEA 2ED1A 4M4ZA 2EYWA 1KSWA 1ZHIA 2HQXA 5CQXA 2O88A 1D3BB 1VQ4Q 4KGXB 3C95A 1NJIU 4QVDA 3JCMb 5GAOq 5GANg 4XAXB 3QXEB 4XTZA 3SWNA 2LDMA 2R58A 2FG0A 3WXMB 3CC2A 3EG2A 3GIBA 2K3XA 3CMAQ 3H6ZA 1UUEA 1VQ7Q 3NMZC 1KHCA 2BKDN 3PIPA 1KD1C 3CCMT 1VQ8T 4LDVA 2X4WA 3EGUA 3CCJQ 4X9CA 2CUBA 3M57A 2DL5A 2DVJA 1R77A 3M55A 3CCLT 2RM4A 1GFDA 1VQNQ 1M27C 1Q7YC 2E41A 1G8XA 2EJ9A 1M8MA 1Y57A 4JLGA 5GJWB 3TU4K 2A28A 1R8OB 2M16A 4AT1B 1M90C 5KYNA 4ELYC 4EPCA 5CQYA 1YI2A 2DM1A 2EQIA 1S72T 2RN8A 2MCNA 3BDLA 3JCMX 3VRYA 4N4HA 1M30A 3O5ZA 1OOTA 3A98A 4M7DG 2VGMA 4OMPA 3CMEQ 1UECA 3HKSA 3M59A 3CCRA 4PJOA 1IZ6A 1AZGB 1JQQA 2XG8D 1NE8A 2QI2A 2D8HA 2F2XA 3C4SA 2PVGB 4C0ZA 1VQKA 3VYGA 4XTUA 4L6V5 2HAXA 1T0JA 3CXCP 2DTIA 5GANh 2X4JA 2MMPA 4PJOC 4MMLA 1FXXA 1BCMA 5DY9A 1KHIA 3SDZA 2LCCA 1JRIA 4D8DA 3OY9A 1YIJA 5I22A 3GBQA 2EKOA 1Q82U 3VS6A 1NLOC 1WX6A 1W1FA 2P0KA 2L89A 1AWOA 3NPFA 1EFNA 5CKHA 2KROA 2O4XB 4ANJA 1Y71A 3EG1A 2E1HA 2KR3A 1RLPC 3JB9J 1QW1A 4PJOE 2XDDA 5D7UA 1HK9A 2CDTA 4ZNXA 2ECZA 2NUTA 4C8QE 3I35A 4M78G 2K5FA 1AZEA 4N0AC 5IH2A 1NZ9A 4GLKA 1WXUA 2GTJA 2VYTA 2DXUA 4JJCA 2QQBA 3T9NA 3M4GA 3G7ZA 2D0NA 6AT1B 2E5KA 3CCQQ 3RR6A 1C0MA 2KXDA 1YITA 2X4XA 3CCSA 2DXCA 2XICA 1O9SA 2YXYA 3EGDB 1J3TA 4J9GA 2LQ8A 2LZ6B 3P8HA 2LC4A 1VYUA 4L5GA 2GTOA 3G71Q 4ATOA 2I0NA 1JB0E 3FIFA 2DXBA 4XU2A 1T3LA 3U23A 4EMGA 2JS0A 1TS9A 2DX1A 4LDWA 1NPRA 2HKNA 1UHFA 3CEYA 3H0IA 5C6SA 1KIKA 3JB9F 4M78C 2A3LA 2QGFB 3A1PA 2DETA 4KUIA 1VQ7T 3C0CA 4J9BA 2EIFA 2FRYA 3J7AF 2A36A 2EYZA 4RTWA 4A4KA 3JSCA 1OEBA 1IHWA 2PZ1A 2MAMA 4MZMA 1WHHA 5CKFA 1SF9A 1YBYA 3P8BB 3CXCA 4F14A 2RHXA 1YJ9T 3CC2T 1X6OA 3G4ST 2DO3A 4N4GA 3RKXA 2O31A 2LNVA 3VRZA 1VQ8Q 1MUZA 1SSFA 4M7AF 1Q7YR 3CPWP 5LJ3g 1D09B 5EG2A 2RK2A 2M0OA 1IXDA 5GAMd 4C5EA 2AIRB 4DEXA 5KYXB 1GRIA 3EHRA 4IUUA 3GPLA 5HK3A 1FWZA 2K5IA 2J7IA 3RMSA 2PU9B 1EX4A 1MNEA 2OX7A 1YCSB 2F2WA 2Y4XA 2FEIA 5GAOp 4LE9A 1NEGA 3CBPA 1YI2Q 3CC4T 3QWYA 4NL2A 2K2MA 1JJ2S 2Z0WA 4F7UB 4C5IA 5D6XA 4FW2A 1D1CA 2DYBA 1YJ9Q 4ZGDB 3CCMQ 4JS4A 4PLIA 2HSPA 1UDLA 1VQ6Q 3VYHB 1D0XA 3NTIA 2PQWA 3HP9A 2MYSA 1K73R 2CP7A 2HMAA 2MK5A 1X43A 1HSQA 5GANe 4PLLA 4J6YA 1M1GA 1MNDA 1N8RU 4KBMB 3A8OB 3CCST 4HCCA 3CCLQ 2JMCA 1MMAA 1K8AC 7AT1B 3AT1B 3HRUA 4L59A 4PJMA 2YWWA 5GAMh 4OB0B 2ENMA 2QQAA 5FRNA 1ZBXA 1CSKA 4HVVA 4C0FA 1KQ1A 4J7IA 4LDYA 3CQTA 2K79A 4OP0A 2QA4A 3OMCA 3EGDA 3M0RA 4PJOG 1XNIA 3CCLA 2CP3A 1YJNQ 3E2UA 3LH5A 4QQGA 4FM4B 2RH2A 2H3JA 2E70A 2E64A 5DLQE 1ZSZA 4ZGJB 3WVDB 1RAIB 2EQJA 2KK4A 1QKWA 5M9OA 5FLXE 2YDLA 4E7SA 1RI9A 4E7LA 1M1KR 2P4RA 4BY6C 3MP6A 2QA4T 2VV5A 2W10A 2KEAA 3OYAA 2OI3A 1E6GA 3CBMA 3F70A 3VKIA 5I11A 1VQPQ 3EFRA 2XU8A 2QEXA 3QKJA 3M54A 1WXTA 3JCMc 2JW4A 4C5HA 2EWNA 3EH1A 1BI3A 3HSBA 4PKCC 2OJ2A 2E6ZA 1IRXA 3VS0A 2HSEB 2HDAA 1W70A 1XOVA 1AWWA 3OBWA 2VB6A 1VQOA 4M77G 2D0QB 4N0AA 1VA7A 3UA6A 2D9TA 3QO3A 1VQ5Q 4BB7A 1YWPA 2LQNA 4M75E 2G6FX 5GAN6 1HXDA 1OYXA 3JV3A 2ZPGB 1UJYA 2X4YA 2LJ3A 3UPUA 1YWOA 4ZGEB 4A63B 3TEEA 2IPOB 3TSWA 4DBHA 4D8KA 4E7IA 1SKUB 1K0SA 3OW2S 2IIMA 2H8HA 2CZ6B 3RKYA 1BI0A 1C6VX 4M75G 4FSXA 4Y91A 3OB9A 2ROLA 2KI7A 3S3OA 2KBTA 3CCUQ 3I56A 3V8LA 1H3HA 1B3QA 1M90U 2K3BA 5LJ3j 4PK4A 2L3PA 4OMQA 1AWJA 3UF4A 4Z88A 4DBQA 1K76A 1VQ4A 1E7OA 3MCAB 1KC8R 2DF6A 3TREA 4F17A 1G3WA 3REAB 4J8OA 3FJPA 3VUZA 1PRMC 4EIKA 2LJ0A 1QVFP 2JN0A 1V76A 5FROA 1S1NA 3I55A 3WVEB 1UG1A 2V1RA 3I56T 4EDUA 4OMOA 3INZA 3GOXA 3DKMA 2PUKB 4NL3A 1NJIC 2JOYA 5CIUA 3G6ET 2K7AA 3D7SB 1U3OA 1MV0B 5LJ3e 2MF2A 1PC0A 4DA4A 4FCYA 2CSQA 4RTUA 2LT1A 1W2BP 3E9GA 1NM7A 2QDYB 2QGGA 2QASA 1AVZC 2RB6A 3VS2A 4GLMA 4PL6A 1OU9A 1FMVA 3OYLA 2P0QA 4DEYA 2JVVA 4FYVB 4PJOF 3TVTA 5D6YA 2K6DA 4M7DD 1PSFA 2KAFA 3JB9G 2RJCA 2AZVA 3V7CA 1G83A 1PHTA 5AYFA 4J9CA 1Q81C 2F1LA 1VYTA 4B9XA 5A0LA 2B86A 1AD5A 2RF0A 4R55A 1I8FA 3MEWA 4IURA 2EFIA 2H3EB 2R57A 4BD3A 4F04B 1YJWT 3CC4A 1K4US 4E7ZA 1QLYA 4C92F 3JCMd 4QQDA 2X9HA 1M90R 1C1AA 1T3SA 1K0XA 3CXCS 1M8VA 5KYWB 3JCMV 2HCKA 1WNLA 3S3MA 3NTHA 1HYOA 3EAEA 5LJ3h 4CC7A 1U5SA 4M77A 2XDPA 2J05A 2FPFA 4Z89A 4J9FA 2E3IA 3OYFA 2YUPA 4M75B 4LN2A 5GANf 2HL3A 3ME9A 4IUQA 5CR2A 5GJVB 3EFOB 3PGGA 4CI0C 5DLOA 3M0SA 4HXJA 4Z02A 2MOXA 4M78F 3E19A 1NPPA 1LJOA 2JTFA 4OMMA 2DZCA 4C0DB 1IHVA 2LCSA 3QPHA 2OAUA 3CMEA 1JEGA 2JNGA 3PMIA 3JCMf 2CT4A 2CKKA 4KUDK 1WLPB 3ASKA 3E9FA 2CZ1B 3HFNA 4OF1A 1VQ7A 1IGUA 4RTVA 2ATCB 4F7UG 2J6FA 1KK7A 2PVDB 1MMGA 2CYZB 5J39A 4JJDA 4A4EA 2QXFA 3G4SA 1IB8A 4LNPA 3Q1JA 5GAMf 2MI6A 3MEVA 1TXQA 4BUGA 2WSFE 2OTJQ 3HPWA 2MPXC 3OS0A 3R6OA 1SEMA 2CSIA 2MWPA 3BDUA 3OYEA 1M1KU 2O9VA 4HT9A 1ZUUA 5LJ5e 4J9IA 3ZEHA 5KE2A 2Y4YA 4M7AB 2RHZA 3LW5E 1Y96A 4J7FA 3CCEQ 2VGNA 3FRNA 2COZA 4O5VA 4XTYA 2NLUA 3EFOA 3BY7A 1H3ZA 4OMNA 2DBMA 1TTHB 1Z9ZA 1X27A 2KGTA 1WFWA 4AG2C 1WPYA 2EBPA 4AFZC 2XDBA 2ZPHB 4M78D 4HVWA 1M1KC 2JT4A 3G1JA 5I21A 4E6RA 1VQ9T 3DLLA 4C92B 2DEQA 4C92D 2CGHA 1BYMA 2XHCA 1YITQ 1TOVA 4Y28E 2FPDA 1VIFA 4PJJA 1ZA2B 4QKUA 2GFUA 4C92G 2LCLA 1QKXA 1OZ2A 3CD6Q 1YN8A 2KQWA 3M0QA 1WHGA 2M0YA 1G3TA 1Q95G 3PVLA 1IGQA 4OMFB 2RQVA 1VQLQ 1RADB 1R0CB 4D6WA 2FB7A 2OTLT 2L3RA 3KXTA 3M4YA 4E7JA 3VS4A 1LPLA 4M78B 2DLPA 2QTXA 3V8JA 4C8QB 3LGLA 3OSSC 2RO0A 4AG1C 1QP2A 1VUBA 3I55T 3CCRT 3M9QA 1B7TA 4A53A 1NYGA 2GQIA 4A4GA 2KE9A 2QEXQ 2X35A 1O75A 4F16A 5FRMA 1I5OB 1QWEA 2A7YA 3J81E 4DOWA 3I56Q 1YI2T 3A5ZB 3JCMe 4E7KA 1I4K1 2FZCB 4M7AC 2DAQA 2NYSA 2KT8A 1ACMB 3FEOA 4ESRA 1D1AA 2OAWA 1YHQT 1VOMA 1X2KA 1QCOA 2HKQB 1BCOA 2QAZA 4DQ2A 3IQLA 1UGRB 1CKBA 1QMCA 2QDLA 4JLIA 4HT8A 3OYKA 4FT4A 4XU3A 2CREA 2JXBA 2DJZA 2L8DA 2PNIA 1VQOQ 3HTRA 1HJDA 4DOVA 5IXFA 3QDFA 1XQHA 1JXOA 5FU6B 4OB2B 1PM3A 5GMKh 5KYYB 2V26A 4B6MA 2RMOA 3X20B 2CP5A 4HA8A 4WCIA 1KD1R 2AKLA 2D1XA 4QQ6A 1JBMA 4C8QD 3OSVA 5IN1A 4MDXA 4AFSC 3I5RA 2EGEA 4RG2A 4M7AG 5KH6A 4HCBA 3JCMh 1D0YA 5L23A 3TCJA 4M75C 4QT7A 5IHIA 1Q81U 3VUBA 4PFPA 3ZFJA 1B34B 4M7AD 1W6XA 2DTOA 2YHTA 2RJEA 5LJ3d 1RUWA 3O8VA 4RMOA 1VIEA 1UFFA 1PNJA 3LWHA 1PD1A 5GAN7 1YJWQ 4C92A 1WHMA 2VXEA 4J83A 3L2UA 1PG5B 1X6GA 1MMDA 5KYUA 1UJ0A 3MEAA 2J6KA 2RA2A 5FU7B 1VQPT 3L2QA 1LVKA 2ZPIB 4PNOA 3CCVA 1TUDA 2VVKA 4J9HA 2VKNA 1CKAA 4RTXA 2O01E 5I2MA 1TSFA 4PFOA 4F7UA 3RUXA 1K9AA 2M9UA 4IUTA 5IAYA 1YJWA 1Q82R 2FYKA 2FZKB 2YUOA 3M0PA 5HCKA 2E5QA 3CPWA 1KQSS 5IHNA 2A08A 2NUZA 2K3YA 1NLPC 4LUEA 1VQMQ 1YJ9A 1B07A 2AHJB 1VQNT 1OPKA 1RAAB 3MJXA 1P92A 4EMKA 4WTOB 1R0BG 2RQTA 3URGA 2ZZDA 1KD1U 2BZ8A 4BDZA 2KDSA 5CKBA 4IKFA 2HBPA 4NS5A 4M77E 5KYXA 1BI1A 4WF2A 2COWA 3CMAT 3CCVT 2QTVA 3JCMP 4PJNA 4BI8B 2LP5A 5KE3A 1HD3A 4LUDA 1QVFS 2GF7A 2CH4A 2YSQA 4RG8A 1ABOA 5ECAA 2X3XD 2O4XA 2O2OA 4F7UF 3SWNC 3G6EA 2BIVA 1XTDA 4C8QC 1H92A 1I1JA 4PFZA 1VQLA 2CP6A 2DMOA 2EQMA 3CC7Q 2L2PA 3FJ5A 1I81A 5GAN2 1F1BB 2FO0A 1I5LA 1MGQA 4M7AE 1U8RA 2JS2A 1QQJA 1UGSB 4XQ3A 4C8QA 1JU5C 1WJQA 1S72A 2V8JA 4BE0A 3RBBB 2CP0A 1WHLA 1UGPB 4FSSA 4J6WA 2E3HA 3SFMA 3X25B 4HKEA 4ZN1A 1OI1A 1FX7A 4KH1B 3HFOA 4M7DF 1WJRA 2HD0A 1AHJB 2DIGA 1SRMA 4A4HA 3PNWC 2LTOA 1YP5A 2EJFA 2DE0X 3OYNA 4BI4A 3M0TA 3CC2Q 3REBB 5GAN8 2VC8A 5GMKe 4OGCA 3X24B 5A0GA 3H0FA 3VV0A 4A54A 1M3AA 1M3CA 3EG9B 5LJ5d 2FL7A 4J6XA 3CCSQ 8ATCB 2VUBA 4M75A 1VQMT 3EFSA 2D6FA 3V8KA 1SPKA 2GBQA 1M1FA 2RI3A 2L0AA 1WQWA 2BTTA 5DM7R 2DERA 4O6JA 1VQ4T 3QIIA 3CC7T 2HZYA 4XK8E 1ZX6A 1QWFA 2WSCE 3PIOA 2BZXA 1YIJQ 4FU6A 2LJ1A 2EPDA 3VS7A 1OV3A 4ZTJA 2BUDA 1AEYA 1VQ6A 1MMNA 3CCMA 1N27A 4GY5A 3QWXX 4FYWB 2J06A 3CCEA 2SEMA 5CO7A 1BI2A 2BZYA 1Q81R 1Z9QA 3JCMW 1KC8U 4M7DB 4EMKC 4JUVA 4LXCA 1OULA 4P5NA 4GBQA 3V7SA 3PTAA 2CH4W 2M02A 2RHUA 3OYCA 5KYWA 5LJ5h 1IREB 4M7AA 1PKSA 3G4SQ 4RUGA 5L8RE 5GAMe 4RCBA 3C94A 5A0DA 3CCRQ 1M5Q1 1TH7A 1OX9A 4QVCA 3I9QA 1UEBA 1BKBA 2V8IA 2RQRA 2F5KA 2M1HA 2CUDA 1VQKQ 2RNAA 2RI2A 2CT3A 1QCFA 4CC3A 1N8RC 3EGXB 2HQHA 3HL8A 3LX7A 4J9DA 4ELZC 5C0MA 4Y92A 4BY6B 3H41A 3CC7A 1ZLMA 1K8AU 2AT1B 4IUVA 4C0GA 3KUFA 4PJOD 3NHNA 2QG9B 2JM8A 1LNXA 2NUPB 5AT1B 1ZUKA 1S72Q 4HCZA 5HKCA 3CCUA 1ZBJA 2B8AA 2ESWA 2DRMA 3N5BB 3VS1A 4RTYA 2L3QA 1JXMA 3GNFB 3QJYA 4N4IA 4LDXA 2X3WD 2AK5A 1W2BS 1YITT 3JCMJ 1YHQQ 1RL2A 5GMKj 2XMFA 2YUQA 2LVMA 5IHKA 1OPLA 3MPUB 1GFCA 3PT9A 3HRTA 2HBWA 1VQPA 1UE9A 3G71A 4J9EA 2DD4A 3VS3A 1Q86R 1YIJT 3ZBDA 1RLQC 1UGVA 1JJ2A 2P4TA 2K5LA 3CCQT 1VQ5A 3J80E 3OYHA 3A8MB 4C8QG 3CCJT 4RTTA 2RJDA 2MWOA 2ZGWA 1Q82C 1MV3A 2HL5C 2FRWA 3CMAA 1X69A 4M7DC 1AT1B 3M0UA 2DVEA 2K57A 3CCET 2C0IA 1E6HA 2YLCA 4C92E 3X26B 3UDCA 1YJNA 3AHUA 2DL7A 1D0ZA 2OTLQ 2K9GA 1BB9A 1TWBA 1ZUYA 2QK0A 1FYNA 1M9SA 4QVZA 1TUCA 3OQ5A 2DD5A 4A4FA 5GMKi 1GXIE 2KNBB 5CCAA 5GAOm 4C8QF 2RPNA 2C0OA 1KC8C 1SHFA 4C5GA 2F5TX 3HRSA 2SRCA 3EG3A 5LJ5j 2DJQA 3NTKA 1MHNA 1SRLA 3G71T 1AWXA 3VU3C 1M2VA 3RERA 2GCXA 4ZTFA 2XKOC 5I2SA 2EQUA 4AFUC 1QVPA 3QYGB 5GAMg 1M3BA 4TVRA 3DB4A 1ABQA 4BACA 1Q86U 1A0NB 1KJWA 1VQ9A 1IO6A 2GQVA 1GBQA 2IVWA 2C0TA 4M77F 5GMKm 2ED0A 2A37A 2L5QA 5CKEA 5GAN3 1WA7A 3ZL7C 1WZOA 1M4ZA 4LDUA 3FB9A 2OTJA 2DK3A 1WQ7A 2R5MA 2KSSA 1AOJA 1XJWB 4X9DA 4CC4B 3ULRB 1Q7YU 4OVAA 3A8GB 3GLXA 2DZ9A 3VJPA 5IXBA 1QVGP 2LX9A 1VQLT 1ZSGA 3PVQA 3H0HA 3MP8A 2V1QA 2EKHA 2R5AA 3RESA 3SD4A 2QEXT 2KYBA 2NUPA 5KYUB 1FMKA 3OMGA 1ZSZC 1M2VB 3DB3A 5LJ3f 4FW1A 5FWCA 3NGPA 1I0CA 1OX8A 1K73C 2QQRA 5J26A 3EGXA 3EHQA 5GAN5 1WXBA 2CZ7B 1SSHA 1ARKA 1I07A 5GAN4 4JRQA 4XTXA 4E2FB 4DBRA 1EZZB 2EYXA 2WSEE 1U1SA 1VQ8A 4M78A 1G3SA 4C0DC 3CMET 4BE1A 3QYHB 3BE3A 1VYVA 4J5YA 2DIQA 2HNIA 5LJ5g 1BU1A 4PJOB 1X75C 3QHSA 2DNUA 1EIFA 4F7UE 3SWNB 1VQ9Q 2KRNA 2YT6A 3LGFA 4XU0A 2KY9A 4JRKA 2FHDA 2KT1A 3CCVQ 1NEBA 4OB3B 2YUNA 3PE0A 3CD6A 2JTMA 3E1SA 3BW1A 3JB9I 2BE7D 4RKUE 2OTJT 1G2BA 2KRMA 1Q86C 2I2LA 1OU8A 2COYA 4AMCA 2DYIA 2MIOA 3CPWS 1KQSA 1JO8A 4OB1B 1TG0A 3JB9H 5CVIA 1SG5A 2PUOB 3A8HB 1T0HA 1SHGA 3JRZA 2DKGA 3L2WA 3OS2A 4BE2A 1RAEB 2EYYA 2E4HA 1N9SA 2F2VA 2P84A 4LD6A 3JCMg 1H8KA 1Y07A 4X1VA 2EGAA 5HK0A 3JAME 1OQKA 8AT1B 1N9RA 3OYDA 5GANj 2P0PA 3S3NA 2X51A 3OW2A 1JJ2P 5HY6A 1OZ3A 4EMKB 1YHQA 1QVFA 2DXTA 2GNCA 2IG0A 4OMLA 2GFAA 2QYZA 1N8RR 4XTVA 3UA7A 3M56A 2BE9B 4FYYB 2ZAEA 3HHTB 4M78E 4JRIA 2DL4A 3G6EQ 3RDVA 1K73U 4YTLA 2Y90A 3OYGA 1WHKA 3QG1A 5GAMj 4HVUA 4VUBA 4K11A 4C92C 4KRTA 1KFZA 3PMTA 1WDXA 1W4SA 3QZ5B 3GNGA 2QQ9A 1KG1A 4M7DE 1WI7A 2G3RA 4KGZB 2E12A 3M5AA 2AZSA 2LNHB 2DEUA 2EW3A 3CCJA 3FLGA 3SEMA 1TUGB 4JZ3A 1Y0MA 1YNZA 2HEQA 1G3YA 3EG0A 2D8JA 3TSZA 2EVRA 4UC4A 3OYBA 2ABLA 3THKA 4JZ4A 1RABB 3L2RA 4CRIA 2PTKA 2ZCFB 2GGRA 1PKTA 2LRQA 1KQ2A 1K8AR 1WGSA 2ROTA 1GBRA 3I5SA 3LYIA 4Z8AA 1VQOT 4JJNK 3QZ9B 3CD6T 1QCNA 2CS7A 4R56A 3SHWA 4MMKA 4II1A 4Q5WA 2VXFA 2FPEA 2EJGA 4FL6A 3RNJA 3RMQA 3MEUA 1VQNA 2XIDA 2EAYA 4ME7A 2PVOB 1X6BA 1Y96B 2A0FB 2DPPB 3P8DA 1K9MU 1NJIR 2EGCA 4ORZA 3JB9D 1YFNA 1PRLC 1WYXA 2DILA 2DL8A 4JRPA 1N6AA 3EG9A 1VQ5T 5CK9A 3EH2A 4XU1A 1H641 1BIBA 5GMKl 5FU6C 1KQSP 2YLBA 3OYJA 2KRSA 4PJLA 5KCOA 2JMAA 2V8KA 4E7HA 4FT2A 3NFCA 3I55Q 4HCKA 1UGQB 1K9MC 2ZPEB 2ZPFB 3GP8A
chains in the Genus database with same CATH topology
4CC3A 1OEBA 2PZ1A 4J9DA 4OMNA 4Y92A 3VS5A 2DBMA 3H41A 1PWTA 1Z9ZA 1X27A 4F14A 2KGTA 1WFWA 4AG2C 2EBPA 1ZLMA 4AFZC 2O31A 3VRZA 1MUZA 1X2QA 4CC2A 4HVWA 3NHNA 2JT4A 5FWBA 2JM8A 3R6NA 4E6RA 1ZUKA 1LCKA 2AKKA 1ZBJA 2ESWA 2DRMA 3VS1A 4DEXA 4RTYA 2L3QA 1JXMA 1GRIA 3EHRA 2FPDA 2X3WD 2L3SA 2AK5A 2J7IA 5FW9A 2XMFA 1QKXA 2YUQA 5IHKA 1OPLA 3KFVA 1YCSB 2F2WA 2JM9A 1GFCA 2FEIA 1YN8A 3M0QA 2HBWA 1NEGA 1UE9A 4LE9A 4J9EA 3VS3A 2DBKA 1RLQC 2M0YA 1UGVA 2M51A 3PVLA 3QWYA 2K2MA 2RQVA 4RTZA 2NWMA 2DYBA 4RTTA 1V1CA 4JPBW 1MV3A 1K1ZA 2HSPA 3UATA 1UDLA 2FRWA 1X69A 2KYMA 3VS4A 1GCQC 2KXCA 3M0UA 2DLPA 1X43A 2DA9A 1HSQA 2C0IA 1E6HA 4AG1C 2JMCA 2O9SA 2DL7A 1NYGA 2GQIA 2KE9A 4F16A 2K9GA 4JJBA 1BB9A 1QWEA 1ZUYA 1FYNA 2ENMA 1TUCA 1CSKA 4HVVA 2JTEA 2VWFA 3CQTA 2KNBB 1NYFA 2KT8A 2K79A 2RPNA 2C0OA 1SHFA 2SRCA 3EG3A 4ESRA 2OAWA 2DJQA 1SRLA 3M0RA 1X2KA 1AWXA 1GCQA 4AFQC 2DL3A 1GL5A 4IIMA 3IQLA 3LH5A 1CKBA 4AFUC 2QDLA 1U06A 2CREA 2JXBA 2PNIA 1HJDA 1M3BA 5IXFA 1QKWA 1ABQA 2YDLA 2J6OA 1A0NB 1JXOA 1RI9A 1KJWA 2P4RA 1IO6A 1GBQA 2W10A 2C0TA 2KEAA 1UHCA 2RMOA 2OI3A 1E6GA 2LX7A 2W0ZA 4WCIA 2AKLA 5I11A 2D1XA 2ED0A 1UTIA 2A37A 1WA7A 3ZL7C 1WXTA 1N5ZA 2RQUA 2JW4A 4R0KA 4AFSC 3I5RA 2EGEA 1AOJA 2OJ2A 5L23A 4QT7A 3VS0A 2HDAA 1W70A 1XOVA 5IHIA 1AWWA 4CC4B 3ULRB 1BK2A 1BBZA 5IXBA 1VA7A 3UA6A 2RQWA 1ZSGA 1GCPA 1W6XA 2LQWA 3PVQA 3H0HA 1YWPA 2LQNA 2LMJA 2EKHA 2V1QA 1RUWA 2G6FX 2KYBA 1UFFA 1PNJA 3JV3A 1NG2A 1UJYA 2LJ3A 1FMKA 1X6GA 1YWOA 5FWCA 3NGPA 4A63B 1UJ0A 1I0CA 4IIOA 3TSWA 4D8KA 2J6KA 1K0SA 3EHQA 1WXBA 1TUDA 2IIMA 1SSHA 2VVKA 2H8HA 1ARKA 2DRKA 4J9HA 1I07A 2VKNA 5EC7A 1WIEA 1CKAA 4RTXA 2ED1A 4M4ZA 2ROLA 2EYWA 2EYXA 2KBTA 1KSWA 2O88A 1H3HA 1K9AA 1B3QA 2K3BA 2L3PA 4OMQA 1VYVA 1AWJA 2YUOA 3UF4A 3M0PA 4Z88A 5HCKA 5IHNA 1K76A 2A08A 2NUZA 1E7OA 1BU1A 2FG0A 1NLPC 2DF6A 4LUEA 3EG2A 4F17A 1B07A 2DNUA 3REAB 1OPKA 1UUEA 1PRMC 4EIKA 2LJ0A 2KRNA 2YT6A 2RQTA 3NMZC 2KT1A 1NEBA 2BZ8A 2YUNA 1S1NA 1UG1A 3PE0A 2V1RA 3EGUA 4OMOA 2CUBA 2DL5A 2DVJA 1G2BA 2KRMA 2K7AA 2MIOA 1JO8A 1U3OA 1MV0B 1TG0A 1GFDA 1M27C 2LP5A 1HD3A 4LUDA 1M8MA 1Y57A 5GJWB 1T0HA 1SHGA 2CH4A 2A28A 2YSQA 2CSQA 4RTUA 1ABOA 5ECAA 2X3XD 2EYYA 2O2OA 2DM1A 2EQIA 1NM7A 2F2VA 2RN8A 2MCNA 1H92A 1I1JA 3VRYA 1M30A 1AVZC 3O5ZA 1OOTA 3A98A 3VS2A 1H8KA 4X1VA 4OMPA 4GLMA 1UECA 2EGAA 2DMOA 2L2PA 4DEYA 1AZGB 1JQQA 3FJ5A 3TVTA 2FO0A 2K6DA 2D8HA 2F2XA 2JS2A 2GNCA 2AZVA 1G83A 1PHTA 4OMLA 1JU5C 4J9CA 3RBBB 3UA7A 1VYTA 4FSSA 1T0JA 2B86A 1AD5A 2RF0A 2DL4A 1SRMA 1K4US 4D8DA 1YP5A 4HVUA 5I22A 3GBQA 2DE0X 4K11A 1QLYA 4KRTA 1KFZA 1WDXA 3VS6A 1NLOC 1WX6A 3M0TA 3REBB 1W1FA 1AWOA 3H0FA 3NPFA 1EFNA 1T3SA 1WI7A 1K0XA 1M3AA 1M3CA 2KROA 3EG1A 2KR3A 1RLPC 2HCKA 2AZSA 2LNHB 4CC7A 1U5SA 1SPKA 2GBQA 2CDTA 4ZNXA 2J05A 2EW3A 2FPFA 2L0AA 3SEMA 2ECZA 4JZ3A 4Z89A 2BTTA 1Y0MA 3I35A 4J9FA 1YNZA 2HEQA 2YUPA 1AZEA 3EG0A 4LN2A 2D8JA 5IH2A 5GJVB 1QCFA 3TSZA 2EVRA 1WXUA 2GTJA 3M0SA 2ABLA 4HXJA 4JJCA 2MOXA 4JZ4A 3THKA 2PTKA 4OMMA 2D0NA 2GGRA 1PKTA 1ZX6A 2E5KA 1QWFA 2LCSA 2KXDA 2BZXA 2ROTA 1GBRA 2LJ1A 2EPDA 3VS7A 3I5SA 1OV3A 4Z8AA 1AEYA 1JEGA 2CT4A 3QWXX 2J06A 3SHWA 2SEMA 1J3TA 1WLPB 2BZYA 1Z9QA 4J9GA 2FPEA 2LZ6B 4RTVA 2J6FA 1VYUA 2GTOA 3RNJA 4GBQA 2I0NA 4JJDA 1X6BA 2CH4W 4LNPA 2EGCA 4ORZA 1PRLC 1WYXA 2DILA 1T3LA 2DL8A 3U23A 2JS0A 2DX1A 1UHFA 1PKSA 1SEMA 4RUGA 3H0IA 2CSIA 1KIKA 2O9VA 1ZUUA 4J9IA 2KRSA 2JMAA 3C0CA 4J9BA 4HCKA 3I9QA 2FRYA 2A36A 2EYZA 4RTWA 2RQRA 2CUDA 2RNAA 2CT3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CC3 A;  1OEB A;  2PZ1 A;  4J9D A;  4OMN A;  4Y92 A;  3VS5 A;  2DBM A;  3H41 A;  1PWT A;  1Z9Z A;  1X27 A;  4F14 A;  2KGT A;  1WFW A;  4AG2 C;  2EBP A;  1ZLM A;  4AFZ C;  2O31 A;  3VRZ A;  1MUZ A;  1X2Q A;  4CC2 A;  4HVW A;  3NHN A;  2JT4 A;  5FWB A;  2JM8 A;  3R6N A;  4E6R A;  1ZUK A;  1LCK A;  2AKK A;  1ZBJ A;  2ESW A;  2DRM A;  3VS1 A;  4DEX A;  4RTY A;  2L3Q A;  1JXM A;  1GRI A;  3EHR A;  2FPD A;  2X3W D;  2L3S A;  2AK5 A;  2J7I A;  5FW9 A;  2XMF A;  1QKX A;  2YUQ A;  5IHK A;  1OPL A;  3KFV A;  1YCS B;  2F2W A;  2JM9 A;  1GFC A;  2FEI A;  1YN8 A;  3M0Q A;  2HBW A;  1NEG A;  1UE9 A;  4LE9 A;  4J9E A;  3VS3 A;  2DBK A;  1RLQ C;  2M0Y A;  1UGV A;  2M51 A;  3PVL A;  3QWY A;  2K2M A;  2RQV A;  4RTZ A;  2NWM A;  2DYB A;  4RTT A;  1V1C A;  4JPB W;  1MV3 A;  1K1Z A;  2HSP A;  3UAT A;  1UDL A;  2FRW A;  1X69 A;  2KYM A;  3VS4 A;  1GCQ C;  2KXC A;  3M0U A;  2DLP A;  1X43 A;  2DA9 A;  1HSQ A;  2C0I A;  1E6H A;  4AG1 C;  2JMC A;  2O9S A;  2DL7 A;  1NYG A;  2GQI A;  2KE9 A;  4F16 A;  2K9G A;  4JJB A;  1BB9 A;  1QWE A;  1ZUY A;  1FYN A;  2ENM A;  1TUC A;  1CSK A;  4HVV A;  2JTE A;  2VWF A;  3CQT A;  2KNB B;  1NYF A;  2KT8 A;  2K79 A;  2RPN A;  2C0O A;  1SHF A;  2SRC A;  3EG3 A;  4ESR A;  2OAW A;  2DJQ A;  1SRL A;  3M0R A;  1X2K A;  1AWX A;  1GCQ A;  4AFQ C;  2DL3 A;  1GL5 A;  4IIM A;  3IQL A;  3LH5 A;  1CKB A;  4AFU C;  2QDL A;  1U06 A;  2CRE A;  2JXB A;  2PNI A;  1HJD A;  1M3B A;  5IXF A;  1QKW A;  1ABQ A;  2YDL A;  2J6O A;  1A0N B;  1JXO A;  1RI9 A;  1KJW A;  2P4R A;  1IO6 A;  1GBQ A;  2W10 A;  2C0T A;  2KEA A;  1UHC A;  2RMO A;  2OI3 A;  1E6G A;  2LX7 A;  2W0Z A;  4WCI A;  2AKL A;  5I11 A;  2D1X A;  2ED0 A;  1UTI A;  2A37 A;  1WA7 A;  3ZL7 C;  1WXT A;  1N5Z A;  2RQU A;  2JW4 A;  4R0K A;  4AFS C;  3I5R A;  2EGE A;  1AOJ A;  2OJ2 A;  5L23 A;  4QT7 A;  3VS0 A;  2HDA A;  1W70 A;  1XOV A;  5IHI A;  1AWW A;  4CC4 B;  3ULR B;  1BK2 A;  1BBZ A;  5IXB A;  1VA7 A;  3UA6 A;  2RQW A;  1ZSG A;  1GCP A;  1W6X A;  2LQW A;  3PVQ A;  3H0H A;  1YWP A;  2LQN A;  2LMJ A;  2EKH A;  2V1Q A;  1RUW A;  2G6F X;  2KYB A;  1UFF A;  1PNJ A;  3JV3 A;  1NG2 A;  1UJY A;  2LJ3 A;  1FMK A;  1X6G A;  1YWO A;  5FWC A;  3NGP A;  4A63 B;  1UJ0 A;  1I0C A;  4IIO A;  3TSW A;  4D8K A;  2J6K A;  1K0S A;  3EHQ A;  1WXB A;  1TUD A;  2IIM A;  1SSH A;  2VVK A;  2H8H A;  1ARK A;  2DRK A;  4J9H A;  1I07 A;  2VKN A;  5EC7 A;  1WIE A;  1CKA A;  4RTX A;  2ED1 A;  4M4Z A;  2ROL A;  2EYW A;  2EYX A;  2KBT A;  1KSW A;  2O88 A;  1H3H A;  1K9A A;  1B3Q A;  2K3B A;  2L3P A;  4OMQ A;  1VYV A;  1AWJ A;  2YUO A;  3UF4 A;  3M0P A;  4Z88 A;  5HCK A;  5IHN A;  1K76 A;  2A08 A;  2NUZ A;  1E7O A;  1BU1 A;  2FG0 A;  1NLP C;  2DF6 A;  4LUE A;  3EG2 A;  4F17 A;  1B07 A;  2DNU A;  3REA B;  1OPK A;  1UUE A;  1PRM C;  4EIK A;  2LJ0 A;  2KRN A;  2YT6 A;  2RQT A;  3NMZ C;  2KT1 A;  1NEB A;  2BZ8 A;  2YUN A;  1S1N A;  1UG1 A;  3PE0 A;  2V1R A;  3EGU A;  4OMO A;  2CUB A;  2DL5 A;  2DVJ A;  1G2B A;  2KRM A;  2K7A A;  2MIO A;  1JO8 A;  1U3O A;  1MV0 B;  1TG0 A;  1GFD A;  1M27 C;  2LP5 A;  1HD3 A;  4LUD A;  1M8M A;  1Y57 A;  5GJW B;  1T0H A;  1SHG A;  2CH4 A;  2A28 A;  2YSQ A;  2CSQ A;  4RTU A;  1ABO A;  5ECA A;  2X3X D;  2EYY A;  2O2O A;  2DM1 A;  2EQI A;  1NM7 A;  2F2V A;  2RN8 A;  2MCN A;  1H92 A;  1I1J A;  3VRY A;  1M30 A;  1AVZ C;  3O5Z A;  1OOT A;  3A98 A;  3VS2 A;  1H8K A;  4X1V A;  4OMP A;  4GLM A;  1UEC A;  2EGA A;  2DMO A;  2L2P A;  4DEY A;  1AZG B;  1JQQ A;  3FJ5 A;  3TVT A;  2FO0 A;  2K6D A;  2D8H A;  2F2X A;  2JS2 A;  2GNC A;  2AZV A;  1G83 A;  1PHT A;  4OML A;  1JU5 C;  4J9C A;  3RBB B;  3UA7 A;  1VYT A;  4FSS A;  1T0J A;  2B86 A;  1AD5 A;  2RF0 A;  2DL4 A;  1SRM A;  1K4U S;  4D8D A;  1YP5 A;  4HVU A;  5I22 A;  3GBQ A;  2DE0 X;  4K11 A;  1QLY A;  4KRT A;  1KFZ A;  1WDX A;  3VS6 A;  1NLO C;  1WX6 A;  3M0T A;  3REB B;  1W1F A;  1AWO A;  3H0F A;  3NPF A;  1EFN A;  1T3S A;  1WI7 A;  1K0X A;  1M3A A;  1M3C A;  2KRO A;  3EG1 A;  2KR3 A;  1RLP C;  2HCK A;  2AZS A;  2LNH B;  4CC7 A;  1U5S A;  1SPK A;  2GBQ A;  2CDT A;  4ZNX A;  2J05 A;  2EW3 A;  2FPF A;  2L0A A;  3SEM A;  2ECZ A;  4JZ3 A;  4Z89 A;  2BTT A;  1Y0M A;  3I35 A;  4J9F A;  1YNZ A;  2HEQ A;  2YUP A;  1AZE A;  3EG0 A;  4LN2 A;  2D8J A;  5IH2 A;  5GJV B;  1QCF A;  3TSZ A;  2EVR A;  1WXU A;  2GTJ A;  3M0S A;  2ABL A;  4HXJ A;  4JJC A;  2MOX A;  4JZ4 A;  3THK A;  2PTK A;  4OMM A;  2D0N A;  2GGR A;  1PKT A;  1ZX6 A;  2E5K A;  1QWF A;  2LCS A;  2KXD A;  2BZX A;  2ROT A;  1GBR A;  2LJ1 A;  2EPD A;  3VS7 A;  3I5S A;  1OV3 A;  4Z8A A;  1AEY A;  1JEG A;  2CT4 A;  3QWX X;  2J06 A;  3SHW A;  2SEM A;  1J3T A;  1WLP B;  2BZY A;  1Z9Q A;  4J9G A;  2FPE A;  2LZ6 B;  4RTV A;  2J6F A;  1VYU A;  2GTO A;  3RNJ A;  4GBQ A;  2I0N A;  4JJD A;  1X6B A;  2CH4 W;  4LNP A;  2EGC A;  4ORZ A;  1PRL C;  1WYX A;  2DIL A;  1T3L A;  2DL8 A;  3U23 A;  2JS0 A;  2DX1 A;  1UHF A;  1PKS A;  1SEM A;  4RUG A;  3H0I A;  2CSI A;  1KIK A;  2O9V A;  1ZUU A;  4J9I A;  2KRS A;  2JMA A;  3C0C A;  4J9B A;  4HCK A;  3I9Q A;  2FRY A;  2A36 A;  2EYZ A;  4RTW A;  2RQR A;  2CUD A;  2RNA A;  2CT3 A; 
#chains in the Genus database with same CATH topology
 3DLM A;  3OS5 A;  2XD0 A;  3QBY A;  1PCX A;  1V29 B;  3VS5 A;  3OW2 P;  1PWT A;  3L2Z A;  1WJS A;  2VAS A;  3CC4 Q;  3QUI A;  1X2Q A;  4CC2 A;  3QDR B;  5GAO n;  2K4Y A;  5FWB A;  3ER0 A;  3LWI A;  5KCH A;  4MZP A;  3FC3 A;  3R6N A;  3V7R A;  1LCK A;  2AKK A;  1PD0 A;  4RCC A;  1YJN T;  3H8Z A;  2L3S A;  2E10 A;  3CPF A;  4JS5 A;  5FW9 A;  3UT1 A;  5GAO r;  4M77 C;  3KFV A;  2JM9 A;  3M53 A;  5J3B A;  3JCM Q;  4FYX B;  3MKD A;  2DBK A;  2XK0 A;  2EYQ A;  3OYI A;  2M51 A;  3OYM A;  5GAN d;  1K9M R;  4RTZ A;  2NWM A;  3H9N A;  1BIA A;  1V1C A;  4JPB W;  4LD9 K;  1RAC B;  4M75 F;  1K1Z A;  4X34 A;  3UAT A;  3QSU A;  1Y7X A;  2KYM A;  1NBE B;  2KVQ G;  3RKW A;  3RIR A;  1GCQ C;  2KXC A;  3X28 B;  1VQK T;  1RAG B;  5D6W A;  2RD1 A;  3C12 A;  4M77 D;  1ZA1 B;  3LLR A;  2DA9 A;  2YRC A;  5CAI A;  3TQ7 P;  4MZT A;  2DFU A;  2O9S A;  1VQ6 T;  4B9W A;  5GAO l;  1M2O A;  3OS1 A;  4JJB A;  3PFS A;  2LT4 A;  3MP1 A;  2XI9 A;  5FU7 C;  3OBY A;  5LL6 S;  2JTE A;  3S6W A;  1U1T A;  2VWF A;  1W2B A;  3L1A A;  3L2V A;  4OGE A;  1YCY A;  1NYF A;  4M77 B;  3L42 A;  1FMW A;  5A2Q E;  4M7D A;  4KGV B;  1GCQ A;  1VQM A;  1RAF B;  4AFQ C;  2DL3 A;  1GL5 A;  1QP3 A;  1X01 A;  4IIM A;  3A8L B;  1ZQ1 A;  2JUF A;  2YRV A;  3M58 A;  1U06 A;  2HQE A;  3QJ6 A;  4ZN3 A;  4KUL A;  3UWN A;  3FDR A;  2RHI A;  4XTW A;  2CP2 A;  2RHY A;  2JZ2 A;  4KT0 E;  2YRD A;  3CCU T;  5IT9 E;  2J6O A;  2RK1 A;  2C06 A;  2LQK A;  4BI3 A;  1QVG A;  5LJ5 f;  1ZSZ B;  2F69 A;  4EMH A;  5CKD A;  2E65 A;  1UHC A;  1RI0 A;  4MDW A;  2LX7 A;  2W0Z A;  3KBG A;  9ATC B;  4JDS A;  1B34 A;  2RJF A;  1UTI A;  2WAC A;  2ZPB B;  1N5Z A;  2RQU A;  4R0K A;  3MO8 A;  3LH0 A;  4V2S A;  2RI5 A;  4IUP A;  1TU0 B;  1DJ7 B;  4BDY A;  5KYY A;  1BK2 A;  2K2V A;  2DTH A;  4FIB A;  3SB2 A;  1D1B A;  2FVU A;  1BBZ A;  2EQK A;  2RQW A;  4E47 A;  2QA4 Q;  1GCP A;  2LQW A;  2QQS A;  2JJ9 A;  1LOJ A;  4NOY A;  2LMJ A;  4DBF A;  2FZG B;  4QW2 A;  3MET A;  3MHX A;  1PSE A;  3OA6 A;  1NG2 A;  1WHJ A;  2OTL A;  1D3B A;  1RAH B;  3CBO A;  2KMT A;  3GF5 A;  2CZ0 B;  3OYY A;  3CCQ A;  4IIO A;  4M75 D;  2NUT B;  3BFM A;  1QVG S;  1UB4 A;  1G5V A;  2E6N A;  2DRK A;  4KH0 B;  5EC7 A;  1WIE A;  2ED1 A;  4M4Z A;  2EYW A;  1KSW A;  1ZHI A;  2HQX A;  5CQX A;  2O88 A;  1D3B B;  1VQ4 Q;  4KGX B;  3C95 A;  1NJI U;  4QVD A;  3JCM b;  5GAO q;  5GAN g;  4XAX B;  3QXE B;  4XTZ A;  3SWN A;  2LDM A;  2R58 A;  2FG0 A;  3WXM B;  3CC2 A;  3EG2 A;  3GIB A;  2K3X A;  3CMA Q;  3H6Z A;  1UUE A;  1VQ7 Q;  3NMZ C;  1KHC A;  2BKD N;  3PIP A;  1KD1 C;  3CCM T;  1VQ8 T;  4LDV A;  2X4W A;  3EGU A;  3CCJ Q;  4X9C A;  2CUB A;  3M57 A;  2DL5 A;  2DVJ A;  1R77 A;  3M55 A;  3CCL T;  2RM4 A;  1GFD A;  1VQN Q;  1M27 C;  1Q7Y C;  2E41 A;  1G8X A;  2EJ9 A;  1M8M A;  1Y57 A;  4JLG A;  5GJW B;  3TU4 K;  2A28 A;  1R8O B;  2M16 A;  4AT1 B;  1M90 C;  5KYN A;  4ELY C;  4EPC A;  5CQY A;  1YI2 A;  2DM1 A;  2EQI A;  1S72 T;  2RN8 A;  2MCN A;  3BDL A;  3JCM X;  3VRY A;  4N4H A;  1M30 A;  3O5Z A;  1OOT A;  3A98 A;  4M7D G;  2VGM A;  4OMP A;  3CME Q;  1UEC A;  3HKS A;  3M59 A;  3CCR A;  4PJO A;  1IZ6 A;  1AZG B;  1JQQ A;  2XG8 D;  1NE8 A;  2QI2 A;  2D8H A;  2F2X A;  3C4S A;  2PVG B;  4C0Z A;  1VQK A;  3VYG A;  4XTU A;  4L6V 5;  2HAX A;  1T0J A;  3CXC P;  2DTI A;  5GAN h;  2X4J A;  2MMP A;  4PJO C;  4MML A;  1FXX A;  1BCM A;  5DY9 A;  1KHI A;  3SDZ A;  2LCC A;  1JRI A;  4D8D A;  3OY9 A;  1YIJ A;  5I22 A;  3GBQ A;  2EKO A;  1Q82 U;  3VS6 A;  1NLO C;  1WX6 A;  1W1F A;  2P0K A;  2L89 A;  1AWO A;  3NPF A;  1EFN A;  5CKH A;  2KRO A;  2O4X B;  4ANJ A;  1Y71 A;  3EG1 A;  2E1H A;  2KR3 A;  1RLP C;  3JB9 J;  1QW1 A;  4PJO E;  2XDD A;  5D7U A;  1HK9 A;  2CDT A;  4ZNX A;  2ECZ A;  2NUT A;  4C8Q E;  3I35 A;  4M78 G;  2K5F A;  1AZE A;  4N0A C;  5IH2 A;  1NZ9 A;  4GLK A;  1WXU A;  2GTJ A;  2VYT A;  2DXU A;  4JJC A;  2QQB A;  3T9N A;  3M4G A;  3G7Z A;  2D0N A;  6AT1 B;  2E5K A;  3CCQ Q;  3RR6 A;  1C0M A;  2KXD A;  1YIT A;  2X4X A;  3CCS A;  2DXC A;  2XIC A;  1O9S A;  2YXY A;  3EGD B;  1J3T A;  4J9G A;  2LQ8 A;  2LZ6 B;  3P8H A;  2LC4 A;  1VYU A;  4L5G A;  2GTO A;  3G71 Q;  4ATO A;  2I0N A;  1JB0 E;  3FIF A;  2DXB A;  4XU2 A;  1T3L A;  3U23 A;  4EMG A;  2JS0 A;  1TS9 A;  2DX1 A;  4LDW A;  1NPR A;  2HKN A;  1UHF A;  3CEY A;  3H0I A;  5C6S A;  1KIK A;  3JB9 F;  4M78 C;  2A3L A;  2QGF B;  3A1P A;  2DET A;  4KUI A;  1VQ7 T;  3C0C A;  4J9B A;  2EIF A;  2FRY A;  3J7A F;  2A36 A;  2EYZ A;  4RTW A;  4A4K A;  3JSC A;  1OEB A;  1IHW A;  2PZ1 A;  2MAM A;  4MZM A;  1WHH A;  5CKF A;  1SF9 A;  1YBY A;  3P8B B;  3CXC A;  4F14 A;  2RHX A;  1YJ9 T;  3CC2 T;  1X6O A;  3G4S T;  2DO3 A;  4N4G A;  3RKX A;  2O31 A;  2LNV A;  3VRZ A;  1VQ8 Q;  1MUZ A;  1SSF A;  4M7A F;  1Q7Y R;  3CPW P;  5LJ3 g;  1D09 B;  5EG2 A;  2RK2 A;  2M0O A;  1IXD A;  5GAM d;  4C5E A;  2AIR B;  4DEX A;  5KYX B;  1GRI A;  3EHR A;  4IUU A;  3GPL A;  5HK3 A;  1FWZ A;  2K5I A;  2J7I A;  3RMS A;  2PU9 B;  1EX4 A;  1MNE A;  2OX7 A;  1YCS B;  2F2W A;  2Y4X A;  2FEI A;  5GAO p;  4LE9 A;  1NEG A;  3CBP A;  1YI2 Q;  3CC4 T;  3QWY A;  4NL2 A;  2K2M A;  1JJ2 S;  2Z0W A;  4F7U B;  4C5I A;  5D6X A;  4FW2 A;  1D1C A;  2DYB A;  1YJ9 Q;  4ZGD B;  3CCM Q;  4JS4 A;  4PLI A;  2HSP A;  1UDL A;  1VQ6 Q;  3VYH B;  1D0X A;  3NTI A;  2PQW A;  3HP9 A;  2MYS A;  1K73 R;  2CP7 A;  2HMA A;  2MK5 A;  1X43 A;  1HSQ A;  5GAN e;  4PLL A;  4J6Y A;  1M1G A;  1MND A;  1N8R U;  4KBM B;  3A8O B;  3CCS T;  4HCC A;  3CCL Q;  2JMC A;  1MMA A;  1K8A C;  7AT1 B;  3AT1 B;  3HRU A;  4L59 A;  4PJM A;  2YWW A;  5GAM h;  4OB0 B;  2ENM A;  2QQA A;  5FRN A;  1ZBX A;  1CSK A;  4HVV A;  4C0F A;  1KQ1 A;  4J7I A;  4LDY A;  3CQT A;  2K79 A;  4OP0 A;  2QA4 A;  3OMC A;  3EGD A;  3M0R A;  4PJO G;  1XNI A;  3CCL A;  2CP3 A;  1YJN Q;  3E2U A;  3LH5 A;  4QQG A;  4FM4 B;  2RH2 A;  2H3J A;  2E70 A;  2E64 A;  5DLQ E;  1ZSZ A;  4ZGJ B;  3WVD B;  1RAI B;  2EQJ A;  2KK4 A;  1QKW A;  5M9O A;  5FLX E;  2YDL A;  4E7S A;  1RI9 A;  4E7L A;  1M1K R;  2P4R A;  4BY6 C;  3MP6 A;  2QA4 T;  2VV5 A;  2W10 A;  2KEA A;  3OYA A;  2OI3 A;  1E6G A;  3CBM A;  3F70 A;  3VKI A;  5I11 A;  1VQP Q;  3EFR A;  2XU8 A;  2QEX A;  3QKJ A;  3M54 A;  1WXT A;  3JCM c;  2JW4 A;  4C5H A;  2EWN A;  3EH1 A;  1BI3 A;  3HSB A;  4PKC C;  2OJ2 A;  2E6Z A;  1IRX A;  3VS0 A;  2HSE B;  2HDA A;  1W70 A;  1XOV A;  1AWW A;  3OBW A;  2VB6 A;  1VQO A;  4M77 G;  2D0Q B;  4N0A A;  1VA7 A;  3UA6 A;  2D9T A;  3QO3 A;  1VQ5 Q;  4BB7 A;  1YWP A;  2LQN A;  4M75 E;  2G6F X;  5GAN 6;  1HXD A;  1OYX A;  3JV3 A;  2ZPG B;  1UJY A;  2X4Y A;  2LJ3 A;  3UPU A;  1YWO A;  4ZGE B;  4A63 B;  3TEE A;  2IPO B;  3TSW A;  4DBH A;  4D8K A;  4E7I A;  1SKU B;  1K0S A;  3OW2 S;  2IIM A;  2H8H A;  2CZ6 B;  3RKY A;  1BI0 A;  1C6V X;  4M75 G;  4FSX A;  4Y91 A;  3OB9 A;  2ROL A;  2KI7 A;  3S3O A;  2KBT A;  3CCU Q;  3I56 A;  3V8L A;  1H3H A;  1B3Q A;  1M90 U;  2K3B A;  5LJ3 j;  4PK4 A;  2L3P A;  4OMQ A;  1AWJ A;  3UF4 A;  4Z88 A;  4DBQ A;  1K76 A;  1VQ4 A;  1E7O A;  3MCA B;  1KC8 R;  2DF6 A;  3TRE A;  4F17 A;  1G3W A;  3REA B;  4J8O A;  3FJP A;  3VUZ A;  1PRM C;  4EIK A;  2LJ0 A;  1QVF P;  2JN0 A;  1V76 A;  5FRO A;  1S1N A;  3I55 A;  3WVE B;  1UG1 A;  2V1R A;  3I56 T;  4EDU A;  4OMO A;  3INZ A;  3GOX A;  3DKM A;  2PUK B;  4NL3 A;  1NJI C;  2JOY A;  5CIU A;  3G6E T;  2K7A A;  3D7S B;  1U3O A;  1MV0 B;  5LJ3 e;  2MF2 A;  1PC0 A;  4DA4 A;  4FCY A;  2CSQ A;  4RTU A;  2LT1 A;  1W2B P;  3E9G A;  1NM7 A;  2QDY B;  2QGG A;  2QAS A;  1AVZ C;  2RB6 A;  3VS2 A;  4GLM A;  4PL6 A;  1OU9 A;  1FMV A;  3OYL A;  2P0Q A;  4DEY A;  2JVV A;  4FYV B;  4PJO F;  3TVT A;  5D6Y A;  2K6D A;  4M7D D;  1PSF A;  2KAF A;  3JB9 G;  2RJC A;  2AZV A;  3V7C A;  1G83 A;  1PHT A;  5AYF A;  4J9C A;  1Q81 C;  2F1L A;  1VYT A;  4B9X A;  5A0L A;  2B86 A;  1AD5 A;  2RF0 A;  4R55 A;  1I8F A;  3MEW A;  4IUR A;  2EFI A;  2H3E B;  2R57 A;  4BD3 A;  4F04 B;  1YJW T;  3CC4 A;  1K4U S;  4E7Z A;  1QLY A;  4C92 F;  3JCM d;  4QQD A;  2X9H A;  1M90 R;  1C1A A;  1T3S A;  1K0X A;  3CXC S;  1M8V A;  5KYW B;  3JCM V;  2HCK A;  1WNL A;  3S3M A;  3NTH A;  1HYO A;  3EAE A;  5LJ3 h;  4CC7 A;  1U5S A;  4M77 A;  2XDP A;  2J05 A;  2FPF A;  4Z89 A;  4J9F A;  2E3I A;  3OYF A;  2YUP A;  4M75 B;  4LN2 A;  5GAN f;  2HL3 A;  3ME9 A;  4IUQ A;  5CR2 A;  5GJV B;  3EFO B;  3PGG A;  4CI0 C;  5DLO A;  3M0S A;  4HXJ A;  4Z02 A;  2MOX A;  4M78 F;  3E19 A;  1NPP A;  1LJO A;  2JTF A;  4OMM A;  2DZC A;  4C0D B;  1IHV A;  2LCS A;  3QPH A;  2OAU A;  3CME A;  1JEG A;  2JNG A;  3PMI A;  3JCM f;  2CT4 A;  2CKK A;  4KUD K;  1WLP B;  3ASK A;  3E9F A;  2CZ1 B;  3HFN A;  4OF1 A;  1VQ7 A;  1IGU A;  4RTV A;  2ATC B;  4F7U G;  2J6F A;  1KK7 A;  2PVD B;  1MMG A;  2CYZ B;  5J39 A;  4JJD A;  4A4E A;  2QXF A;  3G4S A;  1IB8 A;  4LNP A;  3Q1J A;  5GAM f;  2MI6 A;  3MEV A;  1TXQ A;  4BUG A;  2WSF E;  2OTJ Q;  3HPW A;  2MPX C;  3OS0 A;  3R6O A;  1SEM A;  2CSI A;  2MWP A;  3BDU A;  3OYE A;  1M1K U;  2O9V A;  4HT9 A;  1ZUU A;  5LJ5 e;  4J9I A;  3ZEH A;  5KE2 A;  2Y4Y A;  4M7A B;  2RHZ A;  3LW5 E;  1Y96 A;  4J7F A;  3CCE Q;  2VGN A;  3FRN A;  2COZ A;  4O5V A;  4XTY A;  2NLU A;  3EFO A;  3BY7 A;  1H3Z A;  4OMN A;  2DBM A;  1TTH B;  1Z9Z A;  1X27 A;  2KGT A;  1WFW A;  4AG2 C;  1WPY A;  2EBP A;  4AFZ C;  2XDB A;  2ZPH B;  4M78 D;  4HVW A;  1M1K C;  2JT4 A;  3G1J A;  5I21 A;  4E6R A;  1VQ9 T;  3DLL A;  4C92 B;  2DEQ A;  4C92 D;  2CGH A;  1BYM A;  2XHC A;  1YIT Q;  1TOV A;  4Y28 E;  2FPD A;  1VIF A;  4PJJ A;  1ZA2 B;  4QKU A;  2GFU A;  4C92 G;  2LCL A;  1QKX A;  1OZ2 A;  3CD6 Q;  1YN8 A;  2KQW A;  3M0Q A;  1WHG A;  2M0Y A;  1G3T A;  1Q95 G;  3PVL A;  1IGQ A;  4OMF B;  2RQV A;  1VQL Q;  1RAD B;  1R0C B;  4D6W A;  2FB7 A;  2OTL T;  2L3R A;  3KXT A;  3M4Y A;  4E7J A;  3VS4 A;  1LPL A;  4M78 B;  2DLP A;  2QTX A;  3V8J A;  4C8Q B;  3LGL A;  3OSS C;  2RO0 A;  4AG1 C;  1QP2 A;  1VUB A;  3I55 T;  3CCR T;  3M9Q A;  1B7T A;  4A53 A;  1NYG A;  2GQI A;  4A4G A;  2KE9 A;  2QEX Q;  2X35 A;  1O75 A;  4F16 A;  5FRM A;  1I5O B;  1QWE A;  2A7Y A;  3J81 E;  4DOW A;  3I56 Q;  1YI2 T;  3A5Z B;  3JCM e;  4E7K A;  1I4K 1;  2FZC B;  4M7A C;  2DAQ A;  2NYS A;  2KT8 A;  1ACM B;  3FEO A;  4ESR A;  1D1A A;  2OAW A;  1YHQ T;  1VOM A;  1X2K A;  1QCO A;  2HKQ B;  1BCO A;  2QAZ A;  4DQ2 A;  3IQL A;  1UGR B;  1CKB A;  1QMC A;  2QDL A;  4JLI A;  4HT8 A;  3OYK A;  4FT4 A;  4XU3 A;  2CRE A;  2JXB A;  2DJZ A;  2L8D A;  2PNI A;  1VQO Q;  3HTR A;  1HJD A;  4DOV A;  5IXF A;  3QDF A;  1XQH A;  1JXO A;  5FU6 B;  4OB2 B;  1PM3 A;  5GMK h;  5KYY B;  2V26 A;  4B6M A;  2RMO A;  3X20 B;  2CP5 A;  4HA8 A;  4WCI A;  1KD1 R;  2AKL A;  2D1X A;  4QQ6 A;  1JBM A;  4C8Q D;  3OSV A;  5IN1 A;  4MDX A;  4AFS C;  3I5R A;  2EGE A;  4RG2 A;  4M7A G;  5KH6 A;  4HCB A;  3JCM h;  1D0Y A;  5L23 A;  3TCJ A;  4M75 C;  4QT7 A;  5IHI A;  1Q81 U;  3VUB A;  4PFP A;  3ZFJ A;  1B34 B;  4M7A D;  1W6X A;  2DTO A;  2YHT A;  2RJE A;  5LJ3 d;  1RUW A;  3O8V A;  4RMO A;  1VIE A;  1UFF A;  1PNJ A;  3LWH A;  1PD1 A;  5GAN 7;  1YJW Q;  4C92 A;  1WHM A;  2VXE A;  4J83 A;  3L2U A;  1PG5 B;  1X6G A;  1MMD A;  5KYU A;  1UJ0 A;  3MEA A;  2J6K A;  2RA2 A;  5FU7 B;  1VQP T;  3L2Q A;  1LVK A;  2ZPI B;  4PNO A;  3CCV A;  1TUD A;  2VVK A;  4J9H A;  2VKN A;  1CKA A;  4RTX A;  2O01 E;  5I2M A;  1TSF A;  4PFO A;  4F7U A;  3RUX A;  1K9A A;  2M9U A;  4IUT A;  5IAY A;  1YJW A;  1Q82 R;  2FYK A;  2FZK B;  2YUO A;  3M0P A;  5HCK A;  2E5Q A;  3CPW A;  1KQS S;  5IHN A;  2A08 A;  2NUZ A;  2K3Y A;  1NLP C;  4LUE A;  1VQM Q;  1YJ9 A;  1B07 A;  2AHJ B;  1VQN T;  1OPK A;  1RAA B;  3MJX A;  1P92 A;  4EMK A;  4WTO B;  1R0B G;  2RQT A;  3URG A;  2ZZD A;  1KD1 U;  2BZ8 A;  4BDZ A;  2KDS A;  5CKB A;  4IKF A;  2HBP A;  4NS5 A;  4M77 E;  5KYX A;  1BI1 A;  4WF2 A;  2COW A;  3CMA T;  3CCV T;  2QTV A;  3JCM P;  4PJN A;  4BI8 B;  2LP5 A;  5KE3 A;  1HD3 A;  4LUD A;  1QVF S;  2GF7 A;  2CH4 A;  2YSQ A;  4RG8 A;  1ABO A;  5ECA A;  2X3X D;  2O4X A;  2O2O A;  4F7U F;  3SWN C;  3G6E A;  2BIV A;  1XTD A;  4C8Q C;  1H92 A;  1I1J A;  4PFZ A;  1VQL A;  2CP6 A;  2DMO A;  2EQM A;  3CC7 Q;  2L2P A;  3FJ5 A;  1I81 A;  5GAN 2;  1F1B B;  2FO0 A;  1I5L A;  1MGQ A;  4M7A E;  1U8R A;  2JS2 A;  1QQJ A;  1UGS B;  4XQ3 A;  4C8Q A;  1JU5 C;  1WJQ A;  1S72 A;  2V8J A;  4BE0 A;  3RBB B;  2CP0 A;  1WHL A;  1UGP B;  4FSS A;  4J6W A;  2E3H A;  3SFM A;  3X25 B;  4HKE A;  4ZN1 A;  1OI1 A;  1FX7 A;  4KH1 B;  3HFO A;  4M7D F;  1WJR A;  2HD0 A;  1AHJ B;  2DIG A;  1SRM A;  4A4H A;  3PNW C;  2LTO A;  1YP5 A;  2EJF A;  2DE0 X;  3OYN A;  4BI4 A;  3M0T A;  3CC2 Q;  3REB B;  5GAN 8;  2VC8 A;  5GMK e;  4OGC A;  3X24 B;  5A0G A;  3H0F A;  3VV0 A;  4A54 A;  1M3A A;  1M3C A;  3EG9 B;  5LJ5 d;  2FL7 A;  4J6X A;  3CCS Q;  8ATC B;  2VUB A;  4M75 A;  1VQM T;  3EFS A;  2D6F A;  3V8K A;  1SPK A;  2GBQ A;  1M1F A;  2RI3 A;  2L0A A;  1WQW A;  2BTT A;  5DM7 R;  2DER A;  4O6J A;  1VQ4 T;  3QII A;  3CC7 T;  2HZY A;  4XK8 E;  1ZX6 A;  1QWF A;  2WSC E;  3PIO A;  2BZX A;  1YIJ Q;  4FU6 A;  2LJ1 A;  2EPD A;  3VS7 A;  1OV3 A;  4ZTJ A;  2BUD A;  1AEY A;  1VQ6 A;  1MMN A;  3CCM A;  1N27 A;  4GY5 A;  3QWX X;  4FYW B;  2J06 A;  3CCE A;  2SEM A;  5CO7 A;  1BI2 A;  2BZY A;  1Q81 R;  1Z9Q A;  3JCM W;  1KC8 U;  4M7D B;  4EMK C;  4JUV A;  4LXC A;  1OUL A;  4P5N A;  4GBQ A;  3V7S A;  3PTA A;  2CH4 W;  2M02 A;  2RHU A;  3OYC A;  5KYW A;  5LJ5 h;  1IRE B;  4M7A A;  1PKS A;  3G4S Q;  4RUG A;  5L8R E;  5GAM e;  4RCB A;  3C94 A;  5A0D A;  3CCR Q;  1M5Q 1;  1TH7 A;  1OX9 A;  4QVC A;  3I9Q A;  1UEB A;  1BKB A;  2V8I A;  2RQR A;  2F5K A;  2M1H A;  2CUD A;  1VQK Q;  2RNA A;  2RI2 A;  2CT3 A;  1QCF A;  4CC3 A;  1N8R C;  3EGX B;  2HQH A;  3HL8 A;  3LX7 A;  4J9D A;  4ELZ C;  5C0M A;  4Y92 A;  4BY6 B;  3H41 A;  3CC7 A;  1ZLM A;  1K8A U;  2AT1 B;  4IUV A;  4C0G A;  3KUF A;  4PJO D;  3NHN A;  2QG9 B;  2JM8 A;  1LNX A;  2NUP B;  5AT1 B;  1ZUK A;  1S72 Q;  4HCZ A;  5HKC A;  3CCU A;  1ZBJ A;  2B8A A;  2ESW A;  2DRM A;  3N5B B;  3VS1 A;  4RTY A;  2L3Q A;  1JXM A;  3GNF B;  3QJY A;  4N4I A;  4LDX A;  2X3W D;  2AK5 A;  1W2B S;  1YIT T;  3JCM J;  1YHQ Q;  1RL2 A;  5GMK j;  2XMF A;  2YUQ A;  2LVM A;  5IHK A;  1OPL A;  3MPU B;  1GFC A;  3PT9 A;  3HRT A;  2HBW A;  1VQP A;  1UE9 A;  3G71 A;  4J9E A;  2DD4 A;  3VS3 A;  1Q86 R;  1YIJ T;  3ZBD A;  1RLQ C;  1UGV A;  1JJ2 A;  2P4T A;  2K5L A;  3CCQ T;  1VQ5 A;  3J80 E;  3OYH A;  3A8M B;  4C8Q G;  3CCJ T;  4RTT A;  2RJD A;  2MWO A;  2ZGW A;  1Q82 C;  1MV3 A;  2HL5 C;  2FRW A;  3CMA A;  1X69 A;  4M7D C;  1AT1 B;  3M0U A;  2DVE A;  2K57 A;  3CCE T;  2C0I A;  1E6H A;  2YLC A;  4C92 E;  3X26 B;  3UDC A;  1YJN A;  3AHU A;  2DL7 A;  1D0Z A;  2OTL Q;  2K9G A;  1BB9 A;  1TWB A;  1ZUY A;  2QK0 A;  1FYN A;  1M9S A;  4QVZ A;  1TUC A;  3OQ5 A;  2DD5 A;  4A4F A;  5GMK i;  1GXI E;  2KNB B;  5CCA A;  5GAO m;  4C8Q F;  2RPN A;  2C0O A;  1KC8 C;  1SHF A;  4C5G A;  2F5T X;  3HRS A;  2SRC A;  3EG3 A;  5LJ5 j;  2DJQ A;  3NTK A;  1MHN A;  1SRL A;  3G71 T;  1AWX A;  3VU3 C;  1M2V A;  3RER A;  2GCX A;  4ZTF A;  2XKO C;  5I2S A;  2EQU A;  4AFU C;  1QVP A;  3QYG B;  5GAM g;  1M3B A;  4TVR A;  3DB4 A;  1ABQ A;  4BAC A;  1Q86 U;  1A0N B;  1KJW A;  1VQ9 A;  1IO6 A;  2GQV A;  1GBQ A;  2IVW A;  2C0T A;  4M77 F;  5GMK m;  2ED0 A;  2A37 A;  2L5Q A;  5CKE A;  5GAN 3;  1WA7 A;  3ZL7 C;  1WZO A;  1M4Z A;  4LDU A;  3FB9 A;  2OTJ A;  2DK3 A;  1WQ7 A;  2R5M A;  2KSS A;  1AOJ A;  1XJW B;  4X9D A;  4CC4 B;  3ULR B;  1Q7Y U;  4OVA A;  3A8G B;  3GLX A;  2DZ9 A;  3VJP A;  5IXB A;  1QVG P;  2LX9 A;  1VQL T;  1ZSG A;  3PVQ A;  3H0H A;  3MP8 A;  2V1Q A;  2EKH A;  2R5A A;  3RES A;  3SD4 A;  2QEX T;  2KYB A;  2NUP A;  5KYU B;  1FMK A;  3OMG A;  1ZSZ C;  1M2V B;  3DB3 A;  5LJ3 f;  4FW1 A;  5FWC A;  3NGP A;  1I0C A;  1OX8 A;  1K73 C;  2QQR A;  5J26 A;  3EGX A;  3EHQ A;  5GAN 5;  1WXB A;  2CZ7 B;  1SSH A;  1ARK A;  1I07 A;  5GAN 4;  4JRQ A;  4XTX A;  4E2F B;  4DBR A;  1EZZ B;  2EYX A;  2WSE E;  1U1S A;  1VQ8 A;  4M78 A;  1G3S A;  4C0D C;  3CME T;  4BE1 A;  3QYH B;  3BE3 A;  1VYV A;  4J5Y A;  2DIQ A;  2HNI A;  5LJ5 g;  1BU1 A;  4PJO B;  1X75 C;  3QHS A;  2DNU A;  1EIF A;  4F7U E;  3SWN B;  1VQ9 Q;  2KRN A;  2YT6 A;  3LGF A;  4XU0 A;  2KY9 A;  4JRK A;  2FHD A;  2KT1 A;  3CCV Q;  1NEB A;  4OB3 B;  2YUN A;  3PE0 A;  3CD6 A;  2JTM A;  3E1S A;  3BW1 A;  3JB9 I;  2BE7 D;  4RKU E;  2OTJ T;  1G2B A;  2KRM A;  1Q86 C;  2I2L A;  1OU8 A;  2COY A;  4AMC A;  2DYI A;  2MIO A;  3CPW S;  1KQS A;  1JO8 A;  4OB1 B;  1TG0 A;  3JB9 H;  5CVI A;  1SG5 A;  2PUO B;  3A8H B;  1T0H A;  1SHG A;  3JRZ A;  2DKG A;  3L2W A;  3OS2 A;  4BE2 A;  1RAE B;  2EYY A;  2E4H A;  1N9S A;  2F2V A;  2P84 A;  4LD6 A;  3JCM g;  1H8K A;  1Y07 A;  4X1V A;  2EGA A;  5HK0 A;  3JAM E;  1OQK A;  8AT1 B;  1N9R A;  3OYD A;  5GAN j;  2P0P A;  3S3N A;  2X51 A;  3OW2 A;  1JJ2 P;  5HY6 A;  1OZ3 A;  4EMK B;  1YHQ A;  1QVF A;  2DXT A;  2GNC A;  2IG0 A;  4OML A;  2GFA A;  2QYZ A;  1N8R R;  4XTV A;  3UA7 A;  3M56 A;  2BE9 B;  4FYY B;  2ZAE A;  3HHT B;  4M78 E;  4JRI A;  2DL4 A;  3G6E Q;  3RDV A;  1K73 U;  4YTL A;  2Y90 A;  3OYG A;  1WHK A;  3QG1 A;  5GAM j;  4HVU A;  4VUB A;  4K11 A;  4C92 C;  4KRT A;  1KFZ A;  3PMT A;  1WDX A;  1W4S A;  3QZ5 B;  3GNG A;  2QQ9 A;  1KG1 A;  4M7D E;  1WI7 A;  2G3R A;  4KGZ B;  2E12 A;  3M5A A;  2AZS A;  2LNH B;  2DEU A;  2EW3 A;  3CCJ A;  3FLG A;  3SEM A;  1TUG B;  4JZ3 A;  1Y0M A;  1YNZ A;  2HEQ A;  1G3Y A;  3EG0 A;  2D8J A;  3TSZ A;  2EVR A;  4UC4 A;  3OYB A;  2ABL A;  3THK A;  4JZ4 A;  1RAB B;  3L2R A;  4CRI A;  2PTK A;  2ZCF B;  2GGR A;  1PKT A;  2LRQ A;  1KQ2 A;  1K8A R;  1WGS A;  2ROT A;  1GBR A;  3I5S A;  3LYI A;  4Z8A A;  1VQO T;  4JJN K;  3QZ9 B;  3CD6 T;  1QCN A;  2CS7 A;  4R56 A;  3SHW A;  4MMK A;  4II1 A;  4Q5W A;  2VXF A;  2FPE A;  2EJG A;  4FL6 A;  3RNJ A;  3RMQ A;  3MEU A;  1VQN A;  2XID A;  2EAY A;  4ME7 A;  2PVO B;  1X6B A;  1Y96 B;  2A0F B;  2DPP B;  3P8D A;  1K9M U;  1NJI R;  2EGC A;  4ORZ A;  3JB9 D;  1YFN A;  1PRL C;  1WYX A;  2DIL A;  2DL8 A;  4JRP A;  1N6A A;  3EG9 A;  1VQ5 T;  5CK9 A;  3EH2 A;  4XU1 A;  1H64 1;  1BIB A;  5GMK l;  5FU6 C;  1KQS P;  2YLB A;  3OYJ A;  2KRS A;  4PJL A;  5KCO A;  2JMA A;  2V8K A;  4E7H A;  4FT2 A;  3NFC A;  3I55 Q;  4HCK A;  1UGQ B;  1K9M C;  2ZPE B;  2ZPF B;  3GP8 A; 
#chains in the Genus database with same CATH homology
 4CC3 A;  1OEB A;  2PZ1 A;  4J9D A;  4OMN A;  4Y92 A;  3VS5 A;  2DBM A;  3H41 A;  1PWT A;  1Z9Z A;  1X27 A;  4F14 A;  2KGT A;  1WFW A;  4AG2 C;  2EBP A;  1ZLM A;  4AFZ C;  2O31 A;  3VRZ A;  1MUZ A;  1X2Q A;  4CC2 A;  4HVW A;  3NHN A;  2JT4 A;  5FWB A;  2JM8 A;  3R6N A;  4E6R A;  1ZUK A;  1LCK A;  2AKK A;  1ZBJ A;  2ESW A;  2DRM A;  3VS1 A;  4DEX A;  4RTY A;  2L3Q A;  1JXM A;  1GRI A;  3EHR A;  2FPD A;  2X3W D;  2L3S A;  2AK5 A;  2J7I A;  5FW9 A;  2XMF A;  1QKX A;  2YUQ A;  5IHK A;  1OPL A;  3KFV A;  1YCS B;  2F2W A;  2JM9 A;  1GFC A;  2FEI A;  1YN8 A;  3M0Q A;  2HBW A;  1NEG A;  1UE9 A;  4LE9 A;  4J9E A;  3VS3 A;  2DBK A;  1RLQ C;  2M0Y A;  1UGV A;  2M51 A;  3PVL A;  3QWY A;  2K2M A;  2RQV A;  4RTZ A;  2NWM A;  2DYB A;  4RTT A;  1V1C A;  4JPB W;  1MV3 A;  1K1Z A;  2HSP A;  3UAT A;  1UDL A;  2FRW A;  1X69 A;  2KYM A;  3VS4 A;  1GCQ C;  2KXC A;  3M0U A;  2DLP A;  1X43 A;  2DA9 A;  1HSQ A;  2C0I A;  1E6H A;  4AG1 C;  2JMC A;  2O9S A;  2DL7 A;  1NYG A;  2GQI A;  2KE9 A;  4F16 A;  2K9G A;  4JJB A;  1BB9 A;  1QWE A;  1ZUY A;  1FYN A;  2ENM A;  1TUC A;  1CSK A;  4HVV A;  2JTE A;  2VWF A;  3CQT A;  2KNB B;  1NYF A;  2KT8 A;  2K79 A;  2RPN A;  2C0O A;  1SHF A;  2SRC A;  3EG3 A;  4ESR A;  2OAW A;  2DJQ A;  1SRL A;  3M0R A;  1X2K A;  1AWX A;  1GCQ A;  4AFQ C;  2DL3 A;  1GL5 A;  4IIM A;  3IQL A;  3LH5 A;  1CKB A;  4AFU C;  2QDL A;  1U06 A;  2CRE A;  2JXB A;  2PNI A;  1HJD A;  1M3B A;  5IXF A;  1QKW A;  1ABQ A;  2YDL A;  2J6O A;  1A0N B;  1JXO A;  1RI9 A;  1KJW A;  2P4R A;  1IO6 A;  1GBQ A;  2W10 A;  2C0T A;  2KEA A;  1UHC A;  2RMO A;  2OI3 A;  1E6G A;  2LX7 A;  2W0Z A;  4WCI A;  2AKL A;  5I11 A;  2D1X A;  2ED0 A;  1UTI A;  2A37 A;  1WA7 A;  3ZL7 C;  1WXT A;  1N5Z A;  2RQU A;  2JW4 A;  4R0K A;  4AFS C;  3I5R A;  2EGE A;  1AOJ A;  2OJ2 A;  5L23 A;  4QT7 A;  3VS0 A;  2HDA A;  1W70 A;  1XOV A;  5IHI A;  1AWW A;  4CC4 B;  3ULR B;  1BK2 A;  1BBZ A;  5IXB A;  1VA7 A;  3UA6 A;  2RQW A;  1ZSG A;  1GCP A;  1W6X A;  2LQW A;  3PVQ A;  3H0H A;  1YWP A;  2LQN A;  2LMJ A;  2EKH A;  2V1Q A;  1RUW A;  2G6F X;  2KYB A;  1UFF A;  1PNJ A;  3JV3 A;  1NG2 A;  1UJY A;  2LJ3 A;  1FMK A;  1X6G A;  1YWO A;  5FWC A;  3NGP A;  4A63 B;  1UJ0 A;  1I0C A;  4IIO A;  3TSW A;  4D8K A;  2J6K A;  1K0S A;  3EHQ A;  1WXB A;  1TUD A;  2IIM A;  1SSH A;  2VVK A;  2H8H A;  1ARK A;  2DRK A;  4J9H A;  1I07 A;  2VKN A;  5EC7 A;  1WIE A;  1CKA A;  4RTX A;  2ED1 A;  4M4Z A;  2ROL A;  2EYW A;  2EYX A;  2KBT A;  1KSW A;  2O88 A;  1H3H A;  1K9A A;  1B3Q A;  2K3B A;  2L3P A;  4OMQ A;  1VYV A;  1AWJ A;  2YUO A;  3UF4 A;  3M0P A;  4Z88 A;  5HCK A;  5IHN A;  1K76 A;  2A08 A;  2NUZ A;  1E7O A;  1BU1 A;  2FG0 A;  1NLP C;  2DF6 A;  4LUE A;  3EG2 A;  4F17 A;  1B07 A;  2DNU A;  3REA B;  1OPK A;  1UUE A;  1PRM C;  4EIK A;  2LJ0 A;  2KRN A;  2YT6 A;  2RQT A;  3NMZ C;  2KT1 A;  1NEB A;  2BZ8 A;  2YUN A;  1S1N A;  1UG1 A;  3PE0 A;  2V1R A;  3EGU A;  4OMO A;  2CUB A;  2DL5 A;  2DVJ A;  1G2B A;  2KRM A;  2K7A A;  2MIO A;  1JO8 A;  1U3O A;  1MV0 B;  1TG0 A;  1GFD A;  1M27 C;  2LP5 A;  1HD3 A;  4LUD A;  1M8M A;  1Y57 A;  5GJW B;  1T0H A;  1SHG A;  2CH4 A;  2A28 A;  2YSQ A;  2CSQ A;  4RTU A;  1ABO A;  5ECA A;  2X3X D;  2EYY A;  2O2O A;  2DM1 A;  2EQI A;  1NM7 A;  2F2V A;  2RN8 A;  2MCN A;  1H92 A;  1I1J A;  3VRY A;  1M30 A;  1AVZ C;  3O5Z A;  1OOT A;  3A98 A;  3VS2 A;  1H8K A;  4X1V A;  4OMP A;  4GLM A;  1UEC A;  2EGA A;  2DMO A;  2L2P A;  4DEY A;  1AZG B;  1JQQ A;  3FJ5 A;  3TVT A;  2FO0 A;  2K6D A;  2D8H A;  2F2X A;  2JS2 A;  2GNC A;  2AZV A;  1G83 A;  1PHT A;  4OML A;  1JU5 C;  4J9C A;  3RBB B;  3UA7 A;  1VYT A;  4FSS A;  1T0J A;  2B86 A;  1AD5 A;  2RF0 A;  2DL4 A;  1SRM A;  1K4U S;  4D8D A;  1YP5 A;  4HVU A;  5I22 A;  3GBQ A;  2DE0 X;  4K11 A;  1QLY A;  4KRT A;  1KFZ A;  1WDX A;  3VS6 A;  1NLO C;  1WX6 A;  3M0T A;  3REB B;  1W1F A;  1AWO A;  3H0F A;  3NPF A;  1EFN A;  1T3S A;  1WI7 A;  1K0X A;  1M3A A;  1M3C A;  2KRO A;  3EG1 A;  2KR3 A;  1RLP C;  2HCK A;  2AZS A;  2LNH B;  4CC7 A;  1U5S A;  1SPK A;  2GBQ A;  2CDT A;  4ZNX A;  2J05 A;  2EW3 A;  2FPF A;  2L0A A;  3SEM A;  2ECZ A;  4JZ3 A;  4Z89 A;  2BTT A;  1Y0M A;  3I35 A;  4J9F A;  1YNZ A;  2HEQ A;  2YUP A;  1AZE A;  3EG0 A;  4LN2 A;  2D8J A;  5IH2 A;  5GJV B;  1QCF A;  3TSZ A;  2EVR A;  1WXU A;  2GTJ A;  3M0S A;  2ABL A;  4HXJ A;  4JJC A;  2MOX A;  4JZ4 A;  3THK A;  2PTK A;  4OMM A;  2D0N A;  2GGR A;  1PKT A;  1ZX6 A;  2E5K A;  1QWF A;  2LCS A;  2KXD A;  2BZX A;  2ROT A;  1GBR A;  2LJ1 A;  2EPD A;  3VS7 A;  3I5S A;  1OV3 A;  4Z8A A;  1AEY A;  1JEG A;  2CT4 A;  3QWX X;  2J06 A;  3SHW A;  2SEM A;  1J3T A;  1WLP B;  2BZY A;  1Z9Q A;  4J9G A;  2FPE A;  2LZ6 B;  4RTV A;  2J6F A;  1VYU A;  2GTO A;  3RNJ A;  4GBQ A;  2I0N A;  4JJD A;  1X6B A;  2CH4 W;  4LNP A;  2EGC A;  4ORZ A;  1PRL C;  1WYX A;  2DIL A;  1T3L A;  2DL8 A;  3U23 A;  2JS0 A;  2DX1 A;  1UHF A;  1PKS A;  1SEM A;  4RUG A;  3H0I A;  2CSI A;  1KIK A;  2O9V A;  1ZUU A;  4J9I A;  2KRS A;  2JMA A;  3C0C A;  4J9B A;  4HCK A;  3I9Q A;  2FRY A;  2A36 A;  2EYZ A;  4RTW A;  2RQR A;  2CUD A;  2RNA A;  2CT3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...