4HXJA

Crystal structure of sh3:rgt complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural framework of c-Src activation by integrin beta 3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hxjA00
1FYNA 1VYUA 2PNIA 2JMCA 2EGEA 4J9BA 2AKKA 2C0TA 2JT4A 1T0JA 2LX7A 3GBQA 2ROLA 1JEGA 2HEQA 2J7IA 2EYZA 2KEAA 3TSWA 1GCPA 2YUOA 2DRMA 5HCKA 2AZSA 4HCKA 1GRIA 2MIOA 2BZ8A 2EQIA 3RNJA 2CSIA 2J05A 3TVTA 2GNCA 2BZYA 3EG3A 1G2BA 1H92A 3UA6A 1UTIA 1CSKA 2KR3A 1QKXA 1V1CA 1H8KA 1K9AA 3NHNA 4AG1C 1M3BA 2M51A 1B07A 4HVVA 1WYXA 2JMAA 1GCQA 5GJWB 2G6FX 1MV3A 1HD3A 2LJ1A 2EW3A 2M0YA 2GTJA 4Z8AA 1QLYA 2CUBA 1X6BA 4AG2C 2B86A 1ZUKA 2P4RA 1MUZA 1GBRA 1NLOC 1QKWA 4OMOA 2A36A 5IXBA 1KIKA 2DF6A 2D8HA 3M0TA 2A08A 3PVLA 3VS5A 1UJ0A 2OI3A 2LNHB 1NYGA 1UDLA 2DBKA 4AFUC 4J9IA 3NPFA 4CC2A 1BBZA 1ARKA 1RLQC 1UFFA 1AWJA 2O9VA 4IIOA 4J9GA 3REBB 4GLMA 3VRYA 2E5KA 4D8KA 1TG0A 2LJ3A 1AWXA 2X3WD 3ULRB 2AKLA 2O88A 2RMOA 1AEYA 1CKAA 3EG1A 1SRLA 5IH2A 1XOVA 1ZX6A 2KGTA 2OAWA 4EIKA 1WIEA 1JO8A 4AFZC 1NM7A 1UECA 1H3HA 2ESWA 3C0CA 4OMPA 2EYXA 2RN8A 1A0NB 1YCSB 1NEGA 2W0ZA 2CT4A 2J06A 3CQTA 1PKTA 2LJ0A 4IIMA 4J9FA 1WXBA 5ECAA 4RTVA 5IHIA 1AWWA 4ORZA 2DL4A 4X1VA 2CT3A 4A63B 2DJQA 1NEBA 4GBQA 1T0HA 4D8DA 2ED0A 2ECZA 2QDLA 3EG2A 1K0XA 2FEIA 5IHNA 2YUQA 1VYTA 1BB9A 1K4US 4CC4B 2AZVA 5L23A 2CSQA 1NLPC 1WX6A 2O9SA 1SHGA 2JTEA 2KXDA 2J6OA 1Y0MA 3VS7A 4RTWA 3FJ5A 3M0RA 1VA7A 2RQRA 1ZSGA 2D0NA 3LH5A 4ZNXA 1UHCA 1ZBJA 4RUGA 2OJ2A 3KFVA 1TUCA 1UUEA 4OMQA 3O5ZA 1BK2A 4JPBW 2DM1A 1FMKA 1YN8A 3I9QA 1N5ZA 1I07A 4FSSA 1JXMA 2EYWA 2SEMA 2KRNA 3U23A 3VS2A 2SRCA 2CDTA 2JM9A 3PVQA 3PE0A 1SPKA 2MCNA 2DBMA 2LP5A 1ZLMA 2YUPA 1SSHA 1WI7A 2DX1A 1KFZA 2DL8A 1JQQA 2L3PA 3UA7A 2NWMA 2FG0A 4J9DA 1X2KA 2W10A 2BTTA 1J3TA 1AZEA 4DEYA 1Z9ZA 1YP5A 3I5SA 1LCKA 1WDXA 4OMLA 4RTTA 1UHFA 4DEXA 4J9CA 2KRSA 1MV0B 1AWOA 1U5SA 2D1XA 1X69A 5FW9A 1QWEA 2RPNA 3ZL7C 1UE9A 2DLPA 1E7OA 2FRYA 4JJCA 1I1JA 3EG0A 2JS0A 2EBPA 2DRKA 2RF0A 2KXCA 3H0IA 1HJDA 1YNZA 2YT6A 1OEBA 2J6FA 2F2WA 5EC7A 2L2PA 4RTZA 1X2QA 1WA7A 3NGPA 5GJVB 1M27C 1GCQC 1SEMA 2KROA 4RTUA 2L0AA 3RBBB 2AK5A 1JXOA 3REAB 2RQWA 2FPFA 2FRWA 1ZUUA 2VVKA 2JXBA 4AFQC 2A28A 1WFWA 2DL3A 1Z9QA 3VRZA 1M30A 2GGRA 2KYMA 2K2MA 2EYYA 2XMFA 1JU5C 1X43A 2C0IA 3M0QA 5IXFA 1AD5A 1GBQA 1HSQA 5FWCA 2V1QA 1KSWA 2A37A 2I0NA 2LQWA 2EGCA 2GQIA 2LCSA 2EKHA 2FO0A 2K3BA 2L3QA 1U06A 2DE0X 3EHQA 1VYVA 4KRTA 3SEMA 1B3QA 4LNPA 2L3SA 2O31A 2KBTA 2JM8A 2BZXA 2ROTA 2RQUA 4JZ3A 4J9EA 3VS1A 3VS4A 3QWXX 4HXJA 4AFSC 2V1RA 3UF4A 2CREA 4RTYA 3TSZA 2PZ1A 1S1NA 2LQNA 1E6GA 1X6GA 1UGVA 1Y57A 2DILA 4F17A 2HBWA 1PKSA 4E6RA 3M0UA 3M0PA 1PHTA 1YWPA 1T3LA 1RUWA 3JV3A 2C0OA 2F2VA 4LUEA 4F14A 2VKNA 1I0CA 2D8JA 1QCFA 2YUNA 2DYBA 3NMZC 2EGAA 2MOXA 2DMOA 1TUDA 2DL5A 1GFCA 1SRMA 1X27A 1W6XA 5FWBA 4LUDA 3M0SA 3QWYA 2FPDA 1GL5A 4K11A 2X3XD 4Z88A 2GTOA 4HVWA 2K79A 2J6KA 2K6DA 2ABLA 2KRMA 1WXUA 1OPLA 1U3OA 1W1FA 1EFNA 2KNBB 1K0SA 1UJYA 1OV3A 4R0KA 4OMNA 1BU1A 1K76A 3H41A 3VS6A 2YDLA 4RTXA 4Y92A 2CH4A 1KJWA 1OPKA 4JZ4A 1IO6A 1WXTA 1GFDA 2NUZA 3UATA 2ENMA 1AOJA 1M3CA 2H8HA 2VWFA 1UG1A 2KE9A 2O2OA 2DL7A 2CUDA 2K9GA 4Z89A 2HDAA 1NG2A 1E6HA 1K1ZA 2HSPA 1T3SA 2CH4W 5I11A 2F2XA 4M4ZA 4QT7A 2KYBA 2KT8A 4LE9A 3EGUA 1RI9A 3H0HA 4LN2A 2JW4A 2YSQA 4ESRA 2HCKA 2RQTA 4JJBA 4WCIA 2GBQA 3R6NA 5IHKA 2DA9A 2EPDA 3EHRA 3THKA 2IIMA 1AZGB 1PRLC 2LZ6B 4HVUA 4OMMA 2ED1A 2K7AA 1AVZC 1PNJA 2LMJA 2RNAA 1QWFA 1G83A 4J9HA 1YWOA 1M8MA 1PRMC 1ZUYA 2JS2A 1PWTA 1RLPC 1NYFA 4JJDA 2DNUA 1ABOA 2KT1A 1OOTA 3H0FA 1WLPB 3I35A 5I22A 3VS0A 1W70A 4CC3A 1ABQA 2PTKA 4F16A 4CC7A 3IQLA 1CKBA 1M3AA 3VS3A 1SHFA 2EVRA 3I5RA 2FPEA 2DVJA 3SHWA 3A98A 2RQVA
chains in the Genus database with same CATH superfamily
4M75D 1VQ7Q 4FT2A 3FJPA 2PNIA 2XK0A 4MMLA 2EGEA 4M7DB 4J9BA 2QA4A 3A5ZB 1YJWQ 4LDYA 2X4WA 3GBQA 4PFZA 1QCNA 2HEQA 1N9SA 1KC8R 1GCPA 4IUQA 2DRMA 1M2VB 3CEYA 1OZ3A 5EG2A 3RNJA 3JCMg 3TVTA 4R56A 2E12A 1K9MC 5KCHA 4PLIA 4M7AA 3UA6A 2RO0A 4PJOF 1VQOQ 1ZBXA 1UTIA 2DTHA 3OW2S 3OYAA 3NHNA 4VUBA 5A0LA 5HK3A 3G4ST 3EH2A 3DLLA 2JMAA 3LGFA 5J26A 2LT1A 3E2UA 2LJ1A 2CP7A 1D0YA 1WZOA 2GTJA 1WHHA 4M7AD 1I5OB 2GCXA 2CUBA 3EH1A 5HY6A 5KYYA 4C5IA 2LT4A 2R57A 2P4RA 3M54A 4M7DG 1GBRA 3MJXA 2A36A 5IXBA 4JUVA 2YLCA 3PVLA 3VS5A 2RK2A 2LNHB 2V26A 3AHUA 3SDZA 3VV0A 3A8LB 5KE2A 4M77A 3OW2A 1Q86U 4JRQA 1LOJA 2O9VA 3VRYA 4M78E 1M2OA 4D8KA 4BE0A 2LJ3A 1AWXA 1I4K1 2RMOA 1CKAA 3EG1A 3HRTA 3M4YA 3A1PA 5IH2A 1QP2A 1XOVA 1ZX6A 2KGTA 3GNGA 3VJPA 1VQMA 1YIJT 1JO8A 4AFZC 2CP6A 1NM7A 3UDCA 4OMPA 2EYXA 2RN8A 1A0NB 1YCSB 2XD0A 5CR2A 2X51A 5GMKe 4ZTJA 3CQTA 2QQAA 2QYZA 4IIMA 2JZ2A 4M78G 3LH0A 5IHIA 3DLMA 1NEBA 4BI3A 1T0HA 2VXFA 2MAMA 1FMVA 3CXCS 3CCMQ 1ZA2B 2QDLA 2FEIA 3CD6A 1VIEA 1VQ4T 4D6WA 2MPXC 1R8OB 1VQ4Q 2FZGB 3FJ5A 4EDUA 4B6MA 4JRIA 5J3BA 2D0NA 4IKFA 5A0DA 1P92A 1ZBJA 4RUGA 2MK5A 3CBMA 1BK2A 3V8KA 4N0AA 1BIBA 2DM1A 3I9QA 2K2VA 3RMQA 1N5ZA 1YJNA 3U23A 3CC4Q 1GXIE 2BE9B 1QVGS 1VQ6T 1NBEB 2K3YA 2KAFA 7AT1B 1YJWT 5FRNA 2VV5A 2E65A 1G8XA 1TTHB 1I8FA 3QJ6A 2LDMA 2QG9B 4F7UG 3JRZA 2A7YA 1K8AC 2XDDA 3OYNA 1WI7A 1G5VA 2DL8A 3QDRB 1U1TA 3UA7A 4J9DA 4Q5WA 2VYTA 1B34A 2VGNA 4BDYA 1J3TA 2K57A 1Z9ZA 2EJ9A 1D09B 1LCKA 4RCCA 4A54A 4FYXB 2XG8D 5IN1A 1X69A 4XTUA 1YITQ 1M1KR 1QVGA 4MZPA 2PVDB 2COWA 2ATCB 3G4SQ 2LQ8A 4E7IA 1XJWB 5FW9A 2RPNA 2EAYA 1YITT 1UE9A 4KT0E 3ASKA 2YRDA 8AT1B 3OYDA 3KUFA 3H0IA 1X01A 1HJDA 2YT6A 2D0QB 2F2WA 1BI0A 4PJOG 2MYSA 1VQ9Q 2L2PA 4FYYB 5GJVB 4FCYA 3GP8A 2QTXA 1TH7A 3QHSA 1SEMA 1ZHIA 3BY7A 3VKIA 3PMTA 4RTUA 1M90C 1AT1B 1JXOA 2VUBA 1IB8A 2RQWA 2FPFA 3LYIA 4M77E 2DL3A 3CMEQ 1KG1A 1VQ9A 2QQ9A 4MDXA 3JAME 3HRUA 2XMFA 3JSCA 1VQKA 2LQKA 3CCEQ 1GBQA 1HSQA 3EGXB 2V1QA 3PNWC 2A37A 3MEAA 1YIJQ 3EAEA 5FU7B 2LCSA 4ELZC 4KGZB 3I55A 1I5LA 3CCQT 2QASA 3QG1A 4KRTA 3M4GA 3P8HA 4LNPA 3M59A 4JRPA 5CKFA 4C8QC 2JM8A 2BZXA 2EWNA 2QQSA 2ROTA 3C94A 3VS4A 3L2WA 4M75A 1KK7A 3CCMT 3TEEA 2V1RA 2CREA 3QBYA 1W2BP 1RAGB 1E6GA 1RL2A 2LCLA 5D6WA 4F17A 1X6OA 2HBWA 2JN0A 4EPCA 5CKDA 3KBGA 5LJ3j 2A0FB 1K73R 1PHTA 1RUWA 4F14A 1I0CA 3PGGA 5GANh 2BIVA 4J83A 5FU7C 1D1CA 3G6EA 2DMOA 1TUDA 1F1BB 4AT1B 1SRMA 3CPWS 3CCVQ 3M0SA 2RHIA 1MNDA 3CCVT 4K11A 4HVWA 4FYWB 2K6DA 4HT8A 2I2LA 1WXUA 1W1FA 5FLXE 1M4ZA 1K0SA 1UJYA 1OV3A 2K5FA 2KK4A 3MP1A 2CP0A 3H41A 4OB3B 3G1JA 3VS6A 2HD0A 3VUZA 1G3YA 4M78D 4F7UF 3RKYA 2CH4A 3EGDB 2ZPFB 1O75A 3A8OB 1QMCA 4JS4A 4JZ4A 2CZ6B 2NUZA 4ANJA 3P8BB 1Q7YR 1AOJA 2H8HA 2X35A 1Q86R 2CUDA 3CPWA 2OTLA 2K9GA 4TVRA 4KUDK 2Z0WA 4DBRA 2CGHA 5CKEA 1QVFS 2HDAA 4OB1B 1NG2A 1VQLQ 1IHWA 4R55A 2DPPB 4A53A 4E7LA 3Q1JA 4OB2B 2KT8A 1RI9A 1C0MA 3TREA 1Y96A 2JW4A 4QVDA 4BDZA 1N27A 1OI1A 4ESRA 1N8RR 1EX4A 4IUTA 2RQTA 3JCMQ 3OA6A 3JB9I 2EPDA 5KH6A 1M1KU 4XTZA 2COZA 3OS1A 4X34A 1S72T 1PRLC 5CIUA 2ED1A 1RAHB 3PTAA 2QGGA 3CMAA 1IGUA 1PNJA 4V2SA 2RNAA 1QWFA 1PRMC 1ZSZC 3CXCA 1PWTA 4CI0C 1TSFA 4M77G 1M90R 1UEBA 1VIFA 5GAN6 1X75C 1ABQA 3CMET 4MDWA 4F16A 1YCYA 5LJ3h 4EMKA 1CKBA 2R58A 4DOWA 2DK3A 1SHFA 3I5RA 2FPEA 3X25B 5GAN2 1D3BB 3LWHA 1FYNA 1VYUA 3JCMW 3JCMe 2QGFB 4FT4A 2DTOA 2DD4A 2AKKA 1FXXA 1T0JA 2H3JA 2LX7A 2M9UA 5CVIA 3CCQQ 4QVCA 2ROLA 3CCQA 2KVQG 3OMCA 1W2BS 2ZPEB 2J7IA 1Q82C 2KEAA 2E3IA 2YUOA 3CC2Q 2MIOA 2BZ8A 2NUPB 2EQIA 1JBMA 2CSIA 2GNCA 2E1HA 2DFUA 1PD0A 1R0CB 1YHQQ 2WSFE 1CSKA 1Y71A 1QKXA 1PSFA 3OYBA 3EFOB 1IXDA 1MMGA 2HNIA 2M51A 1B07A 4HVVA 3CCUT 4HT9A 1VQ8Q 1GCQA 5GAMd 2G3RA 3OYIA 3OSVA 1YIJA 3OYFA 1WJRA 4BI8B 2QA4T 2DXUA 4J6WA 4ZGEB 4RG2A 1X6BA 2BUDA 3QYHB 2B86A 3H6ZA 2FZCB 1ZUKA 4PKCC 3CC4T 3E9FA 1LVKA 2HQXA 4XTWA 3KXTA 4BY6C 1UDLA 4PFPA 4AFUC 3NPFA 1RAIB 4CC2A 4E7ZA 1ARKA 4WF2A 4XU1A 1VQPA 4IIOA 4J9GA 3REBB 1RABB 4GLMA 4M77D 3L2RA 3I56A 2DVEA 2B8AA 2RA2A 1SRLA 1VQOT 5C6SA 4UC4A 1M9SA 3VUBA 2OAWA 3L1AA 4EIKA 1WIEA 2H3EB 4Y91A 1KQ2A 1N8RU 2P0KA 1NEGA 2W0ZA 1KQSP 2CZ1B 2CT4A 3QUIA 2DTIA 2Y90A 5LJ3g 3L2VA 4BY6B 1WXBA 3QKJA 4WTOB 4M75G 2E5QA 5LL6S 1Q95G 4D8DA 3TCJA 2YHTA 1VQ9T 2ZCFB 4F7UE 5IHNA 1ACMB 2OX7A 2JJ9A 1VYTA 4N0AC 1BB9A 4IURA 4IUUA 5GMKi 4MZMA 5L23A 4C92E 4II1A 1SHGA 3PMIA 4RTWA 5FROA 2QTVA 1R0BG 2RQRA 1ZSGA 4KH0B 3LH5A 3N5BB 4C8QG 3GOXA 1NE8A 1C1AA 3DB3A 2LTOA 1QW1A 1TUCA 4JDSA 3GF5A 4RMOA 4E2FB 1TWBA 5GANg 4B9WA 2F1LA 4FSSA 2CP2A 3CCMA 4M7AB 4BI4A 2DXBA 2HAXA 3QYGB 1H3ZA 2CDTA 1PG5B 5I21A 1FMWA 2L89A 3V7RA 2QAZA 3PE0A 5GAN4 2M1HA 4KULA 1M2VA 4PJOD 4JS5A 2LVMA 3HL8A 4J7FA 3JCMX 1MMNA 2DBMA 4PJNA 4DBFA 5HKCA 2DX1A 1S72A 2XU8A 1JQQA 2L3PA 1VQ7A 1XQHA 2W10A 2GFAA 2P4TA 1R77A 2BTTA 1AZEA 3VYGA 1KHIA 1YP5A 1YHQT 2L3RA 4MMKA 4RTTA 4DEXA 2KRSA 3L2QA 5FU6C 3NFCA 1U5SA 3PIPA 1VQ8T 2MMPA 2OTJA 3ZL7C 2E64A 4JJCA 1UGSB 4M7AC 3LGLA 2JTMA 4M7AF 2AHJB 2J6FA 1TU0B 3OS2A 3CCSA 4DOVA 1Q81R 1KD1R 2XDBA 4C8QA 3TU4K 1M27C 1MGQA 3L2ZA 3NTHA 5A0GA 2LX9A 1RAAB 2KROA 4C92C 1D0XA 5GAOp 2AK5A 3REAB 1UGPB 1MMAA 2F69A 2VVKA 4JLGA 4DBHA 2E3HA 3SFMA 3VRZA 1KQSS 2XHCA 2RI5A 3M0QA 4ZN3A 2M0OA 2MF2A 1Y7XA 3GIBA 4PJOC 5KYWB 1M1FA 4FYVB 5LJ5d 2L3QA 2DE0X 2VC8A 3SEMA 3PT9A 2JUFA 2LNVA 3BDUA 2O31A 3CCRT 3CBPA 3VU3C 2DXCA 2QQBA 2RQUA 4J9EA 3QWXX 3MHXA 2CKKA 3BDLA 3TSZA 4XTXA 2E6NA 4M78C 1M90U 1Y57A 3ER0A 3NTKA 3I56Q 4F7UA 3WXMB 4M7AG 3P8DA 3M0PA 3JV3A 2L5QA 2F2VA 1Y07A 2YXYA 1HK9A 4YTLA 3MPUB 3J81E 3NMZC 1W6XA 3C12A 3CCET 3RERA 3JB9F 4LUDA 1TOVA 4ZGJB 3QWYA 1M1GA 2GTOA 1U3OA 3EG9B 5GAN3 5KYUB 1EFNA 3RESA 3EFOA 2KNBB 5C0MA 4R0KA 4LDWA 1YITA 3MCAB 2CZ0B 5M9OA 4M7DC 1B34B 4FSXA 2LC4A 1VQNT 1Q86C 5GAMf 2RB6A 2XKOC 5CKHA 1OPKA 1IO6A 1YFNA 3PFSA 2ENMA 1K8AR 2VWFA 2KE9A 4LXCA 5GAOn 5D6YA 2V8KA 2Y4YA 4OMFB 1YJ9A 2VASA 2HKQB 2EIFA 3AT1B 5I11A 2F2XA 6AT1B 4M4ZA 1EIFA 4QT7A 4E7HA 3QZ5B 4LN2A 2RHXA 2ZAEA 2YSQA 4A4FA 2CZ7B 3QDFA 2XI9A 4J8OA 4WCIA 4JJBA 2GBQA 3R6NA 2P0QA 1VQKT 2DA9A 3QXEB 5FRMA 3EHRA 4BUGA 5GANf 5GANj 4PNOA 1VQKQ 2IIMA 2LZ6B 2PVGB 2ZGWA 2ZPGB 1AVZC 2FHDA 5D6XA 2LMJA 4C92G 4M78B 1YWOA 3JB9H 3CCLT 5KYXB 2JS2A 2CS7A 4JJDA 2DNUA 2XDPA 3H0FA 4BB7A 4XAXB 1FX7A 5I22A 1W70A 5HK0A 4M7AE 1VQMQ 4M78A 1RADB 2PTKA 1N8RC 4OVAA 1M3AA 5DLOA 2EVRA 3SHWA 2RQVA 2DZCA 1U8RA 1VQLT 3E9GA 1QP3A 2JMCA 2JT4A 4XU0A 2BKDN 4PJOE 2IG0A 3TSWA 3JCMh 5HCKA 2AZSA 3RIRA 5GAMj 1GRIA 2EJFA 3CCRQ 1KQ1A 2K3XA 1QCOA 2J05A 1C6VX 4N4GA 2BZYA 3L42A 2AT1B 1VQPT 2KR3A 1H8KA 4C5HA 3CPWP 1K9AA 1VQPQ 1M3BA 5KYUA 3I56T 1JJ2P 2WACA 3WVEB 4DQ2A 1N9RA 1VQ5A 1WYXA 5GJWB 1HD3A 2EW3A 2EFIA 2M0YA 2CP5A 2JVVA 1QLYA 2HQHA 4E7KA 1WHMA 3HTRA 4XTVA 3OBYA 1NZ9A 3C95A 3G6EQ 1MUZA 1QKWA 4OMOA 1IHVA 2DF6A 2D8HA 3OY9A 3MP6A 1BCOA 2A08A 3G6ET 1M1KC 1UJ0A 2RM4A 2WSEE 1NYGA 2DBKA 4J9IA 1BBZA 2JNGA 3META 3CC2T 4Y28E 2FVUA 2XICA 1K9MR 1PSEA 1KD1U 3CC7A 2QEXT 5GANd 4OB0B 2AIRB 3ULRB 2O88A 4RCBA 5KCOA 3OYHA 4C8QE 4JRKA 2D9TA 4C92B 3S3NA 3DB4A 1MNEA 3C0CA 1YI2A 3CCUQ 4M7DA 2J06A 1PKTA 2QA4Q 4RTVA 1UGRB 2VXEA 4ORZA 3INZA 4X1VA 4C0DB 2YRVA 3UPUA 3MO8A 4A63B 4J5YA 4GBQA 5DY9A 2RJCA 2ED0A 4HCZA 2ECZA 2O01E 4A4KA 2RI2A 5GAN5 4A4EA 2DAQA 5GMKl 2YUQA 3WVDB 2YWWA 1JB0E 1K4US 4CC4B 2AZVA 1G3SA 5L8RE 5LJ5e 2O9SA 3EFRA 2E6ZA 2JTEA 3VS7A 5CQYA 1Q7YU 1VA7A 3O8VA 4KGXB 1H641 2OJ2A 3KFVA 3A8MB 1LNXA 4O6JA 4LD9K 4PJLA 3O5ZA 4DBQA 2E10A 1FMKA 2K5IA 2RH2A 1IGQA 1YN8A 2Y4XA 1JXMA 2PQWA 4NS5A 2NUTB 2KRNA 2EQJA 3SWNB 3VS2A 2SRCA 4QKUA 2X4JA 3CMEA 9ATCB 1D1BA 4C0FA 2JM9A 3PVQA 1WQWA 3R6OA 1VQ8A 2NLUA 2MCNA 2HMAA 4EMHA 1YBYA 3H8ZA 1ZLMA 2YUPA 1RAEB 2DEUA 2HSEB 2R5AA 2OTLQ 2CP3A 2NWMA 2FG0A 3OS0A 3RKXA 4XK8E 3UT1A 4M75E 3EGXA 3ZEHA 3I5SA 1UHFA 3RDVA 3HP9A 4J9CA 1MV0B 1AWOA 3TQ7P 1SKUB 2FZKB 3OYMA 3DKMA 3X24B 4B9XA 1I81A 1WHLA 1E7OA 1TXQA 1I1JA 1WHGA 2JS0A 2EBPA 4BE1A 2RF0A 3X28B 1OU8A 4EMKC 3JCMd 2E41A 2NUTA 5DLQE 1WA7A 3NGPA 4C5GA 2O4XA 5CCAA 3CC7Q 4EMGA 1BIAA 3OS5A 2ZPIB 4ZN1A 1W2BA 1ZQ1A 2RJFA 3HHTB 1G3WA 4BE2A 3JCMf 1Q81U 4M7DF 4BD3A 1ZUUA 3SD4A 5CO7A 4LD6A 2A28A 2X4YA 1M30A 2QEXQ 2GGRA 2KYMA 3OYEA 2K2MA 2EYYA 4HA8A 1X43A 4FL6A 4JLIA 5IXFA 2COYA 1KSWA 4PL6A 5GAOq 2LQWA 2EGCA 2GQIA 4XQ3A 2EYQA 5GAN7 4KGVB 4PJJA 2EKHA 2FO0A 1BI2A 1U06A 1ZA1B 2RK1A 4M77F 3EHQA 3I55T 1VYVA 4HKEA 4M7DE 4NL3A 4F04B 1M5Q1 1B3QA 4N4HA 4PJOB 2KBTA 1MHNA 3RUXA 3HKSA 4JZ3A 3CCEA 3VS1A 3CMAQ 1D1AA 4XU2A 3UF4A 2ZPHB 1KD1C 2PZ1A 1S1NA 2LQNA 2PUKB 4QQGA 1UGVA 2DILA 3CC2A 1Q7YC 3V8JA 1PKSA 3CCLQ 3QIIA 5KE3A 4F7UB 3M0UA 2EQMA 3FB9A 4C5EA 4PK4A 1T3LA 3OYKA 2C0OA 4LDXA 2D8JA 4C0ZA 2EGAA 1VQMT 1RACB 1YJ9T 3V8LA 2DL5A 1GFCA 1X27A 3JCMb 5FWBA 2PUOB 1ZSZB 1QVFA 2DKGA 2J6KA 4GY5A 3JCMP 2MWPA 3EG9A 4GLKA 1LJOA 1HXDA 1AHJB 4QW2A 4C92F 1K8AU 2ZPBB 1K76A 4AMCA 2YDLA 5GMKh 1HYOA 4RTXA 2X4XA 1JRIA 1K73C 4O5VA 3J7AF 1QQJA 2OTLT 1VQOA 4M77B 1M3CA 2MWOA 2RHUA 1UG1A 2O2OA 2DL7A 4M78F 2DD5A 3OYCA 3JB9G 4C92D 3MP8A 5AYFA 1K1ZA 2IVWA 5GAOl 2CH4W 4JJNK 1PC0A 1QVPA 4LE9A 5D7UA 3GPLA 1KC8C 2X9HA 5GMKj 1UGQB 3F70A 4OGEA 2HCKA 2QI2A 4E47A 5IHKA 3G7ZA 2F5TX 3M57A 1D3BA 3QZ9B 2MI6A 4HVUA 1Y96B 1B7TA 2QDYB 1PCXA 3OYJA 4C0DC 5GAOm 1W4SA 3FEOA 4J7IA 4DA4A 4C92A 4QVZA 1VQNQ 4FW1A 2YRCA 1RLPC 1NYFA 1WPYA 2KT1A 1OOTA 3EGDA 3I35A 2NYSA 1JJ2A 4C0GA 3V7CA 4CC3A 3FRNA 1RAFB 3CCSQ 8ATCB 4E7JA 4CC7A 1OYXA 4Z02A 4X9CA 5IAYA 2DVJA 4P5NA 5GAN8 2YLBA 2R5MA 5GAMe 5I2MA 4HCCA 4FW2A 1NPPA 1VQ5Q 5J39A 3S3OA 3ME9A 1OU9A 2C0TA 4L6V5 4EMKB 2P0PA 4OGCA 1JEGA 1VQ5T 3I55Q 1Q82R 1NPRA 2EYZA 3A8HB 2GF7A 4HCKA 3OQ5A 4X9DA 3FLGA 3MEWA 2L8DA 2HL3A 5LJ5h 3EG3A 1G2BA 3MEVA 1H92A 2RI3A 3E19A 3SWNA 2HBPA 3JB9D 3SB2A 1V1CA 4J6XA 4AG1C 2OTJQ 4ZTFA 3ZFJA 3G71A 2OTJT 2QK0A 1VQNA 2G6FX 1MV3A 5LJ3e 1YJWA 2CYZB 4PJMA 4Z8AA 4HCBA 2ZZDA 4IUVA 4AG2C 5GAMh 3CCRA 1RI0A 2M16A 3HPWA 1NLOC 1K9MU 1KIKA 3M0TA 1OZ2A 2OI3A 5LJ5g 3GLXA 1MMDA 4CRIA 3A8GB 4PLLA 1RLQC 2RHZA 1UFFA 1AWJA 4ME7A 3M53A 4OP0A 2E5KA 3CCJA 2V8JA 1TG0A 2X3WD 2VGMA 5CK9A 3CD6Q 2AKLA 1AEYA 1WHJA 4FU6A 4E7SA 1DJ7B 1U1SA 3CD6T 5GANe 3C4SA 1UECA 1H3HA 2ESWA 1VQ7T 1M8VA 1NJIR 2K4YA 1IREB 3X20B 5I2SA 4L59A 1JJ2S 1PD1A 2LJ0A 4NOYA 2WSCE 1BKBA 4J9FA 4M7DD 5ECAA 2FL7A 1AWWA 1WJQA 2DL4A 2EJGA 1YJNT 2CT3A 3T9NA 2DJQA 2KI7A 2QXFA 1YJNQ 3HFNA 3SWNC 3JB9J 3EG2A 1K0XA 1SSFA 2D6FA 3M56A 2C06A 3OYGA 4XU3A 2M02A 2DXTA 2CSQA 2DIQA 1NLPC 1WX6A 3CXCP 2KXDA 2J6OA 1Y0MA 3M0RA 5IT9E 4ZNXA 2FYKA 5KYNA 1UHCA 2GQVA 5AT1B 1UUEA 1VOMA 4OMQA 4JPBW 3S3MA 2NUPA 3OMGA 2DIGA 1I07A 2K5LA 1KC8U 2EYWA 2SEMA 3QO3A 1UB4A 3G4SA 2VB6A 2KY9A 1FWZA 3RMSA 5LJ3d 3M58A 1SPKA 2HQEA 1VQLA 1VQ4A 2LP5A 1SSHA 2HL5C 1KFZA 2KQWA 5LJ5f 3L2UA 2KDSA 3FDRA 1K73U 3J80E 1X2KA 5FU6B 1IRXA 1IZ6A 5CAIA 2DJZA 4A4HA 4DEYA 4M75C 3UWNA 1TUGB 4OMLA 1WDXA 1V76A 2EKOA 3JCMV 2RD1A 2D1XA 3CPFA 4PFOA 4KH1B 4M77C 3EFSA 5GMKm 3CCUA 1QWEA 5A2QE 2DLPA 2FRYA 3HFOA 3EG0A 1YJ9Q 4ATOA 1N6AA 2QQRA 2LCCA 2P84A 2DRKA 4IUPA 5KYXA 2KXCA 1BYMA 1YNZA 1OEBA 4QQ6A 5EC7A 2HKNA 4RTZA 1Q82U 1X2QA 1Q81C 3RR6A 2OAUA 3NTIA 1WNLA 2DERA 1GCQC 2A3LA 2XIDA 2HZYA 4A4GA 4NL2A 2L0AA 1ZSZA 2E70A 4KBMB 4MZTA 3RBBB 5LJ5j 1QVFP 2FRWA 4XTYA 2JXBA 4AFQC 1WFWA 1Z9QA 2LRQA 4LDUA 2JTFA 3X26B 4ELYC 1JU5C 2C0IA 3V7SA 1AD5A 3JCMJ 3M55A 5FWCA 2I0NA 3ZBDA 3LX7A 3MEUA 4C8QB 1VQ6Q 2K3BA 1BI1A 2E4HA 3E1SA 3QSUA 1KHCA 3D7SB 2JOYA 1OQKA 4QQDA 2L3SA 2IPOB 3M5AA 5CQXA 3FIFA 4PJOA 2KMTA 1TS9A 3OBWA 1YHQA 1QVGP 2V8IA 2DO3A 1SF9A 4L5GA 4HXJA 4AFSC 3CC7T 4RTYA 2QEXA 3FC3A 1SG5A 1X6GA 1WGSA 2DZ9A 4E6RA 2DETA 1YWPA 1YI2T 3OSSC 4LUEA 5KYYB 1PM3A 2VKNA 3CC4A 1QCFA 3BFMA 1YI2Q 2YUNA 2DYBA 3CCST 3QJYA 1D0ZA 1WQ7A 4M75B 2MOXA 1WJSA 3JCMc 4C8QD 2FPDA 1GL5A 2X3XD 4Z88A 4ZGDB 3LWIA 2K79A 3QPHA 2ABLA 2FB7A 2KRMA 1OPLA 4RKUE 3CCJT 5GAOr 1S72Q 1OX9A 4BACA 1O9SA 1V29B 3CCJQ 3G71Q 2RHYA 4OMNA 1BU1A 1EZZB 3H9NA 3G71T 4OF1A 4Y92A 2GFUA 3CMAT 1KJWA 1WXTA 1GFDA 4N4IA 4RG8A 2DEQA 3UATA 3MKDA 3BE3A 3BW1A 3GNFB 4M75F 5CKBA 1VUBA 1NJIC 3CCVA 1BI3A 2PVOB 4Z89A 1E6HA 4FM4B 2HSPA 1T3SA 5LJ3f 2EQKA 2RJEA 2RJDA 3VYHB 3RKWA 1KQSA 3M9QA 2KYBA 2KSSA 1OX8A 3EGUA 1VQ6A 3H0HA 2DYIA 3PIOA 2F5KA 2BE7D 1XTDA 4C8QF 1XNIA 5KYWA 1LPLA 3LLRA 3THKA 1BCMA 1AZGB 4LDVA 2O4XB 4OMMA 3HRSA 4FIBA 2K7AA 2PU9B 3OYLA 5DM7R 1G83A 4J9HA 1M8MA 1ZUYA 4KUIA 5GAMg 1OULA 3LW5E 3CCLA 1WHKA 3CBOA 1G3TA 1ABOA 2EQUA 1WLPB 1NJIU 3VS0A 3OB9A 3OW2P 3S6WA 3HSBA 3IQLA 4J6YA 3VS3A 3A98A 3URGA 3OYYA
chains in the Genus database with same CATH topology
1FYNA 1VYUA 2PNIA 2JMCA 2EGEA 4J9BA 2AKKA 2C0TA 2JT4A 1T0JA 2LX7A 3GBQA 2ROLA 1JEGA 2HEQA 2J7IA 2EYZA 2KEAA 3TSWA 1GCPA 2YUOA 2DRMA 5HCKA 2AZSA 4HCKA 1GRIA 2MIOA 2BZ8A 2EQIA 3RNJA 2CSIA 2J05A 3TVTA 2GNCA 2BZYA 3EG3A 1G2BA 1H92A 3UA6A 1UTIA 1CSKA 2KR3A 1QKXA 1V1CA 1H8KA 1K9AA 3NHNA 4AG1C 1M3BA 2M51A 1B07A 4HVVA 1WYXA 2JMAA 1GCQA 5GJWB 2G6FX 1MV3A 1HD3A 2LJ1A 2EW3A 2M0YA 2GTJA 4Z8AA 1QLYA 2CUBA 1X6BA 4AG2C 2B86A 1ZUKA 2P4RA 1MUZA 1GBRA 1NLOC 1QKWA 4OMOA 2A36A 5IXBA 1KIKA 2DF6A 2D8HA 3M0TA 2A08A 3PVLA 3VS5A 1UJ0A 2OI3A 2LNHB 1NYGA 1UDLA 2DBKA 4AFUC 4J9IA 3NPFA 4CC2A 1BBZA 1ARKA 1RLQC 1UFFA 1AWJA 2O9VA 4IIOA 4J9GA 3REBB 4GLMA 3VRYA 2E5KA 4D8KA 1TG0A 2LJ3A 1AWXA 2X3WD 3ULRB 2AKLA 2O88A 2RMOA 1AEYA 1CKAA 3EG1A 1SRLA 5IH2A 1XOVA 1ZX6A 2KGTA 2OAWA 4EIKA 1WIEA 1JO8A 4AFZC 1NM7A 1UECA 1H3HA 2ESWA 3C0CA 4OMPA 2EYXA 2RN8A 1A0NB 1YCSB 1NEGA 2W0ZA 2CT4A 2J06A 3CQTA 1PKTA 2LJ0A 4IIMA 4J9FA 1WXBA 5ECAA 4RTVA 5IHIA 1AWWA 4ORZA 2DL4A 4X1VA 2CT3A 4A63B 2DJQA 1NEBA 4GBQA 1T0HA 4D8DA 2ED0A 2ECZA 2QDLA 3EG2A 1K0XA 2FEIA 5IHNA 2YUQA 1VYTA 1BB9A 1K4US 4CC4B 2AZVA 5L23A 2CSQA 1NLPC 1WX6A 2O9SA 1SHGA 2JTEA 2KXDA 2J6OA 1Y0MA 3VS7A 4RTWA 3FJ5A 3M0RA 1VA7A 2RQRA 1ZSGA 2D0NA 3LH5A 4ZNXA 1UHCA 1ZBJA 4RUGA 2OJ2A 3KFVA 1TUCA 1UUEA 4OMQA 3O5ZA 1BK2A 4JPBW 2DM1A 1FMKA 1YN8A 3I9QA 1N5ZA 1I07A 4FSSA 1JXMA 2EYWA 2SEMA 2KRNA 3U23A 3VS2A 2SRCA 2CDTA 2JM9A 3PVQA 3PE0A 1SPKA 2MCNA 2DBMA 2LP5A 1ZLMA 2YUPA 1SSHA 1WI7A 2DX1A 1KFZA 2DL8A 1JQQA 2L3PA 3UA7A 2NWMA 2FG0A 4J9DA 1X2KA 2W10A 2BTTA 1J3TA 1AZEA 4DEYA 1Z9ZA 1YP5A 3I5SA 1LCKA 1WDXA 4OMLA 4RTTA 1UHFA 4DEXA 4J9CA 2KRSA 1MV0B 1AWOA 1U5SA 2D1XA 1X69A 5FW9A 1QWEA 2RPNA 3ZL7C 1UE9A 2DLPA 1E7OA 2FRYA 4JJCA 1I1JA 3EG0A 2JS0A 2EBPA 2DRKA 2RF0A 2KXCA 3H0IA 1HJDA 1YNZA 2YT6A 1OEBA 2J6FA 2F2WA 5EC7A 2L2PA 4RTZA 1X2QA 1WA7A 3NGPA 5GJVB 1M27C 1GCQC 1SEMA 2KROA 4RTUA 2L0AA 3RBBB 2AK5A 1JXOA 3REAB 2RQWA 2FPFA 2FRWA 1ZUUA 2VVKA 2JXBA 4AFQC 2A28A 1WFWA 2DL3A 1Z9QA 3VRZA 1M30A 2GGRA 2KYMA 2K2MA 2EYYA 2XMFA 1JU5C 1X43A 2C0IA 3M0QA 5IXFA 1AD5A 1GBQA 1HSQA 5FWCA 2V1QA 1KSWA 2A37A 2I0NA 2LQWA 2EGCA 2GQIA 2LCSA 2EKHA 2FO0A 2K3BA 2L3QA 1U06A 2DE0X 3EHQA 1VYVA 4KRTA 3SEMA 1B3QA 4LNPA 2L3SA 2O31A 2KBTA 2JM8A 2BZXA 2ROTA 2RQUA 4JZ3A 4J9EA 3VS1A 3VS4A 3QWXX 4HXJA 4AFSC 2V1RA 3UF4A 2CREA 4RTYA 3TSZA 2PZ1A 1S1NA 2LQNA 1E6GA 1X6GA 1UGVA 1Y57A 2DILA 4F17A 2HBWA 1PKSA 4E6RA 3M0UA 3M0PA 1PHTA 1YWPA 1T3LA 1RUWA 3JV3A 2C0OA 2F2VA 4LUEA 4F14A 2VKNA 1I0CA 2D8JA 1QCFA 2YUNA 2DYBA 3NMZC 2EGAA 2MOXA 2DMOA 1TUDA 2DL5A 1GFCA 1SRMA 1X27A 1W6XA 5FWBA 4LUDA 3M0SA 3QWYA 2FPDA 1GL5A 4K11A 2X3XD 4Z88A 2GTOA 4HVWA 2K79A 2J6KA 2K6DA 2ABLA 2KRMA 1WXUA 1OPLA 1U3OA 1W1FA 1EFNA 2KNBB 1K0SA 1UJYA 1OV3A 4R0KA 4OMNA 1BU1A 1K76A 3H41A 3VS6A 2YDLA 4RTXA 4Y92A 2CH4A 1KJWA 1OPKA 4JZ4A 1IO6A 1WXTA 1GFDA 2NUZA 3UATA 2ENMA 1AOJA 1M3CA 2H8HA 2VWFA 1UG1A 2KE9A 2O2OA 2DL7A 2CUDA 2K9GA 4Z89A 2HDAA 1NG2A 1E6HA 1K1ZA 2HSPA 1T3SA 2CH4W 5I11A 2F2XA 4M4ZA 4QT7A 2KYBA 2KT8A 4LE9A 3EGUA 1RI9A 3H0HA 4LN2A 2JW4A 2YSQA 4ESRA 2HCKA 2RQTA 4JJBA 4WCIA 2GBQA 3R6NA 5IHKA 2DA9A 2EPDA 3EHRA 3THKA 2IIMA 1AZGB 1PRLC 2LZ6B 4HVUA 4OMMA 2ED1A 2K7AA 1AVZC 1PNJA 2LMJA 2RNAA 1QWFA 1G83A 4J9HA 1YWOA 1M8MA 1PRMC 1ZUYA 2JS2A 1PWTA 1RLPC 1NYFA 4JJDA 2DNUA 1ABOA 2KT1A 1OOTA 3H0FA 1WLPB 3I35A 5I22A 3VS0A 1W70A 4CC3A 1ABQA 2PTKA 4F16A 4CC7A 3IQLA 1CKBA 1M3AA 3VS3A 1SHFA 2EVRA 3I5RA 2FPEA 2DVJA 3SHWA 3A98A 2RQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FYN A;  1VYU A;  2PNI A;  2JMC A;  2EGE A;  4J9B A;  2AKK A;  2C0T A;  2JT4 A;  1T0J A;  2LX7 A;  3GBQ A;  2ROL A;  1JEG A;  2HEQ A;  2J7I A;  2EYZ A;  2KEA A;  3TSW A;  1GCP A;  2YUO A;  2DRM A;  5HCK A;  2AZS A;  4HCK A;  1GRI A;  2MIO A;  2BZ8 A;  2EQI A;  3RNJ A;  2CSI A;  2J05 A;  3TVT A;  2GNC A;  2BZY A;  3EG3 A;  1G2B A;  1H92 A;  3UA6 A;  1UTI A;  1CSK A;  2KR3 A;  1QKX A;  1V1C A;  1H8K A;  1K9A A;  3NHN A;  4AG1 C;  1M3B A;  2M51 A;  1B07 A;  4HVV A;  1WYX A;  2JMA A;  1GCQ A;  5GJW B;  2G6F X;  1MV3 A;  1HD3 A;  2LJ1 A;  2EW3 A;  2M0Y A;  2GTJ A;  4Z8A A;  1QLY A;  2CUB A;  1X6B A;  4AG2 C;  2B86 A;  1ZUK A;  2P4R A;  1MUZ A;  1GBR A;  1NLO C;  1QKW A;  4OMO A;  2A36 A;  5IXB A;  1KIK A;  2DF6 A;  2D8H A;  3M0T A;  2A08 A;  3PVL A;  3VS5 A;  1UJ0 A;  2OI3 A;  2LNH B;  1NYG A;  1UDL A;  2DBK A;  4AFU C;  4J9I A;  3NPF A;  4CC2 A;  1BBZ A;  1ARK A;  1RLQ C;  1UFF A;  1AWJ A;  2O9V A;  4IIO A;  4J9G A;  3REB B;  4GLM A;  3VRY A;  2E5K A;  4D8K A;  1TG0 A;  2LJ3 A;  1AWX A;  2X3W D;  3ULR B;  2AKL A;  2O88 A;  2RMO A;  1AEY A;  1CKA A;  3EG1 A;  1SRL A;  5IH2 A;  1XOV A;  1ZX6 A;  2KGT A;  2OAW A;  4EIK A;  1WIE A;  1JO8 A;  4AFZ C;  1NM7 A;  1UEC A;  1H3H A;  2ESW A;  3C0C A;  4OMP A;  2EYX A;  2RN8 A;  1A0N B;  1YCS B;  1NEG A;  2W0Z A;  2CT4 A;  2J06 A;  3CQT A;  1PKT A;  2LJ0 A;  4IIM A;  4J9F A;  1WXB A;  5ECA A;  4RTV A;  5IHI A;  1AWW A;  4ORZ A;  2DL4 A;  4X1V A;  2CT3 A;  4A63 B;  2DJQ A;  1NEB A;  4GBQ A;  1T0H A;  4D8D A;  2ED0 A;  2ECZ A;  2QDL A;  3EG2 A;  1K0X A;  2FEI A;  5IHN A;  2YUQ A;  1VYT A;  1BB9 A;  1K4U S;  4CC4 B;  2AZV A;  5L23 A;  2CSQ A;  1NLP C;  1WX6 A;  2O9S A;  1SHG A;  2JTE A;  2KXD A;  2J6O A;  1Y0M A;  3VS7 A;  4RTW A;  3FJ5 A;  3M0R A;  1VA7 A;  2RQR A;  1ZSG A;  2D0N A;  3LH5 A;  4ZNX A;  1UHC A;  1ZBJ A;  4RUG A;  2OJ2 A;  3KFV A;  1TUC A;  1UUE A;  4OMQ A;  3O5Z A;  1BK2 A;  4JPB W;  2DM1 A;  1FMK A;  1YN8 A;  3I9Q A;  1N5Z A;  1I07 A;  4FSS A;  1JXM A;  2EYW A;  2SEM A;  2KRN A;  3U23 A;  3VS2 A;  2SRC A;  2CDT A;  2JM9 A;  3PVQ A;  3PE0 A;  1SPK A;  2MCN A;  2DBM A;  2LP5 A;  1ZLM A;  2YUP A;  1SSH A;  1WI7 A;  2DX1 A;  1KFZ A;  2DL8 A;  1JQQ A;  2L3P A;  3UA7 A;  2NWM A;  2FG0 A;  4J9D A;  1X2K A;  2W10 A;  2BTT A;  1J3T A;  1AZE A;  4DEY A;  1Z9Z A;  1YP5 A;  3I5S A;  1LCK A;  1WDX A;  4OML A;  4RTT A;  1UHF A;  4DEX A;  4J9C A;  2KRS A;  1MV0 B;  1AWO A;  1U5S A;  2D1X A;  1X69 A;  5FW9 A;  1QWE A;  2RPN A;  3ZL7 C;  1UE9 A;  2DLP A;  1E7O A;  2FRY A;  4JJC A;  1I1J A;  3EG0 A;  2JS0 A;  2EBP A;  2DRK A;  2RF0 A;  2KXC A;  3H0I A;  1HJD A;  1YNZ A;  2YT6 A;  1OEB A;  2J6F A;  2F2W A;  5EC7 A;  2L2P A;  4RTZ A;  1X2Q A;  1WA7 A;  3NGP A;  5GJV B;  1M27 C;  1GCQ C;  1SEM A;  2KRO A;  4RTU A;  2L0A A;  3RBB B;  2AK5 A;  1JXO A;  3REA B;  2RQW A;  2FPF A;  2FRW A;  1ZUU A;  2VVK A;  2JXB A;  4AFQ C;  2A28 A;  1WFW A;  2DL3 A;  1Z9Q A;  3VRZ A;  1M30 A;  2GGR A;  2KYM A;  2K2M A;  2EYY A;  2XMF A;  1JU5 C;  1X43 A;  2C0I A;  3M0Q A;  5IXF A;  1AD5 A;  1GBQ A;  1HSQ A;  5FWC A;  2V1Q A;  1KSW A;  2A37 A;  2I0N A;  2LQW A;  2EGC A;  2GQI A;  2LCS A;  2EKH A;  2FO0 A;  2K3B A;  2L3Q A;  1U06 A;  2DE0 X;  3EHQ A;  1VYV A;  4KRT A;  3SEM A;  1B3Q A;  4LNP A;  2L3S A;  2O31 A;  2KBT A;  2JM8 A;  2BZX A;  2ROT A;  2RQU A;  4JZ3 A;  4J9E A;  3VS1 A;  3VS4 A;  3QWX X;  4HXJ A;  4AFS C;  2V1R A;  3UF4 A;  2CRE A;  4RTY A;  3TSZ A;  2PZ1 A;  1S1N A;  2LQN A;  1E6G A;  1X6G A;  1UGV A;  1Y57 A;  2DIL A;  4F17 A;  2HBW A;  1PKS A;  4E6R A;  3M0U A;  3M0P A;  1PHT A;  1YWP A;  1T3L A;  1RUW A;  3JV3 A;  2C0O A;  2F2V A;  4LUE A;  4F14 A;  2VKN A;  1I0C A;  2D8J A;  1QCF A;  2YUN A;  2DYB A;  3NMZ C;  2EGA A;  2MOX A;  2DMO A;  1TUD A;  2DL5 A;  1GFC A;  1SRM A;  1X27 A;  1W6X A;  5FWB A;  4LUD A;  3M0S A;  3QWY A;  2FPD A;  1GL5 A;  4K11 A;  2X3X D;  4Z88 A;  2GTO A;  4HVW A;  2K79 A;  2J6K A;  2K6D A;  2ABL A;  2KRM A;  1WXU A;  1OPL A;  1U3O A;  1W1F A;  1EFN A;  2KNB B;  1K0S A;  1UJY A;  1OV3 A;  4R0K A;  4OMN A;  1BU1 A;  1K76 A;  3H41 A;  3VS6 A;  2YDL A;  4RTX A;  4Y92 A;  2CH4 A;  1KJW A;  1OPK A;  4JZ4 A;  1IO6 A;  1WXT A;  1GFD A;  2NUZ A;  3UAT A;  2ENM A;  1AOJ A;  1M3C A;  2H8H A;  2VWF A;  1UG1 A;  2KE9 A;  2O2O A;  2DL7 A;  2CUD A;  2K9G A;  4Z89 A;  2HDA A;  1NG2 A;  1E6H A;  1K1Z A;  2HSP A;  1T3S A;  2CH4 W;  5I11 A;  2F2X A;  4M4Z A;  4QT7 A;  2KYB A;  2KT8 A;  4LE9 A;  3EGU A;  1RI9 A;  3H0H A;  4LN2 A;  2JW4 A;  2YSQ A;  4ESR A;  2HCK A;  2RQT A;  4JJB A;  4WCI A;  2GBQ A;  3R6N A;  5IHK A;  2DA9 A;  2EPD A;  3EHR A;  3THK A;  2IIM A;  1AZG B;  1PRL C;  2LZ6 B;  4HVU A;  4OMM A;  2ED1 A;  2K7A A;  1AVZ C;  1PNJ A;  2LMJ A;  2RNA A;  1QWF A;  1G83 A;  4J9H A;  1YWO A;  1M8M A;  1PRM C;  1ZUY A;  2JS2 A;  1PWT A;  1RLP C;  1NYF A;  4JJD A;  2DNU A;  1ABO A;  2KT1 A;  1OOT A;  3H0F A;  1WLP B;  3I35 A;  5I22 A;  3VS0 A;  1W70 A;  4CC3 A;  1ABQ A;  2PTK A;  4F16 A;  4CC7 A;  3IQL A;  1CKB A;  1M3A A;  3VS3 A;  1SHF A;  2EVR A;  3I5R A;  2FPE A;  2DVJ A;  3SHW A;  3A98 A;  2RQV A; 
#chains in the Genus database with same CATH topology
 4M75 D;  1VQ7 Q;  4FT2 A;  3FJP A;  2PNI A;  2XK0 A;  4MML A;  2EGE A;  4M7D B;  4J9B A;  2QA4 A;  3A5Z B;  1YJW Q;  4LDY A;  2X4W A;  3GBQ A;  4PFZ A;  1QCN A;  2HEQ A;  1N9S A;  1KC8 R;  1GCP A;  4IUQ A;  2DRM A;  1M2V B;  3CEY A;  1OZ3 A;  5EG2 A;  3RNJ A;  3JCM g;  3TVT A;  4R56 A;  2E12 A;  1K9M C;  5KCH A;  4PLI A;  4M7A A;  3UA6 A;  2RO0 A;  4PJO F;  1VQO Q;  1ZBX A;  1UTI A;  2DTH A;  3OW2 S;  3OYA A;  3NHN A;  4VUB A;  5A0L A;  5HK3 A;  3G4S T;  3EH2 A;  3DLL A;  2JMA A;  3LGF A;  5J26 A;  2LT1 A;  3E2U A;  2LJ1 A;  2CP7 A;  1D0Y A;  1WZO A;  2GTJ A;  1WHH A;  4M7A D;  1I5O B;  2GCX A;  2CUB A;  3EH1 A;  5HY6 A;  5KYY A;  4C5I A;  2LT4 A;  2R57 A;  2P4R A;  3M54 A;  4M7D G;  1GBR A;  3MJX A;  2A36 A;  5IXB A;  4JUV A;  2YLC A;  3PVL A;  3VS5 A;  2RK2 A;  2LNH B;  2V26 A;  3AHU A;  3SDZ A;  3VV0 A;  3A8L B;  5KE2 A;  4M77 A;  3OW2 A;  1Q86 U;  4JRQ A;  1LOJ A;  2O9V A;  3VRY A;  4M78 E;  1M2O A;  4D8K A;  4BE0 A;  2LJ3 A;  1AWX A;  1I4K 1;  2RMO A;  1CKA A;  3EG1 A;  3HRT A;  3M4Y A;  3A1P A;  5IH2 A;  1QP2 A;  1XOV A;  1ZX6 A;  2KGT A;  3GNG A;  3VJP A;  1VQM A;  1YIJ T;  1JO8 A;  4AFZ C;  2CP6 A;  1NM7 A;  3UDC A;  4OMP A;  2EYX A;  2RN8 A;  1A0N B;  1YCS B;  2XD0 A;  5CR2 A;  2X51 A;  5GMK e;  4ZTJ A;  3CQT A;  2QQA A;  2QYZ A;  4IIM A;  2JZ2 A;  4M78 G;  3LH0 A;  5IHI A;  3DLM A;  1NEB A;  4BI3 A;  1T0H A;  2VXF A;  2MAM A;  1FMV A;  3CXC S;  3CCM Q;  1ZA2 B;  2QDL A;  2FEI A;  3CD6 A;  1VIE A;  1VQ4 T;  4D6W A;  2MPX C;  1R8O B;  1VQ4 Q;  2FZG B;  3FJ5 A;  4EDU A;  4B6M A;  4JRI A;  5J3B A;  2D0N A;  4IKF A;  5A0D A;  1P92 A;  1ZBJ A;  4RUG A;  2MK5 A;  3CBM A;  1BK2 A;  3V8K A;  4N0A A;  1BIB A;  2DM1 A;  3I9Q A;  2K2V A;  3RMQ A;  1N5Z A;  1YJN A;  3U23 A;  3CC4 Q;  1GXI E;  2BE9 B;  1QVG S;  1VQ6 T;  1NBE B;  2K3Y A;  2KAF A;  7AT1 B;  1YJW T;  5FRN A;  2VV5 A;  2E65 A;  1G8X A;  1TTH B;  1I8F A;  3QJ6 A;  2LDM A;  2QG9 B;  4F7U G;  3JRZ A;  2A7Y A;  1K8A C;  2XDD A;  3OYN A;  1WI7 A;  1G5V A;  2DL8 A;  3QDR B;  1U1T A;  3UA7 A;  4J9D A;  4Q5W A;  2VYT A;  1B34 A;  2VGN A;  4BDY A;  1J3T A;  2K57 A;  1Z9Z A;  2EJ9 A;  1D09 B;  1LCK A;  4RCC A;  4A54 A;  4FYX B;  2XG8 D;  5IN1 A;  1X69 A;  4XTU A;  1YIT Q;  1M1K R;  1QVG A;  4MZP A;  2PVD B;  2COW A;  2ATC B;  3G4S Q;  2LQ8 A;  4E7I A;  1XJW B;  5FW9 A;  2RPN A;  2EAY A;  1YIT T;  1UE9 A;  4KT0 E;  3ASK A;  2YRD A;  8AT1 B;  3OYD A;  3KUF A;  3H0I A;  1X01 A;  1HJD A;  2YT6 A;  2D0Q B;  2F2W A;  1BI0 A;  4PJO G;  2MYS A;  1VQ9 Q;  2L2P A;  4FYY B;  5GJV B;  4FCY A;  3GP8 A;  2QTX A;  1TH7 A;  3QHS A;  1SEM A;  1ZHI A;  3BY7 A;  3VKI A;  3PMT A;  4RTU A;  1M90 C;  1AT1 B;  1JXO A;  2VUB A;  1IB8 A;  2RQW A;  2FPF A;  3LYI A;  4M77 E;  2DL3 A;  3CME Q;  1KG1 A;  1VQ9 A;  2QQ9 A;  4MDX A;  3JAM E;  3HRU A;  2XMF A;  3JSC A;  1VQK A;  2LQK A;  3CCE Q;  1GBQ A;  1HSQ A;  3EGX B;  2V1Q A;  3PNW C;  2A37 A;  3MEA A;  1YIJ Q;  3EAE A;  5FU7 B;  2LCS A;  4ELZ C;  4KGZ B;  3I55 A;  1I5L A;  3CCQ T;  2QAS A;  3QG1 A;  4KRT A;  3M4G A;  3P8H A;  4LNP A;  3M59 A;  4JRP A;  5CKF A;  4C8Q C;  2JM8 A;  2BZX A;  2EWN A;  2QQS A;  2ROT A;  3C94 A;  3VS4 A;  3L2W A;  4M75 A;  1KK7 A;  3CCM T;  3TEE A;  2V1R A;  2CRE A;  3QBY A;  1W2B P;  1RAG B;  1E6G A;  1RL2 A;  2LCL A;  5D6W A;  4F17 A;  1X6O A;  2HBW A;  2JN0 A;  4EPC A;  5CKD A;  3KBG A;  5LJ3 j;  2A0F B;  1K73 R;  1PHT A;  1RUW A;  4F14 A;  1I0C A;  3PGG A;  5GAN h;  2BIV A;  4J83 A;  5FU7 C;  1D1C A;  3G6E A;  2DMO A;  1TUD A;  1F1B B;  4AT1 B;  1SRM A;  3CPW S;  3CCV Q;  3M0S A;  2RHI A;  1MND A;  3CCV T;  4K11 A;  4HVW A;  4FYW B;  2K6D A;  4HT8 A;  2I2L A;  1WXU A;  1W1F A;  5FLX E;  1M4Z A;  1K0S A;  1UJY A;  1OV3 A;  2K5F A;  2KK4 A;  3MP1 A;  2CP0 A;  3H41 A;  4OB3 B;  3G1J A;  3VS6 A;  2HD0 A;  3VUZ A;  1G3Y A;  4M78 D;  4F7U F;  3RKY A;  2CH4 A;  3EGD B;  2ZPF B;  1O75 A;  3A8O B;  1QMC A;  4JS4 A;  4JZ4 A;  2CZ6 B;  2NUZ A;  4ANJ A;  3P8B B;  1Q7Y R;  1AOJ A;  2H8H A;  2X35 A;  1Q86 R;  2CUD A;  3CPW A;  2OTL A;  2K9G A;  4TVR A;  4KUD K;  2Z0W A;  4DBR A;  2CGH A;  5CKE A;  1QVF S;  2HDA A;  4OB1 B;  1NG2 A;  1VQL Q;  1IHW A;  4R55 A;  2DPP B;  4A53 A;  4E7L A;  3Q1J A;  4OB2 B;  2KT8 A;  1RI9 A;  1C0M A;  3TRE A;  1Y96 A;  2JW4 A;  4QVD A;  4BDZ A;  1N27 A;  1OI1 A;  4ESR A;  1N8R R;  1EX4 A;  4IUT A;  2RQT A;  3JCM Q;  3OA6 A;  3JB9 I;  2EPD A;  5KH6 A;  1M1K U;  4XTZ A;  2COZ A;  3OS1 A;  4X34 A;  1S72 T;  1PRL C;  5CIU A;  2ED1 A;  1RAH B;  3PTA A;  2QGG A;  3CMA A;  1IGU A;  1PNJ A;  4V2S A;  2RNA A;  1QWF A;  1PRM C;  1ZSZ C;  3CXC A;  1PWT A;  4CI0 C;  1TSF A;  4M77 G;  1M90 R;  1UEB A;  1VIF A;  5GAN 6;  1X75 C;  1ABQ A;  3CME T;  4MDW A;  4F16 A;  1YCY A;  5LJ3 h;  4EMK A;  1CKB A;  2R58 A;  4DOW A;  2DK3 A;  1SHF A;  3I5R A;  2FPE A;  3X25 B;  5GAN 2;  1D3B B;  3LWH A;  1FYN A;  1VYU A;  3JCM W;  3JCM e;  2QGF B;  4FT4 A;  2DTO A;  2DD4 A;  2AKK A;  1FXX A;  1T0J A;  2H3J A;  2LX7 A;  2M9U A;  5CVI A;  3CCQ Q;  4QVC A;  2ROL A;  3CCQ A;  2KVQ G;  3OMC A;  1W2B S;  2ZPE B;  2J7I A;  1Q82 C;  2KEA A;  2E3I A;  2YUO A;  3CC2 Q;  2MIO A;  2BZ8 A;  2NUP B;  2EQI A;  1JBM A;  2CSI A;  2GNC A;  2E1H A;  2DFU A;  1PD0 A;  1R0C B;  1YHQ Q;  2WSF E;  1CSK A;  1Y71 A;  1QKX A;  1PSF A;  3OYB A;  3EFO B;  1IXD A;  1MMG A;  2HNI A;  2M51 A;  1B07 A;  4HVV A;  3CCU T;  4HT9 A;  1VQ8 Q;  1GCQ A;  5GAM d;  2G3R A;  3OYI A;  3OSV A;  1YIJ A;  3OYF A;  1WJR A;  4BI8 B;  2QA4 T;  2DXU A;  4J6W A;  4ZGE B;  4RG2 A;  1X6B A;  2BUD A;  3QYH B;  2B86 A;  3H6Z A;  2FZC B;  1ZUK A;  4PKC C;  3CC4 T;  3E9F A;  1LVK A;  2HQX A;  4XTW A;  3KXT A;  4BY6 C;  1UDL A;  4PFP A;  4AFU C;  3NPF A;  1RAI B;  4CC2 A;  4E7Z A;  1ARK A;  4WF2 A;  4XU1 A;  1VQP A;  4IIO A;  4J9G A;  3REB B;  1RAB B;  4GLM A;  4M77 D;  3L2R A;  3I56 A;  2DVE A;  2B8A A;  2RA2 A;  1SRL A;  1VQO T;  5C6S A;  4UC4 A;  1M9S A;  3VUB A;  2OAW A;  3L1A A;  4EIK A;  1WIE A;  2H3E B;  4Y91 A;  1KQ2 A;  1N8R U;  2P0K A;  1NEG A;  2W0Z A;  1KQS P;  2CZ1 B;  2CT4 A;  3QUI A;  2DTI A;  2Y90 A;  5LJ3 g;  3L2V A;  4BY6 B;  1WXB A;  3QKJ A;  4WTO B;  4M75 G;  2E5Q A;  5LL6 S;  1Q95 G;  4D8D A;  3TCJ A;  2YHT A;  1VQ9 T;  2ZCF B;  4F7U E;  5IHN A;  1ACM B;  2OX7 A;  2JJ9 A;  1VYT A;  4N0A C;  1BB9 A;  4IUR A;  4IUU A;  5GMK i;  4MZM A;  5L23 A;  4C92 E;  4II1 A;  1SHG A;  3PMI A;  4RTW A;  5FRO A;  2QTV A;  1R0B G;  2RQR A;  1ZSG A;  4KH0 B;  3LH5 A;  3N5B B;  4C8Q G;  3GOX A;  1NE8 A;  1C1A A;  3DB3 A;  2LTO A;  1QW1 A;  1TUC A;  4JDS A;  3GF5 A;  4RMO A;  4E2F B;  1TWB A;  5GAN g;  4B9W A;  2F1L A;  4FSS A;  2CP2 A;  3CCM A;  4M7A B;  4BI4 A;  2DXB A;  2HAX A;  3QYG B;  1H3Z A;  2CDT A;  1PG5 B;  5I21 A;  1FMW A;  2L89 A;  3V7R A;  2QAZ A;  3PE0 A;  5GAN 4;  2M1H A;  4KUL A;  1M2V A;  4PJO D;  4JS5 A;  2LVM A;  3HL8 A;  4J7F A;  3JCM X;  1MMN A;  2DBM A;  4PJN A;  4DBF A;  5HKC A;  2DX1 A;  1S72 A;  2XU8 A;  1JQQ A;  2L3P A;  1VQ7 A;  1XQH A;  2W10 A;  2GFA A;  2P4T A;  1R77 A;  2BTT A;  1AZE A;  3VYG A;  1KHI A;  1YP5 A;  1YHQ T;  2L3R A;  4MMK A;  4RTT A;  4DEX A;  2KRS A;  3L2Q A;  5FU6 C;  3NFC A;  1U5S A;  3PIP A;  1VQ8 T;  2MMP A;  2OTJ A;  3ZL7 C;  2E64 A;  4JJC A;  1UGS B;  4M7A C;  3LGL A;  2JTM A;  4M7A F;  2AHJ B;  2J6F A;  1TU0 B;  3OS2 A;  3CCS A;  4DOV A;  1Q81 R;  1KD1 R;  2XDB A;  4C8Q A;  3TU4 K;  1M27 C;  1MGQ A;  3L2Z A;  3NTH A;  5A0G A;  2LX9 A;  1RAA B;  2KRO A;  4C92 C;  1D0X A;  5GAO p;  2AK5 A;  3REA B;  1UGP B;  1MMA A;  2F69 A;  2VVK A;  4JLG A;  4DBH A;  2E3H A;  3SFM A;  3VRZ A;  1KQS S;  2XHC A;  2RI5 A;  3M0Q A;  4ZN3 A;  2M0O A;  2MF2 A;  1Y7X A;  3GIB A;  4PJO C;  5KYW B;  1M1F A;  4FYV B;  5LJ5 d;  2L3Q A;  2DE0 X;  2VC8 A;  3SEM A;  3PT9 A;  2JUF A;  2LNV A;  3BDU A;  2O31 A;  3CCR T;  3CBP A;  3VU3 C;  2DXC A;  2QQB A;  2RQU A;  4J9E A;  3QWX X;  3MHX A;  2CKK A;  3BDL A;  3TSZ A;  4XTX A;  2E6N A;  4M78 C;  1M90 U;  1Y57 A;  3ER0 A;  3NTK A;  3I56 Q;  4F7U A;  3WXM B;  4M7A G;  3P8D A;  3M0P A;  3JV3 A;  2L5Q A;  2F2V A;  1Y07 A;  2YXY A;  1HK9 A;  4YTL A;  3MPU B;  3J81 E;  3NMZ C;  1W6X A;  3C12 A;  3CCE T;  3RER A;  3JB9 F;  4LUD A;  1TOV A;  4ZGJ B;  3QWY A;  1M1G A;  2GTO A;  1U3O A;  3EG9 B;  5GAN 3;  5KYU B;  1EFN A;  3RES A;  3EFO A;  2KNB B;  5C0M A;  4R0K A;  4LDW A;  1YIT A;  3MCA B;  2CZ0 B;  5M9O A;  4M7D C;  1B34 B;  4FSX A;  2LC4 A;  1VQN T;  1Q86 C;  5GAM f;  2RB6 A;  2XKO C;  5CKH A;  1OPK A;  1IO6 A;  1YFN A;  3PFS A;  2ENM A;  1K8A R;  2VWF A;  2KE9 A;  4LXC A;  5GAO n;  5D6Y A;  2V8K A;  2Y4Y A;  4OMF B;  1YJ9 A;  2VAS A;  2HKQ B;  2EIF A;  3AT1 B;  5I11 A;  2F2X A;  6AT1 B;  4M4Z A;  1EIF A;  4QT7 A;  4E7H A;  3QZ5 B;  4LN2 A;  2RHX A;  2ZAE A;  2YSQ A;  4A4F A;  2CZ7 B;  3QDF A;  2XI9 A;  4J8O A;  4WCI A;  4JJB A;  2GBQ A;  3R6N A;  2P0Q A;  1VQK T;  2DA9 A;  3QXE B;  5FRM A;  3EHR A;  4BUG A;  5GAN f;  5GAN j;  4PNO A;  1VQK Q;  2IIM A;  2LZ6 B;  2PVG B;  2ZGW A;  2ZPG B;  1AVZ C;  2FHD A;  5D6X A;  2LMJ A;  4C92 G;  4M78 B;  1YWO A;  3JB9 H;  3CCL T;  5KYX B;  2JS2 A;  2CS7 A;  4JJD A;  2DNU A;  2XDP A;  3H0F A;  4BB7 A;  4XAX B;  1FX7 A;  5I22 A;  1W70 A;  5HK0 A;  4M7A E;  1VQM Q;  4M78 A;  1RAD B;  2PTK A;  1N8R C;  4OVA A;  1M3A A;  5DLO A;  2EVR A;  3SHW A;  2RQV A;  2DZC A;  1U8R A;  1VQL T;  3E9G A;  1QP3 A;  2JMC A;  2JT4 A;  4XU0 A;  2BKD N;  4PJO E;  2IG0 A;  3TSW A;  3JCM h;  5HCK A;  2AZS A;  3RIR A;  5GAM j;  1GRI A;  2EJF A;  3CCR Q;  1KQ1 A;  2K3X A;  1QCO A;  2J05 A;  1C6V X;  4N4G A;  2BZY A;  3L42 A;  2AT1 B;  1VQP T;  2KR3 A;  1H8K A;  4C5H A;  3CPW P;  1K9A A;  1VQP Q;  1M3B A;  5KYU A;  3I56 T;  1JJ2 P;  2WAC A;  3WVE B;  4DQ2 A;  1N9R A;  1VQ5 A;  1WYX A;  5GJW B;  1HD3 A;  2EW3 A;  2EFI A;  2M0Y A;  2CP5 A;  2JVV A;  1QLY A;  2HQH A;  4E7K A;  1WHM A;  3HTR A;  4XTV A;  3OBY A;  1NZ9 A;  3C95 A;  3G6E Q;  1MUZ A;  1QKW A;  4OMO A;  1IHV A;  2DF6 A;  2D8H A;  3OY9 A;  3MP6 A;  1BCO A;  2A08 A;  3G6E T;  1M1K C;  1UJ0 A;  2RM4 A;  2WSE E;  1NYG A;  2DBK A;  4J9I A;  1BBZ A;  2JNG A;  3MET A;  3CC2 T;  4Y28 E;  2FVU A;  2XIC A;  1K9M R;  1PSE A;  1KD1 U;  3CC7 A;  2QEX T;  5GAN d;  4OB0 B;  2AIR B;  3ULR B;  2O88 A;  4RCB A;  5KCO A;  3OYH A;  4C8Q E;  4JRK A;  2D9T A;  4C92 B;  3S3N A;  3DB4 A;  1MNE A;  3C0C A;  1YI2 A;  3CCU Q;  4M7D A;  2J06 A;  1PKT A;  2QA4 Q;  4RTV A;  1UGR B;  2VXE A;  4ORZ A;  3INZ A;  4X1V A;  4C0D B;  2YRV A;  3UPU A;  3MO8 A;  4A63 B;  4J5Y A;  4GBQ A;  5DY9 A;  2RJC A;  2ED0 A;  4HCZ A;  2ECZ A;  2O01 E;  4A4K A;  2RI2 A;  5GAN 5;  4A4E A;  2DAQ A;  5GMK l;  2YUQ A;  3WVD B;  2YWW A;  1JB0 E;  1K4U S;  4CC4 B;  2AZV A;  1G3S A;  5L8R E;  5LJ5 e;  2O9S A;  3EFR A;  2E6Z A;  2JTE A;  3VS7 A;  5CQY A;  1Q7Y U;  1VA7 A;  3O8V A;  4KGX B;  1H64 1;  2OJ2 A;  3KFV A;  3A8M B;  1LNX A;  4O6J A;  4LD9 K;  4PJL A;  3O5Z A;  4DBQ A;  2E10 A;  1FMK A;  2K5I A;  2RH2 A;  1IGQ A;  1YN8 A;  2Y4X A;  1JXM A;  2PQW A;  4NS5 A;  2NUT B;  2KRN A;  2EQJ A;  3SWN B;  3VS2 A;  2SRC A;  4QKU A;  2X4J A;  3CME A;  9ATC B;  1D1B A;  4C0F A;  2JM9 A;  3PVQ A;  1WQW A;  3R6O A;  1VQ8 A;  2NLU A;  2MCN A;  2HMA A;  4EMH A;  1YBY A;  3H8Z A;  1ZLM A;  2YUP A;  1RAE B;  2DEU A;  2HSE B;  2R5A A;  2OTL Q;  2CP3 A;  2NWM A;  2FG0 A;  3OS0 A;  3RKX A;  4XK8 E;  3UT1 A;  4M75 E;  3EGX A;  3ZEH A;  3I5S A;  1UHF A;  3RDV A;  3HP9 A;  4J9C A;  1MV0 B;  1AWO A;  3TQ7 P;  1SKU B;  2FZK B;  3OYM A;  3DKM A;  3X24 B;  4B9X A;  1I81 A;  1WHL A;  1E7O A;  1TXQ A;  1I1J A;  1WHG A;  2JS0 A;  2EBP A;  4BE1 A;  2RF0 A;  3X28 B;  1OU8 A;  4EMK C;  3JCM d;  2E41 A;  2NUT A;  5DLQ E;  1WA7 A;  3NGP A;  4C5G A;  2O4X A;  5CCA A;  3CC7 Q;  4EMG A;  1BIA A;  3OS5 A;  2ZPI B;  4ZN1 A;  1W2B A;  1ZQ1 A;  2RJF A;  3HHT B;  1G3W A;  4BE2 A;  3JCM f;  1Q81 U;  4M7D F;  4BD3 A;  1ZUU A;  3SD4 A;  5CO7 A;  4LD6 A;  2A28 A;  2X4Y A;  1M30 A;  2QEX Q;  2GGR A;  2KYM A;  3OYE A;  2K2M A;  2EYY A;  4HA8 A;  1X43 A;  4FL6 A;  4JLI A;  5IXF A;  2COY A;  1KSW A;  4PL6 A;  5GAO q;  2LQW A;  2EGC A;  2GQI A;  4XQ3 A;  2EYQ A;  5GAN 7;  4KGV B;  4PJJ A;  2EKH A;  2FO0 A;  1BI2 A;  1U06 A;  1ZA1 B;  2RK1 A;  4M77 F;  3EHQ A;  3I55 T;  1VYV A;  4HKE A;  4M7D E;  4NL3 A;  4F04 B;  1M5Q 1;  1B3Q A;  4N4H A;  4PJO B;  2KBT A;  1MHN A;  3RUX A;  3HKS A;  4JZ3 A;  3CCE A;  3VS1 A;  3CMA Q;  1D1A A;  4XU2 A;  3UF4 A;  2ZPH B;  1KD1 C;  2PZ1 A;  1S1N A;  2LQN A;  2PUK B;  4QQG A;  1UGV A;  2DIL A;  3CC2 A;  1Q7Y C;  3V8J A;  1PKS A;  3CCL Q;  3QII A;  5KE3 A;  4F7U B;  3M0U A;  2EQM A;  3FB9 A;  4C5E A;  4PK4 A;  1T3L A;  3OYK A;  2C0O A;  4LDX A;  2D8J A;  4C0Z A;  2EGA A;  1VQM T;  1RAC B;  1YJ9 T;  3V8L A;  2DL5 A;  1GFC A;  1X27 A;  3JCM b;  5FWB A;  2PUO B;  1ZSZ B;  1QVF A;  2DKG A;  2J6K A;  4GY5 A;  3JCM P;  2MWP A;  3EG9 A;  4GLK A;  1LJO A;  1HXD A;  1AHJ B;  4QW2 A;  4C92 F;  1K8A U;  2ZPB B;  1K76 A;  4AMC A;  2YDL A;  5GMK h;  1HYO A;  4RTX A;  2X4X A;  1JRI A;  1K73 C;  4O5V A;  3J7A F;  1QQJ A;  2OTL T;  1VQO A;  4M77 B;  1M3C A;  2MWO A;  2RHU A;  1UG1 A;  2O2O A;  2DL7 A;  4M78 F;  2DD5 A;  3OYC A;  3JB9 G;  4C92 D;  3MP8 A;  5AYF A;  1K1Z A;  2IVW A;  5GAO l;  2CH4 W;  4JJN K;  1PC0 A;  1QVP A;  4LE9 A;  5D7U A;  3GPL A;  1KC8 C;  2X9H A;  5GMK j;  1UGQ B;  3F70 A;  4OGE A;  2HCK A;  2QI2 A;  4E47 A;  5IHK A;  3G7Z A;  2F5T X;  3M57 A;  1D3B A;  3QZ9 B;  2MI6 A;  4HVU A;  1Y96 B;  1B7T A;  2QDY B;  1PCX A;  3OYJ A;  4C0D C;  5GAO m;  1W4S A;  3FEO A;  4J7I A;  4DA4 A;  4C92 A;  4QVZ A;  1VQN Q;  4FW1 A;  2YRC A;  1RLP C;  1NYF A;  1WPY A;  2KT1 A;  1OOT A;  3EGD A;  3I35 A;  2NYS A;  1JJ2 A;  4C0G A;  3V7C A;  4CC3 A;  3FRN A;  1RAF B;  3CCS Q;  8ATC B;  4E7J A;  4CC7 A;  1OYX A;  4Z02 A;  4X9C A;  5IAY A;  2DVJ A;  4P5N A;  5GAN 8;  2YLB A;  2R5M A;  5GAM e;  5I2M A;  4HCC A;  4FW2 A;  1NPP A;  1VQ5 Q;  5J39 A;  3S3O A;  3ME9 A;  1OU9 A;  2C0T A;  4L6V 5;  4EMK B;  2P0P A;  4OGC A;  1JEG A;  1VQ5 T;  3I55 Q;  1Q82 R;  1NPR A;  2EYZ A;  3A8H B;  2GF7 A;  4HCK A;  3OQ5 A;  4X9D A;  3FLG A;  3MEW A;  2L8D A;  2HL3 A;  5LJ5 h;  3EG3 A;  1G2B A;  3MEV A;  1H92 A;  2RI3 A;  3E19 A;  3SWN A;  2HBP A;  3JB9 D;  3SB2 A;  1V1C A;  4J6X A;  4AG1 C;  2OTJ Q;  4ZTF A;  3ZFJ A;  3G71 A;  2OTJ T;  2QK0 A;  1VQN A;  2G6F X;  1MV3 A;  5LJ3 e;  1YJW A;  2CYZ B;  4PJM A;  4Z8A A;  4HCB A;  2ZZD A;  4IUV A;  4AG2 C;  5GAM h;  3CCR A;  1RI0 A;  2M16 A;  3HPW A;  1NLO C;  1K9M U;  1KIK A;  3M0T A;  1OZ2 A;  2OI3 A;  5LJ5 g;  3GLX A;  1MMD A;  4CRI A;  3A8G B;  4PLL A;  1RLQ C;  2RHZ A;  1UFF A;  1AWJ A;  4ME7 A;  3M53 A;  4OP0 A;  2E5K A;  3CCJ A;  2V8J A;  1TG0 A;  2X3W D;  2VGM A;  5CK9 A;  3CD6 Q;  2AKL A;  1AEY A;  1WHJ A;  4FU6 A;  4E7S A;  1DJ7 B;  1U1S A;  3CD6 T;  5GAN e;  3C4S A;  1UEC A;  1H3H A;  2ESW A;  1VQ7 T;  1M8V A;  1NJI R;  2K4Y A;  1IRE B;  3X20 B;  5I2S A;  4L59 A;  1JJ2 S;  1PD1 A;  2LJ0 A;  4NOY A;  2WSC E;  1BKB A;  4J9F A;  4M7D D;  5ECA A;  2FL7 A;  1AWW A;  1WJQ A;  2DL4 A;  2EJG A;  1YJN T;  2CT3 A;  3T9N A;  2DJQ A;  2KI7 A;  2QXF A;  1YJN Q;  3HFN A;  3SWN C;  3JB9 J;  3EG2 A;  1K0X A;  1SSF A;  2D6F A;  3M56 A;  2C06 A;  3OYG A;  4XU3 A;  2M02 A;  2DXT A;  2CSQ A;  2DIQ A;  1NLP C;  1WX6 A;  3CXC P;  2KXD A;  2J6O A;  1Y0M A;  3M0R A;  5IT9 E;  4ZNX A;  2FYK A;  5KYN A;  1UHC A;  2GQV A;  5AT1 B;  1UUE A;  1VOM A;  4OMQ A;  4JPB W;  3S3M A;  2NUP A;  3OMG A;  2DIG A;  1I07 A;  2K5L A;  1KC8 U;  2EYW A;  2SEM A;  3QO3 A;  1UB4 A;  3G4S A;  2VB6 A;  2KY9 A;  1FWZ A;  3RMS A;  5LJ3 d;  3M58 A;  1SPK A;  2HQE A;  1VQL A;  1VQ4 A;  2LP5 A;  1SSH A;  2HL5 C;  1KFZ A;  2KQW A;  5LJ5 f;  3L2U A;  2KDS A;  3FDR A;  1K73 U;  3J80 E;  1X2K A;  5FU6 B;  1IRX A;  1IZ6 A;  5CAI A;  2DJZ A;  4A4H A;  4DEY A;  4M75 C;  3UWN A;  1TUG B;  4OML A;  1WDX A;  1V76 A;  2EKO A;  3JCM V;  2RD1 A;  2D1X A;  3CPF A;  4PFO A;  4KH1 B;  4M77 C;  3EFS A;  5GMK m;  3CCU A;  1QWE A;  5A2Q E;  2DLP A;  2FRY A;  3HFO A;  3EG0 A;  1YJ9 Q;  4ATO A;  1N6A A;  2QQR A;  2LCC A;  2P84 A;  2DRK A;  4IUP A;  5KYX A;  2KXC A;  1BYM A;  1YNZ A;  1OEB A;  4QQ6 A;  5EC7 A;  2HKN A;  4RTZ A;  1Q82 U;  1X2Q A;  1Q81 C;  3RR6 A;  2OAU A;  3NTI A;  1WNL A;  2DER A;  1GCQ C;  2A3L A;  2XID A;  2HZY A;  4A4G A;  4NL2 A;  2L0A A;  1ZSZ A;  2E70 A;  4KBM B;  4MZT A;  3RBB B;  5LJ5 j;  1QVF P;  2FRW A;  4XTY A;  2JXB A;  4AFQ C;  1WFW A;  1Z9Q A;  2LRQ A;  4LDU A;  2JTF A;  3X26 B;  4ELY C;  1JU5 C;  2C0I A;  3V7S A;  1AD5 A;  3JCM J;  3M55 A;  5FWC A;  2I0N A;  3ZBD A;  3LX7 A;  3MEU A;  4C8Q B;  1VQ6 Q;  2K3B A;  1BI1 A;  2E4H A;  3E1S A;  3QSU A;  1KHC A;  3D7S B;  2JOY A;  1OQK A;  4QQD A;  2L3S A;  2IPO B;  3M5A A;  5CQX A;  3FIF A;  4PJO A;  2KMT A;  1TS9 A;  3OBW A;  1YHQ A;  1QVG P;  2V8I A;  2DO3 A;  1SF9 A;  4L5G A;  4HXJ A;  4AFS C;  3CC7 T;  4RTY A;  2QEX A;  3FC3 A;  1SG5 A;  1X6G A;  1WGS A;  2DZ9 A;  4E6R A;  2DET A;  1YWP A;  1YI2 T;  3OSS C;  4LUE A;  5KYY B;  1PM3 A;  2VKN A;  3CC4 A;  1QCF A;  3BFM A;  1YI2 Q;  2YUN A;  2DYB A;  3CCS T;  3QJY A;  1D0Z A;  1WQ7 A;  4M75 B;  2MOX A;  1WJS A;  3JCM c;  4C8Q D;  2FPD A;  1GL5 A;  2X3X D;  4Z88 A;  4ZGD B;  3LWI A;  2K79 A;  3QPH A;  2ABL A;  2FB7 A;  2KRM A;  1OPL A;  4RKU E;  3CCJ T;  5GAO r;  1S72 Q;  1OX9 A;  4BAC A;  1O9S A;  1V29 B;  3CCJ Q;  3G71 Q;  2RHY A;  4OMN A;  1BU1 A;  1EZZ B;  3H9N A;  3G71 T;  4OF1 A;  4Y92 A;  2GFU A;  3CMA T;  1KJW A;  1WXT A;  1GFD A;  4N4I A;  4RG8 A;  2DEQ A;  3UAT A;  3MKD A;  3BE3 A;  3BW1 A;  3GNF B;  4M75 F;  5CKB A;  1VUB A;  1NJI C;  3CCV A;  1BI3 A;  2PVO B;  4Z89 A;  1E6H A;  4FM4 B;  2HSP A;  1T3S A;  5LJ3 f;  2EQK A;  2RJE A;  2RJD A;  3VYH B;  3RKW A;  1KQS A;  3M9Q A;  2KYB A;  2KSS A;  1OX8 A;  3EGU A;  1VQ6 A;  3H0H A;  2DYI A;  3PIO A;  2F5K A;  2BE7 D;  1XTD A;  4C8Q F;  1XNI A;  5KYW A;  1LPL A;  3LLR A;  3THK A;  1BCM A;  1AZG B;  4LDV A;  2O4X B;  4OMM A;  3HRS A;  4FIB A;  2K7A A;  2PU9 B;  3OYL A;  5DM7 R;  1G83 A;  4J9H A;  1M8M A;  1ZUY A;  4KUI A;  5GAM g;  1OUL A;  3LW5 E;  3CCL A;  1WHK A;  3CBO A;  1G3T A;  1ABO A;  2EQU A;  1WLP B;  1NJI U;  3VS0 A;  3OB9 A;  3OW2 P;  3S6W A;  3HSB A;  3IQL A;  4J6Y A;  3VS3 A;  3A98 A;  3URG A;  3OYY A; 
#chains in the Genus database with same CATH homology
 1FYN A;  1VYU A;  2PNI A;  2JMC A;  2EGE A;  4J9B A;  2AKK A;  2C0T A;  2JT4 A;  1T0J A;  2LX7 A;  3GBQ A;  2ROL A;  1JEG A;  2HEQ A;  2J7I A;  2EYZ A;  2KEA A;  3TSW A;  1GCP A;  2YUO A;  2DRM A;  5HCK A;  2AZS A;  4HCK A;  1GRI A;  2MIO A;  2BZ8 A;  2EQI A;  3RNJ A;  2CSI A;  2J05 A;  3TVT A;  2GNC A;  2BZY A;  3EG3 A;  1G2B A;  1H92 A;  3UA6 A;  1UTI A;  1CSK A;  2KR3 A;  1QKX A;  1V1C A;  1H8K A;  1K9A A;  3NHN A;  4AG1 C;  1M3B A;  2M51 A;  1B07 A;  4HVV A;  1WYX A;  2JMA A;  1GCQ A;  5GJW B;  2G6F X;  1MV3 A;  1HD3 A;  2LJ1 A;  2EW3 A;  2M0Y A;  2GTJ A;  4Z8A A;  1QLY A;  2CUB A;  1X6B A;  4AG2 C;  2B86 A;  1ZUK A;  2P4R A;  1MUZ A;  1GBR A;  1NLO C;  1QKW A;  4OMO A;  2A36 A;  5IXB A;  1KIK A;  2DF6 A;  2D8H A;  3M0T A;  2A08 A;  3PVL A;  3VS5 A;  1UJ0 A;  2OI3 A;  2LNH B;  1NYG A;  1UDL A;  2DBK A;  4AFU C;  4J9I A;  3NPF A;  4CC2 A;  1BBZ A;  1ARK A;  1RLQ C;  1UFF A;  1AWJ A;  2O9V A;  4IIO A;  4J9G A;  3REB B;  4GLM A;  3VRY A;  2E5K A;  4D8K A;  1TG0 A;  2LJ3 A;  1AWX A;  2X3W D;  3ULR B;  2AKL A;  2O88 A;  2RMO A;  1AEY A;  1CKA A;  3EG1 A;  1SRL A;  5IH2 A;  1XOV A;  1ZX6 A;  2KGT A;  2OAW A;  4EIK A;  1WIE A;  1JO8 A;  4AFZ C;  1NM7 A;  1UEC A;  1H3H A;  2ESW A;  3C0C A;  4OMP A;  2EYX A;  2RN8 A;  1A0N B;  1YCS B;  1NEG A;  2W0Z A;  2CT4 A;  2J06 A;  3CQT A;  1PKT A;  2LJ0 A;  4IIM A;  4J9F A;  1WXB A;  5ECA A;  4RTV A;  5IHI A;  1AWW A;  4ORZ A;  2DL4 A;  4X1V A;  2CT3 A;  4A63 B;  2DJQ A;  1NEB A;  4GBQ A;  1T0H A;  4D8D A;  2ED0 A;  2ECZ A;  2QDL A;  3EG2 A;  1K0X A;  2FEI A;  5IHN A;  2YUQ A;  1VYT A;  1BB9 A;  1K4U S;  4CC4 B;  2AZV A;  5L23 A;  2CSQ A;  1NLP C;  1WX6 A;  2O9S A;  1SHG A;  2JTE A;  2KXD A;  2J6O A;  1Y0M A;  3VS7 A;  4RTW A;  3FJ5 A;  3M0R A;  1VA7 A;  2RQR A;  1ZSG A;  2D0N A;  3LH5 A;  4ZNX A;  1UHC A;  1ZBJ A;  4RUG A;  2OJ2 A;  3KFV A;  1TUC A;  1UUE A;  4OMQ A;  3O5Z A;  1BK2 A;  4JPB W;  2DM1 A;  1FMK A;  1YN8 A;  3I9Q A;  1N5Z A;  1I07 A;  4FSS A;  1JXM A;  2EYW A;  2SEM A;  2KRN A;  3U23 A;  3VS2 A;  2SRC A;  2CDT A;  2JM9 A;  3PVQ A;  3PE0 A;  1SPK A;  2MCN A;  2DBM A;  2LP5 A;  1ZLM A;  2YUP A;  1SSH A;  1WI7 A;  2DX1 A;  1KFZ A;  2DL8 A;  1JQQ A;  2L3P A;  3UA7 A;  2NWM A;  2FG0 A;  4J9D A;  1X2K A;  2W10 A;  2BTT A;  1J3T A;  1AZE A;  4DEY A;  1Z9Z A;  1YP5 A;  3I5S A;  1LCK A;  1WDX A;  4OML A;  4RTT A;  1UHF A;  4DEX A;  4J9C A;  2KRS A;  1MV0 B;  1AWO A;  1U5S A;  2D1X A;  1X69 A;  5FW9 A;  1QWE A;  2RPN A;  3ZL7 C;  1UE9 A;  2DLP A;  1E7O A;  2FRY A;  4JJC A;  1I1J A;  3EG0 A;  2JS0 A;  2EBP A;  2DRK A;  2RF0 A;  2KXC A;  3H0I A;  1HJD A;  1YNZ A;  2YT6 A;  1OEB A;  2J6F A;  2F2W A;  5EC7 A;  2L2P A;  4RTZ A;  1X2Q A;  1WA7 A;  3NGP A;  5GJV B;  1M27 C;  1GCQ C;  1SEM A;  2KRO A;  4RTU A;  2L0A A;  3RBB B;  2AK5 A;  1JXO A;  3REA B;  2RQW A;  2FPF A;  2FRW A;  1ZUU A;  2VVK A;  2JXB A;  4AFQ C;  2A28 A;  1WFW A;  2DL3 A;  1Z9Q A;  3VRZ A;  1M30 A;  2GGR A;  2KYM A;  2K2M A;  2EYY A;  2XMF A;  1JU5 C;  1X43 A;  2C0I A;  3M0Q A;  5IXF A;  1AD5 A;  1GBQ A;  1HSQ A;  5FWC A;  2V1Q A;  1KSW A;  2A37 A;  2I0N A;  2LQW A;  2EGC A;  2GQI A;  2LCS A;  2EKH A;  2FO0 A;  2K3B A;  2L3Q A;  1U06 A;  2DE0 X;  3EHQ A;  1VYV A;  4KRT A;  3SEM A;  1B3Q A;  4LNP A;  2L3S A;  2O31 A;  2KBT A;  2JM8 A;  2BZX A;  2ROT A;  2RQU A;  4JZ3 A;  4J9E A;  3VS1 A;  3VS4 A;  3QWX X;  4HXJ A;  4AFS C;  2V1R A;  3UF4 A;  2CRE A;  4RTY A;  3TSZ A;  2PZ1 A;  1S1N A;  2LQN A;  1E6G A;  1X6G A;  1UGV A;  1Y57 A;  2DIL A;  4F17 A;  2HBW A;  1PKS A;  4E6R A;  3M0U A;  3M0P A;  1PHT A;  1YWP A;  1T3L A;  1RUW A;  3JV3 A;  2C0O A;  2F2V A;  4LUE A;  4F14 A;  2VKN A;  1I0C A;  2D8J A;  1QCF A;  2YUN A;  2DYB A;  3NMZ C;  2EGA A;  2MOX A;  2DMO A;  1TUD A;  2DL5 A;  1GFC A;  1SRM A;  1X27 A;  1W6X A;  5FWB A;  4LUD A;  3M0S A;  3QWY A;  2FPD A;  1GL5 A;  4K11 A;  2X3X D;  4Z88 A;  2GTO A;  4HVW A;  2K79 A;  2J6K A;  2K6D A;  2ABL A;  2KRM A;  1WXU A;  1OPL A;  1U3O A;  1W1F A;  1EFN A;  2KNB B;  1K0S A;  1UJY A;  1OV3 A;  4R0K A;  4OMN A;  1BU1 A;  1K76 A;  3H41 A;  3VS6 A;  2YDL A;  4RTX A;  4Y92 A;  2CH4 A;  1KJW A;  1OPK A;  4JZ4 A;  1IO6 A;  1WXT A;  1GFD A;  2NUZ A;  3UAT A;  2ENM A;  1AOJ A;  1M3C A;  2H8H A;  2VWF A;  1UG1 A;  2KE9 A;  2O2O A;  2DL7 A;  2CUD A;  2K9G A;  4Z89 A;  2HDA A;  1NG2 A;  1E6H A;  1K1Z A;  2HSP A;  1T3S A;  2CH4 W;  5I11 A;  2F2X A;  4M4Z A;  4QT7 A;  2KYB A;  2KT8 A;  4LE9 A;  3EGU A;  1RI9 A;  3H0H A;  4LN2 A;  2JW4 A;  2YSQ A;  4ESR A;  2HCK A;  2RQT A;  4JJB A;  4WCI A;  2GBQ A;  3R6N A;  5IHK A;  2DA9 A;  2EPD A;  3EHR A;  3THK A;  2IIM A;  1AZG B;  1PRL C;  2LZ6 B;  4HVU A;  4OMM A;  2ED1 A;  2K7A A;  1AVZ C;  1PNJ A;  2LMJ A;  2RNA A;  1QWF A;  1G83 A;  4J9H A;  1YWO A;  1M8M A;  1PRM C;  1ZUY A;  2JS2 A;  1PWT A;  1RLP C;  1NYF A;  4JJD A;  2DNU A;  1ABO A;  2KT1 A;  1OOT A;  3H0F A;  1WLP B;  3I35 A;  5I22 A;  3VS0 A;  1W70 A;  4CC3 A;  1ABQ A;  2PTK A;  4F16 A;  4CC7 A;  3IQL A;  1CKB A;  1M3A A;  3VS3 A;  1SHF A;  2EVR A;  3I5R A;  2FPE A;  2DVJ A;  3SHW A;  3A98 A;  2RQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...