4HXJA

Crystal structure of sh3:rgt complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structural framework of c-Src activation by integrin beta 3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, signaling protein
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hxjA00
1W1FA 4DEXA 5IHNA 2W10A 1B3QA 3IQLA 3EG1A 3THKA 1Z9QA 2DYBA 2EPDA 1AOJA 2KRSA 2OAWA 4J9EA 4AFSC 1PKSA 5IHIA 1YCSB 1SRLA 1VA7A 4D8KA 5IH2A 1ABOA 4OMMA 2BZYA 4OMOA 2KE9A 2YT6A 2A28A 2RPNA 4X1VA 2EGEA 1TUCA 1TUDA 1OOTA 1WYXA 1ZUUA 1K9AA 2DILA 1HD3A 1M3CA 2KXCA 4HCKA 1PHTA 1S1NA 1WIEA 1Y57A 2K9GA 1WI7A 2KT1A 1ARKA 3UA6A 1B07A 2J6KA 2L3SA 5L23A 1X2KA 2GTOA 2CSIA 2DRKA 4Z89A 2J06A 2KBTA 1SHFA 2LQNA 4RTZA 5ECAA 2FRYA 3I9QA 2GNCA 4K11A 2CT3A 3REBB 3ZL7C 2CT4A 2DX1A 3NGPA 3M0TA 1WFWA 1UDLA 2ABLA 2AZSA 1UECA 3A98A 1MV3A 2LNHB 1ZLMA 2YDLA 2LMJA 2LJ3A 1KFZA 1T3SA 4JJBA 1TG0A 1AVZC 2YUOA 2J05A 4OMLA 2LCSA 3UA7A 2RQTA 1MUZA 4Z8AA 2O9SA 2EGAA 1UUEA 3ULRB 2ROTA 1X43A 2CDTA 4AFZC 2RQUA 1JO8A 4DEYA 1CKBA 2KRNA 1AZGB 2EYYA 4CC2A 1M30A 2PZ1A 1X6BA 3O5ZA 4JZ4A 4RTYA 2K3BA 4LUEA 1WXTA 2DJQA 2O9VA 1UG1A 1VYVA 1QWFA 3SEMA 2A08A 2LX7A 2ED1A 3I5SA 2HBWA 5IXFA 2GBQA 1AWOA 1BBZA 2W0ZA 5IHKA 2FEIA 3UATA 1K4US 2GQIA 2RMOA 1NG2A 1CSKA 2RF0A 2AKLA 1OV3A 4RTXA 1GL5A 2DL3A 2KYBA 4ZNXA 2M0YA 3NMZC 2YUNA 4RTTA 1M3AA 5FWBA 1X69A 2AK5A 4JPBW 1GBRA 3VS1A 2K7AA 2KNBB 2JM8A 1GRIA 4J9FA 5IXBA 1NYFA 2NUZA 3H0HA 1UHFA 1MV0B 1WX6A 2J6OA 2RNAA 1NLPC 1JXOA 3M0PA 1LCKA 1ZX6A 1I07A 4R0KA 2PTKA 3EHQA 2CUBA 1Z9ZA 3QWXX 4M4ZA 3FJ5A 1BK2A 1AWJA 2D8JA 2JMCA 2LP5A 4EIKA 4RUGA 4WCIA 4QT7A 1NYGA 1T3LA 2FPFA 1JEGA 2DL4A 2DF6A 4CC7A 5I22A 3TSZA 5EC7A 5GJVB 2MOXA 2B86A 1AZEA 1VYUA 2L2PA 3I5RA 1QKXA 2RQRA 1I1JA 2V1RA 2L3PA 1H8KA 3I35A 4LUDA 2OI3A 1E6HA 2D8HA 2CSQA 4HVVA 1PRLC 3VS0A 2IIMA 4ORZA 2AZVA 1SHGA 4F17A 2BZXA 3LH5A 1WLPB 3NPFA 3H41A 3M0RA 1GFCA 3KFVA 1NLOC 1M27C 1J3TA 1NM7A 1PNJA 2DBKA 2JS2A 1W70A 2JMAA 2F2XA 1W6XA 2SEMA 3PVQA 1A0NB 2DLPA 2QDLA 1UGVA 2ECZA 2DBMA 2HCKA 1H3HA 2DM1A 1YWPA 4J9CA 4Z88A 2DVJA 4AG1C 2JTEA 1WA7A 2ED0A 2MCNA 2G6FX 2GGRA 1NEGA 2EBPA 3VRZA 4LNPA 2C0OA 2X3XD 3CQTA 4J9IA 2LZ6B 3EHRA 4ESRA 1XOVA 3VS5A 2FPEA 1KJWA 1RLQC 2JXBA 1X27A 3QWYA 2FO0A 2RQWA 3EG3A 1OPKA 1BU1A 2KXDA 2VKNA 2KEAA 3U23A 1SSHA 1E6GA 4RTVA 2KYMA 1ABQA 1PKTA 1OPLA 1U3OA 2JW4A 2JM9A 4JJDA 4OMQA 3RBBB 2K2MA 2AKKA 3GBQA 4GBQA 2LJ1A 1AEYA 1JQQA 2YSQA 1RI9A 2O88A 2A37A 2V1QA 4HXJA 1UTIA 2DA9A 1YN8A 2YUPA 4LN2A 1M8MA 3VS6A 3REAB 2C0IA 3TSWA 3M0QA 1V1CA 4Y92A 4RTUA 1JXMA 3JV3A 4J9DA 2RN8A 2E5KA 2SRCA 2JT4A 3PE0A 2F2WA 4IIMA 2KROA 1KSWA 1WXUA 2EKHA 2FPDA 3EG2A 4JJCA 2LQWA 3VS3A 1PWTA 4E6RA 1T0JA 2J6FA 2FG0A 2L3QA 2K6DA 3PVLA 2BTTA 1Y0MA 2J7IA 1QLYA 4RTWA 2CH4W 3UF4A 5FWCA 2D1XA 2HDAA 2F2VA 1EFNA 1AWXA 3C0CA 4J9BA 2VVKA 1K76A 1ZUYA 1AD5A 2OJ2A 4JZ3A 1I0CA 2O31A 2EVRA 2KR3A 4A63B 2ESWA 4AFQC 1IO6A 2CREA 2M51A 4AG2C 1OEBA 4HVUA 1UJYA 1QWEA 1YNZA 2EYWA 4J9GA 2EYXA 1U06A 2DNUA 1X6GA 1X2QA 1WDXA 2CH4A 1QCFA 2X3WD 1CKAA 2I0NA 2YUQA 4KRTA 2DL8A 4HVWA 1FMKA 1AWWA 1YP5A 2DMOA 3EG0A 1GCQC 3VRYA 2MIOA 2ROLA 3M0SA 4D8DA 4OMNA 2D0NA 3H0FA 4F16A 2GTJA 1HJDA 2L0AA 1GCPA 1SEMA 3EGUA 4FSSA 3VS4A 1UJ0A 1UE9A 2EQIA 4GLMA 2EYZA 1PRMC 2EW3A 3SHWA 1ZUKA 1UFFA 2P4RA 3VS7A 2BZ8A 1G2BA 1HSQA 3NHNA 2JS0A 2HEQA 5HCKA 4IIOA 4AFUC 1QKWA 1GBQA 1N5ZA 1FYNA 1ZSGA 1T0HA 1BB9A 1U5SA 2NWMA 2ENMA 1K1ZA 1WXBA 2C0TA 1SPKA 2CUDA 2A36A 2RQVA 1H92A 3H0IA 1E7OA 1NEBA 1G83A 1SRMA 5FW9A 2LJ0A 2DL7A 5GJWB 2KT8A 2DE0X 2HSPA 1ZBJA 2EGCA 3TVTA 2PNIA 1M3BA 2DL5A 1RLPC 1JU5C 3M0UA 3R6NA 1RUWA 2H8HA 1GFDA 1YWOA 4OMPA 4LE9A 2KRMA 3VS2A 2O2OA 2VWFA 2FRWA 1KIKA 1K0XA 4J9HA 1K0SA 5I11A 1UHCA 4CC3A 2XMFA 3RNJA 2KGTA 4CC4B 1VYTA 2DRMA 1GCQA 2K79A 4F14A
chains in the Genus database with same CATH superfamily
1W1FA 2W10A 5FU6C 4KGZB 3IQLA 4Q5WA 2CGHA 4PJMA 1Y71A 3THKA 3ER0A 1Z9QA 2DYBA 4AFSC 4J9EA 3M54A 2RHZA 1VA7A 4D8KA 1N27A 2E4HA 4X1VA 3P8BB 4C8QF 2EGEA 3CMEQ 4M78G 2P0KA 1ZUUA 2AT1B 1HD3A 1IGQA 2KXCA 2OTLT 1PHTA 1Y57A 1YBYA 2O4XB 3CD6Q 3CXCP 3OYDA 2DZ9A 1WGSA 4PJOG 1OU8A 2FL7A 2LQNA 1VIFA 1JJ2S 3DKMA 2BKDN 3MKDA 1NPRA 2XDDA 3MEWA 4ZN3A 4M7DE 1SSFA 4E47A 3REBB 1R8OB 1D3BA 3ZL7C 4DBRA 2QEXT 3M0TA 4M77D 4J6YA 2ZPBB 5KYXB 3HP9A 1ZSZC 1R77A 2J05A 3HFOA 3CC2A 2GFAA 3HTRA 3NTIA 4Z8AA 1VQ5T 3CBOA 5DLQE 2KDSA 2CDTA 4F04B 2RQUA 1CKBA 1SF9A 2NLUA 2QXFA 1D0YA 5J26A 1KQSP 4CI0C 3O5ZA 2YHTA 5GAOn 2YRCA 1VQ9Q 1S72A 2DJQA 1Q82C 3CXCS 2DERA 2DZCA 2YRDA 2ZPFB 2HBWA 2QQBA 2GBQA 1RAEB 1AWOA 2W0ZA 5IHKA 3CCLA 5GAN8 2RK1A 1MMGA 3CBPA 5M9OA 1I5OB 1BCMA 2QTXA 3CCQT 2DEUA 1GL5A 2DL3A 3MPUB 1VQMA 4ZNXA 2M0YA 3NMZC 2F69A 4RTTA 1M3AA 4JPBW 4ZTFA 4J9FA 1VQ7Q 2NUZA 1WX6A 2RNAA 1JXOA 4EMKB 3OMGA 4FYXB 4J83A 2KSSA 2CUBA 3M56A 3VUBA 4M4ZA 1Q81U 1I5LA 1BK2A 2JMCA 2LP5A 4EIKA 4WCIA 1JEGA 1T3LA 2DPPB 2M9UA 2QA4T 3GNGA 1KQSS 3LWHA 5EC7A 3OSSC 2B86A 2FZKB 1AZEA 1NJIR 3OQ5A 1VQLQ 2L2PA 1I1JA 2RO0A 1H8KA 1MGQA 3I35A 1X75C 1VQPT 1UGQB 2CSQA 3VS0A 4KH1B 2OTLA 2EQUA 1SHGA 2VGMA 2LX9A 4LDVA 3CBMA 1YIJT 4HT9A 3VKIA 1GFCA 2HL3A 3QJYA 3CCVT 3X20B 8ATCB 2HD0A 2EJFA 1EIFA 4JRIA 3JCMV 2JS2A 2WSCE 3FLGA 4F7UA 1O9SA 1W6XA 2SEMA 2XDBA 3CCMQ 2V8IA 3G6EA 4WF2A 1U8RA 2COZA 2QDLA 5GAN7 1MMDA 2DM1A 1YWPA 1M2VB 4Z88A 2DVJA 2JTEA 1WA7A 3EFSA 1EX4A 2ED0A 4M7DF 3E9FA 2G6FX 3CCJQ 3SWNB 4C5IA 2GGRA 3QJ6A 3RMQA 1BI0A 3QPHA 3QSUA 1LPLA 4J9IA 4M77F 4NL2A 4ESRA 2IG0A 4J7IA 3QO3A 2GCXA 4JDSA 5LJ5j 2WSEE 3RDVA 3EG3A 5A0GA 3E1SA 7AT1B 1OX8A 3U23A 4N4HA 1VQ5A 2XICA 4TVRA 2KYMA 4C8QB 5GAOm 5FU7B 1U3OA 1XNIA 3HFNA 4GBQA 2LJ1A 1AEYA 4M7AA 2QQSA 1MHNA 4HXJA 3OYKA 2CZ1B 3KBGA 3SD4A 4LN2A 3VS6A 4PFZA 3META 3CCUQ 3CCSQ 1JXMA 2F5TX 4BE1A 2K2VA 3I56A 2NUPA 2FZCB 1VOMA 4PJOB 2G3RA 2HZYA 3PE0A 2XG8D 2KROA 4IIMA 4C92C 4E7IA 3VS3A 3CCQA 1Y96A 2CZ6B 4J6XA 5GAOp 2FG0A 2K6DA 1V76A 4E7HA 3HPWA 3FIFA 1Y0MA 3M53A 4RTWA 1M90C 3ME9A 2HDAA 2F2VA 3CPWA 3C94A 1M1KU 3PT9A 1N9RA 1ZUYA 2QQAA 4JZ3A 1GXIE 1K73U 2A0FB 2EYQA 3RKYA 3JB9I 1YNZA 3C95A 4ATOA 3L2UA 2QA4A 2EYXA 4PNOA 2DNUA 2L89A 1X2QA 1CKAA 5FLXE 4KRTA 2DL8A 3BFMA 1YP5A 2Y90A 2K3XA 4IUPA 2Y4XA 3PMTA 1YJ9T 4F16A 1Q81R 2RD1A 1HJDA 1SEMA 2WACA 1X6OA 1S72Q 3ASKA 2E10A 1YIJA 5GMKm 3JCMP 1JJ2A 2E1HA 3CCVA 2R5MA 5J3BA 1PRMC 2EAYA 4IUTA 3EFOA 5GAN5 3PNWC 3OYGA 3I55Q 3OYIA 1RAAB 4QVDA 3ZFJA 3L2QA 3G71Q 1YJNT 1NPPA 1FMWA 2HEQA 4BI3A 1QVPA 2VXFA 3OYNA 1WJSA 3S6WA 1T0HA 3OYHA 1M1FA 1BIBA 4C92D 1U5SA 1HYOA 3GP8A 2ENMA 1WXBA 2M1HA 5LJ5g 4FM4B 1H92A 2Z0WA 1PM3A 5GMKj 1KC8C 2E41A 2JVVA 2D9TA 1G3YA 5GJWB 3HL8A 1M8VA 2L5QA 4FYYB 1ZBJA 5LJ5e 1JU5C 3TEEA 3AHUA 4N0AA 4LE9A 2KI7A 2KVQG 5CQYA 2KRMA 3VS2A 2CP2A 2O2OA 5GAMj 3PFSA 5GANj 1TXQA 4FW2A 1K0XA 3PIPA 3OA6A 4C8QE 2DTOA 1AHJB 2KGTA 5KYYB 2CYZB 2DJZA 3L2VA 1KG1A 1GCQA 5IHNA 1M4ZA 3JB9D 5HK3A 2OTJQ 1G3TA 2LDMA 2KRSA 4M7DB 1WHGA 1WHJA 4QKUA 1PKSA 5IHIA 3V7SA 3JRZA 1SRLA 3G6EQ 4OMMA 2BZYA 4OMOA 2DAQA 2K5FA 4M77B 2RPNA 2MI6A 1TUDA 1WYXA 1Q86U 3RIRA 4QW2A 1KHCA 1SG5A 2YRVA 3BDLA 1IREB 2WSFE 4HA8A 1M5Q1 1WI7A 1H641 2LCLA 3SDZA 1B07A 1B34A 2L3SA 2OX7A 3LX7A 1X2KA 2CSIA 1G3SA 2DRKA 4Z89A 4BDZA 1YI2T 1M1KR 2M02A 2VB6A 2ZPHB 5KYWA 1RAFB 5LJ5h 5FU6B 1K73R 2QAZA 2FRYA 2XI9A 3H8ZA 2EJ9A 2GNCA 3JCMe 3FJPA 2CT3A 4XK8E 3CPWP 1YJ9A 3NGPA 4XU2A 2XKOC 3CCRQ 4PLLA 2AIRB 1N8RC 2RJDA 1MV3A 3A98A 5CAIA 2RJFA 4LD6A 2MMPA 5LJ5f 2YDLA 2L8DA 2GF7A 2D6FA 2LC4A 1VQ6T 3UA7A 2F5KA 1MUZA 3I56Q 2COWA 3G4ST 4HCZA 1VQ8Q 2EGAA 3ULRB 5CIUA 1YFNA 2CP3A 1JO8A 2QK0A 2E12A 4KH0B 3OYAA 2LCCA 4ELZC 3BE3A 2O01E 1MMAA 4JZ4A 4RTYA 2DFUA 2K3BA 3LH0A 3HRTA 1WXTA 4C92F 1JJ2P 3CC4Q 1QWFA 2A08A 3I5SA 1BBZA 1VIEA 3FEOA 1QP3A 1TS9A 3L1AA 3UATA 1PSEA 1K4US 3CEYA 4XTZA 2B8AA 3QXEB 2RF0A 3QZ9B 1G8XA 2QYZA 2FZGB 4M75A 3CPWS 5GANg 2YUNA 2QASA 3JCMh 1KK7A 1WHMA 4OB1B 2GQVA 1D09B 2JM8A 4DBQA 3CCEA 1PG5B 5IXBA 3L2ZA 1M2OA 1VQ4Q 3H0HA 4C8QG 4DQ2A 1RAHB 2J6OA 3M0PA 5GAMe 2RHXA 5GANe 4OGCA 1I4K1 2DTIA 4N4IA 1ZX6A 1YIJQ 4M7AC 4IKFA 3EHQA 2E3HA 2H3EB 4R56A 2COYA 3GPLA 1C6VX 3L42A 4FYWB 4RG8A 1G5VA 3JB9F 4M78A 2FPFA 2D0QB 2VC8A 5I22A 3X28B 3VYHB 1RACB 1YITT 1W2BA 4C0GA 2L3PA 1QW1A 1YHQQ 2K57A 5KE3A 1E6HA 2D8HA 4FU6A 3L2WA 2DD5A 5CQXA 4F17A 1PCXA 1VQKQ 4D6WA 1X01A 3OS2A 1V29B 4RMOA 3QKJA 4M77E 1HXDA 1VUBA 2VASA 1Q86R 2DBKA 2M16A 1YI2A 4A4EA 2F2XA 4C0DC 3MEVA 5GMKh 1A0NB 5FROA 3EAEA 1UGVA 2XU8A 1H3HA 1RABB 4MDXA 4MZMA 4AG1C 1QCNA 2PQWA 3AT1B 3UWNA 1YJWT 1WZOA 1NEGA 4E7KA 3VRZA 5GAN3 4LNPA 2X3XD 4KULA 2HKQB 1OULA 3OYMA 2E70A 2LZ6B 1XOVA 1IZ6A 2YWWA 4XQ3A 1UEBA 1RLQC 2JXBA 5GAMh 1X27A 1VQ6A 5GANh 2LT4A 2DXCA 3G4SA 2ZAEA 4QVZA 1SSHA 3N5BB 2JM9A 2LRQA 3GLXA 2X9HA 5HK0A 5LJ3e 4M7AD 1JQQA 1RI9A 3CMAQ 2A37A 1Y07A 2E6NA 4ZGJB 1M8MA 3OSVA 3EG9B 2K5IA 3JCMW 4LDWA 3A1PA 2RHIA 2NUTB 4Y92A 4RTUA 4J9DA 5LL6S 1VQNQ 3A5ZB 1RL2A 3CC7Q 2E5KA 2SRCA 2JT4A 2F2WA 1BCOA 3D7SB 1KSWA 3O8VA 1TUGB 1WXUA 2EKHA 3MP6A 1PWTA 2DYIA 4E6RA 2J6FA 2HQXA 2XDPA 4EPCA 1YCYA 2CH4W 5GAN4 1D1BA 3QYGB 1EFNA 4O6JA 2RHYA 3J7AF 4J9BA 2VVKA 4A4KA 1XJWB 2OJ2A 3OYYA 3OYBA 1KHIA 2EVRA 1QCOA 2KR3A 4N0AC 3V8JA 2HL5C 4A63B 4AFQC 3JSCA 1BKBA 1WQWA 2LQ8A 1TTHB 1VQOT 2BUDA 1OZ3A 4C5HA 2EYWA 2OAUA 3M58A 1NJIC 2IVWA 4FL6A 2CH4A 1QCFA 3V8LA 1WJQA 3Q1JA 4RCCA 2I0NA 1YITA 2DK3A 3MP8A 4C92B 1GCQC 3VRYA 2ROLA 1PC0A 5LJ3h 4D8DA 3A8OB 2JJ9A 2D0NA 3H0FA 3M9QA 2DTHA 2KAFA 3EGUA 2FHDA 5I21A 2V8KA 4PJNA 1UE9A 2EQIA 4M7DG 1XTDA 4NS5A 4GLMA 5CKFA 2EYZA 2QEXA 4M77G 3CMET 1RI0A 3RERA 4OP0A 4JS5A 2DXTA 3A8HB 1G2BA 1HSQA 2IPOB 4DOWA 1KC8U 5D7UA 1KD1C 2CP7A 5KYUB 4DOVA 1W2BP 4DA4A 4F7UF 1RAGB 5HCKA 3MO8A 4IIOA 1GBQA 3CD6T 3DLLA 2CP6A 4PJJA 1YJWA 3TQ7P 2C0TA 2RM4A 4IUUA 3FC3A 3CCEQ 2CUDA 3OY9A 4XU1A 2QGGA 3OYEA 2P0PA 1G3WA 1TSFA 1D0ZA 1O75A 1EZZB 2X4YA 2QQ9A 3QYHB 4C5EA 2DE0X 4NOYA 2QGFB 1C1AA 2EKOA 1WPYA 5LJ5d 2PNIA 3TU4K 2DL5A 4IUVA 2HKNA 1GFDA 4OMPA 3JAME 4QQ6A 4EMHA 4M7AF 1WNLA 3G1JA 4OMFB 1KIKA 2X4WA 1K0SA 4ME7A 1UHCA 4CC3A 2PU9B 4CC4B 5GAOr 3RR6A 1WQ7A 3LWIA 1NBEB 3M55A 3JCMc 4DEXA 4OVAA 4XTUA 2P84A 1B3QA 1W2BS 1VQ9T 3M59A 2EPDA 2OAWA 3RUXA 2DXUA 1YCSB 3OS5A 1D3BB 1ABOA 3J80E 2YT6A 4XAXB 3ZBDA 5A0LA 3BW1A 1TH7A 1OOTA 1IGUA 3CC2Q 3P8HA 1R0BG 1MMNA 1K9AA 2RK2A 1KQ1A 3WVEB 1AT1B 1M3CA 4HCKA 3V7RA 4P5NA 4M75C 2KT1A 1ARKA 4BE0A 5CKEA 1VQOA 1VQPA 2J6KA 1XQHA 3OYCA 5L23A 1QMCA 5J39A 2KBTA 5ECAA 2ZZDA 4RTZA 1VQ7T 3I9QA 4EDUA 4K11A 1D1CA 1OI1A 3JCMd 2DX1A 1W4SA 3CCLQ 1QVGA 3GOXA 4FSXA 2ABLA 4FYVB 4DBHA 1N9SA 2AZSA 4M78C 1QVFA 2EWNA 2LMJA 1KFZA 1T3SA 4JJBA 4A4GA 1VQLT 4RG2A 1TG0A 1ZQ1A 4A4FA 3HRUA 2DXBA 1VQMQ 3CMEA 4C92E 2RQTA 5CVIA 2AHJB 4HKEA 4A4HA 3OS0A 2O4XA 2O9SA 3LLRA 3EH2A 1UUEA 4BI8B 1K9MC 4PJOC 1WHLA 4MZTA 4WTOB 3CD6A 1ZA1B 5AT1B 1M30A 2PZ1A 3JCMQ 4E7ZA 3X25B 3VUZA 4LUEA 4ZGDB 2HNIA 1KC8R 4PLIA 3CCMT 2PVGB 3OYLA 3JB9H 2E3IA 5CK9A 2LX7A 2ED1A 5IXFA 4IUQA 3CCJT 5KYXA 2GQIA 2RMOA 1NG2A 1CSKA 4B9XA 4M75E 2CZ7B 4M75D 2OTLQ 1OV3A 4RTXA 5KCHA 4LD9K 2EFIA 3RMSA 4J5YA 5FWBA 2AK5A 3VS1A 2MK5A 4Y91A 1WJRA 1WHKA 2CP5A 1UHFA 3EGDB 1NLPC 5GAMd 3GNFB 5GANd 1OZ2A 1LCKA 4R0KA 4F7UB 1OX9A 2QEXQ 1SKUB 1Z9ZA 3QWXX 3FJ5A 1VQ9A 2VYTA 4QT7A 4II1A 1NYGA 4M78D 3WVDB 2DL4A 4CC7A 3CCUT 3CCST 8AT1B 2MOXA 3JCMX 3I5RA 3JCMg 2KK4A 2EQKA 3DLMA 4GY5A 4A53A 2F1LA 2OI3A 1TU0B 4FT2A 4LXCA 4HVVA 1VQ5Q 4KGXB 2IIMA 4PJLA 2LTOA 2AZVA 4PJOD 1UGPB 3M0RA 3KFVA 2CZ0B 1NLOC 4KUDK 4R55A 4EMKA 2HMAA 1DJ7B 2A7YA 1W70A 2JMAA 1VQ7A 4AT1B 1JB0E 3LGLA 4M7AB 2JN0A 3PVQA 1JRIA 4XTYA 2ECZA 2DBMA 2HCKA 3QZ5B 4HCBA 4J9CA 1Q82U 2PUKB 1FXXA 2MCNA 5LJ3j 2MPXC 4BE2A 1YJNA 2EBPA 3TCJA 1K8AC 1MNEA 4RKUE 1QQJA 3CCQQ 2NUPB 2XK0A 4E7SA 1VQLA 3VS5A 2VGNA 3CPFA 1Q7YC 1KJWA 3QWYA 2FO0A 4C92G 2RQWA 3OW2A 1OPKA 4PK4A 1Y96B 2KXDA 3VYGA 1N6AA 2KEAA 3QBYA 4RTVA 2ATCB 2FYKA 1ABQA 2E65A 3M5AA 1Q95G 3E9GA 4OMQA 2AKKA 3OBYA 5LJ3d 1ZHIA 2HBPA 3I55T 1QVGP 2DO3A 2O88A 5GMKi 4C0DB 3RKXA 4BY6C 1M2VA 2RJEA 3G71T 1QVFP 1ZSZB 3CCMA 3REAB 1KQ2A 2QA4Q 3SWNA 1I8FA 5D6XA 2V26A 3JV3A 2MYSA 5GAMg 1B7TA 2RN8A 1LOJA 3CCJA 1VQPQ 1D0XA 5A2QE 3UPUA 4JJCA 1F1BB 2HQHA 1BYMA 4C8QA 2L3QA 4FT4A 3JB9G 3JCMf 2J7IA 4M75F 3CCVQ 3M57A 4J8OA 5FWCA 2JTMA 5EG2A 2M0OA 3C0CA 3A8LB 2RJCA 3EFOB 2O31A 5DM7R 1IO6A 2CREA 2M51A 1OEBA 4XU3A 2DETA 4HVUA 3MJXA 4UC4A 3V8KA 2VXEA 4C5GA 4PJOA 1X6GA 2X3WD 1WDXA 3CCUA 3CCSA 4LDYA 1QVGS 4M78F 2YUQA 4HVWA 5IT9E 1AWWA 2DMOA 3EG0A 2CS7A 1QP2A 1KD1U 4KT0E 5AYFA 3J81E 2ZGWA 1QVFS 2RI3A 4F7UE 2ZCFB 4J7FA 2OTJT 2L0AA 2HAXA 4FSSA 5CCAA 5KCOA 3VS4A 2X35A 1LJOA 4JUVA 3G6ET 2YXYA 2LNVA 4PJOF 1Q86C 4VUBA 4M7DD 3SHWA 4XTXA 2QTVA 4N4GA 2P4RA 2JNGA 5FRNA 4X9CA 4V2SA 4XU0A 4ZGEB 3V7CA 1JBMA 5A0DA 9ATCB 1N5ZA 1ZSGA 5LJ3g 5D6YA 3JCMb 2XD0A 3P8DA 2E64A 4RCBA 2NWMA 4PFPA 5HKCA 4L59A 4M7AE 3MCAB 2PUOB 3EGXB 5GAMf 5GANf 5CKBA 1E7OA 1NEBA 3HKSA 1SRMA 5FW9A 1Q82R 1PSFA 4BACA 1BI3A 1LVKA 1M90U 3CCRT 2EGCA 1H3ZA 3JB9J 3A8GB 5C0MA 4PKCC 4ANJA 3R6NA 1YWOA 3I55A 4E2FB 1C0MA 1PD0A 3I56T 3KXTA 2VWFA 2ZPEB 4OF1A 6AT1B 3G71A 1VQ8T 3GIBA 4J9HA 2QG9B 4X34A 2K3YA 3H6ZA 3QHSA 2PVDB 2RH2A 4NL3A 4MZPA 1B34B 3PGGA 2A3LA 3OW2P 2DRMA 2K79A 4F14A 1FMVA 3MEUA 4MMKA 3QDRB 2JOYA 5KYWB 1YJ9Q 3EG1A 4XTVA 1AOJA 3PTAA 1TOVA 4HT8A 2R58A 3RKWA 4DBFA 3CC4T 2X4JA 5IH2A 2EQJA 3KUFA 3WXMB 2VUBA 2KE9A 2A28A 2MWOA 3SFMA 5HY6A 1TUCA 4JRPA 2ZPIB 1U1TA 3UDCA 1M1GA 2LT1A 1YJNQ 2DILA 2X4XA 4KUIA 2MWPA 1WIEA 1S1NA 2K9GA 4OB3B 3T9NA 1IHVA 3UA6A 2CP0A 3LGFA 5KYYA 2GTOA 2JZ2A 2J06A 1SHFA 4Z02A 3UT1A 2P0QA 3S3MA 1VQ4T 4YTLA 4OB2B 4B6MA 4AMCA 4M7DA 5LJ3f 2RB6A 5FRMA 1K9MU 3EGDA 2CT4A 4F7UG 2OTJA 1MNDA 1BI1A 4M77A 3C12A 3OBWA 1WFWA 1UDLA 2DIQA 2K4YA 3L2RA 1UECA 3OW2S 2LNHB 3SB2A 4C0FA 1ZLMA 4ELYC 2LJ3A 1AVZC 2YUOA 4OMLA 2MAMA 2LCSA 1KD1R 4GLKA 1YHQT 3NFCA 3FDRA 2DKGA 4M75B 2YLBA 1R0CB 2ROTA 1X43A 4AFZC 4DEYA 1VQKT 2KRNA 1AZGB 2EYYA 1I81A 4BUGA 1BIAA 2BIVA 4CC2A 4E7JA 1M9SA 4EMKC 4QQDA 3OB9A 4FW1A 2DIGA 4M7AG 4MMLA 1ZBXA 2O9VA 1UG1A 1VYVA 3SEMA 2QDYB 5KYNA 4M78B 2FEIA 4FCYA 2EIFA 2CKKA 3CCRA 3LYIA 2K5LA 2X51A 5IAYA 1RADB 3JCMJ 5CO7A 3VU3C 2AKLA 2E5QA 3E2UA 2KYBA 5GAOl 5CKHA 4PFOA 3M4GA 1X69A 1VQ8A 2BE9B 1GBRA 2K7AA 2KNBB 1GRIA 1NZ9A 1M90R 5L8RE 1YI2Q 1NYFA 3GF5A 1P92A 4BI4A 1MV0B 4HCCA 1UGRB 1UGSB 1I07A 2PTKA 3CMAT 3TREA 3QDFA 3RESA 1AWJA 2D8JA 1OYXA 4RUGA 2DF6A 2QI2A 4EMGA 3CC4A 3SWNC 3H9NA 5GAN6 4JRQA 3TSZA 5GJVB 5DY9A 1VYUA 3QIIA 4FIBA 1ZSZA 1VQNT 1N8RU 4JLIA 3FB9A 1QKXA 3X26B 2RQRA 3S3OA 3CC7T 3X24B 2V1RA 4JS4A 1VQ6Q 5DLOA 4LUDA 4IURA 2DVEA 3G4SQ 4BB7A 1PRLC 5CR2A 4ORZA 1WHHA 4JRKA 2BZXA 3LH5A 1WLPB 3NPFA 3H41A 1Q81C 4C8QC 5FU7C 4LDXA 1M27C 1K8AU 1J3TA 3C4SA 1NM7A 2DD4A 4BDYA 1PNJA 4QVCA 1Q7YU 5D6WA 1VQ4A 2RA2A 2KMTA 2DLPA 4O5VA 1ACMB 4JLGA 4QQGA 4CRIA 3MP1A 3OYFA 3OYJA 4L5GA 4OGEA 2C0OA 3CQTA 4XTWA 3EHRA 5C6SA 2FPEA 3DB4A 5I2SA 4KBMB 1YHQA 1K9MR 3HHTB 5GMKl 1BU1A 3OMCA 1UB4A 2P4TA 2VKNA 2XIDA 2KY9A 1U1SA 1E6GA 1PKTA 1OPLA 2JW4A 4JJDA 3RBBB 1VQKA 2K2MA 2I2LA 3F70A 3GBQA 2LVMA 1IHWA 2YSQA 2V1QA 2BE7D 3QG1A 1ZA2B 1UTIA 2DA9A 1YN8A 2YUPA 5KE2A 2ZPGB 3EH1A 4J6WA 2C0IA 5GAOq 3TSWA 2LQKA 3M0QA 4A54A 1V1CA 2C06A 2R5AA 3INZA 1YITQ 3ZEHA 5GAN2 3PMIA 1IXDA 5IN1A 3CXCA 2MF2A 4LDUA 2FPDA 3EG2A 2VV5A 4E7LA 2LQWA 1TWBA 1RAIB 3CCET 1T0JA 2EQMA 4C8QD 3PVLA 2BTTA 1QLYA 1BI2A 3UF4A 2R57A 2D1XA 3EGXA 2E6ZA 4M78E 1AWXA 4ZTJA 3DB3A 2Y4YA 3LW5E 1K76A 1AD5A 1FX7A 2HSEB 5KH6A 1I0CA 3M4YA 3EG9A 2ESWA 3VV0A 2KQWA 4BY6B 4BD3A 3CMAA 2NUTA 4AG2C 1UJYA 1QWEA 4B9WA 1YJWQ 1NE8A 4PJOE 3NTKA 3E19A 4J9GA 2EJGA 3MHXA 1U06A 3VJPA 1D1AA 1VQNA 1FMKA 2JUFA 2XHCA 3CC7A 5CKDA 1M1KC 2MIOA 3BDUA 3NTHA 1IB8A 3M0SA 3MEAA 4OMNA 4X9DA 1KQSA 2GTJA 1K73C 1GCPA 1LNXA 3A8MB 1UJ0A 4ZN1A 2HQEA 2JTFA 2YLCA 2RI2A 4JJNK 1N8RR 1IRXA 2EW3A 2RHUA 4C0ZA 1ZUKA 1UFFA 3CC2T 3VS7A 5I2MA 2BZ8A 2GFUA 3BY7A 4KGVB 3NHNA 1PD1A 4L6V5 2JS0A 3OS1A 1OU9A 1OQKA 4AFUC 1QKWA 3G7ZA 1FYNA 1K8AR 2FVUA 4C92A 1BB9A 3URGA 1Q7YR 1K1ZA 1SPKA 3HRSA 3FRNA 3QUIA 1S72T 2A36A 2RQVA 2NYSA 3H0IA 4PL6A 4M7DC 1G83A 2LJ0A 3EFRA 2DL7A 4OB0B 3CCLT 2KT8A 1HK9A 4M77C 2HSPA 3HSBA 2H3JA 3TVTA 1M3BA 1RLPC 2RI5A 3M0UA 3R6OA 1RUWA 2H8HA 4Y28E 2QQRA 1VQMT 5KYUA 2L3RA 1VQOQ 2DEQA 2V8JA 2FRWA 1Y7XA 4M75G 5I11A 5GMKe 2PVOB 2XMFA 1FWZA 3RNJA 4MDWA 3PIOA 3S3NA 1NJIU 1VYTA 2FB7A 1X6BA
chains in the Genus database with same CATH topology
1W1FA 4DEXA 5IHNA 2W10A 1B3QA 3IQLA 3EG1A 3THKA 1Z9QA 2DYBA 2EPDA 1AOJA 2KRSA 2OAWA 4J9EA 4AFSC 1PKSA 5IHIA 1YCSB 1SRLA 1VA7A 4D8KA 5IH2A 1ABOA 4OMMA 2BZYA 4OMOA 2KE9A 2YT6A 2A28A 2RPNA 4X1VA 2EGEA 1TUCA 1TUDA 1OOTA 1WYXA 1ZUUA 1K9AA 2DILA 1HD3A 1M3CA 2KXCA 4HCKA 1PHTA 1S1NA 1WIEA 1Y57A 2K9GA 1WI7A 2KT1A 1ARKA 3UA6A 1B07A 2J6KA 2L3SA 5L23A 1X2KA 2GTOA 2CSIA 2DRKA 4Z89A 2J06A 2KBTA 1SHFA 2LQNA 4RTZA 5ECAA 2FRYA 3I9QA 2GNCA 4K11A 2CT3A 3REBB 3ZL7C 2CT4A 2DX1A 3NGPA 3M0TA 1WFWA 1UDLA 2ABLA 2AZSA 1UECA 3A98A 1MV3A 2LNHB 1ZLMA 2YDLA 2LMJA 2LJ3A 1KFZA 1T3SA 4JJBA 1TG0A 1AVZC 2YUOA 2J05A 4OMLA 2LCSA 3UA7A 2RQTA 1MUZA 4Z8AA 2O9SA 2EGAA 1UUEA 3ULRB 2ROTA 1X43A 2CDTA 4AFZC 2RQUA 1JO8A 4DEYA 1CKBA 2KRNA 1AZGB 2EYYA 4CC2A 1M30A 2PZ1A 1X6BA 3O5ZA 4JZ4A 4RTYA 2K3BA 4LUEA 1WXTA 2DJQA 2O9VA 1UG1A 1VYVA 1QWFA 3SEMA 2A08A 2LX7A 2ED1A 3I5SA 2HBWA 5IXFA 2GBQA 1AWOA 1BBZA 2W0ZA 5IHKA 2FEIA 3UATA 1K4US 2GQIA 2RMOA 1NG2A 1CSKA 2RF0A 2AKLA 1OV3A 4RTXA 1GL5A 2DL3A 2KYBA 4ZNXA 2M0YA 3NMZC 2YUNA 4RTTA 1M3AA 5FWBA 1X69A 2AK5A 4JPBW 1GBRA 3VS1A 2K7AA 2KNBB 2JM8A 1GRIA 4J9FA 5IXBA 1NYFA 2NUZA 3H0HA 1UHFA 1MV0B 1WX6A 2J6OA 2RNAA 1NLPC 1JXOA 3M0PA 1LCKA 1ZX6A 1I07A 4R0KA 2PTKA 3EHQA 2CUBA 1Z9ZA 3QWXX 4M4ZA 3FJ5A 1BK2A 1AWJA 2D8JA 2JMCA 2LP5A 4EIKA 4RUGA 4WCIA 4QT7A 1NYGA 1T3LA 2FPFA 1JEGA 2DL4A 2DF6A 4CC7A 5I22A 3TSZA 5EC7A 5GJVB 2MOXA 2B86A 1AZEA 1VYUA 2L2PA 3I5RA 1QKXA 2RQRA 1I1JA 2V1RA 2L3PA 1H8KA 3I35A 4LUDA 2OI3A 1E6HA 2D8HA 2CSQA 4HVVA 1PRLC 3VS0A 2IIMA 4ORZA 2AZVA 1SHGA 4F17A 2BZXA 3LH5A 1WLPB 3NPFA 3H41A 3M0RA 1GFCA 3KFVA 1NLOC 1M27C 1J3TA 1NM7A 1PNJA 2DBKA 2JS2A 1W70A 2JMAA 2F2XA 1W6XA 2SEMA 3PVQA 1A0NB 2DLPA 2QDLA 1UGVA 2ECZA 2DBMA 2HCKA 1H3HA 2DM1A 1YWPA 4J9CA 4Z88A 2DVJA 4AG1C 2JTEA 1WA7A 2ED0A 2MCNA 2G6FX 2GGRA 1NEGA 2EBPA 3VRZA 4LNPA 2C0OA 2X3XD 3CQTA 4J9IA 2LZ6B 3EHRA 4ESRA 1XOVA 3VS5A 2FPEA 1KJWA 1RLQC 2JXBA 1X27A 3QWYA 2FO0A 2RQWA 3EG3A 1OPKA 1BU1A 2KXDA 2VKNA 2KEAA 3U23A 1SSHA 1E6GA 4RTVA 2KYMA 1ABQA 1PKTA 1OPLA 1U3OA 2JW4A 2JM9A 4JJDA 4OMQA 3RBBB 2K2MA 2AKKA 3GBQA 4GBQA 2LJ1A 1AEYA 1JQQA 2YSQA 1RI9A 2O88A 2A37A 2V1QA 4HXJA 1UTIA 2DA9A 1YN8A 2YUPA 4LN2A 1M8MA 3VS6A 3REAB 2C0IA 3TSWA 3M0QA 1V1CA 4Y92A 4RTUA 1JXMA 3JV3A 4J9DA 2RN8A 2E5KA 2SRCA 2JT4A 3PE0A 2F2WA 4IIMA 2KROA 1KSWA 1WXUA 2EKHA 2FPDA 3EG2A 4JJCA 2LQWA 3VS3A 1PWTA 4E6RA 1T0JA 2J6FA 2FG0A 2L3QA 2K6DA 3PVLA 2BTTA 1Y0MA 2J7IA 1QLYA 4RTWA 2CH4W 3UF4A 5FWCA 2D1XA 2HDAA 2F2VA 1EFNA 1AWXA 3C0CA 4J9BA 2VVKA 1K76A 1ZUYA 1AD5A 2OJ2A 4JZ3A 1I0CA 2O31A 2EVRA 2KR3A 4A63B 2ESWA 4AFQC 1IO6A 2CREA 2M51A 4AG2C 1OEBA 4HVUA 1UJYA 1QWEA 1YNZA 2EYWA 4J9GA 2EYXA 1U06A 2DNUA 1X6GA 1X2QA 1WDXA 2CH4A 1QCFA 2X3WD 1CKAA 2I0NA 2YUQA 4KRTA 2DL8A 4HVWA 1FMKA 1AWWA 1YP5A 2DMOA 3EG0A 1GCQC 3VRYA 2MIOA 2ROLA 3M0SA 4D8DA 4OMNA 2D0NA 3H0FA 4F16A 2GTJA 1HJDA 2L0AA 1GCPA 1SEMA 3EGUA 4FSSA 3VS4A 1UJ0A 1UE9A 2EQIA 4GLMA 2EYZA 1PRMC 2EW3A 3SHWA 1ZUKA 1UFFA 2P4RA 3VS7A 2BZ8A 1G2BA 1HSQA 3NHNA 2JS0A 2HEQA 5HCKA 4IIOA 4AFUC 1QKWA 1GBQA 1N5ZA 1FYNA 1ZSGA 1T0HA 1BB9A 1U5SA 2NWMA 2ENMA 1K1ZA 1WXBA 2C0TA 1SPKA 2CUDA 2A36A 2RQVA 1H92A 3H0IA 1E7OA 1NEBA 1G83A 1SRMA 5FW9A 2LJ0A 2DL7A 5GJWB 2KT8A 2DE0X 2HSPA 1ZBJA 2EGCA 3TVTA 2PNIA 1M3BA 2DL5A 1RLPC 1JU5C 3M0UA 3R6NA 1RUWA 2H8HA 1GFDA 1YWOA 4OMPA 4LE9A 2KRMA 3VS2A 2O2OA 2VWFA 2FRWA 1KIKA 1K0XA 4J9HA 1K0SA 5I11A 1UHCA 4CC3A 2XMFA 3RNJA 2KGTA 4CC4B 1VYTA 2DRMA 1GCQA 2K79A 4F14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W1F A;  4DEX A;  5IHN A;  2W10 A;  1B3Q A;  3IQL A;  3EG1 A;  3THK A;  1Z9Q A;  2DYB A;  2EPD A;  1AOJ A;  2KRS A;  2OAW A;  4J9E A;  4AFS C;  1PKS A;  5IHI A;  1YCS B;  1SRL A;  1VA7 A;  4D8K A;  5IH2 A;  1ABO A;  4OMM A;  2BZY A;  4OMO A;  2KE9 A;  2YT6 A;  2A28 A;  2RPN A;  4X1V A;  2EGE A;  1TUC A;  1TUD A;  1OOT A;  1WYX A;  1ZUU A;  1K9A A;  2DIL A;  1HD3 A;  1M3C A;  2KXC A;  4HCK A;  1PHT A;  1S1N A;  1WIE A;  1Y57 A;  2K9G A;  1WI7 A;  2KT1 A;  1ARK A;  3UA6 A;  1B07 A;  2J6K A;  2L3S A;  5L23 A;  1X2K A;  2GTO A;  2CSI A;  2DRK A;  4Z89 A;  2J06 A;  2KBT A;  1SHF A;  2LQN A;  4RTZ A;  5ECA A;  2FRY A;  3I9Q A;  2GNC A;  4K11 A;  2CT3 A;  3REB B;  3ZL7 C;  2CT4 A;  2DX1 A;  3NGP A;  3M0T A;  1WFW A;  1UDL A;  2ABL A;  2AZS A;  1UEC A;  3A98 A;  1MV3 A;  2LNH B;  1ZLM A;  2YDL A;  2LMJ A;  2LJ3 A;  1KFZ A;  1T3S A;  4JJB A;  1TG0 A;  1AVZ C;  2YUO A;  2J05 A;  4OML A;  2LCS A;  3UA7 A;  2RQT A;  1MUZ A;  4Z8A A;  2O9S A;  2EGA A;  1UUE A;  3ULR B;  2ROT A;  1X43 A;  2CDT A;  4AFZ C;  2RQU A;  1JO8 A;  4DEY A;  1CKB A;  2KRN A;  1AZG B;  2EYY A;  4CC2 A;  1M30 A;  2PZ1 A;  1X6B A;  3O5Z A;  4JZ4 A;  4RTY A;  2K3B A;  4LUE A;  1WXT A;  2DJQ A;  2O9V A;  1UG1 A;  1VYV A;  1QWF A;  3SEM A;  2A08 A;  2LX7 A;  2ED1 A;  3I5S A;  2HBW A;  5IXF A;  2GBQ A;  1AWO A;  1BBZ A;  2W0Z A;  5IHK A;  2FEI A;  3UAT A;  1K4U S;  2GQI A;  2RMO A;  1NG2 A;  1CSK A;  2RF0 A;  2AKL A;  1OV3 A;  4RTX A;  1GL5 A;  2DL3 A;  2KYB A;  4ZNX A;  2M0Y A;  3NMZ C;  2YUN A;  4RTT A;  1M3A A;  5FWB A;  1X69 A;  2AK5 A;  4JPB W;  1GBR A;  3VS1 A;  2K7A A;  2KNB B;  2JM8 A;  1GRI A;  4J9F A;  5IXB A;  1NYF A;  2NUZ A;  3H0H A;  1UHF A;  1MV0 B;  1WX6 A;  2J6O A;  2RNA A;  1NLP C;  1JXO A;  3M0P A;  1LCK A;  1ZX6 A;  1I07 A;  4R0K A;  2PTK A;  3EHQ A;  2CUB A;  1Z9Z A;  3QWX X;  4M4Z A;  3FJ5 A;  1BK2 A;  1AWJ A;  2D8J A;  2JMC A;  2LP5 A;  4EIK A;  4RUG A;  4WCI A;  4QT7 A;  1NYG A;  1T3L A;  2FPF A;  1JEG A;  2DL4 A;  2DF6 A;  4CC7 A;  5I22 A;  3TSZ A;  5EC7 A;  5GJV B;  2MOX A;  2B86 A;  1AZE A;  1VYU A;  2L2P A;  3I5R A;  1QKX A;  2RQR A;  1I1J A;  2V1R A;  2L3P A;  1H8K A;  3I35 A;  4LUD A;  2OI3 A;  1E6H A;  2D8H A;  2CSQ A;  4HVV A;  1PRL C;  3VS0 A;  2IIM A;  4ORZ A;  2AZV A;  1SHG A;  4F17 A;  2BZX A;  3LH5 A;  1WLP B;  3NPF A;  3H41 A;  3M0R A;  1GFC A;  3KFV A;  1NLO C;  1M27 C;  1J3T A;  1NM7 A;  1PNJ A;  2DBK A;  2JS2 A;  1W70 A;  2JMA A;  2F2X A;  1W6X A;  2SEM A;  3PVQ A;  1A0N B;  2DLP A;  2QDL A;  1UGV A;  2ECZ A;  2DBM A;  2HCK A;  1H3H A;  2DM1 A;  1YWP A;  4J9C A;  4Z88 A;  2DVJ A;  4AG1 C;  2JTE A;  1WA7 A;  2ED0 A;  2MCN A;  2G6F X;  2GGR A;  1NEG A;  2EBP A;  3VRZ A;  4LNP A;  2C0O A;  2X3X D;  3CQT A;  4J9I A;  2LZ6 B;  3EHR A;  4ESR A;  1XOV A;  3VS5 A;  2FPE A;  1KJW A;  1RLQ C;  2JXB A;  1X27 A;  3QWY A;  2FO0 A;  2RQW A;  3EG3 A;  1OPK A;  1BU1 A;  2KXD A;  2VKN A;  2KEA A;  3U23 A;  1SSH A;  1E6G A;  4RTV A;  2KYM A;  1ABQ A;  1PKT A;  1OPL A;  1U3O A;  2JW4 A;  2JM9 A;  4JJD A;  4OMQ A;  3RBB B;  2K2M A;  2AKK A;  3GBQ A;  4GBQ A;  2LJ1 A;  1AEY A;  1JQQ A;  2YSQ A;  1RI9 A;  2O88 A;  2A37 A;  2V1Q A;  4HXJ A;  1UTI A;  2DA9 A;  1YN8 A;  2YUP A;  4LN2 A;  1M8M A;  3VS6 A;  3REA B;  2C0I A;  3TSW A;  3M0Q A;  1V1C A;  4Y92 A;  4RTU A;  1JXM A;  3JV3 A;  4J9D A;  2RN8 A;  2E5K A;  2SRC A;  2JT4 A;  3PE0 A;  2F2W A;  4IIM A;  2KRO A;  1KSW A;  1WXU A;  2EKH A;  2FPD A;  3EG2 A;  4JJC A;  2LQW A;  3VS3 A;  1PWT A;  4E6R A;  1T0J A;  2J6F A;  2FG0 A;  2L3Q A;  2K6D A;  3PVL A;  2BTT A;  1Y0M A;  2J7I A;  1QLY A;  4RTW A;  2CH4 W;  3UF4 A;  5FWC A;  2D1X A;  2HDA A;  2F2V A;  1EFN A;  1AWX A;  3C0C A;  4J9B A;  2VVK A;  1K76 A;  1ZUY A;  1AD5 A;  2OJ2 A;  4JZ3 A;  1I0C A;  2O31 A;  2EVR A;  2KR3 A;  4A63 B;  2ESW A;  4AFQ C;  1IO6 A;  2CRE A;  2M51 A;  4AG2 C;  1OEB A;  4HVU A;  1UJY A;  1QWE A;  1YNZ A;  2EYW A;  4J9G A;  2EYX A;  1U06 A;  2DNU A;  1X6G A;  1X2Q A;  1WDX A;  2CH4 A;  1QCF A;  2X3W D;  1CKA A;  2I0N A;  2YUQ A;  4KRT A;  2DL8 A;  4HVW A;  1FMK A;  1AWW A;  1YP5 A;  2DMO A;  3EG0 A;  1GCQ C;  3VRY A;  2MIO A;  2ROL A;  3M0S A;  4D8D A;  4OMN A;  2D0N A;  3H0F A;  4F16 A;  2GTJ A;  1HJD A;  2L0A A;  1GCP A;  1SEM A;  3EGU A;  4FSS A;  3VS4 A;  1UJ0 A;  1UE9 A;  2EQI A;  4GLM A;  2EYZ A;  1PRM C;  2EW3 A;  3SHW A;  1ZUK A;  1UFF A;  2P4R A;  3VS7 A;  2BZ8 A;  1G2B A;  1HSQ A;  3NHN A;  2JS0 A;  2HEQ A;  5HCK A;  4IIO A;  4AFU C;  1QKW A;  1GBQ A;  1N5Z A;  1FYN A;  1ZSG A;  1T0H A;  1BB9 A;  1U5S A;  2NWM A;  2ENM A;  1K1Z A;  1WXB A;  2C0T A;  1SPK A;  2CUD A;  2A36 A;  2RQV A;  1H92 A;  3H0I A;  1E7O A;  1NEB A;  1G83 A;  1SRM A;  5FW9 A;  2LJ0 A;  2DL7 A;  5GJW B;  2KT8 A;  2DE0 X;  2HSP A;  1ZBJ A;  2EGC A;  3TVT A;  2PNI A;  1M3B A;  2DL5 A;  1RLP C;  1JU5 C;  3M0U A;  3R6N A;  1RUW A;  2H8H A;  1GFD A;  1YWO A;  4OMP A;  4LE9 A;  2KRM A;  3VS2 A;  2O2O A;  2VWF A;  2FRW A;  1KIK A;  1K0X A;  4J9H A;  1K0S A;  5I11 A;  1UHC A;  4CC3 A;  2XMF A;  3RNJ A;  2KGT A;  4CC4 B;  1VYT A;  2DRM A;  1GCQ A;  2K79 A;  4F14 A; 
#chains in the Genus database with same CATH topology
 1W1F A;  2W10 A;  5FU6 C;  4KGZ B;  3IQL A;  4Q5W A;  2CGH A;  4PJM A;  1Y71 A;  3THK A;  3ER0 A;  1Z9Q A;  2DYB A;  4AFS C;  4J9E A;  3M54 A;  2RHZ A;  1VA7 A;  4D8K A;  1N27 A;  2E4H A;  4X1V A;  3P8B B;  4C8Q F;  2EGE A;  3CME Q;  4M78 G;  2P0K A;  1ZUU A;  2AT1 B;  1HD3 A;  1IGQ A;  2KXC A;  2OTL T;  1PHT A;  1Y57 A;  1YBY A;  2O4X B;  3CD6 Q;  3CXC P;  3OYD A;  2DZ9 A;  1WGS A;  4PJO G;  1OU8 A;  2FL7 A;  2LQN A;  1VIF A;  1JJ2 S;  3DKM A;  2BKD N;  3MKD A;  1NPR A;  2XDD A;  3MEW A;  4ZN3 A;  4M7D E;  1SSF A;  4E47 A;  3REB B;  1R8O B;  1D3B A;  3ZL7 C;  4DBR A;  2QEX T;  3M0T A;  4M77 D;  4J6Y A;  2ZPB B;  5KYX B;  3HP9 A;  1ZSZ C;  1R77 A;  2J05 A;  3HFO A;  3CC2 A;  2GFA A;  3HTR A;  3NTI A;  4Z8A A;  1VQ5 T;  3CBO A;  5DLQ E;  2KDS A;  2CDT A;  4F04 B;  2RQU A;  1CKB A;  1SF9 A;  2NLU A;  2QXF A;  1D0Y A;  5J26 A;  1KQS P;  4CI0 C;  3O5Z A;  2YHT A;  5GAO n;  2YRC A;  1VQ9 Q;  1S72 A;  2DJQ A;  1Q82 C;  3CXC S;  2DER A;  2DZC A;  2YRD A;  2ZPF B;  2HBW A;  2QQB A;  2GBQ A;  1RAE B;  1AWO A;  2W0Z A;  5IHK A;  3CCL A;  5GAN 8;  2RK1 A;  1MMG A;  3CBP A;  5M9O A;  1I5O B;  1BCM A;  2QTX A;  3CCQ T;  2DEU A;  1GL5 A;  2DL3 A;  3MPU B;  1VQM A;  4ZNX A;  2M0Y A;  3NMZ C;  2F69 A;  4RTT A;  1M3A A;  4JPB W;  4ZTF A;  4J9F A;  1VQ7 Q;  2NUZ A;  1WX6 A;  2RNA A;  1JXO A;  4EMK B;  3OMG A;  4FYX B;  4J83 A;  2KSS A;  2CUB A;  3M56 A;  3VUB A;  4M4Z A;  1Q81 U;  1I5L A;  1BK2 A;  2JMC A;  2LP5 A;  4EIK A;  4WCI A;  1JEG A;  1T3L A;  2DPP B;  2M9U A;  2QA4 T;  3GNG A;  1KQS S;  3LWH A;  5EC7 A;  3OSS C;  2B86 A;  2FZK B;  1AZE A;  1NJI R;  3OQ5 A;  1VQL Q;  2L2P A;  1I1J A;  2RO0 A;  1H8K A;  1MGQ A;  3I35 A;  1X75 C;  1VQP T;  1UGQ B;  2CSQ A;  3VS0 A;  4KH1 B;  2OTL A;  2EQU A;  1SHG A;  2VGM A;  2LX9 A;  4LDV A;  3CBM A;  1YIJ T;  4HT9 A;  3VKI A;  1GFC A;  2HL3 A;  3QJY A;  3CCV T;  3X20 B;  8ATC B;  2HD0 A;  2EJF A;  1EIF A;  4JRI A;  3JCM V;  2JS2 A;  2WSC E;  3FLG A;  4F7U A;  1O9S A;  1W6X A;  2SEM A;  2XDB A;  3CCM Q;  2V8I A;  3G6E A;  4WF2 A;  1U8R A;  2COZ A;  2QDL A;  5GAN 7;  1MMD A;  2DM1 A;  1YWP A;  1M2V B;  4Z88 A;  2DVJ A;  2JTE A;  1WA7 A;  3EFS A;  1EX4 A;  2ED0 A;  4M7D F;  3E9F A;  2G6F X;  3CCJ Q;  3SWN B;  4C5I A;  2GGR A;  3QJ6 A;  3RMQ A;  1BI0 A;  3QPH A;  3QSU A;  1LPL A;  4J9I A;  4M77 F;  4NL2 A;  4ESR A;  2IG0 A;  4J7I A;  3QO3 A;  2GCX A;  4JDS A;  5LJ5 j;  2WSE E;  3RDV A;  3EG3 A;  5A0G A;  3E1S A;  7AT1 B;  1OX8 A;  3U23 A;  4N4H A;  1VQ5 A;  2XIC A;  4TVR A;  2KYM A;  4C8Q B;  5GAO m;  5FU7 B;  1U3O A;  1XNI A;  3HFN A;  4GBQ A;  2LJ1 A;  1AEY A;  4M7A A;  2QQS A;  1MHN A;  4HXJ A;  3OYK A;  2CZ1 B;  3KBG A;  3SD4 A;  4LN2 A;  3VS6 A;  4PFZ A;  3MET A;  3CCU Q;  3CCS Q;  1JXM A;  2F5T X;  4BE1 A;  2K2V A;  3I56 A;  2NUP A;  2FZC B;  1VOM A;  4PJO B;  2G3R A;  2HZY A;  3PE0 A;  2XG8 D;  2KRO A;  4IIM A;  4C92 C;  4E7I A;  3VS3 A;  3CCQ A;  1Y96 A;  2CZ6 B;  4J6X A;  5GAO p;  2FG0 A;  2K6D A;  1V76 A;  4E7H A;  3HPW A;  3FIF A;  1Y0M A;  3M53 A;  4RTW A;  1M90 C;  3ME9 A;  2HDA A;  2F2V A;  3CPW A;  3C94 A;  1M1K U;  3PT9 A;  1N9R A;  1ZUY A;  2QQA A;  4JZ3 A;  1GXI E;  1K73 U;  2A0F B;  2EYQ A;  3RKY A;  3JB9 I;  1YNZ A;  3C95 A;  4ATO A;  3L2U A;  2QA4 A;  2EYX A;  4PNO A;  2DNU A;  2L89 A;  1X2Q A;  1CKA A;  5FLX E;  4KRT A;  2DL8 A;  3BFM A;  1YP5 A;  2Y90 A;  2K3X A;  4IUP A;  2Y4X A;  3PMT A;  1YJ9 T;  4F16 A;  1Q81 R;  2RD1 A;  1HJD A;  1SEM A;  2WAC A;  1X6O A;  1S72 Q;  3ASK A;  2E10 A;  1YIJ A;  5GMK m;  3JCM P;  1JJ2 A;  2E1H A;  3CCV A;  2R5M A;  5J3B A;  1PRM C;  2EAY A;  4IUT A;  3EFO A;  5GAN 5;  3PNW C;  3OYG A;  3I55 Q;  3OYI A;  1RAA B;  4QVD A;  3ZFJ A;  3L2Q A;  3G71 Q;  1YJN T;  1NPP A;  1FMW A;  2HEQ A;  4BI3 A;  1QVP A;  2VXF A;  3OYN A;  1WJS A;  3S6W A;  1T0H A;  3OYH A;  1M1F A;  1BIB A;  4C92 D;  1U5S A;  1HYO A;  3GP8 A;  2ENM A;  1WXB A;  2M1H A;  5LJ5 g;  4FM4 B;  1H92 A;  2Z0W A;  1PM3 A;  5GMK j;  1KC8 C;  2E41 A;  2JVV A;  2D9T A;  1G3Y A;  5GJW B;  3HL8 A;  1M8V A;  2L5Q A;  4FYY B;  1ZBJ A;  5LJ5 e;  1JU5 C;  3TEE A;  3AHU A;  4N0A A;  4LE9 A;  2KI7 A;  2KVQ G;  5CQY A;  2KRM A;  3VS2 A;  2CP2 A;  2O2O A;  5GAM j;  3PFS A;  5GAN j;  1TXQ A;  4FW2 A;  1K0X A;  3PIP A;  3OA6 A;  4C8Q E;  2DTO A;  1AHJ B;  2KGT A;  5KYY B;  2CYZ B;  2DJZ A;  3L2V A;  1KG1 A;  1GCQ A;  5IHN A;  1M4Z A;  3JB9 D;  5HK3 A;  2OTJ Q;  1G3T A;  2LDM A;  2KRS A;  4M7D B;  1WHG A;  1WHJ A;  4QKU A;  1PKS A;  5IHI A;  3V7S A;  3JRZ A;  1SRL A;  3G6E Q;  4OMM A;  2BZY A;  4OMO A;  2DAQ A;  2K5F A;  4M77 B;  2RPN A;  2MI6 A;  1TUD A;  1WYX A;  1Q86 U;  3RIR A;  4QW2 A;  1KHC A;  1SG5 A;  2YRV A;  3BDL A;  1IRE B;  2WSF E;  4HA8 A;  1M5Q 1;  1WI7 A;  1H64 1;  2LCL A;  3SDZ A;  1B07 A;  1B34 A;  2L3S A;  2OX7 A;  3LX7 A;  1X2K A;  2CSI A;  1G3S A;  2DRK A;  4Z89 A;  4BDZ A;  1YI2 T;  1M1K R;  2M02 A;  2VB6 A;  2ZPH B;  5KYW A;  1RAF B;  5LJ5 h;  5FU6 B;  1K73 R;  2QAZ A;  2FRY A;  2XI9 A;  3H8Z A;  2EJ9 A;  2GNC A;  3JCM e;  3FJP A;  2CT3 A;  4XK8 E;  3CPW P;  1YJ9 A;  3NGP A;  4XU2 A;  2XKO C;  3CCR Q;  4PLL A;  2AIR B;  1N8R C;  2RJD A;  1MV3 A;  3A98 A;  5CAI A;  2RJF A;  4LD6 A;  2MMP A;  5LJ5 f;  2YDL A;  2L8D A;  2GF7 A;  2D6F A;  2LC4 A;  1VQ6 T;  3UA7 A;  2F5K A;  1MUZ A;  3I56 Q;  2COW A;  3G4S T;  4HCZ A;  1VQ8 Q;  2EGA A;  3ULR B;  5CIU A;  1YFN A;  2CP3 A;  1JO8 A;  2QK0 A;  2E12 A;  4KH0 B;  3OYA A;  2LCC A;  4ELZ C;  3BE3 A;  2O01 E;  1MMA A;  4JZ4 A;  4RTY A;  2DFU A;  2K3B A;  3LH0 A;  3HRT A;  1WXT A;  4C92 F;  1JJ2 P;  3CC4 Q;  1QWF A;  2A08 A;  3I5S A;  1BBZ A;  1VIE A;  3FEO A;  1QP3 A;  1TS9 A;  3L1A A;  3UAT A;  1PSE A;  1K4U S;  3CEY A;  4XTZ A;  2B8A A;  3QXE B;  2RF0 A;  3QZ9 B;  1G8X A;  2QYZ A;  2FZG B;  4M75 A;  3CPW S;  5GAN g;  2YUN A;  2QAS A;  3JCM h;  1KK7 A;  1WHM A;  4OB1 B;  2GQV A;  1D09 B;  2JM8 A;  4DBQ A;  3CCE A;  1PG5 B;  5IXB A;  3L2Z A;  1M2O A;  1VQ4 Q;  3H0H A;  4C8Q G;  4DQ2 A;  1RAH B;  2J6O A;  3M0P A;  5GAM e;  2RHX A;  5GAN e;  4OGC A;  1I4K 1;  2DTI A;  4N4I A;  1ZX6 A;  1YIJ Q;  4M7A C;  4IKF A;  3EHQ A;  2E3H A;  2H3E B;  4R56 A;  2COY A;  3GPL A;  1C6V X;  3L42 A;  4FYW B;  4RG8 A;  1G5V A;  3JB9 F;  4M78 A;  2FPF A;  2D0Q B;  2VC8 A;  5I22 A;  3X28 B;  3VYH B;  1RAC B;  1YIT T;  1W2B A;  4C0G A;  2L3P A;  1QW1 A;  1YHQ Q;  2K57 A;  5KE3 A;  1E6H A;  2D8H A;  4FU6 A;  3L2W A;  2DD5 A;  5CQX A;  4F17 A;  1PCX A;  1VQK Q;  4D6W A;  1X01 A;  3OS2 A;  1V29 B;  4RMO A;  3QKJ A;  4M77 E;  1HXD A;  1VUB A;  2VAS A;  1Q86 R;  2DBK A;  2M16 A;  1YI2 A;  4A4E A;  2F2X A;  4C0D C;  3MEV A;  5GMK h;  1A0N B;  5FRO A;  3EAE A;  1UGV A;  2XU8 A;  1H3H A;  1RAB B;  4MDX A;  4MZM A;  4AG1 C;  1QCN A;  2PQW A;  3AT1 B;  3UWN A;  1YJW T;  1WZO A;  1NEG A;  4E7K A;  3VRZ A;  5GAN 3;  4LNP A;  2X3X D;  4KUL A;  2HKQ B;  1OUL A;  3OYM A;  2E70 A;  2LZ6 B;  1XOV A;  1IZ6 A;  2YWW A;  4XQ3 A;  1UEB A;  1RLQ C;  2JXB A;  5GAM h;  1X27 A;  1VQ6 A;  5GAN h;  2LT4 A;  2DXC A;  3G4S A;  2ZAE A;  4QVZ A;  1SSH A;  3N5B B;  2JM9 A;  2LRQ A;  3GLX A;  2X9H A;  5HK0 A;  5LJ3 e;  4M7A D;  1JQQ A;  1RI9 A;  3CMA Q;  2A37 A;  1Y07 A;  2E6N A;  4ZGJ B;  1M8M A;  3OSV A;  3EG9 B;  2K5I A;  3JCM W;  4LDW A;  3A1P A;  2RHI A;  2NUT B;  4Y92 A;  4RTU A;  4J9D A;  5LL6 S;  1VQN Q;  3A5Z B;  1RL2 A;  3CC7 Q;  2E5K A;  2SRC A;  2JT4 A;  2F2W A;  1BCO A;  3D7S B;  1KSW A;  3O8V A;  1TUG B;  1WXU A;  2EKH A;  3MP6 A;  1PWT A;  2DYI A;  4E6R A;  2J6F A;  2HQX A;  2XDP A;  4EPC A;  1YCY A;  2CH4 W;  5GAN 4;  1D1B A;  3QYG B;  1EFN A;  4O6J A;  2RHY A;  3J7A F;  4J9B A;  2VVK A;  4A4K A;  1XJW B;  2OJ2 A;  3OYY A;  3OYB A;  1KHI A;  2EVR A;  1QCO A;  2KR3 A;  4N0A C;  3V8J A;  2HL5 C;  4A63 B;  4AFQ C;  3JSC A;  1BKB A;  1WQW A;  2LQ8 A;  1TTH B;  1VQO T;  2BUD A;  1OZ3 A;  4C5H A;  2EYW A;  2OAU A;  3M58 A;  1NJI C;  2IVW A;  4FL6 A;  2CH4 A;  1QCF A;  3V8L A;  1WJQ A;  3Q1J A;  4RCC A;  2I0N A;  1YIT A;  2DK3 A;  3MP8 A;  4C92 B;  1GCQ C;  3VRY A;  2ROL A;  1PC0 A;  5LJ3 h;  4D8D A;  3A8O B;  2JJ9 A;  2D0N A;  3H0F A;  3M9Q A;  2DTH A;  2KAF A;  3EGU A;  2FHD A;  5I21 A;  2V8K A;  4PJN A;  1UE9 A;  2EQI A;  4M7D G;  1XTD A;  4NS5 A;  4GLM A;  5CKF A;  2EYZ A;  2QEX A;  4M77 G;  3CME T;  1RI0 A;  3RER A;  4OP0 A;  4JS5 A;  2DXT A;  3A8H B;  1G2B A;  1HSQ A;  2IPO B;  4DOW A;  1KC8 U;  5D7U A;  1KD1 C;  2CP7 A;  5KYU B;  4DOV A;  1W2B P;  4DA4 A;  4F7U F;  1RAG B;  5HCK A;  3MO8 A;  4IIO A;  1GBQ A;  3CD6 T;  3DLL A;  2CP6 A;  4PJJ A;  1YJW A;  3TQ7 P;  2C0T A;  2RM4 A;  4IUU A;  3FC3 A;  3CCE Q;  2CUD A;  3OY9 A;  4XU1 A;  2QGG A;  3OYE A;  2P0P A;  1G3W A;  1TSF A;  1D0Z A;  1O75 A;  1EZZ B;  2X4Y A;  2QQ9 A;  3QYH B;  4C5E A;  2DE0 X;  4NOY A;  2QGF B;  1C1A A;  2EKO A;  1WPY A;  5LJ5 d;  2PNI A;  3TU4 K;  2DL5 A;  4IUV A;  2HKN A;  1GFD A;  4OMP A;  3JAM E;  4QQ6 A;  4EMH A;  4M7A F;  1WNL A;  3G1J A;  4OMF B;  1KIK A;  2X4W A;  1K0S A;  4ME7 A;  1UHC A;  4CC3 A;  2PU9 B;  4CC4 B;  5GAO r;  3RR6 A;  1WQ7 A;  3LWI A;  1NBE B;  3M55 A;  3JCM c;  4DEX A;  4OVA A;  4XTU A;  2P84 A;  1B3Q A;  1W2B S;  1VQ9 T;  3M59 A;  2EPD A;  2OAW A;  3RUX A;  2DXU A;  1YCS B;  3OS5 A;  1D3B B;  1ABO A;  3J80 E;  2YT6 A;  4XAX B;  3ZBD A;  5A0L A;  3BW1 A;  1TH7 A;  1OOT A;  1IGU A;  3CC2 Q;  3P8H A;  1R0B G;  1MMN A;  1K9A A;  2RK2 A;  1KQ1 A;  3WVE B;  1AT1 B;  1M3C A;  4HCK A;  3V7R A;  4P5N A;  4M75 C;  2KT1 A;  1ARK A;  4BE0 A;  5CKE A;  1VQO A;  1VQP A;  2J6K A;  1XQH A;  3OYC A;  5L23 A;  1QMC A;  5J39 A;  2KBT A;  5ECA A;  2ZZD A;  4RTZ A;  1VQ7 T;  3I9Q A;  4EDU A;  4K11 A;  1D1C A;  1OI1 A;  3JCM d;  2DX1 A;  1W4S A;  3CCL Q;  1QVG A;  3GOX A;  4FSX A;  2ABL A;  4FYV B;  4DBH A;  1N9S A;  2AZS A;  4M78 C;  1QVF A;  2EWN A;  2LMJ A;  1KFZ A;  1T3S A;  4JJB A;  4A4G A;  1VQL T;  4RG2 A;  1TG0 A;  1ZQ1 A;  4A4F A;  3HRU A;  2DXB A;  1VQM Q;  3CME A;  4C92 E;  2RQT A;  5CVI A;  2AHJ B;  4HKE A;  4A4H A;  3OS0 A;  2O4X A;  2O9S A;  3LLR A;  3EH2 A;  1UUE A;  4BI8 B;  1K9M C;  4PJO C;  1WHL A;  4MZT A;  4WTO B;  3CD6 A;  1ZA1 B;  5AT1 B;  1M30 A;  2PZ1 A;  3JCM Q;  4E7Z A;  3X25 B;  3VUZ A;  4LUE A;  4ZGD B;  2HNI A;  1KC8 R;  4PLI A;  3CCM T;  2PVG B;  3OYL A;  3JB9 H;  2E3I A;  5CK9 A;  2LX7 A;  2ED1 A;  5IXF A;  4IUQ A;  3CCJ T;  5KYX A;  2GQI A;  2RMO A;  1NG2 A;  1CSK A;  4B9X A;  4M75 E;  2CZ7 B;  4M75 D;  2OTL Q;  1OV3 A;  4RTX A;  5KCH A;  4LD9 K;  2EFI A;  3RMS A;  4J5Y A;  5FWB A;  2AK5 A;  3VS1 A;  2MK5 A;  4Y91 A;  1WJR A;  1WHK A;  2CP5 A;  1UHF A;  3EGD B;  1NLP C;  5GAM d;  3GNF B;  5GAN d;  1OZ2 A;  1LCK A;  4R0K A;  4F7U B;  1OX9 A;  2QEX Q;  1SKU B;  1Z9Z A;  3QWX X;  3FJ5 A;  1VQ9 A;  2VYT A;  4QT7 A;  4II1 A;  1NYG A;  4M78 D;  3WVD B;  2DL4 A;  4CC7 A;  3CCU T;  3CCS T;  8AT1 B;  2MOX A;  3JCM X;  3I5R A;  3JCM g;  2KK4 A;  2EQK A;  3DLM A;  4GY5 A;  4A53 A;  2F1L A;  2OI3 A;  1TU0 B;  4FT2 A;  4LXC A;  4HVV A;  1VQ5 Q;  4KGX B;  2IIM A;  4PJL A;  2LTO A;  2AZV A;  4PJO D;  1UGP B;  3M0R A;  3KFV A;  2CZ0 B;  1NLO C;  4KUD K;  4R55 A;  4EMK A;  2HMA A;  1DJ7 B;  2A7Y A;  1W70 A;  2JMA A;  1VQ7 A;  4AT1 B;  1JB0 E;  3LGL A;  4M7A B;  2JN0 A;  3PVQ A;  1JRI A;  4XTY A;  2ECZ A;  2DBM A;  2HCK A;  3QZ5 B;  4HCB A;  4J9C A;  1Q82 U;  2PUK B;  1FXX A;  2MCN A;  5LJ3 j;  2MPX C;  4BE2 A;  1YJN A;  2EBP A;  3TCJ A;  1K8A C;  1MNE A;  4RKU E;  1QQJ A;  3CCQ Q;  2NUP B;  2XK0 A;  4E7S A;  1VQL A;  3VS5 A;  2VGN A;  3CPF A;  1Q7Y C;  1KJW A;  3QWY A;  2FO0 A;  4C92 G;  2RQW A;  3OW2 A;  1OPK A;  4PK4 A;  1Y96 B;  2KXD A;  3VYG A;  1N6A A;  2KEA A;  3QBY A;  4RTV A;  2ATC B;  2FYK A;  1ABQ A;  2E65 A;  3M5A A;  1Q95 G;  3E9G A;  4OMQ A;  2AKK A;  3OBY A;  5LJ3 d;  1ZHI A;  2HBP A;  3I55 T;  1QVG P;  2DO3 A;  2O88 A;  5GMK i;  4C0D B;  3RKX A;  4BY6 C;  1M2V A;  2RJE A;  3G71 T;  1QVF P;  1ZSZ B;  3CCM A;  3REA B;  1KQ2 A;  2QA4 Q;  3SWN A;  1I8F A;  5D6X A;  2V26 A;  3JV3 A;  2MYS A;  5GAM g;  1B7T A;  2RN8 A;  1LOJ A;  3CCJ A;  1VQP Q;  1D0X A;  5A2Q E;  3UPU A;  4JJC A;  1F1B B;  2HQH A;  1BYM A;  4C8Q A;  2L3Q A;  4FT4 A;  3JB9 G;  3JCM f;  2J7I A;  4M75 F;  3CCV Q;  3M57 A;  4J8O A;  5FWC A;  2JTM A;  5EG2 A;  2M0O A;  3C0C A;  3A8L B;  2RJC A;  3EFO B;  2O31 A;  5DM7 R;  1IO6 A;  2CRE A;  2M51 A;  1OEB A;  4XU3 A;  2DET A;  4HVU A;  3MJX A;  4UC4 A;  3V8K A;  2VXE A;  4C5G A;  4PJO A;  1X6G A;  2X3W D;  1WDX A;  3CCU A;  3CCS A;  4LDY A;  1QVG S;  4M78 F;  2YUQ A;  4HVW A;  5IT9 E;  1AWW A;  2DMO A;  3EG0 A;  2CS7 A;  1QP2 A;  1KD1 U;  4KT0 E;  5AYF A;  3J81 E;  2ZGW A;  1QVF S;  2RI3 A;  4F7U E;  2ZCF B;  4J7F A;  2OTJ T;  2L0A A;  2HAX A;  4FSS A;  5CCA A;  5KCO A;  3VS4 A;  2X35 A;  1LJO A;  4JUV A;  3G6E T;  2YXY A;  2LNV A;  4PJO F;  1Q86 C;  4VUB A;  4M7D D;  3SHW A;  4XTX A;  2QTV A;  4N4G A;  2P4R A;  2JNG A;  5FRN A;  4X9C A;  4V2S A;  4XU0 A;  4ZGE B;  3V7C A;  1JBM A;  5A0D A;  9ATC B;  1N5Z A;  1ZSG A;  5LJ3 g;  5D6Y A;  3JCM b;  2XD0 A;  3P8D A;  2E64 A;  4RCB A;  2NWM A;  4PFP A;  5HKC A;  4L59 A;  4M7A E;  3MCA B;  2PUO B;  3EGX B;  5GAM f;  5GAN f;  5CKB A;  1E7O A;  1NEB A;  3HKS A;  1SRM A;  5FW9 A;  1Q82 R;  1PSF A;  4BAC A;  1BI3 A;  1LVK A;  1M90 U;  3CCR T;  2EGC A;  1H3Z A;  3JB9 J;  3A8G B;  5C0M A;  4PKC C;  4ANJ A;  3R6N A;  1YWO A;  3I55 A;  4E2F B;  1C0M A;  1PD0 A;  3I56 T;  3KXT A;  2VWF A;  2ZPE B;  4OF1 A;  6AT1 B;  3G71 A;  1VQ8 T;  3GIB A;  4J9H A;  2QG9 B;  4X34 A;  2K3Y A;  3H6Z A;  3QHS A;  2PVD B;  2RH2 A;  4NL3 A;  4MZP A;  1B34 B;  3PGG A;  2A3L A;  3OW2 P;  2DRM A;  2K79 A;  4F14 A;  1FMV A;  3MEU A;  4MMK A;  3QDR B;  2JOY A;  5KYW B;  1YJ9 Q;  3EG1 A;  4XTV A;  1AOJ A;  3PTA A;  1TOV A;  4HT8 A;  2R58 A;  3RKW A;  4DBF A;  3CC4 T;  2X4J A;  5IH2 A;  2EQJ A;  3KUF A;  3WXM B;  2VUB A;  2KE9 A;  2A28 A;  2MWO A;  3SFM A;  5HY6 A;  1TUC A;  4JRP A;  2ZPI B;  1U1T A;  3UDC A;  1M1G A;  2LT1 A;  1YJN Q;  2DIL A;  2X4X A;  4KUI A;  2MWP A;  1WIE A;  1S1N A;  2K9G A;  4OB3 B;  3T9N A;  1IHV A;  3UA6 A;  2CP0 A;  3LGF A;  5KYY A;  2GTO A;  2JZ2 A;  2J06 A;  1SHF A;  4Z02 A;  3UT1 A;  2P0Q A;  3S3M A;  1VQ4 T;  4YTL A;  4OB2 B;  4B6M A;  4AMC A;  4M7D A;  5LJ3 f;  2RB6 A;  5FRM A;  1K9M U;  3EGD A;  2CT4 A;  4F7U G;  2OTJ A;  1MND A;  1BI1 A;  4M77 A;  3C12 A;  3OBW A;  1WFW A;  1UDL A;  2DIQ A;  2K4Y A;  3L2R A;  1UEC A;  3OW2 S;  2LNH B;  3SB2 A;  4C0F A;  1ZLM A;  4ELY C;  2LJ3 A;  1AVZ C;  2YUO A;  4OML A;  2MAM A;  2LCS A;  1KD1 R;  4GLK A;  1YHQ T;  3NFC A;  3FDR A;  2DKG A;  4M75 B;  2YLB A;  1R0C B;  2ROT A;  1X43 A;  4AFZ C;  4DEY A;  1VQK T;  2KRN A;  1AZG B;  2EYY A;  1I81 A;  4BUG A;  1BIA A;  2BIV A;  4CC2 A;  4E7J A;  1M9S A;  4EMK C;  4QQD A;  3OB9 A;  4FW1 A;  2DIG A;  4M7A G;  4MML A;  1ZBX A;  2O9V A;  1UG1 A;  1VYV A;  3SEM A;  2QDY B;  5KYN A;  4M78 B;  2FEI A;  4FCY A;  2EIF A;  2CKK A;  3CCR A;  3LYI A;  2K5L A;  2X51 A;  5IAY A;  1RAD B;  3JCM J;  5CO7 A;  3VU3 C;  2AKL A;  2E5Q A;  3E2U A;  2KYB A;  5GAO l;  5CKH A;  4PFO A;  3M4G A;  1X69 A;  1VQ8 A;  2BE9 B;  1GBR A;  2K7A A;  2KNB B;  1GRI A;  1NZ9 A;  1M90 R;  5L8R E;  1YI2 Q;  1NYF A;  3GF5 A;  1P92 A;  4BI4 A;  1MV0 B;  4HCC A;  1UGR B;  1UGS B;  1I07 A;  2PTK A;  3CMA T;  3TRE A;  3QDF A;  3RES A;  1AWJ A;  2D8J A;  1OYX A;  4RUG A;  2DF6 A;  2QI2 A;  4EMG A;  3CC4 A;  3SWN C;  3H9N A;  5GAN 6;  4JRQ A;  3TSZ A;  5GJV B;  5DY9 A;  1VYU A;  3QII A;  4FIB A;  1ZSZ A;  1VQN T;  1N8R U;  4JLI A;  3FB9 A;  1QKX A;  3X26 B;  2RQR A;  3S3O A;  3CC7 T;  3X24 B;  2V1R A;  4JS4 A;  1VQ6 Q;  5DLO A;  4LUD A;  4IUR A;  2DVE A;  3G4S Q;  4BB7 A;  1PRL C;  5CR2 A;  4ORZ A;  1WHH A;  4JRK A;  2BZX A;  3LH5 A;  1WLP B;  3NPF A;  3H41 A;  1Q81 C;  4C8Q C;  5FU7 C;  4LDX A;  1M27 C;  1K8A U;  1J3T A;  3C4S A;  1NM7 A;  2DD4 A;  4BDY A;  1PNJ A;  4QVC A;  1Q7Y U;  5D6W A;  1VQ4 A;  2RA2 A;  2KMT A;  2DLP A;  4O5V A;  1ACM B;  4JLG A;  4QQG A;  4CRI A;  3MP1 A;  3OYF A;  3OYJ A;  4L5G A;  4OGE A;  2C0O A;  3CQT A;  4XTW A;  3EHR A;  5C6S A;  2FPE A;  3DB4 A;  5I2S A;  4KBM B;  1YHQ A;  1K9M R;  3HHT B;  5GMK l;  1BU1 A;  3OMC A;  1UB4 A;  2P4T A;  2VKN A;  2XID A;  2KY9 A;  1U1S A;  1E6G A;  1PKT A;  1OPL A;  2JW4 A;  4JJD A;  3RBB B;  1VQK A;  2K2M A;  2I2L A;  3F70 A;  3GBQ A;  2LVM A;  1IHW A;  2YSQ A;  2V1Q A;  2BE7 D;  3QG1 A;  1ZA2 B;  1UTI A;  2DA9 A;  1YN8 A;  2YUP A;  5KE2 A;  2ZPG B;  3EH1 A;  4J6W A;  2C0I A;  5GAO q;  3TSW A;  2LQK A;  3M0Q A;  4A54 A;  1V1C A;  2C06 A;  2R5A A;  3INZ A;  1YIT Q;  3ZEH A;  5GAN 2;  3PMI A;  1IXD A;  5IN1 A;  3CXC A;  2MF2 A;  4LDU A;  2FPD A;  3EG2 A;  2VV5 A;  4E7L A;  2LQW A;  1TWB A;  1RAI B;  3CCE T;  1T0J A;  2EQM A;  4C8Q D;  3PVL A;  2BTT A;  1QLY A;  1BI2 A;  3UF4 A;  2R57 A;  2D1X A;  3EGX A;  2E6Z A;  4M78 E;  1AWX A;  4ZTJ A;  3DB3 A;  2Y4Y A;  3LW5 E;  1K76 A;  1AD5 A;  1FX7 A;  2HSE B;  5KH6 A;  1I0C A;  3M4Y A;  3EG9 A;  2ESW A;  3VV0 A;  2KQW A;  4BY6 B;  4BD3 A;  3CMA A;  2NUT A;  4AG2 C;  1UJY A;  1QWE A;  4B9W A;  1YJW Q;  1NE8 A;  4PJO E;  3NTK A;  3E19 A;  4J9G A;  2EJG A;  3MHX A;  1U06 A;  3VJP A;  1D1A A;  1VQN A;  1FMK A;  2JUF A;  2XHC A;  3CC7 A;  5CKD A;  1M1K C;  2MIO A;  3BDU A;  3NTH A;  1IB8 A;  3M0S A;  3MEA A;  4OMN A;  4X9D A;  1KQS A;  2GTJ A;  1K73 C;  1GCP A;  1LNX A;  3A8M B;  1UJ0 A;  4ZN1 A;  2HQE A;  2JTF A;  2YLC A;  2RI2 A;  4JJN K;  1N8R R;  1IRX A;  2EW3 A;  2RHU A;  4C0Z A;  1ZUK A;  1UFF A;  3CC2 T;  3VS7 A;  5I2M A;  2BZ8 A;  2GFU A;  3BY7 A;  4KGV B;  3NHN A;  1PD1 A;  4L6V 5;  2JS0 A;  3OS1 A;  1OU9 A;  1OQK A;  4AFU C;  1QKW A;  3G7Z A;  1FYN A;  1K8A R;  2FVU A;  4C92 A;  1BB9 A;  3URG A;  1Q7Y R;  1K1Z A;  1SPK A;  3HRS A;  3FRN A;  3QUI A;  1S72 T;  2A36 A;  2RQV A;  2NYS A;  3H0I A;  4PL6 A;  4M7D C;  1G83 A;  2LJ0 A;  3EFR A;  2DL7 A;  4OB0 B;  3CCL T;  2KT8 A;  1HK9 A;  4M77 C;  2HSP A;  3HSB A;  2H3J A;  3TVT A;  1M3B A;  1RLP C;  2RI5 A;  3M0U A;  3R6O A;  1RUW A;  2H8H A;  4Y28 E;  2QQR A;  1VQM T;  5KYU A;  2L3R A;  1VQO Q;  2DEQ A;  2V8J A;  2FRW A;  1Y7X A;  4M75 G;  5I11 A;  5GMK e;  2PVO B;  2XMF A;  1FWZ A;  3RNJ A;  4MDW A;  3PIO A;  3S3N A;  1NJI U;  1VYT A;  2FB7 A;  1X6B A; 
#chains in the Genus database with same CATH homology
 1W1F A;  4DEX A;  5IHN A;  2W10 A;  1B3Q A;  3IQL A;  3EG1 A;  3THK A;  1Z9Q A;  2DYB A;  2EPD A;  1AOJ A;  2KRS A;  2OAW A;  4J9E A;  4AFS C;  1PKS A;  5IHI A;  1YCS B;  1SRL A;  1VA7 A;  4D8K A;  5IH2 A;  1ABO A;  4OMM A;  2BZY A;  4OMO A;  2KE9 A;  2YT6 A;  2A28 A;  2RPN A;  4X1V A;  2EGE A;  1TUC A;  1TUD A;  1OOT A;  1WYX A;  1ZUU A;  1K9A A;  2DIL A;  1HD3 A;  1M3C A;  2KXC A;  4HCK A;  1PHT A;  1S1N A;  1WIE A;  1Y57 A;  2K9G A;  1WI7 A;  2KT1 A;  1ARK A;  3UA6 A;  1B07 A;  2J6K A;  2L3S A;  5L23 A;  1X2K A;  2GTO A;  2CSI A;  2DRK A;  4Z89 A;  2J06 A;  2KBT A;  1SHF A;  2LQN A;  4RTZ A;  5ECA A;  2FRY A;  3I9Q A;  2GNC A;  4K11 A;  2CT3 A;  3REB B;  3ZL7 C;  2CT4 A;  2DX1 A;  3NGP A;  3M0T A;  1WFW A;  1UDL A;  2ABL A;  2AZS A;  1UEC A;  3A98 A;  1MV3 A;  2LNH B;  1ZLM A;  2YDL A;  2LMJ A;  2LJ3 A;  1KFZ A;  1T3S A;  4JJB A;  1TG0 A;  1AVZ C;  2YUO A;  2J05 A;  4OML A;  2LCS A;  3UA7 A;  2RQT A;  1MUZ A;  4Z8A A;  2O9S A;  2EGA A;  1UUE A;  3ULR B;  2ROT A;  1X43 A;  2CDT A;  4AFZ C;  2RQU A;  1JO8 A;  4DEY A;  1CKB A;  2KRN A;  1AZG B;  2EYY A;  4CC2 A;  1M30 A;  2PZ1 A;  1X6B A;  3O5Z A;  4JZ4 A;  4RTY A;  2K3B A;  4LUE A;  1WXT A;  2DJQ A;  2O9V A;  1UG1 A;  1VYV A;  1QWF A;  3SEM A;  2A08 A;  2LX7 A;  2ED1 A;  3I5S A;  2HBW A;  5IXF A;  2GBQ A;  1AWO A;  1BBZ A;  2W0Z A;  5IHK A;  2FEI A;  3UAT A;  1K4U S;  2GQI A;  2RMO A;  1NG2 A;  1CSK A;  2RF0 A;  2AKL A;  1OV3 A;  4RTX A;  1GL5 A;  2DL3 A;  2KYB A;  4ZNX A;  2M0Y A;  3NMZ C;  2YUN A;  4RTT A;  1M3A A;  5FWB A;  1X69 A;  2AK5 A;  4JPB W;  1GBR A;  3VS1 A;  2K7A A;  2KNB B;  2JM8 A;  1GRI A;  4J9F A;  5IXB A;  1NYF A;  2NUZ A;  3H0H A;  1UHF A;  1MV0 B;  1WX6 A;  2J6O A;  2RNA A;  1NLP C;  1JXO A;  3M0P A;  1LCK A;  1ZX6 A;  1I07 A;  4R0K A;  2PTK A;  3EHQ A;  2CUB A;  1Z9Z A;  3QWX X;  4M4Z A;  3FJ5 A;  1BK2 A;  1AWJ A;  2D8J A;  2JMC A;  2LP5 A;  4EIK A;  4RUG A;  4WCI A;  4QT7 A;  1NYG A;  1T3L A;  2FPF A;  1JEG A;  2DL4 A;  2DF6 A;  4CC7 A;  5I22 A;  3TSZ A;  5EC7 A;  5GJV B;  2MOX A;  2B86 A;  1AZE A;  1VYU A;  2L2P A;  3I5R A;  1QKX A;  2RQR A;  1I1J A;  2V1R A;  2L3P A;  1H8K A;  3I35 A;  4LUD A;  2OI3 A;  1E6H A;  2D8H A;  2CSQ A;  4HVV A;  1PRL C;  3VS0 A;  2IIM A;  4ORZ A;  2AZV A;  1SHG A;  4F17 A;  2BZX A;  3LH5 A;  1WLP B;  3NPF A;  3H41 A;  3M0R A;  1GFC A;  3KFV A;  1NLO C;  1M27 C;  1J3T A;  1NM7 A;  1PNJ A;  2DBK A;  2JS2 A;  1W70 A;  2JMA A;  2F2X A;  1W6X A;  2SEM A;  3PVQ A;  1A0N B;  2DLP A;  2QDL A;  1UGV A;  2ECZ A;  2DBM A;  2HCK A;  1H3H A;  2DM1 A;  1YWP A;  4J9C A;  4Z88 A;  2DVJ A;  4AG1 C;  2JTE A;  1WA7 A;  2ED0 A;  2MCN A;  2G6F X;  2GGR A;  1NEG A;  2EBP A;  3VRZ A;  4LNP A;  2C0O A;  2X3X D;  3CQT A;  4J9I A;  2LZ6 B;  3EHR A;  4ESR A;  1XOV A;  3VS5 A;  2FPE A;  1KJW A;  1RLQ C;  2JXB A;  1X27 A;  3QWY A;  2FO0 A;  2RQW A;  3EG3 A;  1OPK A;  1BU1 A;  2KXD A;  2VKN A;  2KEA A;  3U23 A;  1SSH A;  1E6G A;  4RTV A;  2KYM A;  1ABQ A;  1PKT A;  1OPL A;  1U3O A;  2JW4 A;  2JM9 A;  4JJD A;  4OMQ A;  3RBB B;  2K2M A;  2AKK A;  3GBQ A;  4GBQ A;  2LJ1 A;  1AEY A;  1JQQ A;  2YSQ A;  1RI9 A;  2O88 A;  2A37 A;  2V1Q A;  4HXJ A;  1UTI A;  2DA9 A;  1YN8 A;  2YUP A;  4LN2 A;  1M8M A;  3VS6 A;  3REA B;  2C0I A;  3TSW A;  3M0Q A;  1V1C A;  4Y92 A;  4RTU A;  1JXM A;  3JV3 A;  4J9D A;  2RN8 A;  2E5K A;  2SRC A;  2JT4 A;  3PE0 A;  2F2W A;  4IIM A;  2KRO A;  1KSW A;  1WXU A;  2EKH A;  2FPD A;  3EG2 A;  4JJC A;  2LQW A;  3VS3 A;  1PWT A;  4E6R A;  1T0J A;  2J6F A;  2FG0 A;  2L3Q A;  2K6D A;  3PVL A;  2BTT A;  1Y0M A;  2J7I A;  1QLY A;  4RTW A;  2CH4 W;  3UF4 A;  5FWC A;  2D1X A;  2HDA A;  2F2V A;  1EFN A;  1AWX A;  3C0C A;  4J9B A;  2VVK A;  1K76 A;  1ZUY A;  1AD5 A;  2OJ2 A;  4JZ3 A;  1I0C A;  2O31 A;  2EVR A;  2KR3 A;  4A63 B;  2ESW A;  4AFQ C;  1IO6 A;  2CRE A;  2M51 A;  4AG2 C;  1OEB A;  4HVU A;  1UJY A;  1QWE A;  1YNZ A;  2EYW A;  4J9G A;  2EYX A;  1U06 A;  2DNU A;  1X6G A;  1X2Q A;  1WDX A;  2CH4 A;  1QCF A;  2X3W D;  1CKA A;  2I0N A;  2YUQ A;  4KRT A;  2DL8 A;  4HVW A;  1FMK A;  1AWW A;  1YP5 A;  2DMO A;  3EG0 A;  1GCQ C;  3VRY A;  2MIO A;  2ROL A;  3M0S A;  4D8D A;  4OMN A;  2D0N A;  3H0F A;  4F16 A;  2GTJ A;  1HJD A;  2L0A A;  1GCP A;  1SEM A;  3EGU A;  4FSS A;  3VS4 A;  1UJ0 A;  1UE9 A;  2EQI A;  4GLM A;  2EYZ A;  1PRM C;  2EW3 A;  3SHW A;  1ZUK A;  1UFF A;  2P4R A;  3VS7 A;  2BZ8 A;  1G2B A;  1HSQ A;  3NHN A;  2JS0 A;  2HEQ A;  5HCK A;  4IIO A;  4AFU C;  1QKW A;  1GBQ A;  1N5Z A;  1FYN A;  1ZSG A;  1T0H A;  1BB9 A;  1U5S A;  2NWM A;  2ENM A;  1K1Z A;  1WXB A;  2C0T A;  1SPK A;  2CUD A;  2A36 A;  2RQV A;  1H92 A;  3H0I A;  1E7O A;  1NEB A;  1G83 A;  1SRM A;  5FW9 A;  2LJ0 A;  2DL7 A;  5GJW B;  2KT8 A;  2DE0 X;  2HSP A;  1ZBJ A;  2EGC A;  3TVT A;  2PNI A;  1M3B A;  2DL5 A;  1RLP C;  1JU5 C;  3M0U A;  3R6N A;  1RUW A;  2H8H A;  1GFD A;  1YWO A;  4OMP A;  4LE9 A;  2KRM A;  3VS2 A;  2O2O A;  2VWF A;  2FRW A;  1KIK A;  1K0X A;  4J9H A;  1K0S A;  5I11 A;  1UHC A;  4CC3 A;  2XMF A;  3RNJ A;  2KGT A;  4CC4 B;  1VYT A;  2DRM A;  1GCQ A;  2K79 A;  4F14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...