4HXJA

Crystal structure of sh3:rgt complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting, signaling protein
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structural framework of c-Src activation by integrin beta 3
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hxjA00
3GBQA 2ED1A 5I11A 1WXBA 2ECZA 2K2MA 1NM7A 4X1VA 1PNJA 1MV3A 2YUQA 1B3QA 2YUPA 4KRTA 2DA9A 2E5KA 3UF4A 5IH2A 1J3TA 2L3PA 1RI9A 1UG1A 1SRLA 1T3LA 2DJQA 4K11A 4QT7A 2CDTA 2J6FA 4OMNA 3H0HA 2A28A 2ABLA 3R6NA 1N5ZA 2P4RA 1WIEA 3VS0A 1KFZA 2D1XA 4OMMA 1K4US 4RUGA 1UFFA 5EC7A 4RTVA 1W70A 2EBPA 2K3BA 4GLMA 1NLPC 2K7AA 2GTOA 2KGTA 1AWOA 2BZ8A 1NG2A 2YUNA 1ZUKA 2W0ZA 4E6RA 1JQQA 3PE0A 2EKHA 2KRMA 2M51A 1H8KA 2DRMA 3TSZA 3EG1A 3TSWA 3H0FA 3VS5A 5I22A 1ARKA 1WFWA 2HBWA 1AOJA 4Y92A 2FPDA 2HCKA 3EHRA 3NPFA 1TG0A 3SEMA 2F2VA 2B86A 3QWYA 4IIOA 4A63B 2ED0A 1FYNA 2KR3A 1X43A 2RNAA 1SSHA 3VRYA 2L0AA 2KE9A 5FWBA 3M0TA 2J05A 3U23A 5L23A 1B07A 1SRMA 2DL7A 2FO0A 2EYZA 1HSQA 4LUEA 1AEYA 2EVRA 3ZL7C 2EW3A 1UTIA 2A36A 1AWXA 2FRYA 2J7IA 2QDLA 3QWXX 3LH5A 2RF0A 3EHQA 2DL4A 2FRWA 1Y0MA 1T3SA 2D8HA 1FMKA 5IHIA 2CUBA 1MUZA 1K76A 2EGCA 2LX7A 2JS0A 1VA7A 2DNUA 1VYVA 2VKNA 1QWEA 1AVZC 3EG3A 2KXDA 1H3HA 3I5RA 4AG1C 3FJ5A 3IQLA 3VS6A 2MIOA 2X3WD 1M8MA 2HDAA 1K1ZA 2DE0X 2MCNA 3REBB 4DEXA 1UECA 2KRSA 1MV0B 2VWFA 2LCSA 2DRKA 1RLQC 2RMOA 1X69A 3ULRB 2PNIA 2AK5A 2RPNA 3VS4A 5FW9A 4J9DA 2O88A 4RTYA 1WLPB 2DM1A 2IIMA 2DX1A 2DYBA 5HCKA 1E6HA 2RN8A 5IXBA 1ZUYA 2BZYA 2KYBA 1X6BA 3THKA 1GFCA 2C0IA 1UE9A 2KYMA 2O2OA 4RTXA 2H8HA 2SEMA 2JM8A 1ZUUA 3VS3A 2J6KA 2JT4A 4JZ4A 1T0JA 3M0SA 2GNCA 3KFVA 2DVJA 1PRMC 1ZX6A 4LNPA 1OPKA 4RTUA 1M3BA 4J9CA 1UDLA 1WI7A 4JJBA 1OOTA 2J6OA 4ORZA 5IHNA 1K9AA 1PWTA 3UA6A 2KNBB 2VVKA 2DMOA 1YCSB 1JEGA 1E6GA 1M3CA 2CSQA 2DLPA 3VS1A 2HSPA 1LCKA 4AFQC 1QCFA 1I0CA 1NYGA 1PKTA 2RQWA 1IO6A 1KIKA 3JV3A 1EFNA 2PZ1A 1WX6A 2YUOA 4GBQA 1H92A 4HVUA 1M27C 3EGUA 4CC4B 3A98A 2BZXA 4RTTA 4JJDA 2AZSA 3H0IA 2JW4A 2SRCA 1NYFA 2X3XD 4AG2C 4OMOA 3REAB 2ROLA 1JO8A 2OI3A 2OJ2A 2FPFA 2DL5A 1ZSGA 1GCPA 1JXMA 2LNHB 2JM9A 1BBZA 1RLPC 2DBKA 1ABQA 1ABOA 2C0TA 3NGPA 3TVTA 2CT4A 1PKSA 1SEMA 2JXBA 1U06A 2G6FX 1NLOC 2YDLA 3I5SA 1AZEA 1YWPA 1WA7A 3I9QA 1M3AA 4WCIA 1AD5A 3VRZA 2DL8A 1X27A 4FSSA 1RUWA 3NMZC 5GJVB 3UATA 4CC3A 1NEGA 2DL3A 1X6GA 3I35A 3SHWA 2EYYA 1UJ0A 4F14A 1ZLMA 1JXOA 2YT6A 2RQVA 1YN8A 2O9VA 5ECAA 4EIKA 4F16A 2NUZA 2JMCA 4J9IA 2L2PA 4J9BA 4ZNXA 4Z88A 1SHGA 1UHFA 1WXTA 2K9GA 4J9GA 1UHCA 1E7OA 1WDXA 2LJ1A 4AFZC 1V1CA 2RQUA 2GBQA 4AFUC 1KSWA 2AKKA 2FPEA 2AZVA 2V1QA 1CKAA 3NHNA 1VYTA 2HEQA 1TUDA 1PHTA 2DBMA 1AWJA 1QLYA 2KRNA 4M4ZA 2EYXA 1U5SA 2RQRA 4D8KA 1A0NB 2LJ0A 4D8DA 2CT3A 3RBBB 1BB9A 2EGEA 2EQIA 4R0KA 2KBTA 2LP5A 4HCKA 2NWMA 3H41A 2KEAA 2CREA 1QKXA 3M0QA 1WXUA 2MOXA 2KXCA 2K6DA 2V1RA 4OMPA 1NEBA 4LE9A 4Z89A 1G2BA 2D8JA 2LZ6B 3PVLA 4J9HA 1M30A 2GGRA 1TUCA 2C0OA 3O5ZA 2O9SA 1Z9ZA 4OMQA 3VS2A 3M0RA 1QKWA 1VYUA 1G83A 2AKLA 2PTKA 2J06A 1AZGB 1GCQC 5GJWB 2L3SA 1UJYA 2GTJA 2O31A 1S1NA 1Z9QA 2FEIA 2KROA 2ENMA 1YNZA 2XMFA 2F2XA 1HD3A 2L3QA 1X2QA 4F17A 3M0UA 1YP5A 1OV3A 2KT8A 1GCQA 1KJWA 1U3OA 2ESWA 2LMJA 2DF6A 3CQTA 4JZ3A 4Z8AA 3M0PA 4DEYA 4ESRA 2A08A 2CH4W 4AFSC 2W10A 4RTZA 1WYXA 2M0YA 3VS7A 4JPBW 1JU5C 3PVQA 1W1FA 1I07A 2EGAA 2JS2A 1SHFA 4IIMA 4OMLA 2EYWA 1XOVA 2EPDA 2CUDA 3EG2A 1PRLC 2FG0A 2I0NA 1I1JA 1BK2A 2DILA 1BU1A 2F2WA 1W6XA 1CKBA 1HJDA 2LJ3A 1Y57A 4CC2A 5FWCA 5IHKA 1UUEA 4LN2A 2JMAA 1GBQA 2D0NA 2LQNA 2GQIA 1UGVA 1QWFA 4HVWA 4LUDA 4RTWA 2OAWA 2K79A 1GBRA 4JJCA 1GRIA 1OPLA 4J9EA 1CSKA 1AWWA 3EG0A 1SPKA 1GL5A 1K0SA 5IXFA 1X2KA 4HVVA 2LQWA 1ZBJA 1OEBA 2BTTA 2A37A 3C0CA 3RNJA 2YSQA 2CSIA 4CC7A 3UA7A 4HXJA 2KT1A 2JTEA 1GFDA 2RQTA 4J9FA 2CH4A 1K0XA 2ROTA 1T0HA 1YWOA
chains in the Genus database with same CATH superfamily
2NLUA 2HZYA 3GBQA 2EWNA 2ED1A 3CBPA 1TH7A 1MMGA 1LPLA 1KQSS 1O9SA 1WHMA 1Q7YU 3OBYA 5GMKi 1B3QA 2YUPA 3MEWA 5LJ5e 4KRTA 2DA9A 4N4HA 5KYUB 3UF4A 1J3TA 1JRIA 1T3LA 1S72A 2MYSA 1VQ5T 4QT7A 2J6FA 4OMNA 2I2LA 4C8QC 1G3YA 1KC8R 2P4RA 1WIEA 4OVAA 3VS0A 1VQ5Q 5GANe 3I56T 1KG1A 3BY7A 4OGEA 4EMHA 2QG9B 3LYIA 2K7AA 5LL6S 1AWOA 3I56Q 2EFIA 1NG2A 5CKFA 1ZUKA 3PE0A 3M4YA 2M51A 3TSZA 2DRMA 3M58A 3SB2A 2EJGA 4Y92A 3NPFA 5GAMh 1RAEB 1VQOA 2B86A 4A63B 1OQKA 1X43A 4C0DB 2RNAA 3CCQT 1WQ7A 4E7SA 2D0QB 2RD1A 2JUFA 3U23A 1PD1A 2DL7A 5GAN5 2VASA 3CC2T 4FYYB 3CCQQ 1LNXA 4BB7A 4CRIA 4LUEA 2EVRA 3ZL7C 2EW3A 1UTIA 4M77E 3GNGA 3M59A 3OYLA 2XU8A 3OYFA 3CC2Q 2Y4YA 1Y0MA 1K73C 1I5OB 2QQBA 2Y90A 2JS0A 4DOWA 1C0MA 1V29B 1VA7A 2DNUA 1VYVA 3RR6A 2DAQA 2VKNA 1QWEA 5FROA 2DD4A 1AVZC 3CCST 2JN0A 2MIOA 4QVDA 2X3WD 4J83A 2BE7D 1D1AA 3BW1A 3WXMB 3CCSQ 1MV0B 5CQXA 2DRKA 1VQ8T 2QQAA 3EGDB 2JTFA 2X4YA 2BE9B 4BI4A 3DB3A 1Q81R 5FW9A 4J9DA 2D9TA 3G71A 4KH1B 1VQ8Q 2XD0A 3OYKA 5CKBA 2DYBA 2KAFA 4XTVA 2RN8A 2L3RA 3X24B 3GOXA 1ZUYA 1R77A 3FC3A 1GFCA 1SKUB 2A3LA 5EG2A 1WHJA 1YI2T 2KYMA 5FU6C 1VQ4T 2JNGA 3VYHB 1JB0E 1PRMC 1YI2Q 4LNPA 1D0YA 3OW2A 1VQ4Q 1K9MR 4RTUA 2P4TA 1Y7XA 1ZBXA 1M1KR 2M0OA 4TVRA 2X4XA 2COZA 3T9NA 2DMOA 5KYXA 1E6GA 1M3CA 2DLPA 1QCFA 3QO3A 1NYGA 2R5AA 4Y91A 2LQ8A 2C06A 1HYOA 1IGQA 3JV3A 1EFNA 2YUOA 2DXCA 3EGUA 5GAMf 1M2OA 1K8AC 1VQMT 4RTTA 3H0IA 3RDVA 1PSEA 4JLIA 2OX7A 4AG2C 3LX7A 1C1AA 1GCPA 1ZSGA 1JXMA 1NPRA 2XI9A 1VQMQ 1BBZA 1RLPC 1KC8C 1Q82C 2RA2A 3QPHA 4C0ZA 4HKEA 1WPYA 2QQ9A 2DEUA 2CT4A 4ZGJB 3PIOA 1NLOC 2YDLA 2CZ1B 1PD0A 2DIQA 1AD5A 1LOJA 4R56A 3G4ST 1VQPT 4XU3A 3MEAA 1RADB 3HSBA 3CC4A 3CC7T 4ELYC 4VUBA 3SHWA 1VQKA 3MO8A 1B34A 4ELZC 1UJ0A 3G4SQ 3CBOA 1VQPQ 1ZLMA 2YXYA 2F1LA 3CC7Q 4BD3A 4EIKA 1MHNA 2NUZA 4ZGDB 1BI0A 4ZNXA 4XTYA 5DLOA 1D0ZA 1E7OA 2LJ1A 4MZPA 3X26B 1VQ6Q 3CEYA 3FLGA 4M4ZA 2EYXA 5KH6A 2LJ0A 1AHJB 2EGEA 1UEBA 5A0DA 4HCKA 2NWMA 3H41A 3R6OA 5LJ3h 1WJQA 5AYFA 3AHUA 5IAYA 2V1RA 1NEBA 4Z89A 3RMQA 3VV0A 1FWZA 2D8JA 2LZ6B 4J9HA 4XU2A 2GGRA 2MWPA 3TQ7P 4OMQA 3M0RA 4PJOB 2QA4T 1VQ7T 2J06A 1AZGB 1Q81C 5GJWB 1X01A 1VUBA 3A8HB 1UGPB 2O31A 1S1NA 4M75C 1M5Q1 2KROA 2QA4Q 1YNZA 1TUGB 1HD3A 1VQ7Q 2L3QA 2MWOA 3M0UA 2VGMA 5GAMe 5KYNA 4KUDK 1U3OA 5KYYB 4FCYA 1KHCA 4Z8AA 3MEVA 2XHCA 4ZN3A 2X35A 2LVMA 4AFSC 4II1A 5HY6A 4IURA 2RHZA 3VS7A 2P84A 3CCJT 1I07A 2MPXC 4OMLA 1K9MC 2O01E 3LWIA 3OYJA 1M1KC 4Q5WA 4JUVA 3EG2A 3CCJQ 1PRLC 1PC0A 2I0NA 3GIBA 1I1JA 2A7YA 2HD0A 4DA4A 3ZBDA 5FU7B 1CKBA 4L6V5 5HK0A 1HJDA 1ZA1B 2LCLA 2VXEA 1VQ5A 4QQDA 1IREB 5FWCA 5IHKA 1YFNA 3HKSA 2XDDA 3QKJA 1IZ6A 1GBQA 2CGHA 9ATCB 2WSCE 1WHKA 4HVWA 3A8OB 3I56A 3CBMA 2F69A 1VQ9T 5A0LA 1GBRA 4A4EA 1OPLA 2R57A 4J9EA 1CSKA 4M78B 3EG0A 1SPKA 3BFMA 1I8FA 1GL5A 1VQ9Q 2COYA 3HRUA 1ZSZB 5J3BA 5IXFA 2OTLT 3KBGA 1W2BA 3BE3A 3CCMT 2E10A 1H641 1N27A 2YSQA 2OTLQ 1K9MU 3CCMQ 4CC7A 4LDVA 3UA7A 4FL6A 4HXJA 1ZHIA 1NBEB 2AIRB 2CH4A 4DOVA 3CMET 3CCQA 3C12A 2OTJT 1K0XA 4M77C 1QVFA 4LDXA 2X4JA 4PJOG 1WXBA 3CC2A 3CMEQ 2OTJQ 1MV3A 4FW2A 7AT1B 3NTIA 2CP0A 4BE1A 4B9XA 2RJCA 4M77A 2E5KA 1UGQB 5LJ3g 2IVWA 5IH2A 1UG1A 4C8QB 2KI7A 3QYGB 3H0HA 4IKFA 2EQJA 3CC4T 1O75A 1KFZA 3CCSA 3V8KA 4HA8A 1K4US 4RUGA 2M9UA 1YBYA 5CR2A 3JCMW 4RTVA 2EBPA 2K3BA 2NUPB 2ZPBB 1NLPC 4EDUA 5FRMA 2CP2A 1VQ8A 2E41A 3MEUA 2W0ZA 3V7CA 1VIEA 2EKHA 2RHYA 2E1HA 3EG1A 3H0FA 3VS5A 5I2MA 3RKYA 1Y71A 4O5VA 3Q1JA 4M78D 2ATCB 3EG9B 1KQ1A 3ZEHA 2HCKA 4OGCA 3HRSA 3GP8A 1YJ9T 1TG0A 2KK4A 2CP6A 4C5HA 3SEMA 2F2VA 4AMCA 2RJFA 3HTRA 4IIOA 4YTLA 3E9GA 1FYNA 2KR3A 1SSHA 1YI2A 5FWBA 2KMTA 3UDCA 1YJ9Q 1VQ4A 2HAXA 2XDBA 1SRMA 4KBMB 1Q7YC 2DTOA 2K3YA 1G8XA 2EYZA 1HSQA 4M78G 2A36A 2J7IA 2QDLA 1I81A 3EHQA 1RAAB 1FMKA 5IHIA 2CUBA 4RG2A 2EGCA 4XTUA 3M56A 2V8IA 2VUBA 2YWWA 2ZPGB 3WVEB 2KXDA 3RERA 2P0PA 1EX4A 3I5RA 3IQLA 3VS6A 1X75C 4C8QD 2ZGWA 1M8MA 3GF5A 2DE0X 1VQNT 2EAYA 2RO0A 2EJ9A 1VQMA 3SD4A 2KDSA 3QBYA 3SFMA 2K4YA 3D7SB 3ULRB 1VQNQ 2RPNA 4ZN1A 1IXDA 5M9OA 2EYQA 2DX1A 2DVEA 5HCKA 4XK8E 4C8QG 2P0KA 2KYBA 3HL8A 1X6BA 3NFCA 4OB0B 2K5IA 3FIFA 1UE9A 2GCXA 3QJYA 1OYXA 2JOYA 1MNDA 2JM8A 2L89A 1QCOA 2K5LA 3G6ET 5D7UA 3VS3A 3G4SA 4BDYA 1VQPA 2JT4A 1T0JA 3M0SA 5KYXB 2DVJA 3OW2S 3CC7A 2ZPHB 3CCET 4DBRA 3G6EQ 4J9CA 1UDLA 4JJBA 1YIJT 1OOTA 5KE3A 4ORZA 2NUTA 4CI0C 2P0QA 1K9AA 3CCEQ 1PWTA 1VQ6A 2ZCFB 1N6AA 2CSQA 1YIJQ 3I55T 3HFNA 1ACMB 2QXFA 1PKTA 1IO6A 1KIKA 3MP1A 2PZ1A 1WX6A 3I55Q 4GBQA 3PT9A 4HVUA 4XQ3A 3QIIA 3A98A 4M7AB 2BZXA 3VUZA 3M54A 2X3XD 3QUIA 1D09B 2QGFB 4OMOA 1IB8A 3REAB 2ROLA 3ZFJA 2RH2A 2DBKA 2O4XA 5L8RE 2MMPA 4FYVB 3TVTA 2K5FA 1PKSA 1SEMA 1PM3A 2PVDB 4DBHA 3I5SA 1QVGA 2VC8A 3OS5A 3VUBA 4WCIA 2WSFE 3QDFA 2QA4A 1VQ7A 1M1GA 5GMKj 2A0FB 1RUWA 3LGLA 5GJVB 3UATA 2BKDN 3G7ZA 4EMKC 1X6GA 3I35A 2K57A 3META 5CAIA 3H6ZA 3KXTA 2G3RA 3S6WA 4EMKA 2K3XA 1IGUA 4R55A 2JMCA 3FJPA 1SHGA 1UHFA 1WXTA 4PFZA 2LCCA 3FEOA 1V1CA 2GBQA 4AFUC 1RABB 2FPEA 4HCZA 3L42A 2QASA 3CCJA 3NHNA 2DZ9A 1UB4A 5D6YA 2RM4A 3H8ZA 1TUDA 3OYGA 1H3ZA 2DBMA 1AWJA 3QDRB 4PJOF 2KRNA 3CPWP 3VKIA 4D8KA 1A0NB 2LP5A 3N5BB 5C0MA 2CREA 1QKXA 3M0QA 3LLRA 4E7ZA 1WXUA 2MOXA 4M7AD 2RI2A 2ZPIB 3X28B 1YITQ 3PNWC 2KXCA 2IG0A 1X6OA 4BDZA 1BI1A 4LE9A 4PJLA 1G2BA 5CQYA 1M30A 5DLQE 1TUCA 4HT8A 2O9SA 1VQ9A 4ZGEB 4OB2B 2GQVA 1QKWA 1G83A 1EIFA 2PTKA 4M75B 2QTVA 4A4KA 1UJYA 2V8KA 4M7AG 2GTJA 1QVGP 2ENMA 5GAN2 4F7UB 2OTLA 3CCMA 1FXXA 1X2QA 4KUIA 5KYUA 3C95A 1YP5A 3RESA 1MMAA 1OV3A 2VB6A 4L5GA 1KJWA 2ESWA 3DLLA 3CQTA 3PIPA 3JB9F 4JJNK 4JZ3A 4DEYA 4ESRA 3OY9A 4KGVB 2A08A 3OSSC 2W10A 4RTZA 3CMEA 2OTJA 2M0YA 4JPBW 1W1FA 5GAN3 1WJSA 4E7LA 3ME9A 5FRNA 1XOVA 5GAMg 2OAUA 3NTHA 2HL5C 4QVZA 3PTAA 4M78F 1BU1A 3TEEA 3SWNB 4P5NA 1BYMA 1Y07A 4C0DC 5GAN7 1UUEA 2YHTA 3A8GB 2JMAA 2QK0A 4PNOA 1QVPA 3RIRA 1HK9A 4RTWA 2WSEE 4LDWA 1RL2A 3JCMJ 4JJCA 3L2ZA 1VQ6T 1AWWA 4FT4A 4MMKA 1BI3A 1MMNA 1KQSP 1W2BS 1X2KA 4HVVA 1DJ7B 5KCHA 2BTTA 2F5KA 1XTDA 4M75D 2DO3A 3RNJA 4C8QE 5GAN8 2CSIA 1LVKA 4C8QF 1FMVA 1YJ9A 3PFSA 4LD6A 2RQTA 4M77B 4BI8B 2E65A 1QVFS 2DTHA 2ROTA 3WVDB 1M9SA 1W4SA 3URGA 1GXIE 2ECZA 4XTZA 2K2MA 1NM7A 4X1VA 1PNJA 1PCXA 4M75G 1IRXA 4V2SA 2DIGA 3OYNA 5GAN4 2DZCA 5KE2A 3EGDA 2HKQB 4F7UG 1D3BA 2L3PA 4KGZB 4C0FA 2CDTA 2E70A 2QI2A 4JRQA 2A28A 3V8LA 2ABLA 1N5ZA 2RK2A 4M7DB 1BI2A 3OYAA 2D1XA 3DLMA 3QJ6A 2JVVA 3O8VA 5EC7A 2QTXA 2GTOA 4A4GA 1VQNA 2KGTA 3BDUA 3UT1A 2H3EB 3AT1B 2ZPEB 3JCMb 4X9DA 3MP8A 4A4HA 3MCAB 4E6RA 1JQQA 4NOYA 2KRMA 5GAOl 1H8KA 3C94A 1TSFA 3UPUA 3EGXB 4EPCA 1I4K1 4J5YA 4C92B 2PQWA 1ARKA 3EFOB 1WQWA 4BUGA 2D6FA 2FPDA 2QDYB 2LX9A 3EHRA 1M4ZA 2RHUA 4C5EA 1M1FA 2ED0A 3VRYA 1Q86U 3M55A 2KE9A 2J05A 1KD1R 1M2VB 4WF2A 2FO0A 3G6EA 5DM7R 2RJEA 1SG5A 4C5IA 4JS4A 2HKNA 3CCEA 1AWXA 1SF9A 3QWXX 2RF0A 4PLIA 1YIJA 2FRWA 4BI3A 2D8HA 3JB9J 1MUZA 1K76A 2CS7A 1M90R 1Y96B 4PKCC 3JCMX 3I55A 2YRCA 4AG1C 2WACA 3FJ5A 4PJOD 3E19A 4JS5A 2X9HA 2V26A 3CPFA 4IUUA 4J7FA 3REBB 1UECA 2VWFA 4M7DD 2M02A 3L2RA 5CCAA 3MHXA 1BCOA 2HBPA 4LD9K 3VS4A 5C6SA 2LT1A 2QQRA 5GMKm 1TU0B 1WLPB 2DM1A 2IIMA 1PG5B 4PL6A 2VYTA 4X9CA 4XTWA 1TWBA 2LT4A 1RI0A 3NTKA 2HSEB 4M7DG 2HL3A 2KQWA 4C92D 2O2OA 2SEMA 2LRQA 3OYYA 2ZPFB 2DERA 4RCBA 1ZUUA 1QW1A 3KFVA 4FSXA 4M7AE 4KGXB 3S3NA 4XTXA 2VXFA 3JB9D 1OPKA 1RAIB 4M7AF 2YRVA 2DJZA 4ZTJA 5I2SA 3OYMA 4IUTA 1U1SA 5GMKh 4MZMA 3UA6A 4C92G 2KNBB 2VVKA 1BIAA 3QHSA 1JEGA 3VS1A 1U8RA 1UGRB 2HSPA 2QAZA 1LCKA 1I0CA 2MI6A 1LJOA 2RI5A 3HP9A 2RQWA 3JCMd 1N9SA 5LJ3d 3RMSA 3JB9G 4HCBA 1H92A 3A8LB 4MZTA 1M27C 1JJ2A 1NJIU 2R5MA 5J39A 2ZZDA 4JJDA 2XK0A 2JW4A 1YITA 4EMGA 1OU9A 1JO8A 2OI3A 2DL5A 2LNHB 3FDRA 5LJ5d 2JM9A 2PU9B 5LJ3j 3JCMP 2C0TA 3CCLT 5KYYA 3OYIA 1QVGS 4E7JA 1AZEA 3CCLQ 3I9QA 2LNVA 4JDSA 1OX9A 3CXCA 1M3AA 5GANd 2H3JA 5LJ5j 3X20B 3VRZA 4C5GA 2DL8A 4EMKB 4JRKA 4BE2A 3NMZC 2R58A 3OB9A 4RCCA 5J26A 4F14A 1JXOA 2YT6A 2RI3A 2MF2A 1QP3A 5GANj 2RQVA 2RB6A 2FYKA 2PVOB 3V8JA 5ECAA 4QW2A 4F16A 4J9BA 4Z88A 1KD1C 2EQUA 1XNIA 4A53A 1WDXA 2CZ0B 2EJFA 1KSWA 2V1QA 3JB9I 2BUDA 3HFOA 2FVUA 1QLYA 1TS9A 4M75E 4ANJA 3PMTA 3OYDA 1D1CA 4D8DA 4BE0A 2CT3A 4M75F 1BB9A 5FU6B 3MPUB 3JAME 2KBTA 4F7UE 2DD5A 3PMIA 1B7TA 1IHWA 4F7UF 4NL3A 2K6DA 1JJ2P 3C4SA 3FRNA 4QKUA 3O5ZA 4XU0A 3RUXA 3JB9H 3X25B 4J6XA 1AT1B 1Z9ZA 2L5QA 4E7IA 1G3TA 2CP7A 4NS5A 1K8AR 1BIBA 5KYWA 4LDYA 1V76A 1VYUA 4FYXB 2CKKA 3JRZA 4RMOA 4MDWA 2FHDA 4IUQA 4ME7A 4E2FB 3CPWA 1YHQT 2FEIA 2XMFA 1U1TA 4E47A 1Q82R 2F5TX 1KD1U 3CXCP 4F17A 3OYHA 1YJNT 5CIUA 1YHQQ 2KT8A 4C8QA 2QQSA 2LMJA 2DF6A 3ER0A 8ATCB 2KVQG 3M0PA 3KUFA 4HCCA 3LW5E 5CO7A 1YJNQ 5FLXE 3JCMQ 3F70A 1VQLT 3JSCA 2JJ9A 2LTOA 2EGAA 1M90U 4C0GA 1SHFA 4BY6C 3VJPA 1FX7A 4B6MA 2NUPA 4B9WA 1VQLQ 2KY9A 4AT1B 1RAFB 3L2UA 2EPDA 2CUDA 3HPWA 2E6ZA 2FG0A 1B34B 4XAXB 4OF1A 3INZA 2LJ3A 3ASKA 4J6WA 4CC2A 2PUKB 3UWNA 3LH0A 3EG9A 1XQHA 3M53A 5HKCA 2D0NA 2GQIA 2IPOB 1UGVA 3A1PA 3CCUT 2PUOB 5CKDA 4N4GA 2E4HA 3RKWA 2YRDA 4M77F 1KQ2A 3S3MA 2QEXT 1Q86R 3CCUQ 3CMAT 3OS0A 3TCJA 1VIFA 3A5ZB 1PSFA 4GY5A 2LQWA 2QEXQ 3CMAQ 1OEBA 4KH0B 3RKXA 2DXUA 1NZ9A 2A37A 4PJOE 2VV5A 3VU3C 3OYBA 2E3HA 2HQHA 2KT1A 1YITT 3LGFA 2VGNA 1MGQA 4J6YA 4M7DE 1TTHB 2LC4A 1D3BB 4X34A 4M7DF 1T0HA 1YWOA 3VYGA 3OQ5A 1N8RR 2DEQA 5I11A 1YJWT 2YUQA 8AT1B 1KQSA 5GMKe 3JCMc 3SDZA 1OZ3A 1RI9A 1YJWQ 1QMCA 1SRLA 2DJQA 4K11A 2XG8D 1K73U 1G3SA 4C92E 3OMGA 2HQEA 3OA6A 5CKHA 3R6NA 4C92F 1I5LA 3E2UA 3CCVT 1QP2A 2K2VA 4OMMA 1QQJA 2EIFA 2M1HA 1UFFA 2DXTA 1W70A 4GLMA 2X51A 3CCVQ 2BZ8A 2YUNA 3QYHB 3CD6T 3CCRT 3DB4A 3TSWA 3LWHA 5I22A 4ZTFA 4IUVA 5CKEA 1WFWA 1ZQ1A 2HBWA 1AOJA 1KHIA 3CD6Q 2E6NA 3OS2A 3CCRQ 4M78E 4PJNA 2FL7A 4M7AC 3QWYA 5GAOq 2PVGB 3J80E 1VOMA 5D6XA 2L0AA 2E12A 4F04B 3M0TA 4DBFA 5IT9E 5L23A 1B07A 3V7RA 3V7SA 4M7AA 2CYZB 1AEYA 4PFOA 4OB3B 5A0GA 2L8DA 2FRYA 3QXEB 1NJIR 3OS1A 3LH5A 4RG8A 4PK4A 3EH1A 2DL4A 1T3SA 3FB9A 1S72T 2LX7A 2HQXA 5GAMd 4FT2A 5IN1A 3EG3A 1S72Q 4PLLA 3QZ9B 1H3HA 4PJJA 1OU8A 1FMWA 3L1AA 4OB1B 2HDAA 1K1ZA 2X4WA 1G3WA 2MCNA 4DEXA 2KRSA 2LCSA 2AT1B 5GAMj 1K8AU 1RLQC 1Q95G 3OW2P 2RMOA 1X69A 2PNIA 2AK5A 2O88A 4RTYA 1TOVA 3CCLA 1E6HA 1KC8U 5IXBA 1Q82U 2BZYA 3HRTA 4DBQA 1VQOT 2CP5A 5KCOA 3THKA 1Q86C 1WJRA 3A8MB 2C0IA 3OBWA 1R8OB 3JCMh 3L2QA 3EFRA 2CZ6B 2H8HA 2KSSA 4RTXA 1D0XA 1VQOQ 2DXBA 4O6JA 1G5VA 1HXDA 2J6KA 4FIBA 4JZ4A 1NPPA 2GNCA 3H9NA 1ZX6A 2NYSA 2LDMA 1WHGA 1M3BA 2E64A 1WI7A 1WHLA 2J6OA 5IHNA 5LJ5h 4Z02A 2DPPB 1YCSB 1R0BG 4QVCA 1N8RC 4AFQC 2Y4XA 5GAOm 4FW1A 3P8HA 1WGSA 3L2WA 4JRIA 4HT9A 1Q7YR 4E7HA 2LQKA 4OMFB 4J8OA 4XU1A 1JJ2S 5GANh 3HHTB 1IHVA 4CC4B 2HNIA 1OULA 1OX8A 4M75A 2XICA 2AZSA 3MJXA 2SRCA 1NYFA 1WNLA 1QCNA 2OJ2A 4PJMA 2GF7A 4F7UA 5GAOn 2FPFA 2XIDA 3J7AF 2FZGB 3G71T 1TXQA 2EKOA 1ABQA 1ABOA 1C6VX 3NGPA 2DTIA 2E3IA 3L2VA 4M77D 2JXBA 2GFUA 3G71Q 1U06A 2MK5A 2G6FX 5D6WA 1YWPA 1WA7A 3CXCS 4L59A 3QZ5B 3QG1A 1SSFA 5DY9A 1NE8A 2YLBA 1RACB 2B8AA 4N0AC 3QSUA 4NL2A 1X27A 4FSSA 3SWNC 3GNFB 4CC3A 1NEGA 1Q81U 1YHQA 2DL3A 1N8RU 2ZAEA 4M77G 5GAN6 2EYYA 4N0AA 4DQ2A 2RK1A 1MMDA 2CP3A 1YJNA 1XJWB 1P92A 2JTMA 4MDXA 1YN8A 4GLKA 3SWNA 3M57A 2O9VA 2CZ7B 4J9IA 2L2PA 2FB7A 2E5QA 1N9RA 2K9GA 4J9GA 1UHCA 4AFZC 2RQUA 1VQLA 2RJDA 2AKKA 4Y28E 2AZVA 4E7KA 1CKAA 4PFPA 1VYTA 2HEQA 1NJIC 1YCYA 1PHTA 2AHJB 4J7IA 4KT0E 2RHIA 1U5SA 2RQRA 3P8DA 1M1KU 4FM4B 2BIVA 3RBBB 2EQIA 4R0KA 3JCMf 3S3OA 5LJ3f 1JBMA 4IUPA 2KEAA 5KYWB 2NUTB 5GMKl 4ATOA 2V8JA 1BKBA 5CK9A 3MKDA 4OMPA 1BCMA 3EFSA 4FYWB 4JLGA 3PVLA 2C0OA 3CCUA 3JCMg 5LJ5f 2RHXA 3J81E 3VS2A 3MP6A 1OZ2A 3BDLA 1WHHA 5CVIA 2QEXA 3CMAA 2AKLA 3CPWS 4PJOC 4JRPA 1GCQC 2L3SA 4FU6A 1D1BA 1EZZB 1Z9QA 4D6WA 5A2QE 2FZKB 1VQKT 2F2XA 4A4FA 2YLCA 2QGGA 5GANf 4M7DC 3M5AA 2O4XB 5LJ5g 3OYEA 3GPLA 3CC4Q 4PJOA 1GCQA 2EQMA 2COWA 1VQKQ 1RAHB 4UC4A 3OSVA 5AT1B 1K73R 2FZCB 2DFUA 2DK3A 2DKGA 2CH4W 4M7DA 4BY6B 1WYXA 3G1JA 1JU5C 3PVQA 4OP0A 3DKMA 4N4IA 2QYZA 5HK3A 1WZOA 5GANg 2JS2A 2XKOC 4IIMA 2EYWA 2EQKA 2JZ2A 1M8VA 1YJWA 4QQGA 4C92C 3PGGA 2Z0WA 3JCMV 1BK2A 5I21A 3OYCA 2DILA 1W2BP 4LDUA 3GLXA 4QQ6A 3EGXA 2F2WA 1W6XA 1Y57A 1R0CB 1KK7A 1F1BB 4LN2A 5FU7C 4C92A 3EFOA 4LXCA 4KULA 2LQNA 3TREA 3CCVA 1QWFA 3M9QA 3E9FA 4LUDA 3P8BB 2OAWA 2K79A 2MAMA 1QVFP 2DETA 1GRIA 3OMCA 1M2VA 3TU4K 4A54A 1ZA2B 1K0SA 2XDPA 4BACA 1OI1A 2HMAA 4MMLA 2GFAA 3E1SA 4M78C 3CD6A 3CCRA 1ZBJA 2DYIA 3M4GA 1ZSZC 3EAEA 4WTOB 3C0CA 5GAOp 1UGSB 2M16A 4M78A 6AT1B 3EH2A 5GAOr 3JCMe 1Y96A 2JTEA 1GFDA 5LJ3e 4RKUE 4J9FA 1MNEA 1ZSZA 1RAGB 1M90C
chains in the Genus database with same CATH topology
3GBQA 2ED1A 5I11A 1WXBA 2ECZA 2K2MA 1NM7A 4X1VA 1PNJA 1MV3A 2YUQA 1B3QA 2YUPA 4KRTA 2DA9A 2E5KA 3UF4A 5IH2A 1J3TA 2L3PA 1RI9A 1UG1A 1SRLA 1T3LA 2DJQA 4K11A 4QT7A 2CDTA 2J6FA 4OMNA 3H0HA 2A28A 2ABLA 3R6NA 1N5ZA 2P4RA 1WIEA 3VS0A 1KFZA 2D1XA 4OMMA 1K4US 4RUGA 1UFFA 5EC7A 4RTVA 1W70A 2EBPA 2K3BA 4GLMA 1NLPC 2K7AA 2GTOA 2KGTA 1AWOA 2BZ8A 1NG2A 2YUNA 1ZUKA 2W0ZA 4E6RA 1JQQA 3PE0A 2EKHA 2KRMA 2M51A 1H8KA 2DRMA 3TSZA 3EG1A 3TSWA 3H0FA 3VS5A 5I22A 1ARKA 1WFWA 2HBWA 1AOJA 4Y92A 2FPDA 2HCKA 3EHRA 3NPFA 1TG0A 3SEMA 2F2VA 2B86A 3QWYA 4IIOA 4A63B 2ED0A 1FYNA 2KR3A 1X43A 2RNAA 1SSHA 3VRYA 2L0AA 2KE9A 5FWBA 3M0TA 2J05A 3U23A 5L23A 1B07A 1SRMA 2DL7A 2FO0A 2EYZA 1HSQA 4LUEA 1AEYA 2EVRA 3ZL7C 2EW3A 1UTIA 2A36A 1AWXA 2FRYA 2J7IA 2QDLA 3QWXX 3LH5A 2RF0A 3EHQA 2DL4A 2FRWA 1Y0MA 1T3SA 2D8HA 1FMKA 5IHIA 2CUBA 1MUZA 1K76A 2EGCA 2LX7A 2JS0A 1VA7A 2DNUA 1VYVA 2VKNA 1QWEA 1AVZC 3EG3A 2KXDA 1H3HA 3I5RA 4AG1C 3FJ5A 3IQLA 3VS6A 2MIOA 2X3WD 1M8MA 2HDAA 1K1ZA 2DE0X 2MCNA 3REBB 4DEXA 1UECA 2KRSA 1MV0B 2VWFA 2LCSA 2DRKA 1RLQC 2RMOA 1X69A 3ULRB 2PNIA 2AK5A 2RPNA 3VS4A 5FW9A 4J9DA 2O88A 4RTYA 1WLPB 2DM1A 2IIMA 2DX1A 2DYBA 5HCKA 1E6HA 2RN8A 5IXBA 1ZUYA 2BZYA 2KYBA 1X6BA 3THKA 1GFCA 2C0IA 1UE9A 2KYMA 2O2OA 4RTXA 2H8HA 2SEMA 2JM8A 1ZUUA 3VS3A 2J6KA 2JT4A 4JZ4A 1T0JA 3M0SA 2GNCA 3KFVA 2DVJA 1PRMC 1ZX6A 4LNPA 1OPKA 4RTUA 1M3BA 4J9CA 1UDLA 1WI7A 4JJBA 1OOTA 2J6OA 4ORZA 5IHNA 1K9AA 1PWTA 3UA6A 2KNBB 2VVKA 2DMOA 1YCSB 1JEGA 1E6GA 1M3CA 2CSQA 2DLPA 3VS1A 2HSPA 1LCKA 4AFQC 1QCFA 1I0CA 1NYGA 1PKTA 2RQWA 1IO6A 1KIKA 3JV3A 1EFNA 2PZ1A 1WX6A 2YUOA 4GBQA 1H92A 4HVUA 1M27C 3EGUA 4CC4B 3A98A 2BZXA 4RTTA 4JJDA 2AZSA 3H0IA 2JW4A 2SRCA 1NYFA 2X3XD 4AG2C 4OMOA 3REAB 2ROLA 1JO8A 2OI3A 2OJ2A 2FPFA 2DL5A 1ZSGA 1GCPA 1JXMA 2LNHB 2JM9A 1BBZA 1RLPC 2DBKA 1ABQA 1ABOA 2C0TA 3NGPA 3TVTA 2CT4A 1PKSA 1SEMA 2JXBA 1U06A 2G6FX 1NLOC 2YDLA 3I5SA 1AZEA 1YWPA 1WA7A 3I9QA 1M3AA 4WCIA 1AD5A 3VRZA 2DL8A 1X27A 4FSSA 1RUWA 3NMZC 5GJVB 3UATA 4CC3A 1NEGA 2DL3A 1X6GA 3I35A 3SHWA 2EYYA 1UJ0A 4F14A 1ZLMA 1JXOA 2YT6A 2RQVA 1YN8A 2O9VA 5ECAA 4EIKA 4F16A 2NUZA 2JMCA 4J9IA 2L2PA 4J9BA 4ZNXA 4Z88A 1SHGA 1UHFA 1WXTA 2K9GA 4J9GA 1UHCA 1E7OA 1WDXA 2LJ1A 4AFZC 1V1CA 2RQUA 2GBQA 4AFUC 1KSWA 2AKKA 2FPEA 2AZVA 2V1QA 1CKAA 3NHNA 1VYTA 2HEQA 1TUDA 1PHTA 2DBMA 1AWJA 1QLYA 2KRNA 4M4ZA 2EYXA 1U5SA 2RQRA 4D8KA 1A0NB 2LJ0A 4D8DA 2CT3A 3RBBB 1BB9A 2EGEA 2EQIA 4R0KA 2KBTA 2LP5A 4HCKA 2NWMA 3H41A 2KEAA 2CREA 1QKXA 3M0QA 1WXUA 2MOXA 2KXCA 2K6DA 2V1RA 4OMPA 1NEBA 4LE9A 4Z89A 1G2BA 2D8JA 2LZ6B 3PVLA 4J9HA 1M30A 2GGRA 1TUCA 2C0OA 3O5ZA 2O9SA 1Z9ZA 4OMQA 3VS2A 3M0RA 1QKWA 1VYUA 1G83A 2AKLA 2PTKA 2J06A 1AZGB 1GCQC 5GJWB 2L3SA 1UJYA 2GTJA 2O31A 1S1NA 1Z9QA 2FEIA 2KROA 2ENMA 1YNZA 2XMFA 2F2XA 1HD3A 2L3QA 1X2QA 4F17A 3M0UA 1YP5A 1OV3A 2KT8A 1GCQA 1KJWA 1U3OA 2ESWA 2LMJA 2DF6A 3CQTA 4JZ3A 4Z8AA 3M0PA 4DEYA 4ESRA 2A08A 2CH4W 4AFSC 2W10A 4RTZA 1WYXA 2M0YA 3VS7A 4JPBW 1JU5C 3PVQA 1W1FA 1I07A 2EGAA 2JS2A 1SHFA 4IIMA 4OMLA 2EYWA 1XOVA 2EPDA 2CUDA 3EG2A 1PRLC 2FG0A 2I0NA 1I1JA 1BK2A 2DILA 1BU1A 2F2WA 1W6XA 1CKBA 1HJDA 2LJ3A 1Y57A 4CC2A 5FWCA 5IHKA 1UUEA 4LN2A 2JMAA 1GBQA 2D0NA 2LQNA 2GQIA 1UGVA 1QWFA 4HVWA 4LUDA 4RTWA 2OAWA 2K79A 1GBRA 4JJCA 1GRIA 1OPLA 4J9EA 1CSKA 1AWWA 3EG0A 1SPKA 1GL5A 1K0SA 5IXFA 1X2KA 4HVVA 2LQWA 1ZBJA 1OEBA 2BTTA 2A37A 3C0CA 3RNJA 2YSQA 2CSIA 4CC7A 3UA7A 4HXJA 2KT1A 2JTEA 1GFDA 2RQTA 4J9FA 2CH4A 1K0XA 2ROTA 1T0HA 1YWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  2ED1 A;  5I11 A;  1WXB A;  2ECZ A;  2K2M A;  1NM7 A;  4X1V A;  1PNJ A;  1MV3 A;  2YUQ A;  1B3Q A;  2YUP A;  4KRT A;  2DA9 A;  2E5K A;  3UF4 A;  5IH2 A;  1J3T A;  2L3P A;  1RI9 A;  1UG1 A;  1SRL A;  1T3L A;  2DJQ A;  4K11 A;  4QT7 A;  2CDT A;  2J6F A;  4OMN A;  3H0H A;  2A28 A;  2ABL A;  3R6N A;  1N5Z A;  2P4R A;  1WIE A;  3VS0 A;  1KFZ A;  2D1X A;  4OMM A;  1K4U S;  4RUG A;  1UFF A;  5EC7 A;  4RTV A;  1W70 A;  2EBP A;  2K3B A;  4GLM A;  1NLP C;  2K7A A;  2GTO A;  2KGT A;  1AWO A;  2BZ8 A;  1NG2 A;  2YUN A;  1ZUK A;  2W0Z A;  4E6R A;  1JQQ A;  3PE0 A;  2EKH A;  2KRM A;  2M51 A;  1H8K A;  2DRM A;  3TSZ A;  3EG1 A;  3TSW A;  3H0F A;  3VS5 A;  5I22 A;  1ARK A;  1WFW A;  2HBW A;  1AOJ A;  4Y92 A;  2FPD A;  2HCK A;  3EHR A;  3NPF A;  1TG0 A;  3SEM A;  2F2V A;  2B86 A;  3QWY A;  4IIO A;  4A63 B;  2ED0 A;  1FYN A;  2KR3 A;  1X43 A;  2RNA A;  1SSH A;  3VRY A;  2L0A A;  2KE9 A;  5FWB A;  3M0T A;  2J05 A;  3U23 A;  5L23 A;  1B07 A;  1SRM A;  2DL7 A;  2FO0 A;  2EYZ A;  1HSQ A;  4LUE A;  1AEY A;  2EVR A;  3ZL7 C;  2EW3 A;  1UTI A;  2A36 A;  1AWX A;  2FRY A;  2J7I A;  2QDL A;  3QWX X;  3LH5 A;  2RF0 A;  3EHQ A;  2DL4 A;  2FRW A;  1Y0M A;  1T3S A;  2D8H A;  1FMK A;  5IHI A;  2CUB A;  1MUZ A;  1K76 A;  2EGC A;  2LX7 A;  2JS0 A;  1VA7 A;  2DNU A;  1VYV A;  2VKN A;  1QWE A;  1AVZ C;  3EG3 A;  2KXD A;  1H3H A;  3I5R A;  4AG1 C;  3FJ5 A;  3IQL A;  3VS6 A;  2MIO A;  2X3W D;  1M8M A;  2HDA A;  1K1Z A;  2DE0 X;  2MCN A;  3REB B;  4DEX A;  1UEC A;  2KRS A;  1MV0 B;  2VWF A;  2LCS A;  2DRK A;  1RLQ C;  2RMO A;  1X69 A;  3ULR B;  2PNI A;  2AK5 A;  2RPN A;  3VS4 A;  5FW9 A;  4J9D A;  2O88 A;  4RTY A;  1WLP B;  2DM1 A;  2IIM A;  2DX1 A;  2DYB A;  5HCK A;  1E6H A;  2RN8 A;  5IXB A;  1ZUY A;  2BZY A;  2KYB A;  1X6B A;  3THK A;  1GFC A;  2C0I A;  1UE9 A;  2KYM A;  2O2O A;  4RTX A;  2H8H A;  2SEM A;  2JM8 A;  1ZUU A;  3VS3 A;  2J6K A;  2JT4 A;  4JZ4 A;  1T0J A;  3M0S A;  2GNC A;  3KFV A;  2DVJ A;  1PRM C;  1ZX6 A;  4LNP A;  1OPK A;  4RTU A;  1M3B A;  4J9C A;  1UDL A;  1WI7 A;  4JJB A;  1OOT A;  2J6O A;  4ORZ A;  5IHN A;  1K9A A;  1PWT A;  3UA6 A;  2KNB B;  2VVK A;  2DMO A;  1YCS B;  1JEG A;  1E6G A;  1M3C A;  2CSQ A;  2DLP A;  3VS1 A;  2HSP A;  1LCK A;  4AFQ C;  1QCF A;  1I0C A;  1NYG A;  1PKT A;  2RQW A;  1IO6 A;  1KIK A;  3JV3 A;  1EFN A;  2PZ1 A;  1WX6 A;  2YUO A;  4GBQ A;  1H92 A;  4HVU A;  1M27 C;  3EGU A;  4CC4 B;  3A98 A;  2BZX A;  4RTT A;  4JJD A;  2AZS A;  3H0I A;  2JW4 A;  2SRC A;  1NYF A;  2X3X D;  4AG2 C;  4OMO A;  3REA B;  2ROL A;  1JO8 A;  2OI3 A;  2OJ2 A;  2FPF A;  2DL5 A;  1ZSG A;  1GCP A;  1JXM A;  2LNH B;  2JM9 A;  1BBZ A;  1RLP C;  2DBK A;  1ABQ A;  1ABO A;  2C0T A;  3NGP A;  3TVT A;  2CT4 A;  1PKS A;  1SEM A;  2JXB A;  1U06 A;  2G6F X;  1NLO C;  2YDL A;  3I5S A;  1AZE A;  1YWP A;  1WA7 A;  3I9Q A;  1M3A A;  4WCI A;  1AD5 A;  3VRZ A;  2DL8 A;  1X27 A;  4FSS A;  1RUW A;  3NMZ C;  5GJV B;  3UAT A;  4CC3 A;  1NEG A;  2DL3 A;  1X6G A;  3I35 A;  3SHW A;  2EYY A;  1UJ0 A;  4F14 A;  1ZLM A;  1JXO A;  2YT6 A;  2RQV A;  1YN8 A;  2O9V A;  5ECA A;  4EIK A;  4F16 A;  2NUZ A;  2JMC A;  4J9I A;  2L2P A;  4J9B A;  4ZNX A;  4Z88 A;  1SHG A;  1UHF A;  1WXT A;  2K9G A;  4J9G A;  1UHC A;  1E7O A;  1WDX A;  2LJ1 A;  4AFZ C;  1V1C A;  2RQU A;  2GBQ A;  4AFU C;  1KSW A;  2AKK A;  2FPE A;  2AZV A;  2V1Q A;  1CKA A;  3NHN A;  1VYT A;  2HEQ A;  1TUD A;  1PHT A;  2DBM A;  1AWJ A;  1QLY A;  2KRN A;  4M4Z A;  2EYX A;  1U5S A;  2RQR A;  4D8K A;  1A0N B;  2LJ0 A;  4D8D A;  2CT3 A;  3RBB B;  1BB9 A;  2EGE A;  2EQI A;  4R0K A;  2KBT A;  2LP5 A;  4HCK A;  2NWM A;  3H41 A;  2KEA A;  2CRE A;  1QKX A;  3M0Q A;  1WXU A;  2MOX A;  2KXC A;  2K6D A;  2V1R A;  4OMP A;  1NEB A;  4LE9 A;  4Z89 A;  1G2B A;  2D8J A;  2LZ6 B;  3PVL A;  4J9H A;  1M30 A;  2GGR A;  1TUC A;  2C0O A;  3O5Z A;  2O9S A;  1Z9Z A;  4OMQ A;  3VS2 A;  3M0R A;  1QKW A;  1VYU A;  1G83 A;  2AKL A;  2PTK A;  2J06 A;  1AZG B;  1GCQ C;  5GJW B;  2L3S A;  1UJY A;  2GTJ A;  2O31 A;  1S1N A;  1Z9Q A;  2FEI A;  2KRO A;  2ENM A;  1YNZ A;  2XMF A;  2F2X A;  1HD3 A;  2L3Q A;  1X2Q A;  4F17 A;  3M0U A;  1YP5 A;  1OV3 A;  2KT8 A;  1GCQ A;  1KJW A;  1U3O A;  2ESW A;  2LMJ A;  2DF6 A;  3CQT A;  4JZ3 A;  4Z8A A;  3M0P A;  4DEY A;  4ESR A;  2A08 A;  2CH4 W;  4AFS C;  2W10 A;  4RTZ A;  1WYX A;  2M0Y A;  3VS7 A;  4JPB W;  1JU5 C;  3PVQ A;  1W1F A;  1I07 A;  2EGA A;  2JS2 A;  1SHF A;  4IIM A;  4OML A;  2EYW A;  1XOV A;  2EPD A;  2CUD A;  3EG2 A;  1PRL C;  2FG0 A;  2I0N A;  1I1J A;  1BK2 A;  2DIL A;  1BU1 A;  2F2W A;  1W6X A;  1CKB A;  1HJD A;  2LJ3 A;  1Y57 A;  4CC2 A;  5FWC A;  5IHK A;  1UUE A;  4LN2 A;  2JMA A;  1GBQ A;  2D0N A;  2LQN A;  2GQI A;  1UGV A;  1QWF A;  4HVW A;  4LUD A;  4RTW A;  2OAW A;  2K79 A;  1GBR A;  4JJC A;  1GRI A;  1OPL A;  4J9E A;  1CSK A;  1AWW A;  3EG0 A;  1SPK A;  1GL5 A;  1K0S A;  5IXF A;  1X2K A;  4HVV A;  2LQW A;  1ZBJ A;  1OEB A;  2BTT A;  2A37 A;  3C0C A;  3RNJ A;  2YSQ A;  2CSI A;  4CC7 A;  3UA7 A;  4HXJ A;  2KT1 A;  2JTE A;  1GFD A;  2RQT A;  4J9F A;  2CH4 A;  1K0X A;  2ROT A;  1T0H A;  1YWO A; 
#chains in the Genus database with same CATH topology
 2NLU A;  2HZY A;  3GBQ A;  2EWN A;  2ED1 A;  3CBP A;  1TH7 A;  1MMG A;  1LPL A;  1KQS S;  1O9S A;  1WHM A;  1Q7Y U;  3OBY A;  5GMK i;  1B3Q A;  2YUP A;  3MEW A;  5LJ5 e;  4KRT A;  2DA9 A;  4N4H A;  5KYU B;  3UF4 A;  1J3T A;  1JRI A;  1T3L A;  1S72 A;  2MYS A;  1VQ5 T;  4QT7 A;  2J6F A;  4OMN A;  2I2L A;  4C8Q C;  1G3Y A;  1KC8 R;  2P4R A;  1WIE A;  4OVA A;  3VS0 A;  1VQ5 Q;  5GAN e;  3I56 T;  1KG1 A;  3BY7 A;  4OGE A;  4EMH A;  2QG9 B;  3LYI A;  2K7A A;  5LL6 S;  1AWO A;  3I56 Q;  2EFI A;  1NG2 A;  5CKF A;  1ZUK A;  3PE0 A;  3M4Y A;  2M51 A;  3TSZ A;  2DRM A;  3M58 A;  3SB2 A;  2EJG A;  4Y92 A;  3NPF A;  5GAM h;  1RAE B;  1VQO A;  2B86 A;  4A63 B;  1OQK A;  1X43 A;  4C0D B;  2RNA A;  3CCQ T;  1WQ7 A;  4E7S A;  2D0Q B;  2RD1 A;  2JUF A;  3U23 A;  1PD1 A;  2DL7 A;  5GAN 5;  2VAS A;  3CC2 T;  4FYY B;  3CCQ Q;  1LNX A;  4BB7 A;  4CRI A;  4LUE A;  2EVR A;  3ZL7 C;  2EW3 A;  1UTI A;  4M77 E;  3GNG A;  3M59 A;  3OYL A;  2XU8 A;  3OYF A;  3CC2 Q;  2Y4Y A;  1Y0M A;  1K73 C;  1I5O B;  2QQB A;  2Y90 A;  2JS0 A;  4DOW A;  1C0M A;  1V29 B;  1VA7 A;  2DNU A;  1VYV A;  3RR6 A;  2DAQ A;  2VKN A;  1QWE A;  5FRO A;  2DD4 A;  1AVZ C;  3CCS T;  2JN0 A;  2MIO A;  4QVD A;  2X3W D;  4J83 A;  2BE7 D;  1D1A A;  3BW1 A;  3WXM B;  3CCS Q;  1MV0 B;  5CQX A;  2DRK A;  1VQ8 T;  2QQA A;  3EGD B;  2JTF A;  2X4Y A;  2BE9 B;  4BI4 A;  3DB3 A;  1Q81 R;  5FW9 A;  4J9D A;  2D9T A;  3G71 A;  4KH1 B;  1VQ8 Q;  2XD0 A;  3OYK A;  5CKB A;  2DYB A;  2KAF A;  4XTV A;  2RN8 A;  2L3R A;  3X24 B;  3GOX A;  1ZUY A;  1R77 A;  3FC3 A;  1GFC A;  1SKU B;  2A3L A;  5EG2 A;  1WHJ A;  1YI2 T;  2KYM A;  5FU6 C;  1VQ4 T;  2JNG A;  3VYH B;  1JB0 E;  1PRM C;  1YI2 Q;  4LNP A;  1D0Y A;  3OW2 A;  1VQ4 Q;  1K9M R;  4RTU A;  2P4T A;  1Y7X A;  1ZBX A;  1M1K R;  2M0O A;  4TVR A;  2X4X A;  2COZ A;  3T9N A;  2DMO A;  5KYX A;  1E6G A;  1M3C A;  2DLP A;  1QCF A;  3QO3 A;  1NYG A;  2R5A A;  4Y91 A;  2LQ8 A;  2C06 A;  1HYO A;  1IGQ A;  3JV3 A;  1EFN A;  2YUO A;  2DXC A;  3EGU A;  5GAM f;  1M2O A;  1K8A C;  1VQM T;  4RTT A;  3H0I A;  3RDV A;  1PSE A;  4JLI A;  2OX7 A;  4AG2 C;  3LX7 A;  1C1A A;  1GCP A;  1ZSG A;  1JXM A;  1NPR A;  2XI9 A;  1VQM Q;  1BBZ A;  1RLP C;  1KC8 C;  1Q82 C;  2RA2 A;  3QPH A;  4C0Z A;  4HKE A;  1WPY A;  2QQ9 A;  2DEU A;  2CT4 A;  4ZGJ B;  3PIO A;  1NLO C;  2YDL A;  2CZ1 B;  1PD0 A;  2DIQ A;  1AD5 A;  1LOJ A;  4R56 A;  3G4S T;  1VQP T;  4XU3 A;  3MEA A;  1RAD B;  3HSB A;  3CC4 A;  3CC7 T;  4ELY C;  4VUB A;  3SHW A;  1VQK A;  3MO8 A;  1B34 A;  4ELZ C;  1UJ0 A;  3G4S Q;  3CBO A;  1VQP Q;  1ZLM A;  2YXY A;  2F1L A;  3CC7 Q;  4BD3 A;  4EIK A;  1MHN A;  2NUZ A;  4ZGD B;  1BI0 A;  4ZNX A;  4XTY A;  5DLO A;  1D0Z A;  1E7O A;  2LJ1 A;  4MZP A;  3X26 B;  1VQ6 Q;  3CEY A;  3FLG A;  4M4Z A;  2EYX A;  5KH6 A;  2LJ0 A;  1AHJ B;  2EGE A;  1UEB A;  5A0D A;  4HCK A;  2NWM A;  3H41 A;  3R6O A;  5LJ3 h;  1WJQ A;  5AYF A;  3AHU A;  5IAY A;  2V1R A;  1NEB A;  4Z89 A;  3RMQ A;  3VV0 A;  1FWZ A;  2D8J A;  2LZ6 B;  4J9H A;  4XU2 A;  2GGR A;  2MWP A;  3TQ7 P;  4OMQ A;  3M0R A;  4PJO B;  2QA4 T;  1VQ7 T;  2J06 A;  1AZG B;  1Q81 C;  5GJW B;  1X01 A;  1VUB A;  3A8H B;  1UGP B;  2O31 A;  1S1N A;  4M75 C;  1M5Q 1;  2KRO A;  2QA4 Q;  1YNZ A;  1TUG B;  1HD3 A;  1VQ7 Q;  2L3Q A;  2MWO A;  3M0U A;  2VGM A;  5GAM e;  5KYN A;  4KUD K;  1U3O A;  5KYY B;  4FCY A;  1KHC A;  4Z8A A;  3MEV A;  2XHC A;  4ZN3 A;  2X35 A;  2LVM A;  4AFS C;  4II1 A;  5HY6 A;  4IUR A;  2RHZ A;  3VS7 A;  2P84 A;  3CCJ T;  1I07 A;  2MPX C;  4OML A;  1K9M C;  2O01 E;  3LWI A;  3OYJ A;  1M1K C;  4Q5W A;  4JUV A;  3EG2 A;  3CCJ Q;  1PRL C;  1PC0 A;  2I0N A;  3GIB A;  1I1J A;  2A7Y A;  2HD0 A;  4DA4 A;  3ZBD A;  5FU7 B;  1CKB A;  4L6V 5;  5HK0 A;  1HJD A;  1ZA1 B;  2LCL A;  2VXE A;  1VQ5 A;  4QQD A;  1IRE B;  5FWC A;  5IHK A;  1YFN A;  3HKS A;  2XDD A;  3QKJ A;  1IZ6 A;  1GBQ A;  2CGH A;  9ATC B;  2WSC E;  1WHK A;  4HVW A;  3A8O B;  3I56 A;  3CBM A;  2F69 A;  1VQ9 T;  5A0L A;  1GBR A;  4A4E A;  1OPL A;  2R57 A;  4J9E A;  1CSK A;  4M78 B;  3EG0 A;  1SPK A;  3BFM A;  1I8F A;  1GL5 A;  1VQ9 Q;  2COY A;  3HRU A;  1ZSZ B;  5J3B A;  5IXF A;  2OTL T;  3KBG A;  1W2B A;  3BE3 A;  3CCM T;  2E10 A;  1H64 1;  1N27 A;  2YSQ A;  2OTL Q;  1K9M U;  3CCM Q;  4CC7 A;  4LDV A;  3UA7 A;  4FL6 A;  4HXJ A;  1ZHI A;  1NBE B;  2AIR B;  2CH4 A;  4DOV A;  3CME T;  3CCQ A;  3C12 A;  2OTJ T;  1K0X A;  4M77 C;  1QVF A;  4LDX A;  2X4J A;  4PJO G;  1WXB A;  3CC2 A;  3CME Q;  2OTJ Q;  1MV3 A;  4FW2 A;  7AT1 B;  3NTI A;  2CP0 A;  4BE1 A;  4B9X A;  2RJC A;  4M77 A;  2E5K A;  1UGQ B;  5LJ3 g;  2IVW A;  5IH2 A;  1UG1 A;  4C8Q B;  2KI7 A;  3QYG B;  3H0H A;  4IKF A;  2EQJ A;  3CC4 T;  1O75 A;  1KFZ A;  3CCS A;  3V8K A;  4HA8 A;  1K4U S;  4RUG A;  2M9U A;  1YBY A;  5CR2 A;  3JCM W;  4RTV A;  2EBP A;  2K3B A;  2NUP B;  2ZPB B;  1NLP C;  4EDU A;  5FRM A;  2CP2 A;  1VQ8 A;  2E41 A;  3MEU A;  2W0Z A;  3V7C A;  1VIE A;  2EKH A;  2RHY A;  2E1H A;  3EG1 A;  3H0F A;  3VS5 A;  5I2M A;  3RKY A;  1Y71 A;  4O5V A;  3Q1J A;  4M78 D;  2ATC B;  3EG9 B;  1KQ1 A;  3ZEH A;  2HCK A;  4OGC A;  3HRS A;  3GP8 A;  1YJ9 T;  1TG0 A;  2KK4 A;  2CP6 A;  4C5H A;  3SEM A;  2F2V A;  4AMC A;  2RJF A;  3HTR A;  4IIO A;  4YTL A;  3E9G A;  1FYN A;  2KR3 A;  1SSH A;  1YI2 A;  5FWB A;  2KMT A;  3UDC A;  1YJ9 Q;  1VQ4 A;  2HAX A;  2XDB A;  1SRM A;  4KBM B;  1Q7Y C;  2DTO A;  2K3Y A;  1G8X A;  2EYZ A;  1HSQ A;  4M78 G;  2A36 A;  2J7I A;  2QDL A;  1I81 A;  3EHQ A;  1RAA B;  1FMK A;  5IHI A;  2CUB A;  4RG2 A;  2EGC A;  4XTU A;  3M56 A;  2V8I A;  2VUB A;  2YWW A;  2ZPG B;  3WVE B;  2KXD A;  3RER A;  2P0P A;  1EX4 A;  3I5R A;  3IQL A;  3VS6 A;  1X75 C;  4C8Q D;  2ZGW A;  1M8M A;  3GF5 A;  2DE0 X;  1VQN T;  2EAY A;  2RO0 A;  2EJ9 A;  1VQM A;  3SD4 A;  2KDS A;  3QBY A;  3SFM A;  2K4Y A;  3D7S B;  3ULR B;  1VQN Q;  2RPN A;  4ZN1 A;  1IXD A;  5M9O A;  2EYQ A;  2DX1 A;  2DVE A;  5HCK A;  4XK8 E;  4C8Q G;  2P0K A;  2KYB A;  3HL8 A;  1X6B A;  3NFC A;  4OB0 B;  2K5I A;  3FIF A;  1UE9 A;  2GCX A;  3QJY A;  1OYX A;  2JOY A;  1MND A;  2JM8 A;  2L89 A;  1QCO A;  2K5L A;  3G6E T;  5D7U A;  3VS3 A;  3G4S A;  4BDY A;  1VQP A;  2JT4 A;  1T0J A;  3M0S A;  5KYX B;  2DVJ A;  3OW2 S;  3CC7 A;  2ZPH B;  3CCE T;  4DBR A;  3G6E Q;  4J9C A;  1UDL A;  4JJB A;  1YIJ T;  1OOT A;  5KE3 A;  4ORZ A;  2NUT A;  4CI0 C;  2P0Q A;  1K9A A;  3CCE Q;  1PWT A;  1VQ6 A;  2ZCF B;  1N6A A;  2CSQ A;  1YIJ Q;  3I55 T;  3HFN A;  1ACM B;  2QXF A;  1PKT A;  1IO6 A;  1KIK A;  3MP1 A;  2PZ1 A;  1WX6 A;  3I55 Q;  4GBQ A;  3PT9 A;  4HVU A;  4XQ3 A;  3QII A;  3A98 A;  4M7A B;  2BZX A;  3VUZ A;  3M54 A;  2X3X D;  3QUI A;  1D09 B;  2QGF B;  4OMO A;  1IB8 A;  3REA B;  2ROL A;  3ZFJ A;  2RH2 A;  2DBK A;  2O4X A;  5L8R E;  2MMP A;  4FYV B;  3TVT A;  2K5F A;  1PKS A;  1SEM A;  1PM3 A;  2PVD B;  4DBH A;  3I5S A;  1QVG A;  2VC8 A;  3OS5 A;  3VUB A;  4WCI A;  2WSF E;  3QDF A;  2QA4 A;  1VQ7 A;  1M1G A;  5GMK j;  2A0F B;  1RUW A;  3LGL A;  5GJV B;  3UAT A;  2BKD N;  3G7Z A;  4EMK C;  1X6G A;  3I35 A;  2K57 A;  3MET A;  5CAI A;  3H6Z A;  3KXT A;  2G3R A;  3S6W A;  4EMK A;  2K3X A;  1IGU A;  4R55 A;  2JMC A;  3FJP A;  1SHG A;  1UHF A;  1WXT A;  4PFZ A;  2LCC A;  3FEO A;  1V1C A;  2GBQ A;  4AFU C;  1RAB B;  2FPE A;  4HCZ A;  3L42 A;  2QAS A;  3CCJ A;  3NHN A;  2DZ9 A;  1UB4 A;  5D6Y A;  2RM4 A;  3H8Z A;  1TUD A;  3OYG A;  1H3Z A;  2DBM A;  1AWJ A;  3QDR B;  4PJO F;  2KRN A;  3CPW P;  3VKI A;  4D8K A;  1A0N B;  2LP5 A;  3N5B B;  5C0M A;  2CRE A;  1QKX A;  3M0Q A;  3LLR A;  4E7Z A;  1WXU A;  2MOX A;  4M7A D;  2RI2 A;  2ZPI B;  3X28 B;  1YIT Q;  3PNW C;  2KXC A;  2IG0 A;  1X6O A;  4BDZ A;  1BI1 A;  4LE9 A;  4PJL A;  1G2B A;  5CQY A;  1M30 A;  5DLQ E;  1TUC A;  4HT8 A;  2O9S A;  1VQ9 A;  4ZGE B;  4OB2 B;  2GQV A;  1QKW A;  1G83 A;  1EIF A;  2PTK A;  4M75 B;  2QTV A;  4A4K A;  1UJY A;  2V8K A;  4M7A G;  2GTJ A;  1QVG P;  2ENM A;  5GAN 2;  4F7U B;  2OTL A;  3CCM A;  1FXX A;  1X2Q A;  4KUI A;  5KYU A;  3C95 A;  1YP5 A;  3RES A;  1MMA A;  1OV3 A;  2VB6 A;  4L5G A;  1KJW A;  2ESW A;  3DLL A;  3CQT A;  3PIP A;  3JB9 F;  4JJN K;  4JZ3 A;  4DEY A;  4ESR A;  3OY9 A;  4KGV B;  2A08 A;  3OSS C;  2W10 A;  4RTZ A;  3CME A;  2OTJ A;  2M0Y A;  4JPB W;  1W1F A;  5GAN 3;  1WJS A;  4E7L A;  3ME9 A;  5FRN A;  1XOV A;  5GAM g;  2OAU A;  3NTH A;  2HL5 C;  4QVZ A;  3PTA A;  4M78 F;  1BU1 A;  3TEE A;  3SWN B;  4P5N A;  1BYM A;  1Y07 A;  4C0D C;  5GAN 7;  1UUE A;  2YHT A;  3A8G B;  2JMA A;  2QK0 A;  4PNO A;  1QVP A;  3RIR A;  1HK9 A;  4RTW A;  2WSE E;  4LDW A;  1RL2 A;  3JCM J;  4JJC A;  3L2Z A;  1VQ6 T;  1AWW A;  4FT4 A;  4MMK A;  1BI3 A;  1MMN A;  1KQS P;  1W2B S;  1X2K A;  4HVV A;  1DJ7 B;  5KCH A;  2BTT A;  2F5K A;  1XTD A;  4M75 D;  2DO3 A;  3RNJ A;  4C8Q E;  5GAN 8;  2CSI A;  1LVK A;  4C8Q F;  1FMV A;  1YJ9 A;  3PFS A;  4LD6 A;  2RQT A;  4M77 B;  4BI8 B;  2E65 A;  1QVF S;  2DTH A;  2ROT A;  3WVD B;  1M9S A;  1W4S A;  3URG A;  1GXI E;  2ECZ A;  4XTZ A;  2K2M A;  1NM7 A;  4X1V A;  1PNJ A;  1PCX A;  4M75 G;  1IRX A;  4V2S A;  2DIG A;  3OYN A;  5GAN 4;  2DZC A;  5KE2 A;  3EGD A;  2HKQ B;  4F7U G;  1D3B A;  2L3P A;  4KGZ B;  4C0F A;  2CDT A;  2E70 A;  2QI2 A;  4JRQ A;  2A28 A;  3V8L A;  2ABL A;  1N5Z A;  2RK2 A;  4M7D B;  1BI2 A;  3OYA A;  2D1X A;  3DLM A;  3QJ6 A;  2JVV A;  3O8V A;  5EC7 A;  2QTX A;  2GTO A;  4A4G A;  1VQN A;  2KGT A;  3BDU A;  3UT1 A;  2H3E B;  3AT1 B;  2ZPE B;  3JCM b;  4X9D A;  3MP8 A;  4A4H A;  3MCA B;  4E6R A;  1JQQ A;  4NOY A;  2KRM A;  5GAO l;  1H8K A;  3C94 A;  1TSF A;  3UPU A;  3EGX B;  4EPC A;  1I4K 1;  4J5Y A;  4C92 B;  2PQW A;  1ARK A;  3EFO B;  1WQW A;  4BUG A;  2D6F A;  2FPD A;  2QDY B;  2LX9 A;  3EHR A;  1M4Z A;  2RHU A;  4C5E A;  1M1F A;  2ED0 A;  3VRY A;  1Q86 U;  3M55 A;  2KE9 A;  2J05 A;  1KD1 R;  1M2V B;  4WF2 A;  2FO0 A;  3G6E A;  5DM7 R;  2RJE A;  1SG5 A;  4C5I A;  4JS4 A;  2HKN A;  3CCE A;  1AWX A;  1SF9 A;  3QWX X;  2RF0 A;  4PLI A;  1YIJ A;  2FRW A;  4BI3 A;  2D8H A;  3JB9 J;  1MUZ A;  1K76 A;  2CS7 A;  1M90 R;  1Y96 B;  4PKC C;  3JCM X;  3I55 A;  2YRC A;  4AG1 C;  2WAC A;  3FJ5 A;  4PJO D;  3E19 A;  4JS5 A;  2X9H A;  2V26 A;  3CPF A;  4IUU A;  4J7F A;  3REB B;  1UEC A;  2VWF A;  4M7D D;  2M02 A;  3L2R A;  5CCA A;  3MHX A;  1BCO A;  2HBP A;  4LD9 K;  3VS4 A;  5C6S A;  2LT1 A;  2QQR A;  5GMK m;  1TU0 B;  1WLP B;  2DM1 A;  2IIM A;  1PG5 B;  4PL6 A;  2VYT A;  4X9C A;  4XTW A;  1TWB A;  2LT4 A;  1RI0 A;  3NTK A;  2HSE B;  4M7D G;  2HL3 A;  2KQW A;  4C92 D;  2O2O A;  2SEM A;  2LRQ A;  3OYY A;  2ZPF B;  2DER A;  4RCB A;  1ZUU A;  1QW1 A;  3KFV A;  4FSX A;  4M7A E;  4KGX B;  3S3N A;  4XTX A;  2VXF A;  3JB9 D;  1OPK A;  1RAI B;  4M7A F;  2YRV A;  2DJZ A;  4ZTJ A;  5I2S A;  3OYM A;  4IUT A;  1U1S A;  5GMK h;  4MZM A;  3UA6 A;  4C92 G;  2KNB B;  2VVK A;  1BIA A;  3QHS A;  1JEG A;  3VS1 A;  1U8R A;  1UGR B;  2HSP A;  2QAZ A;  1LCK A;  1I0C A;  2MI6 A;  1LJO A;  2RI5 A;  3HP9 A;  2RQW A;  3JCM d;  1N9S A;  5LJ3 d;  3RMS A;  3JB9 G;  4HCB A;  1H92 A;  3A8L B;  4MZT A;  1M27 C;  1JJ2 A;  1NJI U;  2R5M A;  5J39 A;  2ZZD A;  4JJD A;  2XK0 A;  2JW4 A;  1YIT A;  4EMG A;  1OU9 A;  1JO8 A;  2OI3 A;  2DL5 A;  2LNH B;  3FDR A;  5LJ5 d;  2JM9 A;  2PU9 B;  5LJ3 j;  3JCM P;  2C0T A;  3CCL T;  5KYY A;  3OYI A;  1QVG S;  4E7J A;  1AZE A;  3CCL Q;  3I9Q A;  2LNV A;  4JDS A;  1OX9 A;  3CXC A;  1M3A A;  5GAN d;  2H3J A;  5LJ5 j;  3X20 B;  3VRZ A;  4C5G A;  2DL8 A;  4EMK B;  4JRK A;  4BE2 A;  3NMZ C;  2R58 A;  3OB9 A;  4RCC A;  5J26 A;  4F14 A;  1JXO A;  2YT6 A;  2RI3 A;  2MF2 A;  1QP3 A;  5GAN j;  2RQV A;  2RB6 A;  2FYK A;  2PVO B;  3V8J A;  5ECA A;  4QW2 A;  4F16 A;  4J9B A;  4Z88 A;  1KD1 C;  2EQU A;  1XNI A;  4A53 A;  1WDX A;  2CZ0 B;  2EJF A;  1KSW A;  2V1Q A;  3JB9 I;  2BUD A;  3HFO A;  2FVU A;  1QLY A;  1TS9 A;  4M75 E;  4ANJ A;  3PMT A;  3OYD A;  1D1C A;  4D8D A;  4BE0 A;  2CT3 A;  4M75 F;  1BB9 A;  5FU6 B;  3MPU B;  3JAM E;  2KBT A;  4F7U E;  2DD5 A;  3PMI A;  1B7T A;  1IHW A;  4F7U F;  4NL3 A;  2K6D A;  1JJ2 P;  3C4S A;  3FRN A;  4QKU A;  3O5Z A;  4XU0 A;  3RUX A;  3JB9 H;  3X25 B;  4J6X A;  1AT1 B;  1Z9Z A;  2L5Q A;  4E7I A;  1G3T A;  2CP7 A;  4NS5 A;  1K8A R;  1BIB A;  5KYW A;  4LDY A;  1V76 A;  1VYU A;  4FYX B;  2CKK A;  3JRZ A;  4RMO A;  4MDW A;  2FHD A;  4IUQ A;  4ME7 A;  4E2F B;  3CPW A;  1YHQ T;  2FEI A;  2XMF A;  1U1T A;  4E47 A;  1Q82 R;  2F5T X;  1KD1 U;  3CXC P;  4F17 A;  3OYH A;  1YJN T;  5CIU A;  1YHQ Q;  2KT8 A;  4C8Q A;  2QQS A;  2LMJ A;  2DF6 A;  3ER0 A;  8ATC B;  2KVQ G;  3M0P A;  3KUF A;  4HCC A;  3LW5 E;  5CO7 A;  1YJN Q;  5FLX E;  3JCM Q;  3F70 A;  1VQL T;  3JSC A;  2JJ9 A;  2LTO A;  2EGA A;  1M90 U;  4C0G A;  1SHF A;  4BY6 C;  3VJP A;  1FX7 A;  4B6M A;  2NUP A;  4B9W A;  1VQL Q;  2KY9 A;  4AT1 B;  1RAF B;  3L2U A;  2EPD A;  2CUD A;  3HPW A;  2E6Z A;  2FG0 A;  1B34 B;  4XAX B;  4OF1 A;  3INZ A;  2LJ3 A;  3ASK A;  4J6W A;  4CC2 A;  2PUK B;  3UWN A;  3LH0 A;  3EG9 A;  1XQH A;  3M53 A;  5HKC A;  2D0N A;  2GQI A;  2IPO B;  1UGV A;  3A1P A;  3CCU T;  2PUO B;  5CKD A;  4N4G A;  2E4H A;  3RKW A;  2YRD A;  4M77 F;  1KQ2 A;  3S3M A;  2QEX T;  1Q86 R;  3CCU Q;  3CMA T;  3OS0 A;  3TCJ A;  1VIF A;  3A5Z B;  1PSF A;  4GY5 A;  2LQW A;  2QEX Q;  3CMA Q;  1OEB A;  4KH0 B;  3RKX A;  2DXU A;  1NZ9 A;  2A37 A;  4PJO E;  2VV5 A;  3VU3 C;  3OYB A;  2E3H A;  2HQH A;  2KT1 A;  1YIT T;  3LGF A;  2VGN A;  1MGQ A;  4J6Y A;  4M7D E;  1TTH B;  2LC4 A;  1D3B B;  4X34 A;  4M7D F;  1T0H A;  1YWO A;  3VYG A;  3OQ5 A;  1N8R R;  2DEQ A;  5I11 A;  1YJW T;  2YUQ A;  8AT1 B;  1KQS A;  5GMK e;  3JCM c;  3SDZ A;  1OZ3 A;  1RI9 A;  1YJW Q;  1QMC A;  1SRL A;  2DJQ A;  4K11 A;  2XG8 D;  1K73 U;  1G3S A;  4C92 E;  3OMG A;  2HQE A;  3OA6 A;  5CKH A;  3R6N A;  4C92 F;  1I5L A;  3E2U A;  3CCV T;  1QP2 A;  2K2V A;  4OMM A;  1QQJ A;  2EIF A;  2M1H A;  1UFF A;  2DXT A;  1W70 A;  4GLM A;  2X51 A;  3CCV Q;  2BZ8 A;  2YUN A;  3QYH B;  3CD6 T;  3CCR T;  3DB4 A;  3TSW A;  3LWH A;  5I22 A;  4ZTF A;  4IUV A;  5CKE A;  1WFW A;  1ZQ1 A;  2HBW A;  1AOJ A;  1KHI A;  3CD6 Q;  2E6N A;  3OS2 A;  3CCR Q;  4M78 E;  4PJN A;  2FL7 A;  4M7A C;  3QWY A;  5GAO q;  2PVG B;  3J80 E;  1VOM A;  5D6X A;  2L0A A;  2E12 A;  4F04 B;  3M0T A;  4DBF A;  5IT9 E;  5L23 A;  1B07 A;  3V7R A;  3V7S A;  4M7A A;  2CYZ B;  1AEY A;  4PFO A;  4OB3 B;  5A0G A;  2L8D A;  2FRY A;  3QXE B;  1NJI R;  3OS1 A;  3LH5 A;  4RG8 A;  4PK4 A;  3EH1 A;  2DL4 A;  1T3S A;  3FB9 A;  1S72 T;  2LX7 A;  2HQX A;  5GAM d;  4FT2 A;  5IN1 A;  3EG3 A;  1S72 Q;  4PLL A;  3QZ9 B;  1H3H A;  4PJJ A;  1OU8 A;  1FMW A;  3L1A A;  4OB1 B;  2HDA A;  1K1Z A;  2X4W A;  1G3W A;  2MCN A;  4DEX A;  2KRS A;  2LCS A;  2AT1 B;  5GAM j;  1K8A U;  1RLQ C;  1Q95 G;  3OW2 P;  2RMO A;  1X69 A;  2PNI A;  2AK5 A;  2O88 A;  4RTY A;  1TOV A;  3CCL A;  1E6H A;  1KC8 U;  5IXB A;  1Q82 U;  2BZY A;  3HRT A;  4DBQ A;  1VQO T;  2CP5 A;  5KCO A;  3THK A;  1Q86 C;  1WJR A;  3A8M B;  2C0I A;  3OBW A;  1R8O B;  3JCM h;  3L2Q A;  3EFR A;  2CZ6 B;  2H8H A;  2KSS A;  4RTX A;  1D0X A;  1VQO Q;  2DXB A;  4O6J A;  1G5V A;  1HXD A;  2J6K A;  4FIB A;  4JZ4 A;  1NPP A;  2GNC A;  3H9N A;  1ZX6 A;  2NYS A;  2LDM A;  1WHG A;  1M3B A;  2E64 A;  1WI7 A;  1WHL A;  2J6O A;  5IHN A;  5LJ5 h;  4Z02 A;  2DPP B;  1YCS B;  1R0B G;  4QVC A;  1N8R C;  4AFQ C;  2Y4X A;  5GAO m;  4FW1 A;  3P8H A;  1WGS A;  3L2W A;  4JRI A;  4HT9 A;  1Q7Y R;  4E7H A;  2LQK A;  4OMF B;  4J8O A;  4XU1 A;  1JJ2 S;  5GAN h;  3HHT B;  1IHV A;  4CC4 B;  2HNI A;  1OUL A;  1OX8 A;  4M75 A;  2XIC A;  2AZS A;  3MJX A;  2SRC A;  1NYF A;  1WNL A;  1QCN A;  2OJ2 A;  4PJM A;  2GF7 A;  4F7U A;  5GAO n;  2FPF A;  2XID A;  3J7A F;  2FZG B;  3G71 T;  1TXQ A;  2EKO A;  1ABQ A;  1ABO A;  1C6V X;  3NGP A;  2DTI A;  2E3I A;  3L2V A;  4M77 D;  2JXB A;  2GFU A;  3G71 Q;  1U06 A;  2MK5 A;  2G6F X;  5D6W A;  1YWP A;  1WA7 A;  3CXC S;  4L59 A;  3QZ5 B;  3QG1 A;  1SSF A;  5DY9 A;  1NE8 A;  2YLB A;  1RAC B;  2B8A A;  4N0A C;  3QSU A;  4NL2 A;  1X27 A;  4FSS A;  3SWN C;  3GNF B;  4CC3 A;  1NEG A;  1Q81 U;  1YHQ A;  2DL3 A;  1N8R U;  2ZAE A;  4M77 G;  5GAN 6;  2EYY A;  4N0A A;  4DQ2 A;  2RK1 A;  1MMD A;  2CP3 A;  1YJN A;  1XJW B;  1P92 A;  2JTM A;  4MDX A;  1YN8 A;  4GLK A;  3SWN A;  3M57 A;  2O9V A;  2CZ7 B;  4J9I A;  2L2P A;  2FB7 A;  2E5Q A;  1N9R A;  2K9G A;  4J9G A;  1UHC A;  4AFZ C;  2RQU A;  1VQL A;  2RJD A;  2AKK A;  4Y28 E;  2AZV A;  4E7K A;  1CKA A;  4PFP A;  1VYT A;  2HEQ A;  1NJI C;  1YCY A;  1PHT A;  2AHJ B;  4J7I A;  4KT0 E;  2RHI A;  1U5S A;  2RQR A;  3P8D A;  1M1K U;  4FM4 B;  2BIV A;  3RBB B;  2EQI A;  4R0K A;  3JCM f;  3S3O A;  5LJ3 f;  1JBM A;  4IUP A;  2KEA A;  5KYW B;  2NUT B;  5GMK l;  4ATO A;  2V8J A;  1BKB A;  5CK9 A;  3MKD A;  4OMP A;  1BCM A;  3EFS A;  4FYW B;  4JLG A;  3PVL A;  2C0O A;  3CCU A;  3JCM g;  5LJ5 f;  2RHX A;  3J81 E;  3VS2 A;  3MP6 A;  1OZ2 A;  3BDL A;  1WHH A;  5CVI A;  2QEX A;  3CMA A;  2AKL A;  3CPW S;  4PJO C;  4JRP A;  1GCQ C;  2L3S A;  4FU6 A;  1D1B A;  1EZZ B;  1Z9Q A;  4D6W A;  5A2Q E;  2FZK B;  1VQK T;  2F2X A;  4A4F A;  2YLC A;  2QGG A;  5GAN f;  4M7D C;  3M5A A;  2O4X B;  5LJ5 g;  3OYE A;  3GPL A;  3CC4 Q;  4PJO A;  1GCQ A;  2EQM A;  2COW A;  1VQK Q;  1RAH B;  4UC4 A;  3OSV A;  5AT1 B;  1K73 R;  2FZC B;  2DFU A;  2DK3 A;  2DKG A;  2CH4 W;  4M7D A;  4BY6 B;  1WYX A;  3G1J A;  1JU5 C;  3PVQ A;  4OP0 A;  3DKM A;  4N4I A;  2QYZ A;  5HK3 A;  1WZO A;  5GAN g;  2JS2 A;  2XKO C;  4IIM A;  2EYW A;  2EQK A;  2JZ2 A;  1M8V A;  1YJW A;  4QQG A;  4C92 C;  3PGG A;  2Z0W A;  3JCM V;  1BK2 A;  5I21 A;  3OYC A;  2DIL A;  1W2B P;  4LDU A;  3GLX A;  4QQ6 A;  3EGX A;  2F2W A;  1W6X A;  1Y57 A;  1R0C B;  1KK7 A;  1F1B B;  4LN2 A;  5FU7 C;  4C92 A;  3EFO A;  4LXC A;  4KUL A;  2LQN A;  3TRE A;  3CCV A;  1QWF A;  3M9Q A;  3E9F A;  4LUD A;  3P8B B;  2OAW A;  2K79 A;  2MAM A;  1QVF P;  2DET A;  1GRI A;  3OMC A;  1M2V A;  3TU4 K;  4A54 A;  1ZA2 B;  1K0S A;  2XDP A;  4BAC A;  1OI1 A;  2HMA A;  4MML A;  2GFA A;  3E1S A;  4M78 C;  3CD6 A;  3CCR A;  1ZBJ A;  2DYI A;  3M4G A;  1ZSZ C;  3EAE A;  4WTO B;  3C0C A;  5GAO p;  1UGS B;  2M16 A;  4M78 A;  6AT1 B;  3EH2 A;  5GAO r;  3JCM e;  1Y96 A;  2JTE A;  1GFD A;  5LJ3 e;  4RKU E;  4J9F A;  1MNE A;  1ZSZ A;  1RAG B;  1M90 C; 
#chains in the Genus database with same CATH homology
 3GBQ A;  2ED1 A;  5I11 A;  1WXB A;  2ECZ A;  2K2M A;  1NM7 A;  4X1V A;  1PNJ A;  1MV3 A;  2YUQ A;  1B3Q A;  2YUP A;  4KRT A;  2DA9 A;  2E5K A;  3UF4 A;  5IH2 A;  1J3T A;  2L3P A;  1RI9 A;  1UG1 A;  1SRL A;  1T3L A;  2DJQ A;  4K11 A;  4QT7 A;  2CDT A;  2J6F A;  4OMN A;  3H0H A;  2A28 A;  2ABL A;  3R6N A;  1N5Z A;  2P4R A;  1WIE A;  3VS0 A;  1KFZ A;  2D1X A;  4OMM A;  1K4U S;  4RUG A;  1UFF A;  5EC7 A;  4RTV A;  1W70 A;  2EBP A;  2K3B A;  4GLM A;  1NLP C;  2K7A A;  2GTO A;  2KGT A;  1AWO A;  2BZ8 A;  1NG2 A;  2YUN A;  1ZUK A;  2W0Z A;  4E6R A;  1JQQ A;  3PE0 A;  2EKH A;  2KRM A;  2M51 A;  1H8K A;  2DRM A;  3TSZ A;  3EG1 A;  3TSW A;  3H0F A;  3VS5 A;  5I22 A;  1ARK A;  1WFW A;  2HBW A;  1AOJ A;  4Y92 A;  2FPD A;  2HCK A;  3EHR A;  3NPF A;  1TG0 A;  3SEM A;  2F2V A;  2B86 A;  3QWY A;  4IIO A;  4A63 B;  2ED0 A;  1FYN A;  2KR3 A;  1X43 A;  2RNA A;  1SSH A;  3VRY A;  2L0A A;  2KE9 A;  5FWB A;  3M0T A;  2J05 A;  3U23 A;  5L23 A;  1B07 A;  1SRM A;  2DL7 A;  2FO0 A;  2EYZ A;  1HSQ A;  4LUE A;  1AEY A;  2EVR A;  3ZL7 C;  2EW3 A;  1UTI A;  2A36 A;  1AWX A;  2FRY A;  2J7I A;  2QDL A;  3QWX X;  3LH5 A;  2RF0 A;  3EHQ A;  2DL4 A;  2FRW A;  1Y0M A;  1T3S A;  2D8H A;  1FMK A;  5IHI A;  2CUB A;  1MUZ A;  1K76 A;  2EGC A;  2LX7 A;  2JS0 A;  1VA7 A;  2DNU A;  1VYV A;  2VKN A;  1QWE A;  1AVZ C;  3EG3 A;  2KXD A;  1H3H A;  3I5R A;  4AG1 C;  3FJ5 A;  3IQL A;  3VS6 A;  2MIO A;  2X3W D;  1M8M A;  2HDA A;  1K1Z A;  2DE0 X;  2MCN A;  3REB B;  4DEX A;  1UEC A;  2KRS A;  1MV0 B;  2VWF A;  2LCS A;  2DRK A;  1RLQ C;  2RMO A;  1X69 A;  3ULR B;  2PNI A;  2AK5 A;  2RPN A;  3VS4 A;  5FW9 A;  4J9D A;  2O88 A;  4RTY A;  1WLP B;  2DM1 A;  2IIM A;  2DX1 A;  2DYB A;  5HCK A;  1E6H A;  2RN8 A;  5IXB A;  1ZUY A;  2BZY A;  2KYB A;  1X6B A;  3THK A;  1GFC A;  2C0I A;  1UE9 A;  2KYM A;  2O2O A;  4RTX A;  2H8H A;  2SEM A;  2JM8 A;  1ZUU A;  3VS3 A;  2J6K A;  2JT4 A;  4JZ4 A;  1T0J A;  3M0S A;  2GNC A;  3KFV A;  2DVJ A;  1PRM C;  1ZX6 A;  4LNP A;  1OPK A;  4RTU A;  1M3B A;  4J9C A;  1UDL A;  1WI7 A;  4JJB A;  1OOT A;  2J6O A;  4ORZ A;  5IHN A;  1K9A A;  1PWT A;  3UA6 A;  2KNB B;  2VVK A;  2DMO A;  1YCS B;  1JEG A;  1E6G A;  1M3C A;  2CSQ A;  2DLP A;  3VS1 A;  2HSP A;  1LCK A;  4AFQ C;  1QCF A;  1I0C A;  1NYG A;  1PKT A;  2RQW A;  1IO6 A;  1KIK A;  3JV3 A;  1EFN A;  2PZ1 A;  1WX6 A;  2YUO A;  4GBQ A;  1H92 A;  4HVU A;  1M27 C;  3EGU A;  4CC4 B;  3A98 A;  2BZX A;  4RTT A;  4JJD A;  2AZS A;  3H0I A;  2JW4 A;  2SRC A;  1NYF A;  2X3X D;  4AG2 C;  4OMO A;  3REA B;  2ROL A;  1JO8 A;  2OI3 A;  2OJ2 A;  2FPF A;  2DL5 A;  1ZSG A;  1GCP A;  1JXM A;  2LNH B;  2JM9 A;  1BBZ A;  1RLP C;  2DBK A;  1ABQ A;  1ABO A;  2C0T A;  3NGP A;  3TVT A;  2CT4 A;  1PKS A;  1SEM A;  2JXB A;  1U06 A;  2G6F X;  1NLO C;  2YDL A;  3I5S A;  1AZE A;  1YWP A;  1WA7 A;  3I9Q A;  1M3A A;  4WCI A;  1AD5 A;  3VRZ A;  2DL8 A;  1X27 A;  4FSS A;  1RUW A;  3NMZ C;  5GJV B;  3UAT A;  4CC3 A;  1NEG A;  2DL3 A;  1X6G A;  3I35 A;  3SHW A;  2EYY A;  1UJ0 A;  4F14 A;  1ZLM A;  1JXO A;  2YT6 A;  2RQV A;  1YN8 A;  2O9V A;  5ECA A;  4EIK A;  4F16 A;  2NUZ A;  2JMC A;  4J9I A;  2L2P A;  4J9B A;  4ZNX A;  4Z88 A;  1SHG A;  1UHF A;  1WXT A;  2K9G A;  4J9G A;  1UHC A;  1E7O A;  1WDX A;  2LJ1 A;  4AFZ C;  1V1C A;  2RQU A;  2GBQ A;  4AFU C;  1KSW A;  2AKK A;  2FPE A;  2AZV A;  2V1Q A;  1CKA A;  3NHN A;  1VYT A;  2HEQ A;  1TUD A;  1PHT A;  2DBM A;  1AWJ A;  1QLY A;  2KRN A;  4M4Z A;  2EYX A;  1U5S A;  2RQR A;  4D8K A;  1A0N B;  2LJ0 A;  4D8D A;  2CT3 A;  3RBB B;  1BB9 A;  2EGE A;  2EQI A;  4R0K A;  2KBT A;  2LP5 A;  4HCK A;  2NWM A;  3H41 A;  2KEA A;  2CRE A;  1QKX A;  3M0Q A;  1WXU A;  2MOX A;  2KXC A;  2K6D A;  2V1R A;  4OMP A;  1NEB A;  4LE9 A;  4Z89 A;  1G2B A;  2D8J A;  2LZ6 B;  3PVL A;  4J9H A;  1M30 A;  2GGR A;  1TUC A;  2C0O A;  3O5Z A;  2O9S A;  1Z9Z A;  4OMQ A;  3VS2 A;  3M0R A;  1QKW A;  1VYU A;  1G83 A;  2AKL A;  2PTK A;  2J06 A;  1AZG B;  1GCQ C;  5GJW B;  2L3S A;  1UJY A;  2GTJ A;  2O31 A;  1S1N A;  1Z9Q A;  2FEI A;  2KRO A;  2ENM A;  1YNZ A;  2XMF A;  2F2X A;  1HD3 A;  2L3Q A;  1X2Q A;  4F17 A;  3M0U A;  1YP5 A;  1OV3 A;  2KT8 A;  1GCQ A;  1KJW A;  1U3O A;  2ESW A;  2LMJ A;  2DF6 A;  3CQT A;  4JZ3 A;  4Z8A A;  3M0P A;  4DEY A;  4ESR A;  2A08 A;  2CH4 W;  4AFS C;  2W10 A;  4RTZ A;  1WYX A;  2M0Y A;  3VS7 A;  4JPB W;  1JU5 C;  3PVQ A;  1W1F A;  1I07 A;  2EGA A;  2JS2 A;  1SHF A;  4IIM A;  4OML A;  2EYW A;  1XOV A;  2EPD A;  2CUD A;  3EG2 A;  1PRL C;  2FG0 A;  2I0N A;  1I1J A;  1BK2 A;  2DIL A;  1BU1 A;  2F2W A;  1W6X A;  1CKB A;  1HJD A;  2LJ3 A;  1Y57 A;  4CC2 A;  5FWC A;  5IHK A;  1UUE A;  4LN2 A;  2JMA A;  1GBQ A;  2D0N A;  2LQN A;  2GQI A;  1UGV A;  1QWF A;  4HVW A;  4LUD A;  4RTW A;  2OAW A;  2K79 A;  1GBR A;  4JJC A;  1GRI A;  1OPL A;  4J9E A;  1CSK A;  1AWW A;  3EG0 A;  1SPK A;  1GL5 A;  1K0S A;  5IXF A;  1X2K A;  4HVV A;  2LQW A;  1ZBJ A;  1OEB A;  2BTT A;  2A37 A;  3C0C A;  3RNJ A;  2YSQ A;  2CSI A;  4CC7 A;  3UA7 A;  4HXJ A;  2KT1 A;  2JTE A;  1GFD A;  2RQT A;  4J9F A;  2CH4 A;  1K0X A;  2ROT A;  1T0H A;  1YWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...