4HXJA

Crystal structure of sh3:rgt complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
59
structure length
59
Chain Sequence
b'STTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Structural framework of c-Src activation by integrin beta 3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, signaling protein
total genus 13
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2012-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4hxjA00
2EYZA 3TSZA 2DMOA 2HSPA 1FYNA 2LNHB 2HDAA 4X1VA 1YWOA 1MUZA 5FWCA 2PTKA 1ARKA 1VA7A 2C0TA 2MCNA 2RNAA 2V1QA 1AZGB 1PWTA 1W1FA 2X3WD 4J9CA 4M4ZA 1S1NA 2EW3A 3EHQA 4QT7A 2KT8A 3I35A 2ROLA 2EVRA 4Z89A 1QWFA 1Y0MA 5IXBA 4HXJA 1XOVA 2JMCA 2LJ3A 4J9GA 3R6NA 2DJQA 1AVZC 1UDLA 3M0QA 4J9DA 2AKKA 4OMPA 2DL8A 2RMOA 3EG2A 1SHFA 1KSWA 2SEMA 1ZUUA 3U23A 2LQNA 2B86A 5IXFA 2K6DA 2L3SA 1GBQA 1B07A 2M51A 3NGPA 1NEBA 2J06A 2JXBA 1T3SA 2DILA 1JQQA 1ZX6A 1VYUA 2LX7A 3EG3A 1JXMA 2FRWA 1KFZA 2EYXA 2YUOA 2D0NA 2KXCA 4AG1C 4GBQA 4WCIA 2K9GA 3H0FA 2EPDA 1W6XA 1AWJA 2CDTA 2F2XA 5FW9A 1PNJA 1JU5C 2O31A 1T0JA 3LH5A 1X2KA 4E6RA 4CC3A 1RI9A 2L0AA 1PRMC 2DLPA 4CC2A 2P4RA 3NHNA 2RQWA 2V1RA 3ZL7C 2KR3A 2DRKA 4F14A 3NPFA 2BTTA 1UJ0A 1K0SA 3VS6A 2EKHA 3FJ5A 4RTVA 2J7IA 2ED1A 5IHKA 4EIKA 2L3PA 1QLYA 4D8DA 1Z9ZA 2GTJA 1X43A 1CKBA 1YCSB 1X6BA 2XMFA 4JZ3A 1UECA 2DM1A 4RTTA 1OPKA 2YT6A 4D8KA 2FPEA 4AFSC 2KRNA 3JV3A 3EGUA 2KYMA 3I5SA 1OV3A 2BZYA 3PVQA 1G83A 1U5SA 1KJWA 2M0YA 1LCKA 1X6GA 2KE9A 1GCPA 2CSIA 1G2BA 2YUNA 1U3OA 3IQLA 4J9EA 2CT4A 1QWEA 5IHNA 1WXTA 3VS5A 1TG0A 4AFZC 3TSWA 3REBB 2LZ6B 4OMMA 2KNBB 3THKA 1BB9A 2NWMA 3VRZA 2KT1A 5IH2A 5L23A 2ABLA 4RTUA 1ABQA 1AWOA 3KFVA 1YN8A 3VS7A 2ED0A 2KXDA 4JPBW 4JJDA 3VS0A 1M30A 4RTXA 1UE9A 1KIKA 1AWXA 1E6HA 1K9AA 3UATA 3M0RA 1YP5A 4RTZA 1PHTA 4HVUA 1RLPC 2OI3A 1JO8A 3M0SA 3SEMA 2DL5A 2NUZA 4IIMA 2BZ8A 5GJVB 1OPLA 2C0OA 1ZBJA 3VRYA 3H41A 1GFCA 1GRIA 1AOJA 1H92A 1K1ZA 2AZSA 1GL5A 1X2QA 1UHCA 2CUBA 1E6GA 4F16A 1SHGA 1HD3A 4IIOA 4J9IA 3VS2A 2K7AA 1PRLC 2QDLA 4ORZA 3PE0A 1M3CA 1Z9QA 1GFDA 2O2OA 2EYWA 4HVWA 2L2PA 2O88A 4RTYA 2AKLA 2PNIA 2F2WA 1AWWA 2EYYA 2GGRA 1EFNA 1W70A 2VKNA 1NYGA 2I0NA 4Z88A 2YUQA 2RQRA 2MIOA 2YSQA 1JEGA 2VVKA 3A98A 3QWXX 2DL7A 2KROA 1B3QA 4CC4B 2CT3A 2DE0X 2GQIA 1BK2A 2YDLA 3M0TA 2O9SA 1WXBA 3REAB 2FPFA 3TVTA 1NG2A 2RN8A 1K0XA 2JT4A 1X27A 3RBBB 2LMJA 1BBZA 4GLMA 2CSQA 2CH4A 1RUWA 1J3TA 2J6FA 3I5RA 2DL4A 1QCFA 1WA7A 1SEMA 3C0CA 1ZUYA 2IIMA 4R0KA 2RQTA 4LUEA 2DNUA 3H0HA 2J6OA 2A28A 4ESRA 2BZXA 1CKAA 5FWBA 2DBMA 2FPDA 2A37A 4HCKA 1SRMA 4Z8AA 3UF4A 2JMAA 1GCQA 1MV0B 3M0UA 2VWFA 4DEXA 1NLOC 3EG0A 2X3XD 3ULRB 4JJBA 4OMLA 2A36A 1WLPB 4ZNXA 3VS3A 4FSSA 1T3LA 2PZ1A 2D8HA 1M27C 2HBWA 4A63B 1TUCA 2MOXA 2JM9A 4K11A 2CREA 3EG1A 2LCSA 2J6KA 2KBTA 2JS2A 4OMOA 1AEYA 1AD5A 2DBKA 2W10A 2RPNA 1Y57A 1ZUKA 1FMKA 1UTIA 2FRYA 2D1XA 2O9VA 1MV3A 1WDXA 4JJCA 2JTEA 1AZEA 1H8KA 4JZ4A 2W0ZA 3O5ZA 2KYBA 2RQVA 4CC7A 2GBQA 1GCQC 2DF6A 1GBRA 1YNZA 2GNCA 3VS4A 1PKTA 3H0IA 2FO0A 2HCKA 1BU1A 1I0CA 4LE9A 1CSKA 1NYFA 1T0HA 2LQWA 2DL3A 2H8HA 1NM7A 2EQIA 3VS1A 2CUDA 4DEYA 2J05A 1N5ZA 1WX6A 2DVJA 1H3HA 3PVLA 1NEGA 1NLPC 1ABOA 4Y92A 1ZSGA 1WYXA 2C0IA 2K3BA 2G6FX 2SRCA 4OMQA 1UUEA 1HJDA 4KRTA 2D8JA 2L3QA 1UHFA 2JM8A 1ZLMA 2EGEA 2LJ0A 2JS0A 2ESWA 1JXOA 4LNPA 2DA9A 2KEAA 1RLQC 3QWYA 1UG1A 1QKXA 2ROTA 2ECZA 3GBQA 2DX1A 5I11A 1PKSA 1A0NB 1WXUA 3CQTA 1M3BA 2CH4W 2LJ1A 1X69A 1OEBA 4RUGA 3SHWA 5ECAA 4AG2C 2KGTA 1UGVA 2DYBA 2HEQA 4J9BA 1E7OA 3EHRA 1SSHA 4OMNA 2F2VA 5I22A 2K2MA 2FEIA 1V1CA 1U06A 2EGCA 1WIEA 1WI7A 1I07A 4AFQC 1UJYA 2KRSA 4LUDA 4LN2A 1K4US 2EGAA 2FG0A 1QKWA 2GTOA 2OAWA 2RF0A 5EC7A 1UFFA 2OJ2A 2LP5A 3UA7A 2YUPA 2RQUA 3M0PA 5HCKA 4AFUC 1WFWA 4HVVA 3RNJA 4J9HA 2DRMA 1M3AA 1SRLA 4F17A 1TUDA 3I9QA 3NMZC 4RTWA 1M8MA 1VYTA 4J9FA 2E5KA 2JW4A 1OOTA 3UA6A 5GJWB 2A08A 1K76A 2EBPA 1SPKA 1I1JA 2AZVA 5IHIA 2ENMA 2AK5A 1IO6A 2KRMA 1VYVA 2K79A 1YWPA 1HSQA
chains in the Genus database with same CATH superfamily
3WXMB 1UGRB 3TSZA 4ZN1A 2DMOA 5LJ3e 3NTIA 1FYNA 5A0DA 2HDAA 2EQJA 1MUZA 5DLOA 1VQOA 1VQNQ 2PTKA 1ARKA 1VA7A 2C0TA 2RNAA 1YFNA 4M78D 3RERA 3EHQA 1SG5A 1Y0MA 1OULA 5IXBA 2MYSA 2LRQA 5LL6S 1VQPA 1VQ6T 3QZ5B 4DBRA 2FYKA 3L2WA 3RMQA 4M7DD 3M0QA 1YJWT 3PTAA 3LYIA 4OMPA 2RMOA 3EG2A 1NJIC 2SEMA 2MMPA 2HQXA 1ZUUA 3U23A 5IAYA 3QO3A 4FL6A 2L3SA 4BACA 1GBQA 2OTLA 1B07A 1M90R 2KI7A 3EFSA 2NUPA 3QJYA 3SWNA 4OB1B 3CMET 2DILA 1BI1A 3QKJA 4CRIA 5CQYA 2F69A 3G4SA 1XNIA 4NL3A 2EYXA 4ZTFA 2NLUA 1X75C 4F7UB 2CP3A 2RHUA 2X4JA 4OB3B 3CCVA 4AG1C 4WCIA 2O4XA 4EMKB 4M78G 1VQOQ 2F2XA 4XTVA 5FW9A 2K57A 1BCMA 1PNJA 3FDRA 2R58A 3LH5A 4E6RA 3CMAT 2L0AA 3GP8A 1Q7YR 2MAMA 4F7UF 2DLPA 2RI3A 5J26A 3NHNA 4CC2A 3N5BB 2RQWA 1N9RA 2DRKA 4M7DG 1K0SA 1RAEB 3QYGB 3GIBA 3FJ5A 2I2LA 2WSFE 4BUGA 5CKHA 4D8DA 4II1A 2V8KA 1X43A 3M56A 1CKBA 1YCSB 4XTUA 3UDCA 2JTMA 1UECA 2DM1A 4ZGEB 2P4TA 1OPKA 1XJWB 3BW1A 4AFSC 3QXEB 3JV3A 3OS5A 1KQSS 4O6JA 3PVQA 1G83A 2FZKB 1U5SA 3A8HB 2GQVA 1D1BA 4FT2A 4BI8B 4J6WA 5LJ3g 4M7AC 1WHGA 4J7FA 4PJOE 2B8AA 2CSIA 2YUNA 3TEEA 1U3OA 5KYNA 3IQLA 4J9EA 3MHXA 1QWEA 1WHHA 1WXTA 2XDPA 2DZCA 2FZCB 4O5VA 5J3BA 4E2FB 4N4HA 2QYZA 5GAMf 3L1AA 3MKDA 2KNBB 1VQ9A 2CS7A 2QGFB 1EX4A 1TWBA 1ABQA 2R57A 4XTYA 3KFVA 4JRKA 5KYYA 3CPWS 1IRXA 5FU6C 4N4IA 1QCOA 4JPBW 2VC8A 1QVFS 1KIKA 1AWXA 1E6HA 4HT9A 3HRUA 4E7ZA 3M0RA 5GANh 5C6SA 1M5Q1 4KULA 1YJWA 1VUBA 2KVQG 2DL5A 4PJOA 4PLIA 4Q5WA 2DTIA 1HYOA 2IPOB 2EJ9A 2V26A 2WSCE 3F70A 2E64A 3RKYA 4LDXA 1G3SA 1AOJA 3CMEA 4MDXA 1K1ZA 3CCQQ 1X2QA 3GPLA 5FROA 1ZA1B 3CPWA 2COYA 5CKBA 4IIOA 3P8BB 3CCJA 2WACA 4C5HA 1W4SA 1ACMB 1VQ9Q 4DBFA 2VV5A 4B6MA 3WVEB 3OQ5A 2O2OA 2OAUA 1N8RC 2DD4A 4HVWA 1M2OA 4RTYA 2HZYA 2EYYA 4C92E 2GGRA 1C6VX 2RO0A 3H9NA 3O8VA 4Z88A 5KYXB 3ZFJA 2JN0A 1KC8U 1B3QA 3S3NA 5KYWA 2CT3A 1VQMQ 2O9SA 2XDDA 3S6WA 5LJ3d 1TUGB 3I56A 5L8RE 4GLMA 4M7AB 3JCMf 1YIJT 1SEMA 5CQXA 2H3JA 2CZ6B 3CCJQ 4ESRA 3AHUA 2M02A 4M7AF 2DXCA 2X51A 5GAOq 1YHQT 4Z8AA 2QQ9A 3UF4A 1M9SA 5FU6B 2G3RA 1K8AC 5GAMe 3CD6Q 2X3XD 2E65A 4JJBA 3ULRB 1RACB 1MMGA 3L2UA 4F7UE 2D8HA 3LGLA 1JJ2A 3ER0A 2EFIA 2X4XA 4KGZB 4A63B 1TUCA 2M1HA 2LCSA 3DB3A 3X28B 1Q82C 2BIVA 2DIGA 1ZUKA 1FMKA 1UTIA 2FRYA 4ME7A 4Z02A 3VYGA 1ZHIA 1MV3A 3LWIA 2PQWA 3EFRA 1P92A 1UGSB 4LD9K 2CP7A 5D6YA 5KE3A 1H8KA 4E7JA 4JZ4A 4PJNA 1U1SA 4Y28E 4PNOA 1YNZA 3V8LA 2V8JA 1PKTA 3H0IA 9ATCB 2QAZA 3FC3A 1SKUB 2FHDA 1I0CA 4LE9A 1U1TA 2DXUA 1OQKA 2LVMA 2QG9B 5D7UA 4F7UA 1BKBA 1NM7A 5IN1A 3VS1A 4DEYA 4EMKA 4C0ZA 1WX6A 3G71Q 2DVJA 1UGPB 3PVLA 1M1KC 1R0CB 1VOMA 2F1LA 2E4HA 1MGQA 4KT0E 4MZTA 4OMQA 4JRPA 5GAOp 1JB0E 1Q86R 1UHFA 4WTOB 1ZLMA 3EGDA 3OYBA 2JS0A 2ESWA 3VU3C 4MDWA 1Y96B 3QWYA 4PJJA 2EQMA 3AT1B 4A54A 1PKSA 4HKEA 1A0NB 1WXUA 4XU1A 2D6FA 1X69A 3PFSA 5EG2A 4RMOA 1EZZB 1WJSA 1XQHA 3P8HA 3RUXA 2DYBA 2FL7A 3CCEA 1Y07A 1SSHA 2CP6A 3R6OA 1YIJA 4FW2A 3JCMe 1B34A 3E1SA 3M59A 1U06A 1YJ9A 4RKUE 2EGCA 2CYZB 2JTFA 3LLRA 4IUVA 4AFQC 2P0QA 2FG0A 1QKWA 3OYIA 2RQUA 1RL2A 2HSEB 5HCKA 3D7SB 3JB9J 4J9HA 1MNDA 4Y91A 1SRLA 4BY6C 1IHVA 4M77D 3NMZC 1KD1C 3OYFA 5GAMj 1M8MA 3OA6A 3EAEA 1VYTA 1VQ4T 4OGCA 2A08A 1N27A 5A0LA 1SPKA 2LQ8A 1I1JA 2FZGB 5IHIA 2ENMA 1IO6A 2KRMA 2QK0A 2K79A 3UT1A 2LC4A 3CBOA 3DLMA 3CCEQ 2A0FB 2Y4YA 2HSPA 2LNHB 2MPXC 4LDUA 2QQBA 1VQOT 1S1NA 2ZPIB 1YJ9Q 1GXIE 1G8XA 4KGXB 1XOVA 2JMCA 2LJ3A 5GAN8 2DEQA 1VQPT 3JSCA 2DJQA 1AVZC 1UDLA 4RCBA 3A1PA 4DQ2A 4CI0C 2AKKA 2XICA 4M7AE 2X9HA 4M77G 1M4ZA 2ZGWA 1KSWA 4A4HA 2XHCA 2VXEA 3JB9H 2B86A 1TH7A 2BE9B 2DK3A 2JZ2A 2M51A 3BDUA 1NEBA 1VQLA 2OTLT 3JB9F 3CCSA 1OZ2A 2JXBA 1MHNA 1JQQA 2LT4A 1ZX6A 5KYXA 1Q81U 2LX7A 2MI6A 2FRWA 1K73U 5CKDA 2E6NA 1G5VA 4DA4A 1Y7XA 2VXFA 4J7IA 2PVDB 3OBWA 1W6XA 2LDMA 3EFOA 5GAMd 4HCZA 4ANJA 3OYKA 1T0JA 1X2KA 3OYLA 2C06A 3LH0A 2IVWA 4M7AA 3PMTA 1KHCA 5A2QE 3FLGA 2P4RA 5CO7A 3JCMV 2YRVA 1VQNA 2QGGA 2DFUA 2EKHA 4RTVA 4QW2A 2J7IA 2ED1A 3CCMA 2XD0A 1UEBA 5LJ5g 4DOVA 1VQ5Q 1QLYA 2GTJA 3HTRA 4IUQA 3L42A 4BY6B 1KHIA 1I5OB 5DLQE 4VUBA 4RTTA 3L2ZA 5GAMh 3BFMA 2FPEA 1VQLQ 2KRNA 1LOJA 3EGUA 3RKXA 4N4GA 4BE1A 4ZTJA 2HQEA 2RJCA 1OZ3A 1LCKA 4JUVA 1NJIR 3H6ZA 1G2BA 1Q95G 2XIDA 1KG1A 4C0GA 2OTJA 3VS5A 3A8GB 4RG8A 1M8VA 2LZ6B 3P8DA 3THKA 3VRZA 1XTDA 3CPFA 2RK1A 4BDYA 1VQ9T 3OB9A 4C92F 4M75D 2ABLA 2E41A 1BIBA 4FYXB 2GCXA 1RAFB 2CZ1B 2YLCA 4JJDA 3CCMQ 2F5KA 3MEAA 1M30A 3JRZA 3UATA 1YP5A 4C8QD 1VQKA 3HKSA 2QQRA 2QEXA 3C94A 3SEMA 5GANg 2KDSA 1D0XA 3HP9A 5GJVB 4FYWB 2ZAEA 1TSFA 3VRYA 3JCMd 4UC4A 1GRIA 2HAXA 4NL2A 1GL5A 5GAOn 3SB2A 5HK0A 2DD5A 3VV0A 3CC7A 4JS4A 1E6GA 4F16A 3BDLA 2OTJQ 1PC0A 2GFAA 3MJXA 3GF5A 1Y96A 3VS2A 4EMGA 5DY9A 5GMKl 4M75G 2E3IA 3CCJT 1Z9QA 1GFDA 2DZ9A 4PFZA 2K5FA 4E7KA 1M1FA 1ZSZA 2VKNA 2XK0A 4JLGA 3JCMh 4C8QG 2I0NA 3JCMc 3RESA 2JOYA 2KY9A 2MIOA 1VQKQ 2QEXQ 4BB7A 3A98A 3QWXX 3OMGA 5A0GA 4CC4B 2L3RA 3CCLQ 3I55A 2F5TX 2DE0X 2GF7A 1X01A 1RAIB 3REAB 1YJNA 3OYCA 2RN8A 2JNGA 1JRIA 1K0XA 1X27A 3QJ6A 4ZGJB 2ZPEB 4IUUA 4GY5A 1K9MU 5GAN3 2KK4A 4KGVB 3I56T 2CSQA 1J3TA 4FT4A 2J6FA 3I5RA 3VYHB 3CC7Q 2DL4A 3C0CA 2IG0A 4FW1A 1KQ2A 3C95A 2DNUA 2J6OA 2A28A 4IURA 4XU3A 2BZXA 1CKAA 3NFCA 2R5MA 1TTHB 1OX9A 3CCQA 1TU0B 4KH1B 4MMKA 1WQ7A 3ME9A 2HL3A 2VWFA 1NLOC 3EH1A 1OU9A 1D1CA 2A36A 3CCRA 5LJ3j 2VYTA 4AT1B 1M27C 2R5AA 2HQHA 3I55Q 5D6WA 4M78C 3S3OA 5CIUA 3EG1A 1YJNQ 3J7AF 1N8RR 2KBTA 3OBYA 3GLXA 1AD5A 1KQSA 2DBKA 2W10A 2RPNA 1FXXA 2LCLA 5GMKe 2DETA 3HPWA 1WDXA 4JJCA 2JTEA 4LDVA 1YITQ 1AZEA 4M7DC 1VQMA 2A3LA 1QMCA 2W0ZA 2NUTB 2KYBA 2RQVA 4CC7A 2GBQA 1GCQC 3JCMb 2GNCA 3MO8A 4A4FA 2FO0A 3JAME 4C0FA 1RABB 1KC8C 1OI1A 2DL3A 2HD0A 2QXFA 2EQIA 3A8OB 3NTHA 2J05A 1I81A 4J6XA 5CK9A 1QVFA 4BI4A 1AHJB 2Z0WA 1NLPC 3CCRQ 1I8FA 4Y92A 4C0DC 4GLKA 1WYXA 2QTVA 2C0IA 3OSVA 2SRCA 1I4K1 4MZPA 2RJEA 1HJDA 2D8JA 4LD6A 2E12A 3CD6A 1PD1A 2EGEA 1SSFA 2RB6A 1JXOA 2KEAA 1YCYA 1RLQC 3EG9B 1QKXA 2AT1B 1K8AR 3CC2A 3GBQA 2DX1A 1NBEB 2LJ1A 1X6OA 1OEBA 1IGQA 4PJOD 5FU7C 1W2BP 1NE8A 1UGVA 3LGFA 2X35A 4J9BA 3QPHA 3CCET 4JRQA 4DOWA 4E7IA 3OS0A 3TREA 1Q82R 3VUZA 2Y4XA 3MEUA 4FU6A 2V8IA 3TU4K 4C92A 2K4YA 1WI7A 1YJ9T 1UJYA 3A8MB 4LN2A 1K4US 5KYUA 1PCXA 3ZEHA 5EC7A 1UFFA 4QQGA 4QQ6A 2DIQA 3M0PA 3VKIA 5LJ3h 4AFUC 1WFWA 2DKGA 3RNJA 5LJ5f 2D9TA 4M78B 3I9QA 3G71A 4RTWA 3QDFA 2MWOA 3WVDB 2JW4A 1OU8A 2DAQA 1D0YA 4LDWA 4A4GA 3CC2Q 2EBPA 4PJOG 3CMAQ 1M1KR 2AK5A 1F1BB 4C5EA 4M7DB 4M78F 1VYVA 2MK5A 2YWWA 1FMVA 1H3ZA 1H92A 1QVPA 3JB9I 3HRSA 5CKEA 1MMNA 3V8KA 5CCAA 4EMHA 1YWOA 4PFPA 2KSSA 2H3EB 3A8LB 4M7DF 2V1QA 1AZGB 1PWTA 4J9CA 8AT1B 1PSFA 3S3MA 1OX8A 2KT8A 3FJPA 2EVRA 3QIIA 1QWFA 3MP6A 4HXJA 2YXYA 3PIOA 4C5IA 2HBPA 4C0DB 4JRIA 2DL8A 3M54A 1SHFA 3FB9A 5I2MA 2LQNA 5IXFA 2ZPHB 4OB2B 4R55A 4KUDK 3NGPA 2PU9B 3M58A 4FSXA 4DBHA 2LNVA 4L59A 5FLXE 5GANf 1D1AA 1MMDA 2RJDA 1VQLT 1VYUA 3CCST 3EG3A 1KFZA 1D0ZA 5FU7B 3MEWA 2KXCA 3MEVA 4GBQA 4EDUA 1KD1R 2K5LA 3UWNA 2QA4A 4HCBA 2NUPB 2QI2A 1PRMC 5HKCA 4KH0B 5HK3A 2KR3A 2DJZA 4KBMB 4F14A 3HRTA 2DEUA 3VS6A 3TQ7P 3LW5E 4EPCA 1VQNT 5IHKA 4V2SA 2L3PA 3CCMT 1OYXA 4XU2A 4N0AC 1Z9ZA 2O4XB 3M9QA 3QZ9B 2E1HA 1X6BA 2DXBA 4TVRA 2XMFA 1M2VB 3PIPA 2OX7A 2KYMA 2EJGA 1OV3A 1FX7A 2QQSA 4BI3A 5KCHA 1V76A 5LJ5e 2RI2A 2CZ0B 4D6WA 3INZA 5D6XA 3JCMJ 3V7RA 3OYNA 2CT4A 2DYIA 2E5QA 2YRDA 4A53A 1VQ8A 4BDZA 1W2BS 1TG0A 3TSWA 2OTJT 1QW1A 2K3XA 2QA4Q 4OMMA 5I21A 4QVCA 5GAN7 1M1GA 2KT1A 3JCMW 5L23A 2RI5A 4RTUA 1BCOA 1I5LA 1AWOA 1YN8A 1YI2A 2ED0A 4F7UG 2KXDA 1BI0A 1Q81C 5I2SA 3V7SA 1K73C 1K9AA 1N9SA 1VQ7A 3VUBA 1Q86U 1PHTA 4FYVB 2HKNA 1VQKT 2X4WA 2QEXT 2P0PA 3CCUA 2NUZA 3KXTA 4IIMA 2EQKA 4FYYB 1VQ5A 1OPLA 2ZZDA 8ATCB 2C0OA 1ZBJA 1W2BA 3CC4A 3H41A 2AHJB 2RHZA 3M5AA 2K5IA 1WGSA 1BYMA 4MZMA 5GANe 5J39A 1VQ8Q 3OS2A 3JCMX 3CC7T 4J9IA 2K7AA 2E10A 4ORZA 1WHKA 3PE0A 3Q1JA 4QVZA 3VJPA 3RIRA 2BE7D 4M78E 3X25B 3OYMA 2E3HA 1YI2Q 3OYYA 4C5GA 2PNIA 2L5QA 1EFNA 1W70A 2PUOB 3JCMP 1NYGA 1C0MA 3OYGA 1WHJA 4R56A 1TS9A 2DPPB 2LX9A 2M9UA 4M7DE 2XKOC 2RJFA 1VQ7Q 1JEGA 2KROA 3CCUQ 2RHXA 2GQIA 2YDLA 3M0TA 3QDRB 3I55T 2FPFA 1NG2A 5C0MA 2JT4A 4ZN3A 1YJNT 2LMJA 3CC4Q 1BBZA 1RUWA 4M78A 5CVIA 4BE0A 1QCFA 1WA7A 3M55A 2IIMA 1WHLA 2RQTA 4LUEA 3FRNA 2YLBA 4M77C 4OP0A 5LJ5j 3CEYA 5KYWB 3J80E 1S72A 2DBMA 4M7DA 3T9NA 4HT8A 2CGHA 5AYFA 3CCQT 1GCQA 4J83A 1MV0B 4J8OA 3M0UA 4DEXA 3HSBA 2QQAA 4M7AD 4OMLA 3RDVA 1WLPB 1HXDA 3CCRT 3META 1RAHB 2HBWA 2COWA 2YRCA 2MOXA 1QP3A 4FCYA 2RH2A 4IUPA 2J6KA 2HL5C 1AEYA 4BD3A 4WF2A 4X34A 3BE3A 2D1XA 2HKQB 3CCLA 1UGQB 5KH6A 3O5ZA 3QHSA 4A4KA 1VQMT 2EYQA 3VS4A 1LNXA 4LDYA 5GAOl 2HCKA 1S72Q 1RAGB 3X26B 3OY9A 4YTLA 1NYFA 1T0HA 1O9SA 5HY6A 1O75A 4FIBA 5GANj 4XAXB 4M7AG 2CUDA 3PNWC 1N5ZA 3G6EA 1VQ4Q 3QG1A 2K2VA 1ABOA 2DTOA 1K9MC 1EIFA 3J81E 1JJ2P 1FMWA 2ZPBB 3OSSC 2G6FX 3NTKA 5LJ5d 1UUEA 4PK4A 1IHWA 1RADB 2XG8D 1QP2A 1ZQ1A 1MNEA 3GNGA 1MMAA 3OMCA 2LJ0A 3CD6T 4LNPA 4ZGDB 5CKFA 1UG1A 7AT1B 3OS1A 4OVAA 1M3BA 2CH4W 3CC2T 3C4SA 1M2VA 5GAN2 5ECAA 3OW2P 1NJIU 2M0OA 4PLLA 1PSEA 2KGTA 3MPUB 2XI9A 2HEQA 4F04B 2COZA 1E7OA 3EHRA 4M77B 2EQUA 2E70A 1HK9A 2F2VA 5LJ5h 1VQPQ 1YITA 5I22A 1WZOA 4E7LA 3EGDB 4KUIA 1LVKA 1M90C 1WIEA 2WSEE 1I07A 3G6EQ 4M77F 2KRSA 4LUDA 4PKCC 3CBPA 2OAWA 2GTOA 3V7CA 2OTLQ 3DLLA 5GAN4 2P84A 3UA7A 3M57A 3G4SQ 1RI0A 1B34B 1KC8R 1G3YA 2RA2A 3QUIA 4J9FA 3G71T 1WPYA 2BUDA 4QKUA 2E5KA 4M75C 3CCVQ 5GANd 1Q7YC 1OOTA 3UA6A 3QYHB 1WJRA 3DB4A 1M90U 1HSQA 4B9WA 4JDSA 2EWNA 2E6ZA 2EYZA 3ZBDA 4C8QC 2A7YA 3PGGA 4OMFB 3CXCP 3E9GA 4X1VA 3MP1A 5FWCA 3SD4A 2MCNA 3FEOA 1W1FA 1KK7A 2X3WD 4M4ZA 2EW3A 4QT7A 1QVGP 3HFOA 2QASA 3I35A 2ROLA 1VQ6A 4Z89A 2VUBA 1Q7YU 3LX7A 4OF1A 1IGUA 4J9GA 3R6NA 4B9XA 4L6V5 4J6YA 4J9DA 2D0QB 4JLIA 1JBMA 3FIFA 1PG5B 2K6DA 5GAN6 3RKWA 3L2QA 2VGMA 2CZ7B 3X24B 4JJNK 4BE2A 1C1AA 4X9CA 2J06A 1T3SA 4N0AA 2FB7A 1JXMA 2YUOA 2D0NA 4ELZC 1QCNA 1RAAB 5IT9E 2XU8A 3ASKA 2K9GA 1SF9A 3H0FA 3JB9D 2EPDA 1AWJA 2CDTA 3CMAA 3HHTB 1JU5C 2O31A 4QVDA 4CC3A 1D3BB 5AT1B 1RI9A 3EGXB 3JCMQ 2QA4T 2V1RA 3ZL7C 1VQ6Q 3NPFA 1ZBXA 1UJ0A 2BTTA 2LCCA 3OYEA 4ELYC 1YJWQ 3PMIA 5CAIA 3SWNC 4EIKA 2RHYA 3G1JA 4MMLA 3V8JA 2PVOB 1IREB 3EFOB 4IKFA 1R8OB 1VIEA 1JJ2S 4JZ3A 1N8RU 3CMEQ 2YT6A 4D8KA 4M75B 3A5ZB 1DJ7B 3I5SA 2PVGB 2BKDN 2BZYA 3C12A 1Y71A 1BI2A 1KJWA 1ZSZC 3CBMA 3JB9G 2M0YA 1X6GA 2EIFA 4M75F 2KE9A 1GCPA 4C8QB 2AIRB 2RM4A 4E47A 5IHNA 3OW2S 3HL8A 4AFZC 1VQ8T 4E7SA 2VASA 3REBB 1BB9A 2NWMA 2QDYB 2ZPFB 5IH2A 2DO3A 3TCJA 3URGA 4C8QF 5GMKj 4XU0A 2LT1A 3VS7A 2PUKB 3VS0A 1YI2T 2EAYA 4RTXA 1UE9A 2VGNA 2CP0A 1NPRA 3LWHA 1G3WA 4C92D 4RTZA 4OGEA 3I56Q 3QBYA 4LXCA 4HVUA 1RLPC 1IB8A 1VQ7T 2OI3A 1JO8A 3M0SA 3X20B 3M53A 4M77E 3OYJA 3CCUT 2BZ8A 5FRNA 1K8AU 3OW2A 1LPLA 1VQ5T 1YBYA 1GFCA 1AT1B 2CP2A 3CC4T 3M4GA 2AZSA 1PD0A 1UHCA 2CUBA 2HMAA 4L5GA 2ZCFB 1SHGA 3GOXA 1HD3A 3G7ZA 4PJLA 1PRLC 1Q82U 2QDLA 2QTXA 1N6AA 1M3CA 4QQDA 3H8ZA 3CXCS 2EYWA 5GAOr 3E2UA 2L2PA 2O88A 1BI3A 2KAFA 2AKLA 2F2WA 1AWWA 4M77A 3DKMA 1QVGS 4PJOC 3L2VA 4E7HA 4C92G 3SWNB 3OYAA 2CP5A 3MCAB 2YUQA 2RQRA 5GMKi 4NS5A 2YSQA 3SFMA 2VVKA 4XQ3A 3RR6A 2KQWA 2MWPA 2MF2A 2DL7A 2JVVA 4IUTA 1BK2A 5DM7R 1WXBA 4X9DA 2M16A 3TVTA 3RBBB 1M1KU 4P5NA 2RK2A 4DBQA 1ZSZB 2CH4A 1Q81R 1UB4A 3CXCA 1K73R 2XDBA 3PT9A 1ZUYA 4R0KA 1H641 2VB6A 3SDZA 5GAMg 3EH2A 3UPUA 3H0HA 1QVGA 5FWBA 1YHQA 4FM4B 2FPDA 4HCKA 2A37A 4A4EA 1Q86C 1SRMA 1WJQA 4AMCA 4RCCA 1S72T 2JMAA 2EJFA 4PJMA 1D09B 5GMKh 1NPPA 4J5YA 3EG0A 2NUTA 4ZNXA 3VS3A 4FSSA 1T3LA 2PZ1A 3BY7A 5GAOm 2CKKA 1IXDA 1WNLA 2JM9A 4K11A 2CREA 1ZA2B 2JS2A 4OMOA 2RHIA 5LJ3f 4XTXA 1Y57A 4C92C 3M4YA 5GMKm 2DVEA 3GNFB 2O9VA 2EKOA 3E19A 1YIJQ 3HFNA 3CCLT 5FRMA 2LQKA 2RD1A 5KYYB 1KD1U 2DF6A 1GBRA 4XTZA 1TOVA 1YHQQ 1R0BG 4JS5A 1BU1A 1CSKA 1NZ9A 3OYDA 2LQWA 2DERA 2H8HA 3EG9A 4M75E 4OB0B 2KMTA 1WHMA 5KE2A 4XTWA 4PJOB 2P0KA 1H3HA 4ATOA 1NEGA 1IZ6A 3G6ET 1D3BA 3EGXA 1ZSGA 2Y90A 3E9FA 5CR2A 2K3BA 2O01E 1R77A 2ZPGB 4HCCA 2L8DA 4KRTA 2JUFA 4PL6A 1G3TA 4C8QE 2L3QA 2JM8A 4PJOF 3KUFA 1KQSP 2LTOA 3G4ST 3MP8A 2DA9A 3JCMg 2ROTA 2ECZA 3RMSA 1U8RA 3CCVT 5I11A 3CQTA 1V29B 6AT1B 4RUGA 2JJ9A 3SHWA 2FVUA 4AG2C 4XK8E 4M75A 2X4YA 4EMKC 4OMNA 3OYHA 2K2MA 3CPWP 2FEIA 1YITT 1V1CA 4NOYA 2NYSA 2YHTA 1KQ1A 4C8QA 1QVFP 1B7TA 1BIAA 2EGAA 2RF0A 2GFUA 1VIFA 4HA8A 2OJ2A 2LP5A 1WQWA 2YUPA 2DXTA 1QQJA 2K3YA 3CCSQ 2ATCB 5GAN5 3KBGA 4HVVA 2DRMA 1M3AA 1PM3A 4F17A 3QSUA 1TUDA 1VQ4A 5KCOA 1TXQA 2L89A 2HNIA 1LJOA 3L2RA 2DTHA 5GJWB 4C92B 1K76A 4RG2A 1FWZA 5M9OA 2AZVA 4PFOA 5KYUB 1K9MR 1YWPA
chains in the Genus database with same CATH topology
2EYZA 3TSZA 2DMOA 2HSPA 1FYNA 2LNHB 2HDAA 4X1VA 1YWOA 1MUZA 5FWCA 2PTKA 1ARKA 1VA7A 2C0TA 2MCNA 2RNAA 2V1QA 1AZGB 1PWTA 1W1FA 2X3WD 4J9CA 4M4ZA 1S1NA 2EW3A 3EHQA 4QT7A 2KT8A 3I35A 2ROLA 2EVRA 4Z89A 1QWFA 1Y0MA 5IXBA 4HXJA 1XOVA 2JMCA 2LJ3A 4J9GA 3R6NA 2DJQA 1AVZC 1UDLA 3M0QA 4J9DA 2AKKA 4OMPA 2DL8A 2RMOA 3EG2A 1SHFA 1KSWA 2SEMA 1ZUUA 3U23A 2LQNA 2B86A 5IXFA 2K6DA 2L3SA 1GBQA 1B07A 2M51A 3NGPA 1NEBA 2J06A 2JXBA 1T3SA 2DILA 1JQQA 1ZX6A 1VYUA 2LX7A 3EG3A 1JXMA 2FRWA 1KFZA 2EYXA 2YUOA 2D0NA 2KXCA 4AG1C 4GBQA 4WCIA 2K9GA 3H0FA 2EPDA 1W6XA 1AWJA 2CDTA 2F2XA 5FW9A 1PNJA 1JU5C 2O31A 1T0JA 3LH5A 1X2KA 4E6RA 4CC3A 1RI9A 2L0AA 1PRMC 2DLPA 4CC2A 2P4RA 3NHNA 2RQWA 2V1RA 3ZL7C 2KR3A 2DRKA 4F14A 3NPFA 2BTTA 1UJ0A 1K0SA 3VS6A 2EKHA 3FJ5A 4RTVA 2J7IA 2ED1A 5IHKA 4EIKA 2L3PA 1QLYA 4D8DA 1Z9ZA 2GTJA 1X43A 1CKBA 1YCSB 1X6BA 2XMFA 4JZ3A 1UECA 2DM1A 4RTTA 1OPKA 2YT6A 4D8KA 2FPEA 4AFSC 2KRNA 3JV3A 3EGUA 2KYMA 3I5SA 1OV3A 2BZYA 3PVQA 1G83A 1U5SA 1KJWA 2M0YA 1LCKA 1X6GA 2KE9A 1GCPA 2CSIA 1G2BA 2YUNA 1U3OA 3IQLA 4J9EA 2CT4A 1QWEA 5IHNA 1WXTA 3VS5A 1TG0A 4AFZC 3TSWA 3REBB 2LZ6B 4OMMA 2KNBB 3THKA 1BB9A 2NWMA 3VRZA 2KT1A 5IH2A 5L23A 2ABLA 4RTUA 1ABQA 1AWOA 3KFVA 1YN8A 3VS7A 2ED0A 2KXDA 4JPBW 4JJDA 3VS0A 1M30A 4RTXA 1UE9A 1KIKA 1AWXA 1E6HA 1K9AA 3UATA 3M0RA 1YP5A 4RTZA 1PHTA 4HVUA 1RLPC 2OI3A 1JO8A 3M0SA 3SEMA 2DL5A 2NUZA 4IIMA 2BZ8A 5GJVB 1OPLA 2C0OA 1ZBJA 3VRYA 3H41A 1GFCA 1GRIA 1AOJA 1H92A 1K1ZA 2AZSA 1GL5A 1X2QA 1UHCA 2CUBA 1E6GA 4F16A 1SHGA 1HD3A 4IIOA 4J9IA 3VS2A 2K7AA 1PRLC 2QDLA 4ORZA 3PE0A 1M3CA 1Z9QA 1GFDA 2O2OA 2EYWA 4HVWA 2L2PA 2O88A 4RTYA 2AKLA 2PNIA 2F2WA 1AWWA 2EYYA 2GGRA 1EFNA 1W70A 2VKNA 1NYGA 2I0NA 4Z88A 2YUQA 2RQRA 2MIOA 2YSQA 1JEGA 2VVKA 3A98A 3QWXX 2DL7A 2KROA 1B3QA 4CC4B 2CT3A 2DE0X 2GQIA 1BK2A 2YDLA 3M0TA 2O9SA 1WXBA 3REAB 2FPFA 3TVTA 1NG2A 2RN8A 1K0XA 2JT4A 1X27A 3RBBB 2LMJA 1BBZA 4GLMA 2CSQA 2CH4A 1RUWA 1J3TA 2J6FA 3I5RA 2DL4A 1QCFA 1WA7A 1SEMA 3C0CA 1ZUYA 2IIMA 4R0KA 2RQTA 4LUEA 2DNUA 3H0HA 2J6OA 2A28A 4ESRA 2BZXA 1CKAA 5FWBA 2DBMA 2FPDA 2A37A 4HCKA 1SRMA 4Z8AA 3UF4A 2JMAA 1GCQA 1MV0B 3M0UA 2VWFA 4DEXA 1NLOC 3EG0A 2X3XD 3ULRB 4JJBA 4OMLA 2A36A 1WLPB 4ZNXA 3VS3A 4FSSA 1T3LA 2PZ1A 2D8HA 1M27C 2HBWA 4A63B 1TUCA 2MOXA 2JM9A 4K11A 2CREA 3EG1A 2LCSA 2J6KA 2KBTA 2JS2A 4OMOA 1AEYA 1AD5A 2DBKA 2W10A 2RPNA 1Y57A 1ZUKA 1FMKA 1UTIA 2FRYA 2D1XA 2O9VA 1MV3A 1WDXA 4JJCA 2JTEA 1AZEA 1H8KA 4JZ4A 2W0ZA 3O5ZA 2KYBA 2RQVA 4CC7A 2GBQA 1GCQC 2DF6A 1GBRA 1YNZA 2GNCA 3VS4A 1PKTA 3H0IA 2FO0A 2HCKA 1BU1A 1I0CA 4LE9A 1CSKA 1NYFA 1T0HA 2LQWA 2DL3A 2H8HA 1NM7A 2EQIA 3VS1A 2CUDA 4DEYA 2J05A 1N5ZA 1WX6A 2DVJA 1H3HA 3PVLA 1NEGA 1NLPC 1ABOA 4Y92A 1ZSGA 1WYXA 2C0IA 2K3BA 2G6FX 2SRCA 4OMQA 1UUEA 1HJDA 4KRTA 2D8JA 2L3QA 1UHFA 2JM8A 1ZLMA 2EGEA 2LJ0A 2JS0A 2ESWA 1JXOA 4LNPA 2DA9A 2KEAA 1RLQC 3QWYA 1UG1A 1QKXA 2ROTA 2ECZA 3GBQA 2DX1A 5I11A 1PKSA 1A0NB 1WXUA 3CQTA 1M3BA 2CH4W 2LJ1A 1X69A 1OEBA 4RUGA 3SHWA 5ECAA 4AG2C 2KGTA 1UGVA 2DYBA 2HEQA 4J9BA 1E7OA 3EHRA 1SSHA 4OMNA 2F2VA 5I22A 2K2MA 2FEIA 1V1CA 1U06A 2EGCA 1WIEA 1WI7A 1I07A 4AFQC 1UJYA 2KRSA 4LUDA 4LN2A 1K4US 2EGAA 2FG0A 1QKWA 2GTOA 2OAWA 2RF0A 5EC7A 1UFFA 2OJ2A 2LP5A 3UA7A 2YUPA 2RQUA 3M0PA 5HCKA 4AFUC 1WFWA 4HVVA 3RNJA 4J9HA 2DRMA 1M3AA 1SRLA 4F17A 1TUDA 3I9QA 3NMZC 4RTWA 1M8MA 1VYTA 4J9FA 2E5KA 2JW4A 1OOTA 3UA6A 5GJWB 2A08A 1K76A 2EBPA 1SPKA 1I1JA 2AZVA 5IHIA 2ENMA 2AK5A 1IO6A 2KRMA 1VYVA 2K79A 1YWPA 1HSQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYZ A;  3TSZ A;  2DMO A;  2HSP A;  1FYN A;  2LNH B;  2HDA A;  4X1V A;  1YWO A;  1MUZ A;  5FWC A;  2PTK A;  1ARK A;  1VA7 A;  2C0T A;  2MCN A;  2RNA A;  2V1Q A;  1AZG B;  1PWT A;  1W1F A;  2X3W D;  4J9C A;  4M4Z A;  1S1N A;  2EW3 A;  3EHQ A;  4QT7 A;  2KT8 A;  3I35 A;  2ROL A;  2EVR A;  4Z89 A;  1QWF A;  1Y0M A;  5IXB A;  4HXJ A;  1XOV A;  2JMC A;  2LJ3 A;  4J9G A;  3R6N A;  2DJQ A;  1AVZ C;  1UDL A;  3M0Q A;  4J9D A;  2AKK A;  4OMP A;  2DL8 A;  2RMO A;  3EG2 A;  1SHF A;  1KSW A;  2SEM A;  1ZUU A;  3U23 A;  2LQN A;  2B86 A;  5IXF A;  2K6D A;  2L3S A;  1GBQ A;  1B07 A;  2M51 A;  3NGP A;  1NEB A;  2J06 A;  2JXB A;  1T3S A;  2DIL A;  1JQQ A;  1ZX6 A;  1VYU A;  2LX7 A;  3EG3 A;  1JXM A;  2FRW A;  1KFZ A;  2EYX A;  2YUO A;  2D0N A;  2KXC A;  4AG1 C;  4GBQ A;  4WCI A;  2K9G A;  3H0F A;  2EPD A;  1W6X A;  1AWJ A;  2CDT A;  2F2X A;  5FW9 A;  1PNJ A;  1JU5 C;  2O31 A;  1T0J A;  3LH5 A;  1X2K A;  4E6R A;  4CC3 A;  1RI9 A;  2L0A A;  1PRM C;  2DLP A;  4CC2 A;  2P4R A;  3NHN A;  2RQW A;  2V1R A;  3ZL7 C;  2KR3 A;  2DRK A;  4F14 A;  3NPF A;  2BTT A;  1UJ0 A;  1K0S A;  3VS6 A;  2EKH A;  3FJ5 A;  4RTV A;  2J7I A;  2ED1 A;  5IHK A;  4EIK A;  2L3P A;  1QLY A;  4D8D A;  1Z9Z A;  2GTJ A;  1X43 A;  1CKB A;  1YCS B;  1X6B A;  2XMF A;  4JZ3 A;  1UEC A;  2DM1 A;  4RTT A;  1OPK A;  2YT6 A;  4D8K A;  2FPE A;  4AFS C;  2KRN A;  3JV3 A;  3EGU A;  2KYM A;  3I5S A;  1OV3 A;  2BZY A;  3PVQ A;  1G83 A;  1U5S A;  1KJW A;  2M0Y A;  1LCK A;  1X6G A;  2KE9 A;  1GCP A;  2CSI A;  1G2B A;  2YUN A;  1U3O A;  3IQL A;  4J9E A;  2CT4 A;  1QWE A;  5IHN A;  1WXT A;  3VS5 A;  1TG0 A;  4AFZ C;  3TSW A;  3REB B;  2LZ6 B;  4OMM A;  2KNB B;  3THK A;  1BB9 A;  2NWM A;  3VRZ A;  2KT1 A;  5IH2 A;  5L23 A;  2ABL A;  4RTU A;  1ABQ A;  1AWO A;  3KFV A;  1YN8 A;  3VS7 A;  2ED0 A;  2KXD A;  4JPB W;  4JJD A;  3VS0 A;  1M30 A;  4RTX A;  1UE9 A;  1KIK A;  1AWX A;  1E6H A;  1K9A A;  3UAT A;  3M0R A;  1YP5 A;  4RTZ A;  1PHT A;  4HVU A;  1RLP C;  2OI3 A;  1JO8 A;  3M0S A;  3SEM A;  2DL5 A;  2NUZ A;  4IIM A;  2BZ8 A;  5GJV B;  1OPL A;  2C0O A;  1ZBJ A;  3VRY A;  3H41 A;  1GFC A;  1GRI A;  1AOJ A;  1H92 A;  1K1Z A;  2AZS A;  1GL5 A;  1X2Q A;  1UHC A;  2CUB A;  1E6G A;  4F16 A;  1SHG A;  1HD3 A;  4IIO A;  4J9I A;  3VS2 A;  2K7A A;  1PRL C;  2QDL A;  4ORZ A;  3PE0 A;  1M3C A;  1Z9Q A;  1GFD A;  2O2O A;  2EYW A;  4HVW A;  2L2P A;  2O88 A;  4RTY A;  2AKL A;  2PNI A;  2F2W A;  1AWW A;  2EYY A;  2GGR A;  1EFN A;  1W70 A;  2VKN A;  1NYG A;  2I0N A;  4Z88 A;  2YUQ A;  2RQR A;  2MIO A;  2YSQ A;  1JEG A;  2VVK A;  3A98 A;  3QWX X;  2DL7 A;  2KRO A;  1B3Q A;  4CC4 B;  2CT3 A;  2DE0 X;  2GQI A;  1BK2 A;  2YDL A;  3M0T A;  2O9S A;  1WXB A;  3REA B;  2FPF A;  3TVT A;  1NG2 A;  2RN8 A;  1K0X A;  2JT4 A;  1X27 A;  3RBB B;  2LMJ A;  1BBZ A;  4GLM A;  2CSQ A;  2CH4 A;  1RUW A;  1J3T A;  2J6F A;  3I5R A;  2DL4 A;  1QCF A;  1WA7 A;  1SEM A;  3C0C A;  1ZUY A;  2IIM A;  4R0K A;  2RQT A;  4LUE A;  2DNU A;  3H0H A;  2J6O A;  2A28 A;  4ESR A;  2BZX A;  1CKA A;  5FWB A;  2DBM A;  2FPD A;  2A37 A;  4HCK A;  1SRM A;  4Z8A A;  3UF4 A;  2JMA A;  1GCQ A;  1MV0 B;  3M0U A;  2VWF A;  4DEX A;  1NLO C;  3EG0 A;  2X3X D;  3ULR B;  4JJB A;  4OML A;  2A36 A;  1WLP B;  4ZNX A;  3VS3 A;  4FSS A;  1T3L A;  2PZ1 A;  2D8H A;  1M27 C;  2HBW A;  4A63 B;  1TUC A;  2MOX A;  2JM9 A;  4K11 A;  2CRE A;  3EG1 A;  2LCS A;  2J6K A;  2KBT A;  2JS2 A;  4OMO A;  1AEY A;  1AD5 A;  2DBK A;  2W10 A;  2RPN A;  1Y57 A;  1ZUK A;  1FMK A;  1UTI A;  2FRY A;  2D1X A;  2O9V A;  1MV3 A;  1WDX A;  4JJC A;  2JTE A;  1AZE A;  1H8K A;  4JZ4 A;  2W0Z A;  3O5Z A;  2KYB A;  2RQV A;  4CC7 A;  2GBQ A;  1GCQ C;  2DF6 A;  1GBR A;  1YNZ A;  2GNC A;  3VS4 A;  1PKT A;  3H0I A;  2FO0 A;  2HCK A;  1BU1 A;  1I0C A;  4LE9 A;  1CSK A;  1NYF A;  1T0H A;  2LQW A;  2DL3 A;  2H8H A;  1NM7 A;  2EQI A;  3VS1 A;  2CUD A;  4DEY A;  2J05 A;  1N5Z A;  1WX6 A;  2DVJ A;  1H3H A;  3PVL A;  1NEG A;  1NLP C;  1ABO A;  4Y92 A;  1ZSG A;  1WYX A;  2C0I A;  2K3B A;  2G6F X;  2SRC A;  4OMQ A;  1UUE A;  1HJD A;  4KRT A;  2D8J A;  2L3Q A;  1UHF A;  2JM8 A;  1ZLM A;  2EGE A;  2LJ0 A;  2JS0 A;  2ESW A;  1JXO A;  4LNP A;  2DA9 A;  2KEA A;  1RLQ C;  3QWY A;  1UG1 A;  1QKX A;  2ROT A;  2ECZ A;  3GBQ A;  2DX1 A;  5I11 A;  1PKS A;  1A0N B;  1WXU A;  3CQT A;  1M3B A;  2CH4 W;  2LJ1 A;  1X69 A;  1OEB A;  4RUG A;  3SHW A;  5ECA A;  4AG2 C;  2KGT A;  1UGV A;  2DYB A;  2HEQ A;  4J9B A;  1E7O A;  3EHR A;  1SSH A;  4OMN A;  2F2V A;  5I22 A;  2K2M A;  2FEI A;  1V1C A;  1U06 A;  2EGC A;  1WIE A;  1WI7 A;  1I07 A;  4AFQ C;  1UJY A;  2KRS A;  4LUD A;  4LN2 A;  1K4U S;  2EGA A;  2FG0 A;  1QKW A;  2GTO A;  2OAW A;  2RF0 A;  5EC7 A;  1UFF A;  2OJ2 A;  2LP5 A;  3UA7 A;  2YUP A;  2RQU A;  3M0P A;  5HCK A;  4AFU C;  1WFW A;  4HVV A;  3RNJ A;  4J9H A;  2DRM A;  1M3A A;  1SRL A;  4F17 A;  1TUD A;  3I9Q A;  3NMZ C;  4RTW A;  1M8M A;  1VYT A;  4J9F A;  2E5K A;  2JW4 A;  1OOT A;  3UA6 A;  5GJW B;  2A08 A;  1K76 A;  2EBP A;  1SPK A;  1I1J A;  2AZV A;  5IHI A;  2ENM A;  2AK5 A;  1IO6 A;  2KRM A;  1VYV A;  2K79 A;  1YWP A;  1HSQ A; 
#chains in the Genus database with same CATH topology
 3WXM B;  1UGR B;  3TSZ A;  4ZN1 A;  2DMO A;  5LJ3 e;  3NTI A;  1FYN A;  5A0D A;  2HDA A;  2EQJ A;  1MUZ A;  5DLO A;  1VQO A;  1VQN Q;  2PTK A;  1ARK A;  1VA7 A;  2C0T A;  2RNA A;  1YFN A;  4M78 D;  3RER A;  3EHQ A;  1SG5 A;  1Y0M A;  1OUL A;  5IXB A;  2MYS A;  2LRQ A;  5LL6 S;  1VQP A;  1VQ6 T;  3QZ5 B;  4DBR A;  2FYK A;  3L2W A;  3RMQ A;  4M7D D;  3M0Q A;  1YJW T;  3PTA A;  3LYI A;  4OMP A;  2RMO A;  3EG2 A;  1NJI C;  2SEM A;  2MMP A;  2HQX A;  1ZUU A;  3U23 A;  5IAY A;  3QO3 A;  4FL6 A;  2L3S A;  4BAC A;  1GBQ A;  2OTL A;  1B07 A;  1M90 R;  2KI7 A;  3EFS A;  2NUP A;  3QJY A;  3SWN A;  4OB1 B;  3CME T;  2DIL A;  1BI1 A;  3QKJ A;  4CRI A;  5CQY A;  2F69 A;  3G4S A;  1XNI A;  4NL3 A;  2EYX A;  4ZTF A;  2NLU A;  1X75 C;  4F7U B;  2CP3 A;  2RHU A;  2X4J A;  4OB3 B;  3CCV A;  4AG1 C;  4WCI A;  2O4X A;  4EMK B;  4M78 G;  1VQO Q;  2F2X A;  4XTV A;  5FW9 A;  2K57 A;  1BCM A;  1PNJ A;  3FDR A;  2R58 A;  3LH5 A;  4E6R A;  3CMA T;  2L0A A;  3GP8 A;  1Q7Y R;  2MAM A;  4F7U F;  2DLP A;  2RI3 A;  5J26 A;  3NHN A;  4CC2 A;  3N5B B;  2RQW A;  1N9R A;  2DRK A;  4M7D G;  1K0S A;  1RAE B;  3QYG B;  3GIB A;  3FJ5 A;  2I2L A;  2WSF E;  4BUG A;  5CKH A;  4D8D A;  4II1 A;  2V8K A;  1X43 A;  3M56 A;  1CKB A;  1YCS B;  4XTU A;  3UDC A;  2JTM A;  1UEC A;  2DM1 A;  4ZGE B;  2P4T A;  1OPK A;  1XJW B;  3BW1 A;  4AFS C;  3QXE B;  3JV3 A;  3OS5 A;  1KQS S;  4O6J A;  3PVQ A;  1G83 A;  2FZK B;  1U5S A;  3A8H B;  2GQV A;  1D1B A;  4FT2 A;  4BI8 B;  4J6W A;  5LJ3 g;  4M7A C;  1WHG A;  4J7F A;  4PJO E;  2B8A A;  2CSI A;  2YUN A;  3TEE A;  1U3O A;  5KYN A;  3IQL A;  4J9E A;  3MHX A;  1QWE A;  1WHH A;  1WXT A;  2XDP A;  2DZC A;  2FZC B;  4O5V A;  5J3B A;  4E2F B;  4N4H A;  2QYZ A;  5GAM f;  3L1A A;  3MKD A;  2KNB B;  1VQ9 A;  2CS7 A;  2QGF B;  1EX4 A;  1TWB A;  1ABQ A;  2R57 A;  4XTY A;  3KFV A;  4JRK A;  5KYY A;  3CPW S;  1IRX A;  5FU6 C;  4N4I A;  1QCO A;  4JPB W;  2VC8 A;  1QVF S;  1KIK A;  1AWX A;  1E6H A;  4HT9 A;  3HRU A;  4E7Z A;  3M0R A;  5GAN h;  5C6S A;  1M5Q 1;  4KUL A;  1YJW A;  1VUB A;  2KVQ G;  2DL5 A;  4PJO A;  4PLI A;  4Q5W A;  2DTI A;  1HYO A;  2IPO B;  2EJ9 A;  2V26 A;  2WSC E;  3F70 A;  2E64 A;  3RKY A;  4LDX A;  1G3S A;  1AOJ A;  3CME A;  4MDX A;  1K1Z A;  3CCQ Q;  1X2Q A;  3GPL A;  5FRO A;  1ZA1 B;  3CPW A;  2COY A;  5CKB A;  4IIO A;  3P8B B;  3CCJ A;  2WAC A;  4C5H A;  1W4S A;  1ACM B;  1VQ9 Q;  4DBF A;  2VV5 A;  4B6M A;  3WVE B;  3OQ5 A;  2O2O A;  2OAU A;  1N8R C;  2DD4 A;  4HVW A;  1M2O A;  4RTY A;  2HZY A;  2EYY A;  4C92 E;  2GGR A;  1C6V X;  2RO0 A;  3H9N A;  3O8V A;  4Z88 A;  5KYX B;  3ZFJ A;  2JN0 A;  1KC8 U;  1B3Q A;  3S3N A;  5KYW A;  2CT3 A;  1VQM Q;  2O9S A;  2XDD A;  3S6W A;  5LJ3 d;  1TUG B;  3I56 A;  5L8R E;  4GLM A;  4M7A B;  3JCM f;  1YIJ T;  1SEM A;  5CQX A;  2H3J A;  2CZ6 B;  3CCJ Q;  4ESR A;  3AHU A;  2M02 A;  4M7A F;  2DXC A;  2X51 A;  5GAO q;  1YHQ T;  4Z8A A;  2QQ9 A;  3UF4 A;  1M9S A;  5FU6 B;  2G3R A;  1K8A C;  5GAM e;  3CD6 Q;  2X3X D;  2E65 A;  4JJB A;  3ULR B;  1RAC B;  1MMG A;  3L2U A;  4F7U E;  2D8H A;  3LGL A;  1JJ2 A;  3ER0 A;  2EFI A;  2X4X A;  4KGZ B;  4A63 B;  1TUC A;  2M1H A;  2LCS A;  3DB3 A;  3X28 B;  1Q82 C;  2BIV A;  2DIG A;  1ZUK A;  1FMK A;  1UTI A;  2FRY A;  4ME7 A;  4Z02 A;  3VYG A;  1ZHI A;  1MV3 A;  3LWI A;  2PQW A;  3EFR A;  1P92 A;  1UGS B;  4LD9 K;  2CP7 A;  5D6Y A;  5KE3 A;  1H8K A;  4E7J A;  4JZ4 A;  4PJN A;  1U1S A;  4Y28 E;  4PNO A;  1YNZ A;  3V8L A;  2V8J A;  1PKT A;  3H0I A;  9ATC B;  2QAZ A;  3FC3 A;  1SKU B;  2FHD A;  1I0C A;  4LE9 A;  1U1T A;  2DXU A;  1OQK A;  2LVM A;  2QG9 B;  5D7U A;  4F7U A;  1BKB A;  1NM7 A;  5IN1 A;  3VS1 A;  4DEY A;  4EMK A;  4C0Z A;  1WX6 A;  3G71 Q;  2DVJ A;  1UGP B;  3PVL A;  1M1K C;  1R0C B;  1VOM A;  2F1L A;  2E4H A;  1MGQ A;  4KT0 E;  4MZT A;  4OMQ A;  4JRP A;  5GAO p;  1JB0 E;  1Q86 R;  1UHF A;  4WTO B;  1ZLM A;  3EGD A;  3OYB A;  2JS0 A;  2ESW A;  3VU3 C;  4MDW A;  1Y96 B;  3QWY A;  4PJJ A;  2EQM A;  3AT1 B;  4A54 A;  1PKS A;  4HKE A;  1A0N B;  1WXU A;  4XU1 A;  2D6F A;  1X69 A;  3PFS A;  5EG2 A;  4RMO A;  1EZZ B;  1WJS A;  1XQH A;  3P8H A;  3RUX A;  2DYB A;  2FL7 A;  3CCE A;  1Y07 A;  1SSH A;  2CP6 A;  3R6O A;  1YIJ A;  4FW2 A;  3JCM e;  1B34 A;  3E1S A;  3M59 A;  1U06 A;  1YJ9 A;  4RKU E;  2EGC A;  2CYZ B;  2JTF A;  3LLR A;  4IUV A;  4AFQ C;  2P0Q A;  2FG0 A;  1QKW A;  3OYI A;  2RQU A;  1RL2 A;  2HSE B;  5HCK A;  3D7S B;  3JB9 J;  4J9H A;  1MND A;  4Y91 A;  1SRL A;  4BY6 C;  1IHV A;  4M77 D;  3NMZ C;  1KD1 C;  3OYF A;  5GAM j;  1M8M A;  3OA6 A;  3EAE A;  1VYT A;  1VQ4 T;  4OGC A;  2A08 A;  1N27 A;  5A0L A;  1SPK A;  2LQ8 A;  1I1J A;  2FZG B;  5IHI A;  2ENM A;  1IO6 A;  2KRM A;  2QK0 A;  2K79 A;  3UT1 A;  2LC4 A;  3CBO A;  3DLM A;  3CCE Q;  2A0F B;  2Y4Y A;  2HSP A;  2LNH B;  2MPX C;  4LDU A;  2QQB A;  1VQO T;  1S1N A;  2ZPI B;  1YJ9 Q;  1GXI E;  1G8X A;  4KGX B;  1XOV A;  2JMC A;  2LJ3 A;  5GAN 8;  2DEQ A;  1VQP T;  3JSC A;  2DJQ A;  1AVZ C;  1UDL A;  4RCB A;  3A1P A;  4DQ2 A;  4CI0 C;  2AKK A;  2XIC A;  4M7A E;  2X9H A;  4M77 G;  1M4Z A;  2ZGW A;  1KSW A;  4A4H A;  2XHC A;  2VXE A;  3JB9 H;  2B86 A;  1TH7 A;  2BE9 B;  2DK3 A;  2JZ2 A;  2M51 A;  3BDU A;  1NEB A;  1VQL A;  2OTL T;  3JB9 F;  3CCS A;  1OZ2 A;  2JXB A;  1MHN A;  1JQQ A;  2LT4 A;  1ZX6 A;  5KYX A;  1Q81 U;  2LX7 A;  2MI6 A;  2FRW A;  1K73 U;  5CKD A;  2E6N A;  1G5V A;  4DA4 A;  1Y7X A;  2VXF A;  4J7I A;  2PVD B;  3OBW A;  1W6X A;  2LDM A;  3EFO A;  5GAM d;  4HCZ A;  4ANJ A;  3OYK A;  1T0J A;  1X2K A;  3OYL A;  2C06 A;  3LH0 A;  2IVW A;  4M7A A;  3PMT A;  1KHC A;  5A2Q E;  3FLG A;  2P4R A;  5CO7 A;  3JCM V;  2YRV A;  1VQN A;  2QGG A;  2DFU A;  2EKH A;  4RTV A;  4QW2 A;  2J7I A;  2ED1 A;  3CCM A;  2XD0 A;  1UEB A;  5LJ5 g;  4DOV A;  1VQ5 Q;  1QLY A;  2GTJ A;  3HTR A;  4IUQ A;  3L42 A;  4BY6 B;  1KHI A;  1I5O B;  5DLQ E;  4VUB A;  4RTT A;  3L2Z A;  5GAM h;  3BFM A;  2FPE A;  1VQL Q;  2KRN A;  1LOJ A;  3EGU A;  3RKX A;  4N4G A;  4BE1 A;  4ZTJ A;  2HQE A;  2RJC A;  1OZ3 A;  1LCK A;  4JUV A;  1NJI R;  3H6Z A;  1G2B A;  1Q95 G;  2XID A;  1KG1 A;  4C0G A;  2OTJ A;  3VS5 A;  3A8G B;  4RG8 A;  1M8V A;  2LZ6 B;  3P8D A;  3THK A;  3VRZ A;  1XTD A;  3CPF A;  2RK1 A;  4BDY A;  1VQ9 T;  3OB9 A;  4C92 F;  4M75 D;  2ABL A;  2E41 A;  1BIB A;  4FYX B;  2GCX A;  1RAF B;  2CZ1 B;  2YLC A;  4JJD A;  3CCM Q;  2F5K A;  3MEA A;  1M30 A;  3JRZ A;  3UAT A;  1YP5 A;  4C8Q D;  1VQK A;  3HKS A;  2QQR A;  2QEX A;  3C94 A;  3SEM A;  5GAN g;  2KDS A;  1D0X A;  3HP9 A;  5GJV B;  4FYW B;  2ZAE A;  1TSF A;  3VRY A;  3JCM d;  4UC4 A;  1GRI A;  2HAX A;  4NL2 A;  1GL5 A;  5GAO n;  3SB2 A;  5HK0 A;  2DD5 A;  3VV0 A;  3CC7 A;  4JS4 A;  1E6G A;  4F16 A;  3BDL A;  2OTJ Q;  1PC0 A;  2GFA A;  3MJX A;  3GF5 A;  1Y96 A;  3VS2 A;  4EMG A;  5DY9 A;  5GMK l;  4M75 G;  2E3I A;  3CCJ T;  1Z9Q A;  1GFD A;  2DZ9 A;  4PFZ A;  2K5F A;  4E7K A;  1M1F A;  1ZSZ A;  2VKN A;  2XK0 A;  4JLG A;  3JCM h;  4C8Q G;  2I0N A;  3JCM c;  3RES A;  2JOY A;  2KY9 A;  2MIO A;  1VQK Q;  2QEX Q;  4BB7 A;  3A98 A;  3QWX X;  3OMG A;  5A0G A;  4CC4 B;  2L3R A;  3CCL Q;  3I55 A;  2F5T X;  2DE0 X;  2GF7 A;  1X01 A;  1RAI B;  3REA B;  1YJN A;  3OYC A;  2RN8 A;  2JNG A;  1JRI A;  1K0X A;  1X27 A;  3QJ6 A;  4ZGJ B;  2ZPE B;  4IUU A;  4GY5 A;  1K9M U;  5GAN 3;  2KK4 A;  4KGV B;  3I56 T;  2CSQ A;  1J3T A;  4FT4 A;  2J6F A;  3I5R A;  3VYH B;  3CC7 Q;  2DL4 A;  3C0C A;  2IG0 A;  4FW1 A;  1KQ2 A;  3C95 A;  2DNU A;  2J6O A;  2A28 A;  4IUR A;  4XU3 A;  2BZX A;  1CKA A;  3NFC A;  2R5M A;  1TTH B;  1OX9 A;  3CCQ A;  1TU0 B;  4KH1 B;  4MMK A;  1WQ7 A;  3ME9 A;  2HL3 A;  2VWF A;  1NLO C;  3EH1 A;  1OU9 A;  1D1C A;  2A36 A;  3CCR A;  5LJ3 j;  2VYT A;  4AT1 B;  1M27 C;  2R5A A;  2HQH A;  3I55 Q;  5D6W A;  4M78 C;  3S3O A;  5CIU A;  3EG1 A;  1YJN Q;  3J7A F;  1N8R R;  2KBT A;  3OBY A;  3GLX A;  1AD5 A;  1KQS A;  2DBK A;  2W10 A;  2RPN A;  1FXX A;  2LCL A;  5GMK e;  2DET A;  3HPW A;  1WDX A;  4JJC A;  2JTE A;  4LDV A;  1YIT Q;  1AZE A;  4M7D C;  1VQM A;  2A3L A;  1QMC A;  2W0Z A;  2NUT B;  2KYB A;  2RQV A;  4CC7 A;  2GBQ A;  1GCQ C;  3JCM b;  2GNC A;  3MO8 A;  4A4F A;  2FO0 A;  3JAM E;  4C0F A;  1RAB B;  1KC8 C;  1OI1 A;  2DL3 A;  2HD0 A;  2QXF A;  2EQI A;  3A8O B;  3NTH A;  2J05 A;  1I81 A;  4J6X A;  5CK9 A;  1QVF A;  4BI4 A;  1AHJ B;  2Z0W A;  1NLP C;  3CCR Q;  1I8F A;  4Y92 A;  4C0D C;  4GLK A;  1WYX A;  2QTV A;  2C0I A;  3OSV A;  2SRC A;  1I4K 1;  4MZP A;  2RJE A;  1HJD A;  2D8J A;  4LD6 A;  2E12 A;  3CD6 A;  1PD1 A;  2EGE A;  1SSF A;  2RB6 A;  1JXO A;  2KEA A;  1YCY A;  1RLQ C;  3EG9 B;  1QKX A;  2AT1 B;  1K8A R;  3CC2 A;  3GBQ A;  2DX1 A;  1NBE B;  2LJ1 A;  1X6O A;  1OEB A;  1IGQ A;  4PJO D;  5FU7 C;  1W2B P;  1NE8 A;  1UGV A;  3LGF A;  2X35 A;  4J9B A;  3QPH A;  3CCE T;  4JRQ A;  4DOW A;  4E7I A;  3OS0 A;  3TRE A;  1Q82 R;  3VUZ A;  2Y4X A;  3MEU A;  4FU6 A;  2V8I A;  3TU4 K;  4C92 A;  2K4Y A;  1WI7 A;  1YJ9 T;  1UJY A;  3A8M B;  4LN2 A;  1K4U S;  5KYU A;  1PCX A;  3ZEH A;  5EC7 A;  1UFF A;  4QQG A;  4QQ6 A;  2DIQ A;  3M0P A;  3VKI A;  5LJ3 h;  4AFU C;  1WFW A;  2DKG A;  3RNJ A;  5LJ5 f;  2D9T A;  4M78 B;  3I9Q A;  3G71 A;  4RTW A;  3QDF A;  2MWO A;  3WVD B;  2JW4 A;  1OU8 A;  2DAQ A;  1D0Y A;  4LDW A;  4A4G A;  3CC2 Q;  2EBP A;  4PJO G;  3CMA Q;  1M1K R;  2AK5 A;  1F1B B;  4C5E A;  4M7D B;  4M78 F;  1VYV A;  2MK5 A;  2YWW A;  1FMV A;  1H3Z A;  1H92 A;  1QVP A;  3JB9 I;  3HRS A;  5CKE A;  1MMN A;  3V8K A;  5CCA A;  4EMH A;  1YWO A;  4PFP A;  2KSS A;  2H3E B;  3A8L B;  4M7D F;  2V1Q A;  1AZG B;  1PWT A;  4J9C A;  8AT1 B;  1PSF A;  3S3M A;  1OX8 A;  2KT8 A;  3FJP A;  2EVR A;  3QII A;  1QWF A;  3MP6 A;  4HXJ A;  2YXY A;  3PIO A;  4C5I A;  2HBP A;  4C0D B;  4JRI A;  2DL8 A;  3M54 A;  1SHF A;  3FB9 A;  5I2M A;  2LQN A;  5IXF A;  2ZPH B;  4OB2 B;  4R55 A;  4KUD K;  3NGP A;  2PU9 B;  3M58 A;  4FSX A;  4DBH A;  2LNV A;  4L59 A;  5FLX E;  5GAN f;  1D1A A;  1MMD A;  2RJD A;  1VQL T;  1VYU A;  3CCS T;  3EG3 A;  1KFZ A;  1D0Z A;  5FU7 B;  3MEW A;  2KXC A;  3MEV A;  4GBQ A;  4EDU A;  1KD1 R;  2K5L A;  3UWN A;  2QA4 A;  4HCB A;  2NUP B;  2QI2 A;  1PRM C;  5HKC A;  4KH0 B;  5HK3 A;  2KR3 A;  2DJZ A;  4KBM B;  4F14 A;  3HRT A;  2DEU A;  3VS6 A;  3TQ7 P;  3LW5 E;  4EPC A;  1VQN T;  5IHK A;  4V2S A;  2L3P A;  3CCM T;  1OYX A;  4XU2 A;  4N0A C;  1Z9Z A;  2O4X B;  3M9Q A;  3QZ9 B;  2E1H A;  1X6B A;  2DXB A;  4TVR A;  2XMF A;  1M2V B;  3PIP A;  2OX7 A;  2KYM A;  2EJG A;  1OV3 A;  1FX7 A;  2QQS A;  4BI3 A;  5KCH A;  1V76 A;  5LJ5 e;  2RI2 A;  2CZ0 B;  4D6W A;  3INZ A;  5D6X A;  3JCM J;  3V7R A;  3OYN A;  2CT4 A;  2DYI A;  2E5Q A;  2YRD A;  4A53 A;  1VQ8 A;  4BDZ A;  1W2B S;  1TG0 A;  3TSW A;  2OTJ T;  1QW1 A;  2K3X A;  2QA4 Q;  4OMM A;  5I21 A;  4QVC A;  5GAN 7;  1M1G A;  2KT1 A;  3JCM W;  5L23 A;  2RI5 A;  4RTU A;  1BCO A;  1I5L A;  1AWO A;  1YN8 A;  1YI2 A;  2ED0 A;  4F7U G;  2KXD A;  1BI0 A;  1Q81 C;  5I2S A;  3V7S A;  1K73 C;  1K9A A;  1N9S A;  1VQ7 A;  3VUB A;  1Q86 U;  1PHT A;  4FYV B;  2HKN A;  1VQK T;  2X4W A;  2QEX T;  2P0P A;  3CCU A;  2NUZ A;  3KXT A;  4IIM A;  2EQK A;  4FYY B;  1VQ5 A;  1OPL A;  2ZZD A;  8ATC B;  2C0O A;  1ZBJ A;  1W2B A;  3CC4 A;  3H41 A;  2AHJ B;  2RHZ A;  3M5A A;  2K5I A;  1WGS A;  1BYM A;  4MZM A;  5GAN e;  5J39 A;  1VQ8 Q;  3OS2 A;  3JCM X;  3CC7 T;  4J9I A;  2K7A A;  2E10 A;  4ORZ A;  1WHK A;  3PE0 A;  3Q1J A;  4QVZ A;  3VJP A;  3RIR A;  2BE7 D;  4M78 E;  3X25 B;  3OYM A;  2E3H A;  1YI2 Q;  3OYY A;  4C5G A;  2PNI A;  2L5Q A;  1EFN A;  1W70 A;  2PUO B;  3JCM P;  1NYG A;  1C0M A;  3OYG A;  1WHJ A;  4R56 A;  1TS9 A;  2DPP B;  2LX9 A;  2M9U A;  4M7D E;  2XKO C;  2RJF A;  1VQ7 Q;  1JEG A;  2KRO A;  3CCU Q;  2RHX A;  2GQI A;  2YDL A;  3M0T A;  3QDR B;  3I55 T;  2FPF A;  1NG2 A;  5C0M A;  2JT4 A;  4ZN3 A;  1YJN T;  2LMJ A;  3CC4 Q;  1BBZ A;  1RUW A;  4M78 A;  5CVI A;  4BE0 A;  1QCF A;  1WA7 A;  3M55 A;  2IIM A;  1WHL A;  2RQT A;  4LUE A;  3FRN A;  2YLB A;  4M77 C;  4OP0 A;  5LJ5 j;  3CEY A;  5KYW B;  3J80 E;  1S72 A;  2DBM A;  4M7D A;  3T9N A;  4HT8 A;  2CGH A;  5AYF A;  3CCQ T;  1GCQ A;  4J83 A;  1MV0 B;  4J8O A;  3M0U A;  4DEX A;  3HSB A;  2QQA A;  4M7A D;  4OML A;  3RDV A;  1WLP B;  1HXD A;  3CCR T;  3MET A;  1RAH B;  2HBW A;  2COW A;  2YRC A;  2MOX A;  1QP3 A;  4FCY A;  2RH2 A;  4IUP A;  2J6K A;  2HL5 C;  1AEY A;  4BD3 A;  4WF2 A;  4X34 A;  3BE3 A;  2D1X A;  2HKQ B;  3CCL A;  1UGQ B;  5KH6 A;  3O5Z A;  3QHS A;  4A4K A;  1VQM T;  2EYQ A;  3VS4 A;  1LNX A;  4LDY A;  5GAO l;  2HCK A;  1S72 Q;  1RAG B;  3X26 B;  3OY9 A;  4YTL A;  1NYF A;  1T0H A;  1O9S A;  5HY6 A;  1O75 A;  4FIB A;  5GAN j;  4XAX B;  4M7A G;  2CUD A;  3PNW C;  1N5Z A;  3G6E A;  1VQ4 Q;  3QG1 A;  2K2V A;  1ABO A;  2DTO A;  1K9M C;  1EIF A;  3J81 E;  1JJ2 P;  1FMW A;  2ZPB B;  3OSS C;  2G6F X;  3NTK A;  5LJ5 d;  1UUE A;  4PK4 A;  1IHW A;  1RAD B;  2XG8 D;  1QP2 A;  1ZQ1 A;  1MNE A;  3GNG A;  1MMA A;  3OMC A;  2LJ0 A;  3CD6 T;  4LNP A;  4ZGD B;  5CKF A;  1UG1 A;  7AT1 B;  3OS1 A;  4OVA A;  1M3B A;  2CH4 W;  3CC2 T;  3C4S A;  1M2V A;  5GAN 2;  5ECA A;  3OW2 P;  1NJI U;  2M0O A;  4PLL A;  1PSE A;  2KGT A;  3MPU B;  2XI9 A;  2HEQ A;  4F04 B;  2COZ A;  1E7O A;  3EHR A;  4M77 B;  2EQU A;  2E70 A;  1HK9 A;  2F2V A;  5LJ5 h;  1VQP Q;  1YIT A;  5I22 A;  1WZO A;  4E7L A;  3EGD B;  4KUI A;  1LVK A;  1M90 C;  1WIE A;  2WSE E;  1I07 A;  3G6E Q;  4M77 F;  2KRS A;  4LUD A;  4PKC C;  3CBP A;  2OAW A;  2GTO A;  3V7C A;  2OTL Q;  3DLL A;  5GAN 4;  2P84 A;  3UA7 A;  3M57 A;  3G4S Q;  1RI0 A;  1B34 B;  1KC8 R;  1G3Y A;  2RA2 A;  3QUI A;  4J9F A;  3G71 T;  1WPY A;  2BUD A;  4QKU A;  2E5K A;  4M75 C;  3CCV Q;  5GAN d;  1Q7Y C;  1OOT A;  3UA6 A;  3QYH B;  1WJR A;  3DB4 A;  1M90 U;  1HSQ A;  4B9W A;  4JDS A;  2EWN A;  2E6Z A;  2EYZ A;  3ZBD A;  4C8Q C;  2A7Y A;  3PGG A;  4OMF B;  3CXC P;  3E9G A;  4X1V A;  3MP1 A;  5FWC A;  3SD4 A;  2MCN A;  3FEO A;  1W1F A;  1KK7 A;  2X3W D;  4M4Z A;  2EW3 A;  4QT7 A;  1QVG P;  3HFO A;  2QAS A;  3I35 A;  2ROL A;  1VQ6 A;  4Z89 A;  2VUB A;  1Q7Y U;  3LX7 A;  4OF1 A;  1IGU A;  4J9G A;  3R6N A;  4B9X A;  4L6V 5;  4J6Y A;  4J9D A;  2D0Q B;  4JLI A;  1JBM A;  3FIF A;  1PG5 B;  2K6D A;  5GAN 6;  3RKW A;  3L2Q A;  2VGM A;  2CZ7 B;  3X24 B;  4JJN K;  4BE2 A;  1C1A A;  4X9C A;  2J06 A;  1T3S A;  4N0A A;  2FB7 A;  1JXM A;  2YUO A;  2D0N A;  4ELZ C;  1QCN A;  1RAA B;  5IT9 E;  2XU8 A;  3ASK A;  2K9G A;  1SF9 A;  3H0F A;  3JB9 D;  2EPD A;  1AWJ A;  2CDT A;  3CMA A;  3HHT B;  1JU5 C;  2O31 A;  4QVD A;  4CC3 A;  1D3B B;  5AT1 B;  1RI9 A;  3EGX B;  3JCM Q;  2QA4 T;  2V1R A;  3ZL7 C;  1VQ6 Q;  3NPF A;  1ZBX A;  1UJ0 A;  2BTT A;  2LCC A;  3OYE A;  4ELY C;  1YJW Q;  3PMI A;  5CAI A;  3SWN C;  4EIK A;  2RHY A;  3G1J A;  4MML A;  3V8J A;  2PVO B;  1IRE B;  3EFO B;  4IKF A;  1R8O B;  1VIE A;  1JJ2 S;  4JZ3 A;  1N8R U;  3CME Q;  2YT6 A;  4D8K A;  4M75 B;  3A5Z B;  1DJ7 B;  3I5S A;  2PVG B;  2BKD N;  2BZY A;  3C12 A;  1Y71 A;  1BI2 A;  1KJW A;  1ZSZ C;  3CBM A;  3JB9 G;  2M0Y A;  1X6G A;  2EIF A;  4M75 F;  2KE9 A;  1GCP A;  4C8Q B;  2AIR B;  2RM4 A;  4E47 A;  5IHN A;  3OW2 S;  3HL8 A;  4AFZ C;  1VQ8 T;  4E7S A;  2VAS A;  3REB B;  1BB9 A;  2NWM A;  2QDY B;  2ZPF B;  5IH2 A;  2DO3 A;  3TCJ A;  3URG A;  4C8Q F;  5GMK j;  4XU0 A;  2LT1 A;  3VS7 A;  2PUK B;  3VS0 A;  1YI2 T;  2EAY A;  4RTX A;  1UE9 A;  2VGN A;  2CP0 A;  1NPR A;  3LWH A;  1G3W A;  4C92 D;  4RTZ A;  4OGE A;  3I56 Q;  3QBY A;  4LXC A;  4HVU A;  1RLP C;  1IB8 A;  1VQ7 T;  2OI3 A;  1JO8 A;  3M0S A;  3X20 B;  3M53 A;  4M77 E;  3OYJ A;  3CCU T;  2BZ8 A;  5FRN A;  1K8A U;  3OW2 A;  1LPL A;  1VQ5 T;  1YBY A;  1GFC A;  1AT1 B;  2CP2 A;  3CC4 T;  3M4G A;  2AZS A;  1PD0 A;  1UHC A;  2CUB A;  2HMA A;  4L5G A;  2ZCF B;  1SHG A;  3GOX A;  1HD3 A;  3G7Z A;  4PJL A;  1PRL C;  1Q82 U;  2QDL A;  2QTX A;  1N6A A;  1M3C A;  4QQD A;  3H8Z A;  3CXC S;  2EYW A;  5GAO r;  3E2U A;  2L2P A;  2O88 A;  1BI3 A;  2KAF A;  2AKL A;  2F2W A;  1AWW A;  4M77 A;  3DKM A;  1QVG S;  4PJO C;  3L2V A;  4E7H A;  4C92 G;  3SWN B;  3OYA A;  2CP5 A;  3MCA B;  2YUQ A;  2RQR A;  5GMK i;  4NS5 A;  2YSQ A;  3SFM A;  2VVK A;  4XQ3 A;  3RR6 A;  2KQW A;  2MWP A;  2MF2 A;  2DL7 A;  2JVV A;  4IUT A;  1BK2 A;  5DM7 R;  1WXB A;  4X9D A;  2M16 A;  3TVT A;  3RBB B;  1M1K U;  4P5N A;  2RK2 A;  4DBQ A;  1ZSZ B;  2CH4 A;  1Q81 R;  1UB4 A;  3CXC A;  1K73 R;  2XDB A;  3PT9 A;  1ZUY A;  4R0K A;  1H64 1;  2VB6 A;  3SDZ A;  5GAM g;  3EH2 A;  3UPU A;  3H0H A;  1QVG A;  5FWB A;  1YHQ A;  4FM4 B;  2FPD A;  4HCK A;  2A37 A;  4A4E A;  1Q86 C;  1SRM A;  1WJQ A;  4AMC A;  4RCC A;  1S72 T;  2JMA A;  2EJF A;  4PJM A;  1D09 B;  5GMK h;  1NPP A;  4J5Y A;  3EG0 A;  2NUT A;  4ZNX A;  3VS3 A;  4FSS A;  1T3L A;  2PZ1 A;  3BY7 A;  5GAO m;  2CKK A;  1IXD A;  1WNL A;  2JM9 A;  4K11 A;  2CRE A;  1ZA2 B;  2JS2 A;  4OMO A;  2RHI A;  5LJ3 f;  4XTX A;  1Y57 A;  4C92 C;  3M4Y A;  5GMK m;  2DVE A;  3GNF B;  2O9V A;  2EKO A;  3E19 A;  1YIJ Q;  3HFN A;  3CCL T;  5FRM A;  2LQK A;  2RD1 A;  5KYY B;  1KD1 U;  2DF6 A;  1GBR A;  4XTZ A;  1TOV A;  1YHQ Q;  1R0B G;  4JS5 A;  1BU1 A;  1CSK A;  1NZ9 A;  3OYD A;  2LQW A;  2DER A;  2H8H A;  3EG9 A;  4M75 E;  4OB0 B;  2KMT A;  1WHM A;  5KE2 A;  4XTW A;  4PJO B;  2P0K A;  1H3H A;  4ATO A;  1NEG A;  1IZ6 A;  3G6E T;  1D3B A;  3EGX A;  1ZSG A;  2Y90 A;  3E9F A;  5CR2 A;  2K3B A;  2O01 E;  1R77 A;  2ZPG B;  4HCC A;  2L8D A;  4KRT A;  2JUF A;  4PL6 A;  1G3T A;  4C8Q E;  2L3Q A;  2JM8 A;  4PJO F;  3KUF A;  1KQS P;  2LTO A;  3G4S T;  3MP8 A;  2DA9 A;  3JCM g;  2ROT A;  2ECZ A;  3RMS A;  1U8R A;  3CCV T;  5I11 A;  3CQT A;  1V29 B;  6AT1 B;  4RUG A;  2JJ9 A;  3SHW A;  2FVU A;  4AG2 C;  4XK8 E;  4M75 A;  2X4Y A;  4EMK C;  4OMN A;  3OYH A;  2K2M A;  3CPW P;  2FEI A;  1YIT T;  1V1C A;  4NOY A;  2NYS A;  2YHT A;  1KQ1 A;  4C8Q A;  1QVF P;  1B7T A;  1BIA A;  2EGA A;  2RF0 A;  2GFU A;  1VIF A;  4HA8 A;  2OJ2 A;  2LP5 A;  1WQW A;  2YUP A;  2DXT A;  1QQJ A;  2K3Y A;  3CCS Q;  2ATC B;  5GAN 5;  3KBG A;  4HVV A;  2DRM A;  1M3A A;  1PM3 A;  4F17 A;  3QSU A;  1TUD A;  1VQ4 A;  5KCO A;  1TXQ A;  2L89 A;  2HNI A;  1LJO A;  3L2R A;  2DTH A;  5GJW B;  4C92 B;  1K76 A;  4RG2 A;  1FWZ A;  5M9O A;  2AZV A;  4PFO A;  5KYU B;  1K9M R;  1YWP A; 
#chains in the Genus database with same CATH homology
 2EYZ A;  3TSZ A;  2DMO A;  2HSP A;  1FYN A;  2LNH B;  2HDA A;  4X1V A;  1YWO A;  1MUZ A;  5FWC A;  2PTK A;  1ARK A;  1VA7 A;  2C0T A;  2MCN A;  2RNA A;  2V1Q A;  1AZG B;  1PWT A;  1W1F A;  2X3W D;  4J9C A;  4M4Z A;  1S1N A;  2EW3 A;  3EHQ A;  4QT7 A;  2KT8 A;  3I35 A;  2ROL A;  2EVR A;  4Z89 A;  1QWF A;  1Y0M A;  5IXB A;  4HXJ A;  1XOV A;  2JMC A;  2LJ3 A;  4J9G A;  3R6N A;  2DJQ A;  1AVZ C;  1UDL A;  3M0Q A;  4J9D A;  2AKK A;  4OMP A;  2DL8 A;  2RMO A;  3EG2 A;  1SHF A;  1KSW A;  2SEM A;  1ZUU A;  3U23 A;  2LQN A;  2B86 A;  5IXF A;  2K6D A;  2L3S A;  1GBQ A;  1B07 A;  2M51 A;  3NGP A;  1NEB A;  2J06 A;  2JXB A;  1T3S A;  2DIL A;  1JQQ A;  1ZX6 A;  1VYU A;  2LX7 A;  3EG3 A;  1JXM A;  2FRW A;  1KFZ A;  2EYX A;  2YUO A;  2D0N A;  2KXC A;  4AG1 C;  4GBQ A;  4WCI A;  2K9G A;  3H0F A;  2EPD A;  1W6X A;  1AWJ A;  2CDT A;  2F2X A;  5FW9 A;  1PNJ A;  1JU5 C;  2O31 A;  1T0J A;  3LH5 A;  1X2K A;  4E6R A;  4CC3 A;  1RI9 A;  2L0A A;  1PRM C;  2DLP A;  4CC2 A;  2P4R A;  3NHN A;  2RQW A;  2V1R A;  3ZL7 C;  2KR3 A;  2DRK A;  4F14 A;  3NPF A;  2BTT A;  1UJ0 A;  1K0S A;  3VS6 A;  2EKH A;  3FJ5 A;  4RTV A;  2J7I A;  2ED1 A;  5IHK A;  4EIK A;  2L3P A;  1QLY A;  4D8D A;  1Z9Z A;  2GTJ A;  1X43 A;  1CKB A;  1YCS B;  1X6B A;  2XMF A;  4JZ3 A;  1UEC A;  2DM1 A;  4RTT A;  1OPK A;  2YT6 A;  4D8K A;  2FPE A;  4AFS C;  2KRN A;  3JV3 A;  3EGU A;  2KYM A;  3I5S A;  1OV3 A;  2BZY A;  3PVQ A;  1G83 A;  1U5S A;  1KJW A;  2M0Y A;  1LCK A;  1X6G A;  2KE9 A;  1GCP A;  2CSI A;  1G2B A;  2YUN A;  1U3O A;  3IQL A;  4J9E A;  2CT4 A;  1QWE A;  5IHN A;  1WXT A;  3VS5 A;  1TG0 A;  4AFZ C;  3TSW A;  3REB B;  2LZ6 B;  4OMM A;  2KNB B;  3THK A;  1BB9 A;  2NWM A;  3VRZ A;  2KT1 A;  5IH2 A;  5L23 A;  2ABL A;  4RTU A;  1ABQ A;  1AWO A;  3KFV A;  1YN8 A;  3VS7 A;  2ED0 A;  2KXD A;  4JPB W;  4JJD A;  3VS0 A;  1M30 A;  4RTX A;  1UE9 A;  1KIK A;  1AWX A;  1E6H A;  1K9A A;  3UAT A;  3M0R A;  1YP5 A;  4RTZ A;  1PHT A;  4HVU A;  1RLP C;  2OI3 A;  1JO8 A;  3M0S A;  3SEM A;  2DL5 A;  2NUZ A;  4IIM A;  2BZ8 A;  5GJV B;  1OPL A;  2C0O A;  1ZBJ A;  3VRY A;  3H41 A;  1GFC A;  1GRI A;  1AOJ A;  1H92 A;  1K1Z A;  2AZS A;  1GL5 A;  1X2Q A;  1UHC A;  2CUB A;  1E6G A;  4F16 A;  1SHG A;  1HD3 A;  4IIO A;  4J9I A;  3VS2 A;  2K7A A;  1PRL C;  2QDL A;  4ORZ A;  3PE0 A;  1M3C A;  1Z9Q A;  1GFD A;  2O2O A;  2EYW A;  4HVW A;  2L2P A;  2O88 A;  4RTY A;  2AKL A;  2PNI A;  2F2W A;  1AWW A;  2EYY A;  2GGR A;  1EFN A;  1W70 A;  2VKN A;  1NYG A;  2I0N A;  4Z88 A;  2YUQ A;  2RQR A;  2MIO A;  2YSQ A;  1JEG A;  2VVK A;  3A98 A;  3QWX X;  2DL7 A;  2KRO A;  1B3Q A;  4CC4 B;  2CT3 A;  2DE0 X;  2GQI A;  1BK2 A;  2YDL A;  3M0T A;  2O9S A;  1WXB A;  3REA B;  2FPF A;  3TVT A;  1NG2 A;  2RN8 A;  1K0X A;  2JT4 A;  1X27 A;  3RBB B;  2LMJ A;  1BBZ A;  4GLM A;  2CSQ A;  2CH4 A;  1RUW A;  1J3T A;  2J6F A;  3I5R A;  2DL4 A;  1QCF A;  1WA7 A;  1SEM A;  3C0C A;  1ZUY A;  2IIM A;  4R0K A;  2RQT A;  4LUE A;  2DNU A;  3H0H A;  2J6O A;  2A28 A;  4ESR A;  2BZX A;  1CKA A;  5FWB A;  2DBM A;  2FPD A;  2A37 A;  4HCK A;  1SRM A;  4Z8A A;  3UF4 A;  2JMA A;  1GCQ A;  1MV0 B;  3M0U A;  2VWF A;  4DEX A;  1NLO C;  3EG0 A;  2X3X D;  3ULR B;  4JJB A;  4OML A;  2A36 A;  1WLP B;  4ZNX A;  3VS3 A;  4FSS A;  1T3L A;  2PZ1 A;  2D8H A;  1M27 C;  2HBW A;  4A63 B;  1TUC A;  2MOX A;  2JM9 A;  4K11 A;  2CRE A;  3EG1 A;  2LCS A;  2J6K A;  2KBT A;  2JS2 A;  4OMO A;  1AEY A;  1AD5 A;  2DBK A;  2W10 A;  2RPN A;  1Y57 A;  1ZUK A;  1FMK A;  1UTI A;  2FRY A;  2D1X A;  2O9V A;  1MV3 A;  1WDX A;  4JJC A;  2JTE A;  1AZE A;  1H8K A;  4JZ4 A;  2W0Z A;  3O5Z A;  2KYB A;  2RQV A;  4CC7 A;  2GBQ A;  1GCQ C;  2DF6 A;  1GBR A;  1YNZ A;  2GNC A;  3VS4 A;  1PKT A;  3H0I A;  2FO0 A;  2HCK A;  1BU1 A;  1I0C A;  4LE9 A;  1CSK A;  1NYF A;  1T0H A;  2LQW A;  2DL3 A;  2H8H A;  1NM7 A;  2EQI A;  3VS1 A;  2CUD A;  4DEY A;  2J05 A;  1N5Z A;  1WX6 A;  2DVJ A;  1H3H A;  3PVL A;  1NEG A;  1NLP C;  1ABO A;  4Y92 A;  1ZSG A;  1WYX A;  2C0I A;  2K3B A;  2G6F X;  2SRC A;  4OMQ A;  1UUE A;  1HJD A;  4KRT A;  2D8J A;  2L3Q A;  1UHF A;  2JM8 A;  1ZLM A;  2EGE A;  2LJ0 A;  2JS0 A;  2ESW A;  1JXO A;  4LNP A;  2DA9 A;  2KEA A;  1RLQ C;  3QWY A;  1UG1 A;  1QKX A;  2ROT A;  2ECZ A;  3GBQ A;  2DX1 A;  5I11 A;  1PKS A;  1A0N B;  1WXU A;  3CQT A;  1M3B A;  2CH4 W;  2LJ1 A;  1X69 A;  1OEB A;  4RUG A;  3SHW A;  5ECA A;  4AG2 C;  2KGT A;  1UGV A;  2DYB A;  2HEQ A;  4J9B A;  1E7O A;  3EHR A;  1SSH A;  4OMN A;  2F2V A;  5I22 A;  2K2M A;  2FEI A;  1V1C A;  1U06 A;  2EGC A;  1WIE A;  1WI7 A;  1I07 A;  4AFQ C;  1UJY A;  2KRS A;  4LUD A;  4LN2 A;  1K4U S;  2EGA A;  2FG0 A;  1QKW A;  2GTO A;  2OAW A;  2RF0 A;  5EC7 A;  1UFF A;  2OJ2 A;  2LP5 A;  3UA7 A;  2YUP A;  2RQU A;  3M0P A;  5HCK A;  4AFU C;  1WFW A;  4HVV A;  3RNJ A;  4J9H A;  2DRM A;  1M3A A;  1SRL A;  4F17 A;  1TUD A;  3I9Q A;  3NMZ C;  4RTW A;  1M8M A;  1VYT A;  4J9F A;  2E5K A;  2JW4 A;  1OOT A;  3UA6 A;  5GJW B;  2A08 A;  1K76 A;  2EBP A;  1SPK A;  1I1J A;  2AZV A;  5IHI A;  2ENM A;  2AK5 A;  1IO6 A;  2KRM A;  1VYV A;  2K79 A;  1YWP A;  1HSQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...