2YRCA

Solution structure of the zf-sec23_sec24 from human sec23a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
b'GSSGSSGEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein transport protein Sec23A
publication title Solution structure of the zf-Sec23_Sec24 from human Sec23A
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.380 Mainly Beta Roll SH3 type barrels. Zn-finger domain of Sec23/24 2yrcA00
1PD1A 3EH1A 3EFOB 5KYWA 1M2OA 1M2VA 2NUTB 3EG9A 5KYYB 5KYUB 2YRCA 3EGXB 3EGDB 3EFOA 2NUPB 5KYXB 2QTVA 2NUTA 3EH2A 5KYWB 5KYUA 5KYYA 1M2VB 3EGXA 3EGDA 1PD0A 1PCXA 2YRDA 5KYNA 2NUPA 5KYXA 3EG9B
chains in the Genus database with same CATH superfamily
1G3SA 4QT7A 3VS3A 5LJ3g 2LCLA 3S3MA 4FSXA 1M2VA 3QG1A 2CZ1B 3TU4K 1BI3A 1C6VX 2C0OA 3H41A 3I5SA 1QKWA 1M30A 1KHIA 2BZYA 4EMKA 2QA4T 2NWMA 3QUIA 3QSUA 5LJ5e 5KYWB 3L1AA 2LQWA 5GMKl 4M78C 3QPHA 3M59A 2KE9A 2AKKA 1G83A 4F7UE 3OBYA 2CP5A 4QQDA 1OPKA 2RQVA 5CK9A 1TUCA 4A4HA 3BDUA 4LD6A 2ROLA 2LTOA 1UFFA 3TSZA 4E7KA 3SWNB 1NLOC 3ZFJA 3KFVA 3GPLA 2O88A 1M2VB 2EJ9A 4HCZA 2MOXA 1XQHA 5C6SA 1UJ0A 2O9VA 1OU8A 4EMKB 4BE0A 2EYYA 3TVTA 1UG1A 4M78E 2A36A 3M5AA 2CZ0B 2KI7A 2K5IA 4RTVA 4C92E 1KD1R 2EGCA 4LD9K 3P8BB 4UC4A 1UGRB 3CC2Q 2DKGA 3VUZA 5GAOm 1RABB 2GGRA 2X3WD 3RERA 4O5VA 2QAZA 3VS0A 2BTTA 1M1FA 2RA2A 4AT1B 1QWEA 1RAFB 3V8KA 1TXQA 2BZ8A 2DAQA 3E9FA 3TQ7P 4XU2A 3CCSA 3RESA 3DLMA 1TG0A 5KYYB 2RHYA 3M4YA 3X24B 1X6BA 2LNHB 1K73R 2M16A 3OQ5A 2FZKB 1I4K1 3MJXA 1VQMA 2FEIA 2DRMA 3LH0A 1KQ1A 3MPUB 2AKLA 3OS1A 2EQMA 1PHTA 2PTKA 2FL7A 5IAYA 5IH2A 4N4IA 2ESWA 4XQ3A 1U06A 5CR2A 3PGGA 2DNUA 4AFQC 3CC2T 1F1BB 4JJCA 4KH1B 1O75A 2YXYA 4HA8A 2X4XA 5GAMh 2ZPFB 3C12A 4RTZA 4X9CA 4JDSA 3JCMJ 1ZSGA 1PKSA 4C0ZA 4ORZA 3LH5A 1MHNA 2C06A 1YWOA 2Z0WA 3PFSA 1NEBA 1IRXA 4C0FA 1K76A 2DXCA 2JTEA 3MO8A 1K0SA 1RUWA 2FO0A 1YJWA 2VXFA 2OAUA 1UGPB 2CP2A 1EIFA 3P8HA 1Y96B 2FVUA 5KYUA 3CC4Q 1M4ZA 1KQSS 2QQAA 1BCMA 4N0AC 5HY6A 5GAN3 3EHRA 2VGMA 2L5QA 1YJ9Q 3OW2S 3HP9A 2HZYA 4HVVA 4JJDA 3G71A 1K9AA 3HFNA 2NLUA 2E4HA 1WQ7A 1Q95G 5GJVB 4DBHA 3KUFA 1FYNA 1S72A 1VQ5Q 3CMAA 3UPUA 4WCIA 1V1CA 2F69A 2RMOA 1N8RU 3CCJQ 1QLYA 1ACMB 4C8QD 2EQKA 2RN8A 2DTIA 1D1BA 5KYUB 1K1ZA 2B86A 2V1RA 1MMAA 1QVGS 2MYSA 4ELYC 2FRYA 4C5HA 3S3OA 3OYLA 5LJ3f 1PRLC 3CCMA 3ZBDA 1NJIR 2EWNA 4HCBA 1FMVA 1I5LA 1BK2A 3CCUQ 2VYTA 4TVRA 3JCMd 2YUQA 1M3AA 2IIMA 1GCPA 2E41A 2ZCFB 3BY7A 2EQIA 3C94A 2LJ0A 4JRIA 3A8LB 4GBQA 2LP5A 1YJ9T 1IO6A 5L23A 2NUTA 1WNLA 2K79A 1R77A 5CKBA 2JW4A 3R6OA 1P92A 4M7DD 2RI5A 3UT1A 2E6NA 3OS2A 3C4SA 5D6XA 1VQ5T 1W6XA 1M1KR 2KXDA 4OMFB 4PFPA 1ZBXA 2Y4XA 5FU7B 3CCJT 2BKDN 2G3RA 2LJ3A 5LL6S 3OA6A 4OB2B 4X34A 2RD1A 4M7AD 3H8ZA 2MIOA 2E6ZA 4M77F 1WPYA 4CC4B 5KYNA 1JXMA 1RAAB 1Q81R 2A7YA 4HXJA 4BB7A 3JB9I 3QYGB 1XTDA 5GMKm 1HYOA 3JCMX 4KRTA 4NOYA 2ENMA 2YDLA 2DL4A 5GANd 1NE8A 5KCOA 3CCUT 4ANJA 2CH4A 3H9NA 4IUVA 4QVDA 3H0HA 3M9QA 2D9TA 2HEQA 4RMOA 1VQOA 1KC8U 4A4EA 4PLIA 2O2OA 3M53A 1I8FA 3QYHB 5FU6B 3CXCP 4VUBA 4KGXB 1GCQA 1W2BP 2MCNA 2DERA 2LX9A 2PNIA 1UGVA 2LQKA 2V8KA 4WF2A 3G1JA 4JZ3A 3FEOA 2E64A 4PJOD 2K9GA 1YHQQ 2DM1A 1E6HA 4BI8B 4DA4A 3CD6Q 1IGUA 4F14A 2QQBA 2DVEA 3NMZC 2GTJA 5GANg 3JCMe 1UECA 4B9WA 2QEXQ 3T9NA 2R5AA 1LOJA 4IURA 3UF4A 3MP6A 5GAOq 2RO0A 2O4XA 4OMNA 4C8QA 3CCVA 2DLPA 3PE0A 3E2UA 1Q82R 1I1JA 2ROTA 5I22A 2MPXC 4E7HA 3E1SA 2J6KA 1YIJA 1EZZB 4J5YA 4FYXB 5IHNA 4LN2A 1AWJA 2LQNA 1H3HA 1Y0MA 3ER0A 2QGFB 2KQWA 3C95A 1VQ6Q 3L42A 2MK5A 4XAXB 2CS7A 1YHQT 2O4XB 4C8QB 4Q5WA 2BE9B 2F5KA 4EPCA 2NUPA 3CD6T 3M55A 3OS5A 1U5SA 5IXBA 1B34A 5GANe 1M1GA 4E7SA 3GNGA 5A2QE 2QEXT 1Y07A 1VOMA 1WQWA 1X69A 5J39A 4M75A 2DXBA 1WXTA 2M0OA 3TSWA 9ATCB 1HJDA 2LC4A 4M7AA 1KFZA 4JLGA 1M9SA 4FT2A 3CBMA 3FLGA 2M51A 2OTJQ 1YNZA 1K9MC 1TUDA 1NBEB 1M5Q1 1ZSZC 3TCJA 1ZBJA 4MZMA 3NPFA 1NJIC 1PSFA 1R0CB 2YRCA 1QP3A 4AFSC 3BDLA 1X2KA 4NL3A 1BI0A 2NUPB 3OYFA 4JS4A 4M7DB 2A3LA 1VQ8A 4MDXA 3M54A 1T0HA 1O9SA 4F04B 4KUIA 1VIEA 2DIQA 4M77C 3I55T 4M7AB 1D1CA 1ZUYA 3OYCA 2P84A 1VQKQ 1MMGA 2XDDA 1M1KC 1XNIA 2L3QA 1N5ZA 3RMSA 2DBKA 2ZGWA 4ZTJA 2JZ2A 2P0PA 4IIMA 3CBOA 5GMKe 1K8AC 1GBQA 3I56A 3JRZA 1RAEB 3I5RA 3CCQQ 1Q7YU 2OTJT 1JXOA 3RNJA 2DBMA 4OP0A 4M77E 5FRMA 3NGPA 3TEEA 5IXFA 4OB0B 4MZTA 1CSKA 1QVPA 4QW2A 4PJOB 4M4ZA 2P0KA 3S6WA 3GF5A 1GRIA 2HAXA 3G4SQ 1E6GA 2QYZA 4EMKC 2RI2A 4J6YA 2HQHA 1QVFA 4JPBW 5GAOr 2PVOB 4DOVA 1WHKA 2J05A 5LJ3d 2YT6A 1VQ4Q 2KT1A 2ABLA 4ZN1A 1VQKT 4MDWA 4J9DA 2LDMA 1TUGB 2VKNA 3QJ6A 5KYWA 2KT8A 1VQ7T 1PSEA 2L2PA 1MNEA 4M78D 4ESRA 2PU9B 3JCMV 3X26B 3CCQT 1WX6A 4RTUA 5EG2A 5KH6A 2DMOA 1SEMA 3A8HB 3OYGA 4KUDK 1Q81U 4ZNXA 1Y71A 1RACB 5D6WA 1MMDA 1PCXA 2D8JA 2E5KA 2RHUA 4JUVA 2NUZA 4ME7A 3A8GB 3HSBA 3SWNA 1JO8A 2E3HA 2DTOA 3LWIA 5KCHA 1ZUKA 1BKBA 3G4ST 5GANf 4J9IA 3VRYA 2ZPGB 2I2LA 1WDXA 4KH0B 1G3YA 3LWHA 2DEQA 3JB9D 2RPNA 3O5ZA 2KSSA 4F17A 5CQXA 1HK9A 2F2XA 3FIFA 3OYMA 1ABOA 3CMEQ 4PJNA 3OYAA 1VQ4T 1I0CA 4C8QG 3OS0A 2VWFA 3GNFB 2QQSA 2FZCB 2RK1A 1Z9QA 1TWBA 5DM7R 2RF0A 1D0ZA 5CVIA 4J7IA 4GLKA 2VASA 2WACA 2E12A 1PM3A 3ZL7C 3EGDA 2VVKA 4A4FA 2F2VA 4OVAA 5A0DA 1VIFA 3CXCA 2CP7A 3HFOA 3SFMA 1W2BA 3JCMb 4C5IA 1PWTA 2JMAA 5LJ3e 3MEVA 3U23A 2XDPA 2ZPHB 3CCEA 4DEXA 3J80E 4J8OA 5A0GA 5KYYA 2P4TA 2FZGB 2MWOA 4M7DG 5GAN5 1RAHB 3KBGA 5L8RE 2DD4A 4F7UA 4BI3A 1OV3A 2RH2A 2CREA 4M75G 3EGDB 3FB9A 4HKEA 1YJ9A 2DD5A 3X20B 4OGEA 4M7AG 3HKSA 2PVDB 3GOXA 3UDCA 1KHCA 4Y91A 4MMKA 3MEWA 2DJQA 2JJ9A 1OX8A 4E2FB 2GFAA 4E7ZA 3G6EQ 2BE7D 5FRNA 1SHFA 3GP8A 2FYKA 3JCMQ 2KY9A 4JRPA 1FXXA 2GBQA 2RHXA 2L0AA 3V8JA 4C92A 2W10A 2HSPA 4FU6A 4XU1A 5GJWB 4F7UB 1UTIA 2CDTA 4PKCC 3Q1JA 1Y96A 1M2OA 3CCLA 4ATOA 2DXTA 4E7IA 4A4GA 3CCUA 2E3IA 1XJWB 1B07A 4J9HA 1LCKA 2K3YA 1T3SA 3LX7A 2XKOC 3D7SB 2K2MA 3H0FA 1IGQA 2R58A 4M78B 5C0MA 3M0TA 1GFCA 1SSFA 3OYKA 1VQ9A 1U8RA 4C92B 2DZ9A 3CBPA 5KE2A 1RI0A 2E1HA 3PMTA 3G6ET 1UE9A 1Q86U 2ZPEB 4M75F 1VQPA 3OYIA 3RKXA 3EG3A 2YLCA 2KYMA 4C0GA 4AFZC 1SRLA 1WA7A 4XK8E 1LNXA 4KGVB 2HBWA 2EVRA 5CO7A 3CC7A 2J6OA 3M57A 2KRNA 3PNWC 1YI2A 2EQUA 4A63B 1UEBA 5GAMd 3VS2A 2DX1A 4A53A 1WZOA 3DLLA 1RLPC 1FX7A 1QVFP 2P0QA 1LVKA 3RKWA 1M27C 3UWNA 5IN1A 4CI0C 5GAOp 1AOJA 1HSQA 3HL8A 4RKUE 2JS2A 1U1SA 1QKXA 1ZA1B 4C5GA 1K9MR 1M8VA 8ATCB 1YBYA 3CCSQ 2COZA 1W70A 3CD6A 5LJ5j 2F1LA 3OYJA 5D6YA 1M90R 2HQEA 3CC4T 1EFNA 5GAMg 1PNJA 1VQMQ 3PMIA 3QKJA 4QVCA 4R55A 2L3SA 4IKFA 1SG5A 3CPFA 3EG2A 2EYWA 2K5LA 1NPRA 2RB6A 3JCMc 3J81E 2LNVA 4B9XA 1SF9A 1NPPA 2FHDA 2XU8A 3BFMA 3EHQA 1ZUUA 5FWBA 3CCRA 4PNOA 4PFZA 2AHJB 2LZ6B 1YJNQ 2EJGA 2MF2A 1OU9A 2HDAA 2GQIA 2J06A 4C0DC 2X35A 2JMCA 1K8AR 5I21A 2DL7A 5CCAA 2KR3A 4HVWA 1OZ2A 4J7FA 2MWPA 2D8HA 1OYXA 1YJWQ 5J3BA 3ULRB 1SKUB 2YUOA 3I55A 1Z9ZA 3SB2A 1X6GA 1PKTA 1BIAA 4IUQA 2L89A 4J9BA 1M8MA 2YRVA 5M9OA 1B7TA 3G71Q 2M9UA 4CC7A 1CKBA 4BY6C 1DJ7B 1X2QA 3HRSA 2ZPBB 2JT4A 5D7UA 3NFCA 2H3JA 4JRKA 4F7UG 1FWZA 4OMLA 1S72Q 4RTWA 4BE2A 3BE3A 4J6WA 1KD1U 4FW2A 5FROA 2JM9A 2KRMA 1YJNT 4KT0E 4HT9A 5GAN7 1ABQA 4EDUA 4R0KA 2EW3A 3UATA 3L2UA 1BU1A 2K4YA 5HK3A 4M75C 5I11A 2IVWA 3M0RA 1D1AA 2M02A 1IHWA 3LGFA 4M78G 3LW5E 3CCMQ 1YJWT 3INZA 3CPWA 4C92G 2EKHA 2P4RA 3H0IA 4GY5A 2AT1B 2QK0A 3V7RA 3VS5A 2RNAA 2A08A 2DPPB 2FPFA 2YHTA 4HVUA 3QZ9B 3RIRA 4FL6A 2X9HA 2HQXA 2OX7A 3JCMW 1N6AA 3G71T 1AHJB 1VQ7A 3E9GA 2XIDA 1W1FA 2KMTA 1K73U 2ED0A 2EGEA 3OYEA 1JQQA 2RQUA 4M75E 3VS1A 2DJZA 4P5NA 2KAFA 1UGQB 1YITA 1S72T 3EFSA 5GAOn 4ELZC 1G5VA 1PRMC 2OTLA 4OB1B 1PD1A 2OAWA 1OX9A 4JLIA 3PIOA 4M7DA 2CSQA 2DFUA 3ASKA 2KEAA 1QVFS 1RLQC 1AWWA 1YWPA 3MEAA 1VYTA 4M77D 2RQRA 3M0UA 1TS9A 1TU0B 1WHHA 4JRQA 2QA4A 4AG1C 1C1AA 5GAN2 4LDVA 4WTOB 1PD0A 2YRDA 3VUBA 4OMMA 2M1HA 1M3BA 2V8JA 1ZQ1A 3VS6A 2OI3A 2KXCA 1AZGB 1VQOQ 1WHLA 2AZSA 2CUBA 2HSEB 2SEMA 3VYHB 3VU3C 2CT3A 4R56A 4BE1A 1FMWA 3PVLA 3QJYA 1M90C 3GIBA 1VQ6T 4XTZA 1BCOA 3P8DA 2QQ9A 5LJ5h 4C92F 1V76A 2JTFA 2C0TA 2EYZA 2DYBA 1JU5C 1IXDA 2AZVA 3I9QA 1X75C 1TTHB 4FM4B 4IUPA 3WVDB 1QCOA 4L59A 4PJOA 2GNCA 2D6FA 1RADB 3LGLA 3FDRA 1MV3A 2D1XA 3GBQA 3CCVQ 2JS0A 1IZ6A 1IHVA 1VA7A 1X43A 1KG1A 2QXFA 5GAMf 3LYIA 2JXBA 2EKOA 1IREB 2RHIA 1K0XA 1YIJQ 1K9MU 3A8OB 4XU0A 2YSQA 4JZ4A 1NJIU 2RQWA 2X4JA 3MCAB 3ME9A 2QG9B 3SWNC 2CZ6B 5CKDA 1A0NB 2QGGA 3CXCS 1RAIB 2L8DA 8AT1B 2MI6A 2YLBA 1B3QA 2HKNA 1W2BS 1OOTA 2G6FX 4BDYA 1QWFA 2VC8A 2XG8D 2IG0A 1NG2A 2O9SA 3RKYA 1JRIA 1OI1A 3EGXB 4Z88A 4FW1A 2Y4YA 1ZSZA 1TOVA 1RAGB 1TSFA 1WHMA 2K6DA 3VKIA 1MNDA 2E70A 2K2VA 3VJPA 2AK5A 5A0LA 1M1KU 2QI2A 2A28A 4QQ6A 3RUXA 3RR6A 3CCVT 2CSIA 4EIKA 2RJDA 1K8AU 1GXIE 4D8DA 5LJ5g 4M77A 4KGZB 3NTKA 3CC2A 2VB6A 3PTAA 1UDLA 3IQLA 1Y7XA 1YIJT 1C0MA 2E65A 2K5FA 3BW1A 2DE0X 4AG2C 3FJ5A 3N5BB 2XMFA 1ZSZB 2LT4A 1HXDA 2EPDA 4ZGJB 3L2RA 4K11A 1VQ8Q 4E6RA 4C5EA 2K7AA 4DOWA 3J7AF 1RI9A 5J26A 2DVJA 2GQVA 2EJFA 3MP1A 2DYIA 3MKDA 2J6FA 2EQJA 4RUGA 4FT4A 3OW2P 4M77B 4J83A 2XDBA 4X1VA 2DILA 2ZAEA 4KULA 2COWA 3OYNA 1D0XA 4RG2A 3LLRA 3REBB 2X4WA 2QASA 2GCXA 4X9DA 3I56Q 1MUZA 3L2VA 5ECAA 4LUEA 3THKA 1VQLQ 1IB8A 2A37A 4RTXA 3PT9A 4PJJA 2ATCB 4C92C 1KK7A 3CPWP 2CZ7B 1Q82U 2KROA 1QVGP 4HCKA 3O8VA 4QKUA 3OSVA 5GANj 1NYGA 2XK0A 2LVMA 3E19A 1D09B 2PZ1A 1BI1A 4IIOA 1VQ8T 2DK3A 3I35A 1QMCA 1QCNA 5FW9A 3QDRB 1K4US 1NLPC 1VQNQ 1KC8R 4LDUA 5KYXA 5IT9E 3MEUA 1HD3A 2NYSA 2YUPA 1G2BA 3X25B 2XICA 3CC4A 3V8LA 4A4KA 1AWXA 4Y92A 3REAB 3CMET 1NEGA 3NTHA 5DLOA 2LCCA 3DKMA 2LMJA 4D6WA 1R0BG 1UJYA 2ECZA 2HL3A 2PVGB 3QDFA 5HK0A 3I56T 4MMLA 3CQTA 1VQLT 1VQ5A 2VXEA 2DEUA 4B6MA 1M3CA 3OY9A 1H8KA 3L2ZA 4M78A 3CCJA 1G3TA 2O31A 4Z8AA 4C8QF 5KYXB 3M0PA 3WXMB 2K3XA 2CH4W 2D0NA 3TREA 2ED1A 2DXUA 2HL5C 4A54A 4BDZA 5GMKj 2GFUA 1U3OA 1VQNT 4L6V5 4PJOG 3VYGA 3DB4A 1Q86C 4QVZA 5AT1B 3HRTA 1AEYA 2MAMA 2AIRB 2K57A 3QIIA 4XTVA 3QWYA 1ZX6A 1UHCA 2BIVA 3L2WA 2FG0A 2JOYA 1ARKA 2YWWA 3SHWA 2EGAA 3SDZA 1VYVA 3HHTB 4HCCA 2RHZA 4NS5A 2E10A 1PG5B 2KYBA 3OSSC 4M7DF 4OMPA 1MMNA 1KSWA 4OMQA 3M0SA 5FU7C 3OYYA 2R5MA 2HNIA 4E7LA 1U1TA 2K3BA 3M4GA 1Y57A 2XHCA 1N8RC 2KVQG 1YJNA 1UUEA 3URGA 1GFDA 3RBBB 2GTOA 4ZTFA 5IHKA 2DZCA 1UHFA 2COYA 4J6XA 4O6JA 4M7AF 3A8MB 3PIPA 2RM4A 4OF1A 5CIUA 2RJEA 3OMCA 3CCEQ 1JEGA 2QDYB 1EX4A 2QQRA 3VS4A 4BI4A 2V8IA 1V29B 1WXBA 1H92A 3G7ZA 1WJQA 3HTRA 5FU6C 2X51A 3FJPA 2CUDA 1ZHIA 3VRZA 1WYXA 1WJRA 4RCBA 3JCMh 3QBYA 3VS7A 1UGSB 4XTYA 5LJ5f 1LPLA 2O01E 5DLQE 1G8XA 4LDYA 2JM8A 4M77G 1G3WA 1PC0A 1X27A 4PJOF 3JV3A 1JJ2P 2Y90A 2RJFA 2EYXA 4PLLA 3L2QA 1YHQA 2JVVA 4DBQA 1GBRA 2ZZDA 1KQ2A 4OB3B 5CKEA 4LXCA 4FYVB 1AWOA 3H6ZA 2V1QA 3VV0A 3KXTA 3OMGA 2X3XD 1GL5A 3CPWS 2QEXA 1KIKA 2OJ2A 1Q7YR 1YFNA 4ZN3A 1GCQC 1BBZA 5KE3A 5AYFA 2LRQA 2JTMA 3CCET 2IPOB 2M0YA 2VV5A 3CCLQ 1WGSA 1JB0E 4JJBA 2JUFA 4PJLA 1N9RA 1I81A 1MV0B 4PL6A 2LCSA 1ZA2B 4DEYA 5GANh 4CRIA 3META 4D8KA 1KC8C 2DRKA 4N0AA 4EMHA 3JCMP 5GAN8 2KDSA 5LJ3j 4RCCA 1VQ9Q 1VQ6A 3F70A 4EMGA 3M56A 4C8QC 2JNGA 2DA9A 2RK2A 2KBTA 4ZGEB 1KD1C 1BIBA 4LUDA 4GLMA 4XTXA 2HKQB 3HPWA 1YCYA 3QWXX 1FMKA 3CCST 1VQPQ 2EBPA 4M75D 3QHSA 1X01A 2CP6A 5GAMe 3JCMg 3EG1A 4DQ2A 1VQMT 2R57A 3JB9J 3CC7Q 3A1PA 4JS5A 2PQWA 2KNBB 4CC2A 2QDLA 1YI2Q 1KQSA 2EAYA 3CCLT 3SEMA 7AT1B 2EFIA 3UA6A 1WIEA 2NUTB 4C8QE 2OTJA 3PVQA 5CKFA 2WSCE 4FYWB 4XU3A 3CMAQ 2BUDA 3OW2A 3OYBA 4Z02A 2DO3A 2CP0A 2LT1A 3V7SA 4LDXA 4M7DC 4PK4A 2FPDA 4LE9A 3EG0A 3EH2A 2SRCA 2CT4A 1AD5A 3GLXA 4V2SA 1H641 3AT1B 1K73C 2LX7A 5GMKh 1T0JA 1VQ9T 2DIGA 4IUTA 4CC3A 4BD3A 1WFWA 3X28B 1NZ9A 3DB3A 1BI2A 4M7AC 3UA7A 5I2SA 1QVGA 4RTYA 5CKHA 2F5TX 1WHJA 1VQPT 2A0FB 4F16A 2EIFA 1VQKA 3NHNA 4PFOA 4M7DE 1WLPB 1YP5A 2CKKA 2B8AA 3QXEB 1WI7A 2RJCA 1D0YA 1AT1B 3CC7T 1R8OB 5FWCA 3SD4A 3CEYA 1YI2T 1NM7A 4KBMB 1X6OA 3OYHA 2H8HA 4E7JA 2GF7A 3OBWA 4FSSA 2JN0A 2KK4A 3CCQA 2PUKB 3CMAT 4M7AE 3JB9G 3CCRQ 5CQYA 3OYDA 4PJOC 2V26A 1QQJA 2EYQA 3EH1A 5GAOl 2HD0A 2RQTA 3ZEHA 2FB7A 4QQGA 3EG9A 4BUGA 2HMAA 4C0DB 3G4SA 1WJSA 2C0IA 2X4YA 4F7UF 2HCKA 1JJ2S 1AVZC 3AHUA 3CCMT 4DBRA 3I55Q 4RG8A 1T3LA 3JB9H 4DBFA 4L5GA 1OPLA 2ZPIB 1LJOA 4FYYB 5CAIA 1I5OB 1VQ4A 1BYMA 2DETA 4PJOE 4BACA 5GMKi 4N4HA 2XI9A 4PJMA 3C0CA 1OQKA 2L3RA 2MMPA 4M78F 2YUNA 4FCYA 6AT1B 2DL3A 1Q7YC 3QZ5B 4YTLA 1H3ZA 5DY9A 4BY6B 3EG9B 2DL8A 4OMOA 1WHGA 1YCSB 3CCRT 5I2MA 3A5ZB 1N27A 2WSEE 3WVEB 3FRNA 1OZ3A 4XTUA 2VUBA 4ZGDB 3EAEA 1WXUA 4IUUA 3EFOA 4LDWA 1E7OA 5GAN6 1J3TA 1B34B 2QTVA 4J9GA 1W4SA 1OULA 1YN8A 2KRSA 3EGXA 2PUOB 5IHIA 2CP3A 1JBMA 2DTHA 3OB9A 2VGNA 1UB4A 1D3BA 1MGQA 3HRUA 4M75B 3JB9F 1ZLMA 1S1NA 1SPKA 1BB9A 2W0ZA 1QP2A 3M58A 4J9FA 4RTTA 5LJ3h 3CMEA 1RL2A 1VQOT 3JAME 3A98A 3FC3A 4E47A 1SHGA 4AMCA 4N4GA 5LJ5d 1M90U 1VQ7Q 2RI3A 2CYZB 2I0NA 1Q86R 1I07A 3EFOB 1VQLA 4JJNK 2LQ8A 1YITQ 2QTXA 3NTIA 1Q81C 2WSFE 1SRMA 1XOVA 3RMQA 4II1A 3EFRA 2OTLQ 3QO3A 5EC7A 1D3BB 2KGTA 4LNPA 3MP8A 3MHXA 4XTWA 1CKAA 4MZPA 5GAMj 1AZEA 3JSCA 1JJ2A 2H3EB 2DF6A 4OGCA 4FIBA 1KJWA 1N9SA 3S3NA 5FLXE 3RDVA 1VQNA 4Z89A 3JCMf 2QA4Q 3M0QA 1N8RR 3V7CA 1SSHA 2DL5A 1VUBA 4HT8A 1TH7A 1NYFA 1VYUA 1QCFA 2FPEA 2J7IA 2F2WA 5HCKA 4Y28E 2E5QA 4J9EA 4J9CA 2D0QB 4AFUC 1OEBA 2FRWA 2XD0A 2BZXA 5GAN4 4C92D 1QW1A 1YITT 4NL2A 3EGUA 3G6EA 2L3PA 1KQSP 2HBPA 1Q82C 2OTLT 3R6NA 2CGHA 2LJ1A 5HKCA
chains in the Genus database with same CATH topology
1PD1A 3EH1A 3EFOB 5KYWA 1M2OA 1M2VA 2NUTB 3EG9A 5KYYB 5KYUB 2YRCA 3EGXB 3EGDB 3EFOA 2NUPB 5KYXB 2QTVA 2NUTA 3EH2A 5KYWB 5KYUA 5KYYA 1M2VB 3EGXA 3EGDA 1PD0A 1PCXA 2YRDA 5KYNA 2NUPA 5KYXA 3EG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PD1 A;  3EH1 A;  3EFO B;  5KYW A;  1M2O A;  1M2V A;  2NUT B;  3EG9 A;  5KYY B;  5KYU B;  2YRC A;  3EGX B;  3EGD B;  3EFO A;  2NUP B;  5KYX B;  2QTV A;  2NUT A;  3EH2 A;  5KYW B;  5KYU A;  5KYY A;  1M2V B;  3EGX A;  3EGD A;  1PD0 A;  1PCX A;  2YRD A;  5KYN A;  2NUP A;  5KYX A;  3EG9 B; 
#chains in the Genus database with same CATH topology
 1G3S A;  4QT7 A;  3VS3 A;  5LJ3 g;  2LCL A;  3S3M A;  4FSX A;  1M2V A;  3QG1 A;  2CZ1 B;  3TU4 K;  1BI3 A;  1C6V X;  2C0O A;  3H41 A;  3I5S A;  1QKW A;  1M30 A;  1KHI A;  2BZY A;  4EMK A;  2QA4 T;  2NWM A;  3QUI A;  3QSU A;  5LJ5 e;  5KYW B;  3L1A A;  2LQW A;  5GMK l;  4M78 C;  3QPH A;  3M59 A;  2KE9 A;  2AKK A;  1G83 A;  4F7U E;  3OBY A;  2CP5 A;  4QQD A;  1OPK A;  2RQV A;  5CK9 A;  1TUC A;  4A4H A;  3BDU A;  4LD6 A;  2ROL A;  2LTO A;  1UFF A;  3TSZ A;  4E7K A;  3SWN B;  1NLO C;  3ZFJ A;  3KFV A;  3GPL A;  2O88 A;  1M2V B;  2EJ9 A;  4HCZ A;  2MOX A;  1XQH A;  5C6S A;  1UJ0 A;  2O9V A;  1OU8 A;  4EMK B;  4BE0 A;  2EYY A;  3TVT A;  1UG1 A;  4M78 E;  2A36 A;  3M5A A;  2CZ0 B;  2KI7 A;  2K5I A;  4RTV A;  4C92 E;  1KD1 R;  2EGC A;  4LD9 K;  3P8B B;  4UC4 A;  1UGR B;  3CC2 Q;  2DKG A;  3VUZ A;  5GAO m;  1RAB B;  2GGR A;  2X3W D;  3RER A;  4O5V A;  2QAZ A;  3VS0 A;  2BTT A;  1M1F A;  2RA2 A;  4AT1 B;  1QWE A;  1RAF B;  3V8K A;  1TXQ A;  2BZ8 A;  2DAQ A;  3E9F A;  3TQ7 P;  4XU2 A;  3CCS A;  3RES A;  3DLM A;  1TG0 A;  5KYY B;  2RHY A;  3M4Y A;  3X24 B;  1X6B A;  2LNH B;  1K73 R;  2M16 A;  3OQ5 A;  2FZK B;  1I4K 1;  3MJX A;  1VQM A;  2FEI A;  2DRM A;  3LH0 A;  1KQ1 A;  3MPU B;  2AKL A;  3OS1 A;  2EQM A;  1PHT A;  2PTK A;  2FL7 A;  5IAY A;  5IH2 A;  4N4I A;  2ESW A;  4XQ3 A;  1U06 A;  5CR2 A;  3PGG A;  2DNU A;  4AFQ C;  3CC2 T;  1F1B B;  4JJC A;  4KH1 B;  1O75 A;  2YXY A;  4HA8 A;  2X4X A;  5GAM h;  2ZPF B;  3C12 A;  4RTZ A;  4X9C A;  4JDS A;  3JCM J;  1ZSG A;  1PKS A;  4C0Z A;  4ORZ A;  3LH5 A;  1MHN A;  2C06 A;  1YWO A;  2Z0W A;  3PFS A;  1NEB A;  1IRX A;  4C0F A;  1K76 A;  2DXC A;  2JTE A;  3MO8 A;  1K0S A;  1RUW A;  2FO0 A;  1YJW A;  2VXF A;  2OAU A;  1UGP B;  2CP2 A;  1EIF A;  3P8H A;  1Y96 B;  2FVU A;  5KYU A;  3CC4 Q;  1M4Z A;  1KQS S;  2QQA A;  1BCM A;  4N0A C;  5HY6 A;  5GAN 3;  3EHR A;  2VGM A;  2L5Q A;  1YJ9 Q;  3OW2 S;  3HP9 A;  2HZY A;  4HVV A;  4JJD A;  3G71 A;  1K9A A;  3HFN A;  2NLU A;  2E4H A;  1WQ7 A;  1Q95 G;  5GJV B;  4DBH A;  3KUF A;  1FYN A;  1S72 A;  1VQ5 Q;  3CMA A;  3UPU A;  4WCI A;  1V1C A;  2F69 A;  2RMO A;  1N8R U;  3CCJ Q;  1QLY A;  1ACM B;  4C8Q D;  2EQK A;  2RN8 A;  2DTI A;  1D1B A;  5KYU B;  1K1Z A;  2B86 A;  2V1R A;  1MMA A;  1QVG S;  2MYS A;  4ELY C;  2FRY A;  4C5H A;  3S3O A;  3OYL A;  5LJ3 f;  1PRL C;  3CCM A;  3ZBD A;  1NJI R;  2EWN A;  4HCB A;  1FMV A;  1I5L A;  1BK2 A;  3CCU Q;  2VYT A;  4TVR A;  3JCM d;  2YUQ A;  1M3A A;  2IIM A;  1GCP A;  2E41 A;  2ZCF B;  3BY7 A;  2EQI A;  3C94 A;  2LJ0 A;  4JRI A;  3A8L B;  4GBQ A;  2LP5 A;  1YJ9 T;  1IO6 A;  5L23 A;  2NUT A;  1WNL A;  2K79 A;  1R77 A;  5CKB A;  2JW4 A;  3R6O A;  1P92 A;  4M7D D;  2RI5 A;  3UT1 A;  2E6N A;  3OS2 A;  3C4S A;  5D6X A;  1VQ5 T;  1W6X A;  1M1K R;  2KXD A;  4OMF B;  4PFP A;  1ZBX A;  2Y4X A;  5FU7 B;  3CCJ T;  2BKD N;  2G3R A;  2LJ3 A;  5LL6 S;  3OA6 A;  4OB2 B;  4X34 A;  2RD1 A;  4M7A D;  3H8Z A;  2MIO A;  2E6Z A;  4M77 F;  1WPY A;  4CC4 B;  5KYN A;  1JXM A;  1RAA B;  1Q81 R;  2A7Y A;  4HXJ A;  4BB7 A;  3JB9 I;  3QYG B;  1XTD A;  5GMK m;  1HYO A;  3JCM X;  4KRT A;  4NOY A;  2ENM A;  2YDL A;  2DL4 A;  5GAN d;  1NE8 A;  5KCO A;  3CCU T;  4ANJ A;  2CH4 A;  3H9N A;  4IUV A;  4QVD A;  3H0H A;  3M9Q A;  2D9T A;  2HEQ A;  4RMO A;  1VQO A;  1KC8 U;  4A4E A;  4PLI A;  2O2O A;  3M53 A;  1I8F A;  3QYH B;  5FU6 B;  3CXC P;  4VUB A;  4KGX B;  1GCQ A;  1W2B P;  2MCN A;  2DER A;  2LX9 A;  2PNI A;  1UGV A;  2LQK A;  2V8K A;  4WF2 A;  3G1J A;  4JZ3 A;  3FEO A;  2E64 A;  4PJO D;  2K9G A;  1YHQ Q;  2DM1 A;  1E6H A;  4BI8 B;  4DA4 A;  3CD6 Q;  1IGU A;  4F14 A;  2QQB A;  2DVE A;  3NMZ C;  2GTJ A;  5GAN g;  3JCM e;  1UEC A;  4B9W A;  2QEX Q;  3T9N A;  2R5A A;  1LOJ A;  4IUR A;  3UF4 A;  3MP6 A;  5GAO q;  2RO0 A;  2O4X A;  4OMN A;  4C8Q A;  3CCV A;  2DLP A;  3PE0 A;  3E2U A;  1Q82 R;  1I1J A;  2ROT A;  5I22 A;  2MPX C;  4E7H A;  3E1S A;  2J6K A;  1YIJ A;  1EZZ B;  4J5Y A;  4FYX B;  5IHN A;  4LN2 A;  1AWJ A;  2LQN A;  1H3H A;  1Y0M A;  3ER0 A;  2QGF B;  2KQW A;  3C95 A;  1VQ6 Q;  3L42 A;  2MK5 A;  4XAX B;  2CS7 A;  1YHQ T;  2O4X B;  4C8Q B;  4Q5W A;  2BE9 B;  2F5K A;  4EPC A;  2NUP A;  3CD6 T;  3M55 A;  3OS5 A;  1U5S A;  5IXB A;  1B34 A;  5GAN e;  1M1G A;  4E7S A;  3GNG A;  5A2Q E;  2QEX T;  1Y07 A;  1VOM A;  1WQW A;  1X69 A;  5J39 A;  4M75 A;  2DXB A;  1WXT A;  2M0O A;  3TSW A;  9ATC B;  1HJD A;  2LC4 A;  4M7A A;  1KFZ A;  4JLG A;  1M9S A;  4FT2 A;  3CBM A;  3FLG A;  2M51 A;  2OTJ Q;  1YNZ A;  1K9M C;  1TUD A;  1NBE B;  1M5Q 1;  1ZSZ C;  3TCJ A;  1ZBJ A;  4MZM A;  3NPF A;  1NJI C;  1PSF A;  1R0C B;  2YRC A;  1QP3 A;  4AFS C;  3BDL A;  1X2K A;  4NL3 A;  1BI0 A;  2NUP B;  3OYF A;  4JS4 A;  4M7D B;  2A3L A;  1VQ8 A;  4MDX A;  3M54 A;  1T0H A;  1O9S A;  4F04 B;  4KUI A;  1VIE A;  2DIQ A;  4M77 C;  3I55 T;  4M7A B;  1D1C A;  1ZUY A;  3OYC A;  2P84 A;  1VQK Q;  1MMG A;  2XDD A;  1M1K C;  1XNI A;  2L3Q A;  1N5Z A;  3RMS A;  2DBK A;  2ZGW A;  4ZTJ A;  2JZ2 A;  2P0P A;  4IIM A;  3CBO A;  5GMK e;  1K8A C;  1GBQ A;  3I56 A;  3JRZ A;  1RAE B;  3I5R A;  3CCQ Q;  1Q7Y U;  2OTJ T;  1JXO A;  3RNJ A;  2DBM A;  4OP0 A;  4M77 E;  5FRM A;  3NGP A;  3TEE A;  5IXF A;  4OB0 B;  4MZT A;  1CSK A;  1QVP A;  4QW2 A;  4PJO B;  4M4Z A;  2P0K A;  3S6W A;  3GF5 A;  1GRI A;  2HAX A;  3G4S Q;  1E6G A;  2QYZ A;  4EMK C;  2RI2 A;  4J6Y A;  2HQH A;  1QVF A;  4JPB W;  5GAO r;  2PVO B;  4DOV A;  1WHK A;  2J05 A;  5LJ3 d;  2YT6 A;  1VQ4 Q;  2KT1 A;  2ABL A;  4ZN1 A;  1VQK T;  4MDW A;  4J9D A;  2LDM A;  1TUG B;  2VKN A;  3QJ6 A;  5KYW A;  2KT8 A;  1VQ7 T;  1PSE A;  2L2P A;  1MNE A;  4M78 D;  4ESR A;  2PU9 B;  3JCM V;  3X26 B;  3CCQ T;  1WX6 A;  4RTU A;  5EG2 A;  5KH6 A;  2DMO A;  1SEM A;  3A8H B;  3OYG A;  4KUD K;  1Q81 U;  4ZNX A;  1Y71 A;  1RAC B;  5D6W A;  1MMD A;  1PCX A;  2D8J A;  2E5K A;  2RHU A;  4JUV A;  2NUZ A;  4ME7 A;  3A8G B;  3HSB A;  3SWN A;  1JO8 A;  2E3H A;  2DTO A;  3LWI A;  5KCH A;  1ZUK A;  1BKB A;  3G4S T;  5GAN f;  4J9I A;  3VRY A;  2ZPG B;  2I2L A;  1WDX A;  4KH0 B;  1G3Y A;  3LWH A;  2DEQ A;  3JB9 D;  2RPN A;  3O5Z A;  2KSS A;  4F17 A;  5CQX A;  1HK9 A;  2F2X A;  3FIF A;  3OYM A;  1ABO A;  3CME Q;  4PJN A;  3OYA A;  1VQ4 T;  1I0C A;  4C8Q G;  3OS0 A;  2VWF A;  3GNF B;  2QQS A;  2FZC B;  2RK1 A;  1Z9Q A;  1TWB A;  5DM7 R;  2RF0 A;  1D0Z A;  5CVI A;  4J7I A;  4GLK A;  2VAS A;  2WAC A;  2E12 A;  1PM3 A;  3ZL7 C;  3EGD A;  2VVK A;  4A4F A;  2F2V A;  4OVA A;  5A0D A;  1VIF A;  3CXC A;  2CP7 A;  3HFO A;  3SFM A;  1W2B A;  3JCM b;  4C5I A;  1PWT A;  2JMA A;  5LJ3 e;  3MEV A;  3U23 A;  2XDP A;  2ZPH B;  3CCE A;  4DEX A;  3J80 E;  4J8O A;  5A0G A;  5KYY A;  2P4T A;  2FZG B;  2MWO A;  4M7D G;  5GAN 5;  1RAH B;  3KBG A;  5L8R E;  2DD4 A;  4F7U A;  4BI3 A;  1OV3 A;  2RH2 A;  2CRE A;  4M75 G;  3EGD B;  3FB9 A;  4HKE A;  1YJ9 A;  2DD5 A;  3X20 B;  4OGE A;  4M7A G;  3HKS A;  2PVD B;  3GOX A;  3UDC A;  1KHC A;  4Y91 A;  4MMK A;  3MEW A;  2DJQ A;  2JJ9 A;  1OX8 A;  4E2F B;  2GFA A;  4E7Z A;  3G6E Q;  2BE7 D;  5FRN A;  1SHF A;  3GP8 A;  2FYK A;  3JCM Q;  2KY9 A;  4JRP A;  1FXX A;  2GBQ A;  2RHX A;  2L0A A;  3V8J A;  4C92 A;  2W10 A;  2HSP A;  4FU6 A;  4XU1 A;  5GJW B;  4F7U B;  1UTI A;  2CDT A;  4PKC C;  3Q1J A;  1Y96 A;  1M2O A;  3CCL A;  4ATO A;  2DXT A;  4E7I A;  4A4G A;  3CCU A;  2E3I A;  1XJW B;  1B07 A;  4J9H A;  1LCK A;  2K3Y A;  1T3S A;  3LX7 A;  2XKO C;  3D7S B;  2K2M A;  3H0F A;  1IGQ A;  2R58 A;  4M78 B;  5C0M A;  3M0T A;  1GFC A;  1SSF A;  3OYK A;  1VQ9 A;  1U8R A;  4C92 B;  2DZ9 A;  3CBP A;  5KE2 A;  1RI0 A;  2E1H A;  3PMT A;  3G6E T;  1UE9 A;  1Q86 U;  2ZPE B;  4M75 F;  1VQP A;  3OYI A;  3RKX A;  3EG3 A;  2YLC A;  2KYM A;  4C0G A;  4AFZ C;  1SRL A;  1WA7 A;  4XK8 E;  1LNX A;  4KGV B;  2HBW A;  2EVR A;  5CO7 A;  3CC7 A;  2J6O A;  3M57 A;  2KRN A;  3PNW C;  1YI2 A;  2EQU A;  4A63 B;  1UEB A;  5GAM d;  3VS2 A;  2DX1 A;  4A53 A;  1WZO A;  3DLL A;  1RLP C;  1FX7 A;  1QVF P;  2P0Q A;  1LVK A;  3RKW A;  1M27 C;  3UWN A;  5IN1 A;  4CI0 C;  5GAO p;  1AOJ A;  1HSQ A;  3HL8 A;  4RKU E;  2JS2 A;  1U1S A;  1QKX A;  1ZA1 B;  4C5G A;  1K9M R;  1M8V A;  8ATC B;  1YBY A;  3CCS Q;  2COZ A;  1W70 A;  3CD6 A;  5LJ5 j;  2F1L A;  3OYJ A;  5D6Y A;  1M90 R;  2HQE A;  3CC4 T;  1EFN A;  5GAM g;  1PNJ A;  1VQM Q;  3PMI A;  3QKJ A;  4QVC A;  4R55 A;  2L3S A;  4IKF A;  1SG5 A;  3CPF A;  3EG2 A;  2EYW A;  2K5L A;  1NPR A;  2RB6 A;  3JCM c;  3J81 E;  2LNV A;  4B9X A;  1SF9 A;  1NPP A;  2FHD A;  2XU8 A;  3BFM A;  3EHQ A;  1ZUU A;  5FWB A;  3CCR A;  4PNO A;  4PFZ A;  2AHJ B;  2LZ6 B;  1YJN Q;  2EJG A;  2MF2 A;  1OU9 A;  2HDA A;  2GQI A;  2J06 A;  4C0D C;  2X35 A;  2JMC A;  1K8A R;  5I21 A;  2DL7 A;  5CCA A;  2KR3 A;  4HVW A;  1OZ2 A;  4J7F A;  2MWP A;  2D8H A;  1OYX A;  1YJW Q;  5J3B A;  3ULR B;  1SKU B;  2YUO A;  3I55 A;  1Z9Z A;  3SB2 A;  1X6G A;  1PKT A;  1BIA A;  4IUQ A;  2L89 A;  4J9B A;  1M8M A;  2YRV A;  5M9O A;  1B7T A;  3G71 Q;  2M9U A;  4CC7 A;  1CKB A;  4BY6 C;  1DJ7 B;  1X2Q A;  3HRS A;  2ZPB B;  2JT4 A;  5D7U A;  3NFC A;  2H3J A;  4JRK A;  4F7U G;  1FWZ A;  4OML A;  1S72 Q;  4RTW A;  4BE2 A;  3BE3 A;  4J6W A;  1KD1 U;  4FW2 A;  5FRO A;  2JM9 A;  2KRM A;  1YJN T;  4KT0 E;  4HT9 A;  5GAN 7;  1ABQ A;  4EDU A;  4R0K A;  2EW3 A;  3UAT A;  3L2U A;  1BU1 A;  2K4Y A;  5HK3 A;  4M75 C;  5I11 A;  2IVW A;  3M0R A;  1D1A A;  2M02 A;  1IHW A;  3LGF A;  4M78 G;  3LW5 E;  3CCM Q;  1YJW T;  3INZ A;  3CPW A;  4C92 G;  2EKH A;  2P4R A;  3H0I A;  4GY5 A;  2AT1 B;  2QK0 A;  3V7R A;  3VS5 A;  2RNA A;  2A08 A;  2DPP B;  2FPF A;  2YHT A;  4HVU A;  3QZ9 B;  3RIR A;  4FL6 A;  2X9H A;  2HQX A;  2OX7 A;  3JCM W;  1N6A A;  3G71 T;  1AHJ B;  1VQ7 A;  3E9G A;  2XID A;  1W1F A;  2KMT A;  1K73 U;  2ED0 A;  2EGE A;  3OYE A;  1JQQ A;  2RQU A;  4M75 E;  3VS1 A;  2DJZ A;  4P5N A;  2KAF A;  1UGQ B;  1YIT A;  1S72 T;  3EFS A;  5GAO n;  4ELZ C;  1G5V A;  1PRM C;  2OTL A;  4OB1 B;  1PD1 A;  2OAW A;  1OX9 A;  4JLI A;  3PIO A;  4M7D A;  2CSQ A;  2DFU A;  3ASK A;  2KEA A;  1QVF S;  1RLQ C;  1AWW A;  1YWP A;  3MEA A;  1VYT A;  4M77 D;  2RQR A;  3M0U A;  1TS9 A;  1TU0 B;  1WHH A;  4JRQ A;  2QA4 A;  4AG1 C;  1C1A A;  5GAN 2;  4LDV A;  4WTO B;  1PD0 A;  2YRD A;  3VUB A;  4OMM A;  2M1H A;  1M3B A;  2V8J A;  1ZQ1 A;  3VS6 A;  2OI3 A;  2KXC A;  1AZG B;  1VQO Q;  1WHL A;  2AZS A;  2CUB A;  2HSE B;  2SEM A;  3VYH B;  3VU3 C;  2CT3 A;  4R56 A;  4BE1 A;  1FMW A;  3PVL A;  3QJY A;  1M90 C;  3GIB A;  1VQ6 T;  4XTZ A;  1BCO A;  3P8D A;  2QQ9 A;  5LJ5 h;  4C92 F;  1V76 A;  2JTF A;  2C0T A;  2EYZ A;  2DYB A;  1JU5 C;  1IXD A;  2AZV A;  3I9Q A;  1X75 C;  1TTH B;  4FM4 B;  4IUP A;  3WVD B;  1QCO A;  4L59 A;  4PJO A;  2GNC A;  2D6F A;  1RAD B;  3LGL A;  3FDR A;  1MV3 A;  2D1X A;  3GBQ A;  3CCV Q;  2JS0 A;  1IZ6 A;  1IHV A;  1VA7 A;  1X43 A;  1KG1 A;  2QXF A;  5GAM f;  3LYI A;  2JXB A;  2EKO A;  1IRE B;  2RHI A;  1K0X A;  1YIJ Q;  1K9M U;  3A8O B;  4XU0 A;  2YSQ A;  4JZ4 A;  1NJI U;  2RQW A;  2X4J A;  3MCA B;  3ME9 A;  2QG9 B;  3SWN C;  2CZ6 B;  5CKD A;  1A0N B;  2QGG A;  3CXC S;  1RAI B;  2L8D A;  8AT1 B;  2MI6 A;  2YLB A;  1B3Q A;  2HKN A;  1W2B S;  1OOT A;  2G6F X;  4BDY A;  1QWF A;  2VC8 A;  2XG8 D;  2IG0 A;  1NG2 A;  2O9S A;  3RKY A;  1JRI A;  1OI1 A;  3EGX B;  4Z88 A;  4FW1 A;  2Y4Y A;  1ZSZ A;  1TOV A;  1RAG B;  1TSF A;  1WHM A;  2K6D A;  3VKI A;  1MND A;  2E70 A;  2K2V A;  3VJP A;  2AK5 A;  5A0L A;  1M1K U;  2QI2 A;  2A28 A;  4QQ6 A;  3RUX A;  3RR6 A;  3CCV T;  2CSI A;  4EIK A;  2RJD A;  1K8A U;  1GXI E;  4D8D A;  5LJ5 g;  4M77 A;  4KGZ B;  3NTK A;  3CC2 A;  2VB6 A;  3PTA A;  1UDL A;  3IQL A;  1Y7X A;  1YIJ T;  1C0M A;  2E65 A;  2K5F A;  3BW1 A;  2DE0 X;  4AG2 C;  3FJ5 A;  3N5B B;  2XMF A;  1ZSZ B;  2LT4 A;  1HXD A;  2EPD A;  4ZGJ B;  3L2R A;  4K11 A;  1VQ8 Q;  4E6R A;  4C5E A;  2K7A A;  4DOW A;  3J7A F;  1RI9 A;  5J26 A;  2DVJ A;  2GQV A;  2EJF A;  3MP1 A;  2DYI A;  3MKD A;  2J6F A;  2EQJ A;  4RUG A;  4FT4 A;  3OW2 P;  4M77 B;  4J83 A;  2XDB A;  4X1V A;  2DIL A;  2ZAE A;  4KUL A;  2COW A;  3OYN A;  1D0X A;  4RG2 A;  3LLR A;  3REB B;  2X4W A;  2QAS A;  2GCX A;  4X9D A;  3I56 Q;  1MUZ A;  3L2V A;  5ECA A;  4LUE A;  3THK A;  1VQL Q;  1IB8 A;  2A37 A;  4RTX A;  3PT9 A;  4PJJ A;  2ATC B;  4C92 C;  1KK7 A;  3CPW P;  2CZ7 B;  1Q82 U;  2KRO A;  1QVG P;  4HCK A;  3O8V A;  4QKU A;  3OSV A;  5GAN j;  1NYG A;  2XK0 A;  2LVM A;  3E19 A;  1D09 B;  2PZ1 A;  1BI1 A;  4IIO A;  1VQ8 T;  2DK3 A;  3I35 A;  1QMC A;  1QCN A;  5FW9 A;  3QDR B;  1K4U S;  1NLP C;  1VQN Q;  1KC8 R;  4LDU A;  5KYX A;  5IT9 E;  3MEU A;  1HD3 A;  2NYS A;  2YUP A;  1G2B A;  3X25 B;  2XIC A;  3CC4 A;  3V8L A;  4A4K A;  1AWX A;  4Y92 A;  3REA B;  3CME T;  1NEG A;  3NTH A;  5DLO A;  2LCC A;  3DKM A;  2LMJ A;  4D6W A;  1R0B G;  1UJY A;  2ECZ A;  2HL3 A;  2PVG B;  3QDF A;  5HK0 A;  3I56 T;  4MML A;  3CQT A;  1VQL T;  1VQ5 A;  2VXE A;  2DEU A;  4B6M A;  1M3C A;  3OY9 A;  1H8K A;  3L2Z A;  4M78 A;  3CCJ A;  1G3T A;  2O31 A;  4Z8A A;  4C8Q F;  5KYX B;  3M0P A;  3WXM B;  2K3X A;  2CH4 W;  2D0N A;  3TRE A;  2ED1 A;  2DXU A;  2HL5 C;  4A54 A;  4BDZ A;  5GMK j;  2GFU A;  1U3O A;  1VQN T;  4L6V 5;  4PJO G;  3VYG A;  3DB4 A;  1Q86 C;  4QVZ A;  5AT1 B;  3HRT A;  1AEY A;  2MAM A;  2AIR B;  2K57 A;  3QII A;  4XTV A;  3QWY A;  1ZX6 A;  1UHC A;  2BIV A;  3L2W A;  2FG0 A;  2JOY A;  1ARK A;  2YWW A;  3SHW A;  2EGA A;  3SDZ A;  1VYV A;  3HHT B;  4HCC A;  2RHZ A;  4NS5 A;  2E10 A;  1PG5 B;  2KYB A;  3OSS C;  4M7D F;  4OMP A;  1MMN A;  1KSW A;  4OMQ A;  3M0S A;  5FU7 C;  3OYY A;  2R5M A;  2HNI A;  4E7L A;  1U1T A;  2K3B A;  3M4G A;  1Y57 A;  2XHC A;  1N8R C;  2KVQ G;  1YJN A;  1UUE A;  3URG A;  1GFD A;  3RBB B;  2GTO A;  4ZTF A;  5IHK A;  2DZC A;  1UHF A;  2COY A;  4J6X A;  4O6J A;  4M7A F;  3A8M B;  3PIP A;  2RM4 A;  4OF1 A;  5CIU A;  2RJE A;  3OMC A;  3CCE Q;  1JEG A;  2QDY B;  1EX4 A;  2QQR A;  3VS4 A;  4BI4 A;  2V8I A;  1V29 B;  1WXB A;  1H92 A;  3G7Z A;  1WJQ A;  3HTR A;  5FU6 C;  2X51 A;  3FJP A;  2CUD A;  1ZHI A;  3VRZ A;  1WYX A;  1WJR A;  4RCB A;  3JCM h;  3QBY A;  3VS7 A;  1UGS B;  4XTY A;  5LJ5 f;  1LPL A;  2O01 E;  5DLQ E;  1G8X A;  4LDY A;  2JM8 A;  4M77 G;  1G3W A;  1PC0 A;  1X27 A;  4PJO F;  3JV3 A;  1JJ2 P;  2Y90 A;  2RJF A;  2EYX A;  4PLL A;  3L2Q A;  1YHQ A;  2JVV A;  4DBQ A;  1GBR A;  2ZZD A;  1KQ2 A;  4OB3 B;  5CKE A;  4LXC A;  4FYV B;  1AWO A;  3H6Z A;  2V1Q A;  3VV0 A;  3KXT A;  3OMG A;  2X3X D;  1GL5 A;  3CPW S;  2QEX A;  1KIK A;  2OJ2 A;  1Q7Y R;  1YFN A;  4ZN3 A;  1GCQ C;  1BBZ A;  5KE3 A;  5AYF A;  2LRQ A;  2JTM A;  3CCE T;  2IPO B;  2M0Y A;  2VV5 A;  3CCL Q;  1WGS A;  1JB0 E;  4JJB A;  2JUF A;  4PJL A;  1N9R A;  1I81 A;  1MV0 B;  4PL6 A;  2LCS A;  1ZA2 B;  4DEY A;  5GAN h;  4CRI A;  3MET A;  4D8K A;  1KC8 C;  2DRK A;  4N0A A;  4EMH A;  3JCM P;  5GAN 8;  2KDS A;  5LJ3 j;  4RCC A;  1VQ9 Q;  1VQ6 A;  3F70 A;  4EMG A;  3M56 A;  4C8Q C;  2JNG A;  2DA9 A;  2RK2 A;  2KBT A;  4ZGE B;  1KD1 C;  1BIB A;  4LUD A;  4GLM A;  4XTX A;  2HKQ B;  3HPW A;  1YCY A;  3QWX X;  1FMK A;  3CCS T;  1VQP Q;  2EBP A;  4M75 D;  3QHS A;  1X01 A;  2CP6 A;  5GAM e;  3JCM g;  3EG1 A;  4DQ2 A;  1VQM T;  2R57 A;  3JB9 J;  3CC7 Q;  3A1P A;  4JS5 A;  2PQW A;  2KNB B;  4CC2 A;  2QDL A;  1YI2 Q;  1KQS A;  2EAY A;  3CCL T;  3SEM A;  7AT1 B;  2EFI A;  3UA6 A;  1WIE A;  2NUT B;  4C8Q E;  2OTJ A;  3PVQ A;  5CKF A;  2WSC E;  4FYW B;  4XU3 A;  3CMA Q;  2BUD A;  3OW2 A;  3OYB A;  4Z02 A;  2DO3 A;  2CP0 A;  2LT1 A;  3V7S A;  4LDX A;  4M7D C;  4PK4 A;  2FPD A;  4LE9 A;  3EG0 A;  3EH2 A;  2SRC A;  2CT4 A;  1AD5 A;  3GLX A;  4V2S A;  1H64 1;  3AT1 B;  1K73 C;  2LX7 A;  5GMK h;  1T0J A;  1VQ9 T;  2DIG A;  4IUT A;  4CC3 A;  4BD3 A;  1WFW A;  3X28 B;  1NZ9 A;  3DB3 A;  1BI2 A;  4M7A C;  3UA7 A;  5I2S A;  1QVG A;  4RTY A;  5CKH A;  2F5T X;  1WHJ A;  1VQP T;  2A0F B;  4F16 A;  2EIF A;  1VQK A;  3NHN A;  4PFO A;  4M7D E;  1WLP B;  1YP5 A;  2CKK A;  2B8A A;  3QXE B;  1WI7 A;  2RJC A;  1D0Y A;  1AT1 B;  3CC7 T;  1R8O B;  5FWC A;  3SD4 A;  3CEY A;  1YI2 T;  1NM7 A;  4KBM B;  1X6O A;  3OYH A;  2H8H A;  4E7J A;  2GF7 A;  3OBW A;  4FSS A;  2JN0 A;  2KK4 A;  3CCQ A;  2PUK B;  3CMA T;  4M7A E;  3JB9 G;  3CCR Q;  5CQY A;  3OYD A;  4PJO C;  2V26 A;  1QQJ A;  2EYQ A;  3EH1 A;  5GAO l;  2HD0 A;  2RQT A;  3ZEH A;  2FB7 A;  4QQG A;  3EG9 A;  4BUG A;  2HMA A;  4C0D B;  3G4S A;  1WJS A;  2C0I A;  2X4Y A;  4F7U F;  2HCK A;  1JJ2 S;  1AVZ C;  3AHU A;  3CCM T;  4DBR A;  3I55 Q;  4RG8 A;  1T3L A;  3JB9 H;  4DBF A;  4L5G A;  1OPL A;  2ZPI B;  1LJO A;  4FYY B;  5CAI A;  1I5O B;  1VQ4 A;  1BYM A;  2DET A;  4PJO E;  4BAC A;  5GMK i;  4N4H A;  2XI9 A;  4PJM A;  3C0C A;  1OQK A;  2L3R A;  2MMP A;  4M78 F;  2YUN A;  4FCY A;  6AT1 B;  2DL3 A;  1Q7Y C;  3QZ5 B;  4YTL A;  1H3Z A;  5DY9 A;  4BY6 B;  3EG9 B;  2DL8 A;  4OMO A;  1WHG A;  1YCS B;  3CCR T;  5I2M A;  3A5Z B;  1N27 A;  2WSE E;  3WVE B;  3FRN A;  1OZ3 A;  4XTU A;  2VUB A;  4ZGD B;  3EAE A;  1WXU A;  4IUU A;  3EFO A;  4LDW A;  1E7O A;  5GAN 6;  1J3T A;  1B34 B;  2QTV A;  4J9G A;  1W4S A;  1OUL A;  1YN8 A;  2KRS A;  3EGX A;  2PUO B;  5IHI A;  2CP3 A;  1JBM A;  2DTH A;  3OB9 A;  2VGN A;  1UB4 A;  1D3B A;  1MGQ A;  3HRU A;  4M75 B;  3JB9 F;  1ZLM A;  1S1N A;  1SPK A;  1BB9 A;  2W0Z A;  1QP2 A;  3M58 A;  4J9F A;  4RTT A;  5LJ3 h;  3CME A;  1RL2 A;  1VQO T;  3JAM E;  3A98 A;  3FC3 A;  4E47 A;  1SHG A;  4AMC A;  4N4G A;  5LJ5 d;  1M90 U;  1VQ7 Q;  2RI3 A;  2CYZ B;  2I0N A;  1Q86 R;  1I07 A;  3EFO B;  1VQL A;  4JJN K;  2LQ8 A;  1YIT Q;  2QTX A;  3NTI A;  1Q81 C;  2WSF E;  1SRM A;  1XOV A;  3RMQ A;  4II1 A;  3EFR A;  2OTL Q;  3QO3 A;  5EC7 A;  1D3B B;  2KGT A;  4LNP A;  3MP8 A;  3MHX A;  4XTW A;  1CKA A;  4MZP A;  5GAM j;  1AZE A;  3JSC A;  1JJ2 A;  2H3E B;  2DF6 A;  4OGC A;  4FIB A;  1KJW A;  1N9S A;  3S3N A;  5FLX E;  3RDV A;  1VQN A;  4Z89 A;  3JCM f;  2QA4 Q;  3M0Q A;  1N8R R;  3V7C A;  1SSH A;  2DL5 A;  1VUB A;  4HT8 A;  1TH7 A;  1NYF A;  1VYU A;  1QCF A;  2FPE A;  2J7I A;  2F2W A;  5HCK A;  4Y28 E;  2E5Q A;  4J9E A;  4J9C A;  2D0Q B;  4AFU C;  1OEB A;  2FRW A;  2XD0 A;  2BZX A;  5GAN 4;  4C92 D;  1QW1 A;  1YIT T;  4NL2 A;  3EGU A;  3G6E A;  2L3P A;  1KQS P;  2HBP A;  1Q82 C;  2OTL T;  3R6N A;  2CGH A;  2LJ1 A;  5HKC A; 
#chains in the Genus database with same CATH homology
 1PD1 A;  3EH1 A;  3EFO B;  5KYW A;  1M2O A;  1M2V A;  2NUT B;  3EG9 A;  5KYY B;  5KYU B;  2YRC A;  3EGX B;  3EGD B;  3EFO A;  2NUP B;  5KYX B;  2QTV A;  2NUT A;  3EH2 A;  5KYW B;  5KYU A;  5KYY A;  1M2V B;  3EGX A;  3EGD A;  1PD0 A;  1PCX A;  2YRD A;  5KYN A;  2NUP A;  5KYX A;  3EG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...