2YRCA

Solution structure of the zf-sec23_sec24 from human sec23a
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
59
structure length
59
Chain Sequence
GSSGSSGEPVLCSRTTCRAVLNPLCQVDYRAKLWACNFCYQRNQFPPSYAGISELNQPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Protein transport protein Sec23A
publication title Solution structure of the zf-Sec23_Sec24 from human Sec23A
rcsb
source organism Homo sapiens
total genus 5
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2007-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04810 zf-Sec23_Sec24 Sec23/Sec24 zinc finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.380 Mainly Beta Roll SH3 type barrels. Zn-finger domain of Sec23/24 2yrcA00
3EG9B 2NUTA 3EGDA 5KYYA 3EFOB 3EG9A 5KYWB 3EH2A 5KYUB 1PCXA 1M2VB 3EFOA 5KYXB 5KYNA 5KYWA 2YRCA 1PD0A 5KYUA 2NUPB 1M2OA 1M2VA 1PD1A 2NUTB 3EH1A 3EGXB 5KYXA 2QTVA 2YRDA 2NUPA 5KYYB 3EGDB 3EGXA
chains in the Genus database with same CATH superfamily
4CI0C 4F7UA 3JCMb 3OYNA 4A4KA 1VYVA 5GANg 3OYMA 3CCJQ 4GY5A 2FPEA 3CXCA 2DEUA 3G7ZA 2LJ1A 4J9BA 4E7HA 4HCZA 2KNBB 5KYWA 2L89A 1WX6A 2ZGWA 2E6NA 3E9GA 1QVPA 3M0QA 3EG2A 5CVIA 3CCVQ 5HKCA 3ZEHA 1OU9A 3RR6A 4D8KA 1ZSGA 1N9RA 3GPLA 1SRMA 3S3MA 1B7TA 1N8RC 2RNAA 2YUOA 3L42A 1ZA2B 4FU6A 1VQ8A 4M77E 1JJ2S 2XG8D 4RTUA 4E6RA 4C8QF 1KQSS 2R58A 6AT1B 1MV3A 5A0LA 1WHJA 3JB9D 5KYYB 7AT1B 4UC4A 4AFZC 4RMOA 4LDVA 2JW4A 1UGPB 4XU0A 1KD1R 2RI5A 1VQNT 3OS1A 1R0CB 1UTIA 4M78B 1TWBA 4JDSA 2ZPBB 2RHXA 1QVFS 2LX9A 1NLOC 2Y90A 2JMCA 4M78D 1Y57A 2EJGA 1VOMA 3PNWC 2DBMA 1QVGP 3CCUT 3LGFA 5FWBA 2CP0A 4CC4B 1NM7A 3OYDA 4R56A 1Q7YR 3EAEA 2AT1B 3M0SA 5FW9A 3LLRA 1IGUA 1OQKA 5KCOA 4DOVA 4OVAA 2QG9B 2MAMA 2OI3A 1S72Q 2M1HA 4BDYA 2DVEA 1MGQA 4J6YA 4K11A 2YT6A 1YJWT 3I5SA 4JUVA 1H3ZA 1U06A 5CQYA 3OQ5A 2CREA 2V1QA 3M58A 3CCRQ 1M2VB 3M57A 2CGHA 1YBYA 1KG1A 2EQKA 4YTLA 5J39A 3QO3A 3O5ZA 4BDZA 3NTIA 3JB9G 4J9HA 4KRTA 3OYYA 1KD1U 1SKUB 3VKIA 4WTOB 1AOJA 4E7SA 3WVEB 2FZKB 2NUZA 5KYYA 2CP2A 2EIFA 3CCVA 1W4SA 1SF9A 4ESRA 4RKUE 5LJ5e 1BBZA 5GANf 2LCLA 1AHJB 3PT9A 1ZHIA 2XK0A 1YNZA 1Q7YU 4M78G 1WJSA 4XTZA 4M78A 3R6NA 3G6EQ 2MIOA 1X2QA 1VQKQ 1NZ9A 2MWPA 3MEUA 1YJNQ 5LL6S 3CCEA 4C0GA 1B3QA 5GAMd 3GBQA 3GNGA 1RAAB 4PJOF 2MF2A 1EIFA 2OJ2A 1M27C 2QASA 3H8ZA 2C06A 1QLYA 2LQNA 1RAHB 5A2QE 2EQMA 2XDPA 3SHWA 3VRZA 5CCAA 1V29B 1VIFA 5GAMj 3RERA 4FL6A 5FWCA 2OTJQ 2MPXC 2DL5A 4J9DA 2FL7A 1P92A 4R0KA 4CC7A 1M2VA 1PD1A 5IHKA 1HYOA 2M0OA 1UECA 5GAN5 3EHQA 3EGDB 2DILA 4BACA 2RA2A 2LP5A 2YLBA 5CKFA 4KH0B 1OULA 4FM4B 5KYUB 5GAOp 4EMHA 2HL3A 2BIVA 2LMJA 3JCMJ 4FYVB 2BKDN 1S72A 2KK4A 3QDRB 2YWWA 3CCRA 5LJ3h 4PJLA 2EYYA 1OV3A 2DFUA 3EFSA 5GAOq 2QEXT 3QZ5B 3EFRA 1YCYA 3HPWA 1PM3A 1UDLA 2DPPB 2E65A 2PTKA 2E6ZA 1AWJA 4M75F 2QGFB 2RQVA 3CCUQ 4BD3A 1PD0A 1QW1A 1D1BA 3KXTA 1Y07A 3L2UA 4XU1A 4LD6A 3SB2A 2LDMA 4M78C 3X20B 4DBRA 1VQ9T 3G1JA 3FLGA 1DJ7B 2XDBA 1WDXA 2G6FX 1BU1A 2RK1A 1QVGS 3MEWA 2F1LA 2SRCA 1D0YA 3REAB 4LN2A 1PG5B 1AWXA 1W1FA 3G6EA 1XJWB 1RAIB 1VQKA 4HCCA 4JLGA 4LDUA 3M4GA 2QQAA 3V8JA 3ZBDA 4IUUA 1WI7A 1YJNA 4ZTJA 4X9CA 4OGCA 5FU7B 5I21A 3M0PA 5IHIA 3ME9A 4E7KA 3M4YA 2RJDA 3EG3A 3EGDA 3ULRB 1C0MA 1LCKA 2D1XA 3CPWA 1G5VA 1OEBA 4JS5A 3A8OB 4C8QB 5KYUA 1ZBXA 3OSVA 4TVRA 1Q82C 4C8QD 1CKAA 2EAYA 2OTJA 4E7IA 2LTOA 3F70A 2PQWA 4ZN3A 2KDSA 3RBBB 2BZXA 3TU4K 1WLPB 4JPBW 1UEBA 1QWFA 3DKMA 3OMCA 1M1KC 5FRMA 2EYWA 4JRKA 4HT8A 2KBTA 3LW5E 2JTFA 3NGPA 9ATCB 1UGQB 3CMAT 3BFMA 3E1SA 4A4EA 1HD3A 3CC2Q 2JOYA 3JCMd 2EQUA 4OB0B 1BKBA 1TUCA 3PMTA 3CBMA 1KQ1A 1IHWA 2O01E 4M7DF 1SSFA 2QGGA 3JCMW 2K7AA 4X34A 3RIRA 3CBOA 4N0AA 2DK3A 3CPWP 4ATOA 3RNJA 2ESWA 1MUZA 5CQXA 4DA4A 1NLPC 2DVJA 3DB3A 3MPUB 2QXFA 2L8DA 1OZ3A 3EG9B 4OMQA 3QBYA 3C4SA 2LZ6B 4J6WA 4Q5WA 5J26A 3OYJA 2D8JA 3DLMA 3TVTA 2VGNA 2E1HA 4E7JA 1VYTA 4FIBA 4WF2A 1I8FA 5GMKh 5KE2A 2PU9B 2XIDA 4C8QG 2RHZA 3HRUA 4C8QA 4PJNA 1WHKA 2K79A 2RH2A 1NYGA 4EDUA 1KSWA 1MMDA 4XU3A 1QP3A 3EH2A 3CCQT 3VUZA 3FJ5A 1OYXA 4J7FA 2QEXQ 1JEGA 2K5FA 2J06A 1WJRA 3G71T 4OMNA 4KH1B 1VQLA 1VQ6Q 1K9AA 2KYMA 2V8JA 3A8GB 2KEAA 4AMCA 1FWZA 1M8MA 3V8LA 1K73R 5FU6B 1LOJA 2DL8A 1G3YA 2E70A 2LVMA 1IGQA 1R77A 1R0BG 1WXBA 3TSWA 1ARKA 1D1AA 2DLPA 2VKNA 5IXFA 4PJOB 1GFDA 2WSEE 3CCET 2VYTA 2LQWA 4JJBA 2DZ9A 3GP8A 2EW3A 4PJOD 1BI1A 2HBPA 3QPHA 3MO8A 3OW2A 3WVDB 1W6XA 1PKTA 1PKSA 3EG9A 3I55A 3L2WA 4DBFA 2IPOB 3CC2A 2X4JA 2E3HA 4J9EA 2RQTA 4N0AC 2X35A 4KGVB 2H8HA 3ZL7C 3QHSA 4HXJA 3CD6Q 3HP9A 2O88A 4OGEA 4EMGA 3GOXA 5LJ5g 1MV0B 2GGRA 2KY9A 1KD1C 2DA9A 2AZVA 2GFUA 2DD4A 4C5IA 3M53A 5FU7C 1K8AC 4EPCA 5KYWB 2X3XD 1K73U 2DTHA 2PVOB 1WJQA 2DXCA 2X3WD 1UHFA 4QQGA 2PUKB 1UGVA 2V1RA 4C8QC 2DEQA 2X4WA 4LDXA 2IG0A 3J7AF 1Q7YC 1UE9A 3CMAQ 4IIMA 1GBRA 4M75B 4MMLA 1BI0A 3OW2P 4FCYA 2MK5A 4J5YA 4M75D 2YRCA 2G3RA 2ECZA 1K76A 4JJDA 2L5QA 4PJOG 4V2SA 2DXTA 4XTYA 4PJOA 2K4YA 2JM8A 4C0FA 2GNCA 1X75C 4L6V5 4PNOA 3RKXA 1WHHA 5GAMe 3P8DA 1VQ6A 1JU5C 1WXTA 3UT1A 1KHCA 4RUGA 5A0DA 2PNIA 2LT1A 3M54A 1KJWA 4BI4A 1RUWA 1AD5A 2DL3A 3MEVA 1V1CA 5IXBA 1M3BA 2HQXA 3G6ET 3HHTB 3CPWS 1BCMA 1I1JA 1SPKA 3M0TA 1NEGA 1RL2A 4RTXA 3NMZC 1YJNT 4JRQA 2D0NA 2J6OA 3QUIA 1IXDA 2PUOB 5I2MA 2CZ0B 4DOWA 2E5KA 1JXMA 4VUBA 2VXEA 2WSFE 1M9SA 3L2RA 3M0RA 5KYNA 2CSQA 2M9UA 3OMGA 1S1NA 1M2OA 4LE9A 2AHJB 5GANh 2JVVA 2RM4A 1E7OA 3CCQQ 2W10A 1QQJA 2OAWA 4R55A 1RAFB 3G71Q 3JSCA 2CH4W 4EMKB 2OTJT 1LVKA 1NJIC 2FZGB 1UUEA 2DKGA 2RPNA 2HEQA 2K3XA 3CD6A 4M75G 4ZGJB 3LX7A 4M75A 1BCOA 2DF6A 2J6FA 4C92F 3QJYA 1I07A 2GCXA 5CKDA 2E4HA 4WCIA 1Y0MA 2A7YA 2LC4A 3N5BB 3GF5A 3JAME 3CCEQ 4M7DB 2W0ZA 3VJPA 2D8HA 4JJCA 5D6YA 2E12A 4P5NA 5FU6C 4KT0E 1W70A 4J7IA 4M7DD 3PVQA 8ATCB 5LJ5f 1WYXA 4A54A 3CMAA 3CXCP 4HVWA 5KE3A 2E5QA 4OMLA 2M02A 4ELYC 2FYKA 1U3OA 1WHGA 1IREB 2COWA 4PJOC 1M90R 4F04B 4LD9K 2YRVA 3OYBA 1UB4A 4KUIA 3UA7A 3FRNA 2RJFA 1OPLA 2K2MA 2GF7A 4DBHA 2X4YA 3TQ7P 4KGXB 1PSEA 2QDLA 4M77F 3EG1A 4Y28E 1H641 3EH1A 4OMMA 2QQSA 2QI2A 3H41A 1PRMC 2NLUA 2CUDA 3QG1A 2GQIA 5GAOl 5DLOA 5GAOr 2YHTA 4LUDA 4RTYA 2F2VA 2FEIA 4ZNXA 2SEMA 4EMKA 4OB3B 2JM9A 5LJ3d 2CP6A 3I35A 5DM7R 3L2QA 1KC8R 3LH0A 5ECAA 2DYIA 1BI2A 3TREA 2CZ7B 1VQLT 1WQWA 3H0IA 5CKHA 5CAIA 3PIPA 3VRYA 5FROA 1HJDA 5LJ3j 4DBQA 1KK7A 2KGTA 2XHCA 1M90U 4M7DG 3VS1A 3CCQA 2HBWA 3H9NA 4M7DA 2CT4A 1Q81R 4M75C 3OW2S 3G71A 5I22A 3JCMe 1B34B 4PJOE 5CO7A 1I81A 3T9NA 3V7RA 2RO0A 4N4HA 5HK3A 3M56A 2VVKA 2YXYA 2KSSA 2RQRA 2O31A 2K3YA 2ZAEA 3FIFA 3FB9A 2VB6A 2V8KA 2F69A 2DETA 3I55T 5I2SA 3CC2T 2ROTA 4RG8A 2KQWA 1YITT 2LJ0A 2RN8A 2J05A 1KC8U 4F7UE 1T0JA 2FO0A 1UG1A 2CYZB 3U23A 5IH2A 2JMAA 3G4ST 2DXUA 2QK0A 4ZTFA 2AKKA 5KCHA 2ATCB 3JCMQ 1N5ZA 3A8MB 4QVZA 4L5GA 1NE8A 2P0PA 1M4ZA 3JRZA 4CC2A 2L3RA 2EKHA 1D0ZA 1AZGB 1Q81U 3VS6A 1N8RR 4IIOA 4N4GA 4L59A 1SRLA 4D6WA 2VWFA 2DJQA 4MDXA 1GRIA 3A1PA 3RESA 4D8DA 1AWWA 4Z02A 1D0XA 4ZGDB 4QW2A 4EMKC 1ZUKA 2RQUA 2DTIA 3AHUA 1WHLA 3CMEQ 2EPDA 3QWYA 1MNEA 2HQEA 1X6BA 1B34A 2IIMA 3L2VA 1LPLA 3ASKA 3MP1A 4M4ZA 2GTJA 3HSBA 1WXUA 2JS0A 4M7DC 1PWTA 2COZA 4JZ3A 4XK8E 1VQ6T 1F1BB 4BE0A 3C0CA 3VU3C 1WQ7A 4AFQC 2YUPA 3CXCS 4E2FB 1O9SA 2FZCB 2D9TA 2KR3A 1NPRA 2EQIA 3DLLA 1M30A 1YFNA 1N8RU 1RACB 2FB7A 4C5HA 2CT3A 2KYBA 2MCNA 4A4FA 3QYGB 1VUBA 3JCMX 1TUDA 1K73C 2MWOA 1RLPC 2RJCA 4RCCA 5GMKj 2QTVA 1EX4A 3O8VA 1WZOA 3P8BB 2X51A 5CKEA 1QCOA 2P0QA 4PLLA 2HKQB 2RHIA 2K5LA 1VQLQ 4AT1B 2KT8A 3OYEA 1M1GA 4GBQA 4XTUA 4C92B 5IT9E 3CD6T 2JTMA 3C12A 5DLQE 3MJXA 2PZ1A 2HNIA 1SHFA 5IAYA 3UDCA 4C92D 2IVWA 1C1AA 3FDRA 1R8OB 2KAFA 3E9FA 3TEEA 3BDLA 4O6JA 2DMOA 3AT1B 1GCQA 4M7DE 1M3AA 2K6DA 1K4US 4OP0A 1E6HA 2E3IA 4ORZA 1VQMA 4J8OA 3UWNA 3CC4Q 2DL4A 3M55A 5HCKA 3OS0A 3CCMA 2VV5A 3I55Q 1XQHA 4M78E 3LYIA 3ER0A 4XU2A 1ZQ1A 1IO6A 3CMEA 1YITQ 1UJYA 1TS9A 2CP7A 3DB4A 4MDWA 5GMKm 3LWIA 4IUTA 4M77B 1JXOA 3G4SQ 3D7SB 2E64A 3A5ZB 1VIEA 2K2VA 4M77D 2VUBA 2COYA 4IUPA 5IHNA 1CSKA 1X69A 4E7ZA 4ME7A 3JCMP 2HKNA 4HCKA 1TOVA 2Y4XA 3CEYA 1AEYA 1JJ2A 1NYFA 2AZSA 2QAZA 3REBB 5HK0A 8AT1B 3M59A 3C95A 5GMKi 4HA8A 1E6GA 1YJ9T 5EG2A 4XQ3A 1K9MR 4MZPA 4C92G 1GCPA 4C92A 4HKEA 1QCFA 3QDFA 3EHRA 2HSPA 2RMOA 1WIEA 4A63B 3JCMV 4KGZB 4RTZA 1MMAA 2NYSA 1AWOA 1G3SA 4HVUA 2DIGA 2LNVA 2H3EB 2LCCA 3THKA 5KH6A 4JRIA 3QJ6A 2EKOA 1YP5A 4LUEA 1ACMB 3PFSA 2HAXA 2I2LA 3JCMc 1GCQC 3MCAB 3OYAA 2C0OA 4RTTA 1I5LA 3OYFA 3PMIA 5GAN7 2CUBA 4M77G 1XOVA 4PFPA 4XTVA 3MKDA 4LDYA 4M77A 1U5SA 2JNGA 2YRDA 3NTHA 3OS2A 3UA6A 1K9MU 3PGGA 3I56A 4AG1C 2P4RA 3CC4A 5GAMf 2ED0A 2F5TX 5GANd 3WXMB 1Z9QA 4PK4A 2A28A 4J9GA 2CZ1B 4EIKA 1MMNA 2A36A 1YITA 2OX7A 3HL8A 1JRIA 2O4XB 1RADB 3SEMA 2EWNA 5GANj 3OA6A 4CRIA 3G4SA 1VQ7T 1K0XA 3JCMg 5LJ3e 1VQOT 3OS5A 1WHMA 2MOXA 4Z8AA 2FVUA 4LDWA 1JB0E 3GIBA 1KIKA 3VUBA 1M90C 3OYLA 2K9GA 5LJ5h 5D7UA 1RI0A 3OBWA 2NUPB 4XTXA 4Y92A 3S3NA 2NUTB 3EGXB 1SSHA 4C92C 1HXDA 2L2PA 5FLXE 2MMPA 1U8RA 4FSSA 1YI2T 1NBEB 2KRMA 2HL5C 2LRQA 1NPPA 4RTVA 1M5Q1 1G3WA 2EJ9A 2KMTA 2ZPFB 3VS2A 2M0YA 3PE0A 5J3BA 1D09B 2DERA 1BIAA 2DM1A 2KRSA 2DRMA 1KC8C 2F2XA 2JN0A 4OMPA 3CCLT 1JO8A 2DXBA 3V7SA 1Q86R 4FYYB 1VQ5A 1X2KA 1B07A 2CH4A 2JZ2A 1GBQA 2RHYA 3HFOA 2EVRA 3OY9A 4M77C 1TXQA 1G2BA 2DTOA 2DRKA 2V26A 4PLIA 3PTAA 2D6FA 2YUQA 1OOTA 2O4XA 1YJ9Q 1I0CA 2RD1A 3M0UA 3P8HA 4OMFB 1ZX6A 4ANJA 2B86A 4IURA 2DZCA 2L3QA 2CDTA 2QA4A 2R5MA 3UF4A 2DAQA 5GAN6 2QQ9A 1M1KU 1O75A 4NL3A 1Y7XA 4C92E 2CP5A 2EQJA 4C8QE 5DY9A 2HDAA 1PSFA 2EGCA 3X28B 1KFZA 3S6WA 1LJOA 2VC8A 4X9DA 2NUPA 3EGXA 2NUTA 2RK2A 4NOYA 2DX1A 1X43A 4ZGEB 4M7AF 4MZTA 2AKLA 4QQ6A 4IKFA 1Q86U 3I9QA 2ENMA 1VYUA 1H8KA 3BW1A 1VQMT 3OBYA 3J80E 2V8IA 1G83A 1ABQA 3VS3A 1YCSB 1M8VA 3CCMT 1GFCA 1QVGA 2FPFA 4OF1A 2F5KA 2LQ8A 1T3SA 2B8AA 2JXBA 3V7CA 1ZBJA 2BE9B 3CMET 2X9HA 4BI3A 4OMOA 2LJ3A 1OX9A 4FT4A 3JCMf 1IHVA 5D6WA 3JB9J 5GMKe 2DBKA 2QQRA 4J83A 4F14A 3HFNA 1QWEA 3R6OA 4PFOA 1VQPA 1X01A 1D3BB 2C0IA 1X6OA 3JB9I 2ZPGB 1VQ7Q 3VS5A 2DD5A 3FJPA 1VQOQ 3CC7A 5GJVB 1BI3A 1Q95G 1YIJT 2BZYA 1LNXA 3JV3A 1K8AR 2ZCFB 1YWOA 3QSUA 2KE9A 3RKWA 2O9VA 2DL7A 1TUGB 3M9QA 1PNJA 3SWNB 2ABLA 3PIOA 2KXDA 5C0MA 3VS7A 1YI2Q 3H0HA 1YJ9A 3HTRA 1MHNA 1ZLMA 2EGEA 2PVGB 1Y96B 2NWMA 4ELZC 3RKYA 4DEXA 1TH7A 2P0KA 2BUDA 3LH5A 2LCSA 2JT4A 1YHQT 4II1A 3LWHA 3VYGA 2A08A 1UGSB 3EFOB 1XTDA 3KFVA 3S3OA 1H3HA 3CCLQ 3SD4A 5A0GA 3URGA 1RAGB 3CQTA 4RG2A 1IB8A 4OB2B 3CCJA 2P84A 1HK9A 1YWPA 1JQQA 2CKKA 1EZZB 1FMVA 3GNFB 1K8AU 2PVDB 1N9SA 3I56T 2QYZA 4QKUA 3CC4T 1MNDA 2GFAA 2OAUA 4ZN1A 2ZPEB 2O2OA 3LGLA 1D3BA 3NFCA 1VQ4Q 3OSSC 1OPKA 3BE3A 2LNHB 1SHGA 4IUQA 2RI2A 2EYZA 1JBMA 2ED1A 1AZEA 5IN1A 2MI6A 4E47A 3CCSQ 4IUVA 4AFSC 4Y91A 1X6GA 4FYWB 2EJFA 3H6ZA 1SG5A 4J6XA 4Z89A 3SWNA 2Z0WA 1NJIR 1FYNA 1FXXA 2OTLT 4N4IA 3C94A 1VQ7A 1ABOA 1Y96A 1VQOA 5CK9A 5FRNA 1OX8A 4C5EA 1VQMQ 4LNPA 2L3PA 5C6SA 1NEBA 1WFWA 1W2BA 2JTEA 4LXCA 2K5IA 4PJMA 3CCMQ 4B9XA 5AT1B 4M75E 4JLIA 3L1AA 3X24B 3E2UA 3META 3EFOA 3QIIA 1C6VX 3NTKA 2C0TA 2D0QB 4PKCC 1TSFA 4GLKA 4BY6B 1YI2A 5CIUA 2J7IA 5GJWB 3RDVA 1KHIA 1VA7A 3VS0A 3RUXA 4F7UF 3H0FA 2GTOA 2RJEA 1K9MC 4HT9A 2A37A 2DJZA 4FYXB 3OYCA 1RAEB 2GBQA 2ZPHB 1BK2A 2XDDA 4GLMA 1U1SA 3PVLA 4E7LA 1VQ5T 1QP2A 5LJ3g 1A0NB 2WSCE 3IQLA 5GANe 2M51A 2CSIA 2YUNA 3GLXA 3CCLA 1MMGA 2JJ9A 1NJIU 1VQNQ 4QQDA 1YIJQ 2P4TA 3OYGA 2XMFA 1RI9A 2BTTA 5EC7A 2DNUA 3MP8A 1M1FA 1W2BP 2YLCA 1WGSA 3MEAA 2QA4T 3JB9H 2ZZDA 4JZ4A 4A4HA 4B9WA 2XU8A 4PJJA 3X25B 2DYBA 4F16A 2KVQG 1IRXA 2MYSA 2DE0X 2L3SA 2Y4YA 4M7AB 1FX7A 4O5VA 4XTWA 1VQ4A 2DIQA 2K3BA 4BI8B 1CKBA 3MP6A 3RMSA 4M7AD 1YHQQ 3SWNC 1OU8A 1YJWQ 4AG2C 1U1TA 2ROLA 2KT1A 2HZYA 1UFFA 4A53A 1X27A 1J3TA 3OYKA 3CCSA 4FW1A 5GAMg 3Q1JA 1G8XA 2VASA 1AVZC 5I11A 3I5RA 1OZ2A 2RI3A 3KBGA 5GAMh 4BUGA 2R57A 2CS7A 1GXIE 1OI1A 1PCXA 1V76A 2FHDA 5CR2A 3I56Q 4CC3A 4AFUC 1VQ8T 4PFZA 5M9OA 1EFNA 3OYHA 1TU0B 3HRSA 2QQBA 2A3LA 4JJNK 3KUFA 4C0DB 3M5AA 1VQPT 3V8KA 4KULA 3TCJA 1WA7A 5KYXB 2RHUA 3CC7T 2QDYB 2E41A 3E19A 1BB9A 3JB9F 2EFIA 1WPYA 3FEOA 3VYHB 5LJ5d 3HKSA 2LQKA 2HSEB 2OTLQ 2XD0A 1H92A 4M7AG 5L23A 4M7AA 1PC0A 1D1CA 3OB9A 1VQNA 1YIJA 4HCBA 1KQSA 4HVVA 2VGMA 1Q86C 5LJ5j 1ZSZB 1QKWA 4DEYA 4RCBA 2HQHA 5LJ3f 2JUFA 4OB1B 1BYMA 3CCUA 5L8RE 4M78F 2VXFA 3VS4A 4BE1A 3MHXA 3UPUA 4C5GA 2L0AA 2EBPA 2XKOC 4MMKA 3EGUA 5GAN4 4JRPA 4NS5A 1QVFA 4J9CA 5GAN2 1VQ5Q 3SFMA 1QMCA 4X1VA 5AYFA 2XICA 1GL5A 1YHQA 3A8LB 3CCJT 1YJWA 2ZPIB 4BY6C 3QWXX 1K0SA 1N6AA 3NPFA 2HCKA 1FMWA 1YN8A 2K57A 1TG0A 2H3JA 2BE7D 2HMAA 1JJ2P 2FPDA 2FRYA 3A98A 3CCVT 1FMKA 1Z9ZA 1KQSP 2QA4Q 2EYXA 2FG0A 5KYXA 1RABB 2EYQA 3FC3A 2RB6A 5CKBA 4F17A 4B6MA 2R5AA 3INZA 1WNLA 2J6KA 4A4GA 1VQ9Q 1ZA1B 1W2BS 3EG0A 3L2ZA 1Y71A 1KQ2A 2HD0A 3TSZA 5GAN8 2BZ8A 2F2WA 4KBMB 1QVFP 2YSQA 2DO3A 1ZSZA 5GAOm 3X26B 2RQWA 1I5OB 2YDLA 1IZ6A 1T3LA 1Q82R 3VV0A 3J81E 1PHTA 5GAOn 4M7AC 3JCMh 1TTHB 4FSXA 5HY6A 2OTLA 2KI7A 3A8HB 4F7UB 2EGAA 2A0FB 1XNIA 1VQ8Q 3SDZA 4KUDK 3QZ9B 4Z88A 1M1KR 1QKXA 2KROA 2M16A 2XI9A 2I0NA 1PRLC 2GQVA 2O9SA 3BY7A 1G3TA 1ZUYA 1ZUUA 5D6XA 1RLQC 2LX7A 4QVCA 4RTWA 2CP3A 3CBPA 1UHCA 3NHNA 4DQ2A 3OYIA 1VQPQ 2RF0A 1S72T 3CPFA 1I4K1 2X4XA 1NG2A 4BE2A 1BIBA 2E10A 4MZMA 3RMQA 4NL2A 3QKJA 4QT7A 3CC7Q 2CZ6B 3CCRT 3ZFJA 3BDUA 2KRNA 2LT4A 1QCNA 2AIRB 2FRWA 4C0DC 2WACA 1SEMA 4J9IA 3HRTA 4C0ZA 1Q82U 1HSQA 1N27A 4JS4A 2JS2A 3UATA 2AK5A 1Q81C 3QXEB 2QEXA 3QYHB 4M7AE 5GAN3 1VQ4T 1K1ZA 5GMKl 1AT1B 4XAXB 4FT2A 1UJ0A 1T0HA 4J9FA 1UGRB 4QVDA 1M3CA 4FW2A 1VQ9A 1VQKT 4BB7A 2QTXA 4F7UG 4PL6A 2KXCA 3CCST 1ZSZC
chains in the Genus database with same CATH topology
3EG9B 2NUTA 3EGDA 5KYYA 3EFOB 3EG9A 5KYWB 3EH2A 5KYUB 1PCXA 1M2VB 3EFOA 5KYXB 5KYNA 5KYWA 2YRCA 1PD0A 5KYUA 2NUPB 1M2OA 1M2VA 1PD1A 2NUTB 3EH1A 3EGXB 5KYXA 2QTVA 2YRDA 2NUPA 5KYYB 3EGDB 3EGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG9 B;  2NUT A;  3EGD A;  5KYY A;  3EFO B;  3EG9 A;  5KYW B;  3EH2 A;  5KYU B;  1PCX A;  1M2V B;  3EFO A;  5KYX B;  5KYN A;  5KYW A;  2YRC A;  1PD0 A;  5KYU A;  2NUP B;  1M2O A;  1M2V A;  1PD1 A;  2NUT B;  3EH1 A;  3EGX B;  5KYX A;  2QTV A;  2YRD A;  2NUP A;  5KYY B;  3EGD B;  3EGX A; 
#chains in the Genus database with same CATH topology
 4CI0 C;  4F7U A;  3JCM b;  3OYN A;  4A4K A;  1VYV A;  5GAN g;  3OYM A;  3CCJ Q;  4GY5 A;  2FPE A;  3CXC A;  2DEU A;  3G7Z A;  2LJ1 A;  4J9B A;  4E7H A;  4HCZ A;  2KNB B;  5KYW A;  2L89 A;  1WX6 A;  2ZGW A;  2E6N A;  3E9G A;  1QVP A;  3M0Q A;  3EG2 A;  5CVI A;  3CCV Q;  5HKC A;  3ZEH A;  1OU9 A;  3RR6 A;  4D8K A;  1ZSG A;  1N9R A;  3GPL A;  1SRM A;  3S3M A;  1B7T A;  1N8R C;  2RNA A;  2YUO A;  3L42 A;  1ZA2 B;  4FU6 A;  1VQ8 A;  4M77 E;  1JJ2 S;  2XG8 D;  4RTU A;  4E6R A;  4C8Q F;  1KQS S;  2R58 A;  6AT1 B;  1MV3 A;  5A0L A;  1WHJ A;  3JB9 D;  5KYY B;  7AT1 B;  4UC4 A;  4AFZ C;  4RMO A;  4LDV A;  2JW4 A;  1UGP B;  4XU0 A;  1KD1 R;  2RI5 A;  1VQN T;  3OS1 A;  1R0C B;  1UTI A;  4M78 B;  1TWB A;  4JDS A;  2ZPB B;  2RHX A;  1QVF S;  2LX9 A;  1NLO C;  2Y90 A;  2JMC A;  4M78 D;  1Y57 A;  2EJG A;  1VOM A;  3PNW C;  2DBM A;  1QVG P;  3CCU T;  3LGF A;  5FWB A;  2CP0 A;  4CC4 B;  1NM7 A;  3OYD A;  4R56 A;  1Q7Y R;  3EAE A;  2AT1 B;  3M0S A;  5FW9 A;  3LLR A;  1IGU A;  1OQK A;  5KCO A;  4DOV A;  4OVA A;  2QG9 B;  2MAM A;  2OI3 A;  1S72 Q;  2M1H A;  4BDY A;  2DVE A;  1MGQ A;  4J6Y A;  4K11 A;  2YT6 A;  1YJW T;  3I5S A;  4JUV A;  1H3Z A;  1U06 A;  5CQY A;  3OQ5 A;  2CRE A;  2V1Q A;  3M58 A;  3CCR Q;  1M2V B;  3M57 A;  2CGH A;  1YBY A;  1KG1 A;  2EQK A;  4YTL A;  5J39 A;  3QO3 A;  3O5Z A;  4BDZ A;  3NTI A;  3JB9 G;  4J9H A;  4KRT A;  3OYY A;  1KD1 U;  1SKU B;  3VKI A;  4WTO B;  1AOJ A;  4E7S A;  3WVE B;  2FZK B;  2NUZ A;  5KYY A;  2CP2 A;  2EIF A;  3CCV A;  1W4S A;  1SF9 A;  4ESR A;  4RKU E;  5LJ5 e;  1BBZ A;  5GAN f;  2LCL A;  1AHJ B;  3PT9 A;  1ZHI A;  2XK0 A;  1YNZ A;  1Q7Y U;  4M78 G;  1WJS A;  4XTZ A;  4M78 A;  3R6N A;  3G6E Q;  2MIO A;  1X2Q A;  1VQK Q;  1NZ9 A;  2MWP A;  3MEU A;  1YJN Q;  5LL6 S;  3CCE A;  4C0G A;  1B3Q A;  5GAM d;  3GBQ A;  3GNG A;  1RAA B;  4PJO F;  2MF2 A;  1EIF A;  2OJ2 A;  1M27 C;  2QAS A;  3H8Z A;  2C06 A;  1QLY A;  2LQN A;  1RAH B;  5A2Q E;  2EQM A;  2XDP A;  3SHW A;  3VRZ A;  5CCA A;  1V29 B;  1VIF A;  5GAM j;  3RER A;  4FL6 A;  5FWC A;  2OTJ Q;  2MPX C;  2DL5 A;  4J9D A;  2FL7 A;  1P92 A;  4R0K A;  4CC7 A;  1M2V A;  1PD1 A;  5IHK A;  1HYO A;  2M0O A;  1UEC A;  5GAN 5;  3EHQ A;  3EGD B;  2DIL A;  4BAC A;  2RA2 A;  2LP5 A;  2YLB A;  5CKF A;  4KH0 B;  1OUL A;  4FM4 B;  5KYU B;  5GAO p;  4EMH A;  2HL3 A;  2BIV A;  2LMJ A;  3JCM J;  4FYV B;  2BKD N;  1S72 A;  2KK4 A;  3QDR B;  2YWW A;  3CCR A;  5LJ3 h;  4PJL A;  2EYY A;  1OV3 A;  2DFU A;  3EFS A;  5GAO q;  2QEX T;  3QZ5 B;  3EFR A;  1YCY A;  3HPW A;  1PM3 A;  1UDL A;  2DPP B;  2E65 A;  2PTK A;  2E6Z A;  1AWJ A;  4M75 F;  2QGF B;  2RQV A;  3CCU Q;  4BD3 A;  1PD0 A;  1QW1 A;  1D1B A;  3KXT A;  1Y07 A;  3L2U A;  4XU1 A;  4LD6 A;  3SB2 A;  2LDM A;  4M78 C;  3X20 B;  4DBR A;  1VQ9 T;  3G1J A;  3FLG A;  1DJ7 B;  2XDB A;  1WDX A;  2G6F X;  1BU1 A;  2RK1 A;  1QVG S;  3MEW A;  2F1L A;  2SRC A;  1D0Y A;  3REA B;  4LN2 A;  1PG5 B;  1AWX A;  1W1F A;  3G6E A;  1XJW B;  1RAI B;  1VQK A;  4HCC A;  4JLG A;  4LDU A;  3M4G A;  2QQA A;  3V8J A;  3ZBD A;  4IUU A;  1WI7 A;  1YJN A;  4ZTJ A;  4X9C A;  4OGC A;  5FU7 B;  5I21 A;  3M0P A;  5IHI A;  3ME9 A;  4E7K A;  3M4Y A;  2RJD A;  3EG3 A;  3EGD A;  3ULR B;  1C0M A;  1LCK A;  2D1X A;  3CPW A;  1G5V A;  1OEB A;  4JS5 A;  3A8O B;  4C8Q B;  5KYU A;  1ZBX A;  3OSV A;  4TVR A;  1Q82 C;  4C8Q D;  1CKA A;  2EAY A;  2OTJ A;  4E7I A;  2LTO A;  3F70 A;  2PQW A;  4ZN3 A;  2KDS A;  3RBB B;  2BZX A;  3TU4 K;  1WLP B;  4JPB W;  1UEB A;  1QWF A;  3DKM A;  3OMC A;  1M1K C;  5FRM A;  2EYW A;  4JRK A;  4HT8 A;  2KBT A;  3LW5 E;  2JTF A;  3NGP A;  9ATC B;  1UGQ B;  3CMA T;  3BFM A;  3E1S A;  4A4E A;  1HD3 A;  3CC2 Q;  2JOY A;  3JCM d;  2EQU A;  4OB0 B;  1BKB A;  1TUC A;  3PMT A;  3CBM A;  1KQ1 A;  1IHW A;  2O01 E;  4M7D F;  1SSF A;  2QGG A;  3JCM W;  2K7A A;  4X34 A;  3RIR A;  3CBO A;  4N0A A;  2DK3 A;  3CPW P;  4ATO A;  3RNJ A;  2ESW A;  1MUZ A;  5CQX A;  4DA4 A;  1NLP C;  2DVJ A;  3DB3 A;  3MPU B;  2QXF A;  2L8D A;  1OZ3 A;  3EG9 B;  4OMQ A;  3QBY A;  3C4S A;  2LZ6 B;  4J6W A;  4Q5W A;  5J26 A;  3OYJ A;  2D8J A;  3DLM A;  3TVT A;  2VGN A;  2E1H A;  4E7J A;  1VYT A;  4FIB A;  4WF2 A;  1I8F A;  5GMK h;  5KE2 A;  2PU9 B;  2XID A;  4C8Q G;  2RHZ A;  3HRU A;  4C8Q A;  4PJN A;  1WHK A;  2K79 A;  2RH2 A;  1NYG A;  4EDU A;  1KSW A;  1MMD A;  4XU3 A;  1QP3 A;  3EH2 A;  3CCQ T;  3VUZ A;  3FJ5 A;  1OYX A;  4J7F A;  2QEX Q;  1JEG A;  2K5F A;  2J06 A;  1WJR A;  3G71 T;  4OMN A;  4KH1 B;  1VQL A;  1VQ6 Q;  1K9A A;  2KYM A;  2V8J A;  3A8G B;  2KEA A;  4AMC A;  1FWZ A;  1M8M A;  3V8L A;  1K73 R;  5FU6 B;  1LOJ A;  2DL8 A;  1G3Y A;  2E70 A;  2LVM A;  1IGQ A;  1R77 A;  1R0B G;  1WXB A;  3TSW A;  1ARK A;  1D1A A;  2DLP A;  2VKN A;  5IXF A;  4PJO B;  1GFD A;  2WSE E;  3CCE T;  2VYT A;  2LQW A;  4JJB A;  2DZ9 A;  3GP8 A;  2EW3 A;  4PJO D;  1BI1 A;  2HBP A;  3QPH A;  3MO8 A;  3OW2 A;  3WVD B;  1W6X A;  1PKT A;  1PKS A;  3EG9 A;  3I55 A;  3L2W A;  4DBF A;  2IPO B;  3CC2 A;  2X4J A;  2E3H A;  4J9E A;  2RQT A;  4N0A C;  2X35 A;  4KGV B;  2H8H A;  3ZL7 C;  3QHS A;  4HXJ A;  3CD6 Q;  3HP9 A;  2O88 A;  4OGE A;  4EMG A;  3GOX A;  5LJ5 g;  1MV0 B;  2GGR A;  2KY9 A;  1KD1 C;  2DA9 A;  2AZV A;  2GFU A;  2DD4 A;  4C5I A;  3M53 A;  5FU7 C;  1K8A C;  4EPC A;  5KYW B;  2X3X D;  1K73 U;  2DTH A;  2PVO B;  1WJQ A;  2DXC A;  2X3W D;  1UHF A;  4QQG A;  2PUK B;  1UGV A;  2V1R A;  4C8Q C;  2DEQ A;  2X4W A;  4LDX A;  2IG0 A;  3J7A F;  1Q7Y C;  1UE9 A;  3CMA Q;  4IIM A;  1GBR A;  4M75 B;  4MML A;  1BI0 A;  3OW2 P;  4FCY A;  2MK5 A;  4J5Y A;  4M75 D;  2YRC A;  2G3R A;  2ECZ A;  1K76 A;  4JJD A;  2L5Q A;  4PJO G;  4V2S A;  2DXT A;  4XTY A;  4PJO A;  2K4Y A;  2JM8 A;  4C0F A;  2GNC A;  1X75 C;  4L6V 5;  4PNO A;  3RKX A;  1WHH A;  5GAM e;  3P8D A;  1VQ6 A;  1JU5 C;  1WXT A;  3UT1 A;  1KHC A;  4RUG A;  5A0D A;  2PNI A;  2LT1 A;  3M54 A;  1KJW A;  4BI4 A;  1RUW A;  1AD5 A;  2DL3 A;  3MEV A;  1V1C A;  5IXB A;  1M3B A;  2HQX A;  3G6E T;  3HHT B;  3CPW S;  1BCM A;  1I1J A;  1SPK A;  3M0T A;  1NEG A;  1RL2 A;  4RTX A;  3NMZ C;  1YJN T;  4JRQ A;  2D0N A;  2J6O A;  3QUI A;  1IXD A;  2PUO B;  5I2M A;  2CZ0 B;  4DOW A;  2E5K A;  1JXM A;  4VUB A;  2VXE A;  2WSF E;  1M9S A;  3L2R A;  3M0R A;  5KYN A;  2CSQ A;  2M9U A;  3OMG A;  1S1N A;  1M2O A;  4LE9 A;  2AHJ B;  5GAN h;  2JVV A;  2RM4 A;  1E7O A;  3CCQ Q;  2W10 A;  1QQJ A;  2OAW A;  4R55 A;  1RAF B;  3G71 Q;  3JSC A;  2CH4 W;  4EMK B;  2OTJ T;  1LVK A;  1NJI C;  2FZG B;  1UUE A;  2DKG A;  2RPN A;  2HEQ A;  2K3X A;  3CD6 A;  4M75 G;  4ZGJ B;  3LX7 A;  4M75 A;  1BCO A;  2DF6 A;  2J6F A;  4C92 F;  3QJY A;  1I07 A;  2GCX A;  5CKD A;  2E4H A;  4WCI A;  1Y0M A;  2A7Y A;  2LC4 A;  3N5B B;  3GF5 A;  3JAM E;  3CCE Q;  4M7D B;  2W0Z A;  3VJP A;  2D8H A;  4JJC A;  5D6Y A;  2E12 A;  4P5N A;  5FU6 C;  4KT0 E;  1W70 A;  4J7I A;  4M7D D;  3PVQ A;  8ATC B;  5LJ5 f;  1WYX A;  4A54 A;  3CMA A;  3CXC P;  4HVW A;  5KE3 A;  2E5Q A;  4OML A;  2M02 A;  4ELY C;  2FYK A;  1U3O A;  1WHG A;  1IRE B;  2COW A;  4PJO C;  1M90 R;  4F04 B;  4LD9 K;  2YRV A;  3OYB A;  1UB4 A;  4KUI A;  3UA7 A;  3FRN A;  2RJF A;  1OPL A;  2K2M A;  2GF7 A;  4DBH A;  2X4Y A;  3TQ7 P;  4KGX B;  1PSE A;  2QDL A;  4M77 F;  3EG1 A;  4Y28 E;  1H64 1;  3EH1 A;  4OMM A;  2QQS A;  2QI2 A;  3H41 A;  1PRM C;  2NLU A;  2CUD A;  3QG1 A;  2GQI A;  5GAO l;  5DLO A;  5GAO r;  2YHT A;  4LUD A;  4RTY A;  2F2V A;  2FEI A;  4ZNX A;  2SEM A;  4EMK A;  4OB3 B;  2JM9 A;  5LJ3 d;  2CP6 A;  3I35 A;  5DM7 R;  3L2Q A;  1KC8 R;  3LH0 A;  5ECA A;  2DYI A;  1BI2 A;  3TRE A;  2CZ7 B;  1VQL T;  1WQW A;  3H0I A;  5CKH A;  5CAI A;  3PIP A;  3VRY A;  5FRO A;  1HJD A;  5LJ3 j;  4DBQ A;  1KK7 A;  2KGT A;  2XHC A;  1M90 U;  4M7D G;  3VS1 A;  3CCQ A;  2HBW A;  3H9N A;  4M7D A;  2CT4 A;  1Q81 R;  4M75 C;  3OW2 S;  3G71 A;  5I22 A;  3JCM e;  1B34 B;  4PJO E;  5CO7 A;  1I81 A;  3T9N A;  3V7R A;  2RO0 A;  4N4H A;  5HK3 A;  3M56 A;  2VVK A;  2YXY A;  2KSS A;  2RQR A;  2O31 A;  2K3Y A;  2ZAE A;  3FIF A;  3FB9 A;  2VB6 A;  2V8K A;  2F69 A;  2DET A;  3I55 T;  5I2S A;  3CC2 T;  2ROT A;  4RG8 A;  2KQW A;  1YIT T;  2LJ0 A;  2RN8 A;  2J05 A;  1KC8 U;  4F7U E;  1T0J A;  2FO0 A;  1UG1 A;  2CYZ B;  3U23 A;  5IH2 A;  2JMA A;  3G4S T;  2DXU A;  2QK0 A;  4ZTF A;  2AKK A;  5KCH A;  2ATC B;  3JCM Q;  1N5Z A;  3A8M B;  4QVZ A;  4L5G A;  1NE8 A;  2P0P A;  1M4Z A;  3JRZ A;  4CC2 A;  2L3R A;  2EKH A;  1D0Z A;  1AZG B;  1Q81 U;  3VS6 A;  1N8R R;  4IIO A;  4N4G A;  4L59 A;  1SRL A;  4D6W A;  2VWF A;  2DJQ A;  4MDX A;  1GRI A;  3A1P A;  3RES A;  4D8D A;  1AWW A;  4Z02 A;  1D0X A;  4ZGD B;  4QW2 A;  4EMK C;  1ZUK A;  2RQU A;  2DTI A;  3AHU A;  1WHL A;  3CME Q;  2EPD A;  3QWY A;  1MNE A;  2HQE A;  1X6B A;  1B34 A;  2IIM A;  3L2V A;  1LPL A;  3ASK A;  3MP1 A;  4M4Z A;  2GTJ A;  3HSB A;  1WXU A;  2JS0 A;  4M7D C;  1PWT A;  2COZ A;  4JZ3 A;  4XK8 E;  1VQ6 T;  1F1B B;  4BE0 A;  3C0C A;  3VU3 C;  1WQ7 A;  4AFQ C;  2YUP A;  3CXC S;  4E2F B;  1O9S A;  2FZC B;  2D9T A;  2KR3 A;  1NPR A;  2EQI A;  3DLL A;  1M30 A;  1YFN A;  1N8R U;  1RAC B;  2FB7 A;  4C5H A;  2CT3 A;  2KYB A;  2MCN A;  4A4F A;  3QYG B;  1VUB A;  3JCM X;  1TUD A;  1K73 C;  2MWO A;  1RLP C;  2RJC A;  4RCC A;  5GMK j;  2QTV A;  1EX4 A;  3O8V A;  1WZO A;  3P8B B;  2X51 A;  5CKE A;  1QCO A;  2P0Q A;  4PLL A;  2HKQ B;  2RHI A;  2K5L A;  1VQL Q;  4AT1 B;  2KT8 A;  3OYE A;  1M1G A;  4GBQ A;  4XTU A;  4C92 B;  5IT9 E;  3CD6 T;  2JTM A;  3C12 A;  5DLQ E;  3MJX A;  2PZ1 A;  2HNI A;  1SHF A;  5IAY A;  3UDC A;  4C92 D;  2IVW A;  1C1A A;  3FDR A;  1R8O B;  2KAF A;  3E9F A;  3TEE A;  3BDL A;  4O6J A;  2DMO A;  3AT1 B;  1GCQ A;  4M7D E;  1M3A A;  2K6D A;  1K4U S;  4OP0 A;  1E6H A;  2E3I A;  4ORZ A;  1VQM A;  4J8O A;  3UWN A;  3CC4 Q;  2DL4 A;  3M55 A;  5HCK A;  3OS0 A;  3CCM A;  2VV5 A;  3I55 Q;  1XQH A;  4M78 E;  3LYI A;  3ER0 A;  4XU2 A;  1ZQ1 A;  1IO6 A;  3CME A;  1YIT Q;  1UJY A;  1TS9 A;  2CP7 A;  3DB4 A;  4MDW A;  5GMK m;  3LWI A;  4IUT A;  4M77 B;  1JXO A;  3G4S Q;  3D7S B;  2E64 A;  3A5Z B;  1VIE A;  2K2V A;  4M77 D;  2VUB A;  2COY A;  4IUP A;  5IHN A;  1CSK A;  1X69 A;  4E7Z A;  4ME7 A;  3JCM P;  2HKN A;  4HCK A;  1TOV A;  2Y4X A;  3CEY A;  1AEY A;  1JJ2 A;  1NYF A;  2AZS A;  2QAZ A;  3REB B;  5HK0 A;  8AT1 B;  3M59 A;  3C95 A;  5GMK i;  4HA8 A;  1E6G A;  1YJ9 T;  5EG2 A;  4XQ3 A;  1K9M R;  4MZP A;  4C92 G;  1GCP A;  4C92 A;  4HKE A;  1QCF A;  3QDF A;  3EHR A;  2HSP A;  2RMO A;  1WIE A;  4A63 B;  3JCM V;  4KGZ B;  4RTZ A;  1MMA A;  2NYS A;  1AWO A;  1G3S A;  4HVU A;  2DIG A;  2LNV A;  2H3E B;  2LCC A;  3THK A;  5KH6 A;  4JRI A;  3QJ6 A;  2EKO A;  1YP5 A;  4LUE A;  1ACM B;  3PFS A;  2HAX A;  2I2L A;  3JCM c;  1GCQ C;  3MCA B;  3OYA A;  2C0O A;  4RTT A;  1I5L A;  3OYF A;  3PMI A;  5GAN 7;  2CUB A;  4M77 G;  1XOV A;  4PFP A;  4XTV A;  3MKD A;  4LDY A;  4M77 A;  1U5S A;  2JNG A;  2YRD A;  3NTH A;  3OS2 A;  3UA6 A;  1K9M U;  3PGG A;  3I56 A;  4AG1 C;  2P4R A;  3CC4 A;  5GAM f;  2ED0 A;  2F5T X;  5GAN d;  3WXM B;  1Z9Q A;  4PK4 A;  2A28 A;  4J9G A;  2CZ1 B;  4EIK A;  1MMN A;  2A36 A;  1YIT A;  2OX7 A;  3HL8 A;  1JRI A;  2O4X B;  1RAD B;  3SEM A;  2EWN A;  5GAN j;  3OA6 A;  4CRI A;  3G4S A;  1VQ7 T;  1K0X A;  3JCM g;  5LJ3 e;  1VQO T;  3OS5 A;  1WHM A;  2MOX A;  4Z8A A;  2FVU A;  4LDW A;  1JB0 E;  3GIB A;  1KIK A;  3VUB A;  1M90 C;  3OYL A;  2K9G A;  5LJ5 h;  5D7U A;  1RI0 A;  3OBW A;  2NUP B;  4XTX A;  4Y92 A;  3S3N A;  2NUT B;  3EGX B;  1SSH A;  4C92 C;  1HXD A;  2L2P A;  5FLX E;  2MMP A;  1U8R A;  4FSS A;  1YI2 T;  1NBE B;  2KRM A;  2HL5 C;  2LRQ A;  1NPP A;  4RTV A;  1M5Q 1;  1G3W A;  2EJ9 A;  2KMT A;  2ZPF B;  3VS2 A;  2M0Y A;  3PE0 A;  5J3B A;  1D09 B;  2DER A;  1BIA A;  2DM1 A;  2KRS A;  2DRM A;  1KC8 C;  2F2X A;  2JN0 A;  4OMP A;  3CCL T;  1JO8 A;  2DXB A;  3V7S A;  1Q86 R;  4FYY B;  1VQ5 A;  1X2K A;  1B07 A;  2CH4 A;  2JZ2 A;  1GBQ A;  2RHY A;  3HFO A;  2EVR A;  3OY9 A;  4M77 C;  1TXQ A;  1G2B A;  2DTO A;  2DRK A;  2V26 A;  4PLI A;  3PTA A;  2D6F A;  2YUQ A;  1OOT A;  2O4X A;  1YJ9 Q;  1I0C A;  2RD1 A;  3M0U A;  3P8H A;  4OMF B;  1ZX6 A;  4ANJ A;  2B86 A;  4IUR A;  2DZC A;  2L3Q A;  2CDT A;  2QA4 A;  2R5M A;  3UF4 A;  2DAQ A;  5GAN 6;  2QQ9 A;  1M1K U;  1O75 A;  4NL3 A;  1Y7X A;  4C92 E;  2CP5 A;  2EQJ A;  4C8Q E;  5DY9 A;  2HDA A;  1PSF A;  2EGC A;  3X28 B;  1KFZ A;  3S6W A;  1LJO A;  2VC8 A;  4X9D A;  2NUP A;  3EGX A;  2NUT A;  2RK2 A;  4NOY A;  2DX1 A;  1X43 A;  4ZGE B;  4M7A F;  4MZT A;  2AKL A;  4QQ6 A;  4IKF A;  1Q86 U;  3I9Q A;  2ENM A;  1VYU A;  1H8K A;  3BW1 A;  1VQM T;  3OBY A;  3J80 E;  2V8I A;  1G83 A;  1ABQ A;  3VS3 A;  1YCS B;  1M8V A;  3CCM T;  1GFC A;  1QVG A;  2FPF A;  4OF1 A;  2F5K A;  2LQ8 A;  1T3S A;  2B8A A;  2JXB A;  3V7C A;  1ZBJ A;  2BE9 B;  3CME T;  2X9H A;  4BI3 A;  4OMO A;  2LJ3 A;  1OX9 A;  4FT4 A;  3JCM f;  1IHV A;  5D6W A;  3JB9 J;  5GMK e;  2DBK A;  2QQR A;  4J83 A;  4F14 A;  3HFN A;  1QWE A;  3R6O A;  4PFO A;  1VQP A;  1X01 A;  1D3B B;  2C0I A;  1X6O A;  3JB9 I;  2ZPG B;  1VQ7 Q;  3VS5 A;  2DD5 A;  3FJP A;  1VQO Q;  3CC7 A;  5GJV B;  1BI3 A;  1Q95 G;  1YIJ T;  2BZY A;  1LNX A;  3JV3 A;  1K8A R;  2ZCF B;  1YWO A;  3QSU A;  2KE9 A;  3RKW A;  2O9V A;  2DL7 A;  1TUG B;  3M9Q A;  1PNJ A;  3SWN B;  2ABL A;  3PIO A;  2KXD A;  5C0M A;  3VS7 A;  1YI2 Q;  3H0H A;  1YJ9 A;  3HTR A;  1MHN A;  1ZLM A;  2EGE A;  2PVG B;  1Y96 B;  2NWM A;  4ELZ C;  3RKY A;  4DEX A;  1TH7 A;  2P0K A;  2BUD A;  3LH5 A;  2LCS A;  2JT4 A;  1YHQ T;  4II1 A;  3LWH A;  3VYG A;  2A08 A;  1UGS B;  3EFO B;  1XTD A;  3KFV A;  3S3O A;  1H3H A;  3CCL Q;  3SD4 A;  5A0G A;  3URG A;  1RAG B;  3CQT A;  4RG2 A;  1IB8 A;  4OB2 B;  3CCJ A;  2P84 A;  1HK9 A;  1YWP A;  1JQQ A;  2CKK A;  1EZZ B;  1FMV A;  3GNF B;  1K8A U;  2PVD B;  1N9S A;  3I56 T;  2QYZ A;  4QKU A;  3CC4 T;  1MND A;  2GFA A;  2OAU A;  4ZN1 A;  2ZPE B;  2O2O A;  3LGL A;  1D3B A;  3NFC A;  1VQ4 Q;  3OSS C;  1OPK A;  3BE3 A;  2LNH B;  1SHG A;  4IUQ A;  2RI2 A;  2EYZ A;  1JBM A;  2ED1 A;  1AZE A;  5IN1 A;  2MI6 A;  4E47 A;  3CCS Q;  4IUV A;  4AFS C;  4Y91 A;  1X6G A;  4FYW B;  2EJF A;  3H6Z A;  1SG5 A;  4J6X A;  4Z89 A;  3SWN A;  2Z0W A;  1NJI R;  1FYN A;  1FXX A;  2OTL T;  4N4I A;  3C94 A;  1VQ7 A;  1ABO A;  1Y96 A;  1VQO A;  5CK9 A;  5FRN A;  1OX8 A;  4C5E A;  1VQM Q;  4LNP A;  2L3P A;  5C6S A;  1NEB A;  1WFW A;  1W2B A;  2JTE A;  4LXC A;  2K5I A;  4PJM A;  3CCM Q;  4B9X A;  5AT1 B;  4M75 E;  4JLI A;  3L1A A;  3X24 B;  3E2U A;  3MET A;  3EFO A;  3QII A;  1C6V X;  3NTK A;  2C0T A;  2D0Q B;  4PKC C;  1TSF A;  4GLK A;  4BY6 B;  1YI2 A;  5CIU A;  2J7I A;  5GJW B;  3RDV A;  1KHI A;  1VA7 A;  3VS0 A;  3RUX A;  4F7U F;  3H0F A;  2GTO A;  2RJE A;  1K9M C;  4HT9 A;  2A37 A;  2DJZ A;  4FYX B;  3OYC A;  1RAE B;  2GBQ A;  2ZPH B;  1BK2 A;  2XDD A;  4GLM A;  1U1S A;  3PVL A;  4E7L A;  1VQ5 T;  1QP2 A;  5LJ3 g;  1A0N B;  2WSC E;  3IQL A;  5GAN e;  2M51 A;  2CSI A;  2YUN A;  3GLX A;  3CCL A;  1MMG A;  2JJ9 A;  1NJI U;  1VQN Q;  4QQD A;  1YIJ Q;  2P4T A;  3OYG A;  2XMF A;  1RI9 A;  2BTT A;  5EC7 A;  2DNU A;  3MP8 A;  1M1F A;  1W2B P;  2YLC A;  1WGS A;  3MEA A;  2QA4 T;  3JB9 H;  2ZZD A;  4JZ4 A;  4A4H A;  4B9W A;  2XU8 A;  4PJJ A;  3X25 B;  2DYB A;  4F16 A;  2KVQ G;  1IRX A;  2MYS A;  2DE0 X;  2L3S A;  2Y4Y A;  4M7A B;  1FX7 A;  4O5V A;  4XTW A;  1VQ4 A;  2DIQ A;  2K3B A;  4BI8 B;  1CKB A;  3MP6 A;  3RMS A;  4M7A D;  1YHQ Q;  3SWN C;  1OU8 A;  1YJW Q;  4AG2 C;  1U1T A;  2ROL A;  2KT1 A;  2HZY A;  1UFF A;  4A53 A;  1X27 A;  1J3T A;  3OYK A;  3CCS A;  4FW1 A;  5GAM g;  3Q1J A;  1G8X A;  2VAS A;  1AVZ C;  5I11 A;  3I5R A;  1OZ2 A;  2RI3 A;  3KBG A;  5GAM h;  4BUG A;  2R57 A;  2CS7 A;  1GXI E;  1OI1 A;  1PCX A;  1V76 A;  2FHD A;  5CR2 A;  3I56 Q;  4CC3 A;  4AFU C;  1VQ8 T;  4PFZ A;  5M9O A;  1EFN A;  3OYH A;  1TU0 B;  3HRS A;  2QQB A;  2A3L A;  4JJN K;  3KUF A;  4C0D B;  3M5A A;  1VQP T;  3V8K A;  4KUL A;  3TCJ A;  1WA7 A;  5KYX B;  2RHU A;  3CC7 T;  2QDY B;  2E41 A;  3E19 A;  1BB9 A;  3JB9 F;  2EFI A;  1WPY A;  3FEO A;  3VYH B;  5LJ5 d;  3HKS A;  2LQK A;  2HSE B;  2OTL Q;  2XD0 A;  1H92 A;  4M7A G;  5L23 A;  4M7A A;  1PC0 A;  1D1C A;  3OB9 A;  1VQN A;  1YIJ A;  4HCB A;  1KQS A;  4HVV A;  2VGM A;  1Q86 C;  5LJ5 j;  1ZSZ B;  1QKW A;  4DEY A;  4RCB A;  2HQH A;  5LJ3 f;  2JUF A;  4OB1 B;  1BYM A;  3CCU A;  5L8R E;  4M78 F;  2VXF A;  3VS4 A;  4BE1 A;  3MHX A;  3UPU A;  4C5G A;  2L0A A;  2EBP A;  2XKO C;  4MMK A;  3EGU A;  5GAN 4;  4JRP A;  4NS5 A;  1QVF A;  4J9C A;  5GAN 2;  1VQ5 Q;  3SFM A;  1QMC A;  4X1V A;  5AYF A;  2XIC A;  1GL5 A;  1YHQ A;  3A8L B;  3CCJ T;  1YJW A;  2ZPI B;  4BY6 C;  3QWX X;  1K0S A;  1N6A A;  3NPF A;  2HCK A;  1FMW A;  1YN8 A;  2K57 A;  1TG0 A;  2H3J A;  2BE7 D;  2HMA A;  1JJ2 P;  2FPD A;  2FRY A;  3A98 A;  3CCV T;  1FMK A;  1Z9Z A;  1KQS P;  2QA4 Q;  2EYX A;  2FG0 A;  5KYX A;  1RAB B;  2EYQ A;  3FC3 A;  2RB6 A;  5CKB A;  4F17 A;  4B6M A;  2R5A A;  3INZ A;  1WNL A;  2J6K A;  4A4G A;  1VQ9 Q;  1ZA1 B;  1W2B S;  3EG0 A;  3L2Z A;  1Y71 A;  1KQ2 A;  2HD0 A;  3TSZ A;  5GAN 8;  2BZ8 A;  2F2W A;  4KBM B;  1QVF P;  2YSQ A;  2DO3 A;  1ZSZ A;  5GAO m;  3X26 B;  2RQW A;  1I5O B;  2YDL A;  1IZ6 A;  1T3L A;  1Q82 R;  3VV0 A;  3J81 E;  1PHT A;  5GAO n;  4M7A C;  3JCM h;  1TTH B;  4FSX A;  5HY6 A;  2OTL A;  2KI7 A;  3A8H B;  4F7U B;  2EGA A;  2A0F B;  1XNI A;  1VQ8 Q;  3SDZ A;  4KUD K;  3QZ9 B;  4Z88 A;  1M1K R;  1QKX A;  2KRO A;  2M16 A;  2XI9 A;  2I0N A;  1PRL C;  2GQV A;  2O9S A;  3BY7 A;  1G3T A;  1ZUY A;  1ZUU A;  5D6X A;  1RLQ C;  2LX7 A;  4QVC A;  4RTW A;  2CP3 A;  3CBP A;  1UHC A;  3NHN A;  4DQ2 A;  3OYI A;  1VQP Q;  2RF0 A;  1S72 T;  3CPF A;  1I4K 1;  2X4X A;  1NG2 A;  4BE2 A;  1BIB A;  2E10 A;  4MZM A;  3RMQ A;  4NL2 A;  3QKJ A;  4QT7 A;  3CC7 Q;  2CZ6 B;  3CCR T;  3ZFJ A;  3BDU A;  2KRN A;  2LT4 A;  1QCN A;  2AIR B;  2FRW A;  4C0D C;  2WAC A;  1SEM A;  4J9I A;  3HRT A;  4C0Z A;  1Q82 U;  1HSQ A;  1N27 A;  4JS4 A;  2JS2 A;  3UAT A;  2AK5 A;  1Q81 C;  3QXE B;  2QEX A;  3QYH B;  4M7A E;  5GAN 3;  1VQ4 T;  1K1Z A;  5GMK l;  1AT1 B;  4XAX B;  4FT2 A;  1UJ0 A;  1T0H A;  4J9F A;  1UGR B;  4QVD A;  1M3C A;  4FW2 A;  1VQ9 A;  1VQK T;  4BB7 A;  2QTX A;  4F7U G;  4PL6 A;  2KXC A;  3CCS T;  1ZSZ C; 
#chains in the Genus database with same CATH homology
 3EG9 B;  2NUT A;  3EGD A;  5KYY A;  3EFO B;  3EG9 A;  5KYW B;  3EH2 A;  5KYU B;  1PCX A;  1M2V B;  3EFO A;  5KYX B;  5KYN A;  5KYW A;  2YRC A;  1PD0 A;  5KYU A;  2NUP B;  1M2O A;  1M2V A;  1PD1 A;  2NUT B;  3EH1 A;  3EGX B;  5KYX A;  2QTV A;  2YRD A;  2NUP A;  5KYY B;  3EGD B;  3EGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...