1T0HA

Crystal structure of the rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0hA00
2FPFA 4J9GA 2E5KA 2J7IA 3NPFA 1T3SA 2BZXA 2KT8A 1T3LA 1UTIA 4LE9A 2ROLA 1CKAA 2YUOA 2RQRA 2J6KA 2KBTA 1U5SA 2KR3A 2RQUA 1FYNA 2VVKA 1WDXA 2AKKA 2KNBB 1VYTA 3CQTA 1OEBA 2DVJA 2DBKA 1G83A 2EYXA 3IQLA 3EG0A 1WFWA 3A98A 4HVVA 2YUNA 1FMKA 4AG1C 5IXFA 1KFZA 1UHFA 4R0KA 1CKBA 2CUDA 1V1CA 2DBMA 1JEGA 1VYVA 2O88A 1MV0B 1J3TA 2ECZA 3PVLA 3C0CA 3M0SA 4RTWA 1UJ0A 3VRZA 4DEYA 1NLOC 3REBB 2D1XA 4IIOA 1GBQA 4RTXA 2DL5A 2GBQA 2CUBA 1S1NA 3ZL7C 2L2PA 2DRMA 2DX1A 2JT4A 2EQIA 2GTOA 3O5ZA 2P4RA 2RNAA 2JXBA 2LNHB 1MV3A 1NEGA 1PKTA 3VS5A 2CH4W 1RI9A 2C0OA 4LN2A 2H8HA 1AZEA 4CC4B 1SRLA 4JZ4A 4RTVA 2K6DA 2X3WD 2LQNA 1GCPA 1PWTA 2KXDA 4AFUC 1BB9A 2X3XD 2MIOA 1HD3A 1XOVA 3SHWA 3UF4A 3EG3A 2DM1A 2RMOA 1N5ZA 2KRMA 3FJ5A 3VS6A 5I22A 2V1RA 1YWPA 1UUEA 2KYMA 4OMPA 2MOXA 2ENMA 2I0NA 5GJVB 1UE9A 2LJ1A 2A08A 1WX6A 2AZVA 2RN8A 1X69A 2CT3A 2L3QA 4Z89A 5IHKA 1SEMA 4OMLA 2YUQA 2EYZA 5ECAA 3R6NA 2ABLA 1ZUYA 1QKXA 3TVTA 1W70A 4LUEA 4JZ3A 3RNJA 4J9FA 1RLPC 2M51A 4RUGA 1K0SA 1YNZA 1WXBA 2CSIA 3NMZC 1X2QA 5IH2A 1X6BA 3KFVA 4JJCA 1PHTA 2RF0A 4M4ZA 1OV3A 3VS4A 2C0IA 2AZSA 1AZGB 2GNCA 1JO8A 4HVWA 1UHCA 2GGRA 2A37A 4HCKA 2J6FA 4J9DA 1JU5C 3VRYA 1AWXA 1T0HA 2KROA 1RLQC 1KJWA 2JM9A 3I5RA 2KE9A 1NM7A 3PVQA 1BU1A 3EHQA 2PTKA 2K9GA 2HEQA 1JXMA 2HBWA 2RQVA 2AKLA 1G2BA 1X27A 4EIKA 1QWFA 4ZNXA 3EG2A 4ESRA 4KRTA 2ROTA 1K4US 1LCKA 2CT4A 2CSQA 2L0AA 3SEMA 2FRYA 1JXOA 4IIMA 2FEIA 3LH5A 4Z88A 4RTTA 2RPNA 1M8MA 1QWEA 2GQIA 2DE0X 2O31A 1GFCA 2KT1A 3M0QA 4AFSC 2NWMA 1X6GA 4OMQA 2EYYA 1UFFA 1Z9QA 1PKSA 3NGPA 2QDLA 3VS1A 4F14A 1M30A 1AWWA 2K79A 1E6GA 4JJDA 2D0NA 1CSKA 1PRMC 1AEYA 1OPLA 2FPEA 1SHGA 1RUWA 3H41A 2KGTA 2FG0A 1PRLC 2LZ6B 2DNUA 1WXTA 3REAB 1GCQC 1SHFA 3VS0A 2EGCA 5I11A 1IO6A 2RQTA 1GRIA 2F2WA 2EYWA 1SRMA 1M3AA 2EW3A 2K7AA 2ED0A 1B3QA 1Y0MA 1AWJA 2LMJA 2JS0A 4HXJA 2D8HA 3UA7A 3EHRA 2K3BA 1ZUUA 3H0FA 2EKHA 1KIKA 4QT7A 2EVRA 5IXBA 2O9VA 1WA7A 2DF6A 2KXCA 4J9IA 2DRKA 3JV3A 4ORZA 1HJDA 2YSQA 2CH4A 5IHNA 1TUCA 3I9QA 2LP5A 2O9SA 1ARKA 1E6HA 1QCFA 1YCSB 3M0UA 2DYBA 2J05A 2JMCA 2OJ2A 4D8DA 3EG1A 2DL3A 5FWBA 3M0PA 2FPDA 2SRCA 4X1VA 4F16A 4K11A 1T0JA 2DL8A 3TSWA 1EFNA 2EGEA 1K76A 4AFQC 3H0IA 1X2KA 1H8KA 4F17A 1Y57A 1M27C 2F2VA 2F2XA 1OOTA 2CREA 4AG2C 4RTYA 1TUDA 2L3SA 2C0TA 2FO0A 1GBRA 2LJ3A 4OMOA 2OAWA 2VWFA 2YT6A 4OMMA 1GFDA 1VA7A 4RTZA 3U23A 1E7OA 3VS3A 1GL5A 1AVZC 5FW9A 2JW4A 2LCSA 4Y92A 1KSWA 2LJ0A 1NYFA 4CC7A 2W10A 4A63B 4CC2A 1ZX6A 1WLPB 3NHNA 4Z8AA 1TG0A 3M0RA 1K1ZA 2EPDA 2G6FX 2VKNA 1QLYA 2BTTA 2K2MA 1UG1A 1VYUA 1WIEA 1WI7A 1MUZA 1K9AA 2ESWA 2J6OA 1SSHA 3RBBB 2W0ZA 4D8KA 2LX7A 4FSSA 2V1QA 2J06A 3EGUA 5GJWB 2KEAA 3VS2A 1I0CA 1WYXA 3TSZA 3H0HA 2EBPA 1I1JA 1M3CA 1OPKA 3UATA 1UJYA 1HSQA 3QWXX 2BZYA 1YN8A 2EGAA 1NG2A 2M0YA 4E6RA 2JM8A 1YP5A 4LUDA 1M3BA 2AK5A 2HCKA 1I07A 2B86A 2SEMA 4DEXA 2L3PA 4J9EA 1GCQA 1B07A 2YUPA 4OMNA 2PZ1A 1ZUKA 5FWCA 4HVUA 1BBZA 2OI3A 2DJQA 2O2OA 1AD5A 4AFZC 2ED1A 2A36A 3PE0A 2LQWA 2DMOA 5L23A 1W6XA 2JS2A 3UA6A 2DLPA 4JJBA 1PNJA 1NEBA 1UGVA 1ZLMA 5HCKA 3GBQA 5EC7A 4J9BA 2JTEA 2JMAA 2KRNA 3VS7A 4CC3A 1ABQA 3ULRB 2PNIA 1H3HA 1W1FA 4GBQA 1QKWA 1K0XA 2DL7A 3THKA 5IHIA 1WXUA 2BZ8A 4J9CA 3I35A 4JPBW 1AOJA 4GLMA 1BK2A 1X43A 4LNPA 1AWOA 2DILA 1ZSGA 1SPKA 2XMFA 1ZBJA 2IIMA 3I5SA 2DA9A 1H92A 3M0TA 1U3OA 1UECA 2HDAA 1Z9ZA 2FRWA 2A28A 1ABOA 1UDLA 2KRSA 2DL4A 1JQQA 2NUZA 3QWYA 2KYBA 1A0NB 2GTJA 1U06A 4WCIA 2YDLA 4RTUA 2HSPA 1NYGA 4J9HA 2RQWA 2MCNA 1NLPC 1YWOA 2D8JA 2CDTA
chains in the Genus database with same CATH superfamily
2DD5A 2J7IA 2CP0A 1T3SA 2BZXA 3JCMQ 1D0YA 2JVVA 1N8RR 2F69A 2FZKB 1VYTA 3LH0A 3HSBA 3QYGB 1YJWT 1WHKA 2DVJA 2E6NA 5GAN6 4C92B 2CP6A 2WSCE 2EYXA 1BCOA 3I56A 3MJXA 3OYDA 3C94A 3G4SQ 1PM3A 1VQ5T 3CD6T 3FJPA 3C95A 1UHFA 3M58A 2V8JA 2DBMA 2DTHA 3OY9A 2O88A 3OMCA 5IAYA 4FIBA 3C0CA 2QEXQ 5I2MA 3VRZA 3REBB 3PMIA 4M7AC 2ZZDA 1KQSP 2CUBA 3ZL7C 5KCOA 1ZA2B 2JT4A 2RJDA 3CCSA 4J83A 2FVUA 2C06A 3CBMA 3HFNA 2LNHB 3QDRB 3CEYA 1YFNA 2NUPB 1FMVA 3VS5A 4N4GA 2VV5A 1RI9A 2C0OA 1Y07A 1QCNA 4JRQA 4JJNK 1SRLA 4XTYA 1BIAA 4M78E 5DLQE 1YJNQ 4RTVA 2LQNA 1GCPA 2KXDA 3V8LA 2FL7A 4E7JA 3S6WA 3CCMQ 3JCMP 2DM1A 1M2OA 4FYVB 1N5ZA 3VS6A 2V1RA 1YWPA 4CRIA 2ENMA 1OYXA 4M78C 4PFZA 1AT1B 2XDDA 2I0NA 1B7TA 1UE9A 2LJ1A 4VUBA 1M4ZA 4PJOD 4OB2B 2YLCA 1X69A 3INZA 5IHKA 4Z89A 3RERA 3RMSA 2OTLQ 1YJWA 4LUEA 2PQWA 4PJMA 5KYWB 1XNIA 1VQMQ 4JRPA 1VQOQ 1M90R 1RAAB 1F1BB 1YNZA 2M1HA 1WXBA 2CSIA 3GP8A 1KC8C 4MDXA 3G6EQ 2PVOB 1VQ6Q 2HL3A 3OQ5A 1MNDA 3VS4A 2C0IA 2AZSA 3X26B 2M02A 4DOWA 2DO3A 1VQKT 3S3OA 2A37A 5CR2A 4HCKA 1LJOA 4DOVA 5KYYB 4J9DA 3EH2A 1T0HA 2E65A 2QQBA 2XD0A 2KY9A 3VJPA 1RACB 3I5RA 3GOXA 1QCOA 5J39A 3OBWA 4J6WA 2EQKA 1RI0A 2LT4A 2KK4A 3MEUA 4X9DA 1OZ3A 5AYFA 4ESRA 4M75F 3TREA 2X4YA 4KULA 2ROTA 1K4US 1YIJT 2L0AA 2FEIA 4M7DE 3LH5A 3RKXA 2YRDA 1QWEA 2F5TX 3OYGA 2KT1A 1ZHIA 3CCQT 2NWMA 2RHUA 4BY6B 2EYYA 5CVIA 1UFFA 3L2UA 2CP3A 1WNLA 1JJ2A 3LX7A 1VQ8Q 4M7DC 4M75G 3JAME 4V2SA 1CSKA 2LCCA 4FM4B 3M4YA 1OPLA 5HK3A 3M56A 1I5OB 2FG0A 2VXEA 3OYEA 1UGPB 2LZ6B 3X20B 2DNUA 3C12A 5C0MA 3GIBA 2EGCA 2GFUA 5CCAA 2RJCA 2EW3A 2K7AA 2DK3A 2GCXA 1R0BG 2LMJA 4ZN3A 1VQPT 2D8HA 2K4YA 3EHRA 2ZPIB 2K3BA 1VQKA 4JDSA 2CZ1B 2OAUA 3H0FA 2EKHA 5CQXA 1WHGA 5KYXA 2PU9B 4JS4A 4QT7A 3ME9A 5IXBA 3RMQA 2DRKA 2Y90A 2KDSA 2CH4A 3O8VA 2O9SA 4QQGA 1E6HA 2O4XB 1PD1A 3V8JA 2J05A 4F7UG 3MEAA 2JMCA 1Q86C 2BIVA 2KMTA 4KUIA 4F16A 1T0JA 3M55A 3LWHA 4HKEA 3G4ST 3Q1JA 4Q5WA 1K76A 3CPFA 1H8KA 3EG9A 2I2LA 3SFMA 3CCQA 1OOTA 3V7SA 4AG2C 4RTYA 2FHDA 2L3SA 2XDPA 1AHJB 2FO0A 3OS2A 2QEXT 4OMOA 5DLOA 4ME7A 1VQ7T 2VASA 1E7OA 3VS3A 4MMKA 1ZSZB 4A4KA 3EGDB 2HQHA 4BB7A 4Y92A 1VQNA 2X4XA 2EQJA 1KQSA 4CC7A 1U8RA 4CC2A 3JCMd 1ZX6A 2MWPA 1K1ZA 2G6FX 3JB9F 2K2MA 3CCJQ 1U1SA 1YJNT 5KYUA 1D3BB 1KD1R 1WI7A 1VQPA 1Q7YU 3CCLQ 5GAOm 2ESWA 2J6OA 4MZPA 1SSHA 3QYHB 4F04B 1QQJA 3RBBB 3CCMT 2YRCA 1KQ2A 4M7AF 1BYMA 3EFRA 1SKUB 1XTDA 2CGHA 4O6JA 4WTOB 1H641 3H0HA 1BKBA 2QG9B 1I1JA 1G3WA 2K2VA 3QWXX 3L1AA 2KAFA 2X4WA 2EGAA 1NG2A 2E6ZA 1K8AC 4R55A 2SEMA 2L3PA 1GCQA 1K9MR 1TSFA 1ZUKA 4M7AG 4EMKB 4XU3A 1DJ7B 2RHXA 3QZ5B 1VQMT 2VXFA 2QTXA 3G4SA 1VQOT 3MEVA 2ED1A 1VQ4Q 1S72Q 4IKFA 3PE0A 1W6XA 1WHJA 3G6ET 1IXDA 1VQ6T 4JJBA 4HT8A 4M75B 1D1CA 3KXTA 3M57A 2E3IA 1ZLMA 4KUDK 2PUKB 5IN1A 1Q81C 4J9BA 2QEXA 1N9RA 2GFAA 2D0QB 1RAGB 2DL7A 2JTMA 2HNIA 2BZ8A 3JB9I 4C0GA 3OBYA 4J9CA 1ACMB 1OI1A 3META 2CZ6B 4A54A 5GANg 1BIBA 3EFOB 1YJNA 5GANj 1UECA 2EFIA 5FU7C 1UDLA 3P8HA 4A4FA 2A0FB 1JQQA 5CKHA 3FB9A 3CCMA 2RO0A 1A0NB 3MP1A 2YDLA 4E47A 1NYGA 1YI2T 4MZTA 2QDYB 1P92A 1NLPC 5LJ5h 3BW1A 5GAOr 2FPFA 2E5KA 1V29B 3NPFA 3DB4A 3GLXA 2QQ9A 3OYJA 4LE9A 2EQMA 3WXMB 1CKAA 2YUOA 3JCMf 3HHTB 5GAN3 1R0CB 4A53A 3KUFA 2OTLA 1WQ7A 5KCHA 3HTRA 2EYQA 4XAXB 2QXFA 2LNVA 4CI0C 4E7ZA 2RQUA 1WDXA 3P8DA 1VQMA 1OEBA 4BI3A 1VQOA 1VQ9Q 3X25B 2HD0A 1JBMA 5L8RE 4RMOA 3G6EA 1MGQA 1VQ6A 3FEOA 2MI6A 4AG1C 5IXFA 1KFZA 3UDCA 1CKBA 2CUDA 5KE3A 3JCMe 3OW2A 1MV0B 2ECZA 3DB3A 1FMWA 1TOVA 3TCJA 4M7DF 2QA4Q 3M0SA 4RTWA 1UJ0A 4HA8A 1TS9A 3CMAQ 2P84A 4IIOA 1GBQA 2GBQA 4ZN1A 5A2QE 1S1NA 2L2PA 2WSFE 2DRMA 1EZZB 3CCUQ 1QP3A 4C8QE 5HK0A 2RNAA 1NBEB 4IUUA 5LJ3d 2JXBA 3OS0A 1MV3A 1G3SA 2CH4W 4UC4A 1OX8A 1VIFA 3E2UA 3HKSA 4OB1B 4M7DG 4LN2A 1Y96A 2LRQA 1AZEA 5LJ5g 4TVRA 4CC4B 5GANf 4GY5A 4DA4A 1I8FA 5LJ5j 4C8QC 1YITQ 1PWTA 1BB9A 2X3XD 3OS5A 2MIOA 5GAN4 3SHWA 3AT1B 3UF4A 3FJ5A 5I22A 3ER0A 4PFOA 4OMPA 2HL5C 5LJ3g 4M7AB 4C92D 5LJ3j 3MEWA 3ZEHA 2A08A 4EDUA 2AZVA 2DKGA 2WSEE 2RN8A 3CCST 3L2VA 5GANe 3WVEB 1SEMA 5GMKe 2YUQA 2EYZA 3M54A 1ZUYA 2VUBA 3VYHB 3E1SA 4C92A 4JZ3A 3VYGA 4RUGA 3E9FA 1K0SA 1NJIR 3RKWA 3J80E 3CCJT 2V26A 3JCMX 3CCLT 1X6BA 1WJQA 3KFVA 5GAOq 4JJCA 1PHTA 4M4ZA 1OV3A 3RUXA 5C6SA 3NTIA 3E19A 4XTWA 1JO8A 1TXQA 1UHCA 2RHYA 1GXIE 4QKUA 1NJIU 2EWNA 2BKDN 2V8KA 1KHIA 5A0DA 2GQVA 1RLQC 1KJWA 4BI8B 3JCMW 4II1A 3MHXA 3VKIA 4ZTJA 3PVQA 1B34B 3HPWA 1BU1A 2PUOB 3EGXA 2NUPA 1PCXA 2YRVA 2HBWA 2AKLA 3QKJA 1IHWA 2E70A 2EJFA 1VQ4T 2ZPHB 1S72T 1N8RU 4KRTA 4QQDA 1TTHB 1PD0A 3V7RA 2RHZA 5LJ5f 2HAXA 1LCKA 3FC3A 2CSQA 3SEMA 3CBOA 4OMFB 2X9HA 3SB2A 1UB4A 4FW2A 4BE1A 4IIMA 2DPPB 3EH1A 4RTTA 2RPNA 8AT1B 4JS5A 2LQKA 2NUTA 4ANJA 4LDVA 2K3XA 2K5IA 1Q82R 4FYWB 1M2VB 3VS1A 4F14A 2JUFA 5LJ3f 2K79A 3LLRA 1E6GA 2XDBA 4NOYA 1SHGA 2DEQA 5LJ5e 3M9QA 3GPLA 1PRLC 5D6XA 3LW5E 2MF2A 1WXTA 3RDVA 1Q82U 3BDUA 3CCJA 1YJ9Q 2RQTA 5GMKm 1C0MA 1D09B 2EYWA 3CCLA 1RABB 1FWZA 2ED0A 2DXBA 1B3QA 1I4K1 5LJ3e 1NPPA 1KIKA 3JCMc 4M77E 4HCZA 1WGSA 2ZGWA 7AT1B 2DF6A 3CXCP 1RAHB 2MK5A 4J9IA 4M7DB 3JV3A 2BE9B 4KT0E 4ORZA 3PTAA 5IHNA 2LP5A 1QCFA 1YCSB 2H3JA 4KH0B 3CCEQ 1OULA 4E7KA 3OYLA 4M77C 3C4SA 4PJOA 3EG1A 4EPCA 4A4EA 1VQ4A 1S72A 3M0PA 5CK9A 2FB7A 2MYSA 3DLLA 4XTXA 5D7UA 4C5IA 4DBFA 2KVQG 1EFNA 3RKYA 3QJ6A 4AFQC 4F17A 3CC4Q 3QG1A 4LDUA 1D0ZA 1WZOA 2F2XA 4RCBA 1M90U 1M1GA 4BACA 3PMTA 4B6MA 2RJEA 4B9WA 3CMAT 4PFPA 1VA7A 2CZ0B 3MPUB 2Y4XA 2P0QA 2JW4A 3CCUT 2QK0A 1KSWA 2LJ0A 3I55Q 1NYFA 2D9TA 2RK2A 1TG0A 3M0RA 4E7LA 2E64A 4QVDA 2YXYA 1TUGB 5KE2A 2BTTA 3PT9A 1YITT 1NE8A 1K9AA 4R56A 1RAFB 2L8DA 2RB6A 2CP2A 2LX7A 3SWNA 4A4GA 5GAOl 2V1QA 4J6YA 2J06A 1Q7YC 3VS2A 1I0CA 1TH7A 3OS1A 2DZCA 2COZA 2EBPA 1OPKA 3UATA 2DAQA 2RK1A 1HSQA 3GNFB 5J3BA 2BZYA 1VQNT 2M0YA 4FYYB 4E6RA 1YP5A 2M9UA 2O4XA 3A8LB 1I07A 1BCMA 4BE2A 3QJYA 1V76A 4DEXA 1X6OA 4C8QF 4OMNA 2PZ1A 1VQ9A 4ZGJB 1M1FA 3G7ZA 4RG2A 3CCRQ 2OI3A 5KH6A 4PLIA 4AFZC 3CC2Q 4XTVA 3EAEA 2DMOA 5L23A 3CMEQ 4RKUE 3A8HB 4P5NA 2DLPA 3QO3A 2QA4A 3JB9H 3JSCA 5HCKA 5EC7A 4ELYC 2JMAA 2JTFA 3CMAA 4C8QG 3CBPA 3VS7A 1QP2A 2PNIA 4BD3A 1H3HA 4QVCA 5GAMd 1TWBA 1W1FA 1QKWA 2DXCA 1N6AA 3CCUA 3THKA 5IHIA 3EGDA 3HL8A 3JCMh 3FLGA 4C0FA 2RI5A 4PJOE 3I35A 4JPBW 1AOJA 1X43A 2QI2A 1G3YA 2DILA 1IGQA 4OVAA 2IIMA 3I5SA 3QHSA 1U3OA 1YITA 1D3BA 2HDAA 3G1JA 2A28A 1ABOA 4PJOC 1D1AA 2E5QA 2KYBA 2IVWA 9ATCB 5GAMj 4MMLA 4DBHA 2ATCB 2MCNA 1YWOA 2CDTA 4PJNA 4J9GA 2D6FA 1PC0A 1HXDA 1SSFA 2KT8A 1T3LA 1UTIA 5KYXB 4XU2A 3S3MA 2J6KA 4OP0A 2KBTA 2COYA 4ZGDB 1U5SA 3OB9A 4FSXA 2AKKA 2KNBB 3CQTA 2HKQB 4M75D 1MMDA 2E10A 1LOJA 4EMKA 4JLIA 1G83A 3IQLA 1WHLA 5FU7B 3A98A 4HVVA 3PFSA 4N4IA 5GANh 2YUNA 3HRSA 4ZGEB 5GMKh 3CXCS 2BE7D 5CKEA 1KK7A 5GAN2 4MZMA 4M75A 1V1CA 3UT1A 3OSVA 2RD1A 3JCMg 2DTIA 1KD1U 2QQSA 3JB9G 3FRNA 5J26A 1NLOC 2FZCB 3SWNC 2G3RA 3CXCA 1W2BP 2OTLT 2YWWA 3X28B 1IHVA 4J7IA 3AHUA 3O5ZA 1JRIA 2P4RA 2Y4YA 4LXCA 3X24B 4NL3A 5FU6C 4M78F 1Q95G 4E2FB 4JZ4A 3URGA 1ZQ1A 2X3WD 1N9SA 1K9MU 2CP7A 3A1PA 4AFUC 1G3TA 3CC4T 5FRNA 4Y91A 1HD3A 1VQ5Q 5GAMf 1Q86R 3CD6Q 1TU0B 5KYUB 1PG5B 3EG3A 1PSEA 1M8VA 4F7UA 1BI2A 2KRMA 1UUEA 2KYMA 3QPHA 2XU8A 1ZA1B 1M1KR 4M77F 4C5HA 5GJVB 3HFOA 4AT1B 1WX6A 2YHTA 4M78G 2OX7A 3QZ9B 4GLKA 3RESA 1Q86U 2L3QA 4C0DC 1VIEA 1N27A 3RIRA 1QKXA 2HBPA 3TVTA 1SF9A 1W70A 4PLLA 5GAMe 5GMKj 3OA6A 4LD9K 1M1KU 2XICA 1X75C 4C8QB 4KGVB 3M5AA 3NMZC 3TQ7P 1OU8A 1X2QA 4M77G 3V7CA 5IH2A 2RF0A 2RM4A 5DM7R 3JCMJ 3L42A 3MCAB 2A3LA 1AZGB 4HVWA 5GAN5 3OYAA 1VQ8T 1D1BA 1JU5C 3VRYA 4FYXB 4QVZA 5LJ3h 4C5EA 3CCEA 2KE9A 4DQ2A 4IUQA 1NM7A 3G71Q 3PGGA 1NJIC 3JB9D 1YCYA 5M9OA 4YTLA 2PTKA 1QMCA 2HEQA 2RQVA 1X27A 4EIKA 1QWFA 4ZNXA 2OTJQ 2E4HA 1K8AR 3CC4A 4M7AD 2P4TA 1BI0A 4Z88A 1M8MA 2P0PA 4FL6A 3PIPA 2O01E 1GFCA 1N8RC 4N0AA 3M0QA 3OYHA 2F1LA 4M7AA 1X6GA 1Z9QA 3VU3C 1K8AU 4PNOA 1PKSA 3NGPA 2QDLA 1YHQQ 1M30A 1AWWA 3LGFA 3I55A 1C6VX 2D0NA 2ZPFB 4WF2A 3L2ZA 1AEYA 3H41A 1RUWA 3J81E 2DYIA 3D7SB 1GCQC 1IRXA 5I11A 4M78D 2CZ7B 1SRMA 4XTUA 2RHIA 5GMKl 1Y0MA 2DERA 5EG2A 4HXJA 4F7UE 3UA7A 4X34A 1Q82C 3WVDB 4LDWA 1ZUUA 1YIJQ 2QAZA 4L5GA 1VQ8A 2EVRA 3L2WA 2O9VA 2KXCA 3MP8A 1JJ2P 3T9NA 2COWA 2YSQA 1QVFP 1TUCA 3I9QA 1B34A 2BUDA 3M0UA 2JJ9A 4PJOF 3CCRA 2QQRA 2OJ2A 4D8DA 2DL3A 3CC2A 1XJWB 4K11A 3CMEA 2DL8A 2ZCFB 3TSWA 2EGEA 5I2SA 1X2KA 5KYNA 1Y57A 2E12A 2M0OA 3OYCA 1M27C 1MMGA 2F2VA 4M78B 1W2BS 2K3YA 1K73R 2VGNA 1TUDA 2C0TA 1GBRA 4J6XA 5DY9A 2OAWA 2YT6A 4JRKA 4OMMA 1GFDA 1M2VA 3QUIA 3VUZA 1KQ1A 1UGSB 4RTZA 3U23A 1GL5A 1M90C 1AVZC 5FW9A 3VV0A 4D6WA 4IUPA 4M77B 1W2BA 2KI7A 3QSUA 2W10A 4EMHA 2KQWA 4A63B 1K73U 2DEUA 2KSSA 3NHNA 4Z8AA 2VB6A 2RJFA 2R5MA 3A5ZB 1WHMA 1R77A 1EX4A 5A0LA 4XU0A 2F5KA 4M7DD 2HMAA 3J7AF 2W0ZA 4D8KA 4M7AE 1VOMA 3SDZA 3OYKA 3EGUA 5GJWB 2KEAA 1FX7A 3MKDA 3TSZA 3LYIA 1M3CA 4M7DA 1UJYA 4C5GA 4LDXA 1YN8A 4N0AC 1C1AA 2JM8A 1VQ7Q 1EIFA 4LUDA 1M3BA 5KYWA 4Y28E 2B86A 4FU6A 5FWCA 3QBYA 2EAYA 1LVKA 3ASKA 3SD4A 3CPWP 2O2OA 1AD5A 3EGXB 2A36A 2ZPGB 1G5VA 4RG8A 1MMNA 2QASA 5FROA 1PNJA 1H3ZA 1RADB 5KYYA 1RL2A 3GBQA 4CC3A 3ULRB 1R8OB 2NUTB 3KBGA 3M59A 1X01A 4C92E 2WACA 3G71T 1BK2A 2QTVA 1VQ9T 2Z0WA 1ZSGA 2XMFA 3MO8A 3RR6A 2EIFA 1H92A 4C92C 2QGFB 3OYNA 2OTJT 2LCLA 3H6ZA 3R6OA 1VQ5A 4KH1B 3CD6A 4KGZB 4QW2A 1RAIB 2AIRB 1U06A 2QA4T 3CC7Q 2DJZA 4RTUA 2XHCA 2HSPA 4J9HA 2RQWA 3HRUA 2D8JA 2XIDA 3OSSC 1Y7XA 4FCYA 1FXXA 4J8OA 2ROLA 2JZ2A 3QXEB 2RQRA 2CS7A 1YHQT 2XKOC 2KR3A 3BFMA 1WJRA 4XTZA 3GF5A 2JOYA 1FYNA 1LPLA 2VVKA 2DFUA 3QIIA 3VUBA 2DBKA 3HRTA 1M9SA 3EG0A 1WFWA 2RI3A 2XI9A 4FT4A 2B8AA 4KGXB 4PJOB 5GMKi 1FMKA 5FRMA 4A4HA 2VYTA 4Z02A 4XU1A 2MMPA 4R0KA 1JEGA 1VYVA 1JJ2S 5GAMh 1J3TA 4LD6A 1QVFS 3PVLA 3UWNA 1KHCA 4O5VA 3UPUA 1YI2Q 1UGQB 4DEYA 2XK0A 5LL6S 4BE0A 2D1XA 3CCVQ 4RTXA 2DL5A 3G71A 2LQ8A 2DX1A 4IUVA 1KD1C 2EQIA 2GTOA 5CO7A 3H8ZA 2EKOA 1QVFA 5GAN8 2P0KA 1WQWA 2VGMA 2NYSA 4B9XA 4N4HA 1BI1A 1NEGA 2ZPBB 1PKTA 2OTJA 4JLGA 2H8HA 2K6DA 2GF7A 1VQLQ 2DIQA 2LX9A 1XOVA 3OW2P 4F7UF 2RMOA 1KC8R 1ZSZA 2MOXA 1K9MC 2M16A 1ZBXA 5IT9E 1YHQA 4PK4A 3SWNB 2MAMA 5GAOp 2E41A 3P8BB 2CYZB 2CT3A 3NTKA 4OMLA 4BUGA 5ECAA 4X9CA 3R6NA 2ABLA 1IB8A 1KC8U 3RNJA 4J9FA 5FU6B 1RLPC 2M51A 1YBYA 1OQKA 5GAMg 1RAEB 1JB0E 2L89A 3I56Q 1HYOA 1MNEA 1YIJA 4J5YA 1M1KC 3A8MB 4E7IA 2DETA 3N5BB 2GNCA 3A8GB 5CKFA 2GGRA 2NLUA 1KQSS 1G8XA 2RH2A 5AT1B 2H3EB 2J6FA 1AWXA 2AT1B 4BY6C 2KROA 3CPWS 2JM9A 4OGCA 1KG1A 4OB0B 4C0DB 2JNGA 2V8IA 2E3HA 3LWIA 3CCSQ 4DBQA 1Q7YR 3EHQA 4EMGA 1YJ9T 2K9GA 1JXMA 1OU9A 2R58A 1IZ6A 3ZBDA 1G2BA 3MP6A 3EG2A 4ELZC 3CPWA 4BDZA 3TU4K 4KBMB 1OX9A 2CT4A 5A0GA 1QVGP 2FRYA 1QVPA 3EG9B 1JXOA 1O9SA 4E7HA 4JRIA 1U1TA 2GQIA 4OF1A 2DE0X 2O31A 2DIGA 2HSEB 1WHHA 3BE3A 4AFSC 1M5Q1 4OMQA 5I21A 4HCCA 3F70A 3CCET 4C8QD 2MPXC 2HQEA 4XQ3A 4JJDA 5FLXE 1PRMC 2FPEA 5CIUA 5D6YA 3EFOA 2KGTA 2VC8A 1MMAA 4ZTFA 1YJWQ 3REAB 1SHFA 3VS0A 4C0ZA 3H9NA 1IO6A 4C8QA 1GRIA 2F2WA 3BY7A 1M3AA 2QYZA 3JCMV 3TEEA 4HCBA 1AWJA 4JUVA 2JS0A 4L59A 2HQXA 3CC7T 1I5LA 1NPRA 2E1HA 3V8KA 5GANd 2CP5A 1WA7A 3DKMA 3LGLA 2K5LA 3I55T 1VQ7A 4FT2A 1PSFA 3BDLA 1HJDA 3A8OB 3S3NA 1IGUA 1ZSZC 1ARKA 3ZFJA 4C92F 2DYBA 1YJ9A 4LDYA 3OMGA 4L6V5 2EQUA 5FWBA 4BI4A 4IUTA 1O75A 2FPDA 2SRCA 4X1VA 3OYBA 2DVEA 2A7YA 4IURA 2RI2A 3H0IA 2LDMA 2R5AA 4DBRA 4OGEA 4HT9A 2K5FA 2DTOA 4C92G 2CREA 2HKNA 4OB3B 1MHNA 2RA2A 1WJSA 2LJ3A 5CQYA 2VWFA 2YLBA 2K57A 4NS5A 3CCVT 4F7UB 4PL6A 2ZAEA 2DZ9A 2LCSA 3DLMA 3CCRT 2IPOB 1D0XA 2R57A 1WLPB 3CC2T 1VUBA 6AT1B 5HY6A 3PIOA 1UEBA 2EPDA 4M75E 2DXTA 2VKNA 3OW2S 1QLYA 3CMET 3NFCA 4EMKC 1UGRB 2FZGB 4E7SA 1UG1A 1VYUA 1LNXA 1Y71A 1WIEA 1K73C 1W4SA 1MUZA 1BI3A 2MWOA 3OYYA 3CC7A 3L2QA 5HKCA 1VQLT 2X51A 4FSSA 2PVGB 4MDWA 3NTHA 4M75C 2EJGA 1VQKQ 4RCCA 1WYXA 2LT1A 5CKDA 3JRZA 5CAIA 1XQHA 1IREB 3EFSA 5LJ5d 2LC4A 1HK9A 1Q81R 2QQAA 5D6WA 4J7FA 2IG0A 2AK5A 2HCKA 3FIFA 2X4JA 2JN0A 4ATOA 1QW1A 3M53A 4J9EA 1B07A 2YUPA 4PJLA 4HVUA 4NL2A 1BBZA 2DJQA 2QGGA 3GNGA 4QQ6A 2ZPEB 4PKCC 2LQWA 3M4GA 2DXUA 1Q81U 2JS2A 3I56T 3FDRA 1I81A 4M78A 3UA6A 1OZ2A 2EJ9A 3OYFA 1NEBA 4FW1A 1UGVA 4M77D 2LVMA 1YI2A 3L2RA 2JTEA 5GAN7 2KRNA 3CCQQ 3CCVA 3PNWC 1ABQA 4GBQA 2CKKA 8ATCB 4PJJA 1K0XA 5GAOn 3HP9A 4XK8E 1WPYA 1WXUA 3JCMb 4M77A 2XG8D 2FYKA 3OYMA 4GLMA 4LNPA 2PVDB 1VQNQ 2L5QA 1AWOA 2AHJB 4BDYA 1SPKA 1QVGS 1ZBJA 1NZ9A 2L3RA 1SG5A 2DA9A 4AMCA 3JB9J 3M0TA 3QDFA 3OYIA 1Y96B 1Z9ZA 2FRWA 2HZYA 1VQLA 2KRSA 2DL4A 2NUZA 2LTOA 3QWYA 1VQPQ 5CKBA 3E9GA 2GTJA 4WCIA 2DD4A 2X35A 4PJOG 1QVGA
chains in the Genus database with same CATH topology
2FPFA 4J9GA 2E5KA 2J7IA 3NPFA 1T3SA 2BZXA 2KT8A 1T3LA 1UTIA 4LE9A 2ROLA 1CKAA 2YUOA 2RQRA 2J6KA 2KBTA 1U5SA 2KR3A 2RQUA 1FYNA 2VVKA 1WDXA 2AKKA 2KNBB 1VYTA 3CQTA 1OEBA 2DVJA 2DBKA 1G83A 2EYXA 3IQLA 3EG0A 1WFWA 3A98A 4HVVA 2YUNA 1FMKA 4AG1C 5IXFA 1KFZA 1UHFA 4R0KA 1CKBA 2CUDA 1V1CA 2DBMA 1JEGA 1VYVA 2O88A 1MV0B 1J3TA 2ECZA 3PVLA 3C0CA 3M0SA 4RTWA 1UJ0A 3VRZA 4DEYA 1NLOC 3REBB 2D1XA 4IIOA 1GBQA 4RTXA 2DL5A 2GBQA 2CUBA 1S1NA 3ZL7C 2L2PA 2DRMA 2DX1A 2JT4A 2EQIA 2GTOA 3O5ZA 2P4RA 2RNAA 2JXBA 2LNHB 1MV3A 1NEGA 1PKTA 3VS5A 2CH4W 1RI9A 2C0OA 4LN2A 2H8HA 1AZEA 4CC4B 1SRLA 4JZ4A 4RTVA 2K6DA 2X3WD 2LQNA 1GCPA 1PWTA 2KXDA 4AFUC 1BB9A 2X3XD 2MIOA 1HD3A 1XOVA 3SHWA 3UF4A 3EG3A 2DM1A 2RMOA 1N5ZA 2KRMA 3FJ5A 3VS6A 5I22A 2V1RA 1YWPA 1UUEA 2KYMA 4OMPA 2MOXA 2ENMA 2I0NA 5GJVB 1UE9A 2LJ1A 2A08A 1WX6A 2AZVA 2RN8A 1X69A 2CT3A 2L3QA 4Z89A 5IHKA 1SEMA 4OMLA 2YUQA 2EYZA 5ECAA 3R6NA 2ABLA 1ZUYA 1QKXA 3TVTA 1W70A 4LUEA 4JZ3A 3RNJA 4J9FA 1RLPC 2M51A 4RUGA 1K0SA 1YNZA 1WXBA 2CSIA 3NMZC 1X2QA 5IH2A 1X6BA 3KFVA 4JJCA 1PHTA 2RF0A 4M4ZA 1OV3A 3VS4A 2C0IA 2AZSA 1AZGB 2GNCA 1JO8A 4HVWA 1UHCA 2GGRA 2A37A 4HCKA 2J6FA 4J9DA 1JU5C 3VRYA 1AWXA 1T0HA 2KROA 1RLQC 1KJWA 2JM9A 3I5RA 2KE9A 1NM7A 3PVQA 1BU1A 3EHQA 2PTKA 2K9GA 2HEQA 1JXMA 2HBWA 2RQVA 2AKLA 1G2BA 1X27A 4EIKA 1QWFA 4ZNXA 3EG2A 4ESRA 4KRTA 2ROTA 1K4US 1LCKA 2CT4A 2CSQA 2L0AA 3SEMA 2FRYA 1JXOA 4IIMA 2FEIA 3LH5A 4Z88A 4RTTA 2RPNA 1M8MA 1QWEA 2GQIA 2DE0X 2O31A 1GFCA 2KT1A 3M0QA 4AFSC 2NWMA 1X6GA 4OMQA 2EYYA 1UFFA 1Z9QA 1PKSA 3NGPA 2QDLA 3VS1A 4F14A 1M30A 1AWWA 2K79A 1E6GA 4JJDA 2D0NA 1CSKA 1PRMC 1AEYA 1OPLA 2FPEA 1SHGA 1RUWA 3H41A 2KGTA 2FG0A 1PRLC 2LZ6B 2DNUA 1WXTA 3REAB 1GCQC 1SHFA 3VS0A 2EGCA 5I11A 1IO6A 2RQTA 1GRIA 2F2WA 2EYWA 1SRMA 1M3AA 2EW3A 2K7AA 2ED0A 1B3QA 1Y0MA 1AWJA 2LMJA 2JS0A 4HXJA 2D8HA 3UA7A 3EHRA 2K3BA 1ZUUA 3H0FA 2EKHA 1KIKA 4QT7A 2EVRA 5IXBA 2O9VA 1WA7A 2DF6A 2KXCA 4J9IA 2DRKA 3JV3A 4ORZA 1HJDA 2YSQA 2CH4A 5IHNA 1TUCA 3I9QA 2LP5A 2O9SA 1ARKA 1E6HA 1QCFA 1YCSB 3M0UA 2DYBA 2J05A 2JMCA 2OJ2A 4D8DA 3EG1A 2DL3A 5FWBA 3M0PA 2FPDA 2SRCA 4X1VA 4F16A 4K11A 1T0JA 2DL8A 3TSWA 1EFNA 2EGEA 1K76A 4AFQC 3H0IA 1X2KA 1H8KA 4F17A 1Y57A 1M27C 2F2VA 2F2XA 1OOTA 2CREA 4AG2C 4RTYA 1TUDA 2L3SA 2C0TA 2FO0A 1GBRA 2LJ3A 4OMOA 2OAWA 2VWFA 2YT6A 4OMMA 1GFDA 1VA7A 4RTZA 3U23A 1E7OA 3VS3A 1GL5A 1AVZC 5FW9A 2JW4A 2LCSA 4Y92A 1KSWA 2LJ0A 1NYFA 4CC7A 2W10A 4A63B 4CC2A 1ZX6A 1WLPB 3NHNA 4Z8AA 1TG0A 3M0RA 1K1ZA 2EPDA 2G6FX 2VKNA 1QLYA 2BTTA 2K2MA 1UG1A 1VYUA 1WIEA 1WI7A 1MUZA 1K9AA 2ESWA 2J6OA 1SSHA 3RBBB 2W0ZA 4D8KA 2LX7A 4FSSA 2V1QA 2J06A 3EGUA 5GJWB 2KEAA 3VS2A 1I0CA 1WYXA 3TSZA 3H0HA 2EBPA 1I1JA 1M3CA 1OPKA 3UATA 1UJYA 1HSQA 3QWXX 2BZYA 1YN8A 2EGAA 1NG2A 2M0YA 4E6RA 2JM8A 1YP5A 4LUDA 1M3BA 2AK5A 2HCKA 1I07A 2B86A 2SEMA 4DEXA 2L3PA 4J9EA 1GCQA 1B07A 2YUPA 4OMNA 2PZ1A 1ZUKA 5FWCA 4HVUA 1BBZA 2OI3A 2DJQA 2O2OA 1AD5A 4AFZC 2ED1A 2A36A 3PE0A 2LQWA 2DMOA 5L23A 1W6XA 2JS2A 3UA6A 2DLPA 4JJBA 1PNJA 1NEBA 1UGVA 1ZLMA 5HCKA 3GBQA 5EC7A 4J9BA 2JTEA 2JMAA 2KRNA 3VS7A 4CC3A 1ABQA 3ULRB 2PNIA 1H3HA 1W1FA 4GBQA 1QKWA 1K0XA 2DL7A 3THKA 5IHIA 1WXUA 2BZ8A 4J9CA 3I35A 4JPBW 1AOJA 4GLMA 1BK2A 1X43A 4LNPA 1AWOA 2DILA 1ZSGA 1SPKA 2XMFA 1ZBJA 2IIMA 3I5SA 2DA9A 1H92A 3M0TA 1U3OA 1UECA 2HDAA 1Z9ZA 2FRWA 2A28A 1ABOA 1UDLA 2KRSA 2DL4A 1JQQA 2NUZA 3QWYA 2KYBA 1A0NB 2GTJA 1U06A 4WCIA 2YDLA 4RTUA 2HSPA 1NYGA 4J9HA 2RQWA 2MCNA 1NLPC 1YWOA 2D8JA 2CDTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPF A;  4J9G A;  2E5K A;  2J7I A;  3NPF A;  1T3S A;  2BZX A;  2KT8 A;  1T3L A;  1UTI A;  4LE9 A;  2ROL A;  1CKA A;  2YUO A;  2RQR A;  2J6K A;  2KBT A;  1U5S A;  2KR3 A;  2RQU A;  1FYN A;  2VVK A;  1WDX A;  2AKK A;  2KNB B;  1VYT A;  3CQT A;  1OEB A;  2DVJ A;  2DBK A;  1G83 A;  2EYX A;  3IQL A;  3EG0 A;  1WFW A;  3A98 A;  4HVV A;  2YUN A;  1FMK A;  4AG1 C;  5IXF A;  1KFZ A;  1UHF A;  4R0K A;  1CKB A;  2CUD A;  1V1C A;  2DBM A;  1JEG A;  1VYV A;  2O88 A;  1MV0 B;  1J3T A;  2ECZ A;  3PVL A;  3C0C A;  3M0S A;  4RTW A;  1UJ0 A;  3VRZ A;  4DEY A;  1NLO C;  3REB B;  2D1X A;  4IIO A;  1GBQ A;  4RTX A;  2DL5 A;  2GBQ A;  2CUB A;  1S1N A;  3ZL7 C;  2L2P A;  2DRM A;  2DX1 A;  2JT4 A;  2EQI A;  2GTO A;  3O5Z A;  2P4R A;  2RNA A;  2JXB A;  2LNH B;  1MV3 A;  1NEG A;  1PKT A;  3VS5 A;  2CH4 W;  1RI9 A;  2C0O A;  4LN2 A;  2H8H A;  1AZE A;  4CC4 B;  1SRL A;  4JZ4 A;  4RTV A;  2K6D A;  2X3W D;  2LQN A;  1GCP A;  1PWT A;  2KXD A;  4AFU C;  1BB9 A;  2X3X D;  2MIO A;  1HD3 A;  1XOV A;  3SHW A;  3UF4 A;  3EG3 A;  2DM1 A;  2RMO A;  1N5Z A;  2KRM A;  3FJ5 A;  3VS6 A;  5I22 A;  2V1R A;  1YWP A;  1UUE A;  2KYM A;  4OMP A;  2MOX A;  2ENM A;  2I0N A;  5GJV B;  1UE9 A;  2LJ1 A;  2A08 A;  1WX6 A;  2AZV A;  2RN8 A;  1X69 A;  2CT3 A;  2L3Q A;  4Z89 A;  5IHK A;  1SEM A;  4OML A;  2YUQ A;  2EYZ A;  5ECA A;  3R6N A;  2ABL A;  1ZUY A;  1QKX A;  3TVT A;  1W70 A;  4LUE A;  4JZ3 A;  3RNJ A;  4J9F A;  1RLP C;  2M51 A;  4RUG A;  1K0S A;  1YNZ A;  1WXB A;  2CSI A;  3NMZ C;  1X2Q A;  5IH2 A;  1X6B A;  3KFV A;  4JJC A;  1PHT A;  2RF0 A;  4M4Z A;  1OV3 A;  3VS4 A;  2C0I A;  2AZS A;  1AZG B;  2GNC A;  1JO8 A;  4HVW A;  1UHC A;  2GGR A;  2A37 A;  4HCK A;  2J6F A;  4J9D A;  1JU5 C;  3VRY A;  1AWX A;  1T0H A;  2KRO A;  1RLQ C;  1KJW A;  2JM9 A;  3I5R A;  2KE9 A;  1NM7 A;  3PVQ A;  1BU1 A;  3EHQ A;  2PTK A;  2K9G A;  2HEQ A;  1JXM A;  2HBW A;  2RQV A;  2AKL A;  1G2B A;  1X27 A;  4EIK A;  1QWF A;  4ZNX A;  3EG2 A;  4ESR A;  4KRT A;  2ROT A;  1K4U S;  1LCK A;  2CT4 A;  2CSQ A;  2L0A A;  3SEM A;  2FRY A;  1JXO A;  4IIM A;  2FEI A;  3LH5 A;  4Z88 A;  4RTT A;  2RPN A;  1M8M A;  1QWE A;  2GQI A;  2DE0 X;  2O31 A;  1GFC A;  2KT1 A;  3M0Q A;  4AFS C;  2NWM A;  1X6G A;  4OMQ A;  2EYY A;  1UFF A;  1Z9Q A;  1PKS A;  3NGP A;  2QDL A;  3VS1 A;  4F14 A;  1M30 A;  1AWW A;  2K79 A;  1E6G A;  4JJD A;  2D0N A;  1CSK A;  1PRM C;  1AEY A;  1OPL A;  2FPE A;  1SHG A;  1RUW A;  3H41 A;  2KGT A;  2FG0 A;  1PRL C;  2LZ6 B;  2DNU A;  1WXT A;  3REA B;  1GCQ C;  1SHF A;  3VS0 A;  2EGC A;  5I11 A;  1IO6 A;  2RQT A;  1GRI A;  2F2W A;  2EYW A;  1SRM A;  1M3A A;  2EW3 A;  2K7A A;  2ED0 A;  1B3Q A;  1Y0M A;  1AWJ A;  2LMJ A;  2JS0 A;  4HXJ A;  2D8H A;  3UA7 A;  3EHR A;  2K3B A;  1ZUU A;  3H0F A;  2EKH A;  1KIK A;  4QT7 A;  2EVR A;  5IXB A;  2O9V A;  1WA7 A;  2DF6 A;  2KXC A;  4J9I A;  2DRK A;  3JV3 A;  4ORZ A;  1HJD A;  2YSQ A;  2CH4 A;  5IHN A;  1TUC A;  3I9Q A;  2LP5 A;  2O9S A;  1ARK A;  1E6H A;  1QCF A;  1YCS B;  3M0U A;  2DYB A;  2J05 A;  2JMC A;  2OJ2 A;  4D8D A;  3EG1 A;  2DL3 A;  5FWB A;  3M0P A;  2FPD A;  2SRC A;  4X1V A;  4F16 A;  4K11 A;  1T0J A;  2DL8 A;  3TSW A;  1EFN A;  2EGE A;  1K76 A;  4AFQ C;  3H0I A;  1X2K A;  1H8K A;  4F17 A;  1Y57 A;  1M27 C;  2F2V A;  2F2X A;  1OOT A;  2CRE A;  4AG2 C;  4RTY A;  1TUD A;  2L3S A;  2C0T A;  2FO0 A;  1GBR A;  2LJ3 A;  4OMO A;  2OAW A;  2VWF A;  2YT6 A;  4OMM A;  1GFD A;  1VA7 A;  4RTZ A;  3U23 A;  1E7O A;  3VS3 A;  1GL5 A;  1AVZ C;  5FW9 A;  2JW4 A;  2LCS A;  4Y92 A;  1KSW A;  2LJ0 A;  1NYF A;  4CC7 A;  2W10 A;  4A63 B;  4CC2 A;  1ZX6 A;  1WLP B;  3NHN A;  4Z8A A;  1TG0 A;  3M0R A;  1K1Z A;  2EPD A;  2G6F X;  2VKN A;  1QLY A;  2BTT A;  2K2M A;  1UG1 A;  1VYU A;  1WIE A;  1WI7 A;  1MUZ A;  1K9A A;  2ESW A;  2J6O A;  1SSH A;  3RBB B;  2W0Z A;  4D8K A;  2LX7 A;  4FSS A;  2V1Q A;  2J06 A;  3EGU A;  5GJW B;  2KEA A;  3VS2 A;  1I0C A;  1WYX A;  3TSZ A;  3H0H A;  2EBP A;  1I1J A;  1M3C A;  1OPK A;  3UAT A;  1UJY A;  1HSQ A;  3QWX X;  2BZY A;  1YN8 A;  2EGA A;  1NG2 A;  2M0Y A;  4E6R A;  2JM8 A;  1YP5 A;  4LUD A;  1M3B A;  2AK5 A;  2HCK A;  1I07 A;  2B86 A;  2SEM A;  4DEX A;  2L3P A;  4J9E A;  1GCQ A;  1B07 A;  2YUP A;  4OMN A;  2PZ1 A;  1ZUK A;  5FWC A;  4HVU A;  1BBZ A;  2OI3 A;  2DJQ A;  2O2O A;  1AD5 A;  4AFZ C;  2ED1 A;  2A36 A;  3PE0 A;  2LQW A;  2DMO A;  5L23 A;  1W6X A;  2JS2 A;  3UA6 A;  2DLP A;  4JJB A;  1PNJ A;  1NEB A;  1UGV A;  1ZLM A;  5HCK A;  3GBQ A;  5EC7 A;  4J9B A;  2JTE A;  2JMA A;  2KRN A;  3VS7 A;  4CC3 A;  1ABQ A;  3ULR B;  2PNI A;  1H3H A;  1W1F A;  4GBQ A;  1QKW A;  1K0X A;  2DL7 A;  3THK A;  5IHI A;  1WXU A;  2BZ8 A;  4J9C A;  3I35 A;  4JPB W;  1AOJ A;  4GLM A;  1BK2 A;  1X43 A;  4LNP A;  1AWO A;  2DIL A;  1ZSG A;  1SPK A;  2XMF A;  1ZBJ A;  2IIM A;  3I5S A;  2DA9 A;  1H92 A;  3M0T A;  1U3O A;  1UEC A;  2HDA A;  1Z9Z A;  2FRW A;  2A28 A;  1ABO A;  1UDL A;  2KRS A;  2DL4 A;  1JQQ A;  2NUZ A;  3QWY A;  2KYB A;  1A0N B;  2GTJ A;  1U06 A;  4WCI A;  2YDL A;  4RTU A;  2HSP A;  1NYG A;  4J9H A;  2RQW A;  2MCN A;  1NLP C;  1YWO A;  2D8J A;  2CDT A; 
#chains in the Genus database with same CATH topology
 2DD5 A;  2J7I A;  2CP0 A;  1T3S A;  2BZX A;  3JCM Q;  1D0Y A;  2JVV A;  1N8R R;  2F69 A;  2FZK B;  1VYT A;  3LH0 A;  3HSB A;  3QYG B;  1YJW T;  1WHK A;  2DVJ A;  2E6N A;  5GAN 6;  4C92 B;  2CP6 A;  2WSC E;  2EYX A;  1BCO A;  3I56 A;  3MJX A;  3OYD A;  3C94 A;  3G4S Q;  1PM3 A;  1VQ5 T;  3CD6 T;  3FJP A;  3C95 A;  1UHF A;  3M58 A;  2V8J A;  2DBM A;  2DTH A;  3OY9 A;  2O88 A;  3OMC A;  5IAY A;  4FIB A;  3C0C A;  2QEX Q;  5I2M A;  3VRZ A;  3REB B;  3PMI A;  4M7A C;  2ZZD A;  1KQS P;  2CUB A;  3ZL7 C;  5KCO A;  1ZA2 B;  2JT4 A;  2RJD A;  3CCS A;  4J83 A;  2FVU A;  2C06 A;  3CBM A;  3HFN A;  2LNH B;  3QDR B;  3CEY A;  1YFN A;  2NUP B;  1FMV A;  3VS5 A;  4N4G A;  2VV5 A;  1RI9 A;  2C0O A;  1Y07 A;  1QCN A;  4JRQ A;  4JJN K;  1SRL A;  4XTY A;  1BIA A;  4M78 E;  5DLQ E;  1YJN Q;  4RTV A;  2LQN A;  1GCP A;  2KXD A;  3V8L A;  2FL7 A;  4E7J A;  3S6W A;  3CCM Q;  3JCM P;  2DM1 A;  1M2O A;  4FYV B;  1N5Z A;  3VS6 A;  2V1R A;  1YWP A;  4CRI A;  2ENM A;  1OYX A;  4M78 C;  4PFZ A;  1AT1 B;  2XDD A;  2I0N A;  1B7T A;  1UE9 A;  2LJ1 A;  4VUB A;  1M4Z A;  4PJO D;  4OB2 B;  2YLC A;  1X69 A;  3INZ A;  5IHK A;  4Z89 A;  3RER A;  3RMS A;  2OTL Q;  1YJW A;  4LUE A;  2PQW A;  4PJM A;  5KYW B;  1XNI A;  1VQM Q;  4JRP A;  1VQO Q;  1M90 R;  1RAA B;  1F1B B;  1YNZ A;  2M1H A;  1WXB A;  2CSI A;  3GP8 A;  1KC8 C;  4MDX A;  3G6E Q;  2PVO B;  1VQ6 Q;  2HL3 A;  3OQ5 A;  1MND A;  3VS4 A;  2C0I A;  2AZS A;  3X26 B;  2M02 A;  4DOW A;  2DO3 A;  1VQK T;  3S3O A;  2A37 A;  5CR2 A;  4HCK A;  1LJO A;  4DOV A;  5KYY B;  4J9D A;  3EH2 A;  1T0H A;  2E65 A;  2QQB A;  2XD0 A;  2KY9 A;  3VJP A;  1RAC B;  3I5R A;  3GOX A;  1QCO A;  5J39 A;  3OBW A;  4J6W A;  2EQK A;  1RI0 A;  2LT4 A;  2KK4 A;  3MEU A;  4X9D A;  1OZ3 A;  5AYF A;  4ESR A;  4M75 F;  3TRE A;  2X4Y A;  4KUL A;  2ROT A;  1K4U S;  1YIJ T;  2L0A A;  2FEI A;  4M7D E;  3LH5 A;  3RKX A;  2YRD A;  1QWE A;  2F5T X;  3OYG A;  2KT1 A;  1ZHI A;  3CCQ T;  2NWM A;  2RHU A;  4BY6 B;  2EYY A;  5CVI A;  1UFF A;  3L2U A;  2CP3 A;  1WNL A;  1JJ2 A;  3LX7 A;  1VQ8 Q;  4M7D C;  4M75 G;  3JAM E;  4V2S A;  1CSK A;  2LCC A;  4FM4 B;  3M4Y A;  1OPL A;  5HK3 A;  3M56 A;  1I5O B;  2FG0 A;  2VXE A;  3OYE A;  1UGP B;  2LZ6 B;  3X20 B;  2DNU A;  3C12 A;  5C0M A;  3GIB A;  2EGC A;  2GFU A;  5CCA A;  2RJC A;  2EW3 A;  2K7A A;  2DK3 A;  2GCX A;  1R0B G;  2LMJ A;  4ZN3 A;  1VQP T;  2D8H A;  2K4Y A;  3EHR A;  2ZPI B;  2K3B A;  1VQK A;  4JDS A;  2CZ1 B;  2OAU A;  3H0F A;  2EKH A;  5CQX A;  1WHG A;  5KYX A;  2PU9 B;  4JS4 A;  4QT7 A;  3ME9 A;  5IXB A;  3RMQ A;  2DRK A;  2Y90 A;  2KDS A;  2CH4 A;  3O8V A;  2O9S A;  4QQG A;  1E6H A;  2O4X B;  1PD1 A;  3V8J A;  2J05 A;  4F7U G;  3MEA A;  2JMC A;  1Q86 C;  2BIV A;  2KMT A;  4KUI A;  4F16 A;  1T0J A;  3M55 A;  3LWH A;  4HKE A;  3G4S T;  3Q1J A;  4Q5W A;  1K76 A;  3CPF A;  1H8K A;  3EG9 A;  2I2L A;  3SFM A;  3CCQ A;  1OOT A;  3V7S A;  4AG2 C;  4RTY A;  2FHD A;  2L3S A;  2XDP A;  1AHJ B;  2FO0 A;  3OS2 A;  2QEX T;  4OMO A;  5DLO A;  4ME7 A;  1VQ7 T;  2VAS A;  1E7O A;  3VS3 A;  4MMK A;  1ZSZ B;  4A4K A;  3EGD B;  2HQH A;  4BB7 A;  4Y92 A;  1VQN A;  2X4X A;  2EQJ A;  1KQS A;  4CC7 A;  1U8R A;  4CC2 A;  3JCM d;  1ZX6 A;  2MWP A;  1K1Z A;  2G6F X;  3JB9 F;  2K2M A;  3CCJ Q;  1U1S A;  1YJN T;  5KYU A;  1D3B B;  1KD1 R;  1WI7 A;  1VQP A;  1Q7Y U;  3CCL Q;  5GAO m;  2ESW A;  2J6O A;  4MZP A;  1SSH A;  3QYH B;  4F04 B;  1QQJ A;  3RBB B;  3CCM T;  2YRC A;  1KQ2 A;  4M7A F;  1BYM A;  3EFR A;  1SKU B;  1XTD A;  2CGH A;  4O6J A;  4WTO B;  1H64 1;  3H0H A;  1BKB A;  2QG9 B;  1I1J A;  1G3W A;  2K2V A;  3QWX X;  3L1A A;  2KAF A;  2X4W A;  2EGA A;  1NG2 A;  2E6Z A;  1K8A C;  4R55 A;  2SEM A;  2L3P A;  1GCQ A;  1K9M R;  1TSF A;  1ZUK A;  4M7A G;  4EMK B;  4XU3 A;  1DJ7 B;  2RHX A;  3QZ5 B;  1VQM T;  2VXF A;  2QTX A;  3G4S A;  1VQO T;  3MEV A;  2ED1 A;  1VQ4 Q;  1S72 Q;  4IKF A;  3PE0 A;  1W6X A;  1WHJ A;  3G6E T;  1IXD A;  1VQ6 T;  4JJB A;  4HT8 A;  4M75 B;  1D1C A;  3KXT A;  3M57 A;  2E3I A;  1ZLM A;  4KUD K;  2PUK B;  5IN1 A;  1Q81 C;  4J9B A;  2QEX A;  1N9R A;  2GFA A;  2D0Q B;  1RAG B;  2DL7 A;  2JTM A;  2HNI A;  2BZ8 A;  3JB9 I;  4C0G A;  3OBY A;  4J9C A;  1ACM B;  1OI1 A;  3MET A;  2CZ6 B;  4A54 A;  5GAN g;  1BIB A;  3EFO B;  1YJN A;  5GAN j;  1UEC A;  2EFI A;  5FU7 C;  1UDL A;  3P8H A;  4A4F A;  2A0F B;  1JQQ A;  5CKH A;  3FB9 A;  3CCM A;  2RO0 A;  1A0N B;  3MP1 A;  2YDL A;  4E47 A;  1NYG A;  1YI2 T;  4MZT A;  2QDY B;  1P92 A;  1NLP C;  5LJ5 h;  3BW1 A;  5GAO r;  2FPF A;  2E5K A;  1V29 B;  3NPF A;  3DB4 A;  3GLX A;  2QQ9 A;  3OYJ A;  4LE9 A;  2EQM A;  3WXM B;  1CKA A;  2YUO A;  3JCM f;  3HHT B;  5GAN 3;  1R0C B;  4A53 A;  3KUF A;  2OTL A;  1WQ7 A;  5KCH A;  3HTR A;  2EYQ A;  4XAX B;  2QXF A;  2LNV A;  4CI0 C;  4E7Z A;  2RQU A;  1WDX A;  3P8D A;  1VQM A;  1OEB A;  4BI3 A;  1VQO A;  1VQ9 Q;  3X25 B;  2HD0 A;  1JBM A;  5L8R E;  4RMO A;  3G6E A;  1MGQ A;  1VQ6 A;  3FEO A;  2MI6 A;  4AG1 C;  5IXF A;  1KFZ A;  3UDC A;  1CKB A;  2CUD A;  5KE3 A;  3JCM e;  3OW2 A;  1MV0 B;  2ECZ A;  3DB3 A;  1FMW A;  1TOV A;  3TCJ A;  4M7D F;  2QA4 Q;  3M0S A;  4RTW A;  1UJ0 A;  4HA8 A;  1TS9 A;  3CMA Q;  2P84 A;  4IIO A;  1GBQ A;  2GBQ A;  4ZN1 A;  5A2Q E;  1S1N A;  2L2P A;  2WSF E;  2DRM A;  1EZZ B;  3CCU Q;  1QP3 A;  4C8Q E;  5HK0 A;  2RNA A;  1NBE B;  4IUU A;  5LJ3 d;  2JXB A;  3OS0 A;  1MV3 A;  1G3S A;  2CH4 W;  4UC4 A;  1OX8 A;  1VIF A;  3E2U A;  3HKS A;  4OB1 B;  4M7D G;  4LN2 A;  1Y96 A;  2LRQ A;  1AZE A;  5LJ5 g;  4TVR A;  4CC4 B;  5GAN f;  4GY5 A;  4DA4 A;  1I8F A;  5LJ5 j;  4C8Q C;  1YIT Q;  1PWT A;  1BB9 A;  2X3X D;  3OS5 A;  2MIO A;  5GAN 4;  3SHW A;  3AT1 B;  3UF4 A;  3FJ5 A;  5I22 A;  3ER0 A;  4PFO A;  4OMP A;  2HL5 C;  5LJ3 g;  4M7A B;  4C92 D;  5LJ3 j;  3MEW A;  3ZEH A;  2A08 A;  4EDU A;  2AZV A;  2DKG A;  2WSE E;  2RN8 A;  3CCS T;  3L2V A;  5GAN e;  3WVE B;  1SEM A;  5GMK e;  2YUQ A;  2EYZ A;  3M54 A;  1ZUY A;  2VUB A;  3VYH B;  3E1S A;  4C92 A;  4JZ3 A;  3VYG A;  4RUG A;  3E9F A;  1K0S A;  1NJI R;  3RKW A;  3J80 E;  3CCJ T;  2V26 A;  3JCM X;  3CCL T;  1X6B A;  1WJQ A;  3KFV A;  5GAO q;  4JJC A;  1PHT A;  4M4Z A;  1OV3 A;  3RUX A;  5C6S A;  3NTI A;  3E19 A;  4XTW A;  1JO8 A;  1TXQ A;  1UHC A;  2RHY A;  1GXI E;  4QKU A;  1NJI U;  2EWN A;  2BKD N;  2V8K A;  1KHI A;  5A0D A;  2GQV A;  1RLQ C;  1KJW A;  4BI8 B;  3JCM W;  4II1 A;  3MHX A;  3VKI A;  4ZTJ A;  3PVQ A;  1B34 B;  3HPW A;  1BU1 A;  2PUO B;  3EGX A;  2NUP A;  1PCX A;  2YRV A;  2HBW A;  2AKL A;  3QKJ A;  1IHW A;  2E70 A;  2EJF A;  1VQ4 T;  2ZPH B;  1S72 T;  1N8R U;  4KRT A;  4QQD A;  1TTH B;  1PD0 A;  3V7R A;  2RHZ A;  5LJ5 f;  2HAX A;  1LCK A;  3FC3 A;  2CSQ A;  3SEM A;  3CBO A;  4OMF B;  2X9H A;  3SB2 A;  1UB4 A;  4FW2 A;  4BE1 A;  4IIM A;  2DPP B;  3EH1 A;  4RTT A;  2RPN A;  8AT1 B;  4JS5 A;  2LQK A;  2NUT A;  4ANJ A;  4LDV A;  2K3X A;  2K5I A;  1Q82 R;  4FYW B;  1M2V B;  3VS1 A;  4F14 A;  2JUF A;  5LJ3 f;  2K79 A;  3LLR A;  1E6G A;  2XDB A;  4NOY A;  1SHG A;  2DEQ A;  5LJ5 e;  3M9Q A;  3GPL A;  1PRL C;  5D6X A;  3LW5 E;  2MF2 A;  1WXT A;  3RDV A;  1Q82 U;  3BDU A;  3CCJ A;  1YJ9 Q;  2RQT A;  5GMK m;  1C0M A;  1D09 B;  2EYW A;  3CCL A;  1RAB B;  1FWZ A;  2ED0 A;  2DXB A;  1B3Q A;  1I4K 1;  5LJ3 e;  1NPP A;  1KIK A;  3JCM c;  4M77 E;  4HCZ A;  1WGS A;  2ZGW A;  7AT1 B;  2DF6 A;  3CXC P;  1RAH B;  2MK5 A;  4J9I A;  4M7D B;  3JV3 A;  2BE9 B;  4KT0 E;  4ORZ A;  3PTA A;  5IHN A;  2LP5 A;  1QCF A;  1YCS B;  2H3J A;  4KH0 B;  3CCE Q;  1OUL A;  4E7K A;  3OYL A;  4M77 C;  3C4S A;  4PJO A;  3EG1 A;  4EPC A;  4A4E A;  1VQ4 A;  1S72 A;  3M0P A;  5CK9 A;  2FB7 A;  2MYS A;  3DLL A;  4XTX A;  5D7U A;  4C5I A;  4DBF A;  2KVQ G;  1EFN A;  3RKY A;  3QJ6 A;  4AFQ C;  4F17 A;  3CC4 Q;  3QG1 A;  4LDU A;  1D0Z A;  1WZO A;  2F2X A;  4RCB A;  1M90 U;  1M1G A;  4BAC A;  3PMT A;  4B6M A;  2RJE A;  4B9W A;  3CMA T;  4PFP A;  1VA7 A;  2CZ0 B;  3MPU B;  2Y4X A;  2P0Q A;  2JW4 A;  3CCU T;  2QK0 A;  1KSW A;  2LJ0 A;  3I55 Q;  1NYF A;  2D9T A;  2RK2 A;  1TG0 A;  3M0R A;  4E7L A;  2E64 A;  4QVD A;  2YXY A;  1TUG B;  5KE2 A;  2BTT A;  3PT9 A;  1YIT T;  1NE8 A;  1K9A A;  4R56 A;  1RAF B;  2L8D A;  2RB6 A;  2CP2 A;  2LX7 A;  3SWN A;  4A4G A;  5GAO l;  2V1Q A;  4J6Y A;  2J06 A;  1Q7Y C;  3VS2 A;  1I0C A;  1TH7 A;  3OS1 A;  2DZC A;  2COZ A;  2EBP A;  1OPK A;  3UAT A;  2DAQ A;  2RK1 A;  1HSQ A;  3GNF B;  5J3B A;  2BZY A;  1VQN T;  2M0Y A;  4FYY B;  4E6R A;  1YP5 A;  2M9U A;  2O4X A;  3A8L B;  1I07 A;  1BCM A;  4BE2 A;  3QJY A;  1V76 A;  4DEX A;  1X6O A;  4C8Q F;  4OMN A;  2PZ1 A;  1VQ9 A;  4ZGJ B;  1M1F A;  3G7Z A;  4RG2 A;  3CCR Q;  2OI3 A;  5KH6 A;  4PLI A;  4AFZ C;  3CC2 Q;  4XTV A;  3EAE A;  2DMO A;  5L23 A;  3CME Q;  4RKU E;  3A8H B;  4P5N A;  2DLP A;  3QO3 A;  2QA4 A;  3JB9 H;  3JSC A;  5HCK A;  5EC7 A;  4ELY C;  2JMA A;  2JTF A;  3CMA A;  4C8Q G;  3CBP A;  3VS7 A;  1QP2 A;  2PNI A;  4BD3 A;  1H3H A;  4QVC A;  5GAM d;  1TWB A;  1W1F A;  1QKW A;  2DXC A;  1N6A A;  3CCU A;  3THK A;  5IHI A;  3EGD A;  3HL8 A;  3JCM h;  3FLG A;  4C0F A;  2RI5 A;  4PJO E;  3I35 A;  4JPB W;  1AOJ A;  1X43 A;  2QI2 A;  1G3Y A;  2DIL A;  1IGQ A;  4OVA A;  2IIM A;  3I5S A;  3QHS A;  1U3O A;  1YIT A;  1D3B A;  2HDA A;  3G1J A;  2A28 A;  1ABO A;  4PJO C;  1D1A A;  2E5Q A;  2KYB A;  2IVW A;  9ATC B;  5GAM j;  4MML A;  4DBH A;  2ATC B;  2MCN A;  1YWO A;  2CDT A;  4PJN A;  4J9G A;  2D6F A;  1PC0 A;  1HXD A;  1SSF A;  2KT8 A;  1T3L A;  1UTI A;  5KYX B;  4XU2 A;  3S3M A;  2J6K A;  4OP0 A;  2KBT A;  2COY A;  4ZGD B;  1U5S A;  3OB9 A;  4FSX A;  2AKK A;  2KNB B;  3CQT A;  2HKQ B;  4M75 D;  1MMD A;  2E10 A;  1LOJ A;  4EMK A;  4JLI A;  1G83 A;  3IQL A;  1WHL A;  5FU7 B;  3A98 A;  4HVV A;  3PFS A;  4N4I A;  5GAN h;  2YUN A;  3HRS A;  4ZGE B;  5GMK h;  3CXC S;  2BE7 D;  5CKE A;  1KK7 A;  5GAN 2;  4MZM A;  4M75 A;  1V1C A;  3UT1 A;  3OSV A;  2RD1 A;  3JCM g;  2DTI A;  1KD1 U;  2QQS A;  3JB9 G;  3FRN A;  5J26 A;  1NLO C;  2FZC B;  3SWN C;  2G3R A;  3CXC A;  1W2B P;  2OTL T;  2YWW A;  3X28 B;  1IHV A;  4J7I A;  3AHU A;  3O5Z A;  1JRI A;  2P4R A;  2Y4Y A;  4LXC A;  3X24 B;  4NL3 A;  5FU6 C;  4M78 F;  1Q95 G;  4E2F B;  4JZ4 A;  3URG A;  1ZQ1 A;  2X3W D;  1N9S A;  1K9M U;  2CP7 A;  3A1P A;  4AFU C;  1G3T A;  3CC4 T;  5FRN A;  4Y91 A;  1HD3 A;  1VQ5 Q;  5GAM f;  1Q86 R;  3CD6 Q;  1TU0 B;  5KYU B;  1PG5 B;  3EG3 A;  1PSE A;  1M8V A;  4F7U A;  1BI2 A;  2KRM A;  1UUE A;  2KYM A;  3QPH A;  2XU8 A;  1ZA1 B;  1M1K R;  4M77 F;  4C5H A;  5GJV B;  3HFO A;  4AT1 B;  1WX6 A;  2YHT A;  4M78 G;  2OX7 A;  3QZ9 B;  4GLK A;  3RES A;  1Q86 U;  2L3Q A;  4C0D C;  1VIE A;  1N27 A;  3RIR A;  1QKX A;  2HBP A;  3TVT A;  1SF9 A;  1W70 A;  4PLL A;  5GAM e;  5GMK j;  3OA6 A;  4LD9 K;  1M1K U;  2XIC A;  1X75 C;  4C8Q B;  4KGV B;  3M5A A;  3NMZ C;  3TQ7 P;  1OU8 A;  1X2Q A;  4M77 G;  3V7C A;  5IH2 A;  2RF0 A;  2RM4 A;  5DM7 R;  3JCM J;  3L42 A;  3MCA B;  2A3L A;  1AZG B;  4HVW A;  5GAN 5;  3OYA A;  1VQ8 T;  1D1B A;  1JU5 C;  3VRY A;  4FYX B;  4QVZ A;  5LJ3 h;  4C5E A;  3CCE A;  2KE9 A;  4DQ2 A;  4IUQ A;  1NM7 A;  3G71 Q;  3PGG A;  1NJI C;  3JB9 D;  1YCY A;  5M9O A;  4YTL A;  2PTK A;  1QMC A;  2HEQ A;  2RQV A;  1X27 A;  4EIK A;  1QWF A;  4ZNX A;  2OTJ Q;  2E4H A;  1K8A R;  3CC4 A;  4M7A D;  2P4T A;  1BI0 A;  4Z88 A;  1M8M A;  2P0P A;  4FL6 A;  3PIP A;  2O01 E;  1GFC A;  1N8R C;  4N0A A;  3M0Q A;  3OYH A;  2F1L A;  4M7A A;  1X6G A;  1Z9Q A;  3VU3 C;  1K8A U;  4PNO A;  1PKS A;  3NGP A;  2QDL A;  1YHQ Q;  1M30 A;  1AWW A;  3LGF A;  3I55 A;  1C6V X;  2D0N A;  2ZPF B;  4WF2 A;  3L2Z A;  1AEY A;  3H41 A;  1RUW A;  3J81 E;  2DYI A;  3D7S B;  1GCQ C;  1IRX A;  5I11 A;  4M78 D;  2CZ7 B;  1SRM A;  4XTU A;  2RHI A;  5GMK l;  1Y0M A;  2DER A;  5EG2 A;  4HXJ A;  4F7U E;  3UA7 A;  4X34 A;  1Q82 C;  3WVD B;  4LDW A;  1ZUU A;  1YIJ Q;  2QAZ A;  4L5G A;  1VQ8 A;  2EVR A;  3L2W A;  2O9V A;  2KXC A;  3MP8 A;  1JJ2 P;  3T9N A;  2COW A;  2YSQ A;  1QVF P;  1TUC A;  3I9Q A;  1B34 A;  2BUD A;  3M0U A;  2JJ9 A;  4PJO F;  3CCR A;  2QQR A;  2OJ2 A;  4D8D A;  2DL3 A;  3CC2 A;  1XJW B;  4K11 A;  3CME A;  2DL8 A;  2ZCF B;  3TSW A;  2EGE A;  5I2S A;  1X2K A;  5KYN A;  1Y57 A;  2E12 A;  2M0O A;  3OYC A;  1M27 C;  1MMG A;  2F2V A;  4M78 B;  1W2B S;  2K3Y A;  1K73 R;  2VGN A;  1TUD A;  2C0T A;  1GBR A;  4J6X A;  5DY9 A;  2OAW A;  2YT6 A;  4JRK A;  4OMM A;  1GFD A;  1M2V A;  3QUI A;  3VUZ A;  1KQ1 A;  1UGS B;  4RTZ A;  3U23 A;  1GL5 A;  1M90 C;  1AVZ C;  5FW9 A;  3VV0 A;  4D6W A;  4IUP A;  4M77 B;  1W2B A;  2KI7 A;  3QSU A;  2W10 A;  4EMH A;  2KQW A;  4A63 B;  1K73 U;  2DEU A;  2KSS A;  3NHN A;  4Z8A A;  2VB6 A;  2RJF A;  2R5M A;  3A5Z B;  1WHM A;  1R77 A;  1EX4 A;  5A0L A;  4XU0 A;  2F5K A;  4M7D D;  2HMA A;  3J7A F;  2W0Z A;  4D8K A;  4M7A E;  1VOM A;  3SDZ A;  3OYK A;  3EGU A;  5GJW B;  2KEA A;  1FX7 A;  3MKD A;  3TSZ A;  3LYI A;  1M3C A;  4M7D A;  1UJY A;  4C5G A;  4LDX A;  1YN8 A;  4N0A C;  1C1A A;  2JM8 A;  1VQ7 Q;  1EIF A;  4LUD A;  1M3B A;  5KYW A;  4Y28 E;  2B86 A;  4FU6 A;  5FWC A;  3QBY A;  2EAY A;  1LVK A;  3ASK A;  3SD4 A;  3CPW P;  2O2O A;  1AD5 A;  3EGX B;  2A36 A;  2ZPG B;  1G5V A;  4RG8 A;  1MMN A;  2QAS A;  5FRO A;  1PNJ A;  1H3Z A;  1RAD B;  5KYY A;  1RL2 A;  3GBQ A;  4CC3 A;  3ULR B;  1R8O B;  2NUT B;  3KBG A;  3M59 A;  1X01 A;  4C92 E;  2WAC A;  3G71 T;  1BK2 A;  2QTV A;  1VQ9 T;  2Z0W A;  1ZSG A;  2XMF A;  3MO8 A;  3RR6 A;  2EIF A;  1H92 A;  4C92 C;  2QGF B;  3OYN A;  2OTJ T;  2LCL A;  3H6Z A;  3R6O A;  1VQ5 A;  4KH1 B;  3CD6 A;  4KGZ B;  4QW2 A;  1RAI B;  2AIR B;  1U06 A;  2QA4 T;  3CC7 Q;  2DJZ A;  4RTU A;  2XHC A;  2HSP A;  4J9H A;  2RQW A;  3HRU A;  2D8J A;  2XID A;  3OSS C;  1Y7X A;  4FCY A;  1FXX A;  4J8O A;  2ROL A;  2JZ2 A;  3QXE B;  2RQR A;  2CS7 A;  1YHQ T;  2XKO C;  2KR3 A;  3BFM A;  1WJR A;  4XTZ A;  3GF5 A;  2JOY A;  1FYN A;  1LPL A;  2VVK A;  2DFU A;  3QII A;  3VUB A;  2DBK A;  3HRT A;  1M9S A;  3EG0 A;  1WFW A;  2RI3 A;  2XI9 A;  4FT4 A;  2B8A A;  4KGX B;  4PJO B;  5GMK i;  1FMK A;  5FRM A;  4A4H A;  2VYT A;  4Z02 A;  4XU1 A;  2MMP A;  4R0K A;  1JEG A;  1VYV A;  1JJ2 S;  5GAM h;  1J3T A;  4LD6 A;  1QVF S;  3PVL A;  3UWN A;  1KHC A;  4O5V A;  3UPU A;  1YI2 Q;  1UGQ B;  4DEY A;  2XK0 A;  5LL6 S;  4BE0 A;  2D1X A;  3CCV Q;  4RTX A;  2DL5 A;  3G71 A;  2LQ8 A;  2DX1 A;  4IUV A;  1KD1 C;  2EQI A;  2GTO A;  5CO7 A;  3H8Z A;  2EKO A;  1QVF A;  5GAN 8;  2P0K A;  1WQW A;  2VGM A;  2NYS A;  4B9X A;  4N4H A;  1BI1 A;  1NEG A;  2ZPB B;  1PKT A;  2OTJ A;  4JLG A;  2H8H A;  2K6D A;  2GF7 A;  1VQL Q;  2DIQ A;  2LX9 A;  1XOV A;  3OW2 P;  4F7U F;  2RMO A;  1KC8 R;  1ZSZ A;  2MOX A;  1K9M C;  2M16 A;  1ZBX A;  5IT9 E;  1YHQ A;  4PK4 A;  3SWN B;  2MAM A;  5GAO p;  2E41 A;  3P8B B;  2CYZ B;  2CT3 A;  3NTK A;  4OML A;  4BUG A;  5ECA A;  4X9C A;  3R6N A;  2ABL A;  1IB8 A;  1KC8 U;  3RNJ A;  4J9F A;  5FU6 B;  1RLP C;  2M51 A;  1YBY A;  1OQK A;  5GAM g;  1RAE B;  1JB0 E;  2L89 A;  3I56 Q;  1HYO A;  1MNE A;  1YIJ A;  4J5Y A;  1M1K C;  3A8M B;  4E7I A;  2DET A;  3N5B B;  2GNC A;  3A8G B;  5CKF A;  2GGR A;  2NLU A;  1KQS S;  1G8X A;  2RH2 A;  5AT1 B;  2H3E B;  2J6F A;  1AWX A;  2AT1 B;  4BY6 C;  2KRO A;  3CPW S;  2JM9 A;  4OGC A;  1KG1 A;  4OB0 B;  4C0D B;  2JNG A;  2V8I A;  2E3H A;  3LWI A;  3CCS Q;  4DBQ A;  1Q7Y R;  3EHQ A;  4EMG A;  1YJ9 T;  2K9G A;  1JXM A;  1OU9 A;  2R58 A;  1IZ6 A;  3ZBD A;  1G2B A;  3MP6 A;  3EG2 A;  4ELZ C;  3CPW A;  4BDZ A;  3TU4 K;  4KBM B;  1OX9 A;  2CT4 A;  5A0G A;  1QVG P;  2FRY A;  1QVP A;  3EG9 B;  1JXO A;  1O9S A;  4E7H A;  4JRI A;  1U1T A;  2GQI A;  4OF1 A;  2DE0 X;  2O31 A;  2DIG A;  2HSE B;  1WHH A;  3BE3 A;  4AFS C;  1M5Q 1;  4OMQ A;  5I21 A;  4HCC A;  3F70 A;  3CCE T;  4C8Q D;  2MPX C;  2HQE A;  4XQ3 A;  4JJD A;  5FLX E;  1PRM C;  2FPE A;  5CIU A;  5D6Y A;  3EFO A;  2KGT A;  2VC8 A;  1MMA A;  4ZTF A;  1YJW Q;  3REA B;  1SHF A;  3VS0 A;  4C0Z A;  3H9N A;  1IO6 A;  4C8Q A;  1GRI A;  2F2W A;  3BY7 A;  1M3A A;  2QYZ A;  3JCM V;  3TEE A;  4HCB A;  1AWJ A;  4JUV A;  2JS0 A;  4L59 A;  2HQX A;  3CC7 T;  1I5L A;  1NPR A;  2E1H A;  3V8K A;  5GAN d;  2CP5 A;  1WA7 A;  3DKM A;  3LGL A;  2K5L A;  3I55 T;  1VQ7 A;  4FT2 A;  1PSF A;  3BDL A;  1HJD A;  3A8O B;  3S3N A;  1IGU A;  1ZSZ C;  1ARK A;  3ZFJ A;  4C92 F;  2DYB A;  1YJ9 A;  4LDY A;  3OMG A;  4L6V 5;  2EQU A;  5FWB A;  4BI4 A;  4IUT A;  1O75 A;  2FPD A;  2SRC A;  4X1V A;  3OYB A;  2DVE A;  2A7Y A;  4IUR A;  2RI2 A;  3H0I A;  2LDM A;  2R5A A;  4DBR A;  4OGE A;  4HT9 A;  2K5F A;  2DTO A;  4C92 G;  2CRE A;  2HKN A;  4OB3 B;  1MHN A;  2RA2 A;  1WJS A;  2LJ3 A;  5CQY A;  2VWF A;  2YLB A;  2K57 A;  4NS5 A;  3CCV T;  4F7U B;  4PL6 A;  2ZAE A;  2DZ9 A;  2LCS A;  3DLM A;  3CCR T;  2IPO B;  1D0X A;  2R57 A;  1WLP B;  3CC2 T;  1VUB A;  6AT1 B;  5HY6 A;  3PIO A;  1UEB A;  2EPD A;  4M75 E;  2DXT A;  2VKN A;  3OW2 S;  1QLY A;  3CME T;  3NFC A;  4EMK C;  1UGR B;  2FZG B;  4E7S A;  1UG1 A;  1VYU A;  1LNX A;  1Y71 A;  1WIE A;  1K73 C;  1W4S A;  1MUZ A;  1BI3 A;  2MWO A;  3OYY A;  3CC7 A;  3L2Q A;  5HKC A;  1VQL T;  2X51 A;  4FSS A;  2PVG B;  4MDW A;  3NTH A;  4M75 C;  2EJG A;  1VQK Q;  4RCC A;  1WYX A;  2LT1 A;  5CKD A;  3JRZ A;  5CAI A;  1XQH A;  1IRE B;  3EFS A;  5LJ5 d;  2LC4 A;  1HK9 A;  1Q81 R;  2QQA A;  5D6W A;  4J7F A;  2IG0 A;  2AK5 A;  2HCK A;  3FIF A;  2X4J A;  2JN0 A;  4ATO A;  1QW1 A;  3M53 A;  4J9E A;  1B07 A;  2YUP A;  4PJL A;  4HVU A;  4NL2 A;  1BBZ A;  2DJQ A;  2QGG A;  3GNG A;  4QQ6 A;  2ZPE B;  4PKC C;  2LQW A;  3M4G A;  2DXU A;  1Q81 U;  2JS2 A;  3I56 T;  3FDR A;  1I81 A;  4M78 A;  3UA6 A;  1OZ2 A;  2EJ9 A;  3OYF A;  1NEB A;  4FW1 A;  1UGV A;  4M77 D;  2LVM A;  1YI2 A;  3L2R A;  2JTE A;  5GAN 7;  2KRN A;  3CCQ Q;  3CCV A;  3PNW C;  1ABQ A;  4GBQ A;  2CKK A;  8ATC B;  4PJJ A;  1K0X A;  5GAO n;  3HP9 A;  4XK8 E;  1WPY A;  1WXU A;  3JCM b;  4M77 A;  2XG8 D;  2FYK A;  3OYM A;  4GLM A;  4LNP A;  2PVD B;  1VQN Q;  2L5Q A;  1AWO A;  2AHJ B;  4BDY A;  1SPK A;  1QVG S;  1ZBJ A;  1NZ9 A;  2L3R A;  1SG5 A;  2DA9 A;  4AMC A;  3JB9 J;  3M0T A;  3QDF A;  3OYI A;  1Y96 B;  1Z9Z A;  2FRW A;  2HZY A;  1VQL A;  2KRS A;  2DL4 A;  2NUZ A;  2LTO A;  3QWY A;  1VQP Q;  5CKB A;  3E9G A;  2GTJ A;  4WCI A;  2DD4 A;  2X35 A;  4PJO G;  1QVG A; 
#chains in the Genus database with same CATH homology
 2FPF A;  4J9G A;  2E5K A;  2J7I A;  3NPF A;  1T3S A;  2BZX A;  2KT8 A;  1T3L A;  1UTI A;  4LE9 A;  2ROL A;  1CKA A;  2YUO A;  2RQR A;  2J6K A;  2KBT A;  1U5S A;  2KR3 A;  2RQU A;  1FYN A;  2VVK A;  1WDX A;  2AKK A;  2KNB B;  1VYT A;  3CQT A;  1OEB A;  2DVJ A;  2DBK A;  1G83 A;  2EYX A;  3IQL A;  3EG0 A;  1WFW A;  3A98 A;  4HVV A;  2YUN A;  1FMK A;  4AG1 C;  5IXF A;  1KFZ A;  1UHF A;  4R0K A;  1CKB A;  2CUD A;  1V1C A;  2DBM A;  1JEG A;  1VYV A;  2O88 A;  1MV0 B;  1J3T A;  2ECZ A;  3PVL A;  3C0C A;  3M0S A;  4RTW A;  1UJ0 A;  3VRZ A;  4DEY A;  1NLO C;  3REB B;  2D1X A;  4IIO A;  1GBQ A;  4RTX A;  2DL5 A;  2GBQ A;  2CUB A;  1S1N A;  3ZL7 C;  2L2P A;  2DRM A;  2DX1 A;  2JT4 A;  2EQI A;  2GTO A;  3O5Z A;  2P4R A;  2RNA A;  2JXB A;  2LNH B;  1MV3 A;  1NEG A;  1PKT A;  3VS5 A;  2CH4 W;  1RI9 A;  2C0O A;  4LN2 A;  2H8H A;  1AZE A;  4CC4 B;  1SRL A;  4JZ4 A;  4RTV A;  2K6D A;  2X3W D;  2LQN A;  1GCP A;  1PWT A;  2KXD A;  4AFU C;  1BB9 A;  2X3X D;  2MIO A;  1HD3 A;  1XOV A;  3SHW A;  3UF4 A;  3EG3 A;  2DM1 A;  2RMO A;  1N5Z A;  2KRM A;  3FJ5 A;  3VS6 A;  5I22 A;  2V1R A;  1YWP A;  1UUE A;  2KYM A;  4OMP A;  2MOX A;  2ENM A;  2I0N A;  5GJV B;  1UE9 A;  2LJ1 A;  2A08 A;  1WX6 A;  2AZV A;  2RN8 A;  1X69 A;  2CT3 A;  2L3Q A;  4Z89 A;  5IHK A;  1SEM A;  4OML A;  2YUQ A;  2EYZ A;  5ECA A;  3R6N A;  2ABL A;  1ZUY A;  1QKX A;  3TVT A;  1W70 A;  4LUE A;  4JZ3 A;  3RNJ A;  4J9F A;  1RLP C;  2M51 A;  4RUG A;  1K0S A;  1YNZ A;  1WXB A;  2CSI A;  3NMZ C;  1X2Q A;  5IH2 A;  1X6B A;  3KFV A;  4JJC A;  1PHT A;  2RF0 A;  4M4Z A;  1OV3 A;  3VS4 A;  2C0I A;  2AZS A;  1AZG B;  2GNC A;  1JO8 A;  4HVW A;  1UHC A;  2GGR A;  2A37 A;  4HCK A;  2J6F A;  4J9D A;  1JU5 C;  3VRY A;  1AWX A;  1T0H A;  2KRO A;  1RLQ C;  1KJW A;  2JM9 A;  3I5R A;  2KE9 A;  1NM7 A;  3PVQ A;  1BU1 A;  3EHQ A;  2PTK A;  2K9G A;  2HEQ A;  1JXM A;  2HBW A;  2RQV A;  2AKL A;  1G2B A;  1X27 A;  4EIK A;  1QWF A;  4ZNX A;  3EG2 A;  4ESR A;  4KRT A;  2ROT A;  1K4U S;  1LCK A;  2CT4 A;  2CSQ A;  2L0A A;  3SEM A;  2FRY A;  1JXO A;  4IIM A;  2FEI A;  3LH5 A;  4Z88 A;  4RTT A;  2RPN A;  1M8M A;  1QWE A;  2GQI A;  2DE0 X;  2O31 A;  1GFC A;  2KT1 A;  3M0Q A;  4AFS C;  2NWM A;  1X6G A;  4OMQ A;  2EYY A;  1UFF A;  1Z9Q A;  1PKS A;  3NGP A;  2QDL A;  3VS1 A;  4F14 A;  1M30 A;  1AWW A;  2K79 A;  1E6G A;  4JJD A;  2D0N A;  1CSK A;  1PRM C;  1AEY A;  1OPL A;  2FPE A;  1SHG A;  1RUW A;  3H41 A;  2KGT A;  2FG0 A;  1PRL C;  2LZ6 B;  2DNU A;  1WXT A;  3REA B;  1GCQ C;  1SHF A;  3VS0 A;  2EGC A;  5I11 A;  1IO6 A;  2RQT A;  1GRI A;  2F2W A;  2EYW A;  1SRM A;  1M3A A;  2EW3 A;  2K7A A;  2ED0 A;  1B3Q A;  1Y0M A;  1AWJ A;  2LMJ A;  2JS0 A;  4HXJ A;  2D8H A;  3UA7 A;  3EHR A;  2K3B A;  1ZUU A;  3H0F A;  2EKH A;  1KIK A;  4QT7 A;  2EVR A;  5IXB A;  2O9V A;  1WA7 A;  2DF6 A;  2KXC A;  4J9I A;  2DRK A;  3JV3 A;  4ORZ A;  1HJD A;  2YSQ A;  2CH4 A;  5IHN A;  1TUC A;  3I9Q A;  2LP5 A;  2O9S A;  1ARK A;  1E6H A;  1QCF A;  1YCS B;  3M0U A;  2DYB A;  2J05 A;  2JMC A;  2OJ2 A;  4D8D A;  3EG1 A;  2DL3 A;  5FWB A;  3M0P A;  2FPD A;  2SRC A;  4X1V A;  4F16 A;  4K11 A;  1T0J A;  2DL8 A;  3TSW A;  1EFN A;  2EGE A;  1K76 A;  4AFQ C;  3H0I A;  1X2K A;  1H8K A;  4F17 A;  1Y57 A;  1M27 C;  2F2V A;  2F2X A;  1OOT A;  2CRE A;  4AG2 C;  4RTY A;  1TUD A;  2L3S A;  2C0T A;  2FO0 A;  1GBR A;  2LJ3 A;  4OMO A;  2OAW A;  2VWF A;  2YT6 A;  4OMM A;  1GFD A;  1VA7 A;  4RTZ A;  3U23 A;  1E7O A;  3VS3 A;  1GL5 A;  1AVZ C;  5FW9 A;  2JW4 A;  2LCS A;  4Y92 A;  1KSW A;  2LJ0 A;  1NYF A;  4CC7 A;  2W10 A;  4A63 B;  4CC2 A;  1ZX6 A;  1WLP B;  3NHN A;  4Z8A A;  1TG0 A;  3M0R A;  1K1Z A;  2EPD A;  2G6F X;  2VKN A;  1QLY A;  2BTT A;  2K2M A;  1UG1 A;  1VYU A;  1WIE A;  1WI7 A;  1MUZ A;  1K9A A;  2ESW A;  2J6O A;  1SSH A;  3RBB B;  2W0Z A;  4D8K A;  2LX7 A;  4FSS A;  2V1Q A;  2J06 A;  3EGU A;  5GJW B;  2KEA A;  3VS2 A;  1I0C A;  1WYX A;  3TSZ A;  3H0H A;  2EBP A;  1I1J A;  1M3C A;  1OPK A;  3UAT A;  1UJY A;  1HSQ A;  3QWX X;  2BZY A;  1YN8 A;  2EGA A;  1NG2 A;  2M0Y A;  4E6R A;  2JM8 A;  1YP5 A;  4LUD A;  1M3B A;  2AK5 A;  2HCK A;  1I07 A;  2B86 A;  2SEM A;  4DEX A;  2L3P A;  4J9E A;  1GCQ A;  1B07 A;  2YUP A;  4OMN A;  2PZ1 A;  1ZUK A;  5FWC A;  4HVU A;  1BBZ A;  2OI3 A;  2DJQ A;  2O2O A;  1AD5 A;  4AFZ C;  2ED1 A;  2A36 A;  3PE0 A;  2LQW A;  2DMO A;  5L23 A;  1W6X A;  2JS2 A;  3UA6 A;  2DLP A;  4JJB A;  1PNJ A;  1NEB A;  1UGV A;  1ZLM A;  5HCK A;  3GBQ A;  5EC7 A;  4J9B A;  2JTE A;  2JMA A;  2KRN A;  3VS7 A;  4CC3 A;  1ABQ A;  3ULR B;  2PNI A;  1H3H A;  1W1F A;  4GBQ A;  1QKW A;  1K0X A;  2DL7 A;  3THK A;  5IHI A;  1WXU A;  2BZ8 A;  4J9C A;  3I35 A;  4JPB W;  1AOJ A;  4GLM A;  1BK2 A;  1X43 A;  4LNP A;  1AWO A;  2DIL A;  1ZSG A;  1SPK A;  2XMF A;  1ZBJ A;  2IIM A;  3I5S A;  2DA9 A;  1H92 A;  3M0T A;  1U3O A;  1UEC A;  2HDA A;  1Z9Z A;  2FRW A;  2A28 A;  1ABO A;  1UDL A;  2KRS A;  2DL4 A;  1JQQ A;  2NUZ A;  3QWY A;  2KYB A;  1A0N B;  2GTJ A;  1U06 A;  4WCI A;  2YDL A;  4RTU A;  2HSP A;  1NYG A;  4J9H A;  2RQW A;  2MCN A;  1NLP C;  1YWO A;  2D8J A;  2CDT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...