1T0HA

Crystal structure of the rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0hA00
2FPFA 1K1ZA 1WXTA 2AKKA 2CT4A 2LP5A 1Y0MA 1K76A 4LUDA 1B07A 2V1RA 4OMNA 2EGCA 1U06A 4K11A 1JQQA 1MUZA 1PWTA 2B86A 4RTXA 2DRKA 2RQWA 1K9AA 4ESRA 5FWBA 2BZXA 2M0YA 5IHKA 3NHNA 2DX1A 2YUOA 1JXMA 2DNUA 1HJDA 2GTOA 3VS2A 2EYWA 2GBQA 2KT8A 1PHTA 2RQVA 5GJWB 1YWOA 2RQTA 4AFZC 1G83A 4LN2A 3ULRB 5GJVB 2ENMA 2FRWA 2O2OA 1SEMA 2KRNA 2DL7A 2JM8A 3EG0A 2EPDA 3R6NA 2JMAA 1N5ZA 4J9CA 2O88A 1FYNA 2GTJA 2C0IA 2JS0A 2CSQA 1T0HA 3EG2A 1QWFA 1GCQC 2FPEA 2VKNA 1BU1A 2DL4A 1AOJA 4R0KA 2KRMA 1NLOC 2DMOA 2EYXA 1X2QA 4LNPA 3TSZA 1PRMC 1UE9A 2X3XD 1W1FA 2RQUA 5I22A 1KJWA 1I0CA 3TVTA 4RTUA 2L3QA 3LH5A 3M0PA 3PVQA 1ZBJA 2KYBA 1M3CA 2DF6A 2AKLA 1RUWA 2J6FA 3VS4A 2A08A 2KT1A 2VVKA 1CKAA 2J05A 1X6BA 2DE0X 4LUEA 3VS3A 4D8KA 1AWJA 2EYZA 1AD5A 2GNCA 3VRYA 1QKXA 1BK2A 1ZLMA 3O5ZA 1JO8A 2KNBB 1U5SA 4JJBA 4AFQC 2K2MA 2LNHB 3RBBB 1NEGA 1YP5A 4OMOA 2PNIA 1YWPA 2YT6A 1A0NB 1H8KA 2J6OA 1B3QA 2LJ1A 2O9VA 1W6XA 1VYUA 1M8MA 1J3TA 4IIOA 2CH4A 3C0CA 2AK5A 1JEGA 1ARKA 1SHFA 1GCQA 2RPNA 1NM7A 4J9IA 3GBQA 4HCKA 3UF4A 3ZL7C 4J9BA 1E6GA 2FRYA 2IIMA 2D1XA 2ABLA 3KFVA 2XMFA 1GRIA 2JW4A 3UA6A 3A98A 2LZ6B 2LQWA 2DJQA 1QKWA 4RUGA 3VS0A 1OOTA 1Z9QA 2W10A 5FWCA 2CUDA 4HVUA 2G6FX 1G2BA 1UJYA 1I1JA 4OMPA 4WCIA 4A63B 4IIMA 4LE9A 2K7AA 4F14A 2MCNA 2HDAA 2ROLA 4HXJA 3VS7A 1T3LA 1Z9ZA 3EG3A 2ED0A 1RLPC 1YN8A 2OAWA 1U3OA 4FSSA 4JJDA 4RTTA 2W0ZA 1NEBA 2X3WD 1LCKA 4J9HA 2DM1A 3I35A 4RTYA 2KE9A 3EHQA 2KEAA 5IXFA 1AZEA 3VS6A 1JXOA 2NWMA 3H41A 2OI3A 2BZ8A 3EHRA 2DL8A 2DL5A 5HCKA 3REBB 4AFSC 2A36A 2FEIA 1TG0A 2RNAA 1K0XA 3M0QA 4QT7A 2EGAA 4JZ4A 1K4US 2QDLA 5EC7A 1GBRA 4AFUC 3RNJA 1ABQA 1FMKA 2BTTA 3NGPA 1SRMA 2BZYA 1GFDA 2SRCA 1YNZA 2KR3A 2MIOA 2SEMA 1SHGA 4OMLA 3VRZA 1ZUKA 2JT4A 1GL5A 1SPKA 1NYFA 2A37A 1UGVA 1RLQC 4GBQA 2DL3A 1MV0B 3EG1A 1KSWA 3UA7A 1TUDA 2FO0A 2J6KA 2OJ2A 1AZGB 2PTKA 2KRSA 1X27A 3NMZC 3THKA 5L23A 2YSQA 3M0SA 2DILA 3VS1A 4E6RA 1VA7A 1UHCA 4ORZA 1OV3A 1AWOA 4DEYA 3I9QA 4J9GA 2EGEA 2LQNA 2EYYA 1M3AA 1BB9A 4CC7A 2YUPA 4JJCA 1T3SA 2ESWA 2K9GA 1AWXA 1SSHA 2JMCA 1AEYA 2L3PA 1CKBA 1NLPC 1WX6A 2K3BA 2HCKA 1WYXA 1WFWA 2GGRA 1W70A 4KRTA 2JM9A 2O31A 4OMMA 1NYGA 2LJ3A 2F2WA 4Z89A 2AZSA 2DYBA 1UHFA 1M27C 4GLMA 3TSWA 3PVLA 1X6GA 1I07A 3QWYA 2L2PA 1YCSB 4HVVA 4CC4B 2O9SA 4Z88A 1VYVA 4F16A 3NPFA 2M51A 1HSQA 1WXUA 1BBZA 2VWFA 3CQTA 1V1CA 2F2XA 2H8HA 2JS2A 2K79A 2KXCA 1UTIA 1H3HA 1GBQA 1XOVA 1K0SA 4J9DA 1MV3A 2A28A 1PKTA 1TUCA 3M0TA 1OPLA 2FPDA 1QWEA 4OMQA 1GCPA 1M30A 1UECA 2LMJA 2L0AA 3I5RA 1SRLA 1X43A 2ROTA 1X2KA 3VS5A 2PZ1A 1M3BA 1ZUYA 2HEQA 1OEBA 2EKHA 2KGTA 4JPBW 1AVZC 5FW9A 5IHNA 1WA7A 2JTEA 1T0JA 2YUQA 3IQLA 3I5SA 2KYMA 2CREA 1WI7A 1UFFA 2RN8A 3U23A 2D8HA 2ED1A 2GQIA 1WIEA 2NUZA 3EGUA 3H0FA 5IXBA 2DBKA 4D8DA 3H0IA 1GFCA 1X69A 2J7IA 4J9EA 2EBPA 2RMOA 2LX7A 2RQRA 1IO6A 2V1QA 2P4RA 4ZNXA 1UDLA 4F17A 3REAB 2DVJA 1E6HA 1UG1A 2HBWA 2C0TA 5I11A 1KFZA 2DLPA 1E7OA 2MOXA 4CC3A 1RI9A 2KBTA 1UJ0A 2DA9A 2D8JA 2RF0A 4HVWA 1NG2A 2CH4W 2HSPA 2J06A 4Y92A 4RTWA 3SEMA 1KIKA 1HD3A 1AWWA 2AZVA 2KXDA 2DRMA 1S1NA 1ZX6A 4Z8AA 3PE0A 2EQIA 1ZSGA 2D0NA 2YDLA 4EIKA 2FG0A 3JV3A 2F2VA 4RTVA 4CC2A 4AG2C 3FJ5A 2C0OA 2E5KA 3UATA 2LJ0A 1JU5C 1VYTA 2YUNA 1QLYA 2KROA 1UUEA 2CDTA 2EW3A 2EVRA 1EFNA 5ECAA 4AG1C 1ABOA 3SHWA 1WXBA 4RTZA 1WDXA 3M0UA 4JZ3A 1WLPB 2L3SA 1PKSA 2JXBA 5IH2A 2DBMA 4DEXA 5IHIA 1H92A 3H0HA 4J9FA 2CSIA 2LCSA 2ECZA 1QCFA 4X1VA 4M4ZA 1ZUUA 1Y57A 1PRLC 2K6DA 3QWXX 2I0NA 1CSKA 3M0RA 2CT3A 1OPKA 1PNJA 2CUBA
chains in the Genus database with same CATH superfamily
3MKDA 5CK9A 2FPFA 1YITT 4PKCC 1B07A 2QI2A 2V1RA 1VQNA 3S3NA 4FT4A 4QW2A 2B86A 1YBYA 3OW2P 1K9AA 2BZXA 2M0YA 3NHNA 2YUOA 4M75B 1G3YA 2RH2A 3VS2A 4M7AC 3DB4A 2VXFA 2RJFA 3G6EA 4EMKA 1PD1A 2E3IA 2CKKA 4RCCA 3SDZA 4ZTJA 4C92B 1RAAB 4LDYA 1G83A 3X24B 3HSBA 3SWNA 3CD6Q 2O2OA 3JAME 1SEMA 2KRNA 3OYBA 2E3HA 3R6NA 2JMAA 4PJMA 2C0IA 2X4JA 1WQWA 5DY9A 3CC4A 4OB3B 2R5AA 3HRTA 4QQGA 4M77D 4R0KA 2KRMA 1NLOC 5GAN6 3SB2A 1VQ5Q 1X2QA 4X9CA 1PRMC 1UE9A 1RAEB 2NUPB 2LT1A 1YHQA 4MZTA 2V26A 1I0CA 1K73R 4RTUA 3C95A 4MMLA 1YIJT 3QXEB 2DF6A 1S72Q 2J6FA 1U8RA 1P92A 1VQOT 1W2BP 4FIBA 2MWPA 1X6BA 4LUEA 1SSFA 3VS3A 2WSEE 3OYEA 2BKDN 2QA4A 3RMQA 2GNCA 5LJ3h 2A7YA 3VRYA 4FCYA 2ZAEA 2QASA 3O5ZA 4ZTFA 2KNBB 3X25B 4MDWA 4JJBA 2K2MA 4M77F 3RBBB 2CZ6B 1YP5A 1LPLA 9ATCB 4EMKB 3BW1A 4M78E 5KCOA 2EJ9A 1D3BB 1B3QA 2V8JA 2O9VA 1VYUA 4QVDA 1J3TA 1MMGA 3X26B 5FU6C 2DD5A 1VQ5A 5A2QE 5GANj 2L5QA 2O4XA 4PJOF 4BB7A 3LWIA 2HMAA 2ABLA 2PU9B 1UB4A 3CCUA 3KFVA 2XMFA 2EJFA 2JW4A 3VKIA 2MPXC 4DBHA 3G4ST 1QP3A 1OOTA 1PM3A 2QGFB 3KBGA 1Z9QA 5KYXA 1S72A 1C0MA 1M2VB 4FW2A 4M7DD 1UJYA 1Q7YU 1I1JA 1WHMA 3JCMc 1JRIA 5KYUA 1VQ8Q 1QVFS 2ROLA 1BI3A 1T3LA 2XDPA 1VQ6T 2KDSA 3CMET 1U3OA 5I2MA 1NEBA 2X3WD 1TS9A 4J9HA 1NPPA 4IUUA 5GMKe 4HCBA 2HL3A 3CCEA 3CCSQ 4C8QD 1RAIB 3H41A 1ZBXA 2BZ8A 2QGGA 3REBB 2KK4A 1IGQA 2YHTA 1K0XA 2VB6A 4HT9A 4QT7A 4WF2A 4JZ4A 3QYGB 4M7DF 2XKOC 1C1AA 5GAN4 1FMKA 3BDLA 2K3XA 3NGPA 1M90C 2DZ9A 1WHKA 1SRMA 1XQHA 2DO3A 2MF2A 3FRNA 4NL3A 1Q82C 1GFDA 1SHGA 2YWWA 2VXEA 1K8AC 2V8IA 4M78F 2HL5C 4NS5A 2O4XB 3LGFA 3JSCA 3UA7A 1TUDA 6AT1B 1YJWT 1N27A 1X27A 3NMZC 1UGQB 3OSVA 2D6FA 4C8QF 3CXCA 1Y7XA 2EIFA 2ATCB 5KYXB 1VA7A 2QQBA 4ORZA 2FHDA 3RDVA 3NTKA 2EYYA 2AIRB 4M77A 2P0QA 3CCSA 1NLPC 2HCKA 1KC8R 3CC7Q 2JM9A 2O31A 4OMMA 1EX4A 3JB9H 1NYGA 3JB9J 4Z89A 1KHCA 1M27C 1VQNT 3TSWA 2R57A 1NE8A 4HVVA 4CC4B 4M75E 3MCAB 2QXFA 2DERA 3L2ZA 1BIAA 2V8KA 4PJOA 5M9OA 3Q1JA 3OYHA 2XI9A 2EAYA 1WXUA 2HQEA 4BUGA 3RKWA 1BBZA 2VWFA 2CZ0B 1F1BB 2JS2A 2K79A 2KXCA 4C92E 1H3HA 4IUTA 2PUOB 1GBQA 3E2UA 2M1HA 3G6ET 1K0SA 2XU8A 1PKTA 3M0TA 1OPLA 1QWEA 4OMQA 1UECA 4XU1A 2QQAA 3OS5A 3CCLQ 1M1FA 5LJ5d 3JCMP 3A1PA 2HEQA 2D9TA 2EKHA 2KGTA 1VIFA 5IHNA 1SKUB 4JDSA 2JTEA 3CC4T 2F5TX 2RHUA 3U23A 5EG2A 4D6WA 2ED1A 2NUZA 2YRCA 3EGUA 4IUQA 5KYWA 3BE3A 3MP6A 4M77B 1QVGS 3E9GA 1V76A 1OX9A 4D8DA 1YHQT 2OX7A 1X69A 2RI5A 2RQRA 3UPUA 5GAN3 2H3EB 2DFUA 2EWNA 3OS0A 3REAB 1ZA1B 2R5MA 2DVJA 4M78A 1GXIE 2QQSA 1E7OA 4LDVA 3QPHA 4PJOB 3JCMV 3G71A 4LD9K 2QA4T 1M5Q1 1UJ0A 2D8JA 1XNIA 2HSPA 4WTOB 2R58A 4N0AA 2RJDA 4C8QA 2AT1B 1H3ZA 3CCLA 1HD3A 1OULA 2GFUA 2ZGWA 4BD3A 1ZX6A 1NJIU 4XU3A 5CQYA 2ZPEB 1D09B 1PSFA 1BCOA 2HNIA 3L2RA 1K9MC 5AT1B 3JB9I 3WVDB 1JU5C 1VYTA 2RK1A 2RM4A 2EVRA 5FRNA 1ABOA 1Q95G 1WDXA 3M0UA 1BI0A 4PLLA 1ZSZA 2JXBA 3X28B 5A0LA 3CCUT 3SWNC 5IHIA 2RD1A 3PIOA 5KYWB 3CPWS 5LJ5e 1XTDA 1O75A 3P8HA 1FMWA 1QCFA 4X1VA 2DPPB 4M4ZA 1ZUUA 2K6DA 8ATCB 1VQKT 3QWXX 1PSEA 3OMGA 5CVIA 4M7DB 2VC8A 4JJNK 2RHZA 1K1ZA 5I21A 2CT4A 4PJOG 2PVGB 2VYTA 4FYVB 2CS7A 3QHSA 5GAN8 2XK0A 3WXMB 5DM7R 1U06A 3EAEA 2XG8D 1JJ2S 1JQQA 3CCET 1MUZA 1PWTA 1VOMA 3AHUA 1IHWA 2DX1A 4C0GA 2DXTA 4C8QB 2OTJQ 1KQ2A 2RK2A 2DNUA 3JB9G 2EYWA 4PJJA 1H641 2GBQA 1Q7YR 1YJNQ 3OYYA 1PHTA 2ZZDA 3S3MA 1I81A 4DA4A 4FYYB 5AYFA 2GF7A 3CCJQ 1VQLA 2FZGB 4J9CA 1FYNA 1OX8A 1ZSZB 2NLUA 3H6ZA 1YJ9Q 1K73C 1U1SA 2JS0A 2ZCFB 5CO7A 4E7IA 3TU4K 4XAXB 2VKNA 2DL4A 1AOJA 2EYXA 3CBOA 5IAYA 2XHCA 4FYWB 4LNPA 3TSZA 2E64A 4OMFB 3OW2A 1KD1U 2K5LA 2DD4A 5I22A 4M75A 2FZCB 5CKBA 2RHXA 1LOJA 2GFAA 3I56Q 2ZPHB 3LH5A 3M0PA 4M78G 5IN1A 1VQMQ 3GIBA 4N4GA 1RL2A 2YLBA 2OTJA 1KHIA 1VQ4A 2KT1A 2VVKA 4PK4A 1SF9A 1YJNA 3PT9A 1WGSA 4D8KA 1VQ9Q 1AD5A 2RI3A 4EDUA 2QDYB 1JO8A 1N8RR 3CMAQ 2IG0A 2RA2A 2K57A 1QP2A 4GY5A 3ME9A 5LJ3d 3QIIA 2J6OA 4JRQA 2NUPA 3CCMQ 4C0DC 2IVWA 5KYNA 2AK5A 1LVKA 1JEGA 2FVUA 3MP1A 3OBYA 1N9RA 3ZEHA 1QVFP 4J8OA 2WSFE 1O9SA 1Q86U 4FL6A 4JS4A 1W2BA 3UA6A 2HQXA 4M77E 2LQWA 3QSUA 4RUGA 4C5IA 3VS0A 3CCRQ 1PG5B 5HK3A 5GAN7 4HVUA 3G1JA 1QCOA 1OU8A 1R0CB 4OMPA 1R0BG 4XTUA 3EH2A 4IIMA 3CCQQ 2LT4A 4BDYA 4ZN1A 1LNXA 4OGEA 1Z9ZA 2ED0A 5GMKi 4ELYC 4PJOE 5FROA 3CMAA 1M1KU 1D3BA 5GAOn 1KQSS 2OTLA 3EHQA 5D6XA 5LJ3j 1ZHIA 1AZEA 2DVEA 5CIUA 3JCMd 5J3BA 3L2WA 3G71T 2HD0A 5HCKA 3CC2Q 1G8XA 3I55A 1ACMB 2FEIA 3HHTB 1K4US 5EC7A 4AFUC 2X4YA 1M2VA 5GANd 2RHYA 3V8JA 4II1A 5HK0A 2SRCA 2PVDB 1YNZA 4M7AD 2YRDA 1PCXA 2SEMA 4L5GA 2JT4A 3QG1A 1IGUA 2A37A 3CCVT 4GBQA 3EG1A 5LJ3e 5KE3A 3HFOA 2OJ2A 1AZGB 2PTKA 3CCQA 5L8RE 3QDFA 4UC4A 3FJPA 1OU9A 3INZA 5I2SA 2DILA 1U1TA 3VS1A 1KC8C 4M75G 4F7UF 4M7DE 2LVMA 2QEXT 1X75C 4DEYA 3I9QA 2JNGA 3MJXA 3CD6A 1BB9A 2YUPA 1YI2Q 5GAMf 1SSHA 1RADB 4C92G 1NJIR 4PFOA 2L3PA 1CKBA 3META 4J6YA 2HBPA 3L2QA 3CC2A 1WFWA 4M7AF 1W70A 4LDXA 2KQWA 5FU7B 2AZSA 2DYBA 5DLOA 1D0XA 4DOWA 1VQPT 1X6GA 4C8QE 3M4GA 1I5OB 5GAMg 3UWNA 2O9SA 3OYMA 2NUTA 5FLXE 1VYVA 2F1LA 1TUGB 3NPFA 2XIDA 1D0ZA 4E7ZA 2L3RA 4M78C 4JUVA 3TQ7P 1IB8A 1V1CA 1WPYA 2F2XA 3JCMe 1C6VX 2EQKA 4KGVB 3M57A 4N0AC 3LH0A 2FPDA 5CR2A 3JCMQ 2LMJA 3I5RA 1X43A 3QZ9B 1QVGP 1X2KA 4J6WA 2PZ1A 3M53A 2P84A 4JRPA 1VQ7T 1VQLT 5GANe 1OEBA 3HRSA 4PNOA 2OAUA 3OYNA 1YI2A 1WHLA 3OS1A 4MZPA 2X9HA 2CREA 4J5YA 4C5EA 2GQIA 2KVQG 3H0FA 3JCMX 2LQ8A 2QQ9A 2DBKA 2XICA 2ZPIB 1BCMA 4PL6A 4ZN3A 4C0FA 2J7IA 4J9EA 2PVOB 4LDUA 2M9UA 3EG9B 1UDLA 2EFIA 2EYQA 3HP9A 1VQ4T 3MP8A 3MO8A 1G5VA 1UG1A 5LJ5g 2HBWA 2C0TA 3L42A 1JBMA 2DLPA 3L2VA 3HPWA 4C0ZA 2NUTB 4XK8E 2P0PA 4CC3A 1RI9A 2RF0A 3NFCA 1UEBA 3HL8A 3ER0A 3C94A 4DQ2A 1VQ8A 5J39A 2XDBA 1MNEA 5D7UA 4JRIA 2MAMA 4BY6B 1KIKA 1KD1R 2AZVA 2KXDA 4E7LA 4Z8AA 1ZSGA 2YDLA 4EIKA 3JV3A 3J80E 4BI8B 1SG5A 4RTVA 4TVRA 2E1HA 4CC2A 4E47A 3URGA 1RACB 2C0OA 3DKMA 3E1SA 2EQMA 2YUNA 1TSFA 2EW3A 4M7AA 1TWBA 4A53A 4AG1C 3SHWA 1WXBA 4RTZA 1NPRA 4JZ3A 2DEQA 1YITQ 2MK5A 2PQWA 3RR6A 1Q81U 3EGDB 4J9FA 4RG2A 1JJ2P 1M1GA 1PRLC 2K2VA 2I0NA 1CSKA 2A3LA 1WHHA 3M0RA 2CT3A 1OPKA 2COWA 3FIFA 5C0MA 1PNJA 2CUBA 1WXTA 2LP5A 1Y0MA 1K76A 4M75C 4LUDA 1QQJA 2E12A 1Q7YC 2OTLT 3RKXA 4IUVA 4E7SA 1Y96A 2RB6A 3FLGA 3GNGA 3PNWC 4ESRA 5FWBA 1Q86R 2DAQA 4A54A 4C92C 3I55T 2DKGA 4DBQA 3CC7A 2VASA 1HYOA 3HRUA 4F7UB 2CP6A 2JTMA 2M0OA 2DXUA 1YWOA 4AFZC 4BDZA 2X51A 2A0FB 5GJVB 2ENMA 4M7DA 3M55A 4A4KA 3M54A 4M7AB 2FRWA 1W4SA 2DL7A 1M1KR 1RAGB 3EH1A 3EG0A 1N5ZA 2O88A 2GTJA 1YIJQ 2Y4XA 5CKEA 3OYAA 3EG2A 1QWFA 4LXCA 2K5FA 1VQOQ 1TU0B 2FPEA 1BU1A 3ZFJA 3PFSA 4ZGJB 3A8GB 2X4WA 2BUDA 1K73U 3TEEA 5KH6A 2X3XD 5GAMh 1NZ9A 2DZCA 4IKFA 3CD6T 3TVTA 3O8VA 2D0QB 4AMCA 3PVQA 1ZBJA 2KYBA 1M3CA 3QYHB 4C5HA 5KE2A 1N8RC 3QZ5B 2A08A 2E6NA 4CRIA 4LDWA 1CKAA 3AT1B 2FZKB 3V7CA 1Y96B 2DE0X 4EMKC 1VQ5T 3OB9A 1QKXA 1EIFA 1BK2A 1D1BA 3M56A 1U5SA 4AFQC 4M77G 4EMHA 1YWPA 2YT6A 1S72T 1A0NB 2E4HA 3G4SQ 1YIJA 4M7AG 2RHIA 5CCAA 2Y4YA 1W6XA 1VQOA 1M8MA 1TOVA 3C0CA 4MDXA 5GMKm 1ARKA 1GCQA 2RPNA 3OMCA 4O5VA 1WNLA 1WQ7A 2IIMA 5CKDA 3L1AA 3P8DA 1VQ6Q 3CMEQ 1FX7A 1GRIA 3QUIA 2LRQA 4XTVA 2WACA 2DJQA 3LW5E 1QKWA 1KQSP 2WSCE 4OVAA 3FEOA 5FU6B 1TTHB 2W10A 5FWCA 3VV0A 1G2BA 1MMDA 4OF1A 4PLIA 2YRVA 4N4IA 4LE9A 2K7AA 3JCMW 3G7ZA 2MCNA 4YTLA 4HKEA 2Y90A 4QQ6A 1RLPC 2LTOA 1IHVA 3J7AF 4FSSA 4IUPA 4RTTA 2DTHA 1R8OB 1LCKA 2DM1A 4DBFA 4RTYA 2KEAA 3A8MB 4ELZC 5IXFA 3G4SA 3VS6A 1JXOA 3MEWA 2OI3A 4E7JA 2FYKA 3E9FA 1QVPA 2DL8A 3ASKA 4OB2B 2DL5A 1QVFA 4FW1A 5J26A 1YJWQ 1VQ8T 1TG0A 3V8LA 2RNAA 4ME7A 3M0QA 3MEUA 4ATOA 2QDLA 4M7DG 2K3YA 3VUZA 4EPCA 4XTYA 3CXCS 1KQ1A 3CMEA 3C12A 1DJ7B 3VU3C 3JCMf 5D6WA 1BYMA 2KR3A 2MIOA 3VRZA 3CCST 1YFNA 5GAN5 4BY6C 2DL3A 1MV0B 2E41A 3T9NA 5C6SA 4RMOA 2O01E 2KRSA 3FDRA 4CI0C 1NJIC 2YSQA 5GANf 3JRZA 4C8QG 3JCMg 2C06A 1ZA2B 1MGQA 1HK9A 5D6YA 4ZGDB 4RKUE 1OV3A 2L8DA 1AWOA 1M3AA 4CC7A 3CCJA 1AWXA 5GANg 1WX6A 2K3BA 2GGRA 5GAOl 4A4GA 1YJ9A 2DTOA 2JZ2A 2LJ3A 3G6EQ 1ZQ1A 1UHFA 4KH0B 4GLMA 3OYGA 2MWOA 3PVLA 2DTIA 1I07A 1JB0E 1YCSB 2YXYA 2NYSA 4FU6A 4QKUA 4XU2A 4Z88A 3OYCA 4PFZA 4A4EA 4F7UE 4BE2A 4QQDA 4KH1B 2M51A 3I56A 1Q81R 3QJ6A 5GAOp 2LX9A 1VQMA 3CC7T 3BFMA 2H8HA 2XD0A 3M58A 3CC4Q 4M7AE 3QDRB 1WHJA 3M5AA 4KUDK 2DIGA 1VQ9A 3LLRA 1SRLA 5GMKl 2ROTA 3VS5A 2VGMA 1YHQQ 1ZUYA 2DIQA 4ZGEB 4JPBW 1AVZC 4M77C 1WA7A 3IQLA 2YUQA 3EGXA 1YCYA 5CQXA 1WI7A 4Y28E 3ZBDA 3UT1A 2RN8A 3QO3A 2D8HA 2BIVA 4B9WA 1FXXA 1PD0A 3CCMA 5IXBA 2HAXA 4QVCA 2QA4Q 3KUFA 4KULA 3PMTA 3CCLT 3H0IA 1GFCA 3OYFA 4PJOC 1FWZA 2EBPA 3OY9A 2RMOA 2BE7D 1IO6A 1RAFB 2LC4A 2V1QA 3M4YA 1I5LA 5GAN2 4ZNXA 1N6AA 2KSSA 1KK7A 3RMSA 4R56A 3CCRA 3L2UA 4JS5A 1KD1C 1E6HA 3F70A 2QG9B 3OBWA 5I11A 3A8HB 1VUBA 1QVGA 1M90U 4KGZB 1Q82U 2Z0WA 2KBTA 1K8AU 1NG2A 1LJOA 4RTWA 3BY7A 2JTFA 1RI0A 1N9SA 3SEMA 1AWWA 3LYIA 3C4SA 3CCUQ 2QTXA 1S1NA 5A0DA 4Q5WA 3A8LB 1UGSB 2XDDA 2FG0A 2F2VA 1WJQA 4PJOD 4AG2C 1RABB 3FJ5A 4BE1A 3UATA 3BDUA 1VQKQ 5A0GA 1QLYA 1UUEA 2KROA 2CDTA 1EFNA 3V7RA 5ECAA 4AT1B 4XU0A 3EG9A 3RIRA 2HKQB 1UGPB 2L3SA 3EGXB 1PKSA 4JRKA 2JN0A 4M7DC 2DBMA 5HY6A 4DEXA 2QQRA 4BI3A 4XQ3A 4J7FA 3JB9D 1V29B 1H92A 3H0HA 4OB0B 2CSIA 2ECZA 2PUKB 2LQKA 3CCEQ 4R55A 1BI1A 2G3RA 3TCJA 5IT9E 2KI7A 2CP7A 3P8BB 1OZ2A 3SWNB 2KAFA 4MZMA 1Q86C 2MI6A 2AKKA 2MYSA 4C8QC 3GLXA 3CPWA 1OI1A 4OMNA 5GMKj 2EGCA 1Y71A 1WJSA 2KMTA 2COYA 3EFOA 4K11A 3HTRA 1I8FA 4RTXA 2DRKA 2RQWA 3VYHB 5IHKA 5FRMA 1MNDA 2P0KA 2X35A 1VQKA 1M2OA 1JXMA 3LWHA 4RCBA 2HSEB 3JB9F 1HJDA 2GTOA 1M1KC 1IXDA 3GP8A 3JCMJ 3MHXA 3EGDA 2CP0A 2KT8A 2RQVA 1IZ6A 3JCMb 4HA8A 3JCMh 4M78D 5CKFA 1ZSZC 5LJ5f 1JJ2A 2LCCA 3WVEB 2CZ7B 2F5KA 5GJWB 2RQTA 4Z02A 2IPOB 4GLKA 4LN2A 4XTWA 3ULRB 2QTVA 4BACA 2EQUA 3OW2S 4ANJA 2JUFA 1I4K1 4HCZA 2JM8A 1HXDA 2OTJT 2EPDA 3GNFB 4XTXA 5GANh 2QK0A 2EJGA 2CSQA 1T0HA 1YJNT 1GCQC 5GMKh 2BE9B 4PJLA 2DMOA 3VYGA 4A4HA 2E5QA 3PMIA 1FMVA 3S3OA 1W1FA 2RQUA 4E7KA 1KJWA 3CCJT 3CEYA 1BKBA 2JJ9A 4F7UA 2L3QA 2ZPBB 4J83A 3H9NA 2HZYA 3CPFA 1YJ9T 3CPWP 2AKLA 1RUWA 3RKYA 3VS4A 5GAMd 3EFOB 1G3TA 2J05A 2DEUA 1M4ZA 1AWJA 2EYZA 1N8RU 3FB9A 3RERA 1K9MU 4DBRA 1ZLMA 3GF5A 2VV5A 3I56T 1D0YA 3A8OB 2LNHB 1NEGA 2EQJA 1VQMT 4OMOA 5KYUB 2PNIA 3TREA 3EFRA 3NTHA 2E65A 5HKCA 3R6OA 1BI2A 3QJYA 3OA6A 1W2BS 1H8KA 2LJ1A 3CBPA 4J7IA 2FB7A 1VQ9T 1QCNA 4IIOA 1AT1B 2CH4A 4X9DA 1SHFA 2DETA 1PC0A 1NM7A 4J9IA 3GPLA 3GBQA 4HCKA 3UF4A 3ZL7C 4J9BA 3CMAT 1E6GA 2FRYA 5GAOq 2D1XA 2RJCA 3A98A 2LZ6B 4C0DB 3KXTA 4O6JA 3GOXA 4XTZA 3V8KA 2CUDA 5GAMj 3CCMT 2G6FX 4NOYA 1D1AA 4WCIA 3G71Q 4A63B 3RESA 2MMPA 4F14A 2GCXA 2I2LA 2CP2A 4F04B 4J6XA 2HDAA 4HXJA 3VS7A 2QYZA 3EG3A 3MPUB 1YITA 1YN8A 2OAWA 4JJDA 5KYYA 2W0ZA 1KG1A 3CXCP 8AT1B 1RAHB 1B34A 3I35A 2LDMA 4DOVA 3CCRT 2LNVA 2KE9A 2ZPGB 1M8VA 4OP0A 3MEVA 4HCCA 2NWMA 3LGLA 3CCVQ 3EHRA 2DXBA 4M75D 3HFNA 3PTAA 3CCQT 5GAMe 4AFSC 2A36A 3MEAA 1WZOA 5CKHA 2M16A 1TXQA 2EGAA 1WJRA 1KQSA 1GBRA 2ZPFB 3RNJA 4C92D 1ABQA 2DJZA 3SFMA 2BTTA 2DK3A 4RG8A 1AHJB 1M9SA 3RUXA 2BZYA 4P5NA 2QEXQ 4OMLA 1ZUKA 1GL5A 1SPKA 1NYFA 4Y91A 1UGVA 1RLQC 3HKSA 3CC2T 2E70A 2K5IA 1KSWA 2F69A 2FO0A 5GAOm 2J6KA 1D1CA 5L23A 3THKA 1BIBA 1M90R 2K4YA 3M0SA 1Q82R 4M75F 7AT1B 4E6RA 1K8AR 2CYZB 1G3SA 5LJ5j 1UHCA 4F7UG 1VQPQ 2RO0A 3OSSC 3QBYA 5FU7C 4J9GA 2EGEA 2LQNA 3DB3A 3CBMA 1OQKA 4JJCA 1T3SA 2ESWA 2K9GA 4C92F 2JMCA 1AEYA 3CCVA 4KUIA 4IURA 4FSXA 1WYXA 1QW1A 5LL6S 4B9XA 2FL7A 3N5BB 4KRTA 5KYYB 4C5GA 4E2FB 1Q81C 2F2WA 5CAIA 4MMKA 4KT0E 1B34B 2CP5A 2KY9A 3PGGA 4V2SA 3QWYA 2L2PA 3EFSA 2M02A 1MMNA 1R77A 2QEXA 1IREB 2QAZA 5LJ3f 4F16A 1YI2T 1VQ7Q 1HSQA 1VQLQ 2VUBA 2CGHA 3CQTA 4FT2A 2H3JA 1OYXA 1UTIA 4FM4B 1XOVA 5LJ5h 4J9DA 1MV3A 2AHJB 2RI2A 2A28A 1TUCA 4NL2A 4A4FA 1GCPA 1M30A 2L0AA 5LJ3g 4M78B 1VQPA 1EZZB 1M3BA 2JVVA 2E6ZA 2JOYA 4JLGA 4X34A 1WHGA 5FW9A 1VIEA 1T0JA 3I5SA 2KYMA 4BI4A 2B8AA 3A5ZB 1MHNA 1VQ4Q 2HKNA 2YLCA 1UFFA 4BE0A 3X20B 1WIEA 3OYLA 4E7HA 4L6V5 3NTIA 3QKJA 3M9QA 3H8ZA 1NBEB 2LCLA 3DLMA 3DLLA 2DXCA 4OB1B 1XJWB 2LX7A 4L59A 3E19A 1VQ6A 1G3WA 4PJNA 3UDCA 1VQ7A 1TH7A 2GQVA 4N4HA 4HT8A 2P4RA 4F17A 2CP3A 3D7SB 4KBMB 4VUBA 1Y07A 1KFZA 1IRXA 3J81E 2MOXA 4HVWA 2DA9A 1B7TA 2CH4W 2J06A 5KCHA 4PFPA 4Y92A 4KGXB 3V7SA 2L89A 1QMCA 1X6OA 1OZ3A 1VQNQ 2CZ1B 2COZA 2DRMA 2DYIA 3PE0A 2EQIA 2D0NA 4B6MA 3OYDA 1KC8U 4OGCA 2VGNA 2RJEA 3S6WA 2E5KA 4QVZA 4C92A 5GAOr 3FC3A 3OQ5A 2LJ0A 1MMAA 3OYJA 2EKOA 1YJWA 2E10A 3VUBA 3M59A 1WLPB 4JLIA 4LD6A 3LX7A 5IH2A 3OS2A 1K9MR 1X01A 3PIPA 4FYXB 2OTLQ 2X4XA 3OYKA 1UGRB 2HQHA 2LCSA 2P4TA 1Y57A 4EMGA 3OYIA 5DLQE 3SD4A 3I55Q 3VJPA
chains in the Genus database with same CATH topology
2FPFA 1K1ZA 1WXTA 2AKKA 2CT4A 2LP5A 1Y0MA 1K76A 4LUDA 1B07A 2V1RA 4OMNA 2EGCA 1U06A 4K11A 1JQQA 1MUZA 1PWTA 2B86A 4RTXA 2DRKA 2RQWA 1K9AA 4ESRA 5FWBA 2BZXA 2M0YA 5IHKA 3NHNA 2DX1A 2YUOA 1JXMA 2DNUA 1HJDA 2GTOA 3VS2A 2EYWA 2GBQA 2KT8A 1PHTA 2RQVA 5GJWB 1YWOA 2RQTA 4AFZC 1G83A 4LN2A 3ULRB 5GJVB 2ENMA 2FRWA 2O2OA 1SEMA 2KRNA 2DL7A 2JM8A 3EG0A 2EPDA 3R6NA 2JMAA 1N5ZA 4J9CA 2O88A 1FYNA 2GTJA 2C0IA 2JS0A 2CSQA 1T0HA 3EG2A 1QWFA 1GCQC 2FPEA 2VKNA 1BU1A 2DL4A 1AOJA 4R0KA 2KRMA 1NLOC 2DMOA 2EYXA 1X2QA 4LNPA 3TSZA 1PRMC 1UE9A 2X3XD 1W1FA 2RQUA 5I22A 1KJWA 1I0CA 3TVTA 4RTUA 2L3QA 3LH5A 3M0PA 3PVQA 1ZBJA 2KYBA 1M3CA 2DF6A 2AKLA 1RUWA 2J6FA 3VS4A 2A08A 2KT1A 2VVKA 1CKAA 2J05A 1X6BA 2DE0X 4LUEA 3VS3A 4D8KA 1AWJA 2EYZA 1AD5A 2GNCA 3VRYA 1QKXA 1BK2A 1ZLMA 3O5ZA 1JO8A 2KNBB 1U5SA 4JJBA 4AFQC 2K2MA 2LNHB 3RBBB 1NEGA 1YP5A 4OMOA 2PNIA 1YWPA 2YT6A 1A0NB 1H8KA 2J6OA 1B3QA 2LJ1A 2O9VA 1W6XA 1VYUA 1M8MA 1J3TA 4IIOA 2CH4A 3C0CA 2AK5A 1JEGA 1ARKA 1SHFA 1GCQA 2RPNA 1NM7A 4J9IA 3GBQA 4HCKA 3UF4A 3ZL7C 4J9BA 1E6GA 2FRYA 2IIMA 2D1XA 2ABLA 3KFVA 2XMFA 1GRIA 2JW4A 3UA6A 3A98A 2LZ6B 2LQWA 2DJQA 1QKWA 4RUGA 3VS0A 1OOTA 1Z9QA 2W10A 5FWCA 2CUDA 4HVUA 2G6FX 1G2BA 1UJYA 1I1JA 4OMPA 4WCIA 4A63B 4IIMA 4LE9A 2K7AA 4F14A 2MCNA 2HDAA 2ROLA 4HXJA 3VS7A 1T3LA 1Z9ZA 3EG3A 2ED0A 1RLPC 1YN8A 2OAWA 1U3OA 4FSSA 4JJDA 4RTTA 2W0ZA 1NEBA 2X3WD 1LCKA 4J9HA 2DM1A 3I35A 4RTYA 2KE9A 3EHQA 2KEAA 5IXFA 1AZEA 3VS6A 1JXOA 2NWMA 3H41A 2OI3A 2BZ8A 3EHRA 2DL8A 2DL5A 5HCKA 3REBB 4AFSC 2A36A 2FEIA 1TG0A 2RNAA 1K0XA 3M0QA 4QT7A 2EGAA 4JZ4A 1K4US 2QDLA 5EC7A 1GBRA 4AFUC 3RNJA 1ABQA 1FMKA 2BTTA 3NGPA 1SRMA 2BZYA 1GFDA 2SRCA 1YNZA 2KR3A 2MIOA 2SEMA 1SHGA 4OMLA 3VRZA 1ZUKA 2JT4A 1GL5A 1SPKA 1NYFA 2A37A 1UGVA 1RLQC 4GBQA 2DL3A 1MV0B 3EG1A 1KSWA 3UA7A 1TUDA 2FO0A 2J6KA 2OJ2A 1AZGB 2PTKA 2KRSA 1X27A 3NMZC 3THKA 5L23A 2YSQA 3M0SA 2DILA 3VS1A 4E6RA 1VA7A 1UHCA 4ORZA 1OV3A 1AWOA 4DEYA 3I9QA 4J9GA 2EGEA 2LQNA 2EYYA 1M3AA 1BB9A 4CC7A 2YUPA 4JJCA 1T3SA 2ESWA 2K9GA 1AWXA 1SSHA 2JMCA 1AEYA 2L3PA 1CKBA 1NLPC 1WX6A 2K3BA 2HCKA 1WYXA 1WFWA 2GGRA 1W70A 4KRTA 2JM9A 2O31A 4OMMA 1NYGA 2LJ3A 2F2WA 4Z89A 2AZSA 2DYBA 1UHFA 1M27C 4GLMA 3TSWA 3PVLA 1X6GA 1I07A 3QWYA 2L2PA 1YCSB 4HVVA 4CC4B 2O9SA 4Z88A 1VYVA 4F16A 3NPFA 2M51A 1HSQA 1WXUA 1BBZA 2VWFA 3CQTA 1V1CA 2F2XA 2H8HA 2JS2A 2K79A 2KXCA 1UTIA 1H3HA 1GBQA 1XOVA 1K0SA 4J9DA 1MV3A 2A28A 1PKTA 1TUCA 3M0TA 1OPLA 2FPDA 1QWEA 4OMQA 1GCPA 1M30A 1UECA 2LMJA 2L0AA 3I5RA 1SRLA 1X43A 2ROTA 1X2KA 3VS5A 2PZ1A 1M3BA 1ZUYA 2HEQA 1OEBA 2EKHA 2KGTA 4JPBW 1AVZC 5FW9A 5IHNA 1WA7A 2JTEA 1T0JA 2YUQA 3IQLA 3I5SA 2KYMA 2CREA 1WI7A 1UFFA 2RN8A 3U23A 2D8HA 2ED1A 2GQIA 1WIEA 2NUZA 3EGUA 3H0FA 5IXBA 2DBKA 4D8DA 3H0IA 1GFCA 1X69A 2J7IA 4J9EA 2EBPA 2RMOA 2LX7A 2RQRA 1IO6A 2V1QA 2P4RA 4ZNXA 1UDLA 4F17A 3REAB 2DVJA 1E6HA 1UG1A 2HBWA 2C0TA 5I11A 1KFZA 2DLPA 1E7OA 2MOXA 4CC3A 1RI9A 2KBTA 1UJ0A 2DA9A 2D8JA 2RF0A 4HVWA 1NG2A 2CH4W 2HSPA 2J06A 4Y92A 4RTWA 3SEMA 1KIKA 1HD3A 1AWWA 2AZVA 2KXDA 2DRMA 1S1NA 1ZX6A 4Z8AA 3PE0A 2EQIA 1ZSGA 2D0NA 2YDLA 4EIKA 2FG0A 3JV3A 2F2VA 4RTVA 4CC2A 4AG2C 3FJ5A 2C0OA 2E5KA 3UATA 2LJ0A 1JU5C 1VYTA 2YUNA 1QLYA 2KROA 1UUEA 2CDTA 2EW3A 2EVRA 1EFNA 5ECAA 4AG1C 1ABOA 3SHWA 1WXBA 4RTZA 1WDXA 3M0UA 4JZ3A 1WLPB 2L3SA 1PKSA 2JXBA 5IH2A 2DBMA 4DEXA 5IHIA 1H92A 3H0HA 4J9FA 2CSIA 2LCSA 2ECZA 1QCFA 4X1VA 4M4ZA 1ZUUA 1Y57A 1PRLC 2K6DA 3QWXX 2I0NA 1CSKA 3M0RA 2CT3A 1OPKA 1PNJA 2CUBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FPF A;  1K1Z A;  1WXT A;  2AKK A;  2CT4 A;  2LP5 A;  1Y0M A;  1K76 A;  4LUD A;  1B07 A;  2V1R A;  4OMN A;  2EGC A;  1U06 A;  4K11 A;  1JQQ A;  1MUZ A;  1PWT A;  2B86 A;  4RTX A;  2DRK A;  2RQW A;  1K9A A;  4ESR A;  5FWB A;  2BZX A;  2M0Y A;  5IHK A;  3NHN A;  2DX1 A;  2YUO A;  1JXM A;  2DNU A;  1HJD A;  2GTO A;  3VS2 A;  2EYW A;  2GBQ A;  2KT8 A;  1PHT A;  2RQV A;  5GJW B;  1YWO A;  2RQT A;  4AFZ C;  1G83 A;  4LN2 A;  3ULR B;  5GJV B;  2ENM A;  2FRW A;  2O2O A;  1SEM A;  2KRN A;  2DL7 A;  2JM8 A;  3EG0 A;  2EPD A;  3R6N A;  2JMA A;  1N5Z A;  4J9C A;  2O88 A;  1FYN A;  2GTJ A;  2C0I A;  2JS0 A;  2CSQ A;  1T0H A;  3EG2 A;  1QWF A;  1GCQ C;  2FPE A;  2VKN A;  1BU1 A;  2DL4 A;  1AOJ A;  4R0K A;  2KRM A;  1NLO C;  2DMO A;  2EYX A;  1X2Q A;  4LNP A;  3TSZ A;  1PRM C;  1UE9 A;  2X3X D;  1W1F A;  2RQU A;  5I22 A;  1KJW A;  1I0C A;  3TVT A;  4RTU A;  2L3Q A;  3LH5 A;  3M0P A;  3PVQ A;  1ZBJ A;  2KYB A;  1M3C A;  2DF6 A;  2AKL A;  1RUW A;  2J6F A;  3VS4 A;  2A08 A;  2KT1 A;  2VVK A;  1CKA A;  2J05 A;  1X6B A;  2DE0 X;  4LUE A;  3VS3 A;  4D8K A;  1AWJ A;  2EYZ A;  1AD5 A;  2GNC A;  3VRY A;  1QKX A;  1BK2 A;  1ZLM A;  3O5Z A;  1JO8 A;  2KNB B;  1U5S A;  4JJB A;  4AFQ C;  2K2M A;  2LNH B;  3RBB B;  1NEG A;  1YP5 A;  4OMO A;  2PNI A;  1YWP A;  2YT6 A;  1A0N B;  1H8K A;  2J6O A;  1B3Q A;  2LJ1 A;  2O9V A;  1W6X A;  1VYU A;  1M8M A;  1J3T A;  4IIO A;  2CH4 A;  3C0C A;  2AK5 A;  1JEG A;  1ARK A;  1SHF A;  1GCQ A;  2RPN A;  1NM7 A;  4J9I A;  3GBQ A;  4HCK A;  3UF4 A;  3ZL7 C;  4J9B A;  1E6G A;  2FRY A;  2IIM A;  2D1X A;  2ABL A;  3KFV A;  2XMF A;  1GRI A;  2JW4 A;  3UA6 A;  3A98 A;  2LZ6 B;  2LQW A;  2DJQ A;  1QKW A;  4RUG A;  3VS0 A;  1OOT A;  1Z9Q A;  2W10 A;  5FWC A;  2CUD A;  4HVU A;  2G6F X;  1G2B A;  1UJY A;  1I1J A;  4OMP A;  4WCI A;  4A63 B;  4IIM A;  4LE9 A;  2K7A A;  4F14 A;  2MCN A;  2HDA A;  2ROL A;  4HXJ A;  3VS7 A;  1T3L A;  1Z9Z A;  3EG3 A;  2ED0 A;  1RLP C;  1YN8 A;  2OAW A;  1U3O A;  4FSS A;  4JJD A;  4RTT A;  2W0Z A;  1NEB A;  2X3W D;  1LCK A;  4J9H A;  2DM1 A;  3I35 A;  4RTY A;  2KE9 A;  3EHQ A;  2KEA A;  5IXF A;  1AZE A;  3VS6 A;  1JXO A;  2NWM A;  3H41 A;  2OI3 A;  2BZ8 A;  3EHR A;  2DL8 A;  2DL5 A;  5HCK A;  3REB B;  4AFS C;  2A36 A;  2FEI A;  1TG0 A;  2RNA A;  1K0X A;  3M0Q A;  4QT7 A;  2EGA A;  4JZ4 A;  1K4U S;  2QDL A;  5EC7 A;  1GBR A;  4AFU C;  3RNJ A;  1ABQ A;  1FMK A;  2BTT A;  3NGP A;  1SRM A;  2BZY A;  1GFD A;  2SRC A;  1YNZ A;  2KR3 A;  2MIO A;  2SEM A;  1SHG A;  4OML A;  3VRZ A;  1ZUK A;  2JT4 A;  1GL5 A;  1SPK A;  1NYF A;  2A37 A;  1UGV A;  1RLQ C;  4GBQ A;  2DL3 A;  1MV0 B;  3EG1 A;  1KSW A;  3UA7 A;  1TUD A;  2FO0 A;  2J6K A;  2OJ2 A;  1AZG B;  2PTK A;  2KRS A;  1X27 A;  3NMZ C;  3THK A;  5L23 A;  2YSQ A;  3M0S A;  2DIL A;  3VS1 A;  4E6R A;  1VA7 A;  1UHC A;  4ORZ A;  1OV3 A;  1AWO A;  4DEY A;  3I9Q A;  4J9G A;  2EGE A;  2LQN A;  2EYY A;  1M3A A;  1BB9 A;  4CC7 A;  2YUP A;  4JJC A;  1T3S A;  2ESW A;  2K9G A;  1AWX A;  1SSH A;  2JMC A;  1AEY A;  2L3P A;  1CKB A;  1NLP C;  1WX6 A;  2K3B A;  2HCK A;  1WYX A;  1WFW A;  2GGR A;  1W70 A;  4KRT A;  2JM9 A;  2O31 A;  4OMM A;  1NYG A;  2LJ3 A;  2F2W A;  4Z89 A;  2AZS A;  2DYB A;  1UHF A;  1M27 C;  4GLM A;  3TSW A;  3PVL A;  1X6G A;  1I07 A;  3QWY A;  2L2P A;  1YCS B;  4HVV A;  4CC4 B;  2O9S A;  4Z88 A;  1VYV A;  4F16 A;  3NPF A;  2M51 A;  1HSQ A;  1WXU A;  1BBZ A;  2VWF A;  3CQT A;  1V1C A;  2F2X A;  2H8H A;  2JS2 A;  2K79 A;  2KXC A;  1UTI A;  1H3H A;  1GBQ A;  1XOV A;  1K0S A;  4J9D A;  1MV3 A;  2A28 A;  1PKT A;  1TUC A;  3M0T A;  1OPL A;  2FPD A;  1QWE A;  4OMQ A;  1GCP A;  1M30 A;  1UEC A;  2LMJ A;  2L0A A;  3I5R A;  1SRL A;  1X43 A;  2ROT A;  1X2K A;  3VS5 A;  2PZ1 A;  1M3B A;  1ZUY A;  2HEQ A;  1OEB A;  2EKH A;  2KGT A;  4JPB W;  1AVZ C;  5FW9 A;  5IHN A;  1WA7 A;  2JTE A;  1T0J A;  2YUQ A;  3IQL A;  3I5S A;  2KYM A;  2CRE A;  1WI7 A;  1UFF A;  2RN8 A;  3U23 A;  2D8H A;  2ED1 A;  2GQI A;  1WIE A;  2NUZ A;  3EGU A;  3H0F A;  5IXB A;  2DBK A;  4D8D A;  3H0I A;  1GFC A;  1X69 A;  2J7I A;  4J9E A;  2EBP A;  2RMO A;  2LX7 A;  2RQR A;  1IO6 A;  2V1Q A;  2P4R A;  4ZNX A;  1UDL A;  4F17 A;  3REA B;  2DVJ A;  1E6H A;  1UG1 A;  2HBW A;  2C0T A;  5I11 A;  1KFZ A;  2DLP A;  1E7O A;  2MOX A;  4CC3 A;  1RI9 A;  2KBT A;  1UJ0 A;  2DA9 A;  2D8J A;  2RF0 A;  4HVW A;  1NG2 A;  2CH4 W;  2HSP A;  2J06 A;  4Y92 A;  4RTW A;  3SEM A;  1KIK A;  1HD3 A;  1AWW A;  2AZV A;  2KXD A;  2DRM A;  1S1N A;  1ZX6 A;  4Z8A A;  3PE0 A;  2EQI A;  1ZSG A;  2D0N A;  2YDL A;  4EIK A;  2FG0 A;  3JV3 A;  2F2V A;  4RTV A;  4CC2 A;  4AG2 C;  3FJ5 A;  2C0O A;  2E5K A;  3UAT A;  2LJ0 A;  1JU5 C;  1VYT A;  2YUN A;  1QLY A;  2KRO A;  1UUE A;  2CDT A;  2EW3 A;  2EVR A;  1EFN A;  5ECA A;  4AG1 C;  1ABO A;  3SHW A;  1WXB A;  4RTZ A;  1WDX A;  3M0U A;  4JZ3 A;  1WLP B;  2L3S A;  1PKS A;  2JXB A;  5IH2 A;  2DBM A;  4DEX A;  5IHI A;  1H92 A;  3H0H A;  4J9F A;  2CSI A;  2LCS A;  2ECZ A;  1QCF A;  4X1V A;  4M4Z A;  1ZUU A;  1Y57 A;  1PRL C;  2K6D A;  3QWX X;  2I0N A;  1CSK A;  3M0R A;  2CT3 A;  1OPK A;  1PNJ A;  2CUB A; 
#chains in the Genus database with same CATH topology
 3MKD A;  5CK9 A;  2FPF A;  1YIT T;  4PKC C;  1B07 A;  2QI2 A;  2V1R A;  1VQN A;  3S3N A;  4FT4 A;  4QW2 A;  2B86 A;  1YBY A;  3OW2 P;  1K9A A;  2BZX A;  2M0Y A;  3NHN A;  2YUO A;  4M75 B;  1G3Y A;  2RH2 A;  3VS2 A;  4M7A C;  3DB4 A;  2VXF A;  2RJF A;  3G6E A;  4EMK A;  1PD1 A;  2E3I A;  2CKK A;  4RCC A;  3SDZ A;  4ZTJ A;  4C92 B;  1RAA B;  4LDY A;  1G83 A;  3X24 B;  3HSB A;  3SWN A;  3CD6 Q;  2O2O A;  3JAM E;  1SEM A;  2KRN A;  3OYB A;  2E3H A;  3R6N A;  2JMA A;  4PJM A;  2C0I A;  2X4J A;  1WQW A;  5DY9 A;  3CC4 A;  4OB3 B;  2R5A A;  3HRT A;  4QQG A;  4M77 D;  4R0K A;  2KRM A;  1NLO C;  5GAN 6;  3SB2 A;  1VQ5 Q;  1X2Q A;  4X9C A;  1PRM C;  1UE9 A;  1RAE B;  2NUP B;  2LT1 A;  1YHQ A;  4MZT A;  2V26 A;  1I0C A;  1K73 R;  4RTU A;  3C95 A;  4MML A;  1YIJ T;  3QXE B;  2DF6 A;  1S72 Q;  2J6F A;  1U8R A;  1P92 A;  1VQO T;  1W2B P;  4FIB A;  2MWP A;  1X6B A;  4LUE A;  1SSF A;  3VS3 A;  2WSE E;  3OYE A;  2BKD N;  2QA4 A;  3RMQ A;  2GNC A;  5LJ3 h;  2A7Y A;  3VRY A;  4FCY A;  2ZAE A;  2QAS A;  3O5Z A;  4ZTF A;  2KNB B;  3X25 B;  4MDW A;  4JJB A;  2K2M A;  4M77 F;  3RBB B;  2CZ6 B;  1YP5 A;  1LPL A;  9ATC B;  4EMK B;  3BW1 A;  4M78 E;  5KCO A;  2EJ9 A;  1D3B B;  1B3Q A;  2V8J A;  2O9V A;  1VYU A;  4QVD A;  1J3T A;  1MMG A;  3X26 B;  5FU6 C;  2DD5 A;  1VQ5 A;  5A2Q E;  5GAN j;  2L5Q A;  2O4X A;  4PJO F;  4BB7 A;  3LWI A;  2HMA A;  2ABL A;  2PU9 B;  1UB4 A;  3CCU A;  3KFV A;  2XMF A;  2EJF A;  2JW4 A;  3VKI A;  2MPX C;  4DBH A;  3G4S T;  1QP3 A;  1OOT A;  1PM3 A;  2QGF B;  3KBG A;  1Z9Q A;  5KYX A;  1S72 A;  1C0M A;  1M2V B;  4FW2 A;  4M7D D;  1UJY A;  1Q7Y U;  1I1J A;  1WHM A;  3JCM c;  1JRI A;  5KYU A;  1VQ8 Q;  1QVF S;  2ROL A;  1BI3 A;  1T3L A;  2XDP A;  1VQ6 T;  2KDS A;  3CME T;  1U3O A;  5I2M A;  1NEB A;  2X3W D;  1TS9 A;  4J9H A;  1NPP A;  4IUU A;  5GMK e;  4HCB A;  2HL3 A;  3CCE A;  3CCS Q;  4C8Q D;  1RAI B;  3H41 A;  1ZBX A;  2BZ8 A;  2QGG A;  3REB B;  2KK4 A;  1IGQ A;  2YHT A;  1K0X A;  2VB6 A;  4HT9 A;  4QT7 A;  4WF2 A;  4JZ4 A;  3QYG B;  4M7D F;  2XKO C;  1C1A A;  5GAN 4;  1FMK A;  3BDL A;  2K3X A;  3NGP A;  1M90 C;  2DZ9 A;  1WHK A;  1SRM A;  1XQH A;  2DO3 A;  2MF2 A;  3FRN A;  4NL3 A;  1Q82 C;  1GFD A;  1SHG A;  2YWW A;  2VXE A;  1K8A C;  2V8I A;  4M78 F;  2HL5 C;  4NS5 A;  2O4X B;  3LGF A;  3JSC A;  3UA7 A;  1TUD A;  6AT1 B;  1YJW T;  1N27 A;  1X27 A;  3NMZ C;  1UGQ B;  3OSV A;  2D6F A;  4C8Q F;  3CXC A;  1Y7X A;  2EIF A;  2ATC B;  5KYX B;  1VA7 A;  2QQB A;  4ORZ A;  2FHD A;  3RDV A;  3NTK A;  2EYY A;  2AIR B;  4M77 A;  2P0Q A;  3CCS A;  1NLP C;  2HCK A;  1KC8 R;  3CC7 Q;  2JM9 A;  2O31 A;  4OMM A;  1EX4 A;  3JB9 H;  1NYG A;  3JB9 J;  4Z89 A;  1KHC A;  1M27 C;  1VQN T;  3TSW A;  2R57 A;  1NE8 A;  4HVV A;  4CC4 B;  4M75 E;  3MCA B;  2QXF A;  2DER A;  3L2Z A;  1BIA A;  2V8K A;  4PJO A;  5M9O A;  3Q1J A;  3OYH A;  2XI9 A;  2EAY A;  1WXU A;  2HQE A;  4BUG A;  3RKW A;  1BBZ A;  2VWF A;  2CZ0 B;  1F1B B;  2JS2 A;  2K79 A;  2KXC A;  4C92 E;  1H3H A;  4IUT A;  2PUO B;  1GBQ A;  3E2U A;  2M1H A;  3G6E T;  1K0S A;  2XU8 A;  1PKT A;  3M0T A;  1OPL A;  1QWE A;  4OMQ A;  1UEC A;  4XU1 A;  2QQA A;  3OS5 A;  3CCL Q;  1M1F A;  5LJ5 d;  3JCM P;  3A1P A;  2HEQ A;  2D9T A;  2EKH A;  2KGT A;  1VIF A;  5IHN A;  1SKU B;  4JDS A;  2JTE A;  3CC4 T;  2F5T X;  2RHU A;  3U23 A;  5EG2 A;  4D6W A;  2ED1 A;  2NUZ A;  2YRC A;  3EGU A;  4IUQ A;  5KYW A;  3BE3 A;  3MP6 A;  4M77 B;  1QVG S;  3E9G A;  1V76 A;  1OX9 A;  4D8D A;  1YHQ T;  2OX7 A;  1X69 A;  2RI5 A;  2RQR A;  3UPU A;  5GAN 3;  2H3E B;  2DFU A;  2EWN A;  3OS0 A;  3REA B;  1ZA1 B;  2R5M A;  2DVJ A;  4M78 A;  1GXI E;  2QQS A;  1E7O A;  4LDV A;  3QPH A;  4PJO B;  3JCM V;  3G71 A;  4LD9 K;  2QA4 T;  1M5Q 1;  1UJ0 A;  2D8J A;  1XNI A;  2HSP A;  4WTO B;  2R58 A;  4N0A A;  2RJD A;  4C8Q A;  2AT1 B;  1H3Z A;  3CCL A;  1HD3 A;  1OUL A;  2GFU A;  2ZGW A;  4BD3 A;  1ZX6 A;  1NJI U;  4XU3 A;  5CQY A;  2ZPE B;  1D09 B;  1PSF A;  1BCO A;  2HNI A;  3L2R A;  1K9M C;  5AT1 B;  3JB9 I;  3WVD B;  1JU5 C;  1VYT A;  2RK1 A;  2RM4 A;  2EVR A;  5FRN A;  1ABO A;  1Q95 G;  1WDX A;  3M0U A;  1BI0 A;  4PLL A;  1ZSZ A;  2JXB A;  3X28 B;  5A0L A;  3CCU T;  3SWN C;  5IHI A;  2RD1 A;  3PIO A;  5KYW B;  3CPW S;  5LJ5 e;  1XTD A;  1O75 A;  3P8H A;  1FMW A;  1QCF A;  4X1V A;  2DPP B;  4M4Z A;  1ZUU A;  2K6D A;  8ATC B;  1VQK T;  3QWX X;  1PSE A;  3OMG A;  5CVI A;  4M7D B;  2VC8 A;  4JJN K;  2RHZ A;  1K1Z A;  5I21 A;  2CT4 A;  4PJO G;  2PVG B;  2VYT A;  4FYV B;  2CS7 A;  3QHS A;  5GAN 8;  2XK0 A;  3WXM B;  5DM7 R;  1U06 A;  3EAE A;  2XG8 D;  1JJ2 S;  1JQQ A;  3CCE T;  1MUZ A;  1PWT A;  1VOM A;  3AHU A;  1IHW A;  2DX1 A;  4C0G A;  2DXT A;  4C8Q B;  2OTJ Q;  1KQ2 A;  2RK2 A;  2DNU A;  3JB9 G;  2EYW A;  4PJJ A;  1H64 1;  2GBQ A;  1Q7Y R;  1YJN Q;  3OYY A;  1PHT A;  2ZZD A;  3S3M A;  1I81 A;  4DA4 A;  4FYY B;  5AYF A;  2GF7 A;  3CCJ Q;  1VQL A;  2FZG B;  4J9C A;  1FYN A;  1OX8 A;  1ZSZ B;  2NLU A;  3H6Z A;  1YJ9 Q;  1K73 C;  1U1S A;  2JS0 A;  2ZCF B;  5CO7 A;  4E7I A;  3TU4 K;  4XAX B;  2VKN A;  2DL4 A;  1AOJ A;  2EYX A;  3CBO A;  5IAY A;  2XHC A;  4FYW B;  4LNP A;  3TSZ A;  2E64 A;  4OMF B;  3OW2 A;  1KD1 U;  2K5L A;  2DD4 A;  5I22 A;  4M75 A;  2FZC B;  5CKB A;  2RHX A;  1LOJ A;  2GFA A;  3I56 Q;  2ZPH B;  3LH5 A;  3M0P A;  4M78 G;  5IN1 A;  1VQM Q;  3GIB A;  4N4G A;  1RL2 A;  2YLB A;  2OTJ A;  1KHI A;  1VQ4 A;  2KT1 A;  2VVK A;  4PK4 A;  1SF9 A;  1YJN A;  3PT9 A;  1WGS A;  4D8K A;  1VQ9 Q;  1AD5 A;  2RI3 A;  4EDU A;  2QDY B;  1JO8 A;  1N8R R;  3CMA Q;  2IG0 A;  2RA2 A;  2K57 A;  1QP2 A;  4GY5 A;  3ME9 A;  5LJ3 d;  3QII A;  2J6O A;  4JRQ A;  2NUP A;  3CCM Q;  4C0D C;  2IVW A;  5KYN A;  2AK5 A;  1LVK A;  1JEG A;  2FVU A;  3MP1 A;  3OBY A;  1N9R A;  3ZEH A;  1QVF P;  4J8O A;  2WSF E;  1O9S A;  1Q86 U;  4FL6 A;  4JS4 A;  1W2B A;  3UA6 A;  2HQX A;  4M77 E;  2LQW A;  3QSU A;  4RUG A;  4C5I A;  3VS0 A;  3CCR Q;  1PG5 B;  5HK3 A;  5GAN 7;  4HVU A;  3G1J A;  1QCO A;  1OU8 A;  1R0C B;  4OMP A;  1R0B G;  4XTU A;  3EH2 A;  4IIM A;  3CCQ Q;  2LT4 A;  4BDY A;  4ZN1 A;  1LNX A;  4OGE A;  1Z9Z A;  2ED0 A;  5GMK i;  4ELY C;  4PJO E;  5FRO A;  3CMA A;  1M1K U;  1D3B A;  5GAO n;  1KQS S;  2OTL A;  3EHQ A;  5D6X A;  5LJ3 j;  1ZHI A;  1AZE A;  2DVE A;  5CIU A;  3JCM d;  5J3B A;  3L2W A;  3G71 T;  2HD0 A;  5HCK A;  3CC2 Q;  1G8X A;  3I55 A;  1ACM B;  2FEI A;  3HHT B;  1K4U S;  5EC7 A;  4AFU C;  2X4Y A;  1M2V A;  5GAN d;  2RHY A;  3V8J A;  4II1 A;  5HK0 A;  2SRC A;  2PVD B;  1YNZ A;  4M7A D;  2YRD A;  1PCX A;  2SEM A;  4L5G A;  2JT4 A;  3QG1 A;  1IGU A;  2A37 A;  3CCV T;  4GBQ A;  3EG1 A;  5LJ3 e;  5KE3 A;  3HFO A;  2OJ2 A;  1AZG B;  2PTK A;  3CCQ A;  5L8R E;  3QDF A;  4UC4 A;  3FJP A;  1OU9 A;  3INZ A;  5I2S A;  2DIL A;  1U1T A;  3VS1 A;  1KC8 C;  4M75 G;  4F7U F;  4M7D E;  2LVM A;  2QEX T;  1X75 C;  4DEY A;  3I9Q A;  2JNG A;  3MJX A;  3CD6 A;  1BB9 A;  2YUP A;  1YI2 Q;  5GAM f;  1SSH A;  1RAD B;  4C92 G;  1NJI R;  4PFO A;  2L3P A;  1CKB A;  3MET A;  4J6Y A;  2HBP A;  3L2Q A;  3CC2 A;  1WFW A;  4M7A F;  1W70 A;  4LDX A;  2KQW A;  5FU7 B;  2AZS A;  2DYB A;  5DLO A;  1D0X A;  4DOW A;  1VQP T;  1X6G A;  4C8Q E;  3M4G A;  1I5O B;  5GAM g;  3UWN A;  2O9S A;  3OYM A;  2NUT A;  5FLX E;  1VYV A;  2F1L A;  1TUG B;  3NPF A;  2XID A;  1D0Z A;  4E7Z A;  2L3R A;  4M78 C;  4JUV A;  3TQ7 P;  1IB8 A;  1V1C A;  1WPY A;  2F2X A;  3JCM e;  1C6V X;  2EQK A;  4KGV B;  3M57 A;  4N0A C;  3LH0 A;  2FPD A;  5CR2 A;  3JCM Q;  2LMJ A;  3I5R A;  1X43 A;  3QZ9 B;  1QVG P;  1X2K A;  4J6W A;  2PZ1 A;  3M53 A;  2P84 A;  4JRP A;  1VQ7 T;  1VQL T;  5GAN e;  1OEB A;  3HRS A;  4PNO A;  2OAU A;  3OYN A;  1YI2 A;  1WHL A;  3OS1 A;  4MZP A;  2X9H A;  2CRE A;  4J5Y A;  4C5E A;  2GQI A;  2KVQ G;  3H0F A;  3JCM X;  2LQ8 A;  2QQ9 A;  2DBK A;  2XIC A;  2ZPI B;  1BCM A;  4PL6 A;  4ZN3 A;  4C0F A;  2J7I A;  4J9E A;  2PVO B;  4LDU A;  2M9U A;  3EG9 B;  1UDL A;  2EFI A;  2EYQ A;  3HP9 A;  1VQ4 T;  3MP8 A;  3MO8 A;  1G5V A;  1UG1 A;  5LJ5 g;  2HBW A;  2C0T A;  3L42 A;  1JBM A;  2DLP A;  3L2V A;  3HPW A;  4C0Z A;  2NUT B;  4XK8 E;  2P0P A;  4CC3 A;  1RI9 A;  2RF0 A;  3NFC A;  1UEB A;  3HL8 A;  3ER0 A;  3C94 A;  4DQ2 A;  1VQ8 A;  5J39 A;  2XDB A;  1MNE A;  5D7U A;  4JRI A;  2MAM A;  4BY6 B;  1KIK A;  1KD1 R;  2AZV A;  2KXD A;  4E7L A;  4Z8A A;  1ZSG A;  2YDL A;  4EIK A;  3JV3 A;  3J80 E;  4BI8 B;  1SG5 A;  4RTV A;  4TVR A;  2E1H A;  4CC2 A;  4E47 A;  3URG A;  1RAC B;  2C0O A;  3DKM A;  3E1S A;  2EQM A;  2YUN A;  1TSF A;  2EW3 A;  4M7A A;  1TWB A;  4A53 A;  4AG1 C;  3SHW A;  1WXB A;  4RTZ A;  1NPR A;  4JZ3 A;  2DEQ A;  1YIT Q;  2MK5 A;  2PQW A;  3RR6 A;  1Q81 U;  3EGD B;  4J9F A;  4RG2 A;  1JJ2 P;  1M1G A;  1PRL C;  2K2V A;  2I0N A;  1CSK A;  2A3L A;  1WHH A;  3M0R A;  2CT3 A;  1OPK A;  2COW A;  3FIF A;  5C0M A;  1PNJ A;  2CUB A;  1WXT A;  2LP5 A;  1Y0M A;  1K76 A;  4M75 C;  4LUD A;  1QQJ A;  2E12 A;  1Q7Y C;  2OTL T;  3RKX A;  4IUV A;  4E7S A;  1Y96 A;  2RB6 A;  3FLG A;  3GNG A;  3PNW C;  4ESR A;  5FWB A;  1Q86 R;  2DAQ A;  4A54 A;  4C92 C;  3I55 T;  2DKG A;  4DBQ A;  3CC7 A;  2VAS A;  1HYO A;  3HRU A;  4F7U B;  2CP6 A;  2JTM A;  2M0O A;  2DXU A;  1YWO A;  4AFZ C;  4BDZ A;  2X51 A;  2A0F B;  5GJV B;  2ENM A;  4M7D A;  3M55 A;  4A4K A;  3M54 A;  4M7A B;  2FRW A;  1W4S A;  2DL7 A;  1M1K R;  1RAG B;  3EH1 A;  3EG0 A;  1N5Z A;  2O88 A;  2GTJ A;  1YIJ Q;  2Y4X A;  5CKE A;  3OYA A;  3EG2 A;  1QWF A;  4LXC A;  2K5F A;  1VQO Q;  1TU0 B;  2FPE A;  1BU1 A;  3ZFJ A;  3PFS A;  4ZGJ B;  3A8G B;  2X4W A;  2BUD A;  1K73 U;  3TEE A;  5KH6 A;  2X3X D;  5GAM h;  1NZ9 A;  2DZC A;  4IKF A;  3CD6 T;  3TVT A;  3O8V A;  2D0Q B;  4AMC A;  3PVQ A;  1ZBJ A;  2KYB A;  1M3C A;  3QYH B;  4C5H A;  5KE2 A;  1N8R C;  3QZ5 B;  2A08 A;  2E6N A;  4CRI A;  4LDW A;  1CKA A;  3AT1 B;  2FZK B;  3V7C A;  1Y96 B;  2DE0 X;  4EMK C;  1VQ5 T;  3OB9 A;  1QKX A;  1EIF A;  1BK2 A;  1D1B A;  3M56 A;  1U5S A;  4AFQ C;  4M77 G;  4EMH A;  1YWP A;  2YT6 A;  1S72 T;  1A0N B;  2E4H A;  3G4S Q;  1YIJ A;  4M7A G;  2RHI A;  5CCA A;  2Y4Y A;  1W6X A;  1VQO A;  1M8M A;  1TOV A;  3C0C A;  4MDX A;  5GMK m;  1ARK A;  1GCQ A;  2RPN A;  3OMC A;  4O5V A;  1WNL A;  1WQ7 A;  2IIM A;  5CKD A;  3L1A A;  3P8D A;  1VQ6 Q;  3CME Q;  1FX7 A;  1GRI A;  3QUI A;  2LRQ A;  4XTV A;  2WAC A;  2DJQ A;  3LW5 E;  1QKW A;  1KQS P;  2WSC E;  4OVA A;  3FEO A;  5FU6 B;  1TTH B;  2W10 A;  5FWC A;  3VV0 A;  1G2B A;  1MMD A;  4OF1 A;  4PLI A;  2YRV A;  4N4I A;  4LE9 A;  2K7A A;  3JCM W;  3G7Z A;  2MCN A;  4YTL A;  4HKE A;  2Y90 A;  4QQ6 A;  1RLP C;  2LTO A;  1IHV A;  3J7A F;  4FSS A;  4IUP A;  4RTT A;  2DTH A;  1R8O B;  1LCK A;  2DM1 A;  4DBF A;  4RTY A;  2KEA A;  3A8M B;  4ELZ C;  5IXF A;  3G4S A;  3VS6 A;  1JXO A;  3MEW A;  2OI3 A;  4E7J A;  2FYK A;  3E9F A;  1QVP A;  2DL8 A;  3ASK A;  4OB2 B;  2DL5 A;  1QVF A;  4FW1 A;  5J26 A;  1YJW Q;  1VQ8 T;  1TG0 A;  3V8L A;  2RNA A;  4ME7 A;  3M0Q A;  3MEU A;  4ATO A;  2QDL A;  4M7D G;  2K3Y A;  3VUZ A;  4EPC A;  4XTY A;  3CXC S;  1KQ1 A;  3CME A;  3C12 A;  1DJ7 B;  3VU3 C;  3JCM f;  5D6W A;  1BYM A;  2KR3 A;  2MIO A;  3VRZ A;  3CCS T;  1YFN A;  5GAN 5;  4BY6 C;  2DL3 A;  1MV0 B;  2E41 A;  3T9N A;  5C6S A;  4RMO A;  2O01 E;  2KRS A;  3FDR A;  4CI0 C;  1NJI C;  2YSQ A;  5GAN f;  3JRZ A;  4C8Q G;  3JCM g;  2C06 A;  1ZA2 B;  1MGQ A;  1HK9 A;  5D6Y A;  4ZGD B;  4RKU E;  1OV3 A;  2L8D A;  1AWO A;  1M3A A;  4CC7 A;  3CCJ A;  1AWX A;  5GAN g;  1WX6 A;  2K3B A;  2GGR A;  5GAO l;  4A4G A;  1YJ9 A;  2DTO A;  2JZ2 A;  2LJ3 A;  3G6E Q;  1ZQ1 A;  1UHF A;  4KH0 B;  4GLM A;  3OYG A;  2MWO A;  3PVL A;  2DTI A;  1I07 A;  1JB0 E;  1YCS B;  2YXY A;  2NYS A;  4FU6 A;  4QKU A;  4XU2 A;  4Z88 A;  3OYC A;  4PFZ A;  4A4E A;  4F7U E;  4BE2 A;  4QQD A;  4KH1 B;  2M51 A;  3I56 A;  1Q81 R;  3QJ6 A;  5GAO p;  2LX9 A;  1VQM A;  3CC7 T;  3BFM A;  2H8H A;  2XD0 A;  3M58 A;  3CC4 Q;  4M7A E;  3QDR B;  1WHJ A;  3M5A A;  4KUD K;  2DIG A;  1VQ9 A;  3LLR A;  1SRL A;  5GMK l;  2ROT A;  3VS5 A;  2VGM A;  1YHQ Q;  1ZUY A;  2DIQ A;  4ZGE B;  4JPB W;  1AVZ C;  4M77 C;  1WA7 A;  3IQL A;  2YUQ A;  3EGX A;  1YCY A;  5CQX A;  1WI7 A;  4Y28 E;  3ZBD A;  3UT1 A;  2RN8 A;  3QO3 A;  2D8H A;  2BIV A;  4B9W A;  1FXX A;  1PD0 A;  3CCM A;  5IXB A;  2HAX A;  4QVC A;  2QA4 Q;  3KUF A;  4KUL A;  3PMT A;  3CCL T;  3H0I A;  1GFC A;  3OYF A;  4PJO C;  1FWZ A;  2EBP A;  3OY9 A;  2RMO A;  2BE7 D;  1IO6 A;  1RAF B;  2LC4 A;  2V1Q A;  3M4Y A;  1I5L A;  5GAN 2;  4ZNX A;  1N6A A;  2KSS A;  1KK7 A;  3RMS A;  4R56 A;  3CCR A;  3L2U A;  4JS5 A;  1KD1 C;  1E6H A;  3F70 A;  2QG9 B;  3OBW A;  5I11 A;  3A8H B;  1VUB A;  1QVG A;  1M90 U;  4KGZ B;  1Q82 U;  2Z0W A;  2KBT A;  1K8A U;  1NG2 A;  1LJO A;  4RTW A;  3BY7 A;  2JTF A;  1RI0 A;  1N9S A;  3SEM A;  1AWW A;  3LYI A;  3C4S A;  3CCU Q;  2QTX A;  1S1N A;  5A0D A;  4Q5W A;  3A8L B;  1UGS B;  2XDD A;  2FG0 A;  2F2V A;  1WJQ A;  4PJO D;  4AG2 C;  1RAB B;  3FJ5 A;  4BE1 A;  3UAT A;  3BDU A;  1VQK Q;  5A0G A;  1QLY A;  1UUE A;  2KRO A;  2CDT A;  1EFN A;  3V7R A;  5ECA A;  4AT1 B;  4XU0 A;  3EG9 A;  3RIR A;  2HKQ B;  1UGP B;  2L3S A;  3EGX B;  1PKS A;  4JRK A;  2JN0 A;  4M7D C;  2DBM A;  5HY6 A;  4DEX A;  2QQR A;  4BI3 A;  4XQ3 A;  4J7F A;  3JB9 D;  1V29 B;  1H92 A;  3H0H A;  4OB0 B;  2CSI A;  2ECZ A;  2PUK B;  2LQK A;  3CCE Q;  4R55 A;  1BI1 A;  2G3R A;  3TCJ A;  5IT9 E;  2KI7 A;  2CP7 A;  3P8B B;  1OZ2 A;  3SWN B;  2KAF A;  4MZM A;  1Q86 C;  2MI6 A;  2AKK A;  2MYS A;  4C8Q C;  3GLX A;  3CPW A;  1OI1 A;  4OMN A;  5GMK j;  2EGC A;  1Y71 A;  1WJS A;  2KMT A;  2COY A;  3EFO A;  4K11 A;  3HTR A;  1I8F A;  4RTX A;  2DRK A;  2RQW A;  3VYH B;  5IHK A;  5FRM A;  1MND A;  2P0K A;  2X35 A;  1VQK A;  1M2O A;  1JXM A;  3LWH A;  4RCB A;  2HSE B;  3JB9 F;  1HJD A;  2GTO A;  1M1K C;  1IXD A;  3GP8 A;  3JCM J;  3MHX A;  3EGD A;  2CP0 A;  2KT8 A;  2RQV A;  1IZ6 A;  3JCM b;  4HA8 A;  3JCM h;  4M78 D;  5CKF A;  1ZSZ C;  5LJ5 f;  1JJ2 A;  2LCC A;  3WVE B;  2CZ7 B;  2F5K A;  5GJW B;  2RQT A;  4Z02 A;  2IPO B;  4GLK A;  4LN2 A;  4XTW A;  3ULR B;  2QTV A;  4BAC A;  2EQU A;  3OW2 S;  4ANJ A;  2JUF A;  1I4K 1;  4HCZ A;  2JM8 A;  1HXD A;  2OTJ T;  2EPD A;  3GNF B;  4XTX A;  5GAN h;  2QK0 A;  2EJG A;  2CSQ A;  1T0H A;  1YJN T;  1GCQ C;  5GMK h;  2BE9 B;  4PJL A;  2DMO A;  3VYG A;  4A4H A;  2E5Q A;  3PMI A;  1FMV A;  3S3O A;  1W1F A;  2RQU A;  4E7K A;  1KJW A;  3CCJ T;  3CEY A;  1BKB A;  2JJ9 A;  4F7U A;  2L3Q A;  2ZPB B;  4J83 A;  3H9N A;  2HZY A;  3CPF A;  1YJ9 T;  3CPW P;  2AKL A;  1RUW A;  3RKY A;  3VS4 A;  5GAM d;  3EFO B;  1G3T A;  2J05 A;  2DEU A;  1M4Z A;  1AWJ A;  2EYZ A;  1N8R U;  3FB9 A;  3RER A;  1K9M U;  4DBR A;  1ZLM A;  3GF5 A;  2VV5 A;  3I56 T;  1D0Y A;  3A8O B;  2LNH B;  1NEG A;  2EQJ A;  1VQM T;  4OMO A;  5KYU B;  2PNI A;  3TRE A;  3EFR A;  3NTH A;  2E65 A;  5HKC A;  3R6O A;  1BI2 A;  3QJY A;  3OA6 A;  1W2B S;  1H8K A;  2LJ1 A;  3CBP A;  4J7I A;  2FB7 A;  1VQ9 T;  1QCN A;  4IIO A;  1AT1 B;  2CH4 A;  4X9D A;  1SHF A;  2DET A;  1PC0 A;  1NM7 A;  4J9I A;  3GPL A;  3GBQ A;  4HCK A;  3UF4 A;  3ZL7 C;  4J9B A;  3CMA T;  1E6G A;  2FRY A;  5GAO q;  2D1X A;  2RJC A;  3A98 A;  2LZ6 B;  4C0D B;  3KXT A;  4O6J A;  3GOX A;  4XTZ A;  3V8K A;  2CUD A;  5GAM j;  3CCM T;  2G6F X;  4NOY A;  1D1A A;  4WCI A;  3G71 Q;  4A63 B;  3RES A;  2MMP A;  4F14 A;  2GCX A;  2I2L A;  2CP2 A;  4F04 B;  4J6X A;  2HDA A;  4HXJ A;  3VS7 A;  2QYZ A;  3EG3 A;  3MPU B;  1YIT A;  1YN8 A;  2OAW A;  4JJD A;  5KYY A;  2W0Z A;  1KG1 A;  3CXC P;  8AT1 B;  1RAH B;  1B34 A;  3I35 A;  2LDM A;  4DOV A;  3CCR T;  2LNV A;  2KE9 A;  2ZPG B;  1M8V A;  4OP0 A;  3MEV A;  4HCC A;  2NWM A;  3LGL A;  3CCV Q;  3EHR A;  2DXB A;  4M75 D;  3HFN A;  3PTA A;  3CCQ T;  5GAM e;  4AFS C;  2A36 A;  3MEA A;  1WZO A;  5CKH A;  2M16 A;  1TXQ A;  2EGA A;  1WJR A;  1KQS A;  1GBR A;  2ZPF B;  3RNJ A;  4C92 D;  1ABQ A;  2DJZ A;  3SFM A;  2BTT A;  2DK3 A;  4RG8 A;  1AHJ B;  1M9S A;  3RUX A;  2BZY A;  4P5N A;  2QEX Q;  4OML A;  1ZUK A;  1GL5 A;  1SPK A;  1NYF A;  4Y91 A;  1UGV A;  1RLQ C;  3HKS A;  3CC2 T;  2E70 A;  2K5I A;  1KSW A;  2F69 A;  2FO0 A;  5GAO m;  2J6K A;  1D1C A;  5L23 A;  3THK A;  1BIB A;  1M90 R;  2K4Y A;  3M0S A;  1Q82 R;  4M75 F;  7AT1 B;  4E6R A;  1K8A R;  2CYZ B;  1G3S A;  5LJ5 j;  1UHC A;  4F7U G;  1VQP Q;  2RO0 A;  3OSS C;  3QBY A;  5FU7 C;  4J9G A;  2EGE A;  2LQN A;  3DB3 A;  3CBM A;  1OQK A;  4JJC A;  1T3S A;  2ESW A;  2K9G A;  4C92 F;  2JMC A;  1AEY A;  3CCV A;  4KUI A;  4IUR A;  4FSX A;  1WYX A;  1QW1 A;  5LL6 S;  4B9X A;  2FL7 A;  3N5B B;  4KRT A;  5KYY B;  4C5G A;  4E2F B;  1Q81 C;  2F2W A;  5CAI A;  4MMK A;  4KT0 E;  1B34 B;  2CP5 A;  2KY9 A;  3PGG A;  4V2S A;  3QWY A;  2L2P A;  3EFS A;  2M02 A;  1MMN A;  1R77 A;  2QEX A;  1IRE B;  2QAZ A;  5LJ3 f;  4F16 A;  1YI2 T;  1VQ7 Q;  1HSQ A;  1VQL Q;  2VUB A;  2CGH A;  3CQT A;  4FT2 A;  2H3J A;  1OYX A;  1UTI A;  4FM4 B;  1XOV A;  5LJ5 h;  4J9D A;  1MV3 A;  2AHJ B;  2RI2 A;  2A28 A;  1TUC A;  4NL2 A;  4A4F A;  1GCP A;  1M30 A;  2L0A A;  5LJ3 g;  4M78 B;  1VQP A;  1EZZ B;  1M3B A;  2JVV A;  2E6Z A;  2JOY A;  4JLG A;  4X34 A;  1WHG A;  5FW9 A;  1VIE A;  1T0J A;  3I5S A;  2KYM A;  4BI4 A;  2B8A A;  3A5Z B;  1MHN A;  1VQ4 Q;  2HKN A;  2YLC A;  1UFF A;  4BE0 A;  3X20 B;  1WIE A;  3OYL A;  4E7H A;  4L6V 5;  3NTI A;  3QKJ A;  3M9Q A;  3H8Z A;  1NBE B;  2LCL A;  3DLM A;  3DLL A;  2DXC A;  4OB1 B;  1XJW B;  2LX7 A;  4L59 A;  3E19 A;  1VQ6 A;  1G3W A;  4PJN A;  3UDC A;  1VQ7 A;  1TH7 A;  2GQV A;  4N4H A;  4HT8 A;  2P4R A;  4F17 A;  2CP3 A;  3D7S B;  4KBM B;  4VUB A;  1Y07 A;  1KFZ A;  1IRX A;  3J81 E;  2MOX A;  4HVW A;  2DA9 A;  1B7T A;  2CH4 W;  2J06 A;  5KCH A;  4PFP A;  4Y92 A;  4KGX B;  3V7S A;  2L89 A;  1QMC A;  1X6O A;  1OZ3 A;  1VQN Q;  2CZ1 B;  2COZ A;  2DRM A;  2DYI A;  3PE0 A;  2EQI A;  2D0N A;  4B6M A;  3OYD A;  1KC8 U;  4OGC A;  2VGN A;  2RJE A;  3S6W A;  2E5K A;  4QVZ A;  4C92 A;  5GAO r;  3FC3 A;  3OQ5 A;  2LJ0 A;  1MMA A;  3OYJ A;  2EKO A;  1YJW A;  2E10 A;  3VUB A;  3M59 A;  1WLP B;  4JLI A;  4LD6 A;  3LX7 A;  5IH2 A;  3OS2 A;  1K9M R;  1X01 A;  3PIP A;  4FYX B;  2OTL Q;  2X4X A;  3OYK A;  1UGR B;  2HQH A;  2LCS A;  2P4T A;  1Y57 A;  4EMG A;  3OYI A;  5DLQ E;  3SD4 A;  3I55 Q;  3VJP A; 
#chains in the Genus database with same CATH homology
 2FPF A;  1K1Z A;  1WXT A;  2AKK A;  2CT4 A;  2LP5 A;  1Y0M A;  1K76 A;  4LUD A;  1B07 A;  2V1R A;  4OMN A;  2EGC A;  1U06 A;  4K11 A;  1JQQ A;  1MUZ A;  1PWT A;  2B86 A;  4RTX A;  2DRK A;  2RQW A;  1K9A A;  4ESR A;  5FWB A;  2BZX A;  2M0Y A;  5IHK A;  3NHN A;  2DX1 A;  2YUO A;  1JXM A;  2DNU A;  1HJD A;  2GTO A;  3VS2 A;  2EYW A;  2GBQ A;  2KT8 A;  1PHT A;  2RQV A;  5GJW B;  1YWO A;  2RQT A;  4AFZ C;  1G83 A;  4LN2 A;  3ULR B;  5GJV B;  2ENM A;  2FRW A;  2O2O A;  1SEM A;  2KRN A;  2DL7 A;  2JM8 A;  3EG0 A;  2EPD A;  3R6N A;  2JMA A;  1N5Z A;  4J9C A;  2O88 A;  1FYN A;  2GTJ A;  2C0I A;  2JS0 A;  2CSQ A;  1T0H A;  3EG2 A;  1QWF A;  1GCQ C;  2FPE A;  2VKN A;  1BU1 A;  2DL4 A;  1AOJ A;  4R0K A;  2KRM A;  1NLO C;  2DMO A;  2EYX A;  1X2Q A;  4LNP A;  3TSZ A;  1PRM C;  1UE9 A;  2X3X D;  1W1F A;  2RQU A;  5I22 A;  1KJW A;  1I0C A;  3TVT A;  4RTU A;  2L3Q A;  3LH5 A;  3M0P A;  3PVQ A;  1ZBJ A;  2KYB A;  1M3C A;  2DF6 A;  2AKL A;  1RUW A;  2J6F A;  3VS4 A;  2A08 A;  2KT1 A;  2VVK A;  1CKA A;  2J05 A;  1X6B A;  2DE0 X;  4LUE A;  3VS3 A;  4D8K A;  1AWJ A;  2EYZ A;  1AD5 A;  2GNC A;  3VRY A;  1QKX A;  1BK2 A;  1ZLM A;  3O5Z A;  1JO8 A;  2KNB B;  1U5S A;  4JJB A;  4AFQ C;  2K2M A;  2LNH B;  3RBB B;  1NEG A;  1YP5 A;  4OMO A;  2PNI A;  1YWP A;  2YT6 A;  1A0N B;  1H8K A;  2J6O A;  1B3Q A;  2LJ1 A;  2O9V A;  1W6X A;  1VYU A;  1M8M A;  1J3T A;  4IIO A;  2CH4 A;  3C0C A;  2AK5 A;  1JEG A;  1ARK A;  1SHF A;  1GCQ A;  2RPN A;  1NM7 A;  4J9I A;  3GBQ A;  4HCK A;  3UF4 A;  3ZL7 C;  4J9B A;  1E6G A;  2FRY A;  2IIM A;  2D1X A;  2ABL A;  3KFV A;  2XMF A;  1GRI A;  2JW4 A;  3UA6 A;  3A98 A;  2LZ6 B;  2LQW A;  2DJQ A;  1QKW A;  4RUG A;  3VS0 A;  1OOT A;  1Z9Q A;  2W10 A;  5FWC A;  2CUD A;  4HVU A;  2G6F X;  1G2B A;  1UJY A;  1I1J A;  4OMP A;  4WCI A;  4A63 B;  4IIM A;  4LE9 A;  2K7A A;  4F14 A;  2MCN A;  2HDA A;  2ROL A;  4HXJ A;  3VS7 A;  1T3L A;  1Z9Z A;  3EG3 A;  2ED0 A;  1RLP C;  1YN8 A;  2OAW A;  1U3O A;  4FSS A;  4JJD A;  4RTT A;  2W0Z A;  1NEB A;  2X3W D;  1LCK A;  4J9H A;  2DM1 A;  3I35 A;  4RTY A;  2KE9 A;  3EHQ A;  2KEA A;  5IXF A;  1AZE A;  3VS6 A;  1JXO A;  2NWM A;  3H41 A;  2OI3 A;  2BZ8 A;  3EHR A;  2DL8 A;  2DL5 A;  5HCK A;  3REB B;  4AFS C;  2A36 A;  2FEI A;  1TG0 A;  2RNA A;  1K0X A;  3M0Q A;  4QT7 A;  2EGA A;  4JZ4 A;  1K4U S;  2QDL A;  5EC7 A;  1GBR A;  4AFU C;  3RNJ A;  1ABQ A;  1FMK A;  2BTT A;  3NGP A;  1SRM A;  2BZY A;  1GFD A;  2SRC A;  1YNZ A;  2KR3 A;  2MIO A;  2SEM A;  1SHG A;  4OML A;  3VRZ A;  1ZUK A;  2JT4 A;  1GL5 A;  1SPK A;  1NYF A;  2A37 A;  1UGV A;  1RLQ C;  4GBQ A;  2DL3 A;  1MV0 B;  3EG1 A;  1KSW A;  3UA7 A;  1TUD A;  2FO0 A;  2J6K A;  2OJ2 A;  1AZG B;  2PTK A;  2KRS A;  1X27 A;  3NMZ C;  3THK A;  5L23 A;  2YSQ A;  3M0S A;  2DIL A;  3VS1 A;  4E6R A;  1VA7 A;  1UHC A;  4ORZ A;  1OV3 A;  1AWO A;  4DEY A;  3I9Q A;  4J9G A;  2EGE A;  2LQN A;  2EYY A;  1M3A A;  1BB9 A;  4CC7 A;  2YUP A;  4JJC A;  1T3S A;  2ESW A;  2K9G A;  1AWX A;  1SSH A;  2JMC A;  1AEY A;  2L3P A;  1CKB A;  1NLP C;  1WX6 A;  2K3B A;  2HCK A;  1WYX A;  1WFW A;  2GGR A;  1W70 A;  4KRT A;  2JM9 A;  2O31 A;  4OMM A;  1NYG A;  2LJ3 A;  2F2W A;  4Z89 A;  2AZS A;  2DYB A;  1UHF A;  1M27 C;  4GLM A;  3TSW A;  3PVL A;  1X6G A;  1I07 A;  3QWY A;  2L2P A;  1YCS B;  4HVV A;  4CC4 B;  2O9S A;  4Z88 A;  1VYV A;  4F16 A;  3NPF A;  2M51 A;  1HSQ A;  1WXU A;  1BBZ A;  2VWF A;  3CQT A;  1V1C A;  2F2X A;  2H8H A;  2JS2 A;  2K79 A;  2KXC A;  1UTI A;  1H3H A;  1GBQ A;  1XOV A;  1K0S A;  4J9D A;  1MV3 A;  2A28 A;  1PKT A;  1TUC A;  3M0T A;  1OPL A;  2FPD A;  1QWE A;  4OMQ A;  1GCP A;  1M30 A;  1UEC A;  2LMJ A;  2L0A A;  3I5R A;  1SRL A;  1X43 A;  2ROT A;  1X2K A;  3VS5 A;  2PZ1 A;  1M3B A;  1ZUY A;  2HEQ A;  1OEB A;  2EKH A;  2KGT A;  4JPB W;  1AVZ C;  5FW9 A;  5IHN A;  1WA7 A;  2JTE A;  1T0J A;  2YUQ A;  3IQL A;  3I5S A;  2KYM A;  2CRE A;  1WI7 A;  1UFF A;  2RN8 A;  3U23 A;  2D8H A;  2ED1 A;  2GQI A;  1WIE A;  2NUZ A;  3EGU A;  3H0F A;  5IXB A;  2DBK A;  4D8D A;  3H0I A;  1GFC A;  1X69 A;  2J7I A;  4J9E A;  2EBP A;  2RMO A;  2LX7 A;  2RQR A;  1IO6 A;  2V1Q A;  2P4R A;  4ZNX A;  1UDL A;  4F17 A;  3REA B;  2DVJ A;  1E6H A;  1UG1 A;  2HBW A;  2C0T A;  5I11 A;  1KFZ A;  2DLP A;  1E7O A;  2MOX A;  4CC3 A;  1RI9 A;  2KBT A;  1UJ0 A;  2DA9 A;  2D8J A;  2RF0 A;  4HVW A;  1NG2 A;  2CH4 W;  2HSP A;  2J06 A;  4Y92 A;  4RTW A;  3SEM A;  1KIK A;  1HD3 A;  1AWW A;  2AZV A;  2KXD A;  2DRM A;  1S1N A;  1ZX6 A;  4Z8A A;  3PE0 A;  2EQI A;  1ZSG A;  2D0N A;  2YDL A;  4EIK A;  2FG0 A;  3JV3 A;  2F2V A;  4RTV A;  4CC2 A;  4AG2 C;  3FJ5 A;  2C0O A;  2E5K A;  3UAT A;  2LJ0 A;  1JU5 C;  1VYT A;  2YUN A;  1QLY A;  2KRO A;  1UUE A;  2CDT A;  2EW3 A;  2EVR A;  1EFN A;  5ECA A;  4AG1 C;  1ABO A;  3SHW A;  1WXB A;  4RTZ A;  1WDX A;  3M0U A;  4JZ3 A;  1WLP B;  2L3S A;  1PKS A;  2JXB A;  5IH2 A;  2DBM A;  4DEX A;  5IHI A;  1H92 A;  3H0H A;  4J9F A;  2CSI A;  2LCS A;  2ECZ A;  1QCF A;  4X1V A;  4M4Z A;  1ZUU A;  1Y57 A;  1PRL C;  2K6D A;  3QWX X;  2I0N A;  1CSK A;  3M0R A;  2CT3 A;  1OPK A;  1PNJ A;  2CUB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...