1T0HA

Crystal structure of the rattus norvegicus voltage gated calcium channel beta subunit isoform 2a
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
96
structure length
96
Chain Sequence
RREAERQAQAQLEKAKTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEIGFIPSPVKLENMRLQHEQRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VOLTAGE-GATED CALCIUM CHANNEL SUBUNIT BETA2A
publication title Structure of a complex between a voltage-gated calcium channel beta-subunit and an alpha-subunit domain.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Signaling protein
total genus 22
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12052 VGCC_beta4Aa_N Voltage gated calcium channel subunit beta domain 4Aa N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1t0hA00
3M0SA 4IIOA 2M51A 3M0UA 2GQIA 5GJWB 2RMOA 2XMFA 2J06A 3EHQA 1YP5A 1WI7A 2CSIA 4RTUA 1GCQC 2DJQA 2D0NA 1K0SA 2ED0A 1NM7A 2O31A 2HBWA 2YDLA 4GLMA 2YUNA 1U3OA 4RTXA 2AZSA 2LQNA 4Z8AA 2K6DA 1GBRA 1W70A 1CKAA 3VRZA 3EG1A 3REAB 2V1RA 1WDXA 4Z89A 2LJ0A 1KIKA 2GTJA 1JXMA 1PWTA 1YWOA 1AD5A 1SRLA 1OV3A 5L23A 1I07A 1GFCA 1VA7A 1FMKA 2RQVA 3I5SA 1UJYA 5GJVB 1QLYA 1OPLA 2EYWA 4CC4B 3VS3A 4LN2A 4AFQC 2L3SA 1X43A 1NLOC 1K1ZA 2DBKA 1MV0B 1H92A 1B07A 4DEYA 2KRMA 1T3SA 1NLPC 1ABQA 2RNAA 1WXTA 3TSZA 2LJ1A 1JQQA 2DMOA 1H8KA 4RTVA 2NWMA 3THKA 3TVTA 2ABLA 1SEMA 1JO8A 1U5SA 1PKSA 2EW3A 1AZGB 2P4RA 3H0HA 5IH2A 2EVRA 2JMAA 1LCKA 1M3AA 4HVVA 2KEAA 1UE9A 3I5RA 2CH4A 2RN8A 1E7OA 1SPKA 3I9QA 1M3CA 2CSQA 1AEYA 2DYBA 2LJ3A 4IIMA 1TUDA 1Y0MA 1QKWA 2LP5A 4ESRA 1YN8A 2A08A 3H41A 4D8DA 1H3HA 2GBQA 2CT4A 2LZ6B 3VS7A 1ABOA 1OPKA 4J9HA 2EPDA 2DBMA 2KE9A 2FG0A 2DL3A 2EGCA 3U23A 2J6KA 2G6FX 2M0YA 1SHFA 2DNUA 2CUDA 1GRIA 3M0PA 3SHWA 1ARKA 2KGTA 1ZX6A 1AOJA 1RUWA 2KT1A 4JJDA 3VS0A 2K2MA 1TG0A 2KNBB 3ULRB 1GL5A 1X2KA 1WXUA 2JXBA 3PE0A 2B86A 4K11A 1N5ZA 2AZVA 2I0NA 4LNPA 2LNHB 1MUZA 3EG3A 3QWYA 3VS5A 1K4US 2JT4A 1TUCA 2JW4A 4LE9A 4LUEA 2GGRA 1PRMC 3EG2A 3NGPA 4FSSA 1JXOA 1KFZA 1UHFA 2AKLA 1WIEA 2EYYA 1B3QA 2KXDA 1E6GA 1UDLA 2L3QA 4F17A 2KRSA 2ESWA 1M27C 1NEBA 5I22A 3M0TA 1NYFA 4ORZA 5FW9A 4AG1C 1T0JA 4JJBA 2HSPA 3QWXX 1VYVA 2BZXA 4KRTA 2MOXA 1G2BA 1BBZA 4Z88A 4CC2A 3NMZC 3UATA 2KR3A 2DX1A 2JM9A 1RLPC 4OMMA 1QKXA 3EG0A 2BZYA 3NHNA 4M4ZA 2JMCA 1RI9A 1K76A 2O9SA 2VVKA 2OAWA 4RTWA 2KROA 2DILA 1ZUYA 2CREA 1K0XA 4R0KA 1HSQA 2DRMA 2ED1A 2EYXA 4F14A 1AWWA 2L2PA 1VYUA 2DF6A 2FO0A 2O9VA 1UHCA 3VS6A 1G83A 5IHKA 3PVQA 2OI3A 1U06A 4AFUC 4RUGA 2D8HA 4LUDA 4AFSC 2C0IA 2YUOA 1AWOA 1EFNA 1WYXA 3VRYA 4DEXA 3O5ZA 2KT8A 1I1JA 5IHIA 1KSWA 1UGVA 4OMNA 2V1QA 3UF4A 3EGUA 2CH4W 2D8JA 2KYBA 5IXFA 1QCFA 2FRYA 2LQWA 1QWEA 3UA7A 2VWFA 2KRNA 1UG1A 1WA7A 2DLPA 1NG2A 1ZUKA 2EYZA 4J9BA 4JPBW 3SEMA 2K9GA 3LH5A 5EC7A 2JS2A 3TSWA 1XOVA 4J9GA 1X69A 4RTTA 2KBTA 5IHNA 4X1VA 1T3LA 2RQWA 4J9CA 2A28A 1BU1A 1S1NA 1Z9ZA 1V1CA 1X6BA 2AKKA 3UA6A 2KYMA 2FEIA 1Y57A 1UJ0A 1ZLMA 2D1XA 4OMLA 1PNJA 4J9FA 4AFZC 2JM8A 1WFWA 1GBQA 4F16A 1WLPB 5IXBA 2BZ8A 1AWJA 2ECZA 1UTIA 1T0HA 5I11A 3H0FA 1ZUUA 2FPFA 2EKHA 2PNIA 2A36A 2H8HA 2RF0A 1MV3A 3A98A 2L3PA 2W10A 2LX7A 4CC7A 1GFDA 2PTKA 5HCKA 2YUPA 1JU5C 2BTTA 4JJCA 1NYGA 2JTEA 5FWCA 1FYNA 4AG2C 5FWBA 1AVZC 2HEQA 2YSQA 3H0IA 1X2QA 2GNCA 4HCKA 2C0TA 2KXCA 2CT3A 1PRLC 1RLQC 2J05A 1J3TA 1X6GA 3ZL7C 2RQTA 1YCSB 3M0RA 3R6NA 4HVWA 2DM1A 2J7IA 1W6XA 2F2XA 1X27A 4Y92A 1CKBA 2A37A 2J6FA 3VS4A 4CC3A 2EBPA 2MIOA 1GCPA 3NPFA 4HVUA 2CUBA 4ZNXA 1M30A 1WX6A 2GTOA 2LCSA 2DVJA 4E6RA 2RQUA 2PZ1A 2K3BA 2K79A 1AZEA 1UFFA 3M0QA 2O2OA 1UECA 1OOTA 3CQTA 2O88A 2X3WD 3RNJA 1M8MA 2HCKA 1BB9A 2VKNA 1NEGA 3JV3A 4RTYA 2OJ2A 4OMPA 2F2VA 4J9EA 4D8KA 1JEGA 1HJDA 3VS2A 2AK5A 3C0CA 5ECAA 2CDTA 1KJWA 2NUZA 2W0ZA 2L0AA 3PVLA 4GBQA 1Z9QA 4WCIA 1IO6A 2MCNA 4A63B 1VYTA 1A0NB 1BK2A 1I0CA 1QWFA 3GBQA 2ENMA 3RBBB 2DA9A 2C0OA 3KFVA 2DL4A 1UUEA 4J9DA 3REBB 1PHTA 2RQRA 2EGAA 2YUQA 1HD3A 1SHGA 2DL5A 1OEBA 3VS1A 1WXBA 4HXJA 2DL7A 4JZ3A 2HDAA 1AWXA 2YT6A 2JS0A 2RPNA 4RTZA 1PKTA 3FJ5A 1K9AA 2FPEA 2DRKA 1W1FA 2EQIA 2ROTA 3EHRA 2FPDA 1GCQA 4EIKA 1CSKA 1ZBJA 2IIMA 2SRCA 2EGEA 4JZ4A 2QDLA 3IQLA 2LMJA 4J9IA 1SRMA 1YWPA 2DE0X 2SEMA 2FRWA 1SSHA 4OMQA 2X3XD 2J6OA 1YNZA 1ZSGA 2DL8A 2ROLA 3I35A 4OMOA 2F2WA 2K7AA 4QT7A 1M3BA 1E6HA 2E5KA
chains in the Genus database with same CATH superfamily
4M75B 1N8RC 5GJWB 2RMOA 2XMFA 3VKIA 2CGHA 2LCLA 2DJQA 4B6MA 4KH0B 2O31A 2HBWA 3LH0A 4GLMA 4MZMA 3OBYA 4ZN1A 4M7AC 2AZSA 2LQNA 4M7DA 1CKAA 5HY6A 2RM4A 3REAB 3UWNA 3V8LA 3DLMA 3SFMA 1WDXA 4OB0B 3RESA 3CCLQ 3CC4Q 1MMGA 3VUZA 2GTJA 1PWTA 5GAMe 2KK4A 2K5FA 1TWBA 2QTVA 3PT9A 5GAOr 1U8RA 3I5SA 1UJYA 3VYGA 5GJVB 3VS3A 4LN2A 4AFQC 1X43A 5AYFA 1NLOC 3LYIA 2KSSA 1B07A 2HNIA 4DEYA 3LWIA 1NLPC 2CKKA 2IPOB 2OTJA 2RNAA 4KH1B 2LJ1A 4M77G 1H8KA 3CCSA 4O6JA 4BI8B 3M59A 5M9OA 2F69A 1JJ2P 1M1KU 3CCJT 1GXIE 1U5SA 3H0HA 3OY9A 3G1JA 3M57A 3M53A 3D7SB 2KEAA 3JB9G 2CH4A 2RN8A 4KUIA 5FROA 3I9QA 1M3CA 5LJ5h 2OTLQ 1M8VA 2MAMA 2XK0A 2LJ3A 1X75C 4M77E 1QKWA 4M77B 1H3HA 1WJQA 2GF7A 3QZ9B 1ABOA 1IZ6A 1VQ6T 4J8OA 4J9HA 2ZPEB 5A2QE 2RJFA 2EPDA 4LDUA 1K73C 3OYCA 2P4TA 4A4FA 3CC7T 1VQ7A 2XIDA 2RHYA 2RK1A 1AOJA 4JJDA 5I21A 1TG0A 3ULRB 4X9CA 1GL5A 1X2KA 1VQ8A 3ZBDA 2XHCA 1XQHA 4XU3A 1N5ZA 4MMKA 2VUBA 4LNPA 2LRQA 1MUZA 3QWYA 4RG2A 3VS5A 2JT4A 3TREA 4DBHA 4M7AF 4LUEA 2GGRA 2YLCA 3NFCA 1PRMC 3QYGB 3CCQQ 3HFNA 4C92A 1YBYA 1JXOA 1UHFA 5J26A 2KXDA 1YJ9Q 5GAMh 1EX4A 2ESWA 3F70A 5I22A 3QO3A 3C95A 5GAOq 1NYFA 5FW9A 5KYWA 2DTIA 3DKMA 5KYUA 2HSPA 3QHSA 2BZXA 4P5NA 2KVQG 2LC4A 3RKYA 4MZTA 5J39A 4Z88A 4CC2A 3TCJA 4C0FA 1VQKT 5CQXA 4O5VA 1VQ6Q 1VQ5T 4VUBA 3EG0A 4R56A 4M4ZA 3CMAT 1RI9A 2QQ9A 3E19A 2O9SA 2VYTA 2VVKA 1U1SA 1UGSB 3P8BB 4EPCA 5LJ3g 2KROA 2K3YA 2CREA 3CC7Q 4R0KA 3L2UA 1VYUA 2L2PA 2QASA 2JUFA 4EDUA 4XTUA 4KGVB 2E3HA 3MEAA 4FM4B 3PVQA 4FT4A 4HCZA 3V8KA 3JCMP 2JZ2A 1O75A 2E41A 4AFUC 4RUGA 3EFRA 4AFSC 2DKGA 2YUOA 2NYSA 1EFNA 1WYXA 4A4HA 4L59A 3A8OB 3M55A 2F5KA 2CZ1B 2XG8D 1UGVA 4OMNA 5CKFA 4M78D 3G7ZA 2D8JA 5EG2A 2D6FA 5LJ3f 3I55Q 2DD4A 2QTXA 5IXFA 4ZTJA 3OMGA 1RL2A 2KRNA 3P8DA 1IXDA 4WF2A 1ZUKA 3OS2A 4M7DD 3SEMA 3TSWA 1YJNT 3RR6A 3LLRA 3EFOB 3S3OA 2A28A 4BD3A 4KT0E 1BU1A 1S1NA 5GAN3 1V1CA 4M7AG 1RACB 2D1XA 4OMLA 5FRMA 4AFZC 2JM8A 3E9FA 4F16A 3JCMc 2FZCB 3M58A 5KCOA 4OGCA 3HRUA 2EKHA 1BI1A 4BDZA 2R5AA 1JJ2S 2L3PA 5GAOp 2EQJA 1QP2A 4FW1A 2BTTA 4FCYA 5GMKe 3UT1A 3C12A 3HPWA 2JTEA 7AT1B 2X4XA 3OQ5A 2WSEE 3OA6A 5FWBA 1AVZC 3CCJA 2E5QA 2F1LA 4N4IA 2CT3A 4PJMA 1PRLC 2A3LA 1KC8U 4LD6A 2YLBA 3G71T 4Q5WA 1OZ2A 3R6NA 4R55A 2DM1A 2J7IA 1W6XA 2OX7A 3CCMT 1X27A 2HQHA 2IG0A 3OS0A 4Y92A 1CKBA 2KAFA 3RMSA 3NPFA 1VQ6A 4AT1B 4Y28E 1M30A 2LQKA 5GANg 2CP2A 2DVJA 1QCNA 2DJZA 2PZ1A 2YRCA 4EMHA 1AZEA 4M78C 3RKWA 1UECA 1VQ9T 1F1BB 1OU8A 3CQTA 1BI2A 1KQSA 3RNJA 2X4YA 1BB9A 4M7DC 3GP8A 3JV3A 1OZ3A 3VS2A 2BE7D 2KMTA 3C0CA 5ECAA 5C0MA 1YITT 1KJWA 3CC2T 2NUZA 3A8LB 1SSFA 5GAN8 2E12A 1Z9QA 5GANf 4A54A 1OULA 4WCIA 2HKNA 1BK2A 2RK2A 1I0CA 3OYBA 2ENMA 2LVMA 3X24B 2DA9A 1M2VB 1VUBA 4NL2A 2EGAA 2O4XA 4OGEA 1SHGA 3QJYA 2K57A 1VQKA 1VQ4T 1WXBA 4FYYB 4HXJA 1VQ5A 1M9SA 2DL7A 4EMKB 5HKCA 4JZ3A 3SWNA 3CMAA 1YJWT 3CBPA 1PKTA 2K3XA 1I8FA 4HT8A 2RI5A 4L5GA 2DRKA 1W1FA 3CCUA 2M16A 1M1KC 2DEQA 3EHRA 5GAN2 3VV0A 2EKOA 5KCHA 1SSHA 1VQPA 3LGFA 2PVOB 1C6VX 3I35A 1UGQB 1YI2A 3OYFA 1DJ7B 2EJ9A 3M0SA 4IIOA 4F04B 3CC2Q 3M0UA 1K8AR 2QQBA 1IB8A 2QXFA 4LDVA 2J06A 2V8JA 3HHTB 2X9HA 5CKDA 5LJ3d 1WI7A 4RTUA 1GCQC 4C8QD 3FB9A 1K9MU 2QI2A 2WSCE 3WXMB 4OP0A 2ED0A 1NM7A 5LJ3h 4B9XA 2YUNA 4E7LA 1PD1A 1YJNA 4OMFB 1GBRA 1W70A 1WHHA 5KYYA 3X26B 4M78F 3EG1A 1QQJA 2E6NA 2E70A 1FMWA 1VQLT 4Z89A 5CIUA 1JXMA 1KK7A 3BFMA 3GLXA 4M7DF 2LQ8A 2Y4YA 3CCET 3MO8A 2KI7A 5HK3A 5L23A 3NTKA 1GFCA 1TOVA 1VA7A 1B7TA 4L6V5 1QLYA 2L3SA 1K1ZA 2F5TX 2DBKA 1H92A 1NZ9A 3M56A 2ZCFB 3TSZA 2EJFA 1JQQA 2HBPA 4PL6A 3JB9J 2NWMA 3HP9A 2D9TA 2ZPBB 2ABLA 5I2MA 3A5ZB 1JO8A 3SD4A 1BCMA 8AT1B 2MWOA 1PKSA 4XTYA 3WVDB 1AZGB 2P4RA 2EVRA 2MF2A 2NUPA 2FB7A 1M3AA 2PQWA 4HVVA 3I56Q 3JCMd 4RCBA 3QSUA 4PJNA 3QIIA 4RG8A 3G71A 2DYBA 1I5OB 1WQ7A 4FU6A 3MP8A 3OS5A 5DLOA 2P0PA 3SB2A 2A08A 3CCMA 1AT1B 3EH2A 2LZ6B 3BDLA 1WJRA 1K8AU 5LJ5e 1OPKA 3MPUB 3CCRA 3EGXA 3CXCP 4IKFA 3CCEQ 2KE9A 1C0MA 3NTHA 2DIGA 3U23A 4DQ2A 1R77A 2CP6A 2CUDA 3SHWA 1ARKA 2KGTA 1VQ9A 4FSXA 2K2MA 3A1PA 2KNBB 1XTDA 4C8QC 2D0QB 1R0CB 2JXBA 3QDFA 4J7FA 2NUTA 1RI0A 2AHJB 2DPPB 2AZVA 4M78G 1QVGA 1BYMA 1H3ZA 3UPUA 2JW4A 2QQAA 2EYQA 4LE9A 2HZYA 3AT1B 3EFSA 2DFUA 1KHCA 1YITA 3EG2A 3CC2A 1M90C 4M7DG 5GANd 1WIEA 2EYYA 1B3QA 1UDLA 3V7RA 2OTLT 5GAN6 1M27C 1NEBA 5GANh 3LWHA 4QW2A 1YHQT 4HCBA 4JJBA 4CRIA 3QWXX 1VYVA 4M78E 3G6ET 4M78B 1G2BA 1WHKA 4BB7A 2CS7A 1VQ4A 3OYYA 2JM9A 4M7DE 2E6ZA 4M7DB 1I5LA 1YJWA 2VASA 1PSFA 2DO3A 2EAYA 2VGNA 1ZQ1A 4JRPA 2DK3A 1Q82R 1ZUYA 1K0XA 4LDYA 2XDPA 2ZZDA 3PMIA 1AWWA 2DF6A 1Q86R 1UHCA 3VS6A 5IHKA 3DB4A 4F7UA 1Q81R 1KC8C 5AT1B 2D8HA 1WQWA 3HTRA 4C5HA 2C0IA 3MJXA 4OB2B 1PD0A 3CCQT 3O5ZA 2KT8A 4IUQA 3CMEQ 1KQ1A 1VQMA 1KQ2A 3ZFJA 1YJ9T 1VQOA 2V8KA 5GAMj 2CH4W 2X4WA 3HSBA 3M4YA 2KYBA 3JCMX 2FRYA 3H8ZA 2RA2A 1QWEA 2RB6A 1UG1A 4BUGA 2DLPA 1YHQQ 4PJOA 2EYZA 5CVIA 4J9BA 3RIRA 4JPBW 2K9GA 2IVWA 4J9GA 5CO7A 3QUIA 1NJIR 3G6EQ 1OU9A 1NBEB 5IHNA 4ZN3A 1I4K1 1BIBA 1T3LA 3JCMW 3PGGA 2FL7A 1Z9ZA 3SDZA 2AKKA 1X6BA 1VQLA 2KYMA 4C8QF 3H6ZA 2Y4XA 2AIRB 4FIBA 2XI9A 4J9FA 1PNJA 2E4HA 1GBQA 2ECZA 1UTIA 1AHJB 2QK0A 4J6YA 3NTIA 2FPFA 4EMKC 3N5BB 1QVFA 2H8HA 1V76A 3HL8A 2LX7A 2CZ6B 2PTKA 2YUPA 5D6WA 4JJCA 3HKSA 1NYGA 4ANJA 2R5MA 2PUOB 2CP7A 2FHDA 1N8RR 4IUPA 2YSQA 2HEQA 1BKBA 3SWNC 3GOXA 2GCXA 1Q7YC 2GNCA 1N6AA 3I55T 4D6WA 2KXCA 5CKHA 2X4JA 1Q82U 2J05A 1J3TA 1X6GA 4C92E 1TSFA 3FEOA 4C92B 1Q86U 4IUUA 3CXCS 3S3NA 4PKCC 3FIFA 1WHMA 2E3IA 2P0QA 3MEWA 2E64A 1QMCA 3CCLA 2F2XA 3CC4A 2A37A 1WGSA 5KYWB 4Y91A 4CC3A 2LT1A 3GNGA 5KYUB 3HRSA 4BY6C 3MP6A 4FT2A 2CUBA 4ZNXA 3T9NA 1KD1C 3LGLA 2M1HA 4NOYA 4OB1B 3CPWA 2LCSA 4ELYC 2RQUA 3BY7A 1UFFA 2R58A 4BE0A 2LTOA 1NJIU 1OOTA 2O88A 1K9MC 2EQUA 1M8MA 1WJSA 4RTYA 2OJ2A 3GF5A 4D8KA 1HJDA 4C8QG 1ZSZA 2AK5A 1N27A 2RJEA 4A4GA 2L0AA 1VQNT 3GPLA 2YXYA 1S72Q 1IO6A 2E10A 5IN1A 2OTLA 2DXBA 1VIFA 2EIFA 1VYTA 3CBOA 2BE9B 4N0AA 1QP3A 2QA4Q 3V7CA 3OYEA 3G4ST 4J9DA 3REBB 1W4SA 2P84A 1TUGB 1G8XA 4C8QE 2CP5A 2EFIA 4C8QB 3VS1A 1B34A 9ATCB 1X6OA 1AWXA 2XDBA 2WSFE 1PM3A 2YT6A 2JS0A 3JCMg 1K73R 3BW1A 3FJ5A 1K9AA 2FPEA 2COWA 3META 2EQIA 5IT9E 1PCXA 4PLLA 1ZBJA 2IIMA 2SRCA 2EGEA 1G3YA 2QDLA 3IQLA 1YWPA 4OMQA 2J6OA 1H641 4M7AA 1TH7A 2ROLA 1PC0A 2H3EB 4OMOA 3CCQA 1E6HA 3CPWP 2GQIA 4OB3B 3X25B 1VQNQ 2JTFA 1EIFA 3A8MB 3JCMf 1YJ9A 3MHXA 4KBMB 1YP5A 3Q1JA 4PJOD 1I81A 1K0SA 1Y96A 2DD5A 5FU6C 1MMAA 3G4SQ 1YIJQ 4RTXA 2PU9B 2RH2A 2H3JA 4PJJA 3JCMV 3WVEB 2V1RA 2DXUA 2EWNA 1SG5A 2YRVA 1NPRA 3LW5E 5LJ3e 1KIKA 4XU2A 1YWOA 5GMKj 3JCMb 1SRLA 1C1AA 2YRDA 2M9UA 3CC7A 1KD1R 1FMKA 5CKEA 4ATOA 2C06A 8ATCB 2EYWA 3MP1A 3M54A 2B8AA 3OMCA 1RAFB 1IHWA 2KRMA 4C0DC 2HL3A 1T3SA 4C92D 1ABQA 4JRQA 4ELZC 4RTVA 3TEEA 2A0FB 3THKA 3MEVA 1SEMA 3I55A 1TTHB 1N9RA 3TU4K 2EW3A 5IH2A 4EMGA 1W2BA 2JMAA 1LCKA 4PFPA 4KULA 4C5IA 2HAXA 2L5QA 4OF1A 1MHNA 3L1AA 1D1AA 1IGUA 4KUDK 1SPKA 1IHVA 4E7KA 2K2VA 4UC4A 2EQMA 3QPHA 3INZA 4QKUA 1Y0MA 2LP5A 1HXDA 1SKUB 4D8DA 2GBQA 2CT4A 1MMNA 3VS7A 3BE3A 3A8HB 3OW2A 2O4XB 2QAZA 1SF9A 2FG0A 3PTAA 4B9WA 5CK9A 2EGCA 1G3WA 2COYA 3O8VA 2DTOA 3C94A 2QYZA 2J6KA 4PJLA 2G6FX 2M0YA 1SHFA 2DNUA 3SWNB 1RAAB 4ZGJB 1GRIA 4IUVA 3C4SA 2KT1A 4RKUE 4PJOC 3CCVQ 4MZPA 1WXUA 5KYNA 1X01A 2KDSA 2PUKB 4C0GA 2CZ0B 2KQWA 2LNHB 3EG3A 4JRIA 1TUCA 2XU8A 2MMPA 4LDWA 4FSSA 2QEXQ 3RERA 2ZPFB 1KFZA 2AKLA 1KQSP 1YFNA 3I56T 2VGMA 4X34A 4JS5A 2A7YA 1E6GA 4BY6B 2GFAA 4F17A 4DBFA 4JUVA 4IUTA 1T0JA 1VIEA 1FX7A 4DA4A 3QDRB 2MOXA 1BBZA 3JAME 3NMZC 3OBWA 3S6WA 1PG5B 2YWWA 5GANe 3UATA 3FLGA 2DX1A 4C92C 1RLPC 4OMMA 1W2BP 1QKXA 5LL6S 4JDSA 5CQYA 3NHNA 4J6XA 2JMCA 1K76A 5KYYB 4FYWB 2JN0A 2OAWA 3CPFA 4RTWA 3J81E 5HK0A 3L2QA 2RHIA 4TVRA 3P8HA 2VC8A 2Y90A 1HSQA 3CPWS 2ED1A 4J6WA 4F14A 2VXFA 4DBRA 2FZKB 1RAEB 2WACA 3CD6T 2O9VA 1G83A 1BI0A 4BI3A 4XU0A 2OI3A 1NPPA 3OW2P 1VQ8T 3KXTA 4DEXA 2OTJQ 1OQKA 3JCMJ 1I1JA 4BDYA 4IURA 3CCSQ 5IHIA 1KSWA 4F7UF 1ZHIA 2XD0A 3UF4A 3EGUA 4E7SA 1FXXA 5GAMf 4FW2A 3JCMh 3OYGA 1QCFA 1UGRB 2LQWA 3UA7A 2VWFA 1NG2A 5EC7A 5KYXA 2NUPB 3EGDA 1ZBXA 3OB9A 4X1VA 4BI4A 3M4GA 3RUXA 4YTLA 3OSVA 2DYIA 4MMLA 2RHZA 1Y7XA 4PJOF 1Y57A 4QVDA 1RABB 3E2UA 2DERA 1ZA1B 2HQEA 4MDWA 4ZTFA 3JCMQ 5IXBA 1AWJA 3ER0A 3EG9A 5I11A 1D3BA 1M1KR 3H0FA 1D0YA 3EGXB 3CD6Q 4N0AC 2PNIA 1JJ2A 1VQ7Q 2W10A 3OYAA 4M75A 3BDUA 4JRKA 4CC7A 1GFDA 1D1CA 1VQ8Q 3EH1A 5FU6B 1JU5C 3VU3C 5CKBA 2CP3A 1EZZB 3CMET 1FYNA 4AG2C 2YHTA 2NUTB 1X2QA 3OS1A 5LJ5j 1HYOA 5GMKi 2C0TA 3HRTA 5A0GA 4C92F 4A4EA 3OYMA 1IGQA 5DY9A 5DLQE 1YCSB 4M78A 3CEYA 1M2OA 3QYHB 3L2WA 2J6FA 3VS4A 2EBPA 2MIOA 1GCPA 4C0DB 1TU0B 1UGPB 2JTMA 1MNEA 2FVUA 3UDCA 4FYXB 4F7UG 1WX6A 2RJDA 2GTOA 4E6RA 5KE2A 2K79A 2OAUA 3FJPA 5D6YA 1D1BA 2XDDA 2K5LA 1KQSS 3RKXA 3FRNA 1QVPA 2X3WD 2VKNA 4A4KA 4RCCA 4OMPA 2JOYA 3PFSA 3PIPA 1JEGA 3OYJA 4PJOG 1G3TA 4F7UE 3QBYA 4JLIA 5FU7B 4F7UB 3JB9H 3PNWC 4E47A 3PVLA 4GBQA 1MNDA 3I56A 4LDXA 3URGA 2MCNA 5I2SA 1QVGP 4A63B 1A0NB 4M77A 1W2BS 3RBBB 5LJ5d 5CR2A 2C0OA 3KFVA 2DL4A 2QGGA 4N4GA 2RQRA 1HD3A 4PJOE 4PJOB 2DL5A 1OEBA 3CCEA 5GAN5 5D6XA 4QQ6A 1FMVA 1UB4A 3DLLA 4XTVA 3JB9I 2JNGA 3OW2S 2QGFB 3OYDA 4C92G 4DBQA 3R6OA 1XNIA 2ROTA 1OX8A 4LD9K 1Y71A 1GCQA 4QQDA 4EIKA 3CD6A 1G3SA 4JZ4A 3FDRA 2BIVA 3V8JA 3OYIA 4J9IA 4J83A 4E7JA 2KY9A 2MYSA 2X3XD 1YNZA 1ZSGA 2DL8A 2PVDB 4E7IA 2F2WA 2K7AA 1M3BA 2E5KA 1G5VA 2M51A 2G3RA 1S72T 1M90R 4E7ZA 5GAOl 4FYVB 3EHQA 2HKQB 4J5YA 2RD1A 3CCJQ 5GAN4 4II1A 2AT1B 2CSIA 2ZGWA 2CP0A 2QA4T 4NL3A 4HA8A 5GAMd 3PIOA 2DXTA 1Q81U 2D0NA 5GAOn 3PMTA 2YDLA 5C6SA 3J80E 1U3OA 4JLGA 4Z8AA 4C0ZA 2VXEA 2DAQA 2K6DA 1U1TA 2VV5A 2LCCA 3VRZA 1IRXA 2HMAA 3OYKA 4WTOB 1RAHB 2LJ0A 2LDMA 4JJNK 1Q95G 1AD5A 3QJ6A 1OV3A 3DB3A 2FYKA 1I07A 4PLIA 2RQVA 5KH6A 2X35A 1NE8A 2GQVA 4M75D 1OPLA 4CC4B 3CCUT 4KGXB 1MV0B 1KC8R 5CCAA 5GAOm 2M02A 1WXTA 4RMOA 2DMOA 2PVGB 3CMEA 1VQPT 3VUBA 3MKDA 1QVFP 4XTZA 4LXCA 3TVTA 2QQSA 1YI2T 4C5GA 3S3MA 1YHQA 1UE9A 3EFOA 1ZSZB 3I5RA 1YIJT 1E7OA 3GIBA 1BIAA 3G6EA 3ZEHA 3AHUA 2CSQA 1AEYA 4IIMA 1TUDA 4C8QA 4ESRA 1N8RU 1RAGB 1YN8A 3H41A 3M5AA 2E65A 4A53A 4NS5A 2DZ9A 2L89A 1HK9A 1R8OB 5FLXE 1TS9A 5A0LA 1M90U 2EQKA 1VQKQ 3CBMA 4V2SA 2DBMA 2HQXA 5KE3A 1VQ5Q 1QCOA 2LT4A 2DL3A 3CMAQ 1B34B 2DETA 2V26A 2BUDA 1LPLA 3M0PA 2L8DA 1ZX6A 1RUWA 3VS0A 3CCUQ 3X28B 4E7HA 3PE0A 2B86A 4K11A 2V8IA 1BCOA 3JSCA 1QVGS 1KHIA 2I0NA 3TQ7P 1VQPQ 1K4US 1R0BG 1YI2Q 4M7AE 1K8AC 1Q7YR 1OYXA 3NGPA 2DVEA 4M7AB 4AMCA 5A0DA 5CAIA 4M77D 1M1GA 2EJGA 2L3QA 2KRSA 1RAIB 3M0TA 4ORZA 4AG1C 1WZOA 4KRTA 4M75C 3JB9D 1Y96B 1YJNQ 2JVVA 2HL5C 2KR3A 2I2LA 2BZYA 2MK5A 4XQ3A 3CCRT 2ZAEA 4BE1A 1MMDA 2DILA 1JBMA 1OX9A 2DRMA 2EYXA 3CCVT 4MDXA 4X9DA 2ZPGB 3KBGA 2FO0A 1WNLA 1JB0E 1K9MR 1U06A 2HD0A 4JS4A 4LUDA 3L2VA 2ZPHB 4XAXB 1K73U 1AWOA 2XICA 1VOMA 3VRYA 4QQGA 1N9SA 2QEXT 4ZGDB 4ME7A 1S72A 4GLKA 1XJWB 5D7UA 2V1QA 5LJ3j 2HSEB 1M2VA 3HFOA 2QA4A 1WA7A 4PK4A 1FWZA 3OYHA 5FU7C 1OI1A 3LH5A 2JS2A 1LJOA 1XOVA 4EMKA 2BKDN 1X69A 3QXEB 3E1SA 4RTTA 2KBTA 4XTWA 3H9NA 3G71Q 1MGQA 2RQWA 5IAYA 4J9CA 3JCMe 2DTHA 3UA6A 4PNOA 4PFOA 2FEIA 3CCMQ 3OYLA 3M9QA 1UJ0A 1Q7YU 4PFZA 4C5EA 2QG9B 4HT9A 1ZLMA 2MWPA 1WHGA 2Z0WA 1WFWA 3CCRQ 1WLPB 5LJ5g 2BZ8A 4OVAA 1T0HA 1ZUUA 3QZ5B 5GMKh 2DZCA 4M77C 2K4YA 1QVFS 2A36A 2RF0A 1MV3A 3A98A 1VQ9Q 2LX9A 2ATCB 5HCKA 2OTJT 3QG1A 4XTXA 3CCST 4HCCA 1VQNA 1ACMB 3L2RA 1KD1U 5FWCA 1O9SA 4GY5A 3GNFB 1PSEA 3H0IA 4M75F 2X51A 1V29B 2K5IA 3MCAB 4HCKA 4HKEA 2RHXA 1BI3A 3RDVA 1YITQ 3RMQA 1P92A 5LJ5f 1RLQC 3G4SA 1VQMT 3ZL7C 1YIJA 3V7SA 1VQOT 5J3BA 2RQTA 1D0ZA 3OYNA 2GFUA 3CXCA 3M0RA 4N4HA 3LX7A 4HVWA 1TXQA 1UEBA 4QVZA 2ZPIB 1M5Q1 4HVUA 4XK8E 5GAMg 1VQ4Q 1QW1A 2QDYB 2FZGB 5GMKl 1YJWQ 2MPXC 2QQRA 4DOWA 3JRZA 2JJ9A 1Q82C 2NLUA 2K3BA 4M7AD 5L8RE 3M0QA 2O2OA 3ASKA 1VQ7T 2CZ7B 1WHJA 2DEUA 5FRNA 4E2FB 6AT1B 3J7AF 4Z02A 4BACA 1Q86C 1M1FA 3L42A 1Y07A 3QKJA 1Q81C 1RADB 2HCKA 4QVCA 4ZGEB 1NEGA 3X20B 2O01E 2F2VA 5DM7R 4J9EA 4KGZB 5GANj 2CDTA 1D09B 3EAEA 2W0ZA 1IREB 1JRIA 3VJPA 1VQMQ 1VQOQ 2L3RA 3VYHB 3GBQA 1QWFA 2RI3A 2RO0A 2MI6A 2LNVA 1UUEA 2XKOC 2M0OA 2R57A 3OSSC 1NJIC 1PHTA 2CYZB 2E1HA 3L2ZA 2RI2A 3ME9A 2YUQA 3KUFA 5GMKm 1LOJA 4M77F 1LNXA 4FL6A 1ZSZC 1LVKA 5KYXB 1M4ZA 2COZA 3EGDB 2HDAA 2RHUA 3CCLT 2P0KA 3CC4T 1KG1A 1VQLQ 4M75G 1WHLA 1D0XA 4J7IA 2RPNA 4RTZA 1WPYA 4CI0C 1ZA2B 3MEUA 4BE2A 3A8GB 2RJCA 3JB9F 3E9GA 3CCVA 1YCYA 2FPDA 1CSKA 2LMJA 1SRMA 2DE0X 3EG9B 4XU1A 2SEMA 1D3BB 2FRWA 5GAN7 4DOVA 2DIQA 3FC3A 4QT7A 2VB6A 2DXCA 4M75E 2QEXA
chains in the Genus database with same CATH topology
3M0SA 4IIOA 2M51A 3M0UA 2GQIA 5GJWB 2RMOA 2XMFA 2J06A 3EHQA 1YP5A 1WI7A 2CSIA 4RTUA 1GCQC 2DJQA 2D0NA 1K0SA 2ED0A 1NM7A 2O31A 2HBWA 2YDLA 4GLMA 2YUNA 1U3OA 4RTXA 2AZSA 2LQNA 4Z8AA 2K6DA 1GBRA 1W70A 1CKAA 3VRZA 3EG1A 3REAB 2V1RA 1WDXA 4Z89A 2LJ0A 1KIKA 2GTJA 1JXMA 1PWTA 1YWOA 1AD5A 1SRLA 1OV3A 5L23A 1I07A 1GFCA 1VA7A 1FMKA 2RQVA 3I5SA 1UJYA 5GJVB 1QLYA 1OPLA 2EYWA 4CC4B 3VS3A 4LN2A 4AFQC 2L3SA 1X43A 1NLOC 1K1ZA 2DBKA 1MV0B 1H92A 1B07A 4DEYA 2KRMA 1T3SA 1NLPC 1ABQA 2RNAA 1WXTA 3TSZA 2LJ1A 1JQQA 2DMOA 1H8KA 4RTVA 2NWMA 3THKA 3TVTA 2ABLA 1SEMA 1JO8A 1U5SA 1PKSA 2EW3A 1AZGB 2P4RA 3H0HA 5IH2A 2EVRA 2JMAA 1LCKA 1M3AA 4HVVA 2KEAA 1UE9A 3I5RA 2CH4A 2RN8A 1E7OA 1SPKA 3I9QA 1M3CA 2CSQA 1AEYA 2DYBA 2LJ3A 4IIMA 1TUDA 1Y0MA 1QKWA 2LP5A 4ESRA 1YN8A 2A08A 3H41A 4D8DA 1H3HA 2GBQA 2CT4A 2LZ6B 3VS7A 1ABOA 1OPKA 4J9HA 2EPDA 2DBMA 2KE9A 2FG0A 2DL3A 2EGCA 3U23A 2J6KA 2G6FX 2M0YA 1SHFA 2DNUA 2CUDA 1GRIA 3M0PA 3SHWA 1ARKA 2KGTA 1ZX6A 1AOJA 1RUWA 2KT1A 4JJDA 3VS0A 2K2MA 1TG0A 2KNBB 3ULRB 1GL5A 1X2KA 1WXUA 2JXBA 3PE0A 2B86A 4K11A 1N5ZA 2AZVA 2I0NA 4LNPA 2LNHB 1MUZA 3EG3A 3QWYA 3VS5A 1K4US 2JT4A 1TUCA 2JW4A 4LE9A 4LUEA 2GGRA 1PRMC 3EG2A 3NGPA 4FSSA 1JXOA 1KFZA 1UHFA 2AKLA 1WIEA 2EYYA 1B3QA 2KXDA 1E6GA 1UDLA 2L3QA 4F17A 2KRSA 2ESWA 1M27C 1NEBA 5I22A 3M0TA 1NYFA 4ORZA 5FW9A 4AG1C 1T0JA 4JJBA 2HSPA 3QWXX 1VYVA 2BZXA 4KRTA 2MOXA 1G2BA 1BBZA 4Z88A 4CC2A 3NMZC 3UATA 2KR3A 2DX1A 2JM9A 1RLPC 4OMMA 1QKXA 3EG0A 2BZYA 3NHNA 4M4ZA 2JMCA 1RI9A 1K76A 2O9SA 2VVKA 2OAWA 4RTWA 2KROA 2DILA 1ZUYA 2CREA 1K0XA 4R0KA 1HSQA 2DRMA 2ED1A 2EYXA 4F14A 1AWWA 2L2PA 1VYUA 2DF6A 2FO0A 2O9VA 1UHCA 3VS6A 1G83A 5IHKA 3PVQA 2OI3A 1U06A 4AFUC 4RUGA 2D8HA 4LUDA 4AFSC 2C0IA 2YUOA 1AWOA 1EFNA 1WYXA 3VRYA 4DEXA 3O5ZA 2KT8A 1I1JA 5IHIA 1KSWA 1UGVA 4OMNA 2V1QA 3UF4A 3EGUA 2CH4W 2D8JA 2KYBA 5IXFA 1QCFA 2FRYA 2LQWA 1QWEA 3UA7A 2VWFA 2KRNA 1UG1A 1WA7A 2DLPA 1NG2A 1ZUKA 2EYZA 4J9BA 4JPBW 3SEMA 2K9GA 3LH5A 5EC7A 2JS2A 3TSWA 1XOVA 4J9GA 1X69A 4RTTA 2KBTA 5IHNA 4X1VA 1T3LA 2RQWA 4J9CA 2A28A 1BU1A 1S1NA 1Z9ZA 1V1CA 1X6BA 2AKKA 3UA6A 2KYMA 2FEIA 1Y57A 1UJ0A 1ZLMA 2D1XA 4OMLA 1PNJA 4J9FA 4AFZC 2JM8A 1WFWA 1GBQA 4F16A 1WLPB 5IXBA 2BZ8A 1AWJA 2ECZA 1UTIA 1T0HA 5I11A 3H0FA 1ZUUA 2FPFA 2EKHA 2PNIA 2A36A 2H8HA 2RF0A 1MV3A 3A98A 2L3PA 2W10A 2LX7A 4CC7A 1GFDA 2PTKA 5HCKA 2YUPA 1JU5C 2BTTA 4JJCA 1NYGA 2JTEA 5FWCA 1FYNA 4AG2C 5FWBA 1AVZC 2HEQA 2YSQA 3H0IA 1X2QA 2GNCA 4HCKA 2C0TA 2KXCA 2CT3A 1PRLC 1RLQC 2J05A 1J3TA 1X6GA 3ZL7C 2RQTA 1YCSB 3M0RA 3R6NA 4HVWA 2DM1A 2J7IA 1W6XA 2F2XA 1X27A 4Y92A 1CKBA 2A37A 2J6FA 3VS4A 4CC3A 2EBPA 2MIOA 1GCPA 3NPFA 4HVUA 2CUBA 4ZNXA 1M30A 1WX6A 2GTOA 2LCSA 2DVJA 4E6RA 2RQUA 2PZ1A 2K3BA 2K79A 1AZEA 1UFFA 3M0QA 2O2OA 1UECA 1OOTA 3CQTA 2O88A 2X3WD 3RNJA 1M8MA 2HCKA 1BB9A 2VKNA 1NEGA 3JV3A 4RTYA 2OJ2A 4OMPA 2F2VA 4J9EA 4D8KA 1JEGA 1HJDA 3VS2A 2AK5A 3C0CA 5ECAA 2CDTA 1KJWA 2NUZA 2W0ZA 2L0AA 3PVLA 4GBQA 1Z9QA 4WCIA 1IO6A 2MCNA 4A63B 1VYTA 1A0NB 1BK2A 1I0CA 1QWFA 3GBQA 2ENMA 3RBBB 2DA9A 2C0OA 3KFVA 2DL4A 1UUEA 4J9DA 3REBB 1PHTA 2RQRA 2EGAA 2YUQA 1HD3A 1SHGA 2DL5A 1OEBA 3VS1A 1WXBA 4HXJA 2DL7A 4JZ3A 2HDAA 1AWXA 2YT6A 2JS0A 2RPNA 4RTZA 1PKTA 3FJ5A 1K9AA 2FPEA 2DRKA 1W1FA 2EQIA 2ROTA 3EHRA 2FPDA 1GCQA 4EIKA 1CSKA 1ZBJA 2IIMA 2SRCA 2EGEA 4JZ4A 2QDLA 3IQLA 2LMJA 4J9IA 1SRMA 1YWPA 2DE0X 2SEMA 2FRWA 1SSHA 4OMQA 2X3XD 2J6OA 1YNZA 1ZSGA 2DL8A 2ROLA 3I35A 4OMOA 2F2WA 2K7AA 4QT7A 1M3BA 1E6HA 2E5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0S A;  4IIO A;  2M51 A;  3M0U A;  2GQI A;  5GJW B;  2RMO A;  2XMF A;  2J06 A;  3EHQ A;  1YP5 A;  1WI7 A;  2CSI A;  4RTU A;  1GCQ C;  2DJQ A;  2D0N A;  1K0S A;  2ED0 A;  1NM7 A;  2O31 A;  2HBW A;  2YDL A;  4GLM A;  2YUN A;  1U3O A;  4RTX A;  2AZS A;  2LQN A;  4Z8A A;  2K6D A;  1GBR A;  1W70 A;  1CKA A;  3VRZ A;  3EG1 A;  3REA B;  2V1R A;  1WDX A;  4Z89 A;  2LJ0 A;  1KIK A;  2GTJ A;  1JXM A;  1PWT A;  1YWO A;  1AD5 A;  1SRL A;  1OV3 A;  5L23 A;  1I07 A;  1GFC A;  1VA7 A;  1FMK A;  2RQV A;  3I5S A;  1UJY A;  5GJV B;  1QLY A;  1OPL A;  2EYW A;  4CC4 B;  3VS3 A;  4LN2 A;  4AFQ C;  2L3S A;  1X43 A;  1NLO C;  1K1Z A;  2DBK A;  1MV0 B;  1H92 A;  1B07 A;  4DEY A;  2KRM A;  1T3S A;  1NLP C;  1ABQ A;  2RNA A;  1WXT A;  3TSZ A;  2LJ1 A;  1JQQ A;  2DMO A;  1H8K A;  4RTV A;  2NWM A;  3THK A;  3TVT A;  2ABL A;  1SEM A;  1JO8 A;  1U5S A;  1PKS A;  2EW3 A;  1AZG B;  2P4R A;  3H0H A;  5IH2 A;  2EVR A;  2JMA A;  1LCK A;  1M3A A;  4HVV A;  2KEA A;  1UE9 A;  3I5R A;  2CH4 A;  2RN8 A;  1E7O A;  1SPK A;  3I9Q A;  1M3C A;  2CSQ A;  1AEY A;  2DYB A;  2LJ3 A;  4IIM A;  1TUD A;  1Y0M A;  1QKW A;  2LP5 A;  4ESR A;  1YN8 A;  2A08 A;  3H41 A;  4D8D A;  1H3H A;  2GBQ A;  2CT4 A;  2LZ6 B;  3VS7 A;  1ABO A;  1OPK A;  4J9H A;  2EPD A;  2DBM A;  2KE9 A;  2FG0 A;  2DL3 A;  2EGC A;  3U23 A;  2J6K A;  2G6F X;  2M0Y A;  1SHF A;  2DNU A;  2CUD A;  1GRI A;  3M0P A;  3SHW A;  1ARK A;  2KGT A;  1ZX6 A;  1AOJ A;  1RUW A;  2KT1 A;  4JJD A;  3VS0 A;  2K2M A;  1TG0 A;  2KNB B;  3ULR B;  1GL5 A;  1X2K A;  1WXU A;  2JXB A;  3PE0 A;  2B86 A;  4K11 A;  1N5Z A;  2AZV A;  2I0N A;  4LNP A;  2LNH B;  1MUZ A;  3EG3 A;  3QWY A;  3VS5 A;  1K4U S;  2JT4 A;  1TUC A;  2JW4 A;  4LE9 A;  4LUE A;  2GGR A;  1PRM C;  3EG2 A;  3NGP A;  4FSS A;  1JXO A;  1KFZ A;  1UHF A;  2AKL A;  1WIE A;  2EYY A;  1B3Q A;  2KXD A;  1E6G A;  1UDL A;  2L3Q A;  4F17 A;  2KRS A;  2ESW A;  1M27 C;  1NEB A;  5I22 A;  3M0T A;  1NYF A;  4ORZ A;  5FW9 A;  4AG1 C;  1T0J A;  4JJB A;  2HSP A;  3QWX X;  1VYV A;  2BZX A;  4KRT A;  2MOX A;  1G2B A;  1BBZ A;  4Z88 A;  4CC2 A;  3NMZ C;  3UAT A;  2KR3 A;  2DX1 A;  2JM9 A;  1RLP C;  4OMM A;  1QKX A;  3EG0 A;  2BZY A;  3NHN A;  4M4Z A;  2JMC A;  1RI9 A;  1K76 A;  2O9S A;  2VVK A;  2OAW A;  4RTW A;  2KRO A;  2DIL A;  1ZUY A;  2CRE A;  1K0X A;  4R0K A;  1HSQ A;  2DRM A;  2ED1 A;  2EYX A;  4F14 A;  1AWW A;  2L2P A;  1VYU A;  2DF6 A;  2FO0 A;  2O9V A;  1UHC A;  3VS6 A;  1G83 A;  5IHK A;  3PVQ A;  2OI3 A;  1U06 A;  4AFU C;  4RUG A;  2D8H A;  4LUD A;  4AFS C;  2C0I A;  2YUO A;  1AWO A;  1EFN A;  1WYX A;  3VRY A;  4DEX A;  3O5Z A;  2KT8 A;  1I1J A;  5IHI A;  1KSW A;  1UGV A;  4OMN A;  2V1Q A;  3UF4 A;  3EGU A;  2CH4 W;  2D8J A;  2KYB A;  5IXF A;  1QCF A;  2FRY A;  2LQW A;  1QWE A;  3UA7 A;  2VWF A;  2KRN A;  1UG1 A;  1WA7 A;  2DLP A;  1NG2 A;  1ZUK A;  2EYZ A;  4J9B A;  4JPB W;  3SEM A;  2K9G A;  3LH5 A;  5EC7 A;  2JS2 A;  3TSW A;  1XOV A;  4J9G A;  1X69 A;  4RTT A;  2KBT A;  5IHN A;  4X1V A;  1T3L A;  2RQW A;  4J9C A;  2A28 A;  1BU1 A;  1S1N A;  1Z9Z A;  1V1C A;  1X6B A;  2AKK A;  3UA6 A;  2KYM A;  2FEI A;  1Y57 A;  1UJ0 A;  1ZLM A;  2D1X A;  4OML A;  1PNJ A;  4J9F A;  4AFZ C;  2JM8 A;  1WFW A;  1GBQ A;  4F16 A;  1WLP B;  5IXB A;  2BZ8 A;  1AWJ A;  2ECZ A;  1UTI A;  1T0H A;  5I11 A;  3H0F A;  1ZUU A;  2FPF A;  2EKH A;  2PNI A;  2A36 A;  2H8H A;  2RF0 A;  1MV3 A;  3A98 A;  2L3P A;  2W10 A;  2LX7 A;  4CC7 A;  1GFD A;  2PTK A;  5HCK A;  2YUP A;  1JU5 C;  2BTT A;  4JJC A;  1NYG A;  2JTE A;  5FWC A;  1FYN A;  4AG2 C;  5FWB A;  1AVZ C;  2HEQ A;  2YSQ A;  3H0I A;  1X2Q A;  2GNC A;  4HCK A;  2C0T A;  2KXC A;  2CT3 A;  1PRL C;  1RLQ C;  2J05 A;  1J3T A;  1X6G A;  3ZL7 C;  2RQT A;  1YCS B;  3M0R A;  3R6N A;  4HVW A;  2DM1 A;  2J7I A;  1W6X A;  2F2X A;  1X27 A;  4Y92 A;  1CKB A;  2A37 A;  2J6F A;  3VS4 A;  4CC3 A;  2EBP A;  2MIO A;  1GCP A;  3NPF A;  4HVU A;  2CUB A;  4ZNX A;  1M30 A;  1WX6 A;  2GTO A;  2LCS A;  2DVJ A;  4E6R A;  2RQU A;  2PZ1 A;  2K3B A;  2K79 A;  1AZE A;  1UFF A;  3M0Q A;  2O2O A;  1UEC A;  1OOT A;  3CQT A;  2O88 A;  2X3W D;  3RNJ A;  1M8M A;  2HCK A;  1BB9 A;  2VKN A;  1NEG A;  3JV3 A;  4RTY A;  2OJ2 A;  4OMP A;  2F2V A;  4J9E A;  4D8K A;  1JEG A;  1HJD A;  3VS2 A;  2AK5 A;  3C0C A;  5ECA A;  2CDT A;  1KJW A;  2NUZ A;  2W0Z A;  2L0A A;  3PVL A;  4GBQ A;  1Z9Q A;  4WCI A;  1IO6 A;  2MCN A;  4A63 B;  1VYT A;  1A0N B;  1BK2 A;  1I0C A;  1QWF A;  3GBQ A;  2ENM A;  3RBB B;  2DA9 A;  2C0O A;  3KFV A;  2DL4 A;  1UUE A;  4J9D A;  3REB B;  1PHT A;  2RQR A;  2EGA A;  2YUQ A;  1HD3 A;  1SHG A;  2DL5 A;  1OEB A;  3VS1 A;  1WXB A;  4HXJ A;  2DL7 A;  4JZ3 A;  2HDA A;  1AWX A;  2YT6 A;  2JS0 A;  2RPN A;  4RTZ A;  1PKT A;  3FJ5 A;  1K9A A;  2FPE A;  2DRK A;  1W1F A;  2EQI A;  2ROT A;  3EHR A;  2FPD A;  1GCQ A;  4EIK A;  1CSK A;  1ZBJ A;  2IIM A;  2SRC A;  2EGE A;  4JZ4 A;  2QDL A;  3IQL A;  2LMJ A;  4J9I A;  1SRM A;  1YWP A;  2DE0 X;  2SEM A;  2FRW A;  1SSH A;  4OMQ A;  2X3X D;  2J6O A;  1YNZ A;  1ZSG A;  2DL8 A;  2ROL A;  3I35 A;  4OMO A;  2F2W A;  2K7A A;  4QT7 A;  1M3B A;  1E6H A;  2E5K A; 
#chains in the Genus database with same CATH topology
 4M75 B;  1N8R C;  5GJW B;  2RMO A;  2XMF A;  3VKI A;  2CGH A;  2LCL A;  2DJQ A;  4B6M A;  4KH0 B;  2O31 A;  2HBW A;  3LH0 A;  4GLM A;  4MZM A;  3OBY A;  4ZN1 A;  4M7A C;  2AZS A;  2LQN A;  4M7D A;  1CKA A;  5HY6 A;  2RM4 A;  3REA B;  3UWN A;  3V8L A;  3DLM A;  3SFM A;  1WDX A;  4OB0 B;  3RES A;  3CCL Q;  3CC4 Q;  1MMG A;  3VUZ A;  2GTJ A;  1PWT A;  5GAM e;  2KK4 A;  2K5F A;  1TWB A;  2QTV A;  3PT9 A;  5GAO r;  1U8R A;  3I5S A;  1UJY A;  3VYG A;  5GJV B;  3VS3 A;  4LN2 A;  4AFQ C;  1X43 A;  5AYF A;  1NLO C;  3LYI A;  2KSS A;  1B07 A;  2HNI A;  4DEY A;  3LWI A;  1NLP C;  2CKK A;  2IPO B;  2OTJ A;  2RNA A;  4KH1 B;  2LJ1 A;  4M77 G;  1H8K A;  3CCS A;  4O6J A;  4BI8 B;  3M59 A;  5M9O A;  2F69 A;  1JJ2 P;  1M1K U;  3CCJ T;  1GXI E;  1U5S A;  3H0H A;  3OY9 A;  3G1J A;  3M57 A;  3M53 A;  3D7S B;  2KEA A;  3JB9 G;  2CH4 A;  2RN8 A;  4KUI A;  5FRO A;  3I9Q A;  1M3C A;  5LJ5 h;  2OTL Q;  1M8V A;  2MAM A;  2XK0 A;  2LJ3 A;  1X75 C;  4M77 E;  1QKW A;  4M77 B;  1H3H A;  1WJQ A;  2GF7 A;  3QZ9 B;  1ABO A;  1IZ6 A;  1VQ6 T;  4J8O A;  4J9H A;  2ZPE B;  5A2Q E;  2RJF A;  2EPD A;  4LDU A;  1K73 C;  3OYC A;  2P4T A;  4A4F A;  3CC7 T;  1VQ7 A;  2XID A;  2RHY A;  2RK1 A;  1AOJ A;  4JJD A;  5I21 A;  1TG0 A;  3ULR B;  4X9C A;  1GL5 A;  1X2K A;  1VQ8 A;  3ZBD A;  2XHC A;  1XQH A;  4XU3 A;  1N5Z A;  4MMK A;  2VUB A;  4LNP A;  2LRQ A;  1MUZ A;  3QWY A;  4RG2 A;  3VS5 A;  2JT4 A;  3TRE A;  4DBH A;  4M7A F;  4LUE A;  2GGR A;  2YLC A;  3NFC A;  1PRM C;  3QYG B;  3CCQ Q;  3HFN A;  4C92 A;  1YBY A;  1JXO A;  1UHF A;  5J26 A;  2KXD A;  1YJ9 Q;  5GAM h;  1EX4 A;  2ESW A;  3F70 A;  5I22 A;  3QO3 A;  3C95 A;  5GAO q;  1NYF A;  5FW9 A;  5KYW A;  2DTI A;  3DKM A;  5KYU A;  2HSP A;  3QHS A;  2BZX A;  4P5N A;  2KVQ G;  2LC4 A;  3RKY A;  4MZT A;  5J39 A;  4Z88 A;  4CC2 A;  3TCJ A;  4C0F A;  1VQK T;  5CQX A;  4O5V A;  1VQ6 Q;  1VQ5 T;  4VUB A;  3EG0 A;  4R56 A;  4M4Z A;  3CMA T;  1RI9 A;  2QQ9 A;  3E19 A;  2O9S A;  2VYT A;  2VVK A;  1U1S A;  1UGS B;  3P8B B;  4EPC A;  5LJ3 g;  2KRO A;  2K3Y A;  2CRE A;  3CC7 Q;  4R0K A;  3L2U A;  1VYU A;  2L2P A;  2QAS A;  2JUF A;  4EDU A;  4XTU A;  4KGV B;  2E3H A;  3MEA A;  4FM4 B;  3PVQ A;  4FT4 A;  4HCZ A;  3V8K A;  3JCM P;  2JZ2 A;  1O75 A;  2E41 A;  4AFU C;  4RUG A;  3EFR A;  4AFS C;  2DKG A;  2YUO A;  2NYS A;  1EFN A;  1WYX A;  4A4H A;  4L59 A;  3A8O B;  3M55 A;  2F5K A;  2CZ1 B;  2XG8 D;  1UGV A;  4OMN A;  5CKF A;  4M78 D;  3G7Z A;  2D8J A;  5EG2 A;  2D6F A;  5LJ3 f;  3I55 Q;  2DD4 A;  2QTX A;  5IXF A;  4ZTJ A;  3OMG A;  1RL2 A;  2KRN A;  3P8D A;  1IXD A;  4WF2 A;  1ZUK A;  3OS2 A;  4M7D D;  3SEM A;  3TSW A;  1YJN T;  3RR6 A;  3LLR A;  3EFO B;  3S3O A;  2A28 A;  4BD3 A;  4KT0 E;  1BU1 A;  1S1N A;  5GAN 3;  1V1C A;  4M7A G;  1RAC B;  2D1X A;  4OML A;  5FRM A;  4AFZ C;  2JM8 A;  3E9F A;  4F16 A;  3JCM c;  2FZC B;  3M58 A;  5KCO A;  4OGC A;  3HRU A;  2EKH A;  1BI1 A;  4BDZ A;  2R5A A;  1JJ2 S;  2L3P A;  5GAO p;  2EQJ A;  1QP2 A;  4FW1 A;  2BTT A;  4FCY A;  5GMK e;  3UT1 A;  3C12 A;  3HPW A;  2JTE A;  7AT1 B;  2X4X A;  3OQ5 A;  2WSE E;  3OA6 A;  5FWB A;  1AVZ C;  3CCJ A;  2E5Q A;  2F1L A;  4N4I A;  2CT3 A;  4PJM A;  1PRL C;  2A3L A;  1KC8 U;  4LD6 A;  2YLB A;  3G71 T;  4Q5W A;  1OZ2 A;  3R6N A;  4R55 A;  2DM1 A;  2J7I A;  1W6X A;  2OX7 A;  3CCM T;  1X27 A;  2HQH A;  2IG0 A;  3OS0 A;  4Y92 A;  1CKB A;  2KAF A;  3RMS A;  3NPF A;  1VQ6 A;  4AT1 B;  4Y28 E;  1M30 A;  2LQK A;  5GAN g;  2CP2 A;  2DVJ A;  1QCN A;  2DJZ A;  2PZ1 A;  2YRC A;  4EMH A;  1AZE A;  4M78 C;  3RKW A;  1UEC A;  1VQ9 T;  1F1B B;  1OU8 A;  3CQT A;  1BI2 A;  1KQS A;  3RNJ A;  2X4Y A;  1BB9 A;  4M7D C;  3GP8 A;  3JV3 A;  1OZ3 A;  3VS2 A;  2BE7 D;  2KMT A;  3C0C A;  5ECA A;  5C0M A;  1YIT T;  1KJW A;  3CC2 T;  2NUZ A;  3A8L B;  1SSF A;  5GAN 8;  2E12 A;  1Z9Q A;  5GAN f;  4A54 A;  1OUL A;  4WCI A;  2HKN A;  1BK2 A;  2RK2 A;  1I0C A;  3OYB A;  2ENM A;  2LVM A;  3X24 B;  2DA9 A;  1M2V B;  1VUB A;  4NL2 A;  2EGA A;  2O4X A;  4OGE A;  1SHG A;  3QJY A;  2K57 A;  1VQK A;  1VQ4 T;  1WXB A;  4FYY B;  4HXJ A;  1VQ5 A;  1M9S A;  2DL7 A;  4EMK B;  5HKC A;  4JZ3 A;  3SWN A;  3CMA A;  1YJW T;  3CBP A;  1PKT A;  2K3X A;  1I8F A;  4HT8 A;  2RI5 A;  4L5G A;  2DRK A;  1W1F A;  3CCU A;  2M16 A;  1M1K C;  2DEQ A;  3EHR A;  5GAN 2;  3VV0 A;  2EKO A;  5KCH A;  1SSH A;  1VQP A;  3LGF A;  2PVO B;  1C6V X;  3I35 A;  1UGQ B;  1YI2 A;  3OYF A;  1DJ7 B;  2EJ9 A;  3M0S A;  4IIO A;  4F04 B;  3CC2 Q;  3M0U A;  1K8A R;  2QQB A;  1IB8 A;  2QXF A;  4LDV A;  2J06 A;  2V8J A;  3HHT B;  2X9H A;  5CKD A;  5LJ3 d;  1WI7 A;  4RTU A;  1GCQ C;  4C8Q D;  3FB9 A;  1K9M U;  2QI2 A;  2WSC E;  3WXM B;  4OP0 A;  2ED0 A;  1NM7 A;  5LJ3 h;  4B9X A;  2YUN A;  4E7L A;  1PD1 A;  1YJN A;  4OMF B;  1GBR A;  1W70 A;  1WHH A;  5KYY A;  3X26 B;  4M78 F;  3EG1 A;  1QQJ A;  2E6N A;  2E70 A;  1FMW A;  1VQL T;  4Z89 A;  5CIU A;  1JXM A;  1KK7 A;  3BFM A;  3GLX A;  4M7D F;  2LQ8 A;  2Y4Y A;  3CCE T;  3MO8 A;  2KI7 A;  5HK3 A;  5L23 A;  3NTK A;  1GFC A;  1TOV A;  1VA7 A;  1B7T A;  4L6V 5;  1QLY A;  2L3S A;  1K1Z A;  2F5T X;  2DBK A;  1H92 A;  1NZ9 A;  3M56 A;  2ZCF B;  3TSZ A;  2EJF A;  1JQQ A;  2HBP A;  4PL6 A;  3JB9 J;  2NWM A;  3HP9 A;  2D9T A;  2ZPB B;  2ABL A;  5I2M A;  3A5Z B;  1JO8 A;  3SD4 A;  1BCM A;  8AT1 B;  2MWO A;  1PKS A;  4XTY A;  3WVD B;  1AZG B;  2P4R A;  2EVR A;  2MF2 A;  2NUP A;  2FB7 A;  1M3A A;  2PQW A;  4HVV A;  3I56 Q;  3JCM d;  4RCB A;  3QSU A;  4PJN A;  3QII A;  4RG8 A;  3G71 A;  2DYB A;  1I5O B;  1WQ7 A;  4FU6 A;  3MP8 A;  3OS5 A;  5DLO A;  2P0P A;  3SB2 A;  2A08 A;  3CCM A;  1AT1 B;  3EH2 A;  2LZ6 B;  3BDL A;  1WJR A;  1K8A U;  5LJ5 e;  1OPK A;  3MPU B;  3CCR A;  3EGX A;  3CXC P;  4IKF A;  3CCE Q;  2KE9 A;  1C0M A;  3NTH A;  2DIG A;  3U23 A;  4DQ2 A;  1R77 A;  2CP6 A;  2CUD A;  3SHW A;  1ARK A;  2KGT A;  1VQ9 A;  4FSX A;  2K2M A;  3A1P A;  2KNB B;  1XTD A;  4C8Q C;  2D0Q B;  1R0C B;  2JXB A;  3QDF A;  4J7F A;  2NUT A;  1RI0 A;  2AHJ B;  2DPP B;  2AZV A;  4M78 G;  1QVG A;  1BYM A;  1H3Z A;  3UPU A;  2JW4 A;  2QQA A;  2EYQ A;  4LE9 A;  2HZY A;  3AT1 B;  3EFS A;  2DFU A;  1KHC A;  1YIT A;  3EG2 A;  3CC2 A;  1M90 C;  4M7D G;  5GAN d;  1WIE A;  2EYY A;  1B3Q A;  1UDL A;  3V7R A;  2OTL T;  5GAN 6;  1M27 C;  1NEB A;  5GAN h;  3LWH A;  4QW2 A;  1YHQ T;  4HCB A;  4JJB A;  4CRI A;  3QWX X;  1VYV A;  4M78 E;  3G6E T;  4M78 B;  1G2B A;  1WHK A;  4BB7 A;  2CS7 A;  1VQ4 A;  3OYY A;  2JM9 A;  4M7D E;  2E6Z A;  4M7D B;  1I5L A;  1YJW A;  2VAS A;  1PSF A;  2DO3 A;  2EAY A;  2VGN A;  1ZQ1 A;  4JRP A;  2DK3 A;  1Q82 R;  1ZUY A;  1K0X A;  4LDY A;  2XDP A;  2ZZD A;  3PMI A;  1AWW A;  2DF6 A;  1Q86 R;  1UHC A;  3VS6 A;  5IHK A;  3DB4 A;  4F7U A;  1Q81 R;  1KC8 C;  5AT1 B;  2D8H A;  1WQW A;  3HTR A;  4C5H A;  2C0I A;  3MJX A;  4OB2 B;  1PD0 A;  3CCQ T;  3O5Z A;  2KT8 A;  4IUQ A;  3CME Q;  1KQ1 A;  1VQM A;  1KQ2 A;  3ZFJ A;  1YJ9 T;  1VQO A;  2V8K A;  5GAM j;  2CH4 W;  2X4W A;  3HSB A;  3M4Y A;  2KYB A;  3JCM X;  2FRY A;  3H8Z A;  2RA2 A;  1QWE A;  2RB6 A;  1UG1 A;  4BUG A;  2DLP A;  1YHQ Q;  4PJO A;  2EYZ A;  5CVI A;  4J9B A;  3RIR A;  4JPB W;  2K9G A;  2IVW A;  4J9G A;  5CO7 A;  3QUI A;  1NJI R;  3G6E Q;  1OU9 A;  1NBE B;  5IHN A;  4ZN3 A;  1I4K 1;  1BIB A;  1T3L A;  3JCM W;  3PGG A;  2FL7 A;  1Z9Z A;  3SDZ A;  2AKK A;  1X6B A;  1VQL A;  2KYM A;  4C8Q F;  3H6Z A;  2Y4X A;  2AIR B;  4FIB A;  2XI9 A;  4J9F A;  1PNJ A;  2E4H A;  1GBQ A;  2ECZ A;  1UTI A;  1AHJ B;  2QK0 A;  4J6Y A;  3NTI A;  2FPF A;  4EMK C;  3N5B B;  1QVF A;  2H8H A;  1V76 A;  3HL8 A;  2LX7 A;  2CZ6 B;  2PTK A;  2YUP A;  5D6W A;  4JJC A;  3HKS A;  1NYG A;  4ANJ A;  2R5M A;  2PUO B;  2CP7 A;  2FHD A;  1N8R R;  4IUP A;  2YSQ A;  2HEQ A;  1BKB A;  3SWN C;  3GOX A;  2GCX A;  1Q7Y C;  2GNC A;  1N6A A;  3I55 T;  4D6W A;  2KXC A;  5CKH A;  2X4J A;  1Q82 U;  2J05 A;  1J3T A;  1X6G A;  4C92 E;  1TSF A;  3FEO A;  4C92 B;  1Q86 U;  4IUU A;  3CXC S;  3S3N A;  4PKC C;  3FIF A;  1WHM A;  2E3I A;  2P0Q A;  3MEW A;  2E64 A;  1QMC A;  3CCL A;  2F2X A;  3CC4 A;  2A37 A;  1WGS A;  5KYW B;  4Y91 A;  4CC3 A;  2LT1 A;  3GNG A;  5KYU B;  3HRS A;  4BY6 C;  3MP6 A;  4FT2 A;  2CUB A;  4ZNX A;  3T9N A;  1KD1 C;  3LGL A;  2M1H A;  4NOY A;  4OB1 B;  3CPW A;  2LCS A;  4ELY C;  2RQU A;  3BY7 A;  1UFF A;  2R58 A;  4BE0 A;  2LTO A;  1NJI U;  1OOT A;  2O88 A;  1K9M C;  2EQU A;  1M8M A;  1WJS A;  4RTY A;  2OJ2 A;  3GF5 A;  4D8K A;  1HJD A;  4C8Q G;  1ZSZ A;  2AK5 A;  1N27 A;  2RJE A;  4A4G A;  2L0A A;  1VQN T;  3GPL A;  2YXY A;  1S72 Q;  1IO6 A;  2E10 A;  5IN1 A;  2OTL A;  2DXB A;  1VIF A;  2EIF A;  1VYT A;  3CBO A;  2BE9 B;  4N0A A;  1QP3 A;  2QA4 Q;  3V7C A;  3OYE A;  3G4S T;  4J9D A;  3REB B;  1W4S A;  2P84 A;  1TUG B;  1G8X A;  4C8Q E;  2CP5 A;  2EFI A;  4C8Q B;  3VS1 A;  1B34 A;  9ATC B;  1X6O A;  1AWX A;  2XDB A;  2WSF E;  1PM3 A;  2YT6 A;  2JS0 A;  3JCM g;  1K73 R;  3BW1 A;  3FJ5 A;  1K9A A;  2FPE A;  2COW A;  3MET A;  2EQI A;  5IT9 E;  1PCX A;  4PLL A;  1ZBJ A;  2IIM A;  2SRC A;  2EGE A;  1G3Y A;  2QDL A;  3IQL A;  1YWP A;  4OMQ A;  2J6O A;  1H64 1;  4M7A A;  1TH7 A;  2ROL A;  1PC0 A;  2H3E B;  4OMO A;  3CCQ A;  1E6H A;  3CPW P;  2GQI A;  4OB3 B;  3X25 B;  1VQN Q;  2JTF A;  1EIF A;  3A8M B;  3JCM f;  1YJ9 A;  3MHX A;  4KBM B;  1YP5 A;  3Q1J A;  4PJO D;  1I81 A;  1K0S A;  1Y96 A;  2DD5 A;  5FU6 C;  1MMA A;  3G4S Q;  1YIJ Q;  4RTX A;  2PU9 B;  2RH2 A;  2H3J A;  4PJJ A;  3JCM V;  3WVE B;  2V1R A;  2DXU A;  2EWN A;  1SG5 A;  2YRV A;  1NPR A;  3LW5 E;  5LJ3 e;  1KIK A;  4XU2 A;  1YWO A;  5GMK j;  3JCM b;  1SRL A;  1C1A A;  2YRD A;  2M9U A;  3CC7 A;  1KD1 R;  1FMK A;  5CKE A;  4ATO A;  2C06 A;  8ATC B;  2EYW A;  3MP1 A;  3M54 A;  2B8A A;  3OMC A;  1RAF B;  1IHW A;  2KRM A;  4C0D C;  2HL3 A;  1T3S A;  4C92 D;  1ABQ A;  4JRQ A;  4ELZ C;  4RTV A;  3TEE A;  2A0F B;  3THK A;  3MEV A;  1SEM A;  3I55 A;  1TTH B;  1N9R A;  3TU4 K;  2EW3 A;  5IH2 A;  4EMG A;  1W2B A;  2JMA A;  1LCK A;  4PFP A;  4KUL A;  4C5I A;  2HAX A;  2L5Q A;  4OF1 A;  1MHN A;  3L1A A;  1D1A A;  1IGU A;  4KUD K;  1SPK A;  1IHV A;  4E7K A;  2K2V A;  4UC4 A;  2EQM A;  3QPH A;  3INZ A;  4QKU A;  1Y0M A;  2LP5 A;  1HXD A;  1SKU B;  4D8D A;  2GBQ A;  2CT4 A;  1MMN A;  3VS7 A;  3BE3 A;  3A8H B;  3OW2 A;  2O4X B;  2QAZ A;  1SF9 A;  2FG0 A;  3PTA A;  4B9W A;  5CK9 A;  2EGC A;  1G3W A;  2COY A;  3O8V A;  2DTO A;  3C94 A;  2QYZ A;  2J6K A;  4PJL A;  2G6F X;  2M0Y A;  1SHF A;  2DNU A;  3SWN B;  1RAA B;  4ZGJ B;  1GRI A;  4IUV A;  3C4S A;  2KT1 A;  4RKU E;  4PJO C;  3CCV Q;  4MZP A;  1WXU A;  5KYN A;  1X01 A;  2KDS A;  2PUK B;  4C0G A;  2CZ0 B;  2KQW A;  2LNH B;  3EG3 A;  4JRI A;  1TUC A;  2XU8 A;  2MMP A;  4LDW A;  4FSS A;  2QEX Q;  3RER A;  2ZPF B;  1KFZ A;  2AKL A;  1KQS P;  1YFN A;  3I56 T;  2VGM A;  4X34 A;  4JS5 A;  2A7Y A;  1E6G A;  4BY6 B;  2GFA A;  4F17 A;  4DBF A;  4JUV A;  4IUT A;  1T0J A;  1VIE A;  1FX7 A;  4DA4 A;  3QDR B;  2MOX A;  1BBZ A;  3JAM E;  3NMZ C;  3OBW A;  3S6W A;  1PG5 B;  2YWW A;  5GAN e;  3UAT A;  3FLG A;  2DX1 A;  4C92 C;  1RLP C;  4OMM A;  1W2B P;  1QKX A;  5LL6 S;  4JDS A;  5CQY A;  3NHN A;  4J6X A;  2JMC A;  1K76 A;  5KYY B;  4FYW B;  2JN0 A;  2OAW A;  3CPF A;  4RTW A;  3J81 E;  5HK0 A;  3L2Q A;  2RHI A;  4TVR A;  3P8H A;  2VC8 A;  2Y90 A;  1HSQ A;  3CPW S;  2ED1 A;  4J6W A;  4F14 A;  2VXF A;  4DBR A;  2FZK B;  1RAE B;  2WAC A;  3CD6 T;  2O9V A;  1G83 A;  1BI0 A;  4BI3 A;  4XU0 A;  2OI3 A;  1NPP A;  3OW2 P;  1VQ8 T;  3KXT A;  4DEX A;  2OTJ Q;  1OQK A;  3JCM J;  1I1J A;  4BDY A;  4IUR A;  3CCS Q;  5IHI A;  1KSW A;  4F7U F;  1ZHI A;  2XD0 A;  3UF4 A;  3EGU A;  4E7S A;  1FXX A;  5GAM f;  4FW2 A;  3JCM h;  3OYG A;  1QCF A;  1UGR B;  2LQW A;  3UA7 A;  2VWF A;  1NG2 A;  5EC7 A;  5KYX A;  2NUP B;  3EGD A;  1ZBX A;  3OB9 A;  4X1V A;  4BI4 A;  3M4G A;  3RUX A;  4YTL A;  3OSV A;  2DYI A;  4MML A;  2RHZ A;  1Y7X A;  4PJO F;  1Y57 A;  4QVD A;  1RAB B;  3E2U A;  2DER A;  1ZA1 B;  2HQE A;  4MDW A;  4ZTF A;  3JCM Q;  5IXB A;  1AWJ A;  3ER0 A;  3EG9 A;  5I11 A;  1D3B A;  1M1K R;  3H0F A;  1D0Y A;  3EGX B;  3CD6 Q;  4N0A C;  2PNI A;  1JJ2 A;  1VQ7 Q;  2W10 A;  3OYA A;  4M75 A;  3BDU A;  4JRK A;  4CC7 A;  1GFD A;  1D1C A;  1VQ8 Q;  3EH1 A;  5FU6 B;  1JU5 C;  3VU3 C;  5CKB A;  2CP3 A;  1EZZ B;  3CME T;  1FYN A;  4AG2 C;  2YHT A;  2NUT B;  1X2Q A;  3OS1 A;  5LJ5 j;  1HYO A;  5GMK i;  2C0T A;  3HRT A;  5A0G A;  4C92 F;  4A4E A;  3OYM A;  1IGQ A;  5DY9 A;  5DLQ E;  1YCS B;  4M78 A;  3CEY A;  1M2O A;  3QYH B;  3L2W A;  2J6F A;  3VS4 A;  2EBP A;  2MIO A;  1GCP A;  4C0D B;  1TU0 B;  1UGP B;  2JTM A;  1MNE A;  2FVU A;  3UDC A;  4FYX B;  4F7U G;  1WX6 A;  2RJD A;  2GTO A;  4E6R A;  5KE2 A;  2K79 A;  2OAU A;  3FJP A;  5D6Y A;  1D1B A;  2XDD A;  2K5L A;  1KQS S;  3RKX A;  3FRN A;  1QVP A;  2X3W D;  2VKN A;  4A4K A;  4RCC A;  4OMP A;  2JOY A;  3PFS A;  3PIP A;  1JEG A;  3OYJ A;  4PJO G;  1G3T A;  4F7U E;  3QBY A;  4JLI A;  5FU7 B;  4F7U B;  3JB9 H;  3PNW C;  4E47 A;  3PVL A;  4GBQ A;  1MND A;  3I56 A;  4LDX A;  3URG A;  2MCN A;  5I2S A;  1QVG P;  4A63 B;  1A0N B;  4M77 A;  1W2B S;  3RBB B;  5LJ5 d;  5CR2 A;  2C0O A;  3KFV A;  2DL4 A;  2QGG A;  4N4G A;  2RQR A;  1HD3 A;  4PJO E;  4PJO B;  2DL5 A;  1OEB A;  3CCE A;  5GAN 5;  5D6X A;  4QQ6 A;  1FMV A;  1UB4 A;  3DLL A;  4XTV A;  3JB9 I;  2JNG A;  3OW2 S;  2QGF B;  3OYD A;  4C92 G;  4DBQ A;  3R6O A;  1XNI A;  2ROT A;  1OX8 A;  4LD9 K;  1Y71 A;  1GCQ A;  4QQD A;  4EIK A;  3CD6 A;  1G3S A;  4JZ4 A;  3FDR A;  2BIV A;  3V8J A;  3OYI A;  4J9I A;  4J83 A;  4E7J A;  2KY9 A;  2MYS A;  2X3X D;  1YNZ A;  1ZSG A;  2DL8 A;  2PVD B;  4E7I A;  2F2W A;  2K7A A;  1M3B A;  2E5K A;  1G5V A;  2M51 A;  2G3R A;  1S72 T;  1M90 R;  4E7Z A;  5GAO l;  4FYV B;  3EHQ A;  2HKQ B;  4J5Y A;  2RD1 A;  3CCJ Q;  5GAN 4;  4II1 A;  2AT1 B;  2CSI A;  2ZGW A;  2CP0 A;  2QA4 T;  4NL3 A;  4HA8 A;  5GAM d;  3PIO A;  2DXT A;  1Q81 U;  2D0N A;  5GAO n;  3PMT A;  2YDL A;  5C6S A;  3J80 E;  1U3O A;  4JLG A;  4Z8A A;  4C0Z A;  2VXE A;  2DAQ A;  2K6D A;  1U1T A;  2VV5 A;  2LCC A;  3VRZ A;  1IRX A;  2HMA A;  3OYK A;  4WTO B;  1RAH B;  2LJ0 A;  2LDM A;  4JJN K;  1Q95 G;  1AD5 A;  3QJ6 A;  1OV3 A;  3DB3 A;  2FYK A;  1I07 A;  4PLI A;  2RQV A;  5KH6 A;  2X35 A;  1NE8 A;  2GQV A;  4M75 D;  1OPL A;  4CC4 B;  3CCU T;  4KGX B;  1MV0 B;  1KC8 R;  5CCA A;  5GAO m;  2M02 A;  1WXT A;  4RMO A;  2DMO A;  2PVG B;  3CME A;  1VQP T;  3VUB A;  3MKD A;  1QVF P;  4XTZ A;  4LXC A;  3TVT A;  2QQS A;  1YI2 T;  4C5G A;  3S3M A;  1YHQ A;  1UE9 A;  3EFO A;  1ZSZ B;  3I5R A;  1YIJ T;  1E7O A;  3GIB A;  1BIA A;  3G6E A;  3ZEH A;  3AHU A;  2CSQ A;  1AEY A;  4IIM A;  1TUD A;  4C8Q A;  4ESR A;  1N8R U;  1RAG B;  1YN8 A;  3H41 A;  3M5A A;  2E65 A;  4A53 A;  4NS5 A;  2DZ9 A;  2L89 A;  1HK9 A;  1R8O B;  5FLX E;  1TS9 A;  5A0L A;  1M90 U;  2EQK A;  1VQK Q;  3CBM A;  4V2S A;  2DBM A;  2HQX A;  5KE3 A;  1VQ5 Q;  1QCO A;  2LT4 A;  2DL3 A;  3CMA Q;  1B34 B;  2DET A;  2V26 A;  2BUD A;  1LPL A;  3M0P A;  2L8D A;  1ZX6 A;  1RUW A;  3VS0 A;  3CCU Q;  3X28 B;  4E7H A;  3PE0 A;  2B86 A;  4K11 A;  2V8I A;  1BCO A;  3JSC A;  1QVG S;  1KHI A;  2I0N A;  3TQ7 P;  1VQP Q;  1K4U S;  1R0B G;  1YI2 Q;  4M7A E;  1K8A C;  1Q7Y R;  1OYX A;  3NGP A;  2DVE A;  4M7A B;  4AMC A;  5A0D A;  5CAI A;  4M77 D;  1M1G A;  2EJG A;  2L3Q A;  2KRS A;  1RAI B;  3M0T A;  4ORZ A;  4AG1 C;  1WZO A;  4KRT A;  4M75 C;  3JB9 D;  1Y96 B;  1YJN Q;  2JVV A;  2HL5 C;  2KR3 A;  2I2L A;  2BZY A;  2MK5 A;  4XQ3 A;  3CCR T;  2ZAE A;  4BE1 A;  1MMD A;  2DIL A;  1JBM A;  1OX9 A;  2DRM A;  2EYX A;  3CCV T;  4MDX A;  4X9D A;  2ZPG B;  3KBG A;  2FO0 A;  1WNL A;  1JB0 E;  1K9M R;  1U06 A;  2HD0 A;  4JS4 A;  4LUD A;  3L2V A;  2ZPH B;  4XAX B;  1K73 U;  1AWO A;  2XIC A;  1VOM A;  3VRY A;  4QQG A;  1N9S A;  2QEX T;  4ZGD B;  4ME7 A;  1S72 A;  4GLK A;  1XJW B;  5D7U A;  2V1Q A;  5LJ3 j;  2HSE B;  1M2V A;  3HFO A;  2QA4 A;  1WA7 A;  4PK4 A;  1FWZ A;  3OYH A;  5FU7 C;  1OI1 A;  3LH5 A;  2JS2 A;  1LJO A;  1XOV A;  4EMK A;  2BKD N;  1X69 A;  3QXE B;  3E1S A;  4RTT A;  2KBT A;  4XTW A;  3H9N A;  3G71 Q;  1MGQ A;  2RQW A;  5IAY A;  4J9C A;  3JCM e;  2DTH A;  3UA6 A;  4PNO A;  4PFO A;  2FEI A;  3CCM Q;  3OYL A;  3M9Q A;  1UJ0 A;  1Q7Y U;  4PFZ A;  4C5E A;  2QG9 B;  4HT9 A;  1ZLM A;  2MWP A;  1WHG A;  2Z0W A;  1WFW A;  3CCR Q;  1WLP B;  5LJ5 g;  2BZ8 A;  4OVA A;  1T0H A;  1ZUU A;  3QZ5 B;  5GMK h;  2DZC A;  4M77 C;  2K4Y A;  1QVF S;  2A36 A;  2RF0 A;  1MV3 A;  3A98 A;  1VQ9 Q;  2LX9 A;  2ATC B;  5HCK A;  2OTJ T;  3QG1 A;  4XTX A;  3CCS T;  4HCC A;  1VQN A;  1ACM B;  3L2R A;  1KD1 U;  5FWC A;  1O9S A;  4GY5 A;  3GNF B;  1PSE A;  3H0I A;  4M75 F;  2X51 A;  1V29 B;  2K5I A;  3MCA B;  4HCK A;  4HKE A;  2RHX A;  1BI3 A;  3RDV A;  1YIT Q;  3RMQ A;  1P92 A;  5LJ5 f;  1RLQ C;  3G4S A;  1VQM T;  3ZL7 C;  1YIJ A;  3V7S A;  1VQO T;  5J3B A;  2RQT A;  1D0Z A;  3OYN A;  2GFU A;  3CXC A;  3M0R A;  4N4H A;  3LX7 A;  4HVW A;  1TXQ A;  1UEB A;  4QVZ A;  2ZPI B;  1M5Q 1;  4HVU A;  4XK8 E;  5GAM g;  1VQ4 Q;  1QW1 A;  2QDY B;  2FZG B;  5GMK l;  1YJW Q;  2MPX C;  2QQR A;  4DOW A;  3JRZ A;  2JJ9 A;  1Q82 C;  2NLU A;  2K3B A;  4M7A D;  5L8R E;  3M0Q A;  2O2O A;  3ASK A;  1VQ7 T;  2CZ7 B;  1WHJ A;  2DEU A;  5FRN A;  4E2F B;  6AT1 B;  3J7A F;  4Z02 A;  4BAC A;  1Q86 C;  1M1F A;  3L42 A;  1Y07 A;  3QKJ A;  1Q81 C;  1RAD B;  2HCK A;  4QVC A;  4ZGE B;  1NEG A;  3X20 B;  2O01 E;  2F2V A;  5DM7 R;  4J9E A;  4KGZ B;  5GAN j;  2CDT A;  1D09 B;  3EAE A;  2W0Z A;  1IRE B;  1JRI A;  3VJP A;  1VQM Q;  1VQO Q;  2L3R A;  3VYH B;  3GBQ A;  1QWF A;  2RI3 A;  2RO0 A;  2MI6 A;  2LNV A;  1UUE A;  2XKO C;  2M0O A;  2R57 A;  3OSS C;  1NJI C;  1PHT A;  2CYZ B;  2E1H A;  3L2Z A;  2RI2 A;  3ME9 A;  2YUQ A;  3KUF A;  5GMK m;  1LOJ A;  4M77 F;  1LNX A;  4FL6 A;  1ZSZ C;  1LVK A;  5KYX B;  1M4Z A;  2COZ A;  3EGD B;  2HDA A;  2RHU A;  3CCL T;  2P0K A;  3CC4 T;  1KG1 A;  1VQL Q;  4M75 G;  1WHL A;  1D0X A;  4J7I A;  2RPN A;  4RTZ A;  1WPY A;  4CI0 C;  1ZA2 B;  3MEU A;  4BE2 A;  3A8G B;  2RJC A;  3JB9 F;  3E9G A;  3CCV A;  1YCY A;  2FPD A;  1CSK A;  2LMJ A;  1SRM A;  2DE0 X;  3EG9 B;  4XU1 A;  2SEM A;  1D3B B;  2FRW A;  5GAN 7;  4DOV A;  2DIQ A;  3FC3 A;  4QT7 A;  2VB6 A;  2DXC A;  4M75 E;  2QEX A; 
#chains in the Genus database with same CATH homology
 3M0S A;  4IIO A;  2M51 A;  3M0U A;  2GQI A;  5GJW B;  2RMO A;  2XMF A;  2J06 A;  3EHQ A;  1YP5 A;  1WI7 A;  2CSI A;  4RTU A;  1GCQ C;  2DJQ A;  2D0N A;  1K0S A;  2ED0 A;  1NM7 A;  2O31 A;  2HBW A;  2YDL A;  4GLM A;  2YUN A;  1U3O A;  4RTX A;  2AZS A;  2LQN A;  4Z8A A;  2K6D A;  1GBR A;  1W70 A;  1CKA A;  3VRZ A;  3EG1 A;  3REA B;  2V1R A;  1WDX A;  4Z89 A;  2LJ0 A;  1KIK A;  2GTJ A;  1JXM A;  1PWT A;  1YWO A;  1AD5 A;  1SRL A;  1OV3 A;  5L23 A;  1I07 A;  1GFC A;  1VA7 A;  1FMK A;  2RQV A;  3I5S A;  1UJY A;  5GJV B;  1QLY A;  1OPL A;  2EYW A;  4CC4 B;  3VS3 A;  4LN2 A;  4AFQ C;  2L3S A;  1X43 A;  1NLO C;  1K1Z A;  2DBK A;  1MV0 B;  1H92 A;  1B07 A;  4DEY A;  2KRM A;  1T3S A;  1NLP C;  1ABQ A;  2RNA A;  1WXT A;  3TSZ A;  2LJ1 A;  1JQQ A;  2DMO A;  1H8K A;  4RTV A;  2NWM A;  3THK A;  3TVT A;  2ABL A;  1SEM A;  1JO8 A;  1U5S A;  1PKS A;  2EW3 A;  1AZG B;  2P4R A;  3H0H A;  5IH2 A;  2EVR A;  2JMA A;  1LCK A;  1M3A A;  4HVV A;  2KEA A;  1UE9 A;  3I5R A;  2CH4 A;  2RN8 A;  1E7O A;  1SPK A;  3I9Q A;  1M3C A;  2CSQ A;  1AEY A;  2DYB A;  2LJ3 A;  4IIM A;  1TUD A;  1Y0M A;  1QKW A;  2LP5 A;  4ESR A;  1YN8 A;  2A08 A;  3H41 A;  4D8D A;  1H3H A;  2GBQ A;  2CT4 A;  2LZ6 B;  3VS7 A;  1ABO A;  1OPK A;  4J9H A;  2EPD A;  2DBM A;  2KE9 A;  2FG0 A;  2DL3 A;  2EGC A;  3U23 A;  2J6K A;  2G6F X;  2M0Y A;  1SHF A;  2DNU A;  2CUD A;  1GRI A;  3M0P A;  3SHW A;  1ARK A;  2KGT A;  1ZX6 A;  1AOJ A;  1RUW A;  2KT1 A;  4JJD A;  3VS0 A;  2K2M A;  1TG0 A;  2KNB B;  3ULR B;  1GL5 A;  1X2K A;  1WXU A;  2JXB A;  3PE0 A;  2B86 A;  4K11 A;  1N5Z A;  2AZV A;  2I0N A;  4LNP A;  2LNH B;  1MUZ A;  3EG3 A;  3QWY A;  3VS5 A;  1K4U S;  2JT4 A;  1TUC A;  2JW4 A;  4LE9 A;  4LUE A;  2GGR A;  1PRM C;  3EG2 A;  3NGP A;  4FSS A;  1JXO A;  1KFZ A;  1UHF A;  2AKL A;  1WIE A;  2EYY A;  1B3Q A;  2KXD A;  1E6G A;  1UDL A;  2L3Q A;  4F17 A;  2KRS A;  2ESW A;  1M27 C;  1NEB A;  5I22 A;  3M0T A;  1NYF A;  4ORZ A;  5FW9 A;  4AG1 C;  1T0J A;  4JJB A;  2HSP A;  3QWX X;  1VYV A;  2BZX A;  4KRT A;  2MOX A;  1G2B A;  1BBZ A;  4Z88 A;  4CC2 A;  3NMZ C;  3UAT A;  2KR3 A;  2DX1 A;  2JM9 A;  1RLP C;  4OMM A;  1QKX A;  3EG0 A;  2BZY A;  3NHN A;  4M4Z A;  2JMC A;  1RI9 A;  1K76 A;  2O9S A;  2VVK A;  2OAW A;  4RTW A;  2KRO A;  2DIL A;  1ZUY A;  2CRE A;  1K0X A;  4R0K A;  1HSQ A;  2DRM A;  2ED1 A;  2EYX A;  4F14 A;  1AWW A;  2L2P A;  1VYU A;  2DF6 A;  2FO0 A;  2O9V A;  1UHC A;  3VS6 A;  1G83 A;  5IHK A;  3PVQ A;  2OI3 A;  1U06 A;  4AFU C;  4RUG A;  2D8H A;  4LUD A;  4AFS C;  2C0I A;  2YUO A;  1AWO A;  1EFN A;  1WYX A;  3VRY A;  4DEX A;  3O5Z A;  2KT8 A;  1I1J A;  5IHI A;  1KSW A;  1UGV A;  4OMN A;  2V1Q A;  3UF4 A;  3EGU A;  2CH4 W;  2D8J A;  2KYB A;  5IXF A;  1QCF A;  2FRY A;  2LQW A;  1QWE A;  3UA7 A;  2VWF A;  2KRN A;  1UG1 A;  1WA7 A;  2DLP A;  1NG2 A;  1ZUK A;  2EYZ A;  4J9B A;  4JPB W;  3SEM A;  2K9G A;  3LH5 A;  5EC7 A;  2JS2 A;  3TSW A;  1XOV A;  4J9G A;  1X69 A;  4RTT A;  2KBT A;  5IHN A;  4X1V A;  1T3L A;  2RQW A;  4J9C A;  2A28 A;  1BU1 A;  1S1N A;  1Z9Z A;  1V1C A;  1X6B A;  2AKK A;  3UA6 A;  2KYM A;  2FEI A;  1Y57 A;  1UJ0 A;  1ZLM A;  2D1X A;  4OML A;  1PNJ A;  4J9F A;  4AFZ C;  2JM8 A;  1WFW A;  1GBQ A;  4F16 A;  1WLP B;  5IXB A;  2BZ8 A;  1AWJ A;  2ECZ A;  1UTI A;  1T0H A;  5I11 A;  3H0F A;  1ZUU A;  2FPF A;  2EKH A;  2PNI A;  2A36 A;  2H8H A;  2RF0 A;  1MV3 A;  3A98 A;  2L3P A;  2W10 A;  2LX7 A;  4CC7 A;  1GFD A;  2PTK A;  5HCK A;  2YUP A;  1JU5 C;  2BTT A;  4JJC A;  1NYG A;  2JTE A;  5FWC A;  1FYN A;  4AG2 C;  5FWB A;  1AVZ C;  2HEQ A;  2YSQ A;  3H0I A;  1X2Q A;  2GNC A;  4HCK A;  2C0T A;  2KXC A;  2CT3 A;  1PRL C;  1RLQ C;  2J05 A;  1J3T A;  1X6G A;  3ZL7 C;  2RQT A;  1YCS B;  3M0R A;  3R6N A;  4HVW A;  2DM1 A;  2J7I A;  1W6X A;  2F2X A;  1X27 A;  4Y92 A;  1CKB A;  2A37 A;  2J6F A;  3VS4 A;  4CC3 A;  2EBP A;  2MIO A;  1GCP A;  3NPF A;  4HVU A;  2CUB A;  4ZNX A;  1M30 A;  1WX6 A;  2GTO A;  2LCS A;  2DVJ A;  4E6R A;  2RQU A;  2PZ1 A;  2K3B A;  2K79 A;  1AZE A;  1UFF A;  3M0Q A;  2O2O A;  1UEC A;  1OOT A;  3CQT A;  2O88 A;  2X3W D;  3RNJ A;  1M8M A;  2HCK A;  1BB9 A;  2VKN A;  1NEG A;  3JV3 A;  4RTY A;  2OJ2 A;  4OMP A;  2F2V A;  4J9E A;  4D8K A;  1JEG A;  1HJD A;  3VS2 A;  2AK5 A;  3C0C A;  5ECA A;  2CDT A;  1KJW A;  2NUZ A;  2W0Z A;  2L0A A;  3PVL A;  4GBQ A;  1Z9Q A;  4WCI A;  1IO6 A;  2MCN A;  4A63 B;  1VYT A;  1A0N B;  1BK2 A;  1I0C A;  1QWF A;  3GBQ A;  2ENM A;  3RBB B;  2DA9 A;  2C0O A;  3KFV A;  2DL4 A;  1UUE A;  4J9D A;  3REB B;  1PHT A;  2RQR A;  2EGA A;  2YUQ A;  1HD3 A;  1SHG A;  2DL5 A;  1OEB A;  3VS1 A;  1WXB A;  4HXJ A;  2DL7 A;  4JZ3 A;  2HDA A;  1AWX A;  2YT6 A;  2JS0 A;  2RPN A;  4RTZ A;  1PKT A;  3FJ5 A;  1K9A A;  2FPE A;  2DRK A;  1W1F A;  2EQI A;  2ROT A;  3EHR A;  2FPD A;  1GCQ A;  4EIK A;  1CSK A;  1ZBJ A;  2IIM A;  2SRC A;  2EGE A;  4JZ4 A;  2QDL A;  3IQL A;  2LMJ A;  4J9I A;  1SRM A;  1YWP A;  2DE0 X;  2SEM A;  2FRW A;  1SSH A;  4OMQ A;  2X3X D;  2J6O A;  1YNZ A;  1ZSG A;  2DL8 A;  2ROL A;  3I35 A;  4OMO A;  2F2W A;  2K7A A;  4QT7 A;  1M3B A;  1E6H A;  2E5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...