3META

Crystal structure of sgf29 in complex with h3k4me2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
b'GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
molecule tags Transcription
source organism Homo sapiens
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
total genus 37
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3metA02
2G3RA 1WGSA 4IUPA 3E9GA 3DB4A 4HCZA 5FROA 3OYGA 3PNWC 3OYJA 4E7KA 1WJQA 3SD4A 3MP6A 1G5VA 4E7IA 2RHXA 4IUVA 2K3XA 5CIUA 2BIVA 2CKKA 3MEAA 3NTIA 4E7HA 4ZTFA 4QW2A 2F5KA 3EAEA 3QJ6A 4IURA 4LD6A 5D6WA 3OYBA 3OY9A 4BDYA 4E7LA 4QVZA 4QQGA 1XNIA 2GFUA 2L8DA 2O4XB 3OYEA 3LGLA 3O8VA 3M9QA 2RI3A 3OYKA 4B9XA 2IG0A 4UC4A 1RI0A 2E5QA 2RJFA 4RG2A 5C6SA 3OMCA 4C5EA 4A4GA 5KCHA 3OS1A 4IUQA 2NLUA 3Q1JA 5FRNA 3OYAA 4FU6A 3OS2A 2EQJA 4II1A 3OYMA 3F70A 4Z02A 2X4YA 5KH6A 3MEUA 3S3NA 2LCCA 3LGFA 1KHCA 2XK0A 4A4EA 2MWPA 3S3MA 3BDLA 3PMIA 4BE1A 3OS0A 2GF7A 3C4SA 1WJSA 2M0OA 3FEOA 4C5GA 4X34A 3P8DA 3S6WA 2DIGA 5IAYA 5KE3A 3META 5KCOA 4ZTJA 3OYIA 2EQKA 4CRIA 2GFAA 5FRMA 2RJDA 3FLGA 4N4HA 4C5HA 2LTOA 3OMGA 3OYDA 4QQ6A 2RJEA 3QKJA 2RI5A 2LDMA 2R57A 3DLMA 3MEVA 2LVMA 3P8HA 3LLRA 1N27A 3CEYA 3MP1A 3KUFA 2P0KA 4L59A 5D6YA 3NTKA 2M16A 3L2UA 3ME9A 5D6XA 2X4XA 3H8ZA 4B9WA 2JZ2A 4N4GA 4BE0A 1OI1A 4PLLA 2QQSA 4C5IA 2R5MA 4IUUA 2FHDA 3L42A 3FC3A 2RHIA 3PFSA 3OQ5A 3OYHA 3OA6A 2X35A 3MEWA 3QIIA 1SSFA 3L2WA 5C0MA 4BE2A 2BUDA 3LYIA 3H6ZA 4QQDA 4FL6A 1OZ2A 2JTFA 2QQRA 2EKOA 3UT1A 3L2VA 4A4HA 4IKFA 2R5AA 3LX7A 4OVAA 2D9TA 2RHUA 2LRQA 3GOXA 3PMTA 4GY5A 2L89A 2DIQA 5IN1A 1H3ZA 2HQEA 2L3RA 3OYFA 1OZ3A 3L2QA 5J39A 2O4XA 2RHZA 2WACA 2PQWA 1WJRA 3OYNA 5J26A 4A4FA 3OYLA 2EFIA 5M9OA 4Q5WA 3QBYA 1MHNA 2E6NA 4BACA 3MO8A 2RI2A 3OYCA 4PL6A 3S3OA 4N4IA 3MP8A 2K3YA 3NTHA 2R58A 3DB3A 4IUTA 2RHYA 3UWNA 4E7JA 2X4WA 3E9FA 5KE2A 2VYTA 2RJCA 3ZEHA 2YRVA 3ASKA 4EDUA 2MWOA 3FDRA 2RO0A 4BD3A 2EQUA 3L2RA 3OB9A 2XDPA 2HQXA 3LH0A 1OYXA 2M1HA 4PLIA 4BDZA 2B8AA 2EQMA 4NS5A 2BKDN 2DAQA
chains in the Genus database with same CATH superfamily
1P92A 3E9GA 4XTVA 3PT9A 2CKKA 2DMOA 5D6WA 4E7LA 2RM4A 1T0JA 2KRSA 4JJCA 2EVRA 3M0SA 3RKXA 1UGSB 4ZN3A 5GANg 5LJ3g 2HAXA 2DTIA 2VVKA 3A8HB 1DJ7B 2IG0A 4KUDK 1RI0A 2XG8D 1M1FA 2O88A 4R55A 3F70A 4FCYA 4C8QF 1NJIC 2RF0A 4C5GA 2JUFA 3JB9D 2OTJA 1M5Q1 3VYHB 1K8AR 1SG5A 3LW5E 1UG1A 2GQIA 1SHFA 5GANd 2HSPA 3M5AA 3CEYA 1NBEB 4XQ3A 3QJYA 3VS4A 4E7ZA 4XU1A 2AZVA 1Y57A 5GMKe 1YCYA 4J9FA 1JXMA 4C8QG 1NPRA 1RADB 4F7UA 2DKGA 3CPWP 2X35A 3UATA 1AVZC 1S72A 2LMJA 2YHTA 5LJ3h 5CK9A 1S72T 3I9QA 1VQPA 2ZAEA 1YIJT 1WQ7A 1YIJA 1QMCA 1GFDA 1UJYA 2KEAA 1VQNT 2QI2A 1Q82R 3JB9J 2LT1A 1K9MC 4JUVA 5L23A 2GGRA 1LJOA 2CSQA 1UGVA 2DERA 2KK4A 1TUCA 3H0IA 2X4WA 1OPLA 2PTKA 3EH2A 4EDUA 3X20B 2QASA 3EG9A 4YTLA 2CT4A 4M7DF 5IT9E 5GJWB 3LH0A 2M1HA 4LDXA 3FB9A 1K73R 2QTXA 5IXBA 4EMKC 4HCZA 1RACB 1KFZA 4L5GA 1YJWA 1KK7A 2QQ9A 1W2BA 1YJWT 1KQ1A 4EMKA 5GAOq 3RUXA 3CCVT 3R6OA 4M77G 2ZPFB 4E7HA 3DKMA 1UHFA 1K1ZA 3UDCA 1D0YA 3VS5A 4M7DG 1PKSA 1W70A 1MV3A 1O75A 4UC4A 2KR3A 2E4HA 2E41A 1YWOA 4C0GA 2EKHA 2I0NA 4PJOB 3VKIA 3P8DA 2WSFE 4M7AF 1ZSGA 4KUIA 3VRYA 3PVQA 3CC7A 1N5ZA 2COYA 2SEMA 4ZGJB 2LX7A 3QYHB 3MEVA 2IIMA 4MMLA 4PJOE 2E5KA 2X4XA 2L3QA 2G6FX 1VQ6Q 2ROLA 4OMOA 2E12A 2EBPA 3JCMh 1N8RU 3QYGB 1PD1A 3OQ5A 1AD5A 2LQWA 3WXMB 5C0MA 5LJ5d 5I11A 1IRXA 2DO3A 4M78D 1I07A 3GPLA 1ZUUA 3CD6Q 4FYYB 1YJWQ 1WQWA 4LDYA 4Y92A 1U5SA 1M90C 3G7ZA 1H3ZA 1RLPC 3RBBB 2O4XA 4OMPA 1VQ4A 4M7AA 2F69A 1WPYA 3I55T 5GAN6 2W0ZA 1MHNA 1TU0B 4ME7A 2EPDA 5D7UA 2VXEA 4OMQA 4RKUE 4E7JA 2GTJA 1BYMA 4J9DA 4J9CA 1TUGB 1QCNA 2O2OA 4J83A 3CCLQ 2J6OA 1UUEA 1FMKA 1BIAA 1K9MR 3OYJA 1GFCA 3GF5A 3ER0A 4JJNK 1GCQC 3M55A 4LUEA 5EC7A 1M2OA 3QZ9B 2FPEA 4BDYA 4PJOA 1G2BA 1XNIA 1H8KA 2GFUA 2L8DA 2NUZA 2HKQB 3AT1B 5DLOA 1X75C 5FWCA 4IUQA 2NLUA 3M58A 3OYAA 3OW2S 3CCEQ 1UE9A 2V1QA 1KHCA 2RN8A 2CZ6B 1LPLA 3FEOA 4RTVA 4X34A 5DY9A 1ARKA 2FEIA 1VA7A 1G83A 2ZPBB 1U3OA 4PJMA 3QKJA 1ACMB 3J80E 5CVIA 4D8DA 1I0CA 2M16A 4ANJA 2JMCA 4M78B 2V8KA 4J7FA 1I1JA 1M27C 2EYQA 4ATOA 4JPBW 2LT4A 4M78E 3TU4K 1NYGA 3M0RA 2EJ9A 5GANf 2SRCA 3M53A 1SRLA 4Z89A 1QCOA 1VQOA 2K5IA 4HCCA 1I8FA 5HKCA 3C94A 1Y96A 3CC7T 4M7DD 4XTZA 2J6KA 4XTYA 1ZBXA 1C0MA 1RAHB 2K3BA 1FMWA 4JLGA 3G4SQ 1QVGA 4J9IA 1WDXA 2BKDN 5HY6A 1VQ6A 2XD0A 2XDDA 2KXCA 4FYWB 3QSUA 1ZA1B 3MPUB 3CCQA 3CC4A 2A36A 1EX4A 3CXCS 2COWA 4E2FB 3CCSA 3O8VA 3UA6A 1VQ9A 2EQIA 4PJOF 4RG2A 3RNJA 1X6BA 2DYBA 1VIFA 2OAUA 1YITT 2DVEA 2DBKA 3OBYA 2VASA 4EMHA 3E19A 5GANj 3H41A 2CUDA 4M78A 4BE1A 3EG2A 8ATCB 1KC8U 3SWNC 1K73C 4XTUA 3EHRA 3A8MB 2OTLA 1M2VB 3OYDA 2LDMA 3SWNA 1NEBA 3X28B 3LLRA 3RKYA 3UF4A 3G1JA 2JW4A 4OB2B 2E1HA 1AOJA 1D0ZA 1BI2A 2M9UA 2R5MA 1N9RA 1OU8A 3ZFJA 1GCPA 3L2WA 2RNAA 3LYIA 1E6GA 4MZMA 2DF6A 2E64A 2MK5A 3HKSA 1VQ8A 2HL3A 5GAN7 1U8RA 2J06A 4OVAA 2D9TA 3MKDA 3WVDB 3GNFB 1Y71A 1Y96B 3V8JA 3NPFA 2QGFB 1OZ3A 2DX1A 1SPKA 4C92E 1VQKT 2ZPIB 1YN8A 4M75E 1IGUA 1VOMA 4A4FA 5GAN2 1UB4A 3MO8A 5DLQE 1Z9QA 4OB0B 2EWNA 2CREA 3UWNA 1QCFA 1Y0MA 2MWOA 2H8HA 1YJNA 3OB9A 4M75G 1OYXA 1QVGS 3M54A 2DJQA 4D6WA 1H641 1WJQA 5CKBA 3MP6A 3VS1A 1BIBA 5LJ3d 5FU7C 1KJWA 4IUVA 2JS0A 1WIEA 3G71T 3RMSA 2KXDA 1UJ0A 3OSSC 1M2VA 2OTJQ 2KGTA 4PJOC 3SWNB 2VB6A 2MMPA 3OMCA 2MYSA 3I56A 3UA7A 5GMKj 3CXCP 1Q7YU 3PIPA 3JCMd 5FRNA 3Q1JA 1M1KC 2P0QA 5GAOp 2KQWA 2LCCA 2QA4T 3BDLA 3HFOA 2M0OA 4AT1B 4C8QE 5GAOl 2EQKA 4FIBA 5GAN4 4HT8A 3HTRA 3EGUA 1MMAA 2LVMA 3X24B 2O31A 5FU6B 3JB9I 2KDSA 2DXBA 1M3BA 3NTKA 4X1VA 2LCSA 1YP5A 1VQKQ 1YBYA 3CC4Q 2PU9B 4ELYC 1VQ7T 1TWBA 4LDWA 1TOVA 5A0GA 4Y91A 3CCQT 3TVTA 2COZA 2RHUA 3GOXA 4GLMA 1IGQA 5FU6C 5CKHA 2JN0A 2YUPA 2CH4A 5KYUA 4MDXA 1Q81U 2LNVA 1WJRA 3M0PA 4J6YA 4N0AC 1OQKA 1UGRB 4F7UE 1B34A 4HCBA 2LC4A 3M4GA 5GAN8 2K3YA 2DBMA 3NTHA 2C0TA 1C6VX 1SRMA 2RHYA 1CSKA 3FIFA 1G8XA 3EFSA 2X4JA 1V1CA 4AG2C 5KYXB 1RAAB 1AZGB 4XU3A 1HYOA 2L3SA 4A63B 1R8OB 4XTWA 1JB0E 2EQMA 2K6DA 5GANh 1M90U 3CCET 1HJDA 3HRSA 3OYYA 1NJIU 1VQLT 2KYBA 1XQHA 4E7IA 2KAFA 1ZQ1A 2A08A 4FT2A 3G71Q 4ZGEB 4JJDA 4IURA 2LCLA 2VWFA 1TS9A 2QG9B 3CBMA 3HPWA 1OU9A 3V8LA 2A28A 5CQXA 1MUZA 4FU6A 2EQJA 3JV3A 3ZL7C 2MWPA 1K8AC 5GAOn 3HRTA 4AFZC 2KVQG 1TG0A 2IVWA 2NWMA 5GAMf 3JCMe 1Q81R 2LTOA 3A8LB 2RJEA 1H3HA 4L59A 1WNLA 1OV3A 2RD1A 2QDYB 2JZ2A 2M51A 1OI1A 4IUUA 3OYHA 2HCKA 2VGMA 5FLXE 1VQMT 1QP3A 1SSFA 2O01E 4BE2A 4QQDA 1B34B 4JZ3A 2QQRA 5I2MA 3L2VA 2HEQA 1VQLQ 5GMKl 3SEMA 1SKUB 3CCSQ 4JS5A 4FW2A 5IHKA 1VUBA 2GNCA 2YUNA 4K11A 3RR6A 1WXBA 1K4US 1YJ9T 3I55A 1VQ8Q 1M1KU 2QA4A 1QVFS 4XU2A 1Q82U 2Y4XA 4J9BA 2K2VA 2KRMA 5KYYA 3TREA 4FSSA 5IXFA 2ECZA 2DD4A 4QVCA 3CCJQ 3CCUA 2J6FA 1X69A 1VQNQ 3VS6A 3J81E 2YDLA 2DYIA 3OSVA 3PNWC 2FG0A 1VYTA 4E47A 3URGA 1G5VA 2HBPA 1VQOQ 3JCMb 4Z88A 4RG8A 4M4ZA 2BIVA 2BTTA 4F04B 3QUIA 5A0DA 2XIDA 5CCAA 3JSCA 2DE0X 1QVGP 1Y7XA 1S1NA 3CXCA 4M7DE 2HDAA 3OYKA 2ENMA 1VQKA 5C6SA 1XJWB 2A7YA 1U1SA 4F7UF 5KH6A 2RQUA 3VS0A 2E6ZA 3EG9B 2DIGA 4WF2A 2ZCFB 1WXTA 1AWOA 2YLCA 1N27A 2HL5C 3EG0A 2CZ0B 2KRNA 2PNIA 4KGZB 5LJ5g 2P0KA 2LQNA 3I56Q 1MMNA 4F7UG 2C0OA 2HSEB 3FJPA 2F2XA 3CC2A 4IIOA 3GLXA 4JZ4A 3QIIA 1WFWA 4ZNXA 4HKEA 2VC8A 3I35A 2DA9A 4PJLA 2PZ1A 1M90R 2GCXA 2JTFA 4OMLA 3UT1A 1QVPA 1Q81C 4M77C 2GTOA 3HSBA 2L89A 1ZA2B 2DPPB 2OX7A 3V7RA 3PIOA 1TSFA 3OYFA 5J39A 5A2QE 3EG1A 2BZYA 2HKNA 5M9OA 4Q5WA 1CKAA 1QVFA 3V7CA 1ZSZC 2LP5A 3QXEB 2K79A 3M0UA 1MMDA 2F5TX 2ROTA 2M0YA 1VQPQ 1PSFA 3JB9F 1W6XA 2MAMA 4KULA 3L2RA 2NUPB 5AYFA 5A0LA 4J6XA 4RCCA 1M4ZA 1I4K1 1C1AA 3THKA 1ZUKA 2FRWA 2K2MA 4JLIA 4M75C 3SD4A 4AFSC 5LJ3f 2RMOA 4WCIA 3RMQA 4J7IA 2P4RA 5GAN3 2ZPGB 1W4SA 3QJ6A 2PUKB 2E10A 3CC4T 1BB9A 2O4XB 2DM1A 4XK8E 5GAN5 3JB9G 1VQPT 2KMTA 4M7AB 4AG1C 3AHUA 4KT0E 4EIKA 2JT4A 2HBWA 2RJFA 4C8QB 4ESRA 2K9GA 3BFMA 2KROA 4PJJA 4GBQA 3I5RA 1VQ4T 3KXTA 2X4YA 1WI7A 3LGFA 4RTXA 4M7AE 3NGPA 2GF7A 1WJSA 1M1KR 4LN2A 2OTLQ 1RAIB 2JM9A 4M78G 2P0PA 1T3SA 3EH1A 3OMGA 4E7SA 4WTOB 2X51A 5HCKA 2DLPA 3MP1A 1WZOA 4OMMA 5I2SA 1YHQQ 2QK0A 3L2UA 2XMFA 3H8ZA 2E70A 1N6AA 2FZCB 5LJ3e 4C5IA 1NG2A 1KQ2A 5LL6S 3PFSA 3FC3A 1A0NB 3VU3C 1ZUYA 1BI1A 4PKCC 4RTUA 1KIKA 5J3BA 4OMFB 1Q86C 1UHCA 1QW1A 2XI9A 1GBRA 1PNJA 2NUPA 5CAIA 5FW9A 3M4YA 2PQWA 1VIEA 1EIFA 4JDSA 2E65A 2BE7D 2EGAA 3JCMV 5CR2A 1IB8A 2RQVA 1D0XA 2JS2A 5KE2A 3E2UA 3ZEHA 2QA4Q 2RO0A 1TTHB 3KFVA 1ZSZB 4NL2A 4C8QA 1ABOA 3VS3A 1WHGA 4M75A 4P5NA 4E7KA 3P8BB 2LZ6B 1JXOA 2QYZA 3A8GB 2HNIA 4IKFA 4DQ2A 3CCVQ 2YSQA 4NOYA 4M77F 3HFNA 2F5KA 1K9MU 1KG1A 1KQSS 1CKBA 3M9QA 3RESA 1N8RR 5KYNA 4B9XA 1FX7A 2QAZA 4DBQA 1D1AA 2ATCB 1EFNA 2WSEE 2D8JA 2Z0WA 2O9VA 2EYYA 3J7AF 1KHIA 3EGXA 2L2PA 4RCBA 2J05A 4ZN1A 3S3NA 1KC8R 3LH5A 3C0CA 5GAMh 3KBGA 1RLQC 4CRIA 4DEYA 3JCMc 1JU5C 4QQ6A 1UFFA 2RI5A 3DLMA 4J5YA 1M3AA 2EYZA 3JRZA 2K4YA 1VQ5Q 1AT1B 4B9WA 4C92D 1JJ2S 3QO3A 2IPOB 4FL6A 4OF1A 3M0TA 2JNGA 2YRDA 4AFQC 2JM8A 1YIJQ 1QLYA 4C92G 1W2BP 2WSCE 1QVFP 1OOTA 3FRNA 1RI9A 1Y07A 2DNUA 4M75B 5GANe 4RTYA 2OJ2A 1X2KA 4MDWA 1ZLMA 4L6V5 2NUTB 3DB3A 2DL7A 1VQ4Q 3JB9H 2YRVA 3ASKA 4ELZC 3REAB 4C92F 4BDZA 4ZGDB 4DBRA 1HD3A 1R0BG 1WHJA 4E6RA 3MCAB 1LNXA 1PSEA 3NTIA 4FYVB 3JCMg 1VYVA 3BDUA 4LD6A 1GXIE 4QQGA 3PGGA 2DRMA 3A98A 4HVUA 3TQ7P 3ULRB 1G3TA 3MJXA 3OS1A 3VRZA 1NPPA 2JTEA 3TEEA 3WVEB 2HZYA 2X9HA 2KY9A 4VUBA 2F2WA 4JS4A 1E6HA 2DXCA 4BI3A 5AT1B 2GFAA 1AHJB 2RJDA 1WXUA 4FW1A 4MZPA 2KBTA 4OB1B 2P84A 3M56A 1M1GA 3E1SA 2R57A 4OB3B 5KYWA 1D3BB 4O6JA 5HK0A 5D6YA 2QDLA 2DJZA 2RQRA 1Q82C 1FWZA 1J3TA 3C95A 3G4SA 2FHDA 2DTOA 1VQMA 1WHKA 3G4ST 4PFOA 3MEWA 1NJIR 4KGVB 2D0QB 3CCUQ 2V1RA 3LX7A 1ABQA 1I81A 4QT7A 4RTZA 2BE9B 3H9NA 3PTAA 3SB2A 4HXJA 1MNDA 1YJ9A 1V29B 3DLLA 4FYXB 1LCKA 3OYCA 2CYZB 1X27A 2XICA 1ZX6A 2YT6A 2VGNA 4J6WA 1TH7A 2DFUA 1RAFB 3VJPA 1IHVA 4C8QD 2V8JA 5L8RE 1G3YA 2HQXA 2CZ7B 3OYMA 2DAQA 4AFUC 2G3RA 3JCMP 2A0FB 3DB4A 1FYNA 1S72Q 4AMCA 3BY7A 1VQ7A 4X9CA 2P4TA 4TVRA 4C8QC 5CKEA 1K0SA 3A5ZB 2RK2A 3OS5A 2XHCA 3CCMQ 3RKWA 4QVZA 1YJ9Q 2XDBA 3QHSA 1UGQB 2E5QA 1MNEA 5KYWB 1D3BA 2K5LA 3VUZA 2XK0A 2FO0A 2RQWA 2JXBA 3CMEQ 4GLKA 4M7AG 4HCKA 3D7SB 2J7IA 1V76A 2KYMA 5FWBA 2DZCA 3T9NA 2CP7A 2MIOA 3ME9A 1UEBA 6AT1B 1U06A 3REBB 3N5BB 3OW2P 1R0CB 2LJ3A 2H3EB 4PLLA 3CCJT 3L42A 2RA2A 2YWWA 1VQ9Q 3CCLA 3QDRB 3CCLT 3CCVA 2AKLA 5EG2A 1K73U 2AHJB 4A4HA 3H0FA 1KQSA 1NE8A 4F14A 1YNZA 4XU0A 1VYUA 3CCMT 2CH4W 2RB6A 2RHZA 2DZ9A 2EYWA 4PFPA 2ZZDA 2JVVA 3JCMJ 2KT1A 2LQKA 2QQAA 4X9DA 4ORZA 1PKTA 5GMKh 2RI2A 1K8AU 1PCXA 1QKWA 3CMAQ 2HMAA 2DD5A 1ZHIA 2I2LA 4M77D 2O9SA 2DXUA 4BD3A 4KGXB 3A1PA 1VQMQ 1EZZB 1RL2A 2QEXA 1YI2A 1U1TA 4NS5A 3CCRQ 1YI2T 4IUPA 4OMNA 2QQBA 1KD1R 3X25B 3UPUA 1IHWA 2RHXA 1AWJA 5ECAA 2DRKA 4QW2A 1JJ2P 3OYBA 2FYKA 3CC7Q 1RUWA 3LGLA 4OGCA 2D8HA 1BI0A 3MHXA 4J8OA 4F7UB 2PVOB 4CC3A 4PNOA 1VQ9T 4C5EA 1YHQA 2ZPHB 4PFZA 1UTIA 1WX6A 2EIFA 2AK5A 2XU8A 2BZ8A 4CC4B 5KYYB 2FVUA 2GBQA 3PMIA 4C0ZA 1Q95G 8AT1B 3C4SA 2Y4YA 5KCOA 5IAYA 2M02A 2QXFA 3VUBA 3CBPA 4M77E 4C5HA 1PRLC 9ATCB 1QKXA 2A37A 1WHHA 1X01A 4EPCA 4R56A 3H0HA 2B86A 3HRUA 2KNBB 4J9GA 4Z8AA 3CCEA 5GAMg 2RK1A 4N4GA 5GAMj 1K0XA 2CP0A 3M59A 3JCMW 1JJ2A 3ZBDA 1AZEA 4C0DB 2RHIA 3QZ5B 1SEMA 2CUBA 3H6ZA 3EGDA 1UECA 4M7DC 4BI4A 4EMKB 2JTMA 2L3PA 2GQVA 3SDZA 2EYXA 1M9SA 5CO7A 2LNHB 4M7DA 4IIMA 2DVJA 2FZKB 5GAMd 3SHWA 2EJFA 4N0AA 3EFRA 3R6NA 4RTTA 3FJ5A 3M0QA 3GNGA 3X26B 4BACA 2VKNA 3CBOA 4PL6A 3S3OA 1I5OB 1M30A 2F1LA 1GBQA 1YJNT 2QGGA 3FDRA 1AWWA 2D6FA 2XDPA 1TXQA 1GCQA 1T3LA 4PLIA 4C0DC 1D09B 2V8IA 1N8RC 1WGSA 1UGPB 1B3QA 1KC8C 4RUGA 3CD6T 4JRKA 2ESWA 3CD6A 2CP3A 1WHLA 2K3XA 4KH1B 4ZTFA 4LDUA 3JCMf 1HK9A 4HA8A 1NEGA 2ABLA 1RABB 3OYEA 3CC2Q 4HVWA 2CZ1B 4PJOG 1W1FA 1YFNA 2DL3A 1NLPC 1XOVA 3I56T 4QKUA 3OS2A 2DL4A 4II1A 4JJBA 1N9SA 2VUBA 2OI3A 1X6OA 1BKBA 2H3JA 4JRIA 1Z9ZA 4A53A 2A3LA 1KD1C 3EGDB 4XTXA 3JCMQ 2C06A 3RDVA 5DM7R 2V26A 1LOJA 1TUDA 1M8MA 1AEYA 2L5QA 3CPWS 1Q86R 3CPWA 1VQ6T 4M7DB 1D1BA 2YUQA 2QQSA 1F1BB 4KBMB 2X3XD 3BW1A 3OA6A 2CT3A 5GJVB 1QWFA 2BZXA 4LXCA 1KQSP 1OZ2A 1YI2Q 2K57A 2QEXQ 1NYFA 2R5AA 2E3IA 2ZPEB 1LVKA 1SSHA 3CCST 1VQNA 1XTDA 2YUOA 2JOYA 1JEGA 2DL8A 2W10A 3OYNA 1JQQA 3BE3A 1YITA 1OEBA 2DTHA 1WHMA 5CKDA 2KE9A 3QBYA 4R0KA 4HT9A 4PJOD 3HHTB 4KH0B 1GL5A 4DEXA 2EGCA 4KRTA 4LNPA 5GAOm 2FRYA 2YLBA 3E9FA 1YJNQ 5CQYA 2MOXA 5LJ5j 1K9AA 4M75F 4Y28E 1X43A 1NLOC 3M57A 1IREB 3OYGA 3C12A 2DETA 1BCMA 5IHIA 3NFCA 1VQLA 3PE0A 1JO8A 2LQ8A 3MEAA 4MZTA 2FZGB 3EAEA 2RPNA 4RMOA 3I5SA 3HL8A 1KSWA 3GBQA 1VQ8T 4M7AD 5LJ3j 5KCHA 1Q86U 3CCRT 1G3WA 2CSIA 2FB7A 4Z02A 4NL3A 2NYSA 3MEUA 3CMEA 4DOVA 2C0IA 2AZSA 4M75D 4BUGA 3CMET 1PWTA 2PUOB 5KE3A 1YCSB 4ZTJA 4LE9A 3OYIA 3TSZA 1ZSZA 2ED0A 3FLGA 2DEQA 4C92B 3OBWA 2RH2A 2L0AA 3O5ZA 1FMVA 3QWXX 2CP6A 4BY6C 1B7TA 4J9HA 2D1XA 3RIRA 2FPDA 1W2BS 3EFOB 1PM3A 1O9SA 5CKFA 4LD9K 2FPFA 3G71A 1ZBJA 1IZ6A 2RQTA 2DXTA 1IO6A 1NZ9A 2LRQA 3EGXB 1X6GA 3OW2A 2L3RA 2EGEA 3EG3A 2WACA 2AT1B 1M3CA 3OYLA 2CDTA 5LJ5e 3HP9A 4CI0C 2MF2A 4A4KA 2R58A 1YITQ 1Q7YR 5GMKi 3V8KA 2VYTA 5GAOr 3GIBA 1PHTA 2EQUA 2LJ1A 2D0NA 2K5FA 1PD0A 3NHNA 3QG1A 4B6MA 3G6ET 1WLPB 3TCJA 4C0FA 5GMKm 3CCUT 3LWIA 5FROA 4A54A 3RERA 1OPKA 4DBHA 5CIUA 3U23A 3OY9A 1JBMA 2HQHA 1H92A 2YRCA 3I55Q 4C92A 3VYGA 2RI3A 1I5LA 4JRQA 3G6EQ 4M77B 4JRPA 3NMZC 2NUTA 4QVDA 1OX9A 3PVLA 3OS0A 3VS7A 3S6WA 2AKKA 3META 3EFOA 5FRMA 2MPXC 4M78F 2DK3A 4LUDA 4N4HA 1MV0B 2DEUA 1MMGA 4FSXA 1B07A 3P8HA 3GP8A 1IXDA 2CS7A 1PRMC 2KSSA 3KUFA 5HK3A 4EMGA 2MCNA 3JCMX 5D6XA 3CMAT 2Y90A 3CC2T 1Q7YC 1JRIA 1PC0A 1R77A 3VV0A 3CMAA 2LX9A 5I22A 3QWYA 3CCJA 3SFMA 4FT4A 3INZA 1RAEB 2EKOA 2DILA 1QP2A 1HXDA 3PMTA 5IN1A 4FM4B 1KD1U 3CCMA 2HQEA 4V2SA 2CGHA 3L2QA 1G3SA 5IHNA 1SF9A 4O5VA 5LJ5f 2JJ9A 2OAWA 4J9EA 2AIRB 3IQLA 1VQ7Q 2MI6A 2EJGA 2E6NA 1VQOT 5I21A 2OTJT 4PJNA 4N4IA 3VS2A 1OX8A 1BU1A 1RAGB 5LJ5h 1K76A 2QTVA 3CQTA 2EAYA 2JMAA 4HVVA 2X3WD 4XAXB 2B8AA 1SHGA 4MMKA 2QEXT 1BI3A 1GRIA 1T0HA 4M77A 2XKOC 2YXYA 4CC7A 1VQ5A 3TSWA 1VQ5T 3LWHA 1UDLA 2CP2A 2CP5A 4D8KA 4A4GA 5GAMe 3L1AA 3QDFA 1YHQT 4OP0A 4A4EA 3S3MA 2F2VA 5KYUB 2OTLT 1FXXA 4OGEA 4LDVA 3L2ZA 3A8OB 1NM7A 1YWPA 2E3HA 5IH2A 4M78C 2ZGWA 2K7AA 2PVGB 1BBZA 3CPFA 4BB7A 2KT8A 1X2QA 4DA4A 5KYXA 3G6EA 2FL7A 1E7OA 4BE0A 3JAME 4CC2A 2PVDB 4DOWA 1WA7A 2BUDA 1OULA 2KI7A 3CCQQ 4F17A 1MGQA 2DL5A 4GY5A 2DIQA 4BY6B 1QQJA 3V7SA 1BCOA 3CCRA 2LJ0A 1WYXA 1PG5B 3EHQA 7AT1B 5J26A 1AWXA 2EFIA 2ED1A 4BI8B 4C92C 2VV5A 2VXFA 5FU7B 3MP8A 4M7AC 4F16A 1BK2A 2EW3A 4IUTA 4RTWA 2RJCA 4DBFA 1M8VA 4PK4A 1HSQA 2HD0A 3QPHA 1QWEA 1D1CA
chains in the Genus database with same CATH topology
1N8RC 1P92A 4D6WA 1WGSA 1UGPB 3E9GA 4M75A 4P5NA 4E7KA 1H641 1WJQA 3P8BB 1KC8C 5CKBA 3MP6A 3A8GB 2HNIA 3CD6T 4JRKA 1BIBA 5LJ3d 3CD6A 4XTVA 5FU7C 3PT9A 2K3XA 4IUVA 4DQ2A 2CKKA 4ZTFA 3G71T 4NOYA 3RMSA 4IKFA 4M77F 3HFNA 2F5KA 5D6WA 4E7LA 2RM4A 4LDUA 3JCMf 1HK9A 4HA8A 1K9MU 1KG1A 3RKXA 3OYEA 1UGSB 1KQSS 3OSSC 2CZ1B 3M9QA 4ZN3A 4PJOG 3RESA 5GANg 5LJ3g 2HAXA 2DTIA 3A8HB 4B9XA 1DJ7B 1FX7A 2IG0A 4KUDK 3SWNB 1RI0A 1XOVA 2MMPA 4PJOC 3OMCA 3I56A 5GMKj 2XG8D 1Q7YU 3PIPA 3JCMd 1M1FA 5FRNA 3Q1JA 2WSEE 4R55A 3I56T 1M1KC 2P0QA 5GAOp 3OS2A 3J7AF 1KHIA 4II1A 3F70A 4ZN1A 4RCBA 3S3NA 2KQWA 2LCCA 2QA4T 3BDLA 1N9SA 2VUBA 3HFOA 4C8QF 5GAMh 1NJIC 2M0OA 1X6OA 1BKBA 2JUFA 3KBGA 4C5GA 4C8QE 5GAOl 3JB9D 1M5Q1 2OTJA 2EQKA 2H3JA 4FIBA 4JRIA 3VYHB 4CRIA 5GAN4 4HT8A 3JCMc 4A53A 2A3LA 3LW5E 1KD1C 4QQ6A 4XTXA 2RI5A 3DLMA 3JCMQ 2C06A 2LVMA 3X24B 5GANd 5DM7R 3M5AA 4J5YA 1LOJA 3CEYA 5FU6B 4XQ3A 2KDSA 2DXBA 3QJYA 3NTKA 3JB9I 2L5QA 1YBYA 3JRZA 3CPWS 2K4YA 4B9WA 4XU1A 2PU9B 4ELYC 3CPWA 1VQ6T 5GMKe 4M7DB 2OTJT 1YCYA 1VQ7T 4C92D 2QQSA 4C8QG 4KBMB 1NPRA 4LDWA 1JJ2S 5A0GA 3BW1A 4Y91A 2DKGA 4F7UA 2X35A 3QO3A 3OA6A 4FL6A 1OZ2A 4OF1A 3CCQT 1S72A 2K57A 2YHTA 5LJ3h 2JNGA 5CK9A 1S72T 2R5AA 2RHUA 2ZPEB 3GOXA 3CCST 1VQPA 5FU6C 1YIJT 5CKHA 2JN0A 1VQNA 1WQ7A 1XTDA 4C8QA 1YIJA 4C92G 4MDXA 2WSCE 2JOYA 1Q81U 1VQNT 2LNVA 3FRNA 1Y07A 1WJRA 2QI2A 3OYNA 4J6YA 1YITA 3JB9J 2DTHA 4N0AC 5CKDA 4M75B 3QBYA 5GANe 1UGRB 2LT1A 3HHTB 4JUVA 4F7UE 1K9MC 4HT9A 4PJOD 1B34A 4HCBA 2LC4A 3M4GA 5GAN8 1LJOA 4MDWA 2K3YA 4L6V5 3NTHA 3DB3A 5GAOm 2KK4A 2RHYA 2YLBA 3FIFA 2X4WA 3E9FA 2X4JA 3EFSA 5CQYA 3JB9H 2YRVA 3ASKA 3X20B 4EDUA 4ELZC 5LJ5j 4XU3A 4YTLA 4M75F 4M7DF 5IT9E 1R8OB 3LH0A 4XTWA 4Y28E 4C92F 2M1HA 4BDZA 3M57A 4E7HA 3FB9A 1JB0E 1IREB 4ZGDB 2QTXA 4LDXA 2EQMA 4EMKC 4HCZA 5GANh 1M90U 3OYGA 3CCET 3C12A 4L5GA 3HRSA 3OYYA 1YJWA 1NJIU 1VQLT 2QQ9A 3NFCA 1W2BA 1YJWT 3MCAB 1XQHA 1VQLA 4E7IA 1KQ1A 2LQ8A 2KAFA 1ZQ1A 4EMKA 5GAOq 3RUXA 1LNXA 4FT2A 3CCVT 1PSEA 3MEAA 2ZPFB 3NTIA 3R6OA 4M77G 4MZTA 3DKMA 3JCMg 3BDUA 3EAEA 4LD6A 4IURA 4RMOA 2LCLA 1GXIE 3UDCA 4QQGA 3HL8A 3PGGA 3CBMA 1VQ8T 3HPWA 4M7AD 4M7DG 3V8LA 5CQXA 1O75A 5LJ3j 4UC4A 1G3TA 5KCHA 1Q86U 3OS1A 3CCRT 4FU6A 1G3WA 2EQJA 1NPPA 3TEEA 2FB7A 4Z02A 2E41A 4NL3A 3MEUA 3WVEB 3CMEA 4DOVA 1K8AC 2KY9A 2MWPA 4VUBA 4M75D 4BUGA 4C0GA 5GAOn 3CMET 3HRTA 4JS4A 2PUOB 4PJOB 3VKIA 2DXCA 2KVQG 3P8DA 5KE3A 2WSFE 2IVWA 4ZTJA 4M7AF 4BI3A 3OYIA 5GAMf 4KUIA 2GFAA 1AHJB 2RJDA 3FLGA 4MZPA 4OB1B 2DEQA 3JCMe 3CC7A 4C92B 3M56A 2RH2A 3OBWA 2LTOA 1M1GA 3A8LB 4ZGJB 2RJEA 3E1SA 3QYHB 2R57A 4OB3B 3MEVA 4MMLA 1D3BB 4O6JA 5HK0A 4PJOE 4L59A 5D6YA 1WNLA 4BY6C 2RD1A 2QDYB 2DJZA 2X4XA 1Q82C 2JZ2A 1FWZA 3C95A 1OI1A 2E12A 1N8RU 3JCMh 3G4SA 4IUUA 2FHDA 2DTOA 3RIRA 1VQMA 3QYGB 1W2BS 3OYHA 3OQ5A 3G4ST 2VGMA 5FLXE 3MEWA 1VQMT 1QP3A 1SSFA 3WXMB 1O9SA 2O01E 5C0MA 5LJ5d 5CKFA 4BE2A 4LD9K 4QQDA 3G71A 1B34B 2D0QB 2DO3A 4M78D 2QQRA 1IZ6A 5I2MA 3L2VA 2DXTA 3LX7A 5GMKl 3GPLA 1NZ9A 2LRQA 1WQWA 4JS5A 4LDYA 1I81A 1M90C 3G7ZA 1VUBA 1H3ZA 3OW2A 2L3RA 2O4XA 1VQ4A 2WACA 1YJ9T 3I55A 3PTAA 4M7AA 2F69A 1WPYA 3SB2A 3OYLA 1YJ9A 3I55T 1M1KU 5GAN6 1MHNA 1V29B 3DLLA 5LJ5e 2QA4A 4ME7A 1QVFS 4XU2A 1Q82U 2Y4XA 3HP9A 4CI0C 2CYZB 3OYCA 2VXEA 2MF2A 2K2VA 4A4KA 2R58A 4RKUE 2XICA 4E7JA 1BYMA 3TREA 2VGNA 5GMKi 4J6WA 2VYTA 3V8KA 1TH7A 5GAOr 3VJPA 3GIBA 2DD4A 4QVCA 2EQUA 4C8QD 2V8JA 4J83A 1G3YA 2HQXA 5L8RE 2K5FA 2CZ7B 3CCUA 3QG1A 3G6ET 1BIAA 3OYMA 3TCJA 2DAQA 4C0FA 5GMKm 2G3RA 3J81E 3OYJA 3LWIA 3CCUT 3DB4A 3GF5A 3OSVA 5FROA 3PNWC 4E47A 3BY7A 3URGA 3ER0A 4A54A 4JJNK 3RERA 3M55A 2HBPA 1G5VA 3JCMb 1VQ7A 4X9CA 2P4TA 4RG8A 4TVRA 4C8QC 5CIUA 5CKEA 2BIVA 3A5ZB 3QZ9B 3QUIA 5A0DA 2RK2A 3OS5A 2XHCA 4BDYA 3OY9A 4PJOA 3RKWA 2XIDA 4QVZA 1XNIA 2GFUA 5CCAA 3JSCA 2L8DA 1JBMA 3QHSA 2XDBA 1Y7XA 3CXCA 4M7DE 4C92A 3VYGA 2RI3A 3OYKA 5DLOA 1X75C 1UGQB 2E5QA 1VQKA 5C6SA 1I5LA 4JRQA 1D3BA 4IUQA 2NLUA 3M58A 3OYAA 2K5LA 4M77B 3OW2S 4JRPA 2A7YA 4QVDA 1U1SA 3VUZA 4F7UF 5KH6A 1KHCA 2E6ZA 2XK0A 2CZ6B 3OS0A 3FEOA 4GLKA 4M7AG 4X34A 5DY9A 3S6WA 2DIGA 3META 4WF2A 2ZCFB 5FRMA 4M78F 2DK3A 2ZPBB 4N4HA 3QKJA 4FSXA 3J80E 3P8HA 2YLCA 5CVIA 1N27A 3GP8A 2CZ0B 2DZCA 2CS7A 3T9NA 2KSSA 5LJ5g 3KUFA 2P0KA 5HK3A 4EMGA 3JCMX 2M16A 3ME9A 1UEBA 5D6XA 3CMAT 2Y90A 4M78B 4F7UG 3CC2T 1Q7YC 1JRIA 3FJPA 3N5BB 3VV0A 2V8KA 3CMAA 4PLLA 4J7FA 3CC2A 2LX9A 3CCJT 3L42A 2RA2A 3CCLA 3GLXA 3QDRB 3SFMA 3QIIA 4FT4A 3CCJA 3CCLT 4HKEA 2VC8A 2EYQA 3INZA 3CCVA 4ATOA 2GCXA 2JTFA 5EG2A 2EKOA 3UT1A 1K73U 2AHJB 2LT4A 4M78E 4A4HA 1QVPA 3TU4K 1Q81C 1QP2A 1HXDA 4M77C 2EJ9A 1KQSA 5GANf 3HSBA 1NE8A 3PMTA 5IN1A 2L89A 2DPPB 4FM4B 1KD1U 3V7RA 3PIOA 3M53A 4XU0A 2HQEA 3OYFA 3CCMA 2CGHA 4V2SA 3L2QA 1G3SA 5J39A 5A2QE 3CCMT 4O5VA 2RB6A 2RHZA 5LJ5f 2DZ9A 1VQOA 5M9OA 2MI6A 4Q5WA 2EJGA 2K5IA 2ZZDA 2E6NA 1I8FA 2JVVA 3V7CA 5I21A 3JCMJ 1VQOT 4HCCA 1QVFA 2LQKA 2QQAA 5HKCA 4X9DA 5GMKh 2RI2A 1K8AU 4N4IA 3C94A 3QXEB 2DD5A 1Y96A 1ZHIA 2F5TX 2I2LA 4M77D 3CC7T 4M7DD 5LJ5h 4XTZA 1ZBXA 2DXUA 4XTYA 1PSFA 3JB9F 4BD3A 2EAYA 2MAMA 4KULA 3L2RA 4JLGA 5AYFA 5A0LA 1QVGA 1RL2A 4J6XA 4RCCA 1M4ZA 2QEXA 4XAXB 1YI2A 2B8AA 1U1TA 4NS5A 2BKDN 1I4K1 4MMKA 5HY6A 2QEXT 1VQ6A 1BI3A 4IUPA 1YI2T 4M75C 4JLIA 2XDDA 2QQBA 3SD4A 2XD0A 4M77A 3X25B 3UPUA 5LJ3f 2RHXA 3QSUA 3RMQA 2XKOC 3CCQA 4J7IA 5GAN3 4QW2A 1VQ5A 2ZPGB 3OYBA 3CC4A 1W4SA 3QJ6A 2PUKB 2E10A 1VQ5T 3CC4T 2FYKA 3CXCS 3LWHA 2O4XB 3LGLA 4OGCA 4XK8E 5GAN5 3CCSA 3JB9G 3O8VA 1BI0A 1VQPT 2KMTA 3MHXA 4J8OA 4M7AB 2PVOB 4F7UB 4KT0E 1VQ9A 4PJOF 3AHUA 4PNOA 1VQ9T 2RJFA 4C8QB 4RG2A 4C5EA 1YHQA 2ZPHB 4A4GA 5GAMe 3L1AA 2EIFA 1YHQT 1VIFA 2OAUA 3BFMA 1YITT 4OP0A 2DVEA 2XU8A 3OBYA 1VQ4T 4EMHA 2X4YA 3KXTA 3E19A 5GANj 3LGFA 2FVUA 4A4EA 3S3MA 3PMIA 4C0ZA 4M78A 4M7AE 4BE1A 2GF7A 3C4SA 1WJSA 1KC8U 2OTLT 2Y4YA 3SWNC 5IAYA 5KCOA 1K73C 4XTUA 1FXXA 4OGEA 2QXFA 3A8MB 3L2ZA 4LDVA 3A8OB 4M78G 2OTLA 2P0PA 3VUBA 3CBPA 4M77E 4C5HA 4M78C 3OMGA 3OYDA 2ZGWA 2LDMA 2PVGB 1X01A 3SWNA 4EPCA 4R56A 3X28B 3CPFA 4BB7A 3LLRA 3HRUA 3RKYA 3MP1A 5I2SA 4OB2B 2E1HA 4DA4A 3CCEA 5GAMg 3L2UA 3H8ZA 3G6EA 2RK1A 4N4GA 1BI2A 5GAMj 2FL7A 2E70A 4BE0A 2M9UA 1N6AA 3M59A 3JAME 3JCMW 5LJ3e 1JJ2A 4C5IA 2R5MA 3ZBDA 1N9RA 4C0DB 3ZFJA 5LL6S 2RHIA 3PFSA 3FC3A 1KQ2A 2PVDB 3VU3C 3QZ5B 4DOWA 3L2WA 2BUDA 1BI1A 3LYIA 3H6ZA 4PKCC 4MZMA 2E64A 4ZGEB 3HKSA 1VQ8A 5GAN7 1MGQA 1U8RA 5J3BA 4M7DC 4OVAA 2D9TA 3WVDB 4BI4A 4EMKB 3GNFB 4OMFB 1Y71A 1Y96B 2JTMA 4GY5A 3V8JA 2DIQA 2GQVA 1Q86C 3SDZA 4BY6B 3V7SA 1M9SA 3CCRA 1QW1A 2XI9A 5CO7A 1OZ3A 5CAIA 1VQKT 4C92E 4M7DA 2ZPIB 5GAMd 3M4YA 4M75E 2PQWA 2EJFA 4N0AA 1VIEA 1EIFA 3EFRA 5J26A 2EFIA 4A4FA 4BI8B 4C92C 5GAN2 4JDSA 2E65A 3JCMP 3GNGA 1UB4A 3X26B 2VV5A 2VXFA 4BACA 3MO8A 5DLQE 5FU7B 3CBOA 4PL6A 3S3OA 3MP8A 4OB0B 3JCMV 5CR2A 4M7AC 4IUTA 2EWNA 3UWNA 5KE2A 2RJCA 3ZEHA 1YJNT 1M8VA 2MWOA 3FDRA 2RO0A 1YJNA 2D6FA 3OB9A 2HD0A 2XDPA 4M75G 3QPHA 1OYXA 4NL2A 4PLIA 4C0DC 1QVGS 3M54A 2V8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G3R A;  1WGS A;  4IUP A;  3E9G A;  3DB4 A;  4HCZ A;  5FRO A;  3OYG A;  3PNW C;  3OYJ A;  4E7K A;  1WJQ A;  3SD4 A;  3MP6 A;  1G5V A;  4E7I A;  2RHX A;  4IUV A;  2K3X A;  5CIU A;  2BIV A;  2CKK A;  3MEA A;  3NTI A;  4E7H A;  4ZTF A;  4QW2 A;  2F5K A;  3EAE A;  3QJ6 A;  4IUR A;  4LD6 A;  5D6W A;  3OYB A;  3OY9 A;  4BDY A;  4E7L A;  4QVZ A;  4QQG A;  1XNI A;  2GFU A;  2L8D A;  2O4X B;  3OYE A;  3LGL A;  3O8V A;  3M9Q A;  2RI3 A;  3OYK A;  4B9X A;  2IG0 A;  4UC4 A;  1RI0 A;  2E5Q A;  2RJF A;  4RG2 A;  5C6S A;  3OMC A;  4C5E A;  4A4G A;  5KCH A;  3OS1 A;  4IUQ A;  2NLU A;  3Q1J A;  5FRN A;  3OYA A;  4FU6 A;  3OS2 A;  2EQJ A;  4II1 A;  3OYM A;  3F70 A;  4Z02 A;  2X4Y A;  5KH6 A;  3MEU A;  3S3N A;  2LCC A;  3LGF A;  1KHC A;  2XK0 A;  4A4E A;  2MWP A;  3S3M A;  3BDL A;  3PMI A;  4BE1 A;  3OS0 A;  2GF7 A;  3C4S A;  1WJS A;  2M0O A;  3FEO A;  4C5G A;  4X34 A;  3P8D A;  3S6W A;  2DIG A;  5IAY A;  5KE3 A;  3MET A;  5KCO A;  4ZTJ A;  3OYI A;  2EQK A;  4CRI A;  2GFA A;  5FRM A;  2RJD A;  3FLG A;  4N4H A;  4C5H A;  2LTO A;  3OMG A;  3OYD A;  4QQ6 A;  2RJE A;  3QKJ A;  2RI5 A;  2LDM A;  2R57 A;  3DLM A;  3MEV A;  2LVM A;  3P8H A;  3LLR A;  1N27 A;  3CEY A;  3MP1 A;  3KUF A;  2P0K A;  4L59 A;  5D6Y A;  3NTK A;  2M16 A;  3L2U A;  3ME9 A;  5D6X A;  2X4X A;  3H8Z A;  4B9W A;  2JZ2 A;  4N4G A;  4BE0 A;  1OI1 A;  4PLL A;  2QQS A;  4C5I A;  2R5M A;  4IUU A;  2FHD A;  3L42 A;  3FC3 A;  2RHI A;  3PFS A;  3OQ5 A;  3OYH A;  3OA6 A;  2X35 A;  3MEW A;  3QII A;  1SSF A;  3L2W A;  5C0M A;  4BE2 A;  2BUD A;  3LYI A;  3H6Z A;  4QQD A;  4FL6 A;  1OZ2 A;  2JTF A;  2QQR A;  2EKO A;  3UT1 A;  3L2V A;  4A4H A;  4IKF A;  2R5A A;  3LX7 A;  4OVA A;  2D9T A;  2RHU A;  2LRQ A;  3GOX A;  3PMT A;  4GY5 A;  2L89 A;  2DIQ A;  5IN1 A;  1H3Z A;  2HQE A;  2L3R A;  3OYF A;  1OZ3 A;  3L2Q A;  5J39 A;  2O4X A;  2RHZ A;  2WAC A;  2PQW A;  1WJR A;  3OYN A;  5J26 A;  4A4F A;  3OYL A;  2EFI A;  5M9O A;  4Q5W A;  3QBY A;  1MHN A;  2E6N A;  4BAC A;  3MO8 A;  2RI2 A;  3OYC A;  4PL6 A;  3S3O A;  4N4I A;  3MP8 A;  2K3Y A;  3NTH A;  2R58 A;  3DB3 A;  4IUT A;  2RHY A;  3UWN A;  4E7J A;  2X4W A;  3E9F A;  5KE2 A;  2VYT A;  2RJC A;  3ZEH A;  2YRV A;  3ASK A;  4EDU A;  2MWO A;  3FDR A;  2RO0 A;  4BD3 A;  2EQU A;  3L2R A;  3OB9 A;  2XDP A;  2HQX A;  3LH0 A;  1OYX A;  2M1H A;  4PLI A;  4BDZ A;  2B8A A;  2EQM A;  4NS5 A;  2BKD N;  2DAQ A; 
#chains in the Genus database with same CATH topology
 1P92 A;  3E9G A;  4XTV A;  3PT9 A;  2CKK A;  2DMO A;  5D6W A;  4E7L A;  2RM4 A;  1T0J A;  2KRS A;  4JJC A;  2EVR A;  3M0S A;  3RKX A;  1UGS B;  4ZN3 A;  5GAN g;  5LJ3 g;  2HAX A;  2DTI A;  2VVK A;  3A8H B;  1DJ7 B;  2IG0 A;  4KUD K;  1RI0 A;  2XG8 D;  1M1F A;  2O88 A;  4R55 A;  3F70 A;  4FCY A;  4C8Q F;  1NJI C;  2RF0 A;  4C5G A;  2JUF A;  3JB9 D;  2OTJ A;  1M5Q 1;  3VYH B;  1K8A R;  1SG5 A;  3LW5 E;  1UG1 A;  2GQI A;  1SHF A;  5GAN d;  2HSP A;  3M5A A;  3CEY A;  1NBE B;  4XQ3 A;  3QJY A;  3VS4 A;  4E7Z A;  4XU1 A;  2AZV A;  1Y57 A;  5GMK e;  1YCY A;  4J9F A;  1JXM A;  4C8Q G;  1NPR A;  1RAD B;  4F7U A;  2DKG A;  3CPW P;  2X35 A;  3UAT A;  1AVZ C;  1S72 A;  2LMJ A;  2YHT A;  5LJ3 h;  5CK9 A;  1S72 T;  3I9Q A;  1VQP A;  2ZAE A;  1YIJ T;  1WQ7 A;  1YIJ A;  1QMC A;  1GFD A;  1UJY A;  2KEA A;  1VQN T;  2QI2 A;  1Q82 R;  3JB9 J;  2LT1 A;  1K9M C;  4JUV A;  5L23 A;  2GGR A;  1LJO A;  2CSQ A;  1UGV A;  2DER A;  2KK4 A;  1TUC A;  3H0I A;  2X4W A;  1OPL A;  2PTK A;  3EH2 A;  4EDU A;  3X20 B;  2QAS A;  3EG9 A;  4YTL A;  2CT4 A;  4M7D F;  5IT9 E;  5GJW B;  3LH0 A;  2M1H A;  4LDX A;  3FB9 A;  1K73 R;  2QTX A;  5IXB A;  4EMK C;  4HCZ A;  1RAC B;  1KFZ A;  4L5G A;  1YJW A;  1KK7 A;  2QQ9 A;  1W2B A;  1YJW T;  1KQ1 A;  4EMK A;  5GAO q;  3RUX A;  3CCV T;  3R6O A;  4M77 G;  2ZPF B;  4E7H A;  3DKM A;  1UHF A;  1K1Z A;  3UDC A;  1D0Y A;  3VS5 A;  4M7D G;  1PKS A;  1W70 A;  1MV3 A;  1O75 A;  4UC4 A;  2KR3 A;  2E4H A;  2E41 A;  1YWO A;  4C0G A;  2EKH A;  2I0N A;  4PJO B;  3VKI A;  3P8D A;  2WSF E;  4M7A F;  1ZSG A;  4KUI A;  3VRY A;  3PVQ A;  3CC7 A;  1N5Z A;  2COY A;  2SEM A;  4ZGJ B;  2LX7 A;  3QYH B;  3MEV A;  2IIM A;  4MML A;  4PJO E;  2E5K A;  2X4X A;  2L3Q A;  2G6F X;  1VQ6 Q;  2ROL A;  4OMO A;  2E12 A;  2EBP A;  3JCM h;  1N8R U;  3QYG B;  1PD1 A;  3OQ5 A;  1AD5 A;  2LQW A;  3WXM B;  5C0M A;  5LJ5 d;  5I11 A;  1IRX A;  2DO3 A;  4M78 D;  1I07 A;  3GPL A;  1ZUU A;  3CD6 Q;  4FYY B;  1YJW Q;  1WQW A;  4LDY A;  4Y92 A;  1U5S A;  1M90 C;  3G7Z A;  1H3Z A;  1RLP C;  3RBB B;  2O4X A;  4OMP A;  1VQ4 A;  4M7A A;  2F69 A;  1WPY A;  3I55 T;  5GAN 6;  2W0Z A;  1MHN A;  1TU0 B;  4ME7 A;  2EPD A;  5D7U A;  2VXE A;  4OMQ A;  4RKU E;  4E7J A;  2GTJ A;  1BYM A;  4J9D A;  4J9C A;  1TUG B;  1QCN A;  2O2O A;  4J83 A;  3CCL Q;  2J6O A;  1UUE A;  1FMK A;  1BIA A;  1K9M R;  3OYJ A;  1GFC A;  3GF5 A;  3ER0 A;  4JJN K;  1GCQ C;  3M55 A;  4LUE A;  5EC7 A;  1M2O A;  3QZ9 B;  2FPE A;  4BDY A;  4PJO A;  1G2B A;  1XNI A;  1H8K A;  2GFU A;  2L8D A;  2NUZ A;  2HKQ B;  3AT1 B;  5DLO A;  1X75 C;  5FWC A;  4IUQ A;  2NLU A;  3M58 A;  3OYA A;  3OW2 S;  3CCE Q;  1UE9 A;  2V1Q A;  1KHC A;  2RN8 A;  2CZ6 B;  1LPL A;  3FEO A;  4RTV A;  4X34 A;  5DY9 A;  1ARK A;  2FEI A;  1VA7 A;  1G83 A;  2ZPB B;  1U3O A;  4PJM A;  3QKJ A;  1ACM B;  3J80 E;  5CVI A;  4D8D A;  1I0C A;  2M16 A;  4ANJ A;  2JMC A;  4M78 B;  2V8K A;  4J7F A;  1I1J A;  1M27 C;  2EYQ A;  4ATO A;  4JPB W;  2LT4 A;  4M78 E;  3TU4 K;  1NYG A;  3M0R A;  2EJ9 A;  5GAN f;  2SRC A;  3M53 A;  1SRL A;  4Z89 A;  1QCO A;  1VQO A;  2K5I A;  4HCC A;  1I8F A;  5HKC A;  3C94 A;  1Y96 A;  3CC7 T;  4M7D D;  4XTZ A;  2J6K A;  4XTY A;  1ZBX A;  1C0M A;  1RAH B;  2K3B A;  1FMW A;  4JLG A;  3G4S Q;  1QVG A;  4J9I A;  1WDX A;  2BKD N;  5HY6 A;  1VQ6 A;  2XD0 A;  2XDD A;  2KXC A;  4FYW B;  3QSU A;  1ZA1 B;  3MPU B;  3CCQ A;  3CC4 A;  2A36 A;  1EX4 A;  3CXC S;  2COW A;  4E2F B;  3CCS A;  3O8V A;  3UA6 A;  1VQ9 A;  2EQI A;  4PJO F;  4RG2 A;  3RNJ A;  1X6B A;  2DYB A;  1VIF A;  2OAU A;  1YIT T;  2DVE A;  2DBK A;  3OBY A;  2VAS A;  4EMH A;  3E19 A;  5GAN j;  3H41 A;  2CUD A;  4M78 A;  4BE1 A;  3EG2 A;  8ATC B;  1KC8 U;  3SWN C;  1K73 C;  4XTU A;  3EHR A;  3A8M B;  2OTL A;  1M2V B;  3OYD A;  2LDM A;  3SWN A;  1NEB A;  3X28 B;  3LLR A;  3RKY A;  3UF4 A;  3G1J A;  2JW4 A;  4OB2 B;  2E1H A;  1AOJ A;  1D0Z A;  1BI2 A;  2M9U A;  2R5M A;  1N9R A;  1OU8 A;  3ZFJ A;  1GCP A;  3L2W A;  2RNA A;  3LYI A;  1E6G A;  4MZM A;  2DF6 A;  2E64 A;  2MK5 A;  3HKS A;  1VQ8 A;  2HL3 A;  5GAN 7;  1U8R A;  2J06 A;  4OVA A;  2D9T A;  3MKD A;  3WVD B;  3GNF B;  1Y71 A;  1Y96 B;  3V8J A;  3NPF A;  2QGF B;  1OZ3 A;  2DX1 A;  1SPK A;  4C92 E;  1VQK T;  2ZPI B;  1YN8 A;  4M75 E;  1IGU A;  1VOM A;  4A4F A;  5GAN 2;  1UB4 A;  3MO8 A;  5DLQ E;  1Z9Q A;  4OB0 B;  2EWN A;  2CRE A;  3UWN A;  1QCF A;  1Y0M A;  2MWO A;  2H8H A;  1YJN A;  3OB9 A;  4M75 G;  1OYX A;  1QVG S;  3M54 A;  2DJQ A;  4D6W A;  1H64 1;  1WJQ A;  5CKB A;  3MP6 A;  3VS1 A;  1BIB A;  5LJ3 d;  5FU7 C;  1KJW A;  4IUV A;  2JS0 A;  1WIE A;  3G71 T;  3RMS A;  2KXD A;  1UJ0 A;  3OSS C;  1M2V A;  2OTJ Q;  2KGT A;  4PJO C;  3SWN B;  2VB6 A;  2MMP A;  3OMC A;  2MYS A;  3I56 A;  3UA7 A;  5GMK j;  3CXC P;  1Q7Y U;  3PIP A;  3JCM d;  5FRN A;  3Q1J A;  1M1K C;  2P0Q A;  5GAO p;  2KQW A;  2LCC A;  2QA4 T;  3BDL A;  3HFO A;  2M0O A;  4AT1 B;  4C8Q E;  5GAO l;  2EQK A;  4FIB A;  5GAN 4;  4HT8 A;  3HTR A;  3EGU A;  1MMA A;  2LVM A;  3X24 B;  2O31 A;  5FU6 B;  3JB9 I;  2KDS A;  2DXB A;  1M3B A;  3NTK A;  4X1V A;  2LCS A;  1YP5 A;  1VQK Q;  1YBY A;  3CC4 Q;  2PU9 B;  4ELY C;  1VQ7 T;  1TWB A;  4LDW A;  1TOV A;  5A0G A;  4Y91 A;  3CCQ T;  3TVT A;  2COZ A;  2RHU A;  3GOX A;  4GLM A;  1IGQ A;  5FU6 C;  5CKH A;  2JN0 A;  2YUP A;  2CH4 A;  5KYU A;  4MDX A;  1Q81 U;  2LNV A;  1WJR A;  3M0P A;  4J6Y A;  4N0A C;  1OQK A;  1UGR B;  4F7U E;  1B34 A;  4HCB A;  2LC4 A;  3M4G A;  5GAN 8;  2K3Y A;  2DBM A;  3NTH A;  2C0T A;  1C6V X;  1SRM A;  2RHY A;  1CSK A;  3FIF A;  1G8X A;  3EFS A;  2X4J A;  1V1C A;  4AG2 C;  5KYX B;  1RAA B;  1AZG B;  4XU3 A;  1HYO A;  2L3S A;  4A63 B;  1R8O B;  4XTW A;  1JB0 E;  2EQM A;  2K6D A;  5GAN h;  1M90 U;  3CCE T;  1HJD A;  3HRS A;  3OYY A;  1NJI U;  1VQL T;  2KYB A;  1XQH A;  4E7I A;  2KAF A;  1ZQ1 A;  2A08 A;  4FT2 A;  3G71 Q;  4ZGE B;  4JJD A;  4IUR A;  2LCL A;  2VWF A;  1TS9 A;  2QG9 B;  3CBM A;  3HPW A;  1OU9 A;  3V8L A;  2A28 A;  5CQX A;  1MUZ A;  4FU6 A;  2EQJ A;  3JV3 A;  3ZL7 C;  2MWP A;  1K8A C;  5GAO n;  3HRT A;  4AFZ C;  2KVQ G;  1TG0 A;  2IVW A;  2NWM A;  5GAM f;  3JCM e;  1Q81 R;  2LTO A;  3A8L B;  2RJE A;  1H3H A;  4L59 A;  1WNL A;  1OV3 A;  2RD1 A;  2QDY B;  2JZ2 A;  2M51 A;  1OI1 A;  4IUU A;  3OYH A;  2HCK A;  2VGM A;  5FLX E;  1VQM T;  1QP3 A;  1SSF A;  2O01 E;  4BE2 A;  4QQD A;  1B34 B;  4JZ3 A;  2QQR A;  5I2M A;  3L2V A;  2HEQ A;  1VQL Q;  5GMK l;  3SEM A;  1SKU B;  3CCS Q;  4JS5 A;  4FW2 A;  5IHK A;  1VUB A;  2GNC A;  2YUN A;  4K11 A;  3RR6 A;  1WXB A;  1K4U S;  1YJ9 T;  3I55 A;  1VQ8 Q;  1M1K U;  2QA4 A;  1QVF S;  4XU2 A;  1Q82 U;  2Y4X A;  4J9B A;  2K2V A;  2KRM A;  5KYY A;  3TRE A;  4FSS A;  5IXF A;  2ECZ A;  2DD4 A;  4QVC A;  3CCJ Q;  3CCU A;  2J6F A;  1X69 A;  1VQN Q;  3VS6 A;  3J81 E;  2YDL A;  2DYI A;  3OSV A;  3PNW C;  2FG0 A;  1VYT A;  4E47 A;  3URG A;  1G5V A;  2HBP A;  1VQO Q;  3JCM b;  4Z88 A;  4RG8 A;  4M4Z A;  2BIV A;  2BTT A;  4F04 B;  3QUI A;  5A0D A;  2XID A;  5CCA A;  3JSC A;  2DE0 X;  1QVG P;  1Y7X A;  1S1N A;  3CXC A;  4M7D E;  2HDA A;  3OYK A;  2ENM A;  1VQK A;  5C6S A;  1XJW B;  2A7Y A;  1U1S A;  4F7U F;  5KH6 A;  2RQU A;  3VS0 A;  2E6Z A;  3EG9 B;  2DIG A;  4WF2 A;  2ZCF B;  1WXT A;  1AWO A;  2YLC A;  1N27 A;  2HL5 C;  3EG0 A;  2CZ0 B;  2KRN A;  2PNI A;  4KGZ B;  5LJ5 g;  2P0K A;  2LQN A;  3I56 Q;  1MMN A;  4F7U G;  2C0O A;  2HSE B;  3FJP A;  2F2X A;  3CC2 A;  4IIO A;  3GLX A;  4JZ4 A;  3QII A;  1WFW A;  4ZNX A;  4HKE A;  2VC8 A;  3I35 A;  2DA9 A;  4PJL A;  2PZ1 A;  1M90 R;  2GCX A;  2JTF A;  4OML A;  3UT1 A;  1QVP A;  1Q81 C;  4M77 C;  2GTO A;  3HSB A;  2L89 A;  1ZA2 B;  2DPP B;  2OX7 A;  3V7R A;  3PIO A;  1TSF A;  3OYF A;  5J39 A;  5A2Q E;  3EG1 A;  2BZY A;  2HKN A;  5M9O A;  4Q5W A;  1CKA A;  1QVF A;  3V7C A;  1ZSZ C;  2LP5 A;  3QXE B;  2K79 A;  3M0U A;  1MMD A;  2F5T X;  2ROT A;  2M0Y A;  1VQP Q;  1PSF A;  3JB9 F;  1W6X A;  2MAM A;  4KUL A;  3L2R A;  2NUP B;  5AYF A;  5A0L A;  4J6X A;  4RCC A;  1M4Z A;  1I4K 1;  1C1A A;  3THK A;  1ZUK A;  2FRW A;  2K2M A;  4JLI A;  4M75 C;  3SD4 A;  4AFS C;  5LJ3 f;  2RMO A;  4WCI A;  3RMQ A;  4J7I A;  2P4R A;  5GAN 3;  2ZPG B;  1W4S A;  3QJ6 A;  2PUK B;  2E10 A;  3CC4 T;  1BB9 A;  2O4X B;  2DM1 A;  4XK8 E;  5GAN 5;  3JB9 G;  1VQP T;  2KMT A;  4M7A B;  4AG1 C;  3AHU A;  4KT0 E;  4EIK A;  2JT4 A;  2HBW A;  2RJF A;  4C8Q B;  4ESR A;  2K9G A;  3BFM A;  2KRO A;  4PJJ A;  4GBQ A;  3I5R A;  1VQ4 T;  3KXT A;  2X4Y A;  1WI7 A;  3LGF A;  4RTX A;  4M7A E;  3NGP A;  2GF7 A;  1WJS A;  1M1K R;  4LN2 A;  2OTL Q;  1RAI B;  2JM9 A;  4M78 G;  2P0P A;  1T3S A;  3EH1 A;  3OMG A;  4E7S A;  4WTO B;  2X51 A;  5HCK A;  2DLP A;  3MP1 A;  1WZO A;  4OMM A;  5I2S A;  1YHQ Q;  2QK0 A;  3L2U A;  2XMF A;  3H8Z A;  2E70 A;  1N6A A;  2FZC B;  5LJ3 e;  4C5I A;  1NG2 A;  1KQ2 A;  5LL6 S;  3PFS A;  3FC3 A;  1A0N B;  3VU3 C;  1ZUY A;  1BI1 A;  4PKC C;  4RTU A;  1KIK A;  5J3B A;  4OMF B;  1Q86 C;  1UHC A;  1QW1 A;  2XI9 A;  1GBR A;  1PNJ A;  2NUP A;  5CAI A;  5FW9 A;  3M4Y A;  2PQW A;  1VIE A;  1EIF A;  4JDS A;  2E65 A;  2BE7 D;  2EGA A;  3JCM V;  5CR2 A;  1IB8 A;  2RQV A;  1D0X A;  2JS2 A;  5KE2 A;  3E2U A;  3ZEH A;  2QA4 Q;  2RO0 A;  1TTH B;  3KFV A;  1ZSZ B;  4NL2 A;  4C8Q A;  1ABO A;  3VS3 A;  1WHG A;  4M75 A;  4P5N A;  4E7K A;  3P8B B;  2LZ6 B;  1JXO A;  2QYZ A;  3A8G B;  2HNI A;  4IKF A;  4DQ2 A;  3CCV Q;  2YSQ A;  4NOY A;  4M77 F;  3HFN A;  2F5K A;  1K9M U;  1KG1 A;  1KQS S;  1CKB A;  3M9Q A;  3RES A;  1N8R R;  5KYN A;  4B9X A;  1FX7 A;  2QAZ A;  4DBQ A;  1D1A A;  2ATC B;  1EFN A;  2WSE E;  2D8J A;  2Z0W A;  2O9V A;  2EYY A;  3J7A F;  1KHI A;  3EGX A;  2L2P A;  4RCB A;  2J05 A;  4ZN1 A;  3S3N A;  1KC8 R;  3LH5 A;  3C0C A;  5GAM h;  3KBG A;  1RLQ C;  4CRI A;  4DEY A;  3JCM c;  1JU5 C;  4QQ6 A;  1UFF A;  2RI5 A;  3DLM A;  4J5Y A;  1M3A A;  2EYZ A;  3JRZ A;  2K4Y A;  1VQ5 Q;  1AT1 B;  4B9W A;  4C92 D;  1JJ2 S;  3QO3 A;  2IPO B;  4FL6 A;  4OF1 A;  3M0T A;  2JNG A;  2YRD A;  4AFQ C;  2JM8 A;  1YIJ Q;  1QLY A;  4C92 G;  1W2B P;  2WSC E;  1QVF P;  1OOT A;  3FRN A;  1RI9 A;  1Y07 A;  2DNU A;  4M75 B;  5GAN e;  4RTY A;  2OJ2 A;  1X2K A;  4MDW A;  1ZLM A;  4L6V 5;  2NUT B;  3DB3 A;  2DL7 A;  1VQ4 Q;  3JB9 H;  2YRV A;  3ASK A;  4ELZ C;  3REA B;  4C92 F;  4BDZ A;  4ZGD B;  4DBR A;  1HD3 A;  1R0B G;  1WHJ A;  4E6R A;  3MCA B;  1LNX A;  1PSE A;  3NTI A;  4FYV B;  3JCM g;  1VYV A;  3BDU A;  4LD6 A;  1GXI E;  4QQG A;  3PGG A;  2DRM A;  3A98 A;  4HVU A;  3TQ7 P;  3ULR B;  1G3T A;  3MJX A;  3OS1 A;  3VRZ A;  1NPP A;  2JTE A;  3TEE A;  3WVE B;  2HZY A;  2X9H A;  2KY9 A;  4VUB A;  2F2W A;  4JS4 A;  1E6H A;  2DXC A;  4BI3 A;  5AT1 B;  2GFA A;  1AHJ B;  2RJD A;  1WXU A;  4FW1 A;  4MZP A;  2KBT A;  4OB1 B;  2P84 A;  3M56 A;  1M1G A;  3E1S A;  2R57 A;  4OB3 B;  5KYW A;  1D3B B;  4O6J A;  5HK0 A;  5D6Y A;  2QDL A;  2DJZ A;  2RQR A;  1Q82 C;  1FWZ A;  1J3T A;  3C95 A;  3G4S A;  2FHD A;  2DTO A;  1VQM A;  1WHK A;  3G4S T;  4PFO A;  3MEW A;  1NJI R;  4KGV B;  2D0Q B;  3CCU Q;  2V1R A;  3LX7 A;  1ABQ A;  1I81 A;  4QT7 A;  4RTZ A;  2BE9 B;  3H9N A;  3PTA A;  3SB2 A;  4HXJ A;  1MND A;  1YJ9 A;  1V29 B;  3DLL A;  4FYX B;  1LCK A;  3OYC A;  2CYZ B;  1X27 A;  2XIC A;  1ZX6 A;  2YT6 A;  2VGN A;  4J6W A;  1TH7 A;  2DFU A;  1RAF B;  3VJP A;  1IHV A;  4C8Q D;  2V8J A;  5L8R E;  1G3Y A;  2HQX A;  2CZ7 B;  3OYM A;  2DAQ A;  4AFU C;  2G3R A;  3JCM P;  2A0F B;  3DB4 A;  1FYN A;  1S72 Q;  4AMC A;  3BY7 A;  1VQ7 A;  4X9C A;  2P4T A;  4TVR A;  4C8Q C;  5CKE A;  1K0S A;  3A5Z B;  2RK2 A;  3OS5 A;  2XHC A;  3CCM Q;  3RKW A;  4QVZ A;  1YJ9 Q;  2XDB A;  3QHS A;  1UGQ B;  2E5Q A;  1MNE A;  5KYW B;  1D3B A;  2K5L A;  3VUZ A;  2XK0 A;  2FO0 A;  2RQW A;  2JXB A;  3CME Q;  4GLK A;  4M7A G;  4HCK A;  3D7S B;  2J7I A;  1V76 A;  2KYM A;  5FWB A;  2DZC A;  3T9N A;  2CP7 A;  2MIO A;  3ME9 A;  1UEB A;  6AT1 B;  1U06 A;  3REB B;  3N5B B;  3OW2 P;  1R0C B;  2LJ3 A;  2H3E B;  4PLL A;  3CCJ T;  3L42 A;  2RA2 A;  2YWW A;  1VQ9 Q;  3CCL A;  3QDR B;  3CCL T;  3CCV A;  2AKL A;  5EG2 A;  1K73 U;  2AHJ B;  4A4H A;  3H0F A;  1KQS A;  1NE8 A;  4F14 A;  1YNZ A;  4XU0 A;  1VYU A;  3CCM T;  2CH4 W;  2RB6 A;  2RHZ A;  2DZ9 A;  2EYW A;  4PFP A;  2ZZD A;  2JVV A;  3JCM J;  2KT1 A;  2LQK A;  2QQA A;  4X9D A;  4ORZ A;  1PKT A;  5GMK h;  2RI2 A;  1K8A U;  1PCX A;  1QKW A;  3CMA Q;  2HMA A;  2DD5 A;  1ZHI A;  2I2L A;  4M77 D;  2O9S A;  2DXU A;  4BD3 A;  4KGX B;  3A1P A;  1VQM Q;  1EZZ B;  1RL2 A;  2QEX A;  1YI2 A;  1U1T A;  4NS5 A;  3CCR Q;  1YI2 T;  4IUP A;  4OMN A;  2QQB A;  1KD1 R;  3X25 B;  3UPU A;  1IHW A;  2RHX A;  1AWJ A;  5ECA A;  2DRK A;  4QW2 A;  1JJ2 P;  3OYB A;  2FYK A;  3CC7 Q;  1RUW A;  3LGL A;  4OGC A;  2D8H A;  1BI0 A;  3MHX A;  4J8O A;  4F7U B;  2PVO B;  4CC3 A;  4PNO A;  1VQ9 T;  4C5E A;  1YHQ A;  2ZPH B;  4PFZ A;  1UTI A;  1WX6 A;  2EIF A;  2AK5 A;  2XU8 A;  2BZ8 A;  4CC4 B;  5KYY B;  2FVU A;  2GBQ A;  3PMI A;  4C0Z A;  1Q95 G;  8AT1 B;  3C4S A;  2Y4Y A;  5KCO A;  5IAY A;  2M02 A;  2QXF A;  3VUB A;  3CBP A;  4M77 E;  4C5H A;  1PRL C;  9ATC B;  1QKX A;  2A37 A;  1WHH A;  1X01 A;  4EPC A;  4R56 A;  3H0H A;  2B86 A;  3HRU A;  2KNB B;  4J9G A;  4Z8A A;  3CCE A;  5GAM g;  2RK1 A;  4N4G A;  5GAM j;  1K0X A;  2CP0 A;  3M59 A;  3JCM W;  1JJ2 A;  3ZBD A;  1AZE A;  4C0D B;  2RHI A;  3QZ5 B;  1SEM A;  2CUB A;  3H6Z A;  3EGD A;  1UEC A;  4M7D C;  4BI4 A;  4EMK B;  2JTM A;  2L3P A;  2GQV A;  3SDZ A;  2EYX A;  1M9S A;  5CO7 A;  2LNH B;  4M7D A;  4IIM A;  2DVJ A;  2FZK B;  5GAM d;  3SHW A;  2EJF A;  4N0A A;  3EFR A;  3R6N A;  4RTT A;  3FJ5 A;  3M0Q A;  3GNG A;  3X26 B;  4BAC A;  2VKN A;  3CBO A;  4PL6 A;  3S3O A;  1I5O B;  1M30 A;  2F1L A;  1GBQ A;  1YJN T;  2QGG A;  3FDR A;  1AWW A;  2D6F A;  2XDP A;  1TXQ A;  1GCQ A;  1T3L A;  4PLI A;  4C0D C;  1D09 B;  2V8I A;  1N8R C;  1WGS A;  1UGP B;  1B3Q A;  1KC8 C;  4RUG A;  3CD6 T;  4JRK A;  2ESW A;  3CD6 A;  2CP3 A;  1WHL A;  2K3X A;  4KH1 B;  4ZTF A;  4LDU A;  3JCM f;  1HK9 A;  4HA8 A;  1NEG A;  2ABL A;  1RAB B;  3OYE A;  3CC2 Q;  4HVW A;  2CZ1 B;  4PJO G;  1W1F A;  1YFN A;  2DL3 A;  1NLP C;  1XOV A;  3I56 T;  4QKU A;  3OS2 A;  2DL4 A;  4II1 A;  4JJB A;  1N9S A;  2VUB A;  2OI3 A;  1X6O A;  1BKB A;  2H3J A;  4JRI A;  1Z9Z A;  4A53 A;  2A3L A;  1KD1 C;  3EGD B;  4XTX A;  3JCM Q;  2C06 A;  3RDV A;  5DM7 R;  2V26 A;  1LOJ A;  1TUD A;  1M8M A;  1AEY A;  2L5Q A;  3CPW S;  1Q86 R;  3CPW A;  1VQ6 T;  4M7D B;  1D1B A;  2YUQ A;  2QQS A;  1F1B B;  4KBM B;  2X3X D;  3BW1 A;  3OA6 A;  2CT3 A;  5GJV B;  1QWF A;  2BZX A;  4LXC A;  1KQS P;  1OZ2 A;  1YI2 Q;  2K57 A;  2QEX Q;  1NYF A;  2R5A A;  2E3I A;  2ZPE B;  1LVK A;  1SSH A;  3CCS T;  1VQN A;  1XTD A;  2YUO A;  2JOY A;  1JEG A;  2DL8 A;  2W10 A;  3OYN A;  1JQQ A;  3BE3 A;  1YIT A;  1OEB A;  2DTH A;  1WHM A;  5CKD A;  2KE9 A;  3QBY A;  4R0K A;  4HT9 A;  4PJO D;  3HHT B;  4KH0 B;  1GL5 A;  4DEX A;  2EGC A;  4KRT A;  4LNP A;  5GAO m;  2FRY A;  2YLB A;  3E9F A;  1YJN Q;  5CQY A;  2MOX A;  5LJ5 j;  1K9A A;  4M75 F;  4Y28 E;  1X43 A;  1NLO C;  3M57 A;  1IRE B;  3OYG A;  3C12 A;  2DET A;  1BCM A;  5IHI A;  3NFC A;  1VQL A;  3PE0 A;  1JO8 A;  2LQ8 A;  3MEA A;  4MZT A;  2FZG B;  3EAE A;  2RPN A;  4RMO A;  3I5S A;  3HL8 A;  1KSW A;  3GBQ A;  1VQ8 T;  4M7A D;  5LJ3 j;  5KCH A;  1Q86 U;  3CCR T;  1G3W A;  2CSI A;  2FB7 A;  4Z02 A;  4NL3 A;  2NYS A;  3MEU A;  3CME A;  4DOV A;  2C0I A;  2AZS A;  4M75 D;  4BUG A;  3CME T;  1PWT A;  2PUO B;  5KE3 A;  1YCS B;  4ZTJ A;  4LE9 A;  3OYI A;  3TSZ A;  1ZSZ A;  2ED0 A;  3FLG A;  2DEQ A;  4C92 B;  3OBW A;  2RH2 A;  2L0A A;  3O5Z A;  1FMV A;  3QWX X;  2CP6 A;  4BY6 C;  1B7T A;  4J9H A;  2D1X A;  3RIR A;  2FPD A;  1W2B S;  3EFO B;  1PM3 A;  1O9S A;  5CKF A;  4LD9 K;  2FPF A;  3G71 A;  1ZBJ A;  1IZ6 A;  2RQT A;  2DXT A;  1IO6 A;  1NZ9 A;  2LRQ A;  3EGX B;  1X6G A;  3OW2 A;  2L3R A;  2EGE A;  3EG3 A;  2WAC A;  2AT1 B;  1M3C A;  3OYL A;  2CDT A;  5LJ5 e;  3HP9 A;  4CI0 C;  2MF2 A;  4A4K A;  2R58 A;  1YIT Q;  1Q7Y R;  5GMK i;  3V8K A;  2VYT A;  5GAO r;  3GIB A;  1PHT A;  2EQU A;  2LJ1 A;  2D0N A;  2K5F A;  1PD0 A;  3NHN A;  3QG1 A;  4B6M A;  3G6E T;  1WLP B;  3TCJ A;  4C0F A;  5GMK m;  3CCU T;  3LWI A;  5FRO A;  4A54 A;  3RER A;  1OPK A;  4DBH A;  5CIU A;  3U23 A;  3OY9 A;  1JBM A;  2HQH A;  1H92 A;  2YRC A;  3I55 Q;  4C92 A;  3VYG A;  2RI3 A;  1I5L A;  4JRQ A;  3G6E Q;  4M77 B;  4JRP A;  3NMZ C;  2NUT A;  4QVD A;  1OX9 A;  3PVL A;  3OS0 A;  3VS7 A;  3S6W A;  2AKK A;  3MET A;  3EFO A;  5FRM A;  2MPX C;  4M78 F;  2DK3 A;  4LUD A;  4N4H A;  1MV0 B;  2DEU A;  1MMG A;  4FSX A;  1B07 A;  3P8H A;  3GP8 A;  1IXD A;  2CS7 A;  1PRM C;  2KSS A;  3KUF A;  5HK3 A;  4EMG A;  2MCN A;  3JCM X;  5D6X A;  3CMA T;  2Y90 A;  3CC2 T;  1Q7Y C;  1JRI A;  1PC0 A;  1R77 A;  3VV0 A;  3CMA A;  2LX9 A;  5I22 A;  3QWY A;  3CCJ A;  3SFM A;  4FT4 A;  3INZ A;  1RAE B;  2EKO A;  2DIL A;  1QP2 A;  1HXD A;  3PMT A;  5IN1 A;  4FM4 B;  1KD1 U;  3CCM A;  2HQE A;  4V2S A;  2CGH A;  3L2Q A;  1G3S A;  5IHN A;  1SF9 A;  4O5V A;  5LJ5 f;  2JJ9 A;  2OAW A;  4J9E A;  2AIR B;  3IQL A;  1VQ7 Q;  2MI6 A;  2EJG A;  2E6N A;  1VQO T;  5I21 A;  2OTJ T;  4PJN A;  4N4I A;  3VS2 A;  1OX8 A;  1BU1 A;  1RAG B;  5LJ5 h;  1K76 A;  2QTV A;  3CQT A;  2EAY A;  2JMA A;  4HVV A;  2X3W D;  4XAX B;  2B8A A;  1SHG A;  4MMK A;  2QEX T;  1BI3 A;  1GRI A;  1T0H A;  4M77 A;  2XKO C;  2YXY A;  4CC7 A;  1VQ5 A;  3TSW A;  1VQ5 T;  3LWH A;  1UDL A;  2CP2 A;  2CP5 A;  4D8K A;  4A4G A;  5GAM e;  3L1A A;  3QDF A;  1YHQ T;  4OP0 A;  4A4E A;  3S3M A;  2F2V A;  5KYU B;  2OTL T;  1FXX A;  4OGE A;  4LDV A;  3L2Z A;  3A8O B;  1NM7 A;  1YWP A;  2E3H A;  5IH2 A;  4M78 C;  2ZGW A;  2K7A A;  2PVG B;  1BBZ A;  3CPF A;  4BB7 A;  2KT8 A;  1X2Q A;  4DA4 A;  5KYX A;  3G6E A;  2FL7 A;  1E7O A;  4BE0 A;  3JAM E;  4CC2 A;  2PVD B;  4DOW A;  1WA7 A;  2BUD A;  1OUL A;  2KI7 A;  3CCQ Q;  4F17 A;  1MGQ A;  2DL5 A;  4GY5 A;  2DIQ A;  4BY6 B;  1QQJ A;  3V7S A;  1BCO A;  3CCR A;  2LJ0 A;  1WYX A;  1PG5 B;  3EHQ A;  7AT1 B;  5J26 A;  1AWX A;  2EFI A;  2ED1 A;  4BI8 B;  4C92 C;  2VV5 A;  2VXF A;  5FU7 B;  3MP8 A;  4M7A C;  4F16 A;  1BK2 A;  2EW3 A;  4IUT A;  4RTW A;  2RJC A;  4DBF A;  1M8V A;  4PK4 A;  1HSQ A;  2HD0 A;  3QPH A;  1QWE A;  1D1C A; 
#chains in the Genus database with same CATH homology
 1N8R C;  1P92 A;  4D6W A;  1WGS A;  1UGP B;  3E9G A;  4M75 A;  4P5N A;  4E7K A;  1H64 1;  1WJQ A;  3P8B B;  1KC8 C;  5CKB A;  3MP6 A;  3A8G B;  2HNI A;  3CD6 T;  4JRK A;  1BIB A;  5LJ3 d;  3CD6 A;  4XTV A;  5FU7 C;  3PT9 A;  2K3X A;  4IUV A;  4DQ2 A;  2CKK A;  4ZTF A;  3G71 T;  4NOY A;  3RMS A;  4IKF A;  4M77 F;  3HFN A;  2F5K A;  5D6W A;  4E7L A;  2RM4 A;  4LDU A;  3JCM f;  1HK9 A;  4HA8 A;  1K9M U;  1KG1 A;  3RKX A;  3OYE A;  1UGS B;  1KQS S;  3OSS C;  2CZ1 B;  3M9Q A;  4ZN3 A;  4PJO G;  3RES A;  5GAN g;  5LJ3 g;  2HAX A;  2DTI A;  3A8H B;  4B9X A;  1DJ7 B;  1FX7 A;  2IG0 A;  4KUD K;  3SWN B;  1RI0 A;  1XOV A;  2MMP A;  4PJO C;  3OMC A;  3I56 A;  5GMK j;  2XG8 D;  1Q7Y U;  3PIP A;  3JCM d;  1M1F A;  5FRN A;  3Q1J A;  2WSE E;  4R55 A;  3I56 T;  1M1K C;  2P0Q A;  5GAO p;  3OS2 A;  3J7A F;  1KHI A;  4II1 A;  3F70 A;  4ZN1 A;  4RCB A;  3S3N A;  2KQW A;  2LCC A;  2QA4 T;  3BDL A;  1N9S A;  2VUB A;  3HFO A;  4C8Q F;  5GAM h;  1NJI C;  2M0O A;  1X6O A;  1BKB A;  2JUF A;  3KBG A;  4C5G A;  4C8Q E;  5GAO l;  3JB9 D;  1M5Q 1;  2OTJ A;  2EQK A;  2H3J A;  4FIB A;  4JRI A;  3VYH B;  4CRI A;  5GAN 4;  4HT8 A;  3JCM c;  4A53 A;  2A3L A;  3LW5 E;  1KD1 C;  4QQ6 A;  4XTX A;  2RI5 A;  3DLM A;  3JCM Q;  2C06 A;  2LVM A;  3X24 B;  5GAN d;  5DM7 R;  3M5A A;  4J5Y A;  1LOJ A;  3CEY A;  5FU6 B;  4XQ3 A;  2KDS A;  2DXB A;  3QJY A;  3NTK A;  3JB9 I;  2L5Q A;  1YBY A;  3JRZ A;  3CPW S;  2K4Y A;  4B9W A;  4XU1 A;  2PU9 B;  4ELY C;  3CPW A;  1VQ6 T;  5GMK e;  4M7D B;  2OTJ T;  1YCY A;  1VQ7 T;  4C92 D;  2QQS A;  4C8Q G;  4KBM B;  1NPR A;  4LDW A;  1JJ2 S;  5A0G A;  3BW1 A;  4Y91 A;  2DKG A;  4F7U A;  2X35 A;  3QO3 A;  3OA6 A;  4FL6 A;  1OZ2 A;  4OF1 A;  3CCQ T;  1S72 A;  2K57 A;  2YHT A;  5LJ3 h;  2JNG A;  5CK9 A;  1S72 T;  2R5A A;  2RHU A;  2ZPE B;  3GOX A;  3CCS T;  1VQP A;  5FU6 C;  1YIJ T;  5CKH A;  2JN0 A;  1VQN A;  1WQ7 A;  1XTD A;  4C8Q A;  1YIJ A;  4C92 G;  4MDX A;  2WSC E;  2JOY A;  1Q81 U;  1VQN T;  2LNV A;  3FRN A;  1Y07 A;  1WJR A;  2QI2 A;  3OYN A;  4J6Y A;  1YIT A;  3JB9 J;  2DTH A;  4N0A C;  5CKD A;  4M75 B;  3QBY A;  5GAN e;  1UGR B;  2LT1 A;  3HHT B;  4JUV A;  4F7U E;  1K9M C;  4HT9 A;  4PJO D;  1B34 A;  4HCB A;  2LC4 A;  3M4G A;  5GAN 8;  1LJO A;  4MDW A;  2K3Y A;  4L6V 5;  3NTH A;  3DB3 A;  5GAO m;  2KK4 A;  2RHY A;  2YLB A;  3FIF A;  2X4W A;  3E9F A;  2X4J A;  3EFS A;  5CQY A;  3JB9 H;  2YRV A;  3ASK A;  3X20 B;  4EDU A;  4ELZ C;  5LJ5 j;  4XU3 A;  4YTL A;  4M75 F;  4M7D F;  5IT9 E;  1R8O B;  3LH0 A;  4XTW A;  4Y28 E;  4C92 F;  2M1H A;  4BDZ A;  3M57 A;  4E7H A;  3FB9 A;  1JB0 E;  1IRE B;  4ZGD B;  2QTX A;  4LDX A;  2EQM A;  4EMK C;  4HCZ A;  5GAN h;  1M90 U;  3OYG A;  3CCE T;  3C12 A;  4L5G A;  3HRS A;  3OYY A;  1YJW A;  1NJI U;  1VQL T;  2QQ9 A;  3NFC A;  1W2B A;  1YJW T;  3MCA B;  1XQH A;  1VQL A;  4E7I A;  1KQ1 A;  2LQ8 A;  2KAF A;  1ZQ1 A;  4EMK A;  5GAO q;  3RUX A;  1LNX A;  4FT2 A;  3CCV T;  1PSE A;  3MEA A;  2ZPF B;  3NTI A;  3R6O A;  4M77 G;  4MZT A;  3DKM A;  3JCM g;  3BDU A;  3EAE A;  4LD6 A;  4IUR A;  4RMO A;  2LCL A;  1GXI E;  3UDC A;  4QQG A;  3HL8 A;  3PGG A;  3CBM A;  1VQ8 T;  3HPW A;  4M7A D;  4M7D G;  3V8L A;  5CQX A;  1O75 A;  5LJ3 j;  4UC4 A;  1G3T A;  5KCH A;  1Q86 U;  3OS1 A;  3CCR T;  4FU6 A;  1G3W A;  2EQJ A;  1NPP A;  3TEE A;  2FB7 A;  4Z02 A;  2E41 A;  4NL3 A;  3MEU A;  3WVE B;  3CME A;  4DOV A;  1K8A C;  2KY9 A;  2MWP A;  4VUB A;  4M75 D;  4BUG A;  4C0G A;  5GAO n;  3CME T;  3HRT A;  4JS4 A;  2PUO B;  4PJO B;  3VKI A;  2DXC A;  2KVQ G;  3P8D A;  5KE3 A;  2WSF E;  2IVW A;  4ZTJ A;  4M7A F;  4BI3 A;  3OYI A;  5GAM f;  4KUI A;  2GFA A;  1AHJ B;  2RJD A;  3FLG A;  4MZP A;  4OB1 B;  2DEQ A;  3JCM e;  3CC7 A;  4C92 B;  3M56 A;  2RH2 A;  3OBW A;  2LTO A;  1M1G A;  3A8L B;  4ZGJ B;  2RJE A;  3E1S A;  3QYH B;  2R57 A;  4OB3 B;  3MEV A;  4MML A;  1D3B B;  4O6J A;  5HK0 A;  4PJO E;  4L59 A;  5D6Y A;  1WNL A;  4BY6 C;  2RD1 A;  2QDY B;  2DJZ A;  2X4X A;  1Q82 C;  2JZ2 A;  1FWZ A;  3C95 A;  1OI1 A;  2E12 A;  1N8R U;  3JCM h;  3G4S A;  4IUU A;  2FHD A;  2DTO A;  3RIR A;  1VQM A;  3QYG B;  1W2B S;  3OYH A;  3OQ5 A;  3G4S T;  2VGM A;  5FLX E;  3MEW A;  1VQM T;  1QP3 A;  1SSF A;  3WXM B;  1O9S A;  2O01 E;  5C0M A;  5LJ5 d;  5CKF A;  4BE2 A;  4LD9 K;  4QQD A;  3G71 A;  1B34 B;  2D0Q B;  2DO3 A;  4M78 D;  2QQR A;  1IZ6 A;  5I2M A;  3L2V A;  2DXT A;  3LX7 A;  5GMK l;  3GPL A;  1NZ9 A;  2LRQ A;  1WQW A;  4JS5 A;  4LDY A;  1I81 A;  1M90 C;  3G7Z A;  1VUB A;  1H3Z A;  3OW2 A;  2L3R A;  2O4X A;  1VQ4 A;  2WAC A;  1YJ9 T;  3I55 A;  3PTA A;  4M7A A;  2F69 A;  1WPY A;  3SB2 A;  3OYL A;  1YJ9 A;  3I55 T;  1M1K U;  5GAN 6;  1MHN A;  1V29 B;  3DLL A;  5LJ5 e;  2QA4 A;  4ME7 A;  1QVF S;  4XU2 A;  1Q82 U;  2Y4X A;  3HP9 A;  4CI0 C;  2CYZ B;  3OYC A;  2VXE A;  2MF2 A;  2K2V A;  4A4K A;  2R58 A;  4RKU E;  2XIC A;  4E7J A;  1BYM A;  3TRE A;  2VGN A;  5GMK i;  4J6W A;  2VYT A;  3V8K A;  1TH7 A;  5GAO r;  3VJP A;  3GIB A;  2DD4 A;  4QVC A;  2EQU A;  4C8Q D;  2V8J A;  4J83 A;  1G3Y A;  2HQX A;  5L8R E;  2K5F A;  2CZ7 B;  3CCU A;  3QG1 A;  3G6E T;  1BIA A;  3OYM A;  3TCJ A;  2DAQ A;  4C0F A;  5GMK m;  2G3R A;  3J81 E;  3OYJ A;  3LWI A;  3CCU T;  3DB4 A;  3GF5 A;  3OSV A;  5FRO A;  3PNW C;  4E47 A;  3BY7 A;  3URG A;  3ER0 A;  4A54 A;  4JJN K;  3RER A;  3M55 A;  2HBP A;  1G5V A;  3JCM b;  1VQ7 A;  4X9C A;  2P4T A;  4RG8 A;  4TVR A;  4C8Q C;  5CIU A;  5CKE A;  2BIV A;  3A5Z B;  3QZ9 B;  3QUI A;  5A0D A;  2RK2 A;  3OS5 A;  2XHC A;  4BDY A;  3OY9 A;  4PJO A;  3RKW A;  2XID A;  4QVZ A;  1XNI A;  2GFU A;  5CCA A;  3JSC A;  2L8D A;  1JBM A;  3QHS A;  2XDB A;  1Y7X A;  3CXC A;  4M7D E;  4C92 A;  3VYG A;  2RI3 A;  3OYK A;  5DLO A;  1X75 C;  1UGQ B;  2E5Q A;  1VQK A;  5C6S A;  1I5L A;  4JRQ A;  1D3B A;  4IUQ A;  2NLU A;  3M58 A;  3OYA A;  2K5L A;  4M77 B;  3OW2 S;  4JRP A;  2A7Y A;  4QVD A;  1U1S A;  3VUZ A;  4F7U F;  5KH6 A;  1KHC A;  2E6Z A;  2XK0 A;  2CZ6 B;  3OS0 A;  3FEO A;  4GLK A;  4M7A G;  4X34 A;  5DY9 A;  3S6W A;  2DIG A;  3MET A;  4WF2 A;  2ZCF B;  5FRM A;  4M78 F;  2DK3 A;  2ZPB B;  4N4H A;  3QKJ A;  4FSX A;  3J80 E;  3P8H A;  2YLC A;  5CVI A;  1N27 A;  3GP8 A;  2CZ0 B;  2DZC A;  2CS7 A;  3T9N A;  2KSS A;  5LJ5 g;  3KUF A;  2P0K A;  5HK3 A;  4EMG A;  3JCM X;  2M16 A;  3ME9 A;  1UEB A;  5D6X A;  3CMA T;  2Y90 A;  4M78 B;  4F7U G;  3CC2 T;  1Q7Y C;  1JRI A;  3FJP A;  3N5B B;  3VV0 A;  2V8K A;  3CMA A;  4PLL A;  4J7F A;  3CC2 A;  2LX9 A;  3CCJ T;  3L42 A;  2RA2 A;  3CCL A;  3GLX A;  3QDR B;  3SFM A;  3QII A;  4FT4 A;  3CCJ A;  3CCL T;  4HKE A;  2VC8 A;  2EYQ A;  3INZ A;  3CCV A;  4ATO A;  2GCX A;  2JTF A;  5EG2 A;  2EKO A;  3UT1 A;  1K73 U;  2AHJ B;  2LT4 A;  4M78 E;  4A4H A;  1QVP A;  3TU4 K;  1Q81 C;  1QP2 A;  1HXD A;  4M77 C;  2EJ9 A;  1KQS A;  5GAN f;  3HSB A;  1NE8 A;  3PMT A;  5IN1 A;  2L89 A;  2DPP B;  4FM4 B;  1KD1 U;  3V7R A;  3PIO A;  3M53 A;  4XU0 A;  2HQE A;  3OYF A;  3CCM A;  2CGH A;  4V2S A;  3L2Q A;  1G3S A;  5J39 A;  5A2Q E;  3CCM T;  4O5V A;  2RB6 A;  2RHZ A;  5LJ5 f;  2DZ9 A;  1VQO A;  5M9O A;  2MI6 A;  4Q5W A;  2EJG A;  2K5I A;  2ZZD A;  2E6N A;  1I8F A;  2JVV A;  3V7C A;  5I21 A;  3JCM J;  1VQO T;  4HCC A;  1QVF A;  2LQK A;  2QQA A;  5HKC A;  4X9D A;  5GMK h;  2RI2 A;  1K8A U;  4N4I A;  3C94 A;  3QXE B;  2DD5 A;  1Y96 A;  1ZHI A;  2F5T X;  2I2L A;  4M77 D;  3CC7 T;  4M7D D;  5LJ5 h;  4XTZ A;  1ZBX A;  2DXU A;  4XTY A;  1PSF A;  3JB9 F;  4BD3 A;  2EAY A;  2MAM A;  4KUL A;  3L2R A;  4JLG A;  5AYF A;  5A0L A;  1QVG A;  1RL2 A;  4J6X A;  4RCC A;  1M4Z A;  2QEX A;  4XAX B;  1YI2 A;  2B8A A;  1U1T A;  4NS5 A;  2BKD N;  1I4K 1;  4MMK A;  5HY6 A;  2QEX T;  1VQ6 A;  1BI3 A;  4IUP A;  1YI2 T;  4M75 C;  4JLI A;  2XDD A;  2QQB A;  3SD4 A;  2XD0 A;  4M77 A;  3X25 B;  3UPU A;  5LJ3 f;  2RHX A;  3QSU A;  3RMQ A;  2XKO C;  3CCQ A;  4J7I A;  5GAN 3;  4QW2 A;  1VQ5 A;  2ZPG B;  3OYB A;  3CC4 A;  1W4S A;  3QJ6 A;  2PUK B;  2E10 A;  1VQ5 T;  3CC4 T;  2FYK A;  3CXC S;  3LWH A;  2O4X B;  3LGL A;  4OGC A;  4XK8 E;  5GAN 5;  3CCS A;  3JB9 G;  3O8V A;  1BI0 A;  1VQP T;  2KMT A;  3MHX A;  4J8O A;  4M7A B;  2PVO B;  4F7U B;  4KT0 E;  1VQ9 A;  4PJO F;  3AHU A;  4PNO A;  1VQ9 T;  2RJF A;  4C8Q B;  4RG2 A;  4C5E A;  1YHQ A;  2ZPH B;  4A4G A;  5GAM e;  3L1A A;  2EIF A;  1YHQ T;  1VIF A;  2OAU A;  3BFM A;  1YIT T;  4OP0 A;  2DVE A;  2XU8 A;  3OBY A;  1VQ4 T;  4EMH A;  2X4Y A;  3KXT A;  3E19 A;  5GAN j;  3LGF A;  2FVU A;  4A4E A;  3S3M A;  3PMI A;  4C0Z A;  4M78 A;  4M7A E;  4BE1 A;  2GF7 A;  3C4S A;  1WJS A;  1KC8 U;  2OTL T;  2Y4Y A;  3SWN C;  5IAY A;  5KCO A;  1K73 C;  4XTU A;  1FXX A;  4OGE A;  2QXF A;  3A8M B;  3L2Z A;  4LDV A;  3A8O B;  4M78 G;  2OTL A;  2P0P A;  3VUB A;  3CBP A;  4M77 E;  4C5H A;  4M78 C;  3OMG A;  3OYD A;  2ZGW A;  2LDM A;  2PVG B;  1X01 A;  3SWN A;  4EPC A;  4R56 A;  3X28 B;  3CPF A;  4BB7 A;  3LLR A;  3HRU A;  3RKY A;  3MP1 A;  5I2S A;  4OB2 B;  2E1H A;  4DA4 A;  3CCE A;  5GAM g;  3L2U A;  3H8Z A;  3G6E A;  2RK1 A;  4N4G A;  1BI2 A;  5GAM j;  2FL7 A;  2E70 A;  4BE0 A;  2M9U A;  1N6A A;  3M59 A;  3JAM E;  3JCM W;  5LJ3 e;  1JJ2 A;  4C5I A;  2R5M A;  3ZBD A;  1N9R A;  4C0D B;  3ZFJ A;  5LL6 S;  2RHI A;  3PFS A;  3FC3 A;  1KQ2 A;  2PVD B;  3VU3 C;  3QZ5 B;  4DOW A;  3L2W A;  2BUD A;  1BI1 A;  3LYI A;  3H6Z A;  4PKC C;  4MZM A;  2E64 A;  4ZGE B;  3HKS A;  1VQ8 A;  5GAN 7;  1MGQ A;  1U8R A;  5J3B A;  4M7D C;  4OVA A;  2D9T A;  3WVD B;  4BI4 A;  4EMK B;  3GNF B;  4OMF B;  1Y71 A;  1Y96 B;  2JTM A;  4GY5 A;  3V8J A;  2DIQ A;  2GQV A;  1Q86 C;  3SDZ A;  4BY6 B;  3V7S A;  1M9S A;  3CCR A;  1QW1 A;  2XI9 A;  5CO7 A;  1OZ3 A;  5CAI A;  1VQK T;  4C92 E;  4M7D A;  2ZPI B;  5GAM d;  3M4Y A;  4M75 E;  2PQW A;  2EJF A;  4N0A A;  1VIE A;  1EIF A;  3EFR A;  5J26 A;  2EFI A;  4A4F A;  4BI8 B;  4C92 C;  5GAN 2;  4JDS A;  2E65 A;  3JCM P;  3GNG A;  1UB4 A;  3X26 B;  2VV5 A;  2VXF A;  4BAC A;  3MO8 A;  5DLQ E;  5FU7 B;  3CBO A;  4PL6 A;  3S3O A;  3MP8 A;  4OB0 B;  3JCM V;  5CR2 A;  4M7A C;  4IUT A;  2EWN A;  3UWN A;  5KE2 A;  2RJC A;  3ZEH A;  1YJN T;  1M8V A;  2MWO A;  3FDR A;  2RO0 A;  1YJN A;  2D6F A;  3OB9 A;  2HD0 A;  2XDP A;  4M75 G;  3QPH A;  1OYX A;  4NL2 A;  4PLI A;  4C0D C;  1QVG S;  3M54 A;  2V8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...