3META

Crystal structure of sgf29 in complex with h3k4me2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3metA02
3P8HA 3OYDA 2M0OA 3LYIA 2RI5A 4HCZA 3OMGA 4X34A 4BD3A 2RI3A 2RHUA 4B9WA 5IAYA 2E5QA 3L42A 3MP8A 3OMCA 3OYCA 2DAQA 4LD6A 3PNWC 4BDYA 4QQ6A 4C5IA 3OYLA 4PLIA 1N27A 4A4HA 4IKFA 2R5MA 2MWOA 2NLUA 2HQEA 3OS0A 1WJRA 2QQRA 3SD4A 4FU6A 2DIQA 5KE3A 2G3RA 2BUDA 2RHXA 3O8VA 2L89A 3QJ6A 5IN1A 3OYBA 3GOXA 4E7IA 4E7HA 3KUFA 2JTFA 2FHDA 3ME9A 4EDUA 3META 3OB9A 2HQXA 2RJCA 2VYTA 1WJQA 4C5GA 3MP1A 4OVAA 5D6XA 5J26A 4C5HA 2IG0A 3PMTA 4IURA 2GF7A 3MP6A 4BE1A 3OYFA 3S6WA 3F70A 3NTKA 2GFUA 3OYAA 2RJEA 5FRNA 3NTHA 2LCCA 2LVMA 2QQSA 3C4SA 4Q5WA 1OYXA 5FRMA 1RI0A 4UC4A 5CIUA 2RHIA 2RO0A 2GFAA 2RHYA 3MEUA 3OS2A 3H8ZA 4IUPA 2EKOA 5FROA 2LDMA 3PMIA 1H3ZA 3LX7A 3MEAA 4L59A 3ZEHA 3OY9A 4PL6A 3OYGA 3OYNA 2EQUA 3NTIA 4A4FA 3CEYA 3OQ5A 5C6SA 3OYKA 2EQJA 4ZTJA 4N4HA 1WJSA 2R5AA 3E9FA 4QVZA 4E7LA 4IUVA 2O4XA 2X4WA 3FDRA 1XNIA 3DB3A 4FL6A 4BACA 2PQWA 2LTOA 4A4EA 2RHZA 1OZ2A 3M9QA 3FC3A 2O4XB 2R58A 2BKDN 2CKKA 2RJFA 3OA6A 5KCOA 2M1HA 3LH0A 2L3RA 5KH6A 3MEWA 3UWNA 3BDLA 2WACA 5D6WA 3S3OA 1KHCA 2K3XA 3FEOA 4CRIA 4ZTFA 3QBYA 3L2RA 2X35A 2XK0A 3LGFA 4GY5A 3EAEA 3UT1A 4NS5A 1SSFA 2L8DA 3LLRA 2M16A 1MHNA 2EQKA 3ASKA 4N4GA 2RJDA 4C5EA 3QKJA 3L2VA 1OI1A 4B9XA 3OYMA 2DIGA 2F5KA 4II1A 1OZ3A 2P0KA 4PLLA 3OYJA 2EFIA 2YRVA 3OYEA 4IUUA 5C0MA 4QW2A 3P8DA 3L2WA 4E7KA 4A4GA 4IUQA 2EQMA 2XDPA 2MWPA 3MO8A 2D9TA 4IUTA 4BE0A 1G5VA 3LGLA 5M9OA 1WGSA 3Q1JA 4E7JA 4BE2A 3MEVA 3L2UA 2K3YA 2RI2A 3OYIA 2X4XA 2X4YA 3OYHA 3DLMA 3E9GA 5J39A 4BDZA 5D6YA 2R57A 3S3NA 2E6NA 4Z02A 3S3MA 3FLGA 4N4IA 3OS1A 3DB4A 3QIIA 2B8AA 2LRQA 3H6ZA 3PFSA 2BIVA 4QQGA 4RG2A 5KE2A 3L2QA 4QQDA 2JZ2A 5KCHA
chains in the Genus database with same CATH superfamily
2K2VA 2OTLA 3CC4Q 3LYIA 3OMGA 4JRPA 2K57A 3RERA 1MMGA 2PZ1A 3N5BB 1C6VX 3TU4K 3QO3A 2ZPFB 2MYSA 2DTHA 1YJ9T 1N8RR 2QK0A 2G3RA 3ZBDA 1N9RA 3EH1A 1AWJA 4ZGJB 1VQNA 1M3CA 1ZQ1A 5GMKe 1ZUUA 2GFUA 4XU0A 3C4SA 5HY6A 2KBTA 1RABB 1IB8A 4XTYA 1ZSZB 1VYUA 4AFUC 5FU7B 2KYBA 2XI9A 1AZGB 3TVTA 5HCKA 3OY9A 1BI1A 1YJWQ 1LPLA 1K8AC 2CYZB 2H8HA 1WJSA 1C1AA 3RMSA 1XJWB 1KFZA 3FDRA 4FYWB 9ATCB 3VUBA 1UHFA 1Y07A 2RMOA 3CCSA 4M75E 2ZPIB 4HXJA 2FL7A 2M1HA 2WSEE 5A0LA 1GCPA 2WACA 4RTYA 1D1BA 2EWNA 4CRIA 1D1AA 3LGFA 1EIFA 2HNIA 5CCAA 3HFNA 4C0FA 2HL3A 3FJ5A 1PNJA 2KMTA 2DIGA 5IHKA 1WXTA 1NBEB 1VQ6A 1HSQA 4M77F 2HAXA 4J6XA 4JRIA 1G5VA 1BCOA 3QXEB 1T3SA 3JB9D 1X2QA 2E6NA 2EVRA 1Q81C 1IRXA 3CD6A 1Y96A 1Q7YR 1AWWA 2MAMA 3L2ZA 3V8JA 4BD3A 2OTJQ 3OMCA 1SRLA 3VS1A 4C92E 1K76A 2ESWA 2JM8A 1ABOA 1E6GA 4E47A 5GANh 1N27A 4M7AF 5ECAA 3QPHA 4PJOD 2DBKA 4LUDA 1YI2A 2J06A 3G4SA 2DO3A 3O8VA 1IHVA 1LJOA 2JTFA 3I55A 4EMHA 1YCYA 1YIJA 2P0QA 3J7AF 5KYUA 5J26A 1TOVA 2E41A 4JZ4A 1B7TA 3VJPA 2BTTA 2LX7A 1PKTA 3HHTB 1KQSA 2K5LA 5CIUA 4RCCA 1KC8U 4R56A 5FROA 4JRQA 1RLQC 1NZ9A 1I5OB 3REBB 1M8MA 4N0AC 4PFZA 1D1CA 2O9SA 5GAMg 1YITT 3CBOA 3DB3A 3EG2A 3FC3A 1M1FA 1K9AA 3M55A 1HD3A 2L3RA 1VQOA 2KROA 2ZCFB 3H0IA 2YUNA 2FZKB 5FU7C 2D0NA 4RTVA 2YLCA 3QBYA 2COYA 3FRNA 4C0ZA 2J7IA 2DYBA 1Q86C 5GMKl 5LJ5j 4AT1B 2OJ2A 2YRVA 2LQNA 2DERA 5GAN6 4M77A 1JU5C 2H3JA 1VQ8A 3BW1A 4DEXA 2E1HA 5GAMf 4JZ3A 3GLXA 4OGEA 3CCRA 5IHIA 3L2UA 2YT6A 5D6YA 4O5VA 1AOJA 2XU8A 2LRQA 4KULA 5KE2A 5CKEA 3G7ZA 2OTJT 2NUPA 1Q82U 1UGVA 1Y96B 2ZGWA 1VQLQ 4J9EA 3I56Q 2QEXA 1JBMA 3JCMQ 1W6XA 2E64A 4Y28E 3E1SA 2RHXA 2IIMA 4XTVA 4M7DD 1WX6A 1GRIA 1PRMC 2QQAA 5KYUB 1BBZA 4HCCA 3O5ZA 1W2BS 2G6FX 3NTKA 5FWBA 2HBPA 1YJNT 3CCJT 1RI0A 2CUBA 1OEBA 2L2PA 3H8ZA 2RM4A 4DQ2A 2CDTA 1H3ZA 1B07A 4IIOA 4Z8AA 1QVGS 1ARKA 2CP5A 5FLXE 2RF0A 5D7UA 3HKSA 4ZTJA 1VQMA 4QVZA 4PJOE 1PD0A 4C8QF 1M3AA 1SEMA 1YITA 2GQIA 1A0NB 1AWOA 4C92F 1IREB 4C8QG 2XD0A 3THKA 1T0HA 4BUGA 4BY6B 1N8RC 2CKKA 1BCMA 2CP3A 1WFWA 4KBMB 3S3OA 1WIEA 4PFOA 4ORZA 3EG3A 1N5ZA 2M51A 1X43A 1UJYA 4ATOA 1OZ3A 3AT1B 1QCFA 1QVPA 1QLYA 4JLIA 3JB9J 2FRYA 1O9SA 5LJ3g 3CCUA 3PIPA 1WGSA 3LW5E 2YUOA 3PIOA 2MI6A 5GANg 3PFSA 2BIVA 2BZXA 3M0RA 1NE8A 1VQLT 2E5QA 4A53A 1GFCA 3C94A 3I56T 2E3IA 1TH7A 4BDYA 1NLPC 2X4JA 2XMFA 1O75A 1WJRA 2EQIA 3E19A 4ANJA 3QJ6A 5GMKm 2O88A 2MMPA 3A8GB 5GMKj 1E7OA 1RADB 3EFOA 3HPWA 3PMTA 2HKQB 2OTLQ 5GAOn 1VQ4Q 2PNIA 2L0AA 3EHQA 3C12A 3HRTA 5GANf 1YJNA 3CCJA 2CT3A 3QSUA 3LX7A 4HVVA 2NUTA 3RUXA 3CCVA 1OQKA 2FEIA 2KEAA 4JJBA 4PL6A 1LCKA 1Q7YC 4C8QA 4F7UB 3CCLQ 4N4HA 3HP9A 2BE9B 1NYFA 4E7LA 1UHCA 1KD1R 4M7AD 1BIAA 4OMLA 1CKBA 4C92A 4DA4A 1C0MA 5J3BA 2EPDA 1M90U 5CVIA 1KHIA 1VOMA 1B3QA 3UATA 1W2BA 3OA6A 2KNBB 1MV0B 4XU3A 2DTOA 1KHCA 2ENMA 1RAGB 4MZMA 3CC7T 3EAEA 2MK5A 5IT9E 1BI2A 2ZPGB 1RAHB 1IHWA 3L2VA 1OI1A 3A5ZB 2CP2A 3JB9F 1ABQA 2PTKA 2XDDA 2QTVA 2GNCA 2X3XD 3ULRB 3CCSQ 4J7IA 4BY6C 1FMVA 1AEYA 2XDPA 5GAMd 1WYXA 2D9TA 4PK4A 4M78G 1LOJA 4KUIA 5GAN3 2PUKB 1G3YA 2MIOA 1I07A 2A36A 3FIFA 4DBQA 2PVOB 1SKUB 4NL2A 1WLPB 2K5IA 1QQJA 3H6ZA 4PJOF 2RJFA 3JCMP 3WXMB 2MOXA 2M0OA 3RMQA 2YHTA 1QVFA 2CSQA 2X3WD 1VQ6Q 1N6AA 2E4HA 3JCMb 4PLIA 4IKFA 3SFMA 4RTZA 5DLQE 2GCXA 2E65A 3OW2S 2F5TX 5EC7A 4K11A 3META 2HQXA 1UGRB 1YNZA 2O31A 1BB9A 1KG1A 2OTLT 1ZBJA 4JLGA 1B34A 1YBYA 2DLPA 3CD6Q 1PG5B 5GANe 3EGUA 3EFOB 3OSSC 2VB6A 4NOYA 2X51A 2EGEA 4R0KA 4ESRA 2RO0A 3EGDB 2FO0A 2GFAA 2O2OA 3CPFA 2QA4A 2LDMA 1YI2Q 2EYWA 2C06A 2F2WA 3V7RA 3MKDA 3I55Q 1YIJQ 1EX4A 1VQNT 4M75D 2DXUA 2ZAEA 3E9FA 3GF5A 2DETA 2GTJA 2K3BA 2VXEA 4L5GA 2O4XA 2Y4XA 4C8QB 2XICA 3TSZA 1U8RA 2LCLA 3QYHB 4R55A 2QI2A 2A0FB 2FRWA 1RUWA 2QXFA 1K0XA 1BKBA 2YUQA 3GNGA 1K8AU 1NJIR 2KAFA 4J9IA 3LWHA 3INZA 4JUVA 3JCMh 3CC7A 2YSQA 2RN8A 2JVVA 4IUUA 3CCST 2M9UA 4ZN1A 3X20B 1UG1A 4LD9K 1X6GA 2I0NA 4GBQA 1VQOQ 2A37A 4J9GA 4E7JA 4BE2A 4OMFB 3GP8A 3CCMA 3S3NA 4PJOA 3FLGA 4EIKA 3QIIA 4OF1A 4RKUE 1VQ6T 2DXCA 5HK0A 1I1JA 5KYYA 4M7DF 2QGFB 4JS4A 2DL5A 4M7DG 3CCRQ 2VXFA 4CC4B 4FU6A 3JV3A 2DIQA 1OU9A 2DA9A 2DYIA 3M0SA 3JCMV 3KUFA 3ME9A 3SWNC 1Q81U 4EDUA 3CD6T 5LJ3d 3MHXA 2EGAA 2QDLA 2P0PA 2QG9B 2V8KA 5GANd 4M4ZA 2QEXQ 5DM7R 1YI2T 1U5SA 1PHTA 3G4ST 2WSFE 3P8BB 3I55T 1WQWA 1YIJT 3VS0A 1KC8R 4F7UE 3OYNA 3OW2A 2RA2A 4DBFA 4J6WA 4J8OA 1Z9QA 2RQVA 2PQWA 1RACB 2QYZA 2O4XB 2Y4YA 2SEMA 2GTOA 3QDRB 4J9BA 1SHGA 1WDXA 4AFZC 5GAMj 3RKXA 1OPKA 1F1BB 2LQKA 4C0DB 2GBQA 3EHRA 1VQMQ 1TU0B 2F5KA 1PCXA 4PLLA 4CC3A 1VQKA 1YITQ 1PSFA 4KH1B 3M4GA 3BDUA 4PJLA 3JB9I 4RTXA 2RD1A 4M78B 2LNVA 1VQOT 2MCNA 3L1AA 4Z88A 3V8KA 4DBHA 4F04B 1X2KA 1Q86U 1FX7A 3DLMA 1OULA 2VGNA 4XTWA 2LZ6B 1NG2A 1KD1C 3OYDA 1GCQA 2RI5A 4FYVB 4M7DA 1VQ8T 1OV3A 3L42A 3TEEA 1BI3A 3PNWC 3R6OA 4XTZA 5KYNA 3CCRT 3JAME 2ROLA 5GJWB 1D3BA 5AYFA 3CCUQ 1NEGA 3PT9A 4M77G 4JS5A 4WCIA 2CUDA 1EZZB 1TUGB 5CO7A 1K73R 2RK2A 3VKIA 5I2MA 3OB9A 3EG1A 3TSWA 3MP1A 2F69A 2DZ9A 4NL3A 5LL6S 2CP6A 4HVWA 2ED0A 3AHUA 1RI9A 2NWMA 1V29B 1PM3A 5FRNA 4Q5WA 2LCCA 2QEXT 2CREA 1OYXA 3MCAB 5DY9A 4LN2A 3JSCA 2KK4A 1I5LA 5LJ5h 3SDZA 4HA8A 1QP3A 4M7AG 4JPBW 2F2VA 3RBBB 4J83A 1QKWA 1UGSB 2RQUA 1U1SA 2DJZA 1HJDA 1CSKA 1KQSP 1WA7A 4PJNA 1S72A 4PJMA 1ZX6A 2C0IA 2RPNA 2DVJA 2LTOA 2JJ9A 3QZ9B 1R77A 3M58A 1YJNQ 3CCJQ 1IZ6A 5GAOl 2DF6A 1SG5A 2GGRA 4KGXB 5GAOr 4NS5A 2CZ6B 1SSFA 3ASKA 1VQMT 3M0QA 4IIMA 3QKJA 1QWEA 3BE3A 4KH0B 1R0CB 2P0KA 2KT1A 1N8RU 3QZ5B 2EQMA 2H3EB 3WVEB 1ZSZC 3NFCA 1RAFB 1VQ7T 2DM1A 2EW3A 3MEVA 5L23A 1TS9A 2KYMA 2AZSA 2L3PA 3JCMf 4C0DC 2DL7A 3GOXA 3VS3A 2CS7A 1WQ7A 2FZGB 1VQPT 4FSSA 2L3QA 2KI7A 2CZ0B 5LJ3j 2OAUA 4M78C 2DXBA 2JT4A 4Y91A 4A4HA 3CCUT 2NLUA 2EJGA 1NJIC 2VKNA 5IH2A 4E7HA 5GANj 1WHGA 2QDYB 1YWOA 4C5HA 2CP0A 2K6DA 4DEYA 3S6WA 2HD0A 1AT1B 1ZHIA 4X9DA 4M7AA 4M75F 1JQQA 1UTIA 4M75G 2HKNA 2RQWA 4ELZC 2HBWA 3MPUB 3OQ5A 1H8KA 4KUDK 4KGVB 1U06A 4KRTA 1MMDA 1M1KR 3CC4A 1SSHA 1IO6A 4FL6A 2VV5A 3RKWA 1X6OA 4WTOB 1AWXA 2E6ZA 1K9MR 2EBPA 3LH0A 1I4K1 2CP7A 3CCVT 4JJNK 4OMOA 5D6WA 4ZN3A 4HT8A 3FEOA 2KRNA 2C0OA 3VYGA 2MF2A 1Q7YU 4L6V5 3JCMJ 1GFDA 3VS5A 1Y57A 1D0ZA 4PFPA 2D1XA 4RMOA 3OYJA 1R8OB 2CZ7B 3L2WA 4JRKA 3E2UA 5GMKh 1WNLA 1M2OA 4C92G 2RK1A 3OBYA 2SRCA 3JRZA 3JCMe 2K3YA 3SB2A 1MV3A 2X4YA 4LXCA 1VQ7A 1TUCA 2DZCA 2EYZA 2PVDB 3CC7Q 4EMKA 2HZYA 4FIBA 3NPFA 2RHUA 2V26A 1FMWA 3M4YA 1G3WA 5GAOm 1VQPA 4KGZB 2CH4W 1TTHB 1U3OA 4M77B 2VWFA 3SD4A 2KXCA 1M9SA 2DK3A 2BUDA 3UA7A 3CCMQ 2A3LA 2ZPBB 1NPPA 3QG1A 4QVDA 1LNXA 4M75A 2FPEA 1UE9A 3CXCP 2HL5C 2XDBA 1BI0A 2DD5A 3CC2T 2NUPB 4GLMA 4M7AB 1X01A 2V1RA 3CCET 3ZEHA 1ZA2B 3A8LB 3OYGA 5KYXA 1TXQA 3CEYA 3RESA 3PE0A 4ELYC 2ZPHB 2RH2A 2AKKA 1JXMA 2NYSA 4OB0B 5CKBA 1WHLA 2DEQA 2DKGA 2ABLA 4RTWA 1CKAA 3V8LA 3QHSA 2P4TA 1RL2A 4LDYA 2QA4T 3H0FA 2ZPEB 3TREA 2QGGA 3EGXA 4ZTFA 5LJ5f 3JCMW 3L2RA 1K73C 3EG9A 2QQBA 4QKUA 2M16A 1H3HA 1R0BG 2RJDA 4HVUA 1HYOA 1VQNQ 2F1LA 2LT4A 4QW2A 3M0TA 1IXDA 1M4ZA 1JXOA 2JM9A 3A98A 2K5FA 4O6JA 4IUTA 3Q1JA 2C0TA 1GL5A 1ACMB 5IHNA 3GBQA 1PKSA 2X4XA 2J6FA 2R57A 2E5KA 2D8JA 2M02A 1QVGA 1JEGA 3P8HA 2DRKA 1VQKQ 1WHKA 2CZ1B 3OYCA 3JB9G 1M8VA 3OYLA 2YWWA 2R5MA 5HKCA 1X75C 3CCMT 1QVFP 4MZPA 5CAIA 4FT2A 2D6FA 2JS0A 4A4KA 3RIRA 3PGGA 2KY9A 2VYTA 1P92A 4C5GA 2HMAA 2KT8A 4OVAA 2DXTA 3CPWP 3CMEA 2QASA 3F70A 4E7ZA 1VQ9A 1OX8A 4PJOG 3PTAA 4HT9A 1NLOC 4M77C 2DX1A 2EKOA 2JW4A 3CC2A 1OOTA 1N9SA 3CCEA 3CMAA 5KYXB 2K79A 3VS4A 3H41A 2A7YA 5LJ5e 1OZ2A 1XOVA 3OBWA 1YCSB 4M7AC 4FT4A 1M1GA 4D8DA 2BZYA 4PJJA 3G4SQ 3A8HB 3HRSA 5CQXA 3EG9B 2NUTB 4C5EA 3VS2A 2KRMA 5GAN8 5C0MA 1UB4A 2J05A 3J80E 5I2SA 4IUQA 4E2FB 3BFMA 2CSIA 4J9FA 4XQ3A 4C92B 1M2VA 4MDXA 1UEBA 3ZFJA 4E7SA 4N0AA 4Y92A 2KE9A 2DL8A 1VYVA 2E10A 3DKMA 3OYIA 3E9GA 2DPPB 2EYXA 1VQ5T 1M1KC 2O9VA 1VQKT 3L2QA 1MMAA 5KYWA 2RB6A 3QWYA 1G8XA 2GQVA 5A0GA 1UGPB 1DJ7B 3MP8A 3G71A 1K9MC 4LD6A 2DVEA 2MPXC 2P84A 1NM7A 4Z89A 1KK7A 2MWOA 1FYNA 2HQEA 4RUGA 2DNUA 1TUDA 4E7IA 2D0QB 4BI4A 2LQWA 3X28B 1KD1U 3TQ7P 3UPUA 5I22A 2AK5A 4QVCA 3QUIA 2GF7A 4GLKA 2K9GA 2KXDA 3QDFA 3RNJA 3V7CA 5GAMh 2K4YA 1VQ8Q 2RHYA 1JJ2P 4IUPA 3WVDB 2JXBA 4L59A 3IQLA 1H641 2EQUA 5C6SA 5CKFA 2R5AA 1IGUA 1PRLC 2AIRB 4IUVA 4QT7A 4MMKA 1G3SA 2YUPA 2K2MA 2RHZA 1B34B 2PVGB 4FM4B 2VVKA 3X24B 3OW2P 1K4US 4J9HA 5KCOA 4A54A 2DD4A 2BE7D 2K3XA 3ER0A 3CCQA 1SPKA 4OMQA 5GJVB 2KRSA 3LWIA 3LLRA 1MHNA 2EQKA 4N4GA 1S72T 4OMPA 1ZUKA 4C0GA 2FB7A 2HSPA 2PUOB 3EG0A 1W4SA 4LE9A 1VQ4A 4D8KA 1KQSS 4JJDA 2DJQA 1QWFA 5CKHA 1KIKA 2VGMA 3M53A 3I5SA 4P5NA 3HSBA 1SRMA 5A0DA 2LJ3A 5CK9A 3LGLA 3KFVA 2ECZA 1M2VB 3RDVA 5J39A 2EYQA 4MMLA 5CQYA 3VYHB 3CCLA 1EFNA 3DB4A 1VQ5A 2DFUA 5HK3A 5FWCA 1TG0A 2A08A 1WPYA 2IVWA 1LVKA 4HCZA 4C8QC 5KYWB 1AHJB 3G6ET 1YHQA 1BK2A 3NHNA 4C92C 1J3TA 3MJXA 2AZVA 5KE3A 1T3LA 3LH5A 1QCNA 2FHDA 1W1FA 1VQ7Q 1OPLA 4PNOA 1QMCA 1BYMA 4BB7A 2ROTA 2IG0A 7AT1B 3OYFA 3C95A 4PJOB 1X27A 2E70A 2KVQG 1VQPQ 3GIBA 2IPOB 1NJIU 3R6NA 2FPFA 3OS2A 1Q82R 4XAXB 3EFSA 3H9NA 3PMIA 3MEAA 5I11A 5KYYB 3X26B 4OMMA 2COZA 2P4RA 1E6HA 1RAAB 1OU8A 1YN8A 3M5AA 1KQ2A 4HCKA 3SHWA 2W0ZA 3H0HA 1ZSGA 3VS6A 1AD5A 2K7AA 1WXBA 3A8MB 2V8IA 2A28A 4OB1B 4RG8A 2EJFA 2JTMA 2X35A 3QJYA 4M78D 2FZCB 5LJ3h 1X69A 1ZUYA 3CC4T 1MUZA 4OB3B 4C8QE 3P8DA 3I35A 4ZGEB 4A4GA 2DILA 2OX7A 1QW1A 4WF2A 1RLPC 3JCMg 3VU3C 4EPCA 1BU1A 1YWPA 1YJ9A 2RI2A 3OYHA 3CCVQ 1V76A 5AT1B 3G1JA 1WXUA 2LJ1A 3JCMc 3UF4A 4BI3A 4F14A 2XG8D 4J7FA 4AFSC 1JO8A 2VUBA 3V7SA 1WHMA 2OI3A 4JJCA 3G6EA 2ZZDA 2QQRA 3OYBA 1YJWT 1RAEB 2LMJA 3UA6A 4F7UF 4VUBA 2B86A 1I0CA 2L3SA 2DRMA 4LDXA 4F7UG 3VUZA 2BZ8A 1MGQA 3HL8A 1K1ZA 4DOVA 2PU9B 2LVMA 2YRDA 4UC4A 3C0CA 1ZA1B 2RHIA 4M7DB 3MEUA 4FYYB 3OYYA 1VA7A 4X9CA 3M57A 2LT1A 4TVRA 1UDLA 1D3BB 2Z0WA 1V1CA 2EGCA 1UFFA 1ZLMA 3URGA 2FYKA 4PJOC 1KJWA 1TSFA 3CMEQ 1U1TA 2HEQA 1VQ9Q 2NUZA 5GAN5 4A4EA 2COWA 2OAWA 1VIFA 3QYGB 1H92A 3CXCS 5KH6A 2JTEA 3UWNA 1PC0A 3CC2Q 4KT0E 4MDWA 4GY5A 2RQRA 4RCBA 3GNFB 2YLBA 3UT1A 3CBMA 3CCEQ 2DL4A 4FYXB 1M3BA 3CMAQ 2ATCB 3OYMA 2D8HA 2EYYA 2KQWA 5DLOA 2CT4A 3QWXX 4OGCA 4ZNXA 5A2QE 1K73U 1GXIE 1M90R 2QA4Q 2DMOA 4J5YA 2LX9A 4HKEA 3S3MA 2LC4A 1VIEA 2B8AA 2JZ2A 1W70A 4X34A 5IAYA 4V2SA 1I81A 4M78E 2V8JA 3HRUA 5IXFA 1BIBA 4MZTA 2RNAA 3EH2A 1VYTA 3OS0A 3ZL7C 1QCOA 1UJ0A 4F7UA 3PVLA 1KC8C 1XQHA 3HTRA 2JS2A 4OB2B 4ZGDB 4FW2A 1YJWA 2KR3A 4CI0C 5GAN4 4IURA 2LNHB 3MP6A 4BE1A 3T9NA 2YDLA 3G71Q 2X9HA 1G3TA 4JDSA 1M5Q1 5L8RE 4EMGA 4LDVA 4AFQC 3JCMX 4J6YA 4XU1A 1QVFS 4XU2A 4PKCC 5GAMe 3CMET 2DBMA 1VQ9T 2W10A 3JB9H 1XNIA 4DOWA 5LJ5g 4FW1A 3CPWS 5FU6B 3VRZA 4BACA 1NEBA 3M9QA 2XKOC 1GCQC 3FB9A 3BY7A 4M7DC 5GAOq 2DE0X 1WHJA 3MEWA 3SWNA 5I21A 1M30A 1WZOA 1M27C 3M56A 2XK0A 1D0YA 5GMKi 3RR6A 1HXDA 4XTUA 3CMAT 3J81E 1JB0E 4B9XA 2J6KA 2QAZA 5CR2A 3PVQA 3OSVA 2OTJA 1PWTA 2DEUA 1Q82C 1Y0MA 1I8FA 1KQ1A 1PSEA 4B6MA 4BE0A 2E12A 1QKXA 3CXCA 3SEMA 1ZBXA 3CCQQ 2HQHA 4XTXA 4BDZA 1JRIA 2LQ8A 2EAYA 3OS1A 4AG2C 5LJ3f 4M77D 2DTIA 2V1QA 1WI7A 3M0PA 4OMNA 1W2BP 1K8AR 4X1VA 2JMCA 3EGDA 2JUFA 2WSCE 4AG1C 2O01E 2RI3A 4B9WA 2XHCA 1MMNA 2DAQA 4J9CA 4J9DA 4RTTA 3M0UA 5GAN2 1QVGP 2YRCA 3NMZC 1NPRA 3GPLA 1HK9A 1M1KU 1Y7XA 3U23A 2RJCA 1WJQA 5D6XA 1VQ5Q 3JCMd 2KDSA 2M0YA 2QTXA 1UUEA 1K9MU 3G71T 2CH4A 1OX9A 2RJEA 3NTHA 2QQSA 4EMKB 4M7DE 2AKLA 3EFRA 1YHQQ 1IGQA 3UDCA 1FWZA 3CQTA 2KGTA 4LUEA 4RTUA 2YXYA 2FG0A 1D09B 2QQ9A 5FW9A 1SHFA 1Q95G 1K0SA 1D0XA 1VUBA 3NTIA 4A4FA 3OYKA 1MNEA 1FXXA 5IXBA 1Q81R 4CC2A 4M78F 3REAB 1X6BA 4A63B 2R58A 4M75B 4OP0A 8AT1B 4LDUA 3I5RA 1JJ2S 1PD1A 2LCSA 3SWNB 2FPDA 4YTLA 4F17A 3A1PA 4BI8B 2JMAA 4FCYA 1GBQA 1YP5A 2JNGA 2KSSA 3RKYA 3OYEA 1XTDA 5FU6C 4F16A 1VQLA 1T0JA 2MWPA 3FJPA 3I56A 3CPWA 4CC7A 8ATCB 2XIDA 5LJ3e 3CCQT 2HSEB 3OS5A 1Y71A 1Z9ZA 3EGXB 2AHJB 4QQGA 4D6WA 4LDWA 1VQ4T 5KCHA 1S72Q 2JN0A 4E6RA 2HCKA 3DLLA 5GAOp 1UECA 4QQ6A 4C5IA 1WHHA 1YFNA 2EIFA 2EKHA 3VS7A 1QP2A 4AMCA 4FSXA 2L89A 5IN1A 1AVZC 5EG2A 1YJ9Q 4HCBA 1RAIB 2Y90A 3CCLT 3HFOA 3X25B 5GAN7 2E3HA 1Q86R 1TWBA 2L5QA 1YHQT 1ZSZA 3KBGA 3OYAA 2CGHA 5FRMA 4M77E 1M90C 3G6EQ 1FMKA 3VRYA 2EJ9A 3TCJA 3VV0A 2JOYA 2LJ0A 2EQJA 1G2BA 3NGPA 2HDAA 4M78A 2X4WA 6AT1B 2VC8A 2AT1B 3D7SB 4EMKC 2FVUA 4LNPA 2BKDN 4M7AE 1UGQB 3BDLA 4ME7A 2DL3A 4C8QD 3M59A 1SF9A 2L8DA 5CKDA 4C92D 2I2LA 2LP5A 1NYGA 4II1A 2EFIA 1GBRA 1KSWA 3KXTA 1MNDA 4E7KA 3A8OB 1G83A 3I9QA 3MO8A 4M75C 4XK8E 2RQTA 3M54A 1AZEA 5M9OA 3CBPA 5LJ5d 2VASA 4Z02A 1S1NA 4N4IA 1JJ2A 2ED1A 2F2XA 2J6OA 4RG2A 4DBRA 4QQDA
chains in the Genus database with same CATH topology
2K2VA 2OTLA 2M0OA 3RMQA 3LYIA 4BI3A 3OMGA 2YHTA 2RHUA 2XG8D 1QVFA 4JRPA 2K57A 4J7FA 3M4YA 2VUBA 1G3WA 3V7SA 3RERA 5GAOm 1VQPA 1N6AA 3N5BB 3JCMb 4PLIA 3TU4K 4IKFA 3JCMP 3G6EA 4M77B 3SFMA 3QO3A 5DLQE 2ZZDA 2ZPFB 3SD4A 2QQRA 2DTHA 1YJ9T 1M9SA 2DK3A 2E65A 2GCXA 2G3RA 2BUDA 3ZBDA 3OYBA 3OW2S 1YJWT 2F5TX 1N9RA 2A3LA 4VUBA 4F7UF 2ZPBB 1NPPA 3META 3QG1A 2HQXA 1UGRB 4LDXA 1KG1A 2OTLT 4F7UG 4ZGJB 4QVDA 4JLGA 1VQNA 1B34A 1YBYA 1ZQ1A 5GANe 3VUZA 1LNXA 5GMKe 3OSSC 1MGQA 3HL8A 4M75A 4DOVA 2GFUA 4XU0A 2PU9B 2LVMA 4NOYA 3C4SA 5HY6A 2XDBA 4UC4A 4XTYA 1BI0A 2DD5A 2RHIA 2RO0A 3CC2T 4M7DB 2GFAA 4JJNK 3CPFA 3MEUA 3OYYA 2QA4A 4M7AB 1X01A 5FU7B 2LDMA 4X9CA 3CCET 2C06A 3M57A 2XI9A 2LT1A 3ZEHA 3A8LB 3V7RA 3OY9A 3OYGA 4TVRA 1BI1A 1D3BB 3CEYA 3RESA 1VQNT 4ELYC 1K8AC 2ZPHB 2RH2A 4M75D 2CYZB 2DXUA 1WJSA 4OB0B 3E9FA 3GF5A 2VXEA 5CKBA 3RMSA 2FYKA 4L5GA 3URGA 2O4XA 4PJOC 2DEQA 2DKGA 2Y4XA 4C8QB 2XICA 3FDRA 1U1TA 1U8RA 2LCLA 3VUBA 1Y07A 3QYHB 4A4EA 5GAN5 4R55A 4M75E 3CCSA 1VIFA 2QI2A 2ZPIB 3V8LA 3QHSA 2P4TA 1RL2A 3QYGB 4LDYA 2QXFA 2QA4T 3CXCS 2FL7A 3CCJT 2M1HA 2ZPEB 1BKBA 2WSEE 5KH6A 3UWNA 5A0LA 3TREA 2WACA 2EWNA 4CRIA 3GNGA 5LJ5f 4ZTFA 3JCMW 4KT0E 4MDWA 3L2RA 1K73C 2QQBA 4GY5A 3LGFA 4RCBA 1K8AU 3GNFB 1EIFA 2YLBA 2HNIA 3UT1A 2KAFA 3LWHA 2M16A 3CBMA 5CCAA 3HFNA 4C0FA 3INZA 4JUVA 3JCMh 2RJDA 3CC7A 2KMTA 3OYMA 2DIGA 2JVVA 2LT4A 2KQWA 4IUUA 5DLOA 3CCST 2M9UA 4QW2A 4ZN1A 4M7DA 1M4ZA 3X20B 4OGCA 1VQ6A 4M77F 2K5FA 4LD9K 2HAXA 4O6JA 5A2QE 4J6XA 4IUTA 4JRIA 1K73U 1GXIE 1G5VA 3QXEB 3Q1JA 4E7JA 3JB9D 4BE2A 4OMFB 4J5YA 3GP8A 2X4XA 2LX9A 3CCMA 2R57A 3S3NA 2E6NA 4HKEA 3S3MA 4PJOA 3FLGA 2LC4A 3QIIA 4OF1A 1VIEA 2B8AA 1Q81C 1QVGA 3CD6A 2JZ2A 1Y96A 4RKUE 3P8HA 2MAMA 3L2ZA 4X34A 5IAYA 3V8JA 4BD3A 1VQ6T 4V2SA 2DXCA 1I81A 2CZ1B 3OMCA 5HK0A 4M78E 2V8JA 4C92E 3OYCA 3HRUA 3JB9G 4M7DF 1BIBA 1M8VA 3OYLA 4E47A 5GANh 4JS4A 4MZTA 1YJNT 1N27A 4M7AF 2R5MA 3OS0A 4M7DG 2VXFA 5HKCA 4FU6A 3QPHA 4PJOD 1X75C 2DIQA 1YI2A 3G4SA 4F7UA 2DO3A 3O8VA 3CCMT 1KC8C 3JCMV 1LJOA 1XQHA 2JTFA 3KUFA 4OB2B 3I55A 3ME9A 1YCYA 4MZPA 4FT2A 3SWNC 4EMHA 2P0QA 4ZGDB 5CAIA 1YIJA 4EDUA 4A4KA 1YJWA 3J7AF 3RIRA 3PGGA 2KY9A 3CD6T 2VYTA 1P92A 4CI0C 5LJ3d 4C5GA 4OVAA 5J26A 5GAN4 2DXTA 4IURA 3MP6A 4BE1A 3T9NA 3MHXA 2E41A 3CMEA 3F70A 1VQ9A 3VJPA 4PJOG 3PTAA 2P0PA 2V8KA 4HT9A 3HHTB 1KQSA 2K5LA 5CIUA 4M77C 5GANd 1G3TA 5DM7R 4RCCA 1YI2T 3G4ST 1KC8U 4JDSA 4R56A 5FROA 4JRQA 2EKOA 1M5Q1 5L8RE 2WSFE 3CC2A 1NZ9A 3P8BB 4EMGA 1WQWA 3I55T 1YIJT 4LDVA 4F7UE 3OYNA 3JCMX 1N9SA 4N0AC 3CCEA 3OW2A 4J6YA 2RA2A 4XU1A 5GAMg 3CMAA 1YITT 4XU2A 1QVFS 4PKCC 5GAMe 3CMET 4J6WA 4J8OA 1VQ9T 3JB9H 3CBOA 1XNIA 3DB3A 2A7YA 4DOWA 5LJ5g 3CPWS 5FU6B 4BACA 2PQWA 5LJ5e 3FC3A 1OZ2A 3M9QA 2O4XB 2Y4YA 2XKOC 1M1FA 1XOVA 3FB9A 3BY7A 3M55A 3QDRB 5GAOq 4M7DC 3OBWA 2L3RA 1VQOA 5FU7C 2ZCFB 3MEWA 4FT4A 3SWNA 5I21A 4M7AC 1M1GA 2YLCA 3QBYA 3M56A 2XK0A 4EMKA 3A8HB 3HRSA 5GMKi 5GAMj 3FRNA 3RKXA 5CQXA 1HXDA 4XTUA 4C0ZA 3CMAT 2D6FA 3J81E 1Q86C 5GMKl 4C5EA 2LQKA 1JB0E 4B9XA 4C0DB 5LJ5j 5GAN8 2F5KA 4PLLA 1VQKA 2YRVA 1PSFA 5C0MA 5CR2A 5GAN6 4M77A 1UB4A 3OSVA 3J80E 3M4GA 2OTJA 3BDUA 2H3JA 3JB9I 5I2SA 4IUQA 1VQ8A 2RD1A 3BW1A 3BFMA 2E1HA 5GAMf 4M78B 2LNVA 4XQ3A 4C92B 3GLXA 1VQOT 1Q82C 4OGEA 1I8FA 1KQ1A 1PSEA 3L1AA 3CCRA 4BE0A 4MDXA 1UEBA 2E12A 3V8KA 4N0AA 3ZFJA 2E10A 3DKMA 3L2UA 3CXCA 3OYIA 1ZBXA 1Q86U 1FX7A 3DLMA 3E9GA 4XTXA 2DPPB 5D6YA 5A0GA 1JRIA 2VGNA 4BDZA 4O5VA 1VQ5T 2LQ8A 2EAYA 3OS1A 4XTWA 5LJ3f 1M1KC 4M77D 1KD1C 2DTIA 2XU8A 2LRQA 4KULA 5KE2A 3L2QA 1VQKT 5CKEA 3G7ZA 2RB6A 3OYDA 2OTJT 2GQVA 2JUFA 1UGPB 2RI5A 2O01E 2RI3A 1DJ7B 2WSCE 4B9WA 3L42A 2XHCA 1Q82U 1VQ8T 3TEEA 3MP8A 1Y96B 2DAQA 2ZGWA 1BI3A 3PNWC 3R6OA 4LD6A 3G71A 2DVEA 1Q81U 4XTZA 3CCRT 3JAME 2QEXA 1JBMA 2MWOA 3JCMQ 2HQEA 1D3BA 2E64A 4Y28E 5AYFA 5GAN2 3E1SA 1NPRA 3PT9A 4M77G 3GPLA 4JS5A 1HK9A 2RHXA 2D0QB 4BI4A 4E7IA 3X28B 5CO7A 1M1KU 1Y7XA 2RK2A 1KD1U 3UPUA 3VKIA 5I2MA 3OB9A 4XTVA 4M7DD 2RJCA 1WJQA 4QVCA 3MP1A 2F69A 5D6XA 2QQAA 2DZ9A 3QUIA 3JCMd 2KDSA 2GF7A 4GLKA 2QTXA 4NL3A 1K9MU 5LL6S 4HCCA 3G71T 3AHUA 1W2BS 3NTKA 1V29B 2HBPA 2RJEA 3NTHA 2LCCA 2QQSA 4Q5WA 3V7CA 3MCAB 1OYXA 3EFRA 5DY9A 1RI0A 2K4YA 2QEXT 3JSCA 3UDCA 1FWZA 2KK4A 2RHYA 1I5LA 3H8ZA 2RM4A 4IUPA 4DQ2A 5LJ5h 3SDZA 1H3ZA 2QQ9A 4HA8A 3WVDB 1QP3A 4M7AG 1QVGS 4L59A 1H641 1VUBA 2EQUA 3NTIA 4A4FA 4J83A 5FLXE 5C6SA 3OYKA 5CKFA 1UGSB 1FXXA 1U1SA 2DJZA 3HKSA 4ZTJA 2R5AA 1VQMA 4QVZA 1S72A 4PJOE 4C8QF 4IUVA 1YITA 4MMKA 1G3SA 4M78F 4C92F 1IREB 2LTOA 4C8QG 2RHZA 1B34B 2R58A 2PVGB 3QZ9B 4FM4B 3X24B 4BUGA 2XD0A 4BY6B 1N8RC 3M58A 2CKKA 4M75B 5KCOA 4OP0A 4A54A 1IZ6A 2DD4A 5GAOl 4KBMB 3S3OA 2K3XA 3ER0A 4LDUA 1JJ2S 3CCQA 5GAOr 4NS5A 2CZ6B 4YTLA 3SWNB 1SSFA 3LWIA 3LLRA 1MHNA 2EQKA 3ASKA 4BI8B 4N4GA 1VQMT 1S72T 4C0GA 3QKJA 2FB7A 4ATOA 2JNGA 2KSSA 1OZ3A 2P0KA 2PUOB 3RKYA 1W4SA 1XTDA 3OYEA 1VQ4A 1KQSS 5FU6C 5CKHA 1QVPA 1N8RU 2VGMA 3M53A 3QZ5B 1VQLA 2EQMA 4JLIA 3JB9J 4P5NA 1O9SA 2MWPA 3FJPA 3I56A 3CPWA 3HSBA 5GAMh 5A0DA 3WVEB 3JCMc 5CK9A 5LJ3g 3LGLA 3CCUA 3PIPA 2XIDA 5LJ3e 3NFCA 1WGSA 3CCQT 1VQ7T 3MEVA 3LW5E 3OS5A 3PIOA 2MI6A 5J39A 1Y71A 2EYQA 4MMLA 5CQYA 3VYHB 3CCLA 2AHJB 3DB4A 3JCMf 5GANg 3PFSA 4C0DC 4QQGA 2BIVA 4D6WA 4LDWA 5HK3A 3GOXA 1VQ4T 1VQ5A 5KCHA 2CS7A 1WQ7A 1WPYA 2JN0A 2IVWA 1NE8A 4HCZA 4C8QC 5GAOp 3DLLA 1VQPT 1VQLT 2E5QA 4A53A 1AHJB 3C94A 3I56T 3G6ET 2CZ0B 5LJ3j 1TH7A 2OAUA 4M78C 4QQ6A 4C5IA 4C92C 4BDYA 2DXBA 2X4JA 4Y91A 4A4HA 2EIFA 3CCUT 1O75A 2NLUA 1WJRA 1QP2A 2EJGA 4FSXA 3E19A 1NJIC 5KE3A 3QJ6A 2L89A 5IN1A 5EG2A 4HCBA 5GMKm 1YHQA 4E7HA 2Y90A 3CCLT 2MMPA 2FHDA 3HFOA 5GANj 3X25B 3A8GB 5GMKj 5GAN7 2QDYB 4PNOA 5FRNA 3HPWA 1BYMA 4BB7A 4C5HA 2IG0A 3PMTA 3OYFA 3C95A 5GAOn 4PJOB 2L5QA 3S6WA 1YHQT 2HD0A 3KBGA 2E70A 3OYAA 2CGHA 3C12A 1ZHIA 4X9DA 5FRMA 4M7AA 4M75F 2KVQG 4M77E 3GIBA 1M90C 3HRTA 5GANf 1NJIU 1YJNA 3CCJA 3OS2A 4M75G 4XAXB 3EFSA 3PMIA 4ELZC 3LX7A 3MEAA 3QSUA 3X26B 3RUXA 3CCVA 2EJ9A 4PL6A 3OQ5A 3TCJA 4KUDK 3VV0A 2JOYA 1Q7YC 4C8QA 2EQJA 3M5AA 4F7UB 4EMKB 4N4HA 1KQ2A 4M7DE 3HP9A 4E7LA 3CC4A 4M7AD 4M78A 1BIAA 4C92A 4DA4A 2X4WA 2VC8A 2VV5A 4FL6A 5J3BA 1M90U 3A8MB 1X6OA 3RKWA 4EMKC 5CVIA 2FVUA 2V8IA 2E6ZA 2BKDN 1K9MC 1KHIA 1W2BA 4OB1B 3OA6A 4RG8A 4M7AE 1UGQB 3LH0A 2EJFA 1I4K1 4XU3A 4HT8A 2DTOA 3BDLA 4ME7A 2JTMA 1KHCA 5D6WA 3FEOA 4ZN3A 3CCVT 4MZMA 2X35A 4C8QD 3VYGA 2MF2A 3M59A 1Q7YU 3EAEA 3CC7T 4L6V5 3QJYA 1BI2A 2L8DA 5CKDA 5IT9E 2ZPGB 4M78D 5LJ3h 4C92D 3JCMJ 2I2LA 3CC4T 4OB3B 3L2VA 1OI1A 3A5ZB 4RMOA 4C8QE 3JB9F 4II1A 3OYJA 1R8OB 2XDDA 2EFIA 2CZ7B 3KXTA 3P8DA 3L2WA 4E7KA 4ZGEB 4A4GA 3A8OB 4JRKA 4J7IA 4BY6C 5GMKh 1QW1A 2XDPA 3MO8A 5GAMd 2D9TA 1WNLA 4M75C 4WF2A 4XK8E 3M54A 1LOJA 4KUIA 4M78G 3JCMg 4C92G 5GAN3 2PUKB 2RK1A 3OBYA 3VU3C 5M9OA 3JCMe 3JRZA 1G3YA 4EPCA 3CBPA 2K3YA 2RI2A 5LJ5d 1YJ9A 3SB2A 2X4YA 3FIFA 2PVOB 3OYHA 1VQ7A 2DZCA 4Z02A 4NL2A 4N4IA 2PVDB 1JJ2A 2K5IA 3H6ZA 4RG2A 4PJOF 4QQDA 2RJFA 4FIBA 3WXMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8H A;  3OYD A;  2M0O A;  3LYI A;  2RI5 A;  4HCZ A;  3OMG A;  4X34 A;  4BD3 A;  2RI3 A;  2RHU A;  4B9W A;  5IAY A;  2E5Q A;  3L42 A;  3MP8 A;  3OMC A;  3OYC A;  2DAQ A;  4LD6 A;  3PNW C;  4BDY A;  4QQ6 A;  4C5I A;  3OYL A;  4PLI A;  1N27 A;  4A4H A;  4IKF A;  2R5M A;  2MWO A;  2NLU A;  2HQE A;  3OS0 A;  1WJR A;  2QQR A;  3SD4 A;  4FU6 A;  2DIQ A;  5KE3 A;  2G3R A;  2BUD A;  2RHX A;  3O8V A;  2L89 A;  3QJ6 A;  5IN1 A;  3OYB A;  3GOX A;  4E7I A;  4E7H A;  3KUF A;  2JTF A;  2FHD A;  3ME9 A;  4EDU A;  3MET A;  3OB9 A;  2HQX A;  2RJC A;  2VYT A;  1WJQ A;  4C5G A;  3MP1 A;  4OVA A;  5D6X A;  5J26 A;  4C5H A;  2IG0 A;  3PMT A;  4IUR A;  2GF7 A;  3MP6 A;  4BE1 A;  3OYF A;  3S6W A;  3F70 A;  3NTK A;  2GFU A;  3OYA A;  2RJE A;  5FRN A;  3NTH A;  2LCC A;  2LVM A;  2QQS A;  3C4S A;  4Q5W A;  1OYX A;  5FRM A;  1RI0 A;  4UC4 A;  5CIU A;  2RHI A;  2RO0 A;  2GFA A;  2RHY A;  3MEU A;  3OS2 A;  3H8Z A;  4IUP A;  2EKO A;  5FRO A;  2LDM A;  3PMI A;  1H3Z A;  3LX7 A;  3MEA A;  4L59 A;  3ZEH A;  3OY9 A;  4PL6 A;  3OYG A;  3OYN A;  2EQU A;  3NTI A;  4A4F A;  3CEY A;  3OQ5 A;  5C6S A;  3OYK A;  2EQJ A;  4ZTJ A;  4N4H A;  1WJS A;  2R5A A;  3E9F A;  4QVZ A;  4E7L A;  4IUV A;  2O4X A;  2X4W A;  3FDR A;  1XNI A;  3DB3 A;  4FL6 A;  4BAC A;  2PQW A;  2LTO A;  4A4E A;  2RHZ A;  1OZ2 A;  3M9Q A;  3FC3 A;  2O4X B;  2R58 A;  2BKD N;  2CKK A;  2RJF A;  3OA6 A;  5KCO A;  2M1H A;  3LH0 A;  2L3R A;  5KH6 A;  3MEW A;  3UWN A;  3BDL A;  2WAC A;  5D6W A;  3S3O A;  1KHC A;  2K3X A;  3FEO A;  4CRI A;  4ZTF A;  3QBY A;  3L2R A;  2X35 A;  2XK0 A;  3LGF A;  4GY5 A;  3EAE A;  3UT1 A;  4NS5 A;  1SSF A;  2L8D A;  3LLR A;  2M16 A;  1MHN A;  2EQK A;  3ASK A;  4N4G A;  2RJD A;  4C5E A;  3QKJ A;  3L2V A;  1OI1 A;  4B9X A;  3OYM A;  2DIG A;  2F5K A;  4II1 A;  1OZ3 A;  2P0K A;  4PLL A;  3OYJ A;  2EFI A;  2YRV A;  3OYE A;  4IUU A;  5C0M A;  4QW2 A;  3P8D A;  3L2W A;  4E7K A;  4A4G A;  4IUQ A;  2EQM A;  2XDP A;  2MWP A;  3MO8 A;  2D9T A;  4IUT A;  4BE0 A;  1G5V A;  3LGL A;  5M9O A;  1WGS A;  3Q1J A;  4E7J A;  4BE2 A;  3MEV A;  3L2U A;  2K3Y A;  2RI2 A;  3OYI A;  2X4X A;  2X4Y A;  3OYH A;  3DLM A;  3E9G A;  5J39 A;  4BDZ A;  5D6Y A;  2R57 A;  3S3N A;  2E6N A;  4Z02 A;  3S3M A;  3FLG A;  4N4I A;  3OS1 A;  3DB4 A;  3QII A;  2B8A A;  2LRQ A;  3H6Z A;  3PFS A;  2BIV A;  4QQG A;  4RG2 A;  5KE2 A;  3L2Q A;  4QQD A;  2JZ2 A;  5KCH A; 
#chains in the Genus database with same CATH topology
 2K2V A;  2OTL A;  3CC4 Q;  3LYI A;  3OMG A;  4JRP A;  2K57 A;  3RER A;  1MMG A;  2PZ1 A;  3N5B B;  1C6V X;  3TU4 K;  3QO3 A;  2ZPF B;  2MYS A;  2DTH A;  1YJ9 T;  1N8R R;  2QK0 A;  2G3R A;  3ZBD A;  1N9R A;  3EH1 A;  1AWJ A;  4ZGJ B;  1VQN A;  1M3C A;  1ZQ1 A;  5GMK e;  1ZUU A;  2GFU A;  4XU0 A;  3C4S A;  5HY6 A;  2KBT A;  1RAB B;  1IB8 A;  4XTY A;  1ZSZ B;  1VYU A;  4AFU C;  5FU7 B;  2KYB A;  2XI9 A;  1AZG B;  3TVT A;  5HCK A;  3OY9 A;  1BI1 A;  1YJW Q;  1LPL A;  1K8A C;  2CYZ B;  2H8H A;  1WJS A;  1C1A A;  3RMS A;  1XJW B;  1KFZ A;  3FDR A;  4FYW B;  9ATC B;  3VUB A;  1UHF A;  1Y07 A;  2RMO A;  3CCS A;  4M75 E;  2ZPI B;  4HXJ A;  2FL7 A;  2M1H A;  2WSE E;  5A0L A;  1GCP A;  2WAC A;  4RTY A;  1D1B A;  2EWN A;  4CRI A;  1D1A A;  3LGF A;  1EIF A;  2HNI A;  5CCA A;  3HFN A;  4C0F A;  2HL3 A;  3FJ5 A;  1PNJ A;  2KMT A;  2DIG A;  5IHK A;  1WXT A;  1NBE B;  1VQ6 A;  1HSQ A;  4M77 F;  2HAX A;  4J6X A;  4JRI A;  1G5V A;  1BCO A;  3QXE B;  1T3S A;  3JB9 D;  1X2Q A;  2E6N A;  2EVR A;  1Q81 C;  1IRX A;  3CD6 A;  1Y96 A;  1Q7Y R;  1AWW A;  2MAM A;  3L2Z A;  3V8J A;  4BD3 A;  2OTJ Q;  3OMC A;  1SRL A;  3VS1 A;  4C92 E;  1K76 A;  2ESW A;  2JM8 A;  1ABO A;  1E6G A;  4E47 A;  5GAN h;  1N27 A;  4M7A F;  5ECA A;  3QPH A;  4PJO D;  2DBK A;  4LUD A;  1YI2 A;  2J06 A;  3G4S A;  2DO3 A;  3O8V A;  1IHV A;  1LJO A;  2JTF A;  3I55 A;  4EMH A;  1YCY A;  1YIJ A;  2P0Q A;  3J7A F;  5KYU A;  5J26 A;  1TOV A;  2E41 A;  4JZ4 A;  1B7T A;  3VJP A;  2BTT A;  2LX7 A;  1PKT A;  3HHT B;  1KQS A;  2K5L A;  5CIU A;  4RCC A;  1KC8 U;  4R56 A;  5FRO A;  4JRQ A;  1RLQ C;  1NZ9 A;  1I5O B;  3REB B;  1M8M A;  4N0A C;  4PFZ A;  1D1C A;  2O9S A;  5GAM g;  1YIT T;  3CBO A;  3DB3 A;  3EG2 A;  3FC3 A;  1M1F A;  1K9A A;  3M55 A;  1HD3 A;  2L3R A;  1VQO A;  2KRO A;  2ZCF B;  3H0I A;  2YUN A;  2FZK B;  5FU7 C;  2D0N A;  4RTV A;  2YLC A;  3QBY A;  2COY A;  3FRN A;  4C0Z A;  2J7I A;  2DYB A;  1Q86 C;  5GMK l;  5LJ5 j;  4AT1 B;  2OJ2 A;  2YRV A;  2LQN A;  2DER A;  5GAN 6;  4M77 A;  1JU5 C;  2H3J A;  1VQ8 A;  3BW1 A;  4DEX A;  2E1H A;  5GAM f;  4JZ3 A;  3GLX A;  4OGE A;  3CCR A;  5IHI A;  3L2U A;  2YT6 A;  5D6Y A;  4O5V A;  1AOJ A;  2XU8 A;  2LRQ A;  4KUL A;  5KE2 A;  5CKE A;  3G7Z A;  2OTJ T;  2NUP A;  1Q82 U;  1UGV A;  1Y96 B;  2ZGW A;  1VQL Q;  4J9E A;  3I56 Q;  2QEX A;  1JBM A;  3JCM Q;  1W6X A;  2E64 A;  4Y28 E;  3E1S A;  2RHX A;  2IIM A;  4XTV A;  4M7D D;  1WX6 A;  1GRI A;  1PRM C;  2QQA A;  5KYU B;  1BBZ A;  4HCC A;  3O5Z A;  1W2B S;  2G6F X;  3NTK A;  5FWB A;  2HBP A;  1YJN T;  3CCJ T;  1RI0 A;  2CUB A;  1OEB A;  2L2P A;  3H8Z A;  2RM4 A;  4DQ2 A;  2CDT A;  1H3Z A;  1B07 A;  4IIO A;  4Z8A A;  1QVG S;  1ARK A;  2CP5 A;  5FLX E;  2RF0 A;  5D7U A;  3HKS A;  4ZTJ A;  1VQM A;  4QVZ A;  4PJO E;  1PD0 A;  4C8Q F;  1M3A A;  1SEM A;  1YIT A;  2GQI A;  1A0N B;  1AWO A;  4C92 F;  1IRE B;  4C8Q G;  2XD0 A;  3THK A;  1T0H A;  4BUG A;  4BY6 B;  1N8R C;  2CKK A;  1BCM A;  2CP3 A;  1WFW A;  4KBM B;  3S3O A;  1WIE A;  4PFO A;  4ORZ A;  3EG3 A;  1N5Z A;  2M51 A;  1X43 A;  1UJY A;  4ATO A;  1OZ3 A;  3AT1 B;  1QCF A;  1QVP A;  1QLY A;  4JLI A;  3JB9 J;  2FRY A;  1O9S A;  5LJ3 g;  3CCU A;  3PIP A;  1WGS A;  3LW5 E;  2YUO A;  3PIO A;  2MI6 A;  5GAN g;  3PFS A;  2BIV A;  2BZX A;  3M0R A;  1NE8 A;  1VQL T;  2E5Q A;  4A53 A;  1GFC A;  3C94 A;  3I56 T;  2E3I A;  1TH7 A;  4BDY A;  1NLP C;  2X4J A;  2XMF A;  1O75 A;  1WJR A;  2EQI A;  3E19 A;  4ANJ A;  3QJ6 A;  5GMK m;  2O88 A;  2MMP A;  3A8G B;  5GMK j;  1E7O A;  1RAD B;  3EFO A;  3HPW A;  3PMT A;  2HKQ B;  2OTL Q;  5GAO n;  1VQ4 Q;  2PNI A;  2L0A A;  3EHQ A;  3C12 A;  3HRT A;  5GAN f;  1YJN A;  3CCJ A;  2CT3 A;  3QSU A;  3LX7 A;  4HVV A;  2NUT A;  3RUX A;  3CCV A;  1OQK A;  2FEI A;  2KEA A;  4JJB A;  4PL6 A;  1LCK A;  1Q7Y C;  4C8Q A;  4F7U B;  3CCL Q;  4N4H A;  3HP9 A;  2BE9 B;  1NYF A;  4E7L A;  1UHC A;  1KD1 R;  4M7A D;  1BIA A;  4OML A;  1CKB A;  4C92 A;  4DA4 A;  1C0M A;  5J3B A;  2EPD A;  1M90 U;  5CVI A;  1KHI A;  1VOM A;  1B3Q A;  3UAT A;  1W2B A;  3OA6 A;  2KNB B;  1MV0 B;  4XU3 A;  2DTO A;  1KHC A;  2ENM A;  1RAG B;  4MZM A;  3CC7 T;  3EAE A;  2MK5 A;  5IT9 E;  1BI2 A;  2ZPG B;  1RAH B;  1IHW A;  3L2V A;  1OI1 A;  3A5Z B;  2CP2 A;  3JB9 F;  1ABQ A;  2PTK A;  2XDD A;  2QTV A;  2GNC A;  2X3X D;  3ULR B;  3CCS Q;  4J7I A;  4BY6 C;  1FMV A;  1AEY A;  2XDP A;  5GAM d;  1WYX A;  2D9T A;  4PK4 A;  4M78 G;  1LOJ A;  4KUI A;  5GAN 3;  2PUK B;  1G3Y A;  2MIO A;  1I07 A;  2A36 A;  3FIF A;  4DBQ A;  2PVO B;  1SKU B;  4NL2 A;  1WLP B;  2K5I A;  1QQJ A;  3H6Z A;  4PJO F;  2RJF A;  3JCM P;  3WXM B;  2MOX A;  2M0O A;  3RMQ A;  2YHT A;  1QVF A;  2CSQ A;  2X3W D;  1VQ6 Q;  1N6A A;  2E4H A;  3JCM b;  4PLI A;  4IKF A;  3SFM A;  4RTZ A;  5DLQ E;  2GCX A;  2E65 A;  3OW2 S;  2F5T X;  5EC7 A;  4K11 A;  3MET A;  2HQX A;  1UGR B;  1YNZ A;  2O31 A;  1BB9 A;  1KG1 A;  2OTL T;  1ZBJ A;  4JLG A;  1B34 A;  1YBY A;  2DLP A;  3CD6 Q;  1PG5 B;  5GAN e;  3EGU A;  3EFO B;  3OSS C;  2VB6 A;  4NOY A;  2X51 A;  2EGE A;  4R0K A;  4ESR A;  2RO0 A;  3EGD B;  2FO0 A;  2GFA A;  2O2O A;  3CPF A;  2QA4 A;  2LDM A;  1YI2 Q;  2EYW A;  2C06 A;  2F2W A;  3V7R A;  3MKD A;  3I55 Q;  1YIJ Q;  1EX4 A;  1VQN T;  4M75 D;  2DXU A;  2ZAE A;  3E9F A;  3GF5 A;  2DET A;  2GTJ A;  2K3B A;  2VXE A;  4L5G A;  2O4X A;  2Y4X A;  4C8Q B;  2XIC A;  3TSZ A;  1U8R A;  2LCL A;  3QYH B;  4R55 A;  2QI2 A;  2A0F B;  2FRW A;  1RUW A;  2QXF A;  1K0X A;  1BKB A;  2YUQ A;  3GNG A;  1K8A U;  1NJI R;  2KAF A;  4J9I A;  3LWH A;  3INZ A;  4JUV A;  3JCM h;  3CC7 A;  2YSQ A;  2RN8 A;  2JVV A;  4IUU A;  3CCS T;  2M9U A;  4ZN1 A;  3X20 B;  1UG1 A;  4LD9 K;  1X6G A;  2I0N A;  4GBQ A;  1VQO Q;  2A37 A;  4J9G A;  4E7J A;  4BE2 A;  4OMF B;  3GP8 A;  3CCM A;  3S3N A;  4PJO A;  3FLG A;  4EIK A;  3QII A;  4OF1 A;  4RKU E;  1VQ6 T;  2DXC A;  5HK0 A;  1I1J A;  5KYY A;  4M7D F;  2QGF B;  4JS4 A;  2DL5 A;  4M7D G;  3CCR Q;  2VXF A;  4CC4 B;  4FU6 A;  3JV3 A;  2DIQ A;  1OU9 A;  2DA9 A;  2DYI A;  3M0S A;  3JCM V;  3KUF A;  3ME9 A;  3SWN C;  1Q81 U;  4EDU A;  3CD6 T;  5LJ3 d;  3MHX A;  2EGA A;  2QDL A;  2P0P A;  2QG9 B;  2V8K A;  5GAN d;  4M4Z A;  2QEX Q;  5DM7 R;  1YI2 T;  1U5S A;  1PHT A;  3G4S T;  2WSF E;  3P8B B;  3I55 T;  1WQW A;  1YIJ T;  3VS0 A;  1KC8 R;  4F7U E;  3OYN A;  3OW2 A;  2RA2 A;  4DBF A;  4J6W A;  4J8O A;  1Z9Q A;  2RQV A;  2PQW A;  1RAC B;  2QYZ A;  2O4X B;  2Y4Y A;  2SEM A;  2GTO A;  3QDR B;  4J9B A;  1SHG A;  1WDX A;  4AFZ C;  5GAM j;  3RKX A;  1OPK A;  1F1B B;  2LQK A;  4C0D B;  2GBQ A;  3EHR A;  1VQM Q;  1TU0 B;  2F5K A;  1PCX A;  4PLL A;  4CC3 A;  1VQK A;  1YIT Q;  1PSF A;  4KH1 B;  3M4G A;  3BDU A;  4PJL A;  3JB9 I;  4RTX A;  2RD1 A;  4M78 B;  2LNV A;  1VQO T;  2MCN A;  3L1A A;  4Z88 A;  3V8K A;  4DBH A;  4F04 B;  1X2K A;  1Q86 U;  1FX7 A;  3DLM A;  1OUL A;  2VGN A;  4XTW A;  2LZ6 B;  1NG2 A;  1KD1 C;  3OYD A;  1GCQ A;  2RI5 A;  4FYV B;  4M7D A;  1VQ8 T;  1OV3 A;  3L42 A;  3TEE A;  1BI3 A;  3PNW C;  3R6O A;  4XTZ A;  5KYN A;  3CCR T;  3JAM E;  2ROL A;  5GJW B;  1D3B A;  5AYF A;  3CCU Q;  1NEG A;  3PT9 A;  4M77 G;  4JS5 A;  4WCI A;  2CUD A;  1EZZ B;  1TUG B;  5CO7 A;  1K73 R;  2RK2 A;  3VKI A;  5I2M A;  3OB9 A;  3EG1 A;  3TSW A;  3MP1 A;  2F69 A;  2DZ9 A;  4NL3 A;  5LL6 S;  2CP6 A;  4HVW A;  2ED0 A;  3AHU A;  1RI9 A;  2NWM A;  1V29 B;  1PM3 A;  5FRN A;  4Q5W A;  2LCC A;  2QEX T;  2CRE A;  1OYX A;  3MCA B;  5DY9 A;  4LN2 A;  3JSC A;  2KK4 A;  1I5L A;  5LJ5 h;  3SDZ A;  4HA8 A;  1QP3 A;  4M7A G;  4JPB W;  2F2V A;  3RBB B;  4J83 A;  1QKW A;  1UGS B;  2RQU A;  1U1S A;  2DJZ A;  1HJD A;  1CSK A;  1KQS P;  1WA7 A;  4PJN A;  1S72 A;  4PJM A;  1ZX6 A;  2C0I A;  2RPN A;  2DVJ A;  2LTO A;  2JJ9 A;  3QZ9 B;  1R77 A;  3M58 A;  1YJN Q;  3CCJ Q;  1IZ6 A;  5GAO l;  2DF6 A;  1SG5 A;  2GGR A;  4KGX B;  5GAO r;  4NS5 A;  2CZ6 B;  1SSF A;  3ASK A;  1VQM T;  3M0Q A;  4IIM A;  3QKJ A;  1QWE A;  3BE3 A;  4KH0 B;  1R0C B;  2P0K A;  2KT1 A;  1N8R U;  3QZ5 B;  2EQM A;  2H3E B;  3WVE B;  1ZSZ C;  3NFC A;  1RAF B;  1VQ7 T;  2DM1 A;  2EW3 A;  3MEV A;  5L23 A;  1TS9 A;  2KYM A;  2AZS A;  2L3P A;  3JCM f;  4C0D C;  2DL7 A;  3GOX A;  3VS3 A;  2CS7 A;  1WQ7 A;  2FZG B;  1VQP T;  4FSS A;  2L3Q A;  2KI7 A;  2CZ0 B;  5LJ3 j;  2OAU A;  4M78 C;  2DXB A;  2JT4 A;  4Y91 A;  4A4H A;  3CCU T;  2NLU A;  2EJG A;  1NJI C;  2VKN A;  5IH2 A;  4E7H A;  5GAN j;  1WHG A;  2QDY B;  1YWO A;  4C5H A;  2CP0 A;  2K6D A;  4DEY A;  3S6W A;  2HD0 A;  1AT1 B;  1ZHI A;  4X9D A;  4M7A A;  4M75 F;  1JQQ A;  1UTI A;  4M75 G;  2HKN A;  2RQW A;  4ELZ C;  2HBW A;  3MPU B;  3OQ5 A;  1H8K A;  4KUD K;  4KGV B;  1U06 A;  4KRT A;  1MMD A;  1M1K R;  3CC4 A;  1SSH A;  1IO6 A;  4FL6 A;  2VV5 A;  3RKW A;  1X6O A;  4WTO B;  1AWX A;  2E6Z A;  1K9M R;  2EBP A;  3LH0 A;  1I4K 1;  2CP7 A;  3CCV T;  4JJN K;  4OMO A;  5D6W A;  4ZN3 A;  4HT8 A;  3FEO A;  2KRN A;  2C0O A;  3VYG A;  2MF2 A;  1Q7Y U;  4L6V 5;  3JCM J;  1GFD A;  3VS5 A;  1Y57 A;  1D0Z A;  4PFP A;  2D1X A;  4RMO A;  3OYJ A;  1R8O B;  2CZ7 B;  3L2W A;  4JRK A;  3E2U A;  5GMK h;  1WNL A;  1M2O A;  4C92 G;  2RK1 A;  3OBY A;  2SRC A;  3JRZ A;  3JCM e;  2K3Y A;  3SB2 A;  1MV3 A;  2X4Y A;  4LXC A;  1VQ7 A;  1TUC A;  2DZC A;  2EYZ A;  2PVD B;  3CC7 Q;  4EMK A;  2HZY A;  4FIB A;  3NPF A;  2RHU A;  2V26 A;  1FMW A;  3M4Y A;  1G3W A;  5GAO m;  1VQP A;  4KGZ B;  2CH4 W;  1TTH B;  1U3O A;  4M77 B;  2VWF A;  3SD4 A;  2KXC A;  1M9S A;  2DK3 A;  2BUD A;  3UA7 A;  3CCM Q;  2A3L A;  2ZPB B;  1NPP A;  3QG1 A;  4QVD A;  1LNX A;  4M75 A;  2FPE A;  1UE9 A;  3CXC P;  2HL5 C;  2XDB A;  1BI0 A;  2DD5 A;  3CC2 T;  2NUP B;  4GLM A;  4M7A B;  1X01 A;  2V1R A;  3CCE T;  3ZEH A;  1ZA2 B;  3A8L B;  3OYG A;  5KYX A;  1TXQ A;  3CEY A;  3RES A;  3PE0 A;  4ELY C;  2ZPH B;  2RH2 A;  2AKK A;  1JXM A;  2NYS A;  4OB0 B;  5CKB A;  1WHL A;  2DEQ A;  2DKG A;  2ABL A;  4RTW A;  1CKA A;  3V8L A;  3QHS A;  2P4T A;  1RL2 A;  4LDY A;  2QA4 T;  3H0F A;  2ZPE B;  3TRE A;  2QGG A;  3EGX A;  4ZTF A;  5LJ5 f;  3JCM W;  3L2R A;  1K73 C;  3EG9 A;  2QQB A;  4QKU A;  2M16 A;  1H3H A;  1R0B G;  2RJD A;  4HVU A;  1HYO A;  1VQN Q;  2F1L A;  2LT4 A;  4QW2 A;  3M0T A;  1IXD A;  1M4Z A;  1JXO A;  2JM9 A;  3A98 A;  2K5F A;  4O6J A;  4IUT A;  3Q1J A;  2C0T A;  1GL5 A;  1ACM B;  5IHN A;  3GBQ A;  1PKS A;  2X4X A;  2J6F A;  2R57 A;  2E5K A;  2D8J A;  2M02 A;  1QVG A;  1JEG A;  3P8H A;  2DRK A;  1VQK Q;  1WHK A;  2CZ1 B;  3OYC A;  3JB9 G;  1M8V A;  3OYL A;  2YWW A;  2R5M A;  5HKC A;  1X75 C;  3CCM T;  1QVF P;  4MZP A;  5CAI A;  4FT2 A;  2D6F A;  2JS0 A;  4A4K A;  3RIR A;  3PGG A;  2KY9 A;  2VYT A;  1P92 A;  4C5G A;  2HMA A;  2KT8 A;  4OVA A;  2DXT A;  3CPW P;  3CME A;  2QAS A;  3F70 A;  4E7Z A;  1VQ9 A;  1OX8 A;  4PJO G;  3PTA A;  4HT9 A;  1NLO C;  4M77 C;  2DX1 A;  2EKO A;  2JW4 A;  3CC2 A;  1OOT A;  1N9S A;  3CCE A;  3CMA A;  5KYX B;  2K79 A;  3VS4 A;  3H41 A;  2A7Y A;  5LJ5 e;  1OZ2 A;  1XOV A;  3OBW A;  1YCS B;  4M7A C;  4FT4 A;  1M1G A;  4D8D A;  2BZY A;  4PJJ A;  3G4S Q;  3A8H B;  3HRS A;  5CQX A;  3EG9 B;  2NUT B;  4C5E A;  3VS2 A;  2KRM A;  5GAN 8;  5C0M A;  1UB4 A;  2J05 A;  3J80 E;  5I2S A;  4IUQ A;  4E2F B;  3BFM A;  2CSI A;  4J9F A;  4XQ3 A;  4C92 B;  1M2V A;  4MDX A;  1UEB A;  3ZFJ A;  4E7S A;  4N0A A;  4Y92 A;  2KE9 A;  2DL8 A;  1VYV A;  2E10 A;  3DKM A;  3OYI A;  3E9G A;  2DPP B;  2EYX A;  1VQ5 T;  1M1K C;  2O9V A;  1VQK T;  3L2Q A;  1MMA A;  5KYW A;  2RB6 A;  3QWY A;  1G8X A;  2GQV A;  5A0G A;  1UGP B;  1DJ7 B;  3MP8 A;  3G71 A;  1K9M C;  4LD6 A;  2DVE A;  2MPX C;  2P84 A;  1NM7 A;  4Z89 A;  1KK7 A;  2MWO A;  1FYN A;  2HQE A;  4RUG A;  2DNU A;  1TUD A;  4E7I A;  2D0Q B;  4BI4 A;  2LQW A;  3X28 B;  1KD1 U;  3TQ7 P;  3UPU A;  5I22 A;  2AK5 A;  4QVC A;  3QUI A;  2GF7 A;  4GLK A;  2K9G A;  2KXD A;  3QDF A;  3RNJ A;  3V7C A;  5GAM h;  2K4Y A;  1VQ8 Q;  2RHY A;  1JJ2 P;  4IUP A;  3WVD B;  2JXB A;  4L59 A;  3IQL A;  1H64 1;  2EQU A;  5C6S A;  5CKF A;  2R5A A;  1IGU A;  1PRL C;  2AIR B;  4IUV A;  4QT7 A;  4MMK A;  1G3S A;  2YUP A;  2K2M A;  2RHZ A;  1B34 B;  2PVG B;  4FM4 B;  2VVK A;  3X24 B;  3OW2 P;  1K4U S;  4J9H A;  5KCO A;  4A54 A;  2DD4 A;  2BE7 D;  2K3X A;  3ER0 A;  3CCQ A;  1SPK A;  4OMQ A;  5GJV B;  2KRS A;  3LWI A;  3LLR A;  1MHN A;  2EQK A;  4N4G A;  1S72 T;  4OMP A;  1ZUK A;  4C0G A;  2FB7 A;  2HSP A;  2PUO B;  3EG0 A;  1W4S A;  4LE9 A;  1VQ4 A;  4D8K A;  1KQS S;  4JJD A;  2DJQ A;  1QWF A;  5CKH A;  1KIK A;  2VGM A;  3M53 A;  3I5S A;  4P5N A;  3HSB A;  1SRM A;  5A0D A;  2LJ3 A;  5CK9 A;  3LGL A;  3KFV A;  2ECZ A;  1M2V B;  3RDV A;  5J39 A;  2EYQ A;  4MML A;  5CQY A;  3VYH B;  3CCL A;  1EFN A;  3DB4 A;  1VQ5 A;  2DFU A;  5HK3 A;  5FWC A;  1TG0 A;  2A08 A;  1WPY A;  2IVW A;  1LVK A;  4HCZ A;  4C8Q C;  5KYW B;  1AHJ B;  3G6E T;  1YHQ A;  1BK2 A;  3NHN A;  4C92 C;  1J3T A;  3MJX A;  2AZV A;  5KE3 A;  1T3L A;  3LH5 A;  1QCN A;  2FHD A;  1W1F A;  1VQ7 Q;  1OPL A;  4PNO A;  1QMC A;  1BYM A;  4BB7 A;  2ROT A;  2IG0 A;  7AT1 B;  3OYF A;  3C95 A;  4PJO B;  1X27 A;  2E70 A;  2KVQ G;  1VQP Q;  3GIB A;  2IPO B;  1NJI U;  3R6N A;  2FPF A;  3OS2 A;  1Q82 R;  4XAX B;  3EFS A;  3H9N A;  3PMI A;  3MEA A;  5I11 A;  5KYY B;  3X26 B;  4OMM A;  2COZ A;  2P4R A;  1E6H A;  1RAA B;  1OU8 A;  1YN8 A;  3M5A A;  1KQ2 A;  4HCK A;  3SHW A;  2W0Z A;  3H0H A;  1ZSG A;  3VS6 A;  1AD5 A;  2K7A A;  1WXB A;  3A8M B;  2V8I A;  2A28 A;  4OB1 B;  4RG8 A;  2EJF A;  2JTM A;  2X35 A;  3QJY A;  4M78 D;  2FZC B;  5LJ3 h;  1X69 A;  1ZUY A;  3CC4 T;  1MUZ A;  4OB3 B;  4C8Q E;  3P8D A;  3I35 A;  4ZGE B;  4A4G A;  2DIL A;  2OX7 A;  1QW1 A;  4WF2 A;  1RLP C;  3JCM g;  3VU3 C;  4EPC A;  1BU1 A;  1YWP A;  1YJ9 A;  2RI2 A;  3OYH A;  3CCV Q;  1V76 A;  5AT1 B;  3G1J A;  1WXU A;  2LJ1 A;  3JCM c;  3UF4 A;  4BI3 A;  4F14 A;  2XG8 D;  4J7F A;  4AFS C;  1JO8 A;  2VUB A;  3V7S A;  1WHM A;  2OI3 A;  4JJC A;  3G6E A;  2ZZD A;  2QQR A;  3OYB A;  1YJW T;  1RAE B;  2LMJ A;  3UA6 A;  4F7U F;  4VUB A;  2B86 A;  1I0C A;  2L3S A;  2DRM A;  4LDX A;  4F7U G;  3VUZ A;  2BZ8 A;  1MGQ A;  3HL8 A;  1K1Z A;  4DOV A;  2PU9 B;  2LVM A;  2YRD A;  4UC4 A;  3C0C A;  1ZA1 B;  2RHI A;  4M7D B;  3MEU A;  4FYY B;  3OYY A;  1VA7 A;  4X9C A;  3M57 A;  2LT1 A;  4TVR A;  1UDL A;  1D3B B;  2Z0W A;  1V1C A;  2EGC A;  1UFF A;  1ZLM A;  3URG A;  2FYK A;  4PJO C;  1KJW A;  1TSF A;  3CME Q;  1U1T A;  2HEQ A;  1VQ9 Q;  2NUZ A;  5GAN 5;  4A4E A;  2COW A;  2OAW A;  1VIF A;  3QYG B;  1H92 A;  3CXC S;  5KH6 A;  2JTE A;  3UWN A;  1PC0 A;  3CC2 Q;  4KT0 E;  4MDW A;  4GY5 A;  2RQR A;  4RCB A;  3GNF B;  2YLB A;  3UT1 A;  3CBM A;  3CCE Q;  2DL4 A;  4FYX B;  1M3B A;  3CMA Q;  2ATC B;  3OYM A;  2D8H A;  2EYY A;  2KQW A;  5DLO A;  2CT4 A;  3QWX X;  4OGC A;  4ZNX A;  5A2Q E;  1K73 U;  1GXI E;  1M90 R;  2QA4 Q;  2DMO A;  4J5Y A;  2LX9 A;  4HKE A;  3S3M A;  2LC4 A;  1VIE A;  2B8A A;  2JZ2 A;  1W70 A;  4X34 A;  5IAY A;  4V2S A;  1I81 A;  4M78 E;  2V8J A;  3HRU A;  5IXF A;  1BIB A;  4MZT A;  2RNA A;  3EH2 A;  1VYT A;  3OS0 A;  3ZL7 C;  1QCO A;  1UJ0 A;  4F7U A;  3PVL A;  1KC8 C;  1XQH A;  3HTR A;  2JS2 A;  4OB2 B;  4ZGD B;  4FW2 A;  1YJW A;  2KR3 A;  4CI0 C;  5GAN 4;  4IUR A;  2LNH B;  3MP6 A;  4BE1 A;  3T9N A;  2YDL A;  3G71 Q;  2X9H A;  1G3T A;  4JDS A;  1M5Q 1;  5L8R E;  4EMG A;  4LDV A;  4AFQ C;  3JCM X;  4J6Y A;  4XU1 A;  1QVF S;  4XU2 A;  4PKC C;  5GAM e;  3CME T;  2DBM A;  1VQ9 T;  2W10 A;  3JB9 H;  1XNI A;  4DOW A;  5LJ5 g;  4FW1 A;  3CPW S;  5FU6 B;  3VRZ A;  4BAC A;  1NEB A;  3M9Q A;  2XKO C;  1GCQ C;  3FB9 A;  3BY7 A;  4M7D C;  5GAO q;  2DE0 X;  1WHJ A;  3MEW A;  3SWN A;  5I21 A;  1M30 A;  1WZO A;  1M27 C;  3M56 A;  2XK0 A;  1D0Y A;  5GMK i;  3RR6 A;  1HXD A;  4XTU A;  3CMA T;  3J81 E;  1JB0 E;  4B9X A;  2J6K A;  2QAZ A;  5CR2 A;  3PVQ A;  3OSV A;  2OTJ A;  1PWT A;  2DEU A;  1Q82 C;  1Y0M A;  1I8F A;  1KQ1 A;  1PSE A;  4B6M A;  4BE0 A;  2E12 A;  1QKX A;  3CXC A;  3SEM A;  1ZBX A;  3CCQ Q;  2HQH A;  4XTX A;  4BDZ A;  1JRI A;  2LQ8 A;  2EAY A;  3OS1 A;  4AG2 C;  5LJ3 f;  4M77 D;  2DTI A;  2V1Q A;  1WI7 A;  3M0P A;  4OMN A;  1W2B P;  1K8A R;  4X1V A;  2JMC A;  3EGD A;  2JUF A;  2WSC E;  4AG1 C;  2O01 E;  2RI3 A;  4B9W A;  2XHC A;  1MMN A;  2DAQ A;  4J9C A;  4J9D A;  4RTT A;  3M0U A;  5GAN 2;  1QVG P;  2YRC A;  3NMZ C;  1NPR A;  3GPL A;  1HK9 A;  1M1K U;  1Y7X A;  3U23 A;  2RJC A;  1WJQ A;  5D6X A;  1VQ5 Q;  3JCM d;  2KDS A;  2M0Y A;  2QTX A;  1UUE A;  1K9M U;  3G71 T;  2CH4 A;  1OX9 A;  2RJE A;  3NTH A;  2QQS A;  4EMK B;  4M7D E;  2AKL A;  3EFR A;  1YHQ Q;  1IGQ A;  3UDC A;  1FWZ A;  3CQT A;  2KGT A;  4LUE A;  4RTU A;  2YXY A;  2FG0 A;  1D09 B;  2QQ9 A;  5FW9 A;  1SHF A;  1Q95 G;  1K0S A;  1D0X A;  1VUB A;  3NTI A;  4A4F A;  3OYK A;  1MNE A;  1FXX A;  5IXB A;  1Q81 R;  4CC2 A;  4M78 F;  3REA B;  1X6B A;  4A63 B;  2R58 A;  4M75 B;  4OP0 A;  8AT1 B;  4LDU A;  3I5R A;  1JJ2 S;  1PD1 A;  2LCS A;  3SWN B;  2FPD A;  4YTL A;  4F17 A;  3A1P A;  4BI8 B;  2JMA A;  4FCY A;  1GBQ A;  1YP5 A;  2JNG A;  2KSS A;  3RKY A;  3OYE A;  1XTD A;  5FU6 C;  4F16 A;  1VQL A;  1T0J A;  2MWP A;  3FJP A;  3I56 A;  3CPW A;  4CC7 A;  8ATC B;  2XID A;  5LJ3 e;  3CCQ T;  2HSE B;  3OS5 A;  1Y71 A;  1Z9Z A;  3EGX B;  2AHJ B;  4QQG A;  4D6W A;  4LDW A;  1VQ4 T;  5KCH A;  1S72 Q;  2JN0 A;  4E6R A;  2HCK A;  3DLL A;  5GAO p;  1UEC A;  4QQ6 A;  4C5I A;  1WHH A;  1YFN A;  2EIF A;  2EKH A;  3VS7 A;  1QP2 A;  4AMC A;  4FSX A;  2L89 A;  5IN1 A;  1AVZ C;  5EG2 A;  1YJ9 Q;  4HCB A;  1RAI B;  2Y90 A;  3CCL T;  3HFO A;  3X25 B;  5GAN 7;  2E3H A;  1Q86 R;  1TWB A;  2L5Q A;  1YHQ T;  1ZSZ A;  3KBG A;  3OYA A;  2CGH A;  5FRM A;  4M77 E;  1M90 C;  3G6E Q;  1FMK A;  3VRY A;  2EJ9 A;  3TCJ A;  3VV0 A;  2JOY A;  2LJ0 A;  2EQJ A;  1G2B A;  3NGP A;  2HDA A;  4M78 A;  2X4W A;  6AT1 B;  2VC8 A;  2AT1 B;  3D7S B;  4EMK C;  2FVU A;  4LNP A;  2BKD N;  4M7A E;  1UGQ B;  3BDL A;  4ME7 A;  2DL3 A;  4C8Q D;  3M59 A;  1SF9 A;  2L8D A;  5CKD A;  4C92 D;  2I2L A;  2LP5 A;  1NYG A;  4II1 A;  2EFI A;  1GBR A;  1KSW A;  3KXT A;  1MND A;  4E7K A;  3A8O B;  1G83 A;  3I9Q A;  3MO8 A;  4M75 C;  4XK8 E;  2RQT A;  3M54 A;  1AZE A;  5M9O A;  3CBP A;  5LJ5 d;  2VAS A;  4Z02 A;  1S1N A;  4N4I A;  1JJ2 A;  2ED1 A;  2F2X A;  2J6O A;  4RG2 A;  4DBR A;  4QQD A; 
#chains in the Genus database with same CATH homology
 2K2V A;  2OTL A;  2M0O A;  3RMQ A;  3LYI A;  4BI3 A;  3OMG A;  2YHT A;  2RHU A;  2XG8 D;  1QVF A;  4JRP A;  2K57 A;  4J7F A;  3M4Y A;  2VUB A;  1G3W A;  3V7S A;  3RER A;  5GAO m;  1VQP A;  1N6A A;  3N5B B;  3JCM b;  4PLI A;  3TU4 K;  4IKF A;  3JCM P;  3G6E A;  4M77 B;  3SFM A;  3QO3 A;  5DLQ E;  2ZZD A;  2ZPF B;  3SD4 A;  2QQR A;  2DTH A;  1YJ9 T;  1M9S A;  2DK3 A;  2E65 A;  2GCX A;  2G3R A;  2BUD A;  3ZBD A;  3OYB A;  3OW2 S;  1YJW T;  2F5T X;  1N9R A;  2A3L A;  4VUB A;  4F7U F;  2ZPB B;  1NPP A;  3MET A;  3QG1 A;  2HQX A;  1UGR B;  4LDX A;  1KG1 A;  2OTL T;  4F7U G;  4ZGJ B;  4QVD A;  4JLG A;  1VQN A;  1B34 A;  1YBY A;  1ZQ1 A;  5GAN e;  3VUZ A;  1LNX A;  5GMK e;  3OSS C;  1MGQ A;  3HL8 A;  4M75 A;  4DOV A;  2GFU A;  4XU0 A;  2PU9 B;  2LVM A;  4NOY A;  3C4S A;  5HY6 A;  2XDB A;  4UC4 A;  4XTY A;  1BI0 A;  2DD5 A;  2RHI A;  2RO0 A;  3CC2 T;  4M7D B;  2GFA A;  4JJN K;  3CPF A;  3MEU A;  3OYY A;  2QA4 A;  4M7A B;  1X01 A;  5FU7 B;  2LDM A;  4X9C A;  3CCE T;  2C06 A;  3M57 A;  2XI9 A;  2LT1 A;  3ZEH A;  3A8L B;  3V7R A;  3OY9 A;  3OYG A;  4TVR A;  1BI1 A;  1D3B B;  3CEY A;  3RES A;  1VQN T;  4ELY C;  1K8A C;  2ZPH B;  2RH2 A;  4M75 D;  2CYZ B;  2DXU A;  1WJS A;  4OB0 B;  3E9F A;  3GF5 A;  2VXE A;  5CKB A;  3RMS A;  2FYK A;  4L5G A;  3URG A;  2O4X A;  4PJO C;  2DEQ A;  2DKG A;  2Y4X A;  4C8Q B;  2XIC A;  3FDR A;  1U1T A;  1U8R A;  2LCL A;  3VUB A;  1Y07 A;  3QYH B;  4A4E A;  5GAN 5;  4R55 A;  4M75 E;  3CCS A;  1VIF A;  2QI2 A;  2ZPI B;  3V8L A;  3QHS A;  2P4T A;  1RL2 A;  3QYG B;  4LDY A;  2QXF A;  2QA4 T;  3CXC S;  2FL7 A;  3CCJ T;  2M1H A;  2ZPE B;  1BKB A;  2WSE E;  5KH6 A;  3UWN A;  5A0L A;  3TRE A;  2WAC A;  2EWN A;  4CRI A;  3GNG A;  5LJ5 f;  4ZTF A;  3JCM W;  4KT0 E;  4MDW A;  3L2R A;  1K73 C;  2QQB A;  4GY5 A;  3LGF A;  4RCB A;  1K8A U;  3GNF B;  1EIF A;  2YLB A;  2HNI A;  3UT1 A;  2KAF A;  3LWH A;  2M16 A;  3CBM A;  5CCA A;  3HFN A;  4C0F A;  3INZ A;  4JUV A;  3JCM h;  2RJD A;  3CC7 A;  2KMT A;  3OYM A;  2DIG A;  2JVV A;  2LT4 A;  2KQW A;  4IUU A;  5DLO A;  3CCS T;  2M9U A;  4QW2 A;  4ZN1 A;  4M7D A;  1M4Z A;  3X20 B;  4OGC A;  1VQ6 A;  4M77 F;  2K5F A;  4LD9 K;  2HAX A;  4O6J A;  5A2Q E;  4J6X A;  4IUT A;  4JRI A;  1K73 U;  1GXI E;  1G5V A;  3QXE B;  3Q1J A;  4E7J A;  3JB9 D;  4BE2 A;  4OMF B;  4J5Y A;  3GP8 A;  2X4X A;  2LX9 A;  3CCM A;  2R57 A;  3S3N A;  2E6N A;  4HKE A;  3S3M A;  4PJO A;  3FLG A;  2LC4 A;  3QII A;  4OF1 A;  1VIE A;  2B8A A;  1Q81 C;  1QVG A;  3CD6 A;  2JZ2 A;  1Y96 A;  4RKU E;  3P8H A;  2MAM A;  3L2Z A;  4X34 A;  5IAY A;  3V8J A;  4BD3 A;  1VQ6 T;  4V2S A;  2DXC A;  1I81 A;  2CZ1 B;  3OMC A;  5HK0 A;  4M78 E;  2V8J A;  4C92 E;  3OYC A;  3HRU A;  3JB9 G;  4M7D F;  1BIB A;  1M8V A;  3OYL A;  4E47 A;  5GAN h;  4JS4 A;  4MZT A;  1YJN T;  1N27 A;  4M7A F;  2R5M A;  3OS0 A;  4M7D G;  2VXF A;  5HKC A;  4FU6 A;  3QPH A;  4PJO D;  1X75 C;  2DIQ A;  1YI2 A;  3G4S A;  4F7U A;  2DO3 A;  3O8V A;  3CCM T;  1KC8 C;  3JCM V;  1LJO A;  1XQH A;  2JTF A;  3KUF A;  4OB2 B;  3I55 A;  3ME9 A;  1YCY A;  4MZP A;  4FT2 A;  3SWN C;  4EMH A;  2P0Q A;  4ZGD B;  5CAI A;  1YIJ A;  4EDU A;  4A4K A;  1YJW A;  3J7A F;  3RIR A;  3PGG A;  2KY9 A;  3CD6 T;  2VYT A;  1P92 A;  4CI0 C;  5LJ3 d;  4C5G A;  4OVA A;  5J26 A;  5GAN 4;  2DXT A;  4IUR A;  3MP6 A;  4BE1 A;  3T9N A;  3MHX A;  2E41 A;  3CME A;  3F70 A;  1VQ9 A;  3VJP A;  4PJO G;  3PTA A;  2P0P A;  2V8K A;  4HT9 A;  3HHT B;  1KQS A;  2K5L A;  5CIU A;  4M77 C;  5GAN d;  1G3T A;  5DM7 R;  4RCC A;  1YI2 T;  3G4S T;  1KC8 U;  4JDS A;  4R56 A;  5FRO A;  4JRQ A;  2EKO A;  1M5Q 1;  5L8R E;  2WSF E;  3CC2 A;  1NZ9 A;  3P8B B;  4EMG A;  1WQW A;  3I55 T;  1YIJ T;  4LDV A;  4F7U E;  3OYN A;  3JCM X;  1N9S A;  4N0A C;  3CCE A;  3OW2 A;  4J6Y A;  2RA2 A;  4XU1 A;  5GAM g;  3CMA A;  1YIT T;  4XU2 A;  1QVF S;  4PKC C;  5GAM e;  3CME T;  4J6W A;  4J8O A;  1VQ9 T;  3JB9 H;  3CBO A;  1XNI A;  3DB3 A;  2A7Y A;  4DOW A;  5LJ5 g;  3CPW S;  5FU6 B;  4BAC A;  2PQW A;  5LJ5 e;  3FC3 A;  1OZ2 A;  3M9Q A;  2O4X B;  2Y4Y A;  2XKO C;  1M1F A;  1XOV A;  3FB9 A;  3BY7 A;  3M55 A;  3QDR B;  5GAO q;  4M7D C;  3OBW A;  2L3R A;  1VQO A;  5FU7 C;  2ZCF B;  3MEW A;  4FT4 A;  3SWN A;  5I21 A;  4M7A C;  1M1G A;  2YLC A;  3QBY A;  3M56 A;  2XK0 A;  4EMK A;  3A8H B;  3HRS A;  5GMK i;  5GAM j;  3FRN A;  3RKX A;  5CQX A;  1HXD A;  4XTU A;  4C0Z A;  3CMA T;  2D6F A;  3J81 E;  1Q86 C;  5GMK l;  4C5E A;  2LQK A;  1JB0 E;  4B9X A;  4C0D B;  5LJ5 j;  5GAN 8;  2F5K A;  4PLL A;  1VQK A;  2YRV A;  1PSF A;  5C0M A;  5CR2 A;  5GAN 6;  4M77 A;  1UB4 A;  3OSV A;  3J80 E;  3M4G A;  2OTJ A;  3BDU A;  2H3J A;  3JB9 I;  5I2S A;  4IUQ A;  1VQ8 A;  2RD1 A;  3BW1 A;  3BFM A;  2E1H A;  5GAM f;  4M78 B;  2LNV A;  4XQ3 A;  4C92 B;  3GLX A;  1VQO T;  1Q82 C;  4OGE A;  1I8F A;  1KQ1 A;  1PSE A;  3L1A A;  3CCR A;  4BE0 A;  4MDX A;  1UEB A;  2E12 A;  3V8K A;  4N0A A;  3ZFJ A;  2E10 A;  3DKM A;  3L2U A;  3CXC A;  3OYI A;  1ZBX A;  1Q86 U;  1FX7 A;  3DLM A;  3E9G A;  4XTX A;  2DPP B;  5D6Y A;  5A0G A;  1JRI A;  2VGN A;  4BDZ A;  4O5V A;  1VQ5 T;  2LQ8 A;  2EAY A;  3OS1 A;  4XTW A;  5LJ3 f;  1M1K C;  4M77 D;  1KD1 C;  2DTI A;  2XU8 A;  2LRQ A;  4KUL A;  5KE2 A;  3L2Q A;  1VQK T;  5CKE A;  3G7Z A;  2RB6 A;  3OYD A;  2OTJ T;  2GQV A;  2JUF A;  1UGP B;  2RI5 A;  2O01 E;  2RI3 A;  1DJ7 B;  2WSC E;  4B9W A;  3L42 A;  2XHC A;  1Q82 U;  1VQ8 T;  3TEE A;  3MP8 A;  1Y96 B;  2DAQ A;  2ZGW A;  1BI3 A;  3PNW C;  3R6O A;  4LD6 A;  3G71 A;  2DVE A;  1Q81 U;  4XTZ A;  3CCR T;  3JAM E;  2QEX A;  1JBM A;  2MWO A;  3JCM Q;  2HQE A;  1D3B A;  2E64 A;  4Y28 E;  5AYF A;  5GAN 2;  3E1S A;  1NPR A;  3PT9 A;  4M77 G;  3GPL A;  4JS5 A;  1HK9 A;  2RHX A;  2D0Q B;  4BI4 A;  4E7I A;  3X28 B;  5CO7 A;  1M1K U;  1Y7X A;  2RK2 A;  1KD1 U;  3UPU A;  3VKI A;  5I2M A;  3OB9 A;  4XTV A;  4M7D D;  2RJC A;  1WJQ A;  4QVC A;  3MP1 A;  2F69 A;  5D6X A;  2QQA A;  2DZ9 A;  3QUI A;  3JCM d;  2KDS A;  2GF7 A;  4GLK A;  2QTX A;  4NL3 A;  1K9M U;  5LL6 S;  4HCC A;  3G71 T;  3AHU A;  1W2B S;  3NTK A;  1V29 B;  2HBP A;  2RJE A;  3NTH A;  2LCC A;  2QQS A;  4Q5W A;  3V7C A;  3MCA B;  1OYX A;  3EFR A;  5DY9 A;  1RI0 A;  2K4Y A;  2QEX T;  3JSC A;  3UDC A;  1FWZ A;  2KK4 A;  2RHY A;  1I5L A;  3H8Z A;  2RM4 A;  4IUP A;  4DQ2 A;  5LJ5 h;  3SDZ A;  1H3Z A;  2QQ9 A;  4HA8 A;  3WVD B;  1QP3 A;  4M7A G;  1QVG S;  4L59 A;  1H64 1;  1VUB A;  2EQU A;  3NTI A;  4A4F A;  4J83 A;  5FLX E;  5C6S A;  3OYK A;  5CKF A;  1UGS B;  1FXX A;  1U1S A;  2DJZ A;  3HKS A;  4ZTJ A;  2R5A A;  1VQM A;  4QVZ A;  1S72 A;  4PJO E;  4C8Q F;  4IUV A;  1YIT A;  4MMK A;  1G3S A;  4M78 F;  4C92 F;  1IRE B;  2LTO A;  4C8Q G;  2RHZ A;  1B34 B;  2R58 A;  2PVG B;  3QZ9 B;  4FM4 B;  3X24 B;  4BUG A;  2XD0 A;  4BY6 B;  1N8R C;  3M58 A;  2CKK A;  4M75 B;  5KCO A;  4OP0 A;  4A54 A;  1IZ6 A;  2DD4 A;  5GAO l;  4KBM B;  3S3O A;  2K3X A;  3ER0 A;  4LDU A;  1JJ2 S;  3CCQ A;  5GAO r;  4NS5 A;  2CZ6 B;  4YTL A;  3SWN B;  1SSF A;  3LWI A;  3LLR A;  1MHN A;  2EQK A;  3ASK A;  4BI8 B;  4N4G A;  1VQM T;  1S72 T;  4C0G A;  3QKJ A;  2FB7 A;  4ATO A;  2JNG A;  2KSS A;  1OZ3 A;  2P0K A;  2PUO B;  3RKY A;  1W4S A;  1XTD A;  3OYE A;  1VQ4 A;  1KQS S;  5FU6 C;  5CKH A;  1QVP A;  1N8R U;  2VGM A;  3M53 A;  3QZ5 B;  1VQL A;  2EQM A;  4JLI A;  3JB9 J;  4P5N A;  1O9S A;  2MWP A;  3FJP A;  3I56 A;  3CPW A;  3HSB A;  5GAM h;  5A0D A;  3WVE B;  3JCM c;  5CK9 A;  5LJ3 g;  3LGL A;  3CCU A;  3PIP A;  2XID A;  5LJ3 e;  3NFC A;  1WGS A;  3CCQ T;  1VQ7 T;  3MEV A;  3LW5 E;  3OS5 A;  3PIO A;  2MI6 A;  5J39 A;  1Y71 A;  2EYQ A;  4MML A;  5CQY A;  3VYH B;  3CCL A;  2AHJ B;  3DB4 A;  3JCM f;  5GAN g;  3PFS A;  4C0D C;  4QQG A;  2BIV A;  4D6W A;  4LDW A;  5HK3 A;  3GOX A;  1VQ4 T;  1VQ5 A;  5KCH A;  2CS7 A;  1WQ7 A;  1WPY A;  2JN0 A;  2IVW A;  1NE8 A;  4HCZ A;  4C8Q C;  5GAO p;  3DLL A;  1VQP T;  1VQL T;  2E5Q A;  4A53 A;  1AHJ B;  3C94 A;  3I56 T;  3G6E T;  2CZ0 B;  5LJ3 j;  1TH7 A;  2OAU A;  4M78 C;  4QQ6 A;  4C5I A;  4C92 C;  4BDY A;  2DXB A;  2X4J A;  4Y91 A;  4A4H A;  2EIF A;  3CCU T;  1O75 A;  2NLU A;  1WJR A;  1QP2 A;  2EJG A;  4FSX A;  3E19 A;  1NJI C;  5KE3 A;  3QJ6 A;  2L89 A;  5IN1 A;  5EG2 A;  4HCB A;  5GMK m;  1YHQ A;  4E7H A;  2Y90 A;  3CCL T;  2MMP A;  2FHD A;  3HFO A;  5GAN j;  3X25 B;  3A8G B;  5GMK j;  5GAN 7;  2QDY B;  4PNO A;  5FRN A;  3HPW A;  1BYM A;  4BB7 A;  4C5H A;  2IG0 A;  3PMT A;  3OYF A;  3C95 A;  5GAO n;  4PJO B;  2L5Q A;  3S6W A;  1YHQ T;  2HD0 A;  3KBG A;  2E70 A;  3OYA A;  2CGH A;  3C12 A;  1ZHI A;  4X9D A;  5FRM A;  4M7A A;  4M75 F;  2KVQ G;  4M77 E;  3GIB A;  1M90 C;  3HRT A;  5GAN f;  1NJI U;  1YJN A;  3CCJ A;  3OS2 A;  4M75 G;  4XAX B;  3EFS A;  3PMI A;  4ELZ C;  3LX7 A;  3MEA A;  3QSU A;  3X26 B;  3RUX A;  3CCV A;  2EJ9 A;  4PL6 A;  3OQ5 A;  3TCJ A;  4KUD K;  3VV0 A;  2JOY A;  1Q7Y C;  4C8Q A;  2EQJ A;  3M5A A;  4F7U B;  4EMK B;  4N4H A;  1KQ2 A;  4M7D E;  3HP9 A;  4E7L A;  3CC4 A;  4M7A D;  4M78 A;  1BIA A;  4C92 A;  4DA4 A;  2X4W A;  2VC8 A;  2VV5 A;  4FL6 A;  5J3B A;  1M90 U;  3A8M B;  1X6O A;  3RKW A;  4EMK C;  5CVI A;  2FVU A;  2V8I A;  2E6Z A;  2BKD N;  1K9M C;  1KHI A;  1W2B A;  4OB1 B;  3OA6 A;  4RG8 A;  4M7A E;  1UGQ B;  3LH0 A;  2EJF A;  1I4K 1;  4XU3 A;  4HT8 A;  2DTO A;  3BDL A;  4ME7 A;  2JTM A;  1KHC A;  5D6W A;  3FEO A;  4ZN3 A;  3CCV T;  4MZM A;  2X35 A;  4C8Q D;  3VYG A;  2MF2 A;  3M59 A;  1Q7Y U;  3EAE A;  3CC7 T;  4L6V 5;  3QJY A;  1BI2 A;  2L8D A;  5CKD A;  5IT9 E;  2ZPG B;  4M78 D;  5LJ3 h;  4C92 D;  3JCM J;  2I2L A;  3CC4 T;  4OB3 B;  3L2V A;  1OI1 A;  3A5Z B;  4RMO A;  4C8Q E;  3JB9 F;  4II1 A;  3OYJ A;  1R8O B;  2XDD A;  2EFI A;  2CZ7 B;  3KXT A;  3P8D A;  3L2W A;  4E7K A;  4ZGE B;  4A4G A;  3A8O B;  4JRK A;  4J7I A;  4BY6 C;  5GMK h;  1QW1 A;  2XDP A;  3MO8 A;  5GAM d;  2D9T A;  1WNL A;  4M75 C;  4WF2 A;  4XK8 E;  3M54 A;  1LOJ A;  4KUI A;  4M78 G;  3JCM g;  4C92 G;  5GAN 3;  2PUK B;  2RK1 A;  3OBY A;  3VU3 C;  5M9O A;  3JCM e;  3JRZ A;  1G3Y A;  4EPC A;  3CBP A;  2K3Y A;  2RI2 A;  5LJ5 d;  1YJ9 A;  3SB2 A;  2X4Y A;  3FIF A;  2PVO B;  3OYH A;  1VQ7 A;  2DZC A;  4Z02 A;  4NL2 A;  4N4I A;  2PVD B;  1JJ2 A;  2K5I A;  3H6Z A;  4RG2 A;  4PJO F;  4QQD A;  2RJF A;  4FIB A;  3WXM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...