3META

Crystal structure of sgf29 in complex with h3k4me2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
174
structure length
174
Chain Sequence
GRRGVLMTLLQQSAMTLPLWIGKPGDKPPPLCGAIPASGDYVARPGDKVAARVKAVDGDEQWILAEVVSYSHATNKYEVDDIDEEGKERHTLSRRRVIPLPQWKANPETDPEALFQKEQLVLALYPQTTCFYRALIHAPPQRPQDDYSVLFEDTSYADGYSPPLNVAQRYVVAC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SAGA-associated factor 29 homolog
publication title Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 174
sequence length 174
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-03-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07039 DUF1325 SGF29 tudor-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3metA02
2QQSA 4QW2A 4N4IA 3S6WA 2X4YA 2YRVA 2LCCA 3O8VA 3OS1A 4BE1A 4II1A 1RI0A 2WACA 1OI1A 2EKOA 3FEOA 3DB4A 2DIQA 3KUFA 3OB9A 3Q1JA 2R57A 1N27A 2LTOA 2K3XA 3OS0A 3OYKA 3ZEHA 2O4XA 3MEAA 1WJRA 3DLMA 3L2QA 2LRQA 3LGFA 4GY5A 3SD4A 5J26A 4C5GA 2B8AA 3UT1A 5KH6A 2R5MA 2IG0A 3EAEA 4QVZA 2M1HA 3QIIA 2RJEA 3GOXA 4OVAA 4BACA 4QQGA 4ZTFA 2MWOA 2R5AA 5J39A 5IN1A 3META 2LDMA 2E5QA 3NTKA 4IUUA 3OYIA 4BDZA 2BKDN 3QBYA 3PMTA 4HCZA 3DB3A 3NTIA 3P8DA 2RJDA 3H6ZA 4BDYA 2VYTA 1XNIA 4ZTJA 3OYEA 4Q5WA 2GF7A 3E9GA 2BIVA 2XDPA 4C5IA 2RHIA 3OYBA 2DIGA 3LX7A 3FLGA 2FHDA 3OYDA 4C5HA 4E7JA 5C0MA 2EQJA 5M9OA 3OYCA 4PLIA 4E7KA 2NLUA 5CIUA 3FC3A 1KHCA 2G3RA 3MP6A 2JTFA 2M0OA 3CEYA 4B9WA 4C5EA 2L8DA 2RO0A 4A4GA 3OQ5A 4X34A 2HQXA 4E7LA 3M9QA 4A4EA 2F5KA 2RHZA 3MEVA 3BDLA 3MEWA 5FROA 4A4FA 4FU6A 2RJCA 3L42A 3MP1A 5KE2A 2RI2A 2EFIA 2JZ2A 2EQMA 3PFSA 3OS2A 4N4GA 5FRMA 4BE2A 3S3NA 3LGLA 2O4XB 3MP8A 4B9XA 2PQWA 3PMIA 3OYMA 2K3YA 5KE3A 4L59A 1WJSA 1WJQA 3E9FA 4PL6A 3OYAA 2RHUA 3OY9A 5KCHA 2RHYA 4CRIA 3QKJA 3OYGA 4IUQA 4IUVA 2HQEA 2L89A 3FDRA 4Z02A 4UC4A 5D6YA 3OYHA 2E6NA 4QQDA 3OYNA 2GFUA 2RI3A 3NTHA 3PNWC 1OYXA 2X35A 3OMGA 4IKFA 2D9TA 3L2WA 2L3RA 3F70A 4E7HA 3QJ6A 4BD3A 4RG2A 3L2RA 3L2UA 5D6WA 1SSFA 1WGSA 2EQUA 5IAYA 2RJFA 3ME9A 3P8HA 5FRNA 2RHXA 3LH0A 3MEUA 2M16A 2XK0A 2R58A 4IURA 4N4HA 3C4SA 3L2VA 3S3MA 1MHNA 4EDUA 4NS5A 2QQRA 3OYJA 3OMCA 2GFAA 4IUPA 2CKKA 2X4XA 3LYIA 1G5VA 4QQ6A 2BUDA 5C6SA 2EQKA 2RI5A 3OA6A 4IUTA 3OYLA 4LD6A 2MWPA 3ASKA 3OYFA 1H3ZA 2LVMA 3UWNA 2X4WA 3MO8A 3LLRA 4FL6A 3H8ZA 4A4HA 2DAQA 3S3OA 4BE0A 4PLLA 4E7IA 5D6XA 2P0KA 1OZ3A 1OZ2A 5KCOA
chains in the Genus database with same CATH superfamily
1IREB 4M7AC 2LNHB 3LWHA 3OS1A 4OF1A 1K8AU 2F5TX 3H0FA 2LX7A 3DB4A 2BE9B 2C0TA 4L5GA 4AFSC 3QHSA 1M2VB 2DFUA 4DQ2A 4JUVA 3PGGA 2F2VA 3QO3A 4M77E 1AHJB 1KC8U 2KY9A 4FYVB 4QVZA 2MWOA 3M57A 2LDMA 3JCMc 2RQWA 3JCMg 2LJ1A 3H6ZA 2VYTA 1K73R 1KQ1A 1XTDA 2DYBA 1UGPB 2GTOA 2MK5A 3BE3A 3X25B 4M75C 3NMZC 3CCVA 2HBPA 2DYIA 3JCMe 5KYWA 2RPNA 2PVOB 2RHZA 5A2QE 3CD6A 2K3BA 2H3EB 2X4JA 5GAN7 4ELYC 5KE2A 2X3XD 3HPWA 4O6JA 3VS7A 1KD1C 1QP3A 2AK5A 2EKHA 2C06A 1OULA 2KE9A 5KYXB 1VQOA 4L59A 1WJQA 1KQSP 3ZL7C 3PTAA 2FL7A 2OI3A 1K0XA 4XU1A 1JO8A 4E6RA 4XU0A 3OW2A 3G4SQ 2D9TA 3CD6Q 1AD5A 1VQ7T 1M9SA 4NL2A 2LQ8A 4HCKA 3VUZA 1WGSA 2EQUA 3JCMd 2XU8A 2K57A 2M16A 3H9NA 2XHCA 1NEBA 3CCLA 1UDLA 1VQ4A 3OMCA 3CCUT 3GPLA 2QQAA 2LQWA 5KYNA 2KBTA 1G8XA 4ANJA 3A8HB 1ZLMA 2X4WA 1YJNT 2HQHA 1QVGA 1M2VA 4C8QA 2ATCB 5CKFA 2E65A 4XU2A 1IXDA 1IHVA 3MKDA 2KNBB 3O8VA 4A54A 3Q1JA 2K2MA 3J80E 1N27A 1PKTA 2K3XA 3RESA 1OV3A 4J9IA 5A0DA 2DMOA 2HZYA 3THKA 4ORZA 1OOTA 2G6FX 2IG0A 1IO6A 2DRMA 4BACA 4QQGA 5LJ5j 4OGEA 2LP5A 2CP7A 5LJ3h 1M90R 1M27C 3X24B 2EAYA 4J9BA 4JJCA 1XNIA 1QQJA 3M4YA 3NGPA 1GL5A 3OBWA 3FLGA 1BI3A 2KROA 2AKLA 4M77G 5CIUA 5I2SA 5IXBA 3CBPA 3VS5A 2QQBA 4XTWA 5GJVB 2RI2A 3UA6A 2CP0A 4JLGA 2PTKA 4C0ZA 1QCFA 5GAMg 3GLXA 3CXCA 1JEGA 2JOYA 4WTOB 1U8RA 3EGXB 2XDBA 3HKSA 4J6XA 2ROLA 2V1QA 3CCSQ 3PVLA 3OYHA 2E6NA 4QQDA 2D0QB 4RMOA 1NBEB 4IKFA 1TH7A 1P92A 2VUBA 1ZUYA 2AZVA 2MF2A 5CQXA 3SWNB 5CO7A 1KSWA 3GF5A 2EW3A 1D1BA 4AT1B 2EGAA 1RABB 1PRMC 3PVQA 2RNAA 4FW2A 2VV5A 4F14A 1YITQ 5GMKl 4IUTA 4R56A 2JT4A 4OP0A 3CMEQ 2A37A 1BCMA 4M78E 1WPYA 1YJ9A 4A4HA 4BE0A 2K5IA 1R77A 2HNIA 1YFNA 3OBYA 4BY6B 1KQ2A 1D3BA 1B3QA 3JCMP 4RTVA 2O31A 2EKOA 2DIQA 2LTOA 1I5OB 3OYKA 2LC4A 1J3TA 1ZBXA 2R5MA 2RJEA 2NUPA 2R5AA 4BDZA 2E5QA 2RB6A 1Q81R 5I21A 2GGRA 3HL8A 5CKBA 2DRKA 4PJOD 1HD3A 2RHIA 1NJIU 5GAN8 2CT4A 4F04B 4J9HA 3EGDA 3CMAA 1Y96A 3HP9A 2L8DA 3CCMA 3SFMA 4A4FA 4RCCA 1N8RU 2A28A 3EG0A 4XU3A 4EIKA 1W4SA 4JRQA 4AFZC 3M0RA 1ZA1B 2ECZA 1WJSA 1FMKA 4PJNA 1KG1A 3FIFA 3UA7A 3OY9A 3EFOA 2F2WA 2RHYA 4QVCA 3UDCA 4M77A 2V8KA 2J05A 3R6NA 1WXTA 3REAB 2J6FA 4ZGDB 4LNPA 2C0OA 1TOVA 2QEXT 3OSSC 2RQTA 2EYWA 1QWEA 4OMLA 4MDXA 2KDSA 2R58A 1Z9ZA 4MZTA 1VQLA 4M7DD 4PFZA 2JXBA 1NZ9A 5CAIA 3OA6A 3DLLA 4WF2A 1M1FA 4JLIA 4ME7A 4XTYA 1T3SA 3UWNA 1K9MR 1B34B 3H8ZA 1MMAA 2DLPA 4OGCA 1VQ7Q 4D8DA 2A3LA 2HD0A 2K9GA 4O5VA 4BB7A 2QASA 4KBMB 2DXUA 1C0MA 3KBGA 3O5ZA 2DTHA 4EMKA 4BE1A 1Z9QA 3KUFA 2AHJB 2VC8A 2E6ZA 2KQWA 3CCUQ 1QWFA 3CCRA 1U1SA 4M4ZA 2AIRB 5J26A 4M78G 1VQ8T 2PNIA 4JS5A 3A98A 2FPEA 2ZPBB 4LDYA 3H41A 2DK3A 3BFMA 1YJNQ 1VQPA 2OAWA 2YXYA 5LJ5g 3FJPA 3P8DA 1M3BA 4Q5WA 1U3OA 2JM8A 2DIGA 2QK0A 2VGMA 2DM1A 3QUIA 4RTTA 3CCQA 4ZGJB 5CKHA 5M9OA 3L2ZA 4VUBA 3VRYA 4JZ4A 3OSVA 2DTOA 3CEYA 5LJ5e 1IGUA 1Q86R 1UTIA 3FRNA 5FU6B 5I11A 3G1JA 3L42A 3QPHA 1RACB 1U1TA 3OW2S 1UJYA 4KUDK 2DILA 4LDVA 1Q86U 2DX1A 2RF0A 2YRCA 3SWNC 4IUVA 1EFNA 3M55A 3CCVT 5EG2A 2ZPIB 5GAOn 2GFUA 4XTVA 4JRKA 1RUWA 3C12A 5LJ5d 1CKBA 2MOXA 3KFVA 2CYZB 1LCKA 2O01E 1VQOT 4M75D 4N4HA 3VS1A 3RERA 5IXFA 4A4KA 3I56A 3LYIA 3HRUA 1V1CA 4LXCA 1M3AA 4BY6C 4J6YA 1NE8A 2EBPA 1WHLA 4PLLA 2CREA 2DE0X 3VV0A 1OZ3A 1G3YA 1FMWA 2QGGA 3DKMA 3QDRB 4RTUA 2XIDA 3CCLT 4CC4B 1VQ4T 1YCSB 4RKUE 3SD4A 3CXCP 4C5GA 4J5YA 4DEXA 3CCJA 3EAEA 1QLYA 5AT1B 3CBMA 1WA7A 2F69A 2RN8A 5GAN4 3CC7A 3H0IA 4DBQA 1RAFB 1TXQA 3OYEA 2ZPEB 1BCOA 3E9GA 3OYBA 2XDPA 2HMAA 2O88A 1CKAA 5FW9A 3MHXA 1TUDA 1OQKA 3JCMW 1Q7YU 3CXCS 1PSEA 2EJFA 1VQNA 4C0FA 1YI2A 4A4EA 2A36A 3MEVA 3CCEA 2A7YA 3VS3A 4M78A 1ARKA 1GBRA 3JCMX 2DVJA 1YIJA 2QQ9A 3TEEA 2D6FA 5HK3A 3OYMA 1G3SA 1G83A 1KD1U 4PJJA 3PT9A 2ZGWA 5FWCA 3EG3A 4RG8A 2Z0WA 4JPBW 1RLPC 4N0AA 2EWNA 2KK4A 1RAEB 2H8HA 2JMAA 1M30A 3LH5A 2VXFA 2KRMA 2L3QA 4E7HA 1MMDA 2HAXA 4E2FB 2HL3A 5GAMj 3ME9A 1KHIA 1QKXA 4C92A 5IH2A 1SSHA 4F7UA 1Q82C 5KYWB 1H8KA 3QXEB 3TVTA 3SB2A 3C94A 2PUOB 2CKKA 4J9CA 3RKYA 1AWXA 2CSQA 2V1RA 1W6XA 4KRTA 4R0KA 8ATCB 2CZ6B 3M0UA 5CKEA 4ZNXA 1H3ZA 1HSQA 3G6EA 3V8LA 1PC0A 1UGSB 4C8QF 2QEXQ 1RADB 1G3WA 1WFWA 1VQ5A 4J9FA 4II1A 1TUGB 4GBQA 3QJYA 1GRIA 5HY6A 4XTUA 2DF6A 3C0CA 3RUXA 5GAOl 3V8KA 1RI9A 2JJ9A 3QDFA 1E7OA 3JB9G 3JCMf 4HVUA 1VQKA 3JB9F 2PU9B 1YJ9T 2KEAA 5FWBA 1KC8R 1OEBA 3RBBB 3URGA 2OX7A 1K76A 5FU6C 2CZ0B 5HK0A 2CUBA 5GMKj 2F2XA 2OJ2A 4YTLA 4BI4A 4RTYA 4C8QB 1RAAB 2FVUA 4FW1A 4XTXA 4JRPA 1VQ8Q 1M1GA 2AT1B 5GAOq 5A0LA 3JAME 2XMFA 2EFIA 1AWJA 1X2KA 5GMKi 4CC3A 2Y90A 2MPXC 1YHQA 4B9XA 4EMGA 2K3YA 4PL6A 2DL8A 2CP6A 2DETA 5KCHA 2I0NA 3M0QA 2LQNA 3CMAT 4HCCA 3CCMT 1MV0B 1QP2A 4RTZA 2DL3A 2DBMA 3JRZA 1JJ2A 2FZGB 2GQVA 2V26A 3JCMV 4FYXB 1VOMA 1VYVA 2QQRA 3J81E 1SRMA 1SEMA 3CCVQ 2EPDA 5LL6S 1MMNA 2COZA 2X9HA 2O9SA 4E7IA 3RNJA 1PM3A 1WQWA 3TSZA 3JSCA 1YBYA 2X4YA 4PJOE 1X6GA 4FT2A 2DBKA 3A8GB 1VIEA 1OI1A 2WACA 1W2BP 1VQOQ 1Y07A 1VQLT 2LQKA 1M2OA 2GTJA 1B7TA 5HCKA 1TU0B 3I35A 4HA8A 3UT1A 2RA2A 3RKXA 3GOXA 2DJZA 3META 3OYIA 1PCXA 3A8OB 4DA4A 1W2BS 4AFQC 1K0SA 5HKCA 4JJBA 3CCLQ 1N5ZA 1VQ4Q 4KGZB 3MP6A 4HVVA 1V29B 5GMKm 3CCRT 1WX6A 3V7RA 4J8OA 2HQXA 1D3BB 5GAOp 4GLKA 4BI3A 4J83A 1VQPT 2LJ3A 3S3NA 1ZQ1A 2KT1A 1YNZA 2PQWA 3AT1B 3CCQT 4EPCA 2MMPA 3G7ZA 3BW1A 4RCBA 2NUPB 1I1JA 4FIBA 2SEMA 5GAN2 4M77F 2HEQA 3A8MB 3QWYA 3EH1A 1IRXA 4ELZC 2QTVA 4XK8E 2E70A 3OMGA 1K8AC 1K9AA 3L2WA 3F70A 3EGDB 1MV3A 2RJFA 1Y96B 1WXUA 3H0HA 1ACMB 3LH0A 3MEUA 1S72A 3GIBA 4NS5A 1H92A 3BY7A 4IUPA 1QVFA 2P4RA 3PE0A 1PRLC 5A0GA 1Y71A 5D7UA 2NWMA 2DD5A 3RR6A 2MWPA 4DBRA 1MGQA 3UATA 2NUZA 5GAMe 5J3BA 2QQSA 3EFOB 1A0NB 3S6WA 2LMJA 1LNXA 1ZA2B 1RI0A 4MZPA 1BU1A 4M77B 2KVQG 1OPKA 1D0XA 1LOJA 1K73C 3QWXX 1V76A 3I56T 3VYHB 3VS2A 3MPUB 2ZPGB 4GY5A 3GBQA 5KH6A 3FJ5A 3QIIA 1FYNA 2KYMA 2XDDA 4PJOG 4C0GA 4C8QC 1M1KR 4Z8AA 1B07A 2GF7A 5GAN3 2HKQB 2JVVA 1LJOA 1VYTA 5GAMd 1GFDA 2PVGB 4OB2B 3JCMh 1BB9A 2DXBA 4KGVB 4PKCC 4KH1B 2DEQA 4F16A 1ZX6A 1NJIR 1VQ6T 2K5FA 1M1KU 3CCJT 4EMKB 3M4GA 2OTLA 2DL7A 4CC2A 2FPDA 2X3WD 1YJ9Q 3WVDB 3CC7T 2JZ2A 2CH4W 2EVRA 5GMKe 2DXTA 3E1SA 3RMQA 4C92E 2CP3A 3A1PA 4F7UE 1N8RR 4PNOA 3QKJA 4IUQA 3GNGA 3FDRA 4UC4A 1MMGA 4NOYA 3VS6A 1VQNT 3E19A 1YI2T 3CC2A 2X35A 3CCET 4Z89A 2YLBA 4J9DA 2DZCA 1YIJT 2ZCFB 2NUTA 5FRNA 4PK4A 2KXCA 2E64A 2COWA 2CP2A 3CPWA 4DOVA 1YN8A 2DKGA 2X4XA 4QQ6A 3CMAQ 3MJXA 3CCMQ 2K2VA 4OMPA 3LW5E 3CBOA 1UGRB 4PJMA 3EG1A 2ENMA 4RUGA 1WHHA 2YRVA 3M53A 3SHWA 2CUDA 2ZAEA 2CH4A 3FEOA 4KULA 2MI6A 1M90C 2EJ9A 4FSXA 2M51A 5CKDA 1PD1A 3L2QA 2LRQA 2EQIA 4LDUA 5LJ5f 2FB7A 1FWZA 5IN1A 4DOWA 3CC4A 2L5QA 2VGNA 3R6OA 3G6ET 5GANg 1IB8A 3QBYA 1YP5A 1NLOC 2COYA 3M56A 4GLMA 3G71A 5AYFA 1VQ5T 2DD4A 3VS0A 2PUKB 1U5SA 3GP8A 2VVKA 5C0MA 2JMCA 1KIKA 1VQLQ 1TG0A 2G3RA 4C5EA 5GANe 4A4GA 5GJWB 2MAMA 1BK2A 4M78F 1VQKT 1KFZA 1C1AA 2QAZA 3JCMb 2EQMA 1I07A 4PJOA 4QT7A 3OW2P 5KE3A 1PWTA 2DZ9A 1JB0E 2DXCA 1TS9A 2RK1A 4JDSA 2JW4A 3CCRQ 2FRYA 1JU5C 3PNWC 3PIOA 1KQSA 1NPRA 5CCAA 4C92G 1VQPQ 5GANd 4F7UG 5D6WA 1SSFA 2LCSA 4M7AD 2FZCB 4C92F 2YT6A 1YHQT 2K7AA 4QKUA 4F7UF 3L2VA 4OMOA 3ZBDA 1MHNA 3TCJA 4EDUA 1QVGP 1O9SA 3CCQQ 2WSEE 1G5VA 4M78B 1M3CA 3CQTA 4JRIA 4LD6A 2KSSA 1X6OA 2CZ1B 4M77C 4X9CA 3MO8A 3LLRA 4HXJA 1WHJA 2KRSA 2EIFA 4HCZA 4FT4A 1AWWA 1QCOA 1T0HA 4LDXA 2AKKA 1QVGS 3EG2A 2OAUA 1Q81C 1PNJA 3EGUA 3VUBA 3ZEHA 4M7DA 2O4XA 3HSBA 1WJRA 2RMOA 1UFFA 3VS4A 1XOVA 1X2QA 3M59A 3QYHB 1ZBJA 4ZTFA 4C92B 3QZ9B 4Y91A 4F7UB 1GCQA 3V7SA 4PFOA 4J9EA 1HXDA 2KMTA 4OMNA 1TWBA 4EMKC 1MNEA 1Y0MA 3A8LB 3FC3A 2JTFA 3I56Q 2QA4A 1PG5B 3OQ5A 1VQ6A 2FG0A 5I2MA 3BDLA 1YJWA 2DA9A 1Q7YR 2J06A 4XAXB 5DY9A 2QGFB 4KGXB 4C0DB 1YWPA 3RDVA 4F17A 4HCBA 3QZ5B 2YUOA 2ZZDA 1I8FA 2QDLA 3QYGB 2A08A 1RAHB 3RIRA 1IZ6A 4MDWA 5GAOm 5IHKA 4J7FA 1KD1R 1M4ZA 1VQ6Q 2E4HA 3CCJQ 5CK9A 4K11A 2L0AA 2L3RA 2H3JA 1H3HA 4FSSA 2XI9A 3CC7Q 1K9MC 3L2UA 2LJ0A 3P8HA 2YRDA 1BIBA 4IURA 2HDAA 3OYJA 3X28B 1SHGA 3HTRA 2NYSA 5C6SA 1MUZA 1VQMA 2HCKA 3OYFA 2E5KA 1VQNQ 2BZYA 3EG9A 1YI2Q 2JNGA 3CCEQ 2ED0A 1QVPA 4QW2A 1M8VA 2CS7A 7AT1B 2JTMA 1YIJQ 2D0NA 1OU8A 2LT4A 4M75A 1S72T 4E7SA 1GBQA 2EGCA 4AMCA 3I9QA 5LJ3g 1Y7XA 2B8AA 1I81A 1EZZB 1N6AA 4PFPA 1JBMA 5KYYA 1Q86C 2RD1A 3PMTA 4OB3B 3M58A 1BI1A 3VU3C 2QG9B 3TREA 4OMQA 5LJ3e 2FHDA 3I5SA 3VKIA 1VA7A 5LJ5h 5I22A 2K79A 2RQUA 2KRNA 2M0OA 4OMFB 2EYZA 1ZSZB 1VQ9A 2KYBA 3MEWA 3T9NA 2DL4A 3G6EQ 2MYSA 3MP8A 1WHKA 2FEIA 3N5BB 2GCXA 1WZOA 1N9SA 1VQ5Q 2V8IA 2JTEA 4DBFA 2RH2A 4CRIA 3C95A 1BBZA 2FZKB 1UJ0A 3CPWS 4IIOA 5LJ3d 4AG2C 2E3IA 1VQ9Q 2IPOB 2E3HA 1D1AA 2OTLT 4DBHA 1VQKQ 4C8QD 4M78C 2KT8A 5GAOr 2RQVA 2HSEB 3QSUA 3UF4A 3C4SA 2J7IA 2YSQA 2DEUA 2FO0A 1ZSGA 4FYWB 2EQKA 2RI5A 4N0AC 3JV3A 4HT9A 2EYXA 2SRCA 3GNFB 1WHMA 3CC2T 3JB9D 3E2UA 2F1LA 1D0ZA 4LN2A 2CP5A 5EC7A 1OZ2A 2XG8D 2FYKA 6AT1B 1Q7YC 2LCCA 4Y92A 2O9VA 4C92C 1YHQQ 1BI2A 2DPPB 1S1NA 4ATOA 3MEAA 3DLMA 1OX9A 3M5AA 3G4SA 4KH0B 1K73U 2W10A 3M0SA 4ZN3A 1I5LA 2XKOC 1XJWB 1QCNA 1NPPA 2KI7A 1ZSZA 4PJLA 1RAIB 2BIVA 1QMCA 4E7KA 1UEBA 3OYYA 1KHCA 2P0PA 4C0DC 2QTXA 4B9WA 2F5KA 1ZHIA 2Y4XA 4MMKA 5GANj 3CC4T 3JB9J 1BIAA 4LE9A 2YHTA 1IHWA 2CZ7B 1GFCA 3LGLA 3IQLA 1KQSS 1NYGA 3G71T 1PD0A 2GBQA 3I55T 5GAN5 5KYUA 2CSIA 3OYAA 5DM7R 3VYGA 1AZEA 4Z02A 4OB1B 2RI3A 3AHUA 3ZFJA 5GAMf 4RTXA 2LZ6B 1UECA 5FU7B 4RG2A 1ABQA 2B86A 4JJNK 1M8MA 4A63B 1NLPC 1EIFA 1QW1A 2YLCA 4M7DE 2KR3A 2BE7D 2KGTA 1PSFA 2ESWA 2ROTA 3OYLA 3ULRB 1FX7A 1N9RA 2ZPHB 4WCIA 2I2LA 5ECAA 1AVZC 3OB9A 3OS0A 1KC8C 5KYXA 1WQ7A 5CVIA 4J6WA 3CCSA 1M90U 2BZ8A 3EFSA 3EHRA 4OVAA 2NUTB 1UE9A 2QYZA 2BKDN 3JB9I 3SEMA 1JRIA 2BZXA 2RJDA 1ZSZC 4A53A 4JS4A 2WSFE 4C5HA 1ABOA 3OYCA 1YITA 1S72Q 1BKBA 4PLIA 1LVKA 3CMEA 3RMSA 2RO0A 4LUDA 4M77D 1NEGA 2CT3A 3FB9A 5CQYA 2RJCA 1G2BA 1UHCA 1Q95G 3PFSA 5FRMA 2RQRA 4BE2A 4Z88A 4M7AE 4PJOF 2Y4YA 1SPKA 1VIFA 2E1HA 3PMIA 4XTZA 1KJWA 4JJDA 3E9FA 4OMMA 2HL5C 4D6WA 3NHNA 2RM4A 2VB6A 1BI0A 2OTJA 3OYGA 1X69A 2DO3A 2P0QA 2GQIA 3SDZA 2QA4T 4V2SA 1IGQA 4B6MA 3NTHA 4FCYA 1OYXA 2W0ZA 3REBB 4QVDA 2YDLA 1YJWT 1W1FA 4R55A 2IVWA 2A0FB 3L2RA 5DLOA 1ZUUA 2RHXA 2XK0A 4M75E 1VYUA 4EMHA 3X26B 1EX4A 2HKNA 1PKSA 2BUDA 2OTJQ 1T3LA 4ZN1A 3ASKA 1UGQB 2QDYB 3A5ZB 4IIMA 1DJ7B 4E47A 2YUPA 4PJOB 3EHQA 3S3OA 2LT1A 3OS5A 1GCPA 3OYDA 2OTLQ 3MCAB 1NYFA 4MMLA 2E10A 5CR2A 4M7DG 2J6KA 1O75A 4X1VA 4M7DF 3U23A 3NFCA 4NL3A 1VQMT 1Q81U 5GANf 2ZPFB 2M1HA 1SHFA 3EGXA 2XICA 4LUEA 3NTKA 3CC2Q 8AT1B 2LX9A 2DERA 2DJQA 4BDYA 4ZTJA 2VWFA 1UUEA 4E7JA 3SWNA 1TSFA 5LJ3j 4MZMA 1K1ZA 3M9QA 4Y28E 2IIMA 1UGVA 1X6BA 2PZ1A 1VQ7A 4KUIA 2L2PA 2HBWA 1WDXA 3OS2A 4M7DB 2O4XB 1WXBA 1OU9A 1E6GA 2HSPA 3I55A 5IHNA 4DEYA 2RHUA 3CCUA 5FU7C 1JJ2P 1HJDA 4RTWA 5L23A 2EGEA 2L89A 3NPFA 4E7ZA 3EH2A 2L3PA 1YJNA 1WYXA 1VQ9T 1TTHB 4J9GA 4M7AG 3CC4Q 4BD3A 1AT1B 4M7AF 1R0CB 1M5Q1 3TU4K 2K6DA 2PVDB 4AFUC 3INZA 5IAYA 2MCNA 1T0JA 3G71Q 2GNCA 1UG1A 3I5RA 3I55Q 3S3MA 1JJ2S 2KAFA 1K9MU 2VKNA 3HFNA 1CSKA 1F1BB 1KK7A 1RL2A 1AZGB 2E41A 2X51A 4OB0B 5GAMh 1HYOA 4BUGA 1OPLA 1R0BG 4FL6A 5DLQE 1JXMA 1Y57A 2E12A 4L6V5 2P0KA 1Q82R 3VRZA 5KCOA 4M75G 4J7IA 4M75F 1H641 2R57A 1M1KC 2V8JA 3HHTB 2P84A 3HRSA 3TSWA 3J7AF 1VUBA 1RLQC 3CPFA 1Q82U 3TQ7P 1SRLA 4M7AB 2CGHA 4ESRA 5J39A 1W2BA 4XQ3A 4M78D 1WIEA 2QI2A 1NJIC 1ZUKA 3NTIA 4HKEA 1SKUB 2P4TA 5GAN6 4X9DA 2EQJA 4HT8A 3EG9B 2LCLA 2MIOA 2FPFA 2JS2A 2ABLA 1MNDA 1N8RC 1E6HA 4E7LA 1RAGB 1AOJA 3G4ST 2VXEA 5FROA 3CD6T 2JM9A 4FU6A 5GMKh 4C8QE 4M75B 3MP1A 1FXXA 2LNVA 2M0YA 2J6OA 4N4GA 1B34A 4C92D 1WNLA 1BYMA 1YWOA 4FYYB 1UHFA 4KT0E 4D8KA 1X27A 3ER0A 3V7CA 5KYYB 2C0IA 3P8BB 9ATCB 1QVFP 2D8JA 1HK9A 3QJ6A 1R8OB 2CDTA 2L3SA 1W70A 5L8RE 4PJOC 3LWIA 3VJPA 5IT9E 2DVEA 4BI8B 1WHGA 2EYYA 3M0TA 2EYQA 2GFAA 1GXIE 3L1AA 1G3TA 2XD0A 1K4US 1OX8A 2QA4Q 1I0CA 5IHIA 1AWOA 1QVFS 1JXOA 2M9UA 1FMVA 2VASA 3RKWA 1YCYA 3WXMB 4FM4B 1YJWQ 4N4IA 4LD9K 4M7AA 5FLXE 1X01A 3D7SB 1QKWA 5LJ3f 4CC7A 2QXFA 1JQQA 2JUFA 1TUCA 3BDUA 3LGFA 1I4K1 1WI7A 2M02A 2YWWA 3JB9H 1PHTA 3JCMJ 4IUUA 4AG1C 2O2OA 3DB3A 2WSCE 1X43A 4JZ3A 4C5IA 3LX7A 5GANh 2AZSA 2DL5A 2K4YA 2NLUA 1SF9A 1LPLA 3M0PA 4M7DC 4CI0C 4HVWA 1U06A 1C6VX 3CCST 1AEYA 1NM7A 4X34A 1VQMQ 4ZGEB 2FRWA 1D0YA 2QEXA 2DNUA 4P5NA 2YUQA 2RK2A 2YUNA 3PIPA 1GCQC 1D09B 1UB4A 4TVRA 3HRTA 2D1XA 3EFRA 3X20B 1YITT 3V8JA 3UPUA 4LDWA 2HQEA 3CMET 5D6YA 1D1CA 4C8QG 3OYNA 2K5LA 3CPWP 2DTIA 3JCMQ 2D8HA 3KXTA 2KXDA 1NG2A 2JS0A 3WVEB 2JN0A 1XQHA 3QG1A 1K8AR 2OTJT 3M54A 1VQ8A 3HFOA 2EJGA 1SG5A 2LVMA 2DAQA 1X75C 5KYUB 5D6XA 1WLPB 2BTTA 2ED1A
chains in the Genus database with same CATH topology
1G3YA 2I2LA 3DKMA 3QDRB 1IREB 2YRVA 4M7AC 3M53A 3LWHA 3OS1A 4OF1A 1K8AU 2F5TX 3FEOA 3OB9A 2XIDA 3DB4A 4KULA 2MI6A 3OS0A 1M90C 2EJ9A 4FSXA 1KC8C 3CCLT 4L5GA 1VQ4T 3QHSA 1WQ7A 4DQ2A 4JUVA 3PGGA 5CKDA 5CVIA 4J6WA 3CCSA 4RKUE 3QO3A 3L2QA 2LRQA 4M77E 3SD4A 1AHJB 1M90U 1KC8U 2KY9A 3EFSA 4LDUA 4J5YA 4C5GA 5LJ5f 3EAEA 3CCJA 4QVZA 4OVAA 2FB7A 1FWZA 2MWOA 3CBMA 3M57A 5IN1A 4DOWA 2LDMA 3CC4A 2L5QA 2VGNA 2F69A 3R6OA 3G6ET 3JCMc 5GAN4 5GANg 3CC7A 2BKDN 3QBYA 3JB9I 3JCMg 3M56A 1JRIA 2RJDA 3H6ZA 2VYTA 3G71A 1KQ1A 5AYFA 3OYEA 2ZPEB 1XTDA 4A53A 2DD4A 3E9GA 1VQ5T 3OYBA 2XDPA 1UGPB 2PUKB 3GP8A 4JS4A 2WSFE 3X25B 4C5HA 5C0MA 4M75C 3OYCA 3MHXA 1YITA 1BKBA 4PLIA 3JCMW 3CCVA 1Q7YU 2G3RA 2HBPA 1PSEA 3CXCS 4C5EA 5GANe 3CMEA 2EJFA 3RMSA 2RO0A 1VQNA 4A4GA 3JCMe 4C0FA 4M77D 1YI2A 2PVOB 4A4EA 2RHZA 3FB9A 3MEVA 5CQYA 2A7YA 5A2QE 3CCEA 2X4JA 3CD6A 2MAMA 2RJCA 4M78F 1VQKT 4M78A 5GAN7 4ELYC 5KE2A 3HPWA 4O6JA 3JCMX 3JCMb 1QP3A 1KD1C 2EQMA 3PFSA 2C06A 5FRMA 4M7AE 4BE2A 1YIJA 2QQ9A 3TEEA 4PJOF 4PJOA 2Y4YA 5HK3A 1VIFA 1VQOA 2E1HA 3OYMA 3PMIA 4XTZA 2D6FA 1G3SA 4L59A 5KE3A 1WJQA 3E9FA 1KD1U 3PT9A 3PTAA 2DZ9A 2ZGWA 1JB0E 4D6WA 2FL7A 2RM4A 1BI0A 2DXCA 4RG8A 2RK1A 3OYGA 4JDSA 2OTJA 2DO3A 4XU1A 2P0QA 4M7AD 4N0AA 3SDZA 2EWNA 2KK4A 2QA4T 4V2SA 4XU0A 3NTHA 3OW2A 3PNWC 1OYXA 3PIOA 2VXFA 1KQSA 2D9TA 4QVDA 1NPRA 1YJWT 1VQ7T 1M9SA 4NL2A 4E7HA 2LQ8A 4R55A 2IVWA 4C92G 5CCAA 5GANd 2HAXA 3L2RA 5GAMj 3VUZA 5D6WA 1SSFA 1WGSA 2EQUA 4F7UG 3ME9A 5DLOA 2XU8A 1KHIA 4C92F 3JCMd 4C92A 2RHXA 1YHQT 4F7UF 2K57A 2M16A 2XK0A 4M75E 4F7UA 3L2VA 1Q82C 2XHCA 3ZBDA 1MHNA 3QXEB 3TCJA 4EDUA 3CCLA 1O9SA 4EMHA 3X26B 2WSEE 3SB2A 3C94A 3OMCA 3CCUT 1VQ4A 2PUOB 2CKKA 2QQAA 3GPLA 1G5VA 3RKYA 4M78B 2BUDA 4JRIA 4LD6A 2KSSA 1X6OA 3ASKA 4ZN1A 1UGQB 2QDYB 3A5ZB 4E47A 1DJ7B 2CZ6B 5CKEA 1H3ZA 2CZ1B 4M77C 3A8HB 4X9CA 2X4WA 3MO8A 3LLRA 1YJNT 4PJOB 3G6EA 1QVGA 3V8LA 3S3OA 2LT1A 3OS5A 1UGSB 4C8QF 2EIFA 4C8QA 3OYDA 5CKFA 3MCAB 4HCZA 4FT4A 2E65A 1G3WA 4XU2A 4MMLA 2E10A 1VQ5A 3O8VA 4LDXA 5CR2A 4A54A 1QVGS 4II1A 2OAUA 3Q1JA 4M7DG 1O75A 3J80E 1Q81C 1N27A 2K3XA 3QJYA 5HY6A 3RESA 4XTUA 3VUBA 4M7DF 5A0DA 3ZEHA 4M7DA 5GAOl 2O4XA 3NFCA 3RUXA 4NL3A 3HSBA 3V8KA 1WJRA 1VQMT 1Q81U 5GANf 1XOVA 3M59A 3QYHB 2ZPFB 2IG0A 3JB9G 3JCMf 2M1HA 4BACA 4ZTFA 4QQGA 2XICA 1VQKA 4C92B 3JB9F 5LJ5j 2PU9B 4OGEA 3QZ9B 3NTKA 4Y91A 4F7UB 1YJ9T 2LX9A 3V7SA 5LJ3h 3X24B 2EAYA 4BDYA 1XNIA 4ZTJA 3M4YA 1HXDA 2KMTA 3URGA 3OBWA 4EMKC 3FLGA 1BI3A 2CZ0B 5FU6C 4E7JA 5HK0A 5GMKj 3SWNA 3A8LB 4M77G 4YTLA 5CIUA 3FC3A 5LJ3j 4BI4A 4C8QB 2JTFA 5I2SA 4MZMA 2QA4A 2FVUA 4XTXA 4JRPA 3OQ5A 1VQ6A 3CBPA 3M9QA 4Y28E 5I2MA 1M1GA 3BDLA 2QQBA 5GAOq 5A0LA 3JAME 1YJWA 4KUIA 4XTWA 1VQ7A 2RI2A 2EFIA 4JLGA 4XAXB 5DY9A 3OS2A 4C0ZA 5GMKi 4M7DB 4C0DB 2O4XB 2Y90A 5GAMg 1YHQA 4HCBA 3I55A 4B9XA 3GLXA 3QZ5B 2K3YA 4EMGA 3CXCA 2ZZDA 2JOYA 1I8FA 4PL6A 2RHUA 1U8RA 3CCUA 3QYGB 2XDBA 3HKSA 5KCHA 5FU7C 4J6XA 3RIRA 1IZ6A 4MDWA 5GAOm 3CMAT 2L89A 4HCCA 4J7FA 3CCMT 1M4ZA 1QP2A 3OYHA 2E6NA 4QQDA 2D0QB 1YJNA 1VQ9T 4RMOA 5CK9A 4IKFA 2L3RA 1TH7A 4M7AG 1P92A 2H3JA 2MF2A 2VUBA 3JRZA 4BD3A 1JJ2A 5CQXA 3SWNB 4M7AF 5CO7A 3TU4K 1M5Q1 2XI9A 1K9MC 3L2UA 2PVDB 2GQVA 3GF5A 3INZA 5IAYA 3P8HA 3JCMV 1BIBA 4IURA 3S3MA 1JJ2S 2QQRA 2KAFA 3OYJA 3X28B 1K9MU 2VV5A 3HFNA 3J81E 5GMKl 5C6SA 1VQMA 1RL2A 2E41A 4IUTA 4OB0B 5GAMh 4R56A 4BUGA 3OYFA 4OP0A 5LL6S 4FL6A 4M78E 1WPYA 1YJ9A 5DLQE 4A4HA 4BE0A 2JNGA 4E7IA 4PJOC 2E12A 4L6V5 2P0KA 2K5IA 1WQWA 5KCOA 2HNIA 1QVPA 1YBYA 3JSCA 4QW2A 2X4YA 4PJOE 4M75G 1M8VA 2CS7A 3OBYA 4BY6B 1KQ2A 1D3BA 2JTMA 4FT2A 4J7IA 4M75F 2LT4A 3A8GB 1VIEA 1OI1A 2EKOA 2WACA 4M75A 1H641 2DIQA 1S72T 2R57A 1Y07A 2LTOA 1M1KC 3OYKA 2LC4A 1VQLT 2V8JA 3HHTB 2LQKA 1ZBXA 3HRSA 3J7AF 1VUBA 5LJ3g 4HA8A 3CPFA 1Q82U 1Y7XA 2B8AA 4M7AB 2R5MA 2RA2A 3UT1A 3RKXA 2CGHA 1I81A 2RJEA 3GOXA 2DJZA 1N6AA 2R5AA 5J39A 4XQ3A 3META 1JBMA 2E5QA 4M78D 4BDZA 3OYIA 1W2BA 2RB6A 2QI2A 3A8OB 1NJIC 1Q86C 2RD1A 3PMTA 5I21A 3NTIA 4HKEA 4OB3B 4DA4A 3M58A 1BI1A 2P4TA 3HL8A 5CKBA 3VU3C 5GAN6 4PJOD 3TREA 1W2BS 2RHIA 5LJ3e 1NJIU 2FHDA 3VKIA 5GAN8 4X9DA 5LJ5h 2EQJA 4HT8A 5HKCA 2LCLA 3CMAA 1Y96A 3MP6A 2M0OA 3HP9A 1V29B 4OMFB 2L8DA 5GMKm 3CCRT 3CCMA 1N8RC 3V7RA 4J8OA 2HQXA 4E7LA 3SFMA 1VQ9A 3G4ST 2VXEA 3MEWA 5FROA 4A4FA 4RCCA 1D3BB 3CD6T 5GAOp 4GLKA 4FU6A 3T9NA 4C8QE 4M75B 3MP1A 4BI3A 1FXXA 2LNVA 5GMKh 1N8RU 4J83A 4XU3A 1VQPT 4N4GA 3S3NA 1ZQ1A 1W4SA 4JRQA 3MP8A 1B34A 2GCXA 2PQWA 3N5BB 4C92D 1N9SA 1WJSA 2V8IA 1WNLA 3CCQT 1KG1A 1BYMA 3FIFA 4EPCA 2RH2A 2MMPA 3G7ZA 3BW1A 4RCBA 3OY9A 4KT0E 2RHYA 4CRIA 3C95A 3ER0A 4FIBA 4QVCA 3V7CA 3UDCA 5GAN2 4M77F 4M77A 3A8MB 3CPWS 5LJ3d 2V8KA 4ELZC 3P8BB 4ZGDB 4XK8E 2E70A 3OMGA 1K8AC 2QEXT 3L2WA 3OSSC 3F70A 2OTLT 4C8QD 4M78C 1HK9A 3QJ6A 1R8OB 5GAOr 4MDXA 2RJFA 1Y96B 5L8RE 2KDSA 3QSUA 3LH0A 3MEUA 1S72A 3GIBA 2R58A 3LWIA 4MZTA 3C4SA 2DVEA 3VJPA 4BI8B 5IT9E 1VQLA 4NS5A 3BY7A 2EYQA 2GFAA 4IUPA 4M7DD 1QVFA 1GXIE 1NZ9A 3L1AA 5A0GA 2EQKA 2RI5A 1G3TA 5CAIA 1Y71A 3OA6A 3DLLA 2XD0A 2DD5A 4WF2A 1M1FA 2MWPA 4JLIA 1MGQA 4N0AC 4ME7A 4HT9A 3GNFB 4XTYA 3UWNA 3CC2T 1B34B 1QVFS 3H8ZA 5GAMe 3JB9D 4OGCA 2M9UA 5J3BA 3RKWA 1YCYA 1OZ2A 4FM4B 3WXMB 2QQSA 2XG8D 2A3LA 2HD0A 4N4IA 4O5VA 2FYKA 3S6WA 4BB7A 4KBMB 1LNXA 2DXUA 4LD9K 4M7AA 5FLXE 3KBGA 2LCCA 4EMKA 2DTHA 4BE1A 1Q7YC 1X01A 1RI0A 3KUFA 4MZPA 4C92C 4M77B 5LJ3f 2KVQG 2QXFA 2AHJB 2JUFA 1BI2A 1LOJA 2DPPB 2VC8A 1K73C 2E6ZA 2KQWA 3I56T 4ATOA 3MEAA 3VYHB 3CCRA 1U1SA 3BDUA 3DLMA 3M5AA 3LGFA 2ZPGB 4GY5A 1I4K1 5J26A 4M78G 5KH6A 3G4SA 1VQ8T 4JS5A 3JB9H 3QIIA 1K73U 2ZPBB 3JCMJ 4LDYA 2DK3A 3BFMA 4IUUA 4ZN3A 2XDDA 1I5LA 1VQPA 2XKOC 4PJOG 5LJ5g 4C0GA 3FJPA 3DB3A 3P8DA 2WSCE 4C8QC 1NPPA 4Q5WA 2GF7A 5GAN3 2BIVA 4C5IA 3CCQA 2DIGA 2VGMA 3LX7A 3QUIA 2JVVA 1LJOA 5GANh 4ZGJB 5CKHA 5GAMd 5M9OA 2PVGB 4OB2B 3JCMh 3JCMP 2K4YA 4E7KA 1UEBA 2NLUA 2DXBA 3L2ZA 4VUBA 4PKCC 3OYYA 3OSVA 4M7DC 1KHCA 2DEQA 2P0PA 4C0DC 2DTOA 3CEYA 2QTXA 4B9WA 4CI0C 5LJ5e 3CCST 1VQ6T 4X34A 2K5FA 2F5KA 3FRNA 3CCJT 1ZHIA 2Y4XA 4EMKB 4ZGEB 1M1KU 2QEXA 3M4GA 4P5NA 4MMKA 5FU6B 2OTLA 5GANj 3L42A 2RK2A 3CC4T 3QPHA 3PIPA 3JB9J 1BIAA 3WVDB 3CC7T 2JZ2A 2YHTA 1U1TA 2CZ7B 3OW2S 3LGLA 5GMKe 1KQSS 2DXTA 3G71T 3E1SA 1UB4A 4TVRA 3HRTA 3RMQA 4C92E 5GAN5 3I55T 4F7UE 4KUDK 4PNOA 3EFRA 4LDVA 3OYAA 1Q86U 3X20B 1YITT 5DM7R 3QKJA 3SWNC 3V8JA 4IUQA 4IUVA 3UPUA 4LDWA 3M55A 3VYGA 2HQEA 3GNGA 3CCVT 3FDRA 4Z02A 3CMET 4UC4A 5D6YA 4NOYA 5EG2A 1VQNT 2ZPIB 4OB1B 4C8QG 3E19A 5GAOn 3OYNA 1YI2T 2GFUA 2K5LA 2RI3A 3CC2A 3AHUA 2X35A 3ZFJA 3CCET 4XTVA 2DTIA 2YLBA 5GAMf 3JCMQ 3KXTA 4JRKA 5FU7B 2DZCA 3C12A 4RG2A 5LJ5d 1YIJT 2CYZB 2ZCFB 5FRNA 3WVEB 2O01E 1VQOT 4JJNK 4M75D 2E64A 2JN0A 4N4HA 3RERA 4A4KA 1XQHA 3CPWA 1EIFA 1QW1A 4DOVA 2YLCA 4M7DE 3I56A 2DKGA 2X4XA 3LYIA 3QG1A 3HRUA 2OTJT 4QQ6A 3M54A 1PSFA 1VQ8A 4BY6C 3OYLA 3HFOA 2EJGA 4J6YA 2K2VA 2LVMA 1NE8A 3LW5E 1FX7A 2DAQA 1X75C 3CBOA 1UGRB 4PLLA 5D6XA 3VV0A 1OZ3A 1N9RA 2ZPHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QQS A;  4QW2 A;  4N4I A;  3S6W A;  2X4Y A;  2YRV A;  2LCC A;  3O8V A;  3OS1 A;  4BE1 A;  4II1 A;  1RI0 A;  2WAC A;  1OI1 A;  2EKO A;  3FEO A;  3DB4 A;  2DIQ A;  3KUF A;  3OB9 A;  3Q1J A;  2R57 A;  1N27 A;  2LTO A;  2K3X A;  3OS0 A;  3OYK A;  3ZEH A;  2O4X A;  3MEA A;  1WJR A;  3DLM A;  3L2Q A;  2LRQ A;  3LGF A;  4GY5 A;  3SD4 A;  5J26 A;  4C5G A;  2B8A A;  3UT1 A;  5KH6 A;  2R5M A;  2IG0 A;  3EAE A;  4QVZ A;  2M1H A;  3QII A;  2RJE A;  3GOX A;  4OVA A;  4BAC A;  4QQG A;  4ZTF A;  2MWO A;  2R5A A;  5J39 A;  5IN1 A;  3MET A;  2LDM A;  2E5Q A;  3NTK A;  4IUU A;  3OYI A;  4BDZ A;  2BKD N;  3QBY A;  3PMT A;  4HCZ A;  3DB3 A;  3NTI A;  3P8D A;  2RJD A;  3H6Z A;  4BDY A;  2VYT A;  1XNI A;  4ZTJ A;  3OYE A;  4Q5W A;  2GF7 A;  3E9G A;  2BIV A;  2XDP A;  4C5I A;  2RHI A;  3OYB A;  2DIG A;  3LX7 A;  3FLG A;  2FHD A;  3OYD A;  4C5H A;  4E7J A;  5C0M A;  2EQJ A;  5M9O A;  3OYC A;  4PLI A;  4E7K A;  2NLU A;  5CIU A;  3FC3 A;  1KHC A;  2G3R A;  3MP6 A;  2JTF A;  2M0O A;  3CEY A;  4B9W A;  4C5E A;  2L8D A;  2RO0 A;  4A4G A;  3OQ5 A;  4X34 A;  2HQX A;  4E7L A;  3M9Q A;  4A4E A;  2F5K A;  2RHZ A;  3MEV A;  3BDL A;  3MEW A;  5FRO A;  4A4F A;  4FU6 A;  2RJC A;  3L42 A;  3MP1 A;  5KE2 A;  2RI2 A;  2EFI A;  2JZ2 A;  2EQM A;  3PFS A;  3OS2 A;  4N4G A;  5FRM A;  4BE2 A;  3S3N A;  3LGL A;  2O4X B;  3MP8 A;  4B9X A;  2PQW A;  3PMI A;  3OYM A;  2K3Y A;  5KE3 A;  4L59 A;  1WJS A;  1WJQ A;  3E9F A;  4PL6 A;  3OYA A;  2RHU A;  3OY9 A;  5KCH A;  2RHY A;  4CRI A;  3QKJ A;  3OYG A;  4IUQ A;  4IUV A;  2HQE A;  2L89 A;  3FDR A;  4Z02 A;  4UC4 A;  5D6Y A;  3OYH A;  2E6N A;  4QQD A;  3OYN A;  2GFU A;  2RI3 A;  3NTH A;  3PNW C;  1OYX A;  2X35 A;  3OMG A;  4IKF A;  2D9T A;  3L2W A;  2L3R A;  3F70 A;  4E7H A;  3QJ6 A;  4BD3 A;  4RG2 A;  3L2R A;  3L2U A;  5D6W A;  1SSF A;  1WGS A;  2EQU A;  5IAY A;  2RJF A;  3ME9 A;  3P8H A;  5FRN A;  2RHX A;  3LH0 A;  3MEU A;  2M16 A;  2XK0 A;  2R58 A;  4IUR A;  4N4H A;  3C4S A;  3L2V A;  3S3M A;  1MHN A;  4EDU A;  4NS5 A;  2QQR A;  3OYJ A;  3OMC A;  2GFA A;  4IUP A;  2CKK A;  2X4X A;  3LYI A;  1G5V A;  4QQ6 A;  2BUD A;  5C6S A;  2EQK A;  2RI5 A;  3OA6 A;  4IUT A;  3OYL A;  4LD6 A;  2MWP A;  3ASK A;  3OYF A;  1H3Z A;  2LVM A;  3UWN A;  2X4W A;  3MO8 A;  3LLR A;  4FL6 A;  3H8Z A;  4A4H A;  2DAQ A;  3S3O A;  4BE0 A;  4PLL A;  4E7I A;  5D6X A;  2P0K A;  1OZ3 A;  1OZ2 A;  5KCO A; 
#chains in the Genus database with same CATH topology
 1IRE B;  4M7A C;  2LNH B;  3LWH A;  3OS1 A;  4OF1 A;  1K8A U;  2F5T X;  3H0F A;  2LX7 A;  3DB4 A;  2BE9 B;  2C0T A;  4L5G A;  4AFS C;  3QHS A;  1M2V B;  2DFU A;  4DQ2 A;  4JUV A;  3PGG A;  2F2V A;  3QO3 A;  4M77 E;  1AHJ B;  1KC8 U;  2KY9 A;  4FYV B;  4QVZ A;  2MWO A;  3M57 A;  2LDM A;  3JCM c;  2RQW A;  3JCM g;  2LJ1 A;  3H6Z A;  2VYT A;  1K73 R;  1KQ1 A;  1XTD A;  2DYB A;  1UGP B;  2GTO A;  2MK5 A;  3BE3 A;  3X25 B;  4M75 C;  3NMZ C;  3CCV A;  2HBP A;  2DYI A;  3JCM e;  5KYW A;  2RPN A;  2PVO B;  2RHZ A;  5A2Q E;  3CD6 A;  2K3B A;  2H3E B;  2X4J A;  5GAN 7;  4ELY C;  5KE2 A;  2X3X D;  3HPW A;  4O6J A;  3VS7 A;  1KD1 C;  1QP3 A;  2AK5 A;  2EKH A;  2C06 A;  1OUL A;  2KE9 A;  5KYX B;  1VQO A;  4L59 A;  1WJQ A;  1KQS P;  3ZL7 C;  3PTA A;  2FL7 A;  2OI3 A;  1K0X A;  4XU1 A;  1JO8 A;  4E6R A;  4XU0 A;  3OW2 A;  3G4S Q;  2D9T A;  3CD6 Q;  1AD5 A;  1VQ7 T;  1M9S A;  4NL2 A;  2LQ8 A;  4HCK A;  3VUZ A;  1WGS A;  2EQU A;  3JCM d;  2XU8 A;  2K57 A;  2M16 A;  3H9N A;  2XHC A;  1NEB A;  3CCL A;  1UDL A;  1VQ4 A;  3OMC A;  3CCU T;  3GPL A;  2QQA A;  2LQW A;  5KYN A;  2KBT A;  1G8X A;  4ANJ A;  3A8H B;  1ZLM A;  2X4W A;  1YJN T;  2HQH A;  1QVG A;  1M2V A;  4C8Q A;  2ATC B;  5CKF A;  2E65 A;  4XU2 A;  1IXD A;  1IHV A;  3MKD A;  2KNB B;  3O8V A;  4A54 A;  3Q1J A;  2K2M A;  3J80 E;  1N27 A;  1PKT A;  2K3X A;  3RES A;  1OV3 A;  4J9I A;  5A0D A;  2DMO A;  2HZY A;  3THK A;  4ORZ A;  1OOT A;  2G6F X;  2IG0 A;  1IO6 A;  2DRM A;  4BAC A;  4QQG A;  5LJ5 j;  4OGE A;  2LP5 A;  2CP7 A;  5LJ3 h;  1M90 R;  1M27 C;  3X24 B;  2EAY A;  4J9B A;  4JJC A;  1XNI A;  1QQJ A;  3M4Y A;  3NGP A;  1GL5 A;  3OBW A;  3FLG A;  1BI3 A;  2KRO A;  2AKL A;  4M77 G;  5CIU A;  5I2S A;  5IXB A;  3CBP A;  3VS5 A;  2QQB A;  4XTW A;  5GJV B;  2RI2 A;  3UA6 A;  2CP0 A;  4JLG A;  2PTK A;  4C0Z A;  1QCF A;  5GAM g;  3GLX A;  3CXC A;  1JEG A;  2JOY A;  4WTO B;  1U8R A;  3EGX B;  2XDB A;  3HKS A;  4J6X A;  2ROL A;  2V1Q A;  3CCS Q;  3PVL A;  3OYH A;  2E6N A;  4QQD A;  2D0Q B;  4RMO A;  1NBE B;  4IKF A;  1TH7 A;  1P92 A;  2VUB A;  1ZUY A;  2AZV A;  2MF2 A;  5CQX A;  3SWN B;  5CO7 A;  1KSW A;  3GF5 A;  2EW3 A;  1D1B A;  4AT1 B;  2EGA A;  1RAB B;  1PRM C;  3PVQ A;  2RNA A;  4FW2 A;  2VV5 A;  4F14 A;  1YIT Q;  5GMK l;  4IUT A;  4R56 A;  2JT4 A;  4OP0 A;  3CME Q;  2A37 A;  1BCM A;  4M78 E;  1WPY A;  1YJ9 A;  4A4H A;  4BE0 A;  2K5I A;  1R77 A;  2HNI A;  1YFN A;  3OBY A;  4BY6 B;  1KQ2 A;  1D3B A;  1B3Q A;  3JCM P;  4RTV A;  2O31 A;  2EKO A;  2DIQ A;  2LTO A;  1I5O B;  3OYK A;  2LC4 A;  1J3T A;  1ZBX A;  2R5M A;  2RJE A;  2NUP A;  2R5A A;  4BDZ A;  2E5Q A;  2RB6 A;  1Q81 R;  5I21 A;  2GGR A;  3HL8 A;  5CKB A;  2DRK A;  4PJO D;  1HD3 A;  2RHI A;  1NJI U;  5GAN 8;  2CT4 A;  4F04 B;  4J9H A;  3EGD A;  3CMA A;  1Y96 A;  3HP9 A;  2L8D A;  3CCM A;  3SFM A;  4A4F A;  4RCC A;  1N8R U;  2A28 A;  3EG0 A;  4XU3 A;  4EIK A;  1W4S A;  4JRQ A;  4AFZ C;  3M0R A;  1ZA1 B;  2ECZ A;  1WJS A;  1FMK A;  4PJN A;  1KG1 A;  3FIF A;  3UA7 A;  3OY9 A;  3EFO A;  2F2W A;  2RHY A;  4QVC A;  3UDC A;  4M77 A;  2V8K A;  2J05 A;  3R6N A;  1WXT A;  3REA B;  2J6F A;  4ZGD B;  4LNP A;  2C0O A;  1TOV A;  2QEX T;  3OSS C;  2RQT A;  2EYW A;  1QWE A;  4OML A;  4MDX A;  2KDS A;  2R58 A;  1Z9Z A;  4MZT A;  1VQL A;  4M7D D;  4PFZ A;  2JXB A;  1NZ9 A;  5CAI A;  3OA6 A;  3DLL A;  4WF2 A;  1M1F A;  4JLI A;  4ME7 A;  4XTY A;  1T3S A;  3UWN A;  1K9M R;  1B34 B;  3H8Z A;  1MMA A;  2DLP A;  4OGC A;  1VQ7 Q;  4D8D A;  2A3L A;  2HD0 A;  2K9G A;  4O5V A;  4BB7 A;  2QAS A;  4KBM B;  2DXU A;  1C0M A;  3KBG A;  3O5Z A;  2DTH A;  4EMK A;  4BE1 A;  1Z9Q A;  3KUF A;  2AHJ B;  2VC8 A;  2E6Z A;  2KQW A;  3CCU Q;  1QWF A;  3CCR A;  1U1S A;  4M4Z A;  2AIR B;  5J26 A;  4M78 G;  1VQ8 T;  2PNI A;  4JS5 A;  3A98 A;  2FPE A;  2ZPB B;  4LDY A;  3H41 A;  2DK3 A;  3BFM A;  1YJN Q;  1VQP A;  2OAW A;  2YXY A;  5LJ5 g;  3FJP A;  3P8D A;  1M3B A;  4Q5W A;  1U3O A;  2JM8 A;  2DIG A;  2QK0 A;  2VGM A;  2DM1 A;  3QUI A;  4RTT A;  3CCQ A;  4ZGJ B;  5CKH A;  5M9O A;  3L2Z A;  4VUB A;  3VRY A;  4JZ4 A;  3OSV A;  2DTO A;  3CEY A;  5LJ5 e;  1IGU A;  1Q86 R;  1UTI A;  3FRN A;  5FU6 B;  5I11 A;  3G1J A;  3L42 A;  3QPH A;  1RAC B;  1U1T A;  3OW2 S;  1UJY A;  4KUD K;  2DIL A;  4LDV A;  1Q86 U;  2DX1 A;  2RF0 A;  2YRC A;  3SWN C;  4IUV A;  1EFN A;  3M55 A;  3CCV T;  5EG2 A;  2ZPI B;  5GAO n;  2GFU A;  4XTV A;  4JRK A;  1RUW A;  3C12 A;  5LJ5 d;  1CKB A;  2MOX A;  3KFV A;  2CYZ B;  1LCK A;  2O01 E;  1VQO T;  4M75 D;  4N4H A;  3VS1 A;  3RER A;  5IXF A;  4A4K A;  3I56 A;  3LYI A;  3HRU A;  1V1C A;  4LXC A;  1M3A A;  4BY6 C;  4J6Y A;  1NE8 A;  2EBP A;  1WHL A;  4PLL A;  2CRE A;  2DE0 X;  3VV0 A;  1OZ3 A;  1G3Y A;  1FMW A;  2QGG A;  3DKM A;  3QDR B;  4RTU A;  2XID A;  3CCL T;  4CC4 B;  1VQ4 T;  1YCS B;  4RKU E;  3SD4 A;  3CXC P;  4C5G A;  4J5Y A;  4DEX A;  3CCJ A;  3EAE A;  1QLY A;  5AT1 B;  3CBM A;  1WA7 A;  2F69 A;  2RN8 A;  5GAN 4;  3CC7 A;  3H0I A;  4DBQ A;  1RAF B;  1TXQ A;  3OYE A;  2ZPE B;  1BCO A;  3E9G A;  3OYB A;  2XDP A;  2HMA A;  2O88 A;  1CKA A;  5FW9 A;  3MHX A;  1TUD A;  1OQK A;  3JCM W;  1Q7Y U;  3CXC S;  1PSE A;  2EJF A;  1VQN A;  4C0F A;  1YI2 A;  4A4E A;  2A36 A;  3MEV A;  3CCE A;  2A7Y A;  3VS3 A;  4M78 A;  1ARK A;  1GBR A;  3JCM X;  2DVJ A;  1YIJ A;  2QQ9 A;  3TEE A;  2D6F A;  5HK3 A;  3OYM A;  1G3S A;  1G83 A;  1KD1 U;  4PJJ A;  3PT9 A;  2ZGW A;  5FWC A;  3EG3 A;  4RG8 A;  2Z0W A;  4JPB W;  1RLP C;  4N0A A;  2EWN A;  2KK4 A;  1RAE B;  2H8H A;  2JMA A;  1M30 A;  3LH5 A;  2VXF A;  2KRM A;  2L3Q A;  4E7H A;  1MMD A;  2HAX A;  4E2F B;  2HL3 A;  5GAM j;  3ME9 A;  1KHI A;  1QKX A;  4C92 A;  5IH2 A;  1SSH A;  4F7U A;  1Q82 C;  5KYW B;  1H8K A;  3QXE B;  3TVT A;  3SB2 A;  3C94 A;  2PUO B;  2CKK A;  4J9C A;  3RKY A;  1AWX A;  2CSQ A;  2V1R A;  1W6X A;  4KRT A;  4R0K A;  8ATC B;  2CZ6 B;  3M0U A;  5CKE A;  4ZNX A;  1H3Z A;  1HSQ A;  3G6E A;  3V8L A;  1PC0 A;  1UGS B;  4C8Q F;  2QEX Q;  1RAD B;  1G3W A;  1WFW A;  1VQ5 A;  4J9F A;  4II1 A;  1TUG B;  4GBQ A;  3QJY A;  1GRI A;  5HY6 A;  4XTU A;  2DF6 A;  3C0C A;  3RUX A;  5GAO l;  3V8K A;  1RI9 A;  2JJ9 A;  3QDF A;  1E7O A;  3JB9 G;  3JCM f;  4HVU A;  1VQK A;  3JB9 F;  2PU9 B;  1YJ9 T;  2KEA A;  5FWB A;  1KC8 R;  1OEB A;  3RBB B;  3URG A;  2OX7 A;  1K76 A;  5FU6 C;  2CZ0 B;  5HK0 A;  2CUB A;  5GMK j;  2F2X A;  2OJ2 A;  4YTL A;  4BI4 A;  4RTY A;  4C8Q B;  1RAA B;  2FVU A;  4FW1 A;  4XTX A;  4JRP A;  1VQ8 Q;  1M1G A;  2AT1 B;  5GAO q;  5A0L A;  3JAM E;  2XMF A;  2EFI A;  1AWJ A;  1X2K A;  5GMK i;  4CC3 A;  2Y90 A;  2MPX C;  1YHQ A;  4B9X A;  4EMG A;  2K3Y A;  4PL6 A;  2DL8 A;  2CP6 A;  2DET A;  5KCH A;  2I0N A;  3M0Q A;  2LQN A;  3CMA T;  4HCC A;  3CCM T;  1MV0 B;  1QP2 A;  4RTZ A;  2DL3 A;  2DBM A;  3JRZ A;  1JJ2 A;  2FZG B;  2GQV A;  2V26 A;  3JCM V;  4FYX B;  1VOM A;  1VYV A;  2QQR A;  3J81 E;  1SRM A;  1SEM A;  3CCV Q;  2EPD A;  5LL6 S;  1MMN A;  2COZ A;  2X9H A;  2O9S A;  4E7I A;  3RNJ A;  1PM3 A;  1WQW A;  3TSZ A;  3JSC A;  1YBY A;  2X4Y A;  4PJO E;  1X6G A;  4FT2 A;  2DBK A;  3A8G B;  1VIE A;  1OI1 A;  2WAC A;  1W2B P;  1VQO Q;  1Y07 A;  1VQL T;  2LQK A;  1M2O A;  2GTJ A;  1B7T A;  5HCK A;  1TU0 B;  3I35 A;  4HA8 A;  3UT1 A;  2RA2 A;  3RKX A;  3GOX A;  2DJZ A;  3MET A;  3OYI A;  1PCX A;  3A8O B;  4DA4 A;  1W2B S;  4AFQ C;  1K0S A;  5HKC A;  4JJB A;  3CCL Q;  1N5Z A;  1VQ4 Q;  4KGZ B;  3MP6 A;  4HVV A;  1V29 B;  5GMK m;  3CCR T;  1WX6 A;  3V7R A;  4J8O A;  2HQX A;  1D3B B;  5GAO p;  4GLK A;  4BI3 A;  4J83 A;  1VQP T;  2LJ3 A;  3S3N A;  1ZQ1 A;  2KT1 A;  1YNZ A;  2PQW A;  3AT1 B;  3CCQ T;  4EPC A;  2MMP A;  3G7Z A;  3BW1 A;  4RCB A;  2NUP B;  1I1J A;  4FIB A;  2SEM A;  5GAN 2;  4M77 F;  2HEQ A;  3A8M B;  3QWY A;  3EH1 A;  1IRX A;  4ELZ C;  2QTV A;  4XK8 E;  2E70 A;  3OMG A;  1K8A C;  1K9A A;  3L2W A;  3F70 A;  3EGD B;  1MV3 A;  2RJF A;  1Y96 B;  1WXU A;  3H0H A;  1ACM B;  3LH0 A;  3MEU A;  1S72 A;  3GIB A;  4NS5 A;  1H92 A;  3BY7 A;  4IUP A;  1QVF A;  2P4R A;  3PE0 A;  1PRL C;  5A0G A;  1Y71 A;  5D7U A;  2NWM A;  2DD5 A;  3RR6 A;  2MWP A;  4DBR A;  1MGQ A;  3UAT A;  2NUZ A;  5GAM e;  5J3B A;  2QQS A;  3EFO B;  1A0N B;  3S6W A;  2LMJ A;  1LNX A;  1ZA2 B;  1RI0 A;  4MZP A;  1BU1 A;  4M77 B;  2KVQ G;  1OPK A;  1D0X A;  1LOJ A;  1K73 C;  3QWX X;  1V76 A;  3I56 T;  3VYH B;  3VS2 A;  3MPU B;  2ZPG B;  4GY5 A;  3GBQ A;  5KH6 A;  3FJ5 A;  3QII A;  1FYN A;  2KYM A;  2XDD A;  4PJO G;  4C0G A;  4C8Q C;  1M1K R;  4Z8A A;  1B07 A;  2GF7 A;  5GAN 3;  2HKQ B;  2JVV A;  1LJO A;  1VYT A;  5GAM d;  1GFD A;  2PVG B;  4OB2 B;  3JCM h;  1BB9 A;  2DXB A;  4KGV B;  4PKC C;  4KH1 B;  2DEQ A;  4F16 A;  1ZX6 A;  1NJI R;  1VQ6 T;  2K5F A;  1M1K U;  3CCJ T;  4EMK B;  3M4G A;  2OTL A;  2DL7 A;  4CC2 A;  2FPD A;  2X3W D;  1YJ9 Q;  3WVD B;  3CC7 T;  2JZ2 A;  2CH4 W;  2EVR A;  5GMK e;  2DXT A;  3E1S A;  3RMQ A;  4C92 E;  2CP3 A;  3A1P A;  4F7U E;  1N8R R;  4PNO A;  3QKJ A;  4IUQ A;  3GNG A;  3FDR A;  4UC4 A;  1MMG A;  4NOY A;  3VS6 A;  1VQN T;  3E19 A;  1YI2 T;  3CC2 A;  2X35 A;  3CCE T;  4Z89 A;  2YLB A;  4J9D A;  2DZC A;  1YIJ T;  2ZCF B;  2NUT A;  5FRN A;  4PK4 A;  2KXC A;  2E64 A;  2COW A;  2CP2 A;  3CPW A;  4DOV A;  1YN8 A;  2DKG A;  2X4X A;  4QQ6 A;  3CMA Q;  3MJX A;  3CCM Q;  2K2V A;  4OMP A;  3LW5 E;  3CBO A;  1UGR B;  4PJM A;  3EG1 A;  2ENM A;  4RUG A;  1WHH A;  2YRV A;  3M53 A;  3SHW A;  2CUD A;  2ZAE A;  2CH4 A;  3FEO A;  4KUL A;  2MI6 A;  1M90 C;  2EJ9 A;  4FSX A;  2M51 A;  5CKD A;  1PD1 A;  3L2Q A;  2LRQ A;  2EQI A;  4LDU A;  5LJ5 f;  2FB7 A;  1FWZ A;  5IN1 A;  4DOW A;  3CC4 A;  2L5Q A;  2VGN A;  3R6O A;  3G6E T;  5GAN g;  1IB8 A;  3QBY A;  1YP5 A;  1NLO C;  2COY A;  3M56 A;  4GLM A;  3G71 A;  5AYF A;  1VQ5 T;  2DD4 A;  3VS0 A;  2PUK B;  1U5S A;  3GP8 A;  2VVK A;  5C0M A;  2JMC A;  1KIK A;  1VQL Q;  1TG0 A;  2G3R A;  4C5E A;  5GAN e;  4A4G A;  5GJW B;  2MAM A;  1BK2 A;  4M78 F;  1VQK T;  1KFZ A;  1C1A A;  2QAZ A;  3JCM b;  2EQM A;  1I07 A;  4PJO A;  4QT7 A;  3OW2 P;  5KE3 A;  1PWT A;  2DZ9 A;  1JB0 E;  2DXC A;  1TS9 A;  2RK1 A;  4JDS A;  2JW4 A;  3CCR Q;  2FRY A;  1JU5 C;  3PNW C;  3PIO A;  1KQS A;  1NPR A;  5CCA A;  4C92 G;  1VQP Q;  5GAN d;  4F7U G;  5D6W A;  1SSF A;  2LCS A;  4M7A D;  2FZC B;  4C92 F;  2YT6 A;  1YHQ T;  2K7A A;  4QKU A;  4F7U F;  3L2V A;  4OMO A;  3ZBD A;  1MHN A;  3TCJ A;  4EDU A;  1QVG P;  1O9S A;  3CCQ Q;  2WSE E;  1G5V A;  4M78 B;  1M3C A;  3CQT A;  4JRI A;  4LD6 A;  2KSS A;  1X6O A;  2CZ1 B;  4M77 C;  4X9C A;  3MO8 A;  3LLR A;  4HXJ A;  1WHJ A;  2KRS A;  2EIF A;  4HCZ A;  4FT4 A;  1AWW A;  1QCO A;  1T0H A;  4LDX A;  2AKK A;  1QVG S;  3EG2 A;  2OAU A;  1Q81 C;  1PNJ A;  3EGU A;  3VUB A;  3ZEH A;  4M7D A;  2O4X A;  3HSB A;  1WJR A;  2RMO A;  1UFF A;  3VS4 A;  1XOV A;  1X2Q A;  3M59 A;  3QYH B;  1ZBJ A;  4ZTF A;  4C92 B;  3QZ9 B;  4Y91 A;  4F7U B;  1GCQ A;  3V7S A;  4PFO A;  4J9E A;  1HXD A;  2KMT A;  4OMN A;  1TWB A;  4EMK C;  1MNE A;  1Y0M A;  3A8L B;  3FC3 A;  2JTF A;  3I56 Q;  2QA4 A;  1PG5 B;  3OQ5 A;  1VQ6 A;  2FG0 A;  5I2M A;  3BDL A;  1YJW A;  2DA9 A;  1Q7Y R;  2J06 A;  4XAX B;  5DY9 A;  2QGF B;  4KGX B;  4C0D B;  1YWP A;  3RDV A;  4F17 A;  4HCB A;  3QZ5 B;  2YUO A;  2ZZD A;  1I8F A;  2QDL A;  3QYG B;  2A08 A;  1RAH B;  3RIR A;  1IZ6 A;  4MDW A;  5GAO m;  5IHK A;  4J7F A;  1KD1 R;  1M4Z A;  1VQ6 Q;  2E4H A;  3CCJ Q;  5CK9 A;  4K11 A;  2L0A A;  2L3R A;  2H3J A;  1H3H A;  4FSS A;  2XI9 A;  3CC7 Q;  1K9M C;  3L2U A;  2LJ0 A;  3P8H A;  2YRD A;  1BIB A;  4IUR A;  2HDA A;  3OYJ A;  3X28 B;  1SHG A;  3HTR A;  2NYS A;  5C6S A;  1MUZ A;  1VQM A;  2HCK A;  3OYF A;  2E5K A;  1VQN Q;  2BZY A;  3EG9 A;  1YI2 Q;  2JNG A;  3CCE Q;  2ED0 A;  1QVP A;  4QW2 A;  1M8V A;  2CS7 A;  7AT1 B;  2JTM A;  1YIJ Q;  2D0N A;  1OU8 A;  2LT4 A;  4M75 A;  1S72 T;  4E7S A;  1GBQ A;  2EGC A;  4AMC A;  3I9Q A;  5LJ3 g;  1Y7X A;  2B8A A;  1I81 A;  1EZZ B;  1N6A A;  4PFP A;  1JBM A;  5KYY A;  1Q86 C;  2RD1 A;  3PMT A;  4OB3 B;  3M58 A;  1BI1 A;  3VU3 C;  2QG9 B;  3TRE A;  4OMQ A;  5LJ3 e;  2FHD A;  3I5S A;  3VKI A;  1VA7 A;  5LJ5 h;  5I22 A;  2K79 A;  2RQU A;  2KRN A;  2M0O A;  4OMF B;  2EYZ A;  1ZSZ B;  1VQ9 A;  2KYB A;  3MEW A;  3T9N A;  2DL4 A;  3G6E Q;  2MYS A;  3MP8 A;  1WHK A;  2FEI A;  3N5B B;  2GCX A;  1WZO A;  1N9S A;  1VQ5 Q;  2V8I A;  2JTE A;  4DBF A;  2RH2 A;  4CRI A;  3C95 A;  1BBZ A;  2FZK B;  1UJ0 A;  3CPW S;  4IIO A;  5LJ3 d;  4AG2 C;  2E3I A;  1VQ9 Q;  2IPO B;  2E3H A;  1D1A A;  2OTL T;  4DBH A;  1VQK Q;  4C8Q D;  4M78 C;  2KT8 A;  5GAO r;  2RQV A;  2HSE B;  3QSU A;  3UF4 A;  3C4S A;  2J7I A;  2YSQ A;  2DEU A;  2FO0 A;  1ZSG A;  4FYW B;  2EQK A;  2RI5 A;  4N0A C;  3JV3 A;  4HT9 A;  2EYX A;  2SRC A;  3GNF B;  1WHM A;  3CC2 T;  3JB9 D;  3E2U A;  2F1L A;  1D0Z A;  4LN2 A;  2CP5 A;  5EC7 A;  1OZ2 A;  2XG8 D;  2FYK A;  6AT1 B;  1Q7Y C;  2LCC A;  4Y92 A;  2O9V A;  4C92 C;  1YHQ Q;  1BI2 A;  2DPP B;  1S1N A;  4ATO A;  3MEA A;  3DLM A;  1OX9 A;  3M5A A;  3G4S A;  4KH0 B;  1K73 U;  2W10 A;  3M0S A;  4ZN3 A;  1I5L A;  2XKO C;  1XJW B;  1QCN A;  1NPP A;  2KI7 A;  1ZSZ A;  4PJL A;  1RAI B;  2BIV A;  1QMC A;  4E7K A;  1UEB A;  3OYY A;  1KHC A;  2P0P A;  4C0D C;  2QTX A;  4B9W A;  2F5K A;  1ZHI A;  2Y4X A;  4MMK A;  5GAN j;  3CC4 T;  3JB9 J;  1BIA A;  4LE9 A;  2YHT A;  1IHW A;  2CZ7 B;  1GFC A;  3LGL A;  3IQL A;  1KQS S;  1NYG A;  3G71 T;  1PD0 A;  2GBQ A;  3I55 T;  5GAN 5;  5KYU A;  2CSI A;  3OYA A;  5DM7 R;  3VYG A;  1AZE A;  4Z02 A;  4OB1 B;  2RI3 A;  3AHU A;  3ZFJ A;  5GAM f;  4RTX A;  2LZ6 B;  1UEC A;  5FU7 B;  4RG2 A;  1ABQ A;  2B86 A;  4JJN K;  1M8M A;  4A63 B;  1NLP C;  1EIF A;  1QW1 A;  2YLC A;  4M7D E;  2KR3 A;  2BE7 D;  2KGT A;  1PSF A;  2ESW A;  2ROT A;  3OYL A;  3ULR B;  1FX7 A;  1N9R A;  2ZPH B;  4WCI A;  2I2L A;  5ECA A;  1AVZ C;  3OB9 A;  3OS0 A;  1KC8 C;  5KYX A;  1WQ7 A;  5CVI A;  4J6W A;  3CCS A;  1M90 U;  2BZ8 A;  3EFS A;  3EHR A;  4OVA A;  2NUT B;  1UE9 A;  2QYZ A;  2BKD N;  3JB9 I;  3SEM A;  1JRI A;  2BZX A;  2RJD A;  1ZSZ C;  4A53 A;  4JS4 A;  2WSF E;  4C5H A;  1ABO A;  3OYC A;  1YIT A;  1S72 Q;  1BKB A;  4PLI A;  1LVK A;  3CME A;  3RMS A;  2RO0 A;  4LUD A;  4M77 D;  1NEG A;  2CT3 A;  3FB9 A;  5CQY A;  2RJC A;  1G2B A;  1UHC A;  1Q95 G;  3PFS A;  5FRM A;  2RQR A;  4BE2 A;  4Z88 A;  4M7A E;  4PJO F;  2Y4Y A;  1SPK A;  1VIF A;  2E1H A;  3PMI A;  4XTZ A;  1KJW A;  4JJD A;  3E9F A;  4OMM A;  2HL5 C;  4D6W A;  3NHN A;  2RM4 A;  2VB6 A;  1BI0 A;  2OTJ A;  3OYG A;  1X69 A;  2DO3 A;  2P0Q A;  2GQI A;  3SDZ A;  2QA4 T;  4V2S A;  1IGQ A;  4B6M A;  3NTH A;  4FCY A;  1OYX A;  2W0Z A;  3REB B;  4QVD A;  2YDL A;  1YJW T;  1W1F A;  4R55 A;  2IVW A;  2A0F B;  3L2R A;  5DLO A;  1ZUU A;  2RHX A;  2XK0 A;  4M75 E;  1VYU A;  4EMH A;  3X26 B;  1EX4 A;  2HKN A;  1PKS A;  2BUD A;  2OTJ Q;  1T3L A;  4ZN1 A;  3ASK A;  1UGQ B;  2QDY B;  3A5Z B;  4IIM A;  1DJ7 B;  4E47 A;  2YUP A;  4PJO B;  3EHQ A;  3S3O A;  2LT1 A;  3OS5 A;  1GCP A;  3OYD A;  2OTL Q;  3MCA B;  1NYF A;  4MML A;  2E10 A;  5CR2 A;  4M7D G;  2J6K A;  1O75 A;  4X1V A;  4M7D F;  3U23 A;  3NFC A;  4NL3 A;  1VQM T;  1Q81 U;  5GAN f;  2ZPF B;  2M1H A;  1SHF A;  3EGX A;  2XIC A;  4LUE A;  3NTK A;  3CC2 Q;  8AT1 B;  2LX9 A;  2DER A;  2DJQ A;  4BDY A;  4ZTJ A;  2VWF A;  1UUE A;  4E7J A;  3SWN A;  1TSF A;  5LJ3 j;  4MZM A;  1K1Z A;  3M9Q A;  4Y28 E;  2IIM A;  1UGV A;  1X6B A;  2PZ1 A;  1VQ7 A;  4KUI A;  2L2P A;  2HBW A;  1WDX A;  3OS2 A;  4M7D B;  2O4X B;  1WXB A;  1OU9 A;  1E6G A;  2HSP A;  3I55 A;  5IHN A;  4DEY A;  2RHU A;  3CCU A;  5FU7 C;  1JJ2 P;  1HJD A;  4RTW A;  5L23 A;  2EGE A;  2L89 A;  3NPF A;  4E7Z A;  3EH2 A;  2L3P A;  1YJN A;  1WYX A;  1VQ9 T;  1TTH B;  4J9G A;  4M7A G;  3CC4 Q;  4BD3 A;  1AT1 B;  4M7A F;  1R0C B;  1M5Q 1;  3TU4 K;  2K6D A;  2PVD B;  4AFU C;  3INZ A;  5IAY A;  2MCN A;  1T0J A;  3G71 Q;  2GNC A;  1UG1 A;  3I5R A;  3I55 Q;  3S3M A;  1JJ2 S;  2KAF A;  1K9M U;  2VKN A;  3HFN A;  1CSK A;  1F1B B;  1KK7 A;  1RL2 A;  1AZG B;  2E41 A;  2X51 A;  4OB0 B;  5GAM h;  1HYO A;  4BUG A;  1OPL A;  1R0B G;  4FL6 A;  5DLQ E;  1JXM A;  1Y57 A;  2E12 A;  4L6V 5;  2P0K A;  1Q82 R;  3VRZ A;  5KCO A;  4M75 G;  4J7I A;  4M75 F;  1H64 1;  2R57 A;  1M1K C;  2V8J A;  3HHT B;  2P84 A;  3HRS A;  3TSW A;  3J7A F;  1VUB A;  1RLQ C;  3CPF A;  1Q82 U;  3TQ7 P;  1SRL A;  4M7A B;  2CGH A;  4ESR A;  5J39 A;  1W2B A;  4XQ3 A;  4M78 D;  1WIE A;  2QI2 A;  1NJI C;  1ZUK A;  3NTI A;  4HKE A;  1SKU B;  2P4T A;  5GAN 6;  4X9D A;  2EQJ A;  4HT8 A;  3EG9 B;  2LCL A;  2MIO A;  2FPF A;  2JS2 A;  2ABL A;  1MND A;  1N8R C;  1E6H A;  4E7L A;  1RAG B;  1AOJ A;  3G4S T;  2VXE A;  5FRO A;  3CD6 T;  2JM9 A;  4FU6 A;  5GMK h;  4C8Q E;  4M75 B;  3MP1 A;  1FXX A;  2LNV A;  2M0Y A;  2J6O A;  4N4G A;  1B34 A;  4C92 D;  1WNL A;  1BYM A;  1YWO A;  4FYY B;  1UHF A;  4KT0 E;  4D8K A;  1X27 A;  3ER0 A;  3V7C A;  5KYY B;  2C0I A;  3P8B B;  9ATC B;  1QVF P;  2D8J A;  1HK9 A;  3QJ6 A;  1R8O B;  2CDT A;  2L3S A;  1W70 A;  5L8R E;  4PJO C;  3LWI A;  3VJP A;  5IT9 E;  2DVE A;  4BI8 B;  1WHG A;  2EYY A;  3M0T A;  2EYQ A;  2GFA A;  1GXI E;  3L1A A;  1G3T A;  2XD0 A;  1K4U S;  1OX8 A;  2QA4 Q;  1I0C A;  5IHI A;  1AWO A;  1QVF S;  1JXO A;  2M9U A;  1FMV A;  2VAS A;  3RKW A;  1YCY A;  3WXM B;  4FM4 B;  1YJW Q;  4N4I A;  4LD9 K;  4M7A A;  5FLX E;  1X01 A;  3D7S B;  1QKW A;  5LJ3 f;  4CC7 A;  2QXF A;  1JQQ A;  2JUF A;  1TUC A;  3BDU A;  3LGF A;  1I4K 1;  1WI7 A;  2M02 A;  2YWW A;  3JB9 H;  1PHT A;  3JCM J;  4IUU A;  4AG1 C;  2O2O A;  3DB3 A;  2WSC E;  1X43 A;  4JZ3 A;  4C5I A;  3LX7 A;  5GAN h;  2AZS A;  2DL5 A;  2K4Y A;  2NLU A;  1SF9 A;  1LPL A;  3M0P A;  4M7D C;  4CI0 C;  4HVW A;  1U06 A;  1C6V X;  3CCS T;  1AEY A;  1NM7 A;  4X34 A;  1VQM Q;  4ZGE B;  2FRW A;  1D0Y A;  2QEX A;  2DNU A;  4P5N A;  2YUQ A;  2RK2 A;  2YUN A;  3PIP A;  1GCQ C;  1D09 B;  1UB4 A;  4TVR A;  3HRT A;  2D1X A;  3EFR A;  3X20 B;  1YIT T;  3V8J A;  3UPU A;  4LDW A;  2HQE A;  3CME T;  5D6Y A;  1D1C A;  4C8Q G;  3OYN A;  2K5L A;  3CPW P;  2DTI A;  3JCM Q;  2D8H A;  3KXT A;  2KXD A;  1NG2 A;  2JS0 A;  3WVE B;  2JN0 A;  1XQH A;  3QG1 A;  1K8A R;  2OTJ T;  3M54 A;  1VQ8 A;  3HFO A;  2EJG A;  1SG5 A;  2LVM A;  2DAQ A;  1X75 C;  5KYU B;  5D6X A;  1WLP B;  2BTT A;  2ED1 A; 
#chains in the Genus database with same CATH homology
 1G3Y A;  2I2L A;  3DKM A;  3QDR B;  1IRE B;  2YRV A;  4M7A C;  3M53 A;  3LWH A;  3OS1 A;  4OF1 A;  1K8A U;  2F5T X;  3FEO A;  3OB9 A;  2XID A;  3DB4 A;  4KUL A;  2MI6 A;  3OS0 A;  1M90 C;  2EJ9 A;  4FSX A;  1KC8 C;  3CCL T;  4L5G A;  1VQ4 T;  3QHS A;  1WQ7 A;  4DQ2 A;  4JUV A;  3PGG A;  5CKD A;  5CVI A;  4J6W A;  3CCS A;  4RKU E;  3QO3 A;  3L2Q A;  2LRQ A;  4M77 E;  3SD4 A;  1AHJ B;  1M90 U;  1KC8 U;  2KY9 A;  3EFS A;  4LDU A;  4J5Y A;  4C5G A;  5LJ5 f;  3EAE A;  3CCJ A;  4QVZ A;  4OVA A;  2FB7 A;  1FWZ A;  2MWO A;  3CBM A;  3M57 A;  5IN1 A;  4DOW A;  2LDM A;  3CC4 A;  2L5Q A;  2VGN A;  2F69 A;  3R6O A;  3G6E T;  3JCM c;  5GAN 4;  5GAN g;  3CC7 A;  2BKD N;  3QBY A;  3JB9 I;  3JCM g;  3M56 A;  1JRI A;  2RJD A;  3H6Z A;  2VYT A;  3G71 A;  1KQ1 A;  5AYF A;  3OYE A;  2ZPE B;  1XTD A;  4A53 A;  2DD4 A;  3E9G A;  1VQ5 T;  3OYB A;  2XDP A;  1UGP B;  2PUK B;  3GP8 A;  4JS4 A;  2WSF E;  3X25 B;  4C5H A;  5C0M A;  4M75 C;  3OYC A;  3MHX A;  1YIT A;  1BKB A;  4PLI A;  3JCM W;  3CCV A;  1Q7Y U;  2G3R A;  2HBP A;  1PSE A;  3CXC S;  4C5E A;  5GAN e;  3CME A;  2EJF A;  3RMS A;  2RO0 A;  1VQN A;  4A4G A;  3JCM e;  4C0F A;  4M77 D;  1YI2 A;  2PVO B;  4A4E A;  2RHZ A;  3FB9 A;  3MEV A;  5CQY A;  2A7Y A;  5A2Q E;  3CCE A;  2X4J A;  3CD6 A;  2MAM A;  2RJC A;  4M78 F;  1VQK T;  4M78 A;  5GAN 7;  4ELY C;  5KE2 A;  3HPW A;  4O6J A;  3JCM X;  3JCM b;  1QP3 A;  1KD1 C;  2EQM A;  3PFS A;  2C06 A;  5FRM A;  4M7A E;  4BE2 A;  1YIJ A;  2QQ9 A;  3TEE A;  4PJO F;  4PJO A;  2Y4Y A;  5HK3 A;  1VIF A;  1VQO A;  2E1H A;  3OYM A;  3PMI A;  4XTZ A;  2D6F A;  1G3S A;  4L59 A;  5KE3 A;  1WJQ A;  3E9F A;  1KD1 U;  3PT9 A;  3PTA A;  2DZ9 A;  2ZGW A;  1JB0 E;  4D6W A;  2FL7 A;  2RM4 A;  1BI0 A;  2DXC A;  4RG8 A;  2RK1 A;  3OYG A;  4JDS A;  2OTJ A;  2DO3 A;  4XU1 A;  2P0Q A;  4M7A D;  4N0A A;  3SDZ A;  2EWN A;  2KK4 A;  2QA4 T;  4V2S A;  4XU0 A;  3NTH A;  3OW2 A;  3PNW C;  1OYX A;  3PIO A;  2VXF A;  1KQS A;  2D9T A;  4QVD A;  1NPR A;  1YJW T;  1VQ7 T;  1M9S A;  4NL2 A;  4E7H A;  2LQ8 A;  4R55 A;  2IVW A;  4C92 G;  5CCA A;  5GAN d;  2HAX A;  3L2R A;  5GAM j;  3VUZ A;  5D6W A;  1SSF A;  1WGS A;  2EQU A;  4F7U G;  3ME9 A;  5DLO A;  2XU8 A;  1KHI A;  4C92 F;  3JCM d;  4C92 A;  2RHX A;  1YHQ T;  4F7U F;  2K57 A;  2M16 A;  2XK0 A;  4M75 E;  4F7U A;  3L2V A;  1Q82 C;  2XHC A;  3ZBD A;  1MHN A;  3QXE B;  3TCJ A;  4EDU A;  3CCL A;  1O9S A;  4EMH A;  3X26 B;  2WSE E;  3SB2 A;  3C94 A;  3OMC A;  3CCU T;  1VQ4 A;  2PUO B;  2CKK A;  2QQA A;  3GPL A;  1G5V A;  3RKY A;  4M78 B;  2BUD A;  4JRI A;  4LD6 A;  2KSS A;  1X6O A;  3ASK A;  4ZN1 A;  1UGQ B;  2QDY B;  3A5Z B;  4E47 A;  1DJ7 B;  2CZ6 B;  5CKE A;  1H3Z A;  2CZ1 B;  4M77 C;  3A8H B;  4X9C A;  2X4W A;  3MO8 A;  3LLR A;  1YJN T;  4PJO B;  3G6E A;  1QVG A;  3V8L A;  3S3O A;  2LT1 A;  3OS5 A;  1UGS B;  4C8Q F;  2EIF A;  4C8Q A;  3OYD A;  5CKF A;  3MCA B;  4HCZ A;  4FT4 A;  2E65 A;  1G3W A;  4XU2 A;  4MML A;  2E10 A;  1VQ5 A;  3O8V A;  4LDX A;  5CR2 A;  4A54 A;  1QVG S;  4II1 A;  2OAU A;  3Q1J A;  4M7D G;  1O75 A;  3J80 E;  1Q81 C;  1N27 A;  2K3X A;  3QJY A;  5HY6 A;  3RES A;  4XTU A;  3VUB A;  4M7D F;  5A0D A;  3ZEH A;  4M7D A;  5GAO l;  2O4X A;  3NFC A;  3RUX A;  4NL3 A;  3HSB A;  3V8K A;  1WJR A;  1VQM T;  1Q81 U;  5GAN f;  1XOV A;  3M59 A;  3QYH B;  2ZPF B;  2IG0 A;  3JB9 G;  3JCM f;  2M1H A;  4BAC A;  4ZTF A;  4QQG A;  2XIC A;  1VQK A;  4C92 B;  3JB9 F;  5LJ5 j;  2PU9 B;  4OGE A;  3QZ9 B;  3NTK A;  4Y91 A;  4F7U B;  1YJ9 T;  2LX9 A;  3V7S A;  5LJ3 h;  3X24 B;  2EAY A;  4BDY A;  1XNI A;  4ZTJ A;  3M4Y A;  1HXD A;  2KMT A;  3URG A;  3OBW A;  4EMK C;  3FLG A;  1BI3 A;  2CZ0 B;  5FU6 C;  4E7J A;  5HK0 A;  5GMK j;  3SWN A;  3A8L B;  4M77 G;  4YTL A;  5CIU A;  3FC3 A;  5LJ3 j;  4BI4 A;  4C8Q B;  2JTF A;  5I2S A;  4MZM A;  2QA4 A;  2FVU A;  4XTX A;  4JRP A;  3OQ5 A;  1VQ6 A;  3CBP A;  3M9Q A;  4Y28 E;  5I2M A;  1M1G A;  3BDL A;  2QQB A;  5GAO q;  5A0L A;  3JAM E;  1YJW A;  4KUI A;  4XTW A;  1VQ7 A;  2RI2 A;  2EFI A;  4JLG A;  4XAX B;  5DY9 A;  3OS2 A;  4C0Z A;  5GMK i;  4M7D B;  4C0D B;  2O4X B;  2Y90 A;  5GAM g;  1YHQ A;  4HCB A;  3I55 A;  4B9X A;  3GLX A;  3QZ5 B;  2K3Y A;  4EMG A;  3CXC A;  2ZZD A;  2JOY A;  1I8F A;  4PL6 A;  2RHU A;  1U8R A;  3CCU A;  3QYG B;  2XDB A;  3HKS A;  5KCH A;  5FU7 C;  4J6X A;  3RIR A;  1IZ6 A;  4MDW A;  5GAO m;  3CMA T;  2L89 A;  4HCC A;  4J7F A;  3CCM T;  1M4Z A;  1QP2 A;  3OYH A;  2E6N A;  4QQD A;  2D0Q B;  1YJN A;  1VQ9 T;  4RMO A;  5CK9 A;  4IKF A;  2L3R A;  1TH7 A;  4M7A G;  1P92 A;  2H3J A;  2MF2 A;  2VUB A;  3JRZ A;  4BD3 A;  1JJ2 A;  5CQX A;  3SWN B;  4M7A F;  5CO7 A;  3TU4 K;  1M5Q 1;  2XI9 A;  1K9M C;  3L2U A;  2PVD B;  2GQV A;  3GF5 A;  3INZ A;  5IAY A;  3P8H A;  3JCM V;  1BIB A;  4IUR A;  3S3M A;  1JJ2 S;  2QQR A;  2KAF A;  3OYJ A;  3X28 B;  1K9M U;  2VV5 A;  3HFN A;  3J81 E;  5GMK l;  5C6S A;  1VQM A;  1RL2 A;  2E41 A;  4IUT A;  4OB0 B;  5GAM h;  4R56 A;  4BUG A;  3OYF A;  4OP0 A;  5LL6 S;  4FL6 A;  4M78 E;  1WPY A;  1YJ9 A;  5DLQ E;  4A4H A;  4BE0 A;  2JNG A;  4E7I A;  4PJO C;  2E12 A;  4L6V 5;  2P0K A;  2K5I A;  1WQW A;  5KCO A;  2HNI A;  1QVP A;  1YBY A;  3JSC A;  4QW2 A;  2X4Y A;  4PJO E;  4M75 G;  1M8V A;  2CS7 A;  3OBY A;  4BY6 B;  1KQ2 A;  1D3B A;  2JTM A;  4FT2 A;  4J7I A;  4M75 F;  2LT4 A;  3A8G B;  1VIE A;  1OI1 A;  2EKO A;  2WAC A;  4M75 A;  1H64 1;  2DIQ A;  1S72 T;  2R57 A;  1Y07 A;  2LTO A;  1M1K C;  3OYK A;  2LC4 A;  1VQL T;  2V8J A;  3HHT B;  2LQK A;  1ZBX A;  3HRS A;  3J7A F;  1VUB A;  5LJ3 g;  4HA8 A;  3CPF A;  1Q82 U;  1Y7X A;  2B8A A;  4M7A B;  2R5M A;  2RA2 A;  3UT1 A;  3RKX A;  2CGH A;  1I81 A;  2RJE A;  3GOX A;  2DJZ A;  1N6A A;  2R5A A;  5J39 A;  4XQ3 A;  3MET A;  1JBM A;  2E5Q A;  4M78 D;  4BDZ A;  3OYI A;  1W2B A;  2RB6 A;  2QI2 A;  3A8O B;  1NJI C;  1Q86 C;  2RD1 A;  3PMT A;  5I21 A;  3NTI A;  4HKE A;  4OB3 B;  4DA4 A;  3M58 A;  1BI1 A;  2P4T A;  3HL8 A;  5CKB A;  3VU3 C;  5GAN 6;  4PJO D;  3TRE A;  1W2B S;  2RHI A;  5LJ3 e;  1NJI U;  2FHD A;  3VKI A;  5GAN 8;  4X9D A;  5LJ5 h;  2EQJ A;  4HT8 A;  5HKC A;  2LCL A;  3CMA A;  1Y96 A;  3MP6 A;  2M0O A;  3HP9 A;  1V29 B;  4OMF B;  2L8D A;  5GMK m;  3CCR T;  3CCM A;  1N8R C;  3V7R A;  4J8O A;  2HQX A;  4E7L A;  3SFM A;  1VQ9 A;  3G4S T;  2VXE A;  3MEW A;  5FRO A;  4A4F A;  4RCC A;  1D3B B;  3CD6 T;  5GAO p;  4GLK A;  4FU6 A;  3T9N A;  4C8Q E;  4M75 B;  3MP1 A;  4BI3 A;  1FXX A;  2LNV A;  5GMK h;  1N8R U;  4J83 A;  4XU3 A;  1VQP T;  4N4G A;  3S3N A;  1ZQ1 A;  1W4S A;  4JRQ A;  3MP8 A;  1B34 A;  2GCX A;  2PQW A;  3N5B B;  4C92 D;  1N9S A;  1WJS A;  2V8I A;  1WNL A;  3CCQ T;  1KG1 A;  1BYM A;  3FIF A;  4EPC A;  2RH2 A;  2MMP A;  3G7Z A;  3BW1 A;  4RCB A;  3OY9 A;  4KT0 E;  2RHY A;  4CRI A;  3C95 A;  3ER0 A;  4FIB A;  4QVC A;  3V7C A;  3UDC A;  5GAN 2;  4M77 F;  4M77 A;  3A8M B;  3CPW S;  5LJ3 d;  2V8K A;  4ELZ C;  3P8B B;  4ZGD B;  4XK8 E;  2E70 A;  3OMG A;  1K8A C;  2QEX T;  3L2W A;  3OSS C;  3F70 A;  2OTL T;  4C8Q D;  4M78 C;  1HK9 A;  3QJ6 A;  1R8O B;  5GAO r;  4MDX A;  2RJF A;  1Y96 B;  5L8R E;  2KDS A;  3QSU A;  3LH0 A;  3MEU A;  1S72 A;  3GIB A;  2R58 A;  3LWI A;  4MZT A;  3C4S A;  2DVE A;  3VJP A;  4BI8 B;  5IT9 E;  1VQL A;  4NS5 A;  3BY7 A;  2EYQ A;  2GFA A;  4IUP A;  4M7D D;  1QVF A;  1GXI E;  1NZ9 A;  3L1A A;  5A0G A;  2EQK A;  2RI5 A;  1G3T A;  5CAI A;  1Y71 A;  3OA6 A;  3DLL A;  2XD0 A;  2DD5 A;  4WF2 A;  1M1F A;  2MWP A;  4JLI A;  1MGQ A;  4N0A C;  4ME7 A;  4HT9 A;  3GNF B;  4XTY A;  3UWN A;  3CC2 T;  1B34 B;  1QVF S;  3H8Z A;  5GAM e;  3JB9 D;  4OGC A;  2M9U A;  5J3B A;  3RKW A;  1YCY A;  1OZ2 A;  4FM4 B;  3WXM B;  2QQS A;  2XG8 D;  2A3L A;  2HD0 A;  4N4I A;  4O5V A;  2FYK A;  3S6W A;  4BB7 A;  4KBM B;  1LNX A;  2DXU A;  4LD9 K;  4M7A A;  5FLX E;  3KBG A;  2LCC A;  4EMK A;  2DTH A;  4BE1 A;  1Q7Y C;  1X01 A;  1RI0 A;  3KUF A;  4MZP A;  4C92 C;  4M77 B;  5LJ3 f;  2KVQ G;  2QXF A;  2AHJ B;  2JUF A;  1BI2 A;  1LOJ A;  2DPP B;  2VC8 A;  1K73 C;  2E6Z A;  2KQW A;  3I56 T;  4ATO A;  3MEA A;  3VYH B;  3CCR A;  1U1S A;  3BDU A;  3DLM A;  3M5A A;  3LGF A;  2ZPG B;  4GY5 A;  1I4K 1;  5J26 A;  4M78 G;  5KH6 A;  3G4S A;  1VQ8 T;  4JS5 A;  3JB9 H;  3QII A;  1K73 U;  2ZPB B;  3JCM J;  4LDY A;  2DK3 A;  3BFM A;  4IUU A;  4ZN3 A;  2XDD A;  1I5L A;  1VQP A;  2XKO C;  4PJO G;  5LJ5 g;  4C0G A;  3FJP A;  3DB3 A;  3P8D A;  2WSC E;  4C8Q C;  1NPP A;  4Q5W A;  2GF7 A;  5GAN 3;  2BIV A;  4C5I A;  3CCQ A;  2DIG A;  2VGM A;  3LX7 A;  3QUI A;  2JVV A;  1LJO A;  5GAN h;  4ZGJ B;  5CKH A;  5GAM d;  5M9O A;  2PVG B;  4OB2 B;  3JCM h;  3JCM P;  2K4Y A;  4E7K A;  1UEB A;  2NLU A;  2DXB A;  3L2Z A;  4VUB A;  4PKC C;  3OYY A;  3OSV A;  4M7D C;  1KHC A;  2DEQ A;  2P0P A;  4C0D C;  2DTO A;  3CEY A;  2QTX A;  4B9W A;  4CI0 C;  5LJ5 e;  3CCS T;  1VQ6 T;  4X34 A;  2K5F A;  2F5K A;  3FRN A;  3CCJ T;  1ZHI A;  2Y4X A;  4EMK B;  4ZGE B;  1M1K U;  2QEX A;  3M4G A;  4P5N A;  4MMK A;  5FU6 B;  2OTL A;  5GAN j;  3L42 A;  2RK2 A;  3CC4 T;  3QPH A;  3PIP A;  3JB9 J;  1BIA A;  3WVD B;  3CC7 T;  2JZ2 A;  2YHT A;  1U1T A;  2CZ7 B;  3OW2 S;  3LGL A;  5GMK e;  1KQS S;  2DXT A;  3G71 T;  3E1S A;  1UB4 A;  4TVR A;  3HRT A;  3RMQ A;  4C92 E;  5GAN 5;  3I55 T;  4F7U E;  4KUD K;  4PNO A;  3EFR A;  4LDV A;  3OYA A;  1Q86 U;  3X20 B;  1YIT T;  5DM7 R;  3QKJ A;  3SWN C;  3V8J A;  4IUQ A;  4IUV A;  3UPU A;  4LDW A;  3M55 A;  3VYG A;  2HQE A;  3GNG A;  3CCV T;  3FDR A;  4Z02 A;  3CME T;  4UC4 A;  5D6Y A;  4NOY A;  5EG2 A;  1VQN T;  2ZPI B;  4OB1 B;  4C8Q G;  3E19 A;  5GAO n;  3OYN A;  1YI2 T;  2GFU A;  2K5L A;  2RI3 A;  3CC2 A;  3AHU A;  2X35 A;  3ZFJ A;  3CCE T;  4XTV A;  2DTI A;  2YLB A;  5GAM f;  3JCM Q;  3KXT A;  4JRK A;  5FU7 B;  2DZC A;  3C12 A;  4RG2 A;  5LJ5 d;  1YIJ T;  2CYZ B;  2ZCF B;  5FRN A;  3WVE B;  2O01 E;  1VQO T;  4JJN K;  4M75 D;  2E64 A;  2JN0 A;  4N4H A;  3RER A;  4A4K A;  1XQH A;  3CPW A;  1EIF A;  1QW1 A;  4DOV A;  2YLC A;  4M7D E;  3I56 A;  2DKG A;  2X4X A;  3LYI A;  3QG1 A;  3HRU A;  2OTJ T;  4QQ6 A;  3M54 A;  1PSF A;  1VQ8 A;  4BY6 C;  3OYL A;  3HFO A;  2EJG A;  4J6Y A;  2K2V A;  2LVM A;  1NE8 A;  3LW5 E;  1FX7 A;  2DAQ A;  1X75 C;  3CBO A;  1UGR B;  4PLL A;  5D6X A;  3VV0 A;  1OZ3 A;  1N9R A;  2ZPH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...