4OMNA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omnA00
2LNHB 5EC7A 3O5ZA 4AFUC 4D8KA 3FJ5A 2YUNA 1CKAA 3RNJA 4X1VA 2DRKA 4ORZA 5IHIA 2HEQA 1NLPC 2PNIA 4E6RA 4KRTA 4AG1C 2FRWA 3QWYA 1Y0MA 1ABOA 2GTJA 1HJDA 2DL5A 1YWPA 1AD5A 2MCNA 3VS4A 1WA7A 4HCKA 1PKSA 4OMNA 2A37A 2DJQA 2M51A 2DILA 2DYBA 4ZNXA 3TVTA 2GBQA 1Z9ZA 2KRMA 4HVUA 3KFVA 2EYWA 1OOTA 2EQIA 2YUPA 3R6NA 1UTIA 4D8DA 1W70A 1I07A 2RQRA 2LP5A 2KXDA 2RQUA 2L2PA 1WIEA 2J6OA 1TG0A 1I0CA 4RTTA 3VS7A 1M8MA 1K4US 2JXBA 2YUOA 1YCSB 2X3XD 4RTXA 2X3WD 2FPEA 1QWFA 2K9GA 2K3BA 2CH4W 4J9EA 4CC4B 1OPLA 4RTUA 1NG2A 1NLOC 2PTKA 1WI7A 3NPFA 2EKHA 3M0PA 4HVVA 4ESRA 1KJWA 2EW3A 1S1NA 4IIMA 4OMQA 2DBKA 5ECAA 4CC7A 3EG2A 2C0OA 1FYNA 2C0IA 2LJ1A 2DNUA 3A98A 1RUWA 1RI9A 1B07A 2V1QA 3CQTA 1SEMA 1FMKA 1WXBA 2YUQA 2SRCA 2AZSA 2OJ2A 3VS0A 3REBB 3PE0A 1UJ0A 1GFCA 3M0UA 4HXJA 2EVRA 5L23A 2K2MA 3EG0A 1W1FA 2RF0A 1RLPC 1WFWA 2KR3A 3UF4A 2ED1A 1WYXA 1OV3A 4A63B 1AWOA 3NHNA 1I1JA 3THKA 2OI3A 1H8KA 3H0IA 1OEBA 2DRMA 2ESWA 4LE9A 2CUBA 2QDLA 2YSQA 1X27A 3EGUA 1UJYA 1YWOA 3VS3A 1T3SA 2BZYA 1NM7A 1YP5A 3I9QA 1ABQA 2LQNA 2J05A 2DVJA 1TUCA 3LH5A 3TSWA 3VS5A 2L3QA 1PHTA 2CREA 2FG0A 2GNCA 2IIMA 2CDTA 1GCQA 1AWXA 1N5ZA 4K11A 2P4RA 1EFNA 4DEYA 1Z9QA 1QKWA 1M3AA 2JW4A 1W6XA 1HD3A 2LMJA 1GFDA 1AZEA 2D8HA 2D1XA 2D8JA 2KNBB 2J06A 2KXCA 2ECZA 4RTZA 3M0QA 2ED0A 2PZ1A 2LQWA 1SRMA 4JZ4A 3PVQA 5GJVB 4CC2A 1PRLC 2HBWA 4RUGA 1PRMC 2EYYA 4R0KA 2J7IA 2KT8A 2ENMA 2HCKA 1SSHA 1M27C 4CC3A 2LX7A 2YT6A 1UG1A 1AWWA 4F17A 2KT1A 4RTWA 1ZLMA 1TUDA 1U3OA 1KIKA 2DL8A 2JT4A 3VS1A 2MIOA 2DX1A 1RLQC 3EHRA 1YN8A 1ZSGA 4HVWA 4IIOA 2O2OA 1PKTA 5IHNA 2NUZA 2ROLA 1GBRA 2K79A 2YDLA 3TSZA 1M30A 2ROTA 3NGPA 2KEAA 4AFZC 1PNJA 1ZUUA 2VWFA 2RN8A 2CSQA 5IXFA 1BU1A 2CH4A 1M3CA 5I22A 3M0TA 2KRNA 5IH2A 1BBZA 2EYZA 3NMZC 1MV0B 2JM9A 2BTTA 2K7AA 1AWJA 1NYFA 4J9HA 2DA9A 5I11A 1JO8A 4M4ZA 1X6BA 1E6GA 2DL3A 2O31A 1NYGA 3REAB 1AEYA 1UFFA 2RPNA 4Z88A 2DLPA 3U23A 2O88A 3QWXX 1X2KA 2DL7A 2GQIA 2E5KA 4QT7A 1UHCA 1BK2A 2W0ZA 1PWTA 3GBQA 4LUDA 4RTVA 2BZXA 1VA7A 2AKKA 3H0HA 1WDXA 1K76A 3C0CA 1QKXA 1NEGA 4Z89A 3VS6A 1AZGB 4OMMA 1K0SA 2L0AA 2F2WA 1UDLA 4LNPA 4J9FA 4JPBW 1E6HA 1ZBJA 2DMOA 2KE9A 2FPFA 2JMAA 1XOVA 4OMLA 1VYUA 4OMOA 5FWBA 2DL4A 1ZUYA 4LUEA 2RNAA 1U06A 1IO6A 4J9DA 2RQTA 3IQLA 2RMOA 4JJBA 4F14A 2LZ6B 1A0NB 1K1ZA 1WX6A 4WCIA 1QCFA 1GBQA 1G83A 2W10A 4F16A 2D0NA 2J6KA 2K6DA 1CSKA 4LN2A 1ARKA 4GLMA 1NEBA 1SHFA 2FEIA 3I35A 2OAWA 5HCKA 5GJWB 1WXTA 2JS2A 2G6FX 3VRZA 2CT3A 2SEMA 3SEMA 1JXMA 1U5SA 1OPKA 2CT4A 1KSWA 2B86A 1H3HA 1K9AA 4OMPA 1E7OA 2XMFA 1UE9A 1SPKA 2DM1A 4Y92A 1CKBA 1LCKA 2EGCA 2EGEA 1GCQC 1JQQA 2F2VA 4AFSC 1UECA 2A36A 2MOXA 2LJ0A 2C0TA 2V1RA 1UGVA 4AFQC 1YNZA 1T3LA 2EGAA 1X2QA 1GRIA 1JU5C 1MUZA 2AKLA 4EIKA 2J6FA 1ZUKA 4Z8AA 4RTYA 1VYVA 2GGRA 2JM8A 1BB9A 3VRYA 2LJ3A 1B3QA 2NWMA 2HDAA 3I5RA 1X69A 2DF6A 1Y57A 1HSQA 2O9VA 3UATA 2DBMA 2FO0A 3JV3A 1GL5A 2KBTA 2KROA 2M0YA 2RQWA 1X6GA 3H0FA 4JJDA 1KFZA 3I5SA 2JS0A 2AZVA 1SHGA 4J9GA 4J9BA 3UA7A 1JEGA 2KGTA 3H41A 3M0SA 2JMCA 4GBQA 4JJCA 2LCSA 2O9SA 2A28A 2KYMA 1QWEA 1MV3A 3PVLA 2L3PA 2L3SA 3RBBB 5IHKA 3EG1A 3EHQA 1ZX6A 2CUDA 5FW9A 2H8HA 1GCPA 2ABLA 2F2XA 2A08A 2I0NA 4DEXA 1VYTA 2AK5A 2FPDA 1JXOA 1M3BA 4AG2C 1QLYA 4J9CA 1G2BA 3M0RA 1T0JA 4FSSA 2FRYA 1AVZC 2RQVA 3ZL7C 2EPDA 2BZ8A 2EBPA 2KRSA 1H92A 1T0HA 3VS2A 2DE0X 5FWCA 1WLPB 4JZ3A 1AOJA 1SRLA 1K0XA 2VKNA 5IXBA 4J9IA 1UUEA 1J3TA 2JTEA 3UA6A 3EG3A 3SHWA 2KYBA 1WXUA 2GTOA 1UHFA 2EYXA 1V1CA 1X43A 2HSPA 2CSIA 2VVKA 3ULRB
chains in the Genus database with same CATH superfamily
2P4TA 1YITQ 3FLGA 3O5ZA 5KYXA 1D0XA 3I56T 2DRKA 2FVUA 3C12A 5IHIA 2HEQA 5CQXA 2PNIA 1LJOA 4IUQA 3L2QA 2FRWA 1QMCA 2EIFA 3QWYA 2PVOB 2GTJA 2FB7A 1YCYA 1YJ9T 5FU6C 5M9OA 3VS4A 1WA7A 3HTRA 2A37A 2CZ7B 1Z9ZA 3OS5A 3FB9A 2D9TA 2YUPA 4B9WA 1UTIA 2F69A 2KXDA 3OB9A 2RQUA 2L2PA 3TQ7P 2J6OA 1I0CA 3QJYA 1K4US 2YUOA 1RABB 2X3XD 1YFNA 1FWZA 4AT1B 2COZA 4JRIA 2K3BA 1OPLA 2XU8A 1NLOC 3OS2A 4XTXA 5FU7B 3CCRT 4EMGA 3QZ5B 2EKHA 5I2SA 4FYWB 1VQ4A 4EMHA 2DBKA 5CR2A 3EH1A 4M7AE 2C0OA 3PIOA 2V1QA 1RI9A 1B07A 3FEOA 1W4SA 1FMKA 5HKCA 3CCQT 2AHJB 2HKNA 5EG2A 2IG0A 2DPPB 4QVCA 4PJOA 4P5NA 3M53A 1UJ0A 4C8QE 4HXJA 5L23A 2COYA 2RF0A 1WFWA 4J6WA 1X6OA 2KR3A 3UF4A 3LYIA 5HK0A 2NLUA 1UEBA 1XQHA 1OULA 1NJIR 3H0IA 1MMAA 4XTUA 2MMPA 2DRMA 5FLXE 2DXBA 2HBPA 2QDLA 3CCST 1X27A 2BZYA 2L89A 3HRSA 4XK8E 2O01E 2DVJA 2RHXA 1PHTA 1XNIA 1VQLA 2CDTA 2HAXA 2EQKA 5KE3A 1G5VA 2LT4A 2P4RA 4II1A 4CRIA 1Z9QA 1VQ5Q 4JLGA 3OY9A 1YIJT 1W6XA 5CIUA 3OYBA 2D8HA 4PFZA 1NE8A 2CP3A 1ZSZC 3PTAA 4IUVA 1QVFA 2H3JA 4R55A 1N8RR 2LQWA 4JZ4A 3PVQA 5GJVB 2C06A 2HBWA 2RH2A 1TXQA 2XK0A 4RUGA 2X4YA 1RADB 1Y96B 4R0KA 3RR6A 3CCLA 4E47A 1SSHA 4CC3A 4PL6A 2MWPA 1UG1A 5GAN2 4PJOC 1ZLMA 1TUDA 1VQ7Q 1TH7A 4M77G 4XU0A 3DLMA 5HY6A 3VS1A 1VQMQ 2MIOA 1RLQC 4FW2A 1ZSGA 4IIOA 1KHCA 2RJCA 2WSEE 1Q95G 1UGQB 2RHZA 3MPUB 1PNJA 3KUFA 3CXCA 3M59A 2BE9B 2KRNA 3CCVA 1WJSA 3NMZC 3CCUT 4E7JA 5GANf 3FRNA 2RK2A 3RERA 3KBGA 3JB9I 1JO8A 1EZZB 2RD1A 1YITA 4PJJA 2MK5A 1X6BA 1NYGA 1S72T 3ZBDA 2RPNA 4Z88A 1HXDA 2O88A 2DL7A 4BUGA 2XG8D 4RKUE 1Y71A 1BK2A 2QXFA 3BDLA 4DBQA 4RTVA 3EFSA 2QASA 5GMKe 2BZXA 4J6YA 1VQ4T 1UGRB 4GLKA 1QKXA 2D0QB 3M9QA 4M78C 4AMCA 2QQBA 2LRQA 2HL5C 3M55A 1N8RU 1VQ6T 3FC3A 1ZBJA 2KE9A 4OMLA 1MNDA 1C1AA 1BIAA 3M54A 4OB1B 4OMOA 2DK3A 1TS9A 2E3HA 2QAZA 2JVVA 3JCMV 4FCYA 2RNAA 2FZKB 5C6SA 3IQLA 2RMOA 3CMEQ 3JB9F 4JRQA 4J83A 2BUDA 1G83A 2W10A 3OMGA 4F16A 3OW2A 1ZSZA 2O4XA 1MNEA 1K73C 3CC4Q 3EFRA 4EMKC 2V26A 1YJWT 2CT4A 1OPKA 1KSWA 2B86A 2F5KA 4OMPA 1E7OA 2ZGWA 1FXXA 3UT1A 1OX9A 4E2FB 1Q86U 3Q1JA 1JQQA 4XU1A 1M2OA 4Q5WA 1IB8A 2R57A 2YWWA 3INZA 3H9NA 1GRIA 2L5QA 1JU5C 2A0FB 2AIRB 3ZFJA 4DQ2A 2M16A 3NTIA 3GF5A 2O9VA 1TSFA 3CCEQ 1B7TA 1KQSP 2YLCA 1X6GA 3V8KA 2HL3A 3I5SA 4X34A 3EH2A 1RAGB 1JEGA 4JJCA 3M0SA 3EFOA 2KY9A 3RESA 4WTOB 1IZ6A 4JS4A 1VQKA 1RAAB 4IKFA 3A8HB 5FRNA 5GAN6 4Y91A 1X75C 2RHIA 1GCPA 1KQ1A 2K5IA 3OYJA 2V8JA 1JXOA 1M3BA 2RJDA 4J9CA 1G2BA 4L5GA 2DD4A 5KCOA 3OMCA 5LJ3e 1IHWA 2BZ8A 2EBPA 5FWCA 3MEUA 4J8OA 1D0ZA 4M7DA 1AOJA 1K0XA 3D7SB 4PJOF 2QEXQ 3HP9A 2B8AA 1K9MR 5I21A 2QQSA 3M5AA 1M90C 4C8QB 3FIFA 4XU2A 2DKGA 1WXUA 1YHQT 1UHFA 4LD9K 1PM3A 3FJPA 2PUOB 4KGZB 4MZTA 4C92A 3OYMA 3ULRB 4FU6A 1ZBXA 2LNHB 3OYYA 4D8KA 1OU9A 2ZPFB 1D1AA 4X1VA 2YRCA 1VQPA 1HK9A 4F7UG 5GAMg 2K57A 4M7AC 1AHJB 4KH1B 1BIBA 5I2MA 5GAOq 3G4SQ 5GANe 2DXTA 4DBRA 1HJDA 4E7HA 5J39A 4M7DC 3OW2P 2DD5A 1AD5A 1D3BA 4OGCA 2DILA 4ZGDB 3TVTA 2GBQA 2KRMA 4HVUA 4X9DA 3KFVA 1OOTA 1G3SA 5CAIA 2CGHA 3EGDB 1I07A 5GAMf 3GIBA 1WQWA 1WIEA 5GANh 1M90R 3MO8A 4RTTA 1SG5A 2CZ6B 2MI6A 4LDXA 4FT4A 1N9SA 1YCSB 4RTXA 2X3WD 3JCMe 2FPEA 5GAOn 3X20B 2E41A 2LT1A 5KYUB 2CH4W 3G4ST 1Q82R 2BIVA 2PTKA 3CD6A 3NPFA 3M56A 4LDUA 2X51A 4HVVA 4FM4B 3QIIA 2E1HA 1S1NA 4IIMA 2QGFB 3CCLT 2YRDA 2QYZA 4CC7A 3EG2A 2C0IA 2GFAA 2DNUA 3CQTA 3MEAA 1RAEB 2PVGB 2AZSA 1I5OB 3JSCA 4M78B 3EG0A 1XJWB 2ED1A 4BI3A 2CKKA 4A63B 3NHNA 3L2RA 5LJ5d 1OZ3A 4A4EA 4KGXB 2R5MA 1YBYA 3G1JA 4EPCA 3L2UA 1T3SA 1NM7A 3QG1A 1R0CB 1ABQA 4ZN1A 2LQNA 2K3XA 4C92F 3CCEA 2J05A 4KULA 5C0MA 1TUCA 3TSWA 3VS5A 4DA4A 1Q7YU 1M1KR 2CREA 2XKOC 3CMET 2GNCA 3A8GB 5LJ5h 4O5VA 3VUBA 4JDSA 1GCQA 2DERA 3JCMd 2Z0WA 3G71T 1QP2A 4C0DB 1C0MA 5CKBA 2X4XA 2LMJA 1GFDA 2MPXC 4C92G 1TOVA 4M7AF 3HFOA 2KNBB 2F5TX 2QQRA 3PT9A 2J06A 8ATCB 1M4ZA 2X35A 2KXCA 5KCHA 1U8RA 2ED0A 1NPPA 1I81A 4CC2A 1G8XA 3H6ZA 4OGEA 4OP0A 4XTWA 1M27C 4M7AG 4DBHA 5GANd 4KUDK 2KT1A 4RTWA 4J6XA 1KIKA 2VGMA 2DX1A 4RG2A 3HRTA 1PKTA 2NUZA 2ROLA 2P0PA 3O8VA 5FU7C 2JJ9A 5LJ5j 1QCOA 1BU1A 3PIPA 5GANj 5I22A 4FIBA 4RG8A 5IH2A 2EYZA 1ZQ1A 1MV0B 1OX8A 2BTTA 2EJFA 4F7UE 2QG9B 2VXFA 1YJNT 3REAB 3QKJA 2DETA 4J5YA 1YJ9A 1H3ZA 3AHUA 2RJEA 3MEVA 3J7AF 2W0ZA 1PWTA 1KC8U 1BI0A 4LUDA 2V8KA 5CKHA 5FU6B 1VA7A 1SF9A 2LCLA 2AKKA 3H0HA 3RKXA 2KDSA 3OYLA 1YI2A 4Z89A 5LJ5e 4OMMA 1K0SA 1DJ7B 2L0AA 1M1FA 2F2WA 1UDLA 4QVDA 4LNPA 2VASA 4M78A 4PJOG 2DMOA 3WVDB 4N4IA 2FPFA 2FHDA 2QDYB 1VQ8A 3DLLA 1VYUA 3CC2Q 3CCQQ 4M77A 5GMKl 2LCCA 5LJ3h 1Y07A 3OQ5A 2DVEA 2JNGA 1K73U 1IO6A 3E9GA 5GAOp 2VUBA 4JJBA 3JCMc 1R8OB 4XTVA 3OYEA 3C94A 1SSFA 1N6AA 1K1ZA 4EMKB 1WX6A 1VQ5A 1VQNQ 1WNLA 4PNOA 1D3BB 2ZPEB 4DBFA 1K8AR 4PJOE 3G7ZA 4F7UA 3MCAB 2EAYA 3CPFA 2VGNA 4ATOA 2CT3A 3S3OA 4HCZA 3S3NA 2PU9B 1I4K1 4M75C 1VQ9Q 1G3TA 3LWIA 1VQLT 3E2UA 4LD6A 3L1AA 2EGCA 2EGEA 1WJRA 4N4GA 3CBPA 4M75F 2A36A 1I5LA 1M1GA 2H3EB 5GAMh 2LJ0A 3EGDA 2V1RA 1D09B 4FW1A 2KK4A 2EJ9A 3M4GA 6AT1B 2X4JA 1BCMA 3LLRA 1WGSA 1TTHB 2Y4YA 5A0GA 2RI2A 4BE0A 2GGRA 2JM8A 1BB9A 2LJ3A 1OQKA 1WHGA 2HDAA 2R5AA 2YHTA 3TREA 3UATA 1Y57A 3C95A 5CVIA 1GL5A 7AT1B 3RMQA 4CI0C 2KROA 3OS1A 4JJDA 2JTMA 1KFZA 1VQLQ 2M0OA 3UA7A 4J9BA 3JCMW 5CKFA 2KGTA 5CCAA 2JMCA 2Y90A 3TU4K 3OW2S 4J7IA 2CP5A 2KYMA 4C92D 3CCET 2HNIA 1MV3A 4C0DC 3CCRA 1OYXA 3JCMP 1K8AU 2EFIA 3EG1A 5FW9A 3A8LB 2E3IA 2HZYA 2H8HA 2GF7A 5DM7R 1MGQA 2A08A 1PG5B 5LJ5f 2FPDA 4EDUA 3I55Q 1ZHIA 4M7AD 3CMAT 1BYMA 5KYYB 1QLYA 1RAHB 3UPUA 5D7UA 3NTKA 4FSSA 3LW5E 4PK4A 3QO3A 3QPHA 1P92A 2EPDA 4E7KA 1VIEA 2QGGA 1VQKT 1H92A 5LJ3d 1M1KC 3EG9B 4BE2A 2QK0A 4HT8A 2NUTB 1WQ7A 1SRLA 3ASKA 1I8FA 2VKNA 5GANg 1LVKA 2L3RA 3CCJT 4E7LA 1M5Q1 4BI4A 3SHWA 1XTDA 4PFPA 2GTOA 3MP6A 2LVMA 2K4YA 3RUXA 2XI9A 4HT9A 3EFOB 2DXUA 4AFUC 2ZPIB 1LOJA 2XICA 1VQPT 3FJ5A 1UGSB 5CO7A 3BY7A 2QA4T 4ORZA 3G71Q 4PLIA 3OYGA 3OYHA 3A8OB 4KRTA 4RCCA 4AG1C 3CCJA 3OYDA 3VYGA 2E6ZA 1W2BP 2NUPB 2QEXT 1O75A 3CC7T 3QHSA 1YWPA 2K5FA 2DJQA 2M51A 1VQ8T 2DYBA 2L8DA 2KQWA 2MYSA 4WF2A 3TEEA 2P84A 2ZPHB 1QVFS 2EQIA 1YI2Q 3R6NA 4D8DA 1OI1A 4N0AA 2LP5A 5J3BA 1ACMB 3HKSA 1TG0A 1TWBA 4BDYA 3VS7A 2JXBA 1VQ8Q 5D6XA 3LGFA 2QQ9A 4J7FA 1RL2A 3CCQA 3QBYA 4QW2A 4C5IA 1QWFA 4RCBA 5AYFA 2K9GA 3L2ZA 4CC4B 4RTUA 1M2VB 3QYGB 2P0KA 5HK3A 4ESRA 4M77E 1KJWA 4OMQA 4OF1A 4X9CA 2OTLQ 1FYNA 1PD1A 1YITT 1HYOA 2LJ1A 3CCUQ 1BI3A 5A2QE 1SEMA 2MWOA 2SRCA 2LTOA 4KT0E 3URGA 2OTJT 3REBB 3PE0A 2FL7A 1GFCA 4C8QC 2K5LA 3MEWA 2EVRA 2K2MA 3CD6T 4F7UB 5LJ3f 4LXCA 4IUPA 1AT1B 1WYXA 2COWA 2YRVA 1AWOA 1VQ9T 1I1JA 4PLLA 3OYFA 2ZAEA 2KMTA 3THKA 2JZ2A 3ER0A 5CKDA 2ESWA 2IVWA 2EWNA 2M1HA 1PCXA 3EGUA 3OBYA 1UJYA 3PFSA 3EG9A 1EIFA 1IGUA 3CCMQ 3GNFB 3F70A 4JRPA 1LPLA 1YJNQ 3LH5A 2OTJA 2E12A 2FG0A 1WHLA 1VQKQ 2IIMA 4F04B 4BD3A 1RAFB 2LNVA 1AWXA 4DEYA 1QKWA 3CPWS 1VQNA 3QUIA 2DEQA 4OMFB 1AZEA 5CQYA 5GAOm 3SWNC 2XDBA 2I2LA 1Q81U 3JCMg 2HMAA 3P8DA 4E7IA 5D6WA 2ECZA 4RTZA 2HKQB 4PJMA 3OSSC 2DYIA 1VUBA 5KYXB 1YJWQ 1PRLC 1QW1A 3BDUA 2XIDA 2EYYA 4MZPA 3I55A 3CC4T 1M8VA 4C92B 2ENMA 3CCSQ 4PJNA 2LX7A 2YT6A 1AWWA 4OB0B 5FROA 2YXYA 2QEXA 1U3OA 2JT4A 3HSBA 3MP8A 2RHYA 9ATCB 1K9MU 4HVWA 2GCXA 2O2OA 4MZMA 5IHNA 8AT1B 3L2WA 4EMKA 3QJ6A 3PMTA 4M77D 2YDLA 3LGLA 2X9HA 3TSZA 3CD6Q 1M30A 1D0YA 1N9RA 1ZUUA 2LQ8A 1QVGP 2VWFA 2K3YA 2RN8A 2G3RA 4A54A 4KH0B 3OSVA 1BI2A 2QI2A 2CH4A 3S3MA 3N5BB 2NUTA 3M0TA 5L8RE 3GNGA 1BBZA 3GP8A 2JM9A 4N4HA 3OYAA 2FZCB 1Q82U 2DA9A 4PKCC 1S72A 1Q86C 3CMAA 4JUVA 2O31A 1AEYA 1Q7YC 3G4SA 1ZA1B 3JRZA 2DLPA 3U23A 3QWXX 1X2KA 2DO3A 1WJQA 2E5KA 4QT7A 1UHCA 2E70A 2DIGA 1V29B 3V8LA 5D6YA 5KYWB 3CCVT 1WHMA 4M78F 2WSFE 4MMLA 2EKOA 1VQMT 4MDXA 1Q81R 5J26A 2EQJA 1YIJA 1WZOA 1KC8C 4M75A 1K73R 2DEUA 2RB6A 3ZEHA 1N8RC 4J9FA 1WHJA 2HQXA 2P0QA 5GMKm 4ZTJA 2JMAA 1XOVA 2CZ0B 2RM4A 5GAOl 3WVEB 2BKDN 2XDPA 4FL6A 4C5GA 5FWBA 4BY6B 1ZUYA 4LUEA 1U06A 4J9DA 2RQTA 1ZA2B 4F7UF 5LJ3g 2DAQA 1FMWA 2RK1A 1W2BA 2IPOB 4NL2A 4F14A 1KG1A 2LZ6B 1QCFA 1GBQA 3RKYA 2D0NA 1JBMA 2J6KA 2K6DA 1CSKA 3DB4A 1ARKA 4GLMA 1EX4A 1NEBA 4M78E 1SHFA 1VQ6A 1MMDA 5DLQE 4IUUA 5GAN3 1Q7YR 2FEIA 3OBWA 3CXCS 1QQJA 2VB6A 5GAN8 5GJWB 2JS2A 2DXCA 2G6FX 5KE2A 4M77C 2SEMA 4XQ3A 3SEMA 1JXMA 3GLXA 1U5SA 3E1SA 1Q82C 5GAN5 1VQ7T 1W2BS 2XMFA 1UE9A 5LL6S 3RDVA 3QZ9B 4RMOA 3E9FA 1R77A 4Y92A 1CKBA 4VUBA 3X25B 4KBMB 2F2VA 5IAYA 4C5EA 3CC2T 2KI7A 5FRMA 5GAOr 3J80E 3JCMX 3GOXA 1VQ5T 1MMGA 4XAXB 3CBMA 3VU3C 1N27A 1YNZA 1VQOT 2HD0A 3CCJQ 2JN0A 1QVPA 1VQOA 1OZ2A 1MUZA 1F1BB 2J6FA 1KD1R 4C8QG 2DIQA 2AT1B 4HA8A 4C0FA 4RTYA 1KQ2A 4M75E 1YHQQ 4PJOB 4HCCA 1NPRA 2NWMA 4V2SA 1X69A 3S6WA 2LX9A 4IUTA 2DF6A 2DBMA 3JV3A 2EJGA 4FYVB 4L6V5 1MHNA 1KQSS 1PC0A 3EAEA 1IREB 3SB2A 3X26B 5CKEA 1G3WA 2JS0A 3TCJA 1M1KU 1SHGA 3WXMB 2JUFA 5GAMd 4ZTFA 4MDWA 3H41A 4GBQA 4KUIA 2LCSA 2PUKB 3OA6A 2O9SA 2A28A 3DKMA 2QTVA 4C0ZA 3NTHA 4E7SA 5CK9A 1TUGB 4O6JA 3PNWC 2KSSA 2L3SA 2VV5A 3RBBB 1JRIA 3EHQA 4A4GA 1OU8A 2CUDA 3QDFA 3V7SA 2XD0A 2R58A 4ZGJB 1VIFA 4UC4A 2ABLA 3JCMh 3OYNA 1VOMA 4DEXA 1VYTA 4OB2B 2AK5A 1RI0A 1VQ4Q 1JJ2A 4AG2C 1BCOA 1KC8R 3CEYA 2QQAA 1SKUB 1UGPB 4QKUA 1Y7XA 1T0JA 1AVZC 2RQVA 3ZL7C 3AT1B 2MF2A 1NJIU 4FT2A 3LX7A 2QTXA 1M2VA 2A7YA 4M78D 2DE0X 1WLPB 3LWHA 1RAIB 3V8JA 4J9IA 4JS5A 3JCMJ 2D6FA 1H641 1IXDA 3KXTA 2JTEA 1QVGA 2RI3A 2FYKA 3CPWA 1VQNT 5IT9E 2E10A 5GAN7 4B6MA 1V1CA 2HSPA 4LDVA 4A4HA 4ZNXA 4XTYA 4ZGEB 5EC7A 3R6OA 4PFOA 1YJ9Q 4M77B 4PJLA 2YUNA 1CKAA 3RNJA 2ZZDA 4M7DE 1IGQA 1UB4A 2DJZA 1NLPC 4E6RA 1M9SA 2CS7A 4DOVA 4R56A 2NUPA 1Y0MA 2M9UA 3JCMQ 1ABOA 2GFUA 2DL5A 4ME7A 3JCMf 3CC7A 2MCNA 3L42A 4HCKA 1PKSA 2LC4A 4OMNA 3RMSA 2F1LA 2RHUA 3SWNA 4NS5A 4M77F 3JB9H 4M7AB 2EYWA 3CC2A 1B34A 1JJ2P 4HCBA 3PMIA 1YIJQ 3SFMA 2VYTA 4QQGA 1W70A 2OX7A 3CBOA 4D6WA 2RQRA 2KAFA 2V8IA 3UWNA 2JOYA 3CCSA 1M8MA 3DB3A 4BE1A 3P8BB 2DTHA 2NYSA 3QSUA 5DY9A 4J9EA 3CMEA 3OS0A 1Q81C 3ME9A 1NG2A 4LDYA 5A0DA 2OAUA 2GQVA 1U1TA 3G6EQ 3GPLA 1WI7A 5GMKj 1VQ9A 3M0PA 4C92E 1TU0B 3X28B 4BDZA 2EW3A 4GY5A 2CZ1B 3I55T 3CC4A 1K9MC 5ECAA 3CCVQ 3OYCA 2ZCFB 4MMKA 3A98A 1RUWA 1Q86R 1WXBA 2YUQA 2OJ2A 1S72Q 3VS0A 2WSCE 1BI1A 3CMAQ 3M0UA 3I56A 3META 1W1FA 4M7AA 1RLPC 4M75D 1QCNA 2EQUA 3JCMb 3MP1A 1G3YA 1FX7A 2ATCB 1ZSZB 2O4XB 2CP6A 1OV3A 4M7DB 4A4FA 3MHXA 3RIRA 3JB9D 5GMKh 2PVDB 1QVGS 2OI3A 1H8KA 2EQMA 3UDCA 1OEBA 4LE9A 4C8QD 2CUBA 2YSQA 4Z02A 4OB3B 4C92C 1YWOA 3VS3A 1YHQA 3I9QA 1YP5A 2OTLT 2DZCA 4M7DG 1V76A 4QQ6A 4M7DF 2L3QA 4ELZC 1IHVA 5KYYA 1NJIC 3NFCA 3SWNB 3CCRQ 3BFMA 1JJ2S 3VUZA 1N5ZA 4K11A 4QQDA 1EFNA 1M3AA 1RACB 2JW4A 4A4KA 1HD3A 4C0GA 1VQ6Q 1KHIA 2D1XA 2D8JA 2BE7D 3M57A 2PQWA 5GMKi 3M0QA 3LH0A 3CPWP 2XHCA 2PZ1A 1SRMA 1KQSA 1FMVA 1PRMC 1PSEA 2WACA 2J7IA 4M78G 4XTZA 2KT8A 2HCKA 1QP3A 3HL8A 2CP2A 2QA4Q 3HHTB 3SDZA 4F17A 2E65A 2XDDA 4IURA 2DL8A 5LJ5g 4TVRA 4LDWA 3EHRA 1YN8A 1IRXA 3VV0A 1GBRA 2K79A 3SD4A 1VQOQ 2ZPBB 2ROTA 3NGPA 2KEAA 4JLIA 4AFZC 5GAMj 2CSQA 5IXFA 1NBEB 1M3CA 1O9SA 2CYZB 2HQHA 3BE3A 4HKEA 4JJNK 5KH6A 2K7AA 4BY6C 2DTIA 1AWJA 1NYFA 4J9HA 3CCUA 2RA2A 3A1PA 3G71A 5I11A 2YLBA 2MAMA 2EYQA 2FZGB 4M4ZA 1D1BA 1E6GA 2DL3A 1UFFA 1JB0E 2GQIA 2HSEB 5KYUA 1GXIE 4ANJA 3QDRB 3OYIA 3GBQA 3JAME 4BI8B 3V7RA 3HPWA 3P8HA 5AT1B 4PJOD 1WDXA 1K76A 3C0CA 5IN1A 2E5QA 3QYHB 1NEGA 2E4HA 3VS6A 1AZGB 1KK7A 4A53A 4JPBW 1PSFA 1E6HA 1YJNA 4KGVB 2OTJQ 2CP0A 4QVZA 2X4WA 2CP7A 4YTLA 1X01A 3M58A 4C5HA 2DL4A 2E6NA 3EGXA 1C6VX 3RKWA 3JB9J 4L59A 2DZ9A 1A0NB 4WCIA 1YI2T 4LN2A 5GAMe 2RJFA 3VYHB 4E7ZA 3I35A 2OAWA 3HRUA 5HCKA 1BKBA 3MKDA 1WXTA 2OTLA 4FSXA 3FDRA 3VRZA 2KVQG 3VJPA 1H3HA 2DFUA 1K9AA 2DTOA 1YJWA 3VKIA 1SPKA 2DM1A 4ELYC 5KYNA 1LCKA 4JRKA 1GCQC 5DLOA 3A8MB 4AFSC 1UECA 1KD1U 2MOXA 4FYXB 2HQEA 2C0TA 1VQMA 1WHKA 2A3LA 2K2VA 1VQPQ 3HFNA 3JB9G 1UGVA 4AFQC 3BW1A 1T3LA 2EGAA 2VC8A 1WHHA 1X2QA 2AKLA 4EIKA 4DOWA 1ZUKA 4Z8AA 2RI5A 1VYVA 4M75G 3CXCP 1M90U 3VRYA 5KYWA 3CC7Q 1LNXA 2M02A 1B3QA 5GAN4 3I5RA 3EGXB 5A0LA 3CCMA 1HSQA 4M7DD 1Y96A 2FO0A 3E19A 2KBTA 2M0YA 2RQWA 3H0FA 1WPYA 2RO0A 1QVFP 2AZVA 4J9GA 1NZ9A 4BB7A 2E64A 4M75B 3X24B 3OYKA 1K8AC 4XU3A 3M4YA 4FYYB 3V7CA 2VXEA 1QWEA 3PVLA 2L3PA 3PGGA 2LDMA 5IHKA 4NL3A 1ZX6A 3G6EA 4B9XA 5LJ3j 2F2XA 2I0NA 2LQKA 3CCLQ 4N0AC 1MMNA 3L2VA 1B34B 4C8QF 3QXEB 3M0RA 1VQ7A 2FRYA 3H8ZA 3A5ZB 2Y4XA 2KRSA 3T9NA 1KD1C 1T0HA 3VS2A 1R0BG 4NOYA 4C8QA 3I56Q 4JZ3A 2QA4A 3CCMT 5IXBA 4ZN3A 1D1CA 3G6ET 1UUEA 2ZPGB 1J3TA 2JTFA 3UA6A 3EG3A 4OVAA 2KYBA 3MJXA 4Y28E 3J81E 2EYXA 1U1SA 1X43A 4BACA 2CSIA 3C4SA 1PD0A 2VVKA
chains in the Genus database with same CATH topology
2LNHB 5EC7A 3O5ZA 4AFUC 4D8KA 3FJ5A 2YUNA 1CKAA 3RNJA 4X1VA 2DRKA 4ORZA 5IHIA 2HEQA 1NLPC 2PNIA 4E6RA 4KRTA 4AG1C 2FRWA 3QWYA 1Y0MA 1ABOA 2GTJA 1HJDA 2DL5A 1YWPA 1AD5A 2MCNA 3VS4A 1WA7A 4HCKA 1PKSA 4OMNA 2A37A 2DJQA 2M51A 2DILA 2DYBA 4ZNXA 3TVTA 2GBQA 1Z9ZA 2KRMA 4HVUA 3KFVA 2EYWA 1OOTA 2EQIA 2YUPA 3R6NA 1UTIA 4D8DA 1W70A 1I07A 2RQRA 2LP5A 2KXDA 2RQUA 2L2PA 1WIEA 2J6OA 1TG0A 1I0CA 4RTTA 3VS7A 1M8MA 1K4US 2JXBA 2YUOA 1YCSB 2X3XD 4RTXA 2X3WD 2FPEA 1QWFA 2K9GA 2K3BA 2CH4W 4J9EA 4CC4B 1OPLA 4RTUA 1NG2A 1NLOC 2PTKA 1WI7A 3NPFA 2EKHA 3M0PA 4HVVA 4ESRA 1KJWA 2EW3A 1S1NA 4IIMA 4OMQA 2DBKA 5ECAA 4CC7A 3EG2A 2C0OA 1FYNA 2C0IA 2LJ1A 2DNUA 3A98A 1RUWA 1RI9A 1B07A 2V1QA 3CQTA 1SEMA 1FMKA 1WXBA 2YUQA 2SRCA 2AZSA 2OJ2A 3VS0A 3REBB 3PE0A 1UJ0A 1GFCA 3M0UA 4HXJA 2EVRA 5L23A 2K2MA 3EG0A 1W1FA 2RF0A 1RLPC 1WFWA 2KR3A 3UF4A 2ED1A 1WYXA 1OV3A 4A63B 1AWOA 3NHNA 1I1JA 3THKA 2OI3A 1H8KA 3H0IA 1OEBA 2DRMA 2ESWA 4LE9A 2CUBA 2QDLA 2YSQA 1X27A 3EGUA 1UJYA 1YWOA 3VS3A 1T3SA 2BZYA 1NM7A 1YP5A 3I9QA 1ABQA 2LQNA 2J05A 2DVJA 1TUCA 3LH5A 3TSWA 3VS5A 2L3QA 1PHTA 2CREA 2FG0A 2GNCA 2IIMA 2CDTA 1GCQA 1AWXA 1N5ZA 4K11A 2P4RA 1EFNA 4DEYA 1Z9QA 1QKWA 1M3AA 2JW4A 1W6XA 1HD3A 2LMJA 1GFDA 1AZEA 2D8HA 2D1XA 2D8JA 2KNBB 2J06A 2KXCA 2ECZA 4RTZA 3M0QA 2ED0A 2PZ1A 2LQWA 1SRMA 4JZ4A 3PVQA 5GJVB 4CC2A 1PRLC 2HBWA 4RUGA 1PRMC 2EYYA 4R0KA 2J7IA 2KT8A 2ENMA 2HCKA 1SSHA 1M27C 4CC3A 2LX7A 2YT6A 1UG1A 1AWWA 4F17A 2KT1A 4RTWA 1ZLMA 1TUDA 1U3OA 1KIKA 2DL8A 2JT4A 3VS1A 2MIOA 2DX1A 1RLQC 3EHRA 1YN8A 1ZSGA 4HVWA 4IIOA 2O2OA 1PKTA 5IHNA 2NUZA 2ROLA 1GBRA 2K79A 2YDLA 3TSZA 1M30A 2ROTA 3NGPA 2KEAA 4AFZC 1PNJA 1ZUUA 2VWFA 2RN8A 2CSQA 5IXFA 1BU1A 2CH4A 1M3CA 5I22A 3M0TA 2KRNA 5IH2A 1BBZA 2EYZA 3NMZC 1MV0B 2JM9A 2BTTA 2K7AA 1AWJA 1NYFA 4J9HA 2DA9A 5I11A 1JO8A 4M4ZA 1X6BA 1E6GA 2DL3A 2O31A 1NYGA 3REAB 1AEYA 1UFFA 2RPNA 4Z88A 2DLPA 3U23A 2O88A 3QWXX 1X2KA 2DL7A 2GQIA 2E5KA 4QT7A 1UHCA 1BK2A 2W0ZA 1PWTA 3GBQA 4LUDA 4RTVA 2BZXA 1VA7A 2AKKA 3H0HA 1WDXA 1K76A 3C0CA 1QKXA 1NEGA 4Z89A 3VS6A 1AZGB 4OMMA 1K0SA 2L0AA 2F2WA 1UDLA 4LNPA 4J9FA 4JPBW 1E6HA 1ZBJA 2DMOA 2KE9A 2FPFA 2JMAA 1XOVA 4OMLA 1VYUA 4OMOA 5FWBA 2DL4A 1ZUYA 4LUEA 2RNAA 1U06A 1IO6A 4J9DA 2RQTA 3IQLA 2RMOA 4JJBA 4F14A 2LZ6B 1A0NB 1K1ZA 1WX6A 4WCIA 1QCFA 1GBQA 1G83A 2W10A 4F16A 2D0NA 2J6KA 2K6DA 1CSKA 4LN2A 1ARKA 4GLMA 1NEBA 1SHFA 2FEIA 3I35A 2OAWA 5HCKA 5GJWB 1WXTA 2JS2A 2G6FX 3VRZA 2CT3A 2SEMA 3SEMA 1JXMA 1U5SA 1OPKA 2CT4A 1KSWA 2B86A 1H3HA 1K9AA 4OMPA 1E7OA 2XMFA 1UE9A 1SPKA 2DM1A 4Y92A 1CKBA 1LCKA 2EGCA 2EGEA 1GCQC 1JQQA 2F2VA 4AFSC 1UECA 2A36A 2MOXA 2LJ0A 2C0TA 2V1RA 1UGVA 4AFQC 1YNZA 1T3LA 2EGAA 1X2QA 1GRIA 1JU5C 1MUZA 2AKLA 4EIKA 2J6FA 1ZUKA 4Z8AA 4RTYA 1VYVA 2GGRA 2JM8A 1BB9A 3VRYA 2LJ3A 1B3QA 2NWMA 2HDAA 3I5RA 1X69A 2DF6A 1Y57A 1HSQA 2O9VA 3UATA 2DBMA 2FO0A 3JV3A 1GL5A 2KBTA 2KROA 2M0YA 2RQWA 1X6GA 3H0FA 4JJDA 1KFZA 3I5SA 2JS0A 2AZVA 1SHGA 4J9GA 4J9BA 3UA7A 1JEGA 2KGTA 3H41A 3M0SA 2JMCA 4GBQA 4JJCA 2LCSA 2O9SA 2A28A 2KYMA 1QWEA 1MV3A 3PVLA 2L3PA 2L3SA 3RBBB 5IHKA 3EG1A 3EHQA 1ZX6A 2CUDA 5FW9A 2H8HA 1GCPA 2ABLA 2F2XA 2A08A 2I0NA 4DEXA 1VYTA 2AK5A 2FPDA 1JXOA 1M3BA 4AG2C 1QLYA 4J9CA 1G2BA 3M0RA 1T0JA 4FSSA 2FRYA 1AVZC 2RQVA 3ZL7C 2EPDA 2BZ8A 2EBPA 2KRSA 1H92A 1T0HA 3VS2A 2DE0X 5FWCA 1WLPB 4JZ3A 1AOJA 1SRLA 1K0XA 2VKNA 5IXBA 4J9IA 1UUEA 1J3TA 2JTEA 3UA6A 3EG3A 3SHWA 2KYBA 1WXUA 2GTOA 1UHFA 2EYXA 1V1CA 1X43A 2HSPA 2CSIA 2VVKA 3ULRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LNH B;  5EC7 A;  3O5Z A;  4AFU C;  4D8K A;  3FJ5 A;  2YUN A;  1CKA A;  3RNJ A;  4X1V A;  2DRK A;  4ORZ A;  5IHI A;  2HEQ A;  1NLP C;  2PNI A;  4E6R A;  4KRT A;  4AG1 C;  2FRW A;  3QWY A;  1Y0M A;  1ABO A;  2GTJ A;  1HJD A;  2DL5 A;  1YWP A;  1AD5 A;  2MCN A;  3VS4 A;  1WA7 A;  4HCK A;  1PKS A;  4OMN A;  2A37 A;  2DJQ A;  2M51 A;  2DIL A;  2DYB A;  4ZNX A;  3TVT A;  2GBQ A;  1Z9Z A;  2KRM A;  4HVU A;  3KFV A;  2EYW A;  1OOT A;  2EQI A;  2YUP A;  3R6N A;  1UTI A;  4D8D A;  1W70 A;  1I07 A;  2RQR A;  2LP5 A;  2KXD A;  2RQU A;  2L2P A;  1WIE A;  2J6O A;  1TG0 A;  1I0C A;  4RTT A;  3VS7 A;  1M8M A;  1K4U S;  2JXB A;  2YUO A;  1YCS B;  2X3X D;  4RTX A;  2X3W D;  2FPE A;  1QWF A;  2K9G A;  2K3B A;  2CH4 W;  4J9E A;  4CC4 B;  1OPL A;  4RTU A;  1NG2 A;  1NLO C;  2PTK A;  1WI7 A;  3NPF A;  2EKH A;  3M0P A;  4HVV A;  4ESR A;  1KJW A;  2EW3 A;  1S1N A;  4IIM A;  4OMQ A;  2DBK A;  5ECA A;  4CC7 A;  3EG2 A;  2C0O A;  1FYN A;  2C0I A;  2LJ1 A;  2DNU A;  3A98 A;  1RUW A;  1RI9 A;  1B07 A;  2V1Q A;  3CQT A;  1SEM A;  1FMK A;  1WXB A;  2YUQ A;  2SRC A;  2AZS A;  2OJ2 A;  3VS0 A;  3REB B;  3PE0 A;  1UJ0 A;  1GFC A;  3M0U A;  4HXJ A;  2EVR A;  5L23 A;  2K2M A;  3EG0 A;  1W1F A;  2RF0 A;  1RLP C;  1WFW A;  2KR3 A;  3UF4 A;  2ED1 A;  1WYX A;  1OV3 A;  4A63 B;  1AWO A;  3NHN A;  1I1J A;  3THK A;  2OI3 A;  1H8K A;  3H0I A;  1OEB A;  2DRM A;  2ESW A;  4LE9 A;  2CUB A;  2QDL A;  2YSQ A;  1X27 A;  3EGU A;  1UJY A;  1YWO A;  3VS3 A;  1T3S A;  2BZY A;  1NM7 A;  1YP5 A;  3I9Q A;  1ABQ A;  2LQN A;  2J05 A;  2DVJ A;  1TUC A;  3LH5 A;  3TSW A;  3VS5 A;  2L3Q A;  1PHT A;  2CRE A;  2FG0 A;  2GNC A;  2IIM A;  2CDT A;  1GCQ A;  1AWX A;  1N5Z A;  4K11 A;  2P4R A;  1EFN A;  4DEY A;  1Z9Q A;  1QKW A;  1M3A A;  2JW4 A;  1W6X A;  1HD3 A;  2LMJ A;  1GFD A;  1AZE A;  2D8H A;  2D1X A;  2D8J A;  2KNB B;  2J06 A;  2KXC A;  2ECZ A;  4RTZ A;  3M0Q A;  2ED0 A;  2PZ1 A;  2LQW A;  1SRM A;  4JZ4 A;  3PVQ A;  5GJV B;  4CC2 A;  1PRL C;  2HBW A;  4RUG A;  1PRM C;  2EYY A;  4R0K A;  2J7I A;  2KT8 A;  2ENM A;  2HCK A;  1SSH A;  1M27 C;  4CC3 A;  2LX7 A;  2YT6 A;  1UG1 A;  1AWW A;  4F17 A;  2KT1 A;  4RTW A;  1ZLM A;  1TUD A;  1U3O A;  1KIK A;  2DL8 A;  2JT4 A;  3VS1 A;  2MIO A;  2DX1 A;  1RLQ C;  3EHR A;  1YN8 A;  1ZSG A;  4HVW A;  4IIO A;  2O2O A;  1PKT A;  5IHN A;  2NUZ A;  2ROL A;  1GBR A;  2K79 A;  2YDL A;  3TSZ A;  1M30 A;  2ROT A;  3NGP A;  2KEA A;  4AFZ C;  1PNJ A;  1ZUU A;  2VWF A;  2RN8 A;  2CSQ A;  5IXF A;  1BU1 A;  2CH4 A;  1M3C A;  5I22 A;  3M0T A;  2KRN A;  5IH2 A;  1BBZ A;  2EYZ A;  3NMZ C;  1MV0 B;  2JM9 A;  2BTT A;  2K7A A;  1AWJ A;  1NYF A;  4J9H A;  2DA9 A;  5I11 A;  1JO8 A;  4M4Z A;  1X6B A;  1E6G A;  2DL3 A;  2O31 A;  1NYG A;  3REA B;  1AEY A;  1UFF A;  2RPN A;  4Z88 A;  2DLP A;  3U23 A;  2O88 A;  3QWX X;  1X2K A;  2DL7 A;  2GQI A;  2E5K A;  4QT7 A;  1UHC A;  1BK2 A;  2W0Z A;  1PWT A;  3GBQ A;  4LUD A;  4RTV A;  2BZX A;  1VA7 A;  2AKK A;  3H0H A;  1WDX A;  1K76 A;  3C0C A;  1QKX A;  1NEG A;  4Z89 A;  3VS6 A;  1AZG B;  4OMM A;  1K0S A;  2L0A A;  2F2W A;  1UDL A;  4LNP A;  4J9F A;  4JPB W;  1E6H A;  1ZBJ A;  2DMO A;  2KE9 A;  2FPF A;  2JMA A;  1XOV A;  4OML A;  1VYU A;  4OMO A;  5FWB A;  2DL4 A;  1ZUY A;  4LUE A;  2RNA A;  1U06 A;  1IO6 A;  4J9D A;  2RQT A;  3IQL A;  2RMO A;  4JJB A;  4F14 A;  2LZ6 B;  1A0N B;  1K1Z A;  1WX6 A;  4WCI A;  1QCF A;  1GBQ A;  1G83 A;  2W10 A;  4F16 A;  2D0N A;  2J6K A;  2K6D A;  1CSK A;  4LN2 A;  1ARK A;  4GLM A;  1NEB A;  1SHF A;  2FEI A;  3I35 A;  2OAW A;  5HCK A;  5GJW B;  1WXT A;  2JS2 A;  2G6F X;  3VRZ A;  2CT3 A;  2SEM A;  3SEM A;  1JXM A;  1U5S A;  1OPK A;  2CT4 A;  1KSW A;  2B86 A;  1H3H A;  1K9A A;  4OMP A;  1E7O A;  2XMF A;  1UE9 A;  1SPK A;  2DM1 A;  4Y92 A;  1CKB A;  1LCK A;  2EGC A;  2EGE A;  1GCQ C;  1JQQ A;  2F2V A;  4AFS C;  1UEC A;  2A36 A;  2MOX A;  2LJ0 A;  2C0T A;  2V1R A;  1UGV A;  4AFQ C;  1YNZ A;  1T3L A;  2EGA A;  1X2Q A;  1GRI A;  1JU5 C;  1MUZ A;  2AKL A;  4EIK A;  2J6F A;  1ZUK A;  4Z8A A;  4RTY A;  1VYV A;  2GGR A;  2JM8 A;  1BB9 A;  3VRY A;  2LJ3 A;  1B3Q A;  2NWM A;  2HDA A;  3I5R A;  1X69 A;  2DF6 A;  1Y57 A;  1HSQ A;  2O9V A;  3UAT A;  2DBM A;  2FO0 A;  3JV3 A;  1GL5 A;  2KBT A;  2KRO A;  2M0Y A;  2RQW A;  1X6G A;  3H0F A;  4JJD A;  1KFZ A;  3I5S A;  2JS0 A;  2AZV A;  1SHG A;  4J9G A;  4J9B A;  3UA7 A;  1JEG A;  2KGT A;  3H41 A;  3M0S A;  2JMC A;  4GBQ A;  4JJC A;  2LCS A;  2O9S A;  2A28 A;  2KYM A;  1QWE A;  1MV3 A;  3PVL A;  2L3P A;  2L3S A;  3RBB B;  5IHK A;  3EG1 A;  3EHQ A;  1ZX6 A;  2CUD A;  5FW9 A;  2H8H A;  1GCP A;  2ABL A;  2F2X A;  2A08 A;  2I0N A;  4DEX A;  1VYT A;  2AK5 A;  2FPD A;  1JXO A;  1M3B A;  4AG2 C;  1QLY A;  4J9C A;  1G2B A;  3M0R A;  1T0J A;  4FSS A;  2FRY A;  1AVZ C;  2RQV A;  3ZL7 C;  2EPD A;  2BZ8 A;  2EBP A;  2KRS A;  1H92 A;  1T0H A;  3VS2 A;  2DE0 X;  5FWC A;  1WLP B;  4JZ3 A;  1AOJ A;  1SRL A;  1K0X A;  2VKN A;  5IXB A;  4J9I A;  1UUE A;  1J3T A;  2JTE A;  3UA6 A;  3EG3 A;  3SHW A;  2KYB A;  1WXU A;  2GTO A;  1UHF A;  2EYX A;  1V1C A;  1X43 A;  2HSP A;  2CSI A;  2VVK A;  3ULR B; 
#chains in the Genus database with same CATH topology
 2P4T A;  1YIT Q;  3FLG A;  3O5Z A;  5KYX A;  1D0X A;  3I56 T;  2DRK A;  2FVU A;  3C12 A;  5IHI A;  2HEQ A;  5CQX A;  2PNI A;  1LJO A;  4IUQ A;  3L2Q A;  2FRW A;  1QMC A;  2EIF A;  3QWY A;  2PVO B;  2GTJ A;  2FB7 A;  1YCY A;  1YJ9 T;  5FU6 C;  5M9O A;  3VS4 A;  1WA7 A;  3HTR A;  2A37 A;  2CZ7 B;  1Z9Z A;  3OS5 A;  3FB9 A;  2D9T A;  2YUP A;  4B9W A;  1UTI A;  2F69 A;  2KXD A;  3OB9 A;  2RQU A;  2L2P A;  3TQ7 P;  2J6O A;  1I0C A;  3QJY A;  1K4U S;  2YUO A;  1RAB B;  2X3X D;  1YFN A;  1FWZ A;  4AT1 B;  2COZ A;  4JRI A;  2K3B A;  1OPL A;  2XU8 A;  1NLO C;  3OS2 A;  4XTX A;  5FU7 B;  3CCR T;  4EMG A;  3QZ5 B;  2EKH A;  5I2S A;  4FYW B;  1VQ4 A;  4EMH A;  2DBK A;  5CR2 A;  3EH1 A;  4M7A E;  2C0O A;  3PIO A;  2V1Q A;  1RI9 A;  1B07 A;  3FEO A;  1W4S A;  1FMK A;  5HKC A;  3CCQ T;  2AHJ B;  2HKN A;  5EG2 A;  2IG0 A;  2DPP B;  4QVC A;  4PJO A;  4P5N A;  3M53 A;  1UJ0 A;  4C8Q E;  4HXJ A;  5L23 A;  2COY A;  2RF0 A;  1WFW A;  4J6W A;  1X6O A;  2KR3 A;  3UF4 A;  3LYI A;  5HK0 A;  2NLU A;  1UEB A;  1XQH A;  1OUL A;  1NJI R;  3H0I A;  1MMA A;  4XTU A;  2MMP A;  2DRM A;  5FLX E;  2DXB A;  2HBP A;  2QDL A;  3CCS T;  1X27 A;  2BZY A;  2L89 A;  3HRS A;  4XK8 E;  2O01 E;  2DVJ A;  2RHX A;  1PHT A;  1XNI A;  1VQL A;  2CDT A;  2HAX A;  2EQK A;  5KE3 A;  1G5V A;  2LT4 A;  2P4R A;  4II1 A;  4CRI A;  1Z9Q A;  1VQ5 Q;  4JLG A;  3OY9 A;  1YIJ T;  1W6X A;  5CIU A;  3OYB A;  2D8H A;  4PFZ A;  1NE8 A;  2CP3 A;  1ZSZ C;  3PTA A;  4IUV A;  1QVF A;  2H3J A;  4R55 A;  1N8R R;  2LQW A;  4JZ4 A;  3PVQ A;  5GJV B;  2C06 A;  2HBW A;  2RH2 A;  1TXQ A;  2XK0 A;  4RUG A;  2X4Y A;  1RAD B;  1Y96 B;  4R0K A;  3RR6 A;  3CCL A;  4E47 A;  1SSH A;  4CC3 A;  4PL6 A;  2MWP A;  1UG1 A;  5GAN 2;  4PJO C;  1ZLM A;  1TUD A;  1VQ7 Q;  1TH7 A;  4M77 G;  4XU0 A;  3DLM A;  5HY6 A;  3VS1 A;  1VQM Q;  2MIO A;  1RLQ C;  4FW2 A;  1ZSG A;  4IIO A;  1KHC A;  2RJC A;  2WSE E;  1Q95 G;  1UGQ B;  2RHZ A;  3MPU B;  1PNJ A;  3KUF A;  3CXC A;  3M59 A;  2BE9 B;  2KRN A;  3CCV A;  1WJS A;  3NMZ C;  3CCU T;  4E7J A;  5GAN f;  3FRN A;  2RK2 A;  3RER A;  3KBG A;  3JB9 I;  1JO8 A;  1EZZ B;  2RD1 A;  1YIT A;  4PJJ A;  2MK5 A;  1X6B A;  1NYG A;  1S72 T;  3ZBD A;  2RPN A;  4Z88 A;  1HXD A;  2O88 A;  2DL7 A;  4BUG A;  2XG8 D;  4RKU E;  1Y71 A;  1BK2 A;  2QXF A;  3BDL A;  4DBQ A;  4RTV A;  3EFS A;  2QAS A;  5GMK e;  2BZX A;  4J6Y A;  1VQ4 T;  1UGR B;  4GLK A;  1QKX A;  2D0Q B;  3M9Q A;  4M78 C;  4AMC A;  2QQB A;  2LRQ A;  2HL5 C;  3M55 A;  1N8R U;  1VQ6 T;  3FC3 A;  1ZBJ A;  2KE9 A;  4OML A;  1MND A;  1C1A A;  1BIA A;  3M54 A;  4OB1 B;  4OMO A;  2DK3 A;  1TS9 A;  2E3H A;  2QAZ A;  2JVV A;  3JCM V;  4FCY A;  2RNA A;  2FZK B;  5C6S A;  3IQL A;  2RMO A;  3CME Q;  3JB9 F;  4JRQ A;  4J83 A;  2BUD A;  1G83 A;  2W10 A;  3OMG A;  4F16 A;  3OW2 A;  1ZSZ A;  2O4X A;  1MNE A;  1K73 C;  3CC4 Q;  3EFR A;  4EMK C;  2V26 A;  1YJW T;  2CT4 A;  1OPK A;  1KSW A;  2B86 A;  2F5K A;  4OMP A;  1E7O A;  2ZGW A;  1FXX A;  3UT1 A;  1OX9 A;  4E2F B;  1Q86 U;  3Q1J A;  1JQQ A;  4XU1 A;  1M2O A;  4Q5W A;  1IB8 A;  2R57 A;  2YWW A;  3INZ A;  3H9N A;  1GRI A;  2L5Q A;  1JU5 C;  2A0F B;  2AIR B;  3ZFJ A;  4DQ2 A;  2M16 A;  3NTI A;  3GF5 A;  2O9V A;  1TSF A;  3CCE Q;  1B7T A;  1KQS P;  2YLC A;  1X6G A;  3V8K A;  2HL3 A;  3I5S A;  4X34 A;  3EH2 A;  1RAG B;  1JEG A;  4JJC A;  3M0S A;  3EFO A;  2KY9 A;  3RES A;  4WTO B;  1IZ6 A;  4JS4 A;  1VQK A;  1RAA B;  4IKF A;  3A8H B;  5FRN A;  5GAN 6;  4Y91 A;  1X75 C;  2RHI A;  1GCP A;  1KQ1 A;  2K5I A;  3OYJ A;  2V8J A;  1JXO A;  1M3B A;  2RJD A;  4J9C A;  1G2B A;  4L5G A;  2DD4 A;  5KCO A;  3OMC A;  5LJ3 e;  1IHW A;  2BZ8 A;  2EBP A;  5FWC A;  3MEU A;  4J8O A;  1D0Z A;  4M7D A;  1AOJ A;  1K0X A;  3D7S B;  4PJO F;  2QEX Q;  3HP9 A;  2B8A A;  1K9M R;  5I21 A;  2QQS A;  3M5A A;  1M90 C;  4C8Q B;  3FIF A;  4XU2 A;  2DKG A;  1WXU A;  1YHQ T;  1UHF A;  4LD9 K;  1PM3 A;  3FJP A;  2PUO B;  4KGZ B;  4MZT A;  4C92 A;  3OYM A;  3ULR B;  4FU6 A;  1ZBX A;  2LNH B;  3OYY A;  4D8K A;  1OU9 A;  2ZPF B;  1D1A A;  4X1V A;  2YRC A;  1VQP A;  1HK9 A;  4F7U G;  5GAM g;  2K57 A;  4M7A C;  1AHJ B;  4KH1 B;  1BIB A;  5I2M A;  5GAO q;  3G4S Q;  5GAN e;  2DXT A;  4DBR A;  1HJD A;  4E7H A;  5J39 A;  4M7D C;  3OW2 P;  2DD5 A;  1AD5 A;  1D3B A;  4OGC A;  2DIL A;  4ZGD B;  3TVT A;  2GBQ A;  2KRM A;  4HVU A;  4X9D A;  3KFV A;  1OOT A;  1G3S A;  5CAI A;  2CGH A;  3EGD B;  1I07 A;  5GAM f;  3GIB A;  1WQW A;  1WIE A;  5GAN h;  1M90 R;  3MO8 A;  4RTT A;  1SG5 A;  2CZ6 B;  2MI6 A;  4LDX A;  4FT4 A;  1N9S A;  1YCS B;  4RTX A;  2X3W D;  3JCM e;  2FPE A;  5GAO n;  3X20 B;  2E41 A;  2LT1 A;  5KYU B;  2CH4 W;  3G4S T;  1Q82 R;  2BIV A;  2PTK A;  3CD6 A;  3NPF A;  3M56 A;  4LDU A;  2X51 A;  4HVV A;  4FM4 B;  3QII A;  2E1H A;  1S1N A;  4IIM A;  2QGF B;  3CCL T;  2YRD A;  2QYZ A;  4CC7 A;  3EG2 A;  2C0I A;  2GFA A;  2DNU A;  3CQT A;  3MEA A;  1RAE B;  2PVG B;  2AZS A;  1I5O B;  3JSC A;  4M78 B;  3EG0 A;  1XJW B;  2ED1 A;  4BI3 A;  2CKK A;  4A63 B;  3NHN A;  3L2R A;  5LJ5 d;  1OZ3 A;  4A4E A;  4KGX B;  2R5M A;  1YBY A;  3G1J A;  4EPC A;  3L2U A;  1T3S A;  1NM7 A;  3QG1 A;  1R0C B;  1ABQ A;  4ZN1 A;  2LQN A;  2K3X A;  4C92 F;  3CCE A;  2J05 A;  4KUL A;  5C0M A;  1TUC A;  3TSW A;  3VS5 A;  4DA4 A;  1Q7Y U;  1M1K R;  2CRE A;  2XKO C;  3CME T;  2GNC A;  3A8G B;  5LJ5 h;  4O5V A;  3VUB A;  4JDS A;  1GCQ A;  2DER A;  3JCM d;  2Z0W A;  3G71 T;  1QP2 A;  4C0D B;  1C0M A;  5CKB A;  2X4X A;  2LMJ A;  1GFD A;  2MPX C;  4C92 G;  1TOV A;  4M7A F;  3HFO A;  2KNB B;  2F5T X;  2QQR A;  3PT9 A;  2J06 A;  8ATC B;  1M4Z A;  2X35 A;  2KXC A;  5KCH A;  1U8R A;  2ED0 A;  1NPP A;  1I81 A;  4CC2 A;  1G8X A;  3H6Z A;  4OGE A;  4OP0 A;  4XTW A;  1M27 C;  4M7A G;  4DBH A;  5GAN d;  4KUD K;  2KT1 A;  4RTW A;  4J6X A;  1KIK A;  2VGM A;  2DX1 A;  4RG2 A;  3HRT A;  1PKT A;  2NUZ A;  2ROL A;  2P0P A;  3O8V A;  5FU7 C;  2JJ9 A;  5LJ5 j;  1QCO A;  1BU1 A;  3PIP A;  5GAN j;  5I22 A;  4FIB A;  4RG8 A;  5IH2 A;  2EYZ A;  1ZQ1 A;  1MV0 B;  1OX8 A;  2BTT A;  2EJF A;  4F7U E;  2QG9 B;  2VXF A;  1YJN T;  3REA B;  3QKJ A;  2DET A;  4J5Y A;  1YJ9 A;  1H3Z A;  3AHU A;  2RJE A;  3MEV A;  3J7A F;  2W0Z A;  1PWT A;  1KC8 U;  1BI0 A;  4LUD A;  2V8K A;  5CKH A;  5FU6 B;  1VA7 A;  1SF9 A;  2LCL A;  2AKK A;  3H0H A;  3RKX A;  2KDS A;  3OYL A;  1YI2 A;  4Z89 A;  5LJ5 e;  4OMM A;  1K0S A;  1DJ7 B;  2L0A A;  1M1F A;  2F2W A;  1UDL A;  4QVD A;  4LNP A;  2VAS A;  4M78 A;  4PJO G;  2DMO A;  3WVD B;  4N4I A;  2FPF A;  2FHD A;  2QDY B;  1VQ8 A;  3DLL A;  1VYU A;  3CC2 Q;  3CCQ Q;  4M77 A;  5GMK l;  2LCC A;  5LJ3 h;  1Y07 A;  3OQ5 A;  2DVE A;  2JNG A;  1K73 U;  1IO6 A;  3E9G A;  5GAO p;  2VUB A;  4JJB A;  3JCM c;  1R8O B;  4XTV A;  3OYE A;  3C94 A;  1SSF A;  1N6A A;  1K1Z A;  4EMK B;  1WX6 A;  1VQ5 A;  1VQN Q;  1WNL A;  4PNO A;  1D3B B;  2ZPE B;  4DBF A;  1K8A R;  4PJO E;  3G7Z A;  4F7U A;  3MCA B;  2EAY A;  3CPF A;  2VGN A;  4ATO A;  2CT3 A;  3S3O A;  4HCZ A;  3S3N A;  2PU9 B;  1I4K 1;  4M75 C;  1VQ9 Q;  1G3T A;  3LWI A;  1VQL T;  3E2U A;  4LD6 A;  3L1A A;  2EGC A;  2EGE A;  1WJR A;  4N4G A;  3CBP A;  4M75 F;  2A36 A;  1I5L A;  1M1G A;  2H3E B;  5GAM h;  2LJ0 A;  3EGD A;  2V1R A;  1D09 B;  4FW1 A;  2KK4 A;  2EJ9 A;  3M4G A;  6AT1 B;  2X4J A;  1BCM A;  3LLR A;  1WGS A;  1TTH B;  2Y4Y A;  5A0G A;  2RI2 A;  4BE0 A;  2GGR A;  2JM8 A;  1BB9 A;  2LJ3 A;  1OQK A;  1WHG A;  2HDA A;  2R5A A;  2YHT A;  3TRE A;  3UAT A;  1Y57 A;  3C95 A;  5CVI A;  1GL5 A;  7AT1 B;  3RMQ A;  4CI0 C;  2KRO A;  3OS1 A;  4JJD A;  2JTM A;  1KFZ A;  1VQL Q;  2M0O A;  3UA7 A;  4J9B A;  3JCM W;  5CKF A;  2KGT A;  5CCA A;  2JMC A;  2Y90 A;  3TU4 K;  3OW2 S;  4J7I A;  2CP5 A;  2KYM A;  4C92 D;  3CCE T;  2HNI A;  1MV3 A;  4C0D C;  3CCR A;  1OYX A;  3JCM P;  1K8A U;  2EFI A;  3EG1 A;  5FW9 A;  3A8L B;  2E3I A;  2HZY A;  2H8H A;  2GF7 A;  5DM7 R;  1MGQ A;  2A08 A;  1PG5 B;  5LJ5 f;  2FPD A;  4EDU A;  3I55 Q;  1ZHI A;  4M7A D;  3CMA T;  1BYM A;  5KYY B;  1QLY A;  1RAH B;  3UPU A;  5D7U A;  3NTK A;  4FSS A;  3LW5 E;  4PK4 A;  3QO3 A;  3QPH A;  1P92 A;  2EPD A;  4E7K A;  1VIE A;  2QGG A;  1VQK T;  1H92 A;  5LJ3 d;  1M1K C;  3EG9 B;  4BE2 A;  2QK0 A;  4HT8 A;  2NUT B;  1WQ7 A;  1SRL A;  3ASK A;  1I8F A;  2VKN A;  5GAN g;  1LVK A;  2L3R A;  3CCJ T;  4E7L A;  1M5Q 1;  4BI4 A;  3SHW A;  1XTD A;  4PFP A;  2GTO A;  3MP6 A;  2LVM A;  2K4Y A;  3RUX A;  2XI9 A;  4HT9 A;  3EFO B;  2DXU A;  4AFU C;  2ZPI B;  1LOJ A;  2XIC A;  1VQP T;  3FJ5 A;  1UGS B;  5CO7 A;  3BY7 A;  2QA4 T;  4ORZ A;  3G71 Q;  4PLI A;  3OYG A;  3OYH A;  3A8O B;  4KRT A;  4RCC A;  4AG1 C;  3CCJ A;  3OYD A;  3VYG A;  2E6Z A;  1W2B P;  2NUP B;  2QEX T;  1O75 A;  3CC7 T;  3QHS A;  1YWP A;  2K5F A;  2DJQ A;  2M51 A;  1VQ8 T;  2DYB A;  2L8D A;  2KQW A;  2MYS A;  4WF2 A;  3TEE A;  2P84 A;  2ZPH B;  1QVF S;  2EQI A;  1YI2 Q;  3R6N A;  4D8D A;  1OI1 A;  4N0A A;  2LP5 A;  5J3B A;  1ACM B;  3HKS A;  1TG0 A;  1TWB A;  4BDY A;  3VS7 A;  2JXB A;  1VQ8 Q;  5D6X A;  3LGF A;  2QQ9 A;  4J7F A;  1RL2 A;  3CCQ A;  3QBY A;  4QW2 A;  4C5I A;  1QWF A;  4RCB A;  5AYF A;  2K9G A;  3L2Z A;  4CC4 B;  4RTU A;  1M2V B;  3QYG B;  2P0K A;  5HK3 A;  4ESR A;  4M77 E;  1KJW A;  4OMQ A;  4OF1 A;  4X9C A;  2OTL Q;  1FYN A;  1PD1 A;  1YIT T;  1HYO A;  2LJ1 A;  3CCU Q;  1BI3 A;  5A2Q E;  1SEM A;  2MWO A;  2SRC A;  2LTO A;  4KT0 E;  3URG A;  2OTJ T;  3REB B;  3PE0 A;  2FL7 A;  1GFC A;  4C8Q C;  2K5L A;  3MEW A;  2EVR A;  2K2M A;  3CD6 T;  4F7U B;  5LJ3 f;  4LXC A;  4IUP A;  1AT1 B;  1WYX A;  2COW A;  2YRV A;  1AWO A;  1VQ9 T;  1I1J A;  4PLL A;  3OYF A;  2ZAE A;  2KMT A;  3THK A;  2JZ2 A;  3ER0 A;  5CKD A;  2ESW A;  2IVW A;  2EWN A;  2M1H A;  1PCX A;  3EGU A;  3OBY A;  1UJY A;  3PFS A;  3EG9 A;  1EIF A;  1IGU A;  3CCM Q;  3GNF B;  3F70 A;  4JRP A;  1LPL A;  1YJN Q;  3LH5 A;  2OTJ A;  2E12 A;  2FG0 A;  1WHL A;  1VQK Q;  2IIM A;  4F04 B;  4BD3 A;  1RAF B;  2LNV A;  1AWX A;  4DEY A;  1QKW A;  3CPW S;  1VQN A;  3QUI A;  2DEQ A;  4OMF B;  1AZE A;  5CQY A;  5GAO m;  3SWN C;  2XDB A;  2I2L A;  1Q81 U;  3JCM g;  2HMA A;  3P8D A;  4E7I A;  5D6W A;  2ECZ A;  4RTZ A;  2HKQ B;  4PJM A;  3OSS C;  2DYI A;  1VUB A;  5KYX B;  1YJW Q;  1PRL C;  1QW1 A;  3BDU A;  2XID A;  2EYY A;  4MZP A;  3I55 A;  3CC4 T;  1M8V A;  4C92 B;  2ENM A;  3CCS Q;  4PJN A;  2LX7 A;  2YT6 A;  1AWW A;  4OB0 B;  5FRO A;  2YXY A;  2QEX A;  1U3O A;  2JT4 A;  3HSB A;  3MP8 A;  2RHY A;  9ATC B;  1K9M U;  4HVW A;  2GCX A;  2O2O A;  4MZM A;  5IHN A;  8AT1 B;  3L2W A;  4EMK A;  3QJ6 A;  3PMT A;  4M77 D;  2YDL A;  3LGL A;  2X9H A;  3TSZ A;  3CD6 Q;  1M30 A;  1D0Y A;  1N9R A;  1ZUU A;  2LQ8 A;  1QVG P;  2VWF A;  2K3Y A;  2RN8 A;  2G3R A;  4A54 A;  4KH0 B;  3OSV A;  1BI2 A;  2QI2 A;  2CH4 A;  3S3M A;  3N5B B;  2NUT A;  3M0T A;  5L8R E;  3GNG A;  1BBZ A;  3GP8 A;  2JM9 A;  4N4H A;  3OYA A;  2FZC B;  1Q82 U;  2DA9 A;  4PKC C;  1S72 A;  1Q86 C;  3CMA A;  4JUV A;  2O31 A;  1AEY A;  1Q7Y C;  3G4S A;  1ZA1 B;  3JRZ A;  2DLP A;  3U23 A;  3QWX X;  1X2K A;  2DO3 A;  1WJQ A;  2E5K A;  4QT7 A;  1UHC A;  2E70 A;  2DIG A;  1V29 B;  3V8L A;  5D6Y A;  5KYW B;  3CCV T;  1WHM A;  4M78 F;  2WSF E;  4MML A;  2EKO A;  1VQM T;  4MDX A;  1Q81 R;  5J26 A;  2EQJ A;  1YIJ A;  1WZO A;  1KC8 C;  4M75 A;  1K73 R;  2DEU A;  2RB6 A;  3ZEH A;  1N8R C;  4J9F A;  1WHJ A;  2HQX A;  2P0Q A;  5GMK m;  4ZTJ A;  2JMA A;  1XOV A;  2CZ0 B;  2RM4 A;  5GAO l;  3WVE B;  2BKD N;  2XDP A;  4FL6 A;  4C5G A;  5FWB A;  4BY6 B;  1ZUY A;  4LUE A;  1U06 A;  4J9D A;  2RQT A;  1ZA2 B;  4F7U F;  5LJ3 g;  2DAQ A;  1FMW A;  2RK1 A;  1W2B A;  2IPO B;  4NL2 A;  4F14 A;  1KG1 A;  2LZ6 B;  1QCF A;  1GBQ A;  3RKY A;  2D0N A;  1JBM A;  2J6K A;  2K6D A;  1CSK A;  3DB4 A;  1ARK A;  4GLM A;  1EX4 A;  1NEB A;  4M78 E;  1SHF A;  1VQ6 A;  1MMD A;  5DLQ E;  4IUU A;  5GAN 3;  1Q7Y R;  2FEI A;  3OBW A;  3CXC S;  1QQJ A;  2VB6 A;  5GAN 8;  5GJW B;  2JS2 A;  2DXC A;  2G6F X;  5KE2 A;  4M77 C;  2SEM A;  4XQ3 A;  3SEM A;  1JXM A;  3GLX A;  1U5S A;  3E1S A;  1Q82 C;  5GAN 5;  1VQ7 T;  1W2B S;  2XMF A;  1UE9 A;  5LL6 S;  3RDV A;  3QZ9 B;  4RMO A;  3E9F A;  1R77 A;  4Y92 A;  1CKB A;  4VUB A;  3X25 B;  4KBM B;  2F2V A;  5IAY A;  4C5E A;  3CC2 T;  2KI7 A;  5FRM A;  5GAO r;  3J80 E;  3JCM X;  3GOX A;  1VQ5 T;  1MMG A;  4XAX B;  3CBM A;  3VU3 C;  1N27 A;  1YNZ A;  1VQO T;  2HD0 A;  3CCJ Q;  2JN0 A;  1QVP A;  1VQO A;  1OZ2 A;  1MUZ A;  1F1B B;  2J6F A;  1KD1 R;  4C8Q G;  2DIQ A;  2AT1 B;  4HA8 A;  4C0F A;  4RTY A;  1KQ2 A;  4M75 E;  1YHQ Q;  4PJO B;  4HCC A;  1NPR A;  2NWM A;  4V2S A;  1X69 A;  3S6W A;  2LX9 A;  4IUT A;  2DF6 A;  2DBM A;  3JV3 A;  2EJG A;  4FYV B;  4L6V 5;  1MHN A;  1KQS S;  1PC0 A;  3EAE A;  1IRE B;  3SB2 A;  3X26 B;  5CKE A;  1G3W A;  2JS0 A;  3TCJ A;  1M1K U;  1SHG A;  3WXM B;  2JUF A;  5GAM d;  4ZTF A;  4MDW A;  3H41 A;  4GBQ A;  4KUI A;  2LCS A;  2PUK B;  3OA6 A;  2O9S A;  2A28 A;  3DKM A;  2QTV A;  4C0Z A;  3NTH A;  4E7S A;  5CK9 A;  1TUG B;  4O6J A;  3PNW C;  2KSS A;  2L3S A;  2VV5 A;  3RBB B;  1JRI A;  3EHQ A;  4A4G A;  1OU8 A;  2CUD A;  3QDF A;  3V7S A;  2XD0 A;  2R58 A;  4ZGJ B;  1VIF A;  4UC4 A;  2ABL A;  3JCM h;  3OYN A;  1VOM A;  4DEX A;  1VYT A;  4OB2 B;  2AK5 A;  1RI0 A;  1VQ4 Q;  1JJ2 A;  4AG2 C;  1BCO A;  1KC8 R;  3CEY A;  2QQA A;  1SKU B;  1UGP B;  4QKU A;  1Y7X A;  1T0J A;  1AVZ C;  2RQV A;  3ZL7 C;  3AT1 B;  2MF2 A;  1NJI U;  4FT2 A;  3LX7 A;  2QTX A;  1M2V A;  2A7Y A;  4M78 D;  2DE0 X;  1WLP B;  3LWH A;  1RAI B;  3V8J A;  4J9I A;  4JS5 A;  3JCM J;  2D6F A;  1H64 1;  1IXD A;  3KXT A;  2JTE A;  1QVG A;  2RI3 A;  2FYK A;  3CPW A;  1VQN T;  5IT9 E;  2E10 A;  5GAN 7;  4B6M A;  1V1C A;  2HSP A;  4LDV A;  4A4H A;  4ZNX A;  4XTY A;  4ZGE B;  5EC7 A;  3R6O A;  4PFO A;  1YJ9 Q;  4M77 B;  4PJL A;  2YUN A;  1CKA A;  3RNJ A;  2ZZD A;  4M7D E;  1IGQ A;  1UB4 A;  2DJZ A;  1NLP C;  4E6R A;  1M9S A;  2CS7 A;  4DOV A;  4R56 A;  2NUP A;  1Y0M A;  2M9U A;  3JCM Q;  1ABO A;  2GFU A;  2DL5 A;  4ME7 A;  3JCM f;  3CC7 A;  2MCN A;  3L42 A;  4HCK A;  1PKS A;  2LC4 A;  4OMN A;  3RMS A;  2F1L A;  2RHU A;  3SWN A;  4NS5 A;  4M77 F;  3JB9 H;  4M7A B;  2EYW A;  3CC2 A;  1B34 A;  1JJ2 P;  4HCB A;  3PMI A;  1YIJ Q;  3SFM A;  2VYT A;  4QQG A;  1W70 A;  2OX7 A;  3CBO A;  4D6W A;  2RQR A;  2KAF A;  2V8I A;  3UWN A;  2JOY A;  3CCS A;  1M8M A;  3DB3 A;  4BE1 A;  3P8B B;  2DTH A;  2NYS A;  3QSU A;  5DY9 A;  4J9E A;  3CME A;  3OS0 A;  1Q81 C;  3ME9 A;  1NG2 A;  4LDY A;  5A0D A;  2OAU A;  2GQV A;  1U1T A;  3G6E Q;  3GPL A;  1WI7 A;  5GMK j;  1VQ9 A;  3M0P A;  4C92 E;  1TU0 B;  3X28 B;  4BDZ A;  2EW3 A;  4GY5 A;  2CZ1 B;  3I55 T;  3CC4 A;  1K9M C;  5ECA A;  3CCV Q;  3OYC A;  2ZCF B;  4MMK A;  3A98 A;  1RUW A;  1Q86 R;  1WXB A;  2YUQ A;  2OJ2 A;  1S72 Q;  3VS0 A;  2WSC E;  1BI1 A;  3CMA Q;  3M0U A;  3I56 A;  3MET A;  1W1F A;  4M7A A;  1RLP C;  4M75 D;  1QCN A;  2EQU A;  3JCM b;  3MP1 A;  1G3Y A;  1FX7 A;  2ATC B;  1ZSZ B;  2O4X B;  2CP6 A;  1OV3 A;  4M7D B;  4A4F A;  3MHX A;  3RIR A;  3JB9 D;  5GMK h;  2PVD B;  1QVG S;  2OI3 A;  1H8K A;  2EQM A;  3UDC A;  1OEB A;  4LE9 A;  4C8Q D;  2CUB A;  2YSQ A;  4Z02 A;  4OB3 B;  4C92 C;  1YWO A;  3VS3 A;  1YHQ A;  3I9Q A;  1YP5 A;  2OTL T;  2DZC A;  4M7D G;  1V76 A;  4QQ6 A;  4M7D F;  2L3Q A;  4ELZ C;  1IHV A;  5KYY A;  1NJI C;  3NFC A;  3SWN B;  3CCR Q;  3BFM A;  1JJ2 S;  3VUZ A;  1N5Z A;  4K11 A;  4QQD A;  1EFN A;  1M3A A;  1RAC B;  2JW4 A;  4A4K A;  1HD3 A;  4C0G A;  1VQ6 Q;  1KHI A;  2D1X A;  2D8J A;  2BE7 D;  3M57 A;  2PQW A;  5GMK i;  3M0Q A;  3LH0 A;  3CPW P;  2XHC A;  2PZ1 A;  1SRM A;  1KQS A;  1FMV A;  1PRM C;  1PSE A;  2WAC A;  2J7I A;  4M78 G;  4XTZ A;  2KT8 A;  2HCK A;  1QP3 A;  3HL8 A;  2CP2 A;  2QA4 Q;  3HHT B;  3SDZ A;  4F17 A;  2E65 A;  2XDD A;  4IUR A;  2DL8 A;  5LJ5 g;  4TVR A;  4LDW A;  3EHR A;  1YN8 A;  1IRX A;  3VV0 A;  1GBR A;  2K79 A;  3SD4 A;  1VQO Q;  2ZPB B;  2ROT A;  3NGP A;  2KEA A;  4JLI A;  4AFZ C;  5GAM j;  2CSQ A;  5IXF A;  1NBE B;  1M3C A;  1O9S A;  2CYZ B;  2HQH A;  3BE3 A;  4HKE A;  4JJN K;  5KH6 A;  2K7A A;  4BY6 C;  2DTI A;  1AWJ A;  1NYF A;  4J9H A;  3CCU A;  2RA2 A;  3A1P A;  3G71 A;  5I11 A;  2YLB A;  2MAM A;  2EYQ A;  2FZG B;  4M4Z A;  1D1B A;  1E6G A;  2DL3 A;  1UFF A;  1JB0 E;  2GQI A;  2HSE B;  5KYU A;  1GXI E;  4ANJ A;  3QDR B;  3OYI A;  3GBQ A;  3JAM E;  4BI8 B;  3V7R A;  3HPW A;  3P8H A;  5AT1 B;  4PJO D;  1WDX A;  1K76 A;  3C0C A;  5IN1 A;  2E5Q A;  3QYH B;  1NEG A;  2E4H A;  3VS6 A;  1AZG B;  1KK7 A;  4A53 A;  4JPB W;  1PSF A;  1E6H A;  1YJN A;  4KGV B;  2OTJ Q;  2CP0 A;  4QVZ A;  2X4W A;  2CP7 A;  4YTL A;  1X01 A;  3M58 A;  4C5H A;  2DL4 A;  2E6N A;  3EGX A;  1C6V X;  3RKW A;  3JB9 J;  4L59 A;  2DZ9 A;  1A0N B;  4WCI A;  1YI2 T;  4LN2 A;  5GAM e;  2RJF A;  3VYH B;  4E7Z A;  3I35 A;  2OAW A;  3HRU A;  5HCK A;  1BKB A;  3MKD A;  1WXT A;  2OTL A;  4FSX A;  3FDR A;  3VRZ A;  2KVQ G;  3VJP A;  1H3H A;  2DFU A;  1K9A A;  2DTO A;  1YJW A;  3VKI A;  1SPK A;  2DM1 A;  4ELY C;  5KYN A;  1LCK A;  4JRK A;  1GCQ C;  5DLO A;  3A8M B;  4AFS C;  1UEC A;  1KD1 U;  2MOX A;  4FYX B;  2HQE A;  2C0T A;  1VQM A;  1WHK A;  2A3L A;  2K2V A;  1VQP Q;  3HFN A;  3JB9 G;  1UGV A;  4AFQ C;  3BW1 A;  1T3L A;  2EGA A;  2VC8 A;  1WHH A;  1X2Q A;  2AKL A;  4EIK A;  4DOW A;  1ZUK A;  4Z8A A;  2RI5 A;  1VYV A;  4M75 G;  3CXC P;  1M90 U;  3VRY A;  5KYW A;  3CC7 Q;  1LNX A;  2M02 A;  1B3Q A;  5GAN 4;  3I5R A;  3EGX B;  5A0L A;  3CCM A;  1HSQ A;  4M7D D;  1Y96 A;  2FO0 A;  3E19 A;  2KBT A;  2M0Y A;  2RQW A;  3H0F A;  1WPY A;  2RO0 A;  1QVF P;  2AZV A;  4J9G A;  1NZ9 A;  4BB7 A;  2E64 A;  4M75 B;  3X24 B;  3OYK A;  1K8A C;  4XU3 A;  3M4Y A;  4FYY B;  3V7C A;  2VXE A;  1QWE A;  3PVL A;  2L3P A;  3PGG A;  2LDM A;  5IHK A;  4NL3 A;  1ZX6 A;  3G6E A;  4B9X A;  5LJ3 j;  2F2X A;  2I0N A;  2LQK A;  3CCL Q;  4N0A C;  1MMN A;  3L2V A;  1B34 B;  4C8Q F;  3QXE B;  3M0R A;  1VQ7 A;  2FRY A;  3H8Z A;  3A5Z B;  2Y4X A;  2KRS A;  3T9N A;  1KD1 C;  1T0H A;  3VS2 A;  1R0B G;  4NOY A;  4C8Q A;  3I56 Q;  4JZ3 A;  2QA4 A;  3CCM T;  5IXB A;  4ZN3 A;  1D1C A;  3G6E T;  1UUE A;  2ZPG B;  1J3T A;  2JTF A;  3UA6 A;  3EG3 A;  4OVA A;  2KYB A;  3MJX A;  4Y28 E;  3J81 E;  2EYX A;  1U1S A;  1X43 A;  4BAC A;  2CSI A;  3C4S A;  1PD0 A;  2VVK A; 
#chains in the Genus database with same CATH homology
 2LNH B;  5EC7 A;  3O5Z A;  4AFU C;  4D8K A;  3FJ5 A;  2YUN A;  1CKA A;  3RNJ A;  4X1V A;  2DRK A;  4ORZ A;  5IHI A;  2HEQ A;  1NLP C;  2PNI A;  4E6R A;  4KRT A;  4AG1 C;  2FRW A;  3QWY A;  1Y0M A;  1ABO A;  2GTJ A;  1HJD A;  2DL5 A;  1YWP A;  1AD5 A;  2MCN A;  3VS4 A;  1WA7 A;  4HCK A;  1PKS A;  4OMN A;  2A37 A;  2DJQ A;  2M51 A;  2DIL A;  2DYB A;  4ZNX A;  3TVT A;  2GBQ A;  1Z9Z A;  2KRM A;  4HVU A;  3KFV A;  2EYW A;  1OOT A;  2EQI A;  2YUP A;  3R6N A;  1UTI A;  4D8D A;  1W70 A;  1I07 A;  2RQR A;  2LP5 A;  2KXD A;  2RQU A;  2L2P A;  1WIE A;  2J6O A;  1TG0 A;  1I0C A;  4RTT A;  3VS7 A;  1M8M A;  1K4U S;  2JXB A;  2YUO A;  1YCS B;  2X3X D;  4RTX A;  2X3W D;  2FPE A;  1QWF A;  2K9G A;  2K3B A;  2CH4 W;  4J9E A;  4CC4 B;  1OPL A;  4RTU A;  1NG2 A;  1NLO C;  2PTK A;  1WI7 A;  3NPF A;  2EKH A;  3M0P A;  4HVV A;  4ESR A;  1KJW A;  2EW3 A;  1S1N A;  4IIM A;  4OMQ A;  2DBK A;  5ECA A;  4CC7 A;  3EG2 A;  2C0O A;  1FYN A;  2C0I A;  2LJ1 A;  2DNU A;  3A98 A;  1RUW A;  1RI9 A;  1B07 A;  2V1Q A;  3CQT A;  1SEM A;  1FMK A;  1WXB A;  2YUQ A;  2SRC A;  2AZS A;  2OJ2 A;  3VS0 A;  3REB B;  3PE0 A;  1UJ0 A;  1GFC A;  3M0U A;  4HXJ A;  2EVR A;  5L23 A;  2K2M A;  3EG0 A;  1W1F A;  2RF0 A;  1RLP C;  1WFW A;  2KR3 A;  3UF4 A;  2ED1 A;  1WYX A;  1OV3 A;  4A63 B;  1AWO A;  3NHN A;  1I1J A;  3THK A;  2OI3 A;  1H8K A;  3H0I A;  1OEB A;  2DRM A;  2ESW A;  4LE9 A;  2CUB A;  2QDL A;  2YSQ A;  1X27 A;  3EGU A;  1UJY A;  1YWO A;  3VS3 A;  1T3S A;  2BZY A;  1NM7 A;  1YP5 A;  3I9Q A;  1ABQ A;  2LQN A;  2J05 A;  2DVJ A;  1TUC A;  3LH5 A;  3TSW A;  3VS5 A;  2L3Q A;  1PHT A;  2CRE A;  2FG0 A;  2GNC A;  2IIM A;  2CDT A;  1GCQ A;  1AWX A;  1N5Z A;  4K11 A;  2P4R A;  1EFN A;  4DEY A;  1Z9Q A;  1QKW A;  1M3A A;  2JW4 A;  1W6X A;  1HD3 A;  2LMJ A;  1GFD A;  1AZE A;  2D8H A;  2D1X A;  2D8J A;  2KNB B;  2J06 A;  2KXC A;  2ECZ A;  4RTZ A;  3M0Q A;  2ED0 A;  2PZ1 A;  2LQW A;  1SRM A;  4JZ4 A;  3PVQ A;  5GJV B;  4CC2 A;  1PRL C;  2HBW A;  4RUG A;  1PRM C;  2EYY A;  4R0K A;  2J7I A;  2KT8 A;  2ENM A;  2HCK A;  1SSH A;  1M27 C;  4CC3 A;  2LX7 A;  2YT6 A;  1UG1 A;  1AWW A;  4F17 A;  2KT1 A;  4RTW A;  1ZLM A;  1TUD A;  1U3O A;  1KIK A;  2DL8 A;  2JT4 A;  3VS1 A;  2MIO A;  2DX1 A;  1RLQ C;  3EHR A;  1YN8 A;  1ZSG A;  4HVW A;  4IIO A;  2O2O A;  1PKT A;  5IHN A;  2NUZ A;  2ROL A;  1GBR A;  2K79 A;  2YDL A;  3TSZ A;  1M30 A;  2ROT A;  3NGP A;  2KEA A;  4AFZ C;  1PNJ A;  1ZUU A;  2VWF A;  2RN8 A;  2CSQ A;  5IXF A;  1BU1 A;  2CH4 A;  1M3C A;  5I22 A;  3M0T A;  2KRN A;  5IH2 A;  1BBZ A;  2EYZ A;  3NMZ C;  1MV0 B;  2JM9 A;  2BTT A;  2K7A A;  1AWJ A;  1NYF A;  4J9H A;  2DA9 A;  5I11 A;  1JO8 A;  4M4Z A;  1X6B A;  1E6G A;  2DL3 A;  2O31 A;  1NYG A;  3REA B;  1AEY A;  1UFF A;  2RPN A;  4Z88 A;  2DLP A;  3U23 A;  2O88 A;  3QWX X;  1X2K A;  2DL7 A;  2GQI A;  2E5K A;  4QT7 A;  1UHC A;  1BK2 A;  2W0Z A;  1PWT A;  3GBQ A;  4LUD A;  4RTV A;  2BZX A;  1VA7 A;  2AKK A;  3H0H A;  1WDX A;  1K76 A;  3C0C A;  1QKX A;  1NEG A;  4Z89 A;  3VS6 A;  1AZG B;  4OMM A;  1K0S A;  2L0A A;  2F2W A;  1UDL A;  4LNP A;  4J9F A;  4JPB W;  1E6H A;  1ZBJ A;  2DMO A;  2KE9 A;  2FPF A;  2JMA A;  1XOV A;  4OML A;  1VYU A;  4OMO A;  5FWB A;  2DL4 A;  1ZUY A;  4LUE A;  2RNA A;  1U06 A;  1IO6 A;  4J9D A;  2RQT A;  3IQL A;  2RMO A;  4JJB A;  4F14 A;  2LZ6 B;  1A0N B;  1K1Z A;  1WX6 A;  4WCI A;  1QCF A;  1GBQ A;  1G83 A;  2W10 A;  4F16 A;  2D0N A;  2J6K A;  2K6D A;  1CSK A;  4LN2 A;  1ARK A;  4GLM A;  1NEB A;  1SHF A;  2FEI A;  3I35 A;  2OAW A;  5HCK A;  5GJW B;  1WXT A;  2JS2 A;  2G6F X;  3VRZ A;  2CT3 A;  2SEM A;  3SEM A;  1JXM A;  1U5S A;  1OPK A;  2CT4 A;  1KSW A;  2B86 A;  1H3H A;  1K9A A;  4OMP A;  1E7O A;  2XMF A;  1UE9 A;  1SPK A;  2DM1 A;  4Y92 A;  1CKB A;  1LCK A;  2EGC A;  2EGE A;  1GCQ C;  1JQQ A;  2F2V A;  4AFS C;  1UEC A;  2A36 A;  2MOX A;  2LJ0 A;  2C0T A;  2V1R A;  1UGV A;  4AFQ C;  1YNZ A;  1T3L A;  2EGA A;  1X2Q A;  1GRI A;  1JU5 C;  1MUZ A;  2AKL A;  4EIK A;  2J6F A;  1ZUK A;  4Z8A A;  4RTY A;  1VYV A;  2GGR A;  2JM8 A;  1BB9 A;  3VRY A;  2LJ3 A;  1B3Q A;  2NWM A;  2HDA A;  3I5R A;  1X69 A;  2DF6 A;  1Y57 A;  1HSQ A;  2O9V A;  3UAT A;  2DBM A;  2FO0 A;  3JV3 A;  1GL5 A;  2KBT A;  2KRO A;  2M0Y A;  2RQW A;  1X6G A;  3H0F A;  4JJD A;  1KFZ A;  3I5S A;  2JS0 A;  2AZV A;  1SHG A;  4J9G A;  4J9B A;  3UA7 A;  1JEG A;  2KGT A;  3H41 A;  3M0S A;  2JMC A;  4GBQ A;  4JJC A;  2LCS A;  2O9S A;  2A28 A;  2KYM A;  1QWE A;  1MV3 A;  3PVL A;  2L3P A;  2L3S A;  3RBB B;  5IHK A;  3EG1 A;  3EHQ A;  1ZX6 A;  2CUD A;  5FW9 A;  2H8H A;  1GCP A;  2ABL A;  2F2X A;  2A08 A;  2I0N A;  4DEX A;  1VYT A;  2AK5 A;  2FPD A;  1JXO A;  1M3B A;  4AG2 C;  1QLY A;  4J9C A;  1G2B A;  3M0R A;  1T0J A;  4FSS A;  2FRY A;  1AVZ C;  2RQV A;  3ZL7 C;  2EPD A;  2BZ8 A;  2EBP A;  2KRS A;  1H92 A;  1T0H A;  3VS2 A;  2DE0 X;  5FWC A;  1WLP B;  4JZ3 A;  1AOJ A;  1SRL A;  1K0X A;  2VKN A;  5IXB A;  4J9I A;  1UUE A;  1J3T A;  2JTE A;  3UA6 A;  3EG3 A;  3SHW A;  2KYB A;  1WXU A;  2GTO A;  1UHF A;  2EYX A;  1V1C A;  1X43 A;  2HSP A;  2CSI A;  2VVK A;  3ULR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...