4OMNA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omnA00
2HDAA 2LJ0A 2CUBA 2C0TA 3SEMA 2YSQA 2JS0A 3M0UA 2DRMA 3VS3A 3JV3A 3IQLA 5L23A 1W6XA 4ZNXA 1WYXA 1K0SA 1K0XA 1PKSA 1KIKA 2FEIA 1QCFA 1KSWA 2K7AA 3R6NA 4HVVA 2YUQA 2A37A 3O5ZA 4E6RA 1YNZA 4AFQC 2CT3A 3H0FA 4IIOA 1YN8A 1FYNA 2NWMA 2KYMA 4A63B 1NYGA 3SHWA 4X1VA 4OMLA 4IIMA 1VYTA 4AG1C 3M0RA 2LZ6B 4F16A 1VA7A 2RQRA 4LN2A 2DX1A 2L3QA 5HCKA 4DEXA 4J9CA 1GRIA 2O9VA 2AK5A 1QKWA 2DNUA 3NPFA 4OMPA 2K6DA 2M0YA 2DILA 4LE9A 3I35A 2A08A 1AZGB 2DM1A 5FW9A 1NG2A 2J05A 1NYFA 4AG2C 4J9IA 1CKAA 4AFUC 4HCKA 2DYBA 1RI9A 1UHFA 2A28A 2ED0A 2DL7A 4JZ3A 5IHNA 2LMJA 1M3CA 3NMZC 3I9QA 1E6GA 2KT8A 2K79A 3C0CA 4CC4B 1X69A 2L0AA 1I0CA 1CSKA 2DE0X 2EBPA 1JQQA 3VS4A 3CQTA 1BBZA 1WXUA 2DL8A 2ROLA 4J9FA 4JJDA 4OMMA 4Z89A 1GCQC 2DVJA 1T0HA 1JO8A 3RNJA 1A0NB 1E7OA 4JZ4A 2F2XA 1H8KA 4K11A 3THKA 1H3HA 3M0TA 3FJ5A 3VS0A 5IXBA 2JMAA 1ZX6A 1MV0B 3EHRA 2HCKA 2L2PA 2C0IA 3VS2A 1J3TA 1WX6A 1ZLMA 1OOTA 2RNAA 2D0NA 4RTZA 4D8DA 2KT1A 1NLPC 5GJWB 3UATA 2AZSA 1HD3A 1YP5A 1JU5C 4D8KA 1XOVA 2HEQA 2KRMA 3EG2A 2EW3A 2LQWA 2ENMA 2CUDA 2LCSA 2KXDA 2GBQA 1PNJA 2E5KA 2ABLA 3M0PA 1SRMA 3EHQA 1CKBA 5IHKA 2LX7A 1SSHA 1X27A 1VYUA 3UA7A 2O9SA 2NUZA 1JXOA 2ESWA 2GGRA 1KJWA 1UJ0A 1NEBA 2RN8A 2EYYA 1ABOA 2X3WD 2J7IA 3EG1A 1YCSB 2BZXA 2H8HA 4HVWA 2CSQA 1UGVA 3ZL7C 4AFSC 2D8JA 2K9GA 2F2VA 1ZUKA 4OMQA 2MOXA 1SEMA 3REAB 2OI3A 3VS1A 1ZSGA 1K9AA 4RTVA 2LJ1A 3VRZA 4F17A 4HXJA 2KGTA 4RTXA 2EGAA 1M27C 3EG3A 1UDLA 2RQTA 2DBMA 2I0NA 1H92A 2VVKA 5IXFA 3REBB 1EFNA 1W1FA 2QDLA 1BU1A 2SRCA 2JMCA 2DF6A 1MV3A 2FPEA 3LH5A 1M3BA 4ORZA 4R0KA 2VKNA 1I07A 1SHGA 2DA9A 1WIEA 2W10A 4RTYA 3A98A 1X43A 1PRMC 2FO0A 2JTEA 2RQWA 2LP5A 1UG1A 1TUCA 2YT6A 2C0OA 4JJBA 3TSZA 2EGEA 2L3SA 2JS2A 3U23A 2FPDA 3I5SA 2FRYA 2G6FX 2J6KA 3M0QA 2CH4A 1OEBA 1X6GA 1LCKA 3NHNA 1B3QA 1JXMA 2EQIA 1GFCA 3UA6A 1SRLA 3M0SA 2GNCA 2LJ3A 4GLMA 1UHCA 2O2OA 2DLPA 2FG0A 2LQNA 1QLYA 2KRSA 3VRYA 1BB9A 1QWEA 2AZVA 1VYVA 2EPDA 2RF0A 1M30A 1X2QA 3ULRB 1PWTA 2W0ZA 3H0IA 2DL3A 4Z88A 2KEAA 1GBQA 1HJDA 1GCQA 2PZ1A 1U5SA 5FWBA 3TSWA 2FPFA 3QWYA 1SHFA 2KR3A 4KRTA 1AZEA 1IO6A 2YUOA 5IHIA 1WDXA 1K76A 1QWFA 2KE9A 2KRNA 4RUGA 1X2KA 1Z9QA 2FRWA 2KROA 4J9EA 1K1ZA 4CC7A 1ZBJA 2MIOA 2RQVA 2EKHA 1AEYA 1M3AA 4ESRA 4RTUA 4J9GA 2LNHB 2CDTA 1ZUUA 1SPKA 2SEMA 1OPLA 1X6BA 2PNIA 1ABQA 4AFZC 1GCPA 3PVLA 1T3LA 1BK2A 2CH4W 1UFFA 2GTJA 2ROTA 2F2WA 3RBBB 1RLPC 2YDLA 3VS5A 2JW4A 1PHTA 1UE9A 2P4RA 2ECZA 2YUNA 5I22A 4OMOA 1NM7A 1WFWA 1HSQA 2AKLA 2IIMA 1U3OA 4WCIA 4J9DA 2OAWA 3EG0A 3NGPA 1AWJA 1GL5A 1WA7A 1B07A 2AKKA 4F14A 4HVUA 3GBQA 1PRLC 4LUDA 2RQUA 5I11A 2RPNA 1AVZC 1V1CA 2DL4A 1TUDA 2D1XA 2J6FA 2X3XD 1WLPB 1UECA 2YUPA 2B86A 4CC2A 3KFVA 1S1NA 1T0JA 2BZYA 4RTWA 2BTTA 2OJ2A 1T3SA 1N5ZA 1E6HA 1AWOA 1Y57A 1U06A 2O88A 2O31A 2BZ8A 1OPKA 1PKTA 2RMOA 4M4ZA 3UF4A 1M8MA 3VS7A 1WXTA 1Y0MA 4DEYA 2GTOA 2V1QA 2ED1A 3H0HA 4Z8AA 1Z9ZA 1UTIA 1ARKA 1GFDA 1AWWA 2KYBA 2CT4A 3PVQA 5IH2A 2A36A 4OMNA 2KBTA 2EYWA 2DRKA 1G2BA 2EGCA 5FWCA 1I1JA 5ECAA 4LNPA 4JJCA 1AD5A 1OV3A 2HBWA 2V1RA 1WI7A 2DMOA 3H41A 4FSSA 4EIKA 2HSPA 2JM9A 2L3PA 4J9BA 2MCNA 4LUEA 1AOJA 2GQIA 4CC3A 2EVRA 1JEGA 1K4US 3VS6A 2KNBB 1NLOC 1TG0A 1RLQC 4RTTA 1KFZA 1YWOA 1W70A 2CREA 1UJYA 1WXBA 2D8HA 2XMFA 1GBRA 2J06A 2K3BA 3EGUA 2VWFA 2CSIA 2JXBA 3QWXX 2DL5A 2K2MA 2EYXA 1G83A 4GBQA 5GJVB 1UUEA 2J6OA 2M51A 4Y92A 1FMKA 1RUWA 2EYZA 3I5RA 3PE0A 1NEGA 2KXCA 2PTKA 2JM8A 1AWXA 2JT4A 1QKXA 3TVTA 4JPBW 4QT7A 1ZUYA 2DBKA 5EC7A 1MUZA 2DJQA 4J9HA 1YWPA
chains in the Genus database with same CATH superfamily
3INZA 4GY5A 4A4HA 2C0TA 1VIEA 1VQ8T 1SKUB 3IQLA 4HCZA 2PVGB 1TSFA 4YTLA 1YFNA 3HTRA 1BCMA 2FEIA 1IGUA 2D9TA 2KMTA 1KSWA 4UC4A 4XTZA 2HSEB 4LDXA 2FB7A 3R6NA 4A4FA 1YNZA 1X6OA 4OVAA 1YN8A 1VOMA 2NWMA 1S72A 1NZ9A 4A63B 1Q81C 1NYGA 2M0OA 2ZPHB 4BY6B 4X1VA 4ZN1A 5HK0A 5I2SA 2DXBA 3ASKA 5HK3A 4X9CA 1H641 3WVDB 4J7IA 2RQRA 4LN2A 1KC8U 2DX1A 1K8AC 2LNVA 2IG0A 2CYZB 5GAN2 2O9VA 4QQDA 1K73R 2AK5A 1H3ZA 2DNUA 1QVGS 3NPFA 2K6DA 3EFRA 2DM1A 1NG2A 4M77G 4AG2C 2GQVA 2DPPB 5DLOA 1KK7A 1TTHB 2P0QA 2JNGA 2CZ0B 4XK8E 1NBEB 2KT8A 3C0CA 4CC4B 1D09B 1VQKA 1V29B 1CSKA 3CCQQ 4OB1B 1BBZA 2DL8A 2ROLA 4J9FA 3WVEB 3ZBDA 2PVDB 3QJ6A 3CPWA 1VQ5T 1JO8A 2EQMA 1E7OA 3RMSA 3OYFA 2E41A 1VQNQ 5CCAA 2RK1A 5IXBA 4KUDK 3A1PA 5GANh 3MKDA 2JTMA 1ZX6A 2DK3A 4N4IA 4B9XA 1OZ3A 3I56Q 1BIAA 1MV0B 2AHJB 2HCKA 2C0IA 2L2PA 3VS2A 1XNIA 1Y71A 2D0NA 2E70A 5D6WA 4D8DA 3EGDB 1HD3A 4LDWA 1YP5A 1JU5C 4M7AE 4PJOA 2EW3A 4F7UE 2CP2A 2ENMA 4QVCA 2F1LA 4M75D 2GBQA 1PNJA 1SRMA 1C6VX 3RESA 3CCSA 4X9DA 1SSHA 1X27A 1VYUA 1AT1B 2NUZA 4ZTJA 4PJMA 2QI2A 2ESWA 5GAMd 1UJ0A 2EYYA 4JUVA 3QDFA 2DAQA 3EG1A 4C8QA 2FVUA 2QASA 3VU3C 4OMQA 4C5HA 3E9FA 3REAB 3OS1A 3VS1A 4KGXB 2OTLA 4C0DC 1YITT 2LJ1A 1Y96B 2FYKA 1PD1A 3Q1JA 5GMKj 4RTXA 2M02A 5GAOl 3SB2A 2LQKA 1K9MU 1BI2A 5IXFA 4E7SA 1EFNA 3CCET 3LH5A 2BUDA 3C12A 4KT0E 2H3JA 3OMCA 4R0KA 1OI1A 3V7SA 1K73C 4FIBA 5CK9A 4RTYA 2AIRB 3A8GB 3OSSC 3CMEQ 4ZTFA 1UG1A 1VQ8A 2L89A 3EAEA 2C0OA 2DD4A 1PG5B 4OB2B 2OTJT 2J6KA 3HL8A 3M0QA 3QSUA 1X6GA 4FT4A 3HKSA 1LVKA 2HKNA 3NHNA 2AT1B 2KSSA 3VYHB 4GLMA 4XTYA 2YXYA 3A8OB 2KRSA 1VIFA 1NE8A 3VRYA 2QXFA 3RKXA 2AZVA 1VYVA 2XI9A 3EG9B 4OP0A 1X2QA 3H0IA 1VQPQ 4HT9A 3HFNA 5FWBA 3QWYA 1QVFA 3URGA 1JJ2S 2K5FA 4M75B 4KRTA 3JCMX 1IO6A 1I4K1 3JCMe 2KE9A 1X2KA 2RM4A 5GAMj 4BDZA 2FRWA 3C95A 4J9EA 4CC7A 1ZBJA 3LWIA 2L5QA 4JRQA 1AEYA 1WQ7A 4ME7A 2VV5A 4J9GA 1ACMB 4IKFA 4JDSA 4Y91A 1SPKA 2A7YA 1TU0B 2D6FA 4XTVA 1JRIA 1FXXA 2PU9B 4M78F 3RBBB 2X4YA 2RA2A 4J5YA 5GMKm 1VQ5A 2DIGA 3UWNA 2NLUA 3CEYA 1UGRB 1O75A 2QA4Q 2CZ1B 3OB9A 3VYGA 1U3OA 4WCIA 2OAWA 4BI4A 1AWJA 3QIIA 3OYNA 4JJNK 3CMAQ 1KQSP 4ZN3A 4HVUA 1PRLC 4ZGEB 1R8OB 1M5Q1 4IUQA 3A8HB 1QMCA 3MEAA 2DETA 1V1CA 2C06A 1UB4A 3OYGA 2X3XD 3OYCA 2YUPA 5LJ5h 3CCQT 2NUTA 2XD0A 4PJOF 3PMIA 2DXCA 4RTWA 2HQEA 2BTTA 1ZSZA 1E6HA 2ZGWA 3OYEA 2RMOA 1VQNT 1KC8R 1B34B 2WACA 2YLBA 2FZGB 4LDUA 3I56T 4M78D 2V1QA 5LJ3e 4M7AF 1R77A 1Z9ZA 2LCLA 2ZPFB 2MYSA 4HKEA 3WXMB 4M7DA 2OX7A 4RKUE 2A36A 2KBTA 2XG8D 3TCJA 3CD6Q 1NPPA 5D6XA 5FWCA 3M54A 5EG2A 3HRUA 2EJGA 1OV3A 3H41A 2OAUA 4KH1B 1SSFA 4JS4A 2MCNA 2P4TA 3GNGA 4LUEA 1AOJA 3P8BB 2X4XA 3CCEA 4BD3A 4CC3A 1JEGA 4J6YA 4PJOD 3G4SQ 4LDYA 1MGQA 2R57A 1YWOA 2F69A 2RD1A 3FLGA 2DZ9A 2D8HA 2XMFA 5GAN3 4OF1A 2RHIA 3EGUA 2B8AA 2VWFA 3LLRA 4XU2A 3L2UA 1JB0E 2JXBA 2RI2A 3OS5A 1M90R 2MWPA 2IVWA 3NTHA 2FHDA 2XU8A 4C8QD 2EYZA 5GMKh 3X24B 3R6OA 3KUFA 2QAZA 2K2VA 1LPLA 3JB9I 1U1TA 1LNXA 2K5IA 3OYMA 2DJQA 3JCMV 1RI0A 5I21A 3VV0A 2DRMA 3EGXA 3CCUQ 1OU8A 3QYGB 3CMET 1BI3A 3OS0A 4BE0A 1K0XA 3MP1A 1WHLA 1KIKA 1QVGA 3OW2S 3P8DA 2K7AA 6AT1B 2QQRA 2YUQA 2A37A 3O5ZA 2BKDN 3OYYA 4M77E 2DFUA 4DBRA 2HBPA 5IAYA 4M78B 2GCXA 2KYMA 2BIVA 4RG8A 4OMLA 3VUBA 3NFCA 1K9MR 4FCYA 4DBHA 3PMTA 4AG1C 1MMAA 2JTFA 3S3MA 4DQ2A 3HPWA 1KC8C 1VA7A 2JOYA 1VQPT 3C94A 5GAOp 2LX9A 1GRIA 2XK0A 3JCMP 1Q82R 2QK0A 1QKWA 1BKBA 4QVDA 4OMPA 2M0YA 2EAYA 4ELZC 2A08A 4F04B 2J05A 4J9IA 1CKAA 3RIRA 2CGHA 5GAMh 4C5EA 4FM4B 4BDYA 3A5ZB 4GLKA 4JZ3A 5D7UA 5IHNA 4PJOB 4NL2A 1M3CA 1YJ9Q 2NYSA 4XTUA 2K79A 2COZA 1X69A 2DE0X 2WSFE 5KYYB 3VS4A 1WXUA 4LXCA 3OYIA 4OMMA 2RHZA 4L5GA 1B34A 1T0HA 2QQBA 3CCQA 1A0NB 1H8KA 3THKA 3M0TA 5HKCA 1Q7YU 1D0YA 1D0XA 4B9WA 4A54A 3EHRA 4C8QB 2QA4T 1OOTA 2RNAA 2X9HA 3I56A 5GJWB 2E5QA 3CMAT 3TU4K 1W2BS 2XICA 3CCMQ 2ZCFB 1M90C 5D6YA 3SD4A 2DKGA 5KCHA 2MMPA 3CBOA 2LCSA 2DIQA 2E5KA 2ABLA 4M7DF 5CQYA 4C5GA 1CKBA 1BYMA 2LX7A 3BY7A 1IRXA 4E7LA 3UA7A 2P0PA 4M75C 3DLMA 1PD0A 1N8RU 1KJWA 4C92F 4BE1A 1M2OA 1ABOA 2J7IA 4XU0A 2QGFB 1WHJA 1YIJQ 2BZXA 1IB8A 2H8HA 4E7KA 1UGVA 1SG5A 2D8JA 1W4SA 1ZUKA 2O4XB 4E2FB 1ZA1B 3ME9A 4RTVA 4OB0B 1G3SA 4M77C 4F17A 5GAMe 3CBMA 3PT9A 5C0MA 4N0AC 2YHTA 2ZAEA 3CD6T 2KGTA 3MCAB 3CCVQ 2EGAA 4M75G 1M27C 1IZ6A 1K9MC 3JCMc 2DBMA 2I0NA 1H92A 5FU7C 5KYWA 4IUPA 3REBB 2SRCA 1BU1A 2QG9B 3P8HA 1TOVA 3ER0A 2DF6A 5CAIA 4ORZA 4E7JA 5J3BA 4M7DD 3X20B 1Q82C 1SHGA 3G1JA 3GIBA 2FZKB 1R0CB 2W10A 3G4ST 5AYFA 2RJDA 3A98A 4CRIA 2JTEA 5KYXB 2RQWA 1RAIB 5CQXA 1M8VA 3BW1A 4C92D 2PQWA 1TUCA 2GFAA 4TVRA 4NS5A 1KQSS 1YJNQ 3LH0A 2GF7A 2L3SA 2JS2A 3CMEA 2FPDA 4M78A 1U8RA 3GNFB 5LJ5j 2LC4A 2YRVA 3FDRA 1WNLA 4P5NA 1GFCA 3DLLA 1SRLA 2GNCA 2LJ3A 1UHCA 4Y28E 3OYAA 3G6EQ 4CI0C 1QLYA 3EFSA 3MEVA 5KYNA 2RF0A 1WQWA 2XKOC 1PWTA 3MP6A 4XTXA 3A8LB 3QHSA 2K5LA 4Z88A 8AT1B 1M1KU 1GCQA 1VQMQ 2L8DA 4PJJA 3TSWA 2YRCA 1VQPA 1YHQQ 2KR3A 3SWNC 3CCUT 2DVEA 2BE7D 2QQAA 1QVFP 1K76A 2KRNA 2EWNA 3CCLQ 1OULA 1WHHA 1I81A 3QDRB 3JB9H 2RQVA 3AT1B 1RADB 4EMKC 1D1CA 4L6V5 1M2VB 3RDVA 5KYYA 2CDTA 4E7IA 1ABQA 2NUTB 1BK2A 3HFOA 2CH4W 4M7AA 1HYOA 1QVPA 1QW1A 1RLPC 2YDLA 1ZSZB 1Q95G 1WJRA 1G8XA 2ECZA 2YUNA 3JB9F 2Z0WA 2ZPBB 4OMOA 1NM7A 1VQ4Q 3JCMg 1HSQA 2AKLA 3L2QA 1VQ9Q 4EMGA 3QJYA 3NGPA 3PIPA 1WA7A 3ZFJA 5CKHA 1QP3A 1EIFA 2PVOB 2QA4A 4VUBA 3H8ZA 3V8KA 3V8JA 3GLXA 3CMAA 4M7DB 1AVZC 3LGLA 2DL4A 3L2ZA 1YJ9T 3OSVA 4PFOA 3JCMf 2MPXC 4XQ3A 1XQHA 2P84A 4C92B 1S1NA 2R5MA 2BZYA 5CKDA 3J80E 4KGVB 2OJ2A 1T3SA 1N5ZA 4II1A 2O88A 5GANe 1PKTA 3UF4A 3UDCA 2O4XA 3VS7A 4ELYC 3EH2A 1Y0MA 5GAOm 2GTOA 1M9SA 2DO3A 3JB9D 3H0HA 1UTIA 1GFDA 4DBFA 4XU1A 4AMCA 2KYBA 3PVQA 5IH2A 2ZPGB 2EYWA 3OYJA 1XJWB 2DRKA 1BIBA 1QQJA 4MDXA 3OYKA 1V76A 2X4WA 1I1JA 3TREA 2E65A 4JRIA 4JJCA 3CD6A 2V1RA 1WI7A 1RAEB 2HD0A 4KUIA 4EIKA 2HSPA 4J9BA 1OQKA 4BI8B 3V7RA 5KYXA 2GQIA 2KDSA 2EVRA 1Q7YR 4M78G 3CXCS 1IXDA 5LJ3g 1YIJT 3EGXB 3OYBA 1NLOC 3A8MB 3FEOA 4A53A 4RTTA 3VKIA 3G4SA 2A0FB 1GBRA 2J06A 5CIUA 3OW2A 1OU9A 3QWXX 2K2MA 2IPOB 5GJVB 1UUEA 3CC4Q 5LJ3f 3CCVT 2EYQA 1G3YA 3PE0A 1PM3A 8ATCB 2CP0A 3M58A 2JT4A 4X34A 1QKXA 3E1SA 2R58A 1I8FA 2I2LA 4C8QC 3CPWS 4QT7A 2CS7A 2DBKA 1RAHB 4J9HA 1YWPA 1N8RR 2HDAA 4PJOG 2LJ0A 4EMHA 3JAME 2VYTA 3SEMA 2YSQA 1RAAB 3VS3A 1Y07A 3JV3A 3S3NA 5GAOn 1W6XA 4KH0B 5DM7R 5HY6A 1WYXA 3DB3A 1PKSA 3M53A 4RCCA 1QCFA 1YJNT 4MZTA 3CCUA 1M2VA 1QVGP 2DTIA 3CPFA 4FYWB 3L1AA 5FU6C 2CT3A 3MEUA 4IIOA 2XHCA 1G3WA 5KCOA 4C8QG 4FW1A 1N9SA 1BI1A 1YJWQ 4IIMA 3G6ET 1YI2Q 1VYTA 2COWA 2LZ6B 4J8OA 3RR6A 4F16A 3X28B 1AHJB 2L3QA 5HCKA 4DEXA 4J9CA 2KAFA 1VQMT 1RACB 1FX7A 3HSBA 3G71Q 1YHQT 2L3RA 5A2QE 3E2UA 3KBGA 4F7UF 3HHTB 2JN0A 2DILA 4XU3A 1K73U 2Y90A 3I35A 4QW2A 3CCLT 4BY6C 1AZGB 5FW9A 2RO0A 1HK9A 1NYFA 2DERA 2H3EB 4AFUC 1YITA 1TH7A 4O5VA 4HCKA 4PFPA 2D0QB 2DYBA 1W2BA 1JBMA 1OYXA 4DBQA 2ATCB 4C92A 5FROA 1VQ7Q 3NMZC 4BACA 1E6GA 1WJSA 2L0AA 3LGFA 1YJ9A 3CQTA 4Z89A 4FYVB 4LD9K 3JCMJ 3QZ5B 5GMKi 2JZ2A 3JCMd 2DVJA 4HA8A 3GP8A 3RNJA 2E6NA 1M1GA 2E3IA 1Q7YC 2F2XA 4RCBA 4K11A 2WSCE 1H3HA 2CP5A 1P92A 3KXTA 1D1AA 2F5KA 2EFIA 1ZHIA 3FJ5A 3VS0A 1M1KR 2JMAA 1PSEA 2QEXQ 1VQ4T 1B7TA 2EQUA 2O01E 2KK4A 1PCXA 2RJEA 1VQ9T 4RTZA 4J83A 4OGEA 2KT1A 5KE2A 4FYYB 3JCMW 4M7AD 3QUIA 3EH1A 4MMKA 4D8KA 1XOVA 2HEQA 2X51A 5AT1B 2OTJA 3EG2A 3JCMb 3CC2Q 4RG2A 2LQWA 5LJ5e 3BDLA 2CUDA 4BI3A 2KXDA 3M0PA 5LL6S 5KYWB 3CCJQ 4M75E 2O9SA 2ZPEB 1N8RC 4QKUA 1Q86U 5GAN6 2RN8A 1X01A 4FU6A 3HRTA 2DJZA 4A4EA 5FLXE 1YCSB 1MNDA 4EPCA 3PNWC 2CP7A 3ZL7C 4J6XA 1VQOQ 4AFSC 1BI0A 2F2VA 2XDDA 5J39A 3FRNA 1SEMA 3LW5E 4FW2A 3PIOA 2OI3A 2NUPA 2DTHA 4HXJA 4E47A 3O8VA 2EQJA 2RJCA 2FL7A 3BDUA 1UDLA 2RQTA 2VVKA 2QQSA 1MMGA 3CCVA 4M77A 4HCCA 2HL3A 5LJ3d 1D3BA 2DTOA 4N0AA 3M4YA 2HKQB 2RK2A 2RH2A 2VKNA 1I07A 2DA9A 5DLQE 3QXEB 4EDUA 1X43A 2QGGA 2FO0A 2RB6A 1JJ2P 5GAMg 3M9QA 3U23A 4C0FA 1YJNA 2G6FX 1OEBA 2K4YA 3PFSA 1LCKA 5IN1A 1JXMA 5GMKe 3PGGA 3CC4T 1WHGA 3M0SA 2K57A 3NTKA 2DEQA 2A3LA 4L59A 5DY9A 2DLPA 2LQNA 4PL6A 1VQ6Q 2VXEA 1MHNA 4M7AB 1BB9A 1IHVA 2HQHA 1QWEA 1WGSA 2EPDA 5GAMf 5GAN8 3ULRB 3G6EA 1M1KC 4F7UB 4M7DG 3OYDA 3MP8A 1VQNA 2MK5A 1HJDA 2FPFA 3I55Q 4FSXA 4ATOA 4C92G 2YUOA 3E19A 1WDXA 4RUGA 1QWFA 3QYHB 4Z02A 1VQMA 2JUFA 1WHMA 2PUOB 2KROA 4C5IA 1YHQA 5A0DA 3X26B 3TEEA 1NJIU 4QVZA 3CCLA 3CCRQ 3FIFA 3H9NA 4ESRA 3SWNA 4RTUA 3ZEHA 2HMAA 3DKMA 4PLLA 4V2SA 1I5OB 1ZUUA 2SEMA 2M9UA 2PNIA 1OZ2A 2QDYB 4AFZC 1GCPA 1YJWT 1T3LA 3BE3A 3M56A 2V8JA 5GAN4 2LT4A 3MO8A 1YI2T 1UFFA 2GTJA 2ROTA 4EMKA 1VQLQ 1PSFA 3M59A 3HP9A 2P4RA 1WJQA 3META 5KYUA 2DXUA 1WFWA 4E7HA 3LYIA 3G71T 2IIMA 5LJ3j 1GL5A 1N27A 1FMWA 3EG0A 1VQ4A 1OX8A 3J81E 4PK4A 1VQ9A 4ZGDB 2E4HA 2V26A 5FRMA 1KHCA 4PLIA 2RI3A 5I11A 2HL5C 2D1XA 3V8LA 1VQ7T 3EFOA 2J6FA 5GAN7 3RERA 3QZ9B 2XDBA 1WLPB 1UECA 2RI5A 4BB7A 3KFVA 5FRNA 1Y57A 1U06A 2R5AA 1F1BB 2K3YA 3GF5A 3MJXA 1UGQB 5J26A 1O9SA 2QEXT 1WXTA 1JJ2A 1N9RA 3QKJA 2RJFA 3CXCA 3MPUB 4M78E 3QO3A 1IHWA 2E3HA 4QQ6A 2RHXA 1C0MA 3E9GA 2E10A 4J6WA 3OMGA 1VUBA 1N6AA 4R55A 4M75F 3CC2T 3OYLA 3CC7Q 2EGCA 1UGSB 2X4JA 2MWOA 1M4ZA 5ECAA 4LNPA 3CCJT 3F70A 2DMOA 5GANg 1KD1U 4FSSA 2LVMA 1KG1A 2CZ7B 3MHXA 2JM9A 2Y4XA 2QTXA 2JJ9A 2Y4YA 3JRZA 7AT1B 3M5AA 4M77F 4PJOE 3VS6A 2KNBB 1LJOA 3JB9G 1VQOT 1G5VA 5L8RE 1KFZA 1W70A 2CREA 1UJYA 2E12A 2EJFA 1TXQA 4OGCA 5M9OA 5GANf 2CSIA 1TWBA 3LWHA 3SDZA 3OW2P 3S6WA 4GBQA 2CZ6B 1IREB 1M90U 1FMKA 1NEGA 4C8QE 4MDWA 2KXCA 4F7UA 2PTKA 2YWWA 3CC4A 1RAFB 4J7FA 2QYZA 5I2MA 2HAXA 1ZUYA 2VUBA 5EC7A 1Q86R 1MUZA 3PTAA 3OBYA 1WIEA 2CUBA 4KGZB 3RKWA 4IURA 2JS0A 3M0UA 5L23A 2EJ9A 4ZNXA 4E7ZA 1M1FA 1X75C 1K0SA 5CVIA 1QCNA 2COYA 3JCMh 4PNOA 9ATCB 3GPLA 4M77D 3L42A 4HVVA 2LT1A 4E6RA 4MZMA 1S72Q 2X35A 4AFQC 3H0FA 2K3XA 1FYNA 3SHWA 2CP3A 1Q81U 4ANJA 1VQ6T 3M0RA 4NOYA 3JCMQ 1YJWA 1FWZA 1YI2A 3AHUA 1TUGB 2QQ9A 2VASA 4OMFB 4C0GA 3JSCA 1K8AU 5C6SA 3I55T 3OY9A 4HCBA 4DOWA 2LCCA 4JRKA 4M78C 3VJPA 3CCMT 4LE9A 1Q82U 3BFMA 3QG1A 3G71A 3CBPA 4O6JA 3L2WA 1RL2A 2XIDA 1RI9A 1UHFA 2A28A 3CCRT 1VQKQ 2ED0A 2DL7A 2LMJA 1W2BP 3I9QA 3RMQA 1UGPB 1HXDA 1I0CA 2EBPA 1Y7XA 1JQQA 5A0LA 1VQ7A 4JJDA 4HT8A 2HZYA 1D1BA 4MZPA 2M16A 1NPRA 4LD6A 1GCQC 1VQLT 4JZ4A 1XTDA 1KQ2A 3SFMA 4B6MA 5CKFA 4PJOC 1J3TA 1WX6A 1ZLMA 4DA4A 5KE3A 1LOJA 2QEXA 1NLPC 3UATA 2AZSA 4NL3A 5LJ3h 1R0BG 3HRSA 2EKOA 2NUPB 1C1AA 3UPUA 1NJIR 3JB9J 2KRMA 3OBWA 5GMKl 1D0ZA 3N5BB 4M7AC 3CCSQ 3CC2A 4MMLA 3EHQA 2WSEE 5IHKA 2MAMA 4M77B 1Q86C 4DOVA 4IUVA 1D3BB 4A4GA 1JXOA 4FT2A 3RUXA 2GGRA 3CCJA 1NEBA 2E64A 4IUTA 5IT9E 4LDVA 2X3WD 5FU7B 1DJ7B 4N4HA 2JVVA 2LTOA 4HVWA 1KHIA 2CSQA 2OTLQ 1KQ1A 2K9GA 3EGDA 3OYHA 2MOXA 4M7AG 1SF9A 1ZSGA 4N4GA 1K9AA 1PC0A 4AT1B 1VQOA 4F7UG 3VRZA 1IGQA 5LJ5g 4OB3B 5GANd 3G7ZA 3UT1A 4FYXB 3CC7T 2DD5A 3EG3A 2F5TX 1W1FA 2QDLA 3FC3A 2JMCA 1MV3A 3L2RA 2FPEA 1M3BA 2XDPA 2V8KA 5LJ5f 1BCOA 2P0KA 1VQ8Q 4M7DE 2QTVA 1RABB 1PRMC 2HQXA 2LP5A 3OQ5A 2YT6A 4JJBA 4C92E 2MF2A 3TSZA 2EGEA 1G3TA 4XAXB 1Y96A 3I5SA 2M1HA 4C0ZA 4BE2A 2FRYA 2CH4A 4RMOA 3SWNB 4C8QF 1B3QA 4QQGA 2EQIA 3UA6A 3LX7A 2EQKA 3QPHA 2O2OA 2FG0A 2KI7A 1KD1R 3C4SA 4EMKB 1M30A 2EIFA 2W0ZA 1MMDA 1VQ6A 2DL3A 2ZPIB 2KEAA 1GBQA 2PZ1A 5KYUB 1U5SA 3FB9A 4JLGA 1SHFA 2RHUA 4IUUA 5GAOr 1AZEA 5IHIA 5CKEA 2G3RA 1MMNA 3I55A 1Z9QA 2E1HA 2LDMA 1NJIC 1K1ZA 3CCMA 3VUZA 2FZCB 2LRQA 2MIOA 3GOXA 1S72T 4FL6A 2EKHA 1ZQ1A 1M3AA 3H6ZA 2LNHB 4C0DB 3EFOB 1EZZB 3CCRA 2KVQG 2YLCA 1OPLA 1X6BA 3V7CA 1OX9A 1ZA2B 3PVLA 3X25B 4KBMB 5GAOq 3EG9A 2HNIA 2ZZDA 1VQ5Q 2F2WA 3M55A 3D7SB 5GANj 2LQ8A 3VS5A 2JW4A 1PHTA 1UE9A 3QBYA 1QVFS 5I22A 1VQLA 2DXTA 1YIJA 4M75A 3OS2A 3T9NA 4J9DA 5KH6A 1WHKA 1KQSA 1B07A 4PKCC 2AKKA 1U1SA 4F14A 3GBQA 4JLIA 4LUDA 2RQUA 3TQ7P 2VXFA 4JRPA 1VQKT 2RPNA 2VC8A 4JS5A 1TUDA 1ZSZC 1I5LA 5GAN5 4Q5WA 4R56A 1GXIE 2B86A 1Q81R 4CC2A 5CKBA 1T0JA 1UEBA 3DB4A 1AWOA 4XTWA 3M57A 2O31A 4BUGA 2BZ8A 1OPKA 4M4ZA 1M8MA 5A0GA 4M7DC 1K8AR 4DEYA 4ZGJB 1MNEA 3CXCP 2ED1A 4Z8AA 4C92C 1ARKA 3NTIA 1YITQ 1YCYA 2CP6A 1AWWA 3FJPA 2CT4A 2DZCA 4OMNA 3J7AF 1TS9A 1G2BA 4KULA 1RAGB 3CCST 1QCOA 2MI6A 2GFUA 2YRDA 2RHYA 1KD1C 1AD5A 2HBWA 2V8IA 3CCEQ 3CC7A 2CKKA 2L3PA 4WF2A 1WZOA 2DYIA 2KQWA 3CPWP 1K4US 1EX4A 3RKYA 3OA6A 3M4GA 1TG0A 1WPYA 1RLQC 2BE9B 5LJ5d 2OTLT 2VB6A 3S3OA 5CR2A 1WXBA 2K3BA 2VGMA 1ZBXA 2OTJQ 4D6WA 2DL5A 2EYXA 1G83A 2VGNA 2DEUA 2J6OA 2M51A 4PJNA 4Y92A 1RUWA 3I5RA 1FMVA 4PJLA 3MEWA 5CO7A 2E6ZA 4WTOB 2JM8A 2PUKB 1AWXA 4PFZA 3L2VA 2KY9A 3TVTA 1QP2A 4JPBW 5FU6B 4A4KA 1YBYA
chains in the Genus database with same CATH topology
2HDAA 2LJ0A 2CUBA 2C0TA 3SEMA 2YSQA 2JS0A 3M0UA 2DRMA 3VS3A 3JV3A 3IQLA 5L23A 1W6XA 4ZNXA 1WYXA 1K0SA 1K0XA 1PKSA 1KIKA 2FEIA 1QCFA 1KSWA 2K7AA 3R6NA 4HVVA 2YUQA 2A37A 3O5ZA 4E6RA 1YNZA 4AFQC 2CT3A 3H0FA 4IIOA 1YN8A 1FYNA 2NWMA 2KYMA 4A63B 1NYGA 3SHWA 4X1VA 4OMLA 4IIMA 1VYTA 4AG1C 3M0RA 2LZ6B 4F16A 1VA7A 2RQRA 4LN2A 2DX1A 2L3QA 5HCKA 4DEXA 4J9CA 1GRIA 2O9VA 2AK5A 1QKWA 2DNUA 3NPFA 4OMPA 2K6DA 2M0YA 2DILA 4LE9A 3I35A 2A08A 1AZGB 2DM1A 5FW9A 1NG2A 2J05A 1NYFA 4AG2C 4J9IA 1CKAA 4AFUC 4HCKA 2DYBA 1RI9A 1UHFA 2A28A 2ED0A 2DL7A 4JZ3A 5IHNA 2LMJA 1M3CA 3NMZC 3I9QA 1E6GA 2KT8A 2K79A 3C0CA 4CC4B 1X69A 2L0AA 1I0CA 1CSKA 2DE0X 2EBPA 1JQQA 3VS4A 3CQTA 1BBZA 1WXUA 2DL8A 2ROLA 4J9FA 4JJDA 4OMMA 4Z89A 1GCQC 2DVJA 1T0HA 1JO8A 3RNJA 1A0NB 1E7OA 4JZ4A 2F2XA 1H8KA 4K11A 3THKA 1H3HA 3M0TA 3FJ5A 3VS0A 5IXBA 2JMAA 1ZX6A 1MV0B 3EHRA 2HCKA 2L2PA 2C0IA 3VS2A 1J3TA 1WX6A 1ZLMA 1OOTA 2RNAA 2D0NA 4RTZA 4D8DA 2KT1A 1NLPC 5GJWB 3UATA 2AZSA 1HD3A 1YP5A 1JU5C 4D8KA 1XOVA 2HEQA 2KRMA 3EG2A 2EW3A 2LQWA 2ENMA 2CUDA 2LCSA 2KXDA 2GBQA 1PNJA 2E5KA 2ABLA 3M0PA 1SRMA 3EHQA 1CKBA 5IHKA 2LX7A 1SSHA 1X27A 1VYUA 3UA7A 2O9SA 2NUZA 1JXOA 2ESWA 2GGRA 1KJWA 1UJ0A 1NEBA 2RN8A 2EYYA 1ABOA 2X3WD 2J7IA 3EG1A 1YCSB 2BZXA 2H8HA 4HVWA 2CSQA 1UGVA 3ZL7C 4AFSC 2D8JA 2K9GA 2F2VA 1ZUKA 4OMQA 2MOXA 1SEMA 3REAB 2OI3A 3VS1A 1ZSGA 1K9AA 4RTVA 2LJ1A 3VRZA 4F17A 4HXJA 2KGTA 4RTXA 2EGAA 1M27C 3EG3A 1UDLA 2RQTA 2DBMA 2I0NA 1H92A 2VVKA 5IXFA 3REBB 1EFNA 1W1FA 2QDLA 1BU1A 2SRCA 2JMCA 2DF6A 1MV3A 2FPEA 3LH5A 1M3BA 4ORZA 4R0KA 2VKNA 1I07A 1SHGA 2DA9A 1WIEA 2W10A 4RTYA 3A98A 1X43A 1PRMC 2FO0A 2JTEA 2RQWA 2LP5A 1UG1A 1TUCA 2YT6A 2C0OA 4JJBA 3TSZA 2EGEA 2L3SA 2JS2A 3U23A 2FPDA 3I5SA 2FRYA 2G6FX 2J6KA 3M0QA 2CH4A 1OEBA 1X6GA 1LCKA 3NHNA 1B3QA 1JXMA 2EQIA 1GFCA 3UA6A 1SRLA 3M0SA 2GNCA 2LJ3A 4GLMA 1UHCA 2O2OA 2DLPA 2FG0A 2LQNA 1QLYA 2KRSA 3VRYA 1BB9A 1QWEA 2AZVA 1VYVA 2EPDA 2RF0A 1M30A 1X2QA 3ULRB 1PWTA 2W0ZA 3H0IA 2DL3A 4Z88A 2KEAA 1GBQA 1HJDA 1GCQA 2PZ1A 1U5SA 5FWBA 3TSWA 2FPFA 3QWYA 1SHFA 2KR3A 4KRTA 1AZEA 1IO6A 2YUOA 5IHIA 1WDXA 1K76A 1QWFA 2KE9A 2KRNA 4RUGA 1X2KA 1Z9QA 2FRWA 2KROA 4J9EA 1K1ZA 4CC7A 1ZBJA 2MIOA 2RQVA 2EKHA 1AEYA 1M3AA 4ESRA 4RTUA 4J9GA 2LNHB 2CDTA 1ZUUA 1SPKA 2SEMA 1OPLA 1X6BA 2PNIA 1ABQA 4AFZC 1GCPA 3PVLA 1T3LA 1BK2A 2CH4W 1UFFA 2GTJA 2ROTA 2F2WA 3RBBB 1RLPC 2YDLA 3VS5A 2JW4A 1PHTA 1UE9A 2P4RA 2ECZA 2YUNA 5I22A 4OMOA 1NM7A 1WFWA 1HSQA 2AKLA 2IIMA 1U3OA 4WCIA 4J9DA 2OAWA 3EG0A 3NGPA 1AWJA 1GL5A 1WA7A 1B07A 2AKKA 4F14A 4HVUA 3GBQA 1PRLC 4LUDA 2RQUA 5I11A 2RPNA 1AVZC 1V1CA 2DL4A 1TUDA 2D1XA 2J6FA 2X3XD 1WLPB 1UECA 2YUPA 2B86A 4CC2A 3KFVA 1S1NA 1T0JA 2BZYA 4RTWA 2BTTA 2OJ2A 1T3SA 1N5ZA 1E6HA 1AWOA 1Y57A 1U06A 2O88A 2O31A 2BZ8A 1OPKA 1PKTA 2RMOA 4M4ZA 3UF4A 1M8MA 3VS7A 1WXTA 1Y0MA 4DEYA 2GTOA 2V1QA 2ED1A 3H0HA 4Z8AA 1Z9ZA 1UTIA 1ARKA 1GFDA 1AWWA 2KYBA 2CT4A 3PVQA 5IH2A 2A36A 4OMNA 2KBTA 2EYWA 2DRKA 1G2BA 2EGCA 5FWCA 1I1JA 5ECAA 4LNPA 4JJCA 1AD5A 1OV3A 2HBWA 2V1RA 1WI7A 2DMOA 3H41A 4FSSA 4EIKA 2HSPA 2JM9A 2L3PA 4J9BA 2MCNA 4LUEA 1AOJA 2GQIA 4CC3A 2EVRA 1JEGA 1K4US 3VS6A 2KNBB 1NLOC 1TG0A 1RLQC 4RTTA 1KFZA 1YWOA 1W70A 2CREA 1UJYA 1WXBA 2D8HA 2XMFA 1GBRA 2J06A 2K3BA 3EGUA 2VWFA 2CSIA 2JXBA 3QWXX 2DL5A 2K2MA 2EYXA 1G83A 4GBQA 5GJVB 1UUEA 2J6OA 2M51A 4Y92A 1FMKA 1RUWA 2EYZA 3I5RA 3PE0A 1NEGA 2KXCA 2PTKA 2JM8A 1AWXA 2JT4A 1QKXA 3TVTA 4JPBW 4QT7A 1ZUYA 2DBKA 5EC7A 1MUZA 2DJQA 4J9HA 1YWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDA A;  2LJ0 A;  2CUB A;  2C0T A;  3SEM A;  2YSQ A;  2JS0 A;  3M0U A;  2DRM A;  3VS3 A;  3JV3 A;  3IQL A;  5L23 A;  1W6X A;  4ZNX A;  1WYX A;  1K0S A;  1K0X A;  1PKS A;  1KIK A;  2FEI A;  1QCF A;  1KSW A;  2K7A A;  3R6N A;  4HVV A;  2YUQ A;  2A37 A;  3O5Z A;  4E6R A;  1YNZ A;  4AFQ C;  2CT3 A;  3H0F A;  4IIO A;  1YN8 A;  1FYN A;  2NWM A;  2KYM A;  4A63 B;  1NYG A;  3SHW A;  4X1V A;  4OML A;  4IIM A;  1VYT A;  4AG1 C;  3M0R A;  2LZ6 B;  4F16 A;  1VA7 A;  2RQR A;  4LN2 A;  2DX1 A;  2L3Q A;  5HCK A;  4DEX A;  4J9C A;  1GRI A;  2O9V A;  2AK5 A;  1QKW A;  2DNU A;  3NPF A;  4OMP A;  2K6D A;  2M0Y A;  2DIL A;  4LE9 A;  3I35 A;  2A08 A;  1AZG B;  2DM1 A;  5FW9 A;  1NG2 A;  2J05 A;  1NYF A;  4AG2 C;  4J9I A;  1CKA A;  4AFU C;  4HCK A;  2DYB A;  1RI9 A;  1UHF A;  2A28 A;  2ED0 A;  2DL7 A;  4JZ3 A;  5IHN A;  2LMJ A;  1M3C A;  3NMZ C;  3I9Q A;  1E6G A;  2KT8 A;  2K79 A;  3C0C A;  4CC4 B;  1X69 A;  2L0A A;  1I0C A;  1CSK A;  2DE0 X;  2EBP A;  1JQQ A;  3VS4 A;  3CQT A;  1BBZ A;  1WXU A;  2DL8 A;  2ROL A;  4J9F A;  4JJD A;  4OMM A;  4Z89 A;  1GCQ C;  2DVJ A;  1T0H A;  1JO8 A;  3RNJ A;  1A0N B;  1E7O A;  4JZ4 A;  2F2X A;  1H8K A;  4K11 A;  3THK A;  1H3H A;  3M0T A;  3FJ5 A;  3VS0 A;  5IXB A;  2JMA A;  1ZX6 A;  1MV0 B;  3EHR A;  2HCK A;  2L2P A;  2C0I A;  3VS2 A;  1J3T A;  1WX6 A;  1ZLM A;  1OOT A;  2RNA A;  2D0N A;  4RTZ A;  4D8D A;  2KT1 A;  1NLP C;  5GJW B;  3UAT A;  2AZS A;  1HD3 A;  1YP5 A;  1JU5 C;  4D8K A;  1XOV A;  2HEQ A;  2KRM A;  3EG2 A;  2EW3 A;  2LQW A;  2ENM A;  2CUD A;  2LCS A;  2KXD A;  2GBQ A;  1PNJ A;  2E5K A;  2ABL A;  3M0P A;  1SRM A;  3EHQ A;  1CKB A;  5IHK A;  2LX7 A;  1SSH A;  1X27 A;  1VYU A;  3UA7 A;  2O9S A;  2NUZ A;  1JXO A;  2ESW A;  2GGR A;  1KJW A;  1UJ0 A;  1NEB A;  2RN8 A;  2EYY A;  1ABO A;  2X3W D;  2J7I A;  3EG1 A;  1YCS B;  2BZX A;  2H8H A;  4HVW A;  2CSQ A;  1UGV A;  3ZL7 C;  4AFS C;  2D8J A;  2K9G A;  2F2V A;  1ZUK A;  4OMQ A;  2MOX A;  1SEM A;  3REA B;  2OI3 A;  3VS1 A;  1ZSG A;  1K9A A;  4RTV A;  2LJ1 A;  3VRZ A;  4F17 A;  4HXJ A;  2KGT A;  4RTX A;  2EGA A;  1M27 C;  3EG3 A;  1UDL A;  2RQT A;  2DBM A;  2I0N A;  1H92 A;  2VVK A;  5IXF A;  3REB B;  1EFN A;  1W1F A;  2QDL A;  1BU1 A;  2SRC A;  2JMC A;  2DF6 A;  1MV3 A;  2FPE A;  3LH5 A;  1M3B A;  4ORZ A;  4R0K A;  2VKN A;  1I07 A;  1SHG A;  2DA9 A;  1WIE A;  2W10 A;  4RTY A;  3A98 A;  1X43 A;  1PRM C;  2FO0 A;  2JTE A;  2RQW A;  2LP5 A;  1UG1 A;  1TUC A;  2YT6 A;  2C0O A;  4JJB A;  3TSZ A;  2EGE A;  2L3S A;  2JS2 A;  3U23 A;  2FPD A;  3I5S A;  2FRY A;  2G6F X;  2J6K A;  3M0Q A;  2CH4 A;  1OEB A;  1X6G A;  1LCK A;  3NHN A;  1B3Q A;  1JXM A;  2EQI A;  1GFC A;  3UA6 A;  1SRL A;  3M0S A;  2GNC A;  2LJ3 A;  4GLM A;  1UHC A;  2O2O A;  2DLP A;  2FG0 A;  2LQN A;  1QLY A;  2KRS A;  3VRY A;  1BB9 A;  1QWE A;  2AZV A;  1VYV A;  2EPD A;  2RF0 A;  1M30 A;  1X2Q A;  3ULR B;  1PWT A;  2W0Z A;  3H0I A;  2DL3 A;  4Z88 A;  2KEA A;  1GBQ A;  1HJD A;  1GCQ A;  2PZ1 A;  1U5S A;  5FWB A;  3TSW A;  2FPF A;  3QWY A;  1SHF A;  2KR3 A;  4KRT A;  1AZE A;  1IO6 A;  2YUO A;  5IHI A;  1WDX A;  1K76 A;  1QWF A;  2KE9 A;  2KRN A;  4RUG A;  1X2K A;  1Z9Q A;  2FRW A;  2KRO A;  4J9E A;  1K1Z A;  4CC7 A;  1ZBJ A;  2MIO A;  2RQV A;  2EKH A;  1AEY A;  1M3A A;  4ESR A;  4RTU A;  4J9G A;  2LNH B;  2CDT A;  1ZUU A;  1SPK A;  2SEM A;  1OPL A;  1X6B A;  2PNI A;  1ABQ A;  4AFZ C;  1GCP A;  3PVL A;  1T3L A;  1BK2 A;  2CH4 W;  1UFF A;  2GTJ A;  2ROT A;  2F2W A;  3RBB B;  1RLP C;  2YDL A;  3VS5 A;  2JW4 A;  1PHT A;  1UE9 A;  2P4R A;  2ECZ A;  2YUN A;  5I22 A;  4OMO A;  1NM7 A;  1WFW A;  1HSQ A;  2AKL A;  2IIM A;  1U3O A;  4WCI A;  4J9D A;  2OAW A;  3EG0 A;  3NGP A;  1AWJ A;  1GL5 A;  1WA7 A;  1B07 A;  2AKK A;  4F14 A;  4HVU A;  3GBQ A;  1PRL C;  4LUD A;  2RQU A;  5I11 A;  2RPN A;  1AVZ C;  1V1C A;  2DL4 A;  1TUD A;  2D1X A;  2J6F A;  2X3X D;  1WLP B;  1UEC A;  2YUP A;  2B86 A;  4CC2 A;  3KFV A;  1S1N A;  1T0J A;  2BZY A;  4RTW A;  2BTT A;  2OJ2 A;  1T3S A;  1N5Z A;  1E6H A;  1AWO A;  1Y57 A;  1U06 A;  2O88 A;  2O31 A;  2BZ8 A;  1OPK A;  1PKT A;  2RMO A;  4M4Z A;  3UF4 A;  1M8M A;  3VS7 A;  1WXT A;  1Y0M A;  4DEY A;  2GTO A;  2V1Q A;  2ED1 A;  3H0H A;  4Z8A A;  1Z9Z A;  1UTI A;  1ARK A;  1GFD A;  1AWW A;  2KYB A;  2CT4 A;  3PVQ A;  5IH2 A;  2A36 A;  4OMN A;  2KBT A;  2EYW A;  2DRK A;  1G2B A;  2EGC A;  5FWC A;  1I1J A;  5ECA A;  4LNP A;  4JJC A;  1AD5 A;  1OV3 A;  2HBW A;  2V1R A;  1WI7 A;  2DMO A;  3H41 A;  4FSS A;  4EIK A;  2HSP A;  2JM9 A;  2L3P A;  4J9B A;  2MCN A;  4LUE A;  1AOJ A;  2GQI A;  4CC3 A;  2EVR A;  1JEG A;  1K4U S;  3VS6 A;  2KNB B;  1NLO C;  1TG0 A;  1RLQ C;  4RTT A;  1KFZ A;  1YWO A;  1W70 A;  2CRE A;  1UJY A;  1WXB A;  2D8H A;  2XMF A;  1GBR A;  2J06 A;  2K3B A;  3EGU A;  2VWF A;  2CSI A;  2JXB A;  3QWX X;  2DL5 A;  2K2M A;  2EYX A;  1G83 A;  4GBQ A;  5GJV B;  1UUE A;  2J6O A;  2M51 A;  4Y92 A;  1FMK A;  1RUW A;  2EYZ A;  3I5R A;  3PE0 A;  1NEG A;  2KXC A;  2PTK A;  2JM8 A;  1AWX A;  2JT4 A;  1QKX A;  3TVT A;  4JPB W;  4QT7 A;  1ZUY A;  2DBK A;  5EC7 A;  1MUZ A;  2DJQ A;  4J9H A;  1YWP A; 
#chains in the Genus database with same CATH topology
 3INZ A;  4GY5 A;  4A4H A;  2C0T A;  1VIE A;  1VQ8 T;  1SKU B;  3IQL A;  4HCZ A;  2PVG B;  1TSF A;  4YTL A;  1YFN A;  3HTR A;  1BCM A;  2FEI A;  1IGU A;  2D9T A;  2KMT A;  1KSW A;  4UC4 A;  4XTZ A;  2HSE B;  4LDX A;  2FB7 A;  3R6N A;  4A4F A;  1YNZ A;  1X6O A;  4OVA A;  1YN8 A;  1VOM A;  2NWM A;  1S72 A;  1NZ9 A;  4A63 B;  1Q81 C;  1NYG A;  2M0O A;  2ZPH B;  4BY6 B;  4X1V A;  4ZN1 A;  5HK0 A;  5I2S A;  2DXB A;  3ASK A;  5HK3 A;  4X9C A;  1H64 1;  3WVD B;  4J7I A;  2RQR A;  4LN2 A;  1KC8 U;  2DX1 A;  1K8A C;  2LNV A;  2IG0 A;  2CYZ B;  5GAN 2;  2O9V A;  4QQD A;  1K73 R;  2AK5 A;  1H3Z A;  2DNU A;  1QVG S;  3NPF A;  2K6D A;  3EFR A;  2DM1 A;  1NG2 A;  4M77 G;  4AG2 C;  2GQV A;  2DPP B;  5DLO A;  1KK7 A;  1TTH B;  2P0Q A;  2JNG A;  2CZ0 B;  4XK8 E;  1NBE B;  2KT8 A;  3C0C A;  4CC4 B;  1D09 B;  1VQK A;  1V29 B;  1CSK A;  3CCQ Q;  4OB1 B;  1BBZ A;  2DL8 A;  2ROL A;  4J9F A;  3WVE B;  3ZBD A;  2PVD B;  3QJ6 A;  3CPW A;  1VQ5 T;  1JO8 A;  2EQM A;  1E7O A;  3RMS A;  3OYF A;  2E41 A;  1VQN Q;  5CCA A;  2RK1 A;  5IXB A;  4KUD K;  3A1P A;  5GAN h;  3MKD A;  2JTM A;  1ZX6 A;  2DK3 A;  4N4I A;  4B9X A;  1OZ3 A;  3I56 Q;  1BIA A;  1MV0 B;  2AHJ B;  2HCK A;  2C0I A;  2L2P A;  3VS2 A;  1XNI A;  1Y71 A;  2D0N A;  2E70 A;  5D6W A;  4D8D A;  3EGD B;  1HD3 A;  4LDW A;  1YP5 A;  1JU5 C;  4M7A E;  4PJO A;  2EW3 A;  4F7U E;  2CP2 A;  2ENM A;  4QVC A;  2F1L A;  4M75 D;  2GBQ A;  1PNJ A;  1SRM A;  1C6V X;  3RES A;  3CCS A;  4X9D A;  1SSH A;  1X27 A;  1VYU A;  1AT1 B;  2NUZ A;  4ZTJ A;  4PJM A;  2QI2 A;  2ESW A;  5GAM d;  1UJ0 A;  2EYY A;  4JUV A;  3QDF A;  2DAQ A;  3EG1 A;  4C8Q A;  2FVU A;  2QAS A;  3VU3 C;  4OMQ A;  4C5H A;  3E9F A;  3REA B;  3OS1 A;  3VS1 A;  4KGX B;  2OTL A;  4C0D C;  1YIT T;  2LJ1 A;  1Y96 B;  2FYK A;  1PD1 A;  3Q1J A;  5GMK j;  4RTX A;  2M02 A;  5GAO l;  3SB2 A;  2LQK A;  1K9M U;  1BI2 A;  5IXF A;  4E7S A;  1EFN A;  3CCE T;  3LH5 A;  2BUD A;  3C12 A;  4KT0 E;  2H3J A;  3OMC A;  4R0K A;  1OI1 A;  3V7S A;  1K73 C;  4FIB A;  5CK9 A;  4RTY A;  2AIR B;  3A8G B;  3OSS C;  3CME Q;  4ZTF A;  1UG1 A;  1VQ8 A;  2L89 A;  3EAE A;  2C0O A;  2DD4 A;  1PG5 B;  4OB2 B;  2OTJ T;  2J6K A;  3HL8 A;  3M0Q A;  3QSU A;  1X6G A;  4FT4 A;  3HKS A;  1LVK A;  2HKN A;  3NHN A;  2AT1 B;  2KSS A;  3VYH B;  4GLM A;  4XTY A;  2YXY A;  3A8O B;  2KRS A;  1VIF A;  1NE8 A;  3VRY A;  2QXF A;  3RKX A;  2AZV A;  1VYV A;  2XI9 A;  3EG9 B;  4OP0 A;  1X2Q A;  3H0I A;  1VQP Q;  4HT9 A;  3HFN A;  5FWB A;  3QWY A;  1QVF A;  3URG A;  1JJ2 S;  2K5F A;  4M75 B;  4KRT A;  3JCM X;  1IO6 A;  1I4K 1;  3JCM e;  2KE9 A;  1X2K A;  2RM4 A;  5GAM j;  4BDZ A;  2FRW A;  3C95 A;  4J9E A;  4CC7 A;  1ZBJ A;  3LWI A;  2L5Q A;  4JRQ A;  1AEY A;  1WQ7 A;  4ME7 A;  2VV5 A;  4J9G A;  1ACM B;  4IKF A;  4JDS A;  4Y91 A;  1SPK A;  2A7Y A;  1TU0 B;  2D6F A;  4XTV A;  1JRI A;  1FXX A;  2PU9 B;  4M78 F;  3RBB B;  2X4Y A;  2RA2 A;  4J5Y A;  5GMK m;  1VQ5 A;  2DIG A;  3UWN A;  2NLU A;  3CEY A;  1UGR B;  1O75 A;  2QA4 Q;  2CZ1 B;  3OB9 A;  3VYG A;  1U3O A;  4WCI A;  2OAW A;  4BI4 A;  1AWJ A;  3QII A;  3OYN A;  4JJN K;  3CMA Q;  1KQS P;  4ZN3 A;  4HVU A;  1PRL C;  4ZGE B;  1R8O B;  1M5Q 1;  4IUQ A;  3A8H B;  1QMC A;  3MEA A;  2DET A;  1V1C A;  2C06 A;  1UB4 A;  3OYG A;  2X3X D;  3OYC A;  2YUP A;  5LJ5 h;  3CCQ T;  2NUT A;  2XD0 A;  4PJO F;  3PMI A;  2DXC A;  4RTW A;  2HQE A;  2BTT A;  1ZSZ A;  1E6H A;  2ZGW A;  3OYE A;  2RMO A;  1VQN T;  1KC8 R;  1B34 B;  2WAC A;  2YLB A;  2FZG B;  4LDU A;  3I56 T;  4M78 D;  2V1Q A;  5LJ3 e;  4M7A F;  1R77 A;  1Z9Z A;  2LCL A;  2ZPF B;  2MYS A;  4HKE A;  3WXM B;  4M7D A;  2OX7 A;  4RKU E;  2A36 A;  2KBT A;  2XG8 D;  3TCJ A;  3CD6 Q;  1NPP A;  5D6X A;  5FWC A;  3M54 A;  5EG2 A;  3HRU A;  2EJG A;  1OV3 A;  3H41 A;  2OAU A;  4KH1 B;  1SSF A;  4JS4 A;  2MCN A;  2P4T A;  3GNG A;  4LUE A;  1AOJ A;  3P8B B;  2X4X A;  3CCE A;  4BD3 A;  4CC3 A;  1JEG A;  4J6Y A;  4PJO D;  3G4S Q;  4LDY A;  1MGQ A;  2R57 A;  1YWO A;  2F69 A;  2RD1 A;  3FLG A;  2DZ9 A;  2D8H A;  2XMF A;  5GAN 3;  4OF1 A;  2RHI A;  3EGU A;  2B8A A;  2VWF A;  3LLR A;  4XU2 A;  3L2U A;  1JB0 E;  2JXB A;  2RI2 A;  3OS5 A;  1M90 R;  2MWP A;  2IVW A;  3NTH A;  2FHD A;  2XU8 A;  4C8Q D;  2EYZ A;  5GMK h;  3X24 B;  3R6O A;  3KUF A;  2QAZ A;  2K2V A;  1LPL A;  3JB9 I;  1U1T A;  1LNX A;  2K5I A;  3OYM A;  2DJQ A;  3JCM V;  1RI0 A;  5I21 A;  3VV0 A;  2DRM A;  3EGX A;  3CCU Q;  1OU8 A;  3QYG B;  3CME T;  1BI3 A;  3OS0 A;  4BE0 A;  1K0X A;  3MP1 A;  1WHL A;  1KIK A;  1QVG A;  3OW2 S;  3P8D A;  2K7A A;  6AT1 B;  2QQR A;  2YUQ A;  2A37 A;  3O5Z A;  2BKD N;  3OYY A;  4M77 E;  2DFU A;  4DBR A;  2HBP A;  5IAY A;  4M78 B;  2GCX A;  2KYM A;  2BIV A;  4RG8 A;  4OML A;  3VUB A;  3NFC A;  1K9M R;  4FCY A;  4DBH A;  3PMT A;  4AG1 C;  1MMA A;  2JTF A;  3S3M A;  4DQ2 A;  3HPW A;  1KC8 C;  1VA7 A;  2JOY A;  1VQP T;  3C94 A;  5GAO p;  2LX9 A;  1GRI A;  2XK0 A;  3JCM P;  1Q82 R;  2QK0 A;  1QKW A;  1BKB A;  4QVD A;  4OMP A;  2M0Y A;  2EAY A;  4ELZ C;  2A08 A;  4F04 B;  2J05 A;  4J9I A;  1CKA A;  3RIR A;  2CGH A;  5GAM h;  4C5E A;  4FM4 B;  4BDY A;  3A5Z B;  4GLK A;  4JZ3 A;  5D7U A;  5IHN A;  4PJO B;  4NL2 A;  1M3C A;  1YJ9 Q;  2NYS A;  4XTU A;  2K79 A;  2COZ A;  1X69 A;  2DE0 X;  2WSF E;  5KYY B;  3VS4 A;  1WXU A;  4LXC A;  3OYI A;  4OMM A;  2RHZ A;  4L5G A;  1B34 A;  1T0H A;  2QQB A;  3CCQ A;  1A0N B;  1H8K A;  3THK A;  3M0T A;  5HKC A;  1Q7Y U;  1D0Y A;  1D0X A;  4B9W A;  4A54 A;  3EHR A;  4C8Q B;  2QA4 T;  1OOT A;  2RNA A;  2X9H A;  3I56 A;  5GJW B;  2E5Q A;  3CMA T;  3TU4 K;  1W2B S;  2XIC A;  3CCM Q;  2ZCF B;  1M90 C;  5D6Y A;  3SD4 A;  2DKG A;  5KCH A;  2MMP A;  3CBO A;  2LCS A;  2DIQ A;  2E5K A;  2ABL A;  4M7D F;  5CQY A;  4C5G A;  1CKB A;  1BYM A;  2LX7 A;  3BY7 A;  1IRX A;  4E7L A;  3UA7 A;  2P0P A;  4M75 C;  3DLM A;  1PD0 A;  1N8R U;  1KJW A;  4C92 F;  4BE1 A;  1M2O A;  1ABO A;  2J7I A;  4XU0 A;  2QGF B;  1WHJ A;  1YIJ Q;  2BZX A;  1IB8 A;  2H8H A;  4E7K A;  1UGV A;  1SG5 A;  2D8J A;  1W4S A;  1ZUK A;  2O4X B;  4E2F B;  1ZA1 B;  3ME9 A;  4RTV A;  4OB0 B;  1G3S A;  4M77 C;  4F17 A;  5GAM e;  3CBM A;  3PT9 A;  5C0M A;  4N0A C;  2YHT A;  2ZAE A;  3CD6 T;  2KGT A;  3MCA B;  3CCV Q;  2EGA A;  4M75 G;  1M27 C;  1IZ6 A;  1K9M C;  3JCM c;  2DBM A;  2I0N A;  1H92 A;  5FU7 C;  5KYW A;  4IUP A;  3REB B;  2SRC A;  1BU1 A;  2QG9 B;  3P8H A;  1TOV A;  3ER0 A;  2DF6 A;  5CAI A;  4ORZ A;  4E7J A;  5J3B A;  4M7D D;  3X20 B;  1Q82 C;  1SHG A;  3G1J A;  3GIB A;  2FZK B;  1R0C B;  2W10 A;  3G4S T;  5AYF A;  2RJD A;  3A98 A;  4CRI A;  2JTE A;  5KYX B;  2RQW A;  1RAI B;  5CQX A;  1M8V A;  3BW1 A;  4C92 D;  2PQW A;  1TUC A;  2GFA A;  4TVR A;  4NS5 A;  1KQS S;  1YJN Q;  3LH0 A;  2GF7 A;  2L3S A;  2JS2 A;  3CME A;  2FPD A;  4M78 A;  1U8R A;  3GNF B;  5LJ5 j;  2LC4 A;  2YRV A;  3FDR A;  1WNL A;  4P5N A;  1GFC A;  3DLL A;  1SRL A;  2GNC A;  2LJ3 A;  1UHC A;  4Y28 E;  3OYA A;  3G6E Q;  4CI0 C;  1QLY A;  3EFS A;  3MEV A;  5KYN A;  2RF0 A;  1WQW A;  2XKO C;  1PWT A;  3MP6 A;  4XTX A;  3A8L B;  3QHS A;  2K5L A;  4Z88 A;  8AT1 B;  1M1K U;  1GCQ A;  1VQM Q;  2L8D A;  4PJJ A;  3TSW A;  2YRC A;  1VQP A;  1YHQ Q;  2KR3 A;  3SWN C;  3CCU T;  2DVE A;  2BE7 D;  2QQA A;  1QVF P;  1K76 A;  2KRN A;  2EWN A;  3CCL Q;  1OUL A;  1WHH A;  1I81 A;  3QDR B;  3JB9 H;  2RQV A;  3AT1 B;  1RAD B;  4EMK C;  1D1C A;  4L6V 5;  1M2V B;  3RDV A;  5KYY A;  2CDT A;  4E7I A;  1ABQ A;  2NUT B;  1BK2 A;  3HFO A;  2CH4 W;  4M7A A;  1HYO A;  1QVP A;  1QW1 A;  1RLP C;  2YDL A;  1ZSZ B;  1Q95 G;  1WJR A;  1G8X A;  2ECZ A;  2YUN A;  3JB9 F;  2Z0W A;  2ZPB B;  4OMO A;  1NM7 A;  1VQ4 Q;  3JCM g;  1HSQ A;  2AKL A;  3L2Q A;  1VQ9 Q;  4EMG A;  3QJY A;  3NGP A;  3PIP A;  1WA7 A;  3ZFJ A;  5CKH A;  1QP3 A;  1EIF A;  2PVO B;  2QA4 A;  4VUB A;  3H8Z A;  3V8K A;  3V8J A;  3GLX A;  3CMA A;  4M7D B;  1AVZ C;  3LGL A;  2DL4 A;  3L2Z A;  1YJ9 T;  3OSV A;  4PFO A;  3JCM f;  2MPX C;  4XQ3 A;  1XQH A;  2P84 A;  4C92 B;  1S1N A;  2R5M A;  2BZY A;  5CKD A;  3J80 E;  4KGV B;  2OJ2 A;  1T3S A;  1N5Z A;  4II1 A;  2O88 A;  5GAN e;  1PKT A;  3UF4 A;  3UDC A;  2O4X A;  3VS7 A;  4ELY C;  3EH2 A;  1Y0M A;  5GAO m;  2GTO A;  1M9S A;  2DO3 A;  3JB9 D;  3H0H A;  1UTI A;  1GFD A;  4DBF A;  4XU1 A;  4AMC A;  2KYB A;  3PVQ A;  5IH2 A;  2ZPG B;  2EYW A;  3OYJ A;  1XJW B;  2DRK A;  1BIB A;  1QQJ A;  4MDX A;  3OYK A;  1V76 A;  2X4W A;  1I1J A;  3TRE A;  2E65 A;  4JRI A;  4JJC A;  3CD6 A;  2V1R A;  1WI7 A;  1RAE B;  2HD0 A;  4KUI A;  4EIK A;  2HSP A;  4J9B A;  1OQK A;  4BI8 B;  3V7R A;  5KYX A;  2GQI A;  2KDS A;  2EVR A;  1Q7Y R;  4M78 G;  3CXC S;  1IXD A;  5LJ3 g;  1YIJ T;  3EGX B;  3OYB A;  1NLO C;  3A8M B;  3FEO A;  4A53 A;  4RTT A;  3VKI A;  3G4S A;  2A0F B;  1GBR A;  2J06 A;  5CIU A;  3OW2 A;  1OU9 A;  3QWX X;  2K2M A;  2IPO B;  5GJV B;  1UUE A;  3CC4 Q;  5LJ3 f;  3CCV T;  2EYQ A;  1G3Y A;  3PE0 A;  1PM3 A;  8ATC B;  2CP0 A;  3M58 A;  2JT4 A;  4X34 A;  1QKX A;  3E1S A;  2R58 A;  1I8F A;  2I2L A;  4C8Q C;  3CPW S;  4QT7 A;  2CS7 A;  2DBK A;  1RAH B;  4J9H A;  1YWP A;  1N8R R;  2HDA A;  4PJO G;  2LJ0 A;  4EMH A;  3JAM E;  2VYT A;  3SEM A;  2YSQ A;  1RAA B;  3VS3 A;  1Y07 A;  3JV3 A;  3S3N A;  5GAO n;  1W6X A;  4KH0 B;  5DM7 R;  5HY6 A;  1WYX A;  3DB3 A;  1PKS A;  3M53 A;  4RCC A;  1QCF A;  1YJN T;  4MZT A;  3CCU A;  1M2V A;  1QVG P;  2DTI A;  3CPF A;  4FYW B;  3L1A A;  5FU6 C;  2CT3 A;  3MEU A;  4IIO A;  2XHC A;  1G3W A;  5KCO A;  4C8Q G;  4FW1 A;  1N9S A;  1BI1 A;  1YJW Q;  4IIM A;  3G6E T;  1YI2 Q;  1VYT A;  2COW A;  2LZ6 B;  4J8O A;  3RR6 A;  4F16 A;  3X28 B;  1AHJ B;  2L3Q A;  5HCK A;  4DEX A;  4J9C A;  2KAF A;  1VQM T;  1RAC B;  1FX7 A;  3HSB A;  3G71 Q;  1YHQ T;  2L3R A;  5A2Q E;  3E2U A;  3KBG A;  4F7U F;  3HHT B;  2JN0 A;  2DIL A;  4XU3 A;  1K73 U;  2Y90 A;  3I35 A;  4QW2 A;  3CCL T;  4BY6 C;  1AZG B;  5FW9 A;  2RO0 A;  1HK9 A;  1NYF A;  2DER A;  2H3E B;  4AFU C;  1YIT A;  1TH7 A;  4O5V A;  4HCK A;  4PFP A;  2D0Q B;  2DYB A;  1W2B A;  1JBM A;  1OYX A;  4DBQ A;  2ATC B;  4C92 A;  5FRO A;  1VQ7 Q;  3NMZ C;  4BAC A;  1E6G A;  1WJS A;  2L0A A;  3LGF A;  1YJ9 A;  3CQT A;  4Z89 A;  4FYV B;  4LD9 K;  3JCM J;  3QZ5 B;  5GMK i;  2JZ2 A;  3JCM d;  2DVJ A;  4HA8 A;  3GP8 A;  3RNJ A;  2E6N A;  1M1G A;  2E3I A;  1Q7Y C;  2F2X A;  4RCB A;  4K11 A;  2WSC E;  1H3H A;  2CP5 A;  1P92 A;  3KXT A;  1D1A A;  2F5K A;  2EFI A;  1ZHI A;  3FJ5 A;  3VS0 A;  1M1K R;  2JMA A;  1PSE A;  2QEX Q;  1VQ4 T;  1B7T A;  2EQU A;  2O01 E;  2KK4 A;  1PCX A;  2RJE A;  1VQ9 T;  4RTZ A;  4J83 A;  4OGE A;  2KT1 A;  5KE2 A;  4FYY B;  3JCM W;  4M7A D;  3QUI A;  3EH1 A;  4MMK A;  4D8K A;  1XOV A;  2HEQ A;  2X51 A;  5AT1 B;  2OTJ A;  3EG2 A;  3JCM b;  3CC2 Q;  4RG2 A;  2LQW A;  5LJ5 e;  3BDL A;  2CUD A;  4BI3 A;  2KXD A;  3M0P A;  5LL6 S;  5KYW B;  3CCJ Q;  4M75 E;  2O9S A;  2ZPE B;  1N8R C;  4QKU A;  1Q86 U;  5GAN 6;  2RN8 A;  1X01 A;  4FU6 A;  3HRT A;  2DJZ A;  4A4E A;  5FLX E;  1YCS B;  1MND A;  4EPC A;  3PNW C;  2CP7 A;  3ZL7 C;  4J6X A;  1VQO Q;  4AFS C;  1BI0 A;  2F2V A;  2XDD A;  5J39 A;  3FRN A;  1SEM A;  3LW5 E;  4FW2 A;  3PIO A;  2OI3 A;  2NUP A;  2DTH A;  4HXJ A;  4E47 A;  3O8V A;  2EQJ A;  2RJC A;  2FL7 A;  3BDU A;  1UDL A;  2RQT A;  2VVK A;  2QQS A;  1MMG A;  3CCV A;  4M77 A;  4HCC A;  2HL3 A;  5LJ3 d;  1D3B A;  2DTO A;  4N0A A;  3M4Y A;  2HKQ B;  2RK2 A;  2RH2 A;  2VKN A;  1I07 A;  2DA9 A;  5DLQ E;  3QXE B;  4EDU A;  1X43 A;  2QGG A;  2FO0 A;  2RB6 A;  1JJ2 P;  5GAM g;  3M9Q A;  3U23 A;  4C0F A;  1YJN A;  2G6F X;  1OEB A;  2K4Y A;  3PFS A;  1LCK A;  5IN1 A;  1JXM A;  5GMK e;  3PGG A;  3CC4 T;  1WHG A;  3M0S A;  2K57 A;  3NTK A;  2DEQ A;  2A3L A;  4L59 A;  5DY9 A;  2DLP A;  2LQN A;  4PL6 A;  1VQ6 Q;  2VXE A;  1MHN A;  4M7A B;  1BB9 A;  1IHV A;  2HQH A;  1QWE A;  1WGS A;  2EPD A;  5GAM f;  5GAN 8;  3ULR B;  3G6E A;  1M1K C;  4F7U B;  4M7D G;  3OYD A;  3MP8 A;  1VQN A;  2MK5 A;  1HJD A;  2FPF A;  3I55 Q;  4FSX A;  4ATO A;  4C92 G;  2YUO A;  3E19 A;  1WDX A;  4RUG A;  1QWF A;  3QYH B;  4Z02 A;  1VQM A;  2JUF A;  1WHM A;  2PUO B;  2KRO A;  4C5I A;  1YHQ A;  5A0D A;  3X26 B;  3TEE A;  1NJI U;  4QVZ A;  3CCL A;  3CCR Q;  3FIF A;  3H9N A;  4ESR A;  3SWN A;  4RTU A;  3ZEH A;  2HMA A;  3DKM A;  4PLL A;  4V2S A;  1I5O B;  1ZUU A;  2SEM A;  2M9U A;  2PNI A;  1OZ2 A;  2QDY B;  4AFZ C;  1GCP A;  1YJW T;  1T3L A;  3BE3 A;  3M56 A;  2V8J A;  5GAN 4;  2LT4 A;  3MO8 A;  1YI2 T;  1UFF A;  2GTJ A;  2ROT A;  4EMK A;  1VQL Q;  1PSF A;  3M59 A;  3HP9 A;  2P4R A;  1WJQ A;  3MET A;  5KYU A;  2DXU A;  1WFW A;  4E7H A;  3LYI A;  3G71 T;  2IIM A;  5LJ3 j;  1GL5 A;  1N27 A;  1FMW A;  3EG0 A;  1VQ4 A;  1OX8 A;  3J81 E;  4PK4 A;  1VQ9 A;  4ZGD B;  2E4H A;  2V26 A;  5FRM A;  1KHC A;  4PLI A;  2RI3 A;  5I11 A;  2HL5 C;  2D1X A;  3V8L A;  1VQ7 T;  3EFO A;  2J6F A;  5GAN 7;  3RER A;  3QZ9 B;  2XDB A;  1WLP B;  1UEC A;  2RI5 A;  4BB7 A;  3KFV A;  5FRN A;  1Y57 A;  1U06 A;  2R5A A;  1F1B B;  2K3Y A;  3GF5 A;  3MJX A;  1UGQ B;  5J26 A;  1O9S A;  2QEX T;  1WXT A;  1JJ2 A;  1N9R A;  3QKJ A;  2RJF A;  3CXC A;  3MPU B;  4M78 E;  3QO3 A;  1IHW A;  2E3H A;  4QQ6 A;  2RHX A;  1C0M A;  3E9G A;  2E10 A;  4J6W A;  3OMG A;  1VUB A;  1N6A A;  4R55 A;  4M75 F;  3CC2 T;  3OYL A;  3CC7 Q;  2EGC A;  1UGS B;  2X4J A;  2MWO A;  1M4Z A;  5ECA A;  4LNP A;  3CCJ T;  3F70 A;  2DMO A;  5GAN g;  1KD1 U;  4FSS A;  2LVM A;  1KG1 A;  2CZ7 B;  3MHX A;  2JM9 A;  2Y4X A;  2QTX A;  2JJ9 A;  2Y4Y A;  3JRZ A;  7AT1 B;  3M5A A;  4M77 F;  4PJO E;  3VS6 A;  2KNB B;  1LJO A;  3JB9 G;  1VQO T;  1G5V A;  5L8R E;  1KFZ A;  1W70 A;  2CRE A;  1UJY A;  2E12 A;  2EJF A;  1TXQ A;  4OGC A;  5M9O A;  5GAN f;  2CSI A;  1TWB A;  3LWH A;  3SDZ A;  3OW2 P;  3S6W A;  4GBQ A;  2CZ6 B;  1IRE B;  1M90 U;  1FMK A;  1NEG A;  4C8Q E;  4MDW A;  2KXC A;  4F7U A;  2PTK A;  2YWW A;  3CC4 A;  1RAF B;  4J7F A;  2QYZ A;  5I2M A;  2HAX A;  1ZUY A;  2VUB A;  5EC7 A;  1Q86 R;  1MUZ A;  3PTA A;  3OBY A;  1WIE A;  2CUB A;  4KGZ B;  3RKW A;  4IUR A;  2JS0 A;  3M0U A;  5L23 A;  2EJ9 A;  4ZNX A;  4E7Z A;  1M1F A;  1X75 C;  1K0S A;  5CVI A;  1QCN A;  2COY A;  3JCM h;  4PNO A;  9ATC B;  3GPL A;  4M77 D;  3L42 A;  4HVV A;  2LT1 A;  4E6R A;  4MZM A;  1S72 Q;  2X35 A;  4AFQ C;  3H0F A;  2K3X A;  1FYN A;  3SHW A;  2CP3 A;  1Q81 U;  4ANJ A;  1VQ6 T;  3M0R A;  4NOY A;  3JCM Q;  1YJW A;  1FWZ A;  1YI2 A;  3AHU A;  1TUG B;  2QQ9 A;  2VAS A;  4OMF B;  4C0G A;  3JSC A;  1K8A U;  5C6S A;  3I55 T;  3OY9 A;  4HCB A;  4DOW A;  2LCC A;  4JRK A;  4M78 C;  3VJP A;  3CCM T;  4LE9 A;  1Q82 U;  3BFM A;  3QG1 A;  3G71 A;  3CBP A;  4O6J A;  3L2W A;  1RL2 A;  2XID A;  1RI9 A;  1UHF A;  2A28 A;  3CCR T;  1VQK Q;  2ED0 A;  2DL7 A;  2LMJ A;  1W2B P;  3I9Q A;  3RMQ A;  1UGP B;  1HXD A;  1I0C A;  2EBP A;  1Y7X A;  1JQQ A;  5A0L A;  1VQ7 A;  4JJD A;  4HT8 A;  2HZY A;  1D1B A;  4MZP A;  2M16 A;  1NPR A;  4LD6 A;  1GCQ C;  1VQL T;  4JZ4 A;  1XTD A;  1KQ2 A;  3SFM A;  4B6M A;  5CKF A;  4PJO C;  1J3T A;  1WX6 A;  1ZLM A;  4DA4 A;  5KE3 A;  1LOJ A;  2QEX A;  1NLP C;  3UAT A;  2AZS A;  4NL3 A;  5LJ3 h;  1R0B G;  3HRS A;  2EKO A;  2NUP B;  1C1A A;  3UPU A;  1NJI R;  3JB9 J;  2KRM A;  3OBW A;  5GMK l;  1D0Z A;  3N5B B;  4M7A C;  3CCS Q;  3CC2 A;  4MML A;  3EHQ A;  2WSE E;  5IHK A;  2MAM A;  4M77 B;  1Q86 C;  4DOV A;  4IUV A;  1D3B B;  4A4G A;  1JXO A;  4FT2 A;  3RUX A;  2GGR A;  3CCJ A;  1NEB A;  2E64 A;  4IUT A;  5IT9 E;  4LDV A;  2X3W D;  5FU7 B;  1DJ7 B;  4N4H A;  2JVV A;  2LTO A;  4HVW A;  1KHI A;  2CSQ A;  2OTL Q;  1KQ1 A;  2K9G A;  3EGD A;  3OYH A;  2MOX A;  4M7A G;  1SF9 A;  1ZSG A;  4N4G A;  1K9A A;  1PC0 A;  4AT1 B;  1VQO A;  4F7U G;  3VRZ A;  1IGQ A;  5LJ5 g;  4OB3 B;  5GAN d;  3G7Z A;  3UT1 A;  4FYX B;  3CC7 T;  2DD5 A;  3EG3 A;  2F5T X;  1W1F A;  2QDL A;  3FC3 A;  2JMC A;  1MV3 A;  3L2R A;  2FPE A;  1M3B A;  2XDP A;  2V8K A;  5LJ5 f;  1BCO A;  2P0K A;  1VQ8 Q;  4M7D E;  2QTV A;  1RAB B;  1PRM C;  2HQX A;  2LP5 A;  3OQ5 A;  2YT6 A;  4JJB A;  4C92 E;  2MF2 A;  3TSZ A;  2EGE A;  1G3T A;  4XAX B;  1Y96 A;  3I5S A;  2M1H A;  4C0Z A;  4BE2 A;  2FRY A;  2CH4 A;  4RMO A;  3SWN B;  4C8Q F;  1B3Q A;  4QQG A;  2EQI A;  3UA6 A;  3LX7 A;  2EQK A;  3QPH A;  2O2O A;  2FG0 A;  2KI7 A;  1KD1 R;  3C4S A;  4EMK B;  1M30 A;  2EIF A;  2W0Z A;  1MMD A;  1VQ6 A;  2DL3 A;  2ZPI B;  2KEA A;  1GBQ A;  2PZ1 A;  5KYU B;  1U5S A;  3FB9 A;  4JLG A;  1SHF A;  2RHU A;  4IUU A;  5GAO r;  1AZE A;  5IHI A;  5CKE A;  2G3R A;  1MMN A;  3I55 A;  1Z9Q A;  2E1H A;  2LDM A;  1NJI C;  1K1Z A;  3CCM A;  3VUZ A;  2FZC B;  2LRQ A;  2MIO A;  3GOX A;  1S72 T;  4FL6 A;  2EKH A;  1ZQ1 A;  1M3A A;  3H6Z A;  2LNH B;  4C0D B;  3EFO B;  1EZZ B;  3CCR A;  2KVQ G;  2YLC A;  1OPL A;  1X6B A;  3V7C A;  1OX9 A;  1ZA2 B;  3PVL A;  3X25 B;  4KBM B;  5GAO q;  3EG9 A;  2HNI A;  2ZZD A;  1VQ5 Q;  2F2W A;  3M55 A;  3D7S B;  5GAN j;  2LQ8 A;  3VS5 A;  2JW4 A;  1PHT A;  1UE9 A;  3QBY A;  1QVF S;  5I22 A;  1VQL A;  2DXT A;  1YIJ A;  4M75 A;  3OS2 A;  3T9N A;  4J9D A;  5KH6 A;  1WHK A;  1KQS A;  1B07 A;  4PKC C;  2AKK A;  1U1S A;  4F14 A;  3GBQ A;  4JLI A;  4LUD A;  2RQU A;  3TQ7 P;  2VXF A;  4JRP A;  1VQK T;  2RPN A;  2VC8 A;  4JS5 A;  1TUD A;  1ZSZ C;  1I5L A;  5GAN 5;  4Q5W A;  4R56 A;  1GXI E;  2B86 A;  1Q81 R;  4CC2 A;  5CKB A;  1T0J A;  1UEB A;  3DB4 A;  1AWO A;  4XTW A;  3M57 A;  2O31 A;  4BUG A;  2BZ8 A;  1OPK A;  4M4Z A;  1M8M A;  5A0G A;  4M7D C;  1K8A R;  4DEY A;  4ZGJ B;  1MNE A;  3CXC P;  2ED1 A;  4Z8A A;  4C92 C;  1ARK A;  3NTI A;  1YIT Q;  1YCY A;  2CP6 A;  1AWW A;  3FJP A;  2CT4 A;  2DZC A;  4OMN A;  3J7A F;  1TS9 A;  1G2B A;  4KUL A;  1RAG B;  3CCS T;  1QCO A;  2MI6 A;  2GFU A;  2YRD A;  2RHY A;  1KD1 C;  1AD5 A;  2HBW A;  2V8I A;  3CCE Q;  3CC7 A;  2CKK A;  2L3P A;  4WF2 A;  1WZO A;  2DYI A;  2KQW A;  3CPW P;  1K4U S;  1EX4 A;  3RKY A;  3OA6 A;  3M4G A;  1TG0 A;  1WPY A;  1RLQ C;  2BE9 B;  5LJ5 d;  2OTL T;  2VB6 A;  3S3O A;  5CR2 A;  1WXB A;  2K3B A;  2VGM A;  1ZBX A;  2OTJ Q;  4D6W A;  2DL5 A;  2EYX A;  1G83 A;  2VGN A;  2DEU A;  2J6O A;  2M51 A;  4PJN A;  4Y92 A;  1RUW A;  3I5R A;  1FMV A;  4PJL A;  3MEW A;  5CO7 A;  2E6Z A;  4WTO B;  2JM8 A;  2PUK B;  1AWX A;  4PFZ A;  3L2V A;  2KY9 A;  3TVT A;  1QP2 A;  4JPB W;  5FU6 B;  4A4K A;  1YBY A; 
#chains in the Genus database with same CATH homology
 2HDA A;  2LJ0 A;  2CUB A;  2C0T A;  3SEM A;  2YSQ A;  2JS0 A;  3M0U A;  2DRM A;  3VS3 A;  3JV3 A;  3IQL A;  5L23 A;  1W6X A;  4ZNX A;  1WYX A;  1K0S A;  1K0X A;  1PKS A;  1KIK A;  2FEI A;  1QCF A;  1KSW A;  2K7A A;  3R6N A;  4HVV A;  2YUQ A;  2A37 A;  3O5Z A;  4E6R A;  1YNZ A;  4AFQ C;  2CT3 A;  3H0F A;  4IIO A;  1YN8 A;  1FYN A;  2NWM A;  2KYM A;  4A63 B;  1NYG A;  3SHW A;  4X1V A;  4OML A;  4IIM A;  1VYT A;  4AG1 C;  3M0R A;  2LZ6 B;  4F16 A;  1VA7 A;  2RQR A;  4LN2 A;  2DX1 A;  2L3Q A;  5HCK A;  4DEX A;  4J9C A;  1GRI A;  2O9V A;  2AK5 A;  1QKW A;  2DNU A;  3NPF A;  4OMP A;  2K6D A;  2M0Y A;  2DIL A;  4LE9 A;  3I35 A;  2A08 A;  1AZG B;  2DM1 A;  5FW9 A;  1NG2 A;  2J05 A;  1NYF A;  4AG2 C;  4J9I A;  1CKA A;  4AFU C;  4HCK A;  2DYB A;  1RI9 A;  1UHF A;  2A28 A;  2ED0 A;  2DL7 A;  4JZ3 A;  5IHN A;  2LMJ A;  1M3C A;  3NMZ C;  3I9Q A;  1E6G A;  2KT8 A;  2K79 A;  3C0C A;  4CC4 B;  1X69 A;  2L0A A;  1I0C A;  1CSK A;  2DE0 X;  2EBP A;  1JQQ A;  3VS4 A;  3CQT A;  1BBZ A;  1WXU A;  2DL8 A;  2ROL A;  4J9F A;  4JJD A;  4OMM A;  4Z89 A;  1GCQ C;  2DVJ A;  1T0H A;  1JO8 A;  3RNJ A;  1A0N B;  1E7O A;  4JZ4 A;  2F2X A;  1H8K A;  4K11 A;  3THK A;  1H3H A;  3M0T A;  3FJ5 A;  3VS0 A;  5IXB A;  2JMA A;  1ZX6 A;  1MV0 B;  3EHR A;  2HCK A;  2L2P A;  2C0I A;  3VS2 A;  1J3T A;  1WX6 A;  1ZLM A;  1OOT A;  2RNA A;  2D0N A;  4RTZ A;  4D8D A;  2KT1 A;  1NLP C;  5GJW B;  3UAT A;  2AZS A;  1HD3 A;  1YP5 A;  1JU5 C;  4D8K A;  1XOV A;  2HEQ A;  2KRM A;  3EG2 A;  2EW3 A;  2LQW A;  2ENM A;  2CUD A;  2LCS A;  2KXD A;  2GBQ A;  1PNJ A;  2E5K A;  2ABL A;  3M0P A;  1SRM A;  3EHQ A;  1CKB A;  5IHK A;  2LX7 A;  1SSH A;  1X27 A;  1VYU A;  3UA7 A;  2O9S A;  2NUZ A;  1JXO A;  2ESW A;  2GGR A;  1KJW A;  1UJ0 A;  1NEB A;  2RN8 A;  2EYY A;  1ABO A;  2X3W D;  2J7I A;  3EG1 A;  1YCS B;  2BZX A;  2H8H A;  4HVW A;  2CSQ A;  1UGV A;  3ZL7 C;  4AFS C;  2D8J A;  2K9G A;  2F2V A;  1ZUK A;  4OMQ A;  2MOX A;  1SEM A;  3REA B;  2OI3 A;  3VS1 A;  1ZSG A;  1K9A A;  4RTV A;  2LJ1 A;  3VRZ A;  4F17 A;  4HXJ A;  2KGT A;  4RTX A;  2EGA A;  1M27 C;  3EG3 A;  1UDL A;  2RQT A;  2DBM A;  2I0N A;  1H92 A;  2VVK A;  5IXF A;  3REB B;  1EFN A;  1W1F A;  2QDL A;  1BU1 A;  2SRC A;  2JMC A;  2DF6 A;  1MV3 A;  2FPE A;  3LH5 A;  1M3B A;  4ORZ A;  4R0K A;  2VKN A;  1I07 A;  1SHG A;  2DA9 A;  1WIE A;  2W10 A;  4RTY A;  3A98 A;  1X43 A;  1PRM C;  2FO0 A;  2JTE A;  2RQW A;  2LP5 A;  1UG1 A;  1TUC A;  2YT6 A;  2C0O A;  4JJB A;  3TSZ A;  2EGE A;  2L3S A;  2JS2 A;  3U23 A;  2FPD A;  3I5S A;  2FRY A;  2G6F X;  2J6K A;  3M0Q A;  2CH4 A;  1OEB A;  1X6G A;  1LCK A;  3NHN A;  1B3Q A;  1JXM A;  2EQI A;  1GFC A;  3UA6 A;  1SRL A;  3M0S A;  2GNC A;  2LJ3 A;  4GLM A;  1UHC A;  2O2O A;  2DLP A;  2FG0 A;  2LQN A;  1QLY A;  2KRS A;  3VRY A;  1BB9 A;  1QWE A;  2AZV A;  1VYV A;  2EPD A;  2RF0 A;  1M30 A;  1X2Q A;  3ULR B;  1PWT A;  2W0Z A;  3H0I A;  2DL3 A;  4Z88 A;  2KEA A;  1GBQ A;  1HJD A;  1GCQ A;  2PZ1 A;  1U5S A;  5FWB A;  3TSW A;  2FPF A;  3QWY A;  1SHF A;  2KR3 A;  4KRT A;  1AZE A;  1IO6 A;  2YUO A;  5IHI A;  1WDX A;  1K76 A;  1QWF A;  2KE9 A;  2KRN A;  4RUG A;  1X2K A;  1Z9Q A;  2FRW A;  2KRO A;  4J9E A;  1K1Z A;  4CC7 A;  1ZBJ A;  2MIO A;  2RQV A;  2EKH A;  1AEY A;  1M3A A;  4ESR A;  4RTU A;  4J9G A;  2LNH B;  2CDT A;  1ZUU A;  1SPK A;  2SEM A;  1OPL A;  1X6B A;  2PNI A;  1ABQ A;  4AFZ C;  1GCP A;  3PVL A;  1T3L A;  1BK2 A;  2CH4 W;  1UFF A;  2GTJ A;  2ROT A;  2F2W A;  3RBB B;  1RLP C;  2YDL A;  3VS5 A;  2JW4 A;  1PHT A;  1UE9 A;  2P4R A;  2ECZ A;  2YUN A;  5I22 A;  4OMO A;  1NM7 A;  1WFW A;  1HSQ A;  2AKL A;  2IIM A;  1U3O A;  4WCI A;  4J9D A;  2OAW A;  3EG0 A;  3NGP A;  1AWJ A;  1GL5 A;  1WA7 A;  1B07 A;  2AKK A;  4F14 A;  4HVU A;  3GBQ A;  1PRL C;  4LUD A;  2RQU A;  5I11 A;  2RPN A;  1AVZ C;  1V1C A;  2DL4 A;  1TUD A;  2D1X A;  2J6F A;  2X3X D;  1WLP B;  1UEC A;  2YUP A;  2B86 A;  4CC2 A;  3KFV A;  1S1N A;  1T0J A;  2BZY A;  4RTW A;  2BTT A;  2OJ2 A;  1T3S A;  1N5Z A;  1E6H A;  1AWO A;  1Y57 A;  1U06 A;  2O88 A;  2O31 A;  2BZ8 A;  1OPK A;  1PKT A;  2RMO A;  4M4Z A;  3UF4 A;  1M8M A;  3VS7 A;  1WXT A;  1Y0M A;  4DEY A;  2GTO A;  2V1Q A;  2ED1 A;  3H0H A;  4Z8A A;  1Z9Z A;  1UTI A;  1ARK A;  1GFD A;  1AWW A;  2KYB A;  2CT4 A;  3PVQ A;  5IH2 A;  2A36 A;  4OMN A;  2KBT A;  2EYW A;  2DRK A;  1G2B A;  2EGC A;  5FWC A;  1I1J A;  5ECA A;  4LNP A;  4JJC A;  1AD5 A;  1OV3 A;  2HBW A;  2V1R A;  1WI7 A;  2DMO A;  3H41 A;  4FSS A;  4EIK A;  2HSP A;  2JM9 A;  2L3P A;  4J9B A;  2MCN A;  4LUE A;  1AOJ A;  2GQI A;  4CC3 A;  2EVR A;  1JEG A;  1K4U S;  3VS6 A;  2KNB B;  1NLO C;  1TG0 A;  1RLQ C;  4RTT A;  1KFZ A;  1YWO A;  1W70 A;  2CRE A;  1UJY A;  1WXB A;  2D8H A;  2XMF A;  1GBR A;  2J06 A;  2K3B A;  3EGU A;  2VWF A;  2CSI A;  2JXB A;  3QWX X;  2DL5 A;  2K2M A;  2EYX A;  1G83 A;  4GBQ A;  5GJV B;  1UUE A;  2J6O A;  2M51 A;  4Y92 A;  1FMK A;  1RUW A;  2EYZ A;  3I5R A;  3PE0 A;  1NEG A;  2KXC A;  2PTK A;  2JM8 A;  1AWX A;  2JT4 A;  1QKX A;  3TVT A;  4JPB W;  4QT7 A;  1ZUY A;  2DBK A;  5EC7 A;  1MUZ A;  2DJQ A;  4J9H A;  1YWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...