4OMNA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omnA00
2KNBB 1UJYA 2ABLA 5HCKA 1NYFA 2A36A 2DJQA 1UJ0A 1ARKA 4F14A 2GTOA 1QKXA 2K7AA 1UECA 2LNHB 2F2XA 3VRYA 5I11A 2PZ1A 1M3CA 4CC2A 3VS5A 4J9CA 1TUCA 2FEIA 2CT4A 2KRNA 2FPEA 1OPLA 2X3WD 4JPBW 4LN2A 3VS4A 1K0XA 1ABQA 2DLPA 3RBBB 1AEYA 2EYYA 1UUEA 2DL3A 2JS2A 1I0CA 2K6DA 2A37A 2RF0A 3H41A 5IH2A 1VYUA 2DYBA 2RQVA 1ABOA 3CQTA 1MV0B 3I9QA 3NHNA 1BK2A 1AZGB 2F2WA 1WI7A 2JMCA 2E5KA 1FMKA 2D0NA 2J6FA 4AFQC 5IXFA 2LP5A 1TUDA 3R6NA 2FPFA 1S1NA 1FYNA 2D8HA 2ESWA 2LMJA 1AD5A 1UGVA 1HSQA 2J7IA 2VKNA 1UTIA 3H0FA 4Z88A 4F17A 1H8KA 2YSQA 1OEBA 2KT8A 1JEGA 3UATA 2CSIA 1K4US 2RN8A 4QT7A 1ZUYA 2W0ZA 4JZ4A 4EIKA 4HXJA 5L23A 1VYTA 2K2MA 2O88A 1I1JA 1YNZA 1YN8A 1UHFA 4LNPA 3H0HA 3I5SA 1JU5C 4AFZC 1WXUA 4JJDA 2DL7A 2VVKA 1GCQC 2DMOA 2HDAA 3KFVA 2YUOA 2EVRA 2L0AA 3PVLA 2DRKA 2LCSA 3C0CA 4K11A 3M0TA 2M0YA 1G83A 2LZ6B 1M27C 5IHKA 2DBMA 1UHCA 1AWWA 1H92A 2KR3A 4CC4B 1ZUUA 4F16A 1PWTA 3M0SA 4M4ZA 1BBZA 1SPKA 3UA6A 1X43A 2PTKA 2JMAA 1Y0MA 1GBQA 2CDTA 2DILA 1M30A 2DM1A 2MCNA 1X6GA 4RUGA 2BZ8A 1RI9A 1NG2A 1GBRA 2F2VA 2ROLA 2YUNA 2DA9A 2FG0A 1UDLA 2LJ1A 2C0IA 1GCQA 2RQUA 4IIOA 4ESRA 1T3LA 1SHGA 2EGAA 2EYWA 2RNAA 2EKHA 2LX7A 3REAB 3ZL7C 1E7OA 1UFFA 1BU1A 1BB9A 4IIMA 3VS7A 2ROTA 4JZ3A 1MUZA 1U3OA 2KXDA 1WXBA 2ENMA 2FRWA 2P4RA 4OMOA 1NM7A 2ECZA 1AOJA 1T3SA 4X1VA 4HVWA 2GQIA 1YWOA 2J06A 4Z8AA 2JM9A 2FO0A 3VS0A 2YUPA 2KXCA 3EG2A 1E6HA 2DE0X 4J9IA 4RTTA 3PE0A 2EPDA 2DRMA 2JM8A 4CC3A 2EW3A 1QLYA 1M3BA 2JXBA 2YDLA 2L3PA 1ZSGA 2NUZA 1JQQA 2B86A 1WIEA 2M51A 2O9VA 1GFCA 3M0RA 1QWFA 2AK5A 4Y92A 3NMZC 1JXMA 2KE9A 5IHIA 2BZYA 1OOTA 2CH4W 5GJVB 1IO6A 3I35A 1VYVA 1AWJA 1T0HA 2PNIA 3QWXX 2O31A 1AWXA 4J9GA 1WDXA 1QKWA 4J9BA 2YT6A 3EHRA 1U5SA 3NPFA 1HJDA 1ZBJA 2DL5A 1V1CA 4J9FA 2JS0A 1OV3A 4J9HA 4CC7A 1GCPA 4HVUA 2H8HA 1UG1A 4JJCA 3RNJA 1YCSB 1RLQC 3VS6A 4OMLA 2CSQA 2MOXA 1GRIA 4OMNA 1XOVA 2KYBA 4R0KA 3GBQA 5FWBA 3EG1A 1WXTA 2QDLA 1TG0A 1K0SA 2YUQA 1WLPB 3EG3A 5IHNA 2BTTA 2KRSA 4OMMA 2L2PA 4Z89A 4LUDA 1SHFA 1WYXA 2O9SA 1LCKA 1PNJA 1PKTA 4WCIA 4RTYA 2FPDA 4RTXA 3SEMA 2O2OA 1JXOA 1CKBA 3TVTA 1SRLA 3EG0A 2I0NA 2KRMA 1J3TA 4HCKA 4J9DA 4A63B 4OMPA 1WA7A 2KROA 1GL5A 1A0NB 1RUWA 2MIOA 1M3AA 2W10A 1KIKA 2J6OA 1QCFA 1CKAA 2VWFA 1E6GA 1AWOA 4D8KA 1SRMA 2A28A 1NYGA 2DBKA 2IIMA 3EHQA 2OJ2A 4OMQA 4E6RA 5EC7A 1NLPC 1X2QA 2AKKA 2J05A 1NEBA 1PHTA 4AFUC 2SEMA 2CH4A 1NLOC 1KSWA 2ED0A 3VS1A 3VS2A 1PRMC 4LE9A 1X6BA 2CT3A 1Z9QA 2HCKA 1JO8A 1ZLMA 4KRTA 2ED1A 3EGUA 3M0QA 2JTEA 2EBPA 2G6FX 2GBQA 3FJ5A 1Y57A 4RTZA 1QWEA 1K76A 1MV3A 2LQNA 2JW4A 5ECAA 1K1ZA 1UE9A 2LJ0A 2HSPA 3UA7A 3REBB 2KGTA 2RPNA 2XMFA 2C0TA 1SSHA 2DVJA 1N5ZA 2DL8A 1X2KA 3M0PA 2DF6A 4RTVA 3H0IA 3ULRB 3TSWA 2KBTA 2CUDA 3NGPA 2KEAA 1T0JA 2SRCA 3VRZA 4J9EA 4DEYA 1I07A 2OAWA 3PVQA 5I22A 1X69A 2K3BA 2J6KA 2EYXA 2GGRA 2CREA 3VS3A 1G2BA 4ZNXA 2AZVA 4HVVA 2DNUA 2LJ3A 2X3XD 2V1QA 3I5RA 2K79A 2KYMA 1B07A 4AFSC 2HBWA 1K9AA 2RQWA 1GFDA 2RQRA 4FSSA 1W1FA 1SEMA 1Z9ZA 4AG2C 1B3QA 1YWPA 2D8JA 1YP5A 3QWYA 2FRYA 1W70A 1CSKA 5FW9A 4GBQA 1W6XA 2BZXA 4DEXA 2GNCA 4RTWA 2AKLA 1EFNA 4RTUA 2EGEA 2K9GA 3IQLA 1RLPC 3JV3A 1NEGA 1U06A 2EYZA 2V1RA 3SHWA 3A98A 2LQWA 2RQTA 3LH5A 2AZSA 1HD3A 3M0UA 2D1XA 5IXBA 1AZEA 2C0OA 5FWCA 1WFWA 4JJBA 4LUEA 1KFZA 4GLMA 5GJWB 1PRLC 1OPKA 1AVZC 1VA7A 1ZX6A 2CUBA 1H3HA 1X27A 3U23A 4AG1C 2HEQA 1PKSA 3THKA 4D8DA 2GTJA 3UF4A 2KT1A 2L3SA 2DX1A 2DL4A 2EQIA 2L3QA 2NWMA 2EGCA 1ZUKA 2JT4A 3O5ZA 2RMOA 1KJWA 2OI3A 4ORZA 1WX6A 1M8MA 3TSZA 2A08A
chains in the Genus database with same CATH superfamily
3HFOA 4C92G 5GAMd 1K73R 5HCKA 4BE2A 2JJ9A 3RR6A 2QDYB 3L1AA 3I56T 5FU7B 1UJ0A 3OBYA 1X75C 3BFMA 2PUKB 5CQXA 2DD5A 4M7AG 1WHKA 4IUUA 3VJPA 2CZ6B 2F2XA 3HPWA 2QAZA 2L89A 3OYIA 3JB9I 3QO3A 5LJ5d 2FEIA 2XI9A 1W2BA 1VQ7T 2DLPA 1OYXA 1KC8C 2QQ9A 3CCVT 1MGQA 3EH1A 3L2WA 1ACMB 1ZSZC 3JCMh 3ZBDA 4HKEA 2A37A 3OA6A 2KAFA 4UC4A 2D0QB 3L2VA 1QVGS 4C8QC 5M9OA 3PTAA 3CC4A 3JCMW 4BY6B 1AZGB 2F2WA 1VQPA 5C0MA 2E5KA 2QQAA 5KYNA 3URGA 4M7DD 1Y96B 1KD1U 2EQMA 3SWNB 1QVFS 1FYNA 4M7AD 1AD5A 1UGVA 3LGFA 3CMAQ 1VQPT 4A4EA 4LDXA 4KH1B 3OMGA 3E9FA 4AT1B 1YFNA 1JEGA 4NS5A 3CBMA 2XDBA 2XICA 2W0ZA 5KYXB 3CPWS 2CP2A 4F7UE 4PJOD 1VYTA 1PD0A 4M78B 2O88A 3H0HA 2VASA 2A7YA 2EYQA 4FIBA 3I5SA 4JLIA 4BDZA 4JJDA 2XD0A 3KFVA 4DA4A 2EVRA 2LCSA 4Z02A 3FB9A 3MP6A 4M7DG 2DBMA 3HL8A 1HYOA 1AWWA 5GAOl 1V76A 1G3TA 5GAMg 4F16A 4M4ZA 1R8OB 2BE7D 2E6ZA 2YRVA 2DILA 2MCNA 1X6GA 3I55A 1BKBA 4X9CA 4BUGA 1NG2A 2ROLA 3RESA 4M75C 3G6EA 4ZTFA 1OZ2A 2DZ9A 4FU6A 1YHQA 4OGCA 4EMKA 3O8VA 4LXCA 3V7RA 1T3LA 2EGAA 2KSSA 2RNAA 5CVIA 3JB9D 3FRNA 3REAB 3VUZA 1QVGP 1BB9A 4II1A 4IIMA 2ROTA 4JZ3A 4JLGA 3A8GB 4PJOF 2MF2A 1MMGA 4M75B 4HVWA 2V8IA 4KGXB 1Q82U 9ATCB 2BKDN 3VS0A 2KXCA 4BE0A 1N9RA 1UGQB 3PE0A 4NL2A 5I21A 2EPDA 4M75A 2DRMA 3S6WA 1M3BA 2JXBA 2Y4XA 2YDLA 3OY9A 2L3PA 3JCMb 1QQJA 4PJJA 5IN1A 1QWFA 4QKUA 4C0GA 3LH0A 3TEEA 3X20B 4BDYA 3G71T 2BZYA 5GAMf 1IO6A 1VYVA 3N5BB 4ZGJB 4QVCA 1T0HA 2PNIA 3HRSA 3GLXA 3PNWC 2GF7A 2VGMA 3OS0A 2QTVA 4IURA 3MJXA 1VQNQ 1V29B 2HMAA 1M1KU 3JCMV 3PIPA 2M0OA 4LD9K 4FYXB 1X01A 4J6XA 4CRIA 2JN0A 3FEOA 4J9HA 4CC7A 3X26B 4HVUA 1UG1A 1YITQ 2CGHA 4J7IA 4QVZA 3CCEQ 4OMLA 2CSQA 2IG0A 3NTHA 5FWBA 2RJCA 2MWPA 2DTHA 5FLXE 1K0SA 4F04B 2YUQA 3HTRA 4DOWA 3KXTA 2KRSA 4OMMA 5CCAA 2L2PA 5LL6S 1M90U 2KQWA 1WYXA 1ZQ1A 2FHDA 2ZPBB 4MZMA 4N4GA 4IUQA 4YTLA 3CCUT 1CKBA 1SRLA 1NJIU 2I0NA 1J3TA 3S3OA 1D0ZA 4OMPA 1XNIA 3C4SA 4CI0C 1WA7A 4FL6A 3GPLA 2DXBA 3MEUA 3CC7Q 1YIJA 4J6WA 1KIKA 3MCAB 2J6OA 2HQXA 2O4XB 2VWFA 3MP1A 3JRZA 1VQKT 4TVRA 5DM7R 5LJ3h 4M7DE 3EHQA 4OMQA 1NLPC 5GAN6 5CAIA 2QA4A 2J05A 3GNFB 2RH2A 3PMIA 4AFUC 2CH4A 3V8KA 1KSWA 1YITA 4M7DF 3UPUA 3VS1A 2DIGA 3G71Q 2L8DA 4N4HA 2CT3A 1JO8A 5FU7C 3G6ET 2V8KA 7AT1B 5AYFA 3OYYA 5GMKi 1WHGA 3QXEB 4PFOA 3JB9F 3LLRA 1OX9A 3BY7A 5GAOm 3M5AA 4DBFA 2K3XA 3UA7A 2HSPA 3REBB 5HY6A 2RPNA 2DAQA 3EFRA 2DVJA 3CCLT 1N5ZA 2DL8A 1X2KA 3M0PA 4PFPA 1JJ2P 2QA4T 2R5AA 3NGPA 2BE9B 1N27A 2VUBA 4J9EA 3EGDB 1PSFA 4ZGEB 4MMKA 5HK3A 1I07A 3J81E 3PVQA 4C92C 1VQ6A 2EYXA 1JRIA 2CREA 2Y4YA 4M7DA 1G2BA 2RJEA 1VQ8A 3CCSQ 3EGDA 1TTHB 2V1QA 1RAFB 3C12A 2KYMA 5IT9E 2FL7A 3CXCS 2A3LA 4E7KA 1QVFA 2RQWA 4FSSA 3CCSA 4AG2C 1B3QA 1YWPA 2HBPA 5GAN7 1I4K1 3NTIA 3OW2P 3OYNA 1W6XA 2RI3A 4DEXA 2GNCA 4RTWA 4EDUA 4FW1A 4E7SA 3QHSA 1MNEA 3QBYA 4RTUA 1C1AA 1RLPC 3JV3A 1IHVA 2DIQA 1PD1A 4J8OA 1YI2Q 3MEVA 4R56A 2CP0A 4A53A 1VQ6Q 1I5OB 3PT9A 3CC2Q 1ZA2B 1HD3A 4E2FB 1YJNT 3CCMT 2ZPEB 1WGSA 1AVZC 1QP2A 2CUBA 2HQHA 1H3HA 1M1FA 2QTXA 3U23A 5GAN2 4AG1C 2R58A 3ASKA 3X25B 1GXIE 2DD4A 2L3SA 4FT4A 2ZCFB 2ZPIB 5L8RE 1U1TA 3HHTB 2RMOA 3G4SQ 1FWZA 5GAOn 2I2LA 4R55A 4HCBA 1KG1A 1RAEB 1UJYA 1K73C 2A36A 4OB0B 2VB6A 4M7AA 2GTOA 1QKXA 2X4JA 3RKYA 1UECA 5A0LA 2COYA 3RIRA 3L2UA 1RAHB 3GOXA 2E3HA 1FMWA 2RM4A 1BI1A 2FPEA 2X3WD 3VS4A 3CMAA 1HXDA 4A54A 3CCET 1AEYA 3EG9A 2EIFA 1UUEA 1N8RU 4N0AA 3VKIA 3OW2S 3EFSA 1N8RC 3L2RA 3G4SA 2K6DA 3A8OB 2RF0A 3JAME 4M75G 4KGZB 3HSBA 1M2VA 2DYBA 1YJWT 2P0QA 1ABOA 2CP7A 1P92A 3CQTA 1MV0B 3I9QA 4IUPA 1BK2A 2JMCA 3KUFA 2K5IA 2D0NA 3M9QA 5IXFA 5GAN8 2LP5A 5EG2A 3GP8A 4J5YA 1S1NA 1D3BB 1WQ7A 4B6MA 2LNVA 1IREB 3P8HA 3QG1A 1BCMA 3FJPA 4A4KA 3OS2A 2AT1B 4A4GA 2YSQA 1OEBA 3CXCA 4OP0A 2DVEA 2F5TX 2YRDA 3LX7A 4RCBA 5HKCA 3OYKA 4M78A 3CCST 4QT7A 2OTLT 3WVEB 5DLOA 1WJQA 1S72Q 4FYYB 4EIKA 3MHXA 5L23A 5LJ3d 4M78D 5I2SA 2ZGWA 1YNZA 1YN8A 4LNPA 1QW1A 5CQYA 1R0CB 4AFZC 2RHIA 5KYXA 1M2OA 1VIEA 2DL7A 2VVKA 2JVVA 1XQHA 4IUVA 2HDAA 3RKWA 2PUOB 1FMVA 3HFNA 2H3EB 1Y71A 3ER0A 2LZ6B 1G8XA 4NOYA 1Y96A 1VQ4T 1M1KR 1K8AC 1WZOA 1H92A 1ZUUA 1B7TA 3QJ6A 5GAMe 2B8AA 3BDUA 4XU2A 2K3YA 1GBQA 4M77A 2JOYA 2DM1A 3G7ZA 1I5LA 2BZ8A 1RI9A 2MWOA 2NLUA 1ZSZB 2XHCA 2YUNA 2DA9A 1C6VX 5CKBA 2FG0A 1UDLA 5FU6B 3CMET 3CD6A 4IIOA 4ESRA 3CMEQ 2K4YA 1YJWQ 1SHGA 3MP8A 1NPRA 4XTXA 3ZL7C 3CCVA 3VS7A 5DLQE 2P4TA 1MUZA 4PFZA 3VU3C 2KXDA 5GAMj 3M4GA 1NM7A 1AOJA 4MDWA 4PJOB 1VOMA 4HA8A 2J06A 1RACB 5FU6C 2JM9A 2FO0A 4M77F 3M54A 1OX8A 1E6HA 1IZ6A 3G71A 4PL6A 4PJMA 2JM8A 3E19A 5LJ5j 1D1CA 2K2VA 1KQ1A 2NUZA 2OTJQ 1JQQA 2B86A 5FRNA 2PU9B 4ZGDB 1KQSS 1IRXA 2FYKA 2M51A 1VQ8T 2O9VA 1GFCA 4M7AB 4JRPA 4Y92A 5KE2A 4EMKC 5GAMh 1Q82R 1OOTA 4C5IA 3DB4A 3DLMA 3I35A 2EQJA 2L5QA 1AWJA 3CC7A 4C92B 1VQMQ 5GMKe 5A0DA 2CP6A 1PG5B 1YIJT 4IKFA 1Q86R 2O31A 5KH6A 3WVDB 4E7JA 1KD1C 4J9BA 3EHRA 2HQEA 3EG9B 1UGPB 5LJ5h 1IB8A 1YBYA 3A1PA 3A8HB 5CKHA 4J9FA 1YJNQ 1GCPA 2RHYA 3HRUA 3JCMd 3CC2T 2RD1A 3BDLA 5GANh 3CCLQ 2MOXA 3CPWA 2CP5A 1XOVA 2DO3A 3OQ5A 2DXCA 3D7SB 3OSVA 1TXQA 1TG0A 3OYDA 1VQNA 2QXFA 2JTMA 2Z0WA 1VQ7A 4C0DB 4Z89A 2YLBA 2O9SA 1BI3A 1PKTA 3RERA 4RTYA 4PLLA 3DB3A 1Q95G 3EG0A 2KRMA 4WTOB 2VXFA 1VQ5Q 4A63B 2HD0A 2DETA 4XU1A 1WJSA 1D09B 1M3AA 2MIOA 3LGLA 1QVGA 1QCFA 2RJDA 2MI6A 1AWOA 1LOJA 4C5HA 2QEXQ 2XKOC 2DBKA 4J6YA 3TU4K 4E6RA 4C92D 1X2QA 3J7AF 4BI4A 4M78C 1NEBA 1PHTA 2V8JA 2O01E 1VQ7Q 5GAOr 3VS2A 4LE9A 3L2QA 2E6NA 2MPXC 2ZPFB 1D3BA 4KRTA 4EPCA 2RJFA 3EGUA 3M0QA 2JTEA 2X4WA 2EBPA 5GANe 2FZKB 2GBQA 4M78E 4ATOA 1TH7A 2QQRA 5GMKm 1Y57A 4Y91A 1QWEA 4OVAA 2WACA 2JW4A 2FVUA 1VIFA 1WJRA 2LJ0A 2KGTA 1EZZB 2YHTA 1M1KC 4RTVA 3H0IA 3BW1A 3MEWA 5CKFA 1Y07A 2SRCA 4PJOG 2OAWA 2RO0A 1MHNA 1X69A 2K3BA 2J6KA 1M9SA 3VS3A 3J80E 1M8VA 1W4SA 2P84A 2A0FB 2LJ3A 2K79A 3QZ9B 3E1SA 4QVDA 1B07A 1VQLT 2LCCA 4AFSC 1EIFA 4HT8A 5D6YA 2FZCB 5LJ5e 1SEMA 1ZA1B 3OMCA 1EX4A 2D8JA 3QWYA 4FM4B 1CSKA 5FW9A 2F1LA 1KQSP 1NJIR 5KYWA 1M5Q1 2GFUA 3CCRQ 4C5EA 2Y90A 3JCMJ 3CD6T 3E2UA 1K9MU 2L3RA 3CMEA 2EGEA 1W2BP 1BYMA 1BI0A 1G3WA 1VUBA 1NEGA 1U06A 3VUBA 3QIIA 2C06A 2CS7A 2V26A 3QSUA 3CPFA 2CZ7B 5KCOA 2AZSA 3M0UA 3P8DA 2C0OA 1WFWA 4LUEA 3L2ZA 3Q1JA 1BIBA 1YHQT 2E1HA 1JBMA 1OU8A 1YJ9A 5GJWB 4FYWB 5LJ3g 1X27A 2HL5C 1B34B 3T9NA 2GTJA 3UF4A 3VV0A 1Q81U 2HSEB 4M77D 4VUBA 4C8QF 2NWMA 2EGCA 4DBHA 1ZUKA 2PVDB 1KD1R 4WF2A 3CBPA 1IGUA 3JCMQ 2A08A 3CCJA 1NE8A 2KNBB 2QYZA 3JB9H 2QA4Q 3I56A 1F1BB 5LJ5g 3CC4Q 1WQWA 1NYFA 4IUTA 2DJQA 2QI2A 4P5NA 4F14A 1VQ9A 2QK0A 2WSCE 1VQ9T 5I11A 3RDVA 2PZ1A 2ZPHB 2LQKA 3VS5A 1TUCA 2E4HA 3KBGA 4XK8E 1K0XA 1ABQA 3OSSC 3QYGB 2OTJA 3RBBB 2EYYA 2IPOB 2KVQG 4RMOA 2DL3A 3FDRA 1WHLA 2NUPA 1VQOQ 2X9HA 3H41A 2LDMA 3OYGA 1VYUA 4FCYA 1QVFP 3VYGA 1SG5A 2CZ0B 4C92F 3CCJQ 1VQKQ 3C94A 3BE3A 1VQNT 2J6FA 2OTLA 1UB4A 2D6FA 1TUDA 4M7DB 1MNDA 4M7AF 2D8HA 1UEBA 2F5KA 1WPYA 1HSQA 2VKNA 2RHZA 1W2BS 4C8QE 3P8BB 4RG8A 2DZCA 4F17A 2QGGA 3TCJA 2YWWA 2E3IA 3V7CA 1YJNA 2EQKA 3LWIA 3G6EQ 4RCCA 2RHXA 3AT1B 2HL3A 2QEXT 2LQ8A 3V8JA 3G1JA 4HXJA 1VQ4A 5GMKl 4HT9A 1K8AR 4FSXA 1I1JA 2QG9B 1G3YA 2HKQB 1QP3A 4J7FA 1DJ7B 5CO7A 1GCQC 1VQ8Q 5D6WA 2HAXA 2DMOA 2XDDA 4PJNA 2L0AA 4ZTJA 2DRKA 5AT1B 3CCRT 3C0CA 3M0TA 4KUIA 2M0YA 5J26A 1WHJA 4PJOC 1OU9A 2PVOB 3JCMg 2CP3A 4BY6C 5I2MA 3M57A 1PWTA 4PNOA 2PVGB 4MDXA 1SPKA 2EQUA 3HKSA 3OYCA 4BI8B 2PTKA 1XJWB 1Y0MA 2CDTA 4X34A 3JCMc 1TS9A 2QQBA 4C92E 1VQ6T 4RUGA 1QMCA 2M1HA 4M7AC 4OB1B 5KYYA 4MZTA 1JB0E 2D9TA 4M7AE 3A5ZB 3JSCA 2DKGA 5J39A 2C0IA 5J3BA 1M1GA 1RABB 1GCQA 2RQUA 1G3SA 2JTFA 3LWHA 3META 3MEAA 2JUFA 4JUVA 2X35A 2LX7A 3EH2A 4O5VA 1UFFA 2VYTA 3QYHB 1U3OA 1MMNA 4ME7A 1WXBA 2P4RA 4OMOA 4C8QG 4PJOE 2ECZA 2NYSA 4X1VA 4LDYA 3CCMA 1R0BG 2DFUA 2E12A 1Q82C 3EG2A 2DXUA 1D1AA 2NUPB 2EW3A 3EFOB 5IAYA 3H6ZA 4DOVA 5FROA 2ZPGB 3E9GA 4QQ6A 2ZAEA 4OB3B 4B9XA 4BD3A 1NJIC 4PKCC 3PFSA 1KC8U 2M16A 3PIOA 5GJVB 3M56A 3JCMf 3OYLA 1M90C 2VC8A 3QWXX 4MMLA 1M4ZA 2M02A 1TU0B 4J9GA 3CD6Q 4F7UG 1QKWA 4ELYC 1BI2A 2IVWA 3NPFA 1HJDA 3JCMP 1ZBJA 1X6OA 1R77A 1V1CA 3UT1A 2JS0A 1OV3A 1KQSA 3OS1A 1RLQC 3WXMB 1G5VA 1Y7XA 3JB9J 1GRIA 4OMNA 1SKUB 4R0KA 2JZ2A 3TREA 3M55A 1NPPA 1VQKA 4F7UA 1YJ9Q 1WLPB 3EG3A 5IHNA 1VQOA 4BB7A 1HK9A 3DLLA 4DBRA 4F7UB 4A4HA 4M77E 2HZYA 4MZPA 4WCIA 3G4ST 3SEMA 1BCOA 1JXOA 4FT2A 1VQLA 3CMAT 1MMDA 1ZBXA 4J9DA 5KYUB 1YIJQ 3OYJA 1A0NB 2KROA 3M53A 1GL5A 1RUWA 4BI3A 2H3JA 2ATCB 3QPHA 4JS4A 3CCUA 4NL3A 4M78G 2LTOA 1RAGB 1TUGB 4Q5WA 5KYUA 2A28A 1Q81C 1NYGA 2OJ2A 3EAEA 4EMGA 3MKDA 1NBEB 2SEMA 1NLOC 4EMHA 2XU8A 2ED0A 3S3NA 1PRMC 3JCMX 3CCVQ 3DKMA 1X6BA 6AT1B 1WHHA 1YHQQ 1Z9QA 2HCKA 1IXDA 2LT4A 1PSEA 1ZLMA 2GFAA 4FW2A 3JB9G 2ED1A 4OGEA 3OYBA 3FJ5A 3AHUA 2K57A 5D6XA 1IGQA 1K76A 1MV3A 4N0AC 1Q86U 2LQNA 3GNGA 4OF1A 3CXCP 4QQDA 1KHIA 1Q7YR 2C0TA 1SSHA 5CIUA 3QDFA 2KBTA 2CUDA 2AIRB 1T0JA 4M75E 2RI5A 1OQKA 4DEYA 4ZN3A 3CC2A 2BUDA 3OYHA 4C8QD 5I22A 2EJ9A 2GGRA 8AT1B 3R6OA 2K5LA 1JJ2S 4JRKA 2P0PA 4DQ2A 2AZVA 4RG2A 4HVVA 4KT0E 2OAUA 2DNUA 2DEQA 4XTZA 4C0DC 3SFMA 1LJOA 1VQ9Q 2KMTA 2X4XA 4O6JA 3NTKA 2HBWA 3CCQQ 2AHJB 1GFDA 2QEXA 2RK1A 3F70A 4LDUA 1Z9ZA 1YP5A 4L59A 1W70A 4JRQA 4GBQA 1PM3A 4B9WA 2AKLA 1EFNA 3IQLA 2K9GA 2DYIA 2MK5A 5LJ3j 2EYZA 4M75D 4LDVA 2DTOA 5C6SA 3CCJT 3FC3A 3GF5A 1D0XA 3QKJA 3SWNC 3A8LB 1OI1A 3LH5A 5IXBA 2D1XA 2YRCA 4JJBA 2QASA 1KFZA 1WHMA 3C95A 4GLMA 1H3ZA 3OYEA 1PRLC 2MYSA 3SD4A 2HEQA 1PKSA 3THKA 1YCYA 3QJYA 3HP9A 1YJWA 2K5FA 2RA2A 1N6AA 2L3QA 3I55Q 4GLKA 2JT4A 5A2QE 4ZN1A 3X24B 1S72T 4ORZA 1WX6A 3FLGA 2F69A 4M77G 5LJ3e 5GANd 2LX9A 1YITT 1C0MA 4XTUA 2ABLA 2XG8D 1VQMT 3QZ5B 1LNXA 1VQMA 2CYZB 4QQGA 5GMKj 1QVPA 1UGSB 3I56Q 1ARKA 4XTWA 1SSFA 2K7AA 2QGFB 2LNHB 3VRYA 3V8LA 1N9SA 1M3CA 4CC2A 5CKDA 4J9CA 3SB2A 2CT4A 2KRNA 3OB9A 4LN2A 1OPLA 4JPBW 4BACA 3CCMQ 2GCXA 2JS2A 1VQOT 1I0CA 1SF9A 5IH2A 2RQVA 3INZA 1QCNA 4OMFB 3NHNA 1BIAA 3M59A 5CR2A 1WI7A 5GANj 1FMKA 4AFQC 3PMTA 3R6NA 1FX7A 2FPFA 4C5GA 2ESWA 2COZA 5GANf 2LMJA 2J7IA 1UTIA 3H0FA 1WNLA 4Z88A 4N4IA 1H8KA 2R57A 2KT8A 4XQ3A 1RI0A 3EGXA 3UATA 2CSIA 1K4US 2RN8A 3ZFJA 1OULA 2WSEE 4BE1A 1ZUYA 3QDRB 4E7LA 3UWNA 1JJ2A 1KK7A 4JZ4A 4M78F 2EKOA 2K2MA 1Q81R 2YLCA 1UHFA 4AMCA 1JU5C 1VQ5A 1WXUA 2R5MA 4E7HA 3LYIA 2YXYA 1N8RR 1D0YA 3CCUQ 2YUOA 2VGNA 3PVLA 5GAN4 2NUTA 1O9SA 4K11A 3HRTA 1G83A 1M27C 5IHKA 2EWNA 2VXEA 1UHCA 4PJLA 3RMSA 4XU3A 2KR3A 1RADB 4CC4B 4V2SA 5FRMA 4M77C 4PJOA 3M0SA 3NFCA 1BBZA 3UA6A 1X43A 2DEUA 2JMAA 3OW2A 1M30A 4DBQA 3QUIA 1TWBA 4EMKB 3CCLA 3OBWA 1GBRA 2F2VA 4L6V5 2LJ1A 3RUXA 3OYAA 2DJZA 2CKKA 2RB6A 5KYYB 2QQSA 2EYWA 3CBOA 2EKHA 4ELZC 2EJFA 3X28B 2LVMA 2BIVA 4RKUE 4X9DA 1E7OA 1BU1A 4XAXB 5GAN5 2MMPA 2ENMA 2FRWA 4KBMB 1T3SA 3RKXA 2GQIA 4Y28E 5A0GA 3EFOA 1YWOA 4Z8AA 1KC8R 2YUPA 1H641 4QW2A 2DE0X 4J9IA 2XIDA 4RTTA 4KULA 2DPPB 4LDWA 1LPLA 2E41A 4CC3A 4D6WA 3CC7T 1PC0A 1ZHIA 1QLYA 1YI2T 3M4YA 1M2VB 1ZSGA 1WIEA 2XDPA 5GMKh 1U1SA 4C8QA 5GAOp 4F7UF 1VQLQ 3M0RA 4KH0B 2AK5A 3A8MB 1XTDA 3NMZC 1JXMA 2KE9A 5IHIA 2CH4W 4FYVB 2LC4A 3CCQA 1I8FA 4J83A 1S72A 1AWXA 3ME9A 1WDXA 2YT6A 3UDCA 3V7SA 1U5SA 1Q7YU 4C92A 4PLIA 5GAOq 2DL5A 2PQWA 4E7IA 1PCXA 4XU0A 4M75F 1VQPQ 2H8HA 2LT1A 4JJCA 3RNJA 1YCSB 3OYMA 1Q86C 1AT1B 2HKNA 2ZZDA 3VS6A 3PGGA 4KUDK 2FZGB 1TOVA 2KYBA 1OZ3A 3GBQA 5CK9A 3EG1A 1WXTA 2QDLA 2DK3A 2LCLA 2OTLQ 1Q7YC 3SWNA 1YJ9T 2BTTA 4HCZA 3OYFA 3CCEA 3GIBA 2OTJT 2P0KA 4LUDA 1SHFA 3JCMe 4JJNK 4PK4A 2JNGA 1LCKA 1PNJA 3I55T 4HCCA 1K73U 2FPDA 3EGXB 4RTXA 2O2OA 2LRQA 1D1BA 2X4YA 4JDSA 1QCOA 3TVTA 3CCQT 4E7ZA 1B34A 4LD6A 4HCKA 2O4XA 1AHJB 3SDZA 3CCRA 2HNIA 2EJGA 2W10A 1RAIB 1CKAA 1E6GA 4D8KA 1SRMA 2IIMA 4A4FA 5LJ3f 2RK2A 4C0FA 5EC7A 3H9NA 2AKKA 3M58A 4XTVA 5D7UA 2DXTA 2OX7A 4L5GA 2KI7A 2E64A 3LW5E 2WSFE 4JRIA 1K9MR 2KDSA 5DY9A 2G6FX 4RTZA 1ZSZA 2KY9A 5ECAA 1K1ZA 1UE9A 1LVKA 2XMFA 1K9MC 1FXXA 2M9UA 5GAN3 1KQ2A 2DF6A 3ULRB 3TSWA 2MAMA 2KEAA 3VRZA 1UGRB 3RMQA 4C8QB 1YI2A 2GQVA 2DTIA 3CC4T 1TSFA 4JS5A 3CEYA 4ZNXA 3L42A 2X3XD 3I5RA 2G3RA 2RI2A 1K9AA 2KK4A 4GY5A 2RQRA 1M90R 1W1FA 1KHCA 2E65A 3ZEHA 2FRYA 5HK0A 2X51A 2BZXA 1MMAA 1VQ4Q 1VQ5T 3H8ZA 3MPUB 1IHWA 1I81A 2VV5A 2FB7A 2E5QA 5KYWB 2E70A 8ATCB 5LJ5f 3SHWA 2V1RA 2EFIA 1RL2A 3A98A 2LQWA 2RQTA 3VYHB 4ANJA 5KCHA 4E47A 2NUTB 4KGVB 3TQ7P 1AZEA 5FWCA 3FIFA 2CZ1B 1OPKA 2RHUA 1VA7A 1ZX6A 2XK0A 1RAAB 2COWA 4OB2B 2DERA 4D8DA 2EAYA 5GANg 3OS5A 2KT1A 4M77B 2E10A 2DX1A 4C0ZA 2DL4A 2EQIA 3S3MA 1NZ9A 3CPWP 4M7DC 3O5ZA 4XTYA 1KJWA 2OI3A 3MO8A 1O75A 5CKEA 1K8AU 1M8MA 5KE3A 3TSZA 1U8RA
chains in the Genus database with same CATH topology
2KNBB 1UJYA 2ABLA 5HCKA 1NYFA 2A36A 2DJQA 1UJ0A 1ARKA 4F14A 2GTOA 1QKXA 2K7AA 1UECA 2LNHB 2F2XA 3VRYA 5I11A 2PZ1A 1M3CA 4CC2A 3VS5A 4J9CA 1TUCA 2FEIA 2CT4A 2KRNA 2FPEA 1OPLA 2X3WD 4JPBW 4LN2A 3VS4A 1K0XA 1ABQA 2DLPA 3RBBB 1AEYA 2EYYA 1UUEA 2DL3A 2JS2A 1I0CA 2K6DA 2A37A 2RF0A 3H41A 5IH2A 1VYUA 2DYBA 2RQVA 1ABOA 3CQTA 1MV0B 3I9QA 3NHNA 1BK2A 1AZGB 2F2WA 1WI7A 2JMCA 2E5KA 1FMKA 2D0NA 2J6FA 4AFQC 5IXFA 2LP5A 1TUDA 3R6NA 2FPFA 1S1NA 1FYNA 2D8HA 2ESWA 2LMJA 1AD5A 1UGVA 1HSQA 2J7IA 2VKNA 1UTIA 3H0FA 4Z88A 4F17A 1H8KA 2YSQA 1OEBA 2KT8A 1JEGA 3UATA 2CSIA 1K4US 2RN8A 4QT7A 1ZUYA 2W0ZA 4JZ4A 4EIKA 4HXJA 5L23A 1VYTA 2K2MA 2O88A 1I1JA 1YNZA 1YN8A 1UHFA 4LNPA 3H0HA 3I5SA 1JU5C 4AFZC 1WXUA 4JJDA 2DL7A 2VVKA 1GCQC 2DMOA 2HDAA 3KFVA 2YUOA 2EVRA 2L0AA 3PVLA 2DRKA 2LCSA 3C0CA 4K11A 3M0TA 2M0YA 1G83A 2LZ6B 1M27C 5IHKA 2DBMA 1UHCA 1AWWA 1H92A 2KR3A 4CC4B 1ZUUA 4F16A 1PWTA 3M0SA 4M4ZA 1BBZA 1SPKA 3UA6A 1X43A 2PTKA 2JMAA 1Y0MA 1GBQA 2CDTA 2DILA 1M30A 2DM1A 2MCNA 1X6GA 4RUGA 2BZ8A 1RI9A 1NG2A 1GBRA 2F2VA 2ROLA 2YUNA 2DA9A 2FG0A 1UDLA 2LJ1A 2C0IA 1GCQA 2RQUA 4IIOA 4ESRA 1T3LA 1SHGA 2EGAA 2EYWA 2RNAA 2EKHA 2LX7A 3REAB 3ZL7C 1E7OA 1UFFA 1BU1A 1BB9A 4IIMA 3VS7A 2ROTA 4JZ3A 1MUZA 1U3OA 2KXDA 1WXBA 2ENMA 2FRWA 2P4RA 4OMOA 1NM7A 2ECZA 1AOJA 1T3SA 4X1VA 4HVWA 2GQIA 1YWOA 2J06A 4Z8AA 2JM9A 2FO0A 3VS0A 2YUPA 2KXCA 3EG2A 1E6HA 2DE0X 4J9IA 4RTTA 3PE0A 2EPDA 2DRMA 2JM8A 4CC3A 2EW3A 1QLYA 1M3BA 2JXBA 2YDLA 2L3PA 1ZSGA 2NUZA 1JQQA 2B86A 1WIEA 2M51A 2O9VA 1GFCA 3M0RA 1QWFA 2AK5A 4Y92A 3NMZC 1JXMA 2KE9A 5IHIA 2BZYA 1OOTA 2CH4W 5GJVB 1IO6A 3I35A 1VYVA 1AWJA 1T0HA 2PNIA 3QWXX 2O31A 1AWXA 4J9GA 1WDXA 1QKWA 4J9BA 2YT6A 3EHRA 1U5SA 3NPFA 1HJDA 1ZBJA 2DL5A 1V1CA 4J9FA 2JS0A 1OV3A 4J9HA 4CC7A 1GCPA 4HVUA 2H8HA 1UG1A 4JJCA 3RNJA 1YCSB 1RLQC 3VS6A 4OMLA 2CSQA 2MOXA 1GRIA 4OMNA 1XOVA 2KYBA 4R0KA 3GBQA 5FWBA 3EG1A 1WXTA 2QDLA 1TG0A 1K0SA 2YUQA 1WLPB 3EG3A 5IHNA 2BTTA 2KRSA 4OMMA 2L2PA 4Z89A 4LUDA 1SHFA 1WYXA 2O9SA 1LCKA 1PNJA 1PKTA 4WCIA 4RTYA 2FPDA 4RTXA 3SEMA 2O2OA 1JXOA 1CKBA 3TVTA 1SRLA 3EG0A 2I0NA 2KRMA 1J3TA 4HCKA 4J9DA 4A63B 4OMPA 1WA7A 2KROA 1GL5A 1A0NB 1RUWA 2MIOA 1M3AA 2W10A 1KIKA 2J6OA 1QCFA 1CKAA 2VWFA 1E6GA 1AWOA 4D8KA 1SRMA 2A28A 1NYGA 2DBKA 2IIMA 3EHQA 2OJ2A 4OMQA 4E6RA 5EC7A 1NLPC 1X2QA 2AKKA 2J05A 1NEBA 1PHTA 4AFUC 2SEMA 2CH4A 1NLOC 1KSWA 2ED0A 3VS1A 3VS2A 1PRMC 4LE9A 1X6BA 2CT3A 1Z9QA 2HCKA 1JO8A 1ZLMA 4KRTA 2ED1A 3EGUA 3M0QA 2JTEA 2EBPA 2G6FX 2GBQA 3FJ5A 1Y57A 4RTZA 1QWEA 1K76A 1MV3A 2LQNA 2JW4A 5ECAA 1K1ZA 1UE9A 2LJ0A 2HSPA 3UA7A 3REBB 2KGTA 2RPNA 2XMFA 2C0TA 1SSHA 2DVJA 1N5ZA 2DL8A 1X2KA 3M0PA 2DF6A 4RTVA 3H0IA 3ULRB 3TSWA 2KBTA 2CUDA 3NGPA 2KEAA 1T0JA 2SRCA 3VRZA 4J9EA 4DEYA 1I07A 2OAWA 3PVQA 5I22A 1X69A 2K3BA 2J6KA 2EYXA 2GGRA 2CREA 3VS3A 1G2BA 4ZNXA 2AZVA 4HVVA 2DNUA 2LJ3A 2X3XD 2V1QA 3I5RA 2K79A 2KYMA 1B07A 4AFSC 2HBWA 1K9AA 2RQWA 1GFDA 2RQRA 4FSSA 1W1FA 1SEMA 1Z9ZA 4AG2C 1B3QA 1YWPA 2D8JA 1YP5A 3QWYA 2FRYA 1W70A 1CSKA 5FW9A 4GBQA 1W6XA 2BZXA 4DEXA 2GNCA 4RTWA 2AKLA 1EFNA 4RTUA 2EGEA 2K9GA 3IQLA 1RLPC 3JV3A 1NEGA 1U06A 2EYZA 2V1RA 3SHWA 3A98A 2LQWA 2RQTA 3LH5A 2AZSA 1HD3A 3M0UA 2D1XA 5IXBA 1AZEA 2C0OA 5FWCA 1WFWA 4JJBA 4LUEA 1KFZA 4GLMA 5GJWB 1PRLC 1OPKA 1AVZC 1VA7A 1ZX6A 2CUBA 1H3HA 1X27A 3U23A 4AG1C 2HEQA 1PKSA 3THKA 4D8DA 2GTJA 3UF4A 2KT1A 2L3SA 2DX1A 2DL4A 2EQIA 2L3QA 2NWMA 2EGCA 1ZUKA 2JT4A 3O5ZA 2RMOA 1KJWA 2OI3A 4ORZA 1WX6A 1M8MA 3TSZA 2A08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KNB B;  1UJY A;  2ABL A;  5HCK A;  1NYF A;  2A36 A;  2DJQ A;  1UJ0 A;  1ARK A;  4F14 A;  2GTO A;  1QKX A;  2K7A A;  1UEC A;  2LNH B;  2F2X A;  3VRY A;  5I11 A;  2PZ1 A;  1M3C A;  4CC2 A;  3VS5 A;  4J9C A;  1TUC A;  2FEI A;  2CT4 A;  2KRN A;  2FPE A;  1OPL A;  2X3W D;  4JPB W;  4LN2 A;  3VS4 A;  1K0X A;  1ABQ A;  2DLP A;  3RBB B;  1AEY A;  2EYY A;  1UUE A;  2DL3 A;  2JS2 A;  1I0C A;  2K6D A;  2A37 A;  2RF0 A;  3H41 A;  5IH2 A;  1VYU A;  2DYB A;  2RQV A;  1ABO A;  3CQT A;  1MV0 B;  3I9Q A;  3NHN A;  1BK2 A;  1AZG B;  2F2W A;  1WI7 A;  2JMC A;  2E5K A;  1FMK A;  2D0N A;  2J6F A;  4AFQ C;  5IXF A;  2LP5 A;  1TUD A;  3R6N A;  2FPF A;  1S1N A;  1FYN A;  2D8H A;  2ESW A;  2LMJ A;  1AD5 A;  1UGV A;  1HSQ A;  2J7I A;  2VKN A;  1UTI A;  3H0F A;  4Z88 A;  4F17 A;  1H8K A;  2YSQ A;  1OEB A;  2KT8 A;  1JEG A;  3UAT A;  2CSI A;  1K4U S;  2RN8 A;  4QT7 A;  1ZUY A;  2W0Z A;  4JZ4 A;  4EIK A;  4HXJ A;  5L23 A;  1VYT A;  2K2M A;  2O88 A;  1I1J A;  1YNZ A;  1YN8 A;  1UHF A;  4LNP A;  3H0H A;  3I5S A;  1JU5 C;  4AFZ C;  1WXU A;  4JJD A;  2DL7 A;  2VVK A;  1GCQ C;  2DMO A;  2HDA A;  3KFV A;  2YUO A;  2EVR A;  2L0A A;  3PVL A;  2DRK A;  2LCS A;  3C0C A;  4K11 A;  3M0T A;  2M0Y A;  1G83 A;  2LZ6 B;  1M27 C;  5IHK A;  2DBM A;  1UHC A;  1AWW A;  1H92 A;  2KR3 A;  4CC4 B;  1ZUU A;  4F16 A;  1PWT A;  3M0S A;  4M4Z A;  1BBZ A;  1SPK A;  3UA6 A;  1X43 A;  2PTK A;  2JMA A;  1Y0M A;  1GBQ A;  2CDT A;  2DIL A;  1M30 A;  2DM1 A;  2MCN A;  1X6G A;  4RUG A;  2BZ8 A;  1RI9 A;  1NG2 A;  1GBR A;  2F2V A;  2ROL A;  2YUN A;  2DA9 A;  2FG0 A;  1UDL A;  2LJ1 A;  2C0I A;  1GCQ A;  2RQU A;  4IIO A;  4ESR A;  1T3L A;  1SHG A;  2EGA A;  2EYW A;  2RNA A;  2EKH A;  2LX7 A;  3REA B;  3ZL7 C;  1E7O A;  1UFF A;  1BU1 A;  1BB9 A;  4IIM A;  3VS7 A;  2ROT A;  4JZ3 A;  1MUZ A;  1U3O A;  2KXD A;  1WXB A;  2ENM A;  2FRW A;  2P4R A;  4OMO A;  1NM7 A;  2ECZ A;  1AOJ A;  1T3S A;  4X1V A;  4HVW A;  2GQI A;  1YWO A;  2J06 A;  4Z8A A;  2JM9 A;  2FO0 A;  3VS0 A;  2YUP A;  2KXC A;  3EG2 A;  1E6H A;  2DE0 X;  4J9I A;  4RTT A;  3PE0 A;  2EPD A;  2DRM A;  2JM8 A;  4CC3 A;  2EW3 A;  1QLY A;  1M3B A;  2JXB A;  2YDL A;  2L3P A;  1ZSG A;  2NUZ A;  1JQQ A;  2B86 A;  1WIE A;  2M51 A;  2O9V A;  1GFC A;  3M0R A;  1QWF A;  2AK5 A;  4Y92 A;  3NMZ C;  1JXM A;  2KE9 A;  5IHI A;  2BZY A;  1OOT A;  2CH4 W;  5GJV B;  1IO6 A;  3I35 A;  1VYV A;  1AWJ A;  1T0H A;  2PNI A;  3QWX X;  2O31 A;  1AWX A;  4J9G A;  1WDX A;  1QKW A;  4J9B A;  2YT6 A;  3EHR A;  1U5S A;  3NPF A;  1HJD A;  1ZBJ A;  2DL5 A;  1V1C A;  4J9F A;  2JS0 A;  1OV3 A;  4J9H A;  4CC7 A;  1GCP A;  4HVU A;  2H8H A;  1UG1 A;  4JJC A;  3RNJ A;  1YCS B;  1RLQ C;  3VS6 A;  4OML A;  2CSQ A;  2MOX A;  1GRI A;  4OMN A;  1XOV A;  2KYB A;  4R0K A;  3GBQ A;  5FWB A;  3EG1 A;  1WXT A;  2QDL A;  1TG0 A;  1K0S A;  2YUQ A;  1WLP B;  3EG3 A;  5IHN A;  2BTT A;  2KRS A;  4OMM A;  2L2P A;  4Z89 A;  4LUD A;  1SHF A;  1WYX A;  2O9S A;  1LCK A;  1PNJ A;  1PKT A;  4WCI A;  4RTY A;  2FPD A;  4RTX A;  3SEM A;  2O2O A;  1JXO A;  1CKB A;  3TVT A;  1SRL A;  3EG0 A;  2I0N A;  2KRM A;  1J3T A;  4HCK A;  4J9D A;  4A63 B;  4OMP A;  1WA7 A;  2KRO A;  1GL5 A;  1A0N B;  1RUW A;  2MIO A;  1M3A A;  2W10 A;  1KIK A;  2J6O A;  1QCF A;  1CKA A;  2VWF A;  1E6G A;  1AWO A;  4D8K A;  1SRM A;  2A28 A;  1NYG A;  2DBK A;  2IIM A;  3EHQ A;  2OJ2 A;  4OMQ A;  4E6R A;  5EC7 A;  1NLP C;  1X2Q A;  2AKK A;  2J05 A;  1NEB A;  1PHT A;  4AFU C;  2SEM A;  2CH4 A;  1NLO C;  1KSW A;  2ED0 A;  3VS1 A;  3VS2 A;  1PRM C;  4LE9 A;  1X6B A;  2CT3 A;  1Z9Q A;  2HCK A;  1JO8 A;  1ZLM A;  4KRT A;  2ED1 A;  3EGU A;  3M0Q A;  2JTE A;  2EBP A;  2G6F X;  2GBQ A;  3FJ5 A;  1Y57 A;  4RTZ A;  1QWE A;  1K76 A;  1MV3 A;  2LQN A;  2JW4 A;  5ECA A;  1K1Z A;  1UE9 A;  2LJ0 A;  2HSP A;  3UA7 A;  3REB B;  2KGT A;  2RPN A;  2XMF A;  2C0T A;  1SSH A;  2DVJ A;  1N5Z A;  2DL8 A;  1X2K A;  3M0P A;  2DF6 A;  4RTV A;  3H0I A;  3ULR B;  3TSW A;  2KBT A;  2CUD A;  3NGP A;  2KEA A;  1T0J A;  2SRC A;  3VRZ A;  4J9E A;  4DEY A;  1I07 A;  2OAW A;  3PVQ A;  5I22 A;  1X69 A;  2K3B A;  2J6K A;  2EYX A;  2GGR A;  2CRE A;  3VS3 A;  1G2B A;  4ZNX A;  2AZV A;  4HVV A;  2DNU A;  2LJ3 A;  2X3X D;  2V1Q A;  3I5R A;  2K79 A;  2KYM A;  1B07 A;  4AFS C;  2HBW A;  1K9A A;  2RQW A;  1GFD A;  2RQR A;  4FSS A;  1W1F A;  1SEM A;  1Z9Z A;  4AG2 C;  1B3Q A;  1YWP A;  2D8J A;  1YP5 A;  3QWY A;  2FRY A;  1W70 A;  1CSK A;  5FW9 A;  4GBQ A;  1W6X A;  2BZX A;  4DEX A;  2GNC A;  4RTW A;  2AKL A;  1EFN A;  4RTU A;  2EGE A;  2K9G A;  3IQL A;  1RLP C;  3JV3 A;  1NEG A;  1U06 A;  2EYZ A;  2V1R A;  3SHW A;  3A98 A;  2LQW A;  2RQT A;  3LH5 A;  2AZS A;  1HD3 A;  3M0U A;  2D1X A;  5IXB A;  1AZE A;  2C0O A;  5FWC A;  1WFW A;  4JJB A;  4LUE A;  1KFZ A;  4GLM A;  5GJW B;  1PRL C;  1OPK A;  1AVZ C;  1VA7 A;  1ZX6 A;  2CUB A;  1H3H A;  1X27 A;  3U23 A;  4AG1 C;  2HEQ A;  1PKS A;  3THK A;  4D8D A;  2GTJ A;  3UF4 A;  2KT1 A;  2L3S A;  2DX1 A;  2DL4 A;  2EQI A;  2L3Q A;  2NWM A;  2EGC A;  1ZUK A;  2JT4 A;  3O5Z A;  2RMO A;  1KJW A;  2OI3 A;  4ORZ A;  1WX6 A;  1M8M A;  3TSZ A;  2A08 A; 
#chains in the Genus database with same CATH topology
 3HFO A;  4C92 G;  5GAM d;  1K73 R;  5HCK A;  4BE2 A;  2JJ9 A;  3RR6 A;  2QDY B;  3L1A A;  3I56 T;  5FU7 B;  1UJ0 A;  3OBY A;  1X75 C;  3BFM A;  2PUK B;  5CQX A;  2DD5 A;  4M7A G;  1WHK A;  4IUU A;  3VJP A;  2CZ6 B;  2F2X A;  3HPW A;  2QAZ A;  2L89 A;  3OYI A;  3JB9 I;  3QO3 A;  5LJ5 d;  2FEI A;  2XI9 A;  1W2B A;  1VQ7 T;  2DLP A;  1OYX A;  1KC8 C;  2QQ9 A;  3CCV T;  1MGQ A;  3EH1 A;  3L2W A;  1ACM B;  1ZSZ C;  3JCM h;  3ZBD A;  4HKE A;  2A37 A;  3OA6 A;  2KAF A;  4UC4 A;  2D0Q B;  3L2V A;  1QVG S;  4C8Q C;  5M9O A;  3PTA A;  3CC4 A;  3JCM W;  4BY6 B;  1AZG B;  2F2W A;  1VQP A;  5C0M A;  2E5K A;  2QQA A;  5KYN A;  3URG A;  4M7D D;  1Y96 B;  1KD1 U;  2EQM A;  3SWN B;  1QVF S;  1FYN A;  4M7A D;  1AD5 A;  1UGV A;  3LGF A;  3CMA Q;  1VQP T;  4A4E A;  4LDX A;  4KH1 B;  3OMG A;  3E9F A;  4AT1 B;  1YFN A;  1JEG A;  4NS5 A;  3CBM A;  2XDB A;  2XIC A;  2W0Z A;  5KYX B;  3CPW S;  2CP2 A;  4F7U E;  4PJO D;  1VYT A;  1PD0 A;  4M78 B;  2O88 A;  3H0H A;  2VAS A;  2A7Y A;  2EYQ A;  4FIB A;  3I5S A;  4JLI A;  4BDZ A;  4JJD A;  2XD0 A;  3KFV A;  4DA4 A;  2EVR A;  2LCS A;  4Z02 A;  3FB9 A;  3MP6 A;  4M7D G;  2DBM A;  3HL8 A;  1HYO A;  1AWW A;  5GAO l;  1V76 A;  1G3T A;  5GAM g;  4F16 A;  4M4Z A;  1R8O B;  2BE7 D;  2E6Z A;  2YRV A;  2DIL A;  2MCN A;  1X6G A;  3I55 A;  1BKB A;  4X9C A;  4BUG A;  1NG2 A;  2ROL A;  3RES A;  4M75 C;  3G6E A;  4ZTF A;  1OZ2 A;  2DZ9 A;  4FU6 A;  1YHQ A;  4OGC A;  4EMK A;  3O8V A;  4LXC A;  3V7R A;  1T3L A;  2EGA A;  2KSS A;  2RNA A;  5CVI A;  3JB9 D;  3FRN A;  3REA B;  3VUZ A;  1QVG P;  1BB9 A;  4II1 A;  4IIM A;  2ROT A;  4JZ3 A;  4JLG A;  3A8G B;  4PJO F;  2MF2 A;  1MMG A;  4M75 B;  4HVW A;  2V8I A;  4KGX B;  1Q82 U;  9ATC B;  2BKD N;  3VS0 A;  2KXC A;  4BE0 A;  1N9R A;  1UGQ B;  3PE0 A;  4NL2 A;  5I21 A;  2EPD A;  4M75 A;  2DRM A;  3S6W A;  1M3B A;  2JXB A;  2Y4X A;  2YDL A;  3OY9 A;  2L3P A;  3JCM b;  1QQJ A;  4PJJ A;  5IN1 A;  1QWF A;  4QKU A;  4C0G A;  3LH0 A;  3TEE A;  3X20 B;  4BDY A;  3G71 T;  2BZY A;  5GAM f;  1IO6 A;  1VYV A;  3N5B B;  4ZGJ B;  4QVC A;  1T0H A;  2PNI A;  3HRS A;  3GLX A;  3PNW C;  2GF7 A;  2VGM A;  3OS0 A;  2QTV A;  4IUR A;  3MJX A;  1VQN Q;  1V29 B;  2HMA A;  1M1K U;  3JCM V;  3PIP A;  2M0O A;  4LD9 K;  4FYX B;  1X01 A;  4J6X A;  4CRI A;  2JN0 A;  3FEO A;  4J9H A;  4CC7 A;  3X26 B;  4HVU A;  1UG1 A;  1YIT Q;  2CGH A;  4J7I A;  4QVZ A;  3CCE Q;  4OML A;  2CSQ A;  2IG0 A;  3NTH A;  5FWB A;  2RJC A;  2MWP A;  2DTH A;  5FLX E;  1K0S A;  4F04 B;  2YUQ A;  3HTR A;  4DOW A;  3KXT A;  2KRS A;  4OMM A;  5CCA A;  2L2P A;  5LL6 S;  1M90 U;  2KQW A;  1WYX A;  1ZQ1 A;  2FHD A;  2ZPB B;  4MZM A;  4N4G A;  4IUQ A;  4YTL A;  3CCU T;  1CKB A;  1SRL A;  1NJI U;  2I0N A;  1J3T A;  3S3O A;  1D0Z A;  4OMP A;  1XNI A;  3C4S A;  4CI0 C;  1WA7 A;  4FL6 A;  3GPL A;  2DXB A;  3MEU A;  3CC7 Q;  1YIJ A;  4J6W A;  1KIK A;  3MCA B;  2J6O A;  2HQX A;  2O4X B;  2VWF A;  3MP1 A;  3JRZ A;  1VQK T;  4TVR A;  5DM7 R;  5LJ3 h;  4M7D E;  3EHQ A;  4OMQ A;  1NLP C;  5GAN 6;  5CAI A;  2QA4 A;  2J05 A;  3GNF B;  2RH2 A;  3PMI A;  4AFU C;  2CH4 A;  3V8K A;  1KSW A;  1YIT A;  4M7D F;  3UPU A;  3VS1 A;  2DIG A;  3G71 Q;  2L8D A;  4N4H A;  2CT3 A;  1JO8 A;  5FU7 C;  3G6E T;  2V8K A;  7AT1 B;  5AYF A;  3OYY A;  5GMK i;  1WHG A;  3QXE B;  4PFO A;  3JB9 F;  3LLR A;  1OX9 A;  3BY7 A;  5GAO m;  3M5A A;  4DBF A;  2K3X A;  3UA7 A;  2HSP A;  3REB B;  5HY6 A;  2RPN A;  2DAQ A;  3EFR A;  2DVJ A;  3CCL T;  1N5Z A;  2DL8 A;  1X2K A;  3M0P A;  4PFP A;  1JJ2 P;  2QA4 T;  2R5A A;  3NGP A;  2BE9 B;  1N27 A;  2VUB A;  4J9E A;  3EGD B;  1PSF A;  4ZGE B;  4MMK A;  5HK3 A;  1I07 A;  3J81 E;  3PVQ A;  4C92 C;  1VQ6 A;  2EYX A;  1JRI A;  2CRE A;  2Y4Y A;  4M7D A;  1G2B A;  2RJE A;  1VQ8 A;  3CCS Q;  3EGD A;  1TTH B;  2V1Q A;  1RAF B;  3C12 A;  2KYM A;  5IT9 E;  2FL7 A;  3CXC S;  2A3L A;  4E7K A;  1QVF A;  2RQW A;  4FSS A;  3CCS A;  4AG2 C;  1B3Q A;  1YWP A;  2HBP A;  5GAN 7;  1I4K 1;  3NTI A;  3OW2 P;  3OYN A;  1W6X A;  2RI3 A;  4DEX A;  2GNC A;  4RTW A;  4EDU A;  4FW1 A;  4E7S A;  3QHS A;  1MNE A;  3QBY A;  4RTU A;  1C1A A;  1RLP C;  3JV3 A;  1IHV A;  2DIQ A;  1PD1 A;  4J8O A;  1YI2 Q;  3MEV A;  4R56 A;  2CP0 A;  4A53 A;  1VQ6 Q;  1I5O B;  3PT9 A;  3CC2 Q;  1ZA2 B;  1HD3 A;  4E2F B;  1YJN T;  3CCM T;  2ZPE B;  1WGS A;  1AVZ C;  1QP2 A;  2CUB A;  2HQH A;  1H3H A;  1M1F A;  2QTX A;  3U23 A;  5GAN 2;  4AG1 C;  2R58 A;  3ASK A;  3X25 B;  1GXI E;  2DD4 A;  2L3S A;  4FT4 A;  2ZCF B;  2ZPI B;  5L8R E;  1U1T A;  3HHT B;  2RMO A;  3G4S Q;  1FWZ A;  5GAO n;  2I2L A;  4R55 A;  4HCB A;  1KG1 A;  1RAE B;  1UJY A;  1K73 C;  2A36 A;  4OB0 B;  2VB6 A;  4M7A A;  2GTO A;  1QKX A;  2X4J A;  3RKY A;  1UEC A;  5A0L A;  2COY A;  3RIR A;  3L2U A;  1RAH B;  3GOX A;  2E3H A;  1FMW A;  2RM4 A;  1BI1 A;  2FPE A;  2X3W D;  3VS4 A;  3CMA A;  1HXD A;  4A54 A;  3CCE T;  1AEY A;  3EG9 A;  2EIF A;  1UUE A;  1N8R U;  4N0A A;  3VKI A;  3OW2 S;  3EFS A;  1N8R C;  3L2R A;  3G4S A;  2K6D A;  3A8O B;  2RF0 A;  3JAM E;  4M75 G;  4KGZ B;  3HSB A;  1M2V A;  2DYB A;  1YJW T;  2P0Q A;  1ABO A;  2CP7 A;  1P92 A;  3CQT A;  1MV0 B;  3I9Q A;  4IUP A;  1BK2 A;  2JMC A;  3KUF A;  2K5I A;  2D0N A;  3M9Q A;  5IXF A;  5GAN 8;  2LP5 A;  5EG2 A;  3GP8 A;  4J5Y A;  1S1N A;  1D3B B;  1WQ7 A;  4B6M A;  2LNV A;  1IRE B;  3P8H A;  3QG1 A;  1BCM A;  3FJP A;  4A4K A;  3OS2 A;  2AT1 B;  4A4G A;  2YSQ A;  1OEB A;  3CXC A;  4OP0 A;  2DVE A;  2F5T X;  2YRD A;  3LX7 A;  4RCB A;  5HKC A;  3OYK A;  4M78 A;  3CCS T;  4QT7 A;  2OTL T;  3WVE B;  5DLO A;  1WJQ A;  1S72 Q;  4FYY B;  4EIK A;  3MHX A;  5L23 A;  5LJ3 d;  4M78 D;  5I2S A;  2ZGW A;  1YNZ A;  1YN8 A;  4LNP A;  1QW1 A;  5CQY A;  1R0C B;  4AFZ C;  2RHI A;  5KYX A;  1M2O A;  1VIE A;  2DL7 A;  2VVK A;  2JVV A;  1XQH A;  4IUV A;  2HDA A;  3RKW A;  2PUO B;  1FMV A;  3HFN A;  2H3E B;  1Y71 A;  3ER0 A;  2LZ6 B;  1G8X A;  4NOY A;  1Y96 A;  1VQ4 T;  1M1K R;  1K8A C;  1WZO A;  1H92 A;  1ZUU A;  1B7T A;  3QJ6 A;  5GAM e;  2B8A A;  3BDU A;  4XU2 A;  2K3Y A;  1GBQ A;  4M77 A;  2JOY A;  2DM1 A;  3G7Z A;  1I5L A;  2BZ8 A;  1RI9 A;  2MWO A;  2NLU A;  1ZSZ B;  2XHC A;  2YUN A;  2DA9 A;  1C6V X;  5CKB A;  2FG0 A;  1UDL A;  5FU6 B;  3CME T;  3CD6 A;  4IIO A;  4ESR A;  3CME Q;  2K4Y A;  1YJW Q;  1SHG A;  3MP8 A;  1NPR A;  4XTX A;  3ZL7 C;  3CCV A;  3VS7 A;  5DLQ E;  2P4T A;  1MUZ A;  4PFZ A;  3VU3 C;  2KXD A;  5GAM j;  3M4G A;  1NM7 A;  1AOJ A;  4MDW A;  4PJO B;  1VOM A;  4HA8 A;  2J06 A;  1RAC B;  5FU6 C;  2JM9 A;  2FO0 A;  4M77 F;  3M54 A;  1OX8 A;  1E6H A;  1IZ6 A;  3G71 A;  4PL6 A;  4PJM A;  2JM8 A;  3E19 A;  5LJ5 j;  1D1C A;  2K2V A;  1KQ1 A;  2NUZ A;  2OTJ Q;  1JQQ A;  2B86 A;  5FRN A;  2PU9 B;  4ZGD B;  1KQS S;  1IRX A;  2FYK A;  2M51 A;  1VQ8 T;  2O9V A;  1GFC A;  4M7A B;  4JRP A;  4Y92 A;  5KE2 A;  4EMK C;  5GAM h;  1Q82 R;  1OOT A;  4C5I A;  3DB4 A;  3DLM A;  3I35 A;  2EQJ A;  2L5Q A;  1AWJ A;  3CC7 A;  4C92 B;  1VQM Q;  5GMK e;  5A0D A;  2CP6 A;  1PG5 B;  1YIJ T;  4IKF A;  1Q86 R;  2O31 A;  5KH6 A;  3WVD B;  4E7J A;  1KD1 C;  4J9B A;  3EHR A;  2HQE A;  3EG9 B;  1UGP B;  5LJ5 h;  1IB8 A;  1YBY A;  3A1P A;  3A8H B;  5CKH A;  4J9F A;  1YJN Q;  1GCP A;  2RHY A;  3HRU A;  3JCM d;  3CC2 T;  2RD1 A;  3BDL A;  5GAN h;  3CCL Q;  2MOX A;  3CPW A;  2CP5 A;  1XOV A;  2DO3 A;  3OQ5 A;  2DXC A;  3D7S B;  3OSV A;  1TXQ A;  1TG0 A;  3OYD A;  1VQN A;  2QXF A;  2JTM A;  2Z0W A;  1VQ7 A;  4C0D B;  4Z89 A;  2YLB A;  2O9S A;  1BI3 A;  1PKT A;  3RER A;  4RTY A;  4PLL A;  3DB3 A;  1Q95 G;  3EG0 A;  2KRM A;  4WTO B;  2VXF A;  1VQ5 Q;  4A63 B;  2HD0 A;  2DET A;  4XU1 A;  1WJS A;  1D09 B;  1M3A A;  2MIO A;  3LGL A;  1QVG A;  1QCF A;  2RJD A;  2MI6 A;  1AWO A;  1LOJ A;  4C5H A;  2QEX Q;  2XKO C;  2DBK A;  4J6Y A;  3TU4 K;  4E6R A;  4C92 D;  1X2Q A;  3J7A F;  4BI4 A;  4M78 C;  1NEB A;  1PHT A;  2V8J A;  2O01 E;  1VQ7 Q;  5GAO r;  3VS2 A;  4LE9 A;  3L2Q A;  2E6N A;  2MPX C;  2ZPF B;  1D3B A;  4KRT A;  4EPC A;  2RJF A;  3EGU A;  3M0Q A;  2JTE A;  2X4W A;  2EBP A;  5GAN e;  2FZK B;  2GBQ A;  4M78 E;  4ATO A;  1TH7 A;  2QQR A;  5GMK m;  1Y57 A;  4Y91 A;  1QWE A;  4OVA A;  2WAC A;  2JW4 A;  2FVU A;  1VIF A;  1WJR A;  2LJ0 A;  2KGT A;  1EZZ B;  2YHT A;  1M1K C;  4RTV A;  3H0I A;  3BW1 A;  3MEW A;  5CKF A;  1Y07 A;  2SRC A;  4PJO G;  2OAW A;  2RO0 A;  1MHN A;  1X69 A;  2K3B A;  2J6K A;  1M9S A;  3VS3 A;  3J80 E;  1M8V A;  1W4S A;  2P84 A;  2A0F B;  2LJ3 A;  2K79 A;  3QZ9 B;  3E1S A;  4QVD A;  1B07 A;  1VQL T;  2LCC A;  4AFS C;  1EIF A;  4HT8 A;  5D6Y A;  2FZC B;  5LJ5 e;  1SEM A;  1ZA1 B;  3OMC A;  1EX4 A;  2D8J A;  3QWY A;  4FM4 B;  1CSK A;  5FW9 A;  2F1L A;  1KQS P;  1NJI R;  5KYW A;  1M5Q 1;  2GFU A;  3CCR Q;  4C5E A;  2Y90 A;  3JCM J;  3CD6 T;  3E2U A;  1K9M U;  2L3R A;  3CME A;  2EGE A;  1W2B P;  1BYM A;  1BI0 A;  1G3W A;  1VUB A;  1NEG A;  1U06 A;  3VUB A;  3QII A;  2C06 A;  2CS7 A;  2V26 A;  3QSU A;  3CPF A;  2CZ7 B;  5KCO A;  2AZS A;  3M0U A;  3P8D A;  2C0O A;  1WFW A;  4LUE A;  3L2Z A;  3Q1J A;  1BIB A;  1YHQ T;  2E1H A;  1JBM A;  1OU8 A;  1YJ9 A;  5GJW B;  4FYW B;  5LJ3 g;  1X27 A;  2HL5 C;  1B34 B;  3T9N A;  2GTJ A;  3UF4 A;  3VV0 A;  1Q81 U;  2HSE B;  4M77 D;  4VUB A;  4C8Q F;  2NWM A;  2EGC A;  4DBH A;  1ZUK A;  2PVD B;  1KD1 R;  4WF2 A;  3CBP A;  1IGU A;  3JCM Q;  2A08 A;  3CCJ A;  1NE8 A;  2KNB B;  2QYZ A;  3JB9 H;  2QA4 Q;  3I56 A;  1F1B B;  5LJ5 g;  3CC4 Q;  1WQW A;  1NYF A;  4IUT A;  2DJQ A;  2QI2 A;  4P5N A;  4F14 A;  1VQ9 A;  2QK0 A;  2WSC E;  1VQ9 T;  5I11 A;  3RDV A;  2PZ1 A;  2ZPH B;  2LQK A;  3VS5 A;  1TUC A;  2E4H A;  3KBG A;  4XK8 E;  1K0X A;  1ABQ A;  3OSS C;  3QYG B;  2OTJ A;  3RBB B;  2EYY A;  2IPO B;  2KVQ G;  4RMO A;  2DL3 A;  3FDR A;  1WHL A;  2NUP A;  1VQO Q;  2X9H A;  3H41 A;  2LDM A;  3OYG A;  1VYU A;  4FCY A;  1QVF P;  3VYG A;  1SG5 A;  2CZ0 B;  4C92 F;  3CCJ Q;  1VQK Q;  3C94 A;  3BE3 A;  1VQN T;  2J6F A;  2OTL A;  1UB4 A;  2D6F A;  1TUD A;  4M7D B;  1MND A;  4M7A F;  2D8H A;  1UEB A;  2F5K A;  1WPY A;  1HSQ A;  2VKN A;  2RHZ A;  1W2B S;  4C8Q E;  3P8B B;  4RG8 A;  2DZC A;  4F17 A;  2QGG A;  3TCJ A;  2YWW A;  2E3I A;  3V7C A;  1YJN A;  2EQK A;  3LWI A;  3G6E Q;  4RCC A;  2RHX A;  3AT1 B;  2HL3 A;  2QEX T;  2LQ8 A;  3V8J A;  3G1J A;  4HXJ A;  1VQ4 A;  5GMK l;  4HT9 A;  1K8A R;  4FSX A;  1I1J A;  2QG9 B;  1G3Y A;  2HKQ B;  1QP3 A;  4J7F A;  1DJ7 B;  5CO7 A;  1GCQ C;  1VQ8 Q;  5D6W A;  2HAX A;  2DMO A;  2XDD A;  4PJN A;  2L0A A;  4ZTJ A;  2DRK A;  5AT1 B;  3CCR T;  3C0C A;  3M0T A;  4KUI A;  2M0Y A;  5J26 A;  1WHJ A;  4PJO C;  1OU9 A;  2PVO B;  3JCM g;  2CP3 A;  4BY6 C;  5I2M A;  3M57 A;  1PWT A;  4PNO A;  2PVG B;  4MDX A;  1SPK A;  2EQU A;  3HKS A;  3OYC A;  4BI8 B;  2PTK A;  1XJW B;  1Y0M A;  2CDT A;  4X34 A;  3JCM c;  1TS9 A;  2QQB A;  4C92 E;  1VQ6 T;  4RUG A;  1QMC A;  2M1H A;  4M7A C;  4OB1 B;  5KYY A;  4MZT A;  1JB0 E;  2D9T A;  4M7A E;  3A5Z B;  3JSC A;  2DKG A;  5J39 A;  2C0I A;  5J3B A;  1M1G A;  1RAB B;  1GCQ A;  2RQU A;  1G3S A;  2JTF A;  3LWH A;  3MET A;  3MEA A;  2JUF A;  4JUV A;  2X35 A;  2LX7 A;  3EH2 A;  4O5V A;  1UFF A;  2VYT A;  3QYH B;  1U3O A;  1MMN A;  4ME7 A;  1WXB A;  2P4R A;  4OMO A;  4C8Q G;  4PJO E;  2ECZ A;  2NYS A;  4X1V A;  4LDY A;  3CCM A;  1R0B G;  2DFU A;  2E12 A;  1Q82 C;  3EG2 A;  2DXU A;  1D1A A;  2NUP B;  2EW3 A;  3EFO B;  5IAY A;  3H6Z A;  4DOV A;  5FRO A;  2ZPG B;  3E9G A;  4QQ6 A;  2ZAE A;  4OB3 B;  4B9X A;  4BD3 A;  1NJI C;  4PKC C;  3PFS A;  1KC8 U;  2M16 A;  3PIO A;  5GJV B;  3M56 A;  3JCM f;  3OYL A;  1M90 C;  2VC8 A;  3QWX X;  4MML A;  1M4Z A;  2M02 A;  1TU0 B;  4J9G A;  3CD6 Q;  4F7U G;  1QKW A;  4ELY C;  1BI2 A;  2IVW A;  3NPF A;  1HJD A;  3JCM P;  1ZBJ A;  1X6O A;  1R77 A;  1V1C A;  3UT1 A;  2JS0 A;  1OV3 A;  1KQS A;  3OS1 A;  1RLQ C;  3WXM B;  1G5V A;  1Y7X A;  3JB9 J;  1GRI A;  4OMN A;  1SKU B;  4R0K A;  2JZ2 A;  3TRE A;  3M55 A;  1NPP A;  1VQK A;  4F7U A;  1YJ9 Q;  1WLP B;  3EG3 A;  5IHN A;  1VQO A;  4BB7 A;  1HK9 A;  3DLL A;  4DBR A;  4F7U B;  4A4H A;  4M77 E;  2HZY A;  4MZP A;  4WCI A;  3G4S T;  3SEM A;  1BCO A;  1JXO A;  4FT2 A;  1VQL A;  3CMA T;  1MMD A;  1ZBX A;  4J9D A;  5KYU B;  1YIJ Q;  3OYJ A;  1A0N B;  2KRO A;  3M53 A;  1GL5 A;  1RUW A;  4BI3 A;  2H3J A;  2ATC B;  3QPH A;  4JS4 A;  3CCU A;  4NL3 A;  4M78 G;  2LTO A;  1RAG B;  1TUG B;  4Q5W A;  5KYU A;  2A28 A;  1Q81 C;  1NYG A;  2OJ2 A;  3EAE A;  4EMG A;  3MKD A;  1NBE B;  2SEM A;  1NLO C;  4EMH A;  2XU8 A;  2ED0 A;  3S3N A;  1PRM C;  3JCM X;  3CCV Q;  3DKM A;  1X6B A;  6AT1 B;  1WHH A;  1YHQ Q;  1Z9Q A;  2HCK A;  1IXD A;  2LT4 A;  1PSE A;  1ZLM A;  2GFA A;  4FW2 A;  3JB9 G;  2ED1 A;  4OGE A;  3OYB A;  3FJ5 A;  3AHU A;  2K57 A;  5D6X A;  1IGQ A;  1K76 A;  1MV3 A;  4N0A C;  1Q86 U;  2LQN A;  3GNG A;  4OF1 A;  3CXC P;  4QQD A;  1KHI A;  1Q7Y R;  2C0T A;  1SSH A;  5CIU A;  3QDF A;  2KBT A;  2CUD A;  2AIR B;  1T0J A;  4M75 E;  2RI5 A;  1OQK A;  4DEY A;  4ZN3 A;  3CC2 A;  2BUD A;  3OYH A;  4C8Q D;  5I22 A;  2EJ9 A;  2GGR A;  8AT1 B;  3R6O A;  2K5L A;  1JJ2 S;  4JRK A;  2P0P A;  4DQ2 A;  2AZV A;  4RG2 A;  4HVV A;  4KT0 E;  2OAU A;  2DNU A;  2DEQ A;  4XTZ A;  4C0D C;  3SFM A;  1LJO A;  1VQ9 Q;  2KMT A;  2X4X A;  4O6J A;  3NTK A;  2HBW A;  3CCQ Q;  2AHJ B;  1GFD A;  2QEX A;  2RK1 A;  3F70 A;  4LDU A;  1Z9Z A;  1YP5 A;  4L59 A;  1W70 A;  4JRQ A;  4GBQ A;  1PM3 A;  4B9W A;  2AKL A;  1EFN A;  3IQL A;  2K9G A;  2DYI A;  2MK5 A;  5LJ3 j;  2EYZ A;  4M75 D;  4LDV A;  2DTO A;  5C6S A;  3CCJ T;  3FC3 A;  3GF5 A;  1D0X A;  3QKJ A;  3SWN C;  3A8L B;  1OI1 A;  3LH5 A;  5IXB A;  2D1X A;  2YRC A;  4JJB A;  2QAS A;  1KFZ A;  1WHM A;  3C95 A;  4GLM A;  1H3Z A;  3OYE A;  1PRL C;  2MYS A;  3SD4 A;  2HEQ A;  1PKS A;  3THK A;  1YCY A;  3QJY A;  3HP9 A;  1YJW A;  2K5F A;  2RA2 A;  1N6A A;  2L3Q A;  3I55 Q;  4GLK A;  2JT4 A;  5A2Q E;  4ZN1 A;  3X24 B;  1S72 T;  4ORZ A;  1WX6 A;  3FLG A;  2F69 A;  4M77 G;  5LJ3 e;  5GAN d;  2LX9 A;  1YIT T;  1C0M A;  4XTU A;  2ABL A;  2XG8 D;  1VQM T;  3QZ5 B;  1LNX A;  1VQM A;  2CYZ B;  4QQG A;  5GMK j;  1QVP A;  1UGS B;  3I56 Q;  1ARK A;  4XTW A;  1SSF A;  2K7A A;  2QGF B;  2LNH B;  3VRY A;  3V8L A;  1N9S A;  1M3C A;  4CC2 A;  5CKD A;  4J9C A;  3SB2 A;  2CT4 A;  2KRN A;  3OB9 A;  4LN2 A;  1OPL A;  4JPB W;  4BAC A;  3CCM Q;  2GCX A;  2JS2 A;  1VQO T;  1I0C A;  1SF9 A;  5IH2 A;  2RQV A;  3INZ A;  1QCN A;  4OMF B;  3NHN A;  1BIA A;  3M59 A;  5CR2 A;  1WI7 A;  5GAN j;  1FMK A;  4AFQ C;  3PMT A;  3R6N A;  1FX7 A;  2FPF A;  4C5G A;  2ESW A;  2COZ A;  5GAN f;  2LMJ A;  2J7I A;  1UTI A;  3H0F A;  1WNL A;  4Z88 A;  4N4I A;  1H8K A;  2R57 A;  2KT8 A;  4XQ3 A;  1RI0 A;  3EGX A;  3UAT A;  2CSI A;  1K4U S;  2RN8 A;  3ZFJ A;  1OUL A;  2WSE E;  4BE1 A;  1ZUY A;  3QDR B;  4E7L A;  3UWN A;  1JJ2 A;  1KK7 A;  4JZ4 A;  4M78 F;  2EKO A;  2K2M A;  1Q81 R;  2YLC A;  1UHF A;  4AMC A;  1JU5 C;  1VQ5 A;  1WXU A;  2R5M A;  4E7H A;  3LYI A;  2YXY A;  1N8R R;  1D0Y A;  3CCU Q;  2YUO A;  2VGN A;  3PVL A;  5GAN 4;  2NUT A;  1O9S A;  4K11 A;  3HRT A;  1G83 A;  1M27 C;  5IHK A;  2EWN A;  2VXE A;  1UHC A;  4PJL A;  3RMS A;  4XU3 A;  2KR3 A;  1RAD B;  4CC4 B;  4V2S A;  5FRM A;  4M77 C;  4PJO A;  3M0S A;  3NFC A;  1BBZ A;  3UA6 A;  1X43 A;  2DEU A;  2JMA A;  3OW2 A;  1M30 A;  4DBQ A;  3QUI A;  1TWB A;  4EMK B;  3CCL A;  3OBW A;  1GBR A;  2F2V A;  4L6V 5;  2LJ1 A;  3RUX A;  3OYA A;  2DJZ A;  2CKK A;  2RB6 A;  5KYY B;  2QQS A;  2EYW A;  3CBO A;  2EKH A;  4ELZ C;  2EJF A;  3X28 B;  2LVM A;  2BIV A;  4RKU E;  4X9D A;  1E7O A;  1BU1 A;  4XAX B;  5GAN 5;  2MMP A;  2ENM A;  2FRW A;  4KBM B;  1T3S A;  3RKX A;  2GQI A;  4Y28 E;  5A0G A;  3EFO A;  1YWO A;  4Z8A A;  1KC8 R;  2YUP A;  1H64 1;  4QW2 A;  2DE0 X;  4J9I A;  2XID A;  4RTT A;  4KUL A;  2DPP B;  4LDW A;  1LPL A;  2E41 A;  4CC3 A;  4D6W A;  3CC7 T;  1PC0 A;  1ZHI A;  1QLY A;  1YI2 T;  3M4Y A;  1M2V B;  1ZSG A;  1WIE A;  2XDP A;  5GMK h;  1U1S A;  4C8Q A;  5GAO p;  4F7U F;  1VQL Q;  3M0R A;  4KH0 B;  2AK5 A;  3A8M B;  1XTD A;  3NMZ C;  1JXM A;  2KE9 A;  5IHI A;  2CH4 W;  4FYV B;  2LC4 A;  3CCQ A;  1I8F A;  4J83 A;  1S72 A;  1AWX A;  3ME9 A;  1WDX A;  2YT6 A;  3UDC A;  3V7S A;  1U5S A;  1Q7Y U;  4C92 A;  4PLI A;  5GAO q;  2DL5 A;  2PQW A;  4E7I A;  1PCX A;  4XU0 A;  4M75 F;  1VQP Q;  2H8H A;  2LT1 A;  4JJC A;  3RNJ A;  1YCS B;  3OYM A;  1Q86 C;  1AT1 B;  2HKN A;  2ZZD A;  3VS6 A;  3PGG A;  4KUD K;  2FZG B;  1TOV A;  2KYB A;  1OZ3 A;  3GBQ A;  5CK9 A;  3EG1 A;  1WXT A;  2QDL A;  2DK3 A;  2LCL A;  2OTL Q;  1Q7Y C;  3SWN A;  1YJ9 T;  2BTT A;  4HCZ A;  3OYF A;  3CCE A;  3GIB A;  2OTJ T;  2P0K A;  4LUD A;  1SHF A;  3JCM e;  4JJN K;  4PK4 A;  2JNG A;  1LCK A;  1PNJ A;  3I55 T;  4HCC A;  1K73 U;  2FPD A;  3EGX B;  4RTX A;  2O2O A;  2LRQ A;  1D1B A;  2X4Y A;  4JDS A;  1QCO A;  3TVT A;  3CCQ T;  4E7Z A;  1B34 A;  4LD6 A;  4HCK A;  2O4X A;  1AHJ B;  3SDZ A;  3CCR A;  2HNI A;  2EJG A;  2W10 A;  1RAI B;  1CKA A;  1E6G A;  4D8K A;  1SRM A;  2IIM A;  4A4F A;  5LJ3 f;  2RK2 A;  4C0F A;  5EC7 A;  3H9N A;  2AKK A;  3M58 A;  4XTV A;  5D7U A;  2DXT A;  2OX7 A;  4L5G A;  2KI7 A;  2E64 A;  3LW5 E;  2WSF E;  4JRI A;  1K9M R;  2KDS A;  5DY9 A;  2G6F X;  4RTZ A;  1ZSZ A;  2KY9 A;  5ECA A;  1K1Z A;  1UE9 A;  1LVK A;  2XMF A;  1K9M C;  1FXX A;  2M9U A;  5GAN 3;  1KQ2 A;  2DF6 A;  3ULR B;  3TSW A;  2MAM A;  2KEA A;  3VRZ A;  1UGR B;  3RMQ A;  4C8Q B;  1YI2 A;  2GQV A;  2DTI A;  3CC4 T;  1TSF A;  4JS5 A;  3CEY A;  4ZNX A;  3L42 A;  2X3X D;  3I5R A;  2G3R A;  2RI2 A;  1K9A A;  2KK4 A;  4GY5 A;  2RQR A;  1M90 R;  1W1F A;  1KHC A;  2E65 A;  3ZEH A;  2FRY A;  5HK0 A;  2X51 A;  2BZX A;  1MMA A;  1VQ4 Q;  1VQ5 T;  3H8Z A;  3MPU B;  1IHW A;  1I81 A;  2VV5 A;  2FB7 A;  2E5Q A;  5KYW B;  2E70 A;  8ATC B;  5LJ5 f;  3SHW A;  2V1R A;  2EFI A;  1RL2 A;  3A98 A;  2LQW A;  2RQT A;  3VYH B;  4ANJ A;  5KCH A;  4E47 A;  2NUT B;  4KGV B;  3TQ7 P;  1AZE A;  5FWC A;  3FIF A;  2CZ1 B;  1OPK A;  2RHU A;  1VA7 A;  1ZX6 A;  2XK0 A;  1RAA B;  2COW A;  4OB2 B;  2DER A;  4D8D A;  2EAY A;  5GAN g;  3OS5 A;  2KT1 A;  4M77 B;  2E10 A;  2DX1 A;  4C0Z A;  2DL4 A;  2EQI A;  3S3M A;  1NZ9 A;  3CPW P;  4M7D C;  3O5Z A;  4XTY A;  1KJW A;  2OI3 A;  3MO8 A;  1O75 A;  5CKE A;  1K8A U;  1M8M A;  5KE3 A;  3TSZ A;  1U8R A; 
#chains in the Genus database with same CATH homology
 2KNB B;  1UJY A;  2ABL A;  5HCK A;  1NYF A;  2A36 A;  2DJQ A;  1UJ0 A;  1ARK A;  4F14 A;  2GTO A;  1QKX A;  2K7A A;  1UEC A;  2LNH B;  2F2X A;  3VRY A;  5I11 A;  2PZ1 A;  1M3C A;  4CC2 A;  3VS5 A;  4J9C A;  1TUC A;  2FEI A;  2CT4 A;  2KRN A;  2FPE A;  1OPL A;  2X3W D;  4JPB W;  4LN2 A;  3VS4 A;  1K0X A;  1ABQ A;  2DLP A;  3RBB B;  1AEY A;  2EYY A;  1UUE A;  2DL3 A;  2JS2 A;  1I0C A;  2K6D A;  2A37 A;  2RF0 A;  3H41 A;  5IH2 A;  1VYU A;  2DYB A;  2RQV A;  1ABO A;  3CQT A;  1MV0 B;  3I9Q A;  3NHN A;  1BK2 A;  1AZG B;  2F2W A;  1WI7 A;  2JMC A;  2E5K A;  1FMK A;  2D0N A;  2J6F A;  4AFQ C;  5IXF A;  2LP5 A;  1TUD A;  3R6N A;  2FPF A;  1S1N A;  1FYN A;  2D8H A;  2ESW A;  2LMJ A;  1AD5 A;  1UGV A;  1HSQ A;  2J7I A;  2VKN A;  1UTI A;  3H0F A;  4Z88 A;  4F17 A;  1H8K A;  2YSQ A;  1OEB A;  2KT8 A;  1JEG A;  3UAT A;  2CSI A;  1K4U S;  2RN8 A;  4QT7 A;  1ZUY A;  2W0Z A;  4JZ4 A;  4EIK A;  4HXJ A;  5L23 A;  1VYT A;  2K2M A;  2O88 A;  1I1J A;  1YNZ A;  1YN8 A;  1UHF A;  4LNP A;  3H0H A;  3I5S A;  1JU5 C;  4AFZ C;  1WXU A;  4JJD A;  2DL7 A;  2VVK A;  1GCQ C;  2DMO A;  2HDA A;  3KFV A;  2YUO A;  2EVR A;  2L0A A;  3PVL A;  2DRK A;  2LCS A;  3C0C A;  4K11 A;  3M0T A;  2M0Y A;  1G83 A;  2LZ6 B;  1M27 C;  5IHK A;  2DBM A;  1UHC A;  1AWW A;  1H92 A;  2KR3 A;  4CC4 B;  1ZUU A;  4F16 A;  1PWT A;  3M0S A;  4M4Z A;  1BBZ A;  1SPK A;  3UA6 A;  1X43 A;  2PTK A;  2JMA A;  1Y0M A;  1GBQ A;  2CDT A;  2DIL A;  1M30 A;  2DM1 A;  2MCN A;  1X6G A;  4RUG A;  2BZ8 A;  1RI9 A;  1NG2 A;  1GBR A;  2F2V A;  2ROL A;  2YUN A;  2DA9 A;  2FG0 A;  1UDL A;  2LJ1 A;  2C0I A;  1GCQ A;  2RQU A;  4IIO A;  4ESR A;  1T3L A;  1SHG A;  2EGA A;  2EYW A;  2RNA A;  2EKH A;  2LX7 A;  3REA B;  3ZL7 C;  1E7O A;  1UFF A;  1BU1 A;  1BB9 A;  4IIM A;  3VS7 A;  2ROT A;  4JZ3 A;  1MUZ A;  1U3O A;  2KXD A;  1WXB A;  2ENM A;  2FRW A;  2P4R A;  4OMO A;  1NM7 A;  2ECZ A;  1AOJ A;  1T3S A;  4X1V A;  4HVW A;  2GQI A;  1YWO A;  2J06 A;  4Z8A A;  2JM9 A;  2FO0 A;  3VS0 A;  2YUP A;  2KXC A;  3EG2 A;  1E6H A;  2DE0 X;  4J9I A;  4RTT A;  3PE0 A;  2EPD A;  2DRM A;  2JM8 A;  4CC3 A;  2EW3 A;  1QLY A;  1M3B A;  2JXB A;  2YDL A;  2L3P A;  1ZSG A;  2NUZ A;  1JQQ A;  2B86 A;  1WIE A;  2M51 A;  2O9V A;  1GFC A;  3M0R A;  1QWF A;  2AK5 A;  4Y92 A;  3NMZ C;  1JXM A;  2KE9 A;  5IHI A;  2BZY A;  1OOT A;  2CH4 W;  5GJV B;  1IO6 A;  3I35 A;  1VYV A;  1AWJ A;  1T0H A;  2PNI A;  3QWX X;  2O31 A;  1AWX A;  4J9G A;  1WDX A;  1QKW A;  4J9B A;  2YT6 A;  3EHR A;  1U5S A;  3NPF A;  1HJD A;  1ZBJ A;  2DL5 A;  1V1C A;  4J9F A;  2JS0 A;  1OV3 A;  4J9H A;  4CC7 A;  1GCP A;  4HVU A;  2H8H A;  1UG1 A;  4JJC A;  3RNJ A;  1YCS B;  1RLQ C;  3VS6 A;  4OML A;  2CSQ A;  2MOX A;  1GRI A;  4OMN A;  1XOV A;  2KYB A;  4R0K A;  3GBQ A;  5FWB A;  3EG1 A;  1WXT A;  2QDL A;  1TG0 A;  1K0S A;  2YUQ A;  1WLP B;  3EG3 A;  5IHN A;  2BTT A;  2KRS A;  4OMM A;  2L2P A;  4Z89 A;  4LUD A;  1SHF A;  1WYX A;  2O9S A;  1LCK A;  1PNJ A;  1PKT A;  4WCI A;  4RTY A;  2FPD A;  4RTX A;  3SEM A;  2O2O A;  1JXO A;  1CKB A;  3TVT A;  1SRL A;  3EG0 A;  2I0N A;  2KRM A;  1J3T A;  4HCK A;  4J9D A;  4A63 B;  4OMP A;  1WA7 A;  2KRO A;  1GL5 A;  1A0N B;  1RUW A;  2MIO A;  1M3A A;  2W10 A;  1KIK A;  2J6O A;  1QCF A;  1CKA A;  2VWF A;  1E6G A;  1AWO A;  4D8K A;  1SRM A;  2A28 A;  1NYG A;  2DBK A;  2IIM A;  3EHQ A;  2OJ2 A;  4OMQ A;  4E6R A;  5EC7 A;  1NLP C;  1X2Q A;  2AKK A;  2J05 A;  1NEB A;  1PHT A;  4AFU C;  2SEM A;  2CH4 A;  1NLO C;  1KSW A;  2ED0 A;  3VS1 A;  3VS2 A;  1PRM C;  4LE9 A;  1X6B A;  2CT3 A;  1Z9Q A;  2HCK A;  1JO8 A;  1ZLM A;  4KRT A;  2ED1 A;  3EGU A;  3M0Q A;  2JTE A;  2EBP A;  2G6F X;  2GBQ A;  3FJ5 A;  1Y57 A;  4RTZ A;  1QWE A;  1K76 A;  1MV3 A;  2LQN A;  2JW4 A;  5ECA A;  1K1Z A;  1UE9 A;  2LJ0 A;  2HSP A;  3UA7 A;  3REB B;  2KGT A;  2RPN A;  2XMF A;  2C0T A;  1SSH A;  2DVJ A;  1N5Z A;  2DL8 A;  1X2K A;  3M0P A;  2DF6 A;  4RTV A;  3H0I A;  3ULR B;  3TSW A;  2KBT A;  2CUD A;  3NGP A;  2KEA A;  1T0J A;  2SRC A;  3VRZ A;  4J9E A;  4DEY A;  1I07 A;  2OAW A;  3PVQ A;  5I22 A;  1X69 A;  2K3B A;  2J6K A;  2EYX A;  2GGR A;  2CRE A;  3VS3 A;  1G2B A;  4ZNX A;  2AZV A;  4HVV A;  2DNU A;  2LJ3 A;  2X3X D;  2V1Q A;  3I5R A;  2K79 A;  2KYM A;  1B07 A;  4AFS C;  2HBW A;  1K9A A;  2RQW A;  1GFD A;  2RQR A;  4FSS A;  1W1F A;  1SEM A;  1Z9Z A;  4AG2 C;  1B3Q A;  1YWP A;  2D8J A;  1YP5 A;  3QWY A;  2FRY A;  1W70 A;  1CSK A;  5FW9 A;  4GBQ A;  1W6X A;  2BZX A;  4DEX A;  2GNC A;  4RTW A;  2AKL A;  1EFN A;  4RTU A;  2EGE A;  2K9G A;  3IQL A;  1RLP C;  3JV3 A;  1NEG A;  1U06 A;  2EYZ A;  2V1R A;  3SHW A;  3A98 A;  2LQW A;  2RQT A;  3LH5 A;  2AZS A;  1HD3 A;  3M0U A;  2D1X A;  5IXB A;  1AZE A;  2C0O A;  5FWC A;  1WFW A;  4JJB A;  4LUE A;  1KFZ A;  4GLM A;  5GJW B;  1PRL C;  1OPK A;  1AVZ C;  1VA7 A;  1ZX6 A;  2CUB A;  1H3H A;  1X27 A;  3U23 A;  4AG1 C;  2HEQ A;  1PKS A;  3THK A;  4D8D A;  2GTJ A;  3UF4 A;  2KT1 A;  2L3S A;  2DX1 A;  2DL4 A;  2EQI A;  2L3Q A;  2NWM A;  2EGC A;  1ZUK A;  2JT4 A;  3O5Z A;  2RMO A;  1KJW A;  2OI3 A;  4ORZ A;  1WX6 A;  1M8M A;  3TSZ A;  2A08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...