4OMNA

Crystal structure of the intertwined dimer of the c-src tyrosine kinase sh3 domain mutant q128e
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
57
structure length
57
Chain Sequence
MTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGETGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase Src
publication title Electrostatic Effects in the Folding of the SH3 Domain of the c-Src Tyrosine Kinase: pH-Dependence in 3D-Domain Swapping and Amyloid Formation.
pubmed doi rcsb
source organism Gallus gallus
total genus 5
structure length 57
sequence length 57
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4omnA00
1K9AA 1MV0B 2RQVA 2KRMA 2EQIA 2AZVA 1GBRA 1TUDA 3VS5A 2GTJA 4OMOA 1FMKA 2DA9A 2LP5A 1QWEA 2LMJA 1ZUKA 1W6XA 4J9CA 2MIOA 1UHFA 1Z9ZA 5EC7A 4CC4B 2F2XA 1M3BA 1K1ZA 4D8KA 5HCKA 1WDXA 2L3SA 3EG1A 1AWOA 2D8JA 4CC7A 4JPBW 2DBMA 1SRMA 3QWXX 1GCQA 3TVTA 1BK2A 1QCFA 1ZUYA 4AG2C 2DMOA 4JJDA 2DE0X 1VYVA 2C0OA 3PVLA 3TSZA 1X6BA 4RTYA 2EW3A 3UA7A 3VS3A 2SRCA 2BTTA 2J6OA 4EIKA 1AZGB 1X43A 4LE9A 4LUDA 2HDAA 2L2PA 1RUWA 1AZEA 2EGAA 1ZUUA 2CSQA 1T3SA 2KE9A 2FRWA 3H0IA 1E6HA 1TUCA 1GCPA 1QLYA 1KJWA 5FWCA 4QT7A 1E7OA 4AFZC 4CC2A 2LJ0A 2HSPA 2JXBA 2LJ1A 2JT4A 4OMLA 5IH2A 1T0JA 1FYNA 2AKLA 4M4ZA 2V1QA 4CC3A 1NYGA 1WA7A 2CH4W 2KT1A 2LCSA 2A08A 1NM7A 2EYWA 2PTKA 3I5SA 4J9EA 1UGVA 2EYZA 2KXCA 2FRYA 1WX6A 2LQWA 1GFDA 1ARKA 3VS0A 2M51A 3UF4A 2JMAA 2EPDA 1M30A 4JZ4A 2M0YA 2KR3A 2H8HA 3VS6A 2OAWA 1BBZA 1S1NA 4DEYA 2DL3A 2K9GA 3H0HA 1AWXA 2P4RA 1H3HA 2SEMA 3R6NA 1AOJA 1M8MA 2KYMA 2EGCA 2EGEA 2X3WD 1M3AA 2F2VA 3THKA 2FPDA 1X69A 2C0TA 1QKXA 2GQIA 2ABLA 4J9FA 3M0QA 4GBQA 1V1CA 3EG2A 1CKAA 4D8DA 2LZ6B 1PRLC 1WI7A 1JEGA 1H92A 1AWJA 3GBQA 2FO0A 2A28A 1UUEA 4JZ3A 2YT6A 1NEBA 1B07A 1OOTA 1WXTA 2DILA 2BZ8A 3I35A 2DL8A 2HBWA 1M27C 2YSQA 3C0CA 4F14A 1AEYA 3PE0A 2YUPA 2DX1A 4LN2A 1B3QA 2HEQA 4AG1C 1NG2A 1X2KA 3CQTA 2RQUA 4J9HA 3REBB 5GJWB 2RF0A 1OPKA 2DNUA 2GGRA 2O2OA 2W0ZA 4WCIA 1QKWA 1UECA 1UJ0A 1WXBA 2JM8A 4HVVA 2NUZA 2CT4A 2K2MA 3KFVA 1X6GA 1SPKA 1JU5C 2O31A 3NPFA 2YUQA 3VS4A 1T0HA 4J9BA 2YUNA 3H0FA 1UTIA 2GTOA 2BZXA 1YCSB 1U5SA 3IQLA 3U23A 4A63B 1CKBA 1K0SA 5FWBA 1CSKA 4J9GA 1JXMA 2KROA 1VYTA 1AWWA 2OI3A 1ZX6A 1W1FA 3ZL7C 4HVUA 4IIMA 3VRZA 3EG0A 2YUOA 4LUEA 2KRSA 3LH5A 2DL5A 2V1RA 1SHFA 1QWFA 2DRKA 1X27A 3EGUA 2J6KA 3NHNA 3EHRA 1K76A 1ZSGA 5I22A 1NLOC 3VS7A 3REAB 5GJVB 1XOVA 3FJ5A 1E6GA 4GLMA 2B86A 1WIEA 1W70A 2OJ2A 1SEMA 2J05A 4RTUA 2VVKA 2DBKA 1PKTA 2CT3A 1G2BA 5I11A 1JXOA 5ECAA 1PHTA 1UG1A 2DL7A 1G83A 2DM1A 2ENMA 1YWOA 1OV3A 2K79A 1ABQA 1RLPC 2EYYA 1EFNA 1RLQC 2C0IA 2CSIA 4KRTA 1HD3A 5IXFA 2K6DA 2JS2A 1IO6A 3M0SA 2KRNA 2DYBA 1PRMC 1WYXA 2DJQA 2LQNA 4RTZA 4F17A 1T3LA 4HXJA 1UJYA 2DRMA 1K4US 1BU1A 1UHCA 2HCKA 1X2QA 3I5RA 4OMMA 2KXDA 2GBQA 5IXBA 2RNAA 1GCQC 1N5ZA 1Y0MA 4RTVA 3UATA 4JJBA 1PWTA 2GNCA 2CDTA 3PVQA 3NMZC 3TSWA 2J06A 2DL4A 4J9IA 2ESWA 4RTTA 3QWYA 1MUZA 5IHKA 1M3CA 4AFSC 1ABOA 3VRYA 1WXUA 1KSWA 4AFUC 1Y57A 3M0TA 2FEIA 3M0RA 2KGTA 4ZNXA 1GL5A 1H8KA 1Z9QA 4X1VA 1U06A 1HSQA 2VKNA 4HVWA 1J3TA 2EYXA 1A0NB 2AZSA 2RQWA 1JO8A 4Z88A 4E6RA 2FG0A 4Z89A 2CREA 2RQTA 2BZYA 1VA7A 4F16A 1NYFA 1ZBJA 3I9QA 2CUBA 2EVRA 2RQRA 3NGPA 2JS0A 2QDLA 1AD5A 3RNJA 1YP5A 4IIOA 2JTEA 2LJ3A 2AK5A 4ESRA 4OMNA 3M0PA 2KNBB 4OMPA 3VS2A 2FPFA 1GRIA 1YN8A 1UDLA 2ROTA 2RPNA 1WFWA 4LNPA 1LCKA 2DLPA 2A36A 2W10A 2YDLA 3SEMA 2XMFA 4DEXA 1OEBA 1I1JA 3O5ZA 2L0AA 1GFCA 4RTWA 2E5KA 4K11A 2DF6A 2JM9A 2PNIA 1ZLMA 2D1XA 1MV3A 3RBBB 2X3XD 2PZ1A 2MCNA 1I07A 2EKHA 1NEGA 1SSHA 1UFFA 4OMQA 2KEAA 2KBTA 3EG3A 2L3PA 3EHQA 2L3QA 2J7IA 2EBPA 2ED0A 2FPEA 2O88A 4RUGA 3M0UA 2JMCA 3JV3A 4J9DA 2D0NA 2K7AA 2LNHB 4HCKA 2G6FX 1K0XA 2K3BA 4JJCA 3SHWA 5L23A 2RMOA 5FW9A 4Y92A 4R0KA 2NWMA 1KIKA 2ROLA 1WLPB 1SRLA 2ED1A 3A98A 3UA6A 5IHNA 2DVJA 2LX7A 2O9VA 1U3OA 2RN8A 4FSSA 2J6FA 1BB9A 2CH4A 1UE9A 1GBQA 4ORZA 2KYBA 2D8HA 1KFZA 2F2WA 5IHIA 2ECZA 1TG0A 1VYUA 2O9SA 1I0CA 2AKKA 4AFQC 3ULRB 2MOXA 3H41A 2CUDA 2KT8A 1AVZC 4Z8AA 1PNJA 2VWFA 1OPLA 1RI9A 2A37A 1YNZA 1PKSA 2IIMA 4RTXA 1HJDA 1JQQA 1NLPC 2JW4A 1YWPA 3VS1A 2I0NA 1SHGA
chains in the Genus database with same CATH superfamily
3GF5A 4PFOA 2X4JA 1X75C 3FC3A 5GMKh 4M75C 3VS5A 4OMOA 1Y96B 2E10A 2RK2A 2WSCE 3MP1A 4PLIA 3CCJT 1VQPT 1KQ2A 1UGRB 1QWEA 1UHFA 4MMKA 3CC4Q 2K57A 3CC4A 1N8RC 2MYSA 5HCKA 2L3SA 3OB9A 4MZPA 1XTDA 1QCFA 3CC2T 3EG9B 1PD0A 2XG8D 9ATCB 4PFPA 3TSZA 3JCMd 3MP6A 4IUUA 1Q82C 2DJZA 1K8AU 2DTOA 2BTTA 5CKBA 4RG8A 3RKWA 4EIKA 2HDAA 2L2PA 1RUWA 1ZUUA 4B6MA 5D6XA 4PL6A 3QZ9B 2XHCA 2RA2A 3QJ6A 4DBQA 5A2QE 3H0IA 1TUCA 1K9MU 4R55A 2CP6A 3OS5A 1G3SA 4BI8B 4QT7A 1E7OA 1PC0A 4FU6A 5GAN5 4A54A 4FL6A 4F7UE 1T0JA 1FYNA 3M5AA 2QA4Q 2QA4A 3PNWC 2LCSA 1M1KU 4HKEA 4HT8A 2EYWA 2PTKA 3G1JA 3I5SA 4PLLA 3JB9I 1D3BB 3QDFA 3M55A 2HZYA 3UF4A 2H3JA 4PKCC 2EPDA 1RAHB 2M0YA 1YITT 1XJWB 1V76A 4KGZB 3OSVA 3QPHA 2OAWA 1BBZA 4DEYA 2X35A 4N4HA 2QEXT 3EGDA 5GAN4 3TU4K 1YIJT 1QP3A 1M8MA 1VIFA 3CPWS 5FRMA 2EGCA 3CBPA 2F69A 5DM7R 3WXMB 4FW2A 2FPDA 5LJ3d 1X69A 4NL3A 4LDVA 1QKXA 1HK9A 1V1CA 3OYMA 3EG2A 1WI7A 3A8GB 1JEGA 1H92A 1AWJA 2QTXA 4QKUA 3KXTA 1G3WA 5KYWA 4M78D 1RAGB 3X28B 2DETA 5LJ5f 2A28A 2DAQA 4KH0B 3VKIA 2DILA 4ELZC 4IURA 2DL8A 3ZEHA 2H3EB 4E7SA 1WQWA 4FT2A 2E6NA 3WVDB 2HD0A 4LN2A 4M7AC 1B3QA 2HEQA 1BI1A 1RL2A 4AG1C 5HK0A 1KQSS 3CC7T 3SB2A 3GPLA 3REBB 3CCLT 5GJWB 3J7AF 1OPKA 4C8QD 1TUGB 1BI2A 2O2OA 4J83A 4WCIA 4JRPA 1QKWA 1K73R 1UECA 3CCUQ 4M77G 3CCUA 1WXBA 1G5VA 2NUZA 2CT4A 3KFVA 3JB9D 4KT0E 5GMKj 3NPFA 2DPPB 3OYEA 5DLOA 4J9BA 3JCMb 2OX7A 1LNXA 3U23A 3SWNA 1YJWQ 1VUBA 1VQNQ 1CKBA 2YRDA 1YJWA 1VQNA 2ZPEB 1YBYA 2I2LA 4J9GA 1M2VA 1Q7YC 2A0FB 1JJ2S 1AWWA 1NZ9A 1VQOT 4HVUA 5I2MA 4IIMA 3OYHA 2DZ9A 4LD6A 3LH5A 4ME7A 5GAMg 3DB4A 3P8HA 1SHFA 2MI6A 3URGA 1S72Q 1S72A 1H3ZA 1X27A 1GXIE 3L2VA 3VU3C 5GAMh 1B7TA 5I22A 1NLOC 2LNVA 5GMKm 1M2OA 3LX7A 3REAB 2DXUA 3G6ET 1XOVA 2LCLA 4O5VA 4GLMA 2B86A 3S3NA 1WIEA 2YRCA 4J7FA 2J05A 3CCVT 2XICA 2FVUA 2D0QB 4IUTA 1TS9A 3M59A 2JS2A 1VIEA 3HRUA 4N4IA 1VQ9Q 2C06A 1VQ9A 1N9RA 2CP5A 5J26A 1Q95G 3VYGA 1K4US 1TSFA 2EWNA 2HCKA 2KXDA 3FJPA 5IXBA 4C0FA 4LDXA 1N5ZA 4XTYA 4JJBA 1PWTA 4JRKA 2CDTA 3QG1A 1YHQQ 1YHQA 1N6AA 4F7UA 4J9IA 3OYCA 4HA8A 1QQJA 3L2QA 1BYMA 4JDSA 3OA6A 1ZA2B 3V8KA 2KGTA 4XQ3A 2X4XA 1Z9QA 4X1VA 2VKNA 4JLGA 3JCMJ 1ZSZC 3MEVA 1J3TA 1A0NB 1JO8A 4Z88A 2FYKA 2CREA 1ZQ1A 2JS0A 1KD1C 2EAYA 1AD5A 3RNJA 1BCOA 3VUZA 2JTEA 4RCBA 2LJ3A 2KI7A 4M7DC 4M78E 2GF7A 2RJFA 4C0DC 2KNBB 1HYOA 4RG2A 1UDLA 4FT4A 1WFWA 4LNPA 4LXCA 2DLPA 4DEXA 3CPFA 4EMKC 4C92C 1Q7YU 1D09B 2JOYA 2L0AA 2YRVA 2PNIA 3RBBB 5DLQE 3MP8A 2EKHA 3HTRA 2HKNA 2RHXA 4QVZA 3MEAA 1B34A 3GNGA 3EHQA 2VYTA 1YI2T 5GMKi 2J7IA 2QAZA 4RUGA 3VV0A 2YLCA 5KYYA 1VQ8Q 1K73U 3JCMX 1VQ8A 4J9DA 1JB0E 3LGLA 2LNHB 4JRIA 5LJ5e 3D7SB 4C0DB 2M16A 1VQ4Q 4Y92A 1VQ4A 4OB0B 2ROLA 3T9NA 5HY6A 3A98A 2CP3A 5IHNA 2DVJA 2O9VA 2COZA 3UDCA 1EIFA 1ZBXA 2CH4A 2HSEB 1UE9A 3HP9A 1KQ1A 2MK5A 1BI0A 1KFZA 1P92A 2F2WA 5IHIA 4XAXB 3CCEQ 1VYUA 3CMAT 4PJOC 1FWZA 1QCNA 3CCEA 1VQ7T 1KK7A 2O9SA 1QVFP 3ULRB 2K5FA 1BCMA 5CIUA 2FB7A 1D1BA 1WHKA 1IHWA 1VQ5T 3QXEB 4N0AC 5CAIA 2RHIA 4M77D 3M56A 2IIMA 3RDVA 4KUDK 1HJDA 1JQQA 1UGSB 1NLPC 5GANd 1YWPA 3OBWA 2DVEA 3E2UA 5KYXA 1MV0B 1R0CB 1TUDA 1G3TA 4F7UB 2LP5A 2LMJA 4C0GA 1ZUKA 4M75G 2OTLQ 2OTLA 3Q1JA 2DERA 3FRNA 2F2XA 3HL8A 4D8KA 1RAIB 2NUPB 5GMKl 2D8JA 4CC7A 1SRMA 2RM4A 1U1SA 3M4GA 1RAAB 1RAEB 1ZUYA 1D1AA 3HRTA 2C0OA 3PVLA 4RTYA 1WQ7A 8ATCB 1SG5A 3CBOA 5GAOq 2DXTA 4AT1B 2JTMA 2J6OA 1K8AC 2DK3A 1YJ9Q 1X43A 4JUVA 4LE9A 1YJ9A 3ME9A 4OMFB 1UGQB 1AZEA 4M75A 1G3YA 2QXFA 4A4KA 3LGFA 1QVGP 2GQVA 4PJOF 4QQ6A 4DOVA 1VQ6Q 1VQ6A 5M9OA 2K5IA 3OYIA 1E6HA 1QLYA 1K9MC 3F70A 2EQKA 1IXDA 3S3OA 3R6OA 4CC2A 3A1PA 4BE1A 3OMCA 2XD0A 4E47A 4C8QG 2LJ1A 2COWA 1YJNT 4M4ZA 2V1QA 2DYIA 1VQMQ 1VQMA 4CI0C 4CC3A 1KC8R 3DLLA 3V7SA 2KT1A 5KYYB 4MMLA 5I2SA 4M78A 1NM7A 4Y28E 1M1KC 3A8OB 4J9EA 2EYZA 2FRYA 1ARKA 2M51A 3OBYA 2JMAA 4JZ4A 2KR3A 1BI3A 3VS6A 3JCMW 3HSBA 4RKUE 2K9GA 2Y90A 1BIBA 4IUPA 2P4TA 3JCMg 4QQGA 2MWPA 3PTAA 2JVVA 3EFSA 5J39A 3RIRA 3R6NA 3I55T 5GAMf 3CD6Q 4C8QA 1N8RR 3CD6A 2KYMA 2OTJQ 2X3WD 3UWNA 2OTJA 3UT1A 3THKA 1RAFB 2BUDA 4J9FA 2NLUA 4MDWA 4OB2B 1CKAA 4D8DA 5CKEA 5LJ5j 3CMEQ 3JB9H 3CMEA 1UUEA 4MZTA 1VQKQ 1VQKA 5KYXB 1WGSA 4B9WA 2CZ1B 5KCHA 2QQBA 1MMGA 1M27C 5EG2A 4M77E 2CP7A 2YUPA 4L59A 2DX1A 2E12A 1AHJB 3FDRA 3CQTA 4PJMA 1M9SA 2RF0A 4KUIA 4M7AG 3QIIA 1U8RA 1R77A 2W0ZA 2YWWA 1FMVA 3PIPA 3C4SA 2CS7A 2NUTA 2YUQA 3O8VA 1HXDA 3H0FA 2LVMA 2BZXA 3G7ZA 4IKFA 2GCXA 2KROA 1VYTA 4XU3A 1ZX6A 1W1FA 5LJ3g 1WNLA 2K2VA 4A4FA 4LUEA 5HKCA 5LJ3h 2M0OA 1IB8A 4M7AA 4Y91A 1OI1A 1QWFA 2HQHA 5KE3A 3EHRA 1K76A 1ZSGA 1N27A 4FYVB 4PJNA 4TVRA 2E70A 1SEMA 3EGXB 2VVKA 2V8JA 2CT3A 1JXOA 4M75D 2DL7A 4M78B 1R0BG 1YWOA 1OV3A 4DBHA 4WTOB 1RLPC 2EYYA 2R5AA 1RLQC 5KYUB 2CSIA 1HD3A 3M0SA 5KCOA 4KGVB 2DYBA 2VGNA 1VQLQ 1WZOA 1WYXA 2LQNA 4RTZA 3EFOA 4HXJA 4X34A 3CCSQ 3CCSA 5IAYA 1WHMA 3WVEB 4OMMA 3MEUA 2LCCA 3BDLA 4A4EA 2EJFA 1WHLA 4FM4B 3NMZC 4GLKA 3TSWA 3G4SQ 3G4SA 5GAOp 1OULA 1VOMA 3OYJA 2LT1A 3MHXA 3QWYA 2XU8A 1M3CA 3VRYA 1WXUA 1QW1A 2FZKB 1Y57A 4M78F 4GY5A 4ZNXA 1GL5A 1RADB 2EQJA 3HRSA 3NTKA 1HSQA 2CGHA 4HVWA 2EYXA 1D0ZA 2WSEE 1W2BA 4E6RA 3LLRA 1WJSA 4BD3A 2RQTA 2BZYA 3AT1B 2PUKB 3CCRQ 1NYFA 3CCRA 2DKGA 3LH0A 4PJJA 4PNOA 4XTXA 3CPWP 2CUBA 4JLIA 2RJCA 2CZ7B 1X01A 3H6ZA 2JZ2A 3OW2P 2KSSA 1YP5A 2I0NA 2QQSA 4IIOA 5AT1B 2AK5A 5GAN8 1X6OA 4OMNA 2KK4A 4DA4A 4E7ZA 4RCCA 2RH2A 3MCAB 2ZPBB 2FPFA 3M54A 4M7DG 1MNDA 1YN8A 2RPNA 3FLGA 2XMFA 2ATCB 4E7HA 5DY9A 1OEBA 1KG1A 4HCBA 1I1JA 3O5ZA 2NUTB 3ZFJA 2E5KA 4K11A 1ZSZA 5GAMe 2DF6A 4BY6B 4C92G 4BDYA 1KQSP 1MV3A 2X3XD 2MPXC 2E3HA 1LVKA 4CRIA 1UFFA 4C5HA 1VQPQ 3CCJQ 1VQPA 3CCJA 3EG3A 1V29B 1WPYA 2EBPA 4M77A 1XNIA 2O88A 4KBMB 3S6WA 3M0UA 4MZMA 3CCQT 1K73C 2K7AA 4JJNK 2G6FX 4M7DA 1RI0A 2E3IA 1FX7A 3SHWA 2E41A 5FW9A 2QG9B 4OF1A 2NWMA 1KIKA 2QASA 2CKKA 2EFIA 5LL6S 3UA6A 4E7LA 2LX7A 3RR6A 3X20B 3CC2Q 3CC2A 1IGQA 1JJ2P 3MJXA 4EMKA 1I4K1 5FU6C 4C92A 1C0MA 1GBQA 3P8BB 1IGUA 1MMDA 1Q81R 3V7CA 4ZN3A 4LDUA 2AKKA 4E7IA 3M4YA 4M7AD 3EGDB 3H41A 4PJOG 1PNJA 1OPLA 1RI9A 1KD1R 4C5IA 4EMGA 3JCMP 2A37A 2QTVA 2AHJB 3EFOB 3G71T 3GP8A 2Y4YA 5GAN3 5FU7B 4R56A 1YNZA 4M75E 3VS1A 1M4ZA 1K9AA 4FSXA 2RQVA 2AZVA 1FMKA 2DA9A 5KYWB 2L5QA 1MGQA 5FU6B 4OVAA 1W6XA 2MIOA 2VXEA 1Z9ZA 3V7RA 5EC7A 1AT1B 1YCYA 4KH1B 3JCMf 3JB9J 4ANJA 1WDXA 3M53A 2D6FA 4JPBW 2DBMA 1GCQA 1BK2A 3X25B 1YITQ 2ZZDA 4AG2C 1YITA 3OYFA 3FIFA 2DE0X 2XIDA 3E1SA 1VYVA 2QEXQ 2EW3A 1YIJQ 5GAN6 2P0KA 2HL3A 1YIJA 2FZCB 2QGFB 2SRCA 3H8ZA 2CP0A 2EIFA 3VUBA 4C8QE 4QQDA 5AYFA 3TEEA 4J6XA 3L2UA 2DXBA 3SWNB 3CD6T 5KH6A 2E64A 1M2VB 1WHJA 2FRWA 2OTJT 4C5GA 1GCPA 4J6WA 1KJWA 5FWCA 2P0QA 2G3RA 5GANg 4FCYA 2QI2A 2V8IA 1G8XA 2QQ9A 5J3BA 3M58A 3BW1A 2JT4A 4OMLA 2IG0A 2JUFA 2BKDN 1PSEA 2AKLA 2BE9B 4M77B 4ELYC 1NYGA 1WA7A 2CH4W 4NL2A 2M1HA 3CC7Q 3RMSA 3CC4T 3CC7A 4L6V5 4PK4A 3CCLQ 1UGVA 3CCLA 1M5Q1 3QZ5B 4RMOA 1WX6A 3VS0A 1QCOA 3PT9A 1UB4A 2DZCA 2F1LA 1M30A 4QW2A 2H8HA 2WACA 2XDPA 1IZ6A 5LJ3f 2DL3A 1AWXA 5GAMj 2SEMA 3H9NA 1W2BS 2EKOA 2RHYA 2VB6A 1C1AA 1M3AA 2HNIA 5IN1A 1VQOQ 1DJ7B 1VQOA 4M7DD 2C0TA 3QBYA 2GQIA 2ABLA 1PRLC 3OYKA 4J8OA 2CP2A 2ZPGB 2X9HA 4C92D 3N5BB 3OS2A 1NEBA 1B07A 1OOTA 1WXTA 4M7AE 4D6WA 4E7JA 1R8OB 2YSQA 3C0CA 1MHNA 4F14A 1AEYA 3PE0A 2QA4T 3PMIA 2HL5C 4BDZA 5LJ5d 3A8LB 3CCVQ 1NG2A 2FL7A 3BY7A 3OW2A 1PG5B 1BIAA 2E1HA 4J9HA 1NJIR 1I5LA 1K9MR 2OAUA 2BE7D 4L5GA 4UC4A 3BDUA 4F7UF 2DIQA 3RKYA 4NS5A 2P0PA 5CK9A 3L1AA 2DTHA 2K2MA 1D1CA 2DD5A 1SPKA 2DXCA 3VJPA 1JU5C 3OYYA 2O31A 2X4YA 1M90R 3VS4A 5GAOl 4JRQA 1M1FA 1T0HA 3MPUB 1MNEA 2YUNA 4Z02A 3HPWA 1UTIA 2GTOA 3IQLA 1U5SA 2E5QA 2NYSA 1K0SA 1CSKA 4A4HA 2OI3A 2L89A 3ZL7C 2A3LA 3VRZA 4PJOD 1ZHIA 3SDZA 3EG0A 3AHUA 2YUOA 3CXCP 2Z0WA 2DL5A 3ZBDA 1B34B 1SF9A 2V1RA 3QDRB 3PGGA 2DRKA 3EGUA 2AIRB 2MF2A 2J6KA 3VS7A 5GJVB 1QVPA 4OP0A 3FJ5A 3MO8A 1IHVA 1Q86R 2RHUA 3DB3A 4WF2A 1FXXA 1ZA1B 3EFRA 3QKJA 4RTUA 2DBKA 4XTZA 4B9XA 3MKDA 1G2BA 3QJYA 5I11A 5ECAA 3JCMe 1PHTA 5A0LA 2K79A 1EFNA 1EX4A 2C0IA 3S3MA 4X9CA 4KRTA 5IXFA 5C0MA 3JCMh 3CCUT 3X26B 4F17A 1UHCA 2GBQA 3MEWA 3P8DA 1LPLA 3TQ7P 4RTVA 3UATA 3RESA 4II1A 2GNCA 4DOWA 2PUOB 3RKXA 2DL4A 2DFUA 1YJWT 1VQNT 2ESWA 5CKHA 1PSFA 4RTTA 1Q82R 4QVDA 1YI2Q 3DLMA 1YI2A 2EQMA 3M0RA 1H8KA 2RI3A 4ZTJA 4OB3B 1QMCA 1O75A 1JRIA 2RQWA 1S72T 3GOXA 4XU0A 4Z89A 1O9SA 2EJ9A 1LJOA 4F16A 5GAN7 1ZBJA 3I9QA 2EVRA 2RQRA 4VUBA 3DKMA 4M7DE 2QDLA 3BE3A 3KBGA 1XQHA 2O01E 4MDXA 4BE0A 4ESRA 1PM3A 1I8FA 3CMAQ 3CMAA 1VQ7Q 2PVGB 1VQ7A 4C92E 2VXFA 5CKFA 1GRIA 5D6YA 1LCKA 1VQ9T 2W10A 2YDLA 2E65A 4M78C 3SEMA 5CCAA 2BIVA 1VQ5Q 5LJ3e 1VQ5A 1TH7A 3M57A 3JSCA 3FB9A 1GFCA 4M75B 2ZPHB 2JM9A 1ZLMA 2V26A 2PZ1A 2MCNA 1YHQT 2LC4A 1C6VX 3EH1A 3OSSC 2KEAA 3LWIA 2DEUA 2KBTA 4YTLA 3CCMQ 2L3PA 3CCMA 2L3QA 4J7IA 2JJ9A 1NJIU 2ED0A 2FPEA 2M02A 2D9TA 2QDYB 4C8QC 3C94A 1WHGA 3JRZA 2M9UA 3JV3A 3UPUA 2XI9A 2PVOB 4HCKA 2MAMA 1K0XA 4JJCA 5CVIA 2RMOA 1M90U 2K4YA 3TREA 1WLPB 2VASA 2IVWA 4KGXB 2KMTA 4M75F 1D0XA 4AMCA 3OYNA 1OX9A 3QSUA 3I56Q 3I56A 3FEOA 4FSSA 3JCMc 4PJOE 4KULA 2KYBA 2X4WA 3HFNA 1VQLA 1TG0A 1QVFA 1TWBA 5GANf 4AFQC 2CZ6B 2CUDA 2KT8A 5GAOr 1AVZC 1KC8U 2VWFA 4C8QB 4EDUA 1JBMA 5GAOn 5CO7A 1IREB 1Q86U 3V8LA 2ZGWA 2RHZA 3OW2S 1OQKA 2XKOC 4BACA 1PD1A 3RUXA 2KRMA 2EQIA 1GBRA 2FHDA 1YJNQ 2GTJA 1YJNA 2F5KA 1SSFA 4BY6C 3BFMA 4X9DA 3L2RA 3OS1A 2L8DA 4J9CA 4V2SA 1VQ8T 1W4SA 1Q7YR 3OS0A 4C0ZA 1N8RU 2LRQA 1Y7XA 4CC4B 1M3BA 3E19A 1K1ZA 1OYXA 1VQ4T 4C8QF 2HQEA 1RACB 3EG1A 1AWOA 3QWXX 3TVTA 2DD4A 2E6ZA 5L8RE 2DMOA 4JJDA 3JB9F 3EH2A 1OZ2A 2WSFE 3JCMV 1X6BA 1Q82U 2A7YA 2IPOB 4A4GA 3I55Q 3UA7A 3I55A 3VS3A 1D0YA 3L42A 2YHTA 3CCET 5GAN2 1AZGB 1QVGA 4LUDA 4ZN1A 2XDDA 4PFZA 2EGAA 3QYHB 2CSQA 3OYBA 1OZ3A 3C95A 1T3SA 1KHIA 2KE9A 2ZCFB 3GLXA 4O6JA 2RK1A 3CXCA 4AFZC 2LJ0A 2HSPA 4XU1A 5FU7C 4M7AB 2JXBA 5D6WA 1U1TA 5IH2A 2KVQG 1BKBA 3INZA 2QYZA 5KE2A 2EQUA 2OTLT 2A08A 5IT9E 1UEBA 2B8AA 3VYHB 1OU9A 5GAOm 2KXCA 2LQWA 1GFDA 4F7UG 3PIOA 3SFMA 3E9GA 5FRNA 5LJ3j 2FZGB 1S1NA 8AT1B 3H0HA 2KAFA 4FYXB 2P4RA 1H3HA 4M7AF 1AOJA 2PU9B 4BB7A 1NE8A 2EGEA 1YJ9T 4BI3A 2F2VA 4ATOA 2YXYA 3EAEA 4XK8E 1TOVA 2JN0A 2LQ8A 3M0QA 2VUBA 4GBQA 1VQ6T 2LZ6B 5GAMd 4HCCA 4XTUA 1IRXA 4FW1A 3OYAA 2LT4A 2LTOA 3GBQA 2FO0A 4JZ3A 3SWNC 2YT6A 2QK0A 2R5MA 2K3YA 4XU2A 2BZ8A 3I35A 1M8VA 2HBWA 1YFNA 4PJOA 2RJDA 4PJLA 1Q81C 4OGCA 2KQWA 2P84A 5A0GA 3CEYA 1VQMT 2NUPA 4ZTFA 3ASKA 1X2KA 2VC8A 3JAME 1KHCA 2DO3A 2JTFA 2RQUA 1F1BB 4N0AA 2QEXA 1MMAA 4M77C 2DNUA 1TU0B 2GGRA 5FLXE 3GNFB 1I5OB 1UJ0A 2L3RA 2JM8A 4HVVA 1WJQA 1X6GA 3J81E 4J5YA 2K3XA 6AT1B 2HKQB 5GANe 3OQ5A 1YCSB 3TCJA 4A63B 4A53A 5FWBA 1ZSZB 1JXMA 1Y71A 4ZGEB 2O4XA 1FMWA 2HAXA 4FIBA 5GANh 4HT9A 2KRSA 4XTWA 4ZGJB 1M1GA 3X24B 1UGPB 2Y4XA 3CMET 3NHNA 3OY9A 1QVFS 1VQKT 2R58A 1E6GA 5FROA 2PQWA 4M7DB 1W70A 2OJ2A 4F04B 3PFSA 2HQXA 2QQRA 1N9SA 1PKTA 4E7KA 1OX8A 2V8KA 2RJEA 5LJ5g 1UG1A 5HK3A 1G83A 2DM1A 1PCXA 2ENMA 4EMKB 1ABQA 4C92B 5LJ5h 3HHTB 2K6DA 1IO6A 4J6YA 2KRNA 1PRMC 2DJQA 3M9QA 1T3LA 1UJYA 4M77F 2DRMA 1NPPA 1BU1A 2RB6A 1X2QA 3I5RA 1I81A 1LOJA 2RNAA 1GCQC 2ZAEA 1Y0MA 4M7DF 3QHSA 3QYGB 3PVQA 2DEQA 2J06A 5CKDA 1Y96A 3E9FA 1MUZA 5IHKA 3OYGA 1OU8A 4E2FB 4AFSC 1ABOA 4HCZA 3G6EQ 1KSWA 3G6EA 2QGGA 4AFUC 2DIGA 3M0TA 2VGMA 4XTVA 1K8AR 2FEIA 2EYQA 2KY9A 3L2ZA 3CCQQ 4C92F 3CCQA 1U06A 3C12A 1Q81U 5A0DA 3RERA 3KUFA 4NOYA 3LW5E 3OYLA 4LD9K 3GIBA 2AZSA 2XDBA 2FG0A 2PVDB 3CCMT 4OGEA 4EPCA 2YLBA 2E4HA 3CPWA 2HBPA 1W2BP 3QO3A 2X51A 1VA7A 4DBFA 3CCVA 1QVGS 4BI4A 3LYIA 3L2WA 3META 2RD1A 1KD1U 3NGPA 3EG9A 1Y07A 4PJOB 2MWOA 4DBRA 3ER0A 2AT1B 1MMNA 4IUVA 3SD4A 2F5TX 4EMHA 1NPRA 3OYDA 3LWHA 3M0PA 3A8HB 1SKUB 3CXCS 4OMPA 3A5ZB 3VS2A 2XK0A 3I56T 2ROTA 1WHHA 1M1KR 2A36A 3NTHA 3V8JA 1VQLT 5KYNA 3G71Q 2LX9A 3G71A 3CCST 4M78G 1KQSA 2JNGA 4RTWA 2LDMA 5I21A 2D1XA 1I07A 1NEGA 3RMQA 1SSHA 4IUQA 3G4ST 4OMQA 1TTHB 5CQYA 1WJRA 4DQ2A 3NFCA 2O4XB 1TXQA 1NJIC 4BUGA 3OMGA 2ZPIB 2JMCA 2EJGA 2D0NA 3HKSA 4C5EA 5D7UA 2K3BA 1RABB 1D3BA 4OB1B 5L23A 4R0KA 2VV5A 2K5LA 3EGXA 4FYWB 2HMAA 5CQXA 3A8MB 1M90C 3CCRT 4FYYB 4BE2A 1SRLA 2ED1A 1JJ2A 3JB9G 4LDYA 2RI5A 5CR2A 1U3OA 4JS5A 2MMPA 3J80E 2RN8A 2COYA 4LDWA 2J6FA 1BB9A 2R57A 5KYUA 4ORZA 3CBMA 2RI2A 4Q5WA 2D8HA 2KDSA 2ECZA 2QQAA 4N4GA 2LQKA 4JS4A 5GANj 1QP2A 3PMTA 7AT1B 1I0CA 4QVCA 5C6SA 2MOXA 3QUIA 3JCMQ 2DTIA 2CYZB 4Z8AA 2GFAA 4ZGDB 1H641 1EZZB 1KC8C 2CZ0B 2RO0A 5GMKe 1NBEB 2ZPFB 1PKSA 1ACMB 4RTXA 3HFOA 1Q86C 2GFUA 4P5NA 2JW4A 3NTIA 1SHGA
chains in the Genus database with same CATH topology
1K9AA 1MV0B 2RQVA 2KRMA 2EQIA 2AZVA 1GBRA 1TUDA 3VS5A 2GTJA 4OMOA 1FMKA 2DA9A 2LP5A 1QWEA 2LMJA 1ZUKA 1W6XA 4J9CA 2MIOA 1UHFA 1Z9ZA 5EC7A 4CC4B 2F2XA 1M3BA 1K1ZA 4D8KA 5HCKA 1WDXA 2L3SA 3EG1A 1AWOA 2D8JA 4CC7A 4JPBW 2DBMA 1SRMA 3QWXX 1GCQA 3TVTA 1BK2A 1QCFA 1ZUYA 4AG2C 2DMOA 4JJDA 2DE0X 1VYVA 2C0OA 3PVLA 3TSZA 1X6BA 4RTYA 2EW3A 3UA7A 3VS3A 2SRCA 2BTTA 2J6OA 4EIKA 1AZGB 1X43A 4LE9A 4LUDA 2HDAA 2L2PA 1RUWA 1AZEA 2EGAA 1ZUUA 2CSQA 1T3SA 2KE9A 2FRWA 3H0IA 1E6HA 1TUCA 1GCPA 1QLYA 1KJWA 5FWCA 4QT7A 1E7OA 4AFZC 4CC2A 2LJ0A 2HSPA 2JXBA 2LJ1A 2JT4A 4OMLA 5IH2A 1T0JA 1FYNA 2AKLA 4M4ZA 2V1QA 4CC3A 1NYGA 1WA7A 2CH4W 2KT1A 2LCSA 2A08A 1NM7A 2EYWA 2PTKA 3I5SA 4J9EA 1UGVA 2EYZA 2KXCA 2FRYA 1WX6A 2LQWA 1GFDA 1ARKA 3VS0A 2M51A 3UF4A 2JMAA 2EPDA 1M30A 4JZ4A 2M0YA 2KR3A 2H8HA 3VS6A 2OAWA 1BBZA 1S1NA 4DEYA 2DL3A 2K9GA 3H0HA 1AWXA 2P4RA 1H3HA 2SEMA 3R6NA 1AOJA 1M8MA 2KYMA 2EGCA 2EGEA 2X3WD 1M3AA 2F2VA 3THKA 2FPDA 1X69A 2C0TA 1QKXA 2GQIA 2ABLA 4J9FA 3M0QA 4GBQA 1V1CA 3EG2A 1CKAA 4D8DA 2LZ6B 1PRLC 1WI7A 1JEGA 1H92A 1AWJA 3GBQA 2FO0A 2A28A 1UUEA 4JZ3A 2YT6A 1NEBA 1B07A 1OOTA 1WXTA 2DILA 2BZ8A 3I35A 2DL8A 2HBWA 1M27C 2YSQA 3C0CA 4F14A 1AEYA 3PE0A 2YUPA 2DX1A 4LN2A 1B3QA 2HEQA 4AG1C 1NG2A 1X2KA 3CQTA 2RQUA 4J9HA 3REBB 5GJWB 2RF0A 1OPKA 2DNUA 2GGRA 2O2OA 2W0ZA 4WCIA 1QKWA 1UECA 1UJ0A 1WXBA 2JM8A 4HVVA 2NUZA 2CT4A 2K2MA 3KFVA 1X6GA 1SPKA 1JU5C 2O31A 3NPFA 2YUQA 3VS4A 1T0HA 4J9BA 2YUNA 3H0FA 1UTIA 2GTOA 2BZXA 1YCSB 1U5SA 3IQLA 3U23A 4A63B 1CKBA 1K0SA 5FWBA 1CSKA 4J9GA 1JXMA 2KROA 1VYTA 1AWWA 2OI3A 1ZX6A 1W1FA 3ZL7C 4HVUA 4IIMA 3VRZA 3EG0A 2YUOA 4LUEA 2KRSA 3LH5A 2DL5A 2V1RA 1SHFA 1QWFA 2DRKA 1X27A 3EGUA 2J6KA 3NHNA 3EHRA 1K76A 1ZSGA 5I22A 1NLOC 3VS7A 3REAB 5GJVB 1XOVA 3FJ5A 1E6GA 4GLMA 2B86A 1WIEA 1W70A 2OJ2A 1SEMA 2J05A 4RTUA 2VVKA 2DBKA 1PKTA 2CT3A 1G2BA 5I11A 1JXOA 5ECAA 1PHTA 1UG1A 2DL7A 1G83A 2DM1A 2ENMA 1YWOA 1OV3A 2K79A 1ABQA 1RLPC 2EYYA 1EFNA 1RLQC 2C0IA 2CSIA 4KRTA 1HD3A 5IXFA 2K6DA 2JS2A 1IO6A 3M0SA 2KRNA 2DYBA 1PRMC 1WYXA 2DJQA 2LQNA 4RTZA 4F17A 1T3LA 4HXJA 1UJYA 2DRMA 1K4US 1BU1A 1UHCA 2HCKA 1X2QA 3I5RA 4OMMA 2KXDA 2GBQA 5IXBA 2RNAA 1GCQC 1N5ZA 1Y0MA 4RTVA 3UATA 4JJBA 1PWTA 2GNCA 2CDTA 3PVQA 3NMZC 3TSWA 2J06A 2DL4A 4J9IA 2ESWA 4RTTA 3QWYA 1MUZA 5IHKA 1M3CA 4AFSC 1ABOA 3VRYA 1WXUA 1KSWA 4AFUC 1Y57A 3M0TA 2FEIA 3M0RA 2KGTA 4ZNXA 1GL5A 1H8KA 1Z9QA 4X1VA 1U06A 1HSQA 2VKNA 4HVWA 1J3TA 2EYXA 1A0NB 2AZSA 2RQWA 1JO8A 4Z88A 4E6RA 2FG0A 4Z89A 2CREA 2RQTA 2BZYA 1VA7A 4F16A 1NYFA 1ZBJA 3I9QA 2CUBA 2EVRA 2RQRA 3NGPA 2JS0A 2QDLA 1AD5A 3RNJA 1YP5A 4IIOA 2JTEA 2LJ3A 2AK5A 4ESRA 4OMNA 3M0PA 2KNBB 4OMPA 3VS2A 2FPFA 1GRIA 1YN8A 1UDLA 2ROTA 2RPNA 1WFWA 4LNPA 1LCKA 2DLPA 2A36A 2W10A 2YDLA 3SEMA 2XMFA 4DEXA 1OEBA 1I1JA 3O5ZA 2L0AA 1GFCA 4RTWA 2E5KA 4K11A 2DF6A 2JM9A 2PNIA 1ZLMA 2D1XA 1MV3A 3RBBB 2X3XD 2PZ1A 2MCNA 1I07A 2EKHA 1NEGA 1SSHA 1UFFA 4OMQA 2KEAA 2KBTA 3EG3A 2L3PA 3EHQA 2L3QA 2J7IA 2EBPA 2ED0A 2FPEA 2O88A 4RUGA 3M0UA 2JMCA 3JV3A 4J9DA 2D0NA 2K7AA 2LNHB 4HCKA 2G6FX 1K0XA 2K3BA 4JJCA 3SHWA 5L23A 2RMOA 5FW9A 4Y92A 4R0KA 2NWMA 1KIKA 2ROLA 1WLPB 1SRLA 2ED1A 3A98A 3UA6A 5IHNA 2DVJA 2LX7A 2O9VA 1U3OA 2RN8A 4FSSA 2J6FA 1BB9A 2CH4A 1UE9A 1GBQA 4ORZA 2KYBA 2D8HA 1KFZA 2F2WA 5IHIA 2ECZA 1TG0A 1VYUA 2O9SA 1I0CA 2AKKA 4AFQC 3ULRB 2MOXA 3H41A 2CUDA 2KT8A 1AVZC 4Z8AA 1PNJA 2VWFA 1OPLA 1RI9A 2A37A 1YNZA 1PKSA 2IIMA 4RTXA 1HJDA 1JQQA 1NLPC 2JW4A 1YWPA 3VS1A 2I0NA 1SHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K9A A;  1MV0 B;  2RQV A;  2KRM A;  2EQI A;  2AZV A;  1GBR A;  1TUD A;  3VS5 A;  2GTJ A;  4OMO A;  1FMK A;  2DA9 A;  2LP5 A;  1QWE A;  2LMJ A;  1ZUK A;  1W6X A;  4J9C A;  2MIO A;  1UHF A;  1Z9Z A;  5EC7 A;  4CC4 B;  2F2X A;  1M3B A;  1K1Z A;  4D8K A;  5HCK A;  1WDX A;  2L3S A;  3EG1 A;  1AWO A;  2D8J A;  4CC7 A;  4JPB W;  2DBM A;  1SRM A;  3QWX X;  1GCQ A;  3TVT A;  1BK2 A;  1QCF A;  1ZUY A;  4AG2 C;  2DMO A;  4JJD A;  2DE0 X;  1VYV A;  2C0O A;  3PVL A;  3TSZ A;  1X6B A;  4RTY A;  2EW3 A;  3UA7 A;  3VS3 A;  2SRC A;  2BTT A;  2J6O A;  4EIK A;  1AZG B;  1X43 A;  4LE9 A;  4LUD A;  2HDA A;  2L2P A;  1RUW A;  1AZE A;  2EGA A;  1ZUU A;  2CSQ A;  1T3S A;  2KE9 A;  2FRW A;  3H0I A;  1E6H A;  1TUC A;  1GCP A;  1QLY A;  1KJW A;  5FWC A;  4QT7 A;  1E7O A;  4AFZ C;  4CC2 A;  2LJ0 A;  2HSP A;  2JXB A;  2LJ1 A;  2JT4 A;  4OML A;  5IH2 A;  1T0J A;  1FYN A;  2AKL A;  4M4Z A;  2V1Q A;  4CC3 A;  1NYG A;  1WA7 A;  2CH4 W;  2KT1 A;  2LCS A;  2A08 A;  1NM7 A;  2EYW A;  2PTK A;  3I5S A;  4J9E A;  1UGV A;  2EYZ A;  2KXC A;  2FRY A;  1WX6 A;  2LQW A;  1GFD A;  1ARK A;  3VS0 A;  2M51 A;  3UF4 A;  2JMA A;  2EPD A;  1M30 A;  4JZ4 A;  2M0Y A;  2KR3 A;  2H8H A;  3VS6 A;  2OAW A;  1BBZ A;  1S1N A;  4DEY A;  2DL3 A;  2K9G A;  3H0H A;  1AWX A;  2P4R A;  1H3H A;  2SEM A;  3R6N A;  1AOJ A;  1M8M A;  2KYM A;  2EGC A;  2EGE A;  2X3W D;  1M3A A;  2F2V A;  3THK A;  2FPD A;  1X69 A;  2C0T A;  1QKX A;  2GQI A;  2ABL A;  4J9F A;  3M0Q A;  4GBQ A;  1V1C A;  3EG2 A;  1CKA A;  4D8D A;  2LZ6 B;  1PRL C;  1WI7 A;  1JEG A;  1H92 A;  1AWJ A;  3GBQ A;  2FO0 A;  2A28 A;  1UUE A;  4JZ3 A;  2YT6 A;  1NEB A;  1B07 A;  1OOT A;  1WXT A;  2DIL A;  2BZ8 A;  3I35 A;  2DL8 A;  2HBW A;  1M27 C;  2YSQ A;  3C0C A;  4F14 A;  1AEY A;  3PE0 A;  2YUP A;  2DX1 A;  4LN2 A;  1B3Q A;  2HEQ A;  4AG1 C;  1NG2 A;  1X2K A;  3CQT A;  2RQU A;  4J9H A;  3REB B;  5GJW B;  2RF0 A;  1OPK A;  2DNU A;  2GGR A;  2O2O A;  2W0Z A;  4WCI A;  1QKW A;  1UEC A;  1UJ0 A;  1WXB A;  2JM8 A;  4HVV A;  2NUZ A;  2CT4 A;  2K2M A;  3KFV A;  1X6G A;  1SPK A;  1JU5 C;  2O31 A;  3NPF A;  2YUQ A;  3VS4 A;  1T0H A;  4J9B A;  2YUN A;  3H0F A;  1UTI A;  2GTO A;  2BZX A;  1YCS B;  1U5S A;  3IQL A;  3U23 A;  4A63 B;  1CKB A;  1K0S A;  5FWB A;  1CSK A;  4J9G A;  1JXM A;  2KRO A;  1VYT A;  1AWW A;  2OI3 A;  1ZX6 A;  1W1F A;  3ZL7 C;  4HVU A;  4IIM A;  3VRZ A;  3EG0 A;  2YUO A;  4LUE A;  2KRS A;  3LH5 A;  2DL5 A;  2V1R A;  1SHF A;  1QWF A;  2DRK A;  1X27 A;  3EGU A;  2J6K A;  3NHN A;  3EHR A;  1K76 A;  1ZSG A;  5I22 A;  1NLO C;  3VS7 A;  3REA B;  5GJV B;  1XOV A;  3FJ5 A;  1E6G A;  4GLM A;  2B86 A;  1WIE A;  1W70 A;  2OJ2 A;  1SEM A;  2J05 A;  4RTU A;  2VVK A;  2DBK A;  1PKT A;  2CT3 A;  1G2B A;  5I11 A;  1JXO A;  5ECA A;  1PHT A;  1UG1 A;  2DL7 A;  1G83 A;  2DM1 A;  2ENM A;  1YWO A;  1OV3 A;  2K79 A;  1ABQ A;  1RLP C;  2EYY A;  1EFN A;  1RLQ C;  2C0I A;  2CSI A;  4KRT A;  1HD3 A;  5IXF A;  2K6D A;  2JS2 A;  1IO6 A;  3M0S A;  2KRN A;  2DYB A;  1PRM C;  1WYX A;  2DJQ A;  2LQN A;  4RTZ A;  4F17 A;  1T3L A;  4HXJ A;  1UJY A;  2DRM A;  1K4U S;  1BU1 A;  1UHC A;  2HCK A;  1X2Q A;  3I5R A;  4OMM A;  2KXD A;  2GBQ A;  5IXB A;  2RNA A;  1GCQ C;  1N5Z A;  1Y0M A;  4RTV A;  3UAT A;  4JJB A;  1PWT A;  2GNC A;  2CDT A;  3PVQ A;  3NMZ C;  3TSW A;  2J06 A;  2DL4 A;  4J9I A;  2ESW A;  4RTT A;  3QWY A;  1MUZ A;  5IHK A;  1M3C A;  4AFS C;  1ABO A;  3VRY A;  1WXU A;  1KSW A;  4AFU C;  1Y57 A;  3M0T A;  2FEI A;  3M0R A;  2KGT A;  4ZNX A;  1GL5 A;  1H8K A;  1Z9Q A;  4X1V A;  1U06 A;  1HSQ A;  2VKN A;  4HVW A;  1J3T A;  2EYX A;  1A0N B;  2AZS A;  2RQW A;  1JO8 A;  4Z88 A;  4E6R A;  2FG0 A;  4Z89 A;  2CRE A;  2RQT A;  2BZY A;  1VA7 A;  4F16 A;  1NYF A;  1ZBJ A;  3I9Q A;  2CUB A;  2EVR A;  2RQR A;  3NGP A;  2JS0 A;  2QDL A;  1AD5 A;  3RNJ A;  1YP5 A;  4IIO A;  2JTE A;  2LJ3 A;  2AK5 A;  4ESR A;  4OMN A;  3M0P A;  2KNB B;  4OMP A;  3VS2 A;  2FPF A;  1GRI A;  1YN8 A;  1UDL A;  2ROT A;  2RPN A;  1WFW A;  4LNP A;  1LCK A;  2DLP A;  2A36 A;  2W10 A;  2YDL A;  3SEM A;  2XMF A;  4DEX A;  1OEB A;  1I1J A;  3O5Z A;  2L0A A;  1GFC A;  4RTW A;  2E5K A;  4K11 A;  2DF6 A;  2JM9 A;  2PNI A;  1ZLM A;  2D1X A;  1MV3 A;  3RBB B;  2X3X D;  2PZ1 A;  2MCN A;  1I07 A;  2EKH A;  1NEG A;  1SSH A;  1UFF A;  4OMQ A;  2KEA A;  2KBT A;  3EG3 A;  2L3P A;  3EHQ A;  2L3Q A;  2J7I A;  2EBP A;  2ED0 A;  2FPE A;  2O88 A;  4RUG A;  3M0U A;  2JMC A;  3JV3 A;  4J9D A;  2D0N A;  2K7A A;  2LNH B;  4HCK A;  2G6F X;  1K0X A;  2K3B A;  4JJC A;  3SHW A;  5L23 A;  2RMO A;  5FW9 A;  4Y92 A;  4R0K A;  2NWM A;  1KIK A;  2ROL A;  1WLP B;  1SRL A;  2ED1 A;  3A98 A;  3UA6 A;  5IHN A;  2DVJ A;  2LX7 A;  2O9V A;  1U3O A;  2RN8 A;  4FSS A;  2J6F A;  1BB9 A;  2CH4 A;  1UE9 A;  1GBQ A;  4ORZ A;  2KYB A;  2D8H A;  1KFZ A;  2F2W A;  5IHI A;  2ECZ A;  1TG0 A;  1VYU A;  2O9S A;  1I0C A;  2AKK A;  4AFQ C;  3ULR B;  2MOX A;  3H41 A;  2CUD A;  2KT8 A;  1AVZ C;  4Z8A A;  1PNJ A;  2VWF A;  1OPL A;  1RI9 A;  2A37 A;  1YNZ A;  1PKS A;  2IIM A;  4RTX A;  1HJD A;  1JQQ A;  1NLP C;  2JW4 A;  1YWP A;  3VS1 A;  2I0N A;  1SHG A; 
#chains in the Genus database with same CATH topology
 3GF5 A;  4PFO A;  2X4J A;  1X75 C;  3FC3 A;  5GMK h;  4M75 C;  3VS5 A;  4OMO A;  1Y96 B;  2E10 A;  2RK2 A;  2WSC E;  3MP1 A;  4PLI A;  3CCJ T;  1VQP T;  1KQ2 A;  1UGR B;  1QWE A;  1UHF A;  4MMK A;  3CC4 Q;  2K57 A;  3CC4 A;  1N8R C;  2MYS A;  5HCK A;  2L3S A;  3OB9 A;  4MZP A;  1XTD A;  1QCF A;  3CC2 T;  3EG9 B;  1PD0 A;  2XG8 D;  9ATC B;  4PFP A;  3TSZ A;  3JCM d;  3MP6 A;  4IUU A;  1Q82 C;  2DJZ A;  1K8A U;  2DTO A;  2BTT A;  5CKB A;  4RG8 A;  3RKW A;  4EIK A;  2HDA A;  2L2P A;  1RUW A;  1ZUU A;  4B6M A;  5D6X A;  4PL6 A;  3QZ9 B;  2XHC A;  2RA2 A;  3QJ6 A;  4DBQ A;  5A2Q E;  3H0I A;  1TUC A;  1K9M U;  4R55 A;  2CP6 A;  3OS5 A;  1G3S A;  4BI8 B;  4QT7 A;  1E7O A;  1PC0 A;  4FU6 A;  5GAN 5;  4A54 A;  4FL6 A;  4F7U E;  1T0J A;  1FYN A;  3M5A A;  2QA4 Q;  2QA4 A;  3PNW C;  2LCS A;  1M1K U;  4HKE A;  4HT8 A;  2EYW A;  2PTK A;  3G1J A;  3I5S A;  4PLL A;  3JB9 I;  1D3B B;  3QDF A;  3M55 A;  2HZY A;  3UF4 A;  2H3J A;  4PKC C;  2EPD A;  1RAH B;  2M0Y A;  1YIT T;  1XJW B;  1V76 A;  4KGZ B;  3OSV A;  3QPH A;  2OAW A;  1BBZ A;  4DEY A;  2X35 A;  4N4H A;  2QEX T;  3EGD A;  5GAN 4;  3TU4 K;  1YIJ T;  1QP3 A;  1M8M A;  1VIF A;  3CPW S;  5FRM A;  2EGC A;  3CBP A;  2F69 A;  5DM7 R;  3WXM B;  4FW2 A;  2FPD A;  5LJ3 d;  1X69 A;  4NL3 A;  4LDV A;  1QKX A;  1HK9 A;  1V1C A;  3OYM A;  3EG2 A;  1WI7 A;  3A8G B;  1JEG A;  1H92 A;  1AWJ A;  2QTX A;  4QKU A;  3KXT A;  1G3W A;  5KYW A;  4M78 D;  1RAG B;  3X28 B;  2DET A;  5LJ5 f;  2A28 A;  2DAQ A;  4KH0 B;  3VKI A;  2DIL A;  4ELZ C;  4IUR A;  2DL8 A;  3ZEH A;  2H3E B;  4E7S A;  1WQW A;  4FT2 A;  2E6N A;  3WVD B;  2HD0 A;  4LN2 A;  4M7A C;  1B3Q A;  2HEQ A;  1BI1 A;  1RL2 A;  4AG1 C;  5HK0 A;  1KQS S;  3CC7 T;  3SB2 A;  3GPL A;  3REB B;  3CCL T;  5GJW B;  3J7A F;  1OPK A;  4C8Q D;  1TUG B;  1BI2 A;  2O2O A;  4J83 A;  4WCI A;  4JRP A;  1QKW A;  1K73 R;  1UEC A;  3CCU Q;  4M77 G;  3CCU A;  1WXB A;  1G5V A;  2NUZ A;  2CT4 A;  3KFV A;  3JB9 D;  4KT0 E;  5GMK j;  3NPF A;  2DPP B;  3OYE A;  5DLO A;  4J9B A;  3JCM b;  2OX7 A;  1LNX A;  3U23 A;  3SWN A;  1YJW Q;  1VUB A;  1VQN Q;  1CKB A;  2YRD A;  1YJW A;  1VQN A;  2ZPE B;  1YBY A;  2I2L A;  4J9G A;  1M2V A;  1Q7Y C;  2A0F B;  1JJ2 S;  1AWW A;  1NZ9 A;  1VQO T;  4HVU A;  5I2M A;  4IIM A;  3OYH A;  2DZ9 A;  4LD6 A;  3LH5 A;  4ME7 A;  5GAM g;  3DB4 A;  3P8H A;  1SHF A;  2MI6 A;  3URG A;  1S72 Q;  1S72 A;  1H3Z A;  1X27 A;  1GXI E;  3L2V A;  3VU3 C;  5GAM h;  1B7T A;  5I22 A;  1NLO C;  2LNV A;  5GMK m;  1M2O A;  3LX7 A;  3REA B;  2DXU A;  3G6E T;  1XOV A;  2LCL A;  4O5V A;  4GLM A;  2B86 A;  3S3N A;  1WIE A;  2YRC A;  4J7F A;  2J05 A;  3CCV T;  2XIC A;  2FVU A;  2D0Q B;  4IUT A;  1TS9 A;  3M59 A;  2JS2 A;  1VIE A;  3HRU A;  4N4I A;  1VQ9 Q;  2C06 A;  1VQ9 A;  1N9R A;  2CP5 A;  5J26 A;  1Q95 G;  3VYG A;  1K4U S;  1TSF A;  2EWN A;  2HCK A;  2KXD A;  3FJP A;  5IXB A;  4C0F A;  4LDX A;  1N5Z A;  4XTY A;  4JJB A;  1PWT A;  4JRK A;  2CDT A;  3QG1 A;  1YHQ Q;  1YHQ A;  1N6A A;  4F7U A;  4J9I A;  3OYC A;  4HA8 A;  1QQJ A;  3L2Q A;  1BYM A;  4JDS A;  3OA6 A;  1ZA2 B;  3V8K A;  2KGT A;  4XQ3 A;  2X4X A;  1Z9Q A;  4X1V A;  2VKN A;  4JLG A;  3JCM J;  1ZSZ C;  3MEV A;  1J3T A;  1A0N B;  1JO8 A;  4Z88 A;  2FYK A;  2CRE A;  1ZQ1 A;  2JS0 A;  1KD1 C;  2EAY A;  1AD5 A;  3RNJ A;  1BCO A;  3VUZ A;  2JTE A;  4RCB A;  2LJ3 A;  2KI7 A;  4M7D C;  4M78 E;  2GF7 A;  2RJF A;  4C0D C;  2KNB B;  1HYO A;  4RG2 A;  1UDL A;  4FT4 A;  1WFW A;  4LNP A;  4LXC A;  2DLP A;  4DEX A;  3CPF A;  4EMK C;  4C92 C;  1Q7Y U;  1D09 B;  2JOY A;  2L0A A;  2YRV A;  2PNI A;  3RBB B;  5DLQ E;  3MP8 A;  2EKH A;  3HTR A;  2HKN A;  2RHX A;  4QVZ A;  3MEA A;  1B34 A;  3GNG A;  3EHQ A;  2VYT A;  1YI2 T;  5GMK i;  2J7I A;  2QAZ A;  4RUG A;  3VV0 A;  2YLC A;  5KYY A;  1VQ8 Q;  1K73 U;  3JCM X;  1VQ8 A;  4J9D A;  1JB0 E;  3LGL A;  2LNH B;  4JRI A;  5LJ5 e;  3D7S B;  4C0D B;  2M16 A;  1VQ4 Q;  4Y92 A;  1VQ4 A;  4OB0 B;  2ROL A;  3T9N A;  5HY6 A;  3A98 A;  2CP3 A;  5IHN A;  2DVJ A;  2O9V A;  2COZ A;  3UDC A;  1EIF A;  1ZBX A;  2CH4 A;  2HSE B;  1UE9 A;  3HP9 A;  1KQ1 A;  2MK5 A;  1BI0 A;  1KFZ A;  1P92 A;  2F2W A;  5IHI A;  4XAX B;  3CCE Q;  1VYU A;  3CMA T;  4PJO C;  1FWZ A;  1QCN A;  3CCE A;  1VQ7 T;  1KK7 A;  2O9S A;  1QVF P;  3ULR B;  2K5F A;  1BCM A;  5CIU A;  2FB7 A;  1D1B A;  1WHK A;  1IHW A;  1VQ5 T;  3QXE B;  4N0A C;  5CAI A;  2RHI A;  4M77 D;  3M56 A;  2IIM A;  3RDV A;  4KUD K;  1HJD A;  1JQQ A;  1UGS B;  1NLP C;  5GAN d;  1YWP A;  3OBW A;  2DVE A;  3E2U A;  5KYX A;  1MV0 B;  1R0C B;  1TUD A;  1G3T A;  4F7U B;  2LP5 A;  2LMJ A;  4C0G A;  1ZUK A;  4M75 G;  2OTL Q;  2OTL A;  3Q1J A;  2DER A;  3FRN A;  2F2X A;  3HL8 A;  4D8K A;  1RAI B;  2NUP B;  5GMK l;  2D8J A;  4CC7 A;  1SRM A;  2RM4 A;  1U1S A;  3M4G A;  1RAA B;  1RAE B;  1ZUY A;  1D1A A;  3HRT A;  2C0O A;  3PVL A;  4RTY A;  1WQ7 A;  8ATC B;  1SG5 A;  3CBO A;  5GAO q;  2DXT A;  4AT1 B;  2JTM A;  2J6O A;  1K8A C;  2DK3 A;  1YJ9 Q;  1X43 A;  4JUV A;  4LE9 A;  1YJ9 A;  3ME9 A;  4OMF B;  1UGQ B;  1AZE A;  4M75 A;  1G3Y A;  2QXF A;  4A4K A;  3LGF A;  1QVG P;  2GQV A;  4PJO F;  4QQ6 A;  4DOV A;  1VQ6 Q;  1VQ6 A;  5M9O A;  2K5I A;  3OYI A;  1E6H A;  1QLY A;  1K9M C;  3F70 A;  2EQK A;  1IXD A;  3S3O A;  3R6O A;  4CC2 A;  3A1P A;  4BE1 A;  3OMC A;  2XD0 A;  4E47 A;  4C8Q G;  2LJ1 A;  2COW A;  1YJN T;  4M4Z A;  2V1Q A;  2DYI A;  1VQM Q;  1VQM A;  4CI0 C;  4CC3 A;  1KC8 R;  3DLL A;  3V7S A;  2KT1 A;  5KYY B;  4MML A;  5I2S A;  4M78 A;  1NM7 A;  4Y28 E;  1M1K C;  3A8O B;  4J9E A;  2EYZ A;  2FRY A;  1ARK A;  2M51 A;  3OBY A;  2JMA A;  4JZ4 A;  2KR3 A;  1BI3 A;  3VS6 A;  3JCM W;  3HSB A;  4RKU E;  2K9G A;  2Y90 A;  1BIB A;  4IUP A;  2P4T A;  3JCM g;  4QQG A;  2MWP A;  3PTA A;  2JVV A;  3EFS A;  5J39 A;  3RIR A;  3R6N A;  3I55 T;  5GAM f;  3CD6 Q;  4C8Q A;  1N8R R;  3CD6 A;  2KYM A;  2OTJ Q;  2X3W D;  3UWN A;  2OTJ A;  3UT1 A;  3THK A;  1RAF B;  2BUD A;  4J9F A;  2NLU A;  4MDW A;  4OB2 B;  1CKA A;  4D8D A;  5CKE A;  5LJ5 j;  3CME Q;  3JB9 H;  3CME A;  1UUE A;  4MZT A;  1VQK Q;  1VQK A;  5KYX B;  1WGS A;  4B9W A;  2CZ1 B;  5KCH A;  2QQB A;  1MMG A;  1M27 C;  5EG2 A;  4M77 E;  2CP7 A;  2YUP A;  4L59 A;  2DX1 A;  2E12 A;  1AHJ B;  3FDR A;  3CQT A;  4PJM A;  1M9S A;  2RF0 A;  4KUI A;  4M7A G;  3QII A;  1U8R A;  1R77 A;  2W0Z A;  2YWW A;  1FMV A;  3PIP A;  3C4S A;  2CS7 A;  2NUT A;  2YUQ A;  3O8V A;  1HXD A;  3H0F A;  2LVM A;  2BZX A;  3G7Z A;  4IKF A;  2GCX A;  2KRO A;  1VYT A;  4XU3 A;  1ZX6 A;  1W1F A;  5LJ3 g;  1WNL A;  2K2V A;  4A4F A;  4LUE A;  5HKC A;  5LJ3 h;  2M0O A;  1IB8 A;  4M7A A;  4Y91 A;  1OI1 A;  1QWF A;  2HQH A;  5KE3 A;  3EHR A;  1K76 A;  1ZSG A;  1N27 A;  4FYV B;  4PJN A;  4TVR A;  2E70 A;  1SEM A;  3EGX B;  2VVK A;  2V8J A;  2CT3 A;  1JXO A;  4M75 D;  2DL7 A;  4M78 B;  1R0B G;  1YWO A;  1OV3 A;  4DBH A;  4WTO B;  1RLP C;  2EYY A;  2R5A A;  1RLQ C;  5KYU B;  2CSI A;  1HD3 A;  3M0S A;  5KCO A;  4KGV B;  2DYB A;  2VGN A;  1VQL Q;  1WZO A;  1WYX A;  2LQN A;  4RTZ A;  3EFO A;  4HXJ A;  4X34 A;  3CCS Q;  3CCS A;  5IAY A;  1WHM A;  3WVE B;  4OMM A;  3MEU A;  2LCC A;  3BDL A;  4A4E A;  2EJF A;  1WHL A;  4FM4 B;  3NMZ C;  4GLK A;  3TSW A;  3G4S Q;  3G4S A;  5GAO p;  1OUL A;  1VOM A;  3OYJ A;  2LT1 A;  3MHX A;  3QWY A;  2XU8 A;  1M3C A;  3VRY A;  1WXU A;  1QW1 A;  2FZK B;  1Y57 A;  4M78 F;  4GY5 A;  4ZNX A;  1GL5 A;  1RAD B;  2EQJ A;  3HRS A;  3NTK A;  1HSQ A;  2CGH A;  4HVW A;  2EYX A;  1D0Z A;  2WSE E;  1W2B A;  4E6R A;  3LLR A;  1WJS A;  4BD3 A;  2RQT A;  2BZY A;  3AT1 B;  2PUK B;  3CCR Q;  1NYF A;  3CCR A;  2DKG A;  3LH0 A;  4PJJ A;  4PNO A;  4XTX A;  3CPW P;  2CUB A;  4JLI A;  2RJC A;  2CZ7 B;  1X01 A;  3H6Z A;  2JZ2 A;  3OW2 P;  2KSS A;  1YP5 A;  2I0N A;  2QQS A;  4IIO A;  5AT1 B;  2AK5 A;  5GAN 8;  1X6O A;  4OMN A;  2KK4 A;  4DA4 A;  4E7Z A;  4RCC A;  2RH2 A;  3MCA B;  2ZPB B;  2FPF A;  3M54 A;  4M7D G;  1MND A;  1YN8 A;  2RPN A;  3FLG A;  2XMF A;  2ATC B;  4E7H A;  5DY9 A;  1OEB A;  1KG1 A;  4HCB A;  1I1J A;  3O5Z A;  2NUT B;  3ZFJ A;  2E5K A;  4K11 A;  1ZSZ A;  5GAM e;  2DF6 A;  4BY6 B;  4C92 G;  4BDY A;  1KQS P;  1MV3 A;  2X3X D;  2MPX C;  2E3H A;  1LVK A;  4CRI A;  1UFF A;  4C5H A;  1VQP Q;  3CCJ Q;  1VQP A;  3CCJ A;  3EG3 A;  1V29 B;  1WPY A;  2EBP A;  4M77 A;  1XNI A;  2O88 A;  4KBM B;  3S6W A;  3M0U A;  4MZM A;  3CCQ T;  1K73 C;  2K7A A;  4JJN K;  2G6F X;  4M7D A;  1RI0 A;  2E3I A;  1FX7 A;  3SHW A;  2E41 A;  5FW9 A;  2QG9 B;  4OF1 A;  2NWM A;  1KIK A;  2QAS A;  2CKK A;  2EFI A;  5LL6 S;  3UA6 A;  4E7L A;  2LX7 A;  3RR6 A;  3X20 B;  3CC2 Q;  3CC2 A;  1IGQ A;  1JJ2 P;  3MJX A;  4EMK A;  1I4K 1;  5FU6 C;  4C92 A;  1C0M A;  1GBQ A;  3P8B B;  1IGU A;  1MMD A;  1Q81 R;  3V7C A;  4ZN3 A;  4LDU A;  2AKK A;  4E7I A;  3M4Y A;  4M7A D;  3EGD B;  3H41 A;  4PJO G;  1PNJ A;  1OPL A;  1RI9 A;  1KD1 R;  4C5I A;  4EMG A;  3JCM P;  2A37 A;  2QTV A;  2AHJ B;  3EFO B;  3G71 T;  3GP8 A;  2Y4Y A;  5GAN 3;  5FU7 B;  4R56 A;  1YNZ A;  4M75 E;  3VS1 A;  1M4Z A;  1K9A A;  4FSX A;  2RQV A;  2AZV A;  1FMK A;  2DA9 A;  5KYW B;  2L5Q A;  1MGQ A;  5FU6 B;  4OVA A;  1W6X A;  2MIO A;  2VXE A;  1Z9Z A;  3V7R A;  5EC7 A;  1AT1 B;  1YCY A;  4KH1 B;  3JCM f;  3JB9 J;  4ANJ A;  1WDX A;  3M53 A;  2D6F A;  4JPB W;  2DBM A;  1GCQ A;  1BK2 A;  3X25 B;  1YIT Q;  2ZZD A;  4AG2 C;  1YIT A;  3OYF A;  3FIF A;  2DE0 X;  2XID A;  3E1S A;  1VYV A;  2QEX Q;  2EW3 A;  1YIJ Q;  5GAN 6;  2P0K A;  2HL3 A;  1YIJ A;  2FZC B;  2QGF B;  2SRC A;  3H8Z A;  2CP0 A;  2EIF A;  3VUB A;  4C8Q E;  4QQD A;  5AYF A;  3TEE A;  4J6X A;  3L2U A;  2DXB A;  3SWN B;  3CD6 T;  5KH6 A;  2E64 A;  1M2V B;  1WHJ A;  2FRW A;  2OTJ T;  4C5G A;  1GCP A;  4J6W A;  1KJW A;  5FWC A;  2P0Q A;  2G3R A;  5GAN g;  4FCY A;  2QI2 A;  2V8I A;  1G8X A;  2QQ9 A;  5J3B A;  3M58 A;  3BW1 A;  2JT4 A;  4OML A;  2IG0 A;  2JUF A;  2BKD N;  1PSE A;  2AKL A;  2BE9 B;  4M77 B;  4ELY C;  1NYG A;  1WA7 A;  2CH4 W;  4NL2 A;  2M1H A;  3CC7 Q;  3RMS A;  3CC4 T;  3CC7 A;  4L6V 5;  4PK4 A;  3CCL Q;  1UGV A;  3CCL A;  1M5Q 1;  3QZ5 B;  4RMO A;  1WX6 A;  3VS0 A;  1QCO A;  3PT9 A;  1UB4 A;  2DZC A;  2F1L A;  1M30 A;  4QW2 A;  2H8H A;  2WAC A;  2XDP A;  1IZ6 A;  5LJ3 f;  2DL3 A;  1AWX A;  5GAM j;  2SEM A;  3H9N A;  1W2B S;  2EKO A;  2RHY A;  2VB6 A;  1C1A A;  1M3A A;  2HNI A;  5IN1 A;  1VQO Q;  1DJ7 B;  1VQO A;  4M7D D;  2C0T A;  3QBY A;  2GQI A;  2ABL A;  1PRL C;  3OYK A;  4J8O A;  2CP2 A;  2ZPG B;  2X9H A;  4C92 D;  3N5B B;  3OS2 A;  1NEB A;  1B07 A;  1OOT A;  1WXT A;  4M7A E;  4D6W A;  4E7J A;  1R8O B;  2YSQ A;  3C0C A;  1MHN A;  4F14 A;  1AEY A;  3PE0 A;  2QA4 T;  3PMI A;  2HL5 C;  4BDZ A;  5LJ5 d;  3A8L B;  3CCV Q;  1NG2 A;  2FL7 A;  3BY7 A;  3OW2 A;  1PG5 B;  1BIA A;  2E1H A;  4J9H A;  1NJI R;  1I5L A;  1K9M R;  2OAU A;  2BE7 D;  4L5G A;  4UC4 A;  3BDU A;  4F7U F;  2DIQ A;  3RKY A;  4NS5 A;  2P0P A;  5CK9 A;  3L1A A;  2DTH A;  2K2M A;  1D1C A;  2DD5 A;  1SPK A;  2DXC A;  3VJP A;  1JU5 C;  3OYY A;  2O31 A;  2X4Y A;  1M90 R;  3VS4 A;  5GAO l;  4JRQ A;  1M1F A;  1T0H A;  3MPU B;  1MNE A;  2YUN A;  4Z02 A;  3HPW A;  1UTI A;  2GTO A;  3IQL A;  1U5S A;  2E5Q A;  2NYS A;  1K0S A;  1CSK A;  4A4H A;  2OI3 A;  2L89 A;  3ZL7 C;  2A3L A;  3VRZ A;  4PJO D;  1ZHI A;  3SDZ A;  3EG0 A;  3AHU A;  2YUO A;  3CXC P;  2Z0W A;  2DL5 A;  3ZBD A;  1B34 B;  1SF9 A;  2V1R A;  3QDR B;  3PGG A;  2DRK A;  3EGU A;  2AIR B;  2MF2 A;  2J6K A;  3VS7 A;  5GJV B;  1QVP A;  4OP0 A;  3FJ5 A;  3MO8 A;  1IHV A;  1Q86 R;  2RHU A;  3DB3 A;  4WF2 A;  1FXX A;  1ZA1 B;  3EFR A;  3QKJ A;  4RTU A;  2DBK A;  4XTZ A;  4B9X A;  3MKD A;  1G2B A;  3QJY A;  5I11 A;  5ECA A;  3JCM e;  1PHT A;  5A0L A;  2K79 A;  1EFN A;  1EX4 A;  2C0I A;  3S3M A;  4X9C A;  4KRT A;  5IXF A;  5C0M A;  3JCM h;  3CCU T;  3X26 B;  4F17 A;  1UHC A;  2GBQ A;  3MEW A;  3P8D A;  1LPL A;  3TQ7 P;  4RTV A;  3UAT A;  3RES A;  4II1 A;  2GNC A;  4DOW A;  2PUO B;  3RKX A;  2DL4 A;  2DFU A;  1YJW T;  1VQN T;  2ESW A;  5CKH A;  1PSF A;  4RTT A;  1Q82 R;  4QVD A;  1YI2 Q;  3DLM A;  1YI2 A;  2EQM A;  3M0R A;  1H8K A;  2RI3 A;  4ZTJ A;  4OB3 B;  1QMC A;  1O75 A;  1JRI A;  2RQW A;  1S72 T;  3GOX A;  4XU0 A;  4Z89 A;  1O9S A;  2EJ9 A;  1LJO A;  4F16 A;  5GAN 7;  1ZBJ A;  3I9Q A;  2EVR A;  2RQR A;  4VUB A;  3DKM A;  4M7D E;  2QDL A;  3BE3 A;  3KBG A;  1XQH A;  2O01 E;  4MDX A;  4BE0 A;  4ESR A;  1PM3 A;  1I8F A;  3CMA Q;  3CMA A;  1VQ7 Q;  2PVG B;  1VQ7 A;  4C92 E;  2VXF A;  5CKF A;  1GRI A;  5D6Y A;  1LCK A;  1VQ9 T;  2W10 A;  2YDL A;  2E65 A;  4M78 C;  3SEM A;  5CCA A;  2BIV A;  1VQ5 Q;  5LJ3 e;  1VQ5 A;  1TH7 A;  3M57 A;  3JSC A;  3FB9 A;  1GFC A;  4M75 B;  2ZPH B;  2JM9 A;  1ZLM A;  2V26 A;  2PZ1 A;  2MCN A;  1YHQ T;  2LC4 A;  1C6V X;  3EH1 A;  3OSS C;  2KEA A;  3LWI A;  2DEU A;  2KBT A;  4YTL A;  3CCM Q;  2L3P A;  3CCM A;  2L3Q A;  4J7I A;  2JJ9 A;  1NJI U;  2ED0 A;  2FPE A;  2M02 A;  2D9T A;  2QDY B;  4C8Q C;  3C94 A;  1WHG A;  3JRZ A;  2M9U A;  3JV3 A;  3UPU A;  2XI9 A;  2PVO B;  4HCK A;  2MAM A;  1K0X A;  4JJC A;  5CVI A;  2RMO A;  1M90 U;  2K4Y A;  3TRE A;  1WLP B;  2VAS A;  2IVW A;  4KGX B;  2KMT A;  4M75 F;  1D0X A;  4AMC A;  3OYN A;  1OX9 A;  3QSU A;  3I56 Q;  3I56 A;  3FEO A;  4FSS A;  3JCM c;  4PJO E;  4KUL A;  2KYB A;  2X4W A;  3HFN A;  1VQL A;  1TG0 A;  1QVF A;  1TWB A;  5GAN f;  4AFQ C;  2CZ6 B;  2CUD A;  2KT8 A;  5GAO r;  1AVZ C;  1KC8 U;  2VWF A;  4C8Q B;  4EDU A;  1JBM A;  5GAO n;  5CO7 A;  1IRE B;  1Q86 U;  3V8L A;  2ZGW A;  2RHZ A;  3OW2 S;  1OQK A;  2XKO C;  4BAC A;  1PD1 A;  3RUX A;  2KRM A;  2EQI A;  1GBR A;  2FHD A;  1YJN Q;  2GTJ A;  1YJN A;  2F5K A;  1SSF A;  4BY6 C;  3BFM A;  4X9D A;  3L2R A;  3OS1 A;  2L8D A;  4J9C A;  4V2S A;  1VQ8 T;  1W4S A;  1Q7Y R;  3OS0 A;  4C0Z A;  1N8R U;  2LRQ A;  1Y7X A;  4CC4 B;  1M3B A;  3E19 A;  1K1Z A;  1OYX A;  1VQ4 T;  4C8Q F;  2HQE A;  1RAC B;  3EG1 A;  1AWO A;  3QWX X;  3TVT A;  2DD4 A;  2E6Z A;  5L8R E;  2DMO A;  4JJD A;  3JB9 F;  3EH2 A;  1OZ2 A;  2WSF E;  3JCM V;  1X6B A;  1Q82 U;  2A7Y A;  2IPO B;  4A4G A;  3I55 Q;  3UA7 A;  3I55 A;  3VS3 A;  1D0Y A;  3L42 A;  2YHT A;  3CCE T;  5GAN 2;  1AZG B;  1QVG A;  4LUD A;  4ZN1 A;  2XDD A;  4PFZ A;  2EGA A;  3QYH B;  2CSQ A;  3OYB A;  1OZ3 A;  3C95 A;  1T3S A;  1KHI A;  2KE9 A;  2ZCF B;  3GLX A;  4O6J A;  2RK1 A;  3CXC A;  4AFZ C;  2LJ0 A;  2HSP A;  4XU1 A;  5FU7 C;  4M7A B;  2JXB A;  5D6W A;  1U1T A;  5IH2 A;  2KVQ G;  1BKB A;  3INZ A;  2QYZ A;  5KE2 A;  2EQU A;  2OTL T;  2A08 A;  5IT9 E;  1UEB A;  2B8A A;  3VYH B;  1OU9 A;  5GAO m;  2KXC A;  2LQW A;  1GFD A;  4F7U G;  3PIO A;  3SFM A;  3E9G A;  5FRN A;  5LJ3 j;  2FZG B;  1S1N A;  8AT1 B;  3H0H A;  2KAF A;  4FYX B;  2P4R A;  1H3H A;  4M7A F;  1AOJ A;  2PU9 B;  4BB7 A;  1NE8 A;  2EGE A;  1YJ9 T;  4BI3 A;  2F2V A;  4ATO A;  2YXY A;  3EAE A;  4XK8 E;  1TOV A;  2JN0 A;  2LQ8 A;  3M0Q A;  2VUB A;  4GBQ A;  1VQ6 T;  2LZ6 B;  5GAM d;  4HCC A;  4XTU A;  1IRX A;  4FW1 A;  3OYA A;  2LT4 A;  2LTO A;  3GBQ A;  2FO0 A;  4JZ3 A;  3SWN C;  2YT6 A;  2QK0 A;  2R5M A;  2K3Y A;  4XU2 A;  2BZ8 A;  3I35 A;  1M8V A;  2HBW A;  1YFN A;  4PJO A;  2RJD A;  4PJL A;  1Q81 C;  4OGC A;  2KQW A;  2P84 A;  5A0G A;  3CEY A;  1VQM T;  2NUP A;  4ZTF A;  3ASK A;  1X2K A;  2VC8 A;  3JAM E;  1KHC A;  2DO3 A;  2JTF A;  2RQU A;  1F1B B;  4N0A A;  2QEX A;  1MMA A;  4M77 C;  2DNU A;  1TU0 B;  2GGR A;  5FLX E;  3GNF B;  1I5O B;  1UJ0 A;  2L3R A;  2JM8 A;  4HVV A;  1WJQ A;  1X6G A;  3J81 E;  4J5Y A;  2K3X A;  6AT1 B;  2HKQ B;  5GAN e;  3OQ5 A;  1YCS B;  3TCJ A;  4A63 B;  4A53 A;  5FWB A;  1ZSZ B;  1JXM A;  1Y71 A;  4ZGE B;  2O4X A;  1FMW A;  2HAX A;  4FIB A;  5GAN h;  4HT9 A;  2KRS A;  4XTW A;  4ZGJ B;  1M1G A;  3X24 B;  1UGP B;  2Y4X A;  3CME T;  3NHN A;  3OY9 A;  1QVF S;  1VQK T;  2R58 A;  1E6G A;  5FRO A;  2PQW A;  4M7D B;  1W70 A;  2OJ2 A;  4F04 B;  3PFS A;  2HQX A;  2QQR A;  1N9S A;  1PKT A;  4E7K A;  1OX8 A;  2V8K A;  2RJE A;  5LJ5 g;  1UG1 A;  5HK3 A;  1G83 A;  2DM1 A;  1PCX A;  2ENM A;  4EMK B;  1ABQ A;  4C92 B;  5LJ5 h;  3HHT B;  2K6D A;  1IO6 A;  4J6Y A;  2KRN A;  1PRM C;  2DJQ A;  3M9Q A;  1T3L A;  1UJY A;  4M77 F;  2DRM A;  1NPP A;  1BU1 A;  2RB6 A;  1X2Q A;  3I5R A;  1I81 A;  1LOJ A;  2RNA A;  1GCQ C;  2ZAE A;  1Y0M A;  4M7D F;  3QHS A;  3QYG B;  3PVQ A;  2DEQ A;  2J06 A;  5CKD A;  1Y96 A;  3E9F A;  1MUZ A;  5IHK A;  3OYG A;  1OU8 A;  4E2F B;  4AFS C;  1ABO A;  4HCZ A;  3G6E Q;  1KSW A;  3G6E A;  2QGG A;  4AFU C;  2DIG A;  3M0T A;  2VGM A;  4XTV A;  1K8A R;  2FEI A;  2EYQ A;  2KY9 A;  3L2Z A;  3CCQ Q;  4C92 F;  3CCQ A;  1U06 A;  3C12 A;  1Q81 U;  5A0D A;  3RER A;  3KUF A;  4NOY A;  3LW5 E;  3OYL A;  4LD9 K;  3GIB A;  2AZS A;  2XDB A;  2FG0 A;  2PVD B;  3CCM T;  4OGE A;  4EPC A;  2YLB A;  2E4H A;  3CPW A;  2HBP A;  1W2B P;  3QO3 A;  2X51 A;  1VA7 A;  4DBF A;  3CCV A;  1QVG S;  4BI4 A;  3LYI A;  3L2W A;  3MET A;  2RD1 A;  1KD1 U;  3NGP A;  3EG9 A;  1Y07 A;  4PJO B;  2MWO A;  4DBR A;  3ER0 A;  2AT1 B;  1MMN A;  4IUV A;  3SD4 A;  2F5T X;  4EMH A;  1NPR A;  3OYD A;  3LWH A;  3M0P A;  3A8H B;  1SKU B;  3CXC S;  4OMP A;  3A5Z B;  3VS2 A;  2XK0 A;  3I56 T;  2ROT A;  1WHH A;  1M1K R;  2A36 A;  3NTH A;  3V8J A;  1VQL T;  5KYN A;  3G71 Q;  2LX9 A;  3G71 A;  3CCS T;  4M78 G;  1KQS A;  2JNG A;  4RTW A;  2LDM A;  5I21 A;  2D1X A;  1I07 A;  1NEG A;  3RMQ A;  1SSH A;  4IUQ A;  3G4S T;  4OMQ A;  1TTH B;  5CQY A;  1WJR A;  4DQ2 A;  3NFC A;  2O4X B;  1TXQ A;  1NJI C;  4BUG A;  3OMG A;  2ZPI B;  2JMC A;  2EJG A;  2D0N A;  3HKS A;  4C5E A;  5D7U A;  2K3B A;  1RAB B;  1D3B A;  4OB1 B;  5L23 A;  4R0K A;  2VV5 A;  2K5L A;  3EGX A;  4FYW B;  2HMA A;  5CQX A;  3A8M B;  1M90 C;  3CCR T;  4FYY B;  4BE2 A;  1SRL A;  2ED1 A;  1JJ2 A;  3JB9 G;  4LDY A;  2RI5 A;  5CR2 A;  1U3O A;  4JS5 A;  2MMP A;  3J80 E;  2RN8 A;  2COY A;  4LDW A;  2J6F A;  1BB9 A;  2R57 A;  5KYU A;  4ORZ A;  3CBM A;  2RI2 A;  4Q5W A;  2D8H A;  2KDS A;  2ECZ A;  2QQA A;  4N4G A;  2LQK A;  4JS4 A;  5GAN j;  1QP2 A;  3PMT A;  7AT1 B;  1I0C A;  4QVC A;  5C6S A;  2MOX A;  3QUI A;  3JCM Q;  2DTI A;  2CYZ B;  4Z8A A;  2GFA A;  4ZGD B;  1H64 1;  1EZZ B;  1KC8 C;  2CZ0 B;  2RO0 A;  5GMK e;  1NBE B;  2ZPF B;  1PKS A;  1ACM B;  4RTX A;  3HFO A;  1Q86 C;  2GFU A;  4P5N A;  2JW4 A;  3NTI A;  1SHG A; 
#chains in the Genus database with same CATH homology
 1K9A A;  1MV0 B;  2RQV A;  2KRM A;  2EQI A;  2AZV A;  1GBR A;  1TUD A;  3VS5 A;  2GTJ A;  4OMO A;  1FMK A;  2DA9 A;  2LP5 A;  1QWE A;  2LMJ A;  1ZUK A;  1W6X A;  4J9C A;  2MIO A;  1UHF A;  1Z9Z A;  5EC7 A;  4CC4 B;  2F2X A;  1M3B A;  1K1Z A;  4D8K A;  5HCK A;  1WDX A;  2L3S A;  3EG1 A;  1AWO A;  2D8J A;  4CC7 A;  4JPB W;  2DBM A;  1SRM A;  3QWX X;  1GCQ A;  3TVT A;  1BK2 A;  1QCF A;  1ZUY A;  4AG2 C;  2DMO A;  4JJD A;  2DE0 X;  1VYV A;  2C0O A;  3PVL A;  3TSZ A;  1X6B A;  4RTY A;  2EW3 A;  3UA7 A;  3VS3 A;  2SRC A;  2BTT A;  2J6O A;  4EIK A;  1AZG B;  1X43 A;  4LE9 A;  4LUD A;  2HDA A;  2L2P A;  1RUW A;  1AZE A;  2EGA A;  1ZUU A;  2CSQ A;  1T3S A;  2KE9 A;  2FRW A;  3H0I A;  1E6H A;  1TUC A;  1GCP A;  1QLY A;  1KJW A;  5FWC A;  4QT7 A;  1E7O A;  4AFZ C;  4CC2 A;  2LJ0 A;  2HSP A;  2JXB A;  2LJ1 A;  2JT4 A;  4OML A;  5IH2 A;  1T0J A;  1FYN A;  2AKL A;  4M4Z A;  2V1Q A;  4CC3 A;  1NYG A;  1WA7 A;  2CH4 W;  2KT1 A;  2LCS A;  2A08 A;  1NM7 A;  2EYW A;  2PTK A;  3I5S A;  4J9E A;  1UGV A;  2EYZ A;  2KXC A;  2FRY A;  1WX6 A;  2LQW A;  1GFD A;  1ARK A;  3VS0 A;  2M51 A;  3UF4 A;  2JMA A;  2EPD A;  1M30 A;  4JZ4 A;  2M0Y A;  2KR3 A;  2H8H A;  3VS6 A;  2OAW A;  1BBZ A;  1S1N A;  4DEY A;  2DL3 A;  2K9G A;  3H0H A;  1AWX A;  2P4R A;  1H3H A;  2SEM A;  3R6N A;  1AOJ A;  1M8M A;  2KYM A;  2EGC A;  2EGE A;  2X3W D;  1M3A A;  2F2V A;  3THK A;  2FPD A;  1X69 A;  2C0T A;  1QKX A;  2GQI A;  2ABL A;  4J9F A;  3M0Q A;  4GBQ A;  1V1C A;  3EG2 A;  1CKA A;  4D8D A;  2LZ6 B;  1PRL C;  1WI7 A;  1JEG A;  1H92 A;  1AWJ A;  3GBQ A;  2FO0 A;  2A28 A;  1UUE A;  4JZ3 A;  2YT6 A;  1NEB A;  1B07 A;  1OOT A;  1WXT A;  2DIL A;  2BZ8 A;  3I35 A;  2DL8 A;  2HBW A;  1M27 C;  2YSQ A;  3C0C A;  4F14 A;  1AEY A;  3PE0 A;  2YUP A;  2DX1 A;  4LN2 A;  1B3Q A;  2HEQ A;  4AG1 C;  1NG2 A;  1X2K A;  3CQT A;  2RQU A;  4J9H A;  3REB B;  5GJW B;  2RF0 A;  1OPK A;  2DNU A;  2GGR A;  2O2O A;  2W0Z A;  4WCI A;  1QKW A;  1UEC A;  1UJ0 A;  1WXB A;  2JM8 A;  4HVV A;  2NUZ A;  2CT4 A;  2K2M A;  3KFV A;  1X6G A;  1SPK A;  1JU5 C;  2O31 A;  3NPF A;  2YUQ A;  3VS4 A;  1T0H A;  4J9B A;  2YUN A;  3H0F A;  1UTI A;  2GTO A;  2BZX A;  1YCS B;  1U5S A;  3IQL A;  3U23 A;  4A63 B;  1CKB A;  1K0S A;  5FWB A;  1CSK A;  4J9G A;  1JXM A;  2KRO A;  1VYT A;  1AWW A;  2OI3 A;  1ZX6 A;  1W1F A;  3ZL7 C;  4HVU A;  4IIM A;  3VRZ A;  3EG0 A;  2YUO A;  4LUE A;  2KRS A;  3LH5 A;  2DL5 A;  2V1R A;  1SHF A;  1QWF A;  2DRK A;  1X27 A;  3EGU A;  2J6K A;  3NHN A;  3EHR A;  1K76 A;  1ZSG A;  5I22 A;  1NLO C;  3VS7 A;  3REA B;  5GJV B;  1XOV A;  3FJ5 A;  1E6G A;  4GLM A;  2B86 A;  1WIE A;  1W70 A;  2OJ2 A;  1SEM A;  2J05 A;  4RTU A;  2VVK A;  2DBK A;  1PKT A;  2CT3 A;  1G2B A;  5I11 A;  1JXO A;  5ECA A;  1PHT A;  1UG1 A;  2DL7 A;  1G83 A;  2DM1 A;  2ENM A;  1YWO A;  1OV3 A;  2K79 A;  1ABQ A;  1RLP C;  2EYY A;  1EFN A;  1RLQ C;  2C0I A;  2CSI A;  4KRT A;  1HD3 A;  5IXF A;  2K6D A;  2JS2 A;  1IO6 A;  3M0S A;  2KRN A;  2DYB A;  1PRM C;  1WYX A;  2DJQ A;  2LQN A;  4RTZ A;  4F17 A;  1T3L A;  4HXJ A;  1UJY A;  2DRM A;  1K4U S;  1BU1 A;  1UHC A;  2HCK A;  1X2Q A;  3I5R A;  4OMM A;  2KXD A;  2GBQ A;  5IXB A;  2RNA A;  1GCQ C;  1N5Z A;  1Y0M A;  4RTV A;  3UAT A;  4JJB A;  1PWT A;  2GNC A;  2CDT A;  3PVQ A;  3NMZ C;  3TSW A;  2J06 A;  2DL4 A;  4J9I A;  2ESW A;  4RTT A;  3QWY A;  1MUZ A;  5IHK A;  1M3C A;  4AFS C;  1ABO A;  3VRY A;  1WXU A;  1KSW A;  4AFU C;  1Y57 A;  3M0T A;  2FEI A;  3M0R A;  2KGT A;  4ZNX A;  1GL5 A;  1H8K A;  1Z9Q A;  4X1V A;  1U06 A;  1HSQ A;  2VKN A;  4HVW A;  1J3T A;  2EYX A;  1A0N B;  2AZS A;  2RQW A;  1JO8 A;  4Z88 A;  4E6R A;  2FG0 A;  4Z89 A;  2CRE A;  2RQT A;  2BZY A;  1VA7 A;  4F16 A;  1NYF A;  1ZBJ A;  3I9Q A;  2CUB A;  2EVR A;  2RQR A;  3NGP A;  2JS0 A;  2QDL A;  1AD5 A;  3RNJ A;  1YP5 A;  4IIO A;  2JTE A;  2LJ3 A;  2AK5 A;  4ESR A;  4OMN A;  3M0P A;  2KNB B;  4OMP A;  3VS2 A;  2FPF A;  1GRI A;  1YN8 A;  1UDL A;  2ROT A;  2RPN A;  1WFW A;  4LNP A;  1LCK A;  2DLP A;  2A36 A;  2W10 A;  2YDL A;  3SEM A;  2XMF A;  4DEX A;  1OEB A;  1I1J A;  3O5Z A;  2L0A A;  1GFC A;  4RTW A;  2E5K A;  4K11 A;  2DF6 A;  2JM9 A;  2PNI A;  1ZLM A;  2D1X A;  1MV3 A;  3RBB B;  2X3X D;  2PZ1 A;  2MCN A;  1I07 A;  2EKH A;  1NEG A;  1SSH A;  1UFF A;  4OMQ A;  2KEA A;  2KBT A;  3EG3 A;  2L3P A;  3EHQ A;  2L3Q A;  2J7I A;  2EBP A;  2ED0 A;  2FPE A;  2O88 A;  4RUG A;  3M0U A;  2JMC A;  3JV3 A;  4J9D A;  2D0N A;  2K7A A;  2LNH B;  4HCK A;  2G6F X;  1K0X A;  2K3B A;  4JJC A;  3SHW A;  5L23 A;  2RMO A;  5FW9 A;  4Y92 A;  4R0K A;  2NWM A;  1KIK A;  2ROL A;  1WLP B;  1SRL A;  2ED1 A;  3A98 A;  3UA6 A;  5IHN A;  2DVJ A;  2LX7 A;  2O9V A;  1U3O A;  2RN8 A;  4FSS A;  2J6F A;  1BB9 A;  2CH4 A;  1UE9 A;  1GBQ A;  4ORZ A;  2KYB A;  2D8H A;  1KFZ A;  2F2W A;  5IHI A;  2ECZ A;  1TG0 A;  1VYU A;  2O9S A;  1I0C A;  2AKK A;  4AFQ C;  3ULR B;  2MOX A;  3H41 A;  2CUD A;  2KT8 A;  1AVZ C;  4Z8A A;  1PNJ A;  2VWF A;  1OPL A;  1RI9 A;  2A37 A;  1YNZ A;  1PKS A;  2IIM A;  4RTX A;  1HJD A;  1JQQ A;  1NLP C;  2JW4 A;  1YWP A;  3VS1 A;  2I0N A;  1SHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...