3CCUQ

Structure of anisomycin resistant 50s ribosomal subunit: 23s rrna mutation g2482c
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L2P
publication title Mutations outside the anisomycin-binding site can make ribosomes drug-resistant.
pubmed doi rcsb
total genus 19
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2008-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 3ccuQ00
1YHQQ 1N8RR 2OTJQ 1YITQ 1YJNQ 1YI2Q 3CCRQ 1KQSP 1VQ9Q 1VQ7Q 1QVGP 3CC2Q 3G6EQ 3CPWP 3CCMQ 1Q7YR 3CCJQ 1K73R 1W2BP 1K8AR 1K9MR 1VQ8Q 3CXCP 1KD1R 3CMAQ 1VQ5Q 3CMEQ 3CCUQ 3CC7Q 3CCLQ 1M1KR 1NJIR 3CCVQ 1VQMQ 1YJWQ 3OW2P 1VQLQ 3I55Q 3G4SQ 3CCEQ 1VQ6Q 3CD6Q 1VQNQ 3CCQQ 3G71Q 1KC8R 1JJ2P 3CCSQ 1M90R 1Q81R 1Q86R 1YJ9Q 2OTLQ 2QEXQ 1VQKQ 1YIJQ 2QA4Q 3I56Q 1VQOQ 1S72Q 1VQPQ 1Q82R 1QVFP 3CC4Q 1VQ4Q
chains in the Genus database with same CATH superfamily
3V7RA 2DEUA 4M77G 1M8MA 4M7DD 5A2QE 5IHNA 4XU1A 4N4HA 4PJNA 3EFSA 3QZ5B 2HQEA 4J9IA 3BDUA 5C6SA 2GNCA 2DNUA 3CCVT 4E47A 1VQ6A 3QUIA 5LL6S 3G1JA 4Z8AA 1LCKA 2NUTA 5HK3A 2OX7A 1RAFB 2FZGB 2VC8A 2RQWA 1S72Q 5KYUB 1YWPA 3JCMJ 3HRSA 1SG5A 2K4YA 4R0KA 5L23A 2LZ6B 1WXUA 4FM4B 1QQJA 1RI9A 1VYVA 4FT4A 2DXTA 4HA8A 4RG2A 1QCFA 2RHXA 5LJ3e 3CCLQ 3QYGB 4N4GA 3V8KA 5ECAA 1WXTA 2CP2A 2OTLA 1ZX6A 3BDLA 4M7DF 2DKGA 4E7JA 3KUFA 2P0QA 4AFSC 3FEOA 2AKKA 1WHJA 3U23A 4UC4A 2RHIA 1D1BA 2EYZA 2NWMA 2L3QA 2RN8A 4RUGA 3OA6A 4JJBA 3IQLA 2LJ0A 3JCMg 5LJ5g 4OMLA 1K9MU 4IURA 5HK0A 1MMNA 3QWYA 2YRVA 1WI7A 4J9DA 2F2VA 1XJWB 3DLMA 1YITT 3JCMh 1QWFA 1NEGA 2RHUA 4KULA 5KCHA 3PTAA 2AZVA 3ASKA 5GJWB 3CMET 2DEQA 1GCQA 1AWJA 1I81A 3X26B 2KSSA 4KH1B 3TREA 4D8DA 2D8HA 2JM8A 5L8RE 2C06A 4OMMA 3ME9A 1KFZA 4PJMA 2COWA 3G6EQ 1Q81U 1I5OB 2VV5A 3EG0A 1B34B 1UUEA 2KYMA 3CD6A 5KYYB 2MPXC 1YJWA 4ANJA 2LNHB 1M2VA 1UECA 2EQKA 3UA6A 1NLPC 3LW5E 2DXBA 3OBWA 3MEWA 3NHNA 1KQSA 1PNJA 2COZA 4OF1A 2B8AA 3CC4A 4JLGA 2LCLA 5GAMe 4XTUA 5FROA 1PKTA 2XI9A 5GMKh 4JDSA 4NL2A 3VRZA 3PVQA 1WX6A 4M7DA 5HCKA 1OOTA 1J3TA 8AT1B 3CBMA 2JMAA 3JCMW 1IO6A 3A8OB 3OSVA 1VQPQ 1VYTA 1U06A 5FRMA 1YFNA 3CCRA 3OB9A 1QMCA 4R56A 4LD9K 1UGPB 1W4SA 5HY6A 1X6GA 4EMKA 5CCAA 2HL3A 1VQ8Q 3TSZA 5EC7A 3HSBA 2EBPA 3CCUQ 2X4WA 1K4US 3CD6Q 5CQYA 2DIGA 2EQUA 3X24B 2DYBA 2MF2A 5CQXA 4M75G 1TOVA 2RHZA 2YLBA 3EGDB 1RAGB 2CUBA 3KFVA 4C5IA 4JJNK 4CC2A 2Y90A 1RI0A 3MCAB 3M54A 1Y0MA 3L2WA 2CS7A 2P0PA 4PLLA 3CCET 4FYYB 1JXOA 1AWOA 2QDYB 3EAEA 2KRNA 1M90R 1QVFS 4ZN3A 2AKLA 2QG9B 2DJZA 2LQKA 2MOXA 4OB2B 3FIFA 3C0CA 2EGAA 1XNIA 2VASA 1TWBA 1YBYA 4JJCA 2XDPA 1NJIR 4F17A 1BI3A 3KXTA 4E2FB 3PIOA 4HCZA 3G71Q 4AG1C 4KT0E 3X20B 3LWIA 4F7UF 1LVKA 1Q95G 3CBOA 4HCKA 1QKWA 5GAN4 3PMIA 4X9DA 4OMPA 2KK4A 3E9FA 1M1KR 3HPWA 4BI3A 1QKXA 4QKUA 2YHTA 4HKEA 3C94A 2DBMA 1UEBA 3H0HA 1SKUB 1C6VX 3VS6A 4F04B 3DLLA 2R58A 2J6KA 2LCSA 4RCCA 1IRXA 3CBPA 2DERA 1TUDA 4FYWB 5CKBA 3BY7A 2KRSA 3H8ZA 4MDXA 2QTVA 1KQ2A 1YNZA 4F14A 1G3YA 3I55A 2P4TA 2CZ1B 2F69A 4WCIA 2BZYA 2ROTA 1HYOA 2LJ1A 2BUDA 2X3XD 2CP0A 4ESRA 2KBTA 1R8OB 4OB3B 4LDVA 1KSWA 1X27A 4QVCA 5D6XA 3VYHB 1G3TA 2M02A 5GJVB 3CCJT 1VIEA 2CSQA 4M78C 3X25B 1W2BP 1NLOC 2IG0A 1D3BB 3OW2S 2JW4A 2RQVA 1M3BA 3L2ZA 1PC0A 5GMKm 4HVWA 5GAOn 2JS0A 4C8QD 1YCYA 1BI1A 2O2OA 5I2MA 1VQOA 2D0NA 5IXBA 4PJOA 1YJNT 1VQ7T 3P8HA 1UGQB 2GGRA 1WGSA 3P8BB 2FRYA 4IKFA 2DZCA 2K3BA 5GMKl 1V29B 2X4JA 3ZBDA 4F7UA 2EJGA 1KK7A 3QYHB 3G4SQ 4ATOA 1ZSZA 4IUTA 1UJYA 5IN1A 3I56A 2KT8A 3URGA 3JCMQ 1QWEA 4E7LA 4M7AD 4LNPA 1X2KA 3RR6A 4RTTA 4JUVA 1SEMA 1CSKA 2YDLA 1RUWA 4C8QF 1FMVA 2NUZA 5I11A 4JS5A 4E7KA 3CCVQ 1K73C 4MMKA 4Y92A 1KQ1A 1N5ZA 2DTHA 1VQKT 5D6WA 4ZTJA 5A0GA 4E7IA 1Q86C 5GANg 3MO8A 2M0OA 4OVAA 1AEYA 5LJ3j 1QP2A 2COYA 4LXCA 1KC8U 3OS1A 1KD1R 4LDYA 3MP6A 4M78D 1WJQA 4GBQA 1VQLA 5GANh 4PJLA 1UE9A 3I9QA 3QIIA 4DBQA 3CCQA 1MNEA 2FO0A 4B9XA 4M7AF 3TVTA 3QHSA 1QVGA 2M1HA 3I56Q 2GF7A 4C5EA 4RTXA 2JN0A 2DBKA 4XU2A 1KJWA 3VU3C 5GAOm 2L89A 2MAMA 4YTLA 1TTHB 2RHYA 3NTHA 3JV3A 2DETA 1JXMA 1HJDA 3FB9A 1PRLC 4KGXB 3EFRA 2E1HA 4OB0B 2DZ9A 2M51A 2L2PA 4M77A 3E1SA 1X6BA 4E7SA 3CPWA 5GAOl 2ZAEA 1YHQT 1N9RA 2OTJA 4CC7A 1GCQC 2LDMA 1YITQ 1VQ9A 2FZCB 2VUBA 3VS4A 1E6HA 1DJ7B 4WTOB 2JTFA 4KBMB 2VWFA 4IIOA 2HMAA 2F2WA 3HP9A 9ATCB 3CMEQ 2DXCA 2NUPB 1VQLQ 4DA4A 3INZA 1YJ9T 2RI2A 3E9GA 2AZSA 2HAXA 1NJIC 2VGMA 3EH2A 5EG2A 3OYIA 1N6AA 1G83A 1WIEA 5GAOr 3CCMA 4DOWA 4M78B 4C0GA 2EJFA 2VKNA 1X75C 3LLRA 4HCCA 4C0ZA 4XU3A 5KYWA 4HVUA 5GAMj 5D7UA 5KCOA 2KE9A 2XDBA 2V8IA 4RTZA 3QPHA 1YI2A 4M7DC 1O9SA 3QBYA 1M5Q1 2XKOC 4M7AA 5M9OA 2LJ3A 3CCEA 3KBGA 3OYDA 2DA9A 5J3BA 2A37A 5GAN2 2O31A 5KYXA 2KNBB 2K9GA 1ARKA 4EMKC 2CYZB 2SEMA 3ER0A 3JB9G 1QVPA 1N8RR 4JRQA 3A8LB 3H0FA 2KY9A 1RAAB 1AOJA 1X6OA 2E3HA 7AT1B 1HSQA 1NBEB 2NUTB 2F5KA 4Q5WA 2H3EB 1D0YA 1I8FA 4RCBA 2X9HA 2RB6A 1R0BG 4QVDA 4O5VA 4DBRA 4ZTFA 1G3WA 1S72A 2XD0A 3SHWA 2JJ9A 3RESA 2EPDA 3OS5A 3REBB 4BE2A 2NYSA 2GTJA 1Y7XA 1WQWA 4XTWA 2J6OA 2DRKA 1VQMT 3CCEQ 1K8AC 3HFOA 2RQTA 1UTIA 1I07A 2RJFA 2LX9A 4C0DB 2DLPA 1YCSB 1RACB 1M27C 2EYWA 3O8VA 1GFCA 1PD0A 2YWWA 3MP1A 3UF4A 4DBHA 5LJ3g 2FHDA 3JCMX 2WSFE 4JZ4A 1VQNT 1QCNA 4HVVA 1G5VA 1OU9A 1X01A 2O88A 4BUGA 2PVGB 4X9CA 1GXIE 1MV3A 1Z9ZA 2KVQG 3CC2T 4X1VA 1M8VA 1WHKA 3EGXA 4AT1B 2E12A 3HL8A 3CMAT 2LQNA 4HT9A 3I5RA 1T3LA 1TUGB 2O4XA 1VUBA 3M0QA 3VS0A 1GCPA 1KD1C 2DL3A 2A28A 1YJNA 3P8DA 2W10A 1M2VB 2DL8A 3G6EA 2X3WD 1M90U 4J8OA 4C92A 1WXBA 3VS3A 1Q82U 1BB9A 4JRPA 5AT1B 2FEIA 2MWPA 3RKYA 2X4YA 4ORZA 1ZUKA 4D6WA 3OS0A 1PSFA 2LP5A 1FX7A 2F2XA 3VS5A 2QQ9A 1E6GA 4EIKA 4PKCC 4M7DB 1NJIU 1R77A 2HEQA 2YSQA 2OAUA 5LJ5h 3CCJQ 4X34A 3META 4IUVA 3OYHA 1KG1A 1TSFA 1YWOA 2XMFA 2RM4A 2HBPA 1NPRA 4HXJA 2L0AA 2LT1A 4EMKB 4ELZC 2XU8A 4OB1B 1VQPA 5GAMg 3M53A 3JSCA 3JB9J 1M1KU 4ZGEB 3GPLA 1YJNQ 2BE9B 1VQ7Q 2EW3A 1NG2A 1CKBA 2EYXA 1VQ8A 2KMTA 1PM3A 1K76A 3CCUA 1TS9A 1B7TA 4BE0A 1A0NB 2QQAA 3WVEB 3M58A 4BDYA 2DD4A 3LX7A 3QKJA 3V8LA 2ZPHB 4CC3A 3GP8A 5A0DA 3H6ZA 4M78G 2DL7A 2E3IA 1MMGA 1BCMA 4Z88A 4PL6A 1SSHA 1QP3A 5IHKA 2FRWA 1K73R 4J9BA 4DEYA 2E4HA 1RLPC 2EVRA 1Q7YC 3V8JA 4OMNA 4PFPA 4B6MA 2VB6A 1NE8A 3PT9A 1Q86R 1PSEA 4PFOA 1VQKQ 1XTDA 3M55A 3OYNA 2KEAA 2QDLA 2CREA 2FPFA 2DYIA 1YP5A 2CH4W 3OYCA 1N8RC 1OX9A 2QGFB 2A0FB 4PLIA 3TQ7P 2MI6A 2HDAA 3OY9A 2R5AA 5FW9A 4NOYA 1UGSB 1IXDA 5CAIA 1RADB 3QO3A 3G71A 1ZLMA 2L3SA 4PJOD 2QEXA 1FMWA 1OZ2A 4XAXB 5GMKe 2DTIA 3NTIA 1VQ4T 2QYZA 4EPCA 1BU1A 2K2VA 2RA2A 3OMGA 2Y4XA 3GOXA 1JRIA 4C5HA 2ROLA 3BW1A 3TEEA 4JRIA 3L1AA 5CKHA 1W2BA 1QVFP 2LVMA 3OYJA 5GAOp 1YHQQ 1Z9QA 2LT4A 2R5MA 4FSXA 1VIFA 2A36A 3MKDA 3OW2A 4V2SA 1NPPA 2CT4A 2L3PA 4PJOF 4N0AA 5IXFA 1H92A 4E6RA 4C8QC 3S3OA 2EQJA 2DAQA 4DBFA 3CCST 1M30A 2QQRA 1YJ9Q 2QEXQ 4KGVB 2J05A 1KQSS 1M3CA 4J6WA 2BZXA 2AT1B 3JCMf 4ZGDB 5LJ5f 1M1FA 1Y07A 3OYAA 4ME7A 5I21A 1SSFA 4F7UE 4CRIA 1K9MR 2ZPEB 2EJ9A 3L42A 2C0TA 1Y71A 1X43A 1OU8A 2PUKB 4PJOB 4LD6A 1IHWA 3FLGA 2K5IA 2YUNA 3DB4A 2RJDA 3RIRA 3GIBA 5CO7A 1W1FA 2V26A 2DL5A 2JTMA 2JUFA 3LH5A 1NEBA 4M7AC 4AFZC 5DLOA 2KR3A 2K6DA 3OQ5A 2DILA 5I22A 1FMKA 4TVRA 4F7UB 1LOJA 2CDTA 3I35A 2V1RA 4PFZA 2ZPFB 2HKQB 4J5YA 5GAOq 1WYXA 1HD3A 4B9WA 1ZA1B 1OV3A 3M4YA 3VYGA 2VGNA 1UHCA 2J6FA 2CSIA 2YRCA 4M77D 3CCLT 4J9GA 2RH2A 4PNOA 3G4SA 4DEXA 2OJ2A 2ZGWA 5D6YA 4L59A 1EX4A 3D7SB 3PGGA 4E7HA 2K2MA 1UGRB 3DB3A 2K3XA 2E41A 4FW2A 1WQ7A 1U5SA 3OYKA 2C0OA 3SEMA 2CH4A 4FU6A 3HHTB 3M0PA 4OMFB 1BI0A 1BIBA 3UPUA 1ZUUA 2XICA 3CCVA 1D0XA 1VQNA 2BKDN 3OW2P 1VQ6T 2DIQA 4M7DG 3SWNA 3O5ZA 1RAIB 1WZOA 2D9TA 3JRZA 1H8KA 1UFFA 1MHNA 1IZ6A 3RKWA 4BB7A 3R6OA 3CC2A 4J7IA 2KDSA 4RMOA 2P0KA 1RAEB 4M77F 1K8AR 4A4GA 1QLYA 3RERA 1BBZA 3QWXX 5HKCA 2RD1A 2PNIA 3EHQA 3QDRB 2MYSA 3NMZC 1VQMQ 1UB4A 1U3OA 2QK0A 2X4XA 2HQXA 2OTLT 3V7CA 4A53A 2ZPGB 2VXEA 4KUDK 3GF5A 3UWNA 4FCYA 1ACMB 2H8HA 2JTEA 2DVEA 4J6YA 1D1AA 3EH1A 4M77B 1WFWA 2CP3A 4CI0C 3H41A 2QI2A 2HNIA 1ZHIA 2ZPBB 3BFMA 1VQNQ 4MZPA 4C8QE 2GQIA 1WJRA 1MUZA 3PMTA 1NYFA 3NPFA 1YITA 5GAN8 3JCMV 2HQHA 3CC2Q 4LDUA 2K5LA 2CP6A 4KUIA 2JOYA 3HFNA 4KH0B 3CMEA 3CMAQ 3REAB 4C8QB 2FZKB 4QVZA 3C95A 3AHUA 2RQRA 3L2QA 2QA4T 2JM9A 1LNXA 2GFAA 4FYXB 3G7ZA 4C0DC 5KYWB 2JXBA 4HCBA 4J9HA 2D1XA 3JCMd 2EAYA 1BIAA 5LJ5d 3JCMb 4QT7A 3QSUA 1YJWT 1W6XA 3JB9H 4M7AB 3A8HB 3H9NA 4RTUA 1I1JA 2AK5A 5CR2A 3CC4T 1PKSA 3QDFA 2G3RA 2LQWA 3VUZA 2EYQA 1VA7A 4N4IA 5KYXB 4BD3A 4VUBA 1VQ5T 5FU6B 2QTXA 1QCOA 4M78E 2DE0X 2CZ7B 5KE2A 3UDCA 2LQ8A 5GAN5 3OYEA 4QQGA 1ZA2B 1C0MA 1R0CB 1BI2A 2JNGA 2GBQA 1T0HA 2W0ZA 3NGPA 3CCRT 3EG9A 1WHLA 3N5BB 2C0IA 4M75D 1E7OA 1KHIA 3DKMA 4LE9A 3ZL7C 1AWWA 1RLQC 3LYIA 1JJ2S 1K9MC 1JJ2P 3GLXA 4J9EA 4AFQC 3TCJA 3OYMA 3JAME 1O75A 4C92D 2YXYA 1N9SA 5IH2A 3RKXA 4ZGJB 4PJOG 1W70A 3QJYA 4L5GA 1Q7YR 1EZZB 2KYBA 3MEUA 2BIVA 2BE7D 3OS2A 3I5SA 4MDWA 4ELYC 4F7UG 4EMGA 2Y4YA 2LTOA 3A1PA 2MWOA 2ECZA 3EFOA 1PG5B 2AIRB 1T3SA 2XG8D 1Q81C 2RI3A 1IGQA 4M75F 3VS1A 1SPKA 4JS4A 4AG2C 1BK2A 1ABOA 2MCNA 1PWTA 1M4ZA 1WLPB 5GMKj 3CCSA 3EGXB 2VYTA 4C92F 2LNVA 2BZ8A 2EGEA 1OEBA 2PUOB 1VQ4Q 3CPWS 1ZQ1A 1MGQA 2O4XB 1ZBJA 3UT1A 1AZGB 5KH6A 2GTOA 2KQWA 5GANf 1OYXA 4XTZA 3S3MA 3WXMB 4BE1A 4C92B 1K73U 3M9QA 1NYGA 1RL2A 1NZ9A 1AVZC 4GLMA 2B86A 1OULA 1Q86U 2YT6A 3PIPA 3RDVA 4J83A 2JT4A 2G6FX 2QQSA 2DFUA 4A4KA 1LJOA 5CIUA 1B07A 3I55T 1JO8A 1MV0B 3CCSQ 1X2QA 1LPLA 5GAN7 3CEYA 1Y96A 5DY9A 1TU0B 3FRNA 1WDXA 5LJ3h 5KE3A 1JBMA 4NS5A 4RTWA 3TU4K 5AYFA 2Z0WA 3WVDB 2RPNA 3CCJA 4J9CA 3PE0A 2IVWA 3CC7T 2VXFA 2KT1A 2FVUA 2CZ0B 2KXCA 4M75A 1VQOT 1UJ0A 3S6WA 4LN2A 5FRNA 1WHHA 1VQ7A 4BY6B 2DTOA 4C8QG 1GL5A 3LH0A 1XQHA 3CXCS 2DVJA 2LCCA 2PTKA 4M7DE 5FWBA 2M0YA 3CXCP 2V8KA 4JZ3A 3JB9I 1SHFA 5DM7R 1GBQA 4D8KA 4QW2A 3A98A 3H0IA 4RKUE 3I56T 1V76A 3VS2A 2RMOA 4FYVB 5FU7C 3J80E 1OPLA 1IB8A 1YN8A 3EHRA 2X51A 3VUBA 4J6XA 3SFMA 2KAFA 3SWNC 4II1A 2K79A 2DXUA 2YLCA 4M7AG 2HL5C 2XDDA 1TXQA 4PJOC 1VQ6Q 1MMAA 2F5TX 3M57A 4MMLA 1M9SA 1VQKA 2A3LA 3EG3A 3MEVA 3OYYA 1OZ3A 2CGHA 2OAWA 2I2LA 3NTKA 4XQ3A 2HBWA 1ZSZC 1FYNA 2BTTA 1ZUYA 3MPUB 3V7SA 5GAMh 5KYUA 2CT3A 1VQLT 1QVFA 1G2BA 1ABQA 3CCQT 3T9NA 2PZ1A 3UATA 2QA4A 2OTLQ 3R6NA 1U1SA 2KROA 3JCMe 2HSPA 4BI8B 2JVVA 1GRIA 5LJ5e 3CQTA 2WSCE 4GY5A 5I2SA 4ZNXA 3JCMc 4WF2A 3SDZA 3E19A 4FT2A 4JJDA 2DL4A 1FWZA 1N27A 2FG0A 3QG1A 4MZMA 3THKA 4XTXA 5FWCA 1T0JA 2RJCA 5GANd 1AD5A 1SRMA 2LMJA 2K5FA 1ZSGA 2P84A 2OI3A 2HKNA 1M2OA 3VV0A 1YHQA 4JLIA 4QQDA 2OTJT 1VQ9T 3LWHA 4IIMA 5CKDA 4CC4B 1VQ5A 2F1LA 4J9FA 2DMOA 1SRLA 1AT1B 2D8JA 4OGCA 1AZEA 2ATCB 5LJ3f 1YJ9A 2ZZDA 2FPEA 1K8AU 2ZPIB 2I0NA 1P92A 2QA4Q 3E2UA 1WHMA 3A8MB 2DO3A 4A4EA 1K0SA 2ZCFB 3CCMT 1UHFA 1Y57A 2L5QA 2CP5A 1F1BB 2XK0A 1IGUA 4M77C 8ATCB 1I4K1 1YJWQ 4EDUA 1S1NA 4FSSA 2ABLA 5DLQE 2NLUA 2IIMA 1D1CA 5GANj 2HD0A 2EQIA 3CC4Q 1B34A 2JZ2A 2QAZA 3MEAA 2RF0A 5KYYA 1YI2T 2EKOA 2V8JA 2RK1A 1KC8C 2O9VA 1XOVA 4O6JA 1K0XA 2RJEA 5J26A 2EYYA 2KGTA 2V1QA 4C92G 3JB9D 1VQ5Q 1SF9A 1EFNA 3GNGA 1MNDA 4PJOE 1YIJT 1IHVA 2FYKA 2PQWA 1Q82R 5FU7B 1KD1U 3HTRA 3OYFA 3CCRQ 1KQSP 3SWNB 1GFDA 3QJ6A 3M0SA 1OPKA 3MP8A 4BACA 1NM7A 3AT1B 1SHGA 1FXXA 1BKBA 2P4RA 2JS2A 1JB0E 4A63B 3ULRB 1S72T 1WPYA 5IHIA 3SD4A 1RAHB 1AWXA 1C1AA 2ENMA 5GAMf 1ZSZB 3JB9F 2EKHA 2E6NA 1EIFA 1H641 2PVDB 1CKAA 1H3HA 2DF6A 4LUDA 1UG1A 2J06A 2FPDA 3Q1JA 1VQMA 3EGDA 5FU6C 4XTYA 1K9AA 1TG0A 2EFIA 2DX1A 1UDLA 1Q81R 3FDRA 3QXEB 3EG1A 3L2UA 2DRMA 2DD5A 3HRTA 4C0FA 2DM1A 3EGUA 3FC3A 2EGCA 4OP0A 1PRMC 3RMQA 3MHXA 2E10A 4Z02A 3GBQA 2H3JA 1UGVA 1VYUA 2M9UA 2GCXA 1B3QA 1VOMA 1W2BS 4ZN1A 1JU5C 4A54A 2WACA 3EG2A 4LDXA 1OQKA 3M56A 3CMAA 2O01E 1U1TA 3CC7A 1X69A 2CUDA 1ZBXA 2QQBA 4M77E 1Q7YU 2E65A 2J7IA 2PU9B 4C5GA 3GNFB 2HCKA 5LJ3d 2LC4A 1MMDA 4KRTA 3G6ET 4JRKA 2YUPA 3FJPA 4FL6A 1K1ZA 4R55A 5GMKi 3M59A 2K3YA 3RMSA 1N8RU 2VVKA 2ESWA 4J7FA 3VRYA 3I55Q 1U8RA 2D0QB 4JPBW 4XTVA 2WSEE 3A8GB 2IPOB 3A5ZB 4DQ2A 3SB2A 1I0CA 1TH7A 5GAN3 2M16A 4GLKA 2E64A 3BE3A 4L6V5 2RK2A 4M75C 4EMHA 1JJ2A 3OSSC 2O9SA 3OBYA 2QGGA 2E70A 1OX8A 4IUQA 2DPPB 4FW1A 3CC7Q 5KYNA 3M0UA 3EG9B 2R57A 4Y28E 2K7AA 3M4GA 3PVLA 1VQPT 4C92C 1VQOQ 2XIDA 1D3BA 1JEGA 4LUEA 2RO0A 3RNJA 4P5NA 4M7AE 3JCMP 2RQUA 3MJXA 3FJ5A 1VQ8T 3RBBB 5C0MA 2RI5A 3CCUT 3CD6T 1WA7A 4OMOA 4Y91A 1M3AA 5FLXE 3UA7A 2KI7A 3L2VA 4LDWA 3PFSA 3VKIA 1PD1A 1H3ZA 3X28B 3PNWC 3ZEHA 5GANe 3LGFA 3LGLA 4BDZA 3EFOB 1KIKA 4QQ6A 5GAMd 3OYGA 1AHJB 2XHCA 3RUXA 1I5LA 1D09B 1IREB 3HRUA 5CKEA 2EWNA 5J39A 1M90C 2YUOA 5CKFA 2EIFA 4M78F 4OMQA 1Q82C 1TUCA 4BY6C 2MK5A 3J7AF 3OYBA 1M1GA 3VJPA 4AMCA 4M4ZA 3OMCA 2A7YA 1PCXA 5LJ5j 2RNAA 3G71T 3CCQQ 6AT1B 2EQMA 4AFUC 2ED0A 2QXFA 4RG8A 2QEXT 1G3SA 2LRQA 5IT9E 3HKSA 1VQ4A 1BCOA 4C8QA 4K11A 3C4SA 3F70A 2X35A 4XK8E 2MIOA 4RTYA 3VS7A 1WNLA 4A4HA 2AHJB 3M0TA 4MZTA 2L3RA 4F16A 1G8XA 2E5KA 2FB7A 3CPFA 1M1KC 2CZ6B 2PVOB 5GAN6 4XU0A 4FIBA 1QVGS 2OTJQ 2A08A 1VQ9Q 1QVGP 3C12A 1V1CA 1Y96B 2LX7A 4OGEA 2JMCA 5IAYA 2KRMA 3NFCA 2D6FA 1PHTA 4M75E 4IUPA 5A0LA 2CKKA 1JQQA 3QZ9B 1YIJA 2ED1A 1D0ZA 3OYLA 2KXDA 3CXCA 4C92E 2NUPA 2SRCA 3L2RA 1KHCA 4M75B 3CPWP 3CCMQ 2YUQA 1HXDA 2MMPA 1GBRA 4PK4A 5CVIA 2GQVA 2CP7A 1WJSA 2HSEB 4KGZB 3J81E 2GFUA 2DJQA 1OI1A 2E6ZA 3M5AA 3M0RA 4M78A 4E7ZA 1KC8R 1QW1A 4DOVA 2FL7A 1RABB 4PJJA 4N0AC 3TSWA 4BI4A 4RTVA 1YI2Q 4HT8A 4Z89A 4NL3A 2L8DA 3S3NA 5CK9A 2HZYA 1HK9A 2K57A 3ZFJA 3CCLA 1WHGA 3G4ST 2DK3A 2QASA 4IUUA 2E5QA 1YIJQ 2YRDA 1BYMA 4A4FA
chains in the Genus database with same CATH topology
1YHQQ 1N8RR 2OTJQ 1YITQ 1YJNQ 1YI2Q 3CCRQ 1KQSP 1VQ9Q 1VQ7Q 1QVGP 3CC2Q 3G6EQ 3CPWP 3CCMQ 1Q7YR 3CCJQ 1K73R 1W2BP 1K8AR 1K9MR 1VQ8Q 3CXCP 1KD1R 3CMAQ 1VQ5Q 3CMEQ 3CCUQ 3CC7Q 3CCLQ 1M1KR 1NJIR 3CCVQ 1VQMQ 1YJWQ 3OW2P 1VQLQ 3I55Q 3G4SQ 3CCEQ 1VQ6Q 3CD6Q 1VQNQ 3CCQQ 3G71Q 1KC8R 1JJ2P 3CCSQ 1M90R 1Q81R 1Q86R 1YJ9Q 2OTLQ 2QEXQ 1VQKQ 1YIJQ 2QA4Q 3I56Q 1VQOQ 1S72Q 1VQPQ 1Q82R 1QVFP 3CC4Q 1VQ4Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHQ Q;  1N8R R;  2OTJ Q;  1YIT Q;  1YJN Q;  1YI2 Q;  3CCR Q;  1KQS P;  1VQ9 Q;  1VQ7 Q;  1QVG P;  3CC2 Q;  3G6E Q;  3CPW P;  3CCM Q;  1Q7Y R;  3CCJ Q;  1K73 R;  1W2B P;  1K8A R;  1K9M R;  1VQ8 Q;  3CXC P;  1KD1 R;  3CMA Q;  1VQ5 Q;  3CME Q;  3CCU Q;  3CC7 Q;  3CCL Q;  1M1K R;  1NJI R;  3CCV Q;  1VQM Q;  1YJW Q;  3OW2 P;  1VQL Q;  3I55 Q;  3G4S Q;  3CCE Q;  1VQ6 Q;  3CD6 Q;  1VQN Q;  3CCQ Q;  3G71 Q;  1KC8 R;  1JJ2 P;  3CCS Q;  1M90 R;  1Q81 R;  1Q86 R;  1YJ9 Q;  2OTL Q;  2QEX Q;  1VQK Q;  1YIJ Q;  2QA4 Q;  3I56 Q;  1VQO Q;  1S72 Q;  1VQP Q;  1Q82 R;  1QVF P;  3CC4 Q;  1VQ4 Q; 
#chains in the Genus database with same CATH topology
 3V7R A;  2DEU A;  4M77 G;  1M8M A;  4M7D D;  5A2Q E;  5IHN A;  4XU1 A;  4N4H A;  4PJN A;  3EFS A;  3QZ5 B;  2HQE A;  4J9I A;  3BDU A;  5C6S A;  2GNC A;  2DNU A;  3CCV T;  4E47 A;  1VQ6 A;  3QUI A;  5LL6 S;  3G1J A;  4Z8A A;  1LCK A;  2NUT A;  5HK3 A;  2OX7 A;  1RAF B;  2FZG B;  2VC8 A;  2RQW A;  1S72 Q;  5KYU B;  1YWP A;  3JCM J;  3HRS A;  1SG5 A;  2K4Y A;  4R0K A;  5L23 A;  2LZ6 B;  1WXU A;  4FM4 B;  1QQJ A;  1RI9 A;  1VYV A;  4FT4 A;  2DXT A;  4HA8 A;  4RG2 A;  1QCF A;  2RHX A;  5LJ3 e;  3CCL Q;  3QYG B;  4N4G A;  3V8K A;  5ECA A;  1WXT A;  2CP2 A;  2OTL A;  1ZX6 A;  3BDL A;  4M7D F;  2DKG A;  4E7J A;  3KUF A;  2P0Q A;  4AFS C;  3FEO A;  2AKK A;  1WHJ A;  3U23 A;  4UC4 A;  2RHI A;  1D1B A;  2EYZ A;  2NWM A;  2L3Q A;  2RN8 A;  4RUG A;  3OA6 A;  4JJB A;  3IQL A;  2LJ0 A;  3JCM g;  5LJ5 g;  4OML A;  1K9M U;  4IUR A;  5HK0 A;  1MMN A;  3QWY A;  2YRV A;  1WI7 A;  4J9D A;  2F2V A;  1XJW B;  3DLM A;  1YIT T;  3JCM h;  1QWF A;  1NEG A;  2RHU A;  4KUL A;  5KCH A;  3PTA A;  2AZV A;  3ASK A;  5GJW B;  3CME T;  2DEQ A;  1GCQ A;  1AWJ A;  1I81 A;  3X26 B;  2KSS A;  4KH1 B;  3TRE A;  4D8D A;  2D8H A;  2JM8 A;  5L8R E;  2C06 A;  4OMM A;  3ME9 A;  1KFZ A;  4PJM A;  2COW A;  3G6E Q;  1Q81 U;  1I5O B;  2VV5 A;  3EG0 A;  1B34 B;  1UUE A;  2KYM A;  3CD6 A;  5KYY B;  2MPX C;  1YJW A;  4ANJ A;  2LNH B;  1M2V A;  1UEC A;  2EQK A;  3UA6 A;  1NLP C;  3LW5 E;  2DXB A;  3OBW A;  3MEW A;  3NHN A;  1KQS A;  1PNJ A;  2COZ A;  4OF1 A;  2B8A A;  3CC4 A;  4JLG A;  2LCL A;  5GAM e;  4XTU A;  5FRO A;  1PKT A;  2XI9 A;  5GMK h;  4JDS A;  4NL2 A;  3VRZ A;  3PVQ A;  1WX6 A;  4M7D A;  5HCK A;  1OOT A;  1J3T A;  8AT1 B;  3CBM A;  2JMA A;  3JCM W;  1IO6 A;  3A8O B;  3OSV A;  1VQP Q;  1VYT A;  1U06 A;  5FRM A;  1YFN A;  3CCR A;  3OB9 A;  1QMC A;  4R56 A;  4LD9 K;  1UGP B;  1W4S A;  5HY6 A;  1X6G A;  4EMK A;  5CCA A;  2HL3 A;  1VQ8 Q;  3TSZ A;  5EC7 A;  3HSB A;  2EBP A;  3CCU Q;  2X4W A;  1K4U S;  3CD6 Q;  5CQY A;  2DIG A;  2EQU A;  3X24 B;  2DYB A;  2MF2 A;  5CQX A;  4M75 G;  1TOV A;  2RHZ A;  2YLB A;  3EGD B;  1RAG B;  2CUB A;  3KFV A;  4C5I A;  4JJN K;  4CC2 A;  2Y90 A;  1RI0 A;  3MCA B;  3M54 A;  1Y0M A;  3L2W A;  2CS7 A;  2P0P A;  4PLL A;  3CCE T;  4FYY B;  1JXO A;  1AWO A;  2QDY B;  3EAE A;  2KRN A;  1M90 R;  1QVF S;  4ZN3 A;  2AKL A;  2QG9 B;  2DJZ A;  2LQK A;  2MOX A;  4OB2 B;  3FIF A;  3C0C A;  2EGA A;  1XNI A;  2VAS A;  1TWB A;  1YBY A;  4JJC A;  2XDP A;  1NJI R;  4F17 A;  1BI3 A;  3KXT A;  4E2F B;  3PIO A;  4HCZ A;  3G71 Q;  4AG1 C;  4KT0 E;  3X20 B;  3LWI A;  4F7U F;  1LVK A;  1Q95 G;  3CBO A;  4HCK A;  1QKW A;  5GAN 4;  3PMI A;  4X9D A;  4OMP A;  2KK4 A;  3E9F A;  1M1K R;  3HPW A;  4BI3 A;  1QKX A;  4QKU A;  2YHT A;  4HKE A;  3C94 A;  2DBM A;  1UEB A;  3H0H A;  1SKU B;  1C6V X;  3VS6 A;  4F04 B;  3DLL A;  2R58 A;  2J6K A;  2LCS A;  4RCC A;  1IRX A;  3CBP A;  2DER A;  1TUD A;  4FYW B;  5CKB A;  3BY7 A;  2KRS A;  3H8Z A;  4MDX A;  2QTV A;  1KQ2 A;  1YNZ A;  4F14 A;  1G3Y A;  3I55 A;  2P4T A;  2CZ1 B;  2F69 A;  4WCI A;  2BZY A;  2ROT A;  1HYO A;  2LJ1 A;  2BUD A;  2X3X D;  2CP0 A;  4ESR A;  2KBT A;  1R8O B;  4OB3 B;  4LDV A;  1KSW A;  1X27 A;  4QVC A;  5D6X A;  3VYH B;  1G3T A;  2M02 A;  5GJV B;  3CCJ T;  1VIE A;  2CSQ A;  4M78 C;  3X25 B;  1W2B P;  1NLO C;  2IG0 A;  1D3B B;  3OW2 S;  2JW4 A;  2RQV A;  1M3B A;  3L2Z A;  1PC0 A;  5GMK m;  4HVW A;  5GAO n;  2JS0 A;  4C8Q D;  1YCY A;  1BI1 A;  2O2O A;  5I2M A;  1VQO A;  2D0N A;  5IXB A;  4PJO A;  1YJN T;  1VQ7 T;  3P8H A;  1UGQ B;  2GGR A;  1WGS A;  3P8B B;  2FRY A;  4IKF A;  2DZC A;  2K3B A;  5GMK l;  1V29 B;  2X4J A;  3ZBD A;  4F7U A;  2EJG A;  1KK7 A;  3QYH B;  3G4S Q;  4ATO A;  1ZSZ A;  4IUT A;  1UJY A;  5IN1 A;  3I56 A;  2KT8 A;  3URG A;  3JCM Q;  1QWE A;  4E7L A;  4M7A D;  4LNP A;  1X2K A;  3RR6 A;  4RTT A;  4JUV A;  1SEM A;  1CSK A;  2YDL A;  1RUW A;  4C8Q F;  1FMV A;  2NUZ A;  5I11 A;  4JS5 A;  4E7K A;  3CCV Q;  1K73 C;  4MMK A;  4Y92 A;  1KQ1 A;  1N5Z A;  2DTH A;  1VQK T;  5D6W A;  4ZTJ A;  5A0G A;  4E7I A;  1Q86 C;  5GAN g;  3MO8 A;  2M0O A;  4OVA A;  1AEY A;  5LJ3 j;  1QP2 A;  2COY A;  4LXC A;  1KC8 U;  3OS1 A;  1KD1 R;  4LDY A;  3MP6 A;  4M78 D;  1WJQ A;  4GBQ A;  1VQL A;  5GAN h;  4PJL A;  1UE9 A;  3I9Q A;  3QII A;  4DBQ A;  3CCQ A;  1MNE A;  2FO0 A;  4B9X A;  4M7A F;  3TVT A;  3QHS A;  1QVG A;  2M1H A;  3I56 Q;  2GF7 A;  4C5E A;  4RTX A;  2JN0 A;  2DBK A;  4XU2 A;  1KJW A;  3VU3 C;  5GAO m;  2L89 A;  2MAM A;  4YTL A;  1TTH B;  2RHY A;  3NTH A;  3JV3 A;  2DET A;  1JXM A;  1HJD A;  3FB9 A;  1PRL C;  4KGX B;  3EFR A;  2E1H A;  4OB0 B;  2DZ9 A;  2M51 A;  2L2P A;  4M77 A;  3E1S A;  1X6B A;  4E7S A;  3CPW A;  5GAO l;  2ZAE A;  1YHQ T;  1N9R A;  2OTJ A;  4CC7 A;  1GCQ C;  2LDM A;  1YIT Q;  1VQ9 A;  2FZC B;  2VUB A;  3VS4 A;  1E6H A;  1DJ7 B;  4WTO B;  2JTF A;  4KBM B;  2VWF A;  4IIO A;  2HMA A;  2F2W A;  3HP9 A;  9ATC B;  3CME Q;  2DXC A;  2NUP B;  1VQL Q;  4DA4 A;  3INZ A;  1YJ9 T;  2RI2 A;  3E9G A;  2AZS A;  2HAX A;  1NJI C;  2VGM A;  3EH2 A;  5EG2 A;  3OYI A;  1N6A A;  1G83 A;  1WIE A;  5GAO r;  3CCM A;  4DOW A;  4M78 B;  4C0G A;  2EJF A;  2VKN A;  1X75 C;  3LLR A;  4HCC A;  4C0Z A;  4XU3 A;  5KYW A;  4HVU A;  5GAM j;  5D7U A;  5KCO A;  2KE9 A;  2XDB A;  2V8I A;  4RTZ A;  3QPH A;  1YI2 A;  4M7D C;  1O9S A;  3QBY A;  1M5Q 1;  2XKO C;  4M7A A;  5M9O A;  2LJ3 A;  3CCE A;  3KBG A;  3OYD A;  2DA9 A;  5J3B A;  2A37 A;  5GAN 2;  2O31 A;  5KYX A;  2KNB B;  2K9G A;  1ARK A;  4EMK C;  2CYZ B;  2SEM A;  3ER0 A;  3JB9 G;  1QVP A;  1N8R R;  4JRQ A;  3A8L B;  3H0F A;  2KY9 A;  1RAA B;  1AOJ A;  1X6O A;  2E3H A;  7AT1 B;  1HSQ A;  1NBE B;  2NUT B;  2F5K A;  4Q5W A;  2H3E B;  1D0Y A;  1I8F A;  4RCB A;  2X9H A;  2RB6 A;  1R0B G;  4QVD A;  4O5V A;  4DBR A;  4ZTF A;  1G3W A;  1S72 A;  2XD0 A;  3SHW A;  2JJ9 A;  3RES A;  2EPD A;  3OS5 A;  3REB B;  4BE2 A;  2NYS A;  2GTJ A;  1Y7X A;  1WQW A;  4XTW A;  2J6O A;  2DRK A;  1VQM T;  3CCE Q;  1K8A C;  3HFO A;  2RQT A;  1UTI A;  1I07 A;  2RJF A;  2LX9 A;  4C0D B;  2DLP A;  1YCS B;  1RAC B;  1M27 C;  2EYW A;  3O8V A;  1GFC A;  1PD0 A;  2YWW A;  3MP1 A;  3UF4 A;  4DBH A;  5LJ3 g;  2FHD A;  3JCM X;  2WSF E;  4JZ4 A;  1VQN T;  1QCN A;  4HVV A;  1G5V A;  1OU9 A;  1X01 A;  2O88 A;  4BUG A;  2PVG B;  4X9C A;  1GXI E;  1MV3 A;  1Z9Z A;  2KVQ G;  3CC2 T;  4X1V A;  1M8V A;  1WHK A;  3EGX A;  4AT1 B;  2E12 A;  3HL8 A;  3CMA T;  2LQN A;  4HT9 A;  3I5R A;  1T3L A;  1TUG B;  2O4X A;  1VUB A;  3M0Q A;  3VS0 A;  1GCP A;  1KD1 C;  2DL3 A;  2A28 A;  1YJN A;  3P8D A;  2W10 A;  1M2V B;  2DL8 A;  3G6E A;  2X3W D;  1M90 U;  4J8O A;  4C92 A;  1WXB A;  3VS3 A;  1Q82 U;  1BB9 A;  4JRP A;  5AT1 B;  2FEI A;  2MWP A;  3RKY A;  2X4Y A;  4ORZ A;  1ZUK A;  4D6W A;  3OS0 A;  1PSF A;  2LP5 A;  1FX7 A;  2F2X A;  3VS5 A;  2QQ9 A;  1E6G A;  4EIK A;  4PKC C;  4M7D B;  1NJI U;  1R77 A;  2HEQ A;  2YSQ A;  2OAU A;  5LJ5 h;  3CCJ Q;  4X34 A;  3MET A;  4IUV A;  3OYH A;  1KG1 A;  1TSF A;  1YWO A;  2XMF A;  2RM4 A;  2HBP A;  1NPR A;  4HXJ A;  2L0A A;  2LT1 A;  4EMK B;  4ELZ C;  2XU8 A;  4OB1 B;  1VQP A;  5GAM g;  3M53 A;  3JSC A;  3JB9 J;  1M1K U;  4ZGE B;  3GPL A;  1YJN Q;  2BE9 B;  1VQ7 Q;  2EW3 A;  1NG2 A;  1CKB A;  2EYX A;  1VQ8 A;  2KMT A;  1PM3 A;  1K76 A;  3CCU A;  1TS9 A;  1B7T A;  4BE0 A;  1A0N B;  2QQA A;  3WVE B;  3M58 A;  4BDY A;  2DD4 A;  3LX7 A;  3QKJ A;  3V8L A;  2ZPH B;  4CC3 A;  3GP8 A;  5A0D A;  3H6Z A;  4M78 G;  2DL7 A;  2E3I A;  1MMG A;  1BCM A;  4Z88 A;  4PL6 A;  1SSH A;  1QP3 A;  5IHK A;  2FRW A;  1K73 R;  4J9B A;  4DEY A;  2E4H A;  1RLP C;  2EVR A;  1Q7Y C;  3V8J A;  4OMN A;  4PFP A;  4B6M A;  2VB6 A;  1NE8 A;  3PT9 A;  1Q86 R;  1PSE A;  4PFO A;  1VQK Q;  1XTD A;  3M55 A;  3OYN A;  2KEA A;  2QDL A;  2CRE A;  2FPF A;  2DYI A;  1YP5 A;  2CH4 W;  3OYC A;  1N8R C;  1OX9 A;  2QGF B;  2A0F B;  4PLI A;  3TQ7 P;  2MI6 A;  2HDA A;  3OY9 A;  2R5A A;  5FW9 A;  4NOY A;  1UGS B;  1IXD A;  5CAI A;  1RAD B;  3QO3 A;  3G71 A;  1ZLM A;  2L3S A;  4PJO D;  2QEX A;  1FMW A;  1OZ2 A;  4XAX B;  5GMK e;  2DTI A;  3NTI A;  1VQ4 T;  2QYZ A;  4EPC A;  1BU1 A;  2K2V A;  2RA2 A;  3OMG A;  2Y4X A;  3GOX A;  1JRI A;  4C5H A;  2ROL A;  3BW1 A;  3TEE A;  4JRI A;  3L1A A;  5CKH A;  1W2B A;  1QVF P;  2LVM A;  3OYJ A;  5GAO p;  1YHQ Q;  1Z9Q A;  2LT4 A;  2R5M A;  4FSX A;  1VIF A;  2A36 A;  3MKD A;  3OW2 A;  4V2S A;  1NPP A;  2CT4 A;  2L3P A;  4PJO F;  4N0A A;  5IXF A;  1H92 A;  4E6R A;  4C8Q C;  3S3O A;  2EQJ A;  2DAQ A;  4DBF A;  3CCS T;  1M30 A;  2QQR A;  1YJ9 Q;  2QEX Q;  4KGV B;  2J05 A;  1KQS S;  1M3C A;  4J6W A;  2BZX A;  2AT1 B;  3JCM f;  4ZGD B;  5LJ5 f;  1M1F A;  1Y07 A;  3OYA A;  4ME7 A;  5I21 A;  1SSF A;  4F7U E;  4CRI A;  1K9M R;  2ZPE B;  2EJ9 A;  3L42 A;  2C0T A;  1Y71 A;  1X43 A;  1OU8 A;  2PUK B;  4PJO B;  4LD6 A;  1IHW A;  3FLG A;  2K5I A;  2YUN A;  3DB4 A;  2RJD A;  3RIR A;  3GIB A;  5CO7 A;  1W1F A;  2V26 A;  2DL5 A;  2JTM A;  2JUF A;  3LH5 A;  1NEB A;  4M7A C;  4AFZ C;  5DLO A;  2KR3 A;  2K6D A;  3OQ5 A;  2DIL A;  5I22 A;  1FMK A;  4TVR A;  4F7U B;  1LOJ A;  2CDT A;  3I35 A;  2V1R A;  4PFZ A;  2ZPF B;  2HKQ B;  4J5Y A;  5GAO q;  1WYX A;  1HD3 A;  4B9W A;  1ZA1 B;  1OV3 A;  3M4Y A;  3VYG A;  2VGN A;  1UHC A;  2J6F A;  2CSI A;  2YRC A;  4M77 D;  3CCL T;  4J9G A;  2RH2 A;  4PNO A;  3G4S A;  4DEX A;  2OJ2 A;  2ZGW A;  5D6Y A;  4L59 A;  1EX4 A;  3D7S B;  3PGG A;  4E7H A;  2K2M A;  1UGR B;  3DB3 A;  2K3X A;  2E41 A;  4FW2 A;  1WQ7 A;  1U5S A;  3OYK A;  2C0O A;  3SEM A;  2CH4 A;  4FU6 A;  3HHT B;  3M0P A;  4OMF B;  1BI0 A;  1BIB A;  3UPU A;  1ZUU A;  2XIC A;  3CCV A;  1D0X A;  1VQN A;  2BKD N;  3OW2 P;  1VQ6 T;  2DIQ A;  4M7D G;  3SWN A;  3O5Z A;  1RAI B;  1WZO A;  2D9T A;  3JRZ A;  1H8K A;  1UFF A;  1MHN A;  1IZ6 A;  3RKW A;  4BB7 A;  3R6O A;  3CC2 A;  4J7I A;  2KDS A;  4RMO A;  2P0K A;  1RAE B;  4M77 F;  1K8A R;  4A4G A;  1QLY A;  3RER A;  1BBZ A;  3QWX X;  5HKC A;  2RD1 A;  2PNI A;  3EHQ A;  3QDR B;  2MYS A;  3NMZ C;  1VQM Q;  1UB4 A;  1U3O A;  2QK0 A;  2X4X A;  2HQX A;  2OTL T;  3V7C A;  4A53 A;  2ZPG B;  2VXE A;  4KUD K;  3GF5 A;  3UWN A;  4FCY A;  1ACM B;  2H8H A;  2JTE A;  2DVE A;  4J6Y A;  1D1A A;  3EH1 A;  4M77 B;  1WFW A;  2CP3 A;  4CI0 C;  3H41 A;  2QI2 A;  2HNI A;  1ZHI A;  2ZPB B;  3BFM A;  1VQN Q;  4MZP A;  4C8Q E;  2GQI A;  1WJR A;  1MUZ A;  3PMT A;  1NYF A;  3NPF A;  1YIT A;  5GAN 8;  3JCM V;  2HQH A;  3CC2 Q;  4LDU A;  2K5L A;  2CP6 A;  4KUI A;  2JOY A;  3HFN A;  4KH0 B;  3CME A;  3CMA Q;  3REA B;  4C8Q B;  2FZK B;  4QVZ A;  3C95 A;  3AHU A;  2RQR A;  3L2Q A;  2QA4 T;  2JM9 A;  1LNX A;  2GFA A;  4FYX B;  3G7Z A;  4C0D C;  5KYW B;  2JXB A;  4HCB A;  4J9H A;  2D1X A;  3JCM d;  2EAY A;  1BIA A;  5LJ5 d;  3JCM b;  4QT7 A;  3QSU A;  1YJW T;  1W6X A;  3JB9 H;  4M7A B;  3A8H B;  3H9N A;  4RTU A;  1I1J A;  2AK5 A;  5CR2 A;  3CC4 T;  1PKS A;  3QDF A;  2G3R A;  2LQW A;  3VUZ A;  2EYQ A;  1VA7 A;  4N4I A;  5KYX B;  4BD3 A;  4VUB A;  1VQ5 T;  5FU6 B;  2QTX A;  1QCO A;  4M78 E;  2DE0 X;  2CZ7 B;  5KE2 A;  3UDC A;  2LQ8 A;  5GAN 5;  3OYE A;  4QQG A;  1ZA2 B;  1C0M A;  1R0C B;  1BI2 A;  2JNG A;  2GBQ A;  1T0H A;  2W0Z A;  3NGP A;  3CCR T;  3EG9 A;  1WHL A;  3N5B B;  2C0I A;  4M75 D;  1E7O A;  1KHI A;  3DKM A;  4LE9 A;  3ZL7 C;  1AWW A;  1RLQ C;  3LYI A;  1JJ2 S;  1K9M C;  1JJ2 P;  3GLX A;  4J9E A;  4AFQ C;  3TCJ A;  3OYM A;  3JAM E;  1O75 A;  4C92 D;  2YXY A;  1N9S A;  5IH2 A;  3RKX A;  4ZGJ B;  4PJO G;  1W70 A;  3QJY A;  4L5G A;  1Q7Y R;  1EZZ B;  2KYB A;  3MEU A;  2BIV A;  2BE7 D;  3OS2 A;  3I5S A;  4MDW A;  4ELY C;  4F7U G;  4EMG A;  2Y4Y A;  2LTO A;  3A1P A;  2MWO A;  2ECZ A;  3EFO A;  1PG5 B;  2AIR B;  1T3S A;  2XG8 D;  1Q81 C;  2RI3 A;  1IGQ A;  4M75 F;  3VS1 A;  1SPK A;  4JS4 A;  4AG2 C;  1BK2 A;  1ABO A;  2MCN A;  1PWT A;  1M4Z A;  1WLP B;  5GMK j;  3CCS A;  3EGX B;  2VYT A;  4C92 F;  2LNV A;  2BZ8 A;  2EGE A;  1OEB A;  2PUO B;  1VQ4 Q;  3CPW S;  1ZQ1 A;  1MGQ A;  2O4X B;  1ZBJ A;  3UT1 A;  1AZG B;  5KH6 A;  2GTO A;  2KQW A;  5GAN f;  1OYX A;  4XTZ A;  3S3M A;  3WXM B;  4BE1 A;  4C92 B;  1K73 U;  3M9Q A;  1NYG A;  1RL2 A;  1NZ9 A;  1AVZ C;  4GLM A;  2B86 A;  1OUL A;  1Q86 U;  2YT6 A;  3PIP A;  3RDV A;  4J83 A;  2JT4 A;  2G6F X;  2QQS A;  2DFU A;  4A4K A;  1LJO A;  5CIU A;  1B07 A;  3I55 T;  1JO8 A;  1MV0 B;  3CCS Q;  1X2Q A;  1LPL A;  5GAN 7;  3CEY A;  1Y96 A;  5DY9 A;  1TU0 B;  3FRN A;  1WDX A;  5LJ3 h;  5KE3 A;  1JBM A;  4NS5 A;  4RTW A;  3TU4 K;  5AYF A;  2Z0W A;  3WVD B;  2RPN A;  3CCJ A;  4J9C A;  3PE0 A;  2IVW A;  3CC7 T;  2VXF A;  2KT1 A;  2FVU A;  2CZ0 B;  2KXC A;  4M75 A;  1VQO T;  1UJ0 A;  3S6W A;  4LN2 A;  5FRN A;  1WHH A;  1VQ7 A;  4BY6 B;  2DTO A;  4C8Q G;  1GL5 A;  3LH0 A;  1XQH A;  3CXC S;  2DVJ A;  2LCC A;  2PTK A;  4M7D E;  5FWB A;  2M0Y A;  3CXC P;  2V8K A;  4JZ3 A;  3JB9 I;  1SHF A;  5DM7 R;  1GBQ A;  4D8K A;  4QW2 A;  3A98 A;  3H0I A;  4RKU E;  3I56 T;  1V76 A;  3VS2 A;  2RMO A;  4FYV B;  5FU7 C;  3J80 E;  1OPL A;  1IB8 A;  1YN8 A;  3EHR A;  2X51 A;  3VUB A;  4J6X A;  3SFM A;  2KAF A;  3SWN C;  4II1 A;  2K79 A;  2DXU A;  2YLC A;  4M7A G;  2HL5 C;  2XDD A;  1TXQ A;  4PJO C;  1VQ6 Q;  1MMA A;  2F5T X;  3M57 A;  4MML A;  1M9S A;  1VQK A;  2A3L A;  3EG3 A;  3MEV A;  3OYY A;  1OZ3 A;  2CGH A;  2OAW A;  2I2L A;  3NTK A;  4XQ3 A;  2HBW A;  1ZSZ C;  1FYN A;  2BTT A;  1ZUY A;  3MPU B;  3V7S A;  5GAM h;  5KYU A;  2CT3 A;  1VQL T;  1QVF A;  1G2B A;  1ABQ A;  3CCQ T;  3T9N A;  2PZ1 A;  3UAT A;  2QA4 A;  2OTL Q;  3R6N A;  1U1S A;  2KRO A;  3JCM e;  2HSP A;  4BI8 B;  2JVV A;  1GRI A;  5LJ5 e;  3CQT A;  2WSC E;  4GY5 A;  5I2S A;  4ZNX A;  3JCM c;  4WF2 A;  3SDZ A;  3E19 A;  4FT2 A;  4JJD A;  2DL4 A;  1FWZ A;  1N27 A;  2FG0 A;  3QG1 A;  4MZM A;  3THK A;  4XTX A;  5FWC A;  1T0J A;  2RJC A;  5GAN d;  1AD5 A;  1SRM A;  2LMJ A;  2K5F A;  1ZSG A;  2P84 A;  2OI3 A;  2HKN A;  1M2O A;  3VV0 A;  1YHQ A;  4JLI A;  4QQD A;  2OTJ T;  1VQ9 T;  3LWH A;  4IIM A;  5CKD A;  4CC4 B;  1VQ5 A;  2F1L A;  4J9F A;  2DMO A;  1SRL A;  1AT1 B;  2D8J A;  4OGC A;  1AZE A;  2ATC B;  5LJ3 f;  1YJ9 A;  2ZZD A;  2FPE A;  1K8A U;  2ZPI B;  2I0N A;  1P92 A;  2QA4 Q;  3E2U A;  1WHM A;  3A8M B;  2DO3 A;  4A4E A;  1K0S A;  2ZCF B;  3CCM T;  1UHF A;  1Y57 A;  2L5Q A;  2CP5 A;  1F1B B;  2XK0 A;  1IGU A;  4M77 C;  8ATC B;  1I4K 1;  1YJW Q;  4EDU A;  1S1N A;  4FSS A;  2ABL A;  5DLQ E;  2NLU A;  2IIM A;  1D1C A;  5GAN j;  2HD0 A;  2EQI A;  3CC4 Q;  1B34 A;  2JZ2 A;  2QAZ A;  3MEA A;  2RF0 A;  5KYY A;  1YI2 T;  2EKO A;  2V8J A;  2RK1 A;  1KC8 C;  2O9V A;  1XOV A;  4O6J A;  1K0X A;  2RJE A;  5J26 A;  2EYY A;  2KGT A;  2V1Q A;  4C92 G;  3JB9 D;  1VQ5 Q;  1SF9 A;  1EFN A;  3GNG A;  1MND A;  4PJO E;  1YIJ T;  1IHV A;  2FYK A;  2PQW A;  1Q82 R;  5FU7 B;  1KD1 U;  3HTR A;  3OYF A;  3CCR Q;  1KQS P;  3SWN B;  1GFD A;  3QJ6 A;  3M0S A;  1OPK A;  3MP8 A;  4BAC A;  1NM7 A;  3AT1 B;  1SHG A;  1FXX A;  1BKB A;  2P4R A;  2JS2 A;  1JB0 E;  4A63 B;  3ULR B;  1S72 T;  1WPY A;  5IHI A;  3SD4 A;  1RAH B;  1AWX A;  1C1A A;  2ENM A;  5GAM f;  1ZSZ B;  3JB9 F;  2EKH A;  2E6N A;  1EIF A;  1H64 1;  2PVD B;  1CKA A;  1H3H A;  2DF6 A;  4LUD A;  1UG1 A;  2J06 A;  2FPD A;  3Q1J A;  1VQM A;  3EGD A;  5FU6 C;  4XTY A;  1K9A A;  1TG0 A;  2EFI A;  2DX1 A;  1UDL A;  1Q81 R;  3FDR A;  3QXE B;  3EG1 A;  3L2U A;  2DRM A;  2DD5 A;  3HRT A;  4C0F A;  2DM1 A;  3EGU A;  3FC3 A;  2EGC A;  4OP0 A;  1PRM C;  3RMQ A;  3MHX A;  2E10 A;  4Z02 A;  3GBQ A;  2H3J A;  1UGV A;  1VYU A;  2M9U A;  2GCX A;  1B3Q A;  1VOM A;  1W2B S;  4ZN1 A;  1JU5 C;  4A54 A;  2WAC A;  3EG2 A;  4LDX A;  1OQK A;  3M56 A;  3CMA A;  2O01 E;  1U1T A;  3CC7 A;  1X69 A;  2CUD A;  1ZBX A;  2QQB A;  4M77 E;  1Q7Y U;  2E65 A;  2J7I A;  2PU9 B;  4C5G A;  3GNF B;  2HCK A;  5LJ3 d;  2LC4 A;  1MMD A;  4KRT A;  3G6E T;  4JRK A;  2YUP A;  3FJP A;  4FL6 A;  1K1Z A;  4R55 A;  5GMK i;  3M59 A;  2K3Y A;  3RMS A;  1N8R U;  2VVK A;  2ESW A;  4J7F A;  3VRY A;  3I55 Q;  1U8R A;  2D0Q B;  4JPB W;  4XTV A;  2WSE E;  3A8G B;  2IPO B;  3A5Z B;  4DQ2 A;  3SB2 A;  1I0C A;  1TH7 A;  5GAN 3;  2M16 A;  4GLK A;  2E64 A;  3BE3 A;  4L6V 5;  2RK2 A;  4M75 C;  4EMH A;  1JJ2 A;  3OSS C;  2O9S A;  3OBY A;  2QGG A;  2E70 A;  1OX8 A;  4IUQ A;  2DPP B;  4FW1 A;  3CC7 Q;  5KYN A;  3M0U A;  3EG9 B;  2R57 A;  4Y28 E;  2K7A A;  3M4G A;  3PVL A;  1VQP T;  4C92 C;  1VQO Q;  2XID A;  1D3B A;  1JEG A;  4LUE A;  2RO0 A;  3RNJ A;  4P5N A;  4M7A E;  3JCM P;  2RQU A;  3MJX A;  3FJ5 A;  1VQ8 T;  3RBB B;  5C0M A;  2RI5 A;  3CCU T;  3CD6 T;  1WA7 A;  4OMO A;  4Y91 A;  1M3A A;  5FLX E;  3UA7 A;  2KI7 A;  3L2V A;  4LDW A;  3PFS A;  3VKI A;  1PD1 A;  1H3Z A;  3X28 B;  3PNW C;  3ZEH A;  5GAN e;  3LGF A;  3LGL A;  4BDZ A;  3EFO B;  1KIK A;  4QQ6 A;  5GAM d;  3OYG A;  1AHJ B;  2XHC A;  3RUX A;  1I5L A;  1D09 B;  1IRE B;  3HRU A;  5CKE A;  2EWN A;  5J39 A;  1M90 C;  2YUO A;  5CKF A;  2EIF A;  4M78 F;  4OMQ A;  1Q82 C;  1TUC A;  4BY6 C;  2MK5 A;  3J7A F;  3OYB A;  1M1G A;  3VJP A;  4AMC A;  4M4Z A;  3OMC A;  2A7Y A;  1PCX A;  5LJ5 j;  2RNA A;  3G71 T;  3CCQ Q;  6AT1 B;  2EQM A;  4AFU C;  2ED0 A;  2QXF A;  4RG8 A;  2QEX T;  1G3S A;  2LRQ A;  5IT9 E;  3HKS A;  1VQ4 A;  1BCO A;  4C8Q A;  4K11 A;  3C4S A;  3F70 A;  2X35 A;  4XK8 E;  2MIO A;  4RTY A;  3VS7 A;  1WNL A;  4A4H A;  2AHJ B;  3M0T A;  4MZT A;  2L3R A;  4F16 A;  1G8X A;  2E5K A;  2FB7 A;  3CPF A;  1M1K C;  2CZ6 B;  2PVO B;  5GAN 6;  4XU0 A;  4FIB A;  1QVG S;  2OTJ Q;  2A08 A;  1VQ9 Q;  1QVG P;  3C12 A;  1V1C A;  1Y96 B;  2LX7 A;  4OGE A;  2JMC A;  5IAY A;  2KRM A;  3NFC A;  2D6F A;  1PHT A;  4M75 E;  4IUP A;  5A0L A;  2CKK A;  1JQQ A;  3QZ9 B;  1YIJ A;  2ED1 A;  1D0Z A;  3OYL A;  2KXD A;  3CXC A;  4C92 E;  2NUP A;  2SRC A;  3L2R A;  1KHC A;  4M75 B;  3CPW P;  3CCM Q;  2YUQ A;  1HXD A;  2MMP A;  1GBR A;  4PK4 A;  5CVI A;  2GQV A;  2CP7 A;  1WJS A;  2HSE B;  4KGZ B;  3J81 E;  2GFU A;  2DJQ A;  1OI1 A;  2E6Z A;  3M5A A;  3M0R A;  4M78 A;  4E7Z A;  1KC8 R;  1QW1 A;  4DOV A;  2FL7 A;  1RAB B;  4PJJ A;  4N0A C;  3TSW A;  4BI4 A;  4RTV A;  1YI2 Q;  4HT8 A;  4Z89 A;  4NL3 A;  2L8D A;  3S3N A;  5CK9 A;  2HZY A;  1HK9 A;  2K57 A;  3ZFJ A;  3CCL A;  1WHG A;  3G4S T;  2DK3 A;  2QAS A;  4IUU A;  2E5Q A;  1YIJ Q;  2YRD A;  1BYM A;  4A4F A; 
#chains in the Genus database with same CATH homology
 1YHQ Q;  1N8R R;  2OTJ Q;  1YIT Q;  1YJN Q;  1YI2 Q;  3CCR Q;  1KQS P;  1VQ9 Q;  1VQ7 Q;  1QVG P;  3CC2 Q;  3G6E Q;  3CPW P;  3CCM Q;  1Q7Y R;  3CCJ Q;  1K73 R;  1W2B P;  1K8A R;  1K9M R;  1VQ8 Q;  3CXC P;  1KD1 R;  3CMA Q;  1VQ5 Q;  3CME Q;  3CCU Q;  3CC7 Q;  3CCL Q;  1M1K R;  1NJI R;  3CCV Q;  1VQM Q;  1YJW Q;  3OW2 P;  1VQL Q;  3I55 Q;  3G4S Q;  3CCE Q;  1VQ6 Q;  3CD6 Q;  1VQN Q;  3CCQ Q;  3G71 Q;  1KC8 R;  1JJ2 P;  3CCS Q;  1M90 R;  1Q81 R;  1Q86 R;  1YJ9 Q;  2OTL Q;  2QEX Q;  1VQK Q;  1YIJ Q;  2QA4 Q;  3I56 Q;  1VQO Q;  1S72 Q;  1VQP Q;  1Q82 R;  1QVF P;  3CC4 Q;  1VQ4 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...