2E5QA

Solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens]
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
GSSGSSGLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 19
publication title Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e5qA00
2BIVA 3LGFA 3PMIA 5FROA 4C5IA 2LVMA 5J39A 5C0MA 2R58A 4II1A 3M9QA 4E7KA 3OMCA 5KE2A 2O4XA 2L8DA 5J26A 2RHUA 2X4XA 2EFIA 5D6XA 1N27A 3OS0A 3OMGA 3MEUA 4FL6A 3OYMA 4A4HA 4PLIA 3QKJA 4B9XA 1MHNA 2DIQA 4Q5WA 4B9WA 3OA6A 2K3YA 3NTKA 2RO0A 3BDLA 2LDMA 2X4YA 3O8VA 3OYJA 3MEVA 2RI5A 3Q1JA 3L42A 5FRNA 2L3RA 2MWPA 5M9OA 1WJSA 3UT1A 3FDRA 3L2QA 5D6WA 4BE1A 4FU6A 2NLUA 4IUPA 3OYAA 3OYFA 2DAQA 4BDYA 3MEAA 2GFUA 4BDZA 3NTIA 3L2VA 4E7JA 3META 4Z02A 2BUDA 2X35A 5IAYA 2F5KA 4N4IA 3OYDA 3ME9A 4IKFA 3SD4A 3OYNA 4ZTFA 2EQKA 2K3XA 3FEOA 2HQEA 5KE3A 3QIIA 4E7HA 3H8ZA 2RI3A 2LRQA 3P8DA 3ASKA 4IURA 4A4EA 4LD6A 3S3MA 2XDPA 2LTOA 4IUQA 4QQGA 5KCOA 2G3RA 2RI2A 3DLMA 3LLRA 3OYCA 3ZEHA 3LX7A 3L2UA 3F70A 1WJQA 3OYKA 2VYTA 4E7IA 2EKOA 3E9FA 1WJRA 2QQSA 3DB4A 4PLLA 2RHXA 1KHCA 5C6SA 3LYIA 3DB3A 2R5AA 3P8HA 4UC4A 1H3ZA 3OB9A 3UWNA 3MEWA 4C5EA 4C5GA 3OS2A 2O4XB 2BKDN 2CKKA 2R57A 3NTHA 5CIUA 4EDUA 2RJCA 3QJ6A 3OYLA 4BE2A 2QQRA 3E9GA 2DIGA 2X4WA 3S3OA 2RJFA 2GFAA 3MP6A 4L59A 3EAEA 4CRIA 2M16A 1OZ3A 2E5QA 3GOXA 2RHZA 2M1HA 1WGSA 1XNIA 4BACA 2B8AA 2JZ2A 3L2RA 2EQMA 3H6ZA 3PMTA 4IUVA 5D6YA 5IN1A 2PQWA 2RJEA 4IUTA 4PL6A 3MO8A 4QQ6A 4C5HA 3MP8A 4NS5A 3LH0A 4A4GA 1OYXA 1G5VA 2R5MA 2XK0A 2WACA 4GY5A 4QW2A 3CEYA 2RHYA 2RJDA 2FHDA 2YRVA 1OI1A 3OYIA 2L89A 3C4SA 3OYBA 1OZ2A 3FLGA 4OVAA 3L2WA 4N4GA 4ZTJA 3OYHA 3OS1A 4A4FA 4E7LA 4RG2A 2D9TA 4BD3A 3PNWC 2HQXA 3OQ5A 4HCZA 4QQDA 5KCHA 3S3NA 3MP1A 2EQUA 3OYEA 3KUFA 5KH6A 4BE0A 2GF7A 2EQJA 1RI0A 4N4HA 3FC3A 2P0KA 2M0OA 2LCCA 3S6WA 3OY9A 2MWOA 3OYGA 1SSFA 4IUUA 4X34A 3LGLA 3PFSA 4QVZA 2E6NA 2RHIA 3QBYA 2IG0A 2JTFA 5FRMA
chains in the Genus database with same CATH superfamily
1YITT 1PD0A 1WNLA 2KEAA 1VQPT 4M7AG 4KGXB 2O4XA 5KYXA 5GJWB 1YNZA 4M7AB 3OS0A 2DD4A 1PG5B 4ZGDB 4JRQA 2ESWA 1UUEA 1JXOA 5GAOr 1HSQA 2K4YA 2DERA 2DXTA 1ZQ1A 1YI2Q 1QVGA 2CP7A 4JRKA 3OYAA 2XICA 4FW1A 1Q81U 4M7DC 5HK3A 2FYKA 3NTIA 3CCMQ 1H641 4EMGA 1I8FA 4IKFA 4XU3A 2EGAA 1JJ2P 2K3XA 3UA6A 5CQYA 4J6YA 3X20B 5GJVB 2ABLA 3QG1A 2E3HA 2IVWA 4IUQA 4QQGA 4RTUA 3CCVQ 2A36A 2RQVA 1GBRA 2KBTA 3M59A 3TSZA 2RHXA 3EG9A 4QKUA 2KE9A 1PCXA 4J5YA 2GFAA 4OMFB 4M77G 1C6VX 2OTJQ 1PC0A 4ZGEB 1OZ3A 2PZ1A 4M77B 3QZ9B 4RTTA 2EQMA 3H6ZA 1YJNA 3ZFJA 3MP8A 1UTIA 4FW2A 2DL3A 1Q95G 1BYMA 2G6FX 1YFNA 3CCLA 2JXBA 3PIPA 2KVQG 3JCMe 4MDXA 1K0XA 5LJ5e 1NEGA 1TWBA 1KIKA 3VS7A 2EWNA 4C8QC 5GAOn 2ENMA 1PRLC 3CC7Q 5HY6A 1VQ9A 2FG0A 5KH6A 4PFZA 1YITQ 4DOWA 3UATA 3H41A 3M53A 1PD1A 2P0KA 2LCCA 4YTLA 1JJ2S 4EMHA 5GMKe 2K2MA 1AWJA 2JTFA 2YLBA 1G83A 4AG2C 3I9QA 2LVMA 2O9VA 2R58A 3H0IA 2CP5A 4HVWA 2W0ZA 2RK2A 2OJ2A 2X4JA 2YRCA 4PJJA 5GAN8 3A5ZB 2X51A 1D0YA 2J7IA 2QI2A 2HKQB 4FM4B 3I56T 1G2BA 2V26A 1W1FA 2L3RA 2K57A 2YUOA 5D6WA 1M4ZA 2QYZA 2DTHA 3ZL7C 1OX8A 1RADB 1EZZB 3META 2D8JA 4Z02A 4M7AE 1EIFA 2XDBA 3TCJA 3ASKA 1VYUA 1KQSA 1FX7A 4NOYA 5KCOA 2DA9A 5J3BA 4FYXB 4C92G 1SRMA 2DYIA 4C92B 2ROLA 4HT9A 2XMFA 2Z0WA 1D09B 2I2LA 2BKDN 2QASA 4DBHA 2RJCA 3TQ7P 4R55A 2YUNA 2CP3A 3GOXA 1R0BG 2RQRA 3EGUA 5GMKl 4OP0A 3MO8A 1D3BB 3SHWA 1D1CA 2CS7A 4HKEA 1QQJA 3MCAB 3URGA 3INZA 4GBQA 3M58A 1N9RA 1XTDA 3VS2A 9ATCB 1NJIR 1RI0A 1OX9A 1QVFS 2QQBA 1RAGB 2MWOA 2DZ9A 4X34A 3OS2A 2MIOA 3V8JA 1WXBA 3JB9H 1M30A 3I56Q 3V7RA 2EFIA 1ABOA 1KQ1A 3VUBA 3OW2P 4RTYA 4OMPA 2PUOB 2YUQA 4M77A 1KHIA 1XQHA 2CZ6B 1NJIC 1YP5A 1K9MU 4ELYC 4LUEA 4JPBW 3VS3A 5M9OA 3HRSA 2XU8A 1RLPC 3BFMA 2DAQA 2LX9A 1PKTA 4BDZA 1KFZA 2BUDA 2KXDA 2EJGA 3THKA 2F2XA 4F7UF 2KYMA 2ZCFB 4NL3A 3EFOB 2J6KA 2QXFA 4A54A 2YDLA 2VXEA 3QSUA 1SPKA 3OYYA 3UPUA 1WJRA 4PLLA 4KUDK 2R5AA 5CK9A 4J6WA 1RABB 4PFOA 2OTLT 2MOXA 3PIOA 2Y90A 2DL5A 1Q82U 2AKLA 4J9IA 4KH1B 5KYYB 2NUPA 5GAOq 4XTZA 1WLPB 1UE9A 4MZMA 5KYWB 1G3WA 1HD3A 4ELZC 2M51A 4HCZA 3EG3A 3R6OA 1JO8A 1K1ZA 1IGUA 4X9DA 1VYTA 2EQJA 2KGTA 1RAIB 1CKAA 2RHIA 4DBRA 2IG0A 1T0JA 2BIVA 1O75A 2KRMA 2QEXA 3REBB 5FROA 5J39A 2AZVA 2QA4T 1G3SA 2OX7A 2PTKA 4M78F 4LD9K 3CPFA 5KYNA 5IT9E 1YBYA 5FWBA 1ZBJA 2EW3A 4M7AD 4QVCA 1UECA 3CD6T 2HDAA 1K8AU 2COWA 1D3BA 4RTZA 4F17A 1WJSA 3CCET 1OPLA 1RUWA 4FU6A 5GMKj 4RKUE 3EG1A 3EFSA 3L2VA 2NUTA 1NPRA 2DPPB 2IIMA 2FB7A 5A0GA 2O01E 3UDCA 1FMKA 2BZYA 3REAB 2OTLQ 1OQKA 3ZEHA 3L2UA 3V7CA 1YJNQ 3CCJA 2HSEB 2QAZA 4C5GA 1VIFA 4BY6B 2FZKB 3KFVA 4FCYA 1MV3A 3EGXB 3E9GA 2X4WA 2DD5A 2HCKA 3UA7A 1AZGB 1BB9A 3FIFA 3CMEA 1UGPB 2A28A 4BACA 1JJ2A 1BIBA 3X25B 1ZSZB 1G5VA 3DLLA 2H3EB 1Y96B 3M0TA 4KGVB 4Y91A 4EMKB 1WHGA 1Y0MA 3P8BB 1N8RC 3L2WA 4ZTJA 4EPCA 1Z9ZA 2AKKA 2EQUA 5LJ3g 1M2VA 2EBPA 3G71A 4PJOG 3QPHA 3QYHB 2Y4YA 1J3TA 2O9SA 1UGRB 4PJOB 2QA4Q 1KQSS 2ED0A 3L2ZA 3M0QA 2ZPHB 4JRPA 2QDYB 1NBEB 1CSKA 4JS4A 3CD6Q 3QYGB 5L23A 1X6GA 4RMOA 2L8DA 1I4K1 1QKWA 1ZA2B 3G7ZA 3CCEQ 5GAN6 4LXCA 2D6FA 3QDFA 1KC8U 1GCQA 5GAOm 2DK3A 1M27C 2SEMA 1VQMA 3MEAA 2K5IA 2XIDA 4OB2B 3SD4A 1YJ9T 4M7DG 2B86A 1VQ5A 5GAMg 3H9NA 4IURA 4M75C 4BUGA 4M7DB 2JVVA 4CC2A 4M77F 1K0SA 1P92A 2VB6A 3CC4T 3F70A 1WJQA 4M75E 2VC8A 2KK4A 4DBFA 2ZPEB 3P8HA 4DBQA 1TUDA 3CCUA 1I81A 4HXJA 2K6DA 3CPWP 1IHVA 1FYNA 1IGQA 1ZUUA 1LCKA 1W70A 4IUVA 5D6YA 2EIFA 2RJEA 5ECAA 3CC2A 1JB0E 3JRZA 2YWWA 4XTWA 4LDUA 1LOJA 3BY7A 2KRNA 1M8MA 1VUBA 2HL5C 1YJWA 4RTVA 2LQNA 3J7AF 3MJXA 4BI4A 1Q81R 4RG2A 3OQ5A 2A08A 4QQDA 5GANf 2KT8A 1Y71A 1RAFB 3RDVA 2JM9A 4JJBA 3EH1A 5LJ3h 1NPPA 4N0AC 4JRIA 3OY9A 2QGGA 1KJWA 3OYGA 3JAME 2MF2A 5GAMd 1XOVA 1ZX6A 2L5QA 2LJ0A 3HPWA 5LL6S 3IQLA 3PE0A 3HHTB 5FLXE 3RKXA 2ZPBB 3T9NA 5GANd 1Q81C 4AMCA 1V76A 3RUXA 2YRDA 2EGEA 1QKXA 2KMTA 1NE8A 4DOVA 1VQOT 1PSEA 1K73U 1MNDA 3JCMV 2RO0A 4PJOE 1MNEA 1Y57A 2RH2A 1YJ9Q 2CYZB 4XTXA 2L3SA 3L2QA 3CMAA 3CQTA 6AT1B 4JJDA 1ACMB 2GFUA 3E2UA 4C92F 5IAYA 5IHKA 1KQ2A 2EYWA 1N5ZA 4F7UA 3CC4Q 3FEOA 5L8RE 3EH2A 1AWOA 3P8DA 2DKGA 1U1TA 5I2SA 2YSQA 4XTVA 3OW2A 2DEUA 5GAMh 2AK5A 3VV0A 2COZA 1X6OA 2ZPIB 3LX7A 3QJYA 2KYBA 2KRSA 1U06A 2QQSA 3X28B 3LYIA 1HXDA 1UDLA 2D0QB 3NTHA 3MKDA 1UG1A 3S3OA 3MP6A 2X3WD 5EG2A 2E5QA 2K3BA 1VQ4A 3L1AA 4M7DE 2JMCA 2FZGB 2LT1A 2D1XA 4NS5A 1BI1A 3UF4A 1GXIE 2R5MA 2GCXA 2DYBA 4Y92A 1OI1A 2ECZA 3VS1A 3CCSA 4J9GA 3JB9F 4D8DA 1HK9A 1VQLT 2A7YA 2RD1A 2D0NA 4XU1A 2CUBA 1D1BA 2HQHA 1QCNA 4A4KA 5GAOl 2FPDA 1WFWA 4AFQC 1M3CA 1V1CA 2I0NA 4HCKA 5DLQE 1CKBA 4J7FA 1VQOQ 5CVIA 2F2WA 4M78A 1NEBA 3MEUA 2LP5A 4B9XA 1NLOC 3OA6A 2K3YA 1QP2A 4LDYA 1FMVA 3CCQA 2J6FA 3BDLA 2J06A 2VKNA 3Q1JA 1M1GA 4JZ3A 2KI7A 4DEYA 2HAXA 4C8QE 1HJDA 4EIKA 1EX4A 4F04B 2EYXA 3HRUA 2E41A 4MMLA 1VQ7T 4E7JA 4M75D 3OYDA 3I55T 1TUGB 2HQEA 4XTUA 4CI0C 2EKHA 1H8KA 1WHMA 2EVRA 2L2PA 2F2VA 3LLRA 4ORZA 3CMEQ 4HCBA 3EGDB 1R77A 2F69A 4MDWA 4XU2A 1VQ8A 1OV3A 2JW4A 2M02A 2EYQA 3CBMA 4Z89A 3OB9A 5CQXA 2JJ9A 1PHTA 1SG5A 5CKFA 2QQRA 3NPFA 1AWXA 1VQ6T 4OMQA 1BKBA 3AHUA 2CP0A 2L0AA 2SRCA 5IN1A 3CBPA 1PNJA 1K9MR 2CREA 1X6BA 1VQLQ 4A4GA 1S72A 4LNPA 2GGRA 2DRMA 3HP9A 4KBMB 4FT4A 4KRTA 4XU0A 2RA2A 3MPUB 3TSWA 1OZ2A 3TEEA 3RESA 4M7AA 3H0FA 1EFNA 1WYXA 2EAYA 2O88A 2C0IA 2XD0A 1MGQA 2JS2A 2V8IA 1K9MC 2AZSA 1SSFA 1W6XA 4WTOB 2PU9B 4PJOD 2J6OA 4FYYB 3A8LB 3M0SA 4C0ZA 4II1A 1QWFA 1JXMA 2QDLA 1N27A 3D7SB 1VQNT 4CC3A 2DIQA 1Q82R 2CP6A 2LJ3A 2DMOA 4ME7A 1VQ7Q 1ABQA 1KG1A 1W4SA 2CP2A 5GAN3 4C0GA 3G6ET 3I55Q 3ULRB 3CCRA 2WSFE 2HKNA 4KUIA 4BE1A 4M77C 1H92A 3OYFA 2GTJA 1TS9A 1QLYA 2C0OA 2H3JA 2HEQA 3G4SA 1Q82C 1UGVA 5LJ3e 2LMJA 3JCMQ 1VQ6Q 4M7DD 2PVDB 2VWFA 3GPLA 4OB0B 5FU6B 2KY9A 2JN0A 1KHCA 2AT1B 1TH7A 3I5SA 4FYWB 5I11A 2DXBA 3QO3A 3CXCP 4WF2A 3QJ6A 5AYFA 2DIGA 5FU7C 4L59A 3EAEA 3HTRA 1X75C 1WX6A 1M90U 1I07A 1WPYA 4AFSC 1K8AR 3V7SA 7AT1B 1U5SA 2BE7D 1X69A 3EG0A 3KBGA 2K7AA 5GAN7 3FLGA 4OGEA 3VRZA 2JS0A 2RQWA 4AFZC 4RCCA 3J81E 1YJNT 3CPWA 1WQ7A 1TU0B 4KGZB 2VXFA 5GAMe 3M0UA 4DEXA 2ATCB 3OW2S 1K8AC 3G1JA 1VQNQ 2CT3A 4CC7A 2P4RA 3EFRA 3CCLT 4QVZA 2E6NA 2VASA 2ZAEA 4OMOA 1VQKA 2MK5A 4F16A 1JBMA 5C0MA 4DQ2A 4OB1B 3M9QA 4QT7A 4C8QD 3KXTA 2LT4A 2RHUA 3G6EQ 1B34B 1RAEB 1VQ9T 2V1QA 4J9HA 1YI2A 5IXBA 4Q5WA 3LWIA 1QW1A 3CXCS 2VV5A 1RAHB 3RMQA 2VUBA 1WIEA 1SEMA 5FRNA 3CCMA 1OOTA 2K5FA 1LVKA 1Q7YU 4IUPA 1MUZA 4C92A 4RCBA 3H0HA 1ZHIA 2BZXA 2EJ9A 2GTOA 3CCVA 4E7HA 5GAN4 3JCMf 1YHQA 1QP3A 2JT4A 5A0DA 5LJ5f 4HVVA 4KT0E 1ZA1B 1BCMA 4M75G 3JCMJ 1OU9A 2IPOB 3M56A 1I5OB 3M54A 4M75B 1ARKA 2DE0X 2OTJA 1OU8A 1IRXA 2NUZA 3I5RA 2QK0A 3CBOA 5IHIA 2XG8D 4J9EA 3JCMd 1TXQA 1X27A 2P0PA 2K2VA 5EC7A 5LJ5d 3GBQA 3VS6A 2XHCA 4Z8AA 2E64A 3UWNA 1SSHA 1KC8R 3LH0A 3PVQA 2AIRB 2FHDA 5FW9A 1YIJA 4KULA 2KAFA 2MCNA 3LH5A 3CC7A 1YITA 3SDZA 5CR2A 3RR6A 1UGQB 1VQPA 3GLXA 2ZGWA 3PNWC 2K5LA 2DM1A 4JZ4A 3CCLQ 3S3NA 3MP1A 3KUFA 1M9SA 2C06A 2JTEA 1UB4A 3BW1A 3A8HB 1KC8C 1SHGA 1VQ9Q 4IUUA 2GQIA 3SWNB 2E1HA 2DJZA 4HVUA 1PM3A 1YN8A 2JUFA 3NFCA 3TVTA 2LZ6B 2XKOC 1YCSB 4M7AF 4B9WA 3EFOA 1ZBXA 4O5VA 2JOYA 4L5GA 3RERA 2MWPA 1YWPA 1OULA 3M4YA 3FDRA 3NGPA 8ATCB 5KYXB 1Z9QA 1Q86U 2GQVA 1GCQC 2DRKA 2E6ZA 4FT2A 2KDSA 3ZBDA 4TVRA 2LTOA 1QVPA 2LQKA 3SB2A 2FPFA 4E6RA 5KYYA 1TSFA 1KD1U 2K9GA 2F5TX 4OMLA 4OMNA 5KYWA 4UC4A 1S72Q 1H3ZA 4X9CA 3VS0A 3A98A 1BBZA 1K73R 2FO0A 1XJWB 5LJ3j 4L6V5 1SHFA 5GANg 3JCMW 4QW2A 3EG9B 3VU3C 4E7SA 1N8RU 2RQUA 3OSSC 5I21A 1M5Q1 2LJ1A 1N9SA 2P4TA 4OVAA 3A8OB 3MHXA 3OS1A 2X3XD 4LDXA 3M57A 1BI2A 2ZZDA 3TU4K 2DILA 1SF9A 1YWOA 1K73C 1LPLA 1WHKA 1AOJA 3I56A 1IHWA 4JJCA 3PFSA 4ZN1A 2FVUA 1TG0A 4C5IA 3NHNA 4JS5A 2K79A 1B07A 5J26A 3RNJA 1MMNA 1UEBA 1W2BP 4PNOA 2DX1A 1I1JA 2DXCA 1RAAB 3NTKA 3RKYA 1X01A 2LDMA 4BY6C 4A53A 5GAMj 2BTTA 2FRYA 4C8QG 2JMAA 1MMDA 2QEXT 2RK1A 5AT1B 3UT1A 4C8QB 2DL4A 3VYGA 4BDYA 2CH4W 2YHTA 4GLKA 2X35A 1X2KA 2F5KA 1M8VA 3VRYA 3EGXA 4ZTFA 3GNGA 3QIIA 4BI3A 4EMKC 1M3BA 2DVJA 4LD6A 4A63B 1WXTA 2XDPA 4J8OA 2A3LA 3CPWS 1MMGA 1ZSZA 2DL7A 2LNVA 3OYKA 1B7TA 3E9FA 4LDVA 4V2SA 1Y96A 3SWNA 3LW5E 1K9AA 4EMKA 4ESRA 4O6JA 4F7UE 1I0CA 2LQ8A 2RJFA 1RLQC 2DNUA 3RKWA 2JNGA 4CRIA 2KR3A 4R0KA 5D7UA 2E4HA 2LCSA 2RB6A 4PJMA 4PJOA 1W2BS 1WHJA 1BI3A 3CCJT 2WACA 3HSBA 4AG1C 4LE9A 3SFMA 4C0FA 3CEYA 3HFOA 4GLMA 4JDSA 2MAMA 1LJOA 5GANh 5HK0A 1H3HA 3C4SA 3OYBA 5HKCA 1QCOA 3U23A 3CMET 1VQKQ 3GP8A 2DXUA 4PKCC 5KCHA 3CXCA 3FJPA 2P0QA 4E47A 2VVKA 2DBKA 1DJ7B 1GFDA 2MI6A 2L3QA 3VUZA 1AHJB 5KE2A 2A0FB 3V8LA 2QEXQ 3G71T 1PRMC 1M1KU 2CUDA 2AHJB 2ZPGB 5CO7A 3HKSA 2V8JA 4M78C 3O8VA 4M7DA 1WXUA 1C0MA 1YHQQ 3J80E 1V29B 3M0RA 1NYFA 1E6HA 2KT1A 3I35A 4C0DC 4M78E 1D0XA 3ER0A 3JCMX 1WI7A 1UFFA 5CKEA 2QQ9A 3ME9A 2CZ7B 2EQKA 1IO6A 3RMSA 2OTLA 3AT1B 2KSSA 1WHHA 2M0YA 3DLMA 3QUIA 4OMMA 3OYCA 1AD5A 5IHNA 1VQMT 3DB3A 3A8GB 4J7IA 1TOVA 4C5EA 2LC4A 2OAUA 2J05A 4EDUA 3OYLA 3CCJQ 4X1VA 1YIJQ 2VGMA 1VQ5T 2WSEE 3NMZC 1NG2A 1MV0B 2M1HA 2RHZA 2DETA 1VQPQ 1XNIA 2JTMA 4IIOA 2L3PA 4LUDA 2PQWA 1S1NA 4NL2A 4OB3B 5FU7B 2RHYA 4C8QA 5GAN5 3CCUT 1K4US 2CGHA 8AT1B 4AT1B 2DTOA 2LCLA 2V8KA 2QA4A 2DFUA 2E12A 2YT6A 2KQWA 4PK4A 2QGFB 4BE0A 3CC2T 4N4HA 4J83A 2EJFA 2NUPB 5CKHA 2M0OA 3S6WA 1YJWT 3CD6A 1PKSA 3HL8A 4M7AC 3G71Q 2PNIA 5A2QE 4J6XA 3QBYA 5DLOA 3LGFA 3CCEA 2E65A 4DA4A 3JCMP 2LNHB 1JU5C 1QVFP 4BB7A 4HA8A 4RTXA 4FL6A 2VGNA 2HBPA 4HT8A 1LNXA 1M90R 2EYZA 1PWTA 3FJ5A 3X24B 3LWHA 2HMAA 2D8HA 2YXYA 4J9BA 1GBQA 3JCMc 4QVDA 3VKIA 5GAN2 4FSSA 4KH0B 4M75F 1GCPA 2WSCE 4PJNA 1I5LA 4P5NA 4N4IA 4VUBA 3OYNA 1VQMQ 1QCFA 2E70A 1IXDA 1IB8A 2E5KA 3GNFB 4PFPA 1M90C 2KNBB 5A0LA 1T3SA 3O5ZA 1VQ5Q 3CMAT 1SRLA 1C1AA 2CZ0B 2NUTB 1D1AA 3MEWA 1ZUYA 2CKKA 5CIUA 3VS5A 2DTIA 3JB9J 3CCUQ 4M77E 1WZOA 1WA7A 2B8AA 2JZ2A 2O2OA 4IUTA 4IIMA 4RUGA 4C5HA 3OBYA 4E2FB 2V1RA 4JLIA 3JB9G 4LN2A 2A37A 3RIRA 5GAOp 3VJPA 1NLPC 3EHRA 2DZCA 1Q7YR 2C0TA 3CC2Q 2YRVA 4Y28E 1G3TA 5CKBA 2L89A 2YUPA 5KYUB 1YJWQ 4BD3A 5CKDA 3HRTA 3DKMA 1VQ4T 2HD0A 4AFUC 1OPKA 2CT4A 3A8MB 1QVGP 3PTAA 1BCOA 2DO3A 1M3AA 2MMPA 3WXMB 4PJOF 3R6NA 3LGLA 3QHSA 1BK2A 5KE3A 3CCST 2FZCB 5FRMA 3PMIA 1QMCA 4ZNXA 2P84A 1Q7YC 1WDXA 4XAXB 2X4XA 1YCYA 5D6XA 4M78D 1AT1B 4HCCA 1M2VB 1NYGA 1GRIA 1B3QA 1IREB 1IZ6A 1MHNA 1VOMA 2GNCA 4MMKA 1YJ9A 3JB9I 1K76A 2X4YA 4RG8A 3PGGA 2M9UA 3EGDA 1T3LA 3JCMg 3C0CA 4J9CA 3CC4A 5GANe 2NLUA 5LJ5g 2DVEA 3EG2A 2EYYA 3CMAQ 2RI3A 3CCQT 2PVGB 4A4EA 1NJIU 4C92C 2FPEA 1W2BA 3PVLA 2G3RA 2RI2A 2RN8A 3OSVA 2QTXA 4M7DF 4FYVB 4E7IA 2VYTA 2EKOA 1AWWA 4C92E 1BI0A 1QVGS 1VA7A 5DY9A 5I2MA 5IH2A 3C12A 1G3YA 1ZUKA 3QZ5B 2ROTA 3E19A 4MZTA 2NYSA 3VYHB 4F14A 3C94A 1WGSA 4R56A 1UHCA 1G8XA 3JCMb 2OI3A 5I22A 1OYXA 1T0HA 3QXEB 1KSWA 1VQ8T 1OEBA 2ED1A 1VQ4Q 2CZ1B 3JSCA 2E3IA 3OYIA 2FL7A 1RI9A 2OAWA 1Q86R 4N4GA 3OYHA 2MYSA 4A4FA 5LJ5j 2EPDA 2BE9B 2BZ8A 4FIBA 3CCSQ 2DJQA 2RQTA 1FWZA 3FB9A 1S72T 1VQOA 2KXCA 2O31A 3VS4A 5IXFA 1KD1R 2H8HA 1UJ0A 2ZPFB 1GL5A 3BDUA 4C8QF 3OMCA 1JEGA 1KQSP 2YLCA 2MPXC 1Q86C 2RF0A 1RL2A 2CSIA 5FU6C 4A4HA 4CC4B 3OYMA 1TTHB 1O9SA 1NZ9A 1JQQA 3GIBA 4JLGA 3MEVA 3OYJA 2RI5A 1TUCA 1UGSB 1KD1C 3CCQQ 2DL8A 1N8RR 2LX7A 3JCMh 4XQ3A 5KYUA 5LJ5h 2F1LA 2RMOA 1Y7XA 3H8ZA 2LRQA 3PT9A 2HZYA 1FMWA 3S3MA 3E1SA 4XK8E 1UJYA 2XI9A 3CCRT 4M77D 1PSFA 4XTYA 2EGCA 2E10A 2GBQA 3M4GA 3DB4A 5GMKh 4RTWA 4B6MA 4F7UG 1VIEA 2O4XB 2R57A 1M2OA 1VYVA 2DEQA 4F7UB 2PUKB 1M1FA 1N6AA 1VQ8Q 1VQLA 1GFCA 3G4ST 1FXXA 2M16A 2CSQA 3L2RA 4ATOA 4PL6A 1WHLA 2QQAA 4QQ6A 1AVZC 2QTVA 5DM7R 3TREA 1ZLMA 2XK0A 4GY5A 2DF6A 1F1BB 1E6GA 4D8KA 1U8RA 5GMKi 2RJDA 1UHFA 3M55A 1ZSGA 3X26B 2RM4A 1WQWA 4E7LA 3JV3A 2HQXA 2XDDA 1B34A 3RBBB 4JUVA 2PVOB 2RPNA 3QWXX 1RACB 1NM7A 2COYA 3FC3A 4ZGJB 4JJNK 5LJ3f 3SEMA 4E7KA 4FSXA 2HBWA 4ANJA 1VQ7A 1X2QA 3OMGA 1X43A 4PLIA 1JRIA 3QKJA 3I55A 5CAIA 4BI8B 3GF5A 3M0PA 1E7OA 2HL3A 2KROA 3L42A 5LJ3d 1VQKT 2Y4XA 4M78G 4J9FA 4PJLA 2HSPA 3V8KA 5HCKA 4M75A 3OS5A 4M78B 4ZN3A 3CCRQ 2FEIA 3C95A 4C92D 3BE3A 5CCAA 1YI2T 2HNIA 2NWMA 1VQ6A 4C0DB 1QVFA 4MZPA 1KK7A 2CDTA 3CCMT 1R8OB 1BIAA 4D6WA 4K11A 3N5BB 4E7ZA 3G4SQ 1U1SA 2DBMA 1SKUB 4OGCA 5C6SA 5GAMf 5GANj 1D0ZA 4WCIA 1ZSZC 3CCVT 1A0NB 4BE2A 4OF1A 1YHQT 1HYOA 1M1KR 4Z88A 3SWNC 3EHQA 3PMTA 5FWCA 3OBWA 1R0CB 1AEYA 4J9DA 2FRWA 2JM8A 4M4ZA 2OTJT 1AZEA 3FRNA 1Y07A 4PJOC 3JB9D 4N0AA 2D9TA 1U3OA 2LQWA 3QDRB 3HFNA 3M5AA 1VQNA 3OYEA 2X9HA 1QWEA 3A1PA 2GF7A 1MMAA 1M1KC 3WVEB 2DLPA 2RNAA 1BU1A 3QWYA 5GMKm 2QG9B 2CH4A 2EQIA 3WVDB 1YIJT 4LDWA 3G6EA 3CC7T 2W10A
chains in the Genus database with same CATH topology
4JRPA 1YITT 3LGFA 2QDYB 1VQKA 1JBMA 1WNLA 3CCEA 2E65A 5C0MA 3QYGB 4DQ2A 4JS4A 4OB1B 3M9QA 4C8QD 4DA4A 3KXTA 2O4XA 4RMOA 2L8DA 2LT4A 2RHUA 1I4K1 4BB7A 4M7AB 1B34B 4HA8A 3OS0A 1VQ9T 2DD4A 4FL6A 3G7ZA 4ZGDB 2VGNA 2HBPA 4JRQA 1YI2A 1LNXA 4Q5WA 5GAN6 3LWIA 4HT8A 1QW1A 2D6FA 3CXCS 2VV5A 3RMQA 1KC8U 3X24B 3LWHA 5GAOr 2VUBA 2K4YA 5FRNA 2DXTA 3CCMA 1ZQ1A 5GAOm 1QVGA 2K5FA 2DK3A 1Q7YU 4JRKA 4IUPA 3OYAA 1VQMA 3JCMc 2XICA 3VKIA 4QVDA 5GAN2 1Q81U 3MEAA 2K5IA 4C92A 4M7DC 4M75F 5HK3A 2FYKA 3NTIA 1H641 4EMGA 4RCBA 1I8FA 2WSCE 2XIDA 4OB2B 1I5LA 4IKFA 4P5NA 4N4IA 4XU3A 1ZHIA 4VUBA 2EJ9A 3SD4A 3OYNA 1YJ9T 2K3XA 3CCVA 5CQYA 4E7HA 4M7DG 5GAN4 2E70A 5GAMg 1VQ5A 4J6YA 4IURA 4M75C 1QP3A 3JCMf 3X20B 4BUGA 3QG1A 1YHQA 2IVWA 4M7DB 2JVVA 4IUQA 4QQGA 3GNFB 5A0DA 5LJ5f 1M90C 4M77F 4KT0E 5A0LA 1P92A 4M75G 3CC4T 3F70A 1WJQA 3JCMJ 3CMAT 4M75E 3M59A 3M56A 3M54A 2VC8A 2RHXA 4M75B 2KK4A 2ZPEB 2CZ0B 3P8HA 2OTJA 3CCUA 3MEWA 3CBOA 2XG8D 1I81A 2CKKA 5CIUA 4J5YA 3JCMd 2P0PA 2DTIA 2GFAA 4OMFB 4M77G 2K2VA 5LJ5d 3JB9J 4ZGEB 1OZ3A 4M77E 2XHCA 4M77B 3QZ9B 2B8AA 2E64A 2JZ2A 2EQMA 3H6ZA 3UWNA 4IUVA 5D6YA 2EIFA 2RJEA 4IUTA 3ZFJA 1YJNA 1JB0E 3CC2A 4C5HA 3MP8A 3OBYA 3LH0A 3JRZA 4JLIA 4XTWA 4LDUA 3JB9G 3RIRA 1LOJA 3BY7A 5GAOp 1VUBA 3VJPA 1YJWA 1BYMA 2DZCA 2FHDA 1YIJA 3CCLA 4KULA 2KAFA 2YRVA 3J7AF 3CC7A 4Y28E 4BI4A 3PIPA 1G3TA 2KVQG 3JCMe 5CKBA 2L89A 1YITA 3SDZA 4MDXA 5CR2A 5LJ5e 1VQPA 1UGQB 4RG2A 3GLXA 2ZGWA 3PNWC 2K5LA 3OQ5A 3HRTA 4BD3A 5CKDA 4QQDA 3DKMA 5GANf 2HD0A 2EWNA 1Y71A 4C8QC 3MP1A 5GAOn 3S3NA 1VQ4T 3KUFA 5HY6A 1M9SA 1VQ9A 5KH6A 3A8MB 4DOWA 3PTAA 2C06A 1UB4A 3BW1A 3M53A 2P0KA 3A8HB 2LCCA 4YTLA 1NPPA 4N0AC 2DO3A 5LJ3h 4JRIA 3OY9A 1JJ2S 2MMPA 1KC8C 3WXMB 3OYGA 4EMHA 3JAME 4IUUA 4PJOF 2MF2A 3LGLA 3QHSA 1XOVA 5GAMd 5KE3A 5GMKe 2JTFA 2YLBA 2L5QA 3CCST 3SWNB 3HPWA 5FRMA 3PMIA 2LVMA 5LL6S 2E1HA 1Q7YC 2DJZA 2R58A 3HHTB 4XAXB 3RKXA 2ZPBB 3T9NA 5FLXE 5GANd 1Q81C 2X4XA 3RUXA 1YCYA 5D6XA 2JUFA 3NFCA 2KMTA 4M78D 1NE8A 2RK2A 4HCCA 2XKOC 4DOVA 1IZ6A 1IREB 1MHNA 4M7AF 4MMKA 2X4JA 1YJ9A 4B9WA 1VQOT 1PSEA 1K73U 3JB9I 1ZBXA 4O5VA 2RO0A 3A5ZB 4FM4B 2QI2A 3JCMV 5GAN8 2X4YA 2RH2A 4RG8A 3I56T 4PJOE 2JOYA 4L5GA 4M7AG 3RERA 3PGGA 2M9UA 2L3RA 2MWPA 2CYZB 2K57A 4XTXA 3JCMg 3M4YA 3FDRA 3L2QA 5D6WA 3CC4A 5GANe 3CMAA 2NLUA 1M4ZA 5LJ5g 2DTHA 2DVEA 2GFUA 4C92F 1Q86U 2GQVA 3META 4Z02A 4M7AE 5IAYA 2E6ZA 1KQ2A 4F7UA 4FT2A 3FEOA 5L8RE 1EIFA 2XDBA 2KDSA 3TCJA 2RI3A 3CCQT 3P8DA 2PVGB 2DKGA 3ASKA 3ZBDA 4A4EA 4TVRA 1NJIU 1U1TA 4C92C 1KQSA 5I2SA 1FX7A 2LTOA 4NOYA 4XTVA 1QVPA 2LQKA 3OW2A 3SB2A 1W2BA 5KCOA 2G3RA 2RI2A 5GAMh 3OSVA 2QTXA 3VV0A 4M7DF 1KD1U 1X6OA 2ZPIB 3LX7A 5J3BA 4E7IA 2VYTA 3QJYA 4C92G 2EKOA 2QQSA 4C92E 1BI0A 3X28B 1QVGS 2F5TX 3LYIA 1HXDA 4C92B 4HT9A 4UC4A 1H3ZA 5DY9A 5I2MA 4X9CA 2D0QB 2I2LA 3C12A 1G3YA 2BKDN 3NTHA 3QZ5B 2RJCA 3S3OA 4R55A 3MP6A 3E19A 4MZTA 5EG2A 2E5QA 3VYHB 3GOXA 3C94A 1WGSA 4R56A 1VQ4A 3L1AA 4M7DE 5GMKl 4OP0A 3MO8A 1D3BB 2LT1A 4NS5A 3JCMb 1BI1A 5LJ3j 4L6V5 1OYXA 1GXIE 5GANg 3QXEB 2R5MA 3JCMW 1VQ8T 4HKEA 2CS7A 4QW2A 2GCXA 3GIBA 3VU3C 2CZ1B 3JSCA 1N8RU 3OSSC 1OI1A 3MCAB 3URGA 3INZA 1M5Q1 5I21A 1N9SA 2FL7A 3OYIA 3CCSA 3JB9F 2P4TA 1HK9A 4OVAA 4N4GA 3M58A 3OYHA 3A8OB 3MHXA 4A4FA 2A7YA 5LJ5j 1N9RA 3OS1A 1VQLT 2RD1A 1XTDA 4LDXA 4XU1A 4FIBA 3M57A 1BI2A 2ZZDA 3TU4K 1RI0A 1FWZA 3FB9A 1S72T 1VQOA 4A4KA 2QQBA 5GAOl 1K73C 1QVFS 2MWOA 3I56A 2DZ9A 4X34A 3PFSA 5DLQE 4ZN1A 2ZPFB 4J7FA 3OS2A 2FVUA 5CVIA 4C5IA 4JS5A 3BDUA 4C8QF 3V8JA 3JB9H 3OMCA 4M78A 5J26A 3V7RA 2EFIA 1KQ1A 2YLCA 3VUBA 1UEBA 1Q86C 4PNOA 3MEUA 1RL2A 5FU6C 3OYMA 4A4HA 4B9XA 2PUOB 3OA6A 2K3YA 2DXCA 1O9SA 1QP2A 1NZ9A 1KHIA 1XQHA 3NTKA 4LDYA 1X01A 3BDLA 2CZ6B 2LDMA 3RKYA 4BY6C 4A53A 3CCQA 1VQPT 1NJIC 4JLGA 3MEVA 3OYJA 2RI5A 3Q1JA 4ELYC 1K9MU 1M1GA 5GAMj 4C8QG 5M9OA 1UGSB 2QEXT 2HAXA 4C8QE 2RK1A 1KD1C 3UT1A 4C8QB 3HRSA 2XU8A 3BFMA 3VYGA 2DAQA 4BDYA 3HRUA 2E41A 2LX9A 4MMLA 3JCMh 4BDZA 1VQ7T 4XQ3A 4E7JA 4M75D 2YHTA 2BUDA 2X35A 4GLKA 2F5KA 2EJGA 5LJ5h 3OYDA 3I55T 1M8VA 4ZTFA 2HQEA 3GNGA 4XTUA 3QIIA 1Y7XA 3H8ZA 4F7UF 4CI0C 2ZCFB 2LRQA 4BI3A 4NL3A 4EMKC 3PT9A 4LD6A 3S3MA 2XDPA 3E1SA 4XK8E 4J8OA 2A3LA 2QXFA 3CPWS 3LLRA 2XI9A 4A54A 3CCRT 4M77D 4HCBA 1PSFA 2VXEA 3QSUA 4XTYA 3OYYA 2F69A 3UPUA 2LNVA 3OYKA 2E10A 3E9FA 1WJRA 3M4GA 4LDVA 4MDWA 3DB4A 4XU2A 5GMKh 4PLLA 1Y96A 3SWNA 1VQ8A 4V2SA 4KUDK 2R5AA 2EYQA 3CBMA 3LW5E 4EMKA 3OB9A 4F7UG 5CQXA 1VIEA 2O4XB 2R57A 4O6JA 4F7UE 5CK9A 5CKFA 4J6WA 2DEQA 2LQ8A 4F7UB 2PUKB 2QQRA 1M1FA 1N6AA 3JCMP 2OTLT 3PIOA 2RJFA 1VQ6T 1VQLA 3G4ST 1FXXA 2Y90A 1BKBA 2JNGA 2M16A 3RKWA 4CRIA 3AHUA 1Q82U 3L2RA 2RB6A 4ATOA 5IN1A 3CBPA 4PL6A 2QQAA 4QQ6A 4PJOA 1W2BS 4A4GA 5DM7R 5GAOq 1BI3A 3TREA 3CCJT 1S72A 2XK0A 2WACA 4GY5A 4XTZA 3HSBA 3SFMA 4C0FA 1U8RA 3CEYA 3HFOA 4JDSA 2RJDA 3HP9A 3M55A 4FT4A 4KBMB 2MAMA 4MZMA 1LJOA 5GMKi 5GANh 4XU0A 3X26B 1G3WA 2RA2A 2RM4A 5HK0A 1WQWA 3C4SA 3OYBA 1OZ2A 3TEEA 5HKCA 4E7LA 3RESA 4ELZC 2HQXA 3CMET 4HCZA 2XDDA 1B34A 3GP8A 2DXUA 3R6OA 4PKCC 4M7AA 5KCHA 4JUVA 2PVOB 4X9DA 3CXCA 3FJPA 2EAYA 2EQJA 2P0QA 4E47A 2XD0A 1MGQA 3FC3A 2V8IA 1DJ7B 1K9MC 4ZGJB 1SSFA 2MI6A 2RHIA 2PU9B 4PJOD 2IG0A 3VUZA 1AHJB 2BIVA 1O75A 2QEXA 3A8LB 4JJNK 5FROA 5LJ3f 4C0ZA 5J39A 4II1A 4E7KA 4FSXA 5KE2A 2QA4T 1G3SA 3V8LA 4LD9K 4M78F 1N27A 3CPFA 1VQ7A 1VQNT 5IT9E 3OMGA 3G71T 1YBYA 4PLIA 1M1KU 1JRIA 3QKJA 3I55A 5CAIA 2DIQA 2AHJB 4BI8B 4M7AD 3GF5A 2ZPGB 4QVCA 5CO7A 3HKSA 3CD6T 4ME7A 2V8JA 4M78C 3O8VA 1K8AU 4M7DA 1KG1A 1D3BA 1W4SA 5GAN3 3L42A 4C0GA 3G6ET 3J80E 5LJ3d 1V29B 1WJSA 3CCRA 1VQKT 2WSFE 2Y4XA 3CCET 4KUIA 4M78G 4BE1A 4FU6A 4M77C 5GMKj 3V8KA 4RKUE 3OYFA 4M75A 4M78E 4C0DC 3OS5A 3ER0A 4M77A 3EFSA 3JCMX 4M78B 3L2VA 4ZN3A 3C95A 5CKEA 4C92D 2QQ9A 3ME9A 2CZ7B 1NPRA 2DPPB 5CCAA 1YI2T 2EQKA 3RMSA 2H3JA 2HNIA 2OTLA 1VQ6A 2FB7A 5A0GA 2O01E 4C0DB 3G4SA 1QVFA 2KSSA 4MZPA 3UDCA 1Q82C 3CCMT 5LJ3e 3DLMA 1R8OB 3QUIA 1BIAA 3OYCA 3ZEHA 4D6WA 3JCMQ 3L2UA 4M7DD 2PVDB 3N5BB 1VQMT 3V7CA 3GPLA 1U1SA 4OB0B 5FU6B 3CCJA 2KY9A 2JN0A 1KHCA 4OGCA 5C6SA 1TH7A 3DB3A 5GAMf 5GANj 3A8GB 4J7IA 4C5EA 4C5GA 2OAUA 2LC4A 1VIFA 2DXBA 3QO3A 4BY6B 4WF2A 3CCVT 3OYLA 4EDUA 3QJ6A 4BE2A 3E9GA 5AYFA 2DIGA 2VGMA 2DD5A 2X4WA 4OF1A 5FU7C 1YHQT 2WSEE 3EAEA 4L59A 1VQ5T 3FIFA 3SWNC 3CMEA 1X75C 2M1HA 2RHZA 1UGPB 1M90U 1XNIA 2JTMA 4BACA 3PMTA 1JJ2A 1WPYA 1BIBA 2PQWA 3OBWA 3V7SA 3X25B 4NL2A 4OB3B 1G5VA 3DLLA 5FU7B 3KBGA 1Y96B 2RHYA 2OTJT 4C8QA 5GAN5 3CCUT 4Y91A 4EMKB 5GAN7 2CGHA 3P8BB 3FRNA 1N8RC 1Y07A 3FLGA 4PJOC 3L2WA 4OGEA 3JB9D 4ZTJA 2DTOA 4N0AA 2D9TA 4EPCA 2LCLA 2V8KA 3QDRB 2QA4A 2E12A 3HFNA 4RCCA 2KQWA 3M5AA 2EQUA 1VQNA 3OYEA 3J81E 5LJ3g 3G71A 1YJNT 4PJOG 4BE0A 3CC2T 2GF7A 3QPHA 3QYHB 1WQ7A 3CPWA 1M1KC 2Y4YA 3WVEB 4J83A 4N4HA 2VXFA 2EJFA 1UGRB 5CKHA 2M0OA 5GAMe 3G6EA 4PJOB 1KQSS 5GMKm 3L2ZA 3S6WA 1YJWT 3CD6A 3OW2S 1K8AC 3HL8A 4M7AC 2ZPHB 3EFRA 3WVDB 3CCLT 4LDWA 4QVZA 2E6NA 5A2QE 1YIJT 4J6XA 3CC7T 3QBYA 5DLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BIV A;  3LGF A;  3PMI A;  5FRO A;  4C5I A;  2LVM A;  5J39 A;  5C0M A;  2R58 A;  4II1 A;  3M9Q A;  4E7K A;  3OMC A;  5KE2 A;  2O4X A;  2L8D A;  5J26 A;  2RHU A;  2X4X A;  2EFI A;  5D6X A;  1N27 A;  3OS0 A;  3OMG A;  3MEU A;  4FL6 A;  3OYM A;  4A4H A;  4PLI A;  3QKJ A;  4B9X A;  1MHN A;  2DIQ A;  4Q5W A;  4B9W A;  3OA6 A;  2K3Y A;  3NTK A;  2RO0 A;  3BDL A;  2LDM A;  2X4Y A;  3O8V A;  3OYJ A;  3MEV A;  2RI5 A;  3Q1J A;  3L42 A;  5FRN A;  2L3R A;  2MWP A;  5M9O A;  1WJS A;  3UT1 A;  3FDR A;  3L2Q A;  5D6W A;  4BE1 A;  4FU6 A;  2NLU A;  4IUP A;  3OYA A;  3OYF A;  2DAQ A;  4BDY A;  3MEA A;  2GFU A;  4BDZ A;  3NTI A;  3L2V A;  4E7J A;  3MET A;  4Z02 A;  2BUD A;  2X35 A;  5IAY A;  2F5K A;  4N4I A;  3OYD A;  3ME9 A;  4IKF A;  3SD4 A;  3OYN A;  4ZTF A;  2EQK A;  2K3X A;  3FEO A;  2HQE A;  5KE3 A;  3QII A;  4E7H A;  3H8Z A;  2RI3 A;  2LRQ A;  3P8D A;  3ASK A;  4IUR A;  4A4E A;  4LD6 A;  3S3M A;  2XDP A;  2LTO A;  4IUQ A;  4QQG A;  5KCO A;  2G3R A;  2RI2 A;  3DLM A;  3LLR A;  3OYC A;  3ZEH A;  3LX7 A;  3L2U A;  3F70 A;  1WJQ A;  3OYK A;  2VYT A;  4E7I A;  2EKO A;  3E9F A;  1WJR A;  2QQS A;  3DB4 A;  4PLL A;  2RHX A;  1KHC A;  5C6S A;  3LYI A;  3DB3 A;  2R5A A;  3P8H A;  4UC4 A;  1H3Z A;  3OB9 A;  3UWN A;  3MEW A;  4C5E A;  4C5G A;  3OS2 A;  2O4X B;  2BKD N;  2CKK A;  2R57 A;  3NTH A;  5CIU A;  4EDU A;  2RJC A;  3QJ6 A;  3OYL A;  4BE2 A;  2QQR A;  3E9G A;  2DIG A;  2X4W A;  3S3O A;  2RJF A;  2GFA A;  3MP6 A;  4L59 A;  3EAE A;  4CRI A;  2M16 A;  1OZ3 A;  2E5Q A;  3GOX A;  2RHZ A;  2M1H A;  1WGS A;  1XNI A;  4BAC A;  2B8A A;  2JZ2 A;  3L2R A;  2EQM A;  3H6Z A;  3PMT A;  4IUV A;  5D6Y A;  5IN1 A;  2PQW A;  2RJE A;  4IUT A;  4PL6 A;  3MO8 A;  4QQ6 A;  4C5H A;  3MP8 A;  4NS5 A;  3LH0 A;  4A4G A;  1OYX A;  1G5V A;  2R5M A;  2XK0 A;  2WAC A;  4GY5 A;  4QW2 A;  3CEY A;  2RHY A;  2RJD A;  2FHD A;  2YRV A;  1OI1 A;  3OYI A;  2L89 A;  3C4S A;  3OYB A;  1OZ2 A;  3FLG A;  4OVA A;  3L2W A;  4N4G A;  4ZTJ A;  3OYH A;  3OS1 A;  4A4F A;  4E7L A;  4RG2 A;  2D9T A;  4BD3 A;  3PNW C;  2HQX A;  3OQ5 A;  4HCZ A;  4QQD A;  5KCH A;  3S3N A;  3MP1 A;  2EQU A;  3OYE A;  3KUF A;  5KH6 A;  4BE0 A;  2GF7 A;  2EQJ A;  1RI0 A;  4N4H A;  3FC3 A;  2P0K A;  2M0O A;  2LCC A;  3S6W A;  3OY9 A;  2MWO A;  3OYG A;  1SSF A;  4IUU A;  4X34 A;  3LGL A;  3PFS A;  4QVZ A;  2E6N A;  2RHI A;  3QBY A;  2IG0 A;  2JTF A;  5FRM A; 
#chains in the Genus database with same CATH topology
 1YIT T;  1PD0 A;  1WNL A;  2KEA A;  1VQP T;  4M7A G;  4KGX B;  2O4X A;  5KYX A;  5GJW B;  1YNZ A;  4M7A B;  3OS0 A;  2DD4 A;  1PG5 B;  4ZGD B;  4JRQ A;  2ESW A;  1UUE A;  1JXO A;  5GAO r;  1HSQ A;  2K4Y A;  2DER A;  2DXT A;  1ZQ1 A;  1YI2 Q;  1QVG A;  2CP7 A;  4JRK A;  3OYA A;  2XIC A;  4FW1 A;  1Q81 U;  4M7D C;  5HK3 A;  2FYK A;  3NTI A;  3CCM Q;  1H64 1;  4EMG A;  1I8F A;  4IKF A;  4XU3 A;  2EGA A;  1JJ2 P;  2K3X A;  3UA6 A;  5CQY A;  4J6Y A;  3X20 B;  5GJV B;  2ABL A;  3QG1 A;  2E3H A;  2IVW A;  4IUQ A;  4QQG A;  4RTU A;  3CCV Q;  2A36 A;  2RQV A;  1GBR A;  2KBT A;  3M59 A;  3TSZ A;  2RHX A;  3EG9 A;  4QKU A;  2KE9 A;  1PCX A;  4J5Y A;  2GFA A;  4OMF B;  4M77 G;  1C6V X;  2OTJ Q;  1PC0 A;  4ZGE B;  1OZ3 A;  2PZ1 A;  4M77 B;  3QZ9 B;  4RTT A;  2EQM A;  3H6Z A;  1YJN A;  3ZFJ A;  3MP8 A;  1UTI A;  4FW2 A;  2DL3 A;  1Q95 G;  1BYM A;  2G6F X;  1YFN A;  3CCL A;  2JXB A;  3PIP A;  2KVQ G;  3JCM e;  4MDX A;  1K0X A;  5LJ5 e;  1NEG A;  1TWB A;  1KIK A;  3VS7 A;  2EWN A;  4C8Q C;  5GAO n;  2ENM A;  1PRL C;  3CC7 Q;  5HY6 A;  1VQ9 A;  2FG0 A;  5KH6 A;  4PFZ A;  1YIT Q;  4DOW A;  3UAT A;  3H41 A;  3M53 A;  1PD1 A;  2P0K A;  2LCC A;  4YTL A;  1JJ2 S;  4EMH A;  5GMK e;  2K2M A;  1AWJ A;  2JTF A;  2YLB A;  1G83 A;  4AG2 C;  3I9Q A;  2LVM A;  2O9V A;  2R58 A;  3H0I A;  2CP5 A;  4HVW A;  2W0Z A;  2RK2 A;  2OJ2 A;  2X4J A;  2YRC A;  4PJJ A;  5GAN 8;  3A5Z B;  2X51 A;  1D0Y A;  2J7I A;  2QI2 A;  2HKQ B;  4FM4 B;  3I56 T;  1G2B A;  2V26 A;  1W1F A;  2L3R A;  2K57 A;  2YUO A;  5D6W A;  1M4Z A;  2QYZ A;  2DTH A;  3ZL7 C;  1OX8 A;  1RAD B;  1EZZ B;  3MET A;  2D8J A;  4Z02 A;  4M7A E;  1EIF A;  2XDB A;  3TCJ A;  3ASK A;  1VYU A;  1KQS A;  1FX7 A;  4NOY A;  5KCO A;  2DA9 A;  5J3B A;  4FYX B;  4C92 G;  1SRM A;  2DYI A;  4C92 B;  2ROL A;  4HT9 A;  2XMF A;  2Z0W A;  1D09 B;  2I2L A;  2BKD N;  2QAS A;  4DBH A;  2RJC A;  3TQ7 P;  4R55 A;  2YUN A;  2CP3 A;  3GOX A;  1R0B G;  2RQR A;  3EGU A;  5GMK l;  4OP0 A;  3MO8 A;  1D3B B;  3SHW A;  1D1C A;  2CS7 A;  4HKE A;  1QQJ A;  3MCA B;  3URG A;  3INZ A;  4GBQ A;  3M58 A;  1N9R A;  1XTD A;  3VS2 A;  9ATC B;  1NJI R;  1RI0 A;  1OX9 A;  1QVF S;  2QQB A;  1RAG B;  2MWO A;  2DZ9 A;  4X34 A;  3OS2 A;  2MIO A;  3V8J A;  1WXB A;  3JB9 H;  1M30 A;  3I56 Q;  3V7R A;  2EFI A;  1ABO A;  1KQ1 A;  3VUB A;  3OW2 P;  4RTY A;  4OMP A;  2PUO B;  2YUQ A;  4M77 A;  1KHI A;  1XQH A;  2CZ6 B;  1NJI C;  1YP5 A;  1K9M U;  4ELY C;  4LUE A;  4JPB W;  3VS3 A;  5M9O A;  3HRS A;  2XU8 A;  1RLP C;  3BFM A;  2DAQ A;  2LX9 A;  1PKT A;  4BDZ A;  1KFZ A;  2BUD A;  2KXD A;  2EJG A;  3THK A;  2F2X A;  4F7U F;  2KYM A;  2ZCF B;  4NL3 A;  3EFO B;  2J6K A;  2QXF A;  4A54 A;  2YDL A;  2VXE A;  3QSU A;  1SPK A;  3OYY A;  3UPU A;  1WJR A;  4PLL A;  4KUD K;  2R5A A;  5CK9 A;  4J6W A;  1RAB B;  4PFO A;  2OTL T;  2MOX A;  3PIO A;  2Y90 A;  2DL5 A;  1Q82 U;  2AKL A;  4J9I A;  4KH1 B;  5KYY B;  2NUP A;  5GAO q;  4XTZ A;  1WLP B;  1UE9 A;  4MZM A;  5KYW B;  1G3W A;  1HD3 A;  4ELZ C;  2M51 A;  4HCZ A;  3EG3 A;  3R6O A;  1JO8 A;  1K1Z A;  1IGU A;  4X9D A;  1VYT A;  2EQJ A;  2KGT A;  1RAI B;  1CKA A;  2RHI A;  4DBR A;  2IG0 A;  1T0J A;  2BIV A;  1O75 A;  2KRM A;  2QEX A;  3REB B;  5FRO A;  5J39 A;  2AZV A;  2QA4 T;  1G3S A;  2OX7 A;  2PTK A;  4M78 F;  4LD9 K;  3CPF A;  5KYN A;  5IT9 E;  1YBY A;  5FWB A;  1ZBJ A;  2EW3 A;  4M7A D;  4QVC A;  1UEC A;  3CD6 T;  2HDA A;  1K8A U;  2COW A;  1D3B A;  4RTZ A;  4F17 A;  1WJS A;  3CCE T;  1OPL A;  1RUW A;  4FU6 A;  5GMK j;  4RKU E;  3EG1 A;  3EFS A;  3L2V A;  2NUT A;  1NPR A;  2DPP B;  2IIM A;  2FB7 A;  5A0G A;  2O01 E;  3UDC A;  1FMK A;  2BZY A;  3REA B;  2OTL Q;  1OQK A;  3ZEH A;  3L2U A;  3V7C A;  1YJN Q;  3CCJ A;  2HSE B;  2QAZ A;  4C5G A;  1VIF A;  4BY6 B;  2FZK B;  3KFV A;  4FCY A;  1MV3 A;  3EGX B;  3E9G A;  2X4W A;  2DD5 A;  2HCK A;  3UA7 A;  1AZG B;  1BB9 A;  3FIF A;  3CME A;  1UGP B;  2A28 A;  4BAC A;  1JJ2 A;  1BIB A;  3X25 B;  1ZSZ B;  1G5V A;  3DLL A;  2H3E B;  1Y96 B;  3M0T A;  4KGV B;  4Y91 A;  4EMK B;  1WHG A;  1Y0M A;  3P8B B;  1N8R C;  3L2W A;  4ZTJ A;  4EPC A;  1Z9Z A;  2AKK A;  2EQU A;  5LJ3 g;  1M2V A;  2EBP A;  3G71 A;  4PJO G;  3QPH A;  3QYH B;  2Y4Y A;  1J3T A;  2O9S A;  1UGR B;  4PJO B;  2QA4 Q;  1KQS S;  2ED0 A;  3L2Z A;  3M0Q A;  2ZPH B;  4JRP A;  2QDY B;  1NBE B;  1CSK A;  4JS4 A;  3CD6 Q;  3QYG B;  5L23 A;  1X6G A;  4RMO A;  2L8D A;  1I4K 1;  1QKW A;  1ZA2 B;  3G7Z A;  3CCE Q;  5GAN 6;  4LXC A;  2D6F A;  3QDF A;  1KC8 U;  1GCQ A;  5GAO m;  2DK3 A;  1M27 C;  2SEM A;  1VQM A;  3MEA A;  2K5I A;  2XID A;  4OB2 B;  3SD4 A;  1YJ9 T;  4M7D G;  2B86 A;  1VQ5 A;  5GAM g;  3H9N A;  4IUR A;  4M75 C;  4BUG A;  4M7D B;  2JVV A;  4CC2 A;  4M77 F;  1K0S A;  1P92 A;  2VB6 A;  3CC4 T;  3F70 A;  1WJQ A;  4M75 E;  2VC8 A;  2KK4 A;  4DBF A;  2ZPE B;  3P8H A;  4DBQ A;  1TUD A;  3CCU A;  1I81 A;  4HXJ A;  2K6D A;  3CPW P;  1IHV A;  1FYN A;  1IGQ A;  1ZUU A;  1LCK A;  1W70 A;  4IUV A;  5D6Y A;  2EIF A;  2RJE A;  5ECA A;  3CC2 A;  1JB0 E;  3JRZ A;  2YWW A;  4XTW A;  4LDU A;  1LOJ A;  3BY7 A;  2KRN A;  1M8M A;  1VUB A;  2HL5 C;  1YJW A;  4RTV A;  2LQN A;  3J7A F;  3MJX A;  4BI4 A;  1Q81 R;  4RG2 A;  3OQ5 A;  2A08 A;  4QQD A;  5GAN f;  2KT8 A;  1Y71 A;  1RAF B;  3RDV A;  2JM9 A;  4JJB A;  3EH1 A;  5LJ3 h;  1NPP A;  4N0A C;  4JRI A;  3OY9 A;  2QGG A;  1KJW A;  3OYG A;  3JAM E;  2MF2 A;  5GAM d;  1XOV A;  1ZX6 A;  2L5Q A;  2LJ0 A;  3HPW A;  5LL6 S;  3IQL A;  3PE0 A;  3HHT B;  5FLX E;  3RKX A;  2ZPB B;  3T9N A;  5GAN d;  1Q81 C;  4AMC A;  1V76 A;  3RUX A;  2YRD A;  2EGE A;  1QKX A;  2KMT A;  1NE8 A;  4DOV A;  1VQO T;  1PSE A;  1K73 U;  1MND A;  3JCM V;  2RO0 A;  4PJO E;  1MNE A;  1Y57 A;  2RH2 A;  1YJ9 Q;  2CYZ B;  4XTX A;  2L3S A;  3L2Q A;  3CMA A;  3CQT A;  6AT1 B;  4JJD A;  1ACM B;  2GFU A;  3E2U A;  4C92 F;  5IAY A;  5IHK A;  1KQ2 A;  2EYW A;  1N5Z A;  4F7U A;  3CC4 Q;  3FEO A;  5L8R E;  3EH2 A;  1AWO A;  3P8D A;  2DKG A;  1U1T A;  5I2S A;  2YSQ A;  4XTV A;  3OW2 A;  2DEU A;  5GAM h;  2AK5 A;  3VV0 A;  2COZ A;  1X6O A;  2ZPI B;  3LX7 A;  3QJY A;  2KYB A;  2KRS A;  1U06 A;  2QQS A;  3X28 B;  3LYI A;  1HXD A;  1UDL A;  2D0Q B;  3NTH A;  3MKD A;  1UG1 A;  3S3O A;  3MP6 A;  2X3W D;  5EG2 A;  2E5Q A;  2K3B A;  1VQ4 A;  3L1A A;  4M7D E;  2JMC A;  2FZG B;  2LT1 A;  2D1X A;  4NS5 A;  1BI1 A;  3UF4 A;  1GXI E;  2R5M A;  2GCX A;  2DYB A;  4Y92 A;  1OI1 A;  2ECZ A;  3VS1 A;  3CCS A;  4J9G A;  3JB9 F;  4D8D A;  1HK9 A;  1VQL T;  2A7Y A;  2RD1 A;  2D0N A;  4XU1 A;  2CUB A;  1D1B A;  2HQH A;  1QCN A;  4A4K A;  5GAO l;  2FPD A;  1WFW A;  4AFQ C;  1M3C A;  1V1C A;  2I0N A;  4HCK A;  5DLQ E;  1CKB A;  4J7F A;  1VQO Q;  5CVI A;  2F2W A;  4M78 A;  1NEB A;  3MEU A;  2LP5 A;  4B9X A;  1NLO C;  3OA6 A;  2K3Y A;  1QP2 A;  4LDY A;  1FMV A;  3CCQ A;  2J6F A;  3BDL A;  2J06 A;  2VKN A;  3Q1J A;  1M1G A;  4JZ3 A;  2KI7 A;  4DEY A;  2HAX A;  4C8Q E;  1HJD A;  4EIK A;  1EX4 A;  4F04 B;  2EYX A;  3HRU A;  2E41 A;  4MML A;  1VQ7 T;  4E7J A;  4M75 D;  3OYD A;  3I55 T;  1TUG B;  2HQE A;  4XTU A;  4CI0 C;  2EKH A;  1H8K A;  1WHM A;  2EVR A;  2L2P A;  2F2V A;  3LLR A;  4ORZ A;  3CME Q;  4HCB A;  3EGD B;  1R77 A;  2F69 A;  4MDW A;  4XU2 A;  1VQ8 A;  1OV3 A;  2JW4 A;  2M02 A;  2EYQ A;  3CBM A;  4Z89 A;  3OB9 A;  5CQX A;  2JJ9 A;  1PHT A;  1SG5 A;  5CKF A;  2QQR A;  3NPF A;  1AWX A;  1VQ6 T;  4OMQ A;  1BKB A;  3AHU A;  2CP0 A;  2L0A A;  2SRC A;  5IN1 A;  3CBP A;  1PNJ A;  1K9M R;  2CRE A;  1X6B A;  1VQL Q;  4A4G A;  1S72 A;  4LNP A;  2GGR A;  2DRM A;  3HP9 A;  4KBM B;  4FT4 A;  4KRT A;  4XU0 A;  2RA2 A;  3MPU B;  3TSW A;  1OZ2 A;  3TEE A;  3RES A;  4M7A A;  3H0F A;  1EFN A;  1WYX A;  2EAY A;  2O88 A;  2C0I A;  2XD0 A;  1MGQ A;  2JS2 A;  2V8I A;  1K9M C;  2AZS A;  1SSF A;  1W6X A;  4WTO B;  2PU9 B;  4PJO D;  2J6O A;  4FYY B;  3A8L B;  3M0S A;  4C0Z A;  4II1 A;  1QWF A;  1JXM A;  2QDL A;  1N27 A;  3D7S B;  1VQN T;  4CC3 A;  2DIQ A;  1Q82 R;  2CP6 A;  2LJ3 A;  2DMO A;  4ME7 A;  1VQ7 Q;  1ABQ A;  1KG1 A;  1W4S A;  2CP2 A;  5GAN 3;  4C0G A;  3G6E T;  3I55 Q;  3ULR B;  3CCR A;  2WSF E;  2HKN A;  4KUI A;  4BE1 A;  4M77 C;  1H92 A;  3OYF A;  2GTJ A;  1TS9 A;  1QLY A;  2C0O A;  2H3J A;  2HEQ A;  3G4S A;  1Q82 C;  1UGV A;  5LJ3 e;  2LMJ A;  3JCM Q;  1VQ6 Q;  4M7D D;  2PVD B;  2VWF A;  3GPL A;  4OB0 B;  5FU6 B;  2KY9 A;  2JN0 A;  1KHC A;  2AT1 B;  1TH7 A;  3I5S A;  4FYW B;  5I11 A;  2DXB A;  3QO3 A;  3CXC P;  4WF2 A;  3QJ6 A;  5AYF A;  2DIG A;  5FU7 C;  4L59 A;  3EAE A;  3HTR A;  1X75 C;  1WX6 A;  1M90 U;  1I07 A;  1WPY A;  4AFS C;  1K8A R;  3V7S A;  7AT1 B;  1U5S A;  2BE7 D;  1X69 A;  3EG0 A;  3KBG A;  2K7A A;  5GAN 7;  3FLG A;  4OGE A;  3VRZ A;  2JS0 A;  2RQW A;  4AFZ C;  4RCC A;  3J81 E;  1YJN T;  3CPW A;  1WQ7 A;  1TU0 B;  4KGZ B;  2VXF A;  5GAM e;  3M0U A;  4DEX A;  2ATC B;  3OW2 S;  1K8A C;  3G1J A;  1VQN Q;  2CT3 A;  4CC7 A;  2P4R A;  3EFR A;  3CCL T;  4QVZ A;  2E6N A;  2VAS A;  2ZAE A;  4OMO A;  1VQK A;  2MK5 A;  4F16 A;  1JBM A;  5C0M A;  4DQ2 A;  4OB1 B;  3M9Q A;  4QT7 A;  4C8Q D;  3KXT A;  2LT4 A;  2RHU A;  3G6E Q;  1B34 B;  1RAE B;  1VQ9 T;  2V1Q A;  4J9H A;  1YI2 A;  5IXB A;  4Q5W A;  3LWI A;  1QW1 A;  3CXC S;  2VV5 A;  1RAH B;  3RMQ A;  2VUB A;  1WIE A;  1SEM A;  5FRN A;  3CCM A;  1OOT A;  2K5F A;  1LVK A;  1Q7Y U;  4IUP A;  1MUZ A;  4C92 A;  4RCB A;  3H0H A;  1ZHI A;  2BZX A;  2EJ9 A;  2GTO A;  3CCV A;  4E7H A;  5GAN 4;  3JCM f;  1YHQ A;  1QP3 A;  2JT4 A;  5A0D A;  5LJ5 f;  4HVV A;  4KT0 E;  1ZA1 B;  1BCM A;  4M75 G;  3JCM J;  1OU9 A;  2IPO B;  3M56 A;  1I5O B;  3M54 A;  4M75 B;  1ARK A;  2DE0 X;  2OTJ A;  1OU8 A;  1IRX A;  2NUZ A;  3I5R A;  2QK0 A;  3CBO A;  5IHI A;  2XG8 D;  4J9E A;  3JCM d;  1TXQ A;  1X27 A;  2P0P A;  2K2V A;  5EC7 A;  5LJ5 d;  3GBQ A;  3VS6 A;  2XHC A;  4Z8A A;  2E64 A;  3UWN A;  1SSH A;  1KC8 R;  3LH0 A;  3PVQ A;  2AIR B;  2FHD A;  5FW9 A;  1YIJ A;  4KUL A;  2KAF A;  2MCN A;  3LH5 A;  3CC7 A;  1YIT A;  3SDZ A;  5CR2 A;  3RR6 A;  1UGQ B;  1VQP A;  3GLX A;  2ZGW A;  3PNW C;  2K5L A;  2DM1 A;  4JZ4 A;  3CCL Q;  3S3N A;  3MP1 A;  3KUF A;  1M9S A;  2C06 A;  2JTE A;  1UB4 A;  3BW1 A;  3A8H B;  1KC8 C;  1SHG A;  1VQ9 Q;  4IUU A;  2GQI A;  3SWN B;  2E1H A;  2DJZ A;  4HVU A;  1PM3 A;  1YN8 A;  2JUF A;  3NFC A;  3TVT A;  2LZ6 B;  2XKO C;  1YCS B;  4M7A F;  4B9W A;  3EFO A;  1ZBX A;  4O5V A;  2JOY A;  4L5G A;  3RER A;  2MWP A;  1YWP A;  1OUL A;  3M4Y A;  3FDR A;  3NGP A;  8ATC B;  5KYX B;  1Z9Q A;  1Q86 U;  2GQV A;  1GCQ C;  2DRK A;  2E6Z A;  4FT2 A;  2KDS A;  3ZBD A;  4TVR A;  2LTO A;  1QVP A;  2LQK A;  3SB2 A;  2FPF A;  4E6R A;  5KYY A;  1TSF A;  1KD1 U;  2K9G A;  2F5T X;  4OML A;  4OMN A;  5KYW A;  4UC4 A;  1S72 Q;  1H3Z A;  4X9C A;  3VS0 A;  3A98 A;  1BBZ A;  1K73 R;  2FO0 A;  1XJW B;  5LJ3 j;  4L6V 5;  1SHF A;  5GAN g;  3JCM W;  4QW2 A;  3EG9 B;  3VU3 C;  4E7S A;  1N8R U;  2RQU A;  3OSS C;  5I21 A;  1M5Q 1;  2LJ1 A;  1N9S A;  2P4T A;  4OVA A;  3A8O B;  3MHX A;  3OS1 A;  2X3X D;  4LDX A;  3M57 A;  1BI2 A;  2ZZD A;  3TU4 K;  2DIL A;  1SF9 A;  1YWO A;  1K73 C;  1LPL A;  1WHK A;  1AOJ A;  3I56 A;  1IHW A;  4JJC A;  3PFS A;  4ZN1 A;  2FVU A;  1TG0 A;  4C5I A;  3NHN A;  4JS5 A;  2K79 A;  1B07 A;  5J26 A;  3RNJ A;  1MMN A;  1UEB A;  1W2B P;  4PNO A;  2DX1 A;  1I1J A;  2DXC A;  1RAA B;  3NTK A;  3RKY A;  1X01 A;  2LDM A;  4BY6 C;  4A53 A;  5GAM j;  2BTT A;  2FRY A;  4C8Q G;  2JMA A;  1MMD A;  2QEX T;  2RK1 A;  5AT1 B;  3UT1 A;  4C8Q B;  2DL4 A;  3VYG A;  4BDY A;  2CH4 W;  2YHT A;  4GLK A;  2X35 A;  1X2K A;  2F5K A;  1M8V A;  3VRY A;  3EGX A;  4ZTF A;  3GNG A;  3QII A;  4BI3 A;  4EMK C;  1M3B A;  2DVJ A;  4LD6 A;  4A63 B;  1WXT A;  2XDP A;  4J8O A;  2A3L A;  3CPW S;  1MMG A;  1ZSZ A;  2DL7 A;  2LNV A;  3OYK A;  1B7T A;  3E9F A;  4LDV A;  4V2S A;  1Y96 A;  3SWN A;  3LW5 E;  1K9A A;  4EMK A;  4ESR A;  4O6J A;  4F7U E;  1I0C A;  2LQ8 A;  2RJF A;  1RLQ C;  2DNU A;  3RKW A;  2JNG A;  4CRI A;  2KR3 A;  4R0K A;  5D7U A;  2E4H A;  2LCS A;  2RB6 A;  4PJM A;  4PJO A;  1W2B S;  1WHJ A;  1BI3 A;  3CCJ T;  2WAC A;  3HSB A;  4AG1 C;  4LE9 A;  3SFM A;  4C0F A;  3CEY A;  3HFO A;  4GLM A;  4JDS A;  2MAM A;  1LJO A;  5GAN h;  5HK0 A;  1H3H A;  3C4S A;  3OYB A;  5HKC A;  1QCO A;  3U23 A;  3CME T;  1VQK Q;  3GP8 A;  2DXU A;  4PKC C;  5KCH A;  3CXC A;  3FJP A;  2P0Q A;  4E47 A;  2VVK A;  2DBK A;  1DJ7 B;  1GFD A;  2MI6 A;  2L3Q A;  3VUZ A;  1AHJ B;  5KE2 A;  2A0F B;  3V8L A;  2QEX Q;  3G71 T;  1PRM C;  1M1K U;  2CUD A;  2AHJ B;  2ZPG B;  5CO7 A;  3HKS A;  2V8J A;  4M78 C;  3O8V A;  4M7D A;  1WXU A;  1C0M A;  1YHQ Q;  3J80 E;  1V29 B;  3M0R A;  1NYF A;  1E6H A;  2KT1 A;  3I35 A;  4C0D C;  4M78 E;  1D0X A;  3ER0 A;  3JCM X;  1WI7 A;  1UFF A;  5CKE A;  2QQ9 A;  3ME9 A;  2CZ7 B;  2EQK A;  1IO6 A;  3RMS A;  2OTL A;  3AT1 B;  2KSS A;  1WHH A;  2M0Y A;  3DLM A;  3QUI A;  4OMM A;  3OYC A;  1AD5 A;  5IHN A;  1VQM T;  3DB3 A;  3A8G B;  4J7I A;  1TOV A;  4C5E A;  2LC4 A;  2OAU A;  2J05 A;  4EDU A;  3OYL A;  3CCJ Q;  4X1V A;  1YIJ Q;  2VGM A;  1VQ5 T;  2WSE E;  3NMZ C;  1NG2 A;  1MV0 B;  2M1H A;  2RHZ A;  2DET A;  1VQP Q;  1XNI A;  2JTM A;  4IIO A;  2L3P A;  4LUD A;  2PQW A;  1S1N A;  4NL2 A;  4OB3 B;  5FU7 B;  2RHY A;  4C8Q A;  5GAN 5;  3CCU T;  1K4U S;  2CGH A;  8AT1 B;  4AT1 B;  2DTO A;  2LCL A;  2V8K A;  2QA4 A;  2DFU A;  2E12 A;  2YT6 A;  2KQW A;  4PK4 A;  2QGF B;  4BE0 A;  3CC2 T;  4N4H A;  4J83 A;  2EJF A;  2NUP B;  5CKH A;  2M0O A;  3S6W A;  1YJW T;  3CD6 A;  1PKS A;  3HL8 A;  4M7A C;  3G71 Q;  2PNI A;  5A2Q E;  4J6X A;  3QBY A;  5DLO A;  3LGF A;  3CCE A;  2E65 A;  4DA4 A;  3JCM P;  2LNH B;  1JU5 C;  1QVF P;  4BB7 A;  4HA8 A;  4RTX A;  4FL6 A;  2VGN A;  2HBP A;  4HT8 A;  1LNX A;  1M90 R;  2EYZ A;  1PWT A;  3FJ5 A;  3X24 B;  3LWH A;  2HMA A;  2D8H A;  2YXY A;  4J9B A;  1GBQ A;  3JCM c;  4QVD A;  3VKI A;  5GAN 2;  4FSS A;  4KH0 B;  4M75 F;  1GCP A;  2WSC E;  4PJN A;  1I5L A;  4P5N A;  4N4I A;  4VUB A;  3OYN A;  1VQM Q;  1QCF A;  2E70 A;  1IXD A;  1IB8 A;  2E5K A;  3GNF B;  4PFP A;  1M90 C;  2KNB B;  5A0L A;  1T3S A;  3O5Z A;  1VQ5 Q;  3CMA T;  1SRL A;  1C1A A;  2CZ0 B;  2NUT B;  1D1A A;  3MEW A;  1ZUY A;  2CKK A;  5CIU A;  3VS5 A;  2DTI A;  3JB9 J;  3CCU Q;  4M77 E;  1WZO A;  1WA7 A;  2B8A A;  2JZ2 A;  2O2O A;  4IUT A;  4IIM A;  4RUG A;  4C5H A;  3OBY A;  4E2F B;  2V1R A;  4JLI A;  3JB9 G;  4LN2 A;  2A37 A;  3RIR A;  5GAO p;  3VJP A;  1NLP C;  3EHR A;  2DZC A;  1Q7Y R;  2C0T A;  3CC2 Q;  2YRV A;  4Y28 E;  1G3T A;  5CKB A;  2L89 A;  2YUP A;  5KYU B;  1YJW Q;  4BD3 A;  5CKD A;  3HRT A;  3DKM A;  1VQ4 T;  2HD0 A;  4AFU C;  1OPK A;  2CT4 A;  3A8M B;  1QVG P;  3PTA A;  1BCO A;  2DO3 A;  1M3A A;  2MMP A;  3WXM B;  4PJO F;  3R6N A;  3LGL A;  3QHS A;  1BK2 A;  5KE3 A;  3CCS T;  2FZC B;  5FRM A;  3PMI A;  1QMC A;  4ZNX A;  2P84 A;  1Q7Y C;  1WDX A;  4XAX B;  2X4X A;  1YCY A;  5D6X A;  4M78 D;  1AT1 B;  4HCC A;  1M2V B;  1NYG A;  1GRI A;  1B3Q A;  1IRE B;  1IZ6 A;  1MHN A;  1VOM A;  2GNC A;  4MMK A;  1YJ9 A;  3JB9 I;  1K76 A;  2X4Y A;  4RG8 A;  3PGG A;  2M9U A;  3EGD A;  1T3L A;  3JCM g;  3C0C A;  4J9C A;  3CC4 A;  5GAN e;  2NLU A;  5LJ5 g;  2DVE A;  3EG2 A;  2EYY A;  3CMA Q;  2RI3 A;  3CCQ T;  2PVG B;  4A4E A;  1NJI U;  4C92 C;  2FPE A;  1W2B A;  3PVL A;  2G3R A;  2RI2 A;  2RN8 A;  3OSV A;  2QTX A;  4M7D F;  4FYV B;  4E7I A;  2VYT A;  2EKO A;  1AWW A;  4C92 E;  1BI0 A;  1QVG S;  1VA7 A;  5DY9 A;  5I2M A;  5IH2 A;  3C12 A;  1G3Y A;  1ZUK A;  3QZ5 B;  2ROT A;  3E19 A;  4MZT A;  2NYS A;  3VYH B;  4F14 A;  3C94 A;  1WGS A;  4R56 A;  1UHC A;  1G8X A;  3JCM b;  2OI3 A;  5I22 A;  1OYX A;  1T0H A;  3QXE B;  1KSW A;  1VQ8 T;  1OEB A;  2ED1 A;  1VQ4 Q;  2CZ1 B;  3JSC A;  2E3I A;  3OYI A;  2FL7 A;  1RI9 A;  2OAW A;  1Q86 R;  4N4G A;  3OYH A;  2MYS A;  4A4F A;  5LJ5 j;  2EPD A;  2BE9 B;  2BZ8 A;  4FIB A;  3CCS Q;  2DJQ A;  2RQT A;  1FWZ A;  3FB9 A;  1S72 T;  1VQO A;  2KXC A;  2O31 A;  3VS4 A;  5IXF A;  1KD1 R;  2H8H A;  1UJ0 A;  2ZPF B;  1GL5 A;  3BDU A;  4C8Q F;  3OMC A;  1JEG A;  1KQS P;  2YLC A;  2MPX C;  1Q86 C;  2RF0 A;  1RL2 A;  2CSI A;  5FU6 C;  4A4H A;  4CC4 B;  3OYM A;  1TTH B;  1O9S A;  1NZ9 A;  1JQQ A;  3GIB A;  4JLG A;  3MEV A;  3OYJ A;  2RI5 A;  1TUC A;  1UGS B;  1KD1 C;  3CCQ Q;  2DL8 A;  1N8R R;  2LX7 A;  3JCM h;  4XQ3 A;  5KYU A;  5LJ5 h;  2F1L A;  2RMO A;  1Y7X A;  3H8Z A;  2LRQ A;  3PT9 A;  2HZY A;  1FMW A;  3S3M A;  3E1S A;  4XK8 E;  1UJY A;  2XI9 A;  3CCR T;  4M77 D;  1PSF A;  4XTY A;  2EGC A;  2E10 A;  2GBQ A;  3M4G A;  3DB4 A;  5GMK h;  4RTW A;  4B6M A;  4F7U G;  1VIE A;  2O4X B;  2R57 A;  1M2O A;  1VYV A;  2DEQ A;  4F7U B;  2PUK B;  1M1F A;  1N6A A;  1VQ8 Q;  1VQL A;  1GFC A;  3G4S T;  1FXX A;  2M16 A;  2CSQ A;  3L2R A;  4ATO A;  4PL6 A;  1WHL A;  2QQA A;  4QQ6 A;  1AVZ C;  2QTV A;  5DM7 R;  3TRE A;  1ZLM A;  2XK0 A;  4GY5 A;  2DF6 A;  1F1B B;  1E6G A;  4D8K A;  1U8R A;  5GMK i;  2RJD A;  1UHF A;  3M55 A;  1ZSG A;  3X26 B;  2RM4 A;  1WQW A;  4E7L A;  3JV3 A;  2HQX A;  2XDD A;  1B34 A;  3RBB B;  4JUV A;  2PVO B;  2RPN A;  3QWX X;  1RAC B;  1NM7 A;  2COY A;  3FC3 A;  4ZGJ B;  4JJN K;  5LJ3 f;  3SEM A;  4E7K A;  4FSX A;  2HBW A;  4ANJ A;  1VQ7 A;  1X2Q A;  3OMG A;  1X43 A;  4PLI A;  1JRI A;  3QKJ A;  3I55 A;  5CAI A;  4BI8 B;  3GF5 A;  3M0P A;  1E7O A;  2HL3 A;  2KRO A;  3L42 A;  5LJ3 d;  1VQK T;  2Y4X A;  4M78 G;  4J9F A;  4PJL A;  2HSP A;  3V8K A;  5HCK A;  4M75 A;  3OS5 A;  4M78 B;  4ZN3 A;  3CCR Q;  2FEI A;  3C95 A;  4C92 D;  3BE3 A;  5CCA A;  1YI2 T;  2HNI A;  2NWM A;  1VQ6 A;  4C0D B;  1QVF A;  4MZP A;  1KK7 A;  2CDT A;  3CCM T;  1R8O B;  1BIA A;  4D6W A;  4K11 A;  3N5B B;  4E7Z A;  3G4S Q;  1U1S A;  2DBM A;  1SKU B;  4OGC A;  5C6S A;  5GAM f;  5GAN j;  1D0Z A;  4WCI A;  1ZSZ C;  3CCV T;  1A0N B;  4BE2 A;  4OF1 A;  1YHQ T;  1HYO A;  1M1K R;  4Z88 A;  3SWN C;  3EHQ A;  3PMT A;  5FWC A;  3OBW A;  1R0C B;  1AEY A;  4J9D A;  2FRW A;  2JM8 A;  4M4Z A;  2OTJ T;  1AZE A;  3FRN A;  1Y07 A;  4PJO C;  3JB9 D;  4N0A A;  2D9T A;  1U3O A;  2LQW A;  3QDR B;  3HFN A;  3M5A A;  1VQN A;  3OYE A;  2X9H A;  1QWE A;  3A1P A;  2GF7 A;  1MMA A;  1M1K C;  3WVE B;  2DLP A;  2RNA A;  1BU1 A;  3QWY A;  5GMK m;  2QG9 B;  2CH4 A;  2EQI A;  3WVD B;  1YIJ T;  4LDW A;  3G6E A;  3CC7 T;  2W10 A; 
#chains in the Genus database with same CATH homology
 4JRP A;  1YIT T;  3LGF A;  2QDY B;  1VQK A;  1JBM A;  1WNL A;  3CCE A;  2E65 A;  5C0M A;  3QYG B;  4DQ2 A;  4JS4 A;  4OB1 B;  3M9Q A;  4C8Q D;  4DA4 A;  3KXT A;  2O4X A;  4RMO A;  2L8D A;  2LT4 A;  2RHU A;  1I4K 1;  4BB7 A;  4M7A B;  1B34 B;  4HA8 A;  3OS0 A;  1VQ9 T;  2DD4 A;  4FL6 A;  3G7Z A;  4ZGD B;  2VGN A;  2HBP A;  4JRQ A;  1YI2 A;  1LNX A;  4Q5W A;  5GAN 6;  3LWI A;  4HT8 A;  1QW1 A;  2D6F A;  3CXC S;  2VV5 A;  3RMQ A;  1KC8 U;  3X24 B;  3LWH A;  5GAO r;  2VUB A;  2K4Y A;  5FRN A;  2DXT A;  3CCM A;  1ZQ1 A;  5GAO m;  1QVG A;  2K5F A;  2DK3 A;  1Q7Y U;  4JRK A;  4IUP A;  3OYA A;  1VQM A;  3JCM c;  2XIC A;  3VKI A;  4QVD A;  5GAN 2;  1Q81 U;  3MEA A;  2K5I A;  4C92 A;  4M7D C;  4M75 F;  5HK3 A;  2FYK A;  3NTI A;  1H64 1;  4EMG A;  4RCB A;  1I8F A;  2WSC E;  2XID A;  4OB2 B;  1I5L A;  4IKF A;  4P5N A;  4N4I A;  4XU3 A;  1ZHI A;  4VUB A;  2EJ9 A;  3SD4 A;  3OYN A;  1YJ9 T;  2K3X A;  3CCV A;  5CQY A;  4E7H A;  4M7D G;  5GAN 4;  2E70 A;  5GAM g;  1VQ5 A;  4J6Y A;  4IUR A;  4M75 C;  1QP3 A;  3JCM f;  3X20 B;  4BUG A;  3QG1 A;  1YHQ A;  2IVW A;  4M7D B;  2JVV A;  4IUQ A;  4QQG A;  3GNF B;  5A0D A;  5LJ5 f;  1M90 C;  4M77 F;  4KT0 E;  5A0L A;  1P92 A;  4M75 G;  3CC4 T;  3F70 A;  1WJQ A;  3JCM J;  3CMA T;  4M75 E;  3M59 A;  3M56 A;  3M54 A;  2VC8 A;  2RHX A;  4M75 B;  2KK4 A;  2ZPE B;  2CZ0 B;  3P8H A;  2OTJ A;  3CCU A;  3MEW A;  3CBO A;  2XG8 D;  1I81 A;  2CKK A;  5CIU A;  4J5Y A;  3JCM d;  2P0P A;  2DTI A;  2GFA A;  4OMF B;  4M77 G;  2K2V A;  5LJ5 d;  3JB9 J;  4ZGE B;  1OZ3 A;  4M77 E;  2XHC A;  4M77 B;  3QZ9 B;  2B8A A;  2E64 A;  2JZ2 A;  2EQM A;  3H6Z A;  3UWN A;  4IUV A;  5D6Y A;  2EIF A;  2RJE A;  4IUT A;  3ZFJ A;  1YJN A;  1JB0 E;  3CC2 A;  4C5H A;  3MP8 A;  3OBY A;  3LH0 A;  3JRZ A;  4JLI A;  4XTW A;  4LDU A;  3JB9 G;  3RIR A;  1LOJ A;  3BY7 A;  5GAO p;  1VUB A;  3VJP A;  1YJW A;  1BYM A;  2DZC A;  2FHD A;  1YIJ A;  3CCL A;  4KUL A;  2KAF A;  2YRV A;  3J7A F;  3CC7 A;  4Y28 E;  4BI4 A;  3PIP A;  1G3T A;  2KVQ G;  3JCM e;  5CKB A;  2L89 A;  1YIT A;  3SDZ A;  4MDX A;  5CR2 A;  5LJ5 e;  1VQP A;  1UGQ B;  4RG2 A;  3GLX A;  2ZGW A;  3PNW C;  2K5L A;  3OQ5 A;  3HRT A;  4BD3 A;  5CKD A;  4QQD A;  3DKM A;  5GAN f;  2HD0 A;  2EWN A;  1Y71 A;  4C8Q C;  3MP1 A;  5GAO n;  3S3N A;  1VQ4 T;  3KUF A;  5HY6 A;  1M9S A;  1VQ9 A;  5KH6 A;  3A8M B;  4DOW A;  3PTA A;  2C06 A;  1UB4 A;  3BW1 A;  3M53 A;  2P0K A;  3A8H B;  2LCC A;  4YTL A;  1NPP A;  4N0A C;  2DO3 A;  5LJ3 h;  4JRI A;  3OY9 A;  1JJ2 S;  2MMP A;  1KC8 C;  3WXM B;  3OYG A;  4EMH A;  3JAM E;  4IUU A;  4PJO F;  2MF2 A;  3LGL A;  3QHS A;  1XOV A;  5GAM d;  5KE3 A;  5GMK e;  2JTF A;  2YLB A;  2L5Q A;  3CCS T;  3SWN B;  3HPW A;  5FRM A;  3PMI A;  2LVM A;  5LL6 S;  2E1H A;  1Q7Y C;  2DJZ A;  2R58 A;  3HHT B;  4XAX B;  3RKX A;  2ZPB B;  3T9N A;  5FLX E;  5GAN d;  1Q81 C;  2X4X A;  3RUX A;  1YCY A;  5D6X A;  2JUF A;  3NFC A;  2KMT A;  4M78 D;  1NE8 A;  2RK2 A;  4HCC A;  2XKO C;  4DOV A;  1IZ6 A;  1IRE B;  1MHN A;  4M7A F;  4MMK A;  2X4J A;  1YJ9 A;  4B9W A;  1VQO T;  1PSE A;  1K73 U;  3JB9 I;  1ZBX A;  4O5V A;  2RO0 A;  3A5Z B;  4FM4 B;  2QI2 A;  3JCM V;  5GAN 8;  2X4Y A;  2RH2 A;  4RG8 A;  3I56 T;  4PJO E;  2JOY A;  4L5G A;  4M7A G;  3RER A;  3PGG A;  2M9U A;  2L3R A;  2MWP A;  2CYZ B;  2K57 A;  4XTX A;  3JCM g;  3M4Y A;  3FDR A;  3L2Q A;  5D6W A;  3CC4 A;  5GAN e;  3CMA A;  2NLU A;  1M4Z A;  5LJ5 g;  2DTH A;  2DVE A;  2GFU A;  4C92 F;  1Q86 U;  2GQV A;  3MET A;  4Z02 A;  4M7A E;  5IAY A;  2E6Z A;  1KQ2 A;  4F7U A;  4FT2 A;  3FEO A;  5L8R E;  1EIF A;  2XDB A;  2KDS A;  3TCJ A;  2RI3 A;  3CCQ T;  3P8D A;  2PVG B;  2DKG A;  3ASK A;  3ZBD A;  4A4E A;  4TVR A;  1NJI U;  1U1T A;  4C92 C;  1KQS A;  5I2S A;  1FX7 A;  2LTO A;  4NOY A;  4XTV A;  1QVP A;  2LQK A;  3OW2 A;  3SB2 A;  1W2B A;  5KCO A;  2G3R A;  2RI2 A;  5GAM h;  3OSV A;  2QTX A;  3VV0 A;  4M7D F;  1KD1 U;  1X6O A;  2ZPI B;  3LX7 A;  5J3B A;  4E7I A;  2VYT A;  3QJY A;  4C92 G;  2EKO A;  2QQS A;  4C92 E;  1BI0 A;  3X28 B;  1QVG S;  2F5T X;  3LYI A;  1HXD A;  4C92 B;  4HT9 A;  4UC4 A;  1H3Z A;  5DY9 A;  5I2M A;  4X9C A;  2D0Q B;  2I2L A;  3C12 A;  1G3Y A;  2BKD N;  3NTH A;  3QZ5 B;  2RJC A;  3S3O A;  4R55 A;  3MP6 A;  3E19 A;  4MZT A;  5EG2 A;  2E5Q A;  3VYH B;  3GOX A;  3C94 A;  1WGS A;  4R56 A;  1VQ4 A;  3L1A A;  4M7D E;  5GMK l;  4OP0 A;  3MO8 A;  1D3B B;  2LT1 A;  4NS5 A;  3JCM b;  1BI1 A;  5LJ3 j;  4L6V 5;  1OYX A;  1GXI E;  5GAN g;  3QXE B;  2R5M A;  3JCM W;  1VQ8 T;  4HKE A;  2CS7 A;  4QW2 A;  2GCX A;  3GIB A;  3VU3 C;  2CZ1 B;  3JSC A;  1N8R U;  3OSS C;  1OI1 A;  3MCA B;  3URG A;  3INZ A;  1M5Q 1;  5I21 A;  1N9S A;  2FL7 A;  3OYI A;  3CCS A;  3JB9 F;  2P4T A;  1HK9 A;  4OVA A;  4N4G A;  3M58 A;  3OYH A;  3A8O B;  3MHX A;  4A4F A;  2A7Y A;  5LJ5 j;  1N9R A;  3OS1 A;  1VQL T;  2RD1 A;  1XTD A;  4LDX A;  4XU1 A;  4FIB A;  3M57 A;  1BI2 A;  2ZZD A;  3TU4 K;  1RI0 A;  1FWZ A;  3FB9 A;  1S72 T;  1VQO A;  4A4K A;  2QQB A;  5GAO l;  1K73 C;  1QVF S;  2MWO A;  3I56 A;  2DZ9 A;  4X34 A;  3PFS A;  5DLQ E;  4ZN1 A;  2ZPF B;  4J7F A;  3OS2 A;  2FVU A;  5CVI A;  4C5I A;  4JS5 A;  3BDU A;  4C8Q F;  3V8J A;  3JB9 H;  3OMC A;  4M78 A;  5J26 A;  3V7R A;  2EFI A;  1KQ1 A;  2YLC A;  3VUB A;  1UEB A;  1Q86 C;  4PNO A;  3MEU A;  1RL2 A;  5FU6 C;  3OYM A;  4A4H A;  4B9X A;  2PUO B;  3OA6 A;  2K3Y A;  2DXC A;  1O9S A;  1QP2 A;  1NZ9 A;  1KHI A;  1XQH A;  3NTK A;  4LDY A;  1X01 A;  3BDL A;  2CZ6 B;  2LDM A;  3RKY A;  4BY6 C;  4A53 A;  3CCQ A;  1VQP T;  1NJI C;  4JLG A;  3MEV A;  3OYJ A;  2RI5 A;  3Q1J A;  4ELY C;  1K9M U;  1M1G A;  5GAM j;  4C8Q G;  5M9O A;  1UGS B;  2QEX T;  2HAX A;  4C8Q E;  2RK1 A;  1KD1 C;  3UT1 A;  4C8Q B;  3HRS A;  2XU8 A;  3BFM A;  3VYG A;  2DAQ A;  4BDY A;  3HRU A;  2E41 A;  2LX9 A;  4MML A;  3JCM h;  4BDZ A;  1VQ7 T;  4XQ3 A;  4E7J A;  4M75 D;  2YHT A;  2BUD A;  2X35 A;  4GLK A;  2F5K A;  2EJG A;  5LJ5 h;  3OYD A;  3I55 T;  1M8V A;  4ZTF A;  2HQE A;  3GNG A;  4XTU A;  3QII A;  1Y7X A;  3H8Z A;  4F7U F;  4CI0 C;  2ZCF B;  2LRQ A;  4BI3 A;  4NL3 A;  4EMK C;  3PT9 A;  4LD6 A;  3S3M A;  2XDP A;  3E1S A;  4XK8 E;  4J8O A;  2A3L A;  2QXF A;  3CPW S;  3LLR A;  2XI9 A;  4A54 A;  3CCR T;  4M77 D;  4HCB A;  1PSF A;  2VXE A;  3QSU A;  4XTY A;  3OYY A;  2F69 A;  3UPU A;  2LNV A;  3OYK A;  2E10 A;  3E9F A;  1WJR A;  3M4G A;  4LDV A;  4MDW A;  3DB4 A;  4XU2 A;  5GMK h;  4PLL A;  1Y96 A;  3SWN A;  1VQ8 A;  4V2S A;  4KUD K;  2R5A A;  2EYQ A;  3CBM A;  3LW5 E;  4EMK A;  3OB9 A;  4F7U G;  5CQX A;  1VIE A;  2O4X B;  2R57 A;  4O6J A;  4F7U E;  5CK9 A;  5CKF A;  4J6W A;  2DEQ A;  2LQ8 A;  4F7U B;  2PUK B;  2QQR A;  1M1F A;  1N6A A;  3JCM P;  2OTL T;  3PIO A;  2RJF A;  1VQ6 T;  1VQL A;  3G4S T;  1FXX A;  2Y90 A;  1BKB A;  2JNG A;  2M16 A;  3RKW A;  4CRI A;  3AHU A;  1Q82 U;  3L2R A;  2RB6 A;  4ATO A;  5IN1 A;  3CBP A;  4PL6 A;  2QQA A;  4QQ6 A;  4PJO A;  1W2B S;  4A4G A;  5DM7 R;  5GAO q;  1BI3 A;  3TRE A;  3CCJ T;  1S72 A;  2XK0 A;  2WAC A;  4GY5 A;  4XTZ A;  3HSB A;  3SFM A;  4C0F A;  1U8R A;  3CEY A;  3HFO A;  4JDS A;  2RJD A;  3HP9 A;  3M55 A;  4FT4 A;  4KBM B;  2MAM A;  4MZM A;  1LJO A;  5GMK i;  5GAN h;  4XU0 A;  3X26 B;  1G3W A;  2RA2 A;  2RM4 A;  5HK0 A;  1WQW A;  3C4S A;  3OYB A;  1OZ2 A;  3TEE A;  5HKC A;  4E7L A;  3RES A;  4ELZ C;  2HQX A;  3CME T;  4HCZ A;  2XDD A;  1B34 A;  3GP8 A;  2DXU A;  3R6O A;  4PKC C;  4M7A A;  5KCH A;  4JUV A;  2PVO B;  4X9D A;  3CXC A;  3FJP A;  2EAY A;  2EQJ A;  2P0Q A;  4E47 A;  2XD0 A;  1MGQ A;  3FC3 A;  2V8I A;  1DJ7 B;  1K9M C;  4ZGJ B;  1SSF A;  2MI6 A;  2RHI A;  2PU9 B;  4PJO D;  2IG0 A;  3VUZ A;  1AHJ B;  2BIV A;  1O75 A;  2QEX A;  3A8L B;  4JJN K;  5FRO A;  5LJ3 f;  4C0Z A;  5J39 A;  4II1 A;  4E7K A;  4FSX A;  5KE2 A;  2QA4 T;  1G3S A;  3V8L A;  4LD9 K;  4M78 F;  1N27 A;  3CPF A;  1VQ7 A;  1VQN T;  5IT9 E;  3OMG A;  3G71 T;  1YBY A;  4PLI A;  1M1K U;  1JRI A;  3QKJ A;  3I55 A;  5CAI A;  2DIQ A;  2AHJ B;  4BI8 B;  4M7A D;  3GF5 A;  2ZPG B;  4QVC A;  5CO7 A;  3HKS A;  3CD6 T;  4ME7 A;  2V8J A;  4M78 C;  3O8V A;  1K8A U;  4M7D A;  1KG1 A;  1D3B A;  1W4S A;  5GAN 3;  3L42 A;  4C0G A;  3G6E T;  3J80 E;  5LJ3 d;  1V29 B;  1WJS A;  3CCR A;  1VQK T;  2WSF E;  2Y4X A;  3CCE T;  4KUI A;  4M78 G;  4BE1 A;  4FU6 A;  4M77 C;  5GMK j;  3V8K A;  4RKU E;  3OYF A;  4M75 A;  4M78 E;  4C0D C;  3OS5 A;  3ER0 A;  4M77 A;  3EFS A;  3JCM X;  4M78 B;  3L2V A;  4ZN3 A;  3C95 A;  5CKE A;  4C92 D;  2QQ9 A;  3ME9 A;  2CZ7 B;  1NPR A;  2DPP B;  5CCA A;  1YI2 T;  2EQK A;  3RMS A;  2H3J A;  2HNI A;  2OTL A;  1VQ6 A;  2FB7 A;  5A0G A;  2O01 E;  4C0D B;  3G4S A;  1QVF A;  2KSS A;  4MZP A;  3UDC A;  1Q82 C;  3CCM T;  5LJ3 e;  3DLM A;  1R8O B;  3QUI A;  1BIA A;  3OYC A;  3ZEH A;  4D6W A;  3JCM Q;  3L2U A;  4M7D D;  2PVD B;  3N5B B;  1VQM T;  3V7C A;  3GPL A;  1U1S A;  4OB0 B;  5FU6 B;  3CCJ A;  2KY9 A;  2JN0 A;  1KHC A;  4OGC A;  5C6S A;  1TH7 A;  3DB3 A;  5GAM f;  5GAN j;  3A8G B;  4J7I A;  4C5E A;  4C5G A;  2OAU A;  2LC4 A;  1VIF A;  2DXB A;  3QO3 A;  4BY6 B;  4WF2 A;  3CCV T;  3OYL A;  4EDU A;  3QJ6 A;  4BE2 A;  3E9G A;  5AYF A;  2DIG A;  2VGM A;  2DD5 A;  2X4W A;  4OF1 A;  5FU7 C;  1YHQ T;  2WSE E;  3EAE A;  4L59 A;  1VQ5 T;  3FIF A;  3SWN C;  3CME A;  1X75 C;  2M1H A;  2RHZ A;  1UGP B;  1M90 U;  1XNI A;  2JTM A;  4BAC A;  3PMT A;  1JJ2 A;  1WPY A;  1BIB A;  2PQW A;  3OBW A;  3V7S A;  3X25 B;  4NL2 A;  4OB3 B;  1G5V A;  3DLL A;  5FU7 B;  3KBG A;  1Y96 B;  2RHY A;  2OTJ T;  4C8Q A;  5GAN 5;  3CCU T;  4Y91 A;  4EMK B;  5GAN 7;  2CGH A;  3P8B B;  3FRN A;  1N8R C;  1Y07 A;  3FLG A;  4PJO C;  3L2W A;  4OGE A;  3JB9 D;  4ZTJ A;  2DTO A;  4N0A A;  2D9T A;  4EPC A;  2LCL A;  2V8K A;  3QDR B;  2QA4 A;  2E12 A;  3HFN A;  4RCC A;  2KQW A;  3M5A A;  2EQU A;  1VQN A;  3OYE A;  3J81 E;  5LJ3 g;  3G71 A;  1YJN T;  4PJO G;  4BE0 A;  3CC2 T;  2GF7 A;  3QPH A;  3QYH B;  1WQ7 A;  3CPW A;  1M1K C;  2Y4Y A;  3WVE B;  4J83 A;  4N4H A;  2VXF A;  2EJF A;  1UGR B;  5CKH A;  2M0O A;  5GAM e;  3G6E A;  4PJO B;  1KQS S;  5GMK m;  3L2Z A;  3S6W A;  1YJW T;  3CD6 A;  3OW2 S;  1K8A C;  3HL8 A;  4M7A C;  2ZPH B;  3EFR A;  3WVD B;  3CCL T;  4LDW A;  4QVZ A;  2E6N A;  5A2Q E;  1YIJ T;  4J6X A;  3CC7 T;  3QBY A;  5DLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...