2E5QA

Solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens]
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
b'GSSGSSGLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 19
publication title Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e5qA00
2O4XA 5J26A 2QQRA 3OYBA 3DLMA 3OYIA 4E7KA 2X4YA 1WJRA 4ZTFA 3ZEHA 2DIQA 2RI3A 4BE2A 4UC4A 3OYCA 3OYAA 2HQXA 3S3NA 2EFIA 3DB4A 4QW2A 4A4GA 4BDZA 1MHNA 3PNWC 4IUTA 3MEWA 4NS5A 4Z02A 3OY9A 2BIVA 3EAEA 3LLRA 3LX7A 5IAYA 2M0OA 4FU6A 4Q5WA 3E9FA 4IUUA 2EQMA 4EDUA 3OYDA 5FRMA 3L2WA 5KE3A 2EQKA 3M9QA 3FC3A 2EKOA 1WJQA 4L59A 5D6WA 3FDRA 3L42A 3SD4A 4B9XA 2G3RA 2LRQA 4BD3A 2MWPA 4IUPA 3S3MA 3P8DA 5KH6A 2RHYA 3UWNA 2GFAA 2YRVA 3OS2A 4E7HA 1H3ZA 4IKFA 4GY5A 3FEOA 3OYLA 3MP6A 3PMIA 2X35A 3QIIA 3OYHA 5KCHA 3OYGA 5FRNA 4A4EA 3OYMA 3OYKA 2QQSA 3OA6A 2D9TA 4C5GA 3OYFA 2L3RA 2GF7A 2RJCA 3S6WA 3OMCA 3OYJA 2WACA 3CEYA 4BDYA 2EQUA 5D6YA 2XK0A 5D6XA 2RHIA 4N4IA 4PLLA 4C5HA 1XNIA 2E6NA 2L89A 2FHDA 4QVZA 2RHXA 3OYEA 4PLIA 3MP1A 2LTOA 2RI5A 2K3XA 3L2RA 4CRIA 4B9WA 3KUFA 2RJFA 2IG0A 5M9OA 3H8ZA 3LYIA 1WJSA 2LDMA 2LCCA 3GOXA 4RG2A 3NTHA 5IN1A 2X4WA 5C0MA 3DB3A 3OB9A 4IUVA 5FROA 5J39A 3L2QA 3L2VA 5KCOA 3H6ZA 2RHUA 3P8HA 2JZ2A 1N27A 2P0KA 2R58A 4C5IA 4E7IA 2R5MA 4LD6A 2R57A 3OS1A 2XDPA 4HCZA 3Q1JA 4N4GA 2GFUA 1SSFA 3MEVA 2NLUA 2DIGA 2F5KA 1OZ2A 3ME9A 2LVMA 1OYXA 3PFSA 3QJ6A 4QQ6A 3C4SA 3S3OA 4C5EA 4II1A 4QQGA 2DAQA 1G5VA 4OVAA 3NTKA 2RO0A 2R5AA 2M16A 5KE2A 3FLGA 4E7LA 3MEAA 4BACA 1RI0A 2L8DA 3META 3LGLA 2MWOA 3E9GA 2EQJA 1OI1A 2BKDN 4BE1A 3OQ5A 3MO8A 3QKJA 4BE0A 1KHCA 3MEUA 3ASKA 4N4HA 2M1HA 3MP8A 2CKKA 3LH0A 3QBYA 5C6SA 2HQEA 2RJEA 3LGFA 4IURA 2X4XA 2RJDA 4A4FA 4QQDA 3NTIA 3F70A 4A4HA 3OMGA 3O8VA 4FL6A 2RHZA 4PL6A 2O4XB 1OZ3A 2K3YA 2BUDA 2RI2A 2PQWA 3PMTA 2JTFA 2B8AA 1WGSA 2VYTA 4IUQA 4E7JA 5CIUA 3OS0A 3L2UA 3BDLA 2E5QA 3OYNA 3UT1A 4X34A 4ZTJA
chains in the Genus database with same CATH superfamily
1J3TA 2ATCB 3PGGA 2HBWA 3NFCA 1I81A 3QDFA 3TSZA 4M7DE 4ZTFA 2P84A 5GAOn 2DZ9A 1M90U 1NBEB 4N0AC 2XI9A 1UFFA 4IUUA 4OGCA 1QW1A 1ZUKA 1VQ6Q 3EHRA 4F7UE 1AWXA 1LVKA 1H3ZA 1KHIA 1RAIB 4C8QF 1R0CB 4J6WA 2X9HA 3OYMA 4C8QG 2ZZDA 2YUNA 8ATCB 3V8LA 1ZX6A 3E2UA 1LNXA 3EG2A 5KYUB 2FL7A 3MP1A 5FWBA 5FLXE 4E2FB 4CRIA 5CKFA 2HEQA 1U3OA 2QDYB 3H41A 2EGCA 4QT7A 4LUDA 2QA4Q 4ELYC 3H6ZA 2KI7A 4RUGA 1GXIE 3PT9A 3CMEA 3E1SA 3VS5A 1KIKA 4IIOA 4M78A 5FU6C 4DBQA 1IREB 2XDBA 4HA8A 4NL2A 1UEBA 2KT8A 1VQPT 3LH0A 1N9RA 1JJ2S 3M56A 1Q86R 1X27A 2X4XA 4FYVB 2ED1A 2E64A 2A0FB 3LWIA 3O8VA 1M1KC 2EVRA 2RI2A 3JAME 4OP0A 5CIUA 3L2UA 3URGA 1YJNQ 1UUEA 1NLPC 3HL8A 2D8HA 2XG8D 2RB6A 4M78F 2J7IA 4LE9A 5CVIA 4DEXA 5IXFA 2QAZA 4C8QD 4M78G 5GMKm 1KQ2A 3QG1A 3JCMV 3A8LB 2GGRA 3CCUQ 3GLXA 4OB3B 4E7ZA 3SFMA 1ZSZB 1BIBA 3HP9A 3LX7A 4WF2A 1HXDA 3M4GA 1D1BA 5CKEA 4ELZC 1Q7YC 4M77F 3A8HB 1RACB 4ZN1A 1NJIU 3M5AA 4M77G 3X24B 5HY6A 2DBMA 2RHYA 3CPFA 3EHQA 3CD6A 2DXTA 1SPKA 3CCMQ 3SEMA 1VQNA 4C5GA 4BB7A 3CCJQ 1YNZA 1ZUYA 2O9VA 2L3QA 4LD9K 1HD3A 2AKKA 2KDSA 2XK0A 5FWCA 1AEYA 4A53A 4HXJA 1K0XA 1AVZC 2FVUA 4B9WA 1G3WA 1UECA 2DTHA 3I56A 1JJ2A 1UDLA 2CGHA 3G6ET 1Q86C 4JJCA 1W2BS 2QEXA 4RTZA 4F17A 1YIJT 4N4GA 2K3BA 4FCYA 3EFOA 5LJ3e 3G71T 5KYWB 1Q82R 2O88A 3VRYA 3FLGA 4J6YA 4M78D 5GMKh 4PJOA 4NOYA 4E6RA 1WHHA 1OULA 4WCIA 1PCXA 2VVKA 4LDUA 1KHCA 3CC4T 2M1HA 2K6DA 2QGFB 1OX9A 4A63B 2CZ1B 2HQEA 1LCKA 2RJDA 5L8RE 2JXBA 1YI2Q 2DL8A 1PWTA 1VQ5A 4M77D 2LMJA 4X1VA 2JN0A 3T9NA 1S72Q 3SHWA 3D7SB 1NYGA 5DM7R 1WHLA 1JO8A 4N0AA 2DJZA 3CQTA 4EMKB 4PJOF 2KRSA 3H0HA 2EIFA 1TUCA 5GAN8 2JVVA 2DETA 1D1CA 2DEQA 2E65A 4AFZC 1LJOA 4RTYA 4J5YA 1XTDA 2E1HA 4IUPA 5KH6A 1VQ9A 2WSFE 3MP6A 1NPRA 1NG2A 3BY7A 3OA6A 1W2BA 1GRIA 2D0QB 2L3RA 4A54A 1XJWB 1WQWA 3TQ7P 3OW2P 2QDLA 5GAMj 3FRNA 5I21A 2NWMA 4KGVB 4PLLA 4ORZA 3GIBA 1SRLA 2JTMA 1GFDA 4J9FA 1K8AR 2QQ9A 3VV0A 3SWNC 1RAAB 1VQLA 5KYYB 1N8RC 3OB9A 2D1XA 2YDLA 4M75E 5GANh 3EGXB 2EGAA 1VQ8A 2P0KA 1N27A 3RERA 2GCXA 2KRNA 5GMKl 1VQPA 3TSWA 3KXTA 3PFSA 2DLPA 1BI2A 4M7DA 1K1ZA 2E70A 4XTXA 1D0ZA 3I9QA 4LNPA 1R8OB 3M0RA 2M9UA 1N6AA 2EJGA 2A37A 5GAMh 1YJ9Q 4PJOD 4F7UA 3I55Q 1GCQC 2P0QA 1VQOQ 2E3IA 1EIFA 3CCRQ 3VKIA 1X43A 2VYTA 2FG0A 2LZ6B 2VV5A 1UGPB 2K79A 4K11A 1TXQA 3C95A 1BKBA 4FW1A 2K2VA 3ZFJA 1YITQ 1I4K1 2M0YA 1XQHA 2ZPFB 5GAN3 3OY9A 1YHQQ 3A1PA 3HSBA 1LPLA 4F7UF 3FJPA 3ZL7C 3QUIA 4F7UG 5GANg 4B9XA 1ZUUA 4Y92A 2ZAEA 4E7HA 1E6GA 5HK0A 3NPFA 4M75C 2D0NA 2QQSA 1HYOA 1YJWT 2RH2A 1FYNA 1D0XA 2DX1A 9ATCB 3JB9D 2V8IA 1VIFA 3JCMf 1XOVA 3X26B 3CPWS 4AT1B 1RAEB 4D8DA 1VQMA 1WIEA 2KE9A 1YIJA 2M51A 5GAMg 4OMNA 4EIKA 4JRQA 2AHJB 3G71A 1O75A 3REAB 3EFRA 3UA7A 1PSEA 2DYIA 1X01A 1RLQC 1UGQB 2FPDA 2IVWA 3EG9B 4HCZA 5GAN6 1Q81C 3OBWA 2NLUA 2DPPB 5A0LA 1KC8R 1OV3A 4Y28E 4C5EA 2DMOA 4OB2B 2DAQA 4QQGA 1M1GA 3HPWA 3JCMW 1OU8A 1PM3A 1TTHB 5LJ3j 3CC7Q 3ASKA 4OF1A 2HKNA 4M7AE 4IURA 2V8KA 1I8FA 1QWEA 4A4HA 1NLOC 1WGSA 1G8XA 1QCFA 2OTLT 2QTVA 3CCST 2LJ1A 1UHCA 2X4YA 3ZBDA 2OJ2A 4HVWA 2DIQA 3MEWA 3CPWA 3EAEA 4J9DA 1NPPA 3OBYA 2XU8A 3FC3A 5GAN5 1QKXA 3AHUA 1BIAA 1K9MR 3OYHA 1VQ7A 2RN8A 3QZ9B 3OYKA 2ROTA 1ZBJA 4KT0E 4OMLA 1EZZB 1UTIA 2FPFA 1KD1C 2COZA 1IZ6A 2COWA 4JZ4A 2XD0A 4DA4A 1ABOA 3V8JA 4CC4B 2P0PA 2C06A 3SWNA 2EW3A 3IQLA 1Z9QA 2LNVA 2JS0A 2KRMA 2PU9B 4Z8AA 3GPLA 5GAN2 1YN8A 2FYKA 2HKQB 3HFOA 1MMAA 2HQHA 1Y96B 3JCMQ 4M7AC 1VOMA 1WXBA 2C0TA 1WHGA 5GJWB 1TS9A 3TVTA 1C6VX 2DNUA 3QDRB 4RTTA 1I07A 2CSQA 3QJ6A 1B34B 1WXTA 4X9DA 2BE7D 3JCMe 2Z0WA 4HCKA 1VQKT 1U1TA 1HJDA 4JRPA 3J80E 3META 3M58A 2A3LA 3JSCA 1RAGB 1GCQA 4BE0A 3MEUA 3RR6A 2QK0A 3U23A 3CCEA 3CD6Q 1M2VB 4A4FA 1B3QA 2FO0A 3F70A 3NGPA 3GP8A 4FL6A 2RHZA 4R0KA 1HSQA 4IUQA 1Y0MA 4E7JA 1RAFB 3G1JA 2KXCA 1U8RA 2JM9A 3BE3A 4OMQA 1UB4A 4KGZB 1K73C 4KRTA 1NM7A 2NUTB 4PJOC 4C92E 1AD5A 4IUTA 2BIVA 4MDWA 1K0SA 1YJWA 4FM4B 5J3BA 3OYDA 5IT9E 3MCAB 3M9QA 5GAOm 2PZ1A 1C1AA 4R55A 4JLGA 2QEXQ 2YLCA 4AFQC 1FWZA 4M75A 2MWPA 3OS2A 1FMVA 1X6GA 2GFAA 1VQ4A 2LCLA 2JM8A 5LJ3d 1D3BA 3CXCS 4PJNA 4OMMA 5DY9A 4AG1C 2LJ0A 4FT2A 3OMCA 1V1CA 4ZGEB 2LP5A 3EG0A 5KYXB 3RBBB 1DJ7B 1UGSB 3M0PA 1JBMA 2YUOA 1OX8A 1M1KR 1KQSP 1Q86U 3L2RA 3A98A 1VQ6T 4XU1A 3RUXA 4PFPA 1VQ5Q 2CDTA 2JUFA 4M75F 5GAOq 4XAXB 1YP5A 4M75G 2RQUA 5LJ3f 3H9NA 2R58A 4C5IA 2RQRA 4E7IA 2LC4A 2K4YA 1MV0B 1I1JA 1OZ2A 4ZGDB 1GL5A 2XDDA 1KK7A 1VUBA 3HHTB 4J7IA 2RO0A 1Q7YR 2RQWA 5LJ5e 3G4SQ 2DTIA 2KYBA 1G83A 3P8BB 4C92C 1KFZA 3CCSA 3QKJA 4GBQA 4DQ2A 4HVVA 1M8VA 4N4HA 2EBPA 4A4KA 4JS4A 1VQ9Q 3M0SA 1Q95G 3THKA 2QA4T 4FSXA 2YXYA 2QI2A 1KJWA 1QVGS 3FIFA 4XK8E 5AT1B 4AMCA 4M7DC 1I0CA 3HFNA 3CXCA 2ZPGB 2JMCA 1UHFA 3SDZA 2EFIA 4QW2A 1OPLA 4PJLA 1QCOA 4NS5A 2W0ZA 5IAYA 2EQMA 4CI0C 2C0OA 1VQ8Q 1Y7XA 1IGQA 2FRWA 3FDRA 3VJPA 4BD3A 2CP3A 4NL3A 2K5FA 2LX7A 1YJNT 2BZ8A 2KXDA 2JW4A 4C0DC 4XU3A 4M75D 1Q82U 2J6OA 2BZYA 2CSIA 1AZEA 3J81E 2MMPA 1JXOA 1ACMB 1M3AA 3EGDB 3EG3A 4PNOA 3RKXA 3CCUT 5A0DA 1QVFP 2ESWA 7AT1B 2PNIA 4PLIA 4P5NA 5DLQE 3TEEA 2GBQA 2XMFA 1FX7A 2YSQA 4M7AA 2LCCA 1VQKA 4IUVA 1RL2A 1MUZA 3CCLA 1RAHB 3WVEB 3CCMT 1M4ZA 2JZ2A 2DXUA 4C8QB 5KYYA 5FU7C 2EYZA 3CCJT 2KT1A 4MZPA 3CC2Q 1ZQ1A 1QVGA 3ME9A 4PK4A 4RG8A 2HAXA 2NUPA 3NTKA 4CC7A 1U06A 2MWOA 1GBRA 5GAOl 2NYSA 4J9EA 4M7AF 4BI3A 2G6FX 1ZA2B 3QBYA 1EX4A 1IHVA 4M7AG 3NTIA 3CCVA 4HT9A 4O6JA 2VKNA 1M90C 1OZ3A 3M53A 4D6WA 2BUDA 2HL5C 2DL3A 1WQ7A 3OS0A 4B6MA 2E5QA 4MZTA 2X51A 4DEYA 4J83A 1G3TA 5A2QE 1VQMQ 3RDVA 4PFZA 4J6XA 1N8RR 1K8AU 3BFMA 4XTWA 2LNHB 2K7AA 2M0OA 2FPEA 1T0HA 4ESRA 4V2SA 2EQKA 5D6WA 1YI2T 2AT1B 1UGVA 4Z89A 2SEMA 2KSSA 4BI4A 3HRSA 1S72T 2CP5A 2DEUA 1ZBXA 3QWXX 4M78B 2CP2A 2V8JA 4JJDA 4PJOG 3JCMb 5D6XA 1Y57A 3M59A 4OB0B 2JT4A 3KFVA 2CT4A 1JQQA 2J06A 4KH0B 5ECAA 4M77B 2DILA 1ZHIA 2MI6A 3QHSA 5FROA 3V8KA 2CUDA 4M7AD 4D8KA 2R57A 2EQIA 2QA4A 2EWNA 4OVAA 2VWFA 3MPUB 4C92A 2ZPEB 2YT6A 2L8DA 1R77A 2EYYA 5EG2A 3JB9F 3RKWA 3M55A 5LJ5j 1EFNA 3JB9G 4J9IA 4FYWB 3UDCA 1VQ7Q 2O4XB 4XTVA 3ER0A 3JB9H 1E7OA 3CMAQ 1PG5B 3X25B 4ZTJA 1R0BG 1WYXA 2QGGA 3OYBA 3OYIA 4IIMA 2AZVA 3VRZA 3ZEHA 5CKBA 4UC4A 3VYHB 4C92F 3CCQQ 1NJIC 4XU2A 1S1NA 4FW2A 1W4SA 4C92G 2DVEA 1WXUA 5EC7A 3OS5A 1YJ9T 1PC0A 1NYFA 3I55T 3UA6A 1VQOT 4CC3A 2EKOA 5DLOA 1Q81R 4L59A 3CCUA 3CCRT 1N5ZA 3L42A 3SD4A 2CP6A 2AZSA 2A36A 2DBKA 1K76A 2YLBA 2X35A 4M7DF 3OYGA 1KC8U 4DBFA 1PKSA 2D9TA 3JCMd 4M7DG 3FJ5A 3EFOB 2KROA 2ZPBB 1YITT 2F2WA 3VS6A 4PJOB 1WA7A 4QVZA 2RHXA 1YHQT 4C0ZA 3CCJA 2LTOA 2YUPA 3CCEQ 4X9CA 4JLIA 1ZSZC 3JCMJ 1MV3A 1WJSA 2LDMA 2VGMA 4EMGA 3NTHA 3L2QA 2X4WA 2HD0A 5KCOA 4F14A 2Y90A 4RCCA 5GAN7 6AT1B 3R6NA 4ANJA 4RTXA 2R5MA 2Y4XA 2GNCA 4LD6A 2RD1A 2VUBA 3Q1JA 3G6EA 2GFUA 4XTYA 2DIGA 1OYXA 3R6OA 2RQTA 1M30A 2R5AA 4GLMA 4OMOA 3VS7A 4XTUA 5GAOr 1B34A 5D7UA 2JMAA 2YWWA 2O01E 2OTJQ 1JRIA 2CYZB 4C92D 1X75C 3M57A 2RJEA 2KGTA 1VQ4Q 1WFWA 1KD1R 5CQXA 1K9MU 3C0CA 2OX7A 5I22A 3CC4A 2D6FA 4AG2C 4M77E 2H3EB 1M2VA 2MK5A 1QWFA 2VXFA 4XTZA 1WZOA 2QQRA 1M3CA 2ED0A 4M7DD 3PE0A 3OYAA 2K9GA 4A4GA 3DB4A 4BDZA 2V1RA 2E6ZA 1M9SA 1S72A 3CC7T 1BB9A 1MMDA 4EDUA 2V1QA 1BU1A 2JOYA 2RQVA 4OMFB 2RA2A 2F5TX 3LH5A 3OW2S 4L5GA 1K4US 2K5IA 3OYLA 1H3HA 5FU6B 4DBHA 4ATOA 1RI9A 5I11A 4WTOB 1ZA1B 3M4YA 5LJ5d 3A8MB 3V7SA 3JCMX 3JCMP 4BDYA 2DRKA 4M4ZA 2X3WD 4KGXB 2H3JA 2DRMA 2RI5A 1QKWA 4JJBA 2RMOA 2RJFA 2IG0A 4F7UB 3CMEQ 4OGEA 4XQ3A 5LJ3h 4MDXA 1AOJA 2DJQA 1WI7A 2DE0X 2HNIA 1K73R 2O2OA 2DM1A 2IIMA 3QXEB 3OS1A 4J7FA 2L5QA 4FT4A 5LJ5f 3JV3A 3MEVA 1OU9A 3QSUA 5HK3A 2LT4A 2P4TA 3EG1A 1TU0B 1SG5A 5KYUA 1MNDA 2EAYA 1UGRB 2BTTA 3V7RA 4Y91A 3LWHA 3A8GB 1M8MA 1D0YA 1YWPA 3VS0A 1SF9A 5GMKe 2B8AA 3OW2A 1WPYA 1W6XA 2EYQA 1YJ9A 5FU7B 1JJ2P 1UJYA 4QKUA 1VQOA 2QQBA 3DLMA 3C12A 4LXCA 1IGUA 2ECZA 3PVLA 3OYCA 1UE9A 1M1KU 3VYGA 1KQ1A 3V7CA 2HSPA 5IH2A 4XU0A 4Z02A 4O5VA 4HKEA 2ZGWA 2BE9B 2RPNA 3EFSA 2EYXA 5LJ3g 1T0JA 2QXFA 2GQIA 3L2WA 1VQNQ 3CD6T 3CCLQ 4ZN3A 1VQNT 3P8DA 3UWNA 3PMIA 4Z88A 3RIRA 2KYMA 2DZCA 1Q7YU 3AT1B 1TWBA 2DL4A 3OYJA 2HL3A 5CK9A 4JZ3A 3I56Q 2L89A 1PD0A 3HKSA 1BI0A 3OYEA 1ZSZA 3VS3A 2QTXA 3H0FA 2VC8A 3H8ZA 2YUQA 2DXBA 2QEXT 3GOXA 2E41A 2LQNA 1WNLA 2CZ6B 1SSHA 1ABQA 3UATA 2XDPA 2HSEB 1NE8A 1AWOA 2F69A 2AK5A 3BW1A 2FZCB 1Y71A 3C4SA 3QYHB 4II1A 1G5VA 1W2BP 3M0QA 1NEBA 5GANe 4BACA 1RI0A 1X2KA 1RABB 2CZ7B 3E9GA 2BKDN 1WHMA 2DYBA 2OAWA 2PVOB 3QYGB 3OYYA 5C6SA 4BY6C 3RESA 1VQ5T 2CP7A 1JXMA 2K3YA 3PMTA 2JTFA 3CC7A 2DXCA 1BYMA 1H92A 5LL6S 1NZ9A 2LQ8A 2DTOA 5J26A 5GAMe 2DD5A 2HZYA 1X6OA 1BK2A 1GCPA 1WJRA 1ARKA 2OTLA 5KYWA 2JJ9A 3G4ST 1AZGB 4JPBW 2XIDA 4KULA 3UPUA 3SWNB 1IB8A 8AT1B 1G3SA 4E47A 2DFUA 2FEIA 3E9FA 1VQ9T 3VUZA 5KE3A 4PJMA 3J7AF 4VUBA 1M5Q1 2GTJA 2G3RA 2FZGB 3DLLA 2YRVA 2ZPHB 3VS2A 3O5ZA 3EH1A 1M1FA 4BUGA 4RTVA 1IRXA 2DO3A 1AT1B 2ZPIB 2HMAA 4J9BA 2GF7A 2XKOC 3S6WA 2SRCA 2EQUA 1VQLQ 3MKDA 4C5HA 4EMKA 4PFOA 2FHDA 2RM4A 5KYNA 1M90R 1VQLT 4F04B 1QP3A 2F2XA 3TU4K 1TUGB 1VQ8T 1VQPQ 1QQJA 1B7TA 3DB3A 3HRUA 3PIOA 5A0GA 2CZ0B 3WVDB 2RHUA 2WSCE 4M77A 2LX9A 3VUBA 1CKBA 4C0FA 2YHTA 4DOVA 1VIEA 1UJ0A 4QQ6A 1N8RU 1WX6A 2M16A 1WLPB 1V76A 1A0NB 2I2LA 2KBTA 4BE1A 2CP0A 1H8KA 1WHJA 1TUDA 1B07A 3H0IA 2AIRB 1KG1A 1CSKA 2K57A 1PKTA 2LJ3A 4M75B 1U1SA 2C0IA 2E12A 4YTLA 2NUZA 1ZSGA 4J9CA 3EGXA 2PQWA 3L2ZA 2LT1A 1D3BB 3DKMA 3BDLA 1Y07A 3CC2T 2O4XA 1IHWA 4E7KA 5GMKj 1PHTA 4BE2A 2HQXA 2KY9A 2KNBB 1UG1A 5GJVB 3MJXA 3RMQA 1M27C 5FRMA 2PTKA 2PVGB 2FB7A 3A8OB 4BI8B 4FYYB 1OOTA 1YFNA 3QPHA 3G6EQ 4GY5A 3FEOA 1AWJA 5CCAA 5FRNA 3FB9A 1TSFA 4A4EA 4OB1B 1YIJQ 1KSWA 2GTOA 1KQSS 2XHCA 1VQMT 4HVUA 2E5KA 3G71Q 1YWOA 1BBZA 1PSFA 3INZA 4J8OA 4DOWA 2DVJA 1HK9A 2X3XD 2K2MA 3KUFA 2HBPA 2DK3A 2DERA 1T3SA 1I5OB 3CC4Q 4R56A 3CPWP 1QLYA 5C0MA 3JCMh 2RK1A 1VQ6A 1QP2A 3TCJA 4JRIA 4KUIA 5CQYA 1NJIR 2ENMA 1IO6A 2ROLA 1JEGA 3REBB 4RKUE 3S3OA 1SKUB 3A5ZB 1YBYA 1P92A 4GLKA 5CO7A 5IHIA 2JS2A 3M54A 4E7SA 1N9SA 1OI1A 2A08A 3MO8A 5IXBA 1Q81U 2CH4A 5GANj 3E19A 3LGFA 4LDVA 3G4SA 4EMHA 2P4RA 4PL6A 1C0MA 2OI3A 1GBQA 3NMZC 5GMKi 3EG9A 3I5RA 1M2OA 1CKAA 2CT3A 1GFCA 2RF0A 3RMSA 1KQSA 1QCNA 1RUWA 3S3NA 2IPOB 4MZMA 5HKCA 2H8HA 1OQKA 5IHNA 4J9GA 4RTUA 4KBMB 2DF6A 4Q5WA 2QYZA 2FZKB 4M7AB 1F1BB 1Q82C 2L2PA 3JCMg 2MAMA 2WSEE 1VQ7T 4JJNK 2RNAA 3KBGA 1RLPC 4JDSA 4MMKA 5CAIA 3WXMB 3CMAT 3QIIA 1QVFS 1T3LA 4RTWA 4C8QE 2EJ9A 3BDUA 2KMTA 2J6KA 3TREA 3OYFA 1TOVA 4TVRA 4PKCC 5IHKA 1YJNA 3QO3A 1X6BA 3CEYA 2NUPB 3CCQT 3JCMc 4DBRA 1SHGA 4N4IA 4HCCA 4ZGJB 2W10A 2E6NA 3QZ5B 3OSSC 3PIPA 1BI3A 2LQKA 3CBMA 2E4HA 3VS4A 4LUEA 1KD1U 2O9SA 4RG2A 4KH1B 5FW9A 5LJ5h 1Z9ZA 2X4JA 1IXDA 3PVQA 2J6FA 1WDXA 2L3SA 2ABLA 1SSFA 2KK4A 3VU3C 3GBQA 3CCMA 4FSSA 1K9AA 4KUDK 1YCYA 2K5LA 2PUKB 3MEAA 2A28A 2A7YA 5I2SA 1JU5C 3CCET 2D8JA 2DA9A 3CC2A 2BZXA 2MOXA 1YCSB 3CBOA 2EPDA 2EGEA 1QMCA 4FIBA 1U5SA 3MHXA 4QQDA 4PJJA 1Y96A 1PNJA 1TG0A 3OMGA 1K8AC 2DD4A 1QVPA 4OMPA 2MF2A 2KAFA 3UT1A 3JB9I 1QVFA 1AWWA 2EJFA 1YJWQ 4C8QC 4M78E 1D1AA 1OEBA 2O31A 2RI3A 4RCBA 2MIOA 2CUBA 2B86A 2VXEA 3GF5A 1BCMA 4HT8A 1PRMC 2OTJT 1MGQA 2MYSA 1VA7A 4MMLA 4FU6A 1W1FA 4RMOA 2COYA 1VQ4T 3L1AA 2RK2A 4BY6B 5CR2A 1K73U 1JB0E 5LJ5g 5HCKA 2LCSA 4EPCA 2KQWA 1SEMA 5KCHA 1SRMA 1YI2A 1AHJB 3RNJA 2CS7A 4QVDA 5GANd 5AYFA 3HRTA 3RKYA 3G7ZA 4CC2A 1MMNA 4LN2A 2AKLA 3LW5E 4C92B 2PVDB 1FXXA 1XNIA 2NUTA 3CXCP 2QQAA 1O9SA 4ME7A 1LOJA 2DL5A 3LYIA 3I5SA 1I5LA 2DKGA 1SHFA 3EGUA 5IN1A 3L2VA 5J39A 5GAMd 3P8HA 1G3YA 1PRLC 4M7DB 4JS5A 1H641 4HCBA 5GANf 2OTLQ 4JUVA 4F16A 2L3PA 3CCSQ 5I2MA 2LVMA 3HTRA 1VYTA 2YRCA 2Y4YA 4M78C 4EMKC 5KE2A 5KYXA 1X69A 2KEAA 3VS1A 3PTAA 3LGLA 2L0AA 2EKHA 2QASA 3EH2A 3CMET 3GNGA 3MP8A 4C0GA 1NEGA 4C0DB 5GAMf 4M77C 2VASA 3X20B 4L6V5 1WHKA 1X2QA 2VB6A 5GAN4 2LQWA 2ZCFB 1MMGA 4IKFA 2E10A 3JB9J 1RADB 1MHNA 3PNWC 3X28B 3CMAA 1QVGP 4PJOE 2JNGA 3LLRA 1VYUA 1KC8C 3QWYA 2XICA 3I35A 3M0UA 4ZNXA 1WJQA 2I0NA 3CCQA 2VGNA 2F2VA 2PUOB 1D09B 2LRQA 1OPKA 3S3MA 3I55A 3CCRA 1BI1A 2J05A 3OSVA 4J9HA 2MCNA 4LDWA 3C94A 1V29B 2RJCA 2OAUA 4FYXB 3UF4A 1M3BA 2WACA 5D6YA 2RHIA 1VQKQ 1E6HA 2HDAA 2K3XA 1YITA 3SB2A 1VYVA 3M0TA 3CCLT 5M9OA 3GNFB 5CKHA 2M02A 1TH7A 2V26A 1YHQA 2KR3A 3JRZA 3ULRB 2GQVA 3N5BB 3QJYA 1MNEA 2EYWA 4AFUC 2CH4W 2FRYA 2JTEA 2F5KA 2MPXC 1ZLMA 2QG9B 4LDXA 5L23A 5GAOp 3EGDA 3NHNA 3I56T 4E7LA 2E3HA 1K9MC 1W70A 3CCVQ 4JRKA 2EQJA 2DL7A 2F1LA 3CBPA 5CKDA 1FMKA 3OQ5A 4QVCA 3CCVT 2KVQG 2CKKA 4LDYA 1G2BA 2HCKA 2CREA 1PD1A 1FMWA 2OTJA 4C8QA 1BCOA 2YRDA 3OYNA 4AFSC 4X34A
chains in the Genus database with same CATH topology
2O4XA 3OYBA 3PGGA 3OYIA 4E7KA 3NFCA 1I81A 2X4YA 5GMKj 4M7DE 4ZTFA 3ZBDA 3ZEHA 5GAOn 2DIQA 2DZ9A 5CKBA 4UC4A 4BE2A 1M90U 2HQXA 3VYHB 2KY9A 4C92F 4N0AC 1NJIC 2XI9A 4XU2A 3MEWA 4C92G 1W4SA 2DVEA 3CPWA 3RMQA 3EAEA 1NPPA 3OBYA 3OS5A 1YJ9T 4IUUA 4OGCA 5FRMA 1QW1A 2XU8A 3I55T 2PVGB 4F7UE 1VQOT 3FC3A 2FB7A 5DLOA 2EKOA 3A8OB 4L59A 3CCUA 3CCRT 4M7DF 4BI8B 3L42A 3SD4A 5GAN5 3AHUA 3QPHA 1H3ZA 1KHIA 1BIAA 2YLBA 4GY5A 3FEOA 4C8QF 2X35A 4J6WA 5CCAA 3OYHA 3OYGA 1KC8U 3FB9A 1VQ7A 5FRNA 4A4EA 3OYMA 3QZ9B 3OYKA 4C8QG 2D9TA 4OB1B 3JCMd 4M7DG 4KT0E 1KQSS 2XHCA 2ZZDA 1VQMT 1KD1C 1IZ6A 2ZPBB 3V8LA 1YITT 2XD0A 4DA4A 1PSFA 4PJOB 3INZA 3V8JA 1LNXA 4J8OA 4DOWA 4QVZA 2RHXA 1YHQT 1HK9A 2P0PA 3SWNA 2FL7A 3MP1A 4C0ZA 2LTOA 5FLXE 3CCJA 2C06A 2LNVA 4CRIA 4X9CA 5CKFA 3KUFA 2HBPA 2DK3A 2PU9B 4JLIA 3JCMJ 3GPLA 5GAN2 2QDYB 1WJSA 2LDMA 2FYKA 2VGMA 3HFOA 4R56A 4EMGA 3NTHA 1Y96B 2X4WA 3JCMh 5C0MA 3JCMQ 3L2QA 4M7AC 2RK1A 1VQ6A 4ELYC 2HD0A 1QP2A 3TCJA 5KCOA 3H6ZA 2Y90A 4JRIA 4RCCA 5GAN7 4KUIA 5CQYA 3QDRB 2R5MA 2Y4XA 4LD6A 1GXIE 2RD1A 2VUBA 3Q1JA 3PT9A 3CMEA 3E1SA 3G6EA 2GFUA 4XTYA 3QJ6A 2DIGA 4M78A 5FU6C 1OYXA 4RKUE 3R6OA 1B34B 3S3OA 1IREB 4X9DA 3A5ZB 3JCMe 1YBYA 1VQKT 1P92A 1U1TA 2R5AA 4GLKA 5CO7A 2XDBA 4JRPA 3J80E 4HA8A 3META 3M54A 4XTUA 5GAOr 1N9SA 1B34A 1OI1A 3M58A 2A3LA 3JSCA 2O01E 3MO8A 1Q81U 4BE0A 1JRIA 2CYZB 4NL2A 1UEBA 3MEUA 4C92D 1X75C 1VQPT 3M57A 3LH0A 5GANj 1N9RA 3E19A 2RJEA 3LGFA 3M56A 4LDVA 2X4XA 3CCEA 1JJ2S 4A4FA 3G4SA 5CQXA 2E64A 3F70A 4EMHA 3LWIA 1K9MU 3GP8A 3O8VA 4FL6A 2RHZA 4PL6A 3CC4A 1M1KC 2D6FA 2RI2A 4IUQA 3JAME 4OP0A 4M77E 4E7JA 5CIUA 3L2UA 3URGA 3HL8A 2XG8D 5GMKi 1U8RA 2VXFA 4XTZA 2RB6A 4M78F 2QQRA 5CVIA 4C8QD 4M78G 5GMKm 4M7DD 3RMSA 1KQSA 1KQ2A 1UB4A 3S3NA 3OYAA 3QG1A 3JCMV 3A8LB 1K73C 4A4GA 3DB4A 4MZMA 4BDZA 4PJOC 2E6ZA 4C92E 3GLXA 4OB3B 5HKCA 4IUTA 1M9SA 1S72A 3SFMA 3CC7T 2BIVA 1BIBA 3HP9A 4MDWA 1YJWA 3LX7A 4WF2A 1HXDA 4KBMB 4Q5WA 4FM4B 4EDUA 5J3BA 4M7AB 2JOYA 3OYDA 5IT9E 3M4GA 3MCAB 1Q82C 5CKEA 4ELZC 3M9QA 3JCMg 5GAOm 4OMFB 1Q7YC 4M77F 3A8HB 4R55A 2MAMA 2WSEE 1VQ7T 2RA2A 2F5TX 4JLGA 2YLCA 4ZN1A 4JJNK 3KBGA 1FWZA 3M5AA 4M77G 4M75A 3X24B 3OW2S 2MWPA 4L5GA 5HY6A 4JDSA 4MMKA 3OS2A 2RHYA 3CPFA 2GFAA 2K5IA 3CD6A 1VQ4A 2DXTA 2LCLA 3OYLA 5CAIA 3WXMB 3CMAT 3QIIA 1QVFS 5FU6B 5LJ3d 1D3BA 4C8QE 2EJ9A 3BDUA 4ATOA 2KMTA 3CXCS 1VQNA 4C5GA 3TREA 5DY9A 3OYFA 4BB7A 4TVRA 4PKCC 3M4YA 5LJ5d 3A8MB 1YJNA 3V7SA 4FT2A 3OMCA 3QO3A 3JCMX 4LD9K 3JCMP 3CEYA 4ZGEB 4BDYA 2KDSA 3CCQT 3JCMc 2XK0A 4N4IA 4HCCA 4ZGJB 1DJ7B 1UGSB 2E6NA 3QZ5B 3OSSC 3PIPA 1BI3A 1JBMA 2LQKA 4A53A 2H3JA 2RI5A 3CBMA 1Q86U 3L2RA 1VQ6T 2FVUA 4B9WA 2RJFA 1KD1U 2IG0A 4F7UB 4XU1A 3RUXA 1G3WA 4OGEA 2DTHA 4XQ3A 5LJ3h 4MDXA 4RG2A 2JUFA 4M75F 3I56A 1JJ2A 2CGHA 2HNIA 4XAXB 5GAOq 3G6ET 1Q86C 4M75G 5LJ5h 1W2BS 5LJ3f 2QEXA 2R58A 2X4JA 4C5IA 4E7IA 2LC4A 2K4YA 3QXEB 1YIJT 3OS1A 4J7FA 2L5QA 4FT4A 4N4GA 5LJ5f 1SSFA 3MEVA 2KK4A 1OZ2A 3VU3C 4ZGDB 3CCMA 5LJ3e 3G71T 2XDDA 1VUBA 3HHTB 4J7IA 3QSUA 4KUDK 1YCYA 2K5LA 2PUKB 2RO0A 3FLGA 4J6YA 3MEAA 5HK3A 2LT4A 5LJ5e 4M78D 2DTIA 2A7YA 5GMKh 2P4TA 5I2SA 4PJOA 4NOYA 3CCET 3P8BB 4C92C 3CC2A 2EAYA 1UGRB 3CCSA 3QKJA 4LDUA 4DQ2A 1KHCA 3CC4T 1M8VA 3V7RA 4N4HA 2M1HA 4Y91A 4A4KA 3LWHA 4JS4A 2CZ1B 2HQEA 3CBOA 3A8GB 4FIBA 3MHXA 2RJDA 2QA4T 4QQDA 5L8RE 1Y96A 3OMGA 4FSXA 5GMKe 1K8AC 1VQ5A 2B8AA 2DD4A 2QI2A 3OW2A 1QVPA 1WPYA 4M77D 2EYQA 2JN0A 2MF2A 1QVGS 3FIFA 3T9NA 1YJ9A 5FU7B 2KAFA 3UT1A 3JB9I 1QVFA 2EJFA 4XK8E 5DM7R 4C8QC 1VQOA 2QQBA 3DLMA 4M7DC 3HFNA 4M78E 3CXCA 2ZPGB 4N0AA 2DJZA 3C12A 3SDZA 2RI3A 4RCBA 3OYCA 2EFIA 1M1KU 4QW2A 3VYGA 4EMKB 1KQ1A 2VXEA 3V7CA 4PJOF 4NS5A 3GF5A 2EIFA 4XU0A 4HT8A 4Z02A 4O5VA 5GAN8 2OTJT 1MGQA 2ZGWA 2JVVA 4HKEA 4MMLA 5IAYA 4FU6A 3CMET 4RMOA 2EQMA 3EFSA 5LJ3g 2QXFA 3L2WA 4CI0C 3CD6T 1VQ4T 3L1AA 2RK2A 2DEQA 4BY6B 5CR2A 1Y7XA 1K73U 2E65A 1JB0E 3FDRA 1LJOA 3VJPA 5LJ5g 4ZN3A 4J5YA 1XTDA 2E1HA 1VQNT 4BD3A 4IUPA 3P8DA 4NL3A 2K5FA 3UWNA 5KH6A 1VQ9A 4EPCA 2KQWA 1YJNT 2WSFE 3MP6A 3PMIA 1NPRA 5KCHA 4C0DC 1YI2A 1AHJB 3BY7A 4XU3A 3OA6A 4M75D 1W2BA 3RIRA 2CS7A 2DZCA 4QVDA 1Q82U 2D0QB 2L3RA 4A54A 5GANd 1Q7YU 1WQWA 5AYFA 3HRTA 3RKYA 3J81E 3G7ZA 5GAMj 3FRNA 2MMPA 5I21A 3OYJA 4PNOA 3RKXA 3CCUT 5CK9A 3LW5E 4PLLA 4C92B 5A0DA 2PVDB 1FXXA 1XNIA 3GIBA 2L89A 2QQAA 2JTMA 3HKSA 1BI0A 3OYEA 4PLIA 4P5NA 5DLQE 3TEEA 1O9SA 2QQ9A 2QTXA 4ME7A 3VV0A 1FX7A 1LOJA 2VC8A 3SWNC 3H8ZA 3LYIA 4M7AA 2DXBA 1I5LA 2QEXT 1VQLA 2DKGA 2LCCA 2E41A 3GOXA 1N8RC 5IN1A 3L2VA 1VQKA 3OB9A 4IUVA 1RL2A 4M75E 5J39A 5GANh 3CCLA 1WNLA 1VQ8A 2CZ6B 5GAMd 3P8HA 3WVEB 1G3YA 1M4ZA 1N27A 2DXUA 2JZ2A 2P0KA 2GCXA 4C8QB 3CCMT 4JS5A 3RERA 5FU7C 4M7DB 5GMKl 2XDPA 1H641 3CCJT 4HCBA 5GANf 1VQPA 4JUVA 4MZPA 3KXTA 1NE8A 1ZQ1A 2F69A 1QVGA 3PFSA 3BW1A 1BI2A 3ME9A 2LVMA 5I2MA 1Y71A 3C4SA 3QYHB 4M7DA 1NJIU 2E70A 4II1A 4RG8A 2Y4YA 2HAXA 1G5VA 4M78C 3NTKA 4EMKC 5KE2A 4XTXA 5GANe 4BACA 1RI0A 3PTAA 2CZ7B 3LGLA 2MWOA 1R8OB 3E9GA 2BKDN 2M9UA 5GAOl 1N6AA 2PVOB 4M7AF 2EJGA 3GNGA 4BI3A 3QYGB 3OYYA 5GAMh 3MP8A 5C6SA 4BY6C 3QBYA 3RESA 4F7UA 4C0GA 1VQ5T 4PJOD 4M7AG 2P0QA 3NTIA 1EIFA 3CCVA 4HT9A 4C0DB 4O6JA 1M90C 5GAMf 1OZ3A 3M53A 2K3YA 2BUDA 4M77C 3VKIA 3PMTA 4D6WA 2JTFA 2VYTA 3X20B 4L6V5 3CC7A 2DXCA 1WQ7A 3OS0A 1BYMA 2E5QA 4MZTA 5LL6S 1NZ9A 2VV5A 2LQ8A 1UGPB 2DTOA 5GAN4 5J26A 5GAMe 2DD5A 4J83A 2ZCFB 1G3TA 1X6OA 1WJRA 5A2QE 3C95A 2OTLA 4IKFA 2E10A 1BKBA 3G4ST 3JB9J 4J6XA 1MHNA 2K2VA 3ZFJA 1K8AU 1I4K1 3PNWC 1XQHA 2ZPFB 3X28B 3CMAA 4PJOE 2XIDA 3BFMA 2JNGA 4KULA 5GAN3 3OY9A 3SWNB 3UPUA 3LLRA 4XTWA 1G3SA 4E47A 1KC8C 2M0OA 3E9FA 3HSBA 1VQ9T 3VUZA 2XICA 4F7UF 5KE3A 4V2SA 3FJPA 2EQKA 3QUIA 1WJQA 4VUBA 3J7AF 1M5Q1 4F7UG 3CCQA 5D6WA 5GANg 4B9XA 2VGNA 4ZTJA 1YI2T 2PUOB 2G3RA 2LRQA 3S3MA 3DLLA 3I55A 4E7HA 2YRVA 2ZPHB 5HK0A 4M75C 2KSSA 4BI4A 3HRSA 1BI1A 1M1FA 4BUGA 3CCRA 1S72T 1ZBXA 2QQSA 1YJWT 2RH2A 3OSVA 2DO3A 2ZPIB 3JB9D 2V8IA 4M78B 4LDWA 3C94A 1V29B 1VIFA 2GF7A 2RJCA 2OAUA 2XKOC 3S6WA 2V8JA 3JCMf 1XOVA 2WACA 4PJOG 2EQUA 5D6YA 3JCMb 5D6XA 2RHIA 3X26B 4C5HA 3CPWS 4EMKA 2FHDA 2RM4A 3M59A 4OB0B 1VQMA 1VQLT 1YIJA 5GAMg 2K3XA 1QP3A 1YITA 3SB2A 4JRQA 3TU4K 3CCLT 5M9OA 1VQ8T 2AHJB 3GNFB 5CKHA 1O75A 1TH7A 4M77B 3G71A 1YHQA 1ZHIA 3JRZA 2MI6A 3DB3A 3QHSA 5FROA 2GQVA 3HRUA 3N5BB 5A0GA 3V8KA 3PIOA 2CZ0B 4M7AD 3WVDB 3QJYA 3EFRA 2RHUA 2WSCE 4M77A 1PSEA 2LX9A 1X01A 2R57A 1UGQB 4HCZA 2IVWA 3VUBA 4C0FA 2YHTA 4DOVA 5GAN6 1Q81C 1VIEA 3OBWA 2NLUA 2DPPB 2F5KA 5A0LA 4QQ6A 2QA4A 1N8RU 4LDXA 4Y28E 4C5EA 2EWNA 2DAQA 4OB2B 4QQGA 1M1GA 4OVAA 5GAOp 2M16A 3HPWA 3I56T 4E7LA 1K9MC 4C92A 2ZPEB 3JCMW 2L8DA 4JRKA 2EQJA 2I2LA 3CBPA 5CKDA 4BE1A 5LJ3j 3OQ5A 4QVCA 3CCVT 5EG2A 3ASKA 2KVQG 3JB9F 3RKWA 3M55A 4OF1A 2CKKA 4M7AE 1KG1A 4LDYA 4IURA 2K57A 5LJ5j 2V8KA 3JB9G 1I8FA 4M75B 1U1SA 3UDCA 2E12A 4YTLA 4A4HA 2O4XB 4XTVA 3ER0A 3JB9H 2PQWA 3L2ZA 1WGSA 2LT1A 2OTJA 1D3BB 3DKMA 4C8QA 3BDLA 2OTLT 1Y07A 3OYNA 3CC2T 4X34A 3X25B 3CCST
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X A;  5J26 A;  2QQR A;  3OYB A;  3DLM A;  3OYI A;  4E7K A;  2X4Y A;  1WJR A;  4ZTF A;  3ZEH A;  2DIQ A;  2RI3 A;  4BE2 A;  4UC4 A;  3OYC A;  3OYA A;  2HQX A;  3S3N A;  2EFI A;  3DB4 A;  4QW2 A;  4A4G A;  4BDZ A;  1MHN A;  3PNW C;  4IUT A;  3MEW A;  4NS5 A;  4Z02 A;  3OY9 A;  2BIV A;  3EAE A;  3LLR A;  3LX7 A;  5IAY A;  2M0O A;  4FU6 A;  4Q5W A;  3E9F A;  4IUU A;  2EQM A;  4EDU A;  3OYD A;  5FRM A;  3L2W A;  5KE3 A;  2EQK A;  3M9Q A;  3FC3 A;  2EKO A;  1WJQ A;  4L59 A;  5D6W A;  3FDR A;  3L42 A;  3SD4 A;  4B9X A;  2G3R A;  2LRQ A;  4BD3 A;  2MWP A;  4IUP A;  3S3M A;  3P8D A;  5KH6 A;  2RHY A;  3UWN A;  2GFA A;  2YRV A;  3OS2 A;  4E7H A;  1H3Z A;  4IKF A;  4GY5 A;  3FEO A;  3OYL A;  3MP6 A;  3PMI A;  2X35 A;  3QII A;  3OYH A;  5KCH A;  3OYG A;  5FRN A;  4A4E A;  3OYM A;  3OYK A;  2QQS A;  3OA6 A;  2D9T A;  4C5G A;  3OYF A;  2L3R A;  2GF7 A;  2RJC A;  3S6W A;  3OMC A;  3OYJ A;  2WAC A;  3CEY A;  4BDY A;  2EQU A;  5D6Y A;  2XK0 A;  5D6X A;  2RHI A;  4N4I A;  4PLL A;  4C5H A;  1XNI A;  2E6N A;  2L89 A;  2FHD A;  4QVZ A;  2RHX A;  3OYE A;  4PLI A;  3MP1 A;  2LTO A;  2RI5 A;  2K3X A;  3L2R A;  4CRI A;  4B9W A;  3KUF A;  2RJF A;  2IG0 A;  5M9O A;  3H8Z A;  3LYI A;  1WJS A;  2LDM A;  2LCC A;  3GOX A;  4RG2 A;  3NTH A;  5IN1 A;  2X4W A;  5C0M A;  3DB3 A;  3OB9 A;  4IUV A;  5FRO A;  5J39 A;  3L2Q A;  3L2V A;  5KCO A;  3H6Z A;  2RHU A;  3P8H A;  2JZ2 A;  1N27 A;  2P0K A;  2R58 A;  4C5I A;  4E7I A;  2R5M A;  4LD6 A;  2R57 A;  3OS1 A;  2XDP A;  4HCZ A;  3Q1J A;  4N4G A;  2GFU A;  1SSF A;  3MEV A;  2NLU A;  2DIG A;  2F5K A;  1OZ2 A;  3ME9 A;  2LVM A;  1OYX A;  3PFS A;  3QJ6 A;  4QQ6 A;  3C4S A;  3S3O A;  4C5E A;  4II1 A;  4QQG A;  2DAQ A;  1G5V A;  4OVA A;  3NTK A;  2RO0 A;  2R5A A;  2M16 A;  5KE2 A;  3FLG A;  4E7L A;  3MEA A;  4BAC A;  1RI0 A;  2L8D A;  3MET A;  3LGL A;  2MWO A;  3E9G A;  2EQJ A;  1OI1 A;  2BKD N;  4BE1 A;  3OQ5 A;  3MO8 A;  3QKJ A;  4BE0 A;  1KHC A;  3MEU A;  3ASK A;  4N4H A;  2M1H A;  3MP8 A;  2CKK A;  3LH0 A;  3QBY A;  5C6S A;  2HQE A;  2RJE A;  3LGF A;  4IUR A;  2X4X A;  2RJD A;  4A4F A;  4QQD A;  3NTI A;  3F70 A;  4A4H A;  3OMG A;  3O8V A;  4FL6 A;  2RHZ A;  4PL6 A;  2O4X B;  1OZ3 A;  2K3Y A;  2BUD A;  2RI2 A;  2PQW A;  3PMT A;  2JTF A;  2B8A A;  1WGS A;  2VYT A;  4IUQ A;  4E7J A;  5CIU A;  3OS0 A;  3L2U A;  3BDL A;  2E5Q A;  3OYN A;  3UT1 A;  4X34 A;  4ZTJ A; 
#chains in the Genus database with same CATH topology
 1J3T A;  2ATC B;  3PGG A;  2HBW A;  3NFC A;  1I81 A;  3QDF A;  3TSZ A;  4M7D E;  4ZTF A;  2P84 A;  5GAO n;  2DZ9 A;  1M90 U;  1NBE B;  4N0A C;  2XI9 A;  1UFF A;  4IUU A;  4OGC A;  1QW1 A;  1ZUK A;  1VQ6 Q;  3EHR A;  4F7U E;  1AWX A;  1LVK A;  1H3Z A;  1KHI A;  1RAI B;  4C8Q F;  1R0C B;  4J6W A;  2X9H A;  3OYM A;  4C8Q G;  2ZZD A;  2YUN A;  8ATC B;  3V8L A;  1ZX6 A;  3E2U A;  1LNX A;  3EG2 A;  5KYU B;  2FL7 A;  3MP1 A;  5FWB A;  5FLX E;  4E2F B;  4CRI A;  5CKF A;  2HEQ A;  1U3O A;  2QDY B;  3H41 A;  2EGC A;  4QT7 A;  4LUD A;  2QA4 Q;  4ELY C;  3H6Z A;  2KI7 A;  4RUG A;  1GXI E;  3PT9 A;  3CME A;  3E1S A;  3VS5 A;  1KIK A;  4IIO A;  4M78 A;  5FU6 C;  4DBQ A;  1IRE B;  2XDB A;  4HA8 A;  4NL2 A;  1UEB A;  2KT8 A;  1VQP T;  3LH0 A;  1N9R A;  1JJ2 S;  3M56 A;  1Q86 R;  1X27 A;  2X4X A;  4FYV B;  2ED1 A;  2E64 A;  2A0F B;  3LWI A;  3O8V A;  1M1K C;  2EVR A;  2RI2 A;  3JAM E;  4OP0 A;  5CIU A;  3L2U A;  3URG A;  1YJN Q;  1UUE A;  1NLP C;  3HL8 A;  2D8H A;  2XG8 D;  2RB6 A;  4M78 F;  2J7I A;  4LE9 A;  5CVI A;  4DEX A;  5IXF A;  2QAZ A;  4C8Q D;  4M78 G;  5GMK m;  1KQ2 A;  3QG1 A;  3JCM V;  3A8L B;  2GGR A;  3CCU Q;  3GLX A;  4OB3 B;  4E7Z A;  3SFM A;  1ZSZ B;  1BIB A;  3HP9 A;  3LX7 A;  4WF2 A;  1HXD A;  3M4G A;  1D1B A;  5CKE A;  4ELZ C;  1Q7Y C;  4M77 F;  3A8H B;  1RAC B;  4ZN1 A;  1NJI U;  3M5A A;  4M77 G;  3X24 B;  5HY6 A;  2DBM A;  2RHY A;  3CPF A;  3EHQ A;  3CD6 A;  2DXT A;  1SPK A;  3CCM Q;  3SEM A;  1VQN A;  4C5G A;  4BB7 A;  3CCJ Q;  1YNZ A;  1ZUY A;  2O9V A;  2L3Q A;  4LD9 K;  1HD3 A;  2AKK A;  2KDS A;  2XK0 A;  5FWC A;  1AEY A;  4A53 A;  4HXJ A;  1K0X A;  1AVZ C;  2FVU A;  4B9W A;  1G3W A;  1UEC A;  2DTH A;  3I56 A;  1JJ2 A;  1UDL A;  2CGH A;  3G6E T;  1Q86 C;  4JJC A;  1W2B S;  2QEX A;  4RTZ A;  4F17 A;  1YIJ T;  4N4G A;  2K3B A;  4FCY A;  3EFO A;  5LJ3 e;  3G71 T;  5KYW B;  1Q82 R;  2O88 A;  3VRY A;  3FLG A;  4J6Y A;  4M78 D;  5GMK h;  4PJO A;  4NOY A;  4E6R A;  1WHH A;  1OUL A;  4WCI A;  1PCX A;  2VVK A;  4LDU A;  1KHC A;  3CC4 T;  2M1H A;  2K6D A;  2QGF B;  1OX9 A;  4A63 B;  2CZ1 B;  2HQE A;  1LCK A;  2RJD A;  5L8R E;  2JXB A;  1YI2 Q;  2DL8 A;  1PWT A;  1VQ5 A;  4M77 D;  2LMJ A;  4X1V A;  2JN0 A;  3T9N A;  1S72 Q;  3SHW A;  3D7S B;  1NYG A;  5DM7 R;  1WHL A;  1JO8 A;  4N0A A;  2DJZ A;  3CQT A;  4EMK B;  4PJO F;  2KRS A;  3H0H A;  2EIF A;  1TUC A;  5GAN 8;  2JVV A;  2DET A;  1D1C A;  2DEQ A;  2E65 A;  4AFZ C;  1LJO A;  4RTY A;  4J5Y A;  1XTD A;  2E1H A;  4IUP A;  5KH6 A;  1VQ9 A;  2WSF E;  3MP6 A;  1NPR A;  1NG2 A;  3BY7 A;  3OA6 A;  1W2B A;  1GRI A;  2D0Q B;  2L3R A;  4A54 A;  1XJW B;  1WQW A;  3TQ7 P;  3OW2 P;  2QDL A;  5GAM j;  3FRN A;  5I21 A;  2NWM A;  4KGV B;  4PLL A;  4ORZ A;  3GIB A;  1SRL A;  2JTM A;  1GFD A;  4J9F A;  1K8A R;  2QQ9 A;  3VV0 A;  3SWN C;  1RAA B;  1VQL A;  5KYY B;  1N8R C;  3OB9 A;  2D1X A;  2YDL A;  4M75 E;  5GAN h;  3EGX B;  2EGA A;  1VQ8 A;  2P0K A;  1N27 A;  3RER A;  2GCX A;  2KRN A;  5GMK l;  1VQP A;  3TSW A;  3KXT A;  3PFS A;  2DLP A;  1BI2 A;  4M7D A;  1K1Z A;  2E70 A;  4XTX A;  1D0Z A;  3I9Q A;  4LNP A;  1R8O B;  3M0R A;  2M9U A;  1N6A A;  2EJG A;  2A37 A;  5GAM h;  1YJ9 Q;  4PJO D;  4F7U A;  3I55 Q;  1GCQ C;  2P0Q A;  1VQO Q;  2E3I A;  1EIF A;  3CCR Q;  3VKI A;  1X43 A;  2VYT A;  2FG0 A;  2LZ6 B;  2VV5 A;  1UGP B;  2K79 A;  4K11 A;  1TXQ A;  3C95 A;  1BKB A;  4FW1 A;  2K2V A;  3ZFJ A;  1YIT Q;  1I4K 1;  2M0Y A;  1XQH A;  2ZPF B;  5GAN 3;  3OY9 A;  1YHQ Q;  3A1P A;  3HSB A;  1LPL A;  4F7U F;  3FJP A;  3ZL7 C;  3QUI A;  4F7U G;  5GAN g;  4B9X A;  1ZUU A;  4Y92 A;  2ZAE A;  4E7H A;  1E6G A;  5HK0 A;  3NPF A;  4M75 C;  2D0N A;  2QQS A;  1HYO A;  1YJW T;  2RH2 A;  1FYN A;  1D0X A;  2DX1 A;  9ATC B;  3JB9 D;  2V8I A;  1VIF A;  3JCM f;  1XOV A;  3X26 B;  3CPW S;  4AT1 B;  1RAE B;  4D8D A;  1VQM A;  1WIE A;  2KE9 A;  1YIJ A;  2M51 A;  5GAM g;  4OMN A;  4EIK A;  4JRQ A;  2AHJ B;  3G71 A;  1O75 A;  3REA B;  3EFR A;  3UA7 A;  1PSE A;  2DYI A;  1X01 A;  1RLQ C;  1UGQ B;  2FPD A;  2IVW A;  3EG9 B;  4HCZ A;  5GAN 6;  1Q81 C;  3OBW A;  2NLU A;  2DPP B;  5A0L A;  1KC8 R;  1OV3 A;  4Y28 E;  4C5E A;  2DMO A;  4OB2 B;  2DAQ A;  4QQG A;  1M1G A;  3HPW A;  3JCM W;  1OU8 A;  1PM3 A;  1TTH B;  5LJ3 j;  3CC7 Q;  3ASK A;  4OF1 A;  2HKN A;  4M7A E;  4IUR A;  2V8K A;  1I8F A;  1QWE A;  4A4H A;  1NLO C;  1WGS A;  1G8X A;  1QCF A;  2OTL T;  2QTV A;  3CCS T;  2LJ1 A;  1UHC A;  2X4Y A;  3ZBD A;  2OJ2 A;  4HVW A;  2DIQ A;  3MEW A;  3CPW A;  3EAE A;  4J9D A;  1NPP A;  3OBY A;  2XU8 A;  3FC3 A;  5GAN 5;  1QKX A;  3AHU A;  1BIA A;  1K9M R;  3OYH A;  1VQ7 A;  2RN8 A;  3QZ9 B;  3OYK A;  2ROT A;  1ZBJ A;  4KT0 E;  4OML A;  1EZZ B;  1UTI A;  2FPF A;  1KD1 C;  2COZ A;  1IZ6 A;  2COW A;  4JZ4 A;  2XD0 A;  4DA4 A;  1ABO A;  3V8J A;  4CC4 B;  2P0P A;  2C06 A;  3SWN A;  2EW3 A;  3IQL A;  1Z9Q A;  2LNV A;  2JS0 A;  2KRM A;  2PU9 B;  4Z8A A;  3GPL A;  5GAN 2;  1YN8 A;  2FYK A;  2HKQ B;  3HFO A;  1MMA A;  2HQH A;  1Y96 B;  3JCM Q;  4M7A C;  1VOM A;  1WXB A;  2C0T A;  1WHG A;  5GJW B;  1TS9 A;  3TVT A;  1C6V X;  2DNU A;  3QDR B;  4RTT A;  1I07 A;  2CSQ A;  3QJ6 A;  1B34 B;  1WXT A;  4X9D A;  2BE7 D;  3JCM e;  2Z0W A;  4HCK A;  1VQK T;  1U1T A;  1HJD A;  4JRP A;  3J80 E;  3MET A;  3M58 A;  2A3L A;  3JSC A;  1RAG B;  1GCQ A;  4BE0 A;  3MEU A;  3RR6 A;  2QK0 A;  3U23 A;  3CCE A;  3CD6 Q;  1M2V B;  4A4F A;  1B3Q A;  2FO0 A;  3F70 A;  3NGP A;  3GP8 A;  4FL6 A;  2RHZ A;  4R0K A;  1HSQ A;  4IUQ A;  1Y0M A;  4E7J A;  1RAF B;  3G1J A;  2KXC A;  1U8R A;  2JM9 A;  3BE3 A;  4OMQ A;  1UB4 A;  4KGZ B;  1K73 C;  4KRT A;  1NM7 A;  2NUT B;  4PJO C;  4C92 E;  1AD5 A;  4IUT A;  2BIV A;  4MDW A;  1K0S A;  1YJW A;  4FM4 B;  5J3B A;  3OYD A;  5IT9 E;  3MCA B;  3M9Q A;  5GAO m;  2PZ1 A;  1C1A A;  4R55 A;  4JLG A;  2QEX Q;  2YLC A;  4AFQ C;  1FWZ A;  4M75 A;  2MWP A;  3OS2 A;  1FMV A;  1X6G A;  2GFA A;  1VQ4 A;  2LCL A;  2JM8 A;  5LJ3 d;  1D3B A;  3CXC S;  4PJN A;  4OMM A;  5DY9 A;  4AG1 C;  2LJ0 A;  4FT2 A;  3OMC A;  1V1C A;  4ZGE B;  2LP5 A;  3EG0 A;  5KYX B;  3RBB B;  1DJ7 B;  1UGS B;  3M0P A;  1JBM A;  2YUO A;  1OX8 A;  1M1K R;  1KQS P;  1Q86 U;  3L2R A;  3A98 A;  1VQ6 T;  4XU1 A;  3RUX A;  4PFP A;  1VQ5 Q;  2CDT A;  2JUF A;  4M75 F;  5GAO q;  4XAX B;  1YP5 A;  4M75 G;  2RQU A;  5LJ3 f;  3H9N A;  2R58 A;  4C5I A;  2RQR A;  4E7I A;  2LC4 A;  2K4Y A;  1MV0 B;  1I1J A;  1OZ2 A;  4ZGD B;  1GL5 A;  2XDD A;  1KK7 A;  1VUB A;  3HHT B;  4J7I A;  2RO0 A;  1Q7Y R;  2RQW A;  5LJ5 e;  3G4S Q;  2DTI A;  2KYB A;  1G83 A;  3P8B B;  4C92 C;  1KFZ A;  3CCS A;  3QKJ A;  4GBQ A;  4DQ2 A;  4HVV A;  1M8V A;  4N4H A;  2EBP A;  4A4K A;  4JS4 A;  1VQ9 Q;  3M0S A;  1Q95 G;  3THK A;  2QA4 T;  4FSX A;  2YXY A;  2QI2 A;  1KJW A;  1QVG S;  3FIF A;  4XK8 E;  5AT1 B;  4AMC A;  4M7D C;  1I0C A;  3HFN A;  3CXC A;  2ZPG B;  2JMC A;  1UHF A;  3SDZ A;  2EFI A;  4QW2 A;  1OPL A;  4PJL A;  1QCO A;  4NS5 A;  2W0Z A;  5IAY A;  2EQM A;  4CI0 C;  2C0O A;  1VQ8 Q;  1Y7X A;  1IGQ A;  2FRW A;  3FDR A;  3VJP A;  4BD3 A;  2CP3 A;  4NL3 A;  2K5F A;  2LX7 A;  1YJN T;  2BZ8 A;  2KXD A;  2JW4 A;  4C0D C;  4XU3 A;  4M75 D;  1Q82 U;  2J6O A;  2BZY A;  2CSI A;  1AZE A;  3J81 E;  2MMP A;  1JXO A;  1ACM B;  1M3A A;  3EGD B;  3EG3 A;  4PNO A;  3RKX A;  3CCU T;  5A0D A;  1QVF P;  2ESW A;  7AT1 B;  2PNI A;  4PLI A;  4P5N A;  5DLQ E;  3TEE A;  2GBQ A;  2XMF A;  1FX7 A;  2YSQ A;  4M7A A;  2LCC A;  1VQK A;  4IUV A;  1RL2 A;  1MUZ A;  3CCL A;  1RAH B;  3WVE B;  3CCM T;  1M4Z A;  2JZ2 A;  2DXU A;  4C8Q B;  5KYY A;  5FU7 C;  2EYZ A;  3CCJ T;  2KT1 A;  4MZP A;  3CC2 Q;  1ZQ1 A;  1QVG A;  3ME9 A;  4PK4 A;  4RG8 A;  2HAX A;  2NUP A;  3NTK A;  4CC7 A;  1U06 A;  2MWO A;  1GBR A;  5GAO l;  2NYS A;  4J9E A;  4M7A F;  4BI3 A;  2G6F X;  1ZA2 B;  3QBY A;  1EX4 A;  1IHV A;  4M7A G;  3NTI A;  3CCV A;  4HT9 A;  4O6J A;  2VKN A;  1M90 C;  1OZ3 A;  3M53 A;  4D6W A;  2BUD A;  2HL5 C;  2DL3 A;  1WQ7 A;  3OS0 A;  4B6M A;  2E5Q A;  4MZT A;  2X51 A;  4DEY A;  4J83 A;  1G3T A;  5A2Q E;  1VQM Q;  3RDV A;  4PFZ A;  4J6X A;  1N8R R;  1K8A U;  3BFM A;  4XTW A;  2LNH B;  2K7A A;  2M0O A;  2FPE A;  1T0H A;  4ESR A;  4V2S A;  2EQK A;  5D6W A;  1YI2 T;  2AT1 B;  1UGV A;  4Z89 A;  2SEM A;  2KSS A;  4BI4 A;  3HRS A;  1S72 T;  2CP5 A;  2DEU A;  1ZBX A;  3QWX X;  4M78 B;  2CP2 A;  2V8J A;  4JJD A;  4PJO G;  3JCM b;  5D6X A;  1Y57 A;  3M59 A;  4OB0 B;  2JT4 A;  3KFV A;  2CT4 A;  1JQQ A;  2J06 A;  4KH0 B;  5ECA A;  4M77 B;  2DIL A;  1ZHI A;  2MI6 A;  3QHS A;  5FRO A;  3V8K A;  2CUD A;  4M7A D;  4D8K A;  2R57 A;  2EQI A;  2QA4 A;  2EWN A;  4OVA A;  2VWF A;  3MPU B;  4C92 A;  2ZPE B;  2YT6 A;  2L8D A;  1R77 A;  2EYY A;  5EG2 A;  3JB9 F;  3RKW A;  3M55 A;  5LJ5 j;  1EFN A;  3JB9 G;  4J9I A;  4FYW B;  3UDC A;  1VQ7 Q;  2O4X B;  4XTV A;  3ER0 A;  3JB9 H;  1E7O A;  3CMA Q;  1PG5 B;  3X25 B;  4ZTJ A;  1R0B G;  1WYX A;  2QGG A;  3OYB A;  3OYI A;  4IIM A;  2AZV A;  3VRZ A;  3ZEH A;  5CKB A;  4UC4 A;  3VYH B;  4C92 F;  3CCQ Q;  1NJI C;  4XU2 A;  1S1N A;  4FW2 A;  1W4S A;  4C92 G;  2DVE A;  1WXU A;  5EC7 A;  3OS5 A;  1YJ9 T;  1PC0 A;  1NYF A;  3I55 T;  3UA6 A;  1VQO T;  4CC3 A;  2EKO A;  5DLO A;  1Q81 R;  4L59 A;  3CCU A;  3CCR T;  1N5Z A;  3L42 A;  3SD4 A;  2CP6 A;  2AZS A;  2A36 A;  2DBK A;  1K76 A;  2YLB A;  2X35 A;  4M7D F;  3OYG A;  1KC8 U;  4DBF A;  1PKS A;  2D9T A;  3JCM d;  4M7D G;  3FJ5 A;  3EFO B;  2KRO A;  2ZPB B;  1YIT T;  2F2W A;  3VS6 A;  4PJO B;  1WA7 A;  4QVZ A;  2RHX A;  1YHQ T;  4C0Z A;  3CCJ A;  2LTO A;  2YUP A;  3CCE Q;  4X9C A;  4JLI A;  1ZSZ C;  3JCM J;  1MV3 A;  1WJS A;  2LDM A;  2VGM A;  4EMG A;  3NTH A;  3L2Q A;  2X4W A;  2HD0 A;  5KCO A;  4F14 A;  2Y90 A;  4RCC A;  5GAN 7;  6AT1 B;  3R6N A;  4ANJ A;  4RTX A;  2R5M A;  2Y4X A;  2GNC A;  4LD6 A;  2RD1 A;  2VUB A;  3Q1J A;  3G6E A;  2GFU A;  4XTY A;  2DIG A;  1OYX A;  3R6O A;  2RQT A;  1M30 A;  2R5A A;  4GLM A;  4OMO A;  3VS7 A;  4XTU A;  5GAO r;  1B34 A;  5D7U A;  2JMA A;  2YWW A;  2O01 E;  2OTJ Q;  1JRI A;  2CYZ B;  4C92 D;  1X75 C;  3M57 A;  2RJE A;  2KGT A;  1VQ4 Q;  1WFW A;  1KD1 R;  5CQX A;  1K9M U;  3C0C A;  2OX7 A;  5I22 A;  3CC4 A;  2D6F A;  4AG2 C;  4M77 E;  2H3E B;  1M2V A;  2MK5 A;  1QWF A;  2VXF A;  4XTZ A;  1WZO A;  2QQR A;  1M3C A;  2ED0 A;  4M7D D;  3PE0 A;  3OYA A;  2K9G A;  4A4G A;  3DB4 A;  4BDZ A;  2V1R A;  2E6Z A;  1M9S A;  1S72 A;  3CC7 T;  1BB9 A;  1MMD A;  4EDU A;  2V1Q A;  1BU1 A;  2JOY A;  2RQV A;  4OMF B;  2RA2 A;  2F5T X;  3LH5 A;  3OW2 S;  4L5G A;  1K4U S;  2K5I A;  3OYL A;  1H3H A;  5FU6 B;  4DBH A;  4ATO A;  1RI9 A;  5I11 A;  4WTO B;  1ZA1 B;  3M4Y A;  5LJ5 d;  3A8M B;  3V7S A;  3JCM X;  3JCM P;  4BDY A;  2DRK A;  4M4Z A;  2X3W D;  4KGX B;  2H3J A;  2DRM A;  2RI5 A;  1QKW A;  4JJB A;  2RMO A;  2RJF A;  2IG0 A;  4F7U B;  3CME Q;  4OGE A;  4XQ3 A;  5LJ3 h;  4MDX A;  1AOJ A;  2DJQ A;  1WI7 A;  2DE0 X;  2HNI A;  1K73 R;  2O2O A;  2DM1 A;  2IIM A;  3QXE B;  3OS1 A;  4J7F A;  2L5Q A;  4FT4 A;  5LJ5 f;  3JV3 A;  3MEV A;  1OU9 A;  3QSU A;  5HK3 A;  2LT4 A;  2P4T A;  3EG1 A;  1TU0 B;  1SG5 A;  5KYU A;  1MND A;  2EAY A;  1UGR B;  2BTT A;  3V7R A;  4Y91 A;  3LWH A;  3A8G B;  1M8M A;  1D0Y A;  1YWP A;  3VS0 A;  1SF9 A;  5GMK e;  2B8A A;  3OW2 A;  1WPY A;  1W6X A;  2EYQ A;  1YJ9 A;  5FU7 B;  1JJ2 P;  1UJY A;  4QKU A;  1VQO A;  2QQB A;  3DLM A;  3C12 A;  4LXC A;  1IGU A;  2ECZ A;  3PVL A;  3OYC A;  1UE9 A;  1M1K U;  3VYG A;  1KQ1 A;  3V7C A;  2HSP A;  5IH2 A;  4XU0 A;  4Z02 A;  4O5V A;  4HKE A;  2ZGW A;  2BE9 B;  2RPN A;  3EFS A;  2EYX A;  5LJ3 g;  1T0J A;  2QXF A;  2GQI A;  3L2W A;  1VQN Q;  3CD6 T;  3CCL Q;  4ZN3 A;  1VQN T;  3P8D A;  3UWN A;  3PMI A;  4Z88 A;  3RIR A;  2KYM A;  2DZC A;  1Q7Y U;  3AT1 B;  1TWB A;  2DL4 A;  3OYJ A;  2HL3 A;  5CK9 A;  4JZ3 A;  3I56 Q;  2L89 A;  1PD0 A;  3HKS A;  1BI0 A;  3OYE A;  1ZSZ A;  3VS3 A;  2QTX A;  3H0F A;  2VC8 A;  3H8Z A;  2YUQ A;  2DXB A;  2QEX T;  3GOX A;  2E41 A;  2LQN A;  1WNL A;  2CZ6 B;  1SSH A;  1ABQ A;  3UAT A;  2XDP A;  2HSE B;  1NE8 A;  1AWO A;  2F69 A;  2AK5 A;  3BW1 A;  2FZC B;  1Y71 A;  3C4S A;  3QYH B;  4II1 A;  1G5V A;  1W2B P;  3M0Q A;  1NEB A;  5GAN e;  4BAC A;  1RI0 A;  1X2K A;  1RAB B;  2CZ7 B;  3E9G A;  2BKD N;  1WHM A;  2DYB A;  2OAW A;  2PVO B;  3QYG B;  3OYY A;  5C6S A;  4BY6 C;  3RES A;  1VQ5 T;  2CP7 A;  1JXM A;  2K3Y A;  3PMT A;  2JTF A;  3CC7 A;  2DXC A;  1BYM A;  1H92 A;  5LL6 S;  1NZ9 A;  2LQ8 A;  2DTO A;  5J26 A;  5GAM e;  2DD5 A;  2HZY A;  1X6O A;  1BK2 A;  1GCP A;  1WJR A;  1ARK A;  2OTL A;  5KYW A;  2JJ9 A;  3G4S T;  1AZG B;  4JPB W;  2XID A;  4KUL A;  3UPU A;  3SWN B;  1IB8 A;  8AT1 B;  1G3S A;  4E47 A;  2DFU A;  2FEI A;  3E9F A;  1VQ9 T;  3VUZ A;  5KE3 A;  4PJM A;  3J7A F;  4VUB A;  1M5Q 1;  2GTJ A;  2G3R A;  2FZG B;  3DLL A;  2YRV A;  2ZPH B;  3VS2 A;  3O5Z A;  3EH1 A;  1M1F A;  4BUG A;  4RTV A;  1IRX A;  2DO3 A;  1AT1 B;  2ZPI B;  2HMA A;  4J9B A;  2GF7 A;  2XKO C;  3S6W A;  2SRC A;  2EQU A;  1VQL Q;  3MKD A;  4C5H A;  4EMK A;  4PFO A;  2FHD A;  2RM4 A;  5KYN A;  1M90 R;  1VQL T;  4F04 B;  1QP3 A;  2F2X A;  3TU4 K;  1TUG B;  1VQ8 T;  1VQP Q;  1QQJ A;  1B7T A;  3DB3 A;  3HRU A;  3PIO A;  5A0G A;  2CZ0 B;  3WVD B;  2RHU A;  2WSC E;  4M77 A;  2LX9 A;  3VUB A;  1CKB A;  4C0F A;  2YHT A;  4DOV A;  1VIE A;  1UJ0 A;  4QQ6 A;  1N8R U;  1WX6 A;  2M16 A;  1WLP B;  1V76 A;  1A0N B;  2I2L A;  2KBT A;  4BE1 A;  2CP0 A;  1H8K A;  1WHJ A;  1TUD A;  1B07 A;  3H0I A;  2AIR B;  1KG1 A;  1CSK A;  2K57 A;  1PKT A;  2LJ3 A;  4M75 B;  1U1S A;  2C0I A;  2E12 A;  4YTL A;  2NUZ A;  1ZSG A;  4J9C A;  3EGX A;  2PQW A;  3L2Z A;  2LT1 A;  1D3B B;  3DKM A;  3BDL A;  1Y07 A;  3CC2 T;  2O4X A;  1IHW A;  4E7K A;  5GMK j;  1PHT A;  4BE2 A;  2HQX A;  2KY9 A;  2KNB B;  1UG1 A;  5GJV B;  3MJX A;  3RMQ A;  1M27 C;  5FRM A;  2PTK A;  2PVG B;  2FB7 A;  3A8O B;  4BI8 B;  4FYY B;  1OOT A;  1YFN A;  3QPH A;  3G6E Q;  4GY5 A;  3FEO A;  1AWJ A;  5CCA A;  5FRN A;  3FB9 A;  1TSF A;  4A4E A;  4OB1 B;  1YIJ Q;  1KSW A;  2GTO A;  1KQS S;  2XHC A;  1VQM T;  4HVU A;  2E5K A;  3G71 Q;  1YWO A;  1BBZ A;  1PSF A;  3INZ A;  4J8O A;  4DOW A;  2DVJ A;  1HK9 A;  2X3X D;  2K2M A;  3KUF A;  2HBP A;  2DK3 A;  2DER A;  1T3S A;  1I5O B;  3CC4 Q;  4R56 A;  3CPW P;  1QLY A;  5C0M A;  3JCM h;  2RK1 A;  1VQ6 A;  1QP2 A;  3TCJ A;  4JRI A;  4KUI A;  5CQY A;  1NJI R;  2ENM A;  1IO6 A;  2ROL A;  1JEG A;  3REB B;  4RKU E;  3S3O A;  1SKU B;  3A5Z B;  1YBY A;  1P92 A;  4GLK A;  5CO7 A;  5IHI A;  2JS2 A;  3M54 A;  4E7S A;  1N9S A;  1OI1 A;  2A08 A;  3MO8 A;  5IXB A;  1Q81 U;  2CH4 A;  5GAN j;  3E19 A;  3LGF A;  4LDV A;  3G4S A;  4EMH A;  2P4R A;  4PL6 A;  1C0M A;  2OI3 A;  1GBQ A;  3NMZ C;  5GMK i;  3EG9 A;  3I5R A;  1M2O A;  1CKA A;  2CT3 A;  1GFC A;  2RF0 A;  3RMS A;  1KQS A;  1QCN A;  1RUW A;  3S3N A;  2IPO B;  4MZM A;  5HKC A;  2H8H A;  1OQK A;  5IHN A;  4J9G A;  4RTU A;  4KBM B;  2DF6 A;  4Q5W A;  2QYZ A;  2FZK B;  4M7A B;  1F1B B;  1Q82 C;  2L2P A;  3JCM g;  2MAM A;  2WSE E;  1VQ7 T;  4JJN K;  2RNA A;  3KBG A;  1RLP C;  4JDS A;  4MMK A;  5CAI A;  3WXM B;  3CMA T;  3QII A;  1QVF S;  1T3L A;  4RTW A;  4C8Q E;  2EJ9 A;  3BDU A;  2KMT A;  2J6K A;  3TRE A;  3OYF A;  1TOV A;  4TVR A;  4PKC C;  5IHK A;  1YJN A;  3QO3 A;  1X6B A;  3CEY A;  2NUP B;  3CCQ T;  3JCM c;  4DBR A;  1SHG A;  4N4I A;  4HCC A;  4ZGJ B;  2W10 A;  2E6N A;  3QZ5 B;  3OSS C;  3PIP A;  1BI3 A;  2LQK A;  3CBM A;  2E4H A;  3VS4 A;  4LUE A;  1KD1 U;  2O9S A;  4RG2 A;  4KH1 B;  5FW9 A;  5LJ5 h;  1Z9Z A;  2X4J A;  1IXD A;  3PVQ A;  2J6F A;  1WDX A;  2L3S A;  2ABL A;  1SSF A;  2KK4 A;  3VU3 C;  3GBQ A;  3CCM A;  4FSS A;  1K9A A;  4KUD K;  1YCY A;  2K5L A;  2PUK B;  3MEA A;  2A28 A;  2A7Y A;  5I2S A;  1JU5 C;  3CCE T;  2D8J A;  2DA9 A;  3CC2 A;  2BZX A;  2MOX A;  1YCS B;  3CBO A;  2EPD A;  2EGE A;  1QMC A;  4FIB A;  1U5S A;  3MHX A;  4QQD A;  4PJJ A;  1Y96 A;  1PNJ A;  1TG0 A;  3OMG A;  1K8A C;  2DD4 A;  1QVP A;  4OMP A;  2MF2 A;  2KAF A;  3UT1 A;  3JB9 I;  1QVF A;  1AWW A;  2EJF A;  1YJW Q;  4C8Q C;  4M78 E;  1D1A A;  1OEB A;  2O31 A;  2RI3 A;  4RCB A;  2MIO A;  2CUB A;  2B86 A;  2VXE A;  3GF5 A;  1BCM A;  4HT8 A;  1PRM C;  2OTJ T;  1MGQ A;  2MYS A;  1VA7 A;  4MML A;  4FU6 A;  1W1F A;  4RMO A;  2COY A;  1VQ4 T;  3L1A A;  2RK2 A;  4BY6 B;  5CR2 A;  1K73 U;  1JB0 E;  5LJ5 g;  5HCK A;  2LCS A;  4EPC A;  2KQW A;  1SEM A;  5KCH A;  1SRM A;  1YI2 A;  1AHJ B;  3RNJ A;  2CS7 A;  4QVD A;  5GAN d;  5AYF A;  3HRT A;  3RKY A;  3G7Z A;  4CC2 A;  1MMN A;  4LN2 A;  2AKL A;  3LW5 E;  4C92 B;  2PVD B;  1FXX A;  1XNI A;  2NUT A;  3CXC P;  2QQA A;  1O9S A;  4ME7 A;  1LOJ A;  2DL5 A;  3LYI A;  3I5S A;  1I5L A;  2DKG A;  1SHF A;  3EGU A;  5IN1 A;  3L2V A;  5J39 A;  5GAM d;  3P8H A;  1G3Y A;  1PRL C;  4M7D B;  4JS5 A;  1H64 1;  4HCB A;  5GAN f;  2OTL Q;  4JUV A;  4F16 A;  2L3P A;  3CCS Q;  5I2M A;  2LVM A;  3HTR A;  1VYT A;  2YRC A;  2Y4Y A;  4M78 C;  4EMK C;  5KE2 A;  5KYX A;  1X69 A;  2KEA A;  3VS1 A;  3PTA A;  3LGL A;  2L0A A;  2EKH A;  2QAS A;  3EH2 A;  3CME T;  3GNG A;  3MP8 A;  4C0G A;  1NEG A;  4C0D B;  5GAM f;  4M77 C;  2VAS A;  3X20 B;  4L6V 5;  1WHK A;  1X2Q A;  2VB6 A;  5GAN 4;  2LQW A;  2ZCF B;  1MMG A;  4IKF A;  2E10 A;  3JB9 J;  1RAD B;  1MHN A;  3PNW C;  3X28 B;  3CMA A;  1QVG P;  4PJO E;  2JNG A;  3LLR A;  1VYU A;  1KC8 C;  3QWY A;  2XIC A;  3I35 A;  3M0U A;  4ZNX A;  1WJQ A;  2I0N A;  3CCQ A;  2VGN A;  2F2V A;  2PUO B;  1D09 B;  2LRQ A;  1OPK A;  3S3M A;  3I55 A;  3CCR A;  1BI1 A;  2J05 A;  3OSV A;  4J9H A;  2MCN A;  4LDW A;  3C94 A;  1V29 B;  2RJC A;  2OAU A;  4FYX B;  3UF4 A;  1M3B A;  2WAC A;  5D6Y A;  2RHI A;  1VQK Q;  1E6H A;  2HDA A;  2K3X A;  1YIT A;  3SB2 A;  1VYV A;  3M0T A;  3CCL T;  5M9O A;  3GNF B;  5CKH A;  2M02 A;  1TH7 A;  2V26 A;  1YHQ A;  2KR3 A;  3JRZ A;  3ULR B;  2GQV A;  3N5B B;  3QJY A;  1MNE A;  2EYW A;  4AFU C;  2CH4 W;  2FRY A;  2JTE A;  2F5K A;  2MPX C;  1ZLM A;  2QG9 B;  4LDX A;  5L23 A;  5GAO p;  3EGD A;  3NHN A;  3I56 T;  4E7L A;  2E3H A;  1K9M C;  1W70 A;  3CCV Q;  4JRK A;  2EQJ A;  2DL7 A;  2F1L A;  3CBP A;  5CKD A;  1FMK A;  3OQ5 A;  4QVC A;  3CCV T;  2KVQ G;  2CKK A;  4LDY A;  1G2B A;  2HCK A;  2CRE A;  1PD1 A;  1FMW A;  2OTJ A;  4C8Q A;  1BCO A;  2YRD A;  3OYN A;  4AFS C;  4X34 A; 
#chains in the Genus database with same CATH homology
 2O4X A;  3OYB A;  3PGG A;  3OYI A;  4E7K A;  3NFC A;  1I81 A;  2X4Y A;  5GMK j;  4M7D E;  4ZTF A;  3ZBD A;  3ZEH A;  5GAO n;  2DIQ A;  2DZ9 A;  5CKB A;  4UC4 A;  4BE2 A;  1M90 U;  2HQX A;  3VYH B;  2KY9 A;  4C92 F;  4N0A C;  1NJI C;  2XI9 A;  4XU2 A;  3MEW A;  4C92 G;  1W4S A;  2DVE A;  3CPW A;  3RMQ A;  3EAE A;  1NPP A;  3OBY A;  3OS5 A;  1YJ9 T;  4IUU A;  4OGC A;  5FRM A;  1QW1 A;  2XU8 A;  3I55 T;  2PVG B;  4F7U E;  1VQO T;  3FC3 A;  2FB7 A;  5DLO A;  2EKO A;  3A8O B;  4L59 A;  3CCU A;  3CCR T;  4M7D F;  4BI8 B;  3L42 A;  3SD4 A;  5GAN 5;  3AHU A;  3QPH A;  1H3Z A;  1KHI A;  1BIA A;  2YLB A;  4GY5 A;  3FEO A;  4C8Q F;  2X35 A;  4J6W A;  5CCA A;  3OYH A;  3OYG A;  1KC8 U;  3FB9 A;  1VQ7 A;  5FRN A;  4A4E A;  3OYM A;  3QZ9 B;  3OYK A;  4C8Q G;  2D9T A;  4OB1 B;  3JCM d;  4M7D G;  4KT0 E;  1KQS S;  2XHC A;  2ZZD A;  1VQM T;  1KD1 C;  1IZ6 A;  2ZPB B;  3V8L A;  1YIT T;  2XD0 A;  4DA4 A;  1PSF A;  4PJO B;  3INZ A;  3V8J A;  1LNX A;  4J8O A;  4DOW A;  4QVZ A;  2RHX A;  1YHQ T;  1HK9 A;  2P0P A;  3SWN A;  2FL7 A;  3MP1 A;  4C0Z A;  2LTO A;  5FLX E;  3CCJ A;  2C06 A;  2LNV A;  4CRI A;  4X9C A;  5CKF A;  3KUF A;  2HBP A;  2DK3 A;  2PU9 B;  4JLI A;  3JCM J;  3GPL A;  5GAN 2;  2QDY B;  1WJS A;  2LDM A;  2FYK A;  2VGM A;  3HFO A;  4R56 A;  4EMG A;  3NTH A;  1Y96 B;  2X4W A;  3JCM h;  5C0M A;  3JCM Q;  3L2Q A;  4M7A C;  2RK1 A;  1VQ6 A;  4ELY C;  2HD0 A;  1QP2 A;  3TCJ A;  5KCO A;  3H6Z A;  2Y90 A;  4JRI A;  4RCC A;  5GAN 7;  4KUI A;  5CQY A;  3QDR B;  2R5M A;  2Y4X A;  4LD6 A;  1GXI E;  2RD1 A;  2VUB A;  3Q1J A;  3PT9 A;  3CME A;  3E1S A;  3G6E A;  2GFU A;  4XTY A;  3QJ6 A;  2DIG A;  4M78 A;  5FU6 C;  1OYX A;  4RKU E;  3R6O A;  1B34 B;  3S3O A;  1IRE B;  4X9D A;  3A5Z B;  3JCM e;  1YBY A;  1VQK T;  1P92 A;  1U1T A;  2R5A A;  4GLK A;  5CO7 A;  2XDB A;  4JRP A;  3J80 E;  4HA8 A;  3MET A;  3M54 A;  4XTU A;  5GAO r;  1N9S A;  1B34 A;  1OI1 A;  3M58 A;  2A3L A;  3JSC A;  2O01 E;  3MO8 A;  1Q81 U;  4BE0 A;  1JRI A;  2CYZ B;  4NL2 A;  1UEB A;  3MEU A;  4C92 D;  1X75 C;  1VQP T;  3M57 A;  3LH0 A;  5GAN j;  1N9R A;  3E19 A;  2RJE A;  3LGF A;  3M56 A;  4LDV A;  2X4X A;  3CCE A;  1JJ2 S;  4A4F A;  3G4S A;  5CQX A;  2E64 A;  3F70 A;  4EMH A;  3LWI A;  1K9M U;  3GP8 A;  3O8V A;  4FL6 A;  2RHZ A;  4PL6 A;  3CC4 A;  1M1K C;  2D6F A;  2RI2 A;  4IUQ A;  3JAM E;  4OP0 A;  4M77 E;  4E7J A;  5CIU A;  3L2U A;  3URG A;  3HL8 A;  2XG8 D;  5GMK i;  1U8R A;  2VXF A;  4XTZ A;  2RB6 A;  4M78 F;  2QQR A;  5CVI A;  4C8Q D;  4M78 G;  5GMK m;  4M7D D;  3RMS A;  1KQS A;  1KQ2 A;  1UB4 A;  3S3N A;  3OYA A;  3QG1 A;  3JCM V;  3A8L B;  1K73 C;  4A4G A;  3DB4 A;  4MZM A;  4BDZ A;  4PJO C;  2E6Z A;  4C92 E;  3GLX A;  4OB3 B;  5HKC A;  4IUT A;  1M9S A;  1S72 A;  3SFM A;  3CC7 T;  2BIV A;  1BIB A;  3HP9 A;  4MDW A;  1YJW A;  3LX7 A;  4WF2 A;  1HXD A;  4KBM B;  4Q5W A;  4FM4 B;  4EDU A;  5J3B A;  4M7A B;  2JOY A;  3OYD A;  5IT9 E;  3M4G A;  3MCA B;  1Q82 C;  5CKE A;  4ELZ C;  3M9Q A;  3JCM g;  5GAO m;  4OMF B;  1Q7Y C;  4M77 F;  3A8H B;  4R55 A;  2MAM A;  2WSE E;  1VQ7 T;  2RA2 A;  2F5T X;  4JLG A;  2YLC A;  4ZN1 A;  4JJN K;  3KBG A;  1FWZ A;  3M5A A;  4M77 G;  4M75 A;  3X24 B;  3OW2 S;  2MWP A;  4L5G A;  5HY6 A;  4JDS A;  4MMK A;  3OS2 A;  2RHY A;  3CPF A;  2GFA A;  2K5I A;  3CD6 A;  1VQ4 A;  2DXT A;  2LCL A;  3OYL A;  5CAI A;  3WXM B;  3CMA T;  3QII A;  1QVF S;  5FU6 B;  5LJ3 d;  1D3B A;  4C8Q E;  2EJ9 A;  3BDU A;  4ATO A;  2KMT A;  3CXC S;  1VQN A;  4C5G A;  3TRE A;  5DY9 A;  3OYF A;  4BB7 A;  4TVR A;  4PKC C;  3M4Y A;  5LJ5 d;  3A8M B;  1YJN A;  3V7S A;  4FT2 A;  3OMC A;  3QO3 A;  3JCM X;  4LD9 K;  3JCM P;  3CEY A;  4ZGE B;  4BDY A;  2KDS A;  3CCQ T;  3JCM c;  2XK0 A;  4N4I A;  4HCC A;  4ZGJ B;  1DJ7 B;  1UGS B;  2E6N A;  3QZ5 B;  3OSS C;  3PIP A;  1BI3 A;  1JBM A;  2LQK A;  4A53 A;  2H3J A;  2RI5 A;  3CBM A;  1Q86 U;  3L2R A;  1VQ6 T;  2FVU A;  4B9W A;  2RJF A;  1KD1 U;  2IG0 A;  4F7U B;  4XU1 A;  3RUX A;  1G3W A;  4OGE A;  2DTH A;  4XQ3 A;  5LJ3 h;  4MDX A;  4RG2 A;  2JUF A;  4M75 F;  3I56 A;  1JJ2 A;  2CGH A;  2HNI A;  4XAX B;  5GAO q;  3G6E T;  1Q86 C;  4M75 G;  5LJ5 h;  1W2B S;  5LJ3 f;  2QEX A;  2R58 A;  2X4J A;  4C5I A;  4E7I A;  2LC4 A;  2K4Y A;  3QXE B;  1YIJ T;  3OS1 A;  4J7F A;  2L5Q A;  4FT4 A;  4N4G A;  5LJ5 f;  1SSF A;  3MEV A;  2KK4 A;  1OZ2 A;  3VU3 C;  4ZGD B;  3CCM A;  5LJ3 e;  3G71 T;  2XDD A;  1VUB A;  3HHT B;  4J7I A;  3QSU A;  4KUD K;  1YCY A;  2K5L A;  2PUK B;  2RO0 A;  3FLG A;  4J6Y A;  3MEA A;  5HK3 A;  2LT4 A;  5LJ5 e;  4M78 D;  2DTI A;  2A7Y A;  5GMK h;  2P4T A;  5I2S A;  4PJO A;  4NOY A;  3CCE T;  3P8B B;  4C92 C;  3CC2 A;  2EAY A;  1UGR B;  3CCS A;  3QKJ A;  4LDU A;  4DQ2 A;  1KHC A;  3CC4 T;  1M8V A;  3V7R A;  4N4H A;  2M1H A;  4Y91 A;  4A4K A;  3LWH A;  4JS4 A;  2CZ1 B;  2HQE A;  3CBO A;  3A8G B;  4FIB A;  3MHX A;  2RJD A;  2QA4 T;  4QQD A;  5L8R E;  1Y96 A;  3OMG A;  4FSX A;  5GMK e;  1K8A C;  1VQ5 A;  2B8A A;  2DD4 A;  2QI2 A;  3OW2 A;  1QVP A;  1WPY A;  4M77 D;  2EYQ A;  2JN0 A;  2MF2 A;  1QVG S;  3FIF A;  3T9N A;  1YJ9 A;  5FU7 B;  2KAF A;  3UT1 A;  3JB9 I;  1QVF A;  2EJF A;  4XK8 E;  5DM7 R;  4C8Q C;  1VQO A;  2QQB A;  3DLM A;  4M7D C;  3HFN A;  4M78 E;  3CXC A;  2ZPG B;  4N0A A;  2DJZ A;  3C12 A;  3SDZ A;  2RI3 A;  4RCB A;  3OYC A;  2EFI A;  1M1K U;  4QW2 A;  3VYG A;  4EMK B;  1KQ1 A;  2VXE A;  3V7C A;  4PJO F;  4NS5 A;  3GF5 A;  2EIF A;  4XU0 A;  4HT8 A;  4Z02 A;  4O5V A;  5GAN 8;  2OTJ T;  1MGQ A;  2ZGW A;  2JVV A;  4HKE A;  4MML A;  5IAY A;  4FU6 A;  3CME T;  4RMO A;  2EQM A;  3EFS A;  5LJ3 g;  2QXF A;  3L2W A;  4CI0 C;  3CD6 T;  1VQ4 T;  3L1A A;  2RK2 A;  2DEQ A;  4BY6 B;  5CR2 A;  1Y7X A;  1K73 U;  2E65 A;  1JB0 E;  3FDR A;  1LJO A;  3VJP A;  5LJ5 g;  4ZN3 A;  4J5Y A;  1XTD A;  2E1H A;  1VQN T;  4BD3 A;  4IUP A;  3P8D A;  4NL3 A;  2K5F A;  3UWN A;  5KH6 A;  1VQ9 A;  4EPC A;  2KQW A;  1YJN T;  2WSF E;  3MP6 A;  3PMI A;  1NPR A;  5KCH A;  4C0D C;  1YI2 A;  1AHJ B;  3BY7 A;  4XU3 A;  3OA6 A;  4M75 D;  1W2B A;  3RIR A;  2CS7 A;  2DZC A;  4QVD A;  1Q82 U;  2D0Q B;  2L3R A;  4A54 A;  5GAN d;  1Q7Y U;  1WQW A;  5AYF A;  3HRT A;  3RKY A;  3J81 E;  3G7Z A;  5GAM j;  3FRN A;  2MMP A;  5I21 A;  3OYJ A;  4PNO A;  3RKX A;  3CCU T;  5CK9 A;  3LW5 E;  4PLL A;  4C92 B;  5A0D A;  2PVD B;  1FXX A;  1XNI A;  3GIB A;  2L89 A;  2QQA A;  2JTM A;  3HKS A;  1BI0 A;  3OYE A;  4PLI A;  4P5N A;  5DLQ E;  3TEE A;  1O9S A;  2QQ9 A;  2QTX A;  4ME7 A;  3VV0 A;  1FX7 A;  1LOJ A;  2VC8 A;  3SWN C;  3H8Z A;  3LYI A;  4M7A A;  2DXB A;  1I5L A;  2QEX T;  1VQL A;  2DKG A;  2LCC A;  2E41 A;  3GOX A;  1N8R C;  5IN1 A;  3L2V A;  1VQK A;  3OB9 A;  4IUV A;  1RL2 A;  4M75 E;  5J39 A;  5GAN h;  3CCL A;  1WNL A;  1VQ8 A;  2CZ6 B;  5GAM d;  3P8H A;  3WVE B;  1G3Y A;  1M4Z A;  1N27 A;  2DXU A;  2JZ2 A;  2P0K A;  2GCX A;  4C8Q B;  3CCM T;  4JS5 A;  3RER A;  5FU7 C;  4M7D B;  5GMK l;  2XDP A;  1H64 1;  3CCJ T;  4HCB A;  5GAN f;  1VQP A;  4JUV A;  4MZP A;  3KXT A;  1NE8 A;  1ZQ1 A;  2F69 A;  1QVG A;  3PFS A;  3BW1 A;  1BI2 A;  3ME9 A;  2LVM A;  5I2M A;  1Y71 A;  3C4S A;  3QYH B;  4M7D A;  1NJI U;  2E70 A;  4II1 A;  4RG8 A;  2Y4Y A;  2HAX A;  1G5V A;  4M78 C;  3NTK A;  4EMK C;  5KE2 A;  4XTX A;  5GAN e;  4BAC A;  1RI0 A;  3PTA A;  2CZ7 B;  3LGL A;  2MWO A;  1R8O B;  3E9G A;  2BKD N;  2M9U A;  5GAO l;  1N6A A;  2PVO B;  4M7A F;  2EJG A;  3GNG A;  4BI3 A;  3QYG B;  3OYY A;  5GAM h;  3MP8 A;  5C6S A;  4BY6 C;  3QBY A;  3RES A;  4F7U A;  4C0G A;  1VQ5 T;  4PJO D;  4M7A G;  2P0Q A;  3NTI A;  1EIF A;  3CCV A;  4HT9 A;  4C0D B;  4O6J A;  1M90 C;  5GAM f;  1OZ3 A;  3M53 A;  2K3Y A;  2BUD A;  4M77 C;  3VKI A;  3PMT A;  4D6W A;  2JTF A;  2VYT A;  3X20 B;  4L6V 5;  3CC7 A;  2DXC A;  1WQ7 A;  3OS0 A;  1BYM A;  2E5Q A;  4MZT A;  5LL6 S;  1NZ9 A;  2VV5 A;  2LQ8 A;  1UGP B;  2DTO A;  5GAN 4;  5J26 A;  5GAM e;  2DD5 A;  4J83 A;  2ZCF B;  1G3T A;  1X6O A;  1WJR A;  5A2Q E;  3C95 A;  2OTL A;  4IKF A;  2E10 A;  1BKB A;  3G4S T;  3JB9 J;  4J6X A;  1MHN A;  2K2V A;  3ZFJ A;  1K8A U;  1I4K 1;  3PNW C;  1XQH A;  2ZPF B;  3X28 B;  3CMA A;  4PJO E;  2XID A;  3BFM A;  2JNG A;  4KUL A;  5GAN 3;  3OY9 A;  3SWN B;  3UPU A;  3LLR A;  4XTW A;  1G3S A;  4E47 A;  1KC8 C;  2M0O A;  3E9F A;  3HSB A;  1VQ9 T;  3VUZ A;  2XIC A;  4F7U F;  5KE3 A;  4V2S A;  3FJP A;  2EQK A;  3QUI A;  1WJQ A;  4VUB A;  3J7A F;  1M5Q 1;  4F7U G;  3CCQ A;  5D6W A;  5GAN g;  4B9X A;  2VGN A;  4ZTJ A;  1YI2 T;  2PUO B;  2G3R A;  2LRQ A;  3S3M A;  3DLL A;  3I55 A;  4E7H A;  2YRV A;  2ZPH B;  5HK0 A;  4M75 C;  2KSS A;  4BI4 A;  3HRS A;  1BI1 A;  1M1F A;  4BUG A;  3CCR A;  1S72 T;  1ZBX A;  2QQS A;  1YJW T;  2RH2 A;  3OSV A;  2DO3 A;  2ZPI B;  3JB9 D;  2V8I A;  4M78 B;  4LDW A;  3C94 A;  1V29 B;  1VIF A;  2GF7 A;  2RJC A;  2OAU A;  2XKO C;  3S6W A;  2V8J A;  3JCM f;  1XOV A;  2WAC A;  4PJO G;  2EQU A;  5D6Y A;  3JCM b;  5D6X A;  2RHI A;  3X26 B;  4C5H A;  3CPW S;  4EMK A;  2FHD A;  2RM4 A;  3M59 A;  4OB0 B;  1VQM A;  1VQL T;  1YIJ A;  5GAM g;  2K3X A;  1QP3 A;  1YIT A;  3SB2 A;  4JRQ A;  3TU4 K;  3CCL T;  5M9O A;  1VQ8 T;  2AHJ B;  3GNF B;  5CKH A;  1O75 A;  1TH7 A;  4M77 B;  3G71 A;  1YHQ A;  1ZHI A;  3JRZ A;  2MI6 A;  3DB3 A;  3QHS A;  5FRO A;  2GQV A;  3HRU A;  3N5B B;  5A0G A;  3V8K A;  3PIO A;  2CZ0 B;  4M7A D;  3WVD B;  3QJY A;  3EFR A;  2RHU A;  2WSC E;  4M77 A;  1PSE A;  2LX9 A;  1X01 A;  2R57 A;  1UGQ B;  4HCZ A;  2IVW A;  3VUB A;  4C0F A;  2YHT A;  4DOV A;  5GAN 6;  1Q81 C;  1VIE A;  3OBW A;  2NLU A;  2DPP B;  2F5K A;  5A0L A;  4QQ6 A;  2QA4 A;  1N8R U;  4LDX A;  4Y28 E;  4C5E A;  2EWN A;  2DAQ A;  4OB2 B;  4QQG A;  1M1G A;  4OVA A;  5GAO p;  2M16 A;  3HPW A;  3I56 T;  4E7L A;  1K9M C;  4C92 A;  2ZPE B;  3JCM W;  2L8D A;  4JRK A;  2EQJ A;  2I2L A;  3CBP A;  5CKD A;  4BE1 A;  5LJ3 j;  3OQ5 A;  4QVC A;  3CCV T;  5EG2 A;  3ASK A;  2KVQ G;  3JB9 F;  3RKW A;  3M55 A;  4OF1 A;  2CKK A;  4M7A E;  1KG1 A;  4LDY A;  4IUR A;  2K57 A;  5LJ5 j;  2V8K A;  3JB9 G;  1I8F A;  4M75 B;  1U1S A;  3UDC A;  2E12 A;  4YTL A;  4A4H A;  2O4X B;  4XTV A;  3ER0 A;  3JB9 H;  2PQW A;  3L2Z A;  1WGS A;  2LT1 A;  2OTJ A;  1D3B B;  3DKM A;  4C8Q A;  3BDL A;  2OTL T;  1Y07 A;  3OYN A;  3CC2 T;  4X34 A;  3X25 B;  3CCS T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...