2E5QA

Solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens]
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
GSSGSSGLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHD finger protein 19
publication title Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e5qA00
3P8HA 4QQ6A 3OYAA 1OZ2A 2EQMA 4IUTA 4A4FA 3ASKA 2B8AA 5IAYA 2JZ2A 3PMTA 3L2WA 4FU6A 4EDUA 3OMCA 3L2UA 3OYHA 3OS1A 1WGSA 2EKOA 3E9FA 2F5KA 2MWOA 3KUFA 2BIVA 5KE2A 4A4HA 2R5MA 2EQUA 2M16A 2RJEA 4IURA 4PLLA 3OYDA 3LX7A 3OYLA 5M9OA 3OYBA 4BD3A 3OYNA 3S3NA 4IUPA 4B9WA 3OS2A 2VYTA 2XK0A 5D6WA 4GY5A 2D9TA 2EQKA 2GFAA 5KCOA 4BE0A 3S3MA 2GFUA 4C5GA 5C0MA 2L3RA 2P0KA 2NLUA 1WJRA 4Q5WA 5KCHA 3META 3H8ZA 4CRIA 3H6ZA 2K3XA 3S6WA 2PQWA 2RI2A 5IN1A 2M0OA 3PNWC 2X35A 3LH0A 2EFIA 2RHXA 3QIIA 2XDPA 3OYKA 2L8DA 3MO8A 3FEOA 3DLMA 4BE1A 2CKKA 3F70A 4BACA 3OYCA 4B9XA 2JTFA 3DB3A 3OMGA 3OYFA 5D6YA 4BDYA 3NTHA 3MEWA 3LGLA 2K3YA 2QQRA 1OI1A 2G3RA 2RI3A 1SSFA 3PMIA 2L89A 3NTKA 3OYGA 1H3ZA 2R5AA 2MWPA 4E7HA 4BDZA 4QVZA 2GF7A 3MEAA 3ZEHA 3E9GA 2EQJA 3OS0A 3MEUA 2X4XA 3L2VA 1OZ3A 2E6NA 4HCZA 3EAEA 2RHZA 5C6SA 3MP1A 2DIQA 4N4IA 4OVAA 3OA6A 2X4WA 1WJSA 3S3OA 4II1A 4ZTFA 2IG0A 4IUVA 5FRMA 3ME9A 4IUQA 3L2QA 3FLGA 4LD6A 3FDRA 4FL6A 4C5EA 3LGFA 3O8VA 4QW2A 2M1HA 2RO0A 1RI0A 3QBYA 4A4GA 3OYMA 3NTIA 2LRQA 2O4XB 2RHUA 3UWNA 5J26A 2YRVA 3QKJA 2X4YA 4N4GA 2R57A 1G5VA 2RJFA 4X34A 1XNIA 3OB9A 4C5HA 4E7KA 3MP6A 2DIGA 4N4HA 4Z02A 2RJCA 2RJDA 4IKFA 5KH6A 2R58A 2WACA 2RHYA 5J39A 3UT1A 2O4XA 3OQ5A 4UC4A 3L42A 5D6XA 3BDLA 5FRNA 2E5QA 4C5IA 3P8DA 5CIUA 4PLIA 5KE3A 2HQEA 3M9QA 4IUUA 3OYIA 3MP8A 1N27A 3Q1JA 5FROA 2RI5A 2LVMA 4PL6A 3PFSA 3SD4A 3GOXA 2LCCA 4E7IA 4BE2A 1OYXA 4RG2A 1WJQA 2RHIA 3LYIA 4QQDA 4QQGA 3QJ6A 2BUDA 2FHDA 3C4SA 3DB4A 4L59A 1MHNA 3OYEA 4A4EA 3OYJA 4ZTJA 4NS5A 2BKDN 2HQXA 3L2RA 2DAQA 2LDMA 3FC3A 2LTOA 4E7LA 3OY9A 3CEYA 4E7JA 3MEVA 2QQSA 3LLRA 1KHCA
chains in the Genus database with same CATH superfamily
4FT4A 1ZBXA 4GLMA 3CCRQ 2JZ2A 2DFUA 3OYHA 4C92D 3QSUA 1X01A 2MWOA 2CP5A 1WIEA 4FIBA 1UDLA 4HCBA 1JB0E 3CCSQ 1Q82U 1R77A 1BIBA 2VYTA 4FYVB 3EH1A 2M51A 1JBMA 2L3PA 4C0GA 1UJYA 5KCHA 1TXQA 2CP7A 2JM8A 2K3XA 1M9SA 2J6FA 3CD6A 4M7AC 2Y90A 2DEUA 4WF2A 3DLMA 5CKEA 1T3SA 2JTFA 5CO7A 1H92A 5HK3A 3JV3A 2J05A 2DYIA 2EJ9A 3HRTA 3IQLA 2K79A 4J9DA 4XTUA 2G3RA 1SSFA 1TSFA 1UGVA 4RTXA 1PSFA 4XU2A 1VQ8T 2EQJA 1MV3A 3OS0A 2X4XA 1U8RA 2V8KA 1PKTA 3LWIA 5FRMA 2ABLA 4LD6A 4PK4A 1VQ6Q 2XKOC 5KYXB 1VQ7T 4LDVA 2I0NA 1D3BB 1TG0A 1VQKT 5LJ3g 3BY7A 1BBZA 2X4YA 4EMKB 5KYWB 1N6AA 3QYGB 2AK5A 2ED0A 2R58A 2WACA 3C0CA 3BDLA 4C8QF 1LVKA 4OMFB 4PJJA 3RKXA 4D8DA 4QVDA 5GAOp 4LUEA 2OI3A 2BUDA 3C4SA 3CCJQ 3OYJA 2BKDN 3QDFA 1G2BA 1RAAB 3FC3A 3OY9A 4R0KA 2CP6A 1GFDA 1MNDA 2EBPA 1ZLMA 5ECAA 5GANh 1VQ5T 4FYWB 2JXBA 3OMCA 4HA8A 1B3QA 2GBQA 2LZ6B 4KGVB 3WXMB 5HY6A 3LX7A 5DLQE 2EYZA 2VXEA 2CP3A 3EG9A 3S3NA 2LJ0A 4M77A 1GL5A 2ZPIB 2QYZA 5KCOA 2D9TA 2ESWA 5CKDA 2OJ2A 2RMOA 2KRSA 3M0SA 5C0MA 3CMAT 2L3RA 3SWNA 2E5KA 3QPHA 2IPOB 1M90C 1X2KA 2CDTA 3MPUB 4B9XA 3PE0A 2QGGA 3LWHA 5GAMj 4ZN1A 2COYA 2E64A 1VQ8Q 2XICA 4OMNA 2YDLA 1SEMA 3WVDB 2KNBB 2R5AA 1R8OB 4M7DF 3CXCA 3TREA 4ZTFA 2ZPGB 1YJ9A 1VQ7Q 2KYBA 3FLGA 1VQKQ 4ZNXA 1VQ9A 5KYYB 2LQ8A 2RNAA 3GIBA 3QKJA 2YRVA 2CUBA 1GRIA 3C94A 2J06A 3MP6A 1Q86U 1IRXA 4NL3A 1GFCA 1S72Q 1GCPA 2DJQA 3CBPA 3V8KA 1K73R 3I5SA 4J7FA 2D6FA 2NWMA 5GJVB 2BZYA 4PL6A 1JRIA 1NZ9A 2LCCA 4BI8B 2XHCA 2KAFA 5CKBA 2DILA 2RHIA 4BE2A 4M75D 1T3LA 1Y96A 2GNCA 3REAB 2OTJT 1M1KU 5GAMf 2LTOA 4M78A 1WYXA 1KQ1A 5AT1B 1VQ5Q 2HZYA 4MZTA 3PMTA 1WXUA 3QG1A 4LE9A 4JS5A 3E9FA 2F5KA 1D1CA 2IVWA 2BIVA 2YSQA 3CXCP 4PJOA 2EYWA 4RCCA 2MMPA 2LCSA 1NLOC 3TEEA 3M0UA 4Z8AA 3RKWA 2K9GA 3QHSA 2D0QB 3FJPA 2L0AA 3S3MA 1V76A 3VS1A 4F7UA 3TVTA 3G6EA 4X9CA 2RQTA 1Q82R 1X6OA 2KSSA 5IHKA 2KXDA 2MI6A 1K9AA 4ESRA 2K3YA 4BI4A 1QMCA 3N5BB 1Z9ZA 2COWA 2VWFA 2EJGA 1RAFB 1WFWA 4E7HA 2AT1B 4LDYA 1WI7A 1RAIB 2CS7A 5J3BA 1RAEB 4II1A 3VRZA 1JU5C 4J9CA 2LJ1A 3QXEB 1KC8U 2DXUA 3J81E 5CVIA 3NTIA 2LRQA 5A0LA 3CCQA 4N4GA 1WA7A 1NG2A 2ECZA 4C92E 4E7KA 4Z02A 1KJWA 2DD5A 3PT9A 1Y07A 2DL5A 2AHJB 3M56A 1TOVA 4XU0A 4C92B 1GCQC 2QEXT 3JSCA 2YRDA 1G83A 4E7ZA 4HCCA 2B86A 3CC2T 5I11A 3ZL7C 3M4YA 8ATCB 1GBRA 3L2RA 3NMZC 2QGFB 1VQ4Q 2XI9A 2RQRA 1V29B 2QG9B 3VKIA 3L2WA 4NOYA 3OBYA 1VQOQ 2X9HA 2R5MA 3LH5A 1FXXA 3OYNA 2LC4A 3CMET 3H0HA 2LX9A 1BYMA 3G4ST 5LJ5j 2CYZB 1IB8A 1NBEB 4X9DA 5CKFA 1OOTA 4HXJA 3JB9G 3GP8A 4AT1B 5LJ3h 1K73C 1YI2A 1M3BA 1IREB 5GAOl 2A0FB 2X51A 1QWEA 3MHXA 2DL8A 3O5ZA 3I56T 1BK2A 4ZGDB 3CCMA 2L89A 1TUCA 1NPRA 4JJNK 4C8QC 3I55A 4HCZA 2JUFA 1LOJA 5C6SA 2X4WA 2F2XA 2YT6A 4N0AA 1KHIA 1MGQA 3HRUA 5GAOq 3O8VA 1J3TA 3ULRB 3JB9H 1AWOA 4J9GA 4PFZA 1YCYA 5KYUB 1RLQC 1BCOA 4O5VA 4C92G 5FWCA 3JCMh 2ZPBB 4KH1B 1EIFA 5LJ5f 2NUPB 4HVWA 1WPYA 3L42A 3THKA 1Q82C 1WQWA 5FU7C 3EFOB 2E5QA 4M7AA 4PJNA 5D7UA 1UGQB 3CPFA 1Q86R 2FYKA 5GAMe 1B07A 4TVRA 2BE9B 1I4K1 1AWJA 1O75A 4XTWA 1VIFA 1VQPT 3CCRA 1PD1A 4CI0C 2Y4XA 2VGMA 1FYNA 1QLYA 3VS4A 5L23A 3EHRA 3MEVA 1CSKA 2W0ZA 3ZFJA 3E1SA 1W70A 4BUGA 4P5NA 1ZSZC 5IAYA 2RQWA 5GAN2 2B8AA 1PC0A 2JOYA 5FW9A 4DBQA 5I2MA 3OS1A 4JRKA 3CCSA 1M1KR 3CMEQ 1W2BA 2HBWA 1ZHIA 3G4SQ 4RG8A 2L3QA 1WHHA 2DXTA 1ACMB 2E6ZA 1VOMA 4M7DC 2E1HA 4EMGA 1JXOA 2NLUA 1TS9A 1HJDA 1GBQA 2ZCFB 2LT4A 3PNWC 4MMKA 2XDPA 3OYKA 4BE1A 4XTXA 3L2ZA 3G71T 1I5OB 2O2OA 2COZA 2VV5A 3A98A 1VQNA 1D09B 3UA6A 2YHTA 3RESA 3VU3C 2QA4T 2XDDA 2OTLT 2WSEE 1JJ2S 3JRZA 3MP1A 1X6BA 2M02A 3SFMA 2PVGB 2DVEA 1ZUYA 2KE9A 2YUPA 3BDUA 4RTWA 2YXYA 3INZA 4M75B 1V1CA 3U23A 4PFOA 1WHMA 4A53A 3VS2A 3DKMA 2HBPA 2A36A 1KC8R 4MMLA 5IT9E 1YCSB 4BB7A 2EGEA 3UT1A 1RLPC 1BCMA 1UTIA 2HSPA 3OQ5A 5KYWA 4OMOA 4BY6B 3CCJA 3OBWA 4JRIA 2QTXA 3D7SB 2D8HA 4J6XA 4C5EA 1Y57A 2DETA 4L59A 2QAZA 1YWPA 2DXCA 3H41A 1H8KA 4D8KA 4DQ2A 2EWNA 1O9SA 1WXBA 5GANd 3LLRA 3QBYA 2E65A 3P8BB 2YUNA 2RB6A 3H9NA 1Q81U 3RDVA 1M2OA 2HNIA 1QKWA 3JAME 1WX6A 5M9OA 3UF4A 5GMKj 4BD3A 1ZUKA 4KGXB 4LUDA 4B9WA 3CCLT 2K5LA 2OAWA 2K2MA 1N9SA 3HFOA 4OMMA 1PCXA 1BI3A 4N0AC 1VQ8A 2DBKA 2FZCB 4ELYC 3SHWA 1Q86C 3EH2A 1JEGA 1YITT 3X25B 1CKBA 2KGTA 2RI3A 3EGUA 3PMIA 1YJWT 2OTLQ 2KROA 3HHTB 1VQ7A 1VQKA 3JB9F 1OZ3A 3CPWS 5KYNA 1XTDA 1YIJT 4M75G 2KQWA 3JCMQ 1M1KC 3FDRA 2EYXA 2P0PA 1IGUA 3EHQA 2KI7A 1ZSGA 2O4XB 1I81A 1PHTA 1C6VX 1S72A 1AT1B 5LJ5e 2K4YA 1G5VA 3LW5E 1K0SA 3OB9A 1VQMT 2ED1A 2GCXA 1VQNQ 5DLOA 3A8MB 2P4TA 1ZBJA 4IIOA 4JZ4A 4KUIA 2PVOB 3RKYA 5FRNA 3A8OB 2RN8A 1JJ2P 5L8RE 2F2WA 4J9EA 1M3AA 1VQ5A 3VS3A 4FW1A 3QJ6A 4NS5A 1BKBA 4C92F 3FB9A 2A08A 2QQSA 4PJOD 1K0XA 3EG3A 1KHCA 2BZ8A 2FEIA 2RF0A 3L2UA 2HL3A 5KE2A 4A4HA 2PU9B 1GXIE 3OYDA 3EFRA 3R6OA 2PUOB 5CCAA 4AFZC 5CQXA 3FRNA 2Y4YA 3WVEB 4HT9A 3JCMf 1X75C 1KC8C 3CD6T 1NEGA 4GY5A 3CCUT 2GFUA 2O01E 2DO3A 3EGXA 2KT8A 2HCKA 3META 2C0OA 3H8ZA 4OGCA 2PQWA 2EFIA 1GCQA 1QCFA 1K8AU 1LNXA 1AWXA 3EG0A 2VB6A 3LGLA 4KRTA 3CCVT 3E2UA 3I5RA 3NTKA 3M54A 2X3XD 2VVKA 4QVZA 2JMCA 2K6DA 4CC2A 3MEUA 2KRNA 1VYVA 3OSSC 2KYMA 4EMKC 4RTUA 5GAN8 1QVGS 2DA9A 1MUZA 3EG1A 1B7TA 2DEQA 3J80E 4XTZA 3LGFA 4R55A 2RO0A 3VUBA 4LN2A 2DPPB 1TU0B 1PG5B 3EG2A 5GAN4 4RMOA 5J39A 2MIOA 2FPDA 1U06A 3V8JA 1PWTA 5IXFA 2BE7D 2MF2A 2O9SA 1WZOA 4KUDK 4QVCA 2DRMA 3CPWP 2L3SA 1VQ4A 3V7SA 3SD4A 2EPDA 4C0DB 1OYXA 1TWBA 2DLPA 3QWYA 4RG2A 2D8JA 2MAMA 2GTOA 2RQVA 2PZ1A 4E7LA 3RBBB 1VQOA 4NL2A 4RTZA 3URGA 4C8QA 4HVUA 3TQ7P 1HXDA 4JRQA 3QDRB 1FMWA 4HKEA 1AZEA 2ZAEA 2QASA 3CCUQ 2E3IA 2RH2A 2ZZDA 3CC4T 1KIKA 2ZPFB 3VS0A 1Q7YU 2AKLA 2L2PA 1Q81R 3BE3A 5LJ3d 4FYXB 2P0KA 4Y91A 2QDLA 1K76A 2XDBA 1ZA2B 2X35A 2AKKA 4MZPA 2BTTA 3CCVQ 7AT1B 1IHWA 2XU8A 3OS5A 3DB3A 4J6WA 3UDCA 1HYOA 2LQNA 2MOXA 1OULA 5A0DA 2KK4A 2RK1A 2CSIA 3CMAQ 1YHQT 2X3WD 2GF7A 2EIFA 3VYGA 1UECA 1NLPC 1XQHA 2E6NA 1ZSZA 5GAMg 4AG1C 5GMKe 4DOVA 2SEMA 3CBOA 2VXFA 3JCMd 3UWNA 5J26A 2XG8D 4M77E 1BB9A 4M7AD 1YN8A 4M7DA 4KULA 1AHJB 4LXCA 1WHGA 3MCAB 4B6MA 1Y71A 3EG9B 1JO8A 4M75F 4R56A 2QXFA 4A4KA 5CIUA 4PLIA 3KBGA 1OX8A 2V1RA 3SWNB 1QVGP 3GOXA 3PFSA 2FG0A 2LX7A 3RR6A 1UHCA 4ANJA 2J7IA 3EFOA 4ZTJA 3DB4A 2DK3A 1BIAA 1PNJA 2PUKB 1X69A 3CMEA 4PFPA 3I9QA 2IIMA 2KT1A 3G4SA 3J7AF 2EW3A 3JCMe 3CC4Q 5IXBA 2HQHA 4IURA 4PLLA 3M0QA 3HRSA 2OTJQ 1HSQA 4J5YA 2ROTA 3KXTA 3A8HB 3X24B 2JN0A 1G3YA 3OS2A 1D1AA 5GANj 3TCJA 2QQBA 4A54A 5DM7R 5AYFA 1UHFA 1WDXA 3VV0A 2HAXA 1EZZB 4OB0B 1I5LA 1M1FA 2MK5A 1AEYA 2RA2A 2E12A 4BDYA 2K5IA 1YHQQ 2H3JA 3REBB 4E6RA 1FMVA 2YUOA 2EAYA 1Z9QA 3EFSA 4M78E 2O9VA 1K8AR 1Y0MA 3CCET 3EAEA 2J6KA 3OA6A 3S3OA 3CCQT 2DTIA 3HTRA 2HSEB 1IGQA 3OW2S 4XTYA 4OGEA 2QK0A 2EJFA 2M1HA 3R6NA 1JQQA 1RI0A 4PJOE 4CC4B 1KG1A 1K4US 2CREA 5FU6B 4C92C 3BW1A 1Q81C 4J8OA 2DXBA 2EYQA 5HCKA 4PJOB 1VQLT 4F7UE 4RTVA 5GANf 3BFMA 2GQIA 4DBRA 5GMKm 4C5IA 1ABOA 3JCMb 2HQEA 3X28B 4OMPA 4F7UB 1TTHB 4JJCA 1G3WA 2PTKA 4FSXA 1NYGA 1NJIU 2HQXA 1M8MA 2AZSA 1KSWA 2FB7A 5I22A 4O6JA 3VS6A 2V1QA 2QEXQ 3OYAA 2WSFE 1UGSB 2KMTA 4PKCC 2F2VA 1IZ6A 4EDUA 2JS0A 3CC2Q 5IHIA 5LL6S 4F04B 4ZGEB 2M16A 4IIMA 4CC7A 3M4GA 1SG5A 2DBMA 2C06A 2JT4A 2XK0A 2DTHA 3RERA 4XQ3A 1IHVA 4AFQC 4Q5WA 4CRIA 3CQTA 2K3BA 1QWFA 1H3HA 5GMKl 2RHXA 1PRLC 1Q7YR 3FEOA 4FSSA 1YP5A 4BACA 2OTLA 2D0NA 1QQJA 2E41A 4PJLA 2VUBA 1KQSS 2W10A 5LJ5g 4M4ZA 3I55T 2O31A 4JPBW 3CCEQ 2RD1A 4GLKA 4XU3A 4RTYA 2JW4A 2RHZA 3X26B 2RK2A 4F16A 4IUVA 4CC3A 3ME9A 5FWBA 1UEBA 3I56Q 1R0BG 3JCMW 4PJOG 3M57A 2DF6A 4JZ3A 1D0YA 1VQLQ 2RJFA 2KR3A 1X6GA 5KH6A 2CZ1B 2AZVA 4F7UG 2O4XA 1OU8A 2K5FA 3M53A 1RI9A 2GGRA 3CCRT 3M9QA 1N27A 2E3HA 2GTJA 1WHJA 3A1PA 1Y7XA 4QQGA 4A4EA 2M9UA 2LDMA 1YNZA 3ZBDA 3CCST 1K8AC 1AD5A 1BI0A 5KYXA 2LT1A 4QQ6A 1D3BA 2VGNA 3NPFA 5EC7A 1YWOA 5I21A 1RABB 4EMKA 3JCMP 1QKXA 2FPEA 1SKUB 2YRCA 1FWZA 3T9NA 1VQPQ 3AHUA 1NPPA 1ZX6A 2DVJA 3V8LA 4OP0A 5GAMh 4C5GA 5I2SA 1D1BA 1UE9A 1W4SA 2RPNA 3M0TA 3ER0A 1VYTA 3G7ZA 2DTOA 4M77D 5GJWB 2L8DA 1D0XA 2BZXA 4M7AE 2M0YA 4OB1B 1F1BB 1YJNT 3MEWA 1YIJA 1SHFA 2HMAA 1VQ6T 4QKUA 2A28A 1RADB 5CR2A 2DYBA 1UB4A 1OX9A 4M7AB 5LJ3j 5GMKi 2LNVA 3MEAA 3E9GA 3C12A 3ZEHA 1NYFA 4M75C 4OF1A 1JJ2A 2A3LA 3G71Q 1QCNA 1VIEA 1RAHB 2LNHB 1R0CB 3RIRA 1OV3A 2YLBA 4BY6C 2RHUA 3CC7T 4X1VA 2QA4Q 5GANe 1KQSP 1E7OA 1OU9A 2JVVA 1N8RU 2JM9A 3VS7A 1TUDA 1MNEA 4V2SA 2DE0X 2KY9A 1Q7YC 1KQ2A 2DL7A 3PVLA 2NUTB 4AMCA 2CH4A 1UFFA 2LVMA 2RI5A 3QZ5B 3VUZA 4C8QD 2FHDA 3M0PA 4DEXA 4M77F 1H641 2K57A 1PRMC 4RKUE 5KYYA 2DKGA 2NYSA 1OPKA 3AT1B 2CH4W 1TUGB 2JTMA 4IUTA 5LJ3f 3CCUA 4FU6A 1NJIR 2FL7A 2YWWA 3EGDB 1UGRB 3UPUA 4M78D 4MDWA 2RJEA 2HKNA 3M0RA 3OYLA 2G6FX 1UJ0A 2LP5A 4QT7A 4IUPA 5D6WA 2GFAA 2EQKA 2F1LA 3MJXA 5GAN5 2CT4A 3TSZA 2YUQA 3CCVA 2CZ6B 3H6ZA 1UUEA 2CT3A 1YJNQ 4XU1A 1LCKA 3CMAA 4M7AG 3CCLQ 5FLXE 3VS5A 1G3SA 4ELZC 4HCKA 4J9FA 2P0QA 2FRYA 1QVFS 3CXCS 3CPWA 4OVAA 2P4RA 1S72T 1YITQ 4IUQA 3L2QA 1KD1U 2DZ9A 2QDYB 4FL6A 3CC7Q 4LDXA 1P92A 4M7DD 2QQAA 1YJWQ 4A4GA 4C0FA 1SRLA 2XMFA 2J6OA 4LDUA 1LPLA 4ZN3A 1M2VB 4X34A 1QCOA 1MMGA 3QO3A 4M78F 4E2FB 4XAXB 5DY9A 1E6HA 1B34B 1YIJQ 1QP2A 2FZKB 2V26A 4OB3B 3TSWA 5A2QE 4JJDA 1XJWB 3JCMg 2OAUA 3A8GB 2O88A 4IUUA 4RTTA 2VKNA 4PJOF 2KEAA 4FM4B 2FRWA 1YBYA 2HEQA 1AVZC 1VQMQ 3QZ9B 4HT8A 3VJPA 4JRPA 3CEYA 4E7JA 3A5ZB 4F7UF 2CZ7B 2DL4A 1MMNA 1ZA1B 3P8HA 3CC4A 1M30A 5LJ5h 2LQKA 3ASKA 1WNLA 3JCMX 2OTJA 4KBMB 2EGCA 3KFVA 2C0TA 1VA7A 2EQUA 2E70A 2KRMA 1PSEA 1PM3A 4C92A 2PNIA 5CKHA 1MV0B 1LJOA 1QVFA 1RAGB 3RMQA 4JS4A 4WCIA 1TH7A 3M5AA 3M55A 5GAN7 1K9MU 1DJ7B 2JJ9A 1YHQA 3LH0A 3X20B 4PJMA 1M8VA 3NHNA 3MO8A 4OB2B 2NUZA 1BU1A 1ZUUA 5HK0A 4JDSA 1AZGB 4FW2A 3CD6Q 1OI1A 3GNGA 2F69A 3QJYA 1N9RA 1AOJA 1JXMA 2MWPA 4BDZA 2MYSA 3H0FA 1NJIC 2CUDA 1WJSA 2FVUA 6AT1B 1QVGA 2LCLA 3PIOA 1YFNA 3NFCA 3L1AA 3NGPA 3C95A 1G8XA 2R57A 2HKQB 4ME7A 1YJ9T 5GAOn 4K11A 2C0IA 4IKFA 4C0DC 1VQ9T 1VQ4T 4VUBA 4J9HA 5D6XA 2X4JA 5EG2A 2F5TX 1QVFP 3PGGA 5KE3A 4RUGA 4AG2C 1VYUA 1N8RR 1QP3A 2JMAA 2ATCB 3EGXB 1WXTA 1VQOT 2AIRB 1M3CA 2EKHA 4BI3A 2Z0WA 2CZ0B 4QQDA 3OYEA 2D1XA 2QEXA 5LJ3e 4DBHA 2A37A 1K1ZA 3CBMA 5GAN3 3CC2A 1OZ2A 1RUWA 4KT0E 4A4FA 2JS2A 5KYUA 4M77B 3RNJA 2EKOA 4J9IA 2MCNA 2KBTA 3QYHB 2NUPA 1T0JA 4AFSC 3OYYA 1HD3A 3M59A 1WHKA 1WJRA 2CP0A 3M58A 1UGPB 1EX4A 4E7SA 2RI2A 1MMAA 2M0OA 1I07A 1NEBA 3QIIA 2CKKA 3CCEA 3OYCA 2DJZA 1A0NB 2EYYA 3NTHA 2FPFA 5IHNA 2QQRA 1FMKA 4L6V5 2H8HA 3JCMV 3HSBA 2ENMA 2OX7A 3G6ET 5CAIA 3RUXA 3OYGA 4JUVA 2PVDB 2DMOA 4J83A 4XTVA 1T0HA 3JCMJ 1RACB 3JB9I 4Y92A 1PKSA 3I56A 1U5SA 3L2VA 3GF5A 1I0CA 4N4IA 2LQWA 4C8QE 2IG0A 2QTVA 2CP2A 5GAOm 3HFNA 4LNPA 1VQLA 4M7AF 4KH0B 1W1FA 1M1GA 1S1NA 1YJ9Q 4C8QB 4M77C 2YLCA 2RQUA 1BI1A 5IH2A 1VQ9Q 1HK9A 2KVQG 3FIFA 3HKSA 1KD1R 1M90U 2JNGA 2DIGA 4N4HA 3SWNC 2MPXC 1C0MA 1Y96B 1AWWA 1X27A 1WHLA 5HKCA 4M78B 4JJBA 4WTOB 2RM4A 1EFNA 1KFZA 2E4HA 2H3EB 2ZPHB 2HDAA 2QI2A 4RCBA 5FU7B 2DAQA 4MZMA 4M77G 5GMKh 2DD4A 2EGAA 1ARKA 4DBFA 2XD0A 3QWXX 3SB2A 2CSQA 4JLIA 4M75A 1VQPA 3GLXA 1M5Q1 1D0ZA 1WGSA 1ZQ1A 3KUFA 1W2BS 2KXCA 3OYBA 4DOWA 1ZSZB 5GAMd 4ZGJB 3HP9A 1BI2A 1CKAA 3PVQA 4BE0A 2QQ9A 4J7IA 4M7DE 5A0GA 2A7YA 3S6WA 2LMJA 2HL5C 2DL3A 1I1JA 1NM7A 1SRMA 3HPWA 1N8RC 3F70A 2DM1A 4M7DB 3G6EQ 3OMGA 3OYFA 5D6YA 3DLLA 3PTAA 4DEYA 2ROLA 4F14A 1K9MR 4EPCA 5GANg 1MMDA 3FJ5A 4EIKA 4M78C 2VASA 3G71A 4KGZB 1YI2T 4AFUC 2V8IA 5FU6C 8AT1B 3V7CA 3JCMc 2DIQA 2ZGWA 4FCYA 4C8QG 3CCMT 2QA4A 4PJOC 3OW2A 4MDXA 4FYYB 3OSVA 1UG1A 1QW1A 1XOVA 3E19A 5CQYA 3MKDA 4DA4A 2DZCA 4C5HA 3TU4K 2RJCA 2RJDA 4OMLA 3CCQQ 4M78G 1C1AA 2RHYA 4ORZA 2HD0A 2DNUA 4LDWA 3SDZA 1RL2A 4J6YA 3V7RA 3OYIA 2CGHA 5FROA 3GNFB 4FT2A 3VRYA 4J9BA 1QVPA 2ZPEB 3PIPA 4E7IA 1WJQA 3LYIA 3H0IA 3G1JA 2NUTA 2VC8A 3QUIA 2EQMA 9ATCB 4JLGA 2FO0A 1ABQA 1SPKA 4A63B 1I8FA 1PD0A 1Q95G 1W6XA 1E6GA 2E10A 2WSCE 3OW2P 1KD1C 1NE8A 1FX7A 1U1TA 3EGDA 1X43A 1YJNA 3GPLA 3GBQA 5GAN6 5CK9A 3I35A 4M7DG 1VQ6A 2JTEA 3VYHB 4M75E 5IN1A 3CCLA 3UA7A 2K2VA 3SEMA 4LD9K 4Z88A 2DRKA 1SHGA 4HVVA 3RMSA 1OQKA 1KQSA 1M27C 2LJ3A 1YI2Q 1VUBA 1SSHA 4Y28E 1W2BP 1H3ZA 4Z89A 2DX1A 2V8JA 2XIDA 2EVRA 1YITA 5GAOr 1X2QA 3A8LB 3CCMQ 3CC7A 4C0ZA 1YJWA 1VQNT 1IXDA 3I55Q 3JB9D 2L5QA 4EMHA 2I2LA 4QW2A 3OYMA 2FZGB 2GQVA 1K73U 2EQIA 1G3TA 1M4ZA 1XNIA 2P84A 1KK7A 4F17A 1U1SA 3JB9J 1WQ7A 2DERA 4UC4A 1N5ZA 2KDSA 4L5GA 4D6WA 4ATOA 1M2VA 4GBQA 4OMQA 3P8DA 1U3OA 1IO6A 1M90R 3UATA 2K7AA 1VQMA 3MP8A 4YTLA 3Q1JA 1B34A 1OPLA 1K9MC 2SRCA 4PNOA 4XK8E 1MHNA 1WLPB 1OEBA 5LJ5d 3HL8A 3CCJT 4E47A 1SF9A
chains in the Genus database with same CATH topology
3P8HA 4BUGA 4P5NA 3CC4A 4FT4A 5IAYA 5LJ5h 2LQKA 1ZBXA 2B8AA 3ASKA 2JOYA 5GAN2 1WNLA 2JZ2A 3G4SA 3JCMX 3J7AF 2OTJA 4KBMB 3OYHA 5I2MA 3OS1A 4C92D 4JRKA 3CCSA 1X01A 3QSUA 2MWOA 3JCMe 1W2BA 2EQUA 4FIBA 2E70A 4IURA 4PLLA 1ZHIA 1VQ5A 4HCBA 3HRSA 4RG8A 4J5YA 1JB0E 3KXTA 1PSEA 3A8HB 3X24B 2JN0A 1Q82U 2DXTA 1G3YA 1BIBA 2VYTA 4C92A 3OS2A 2E6ZA 5CKHA 4M7DC 1LJOA 5GANj 1QVFA 2E1HA 3RMQA 1JBMA 2QQBA 3TCJA 5AYFA 4A54A 4C0GA 1TH7A 4EMGA 5DM7R 5KCHA 2NLUA 3M5AA 3M55A 4JS4A 5GAN7 3VV0A 1K9MU 1DJ7B 2ZCFB 2K3XA 1YHQA 1M9SA 2LT4A 3PNWC 2HAXA 4OB0B 1I5LA 1M1FA 3LH0A 3X20B 3CD6A 4MMKA 4M7AC 2XDPA 3OYKA 1M8VA 2Y90A 3MO8A 4OB2B 3DLMA 3L2ZA 4WF2A 4XTXA 2RA2A 5CKEA 3G71T 5HK0A 2E12A 4JDSA 2JTFA 5CO7A 4BDYA 2K5IA 5HK3A 4XTUA 3HRTA 2EJ9A 3PIPA 2VV5A 1OI1A 2H3JA 1VQNA 2G3RA 1SSFA 3GNGA 2F69A 3QJYA 1N9RA 2YHTA 3RESA 1PSFA 4XU2A 3VU3C 2EAYA 2MWPA 3EFSA 2QA4T 4BDZA 1VQ8T 2XDDA 4M78E 2EQJA 3OS0A 3CCET 2X4XA 1U8RA 2OTLT 2WSEE 3EAEA 1JJ2S 3JRZA 3MP1A 3OA6A 1NJIC 3S3OA 2FVUA 1WJSA 2V8KA 3SFMA 2LCLA 3PIOA 2PVGB 3LWIA 3CCQT 1QVGA 5FRMA 2DVEA 3NFCA 2DTIA 3L1AA 4LD6A 3OW2S 4XTYA 3BDUA 3C95A 4OGEA 2EJFA 3INZA 2M1HA 4PJOE 1RI0A 2XKOC 1VQ7T 4LDVA 1KG1A 1D3BB 1VQKT 4M75B 5FU6B 5LJ3g 3BY7A 4C92C 3BW1A 2X4YA 2R57A 4EMKB 1Q81C 4ME7A 4A53A 4J8OA 3DKMA 1YJ9T 2DXBA 2EYQA 2HBPA 5GAOn 1N6AA 4PJOB 3QYGB 4MMLA 5IT9E 4BE1A 4IKFA 4C0DC 1VQ9T 4F7UE 4BB7A 2R58A 2WACA 1VQLT 1VQ4T 3UT1A 3OQ5A 4VUBA 5GANf 5D6XA 3BDLA 4C8QF 3BFMA 4BY6B 2X4JA 5GMKm 4OMFB 3RKXA 4C5IA 5EG2A 2F5TX 3CCJA 3PGGA 5KE3A 3JCMb 3OBWA 2HQEA 4JRIA 3X28B 2QTXA 4F7UB 4QVDA 1QP3A 4J6XA 1VQOT 1G3WA 5GAOp 4C5EA 4BI3A 4FSXA 4QQDA 2CZ0B 4L59A 2BUDA 3C4SA 3OYEA 2QEXA 3OYJA 1NJIU 5LJ3e 2BKDN 2HQXA 2DXCA 3FC3A 3CBMA 2FB7A 4DQ2A 3OY9A 2EWNA 1O9SA 5GAN3 3CC2A 4BE2A 5GANd 4O6JA 3LLRA 3QBYA 2E65A 3OYAA 2WSFE 1UGSB 1OZ2A 4KT0E 4A4FA 2KMTA 3P8BB 4PKCC 5GANh 1IZ6A 4EDUA 3OMCA 1VQ5T 4M77B 2RB6A 4HA8A 2EKOA 1Q81U 5LL6S 4ZGEB 2M16A 2HNIA 3WXMB 5HY6A 3QYHB 3LX7A 5DLQE 3JAME 3M4GA 5M9OA 5GMKj 4BD3A 2VXEA 2C06A 3S3NA 4M77A 4B9WA 3CCLT 2ZPIB 2XK0A 3OYYA 5KCOA 2D9TA 2DTHA 2K5LA 3RERA 4XQ3A 5CKDA 3M59A 1N9SA 5C0MA 3CMAT 2L3RA 4Q5WA 3SWNA 1WJRA 3HFOA 3M58A 1UGPB 3QPHA 4CRIA 2RI2A 2M0OA 5GMKl 1BI3A 2RHXA 3QIIA 4N0AC 1M90C 1VQ8A 4ELYC 3FEOA 2CKKA 1Q86C 3CCEA 3OYCA 4BACA 2DJZA 4B9XA 2OTLA 1YITT 3X25B 2E41A 2VUBA 3NTHA 1KQSS 3LWHA 2QQRA 4L6V5 5LJ5g 5GAMj 4ZN1A 3JCMV 2E64A 3I55T 3HSBA 2XICA 2RI3A 3PMIA 1YJWT 3G6ET 3WVDB 5CAIA 3RUXA 2RD1A 3OYGA 4JUVA 4GLKA 2R5AA 1R8OB 2PVDB 4J83A 4XU3A 3HHTB 1VQ7A 4XTVA 3JCMJ 1VQKA 3JB9I 3JB9F 4M7DF 3I56A 3L2VA 3CXCA 1OZ3A 3GF5A 2RHZA 3TREA 3X26B 3CPWS 4N4IA 2RK2A 4C8QE 4ZTFA 2IG0A 2ZPGB 1XTDA 4IUVA 4M75G 2KQWA 3JCMQ 3ME9A 5GAOm 3HFNA 1YIJT 1YJ9A 1M1KC 3FLGA 1UEBA 3FDRA 1VQ9A 1VQLA 4M7AF 3JCMW 2LQ8A 1M1GA 4PJOG 2P0PA 4C8QB 2O4XB 1I81A 2YLCA 3M57A 4M77C 3GIBA 1S72A 2YRVA 2K4YA 3QKJA 1BI1A 5LJ5e 1G5VA 1HK9A 3LW5E 2KVQG 3FIFA 2RJFA 3HKSA 3OB9A 3C94A 1M90U 2JNGA 3MP6A 2DIGA 4N4HA 3SWNC 1Q86U 4NL3A 1VQMT 5KH6A 2CZ1B 2GCXA 5DLOA 3A8MB 4F7UG 2P4TA 2O4XA 4KUIA 2K5FA 2PVOB 3RKYA 5FRNA 3CBPA 3M53A 3A8OB 1Y96B 3V8KA 4J7FA 2D6FA 3CCRT 3M9QA 5HKCA 4M78B 1N27A 5L8RE 2RM4A 4PL6A 1JRIA 1NZ9A 2LCCA 4BI8B 2KAFA 2XHCA 5CKBA 1Y7XA 2RHIA 2ZPHB 4QQGA 4M75D 3QJ6A 2QI2A 1Y96A 4RCBA 4A4EA 2M9UA 4NS5A 5FU7B 1BKBA 2DAQA 2OTJT 2LDMA 4MZMA 1M1KU 4C92F 5GAMf 2LTOA 4M78A 4M77G 3FB9A 3ZBDA 3CCST 1K8AC 5GMKh 2DD4A 1KQ1A 2QQSA 4PJOD 2XD0A 3SB2A 1KHCA 1BI0A 2LT1A 4QQ6A 4JLIA 1D3BA 2VGNA 4M75A 4MZTA 3PMTA 1VQPA 3GLXA 3QG1A 5I21A 1M5Q1 4EMKA 3L2UA 3JCMP 4JS5A 1WGSA 1ZQ1A 3E9FA 2F5KA 2IVWA 3KUFA 2BIVA 1FWZA 4A4HA 5KE2A 2PU9B 1W2BS 4PJOA 1GXIE 3T9NA 3OYDA 3EFRA 3R6OA 2PUOB 5CCAA 3OYBA 4RCCA 2MMPA 4DOWA 3TEEA 5CQXA 3AHUA 3FRNA 2Y4YA 3RKWA 1NPPA 3WVEB 5GAMd 3V8LA 4HT9A 4ZGJB 3JCMf 1X75C 3HP9A 1BI2A 2D0QB 3QHSA 3FJPA 4GY5A 3CCUT 4BE0A 1KC8C 3S3MA 3CD6T 2QQ9A 4OP0A 2GFUA 5GAMh 4F7UA 2O01E 4J7IA 4C5GA 2DO3A 3CMEA 5I2SA 1W4SA 4M7DE 5A0GA 3META 3H8ZA 4OGCA 3G6EA 2A7YA 4X9CA 3S6WA 2PQWA 3ER0A 3G7ZA 2DTOA 2EFIA 4M77D 3HPWA 2L8DA 1X6OA 1N8RC 3F70A 2KSSA 2MI6A 4M7DB 4M7AE 1K8AU 4OB1B 1LNXA 3OMGA 5D6YA 3OYFA 3DLLA 1YJNT 3MEWA 3LGLA 3PTAA 2K3YA 4BI4A 3N5BB 1YIJA 4EPCA 5GANg 3CCVT 1VQ6T 2EJGA 3NTKA 4M78C 3M54A 5CR2A 3G71A 1UB4A 4M7AB 5LJ3j 4E7HA 5GMKi 4LDYA 1YI2T 4QVZA 2LNVA 3MEAA 3E9GA 3C12A 3ZEHA 2V8IA 3MEUA 4M75C 5FU6C 2CS7A 3OSSC 4OF1A 3V7CA 1JJ2A 3JCMc 2DIQA 2A3LA 2ZGWA 5J3BA 4EMKC 4II1A 5GAN8 1QVGS 4C8QG 1VIEA 3CCMT 3QXEB 2DEQA 2QA4A 4PJOC 3J80E 3OW2A 1KC8U 4MDXA 4XTZA 2DXUA 3J81E 3RIRA 3LGFA 5CVIA 4R55A 2RO0A 3OSVA 5GAOq 3NTIA 3VUBA 2LRQA 1QW1A 2YLBA 2RHUA 4BY6C 5A0LA 3CC7T 3CCQA 2DPPB 1XOVA 3E19A 4N4GA 5CQYA 4DA4A 5GANe 2DZCA 4C5HA 4C92E 3TU4K 2JVVA 4E7KA 4Z02A 1N8RU 2DD5A 2RJCA 2RJDA 3PT9A 5GAN4 4RMOA 4M78G 2RHYA 5J39A 1Y07A 2AHJB 3V8JA 4V2SA 2HD0A 3M56A 2KY9A 2MF2A 4LDWA 3SDZA 4XU0A 4C92B 2QEXT 1RL2A 1Q7YC 3JSCA 4J6YA 4KUDK 3V7RA 1KQ2A 3OYIA 4QVCA 2CGHA 5FROA 4HCCA 3GNFB 1VQ4A 3CC2T 3V7SA 2RI5A 2LVMA 4FT2A 3SD4A 1QVPA 2ZPEB 3M4YA 1OYXA 3QZ5B 1WJQA 4RG2A 3LYIA 3VUZA 4C0DB 4C8QD 2FHDA 2MAMA 3L2RA 4M77F 1H641 2K57A 2XI9A 4E7LA 4RKUE 1VQOA 1V29B 2VC8A 3QUIA 2DKGA 4NL2A 2JTMA 2EQMA 3URGA 4IUTA 5LJ3f 4C8QA 4JLGA 3VKIA 3CCUA 3L2WA 4FU6A 4NOYA 3OBYA 1HXDA 4JRQA 2FL7A 3UPUA 1UGRB 1I8FA 3QDRB 4M78D 2R5MA 4HKEA 4MDWA 2RJEA 3OYLA 2RH2A 1FXXA 2ZZDA 3OYNA 2LC4A 3CMET 2E10A 2WSCE 4IUPA 3CC4T 2LX9A 1BYMA 1KD1C 2ZPFB 5D6WA 3G4ST 5LJ5j 1NE8A 1FX7A 2GFAA 1U1TA 2EQKA 1Q7YU 2CYZB 1YJNA 3GPLA 5GAN6 4X9DA 5CK9A 5LJ3d 5CKFA 5GAN5 2P0KA 4Y91A 3JB9G 3CCVA 4M7DG 3GP8A 1VQ6A 2CZ6B 3H6ZA 3VYHB 4M75E 2XDBA 5IN1A 5LJ3h 1K73C 3CCLA 2X35A 1YI2A 4MZPA 4XU1A 1IREB 5GAOl 2K2VA 4LD9K 2XU8A 3OS5A 3CMAA 3DB3A 3RMSA 3MHXA 4M7AG 4J6WA 4M7DD 1KQSA 3UDCA 5FLXE 3I56T 1VUBA 4ZGDB 3CCMA 4Y28E 1G3SA 2L89A 4ELZC 5A0DA 2KK4A 2RK1A 1NPRA 1YHQT 1H3ZA 4JJNK 2V8JA 2P0QA 2XIDA 1YITA 5GAOr 2GF7A 2EIFA 3VYGA 1QVFS 3A8LB 4C8QC 3CC7A 3I55A 1XQHA 4C0ZA 2E6NA 3CXCS 4HCZA 2JUFA 1LOJA 5C6SA 3CPWA 4OVAA 1YJWA 2X4WA 1S72T 1VQNT 4IUQA 3L2QA 1KD1U 4N0AA 5GAMg 2DZ9A 2QDYB 4FL6A 4LDXA 1KHIA 1MGQA 3JB9D 1P92A 2L5QA 3HRUA 2QQAA 4EMHA 2I2LA 3O8VA 4QW2A 4A4GA 4DOVA 4C0FA 5GMKe 3OYMA 3CBOA 3JB9H 2VXFA 3JCMd 3UWNA 5J26A 2XG8D 4LDUA 1YCYA 2GQVA 4ZN3A 1K73U 4M77E 1G3TA 4X34A 1M4ZA 1XNIA 4O5VA 4M7AD 4C92G 3JCMh 3QO3A 4M78F 4M7DA 1U1SA 4KULA 1AHJB 2ZPBB 3MCAB 3JB9J 4XAXB 5DY9A 1B34B 1WQ7A 1QP2A 5LJ5f 1EIFA 1Y71A 4OB3B 4UC4A 1WPYA 2KDSA 3L42A 4L5GA 1WQWA 5FU7C 4D6WA 5A2QE 4M75F 1Q82C 4ATOA 2E5QA 4R56A 2QXFA 3P8DA 4A4KA 3JCMg 5CIUA 2OAUA 3A8GB 4PLIA 4M7AA 3KBGA 4IUUA 1VQMA 3MP8A 4YTLA 1UGQB 3Q1JA 3CPFA 2FYKA 5GAMe 1B34A 4PJOF 4TVRA 3SWNB 3GOXA 4E7IA 3PFSA 1K9MC 1I4K1 4FM4B 1YBYA 4ZTJA 3DB4A 4PNOA 1MHNA 2DK3A 4XK8E 1O75A 4XTWA 1VIFA 1VQPT 3QZ9B 1BIAA 4HT8A 3VJPA 3CCRA 4JRPA 4CI0C 2Y4XA 2VGMA 3CEYA 5LJ5d 3HL8A 3A5ZB 3MEVA 2PUKB 4E47A 3CCJT 4E7JA 4F7UF 2CZ7B 3ZFJA 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8H A;  4QQ6 A;  3OYA A;  1OZ2 A;  2EQM A;  4IUT A;  4A4F A;  3ASK A;  2B8A A;  5IAY A;  2JZ2 A;  3PMT A;  3L2W A;  4FU6 A;  4EDU A;  3OMC A;  3L2U A;  3OYH A;  3OS1 A;  1WGS A;  2EKO A;  3E9F A;  2F5K A;  2MWO A;  3KUF A;  2BIV A;  5KE2 A;  4A4H A;  2R5M A;  2EQU A;  2M16 A;  2RJE A;  4IUR A;  4PLL A;  3OYD A;  3LX7 A;  3OYL A;  5M9O A;  3OYB A;  4BD3 A;  3OYN A;  3S3N A;  4IUP A;  4B9W A;  3OS2 A;  2VYT A;  2XK0 A;  5D6W A;  4GY5 A;  2D9T A;  2EQK A;  2GFA A;  5KCO A;  4BE0 A;  3S3M A;  2GFU A;  4C5G A;  5C0M A;  2L3R A;  2P0K A;  2NLU A;  1WJR A;  4Q5W A;  5KCH A;  3MET A;  3H8Z A;  4CRI A;  3H6Z A;  2K3X A;  3S6W A;  2PQW A;  2RI2 A;  5IN1 A;  2M0O A;  3PNW C;  2X35 A;  3LH0 A;  2EFI A;  2RHX A;  3QII A;  2XDP A;  3OYK A;  2L8D A;  3MO8 A;  3FEO A;  3DLM A;  4BE1 A;  2CKK A;  3F70 A;  4BAC A;  3OYC A;  4B9X A;  2JTF A;  3DB3 A;  3OMG A;  3OYF A;  5D6Y A;  4BDY A;  3NTH A;  3MEW A;  3LGL A;  2K3Y A;  2QQR A;  1OI1 A;  2G3R A;  2RI3 A;  1SSF A;  3PMI A;  2L89 A;  3NTK A;  3OYG A;  1H3Z A;  2R5A A;  2MWP A;  4E7H A;  4BDZ A;  4QVZ A;  2GF7 A;  3MEA A;  3ZEH A;  3E9G A;  2EQJ A;  3OS0 A;  3MEU A;  2X4X A;  3L2V A;  1OZ3 A;  2E6N A;  4HCZ A;  3EAE A;  2RHZ A;  5C6S A;  3MP1 A;  2DIQ A;  4N4I A;  4OVA A;  3OA6 A;  2X4W A;  1WJS A;  3S3O A;  4II1 A;  4ZTF A;  2IG0 A;  4IUV A;  5FRM A;  3ME9 A;  4IUQ A;  3L2Q A;  3FLG A;  4LD6 A;  3FDR A;  4FL6 A;  4C5E A;  3LGF A;  3O8V A;  4QW2 A;  2M1H A;  2RO0 A;  1RI0 A;  3QBY A;  4A4G A;  3OYM A;  3NTI A;  2LRQ A;  2O4X B;  2RHU A;  3UWN A;  5J26 A;  2YRV A;  3QKJ A;  2X4Y A;  4N4G A;  2R57 A;  1G5V A;  2RJF A;  4X34 A;  1XNI A;  3OB9 A;  4C5H A;  4E7K A;  3MP6 A;  2DIG A;  4N4H A;  4Z02 A;  2RJC A;  2RJD A;  4IKF A;  5KH6 A;  2R58 A;  2WAC A;  2RHY A;  5J39 A;  3UT1 A;  2O4X A;  3OQ5 A;  4UC4 A;  3L42 A;  5D6X A;  3BDL A;  5FRN A;  2E5Q A;  4C5I A;  3P8D A;  5CIU A;  4PLI A;  5KE3 A;  2HQE A;  3M9Q A;  4IUU A;  3OYI A;  3MP8 A;  1N27 A;  3Q1J A;  5FRO A;  2RI5 A;  2LVM A;  4PL6 A;  3PFS A;  3SD4 A;  3GOX A;  2LCC A;  4E7I A;  4BE2 A;  1OYX A;  4RG2 A;  1WJQ A;  2RHI A;  3LYI A;  4QQD A;  4QQG A;  3QJ6 A;  2BUD A;  2FHD A;  3C4S A;  3DB4 A;  4L59 A;  1MHN A;  3OYE A;  4A4E A;  3OYJ A;  4ZTJ A;  4NS5 A;  2BKD N;  2HQX A;  3L2R A;  2DAQ A;  2LDM A;  3FC3 A;  2LTO A;  4E7L A;  3OY9 A;  3CEY A;  4E7J A;  3MEV A;  2QQS A;  3LLR A;  1KHC A; 
#chains in the Genus database with same CATH topology
 4FT4 A;  1ZBX A;  4GLM A;  3CCR Q;  2JZ2 A;  2DFU A;  3OYH A;  4C92 D;  3QSU A;  1X01 A;  2MWO A;  2CP5 A;  1WIE A;  4FIB A;  1UDL A;  4HCB A;  1JB0 E;  3CCS Q;  1Q82 U;  1R77 A;  1BIB A;  2VYT A;  4FYV B;  3EH1 A;  2M51 A;  1JBM A;  2L3P A;  4C0G A;  1UJY A;  5KCH A;  1TXQ A;  2CP7 A;  2JM8 A;  2K3X A;  1M9S A;  2J6F A;  3CD6 A;  4M7A C;  2Y90 A;  2DEU A;  4WF2 A;  3DLM A;  5CKE A;  1T3S A;  2JTF A;  5CO7 A;  1H92 A;  5HK3 A;  3JV3 A;  2J05 A;  2DYI A;  2EJ9 A;  3HRT A;  3IQL A;  2K79 A;  4J9D A;  4XTU A;  2G3R A;  1SSF A;  1TSF A;  1UGV A;  4RTX A;  1PSF A;  4XU2 A;  1VQ8 T;  2EQJ A;  1MV3 A;  3OS0 A;  2X4X A;  1U8R A;  2V8K A;  1PKT A;  3LWI A;  5FRM A;  2ABL A;  4LD6 A;  4PK4 A;  1VQ6 Q;  2XKO C;  5KYX B;  1VQ7 T;  4LDV A;  2I0N A;  1D3B B;  1TG0 A;  1VQK T;  5LJ3 g;  3BY7 A;  1BBZ A;  2X4Y A;  4EMK B;  5KYW B;  1N6A A;  3QYG B;  2AK5 A;  2ED0 A;  2R58 A;  2WAC A;  3C0C A;  3BDL A;  4C8Q F;  1LVK A;  4OMF B;  4PJJ A;  3RKX A;  4D8D A;  4QVD A;  5GAO p;  4LUE A;  2OI3 A;  2BUD A;  3C4S A;  3CCJ Q;  3OYJ A;  2BKD N;  3QDF A;  1G2B A;  1RAA B;  3FC3 A;  3OY9 A;  4R0K A;  2CP6 A;  1GFD A;  1MND A;  2EBP A;  1ZLM A;  5ECA A;  5GAN h;  1VQ5 T;  4FYW B;  2JXB A;  3OMC A;  4HA8 A;  1B3Q A;  2GBQ A;  2LZ6 B;  4KGV B;  3WXM B;  5HY6 A;  3LX7 A;  5DLQ E;  2EYZ A;  2VXE A;  2CP3 A;  3EG9 A;  3S3N A;  2LJ0 A;  4M77 A;  1GL5 A;  2ZPI B;  2QYZ A;  5KCO A;  2D9T A;  2ESW A;  5CKD A;  2OJ2 A;  2RMO A;  2KRS A;  3M0S A;  5C0M A;  3CMA T;  2L3R A;  3SWN A;  2E5K A;  3QPH A;  2IPO B;  1M90 C;  1X2K A;  2CDT A;  3MPU B;  4B9X A;  3PE0 A;  2QGG A;  3LWH A;  5GAM j;  4ZN1 A;  2COY A;  2E64 A;  1VQ8 Q;  2XIC A;  4OMN A;  2YDL A;  1SEM A;  3WVD B;  2KNB B;  2R5A A;  1R8O B;  4M7D F;  3CXC A;  3TRE A;  4ZTF A;  2ZPG B;  1YJ9 A;  1VQ7 Q;  2KYB A;  3FLG A;  1VQK Q;  4ZNX A;  1VQ9 A;  5KYY B;  2LQ8 A;  2RNA A;  3GIB A;  3QKJ A;  2YRV A;  2CUB A;  1GRI A;  3C94 A;  2J06 A;  3MP6 A;  1Q86 U;  1IRX A;  4NL3 A;  1GFC A;  1S72 Q;  1GCP A;  2DJQ A;  3CBP A;  3V8K A;  1K73 R;  3I5S A;  4J7F A;  2D6F A;  2NWM A;  5GJV B;  2BZY A;  4PL6 A;  1JRI A;  1NZ9 A;  2LCC A;  4BI8 B;  2XHC A;  2KAF A;  5CKB A;  2DIL A;  2RHI A;  4BE2 A;  4M75 D;  1T3L A;  1Y96 A;  2GNC A;  3REA B;  2OTJ T;  1M1K U;  5GAM f;  2LTO A;  4M78 A;  1WYX A;  1KQ1 A;  5AT1 B;  1VQ5 Q;  2HZY A;  4MZT A;  3PMT A;  1WXU A;  3QG1 A;  4LE9 A;  4JS5 A;  3E9F A;  2F5K A;  1D1C A;  2IVW A;  2BIV A;  2YSQ A;  3CXC P;  4PJO A;  2EYW A;  4RCC A;  2MMP A;  2LCS A;  1NLO C;  3TEE A;  3M0U A;  4Z8A A;  3RKW A;  2K9G A;  3QHS A;  2D0Q B;  3FJP A;  2L0A A;  3S3M A;  1V76 A;  3VS1 A;  4F7U A;  3TVT A;  3G6E A;  4X9C A;  2RQT A;  1Q82 R;  1X6O A;  2KSS A;  5IHK A;  2KXD A;  2MI6 A;  1K9A A;  4ESR A;  2K3Y A;  4BI4 A;  1QMC A;  3N5B B;  1Z9Z A;  2COW A;  2VWF A;  2EJG A;  1RAF B;  1WFW A;  4E7H A;  2AT1 B;  4LDY A;  1WI7 A;  1RAI B;  2CS7 A;  5J3B A;  1RAE B;  4II1 A;  3VRZ A;  1JU5 C;  4J9C A;  2LJ1 A;  3QXE B;  1KC8 U;  2DXU A;  3J81 E;  5CVI A;  3NTI A;  2LRQ A;  5A0L A;  3CCQ A;  4N4G A;  1WA7 A;  1NG2 A;  2ECZ A;  4C92 E;  4E7K A;  4Z02 A;  1KJW A;  2DD5 A;  3PT9 A;  1Y07 A;  2DL5 A;  2AHJ B;  3M56 A;  1TOV A;  4XU0 A;  4C92 B;  1GCQ C;  2QEX T;  3JSC A;  2YRD A;  1G83 A;  4E7Z A;  4HCC A;  2B86 A;  3CC2 T;  5I11 A;  3ZL7 C;  3M4Y A;  8ATC B;  1GBR A;  3L2R A;  3NMZ C;  2QGF B;  1VQ4 Q;  2XI9 A;  2RQR A;  1V29 B;  2QG9 B;  3VKI A;  3L2W A;  4NOY A;  3OBY A;  1VQO Q;  2X9H A;  2R5M A;  3LH5 A;  1FXX A;  3OYN A;  2LC4 A;  3CME T;  3H0H A;  2LX9 A;  1BYM A;  3G4S T;  5LJ5 j;  2CYZ B;  1IB8 A;  1NBE B;  4X9D A;  5CKF A;  1OOT A;  4HXJ A;  3JB9 G;  3GP8 A;  4AT1 B;  5LJ3 h;  1K73 C;  1YI2 A;  1M3B A;  1IRE B;  5GAO l;  2A0F B;  2X51 A;  1QWE A;  3MHX A;  2DL8 A;  3O5Z A;  3I56 T;  1BK2 A;  4ZGD B;  3CCM A;  2L89 A;  1TUC A;  1NPR A;  4JJN K;  4C8Q C;  3I55 A;  4HCZ A;  2JUF A;  1LOJ A;  5C6S A;  2X4W A;  2F2X A;  2YT6 A;  4N0A A;  1KHI A;  1MGQ A;  3HRU A;  5GAO q;  3O8V A;  1J3T A;  3ULR B;  3JB9 H;  1AWO A;  4J9G A;  4PFZ A;  1YCY A;  5KYU B;  1RLQ C;  1BCO A;  4O5V A;  4C92 G;  5FWC A;  3JCM h;  2ZPB B;  4KH1 B;  1EIF A;  5LJ5 f;  2NUP B;  4HVW A;  1WPY A;  3L42 A;  3THK A;  1Q82 C;  1WQW A;  5FU7 C;  3EFO B;  2E5Q A;  4M7A A;  4PJN A;  5D7U A;  1UGQ B;  3CPF A;  1Q86 R;  2FYK A;  5GAM e;  1B07 A;  4TVR A;  2BE9 B;  1I4K 1;  1AWJ A;  1O75 A;  4XTW A;  1VIF A;  1VQP T;  3CCR A;  1PD1 A;  4CI0 C;  2Y4X A;  2VGM A;  1FYN A;  1QLY A;  3VS4 A;  5L23 A;  3EHR A;  3MEV A;  1CSK A;  2W0Z A;  3ZFJ A;  3E1S A;  1W70 A;  4BUG A;  4P5N A;  1ZSZ C;  5IAY A;  2RQW A;  5GAN 2;  2B8A A;  1PC0 A;  2JOY A;  5FW9 A;  4DBQ A;  5I2M A;  3OS1 A;  4JRK A;  3CCS A;  1M1K R;  3CME Q;  1W2B A;  2HBW A;  1ZHI A;  3G4S Q;  4RG8 A;  2L3Q A;  1WHH A;  2DXT A;  1ACM B;  2E6Z A;  1VOM A;  4M7D C;  2E1H A;  4EMG A;  1JXO A;  2NLU A;  1TS9 A;  1HJD A;  1GBQ A;  2ZCF B;  2LT4 A;  3PNW C;  4MMK A;  2XDP A;  3OYK A;  4BE1 A;  4XTX A;  3L2Z A;  3G71 T;  1I5O B;  2O2O A;  2COZ A;  2VV5 A;  3A98 A;  1VQN A;  1D09 B;  3UA6 A;  2YHT A;  3RES A;  3VU3 C;  2QA4 T;  2XDD A;  2OTL T;  2WSE E;  1JJ2 S;  3JRZ A;  3MP1 A;  1X6B A;  2M02 A;  3SFM A;  2PVG B;  2DVE A;  1ZUY A;  2KE9 A;  2YUP A;  3BDU A;  4RTW A;  2YXY A;  3INZ A;  4M75 B;  1V1C A;  3U23 A;  4PFO A;  1WHM A;  4A53 A;  3VS2 A;  3DKM A;  2HBP A;  2A36 A;  1KC8 R;  4MML A;  5IT9 E;  1YCS B;  4BB7 A;  2EGE A;  3UT1 A;  1RLP C;  1BCM A;  1UTI A;  2HSP A;  3OQ5 A;  5KYW A;  4OMO A;  4BY6 B;  3CCJ A;  3OBW A;  4JRI A;  2QTX A;  3D7S B;  2D8H A;  4J6X A;  4C5E A;  1Y57 A;  2DET A;  4L59 A;  2QAZ A;  1YWP A;  2DXC A;  3H41 A;  1H8K A;  4D8K A;  4DQ2 A;  2EWN A;  1O9S A;  1WXB A;  5GAN d;  3LLR A;  3QBY A;  2E65 A;  3P8B B;  2YUN A;  2RB6 A;  3H9N A;  1Q81 U;  3RDV A;  1M2O A;  2HNI A;  1QKW A;  3JAM E;  1WX6 A;  5M9O A;  3UF4 A;  5GMK j;  4BD3 A;  1ZUK A;  4KGX B;  4LUD A;  4B9W A;  3CCL T;  2K5L A;  2OAW A;  2K2M A;  1N9S A;  3HFO A;  4OMM A;  1PCX A;  1BI3 A;  4N0A C;  1VQ8 A;  2DBK A;  2FZC B;  4ELY C;  3SHW A;  1Q86 C;  3EH2 A;  1JEG A;  1YIT T;  3X25 B;  1CKB A;  2KGT A;  2RI3 A;  3EGU A;  3PMI A;  1YJW T;  2OTL Q;  2KRO A;  3HHT B;  1VQ7 A;  1VQK A;  3JB9 F;  1OZ3 A;  3CPW S;  5KYN A;  1XTD A;  1YIJ T;  4M75 G;  2KQW A;  3JCM Q;  1M1K C;  3FDR A;  2EYX A;  2P0P A;  1IGU A;  3EHQ A;  2KI7 A;  1ZSG A;  2O4X B;  1I81 A;  1PHT A;  1C6V X;  1S72 A;  1AT1 B;  5LJ5 e;  2K4Y A;  1G5V A;  3LW5 E;  1K0S A;  3OB9 A;  1VQM T;  2ED1 A;  2GCX A;  1VQN Q;  5DLO A;  3A8M B;  2P4T A;  1ZBJ A;  4IIO A;  4JZ4 A;  4KUI A;  2PVO B;  3RKY A;  5FRN A;  3A8O B;  2RN8 A;  1JJ2 P;  5L8R E;  2F2W A;  4J9E A;  1M3A A;  1VQ5 A;  3VS3 A;  4FW1 A;  3QJ6 A;  4NS5 A;  1BKB A;  4C92 F;  3FB9 A;  2A08 A;  2QQS A;  4PJO D;  1K0X A;  3EG3 A;  1KHC A;  2BZ8 A;  2FEI A;  2RF0 A;  3L2U A;  2HL3 A;  5KE2 A;  4A4H A;  2PU9 B;  1GXI E;  3OYD A;  3EFR A;  3R6O A;  2PUO B;  5CCA A;  4AFZ C;  5CQX A;  3FRN A;  2Y4Y A;  3WVE B;  4HT9 A;  3JCM f;  1X75 C;  1KC8 C;  3CD6 T;  1NEG A;  4GY5 A;  3CCU T;  2GFU A;  2O01 E;  2DO3 A;  3EGX A;  2KT8 A;  2HCK A;  3MET A;  2C0O A;  3H8Z A;  4OGC A;  2PQW A;  2EFI A;  1GCQ A;  1QCF A;  1K8A U;  1LNX A;  1AWX A;  3EG0 A;  2VB6 A;  3LGL A;  4KRT A;  3CCV T;  3E2U A;  3I5R A;  3NTK A;  3M54 A;  2X3X D;  2VVK A;  4QVZ A;  2JMC A;  2K6D A;  4CC2 A;  3MEU A;  2KRN A;  1VYV A;  3OSS C;  2KYM A;  4EMK C;  4RTU A;  5GAN 8;  1QVG S;  2DA9 A;  1MUZ A;  3EG1 A;  1B7T A;  2DEQ A;  3J80 E;  4XTZ A;  3LGF A;  4R55 A;  2RO0 A;  3VUB A;  4LN2 A;  2DPP B;  1TU0 B;  1PG5 B;  3EG2 A;  5GAN 4;  4RMO A;  5J39 A;  2MIO A;  2FPD A;  1U06 A;  3V8J A;  1PWT A;  5IXF A;  2BE7 D;  2MF2 A;  2O9S A;  1WZO A;  4KUD K;  4QVC A;  2DRM A;  3CPW P;  2L3S A;  1VQ4 A;  3V7S A;  3SD4 A;  2EPD A;  4C0D B;  1OYX A;  1TWB A;  2DLP A;  3QWY A;  4RG2 A;  2D8J A;  2MAM A;  2GTO A;  2RQV A;  2PZ1 A;  4E7L A;  3RBB B;  1VQO A;  4NL2 A;  4RTZ A;  3URG A;  4C8Q A;  4HVU A;  3TQ7 P;  1HXD A;  4JRQ A;  3QDR B;  1FMW A;  4HKE A;  1AZE A;  2ZAE A;  2QAS A;  3CCU Q;  2E3I A;  2RH2 A;  2ZZD A;  3CC4 T;  1KIK A;  2ZPF B;  3VS0 A;  1Q7Y U;  2AKL A;  2L2P A;  1Q81 R;  3BE3 A;  5LJ3 d;  4FYX B;  2P0K A;  4Y91 A;  2QDL A;  1K76 A;  2XDB A;  1ZA2 B;  2X35 A;  2AKK A;  4MZP A;  2BTT A;  3CCV Q;  7AT1 B;  1IHW A;  2XU8 A;  3OS5 A;  3DB3 A;  4J6W A;  3UDC A;  1HYO A;  2LQN A;  2MOX A;  1OUL A;  5A0D A;  2KK4 A;  2RK1 A;  2CSI A;  3CMA Q;  1YHQ T;  2X3W D;  2GF7 A;  2EIF A;  3VYG A;  1UEC A;  1NLP C;  1XQH A;  2E6N A;  1ZSZ A;  5GAM g;  4AG1 C;  5GMK e;  4DOV A;  2SEM A;  3CBO A;  2VXF A;  3JCM d;  3UWN A;  5J26 A;  2XG8 D;  4M77 E;  1BB9 A;  4M7A D;  1YN8 A;  4M7D A;  4KUL A;  1AHJ B;  4LXC A;  1WHG A;  3MCA B;  4B6M A;  1Y71 A;  3EG9 B;  1JO8 A;  4M75 F;  4R56 A;  2QXF A;  4A4K A;  5CIU A;  4PLI A;  3KBG A;  1OX8 A;  2V1R A;  3SWN B;  1QVG P;  3GOX A;  3PFS A;  2FG0 A;  2LX7 A;  3RR6 A;  1UHC A;  4ANJ A;  2J7I A;  3EFO A;  4ZTJ A;  3DB4 A;  2DK3 A;  1BIA A;  1PNJ A;  2PUK B;  1X69 A;  3CME A;  4PFP A;  3I9Q A;  2IIM A;  2KT1 A;  3G4S A;  3J7A F;  2EW3 A;  3JCM e;  3CC4 Q;  5IXB A;  2HQH A;  4IUR A;  4PLL A;  3M0Q A;  3HRS A;  2OTJ Q;  1HSQ A;  4J5Y A;  2ROT A;  3KXT A;  3A8H B;  3X24 B;  2JN0 A;  1G3Y A;  3OS2 A;  1D1A A;  5GAN j;  3TCJ A;  2QQB A;  4A54 A;  5DM7 R;  5AYF A;  1UHF A;  1WDX A;  3VV0 A;  2HAX A;  1EZZ B;  4OB0 B;  1I5L A;  1M1F A;  2MK5 A;  1AEY A;  2RA2 A;  2E12 A;  4BDY A;  2K5I A;  1YHQ Q;  2H3J A;  3REB B;  4E6R A;  1FMV A;  2YUO A;  2EAY A;  1Z9Q A;  3EFS A;  4M78 E;  2O9V A;  1K8A R;  1Y0M A;  3CCE T;  3EAE A;  2J6K A;  3OA6 A;  3S3O A;  3CCQ T;  2DTI A;  3HTR A;  2HSE B;  1IGQ A;  3OW2 S;  4XTY A;  4OGE A;  2QK0 A;  2EJF A;  2M1H A;  3R6N A;  1JQQ A;  1RI0 A;  4PJO E;  4CC4 B;  1KG1 A;  1K4U S;  2CRE A;  5FU6 B;  4C92 C;  3BW1 A;  1Q81 C;  4J8O A;  2DXB A;  2EYQ A;  5HCK A;  4PJO B;  1VQL T;  4F7U E;  4RTV A;  5GAN f;  3BFM A;  2GQI A;  4DBR A;  5GMK m;  4C5I A;  1ABO A;  3JCM b;  2HQE A;  3X28 B;  4OMP A;  4F7U B;  1TTH B;  4JJC A;  1G3W A;  2PTK A;  4FSX A;  1NYG A;  1NJI U;  2HQX A;  1M8M A;  2AZS A;  1KSW A;  2FB7 A;  5I22 A;  4O6J A;  3VS6 A;  2V1Q A;  2QEX Q;  3OYA A;  2WSF E;  1UGS B;  2KMT A;  4PKC C;  2F2V A;  1IZ6 A;  4EDU A;  2JS0 A;  3CC2 Q;  5IHI A;  5LL6 S;  4F04 B;  4ZGE B;  2M16 A;  4IIM A;  4CC7 A;  3M4G A;  1SG5 A;  2DBM A;  2C06 A;  2JT4 A;  2XK0 A;  2DTH A;  3RER A;  4XQ3 A;  1IHV A;  4AFQ C;  4Q5W A;  4CRI A;  3CQT A;  2K3B A;  1QWF A;  1H3H A;  5GMK l;  2RHX A;  1PRL C;  1Q7Y R;  3FEO A;  4FSS A;  1YP5 A;  4BAC A;  2OTL A;  2D0N A;  1QQJ A;  2E41 A;  4PJL A;  2VUB A;  1KQS S;  2W10 A;  5LJ5 g;  4M4Z A;  3I55 T;  2O31 A;  4JPB W;  3CCE Q;  2RD1 A;  4GLK A;  4XU3 A;  4RTY A;  2JW4 A;  2RHZ A;  3X26 B;  2RK2 A;  4F16 A;  4IUV A;  4CC3 A;  3ME9 A;  5FWB A;  1UEB A;  3I56 Q;  1R0B G;  3JCM W;  4PJO G;  3M57 A;  2DF6 A;  4JZ3 A;  1D0Y A;  1VQL Q;  2RJF A;  2KR3 A;  1X6G A;  5KH6 A;  2CZ1 B;  2AZV A;  4F7U G;  2O4X A;  1OU8 A;  2K5F A;  3M53 A;  1RI9 A;  2GGR A;  3CCR T;  3M9Q A;  1N27 A;  2E3H A;  2GTJ A;  1WHJ A;  3A1P A;  1Y7X A;  4QQG A;  4A4E A;  2M9U A;  2LDM A;  1YNZ A;  3ZBD A;  3CCS T;  1K8A C;  1AD5 A;  1BI0 A;  5KYX A;  2LT1 A;  4QQ6 A;  1D3B A;  2VGN A;  3NPF A;  5EC7 A;  1YWO A;  5I21 A;  1RAB B;  4EMK A;  3JCM P;  1QKX A;  2FPE A;  1SKU B;  2YRC A;  1FWZ A;  3T9N A;  1VQP Q;  3AHU A;  1NPP A;  1ZX6 A;  2DVJ A;  3V8L A;  4OP0 A;  5GAM h;  4C5G A;  5I2S A;  1D1B A;  1UE9 A;  1W4S A;  2RPN A;  3M0T A;  3ER0 A;  1VYT A;  3G7Z A;  2DTO A;  4M77 D;  5GJW B;  2L8D A;  1D0X A;  2BZX A;  4M7A E;  2M0Y A;  4OB1 B;  1F1B B;  1YJN T;  3MEW A;  1YIJ A;  1SHF A;  2HMA A;  1VQ6 T;  4QKU A;  2A28 A;  1RAD B;  5CR2 A;  2DYB A;  1UB4 A;  1OX9 A;  4M7A B;  5LJ3 j;  5GMK i;  2LNV A;  3MEA A;  3E9G A;  3C12 A;  3ZEH A;  1NYF A;  4M75 C;  4OF1 A;  1JJ2 A;  2A3L A;  3G71 Q;  1QCN A;  1VIE A;  1RAH B;  2LNH B;  1R0C B;  3RIR A;  1OV3 A;  2YLB A;  4BY6 C;  2RHU A;  3CC7 T;  4X1V A;  2QA4 Q;  5GAN e;  1KQS P;  1E7O A;  1OU9 A;  2JVV A;  1N8R U;  2JM9 A;  3VS7 A;  1TUD A;  1MNE A;  4V2S A;  2DE0 X;  2KY9 A;  1Q7Y C;  1KQ2 A;  2DL7 A;  3PVL A;  2NUT B;  4AMC A;  2CH4 A;  1UFF A;  2LVM A;  2RI5 A;  3QZ5 B;  3VUZ A;  4C8Q D;  2FHD A;  3M0P A;  4DEX A;  4M77 F;  1H64 1;  2K57 A;  1PRM C;  4RKU E;  5KYY A;  2DKG A;  2NYS A;  1OPK A;  3AT1 B;  2CH4 W;  1TUG B;  2JTM A;  4IUT A;  5LJ3 f;  3CCU A;  4FU6 A;  1NJI R;  2FL7 A;  2YWW A;  3EGD B;  1UGR B;  3UPU A;  4M78 D;  4MDW A;  2RJE A;  2HKN A;  3M0R A;  3OYL A;  2G6F X;  1UJ0 A;  2LP5 A;  4QT7 A;  4IUP A;  5D6W A;  2GFA A;  2EQK A;  2F1L A;  3MJX A;  5GAN 5;  2CT4 A;  3TSZ A;  2YUQ A;  3CCV A;  2CZ6 B;  3H6Z A;  1UUE A;  2CT3 A;  1YJN Q;  4XU1 A;  1LCK A;  3CMA A;  4M7A G;  3CCL Q;  5FLX E;  3VS5 A;  1G3S A;  4ELZ C;  4HCK A;  4J9F A;  2P0Q A;  2FRY A;  1QVF S;  3CXC S;  3CPW A;  4OVA A;  2P4R A;  1S72 T;  1YIT Q;  4IUQ A;  3L2Q A;  1KD1 U;  2DZ9 A;  2QDY B;  4FL6 A;  3CC7 Q;  4LDX A;  1P92 A;  4M7D D;  2QQA A;  1YJW Q;  4A4G A;  4C0F A;  1SRL A;  2XMF A;  2J6O A;  4LDU A;  1LPL A;  4ZN3 A;  1M2V B;  4X34 A;  1QCO A;  1MMG A;  3QO3 A;  4M78 F;  4E2F B;  4XAX B;  5DY9 A;  1E6H A;  1B34 B;  1YIJ Q;  1QP2 A;  2FZK B;  2V26 A;  4OB3 B;  3TSW A;  5A2Q E;  4JJD A;  1XJW B;  3JCM g;  2OAU A;  3A8G B;  2O88 A;  4IUU A;  4RTT A;  2VKN A;  4PJO F;  2KEA A;  4FM4 B;  2FRW A;  1YBY A;  2HEQ A;  1AVZ C;  1VQM Q;  3QZ9 B;  4HT8 A;  3VJP A;  4JRP A;  3CEY A;  4E7J A;  3A5Z B;  4F7U F;  2CZ7 B;  2DL4 A;  1MMN A;  1ZA1 B;  3P8H A;  3CC4 A;  1M30 A;  5LJ5 h;  2LQK A;  3ASK A;  1WNL A;  3JCM X;  2OTJ A;  4KBM B;  2EGC A;  3KFV A;  2C0T A;  1VA7 A;  2EQU A;  2E70 A;  2KRM A;  1PSE A;  1PM3 A;  4C92 A;  2PNI A;  5CKH A;  1MV0 B;  1LJO A;  1QVF A;  1RAG B;  3RMQ A;  4JS4 A;  4WCI A;  1TH7 A;  3M5A A;  3M55 A;  5GAN 7;  1K9M U;  1DJ7 B;  2JJ9 A;  1YHQ A;  3LH0 A;  3X20 B;  4PJM A;  1M8V A;  3NHN A;  3MO8 A;  4OB2 B;  2NUZ A;  1BU1 A;  1ZUU A;  5HK0 A;  4JDS A;  1AZG B;  4FW2 A;  3CD6 Q;  1OI1 A;  3GNG A;  2F69 A;  3QJY A;  1N9R A;  1AOJ A;  1JXM A;  2MWP A;  4BDZ A;  2MYS A;  3H0F A;  1NJI C;  2CUD A;  1WJS A;  2FVU A;  6AT1 B;  1QVG A;  2LCL A;  3PIO A;  1YFN A;  3NFC A;  3L1A A;  3NGP A;  3C95 A;  1G8X A;  2R57 A;  2HKQ B;  4ME7 A;  1YJ9 T;  5GAO n;  4K11 A;  2C0I A;  4IKF A;  4C0D C;  1VQ9 T;  1VQ4 T;  4VUB A;  4J9H A;  5D6X A;  2X4J A;  5EG2 A;  2F5T X;  1QVF P;  3PGG A;  5KE3 A;  4RUG A;  4AG2 C;  1VYU A;  1N8R R;  1QP3 A;  2JMA A;  2ATC B;  3EGX B;  1WXT A;  1VQO T;  2AIR B;  1M3C A;  2EKH A;  4BI3 A;  2Z0W A;  2CZ0 B;  4QQD A;  3OYE A;  2D1X A;  2QEX A;  5LJ3 e;  4DBH A;  2A37 A;  1K1Z A;  3CBM A;  5GAN 3;  3CC2 A;  1OZ2 A;  1RUW A;  4KT0 E;  4A4F A;  2JS2 A;  5KYU A;  4M77 B;  3RNJ A;  2EKO A;  4J9I A;  2MCN A;  2KBT A;  3QYH B;  2NUP A;  1T0J A;  4AFS C;  3OYY A;  1HD3 A;  3M59 A;  1WHK A;  1WJR A;  2CP0 A;  3M58 A;  1UGP B;  1EX4 A;  4E7S A;  2RI2 A;  1MMA A;  2M0O A;  1I07 A;  1NEB A;  3QII A;  2CKK A;  3CCE A;  3OYC A;  2DJZ A;  1A0N B;  2EYY A;  3NTH A;  2FPF A;  5IHN A;  2QQR A;  1FMK A;  4L6V 5;  2H8H A;  3JCM V;  3HSB A;  2ENM A;  2OX7 A;  3G6E T;  5CAI A;  3RUX A;  3OYG A;  4JUV A;  2PVD B;  2DMO A;  4J83 A;  4XTV A;  1T0H A;  3JCM J;  1RAC B;  3JB9 I;  4Y92 A;  1PKS A;  3I56 A;  1U5S A;  3L2V A;  3GF5 A;  1I0C A;  4N4I A;  2LQW A;  4C8Q E;  2IG0 A;  2QTV A;  2CP2 A;  5GAO m;  3HFN A;  4LNP A;  1VQL A;  4M7A F;  4KH0 B;  1W1F A;  1M1G A;  1S1N A;  1YJ9 Q;  4C8Q B;  4M77 C;  2YLC A;  2RQU A;  1BI1 A;  5IH2 A;  1VQ9 Q;  1HK9 A;  2KVQ G;  3FIF A;  3HKS A;  1KD1 R;  1M90 U;  2JNG A;  2DIG A;  4N4H A;  3SWN C;  2MPX C;  1C0M A;  1Y96 B;  1AWW A;  1X27 A;  1WHL A;  5HKC A;  4M78 B;  4JJB A;  4WTO B;  2RM4 A;  1EFN A;  1KFZ A;  2E4H A;  2H3E B;  2ZPH B;  2HDA A;  2QI2 A;  4RCB A;  5FU7 B;  2DAQ A;  4MZM A;  4M77 G;  5GMK h;  2DD4 A;  2EGA A;  1ARK A;  4DBF A;  2XD0 A;  3QWX X;  3SB2 A;  2CSQ A;  4JLI A;  4M75 A;  1VQP A;  3GLX A;  1M5Q 1;  1D0Z A;  1WGS A;  1ZQ1 A;  3KUF A;  1W2B S;  2KXC A;  3OYB A;  4DOW A;  1ZSZ B;  5GAM d;  4ZGJ B;  3HP9 A;  1BI2 A;  1CKA A;  3PVQ A;  4BE0 A;  2QQ9 A;  4J7I A;  4M7D E;  5A0G A;  2A7Y A;  3S6W A;  2LMJ A;  2HL5 C;  2DL3 A;  1I1J A;  1NM7 A;  1SRM A;  3HPW A;  1N8R C;  3F70 A;  2DM1 A;  4M7D B;  3G6E Q;  3OMG A;  3OYF A;  5D6Y A;  3DLL A;  3PTA A;  4DEY A;  2ROL A;  4F14 A;  1K9M R;  4EPC A;  5GAN g;  1MMD A;  3FJ5 A;  4EIK A;  4M78 C;  2VAS A;  3G71 A;  4KGZ B;  1YI2 T;  4AFU C;  2V8I A;  5FU6 C;  8AT1 B;  3V7C A;  3JCM c;  2DIQ A;  2ZGW A;  4FCY A;  4C8Q G;  3CCM T;  2QA4 A;  4PJO C;  3OW2 A;  4MDX A;  4FYY B;  3OSV A;  1UG1 A;  1QW1 A;  1XOV A;  3E19 A;  5CQY A;  3MKD A;  4DA4 A;  2DZC A;  4C5H A;  3TU4 K;  2RJC A;  2RJD A;  4OML A;  3CCQ Q;  4M78 G;  1C1A A;  2RHY A;  4ORZ A;  2HD0 A;  2DNU A;  4LDW A;  3SDZ A;  1RL2 A;  4J6Y A;  3V7R A;  3OYI A;  2CGH A;  5FRO A;  3GNF B;  4FT2 A;  3VRY A;  4J9B A;  1QVP A;  2ZPE B;  3PIP A;  4E7I A;  1WJQ A;  3LYI A;  3H0I A;  3G1J A;  2NUT A;  2VC8 A;  3QUI A;  2EQM A;  9ATC B;  4JLG A;  2FO0 A;  1ABQ A;  1SPK A;  4A63 B;  1I8F A;  1PD0 A;  1Q95 G;  1W6X A;  1E6G A;  2E10 A;  2WSC E;  3OW2 P;  1KD1 C;  1NE8 A;  1FX7 A;  1U1T A;  3EGD A;  1X43 A;  1YJN A;  3GPL A;  3GBQ A;  5GAN 6;  5CK9 A;  3I35 A;  4M7D G;  1VQ6 A;  2JTE A;  3VYH B;  4M75 E;  5IN1 A;  3CCL A;  3UA7 A;  2K2V A;  3SEM A;  4LD9 K;  4Z88 A;  2DRK A;  1SHG A;  4HVV A;  3RMS A;  1OQK A;  1KQS A;  1M27 C;  2LJ3 A;  1YI2 Q;  1VUB A;  1SSH A;  4Y28 E;  1W2B P;  1H3Z A;  4Z89 A;  2DX1 A;  2V8J A;  2XID A;  2EVR A;  1YIT A;  5GAO r;  1X2Q A;  3A8L B;  3CCM Q;  3CC7 A;  4C0Z A;  1YJW A;  1VQN T;  1IXD A;  3I55 Q;  3JB9 D;  2L5Q A;  4EMH A;  2I2L A;  4QW2 A;  3OYM A;  2FZG B;  2GQV A;  1K73 U;  2EQI A;  1G3T A;  1M4Z A;  1XNI A;  2P84 A;  1KK7 A;  4F17 A;  1U1S A;  3JB9 J;  1WQ7 A;  2DER A;  4UC4 A;  1N5Z A;  2KDS A;  4L5G A;  4D6W A;  4ATO A;  1M2V A;  4GBQ A;  4OMQ A;  3P8D A;  1U3O A;  1IO6 A;  1M90 R;  3UAT A;  2K7A A;  1VQM A;  3MP8 A;  4YTL A;  3Q1J A;  1B34 A;  1OPL A;  1K9M C;  2SRC A;  4PNO A;  4XK8 E;  1MHN A;  1WLP B;  1OEB A;  5LJ5 d;  3HL8 A;  3CCJ T;  4E47 A;  1SF9 A; 
#chains in the Genus database with same CATH homology
 3P8H A;  4BUG A;  4P5N A;  3CC4 A;  4FT4 A;  5IAY A;  5LJ5 h;  2LQK A;  1ZBX A;  2B8A A;  3ASK A;  2JOY A;  5GAN 2;  1WNL A;  2JZ2 A;  3G4S A;  3JCM X;  3J7A F;  2OTJ A;  4KBM B;  3OYH A;  5I2M A;  3OS1 A;  4C92 D;  4JRK A;  3CCS A;  1X01 A;  3QSU A;  2MWO A;  3JCM e;  1W2B A;  2EQU A;  4FIB A;  2E70 A;  4IUR A;  4PLL A;  1ZHI A;  1VQ5 A;  4HCB A;  3HRS A;  4RG8 A;  4J5Y A;  1JB0 E;  3KXT A;  1PSE A;  3A8H B;  3X24 B;  2JN0 A;  1Q82 U;  2DXT A;  1G3Y A;  1BIB A;  2VYT A;  4C92 A;  3OS2 A;  2E6Z A;  5CKH A;  4M7D C;  1LJO A;  5GAN j;  1QVF A;  2E1H A;  3RMQ A;  1JBM A;  2QQB A;  3TCJ A;  5AYF A;  4A54 A;  4C0G A;  1TH7 A;  4EMG A;  5DM7 R;  5KCH A;  2NLU A;  3M5A A;  3M55 A;  4JS4 A;  5GAN 7;  3VV0 A;  1K9M U;  1DJ7 B;  2ZCF B;  2K3X A;  1YHQ A;  1M9S A;  2LT4 A;  3PNW C;  2HAX A;  4OB0 B;  1I5L A;  1M1F A;  3LH0 A;  3X20 B;  3CD6 A;  4MMK A;  4M7A C;  2XDP A;  3OYK A;  1M8V A;  2Y90 A;  3MO8 A;  4OB2 B;  3DLM A;  3L2Z A;  4WF2 A;  4XTX A;  2RA2 A;  5CKE A;  3G71 T;  5HK0 A;  2E12 A;  4JDS A;  2JTF A;  5CO7 A;  4BDY A;  2K5I A;  5HK3 A;  4XTU A;  3HRT A;  2EJ9 A;  3PIP A;  2VV5 A;  1OI1 A;  2H3J A;  1VQN A;  2G3R A;  1SSF A;  3GNG A;  2F69 A;  3QJY A;  1N9R A;  2YHT A;  3RES A;  1PSF A;  4XU2 A;  3VU3 C;  2EAY A;  2MWP A;  3EFS A;  2QA4 T;  4BDZ A;  1VQ8 T;  2XDD A;  4M78 E;  2EQJ A;  3OS0 A;  3CCE T;  2X4X A;  1U8R A;  2OTL T;  2WSE E;  3EAE A;  1JJ2 S;  3JRZ A;  3MP1 A;  3OA6 A;  1NJI C;  3S3O A;  2FVU A;  1WJS A;  2V8K A;  3SFM A;  2LCL A;  3PIO A;  2PVG B;  3LWI A;  3CCQ T;  1QVG A;  5FRM A;  2DVE A;  3NFC A;  2DTI A;  3L1A A;  4LD6 A;  3OW2 S;  4XTY A;  3BDU A;  3C95 A;  4OGE A;  2EJF A;  3INZ A;  2M1H A;  4PJO E;  1RI0 A;  2XKO C;  1VQ7 T;  4LDV A;  1KG1 A;  1D3B B;  1VQK T;  4M75 B;  5FU6 B;  5LJ3 g;  3BY7 A;  4C92 C;  3BW1 A;  2X4Y A;  2R57 A;  4EMK B;  1Q81 C;  4ME7 A;  4A53 A;  4J8O A;  3DKM A;  1YJ9 T;  2DXB A;  2EYQ A;  2HBP A;  5GAO n;  1N6A A;  4PJO B;  3QYG B;  4MML A;  5IT9 E;  4BE1 A;  4IKF A;  4C0D C;  1VQ9 T;  4F7U E;  4BB7 A;  2R58 A;  2WAC A;  1VQL T;  1VQ4 T;  3UT1 A;  3OQ5 A;  4VUB A;  5GAN f;  5D6X A;  3BDL A;  4C8Q F;  3BFM A;  4BY6 B;  2X4J A;  5GMK m;  4OMF B;  3RKX A;  4C5I A;  5EG2 A;  2F5T X;  3CCJ A;  3PGG A;  5KE3 A;  3JCM b;  3OBW A;  2HQE A;  4JRI A;  3X28 B;  2QTX A;  4F7U B;  4QVD A;  1QP3 A;  4J6X A;  1VQO T;  1G3W A;  5GAO p;  4C5E A;  4BI3 A;  4FSX A;  4QQD A;  2CZ0 B;  4L59 A;  2BUD A;  3C4S A;  3OYE A;  2QEX A;  3OYJ A;  1NJI U;  5LJ3 e;  2BKD N;  2HQX A;  2DXC A;  3FC3 A;  3CBM A;  2FB7 A;  4DQ2 A;  3OY9 A;  2EWN A;  1O9S A;  5GAN 3;  3CC2 A;  4BE2 A;  5GAN d;  4O6J A;  3LLR A;  3QBY A;  2E65 A;  3OYA A;  2WSF E;  1UGS B;  1OZ2 A;  4KT0 E;  4A4F A;  2KMT A;  3P8B B;  4PKC C;  5GAN h;  1IZ6 A;  4EDU A;  3OMC A;  1VQ5 T;  4M77 B;  2RB6 A;  4HA8 A;  2EKO A;  1Q81 U;  5LL6 S;  4ZGE B;  2M16 A;  2HNI A;  3WXM B;  5HY6 A;  3QYH B;  3LX7 A;  5DLQ E;  3JAM E;  3M4G A;  5M9O A;  5GMK j;  4BD3 A;  2VXE A;  2C06 A;  3S3N A;  4M77 A;  4B9W A;  3CCL T;  2ZPI B;  2XK0 A;  3OYY A;  5KCO A;  2D9T A;  2DTH A;  2K5L A;  3RER A;  4XQ3 A;  5CKD A;  3M59 A;  1N9S A;  5C0M A;  3CMA T;  2L3R A;  4Q5W A;  3SWN A;  1WJR A;  3HFO A;  3M58 A;  1UGP B;  3QPH A;  4CRI A;  2RI2 A;  2M0O A;  5GMK l;  1BI3 A;  2RHX A;  3QII A;  4N0A C;  1M90 C;  1VQ8 A;  4ELY C;  3FEO A;  2CKK A;  1Q86 C;  3CCE A;  3OYC A;  4BAC A;  2DJZ A;  4B9X A;  2OTL A;  1YIT T;  3X25 B;  2E41 A;  2VUB A;  3NTH A;  1KQS S;  3LWH A;  2QQR A;  4L6V 5;  5LJ5 g;  5GAM j;  4ZN1 A;  3JCM V;  2E64 A;  3I55 T;  3HSB A;  2XIC A;  2RI3 A;  3PMI A;  1YJW T;  3G6E T;  3WVD B;  5CAI A;  3RUX A;  2RD1 A;  3OYG A;  4JUV A;  4GLK A;  2R5A A;  1R8O B;  2PVD B;  4J83 A;  4XU3 A;  3HHT B;  1VQ7 A;  4XTV A;  3JCM J;  1VQK A;  3JB9 I;  3JB9 F;  4M7D F;  3I56 A;  3L2V A;  3CXC A;  1OZ3 A;  3GF5 A;  2RHZ A;  3TRE A;  3X26 B;  3CPW S;  4N4I A;  2RK2 A;  4C8Q E;  4ZTF A;  2IG0 A;  2ZPG B;  1XTD A;  4IUV A;  4M75 G;  2KQW A;  3JCM Q;  3ME9 A;  5GAO m;  3HFN A;  1YIJ T;  1YJ9 A;  1M1K C;  3FLG A;  1UEB A;  3FDR A;  1VQ9 A;  1VQL A;  4M7A F;  3JCM W;  2LQ8 A;  1M1G A;  4PJO G;  2P0P A;  4C8Q B;  2O4X B;  1I81 A;  2YLC A;  3M57 A;  4M77 C;  3GIB A;  1S72 A;  2YRV A;  2K4Y A;  3QKJ A;  1BI1 A;  5LJ5 e;  1G5V A;  1HK9 A;  3LW5 E;  2KVQ G;  3FIF A;  2RJF A;  3HKS A;  3OB9 A;  3C94 A;  1M90 U;  2JNG A;  3MP6 A;  2DIG A;  4N4H A;  3SWN C;  1Q86 U;  4NL3 A;  1VQM T;  5KH6 A;  2CZ1 B;  2GCX A;  5DLO A;  3A8M B;  4F7U G;  2P4T A;  2O4X A;  4KUI A;  2K5F A;  2PVO B;  3RKY A;  5FRN A;  3CBP A;  3M53 A;  3A8O B;  1Y96 B;  3V8K A;  4J7F A;  2D6F A;  3CCR T;  3M9Q A;  5HKC A;  4M78 B;  1N27 A;  5L8R E;  2RM4 A;  4PL6 A;  1JRI A;  1NZ9 A;  2LCC A;  4BI8 B;  2KAF A;  2XHC A;  5CKB A;  1Y7X A;  2RHI A;  2ZPH B;  4QQG A;  4M75 D;  3QJ6 A;  2QI2 A;  1Y96 A;  4RCB A;  4A4E A;  2M9U A;  4NS5 A;  5FU7 B;  1BKB A;  2DAQ A;  2OTJ T;  2LDM A;  4MZM A;  1M1K U;  4C92 F;  5GAM f;  2LTO A;  4M78 A;  4M77 G;  3FB9 A;  3ZBD A;  3CCS T;  1K8A C;  5GMK h;  2DD4 A;  1KQ1 A;  2QQS A;  4PJO D;  2XD0 A;  3SB2 A;  1KHC A;  1BI0 A;  2LT1 A;  4QQ6 A;  4JLI A;  1D3B A;  2VGN A;  4M75 A;  4MZT A;  3PMT A;  1VQP A;  3GLX A;  3QG1 A;  5I21 A;  1M5Q 1;  4EMK A;  3L2U A;  3JCM P;  4JS5 A;  1WGS A;  1ZQ1 A;  3E9F A;  2F5K A;  2IVW A;  3KUF A;  2BIV A;  1FWZ A;  4A4H A;  5KE2 A;  2PU9 B;  1W2B S;  4PJO A;  1GXI E;  3T9N A;  3OYD A;  3EFR A;  3R6O A;  2PUO B;  5CCA A;  3OYB A;  4RCC A;  2MMP A;  4DOW A;  3TEE A;  5CQX A;  3AHU A;  3FRN A;  2Y4Y A;  3RKW A;  1NPP A;  3WVE B;  5GAM d;  3V8L A;  4HT9 A;  4ZGJ B;  3JCM f;  1X75 C;  3HP9 A;  1BI2 A;  2D0Q B;  3QHS A;  3FJP A;  4GY5 A;  3CCU T;  4BE0 A;  1KC8 C;  3S3M A;  3CD6 T;  2QQ9 A;  4OP0 A;  2GFU A;  5GAM h;  4F7U A;  2O01 E;  4J7I A;  4C5G A;  2DO3 A;  3CME A;  5I2S A;  1W4S A;  4M7D E;  5A0G A;  3MET A;  3H8Z A;  4OGC A;  3G6E A;  2A7Y A;  4X9C A;  3S6W A;  2PQW A;  3ER0 A;  3G7Z A;  2DTO A;  2EFI A;  4M77 D;  3HPW A;  2L8D A;  1X6O A;  1N8R C;  3F70 A;  2KSS A;  2MI6 A;  4M7D B;  4M7A E;  1K8A U;  4OB1 B;  1LNX A;  3OMG A;  5D6Y A;  3OYF A;  3DLL A;  1YJN T;  3MEW A;  3LGL A;  3PTA A;  2K3Y A;  4BI4 A;  3N5B B;  1YIJ A;  4EPC A;  5GAN g;  3CCV T;  1VQ6 T;  2EJG A;  3NTK A;  4M78 C;  3M54 A;  5CR2 A;  3G71 A;  1UB4 A;  4M7A B;  5LJ3 j;  4E7H A;  5GMK i;  4LDY A;  1YI2 T;  4QVZ A;  2LNV A;  3MEA A;  3E9G A;  3C12 A;  3ZEH A;  2V8I A;  3MEU A;  4M75 C;  5FU6 C;  2CS7 A;  3OSS C;  4OF1 A;  3V7C A;  1JJ2 A;  3JCM c;  2DIQ A;  2A3L A;  2ZGW A;  5J3B A;  4EMK C;  4II1 A;  5GAN 8;  1QVG S;  4C8Q G;  1VIE A;  3CCM T;  3QXE B;  2DEQ A;  2QA4 A;  4PJO C;  3J80 E;  3OW2 A;  1KC8 U;  4MDX A;  4XTZ A;  2DXU A;  3J81 E;  3RIR A;  3LGF A;  5CVI A;  4R55 A;  2RO0 A;  3OSV A;  5GAO q;  3NTI A;  3VUB A;  2LRQ A;  1QW1 A;  2YLB A;  2RHU A;  4BY6 C;  5A0L A;  3CC7 T;  3CCQ A;  2DPP B;  1XOV A;  3E19 A;  4N4G A;  5CQY A;  4DA4 A;  5GAN e;  2DZC A;  4C5H A;  4C92 E;  3TU4 K;  2JVV A;  4E7K A;  4Z02 A;  1N8R U;  2DD5 A;  2RJC A;  2RJD A;  3PT9 A;  5GAN 4;  4RMO A;  4M78 G;  2RHY A;  5J39 A;  1Y07 A;  2AHJ B;  3V8J A;  4V2S A;  2HD0 A;  3M56 A;  2KY9 A;  2MF2 A;  4LDW A;  3SDZ A;  4XU0 A;  4C92 B;  2QEX T;  1RL2 A;  1Q7Y C;  3JSC A;  4J6Y A;  4KUD K;  3V7R A;  1KQ2 A;  3OYI A;  4QVC A;  2CGH A;  5FRO A;  4HCC A;  3GNF B;  1VQ4 A;  3CC2 T;  3V7S A;  2RI5 A;  2LVM A;  4FT2 A;  3SD4 A;  1QVP A;  2ZPE B;  3M4Y A;  1OYX A;  3QZ5 B;  1WJQ A;  4RG2 A;  3LYI A;  3VUZ A;  4C0D B;  4C8Q D;  2FHD A;  2MAM A;  3L2R A;  4M77 F;  1H64 1;  2K57 A;  2XI9 A;  4E7L A;  4RKU E;  1VQO A;  1V29 B;  2VC8 A;  3QUI A;  2DKG A;  4NL2 A;  2JTM A;  2EQM A;  3URG A;  4IUT A;  5LJ3 f;  4C8Q A;  4JLG A;  3VKI A;  3CCU A;  3L2W A;  4FU6 A;  4NOY A;  3OBY A;  1HXD A;  4JRQ A;  2FL7 A;  3UPU A;  1UGR B;  1I8F A;  3QDR B;  4M78 D;  2R5M A;  4HKE A;  4MDW A;  2RJE A;  3OYL A;  2RH2 A;  1FXX A;  2ZZD A;  3OYN A;  2LC4 A;  3CME T;  2E10 A;  2WSC E;  4IUP A;  3CC4 T;  2LX9 A;  1BYM A;  1KD1 C;  2ZPF B;  5D6W A;  3G4S T;  5LJ5 j;  1NE8 A;  1FX7 A;  2GFA A;  1U1T A;  2EQK A;  1Q7Y U;  2CYZ B;  1YJN A;  3GPL A;  5GAN 6;  4X9D A;  5CK9 A;  5LJ3 d;  5CKF A;  5GAN 5;  2P0K A;  4Y91 A;  3JB9 G;  3CCV A;  4M7D G;  3GP8 A;  1VQ6 A;  2CZ6 B;  3H6Z A;  3VYH B;  4M75 E;  2XDB A;  5IN1 A;  5LJ3 h;  1K73 C;  3CCL A;  2X35 A;  1YI2 A;  4MZP A;  4XU1 A;  1IRE B;  5GAO l;  2K2V A;  4LD9 K;  2XU8 A;  3OS5 A;  3CMA A;  3DB3 A;  3RMS A;  3MHX A;  4M7A G;  4J6W A;  4M7D D;  1KQS A;  3UDC A;  5FLX E;  3I56 T;  1VUB A;  4ZGD B;  3CCM A;  4Y28 E;  1G3S A;  2L89 A;  4ELZ C;  5A0D A;  2KK4 A;  2RK1 A;  1NPR A;  1YHQ T;  1H3Z A;  4JJN K;  2V8J A;  2P0Q A;  2XID A;  1YIT A;  5GAO r;  2GF7 A;  2EIF A;  3VYG A;  1QVF S;  3A8L B;  4C8Q C;  3CC7 A;  3I55 A;  1XQH A;  4C0Z A;  2E6N A;  3CXC S;  4HCZ A;  2JUF A;  1LOJ A;  5C6S A;  3CPW A;  4OVA A;  1YJW A;  2X4W A;  1S72 T;  1VQN T;  4IUQ A;  3L2Q A;  1KD1 U;  4N0A A;  5GAM g;  2DZ9 A;  2QDY B;  4FL6 A;  4LDX A;  1KHI A;  1MGQ A;  3JB9 D;  1P92 A;  2L5Q A;  3HRU A;  2QQA A;  4EMH A;  2I2L A;  3O8V A;  4QW2 A;  4A4G A;  4DOV A;  4C0F A;  5GMK e;  3OYM A;  3CBO A;  3JB9 H;  2VXF A;  3JCM d;  3UWN A;  5J26 A;  2XG8 D;  4LDU A;  1YCY A;  2GQV A;  4ZN3 A;  1K73 U;  4M77 E;  1G3T A;  4X34 A;  1M4Z A;  1XNI A;  4O5V A;  4M7A D;  4C92 G;  3JCM h;  3QO3 A;  4M78 F;  4M7D A;  1U1S A;  4KUL A;  1AHJ B;  2ZPB B;  3MCA B;  3JB9 J;  4XAX B;  5DY9 A;  1B34 B;  1WQ7 A;  1QP2 A;  5LJ5 f;  1EIF A;  1Y71 A;  4OB3 B;  4UC4 A;  1WPY A;  2KDS A;  3L42 A;  4L5G A;  1WQW A;  5FU7 C;  4D6W A;  5A2Q E;  4M75 F;  1Q82 C;  4ATO A;  2E5Q A;  4R56 A;  2QXF A;  3P8D A;  4A4K A;  3JCM g;  5CIU A;  2OAU A;  3A8G B;  4PLI A;  4M7A A;  3KBG A;  4IUU A;  1VQM A;  3MP8 A;  4YTL A;  1UGQ B;  3Q1J A;  3CPF A;  2FYK A;  5GAM e;  1B34 A;  4PJO F;  4TVR A;  3SWN B;  3GOX A;  4E7I A;  3PFS A;  1K9M C;  1I4K 1;  4FM4 B;  1YBY A;  4ZTJ A;  3DB4 A;  4PNO A;  1MHN A;  2DK3 A;  4XK8 E;  1O75 A;  4XTW A;  1VIF A;  1VQP T;  3QZ9 B;  1BIA A;  4HT8 A;  3VJP A;  3CCR A;  4JRP A;  4CI0 C;  2Y4X A;  2VGM A;  3CEY A;  5LJ5 d;  3HL8 A;  3A5Z B;  3MEV A;  2PUK B;  4E47 A;  3CCJ T;  4E7J A;  4F7U F;  2CZ7 B;  3ZFJ A;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...