2E5QA

Solution structure of the tudor domain of phd finger protein 19, isoform b [homo sapiens]
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
63
Chain Sequence
GSSGSSGLTEGQYVLCRWTDGLYYLGKIKRVSSSKQSCLVTFEDNSKYWVLWKDIQHAGVPGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PHD finger protein 19
publication title Solution structure of the TUDOR domain of PHD finger protein 19, isoform b [Homo sapiens]
rcsb
source organism Homo sapiens
total genus 6
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 2006-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2e5qA00
2LDMA 2LCCA 3MO8A 3MP6A 5IAYA 3H8ZA 2X35A 2RI5A 2RHUA 4E7KA 3O8VA 3UWNA 4IUQA 4A4GA 1WJSA 4A4HA 3OYAA 4FL6A 3F70A 2X4XA 3MEVA 4A4FA 4NS5A 3DB3A 2RJCA 5J26A 3QIIA 3FDRA 5C6SA 2WACA 2GFUA 3LYIA 3MEAA 4CRIA 2EQUA 3H6ZA 4QQGA 3OMGA 2O4XB 4II1A 5D6YA 3OS0A 4E7HA 2M1HA 4PLLA 4IUTA 3SD4A 2NLUA 2P0KA 4N4GA 5FRNA 5KCHA 2GFAA 1WJRA 2BIVA 3E9FA 3OYDA 4QQ6A 2L89A 2RHYA 3OY9A 3OYJA 2DAQA 2RHXA 4BE1A 2HQXA 2RI3A 3KUFA 4IUVA 2QQSA 3E9GA 4IUUA 5KE2A 2EFIA 2BUDA 3FLGA 3BDLA 4B9XA 3OYKA 3UT1A 2HQEA 2RJEA 2DIQA 3OA6A 2RO0A 2YRVA 2RHIA 3OYGA 1XNIA 4IURA 5FRMA 1G5VA 2JZ2A 2EKOA 2EQKA 2MWPA 2FHDA 5FROA 3ASKA 2D9TA 1WJQA 3FEOA 3PMTA 3OQ5A 3DB4A 1H3ZA 3LX7A 2DIGA 2XDPA 4BDZA 2QQRA 4LD6A 4BD3A 2BKDN 3PFSA 4IKFA 3OMCA 2R58A 3LLRA 4B9WA 4N4HA 3Q1JA 3QBYA 2IG0A 1SSFA 5KH6A 3L2UA 3QKJA 4EDUA 1RI0A 2E6NA 3OYNA 4PLIA 4E7JA 3OYFA 2X4WA 2M16A 2R57A 3OS1A 4BE0A 3QJ6A 3L2QA 3EAEA 3CEYA 5D6XA 3FC3A 2K3XA 2L8DA 3MEWA 3NTKA 3DLMA 4GY5A 3OYEA 4RG2A 4FU6A 2RI2A 4C5EA 3OYHA 1N27A 3LH0A 2EQJA 4C5GA 1OZ3A 3GOXA 4A4EA 2LTOA 3PNWC 4ZTJA 2X4YA 3L2VA 4ZTFA 3S6WA 4C5HA 3ME9A 2LVMA 2O4XA 2F5KA 2PQWA 5KCOA 3OYIA 4Z02A 4Q5WA 2MWOA 4PL6A 2R5MA 4BDYA 4E7IA 3OYMA 2K3YA 3P8DA 2B8AA 3OS2A 1KHCA 3META 3L2WA 3S3NA 5KE3A 2GF7A 1OI1A 3LGFA 4IUPA 3OYLA 3PMIA 3S3MA 2M0OA 4E7LA 2RJFA 1OZ2A 4X34A 1MHNA 5CIUA 3ZEHA 5D6WA 4QW2A 2LRQA 3NTIA 5IN1A 2VYTA 3P8HA 3NTHA 3S3OA 4QVZA 3L42A 3L2RA 5J39A 3M9QA 3LGLA 2CKKA 3C4SA 3OB9A 1WGSA 2XK0A 2R5AA 3MP1A 4QQDA 4UC4A 3MEUA 4OVAA 5C0MA 3OYCA 3MP8A 4C5IA 2L3RA 2E5QA 4HCZA 2RJDA 1OYXA 2EQMA 2G3RA 4N4IA 2JTFA 4BACA 4L59A 5M9OA 3OYBA 4BE2A 2RHZA
chains in the Genus database with same CATH superfamily
4NOYA 2ENMA 3VUBA 3OYAA 5A0LA 1UE9A 3FDRA 3LYIA 2EQUA 1TWBA 5IT9E 1AWWA 4BY6B 3CCRA 1N6AA 1W6XA 4M78C 5GAMf 3CCUT 2FG0A 1O75A 1UECA 1QVGA 3CC4Q 5GANg 3X20B 1PRMC 3JSCA 2QK0A 3RR6A 3WVDB 4J9HA 3OA6A 2RHIA 2IPOB 5I22A 1OU8A 2O01E 3JCMW 2A36A 2MK5A 4MZPA 4ATOA 3CXCS 2WSEE 2DEUA 3QSUA 2FPDA 4C0DB 3QKJA 3SWNC 3RKYA 2E10A 1JJ2P 2QQ9A 3BY7A 2XICA 2CH4W 3H0HA 4HVVA 3VS0A 1GBRA 3HHTB 2QDYB 5GAOq 2PQWA 4M77D 4PL6A 3SB2A 1QWFA 2LT1A 3TREA 1P92A 4ZN1A 3ZL7C 2EYXA 4EMKB 2JUFA 3M4GA 5I2SA 1YITA 4KH1B 2XU8A 1LOJA 4IIOA 2FZKB 1R8OB 4FYVB 3MP8A 4XQ3A 2G3RA 2MIOA 2RK2A 4MDXA 1U3OA 4J7IA 2EVRA 2KRNA 3JB9I 1M1KR 2LCCA 2RHUA 2CP7A 2NUZA 3O5ZA 4HKEA 1TOVA 2FB7A 2KYBA 4A4FA 4NS5A 1MNDA 4JJNK 3CCMA 5CKEA 4OMPA 5ECAA 1VQMA 5C6SA 4F7UE 3G71T 2A3LA 1GL5A 4DOWA 2P4RA 1D0XA 1FMVA 2BZ8A 1JU5C 3EGDA 3CCMT 1VQMT 2EGAA 2NWMA 1B34A 5LJ5h 3EG1A 3L2ZA 4E2FB 4B9XA 1N8RC 2KR3A 1M30A 1PCXA 3JCMV 1W4SA 2QTXA 1MUZA 1RUWA 2RN8A 3IQLA 1Q7YR 1E6HA 4V2SA 1YWOA 4QVDA 1YIJA 2BKDN 5CKHA 2KRMA 2KRSA 1YCSB 1QKXA 1OEBA 2OTLQ 3H9NA 1QCOA 1UGSB 4C92E 1RI0A 2YT6A 3T9NA 3X25B 2K3XA 1WI7A 2QEXA 2DO3A 3M59A 2JXBA 1YIJT 1PG5B 2FRYA 1ZSZA 2HBPA 5EG2A 2AHJB 2HBWA 1Q81R 3WVEB 1U06A 4JRIA 3OYYA 4F16A 2JTMA 1NYGA 1YJ9Q 5KCOA 1M90C 2QEXT 1Q82C 1VIFA 5CR2A 1IB8A 4R0KA 3FB9A 3S3MA 1K9MR 1K73C 1UGVA 1BKBA 5CIUA 1B07A 4FM4B 1FYNA 2CT3A 3GBQA 1KFZA 3GF5A 4QQDA 2DETA 5LJ3g 1RAFB 1YFNA 2AKLA 2VXEA 1LNXA 2DE0X 4Z8AA 2PVDB 1PHTA 1KQ2A 2E3HA 1QVFS 2X35A 1CSKA 2AT1B 3VS5A 8ATCB 4X9DA 1N9RA 1SEMA 4P5NA 2RPNA 1EIFA 4J9FA 1M8VA 2D8JA 2C06A 3EH1A 4IUTA 1M4ZA 4CC2A 5KYUB 2ED1A 3OYDA 4M75F 1YHQQ 2L3SA 2RI3A 2OTJA 4DEYA 5LJ5j 1TTHB 5GMKe 2EFIA 1M3CA 2QXFA 4XTUA 3CD6Q 2YRVA 3GNFB 1BK2A 5GMKl 1TXQA 1R0CB 4L5GA 3M53A 4E7ZA 4PFPA 4FSXA 2OTJT 1IHVA 2BZYA 2XDPA 1HJDA 3PFSA 3THKA 1WIEA 3CCEQ 1Z9ZA 3C0CA 5KYXA 2IG0A 1SSFA 1VIEA 1VQ5A 1WX6A 1X69A 2H8HA 4J9EA 3FC3A 5AYFA 1ZUYA 2J05A 1T3LA 4EMHA 4OB3B 2RI2A 5GAN5 2QG9B 1N27A 3EG0A 1RADB 3UA7A 1NJIC 2HNIA 1VQPT 1WQ7A 2GQVA 4M78D 1SKUB 1VQ5T 1HK9A 2EYYA 1VQNQ 5GANf 2JM8A 3CCRQ 3QDFA 2YXYA 2DZCA 1K9AA 2HKQB 4RTZA 5GMKh 2LJ1A 1G83A 4R56A 3L42A 1UHCA 3M0RA 3CC4A 3MCAB 2E5QA 2CUBA 2RJDA 2JTFA 4BACA 2IVWA 1TUDA 2OJ2A 2RMOA 1LCKA 1NG2A 5LJ5d 2K7AA 5LL6S 1WXUA 2RI5A 1YJWQ 3GPLA 3C95A 2COWA 4Y92A 2CSQA 1ZBXA 1GRIA 1TSFA 3QIIA 3CC4T 1FXXA 1JBMA 2HSPA 1VA7A 1NM7A 3INZA 4II1A 2YDLA 1N8RU 1BU1A 1QMCA 5KCHA 5GAMh 1X43A 4M77F 4IUVA 3KUFA 1GCPA 3HRTA 2RQWA 4JUVA 1TS9A 3VS6A 3ZFJA 3FLGA 3BDLA 3QWYA 1BIBA 4LDVA 2RO0A 2L2PA 1KD1C 2KQWA 2E41A 3TEEA 5CAIA 4RCCA 2VB6A 2I0NA 4C8QA 3RKXA 2V8IA 1YITQ 4BDZA 2W10A 3JB9J 4PJOA 2R58A 2DBMA 3M57A 4J9IA 5HKCA 2ZCFB 1FWZA 2M16A 4M77A 2EPDA 2KBTA 2ROLA 4OMFB 1M90U 3X28B 1YWPA 1Q82U 1WQWA 1MMGA 5IHIA 1DJ7B 4KUIA 2DRMA 1UJYA 1IXDA 1NLPC 3JCMe 4ZGEB 4JZ3A 4HVUA 2DL5A 1YJNA 2LQNA 1EFNA 2DK3A 1WHMA 2LX9A 2QGFB 2VUBA 3JCMb 2DF6A 1GXIE 1X6BA 3LWIA 3CC2A 2VYTA 3V7CA 3TCJA 1WHKA 1KQSA 3FJ5A 1YP5A 3NPFA 1NEGA 2L0AA 4GBQA 3MKDA 4BUGA 2RHZA 2CGHA 4LDWA 5AT1B 1QQJA 2YRDA 4OP0A 3HTRA 2DXCA 3CC2T 2YLBA 4A4GA 2DL3A 1V1CA 3MEAA 2LQ8A 3M0QA 4BY6C 2QASA 1GCQA 2QEXQ 3EHQA 2OTLA 1M1FA 1NE8A 4RTYA 2KDSA 5GAMj 1BCMA 2P0KA 4KRTA 2DM1A 3E9FA 1QW1A 2BZXA 4ZN3A 3CPWP 2KNBB 2RHYA 3RKWA 1K8AR 4OMOA 4C8QG 3LWHA 2EYZA 1VYVA 1AT1B 4JRQA 2AK5A 2A28A 3CMEA 2X4JA 1BI2A 1KQ1A 4PJOG 2OTLT 3R6NA 4A63B 1BI1A 1CKAA 4AT1B 1YJ9A 1H3ZA 4D6WA 2VGMA 4ELZC 1VYUA 1NJIU 1BI3A 4PNOA 2F5TX 4LN2A 2A0FB 4FW2A 3EAEA 2P0QA 1MV0B 1YJ9T 3DLMA 1TUCA 4C5EA 2PTKA 3OYHA 1QVPA 2GQIA 1LPLA 1OZ3A 6AT1B 2HL5C 1M8MA 2PUKB 3A5ZB 3N5BB 1D3BB 2KVQG 1M1GA 3I9QA 1AD5A 5A0GA 2KXCA 2O4XA 2XDBA 3ULRB 4HT8A 3OBWA 4M7AA 1AZGB 2AKKA 3BW1A 2OTJQ 4K11A 2CH4A 2PZ1A 5KYYA 4ELYC 3QJYA 4QVZA 1Y71A 2NUTA 4PJOB 4M7DA 5GAMd 1X2KA 1QKWA 1VQLQ 3BFMA 2XI9A 3MP6A 3CD6A 2F2XA 3R6OA 1JJ2S 2DYIA 4BI8B 1WJSA 3VYHB 4LUEA 3EGXB 3FIFA 1T0JA 1UUEA 1YHQT 2DXBA 2ZGWA 4DEXA 4E7SA 2ZPFB 2J06A 2V8KA 2EAYA 3CBPA 3NFCA 1WHLA 1X27A 4M78F 3CD6T 1KD1U 1U1SA 2GFAA 2MMPA 3M0PA 2DX1A 4RTUA 1ZUUA 3VJPA 2OX7A 2CZ6B 2WSFE 3CCET 4KT0E 2ATCB 2JJ9A 2CP6A 2VWFA 2QQBA 3ASKA 2DZ9A 5FU6C 1VQNA 4PFZA 1NPPA 2EW3A 1K1ZA 3AHUA 3QBYA 1QP3A 3EG9B 1D1CA 3OYFA 5GAOm 2DERA 2YWWA 4GY5A 1J3TA 1VQNT 3CCRT 3LH0A 4J6YA 2DTIA 2YUPA 3PNWC 4FIBA 5KYWA 4M7AG 3M0TA 2SRCA 2KAFA 1U1TA 1YJWA 3E19A 3I56Q 2JVVA 5DM7R 2B8AA 2VVKA 5GANh 3RIRA 4XU3A 4C92D 4M7DG 1AWXA 3JV3A 1RACB 4RCBA 3NHNA 5DY9A 1PSFA 4C0ZA 1XOVA 3REAB 1FMWA 5A2QE 1YJWT 2F2WA 2VXFA 3L2RA 2GBQA 1YI2A 2CKKA 1IRXA 4HCZA 2FYKA 4L59A 3PGGA 1QVGP 2X51A 1QCNA 3EFOA 2D8HA 2DLPA 3UWNA 1SSHA 2YSQA 3PIOA 1YI2T 2ED0A 2X3XD 2KT1A 4Z88A 2BE7D 2CP2A 2RJCA 4EPCA 3JRZA 4NL2A 1H8KA 2M9UA 2VASA 3VS7A 2DA9A 1M1KC 2O4XB 3CBOA 1LVKA 2K2VA 4KULA 4XTVA 2NLUA 4M7AB 2NUPA 3A8GB 3CXCA 1NYFA 3TU4K 2LX7A 1YITT 3E9GA 3QPHA 5IH2A 1X6GA 3ZBDA 5FW9A 4XU2A 1YJNQ 4DBFA 1V76A 4M7DB 2EQKA 4KUDK 4L6V5 2GCXA 3FJPA 3JB9G 1VQ7A 3CC2Q 4RTTA 4OMMA 3VKIA 1PD0A 1UGPB 4LD9K 1YNZA 4HXJA 3JCMf 1Q7YC 1G8XA 9ATCB 4J83A 2YUQA 3UATA 2QTVA 2ZPEB 1G3YA 1QP2A 2L8DA 3NTKA 3OYEA 2EYQA 4C5GA 4XAXB 1WYXA 4CC4B 1VQKQ 3M4YA 2AIRB 5FU6B 3URGA 3EH2A 1NBEB 4Z02A 4FYWB 2DRKA 4RUGA 1C6VX 1VQ8Q 2K3YA 5FLXE 1YBYA 4KGZB 5GANj 3AT1B 2LCSA 1OOTA 1ZBJA 3EFRA 2LP5A 3LGFA 1Q81C 3VRYA 1K4US 4J5YA 2DKGA 4FSSA 3CMEQ 4QKUA 4JJDA 5LJ3e 1Q86R 1KC8R 4NL3A 1TU0B 5CCAA 1K9MC 2F69A 4IIMA 4JDSA 2NYSA 4OB2B 4BE2A 4C8QE 2JW4A 1TG0A 2ZPGB 1ZSZC 1VYTA 2F1LA 4PJOE 2X4XA 3MEVA 2PVOB 2COZA 3TSWA 5J26A 1ZA2B 1LJOA 4WTOB 2V8JA 2X3WD 4EMGA 2CT4A 3QG1A 1WFWA 2CS7A 2O9SA 4OMQA 3C94A 4CC3A 1RAIB 3DLLA 4RG8A 3PIPA 4MZMA 3P8BB 2RHXA 2LQWA 5D7UA 1BI0A 4AFZC 2CYZB 4TVRA 3OYKA 2O88A 1XNIA 1RLQC 2EKOA 2K57A 5CO7A 2ZAEA 3OQ5A 3DB4A 3LX7A 3JCMX 1SRMA 3HFNA 1KK7A 3EFSA 2RF0A 5GANd 3LLRA 1I0CA 1PSEA 3EHRA 3L2UA 3QUIA 3OYNA 2RK1A 5GAOr 3MEWA 4FU6A 2EQJA 1W2BS 1E6GA 1ZHIA 4OGEA 4JRKA 2LTOA 1Y7XA 4DBQA 2NUPB 1VQLA 1BCOA 4ZTFA 2XG8D 3DKMA 3JAME 2J6OA 1S72Q 2FRWA 3JCMJ 3S3NA 3CCJA 3OYLA 5HY6A 1QVFA 1UHFA 2LZ6B 3M54A 1VQLT 4M75A 2SEMA 3P8HA 2Z0WA 2QI2A 2KEAA 4F7UF 4F04B 1VQ4A 3EGDB 1IGUA 3V8KA 5L23A 4N4IA 1SHGA 2CUDA 2I2LA 4RKUE 1B34B 1M1KU 2LDMA 2QGGA 5FWCA 3I35A 1UG1A 5FWBA 3VUZA 1BB9A 3G4SA 4XU0A 1W2BA 2HAXA 4QQGA 3OMGA 4E7HA 5A0DA 2JMCA 3SD4A 4FCYA 3OS5A 2F2VA 2WSCE 4F7UA 2RQUA 2J6KA 2RA2A 4C92F 1ZSZB 2PUOB 4IURA 2AZVA 2M0YA 2L3QA 2L5QA 4M7AE 1Q7YU 3FEOA 2KK4A 3PE0A 5GAMg 3I56A 2VGNA 1AEYA 4LD6A 3HRUA 2GNCA 3OMCA 1YI2Q 1TUGB 2A08A 4M7DE 1I5OB 1B3QA 1WNLA 1JXMA 3I56T 2E1HA 3CBMA 2JMAA 3OSVA 3L2VA 1Q81U 3CPWS 4AFSC 2KE9A 4M75G 1PWTA 2IIMA 4ZGJB 3CCVQ 3MHXA 2CZ7B 4C8QC 1M2VA 4LDUA 1K9MU 3VS2A 4X34A 5DLOA 2E6ZA 1PC0A 4PJOC 1G3TA 3KBGA 2KGTA 3CQTA 2DJQA 2EGEA 4O5VA 4J9DA 2ZPHB 3M9QA 2ESWA 2FL7A 2LNVA 1OYXA 4M77C 1OU9A 3NMZC 1AOJA 4JS5A 1VQ7Q 2LC4A 5IAYA 3H8ZA 1UGRB 4E7KA 5I21A 4HCCA 4A4HA 4FL6A 4LNPA 3DB3A 5GMKj 2MYSA 1UB4A 1ZUKA 5HK0A 3NGPA 3RUXA 1YJNT 2ZZDA 2K5FA 2DL7A 1UGQB 1WJRA 5KYXB 1M9SA 2LCLA 3I5RA 4QQ6A 1AZEA 1RAAB 2FO0A 1UFFA 3OY9A 1QWEA 3OW2S 4Y91A 2QQSA 1RABB 2J6FA 5KE2A 2BUDA 3KFVA 4A53A 2K79A 2EYWA 2VC8A 1W70A 3UT1A 3QYGB 3E1SA 1WHJA 2LQKA 1G5VA 3A8MB 1K8AC 1VQKA 4KGXB 4OB0B 2PU9B 4DQ2A 1VQ8A 2EJGA 3A98A 2FZCB 3CPFA 4XTZA 5CKDA 3A8OB 1PKTA 3JCMh 2X4WA 3H0FA 1VQKT 1GCQC 4ME7A 2K5LA 1VQ8T 3HKSA 4OMLA 3QYHB 4J9CA 1WA7A 1KQSP 2X4YA 1WLPB 3M58A 5LJ3f 4C5HA 1PRLC 1HYOA 2F5KA 4M77G 1H641 3CMET 2J7IA 2LT4A 1D0ZA 2M02A 4D8KA 3P8DA 2JOYA 3EGUA 3I5SA 3META 1OI1A 4X1VA 3OW2A 1KIKA 2XIDA 1VQ6Q 1KSWA 2MOXA 1PNJA 1K0XA 3X24B 3CCLQ 3ZEHA 4LDXA 5IN1A 1M2OA 3SHWA 2W0ZA 2XD0A 1RAGB 1G3WA 2DXTA 4OF1A 5M9OA 4RTVA 3RERA 2M51A 1IHWA 3QZ9B 4N0AA 4C8QB 4EMKA 3VU3C 2DBKA 4XK8E 2HD0A 5D6YA 2O2OA 2PNIA 3M5AA 3GNGA 4M7AC 4F17A 3BE3A 4JLGA 5FRNA 2BIVA 1M5Q1 2FEIA 3SEMA 2L89A 5IHNA 1M2VB 2Y4YA 4M77B 2ZPBB 2CREA 2K3BA 3J80E 1RLPC 4M7DC 5GAOp 4C0FA 4DOVA 3CCJQ 4BI4A 1VQ9A 1ZA1B 8AT1B 1RI9A 1ACMB 5CKFA 2DVEA 3CCQA 4JRPA 3BDUA 1X6OA 3CMAQ 1S72A 1U8RA 3MPUB 2RB6A 3D7SB 3V8JA 2LNHB 2QA4A 1VQ4Q 4XU1A 2C0IA 2E64A 3A1PA 1Q95G 4JJCA 2E6NA 4PKCC 1VQ9T 1OPLA 3QJ6A 3L2QA 3CEYA 3CCQT 1MGQA 2XMFA 4AFQC 1NPRA 3OBYA 1ABQA 1S72T 4A54A 2HL3A 4KGVB 1SPKA 3L1AA 3G4SQ 2LVMA 1JB0E 2HQHA 3CC7A 1HXDA 2BE9B 4Z89A 1I8FA 2DD5A 3GLXA 4M78A 3CCUA 3QXEB 4ESRA 1Y07A 3PMIA 1AVZC 1MHNA 4ORZA 1JJ2A 5D6WA 2HCKA 5J39A 3LGLA 3CC7T 2R5AA 1ZX6A 2BTTA 2OI3A 3VS3A 1XJWB 2L3PA 3A8LB 2EQMA 1MMAA 4DBHA 2YUOA 2E65A 4J6WA 1RAHB 3MO8A 1D1BA 5CKBA 4IUQA 3CCSA 5IXBA 4PJMA 3X26B 1ABOA 3SWNA 5FU7C 3V8LA 3V7SA 5I2MA 3HPWA 4FYYB 1JRIA 1OULA 3CCST 4FYXB 1K8AU 2EIFA 3JCMd 1VQOQ 1D0YA 4PJNA 2HQXA 4C8QD 3UPUA 3QHSA 3FRNA 4E6RA 2RJEA 2DIQA 2RQRA 4PJOD 3OYGA 5GAN6 5GAN2 2E5KA 2JM9A 1A0NB 3GIBA 4M75E 4IKFA 3CCVA 3UDCA 3EG2A 5LJ5e 4OMNA 1EZZB 2JN0A 4N4HA 5CQXA 5KYUA 1WXBA 1JXOA 2VV5A 4BE0A 3HFOA 5KYYB 1ARKA 4WCIA 2NUTB 3HL8A 3CCVT 4A4EA 3RMSA 5DLQE 1ZQ1A 2K9GA 1JQQA 3E2UA 4M78G 2OAUA 2V1RA 2K5IA 3G71A 1EX4A 3OYIA 1NZ9A 2EQIA 2GTOA 5GAN4 4HCBA 5LJ5g 4HVWA 1KJWA 1PM3A 4HT9A 1YN8A 2RJFA 2GGRA 4GLMA 3GP8A 1VQ7T 5GAOl 2DD4A 3A8HB 4UC4A 5IHKA 3MP1A 1HD3A 1NEBA 5GJVB 2L3RA 2EBPA 2ROTA 1SF9A 3VYGA 3PVLA 3CXCP 2DTOA 1AWJA 5GMKm 3SFMA 1Q86C 1KC8C 1I5LA 1ZLMA 5EC7A 3I55Q 3QDRB 2CP3A 3UF4A 2FVUA 1N8RR 3QO3A 2EWNA 4XTYA 4N4GA 1W1FA 1Y0MA 4M78B 1G2BA 5CK9A 2DAQA 1OPKA 1MV3A 1XTDA 2HQEA 1D09B 4AG1C 2A37A 1WHHA 5KYWB 2JZ2A 1UJ0A 2MWPA 5FROA 3JCMQ 4M77E 4D8DA 4QVCA 5J3BA 5FU7B 1IGQA 1M3BA 4B9WA 1G3SA 2MCNA 2CP0A 1VQ6A 2YHTA 2D1XA 3VRZA 3QZ5B 3M56A 4EDUA 3CCLA 2R57A 2DJZA 3OS1A 5GAN7 2QQAA 3SWNB 1M90R 4AFUC 1Q82R 3TQ7P 3G7ZA 3RMQA 1Z9QA 4M7AD 1U5SA 1VQ6T 4LE9A 2KT8A 1NLOC 1JO8A 3HSBA 1K73R 3CCLT 3OSSC 3EFOB 2KMTA 5LJ3h 2RH2A 1IO6A 1AWOA 2MWOA 4E7IA 2R5MA 2LMJA 4MMKA 3OYMA 3TSZA 1I4K1 1KG1A 1MMDA 4O6JA 5GAOn 4M7DD 2GF7A 4J9BA 2DEQA 2DILA 1OZ2A 2EJFA 4QW2A 2KSSA 3NTHA 4EIKA 1X01A 2RQVA 1K76A 3OB9A 4WF2A 2O31A 4HA8A 1VQ9Q 1I81A 1VUBA 1BIAA 1Y96A 1QCFA 1O9SA 3CCQQ 3H41A 3M55A 3G1JA 4JPBW 1OV3A 2RD1A 2C0OA 2JS2A 2QA4Q 1GFDA 2ECZA 2CP5A 3JCMc 3CMAA 4CRIA 1N5ZA 2HKNA 3G6EA 5I11A 2M1HA 1VQPA 2E12A 2QYZA 3CCJT 4M75C 1QLYA 1RAEB 2DYBA 2XHCA 1WXTA 3U23A 3CMAT 2YUNA 3KXTA 3TVTA 2JT4A 1Y57A 3EG3A 1FX7A 4FW1A 4IUUA 4FT2A 4DA4A 3RNJA 3CC7Q 3G6ET 1N9SA 4CC7A 3CCUQ 1F1BB 1VQ4T 5FRMA 2EJ9A 4FT4A 4PFOA 4RTWA 2D9TA 5GAMe 3PMTA 1SG5A 3JB9D 1WHGA 2QQRA 5GAN8 3UA6A 4BB7A 1NJIR 3J81E 1SRLA 2HDAA 3VV0A 5KH6A 4E7JA 1T0HA 3REBB 2V1QA 3G4ST 2D0NA 1QVFP 5CVIA 5D6XA 4B6MA 5GMKi 5HCKA 3VS1A 1FMKA 3CCSQ 1BYMA 3PTAA 1R0BG 1HSQA 2LJ0A 3ME9A 5LJ3j 2P0PA 1I1JA 4YTLA 4Q5WA 4J8OA 1D1AA 3C12A 1AHJB 2CDTA 5KE3A 2P4TA 4C8QF 3QWXX 5KYNA 1S1NA 4AG2C 1B7TA 1VOMA 4PJOF 2YRCA 4VUBA 1W2BP 1K0SA 1OQKA 4C92A 1MMNA 1WGSA 2P84A 1Q86U 1KC8U 4E47A 5C0MA 3OYCA 1VQOA 1PD1A 2RNAA 1D3BA 2DXUA 2XKOC 2MF2A 1YCYA 1RL2A 1C0MA 3O8VA 4C92C 2MAMA 5GAN3 2Y4XA 2DNUA 2DVJA 3F70A 2VKNA 2MPXC 2FZGB 2E70A 1VQOT 1KQSS 4CI0C 4LDYA 3H6ZA 2H3EB 3OS0A 4M4ZA 2H3JA 1KD1R 4C0GA 2DL4A 2DPPB 3M0SA 5LJ5f 3G71Q 4ANJA 4X9CA 3HRSA 1T3SA 4LUDA 2Y90A 2HZYA 4OB1B 2PVGB 3EGXA 2FHDA 2KY9A 4M78E 4F7UG 3CCMQ 1JEGA 3ER0A 1X75C 1Y96B 1WJQA 3SDZA 1VQMQ 2CSIA 2MI6A 1K73U 2DIGA 3PT9A 5LJ3d 4DBRA 2KI7A 3VS4A 4MZTA 5GJWB 4J6XA 3RBBB 3CPWA 3M0UA 3Q1JA 2OAWA 2D6FA 1TH7A 4PLIA 4JZ4A 4M75B 2C0TA 2EGCA 2KYMA 2E3IA 2RM4A 2XDDA 7AT1B 2FPEA 1X2QA 3MJXA 4HCKA 2EKHA 2K6DA 3S6WA 1OX8A 3RDVA 1BBZA 2QAZA 4J7FA 5HK3A 2HSEB 4JLIA 1UEBA 4Y28E 3LH5A 1C1AA 3JCMg 1YIJQ 3OS2A 3L2WA 4C92G 4IUPA 3I55A 2M0OA 1H92A 2FPFA 3EG9A 4LXCA 2LRQA 2K2MA 2XK0A 4QT7A 3MEUA 4OVAA 4F7UB 2HMAA 4ZNXA 4C5IA 1M3AA 3I55T 1MNEA 2RQTA 4F14A 1E7OA 4XTWA 1GFCA 3H0IA 2JTEA 2V26A 2KROA 2GFUA 2WACA 2HEQA 5CQYA 2CZ1B 2X9HA 2ZPIB 1WDXA 2D0QB 2K4YA 2GTJA 4M7AF 3JB9H 4PLLA 3J7AF 1IZ6A 4ZGDB 4C0DC 4PJLA 1GBQA 4JS4A 1R77A 3OYJA 2COYA 4BE1A 1ZSGA 4JJBA 4MDWA 2G6FX 1UTIA 1WPYA 1KHIA 2CZ0B 4M7DF 4C92B 5L8RE 3WXMB 1CKBA 4KH0B 4MMLA 2DFUA 4A4KA 4BD3A 4N0AC 1XQHA 1PKSA 4PJJA 2ABLA 4EMKC 1OX9A 4GLKA 1IREB 2A7YA 3OW2P 2KXDA 1M27C 4RG2A 2LJ3A 2JNGA 3GOXA 3JCMP 4RTXA 4J9GA 4ZTJA 1SHFA 1YHQA 4RMOA 3V7RA 4AMCA 4PK4A 1QVGS 2E4HA 2YLCA 2O9VA 4M75D 3G6EQ 4BDYA 3RESA 3HP9A 1KHCA 1VQPQ 4BI3A 2B86A 4E7LA 1UDLA 2DL8A 2DMOA 4XTXA 1VQ5Q 5IXFA 3NTIA 3S3OA 2QDLA 4R55A 1WZOA 3PVQA 3C4SA 3CCEA 2QA4T 4OGCA 1V29B 1I07A 1H3HA 3JB9F 3LW5E 2AZSA 2JS0A 2DTHA 4KBMB 5GANe 3OYBA
chains in the Genus database with same CATH topology
2CGHA 2LDMA 4LDWA 4NOYA 4OP0A 2DTOA 2DXCA 3CC2T 2YLBA 5GMKm 4A4GA 3SFMA 1Q86C 3VUBA 3OYAA 1KC8C 5A0LA 1I5LA 3VUZA 3FDRA 3LYIA 2LQ8A 3MEAA 3QDRB 3G4SA 4BY6C 4XU0A 1W2BA 2EQUA 2FVUA 2HAXA 4QQGA 5IT9E 3OMGA 4BY6B 4E7HA 3CCRA 1N6AA 4M78C 5A0DA 3QO3A 1M1FA 1NE8A 5GAMf 2KDSA 3SD4A 2OTLA 2EWNA 4XTYA 5GAMj 2P0KA 3CCUT 3OS5A 4N4GA 4M78B 3E9FA 1O75A 1QW1A 4ZN3A 5CK9A 2WSCE 4F7UA 1QVGA 2RHYA 3RKWA 5GANg 2DAQA 2RA2A 3X20B 3JSCA 4C8QG 3LWHA 4JRQA 3CMEA 2X4JA 1XTDA 4C92F 3WVDB 2HQEA 3OA6A 1BI2A 1KQ1A 2PUOB 2RHIA 4PJOG 2OTLT 4IURA 2JZ2A 2L5QA 1BI1A 2MWPA 2O01E 4M7AE 1Q7YU 3JCMW 5FROA 1YJ9A 3FEOA 4MZPA 2KK4A 4ATOA 1H3ZA 4D6WA 5GAMg 2VGMA 3JCMQ 2VGNA 4M77E 3I56A 4LD6A 3HRUA 4QVCA 3CXCS 2WSEE 5J3BA 3OMCA 4ELZC 5FU7B 3QSUA 1NJIU 4B9WA 1G3SA 1BI3A 1VQ6A 4C0DB 2YHTA 4M7DE 4PNOA 3QKJA 3QZ5B 3M56A 4EDUA 2F5TX 3CCLA 3SWNC 2R57A 2DJZA 3OS1A 1WNLA 3EAEA 2P0QA 3RKYA 5GAN7 1YJ9T 3DLMA 2QQAA 3SWNB 2E10A 4C5EA 2QQ9A 3OYHA 3I56T 1QVPA 1OZ3A 2E1HA 3BY7A 3CBMA 2XICA 3G7ZA 3OSVA 3RMQA 4M7AD 2PUKB 1VQ6T 3A5ZB 3L2VA 1Q81U 3N5BB 1D3BB 2KVQG 2QDYB 1M1GA 3HHTB 3HSBA 3CPWS 3OSSC 3CCLT 5GAOq 5A0GA 2KMTA 2O4XA 2PQWA 5LJ3h 4M77D 4M75G 4HT8A 2RH2A 2XDBA 2MWOA 3OBWA 2R5MA 4MMKA 4PL6A 3OYMA 3SB2A 4E7IA 1I4K1 4ZGJB 4M7AA 2LT1A 3TREA 1KG1A 4O6JA 3MHXA 1P92A 2CZ7B 4C8QC 5GAOn 4M7DD 2GF7A 4ZN1A 2DEQA 4EMKB 4LDUA 1K9MU 1OZ2A 4X34A 5DLOA 2E6ZA 2JUFA 3BW1A 2EJFA 3M4GA 4PJOC 4QW2A 1G3TA 5I2SA 2KSSA 1YITA 4ELYC 3QJYA 3NTHA 3KBGA 4QVZA 1X01A 1Y71A 2XU8A 4O5VA 4PJOB 2ZPHB 3M9QA 3OB9A 4WF2A 4M7DA 1LOJA 2FL7A 1R8OB 5GAMd 3MP8A 4HA8A 4XQ3A 2LNVA 1OYXA 1I81A 1VUBA 2G3RA 1BIAA 1Y96A 2RK2A 4M77C 4MDXA 4J7IA 3BFMA 1O9SA 2XI9A 3JB9I 4JS5A 2LCCA 2LC4A 3MP6A 5IAYA 3H8ZA 3CD6A 1UGRB 4E7KA 2RHUA 5I21A 3M55A 4HKEA 3R6OA 2RD1A 1JJ2S 4BI8B 4HCCA 1WJSA 4A4HA 2FB7A 4FL6A 4A4FA 4NS5A 4JJNK 3DB3A 3VYHB 5GMKj 3CCMA 5CKEA 3FIFA 1UB4A 1YHQT 2DXBA 2ZGWA 5C6SA 3JCMc 4F7UE 3CMAA 1VQMA 4CRIA 5HK0A 3G71T 2A3LA 2ZPFB 2V8KA 4DOWA 3G6EA 2EAYA 3RUXA 3CBPA 3NFCA 1YJNT 2M1HA 3CD6T 2ZZDA 4M78F 2K5FA 1KD1U 1U1SA 1VQPA 2E12A 1UGQB 2GFAA 1WJRA 2MMPA 3CCJT 1M9SA 2LCLA 4M75C 4QQ6A 3CCMT 3OY9A 2XHCA 1VQMT 3OW2S 4Y91A 2QQSA 3CMAT 1B34A 3KXTA 3VJPA 5LJ5h 4FT2A 1FX7A 3L2ZA 4IUUA 5KE2A 2BUDA 4DA4A 4B9XA 4A53A 2CZ6B 2WSFE 2VC8A 3UT1A 3G6ET 1N9SA 1N8RC 3QYGB 3CCET 3E1SA 4KT0E 1W4SA 2QTXA 3JCMV 1VQ4T 2LQKA 5FRMA 1G5VA 2EJ9A 2QQBA 4FT4A 3A8MB 1K8AC 1VQKA 3ASKA 2DZ9A 2D9TA 5FU6C 4OB0B 2PU9B 3PMTA 5GAMe 4DQ2A 3JB9D 1VQNA 1VQ8A 4V2SA 1NPPA 2QQRA 2EJGA 4QVDA 2BKDN 5CKHA 1YIJA 3CPFA 5GAN8 4XTZA 4BB7A 5CKDA 3A8OB 3J81E 3AHUA 3QBYA 1QP3A 1UGSB 4C92E 3VV0A 5KH6A 4E7JA 1RI0A 3JCMh 2X4WA 5GAOm 3OYFA 3G4ST 1VQKT 4ME7A 5CVIA 5D6XA 2K3XA 3T9NA 4GY5A 3X25B 5GMKi 2K5LA 2QEXA 1VQNT 1VQ8T 3CCRT 3LH0A 2DO3A 3HKSA 3M59A 1YIJT 4J6YA 3QYHB 2DTIA 2HBPA 1BYMA 4FIBA 3PNWC 5EG2A 3PTAA 4M7AG 2X4YA 2AHJB 3WVEB 3M58A 5LJ3f 2KAFA 3ME9A 4C5HA 5LJ3j 2P0PA 3OYYA 4JRIA 1U1TA 2JTMA 2F5KA 4YTLA 4M77G 1H641 1YJWA 5KCOA 1M90C 3E19A 3CMET 4Q5WA 2LT4A 4J8OA 2QEXT 1Q82C 2JVVA 3C12A 1VIFA 1AHJB 3P8DA 2B8AA 2JOYA 5CR2A 5DM7R 5GANh 3META 3RIRA 4XU3A 4C92D 4M7DG 5KE3A 3FB9A 1OI1A 2P4TA 4C8QF 3OW2A 2XIDA 3S3MA 4RCBA 1K73C 1BKBA 5CIUA 5DY9A 1PSFA 3X24B 3ZEHA 4FM4B 4C0ZA 4LDXA 1XOVA 4PJOF 5IN1A 5A2QE 4VUBA 1YJWT 3L2RA 2VXFA 4C92A 1YI2A 3GF5A 2CKKA 1WGSA 1Q86U 4QQDA 1KC8U 2XD0A 4E47A 5C0MA 5LJ3g 3OYCA 1G3WA 2DXTA 4HCZA 4OF1A 2FYKA 1VQOA 4L59A 2VXEA 1D3BA 2DXUA 5M9OA 3PGGA 1LNXA 2XKOC 2MF2A 2PVDB 1YCYA 3RERA 1RL2A 1KQ2A 1QVFS 2X35A 3O8VA 4C92C 2MAMA 5GAN3 2Y4XA 3UWNA 3PIOA 3QZ9B 3F70A 4N0AA 4X9DA 1YI2T 1N9RA 4C8QB 4EPCA 2RJCA 4P5NA 3JRZA 4NL2A 2M9UA 2E70A 3VU3C 4EMKA 1VQOT 1KQSS 4CI0C 1M1KC 1EIFA 4LDYA 3H6ZA 4XK8E 2HD0A 2O4XB 3CBOA 5D6YA 3M5AA 2K2VA 3OS0A 4KULA 3GNGA 4M7AC 1M8VA 4XTVA 2C06A 4IUTA 2H3JA 2NLUA 1M4ZA 4JLGA 4M7AB 4C0GA 5FRNA 2BIVA 1M5Q1 2DPPB 3A8GB 3OYDA 2L89A 4M75F 3CXCA 5LJ5f 2Y4YA 2RI3A 4M77B 3TU4K 5LJ5j 2OTJA 2ZPBB 1YITT 3E9GA 5GMKe 3J80E 2EFIA 4M7DC 2QXFA 3QPHA 4XTUA 3ZBDA 4XU2A 4C0FA 5GAOp 4DOVA 4X9CA 2YRVA 3GNFB 4M7DB 3HRSA 5GMKl 2Y90A 2EQKA 4BI4A 2PVGB 4OB1B 4L5GA 1VQ9A 2FHDA 2KY9A 4L6V5 4M78E 2GCXA 4F7UG 3ER0A 5CKFA 3M53A 1X75C 1Y96B 1WJQA 2DVEA 3FJPA 3SDZA 3CCQA 3BDUA 1X6OA 4FSXA 2MI6A 4JRPA 2DIGA 3PT9A 5LJ3d 3JB9G 1K73U 1VQ7A 2OTJT 2XDPA 4MZTA 3PFSA 4J6XA 1S72A 1U8RA 3VKIA 2RB6A 1UGPB 3V8JA 4LD9K 3CPWA 2QA4A 3Q1JA 4XU1A 2E64A 3JCMf 2IG0A 1SSFA 1Q7YC 2D6FA 1VIEA 2E6NA 4PKCC 1TH7A 4M75B 4PLIA 1VQ9T 1VQ5A 4J83A 3QJ6A 3L2QA 2ZPEB 1G3YA 3CEYA 3FC3A 5AYFA 1QP2A 2L8DA 3NTKA 3CCQT 1MGQA 3OYEA 4EMHA 4OB3B 2RI2A 1NPRA 5GAN5 1N27A 2EYQA 3OBYA 4C5GA 4KUDK 2RM4A 2XDDA 4XAXB 1S72T 1NJIC 2HNIA 4A54A 1VQPT 1WQ7A 2GQVA 4M78D 3L1AA 3S6WA 1VQ5T 2LVMA 3M4YA 4J7FA 1JB0E 5FU6B 3URGA 1HK9A 5HK3A 4JLIA 1UEBA 4Z02A 4Y28E 5GANf 3CC7A 2K3YA 5FLXE 1HXDA 1YBYA 3JCMg 5GANj 1I8FA 3OS2A 2DD5A 3GLXA 4M78A 3L2WA 3CCUA 2DZCA 3EFRA 3QXEB 4C92G 3LGFA 4IUPA 1Y07A 3I55A 3PMIA 1Q81C 2M0OA 4J5YA 5GMKh 1MHNA 1JJ2A 5D6WA 2LRQA 4R56A 2DKGA 3L42A 5J39A 3LGLA 3CC7T 2XK0A 5LJ3e 2R5AA 3MEUA 4OVAA 4NL3A 3CC4A 3MCAB 4F7UB 4C5IA 5CCAA 2E5QA 2RJDA 3A8LB 1K9MC 2EQMA 2F69A 2JTFA 4JDSA 3I55T 4BACA 2IVWA 4OB2B 4BE2A 2E65A 4J6WA 4C8QE 5LJ5d 3MO8A 5LL6S 2ZPGB 2RI5A 3GPLA 5CKBA 3C95A 4IUQA 4XTWA 3CCSA 2X4XA 3MEVA 4PJOE 2PVOB 1ZBXA 5J26A 3QIIA 3CC4T 1FXXA 3X26B 2WACA 1JBMA 2GFUA 5CQYA 1LJOA 2CZ1B 2V8JA 2ZPIB 3SWNA 2D0QB 2K4YA 3INZA 3QG1A 4II1A 4EMGA 5FU7C 1N8RU 2CS7A 3V8LA 3JB9H 4PLLA 3V7SA 4M7AF 5I2MA 3J7AF 1IZ6A 4ZGDB 3C94A 3HPWA 4C0DC 1JRIA 5KCHA 5GAMh 3DLLA 4RG8A 3CCST 3PIPA 4JS4A 4M77F 4MZMA 1K8AU 2EIFA 3JCMd 3P8BB 2RHXA 3OYJA 4BE1A 2HQXA 4IUVA 3KUFA 3HRTA 4MDWA 4C8QD 3UPUA 4JUVA 1BI0A 3QHSA 1WPYA 2CYZB 3FRNA 3FLGA 1KHIA 2CZ0B 3BDLA 4TVRA 3VYGA 3ZFJA 3OYKA 4M7DF 2RJEA 1BIBA 2DIQA 4LDVA 2RO0A 1KD1C 4C92B 5L8RE 4PJOD 2KQWA 3OYGA 2E41A 3TEEA 1XNIA 5GAN6 5CAIA 5GAN2 5CO7A 2EKOA 2K57A 4RCCA 3WXMB 4C8QA 4MMLA 3OQ5A 3DB4A 3LX7A 3GIBA 3RKXA 4A4KA 3JCMX 2V8IA 4BDZA 4M75E 3HFNA 4BD3A 3JB9J 4PJOA 4IKFA 3CCVA 3UDCA 2R58A 4N0AC 1XQHA 3M57A 3EFSA 5GANd 5LJ5e 3LLRA 2JN0A 1PSEA 4N4HA 4EMKC 5CQXA 3L2UA 3QUIA 4GLKA 3OYNA 5HKCA 2ZCFB 1IREB 2A7YA 2VV5A 1FWZA 2M16A 2RK1A 4BE0A 5GAOr 3HFOA 4M77A 3MEWA 4OMFB 4RG2A 1M90U 4FU6A 3X28B 2EQJA 1W2BS 1Q82U 2JNGA 3GOXA 3JCMP 1WQWA 1ZHIA 3HL8A 4OGEA 4A4EA 3CCVT 4JRKA 3RMSA 2LTOA 5DLQE 1Y7XA 1ZQ1A 4ZTJA 1VQLA 4M78G 1YHQA 4ZTFA 4RMOA 2OAUA 1DJ7B 4KUIA 3V7RA 2XG8D 1QVGS 2YLCA 3G71A 2K5IA 3DKMA 4M75D 3OYIA 3JCMe 4ZGEB 3JAME 1NZ9A 3RESA 4BDYA 3HP9A 1YJNA 5GAN4 4HCBA 5LJ5g 1KHCA 3JCMJ 3S3NA 3CCJA 3OYLA 5HY6A 2DK3A 2LX9A 1QVFA 4HT9A 4BI3A 4E7LA 3M54A 2RJFA 2VUBA 1VQLT 4M75A 3JCMb 4XTXA 3GP8A 1GXIE 1VQ7T 3LWIA 3NTIA 5GAOl 3CC2A 2VYTA 3P8HA 3V7CA 3S3OA 4R55A 3TCJA 2QI2A 2DD4A 3A8HB 4UC4A 3C4SA 3CCEA 4F7UF 1KQSA 3MP1A 4OGCA 2QA4T 1V29B 1VQ4A 3JB9F 2L3RA 3V8KA 3LW5E 4N4IA 2I2LA 4RKUE 2DTHA 4KBMB 5GANe 3OYBA 1B34B 4BUGA 2RHZA 1M1KU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LDM A;  2LCC A;  3MO8 A;  3MP6 A;  5IAY A;  3H8Z A;  2X35 A;  2RI5 A;  2RHU A;  4E7K A;  3O8V A;  3UWN A;  4IUQ A;  4A4G A;  1WJS A;  4A4H A;  3OYA A;  4FL6 A;  3F70 A;  2X4X A;  3MEV A;  4A4F A;  4NS5 A;  3DB3 A;  2RJC A;  5J26 A;  3QII A;  3FDR A;  5C6S A;  2WAC A;  2GFU A;  3LYI A;  3MEA A;  4CRI A;  2EQU A;  3H6Z A;  4QQG A;  3OMG A;  2O4X B;  4II1 A;  5D6Y A;  3OS0 A;  4E7H A;  2M1H A;  4PLL A;  4IUT A;  3SD4 A;  2NLU A;  2P0K A;  4N4G A;  5FRN A;  5KCH A;  2GFA A;  1WJR A;  2BIV A;  3E9F A;  3OYD A;  4QQ6 A;  2L89 A;  2RHY A;  3OY9 A;  3OYJ A;  2DAQ A;  2RHX A;  4BE1 A;  2HQX A;  2RI3 A;  3KUF A;  4IUV A;  2QQS A;  3E9G A;  4IUU A;  5KE2 A;  2EFI A;  2BUD A;  3FLG A;  3BDL A;  4B9X A;  3OYK A;  3UT1 A;  2HQE A;  2RJE A;  2DIQ A;  3OA6 A;  2RO0 A;  2YRV A;  2RHI A;  3OYG A;  1XNI A;  4IUR A;  5FRM A;  1G5V A;  2JZ2 A;  2EKO A;  2EQK A;  2MWP A;  2FHD A;  5FRO A;  3ASK A;  2D9T A;  1WJQ A;  3FEO A;  3PMT A;  3OQ5 A;  3DB4 A;  1H3Z A;  3LX7 A;  2DIG A;  2XDP A;  4BDZ A;  2QQR A;  4LD6 A;  4BD3 A;  2BKD N;  3PFS A;  4IKF A;  3OMC A;  2R58 A;  3LLR A;  4B9W A;  4N4H A;  3Q1J A;  3QBY A;  2IG0 A;  1SSF A;  5KH6 A;  3L2U A;  3QKJ A;  4EDU A;  1RI0 A;  2E6N A;  3OYN A;  4PLI A;  4E7J A;  3OYF A;  2X4W A;  2M16 A;  2R57 A;  3OS1 A;  4BE0 A;  3QJ6 A;  3L2Q A;  3EAE A;  3CEY A;  5D6X A;  3FC3 A;  2K3X A;  2L8D A;  3MEW A;  3NTK A;  3DLM A;  4GY5 A;  3OYE A;  4RG2 A;  4FU6 A;  2RI2 A;  4C5E A;  3OYH A;  1N27 A;  3LH0 A;  2EQJ A;  4C5G A;  1OZ3 A;  3GOX A;  4A4E A;  2LTO A;  3PNW C;  4ZTJ A;  2X4Y A;  3L2V A;  4ZTF A;  3S6W A;  4C5H A;  3ME9 A;  2LVM A;  2O4X A;  2F5K A;  2PQW A;  5KCO A;  3OYI A;  4Z02 A;  4Q5W A;  2MWO A;  4PL6 A;  2R5M A;  4BDY A;  4E7I A;  3OYM A;  2K3Y A;  3P8D A;  2B8A A;  3OS2 A;  1KHC A;  3MET A;  3L2W A;  3S3N A;  5KE3 A;  2GF7 A;  1OI1 A;  3LGF A;  4IUP A;  3OYL A;  3PMI A;  3S3M A;  2M0O A;  4E7L A;  2RJF A;  1OZ2 A;  4X34 A;  1MHN A;  5CIU A;  3ZEH A;  5D6W A;  4QW2 A;  2LRQ A;  3NTI A;  5IN1 A;  2VYT A;  3P8H A;  3NTH A;  3S3O A;  4QVZ A;  3L42 A;  3L2R A;  5J39 A;  3M9Q A;  3LGL A;  2CKK A;  3C4S A;  3OB9 A;  1WGS A;  2XK0 A;  2R5A A;  3MP1 A;  4QQD A;  4UC4 A;  3MEU A;  4OVA A;  5C0M A;  3OYC A;  3MP8 A;  4C5I A;  2L3R A;  2E5Q A;  4HCZ A;  2RJD A;  1OYX A;  2EQM A;  2G3R A;  4N4I A;  2JTF A;  4BAC A;  4L59 A;  5M9O A;  3OYB A;  4BE2 A;  2RHZ A; 
#chains in the Genus database with same CATH topology
 4NOY A;  2ENM A;  3VUB A;  3OYA A;  5A0L A;  1UE9 A;  3FDR A;  3LYI A;  2EQU A;  1TWB A;  5IT9 E;  1AWW A;  4BY6 B;  3CCR A;  1N6A A;  1W6X A;  4M78 C;  5GAM f;  3CCU T;  2FG0 A;  1O75 A;  1UEC A;  1QVG A;  3CC4 Q;  5GAN g;  3X20 B;  1PRM C;  3JSC A;  2QK0 A;  3RR6 A;  3WVD B;  4J9H A;  3OA6 A;  2RHI A;  2IPO B;  5I22 A;  1OU8 A;  2O01 E;  3JCM W;  2A36 A;  2MK5 A;  4MZP A;  4ATO A;  3CXC S;  2WSE E;  2DEU A;  3QSU A;  2FPD A;  4C0D B;  3QKJ A;  3SWN C;  3RKY A;  2E10 A;  1JJ2 P;  2QQ9 A;  3BY7 A;  2XIC A;  2CH4 W;  3H0H A;  4HVV A;  3VS0 A;  1GBR A;  3HHT B;  2QDY B;  5GAO q;  2PQW A;  4M77 D;  4PL6 A;  3SB2 A;  1QWF A;  2LT1 A;  3TRE A;  1P92 A;  4ZN1 A;  3ZL7 C;  2EYX A;  4EMK B;  2JUF A;  3M4G A;  5I2S A;  1YIT A;  4KH1 B;  2XU8 A;  1LOJ A;  4IIO A;  2FZK B;  1R8O B;  4FYV B;  3MP8 A;  4XQ3 A;  2G3R A;  2MIO A;  2RK2 A;  4MDX A;  1U3O A;  4J7I A;  2EVR A;  2KRN A;  3JB9 I;  1M1K R;  2LCC A;  2RHU A;  2CP7 A;  2NUZ A;  3O5Z A;  4HKE A;  1TOV A;  2FB7 A;  2KYB A;  4A4F A;  4NS5 A;  1MND A;  4JJN K;  3CCM A;  5CKE A;  4OMP A;  5ECA A;  1VQM A;  5C6S A;  4F7U E;  3G71 T;  2A3L A;  1GL5 A;  4DOW A;  2P4R A;  1D0X A;  1FMV A;  2BZ8 A;  1JU5 C;  3EGD A;  3CCM T;  1VQM T;  2EGA A;  2NWM A;  1B34 A;  5LJ5 h;  3EG1 A;  3L2Z A;  4E2F B;  4B9X A;  1N8R C;  2KR3 A;  1M30 A;  1PCX A;  3JCM V;  1W4S A;  2QTX A;  1MUZ A;  1RUW A;  2RN8 A;  3IQL A;  1Q7Y R;  1E6H A;  4V2S A;  1YWO A;  4QVD A;  1YIJ A;  2BKD N;  5CKH A;  2KRM A;  2KRS A;  1YCS B;  1QKX A;  1OEB A;  2OTL Q;  3H9N A;  1QCO A;  1UGS B;  4C92 E;  1RI0 A;  2YT6 A;  3T9N A;  3X25 B;  2K3X A;  1WI7 A;  2QEX A;  2DO3 A;  3M59 A;  2JXB A;  1YIJ T;  1PG5 B;  2FRY A;  1ZSZ A;  2HBP A;  5EG2 A;  2AHJ B;  2HBW A;  1Q81 R;  3WVE B;  1U06 A;  4JRI A;  3OYY A;  4F16 A;  2JTM A;  1NYG A;  1YJ9 Q;  5KCO A;  1M90 C;  2QEX T;  1Q82 C;  1VIF A;  5CR2 A;  1IB8 A;  4R0K A;  3FB9 A;  3S3M A;  1K9M R;  1K73 C;  1UGV A;  1BKB A;  5CIU A;  1B07 A;  4FM4 B;  1FYN A;  2CT3 A;  3GBQ A;  1KFZ A;  3GF5 A;  4QQD A;  2DET A;  5LJ3 g;  1RAF B;  1YFN A;  2AKL A;  2VXE A;  1LNX A;  2DE0 X;  4Z8A A;  2PVD B;  1PHT A;  1KQ2 A;  2E3H A;  1QVF S;  2X35 A;  1CSK A;  2AT1 B;  3VS5 A;  8ATC B;  4X9D A;  1N9R A;  1SEM A;  4P5N A;  2RPN A;  1EIF A;  4J9F A;  1M8V A;  2D8J A;  2C06 A;  3EH1 A;  4IUT A;  1M4Z A;  4CC2 A;  5KYU B;  2ED1 A;  3OYD A;  4M75 F;  1YHQ Q;  2L3S A;  2RI3 A;  2OTJ A;  4DEY A;  5LJ5 j;  1TTH B;  5GMK e;  2EFI A;  1M3C A;  2QXF A;  4XTU A;  3CD6 Q;  2YRV A;  3GNF B;  1BK2 A;  5GMK l;  1TXQ A;  1R0C B;  4L5G A;  3M53 A;  4E7Z A;  4PFP A;  4FSX A;  2OTJ T;  1IHV A;  2BZY A;  2XDP A;  1HJD A;  3PFS A;  3THK A;  1WIE A;  3CCE Q;  1Z9Z A;  3C0C A;  5KYX A;  2IG0 A;  1SSF A;  1VIE A;  1VQ5 A;  1WX6 A;  1X69 A;  2H8H A;  4J9E A;  3FC3 A;  5AYF A;  1ZUY A;  2J05 A;  1T3L A;  4EMH A;  4OB3 B;  2RI2 A;  5GAN 5;  2QG9 B;  1N27 A;  3EG0 A;  1RAD B;  3UA7 A;  1NJI C;  2HNI A;  1VQP T;  1WQ7 A;  2GQV A;  4M78 D;  1SKU B;  1VQ5 T;  1HK9 A;  2EYY A;  1VQN Q;  5GAN f;  2JM8 A;  3CCR Q;  3QDF A;  2YXY A;  2DZC A;  1K9A A;  2HKQ B;  4RTZ A;  5GMK h;  2LJ1 A;  1G83 A;  4R56 A;  3L42 A;  1UHC A;  3M0R A;  3CC4 A;  3MCA B;  2E5Q A;  2CUB A;  2RJD A;  2JTF A;  4BAC A;  2IVW A;  1TUD A;  2OJ2 A;  2RMO A;  1LCK A;  1NG2 A;  5LJ5 d;  2K7A A;  5LL6 S;  1WXU A;  2RI5 A;  1YJW Q;  3GPL A;  3C95 A;  2COW A;  4Y92 A;  2CSQ A;  1ZBX A;  1GRI A;  1TSF A;  3QII A;  3CC4 T;  1FXX A;  1JBM A;  2HSP A;  1VA7 A;  1NM7 A;  3INZ A;  4II1 A;  2YDL A;  1N8R U;  1BU1 A;  1QMC A;  5KCH A;  5GAM h;  1X43 A;  4M77 F;  4IUV A;  3KUF A;  1GCP A;  3HRT A;  2RQW A;  4JUV A;  1TS9 A;  3VS6 A;  3ZFJ A;  3FLG A;  3BDL A;  3QWY A;  1BIB A;  4LDV A;  2RO0 A;  2L2P A;  1KD1 C;  2KQW A;  2E41 A;  3TEE A;  5CAI A;  4RCC A;  2VB6 A;  2I0N A;  4C8Q A;  3RKX A;  2V8I A;  1YIT Q;  4BDZ A;  2W10 A;  3JB9 J;  4PJO A;  2R58 A;  2DBM A;  3M57 A;  4J9I A;  5HKC A;  2ZCF B;  1FWZ A;  2M16 A;  4M77 A;  2EPD A;  2KBT A;  2ROL A;  4OMF B;  1M90 U;  3X28 B;  1YWP A;  1Q82 U;  1WQW A;  1MMG A;  5IHI A;  1DJ7 B;  4KUI A;  2DRM A;  1UJY A;  1IXD A;  1NLP C;  3JCM e;  4ZGE B;  4JZ3 A;  4HVU A;  2DL5 A;  1YJN A;  2LQN A;  1EFN A;  2DK3 A;  1WHM A;  2LX9 A;  2QGF B;  2VUB A;  3JCM b;  2DF6 A;  1GXI E;  1X6B A;  3LWI A;  3CC2 A;  2VYT A;  3V7C A;  3TCJ A;  1WHK A;  1KQS A;  3FJ5 A;  1YP5 A;  3NPF A;  1NEG A;  2L0A A;  4GBQ A;  3MKD A;  4BUG A;  2RHZ A;  2CGH A;  4LDW A;  5AT1 B;  1QQJ A;  2YRD A;  4OP0 A;  3HTR A;  2DXC A;  3CC2 T;  2YLB A;  4A4G A;  2DL3 A;  1V1C A;  3MEA A;  2LQ8 A;  3M0Q A;  4BY6 C;  2QAS A;  1GCQ A;  2QEX Q;  3EHQ A;  2OTL A;  1M1F A;  1NE8 A;  4RTY A;  2KDS A;  5GAM j;  1BCM A;  2P0K A;  4KRT A;  2DM1 A;  3E9F A;  1QW1 A;  2BZX A;  4ZN3 A;  3CPW P;  2KNB B;  2RHY A;  3RKW A;  1K8A R;  4OMO A;  4C8Q G;  3LWH A;  2EYZ A;  1VYV A;  1AT1 B;  4JRQ A;  2AK5 A;  2A28 A;  3CME A;  2X4J A;  1BI2 A;  1KQ1 A;  4PJO G;  2OTL T;  3R6N A;  4A63 B;  1BI1 A;  1CKA A;  4AT1 B;  1YJ9 A;  1H3Z A;  4D6W A;  2VGM A;  4ELZ C;  1VYU A;  1NJI U;  1BI3 A;  4PNO A;  2F5T X;  4LN2 A;  2A0F B;  4FW2 A;  3EAE A;  2P0Q A;  1MV0 B;  1YJ9 T;  3DLM A;  1TUC A;  4C5E A;  2PTK A;  3OYH A;  1QVP A;  2GQI A;  1LPL A;  1OZ3 A;  6AT1 B;  2HL5 C;  1M8M A;  2PUK B;  3A5Z B;  3N5B B;  1D3B B;  2KVQ G;  1M1G A;  3I9Q A;  1AD5 A;  5A0G A;  2KXC A;  2O4X A;  2XDB A;  3ULR B;  4HT8 A;  3OBW A;  4M7A A;  1AZG B;  2AKK A;  3BW1 A;  2OTJ Q;  4K11 A;  2CH4 A;  2PZ1 A;  5KYY A;  4ELY C;  3QJY A;  4QVZ A;  1Y71 A;  2NUT A;  4PJO B;  4M7D A;  5GAM d;  1X2K A;  1QKW A;  1VQL Q;  3BFM A;  2XI9 A;  3MP6 A;  3CD6 A;  2F2X A;  3R6O A;  1JJ2 S;  2DYI A;  4BI8 B;  1WJS A;  3VYH B;  4LUE A;  3EGX B;  3FIF A;  1T0J A;  1UUE A;  1YHQ T;  2DXB A;  2ZGW A;  4DEX A;  4E7S A;  2ZPF B;  2J06 A;  2V8K A;  2EAY A;  3CBP A;  3NFC A;  1WHL A;  1X27 A;  4M78 F;  3CD6 T;  1KD1 U;  1U1S A;  2GFA A;  2MMP A;  3M0P A;  2DX1 A;  4RTU A;  1ZUU A;  3VJP A;  2OX7 A;  2CZ6 B;  2WSF E;  3CCE T;  4KT0 E;  2ATC B;  2JJ9 A;  2CP6 A;  2VWF A;  2QQB A;  3ASK A;  2DZ9 A;  5FU6 C;  1VQN A;  4PFZ A;  1NPP A;  2EW3 A;  1K1Z A;  3AHU A;  3QBY A;  1QP3 A;  3EG9 B;  1D1C A;  3OYF A;  5GAO m;  2DER A;  2YWW A;  4GY5 A;  1J3T A;  1VQN T;  3CCR T;  3LH0 A;  4J6Y A;  2DTI A;  2YUP A;  3PNW C;  4FIB A;  5KYW A;  4M7A G;  3M0T A;  2SRC A;  2KAF A;  1U1T A;  1YJW A;  3E19 A;  3I56 Q;  2JVV A;  5DM7 R;  2B8A A;  2VVK A;  5GAN h;  3RIR A;  4XU3 A;  4C92 D;  4M7D G;  1AWX A;  3JV3 A;  1RAC B;  4RCB A;  3NHN A;  5DY9 A;  1PSF A;  4C0Z A;  1XOV A;  3REA B;  1FMW A;  5A2Q E;  1YJW T;  2F2W A;  2VXF A;  3L2R A;  2GBQ A;  1YI2 A;  2CKK A;  1IRX A;  4HCZ A;  2FYK A;  4L59 A;  3PGG A;  1QVG P;  2X51 A;  1QCN A;  3EFO A;  2D8H A;  2DLP A;  3UWN A;  1SSH A;  2YSQ A;  3PIO A;  1YI2 T;  2ED0 A;  2X3X D;  2KT1 A;  4Z88 A;  2BE7 D;  2CP2 A;  2RJC A;  4EPC A;  3JRZ A;  4NL2 A;  1H8K A;  2M9U A;  2VAS A;  3VS7 A;  2DA9 A;  1M1K C;  2O4X B;  3CBO A;  1LVK A;  2K2V A;  4KUL A;  4XTV A;  2NLU A;  4M7A B;  2NUP A;  3A8G B;  3CXC A;  1NYF A;  3TU4 K;  2LX7 A;  1YIT T;  3E9G A;  3QPH A;  5IH2 A;  1X6G A;  3ZBD A;  5FW9 A;  4XU2 A;  1YJN Q;  4DBF A;  1V76 A;  4M7D B;  2EQK A;  4KUD K;  4L6V 5;  2GCX A;  3FJP A;  3JB9 G;  1VQ7 A;  3CC2 Q;  4RTT A;  4OMM A;  3VKI A;  1PD0 A;  1UGP B;  4LD9 K;  1YNZ A;  4HXJ A;  3JCM f;  1Q7Y C;  1G8X A;  9ATC B;  4J83 A;  2YUQ A;  3UAT A;  2QTV A;  2ZPE B;  1G3Y A;  1QP2 A;  2L8D A;  3NTK A;  3OYE A;  2EYQ A;  4C5G A;  4XAX B;  1WYX A;  4CC4 B;  1VQK Q;  3M4Y A;  2AIR B;  5FU6 B;  3URG A;  3EH2 A;  1NBE B;  4Z02 A;  4FYW B;  2DRK A;  4RUG A;  1C6V X;  1VQ8 Q;  2K3Y A;  5FLX E;  1YBY A;  4KGZ B;  5GAN j;  3AT1 B;  2LCS A;  1OOT A;  1ZBJ A;  3EFR A;  2LP5 A;  3LGF A;  1Q81 C;  3VRY A;  1K4U S;  4J5Y A;  2DKG A;  4FSS A;  3CME Q;  4QKU A;  4JJD A;  5LJ3 e;  1Q86 R;  1KC8 R;  4NL3 A;  1TU0 B;  5CCA A;  1K9M C;  2F69 A;  4IIM A;  4JDS A;  2NYS A;  4OB2 B;  4BE2 A;  4C8Q E;  2JW4 A;  1TG0 A;  2ZPG B;  1ZSZ C;  1VYT A;  2F1L A;  4PJO E;  2X4X A;  3MEV A;  2PVO B;  2COZ A;  3TSW A;  5J26 A;  1ZA2 B;  1LJO A;  4WTO B;  2V8J A;  2X3W D;  4EMG A;  2CT4 A;  3QG1 A;  1WFW A;  2CS7 A;  2O9S A;  4OMQ A;  3C94 A;  4CC3 A;  1RAI B;  3DLL A;  4RG8 A;  3PIP A;  4MZM A;  3P8B B;  2RHX A;  2LQW A;  5D7U A;  1BI0 A;  4AFZ C;  2CYZ B;  4TVR A;  3OYK A;  2O88 A;  1XNI A;  1RLQ C;  2EKO A;  2K57 A;  5CO7 A;  2ZAE A;  3OQ5 A;  3DB4 A;  3LX7 A;  3JCM X;  1SRM A;  3HFN A;  1KK7 A;  3EFS A;  2RF0 A;  5GAN d;  3LLR A;  1I0C A;  1PSE A;  3EHR A;  3L2U A;  3QUI A;  3OYN A;  2RK1 A;  5GAO r;  3MEW A;  4FU6 A;  2EQJ A;  1W2B S;  1E6G A;  1ZHI A;  4OGE A;  4JRK A;  2LTO A;  1Y7X A;  4DBQ A;  2NUP B;  1VQL A;  1BCO A;  4ZTF A;  2XG8 D;  3DKM A;  3JAM E;  2J6O A;  1S72 Q;  2FRW A;  3JCM J;  3S3N A;  3CCJ A;  3OYL A;  5HY6 A;  1QVF A;  1UHF A;  2LZ6 B;  3M54 A;  1VQL T;  4M75 A;  2SEM A;  3P8H A;  2Z0W A;  2QI2 A;  2KEA A;  4F7U F;  4F04 B;  1VQ4 A;  3EGD B;  1IGU A;  3V8K A;  5L23 A;  4N4I A;  1SHG A;  2CUD A;  2I2L A;  4RKU E;  1B34 B;  1M1K U;  2LDM A;  2QGG A;  5FWC A;  3I35 A;  1UG1 A;  5FWB A;  3VUZ A;  1BB9 A;  3G4S A;  4XU0 A;  1W2B A;  2HAX A;  4QQG A;  3OMG A;  4E7H A;  5A0D A;  2JMC A;  3SD4 A;  4FCY A;  3OS5 A;  2F2V A;  2WSC E;  4F7U A;  2RQU A;  2J6K A;  2RA2 A;  4C92 F;  1ZSZ B;  2PUO B;  4IUR A;  2AZV A;  2M0Y A;  2L3Q A;  2L5Q A;  4M7A E;  1Q7Y U;  3FEO A;  2KK4 A;  3PE0 A;  5GAM g;  3I56 A;  2VGN A;  1AEY A;  4LD6 A;  3HRU A;  2GNC A;  3OMC A;  1YI2 Q;  1TUG B;  2A08 A;  4M7D E;  1I5O B;  1B3Q A;  1WNL A;  1JXM A;  3I56 T;  2E1H A;  3CBM A;  2JMA A;  3OSV A;  3L2V A;  1Q81 U;  3CPW S;  4AFS C;  2KE9 A;  4M75 G;  1PWT A;  2IIM A;  4ZGJ B;  3CCV Q;  3MHX A;  2CZ7 B;  4C8Q C;  1M2V A;  4LDU A;  1K9M U;  3VS2 A;  4X34 A;  5DLO A;  2E6Z A;  1PC0 A;  4PJO C;  1G3T A;  3KBG A;  2KGT A;  3CQT A;  2DJQ A;  2EGE A;  4O5V A;  4J9D A;  2ZPH B;  3M9Q A;  2ESW A;  2FL7 A;  2LNV A;  1OYX A;  4M77 C;  1OU9 A;  3NMZ C;  1AOJ A;  4JS5 A;  1VQ7 Q;  2LC4 A;  5IAY A;  3H8Z A;  1UGR B;  4E7K A;  5I21 A;  4HCC A;  4A4H A;  4FL6 A;  4LNP A;  3DB3 A;  5GMK j;  2MYS A;  1UB4 A;  1ZUK A;  5HK0 A;  3NGP A;  3RUX A;  1YJN T;  2ZZD A;  2K5F A;  2DL7 A;  1UGQ B;  1WJR A;  5KYX B;  1M9S A;  2LCL A;  3I5R A;  4QQ6 A;  1AZE A;  1RAA B;  2FO0 A;  1UFF A;  3OY9 A;  1QWE A;  3OW2 S;  4Y91 A;  2QQS A;  1RAB B;  2J6F A;  5KE2 A;  2BUD A;  3KFV A;  4A53 A;  2K79 A;  2EYW A;  2VC8 A;  1W70 A;  3UT1 A;  3QYG B;  3E1S A;  1WHJ A;  2LQK A;  1G5V A;  3A8M B;  1K8A C;  1VQK A;  4KGX B;  4OB0 B;  2PU9 B;  4DQ2 A;  1VQ8 A;  2EJG A;  3A98 A;  2FZC B;  3CPF A;  4XTZ A;  5CKD A;  3A8O B;  1PKT A;  3JCM h;  2X4W A;  3H0F A;  1VQK T;  1GCQ C;  4ME7 A;  2K5L A;  1VQ8 T;  3HKS A;  4OML A;  3QYH B;  4J9C A;  1WA7 A;  1KQS P;  2X4Y A;  1WLP B;  3M58 A;  5LJ3 f;  4C5H A;  1PRL C;  1HYO A;  2F5K A;  4M77 G;  1H64 1;  3CME T;  2J7I A;  2LT4 A;  1D0Z A;  2M02 A;  4D8K A;  3P8D A;  2JOY A;  3EGU A;  3I5S A;  3MET A;  1OI1 A;  4X1V A;  3OW2 A;  1KIK A;  2XID A;  1VQ6 Q;  1KSW A;  2MOX A;  1PNJ A;  1K0X A;  3X24 B;  3CCL Q;  3ZEH A;  4LDX A;  5IN1 A;  1M2O A;  3SHW A;  2W0Z A;  2XD0 A;  1RAG B;  1G3W A;  2DXT A;  4OF1 A;  5M9O A;  4RTV A;  3RER A;  2M51 A;  1IHW A;  3QZ9 B;  4N0A A;  4C8Q B;  4EMK A;  3VU3 C;  2DBK A;  4XK8 E;  2HD0 A;  5D6Y A;  2O2O A;  2PNI A;  3M5A A;  3GNG A;  4M7A C;  4F17 A;  3BE3 A;  4JLG A;  5FRN A;  2BIV A;  1M5Q 1;  2FEI A;  3SEM A;  2L89 A;  5IHN A;  1M2V B;  2Y4Y A;  4M77 B;  2ZPB B;  2CRE A;  2K3B A;  3J80 E;  1RLP C;  4M7D C;  5GAO p;  4C0F A;  4DOV A;  3CCJ Q;  4BI4 A;  1VQ9 A;  1ZA1 B;  8AT1 B;  1RI9 A;  1ACM B;  5CKF A;  2DVE A;  3CCQ A;  4JRP A;  3BDU A;  1X6O A;  3CMA Q;  1S72 A;  1U8R A;  3MPU B;  2RB6 A;  3D7S B;  3V8J A;  2LNH B;  2QA4 A;  1VQ4 Q;  4XU1 A;  2C0I A;  2E64 A;  3A1P A;  1Q95 G;  4JJC A;  2E6N A;  4PKC C;  1VQ9 T;  1OPL A;  3QJ6 A;  3L2Q A;  3CEY A;  3CCQ T;  1MGQ A;  2XMF A;  4AFQ C;  1NPR A;  3OBY A;  1ABQ A;  1S72 T;  4A54 A;  2HL3 A;  4KGV B;  1SPK A;  3L1A A;  3G4S Q;  2LVM A;  1JB0 E;  2HQH A;  3CC7 A;  1HXD A;  2BE9 B;  4Z89 A;  1I8F A;  2DD5 A;  3GLX A;  4M78 A;  3CCU A;  3QXE B;  4ESR A;  1Y07 A;  3PMI A;  1AVZ C;  1MHN A;  4ORZ A;  1JJ2 A;  5D6W A;  2HCK A;  5J39 A;  3LGL A;  3CC7 T;  2R5A A;  1ZX6 A;  2BTT A;  2OI3 A;  3VS3 A;  1XJW B;  2L3P A;  3A8L B;  2EQM A;  1MMA A;  4DBH A;  2YUO A;  2E65 A;  4J6W A;  1RAH B;  3MO8 A;  1D1B A;  5CKB A;  4IUQ A;  3CCS A;  5IXB A;  4PJM A;  3X26 B;  1ABO A;  3SWN A;  5FU7 C;  3V8L A;  3V7S A;  5I2M A;  3HPW A;  4FYY B;  1JRI A;  1OUL A;  3CCS T;  4FYX B;  1K8A U;  2EIF A;  3JCM d;  1VQO Q;  1D0Y A;  4PJN A;  2HQX A;  4C8Q D;  3UPU A;  3QHS A;  3FRN A;  4E6R A;  2RJE A;  2DIQ A;  2RQR A;  4PJO D;  3OYG A;  5GAN 6;  5GAN 2;  2E5K A;  2JM9 A;  1A0N B;  3GIB A;  4M75 E;  4IKF A;  3CCV A;  3UDC A;  3EG2 A;  5LJ5 e;  4OMN A;  1EZZ B;  2JN0 A;  4N4H A;  5CQX A;  5KYU A;  1WXB A;  1JXO A;  2VV5 A;  4BE0 A;  3HFO A;  5KYY B;  1ARK A;  4WCI A;  2NUT B;  3HL8 A;  3CCV T;  4A4E A;  3RMS A;  5DLQ E;  1ZQ1 A;  2K9G A;  1JQQ A;  3E2U A;  4M78 G;  2OAU A;  2V1R A;  2K5I A;  3G71 A;  1EX4 A;  3OYI A;  1NZ9 A;  2EQI A;  2GTO A;  5GAN 4;  4HCB A;  5LJ5 g;  4HVW A;  1KJW A;  1PM3 A;  4HT9 A;  1YN8 A;  2RJF A;  2GGR A;  4GLM A;  3GP8 A;  1VQ7 T;  5GAO l;  2DD4 A;  3A8H B;  4UC4 A;  5IHK A;  3MP1 A;  1HD3 A;  1NEB A;  5GJV B;  2L3R A;  2EBP A;  2ROT A;  1SF9 A;  3VYG A;  3PVL A;  3CXC P;  2DTO A;  1AWJ A;  5GMK m;  3SFM A;  1Q86 C;  1KC8 C;  1I5L A;  1ZLM A;  5EC7 A;  3I55 Q;  3QDR B;  2CP3 A;  3UF4 A;  2FVU A;  1N8R R;  3QO3 A;  2EWN A;  4XTY A;  4N4G A;  1W1F A;  1Y0M A;  4M78 B;  1G2B A;  5CK9 A;  2DAQ A;  1OPK A;  1MV3 A;  1XTD A;  2HQE A;  1D09 B;  4AG1 C;  2A37 A;  1WHH A;  5KYW B;  2JZ2 A;  1UJ0 A;  2MWP A;  5FRO A;  3JCM Q;  4M77 E;  4D8D A;  4QVC A;  5J3B A;  5FU7 B;  1IGQ A;  1M3B A;  4B9W A;  1G3S A;  2MCN A;  2CP0 A;  1VQ6 A;  2YHT A;  2D1X A;  3VRZ A;  3QZ5 B;  3M56 A;  4EDU A;  3CCL A;  2R57 A;  2DJZ A;  3OS1 A;  5GAN 7;  2QQA A;  3SWN B;  1M90 R;  4AFU C;  1Q82 R;  3TQ7 P;  3G7Z A;  3RMQ A;  1Z9Q A;  4M7A D;  1U5S A;  1VQ6 T;  4LE9 A;  2KT8 A;  1NLO C;  1JO8 A;  3HSB A;  1K73 R;  3CCL T;  3OSS C;  3EFO B;  2KMT A;  5LJ3 h;  2RH2 A;  1IO6 A;  1AWO A;  2MWO A;  4E7I A;  2R5M A;  2LMJ A;  4MMK A;  3OYM A;  3TSZ A;  1I4K 1;  1KG1 A;  1MMD A;  4O6J A;  5GAO n;  4M7D D;  2GF7 A;  4J9B A;  2DEQ A;  2DIL A;  1OZ2 A;  2EJF A;  4QW2 A;  2KSS A;  3NTH A;  4EIK A;  1X01 A;  2RQV A;  1K76 A;  3OB9 A;  4WF2 A;  2O31 A;  4HA8 A;  1VQ9 Q;  1I81 A;  1VUB A;  1BIA A;  1Y96 A;  1QCF A;  1O9S A;  3CCQ Q;  3H41 A;  3M55 A;  3G1J A;  4JPB W;  1OV3 A;  2RD1 A;  2C0O A;  2JS2 A;  2QA4 Q;  1GFD A;  2ECZ A;  2CP5 A;  3JCM c;  3CMA A;  4CRI A;  1N5Z A;  2HKN A;  3G6E A;  5I11 A;  2M1H A;  1VQP A;  2E12 A;  2QYZ A;  3CCJ T;  4M75 C;  1QLY A;  1RAE B;  2DYB A;  2XHC A;  1WXT A;  3U23 A;  3CMA T;  2YUN A;  3KXT A;  3TVT A;  2JT4 A;  1Y57 A;  3EG3 A;  1FX7 A;  4FW1 A;  4IUU A;  4FT2 A;  4DA4 A;  3RNJ A;  3CC7 Q;  3G6E T;  1N9S A;  4CC7 A;  3CCU Q;  1F1B B;  1VQ4 T;  5FRM A;  2EJ9 A;  4FT4 A;  4PFO A;  4RTW A;  2D9T A;  5GAM e;  3PMT A;  1SG5 A;  3JB9 D;  1WHG A;  2QQR A;  5GAN 8;  3UA6 A;  4BB7 A;  1NJI R;  3J81 E;  1SRL A;  2HDA A;  3VV0 A;  5KH6 A;  4E7J A;  1T0H A;  3REB B;  2V1Q A;  3G4S T;  2D0N A;  1QVF P;  5CVI A;  5D6X A;  4B6M A;  5GMK i;  5HCK A;  3VS1 A;  1FMK A;  3CCS Q;  1BYM A;  3PTA A;  1R0B G;  1HSQ A;  2LJ0 A;  3ME9 A;  5LJ3 j;  2P0P A;  1I1J A;  4YTL A;  4Q5W A;  4J8O A;  1D1A A;  3C12 A;  1AHJ B;  2CDT A;  5KE3 A;  2P4T A;  4C8Q F;  3QWX X;  5KYN A;  1S1N A;  4AG2 C;  1B7T A;  1VOM A;  4PJO F;  2YRC A;  4VUB A;  1W2B P;  1K0S A;  1OQK A;  4C92 A;  1MMN A;  1WGS A;  2P84 A;  1Q86 U;  1KC8 U;  4E47 A;  5C0M A;  3OYC A;  1VQO A;  1PD1 A;  2RNA A;  1D3B A;  2DXU A;  2XKO C;  2MF2 A;  1YCY A;  1RL2 A;  1C0M A;  3O8V A;  4C92 C;  2MAM A;  5GAN 3;  2Y4X A;  2DNU A;  2DVJ A;  3F70 A;  2VKN A;  2MPX C;  2FZG B;  2E70 A;  1VQO T;  1KQS S;  4CI0 C;  4LDY A;  3H6Z A;  2H3E B;  3OS0 A;  4M4Z A;  2H3J A;  1KD1 R;  4C0G A;  2DL4 A;  2DPP B;  3M0S A;  5LJ5 f;  3G71 Q;  4ANJ A;  4X9C A;  3HRS A;  1T3S A;  4LUD A;  2Y90 A;  2HZY A;  4OB1 B;  2PVG B;  3EGX A;  2FHD A;  2KY9 A;  4M78 E;  4F7U G;  3CCM Q;  1JEG A;  3ER0 A;  1X75 C;  1Y96 B;  1WJQ A;  3SDZ A;  1VQM Q;  2CSI A;  2MI6 A;  1K73 U;  2DIG A;  3PT9 A;  5LJ3 d;  4DBR A;  2KI7 A;  3VS4 A;  4MZT A;  5GJW B;  4J6X A;  3RBB B;  3CPW A;  3M0U A;  3Q1J A;  2OAW A;  2D6F A;  1TH7 A;  4PLI A;  4JZ4 A;  4M75 B;  2C0T A;  2EGC A;  2KYM A;  2E3I A;  2RM4 A;  2XDD A;  7AT1 B;  2FPE A;  1X2Q A;  3MJX A;  4HCK A;  2EKH A;  2K6D A;  3S6W A;  1OX8 A;  3RDV A;  1BBZ A;  2QAZ A;  4J7F A;  5HK3 A;  2HSE B;  4JLI A;  1UEB A;  4Y28 E;  3LH5 A;  1C1A A;  3JCM g;  1YIJ Q;  3OS2 A;  3L2W A;  4C92 G;  4IUP A;  3I55 A;  2M0O A;  1H92 A;  2FPF A;  3EG9 A;  4LXC A;  2LRQ A;  2K2M A;  2XK0 A;  4QT7 A;  3MEU A;  4OVA A;  4F7U B;  2HMA A;  4ZNX A;  4C5I A;  1M3A A;  3I55 T;  1MNE A;  2RQT A;  4F14 A;  1E7O A;  4XTW A;  1GFC A;  3H0I A;  2JTE A;  2V26 A;  2KRO A;  2GFU A;  2WAC A;  2HEQ A;  5CQY A;  2CZ1 B;  2X9H A;  2ZPI B;  1WDX A;  2D0Q B;  2K4Y A;  2GTJ A;  4M7A F;  3JB9 H;  4PLL A;  3J7A F;  1IZ6 A;  4ZGD B;  4C0D C;  4PJL A;  1GBQ A;  4JS4 A;  1R77 A;  3OYJ A;  2COY A;  4BE1 A;  1ZSG A;  4JJB A;  4MDW A;  2G6F X;  1UTI A;  1WPY A;  1KHI A;  2CZ0 B;  4M7D F;  4C92 B;  5L8R E;  3WXM B;  1CKB A;  4KH0 B;  4MML A;  2DFU A;  4A4K A;  4BD3 A;  4N0A C;  1XQH A;  1PKS A;  4PJJ A;  2ABL A;  4EMK C;  1OX9 A;  4GLK A;  1IRE B;  2A7Y A;  3OW2 P;  2KXD A;  1M27 C;  4RG2 A;  2LJ3 A;  2JNG A;  3GOX A;  3JCM P;  4RTX A;  4J9G A;  4ZTJ A;  1SHF A;  1YHQ A;  4RMO A;  3V7R A;  4AMC A;  4PK4 A;  1QVG S;  2E4H A;  2YLC A;  2O9V A;  4M75 D;  3G6E Q;  4BDY A;  3RES A;  3HP9 A;  1KHC A;  1VQP Q;  4BI3 A;  2B86 A;  4E7L A;  1UDL A;  2DL8 A;  2DMO A;  4XTX A;  1VQ5 Q;  5IXF A;  3NTI A;  3S3O A;  2QDL A;  4R55 A;  1WZO A;  3PVQ A;  3C4S A;  3CCE A;  2QA4 T;  4OGC A;  1V29 B;  1I07 A;  1H3H A;  3JB9 F;  3LW5 E;  2AZS A;  2JS0 A;  2DTH A;  4KBM B;  5GAN e;  3OYB A; 
#chains in the Genus database with same CATH homology
 2CGH A;  2LDM A;  4LDW A;  4NOY A;  4OP0 A;  2DTO A;  2DXC A;  3CC2 T;  2YLB A;  5GMK m;  4A4G A;  3SFM A;  1Q86 C;  3VUB A;  3OYA A;  1KC8 C;  5A0L A;  1I5L A;  3VUZ A;  3FDR A;  3LYI A;  2LQ8 A;  3MEA A;  3QDR B;  3G4S A;  4BY6 C;  4XU0 A;  1W2B A;  2EQU A;  2FVU A;  2HAX A;  4QQG A;  5IT9 E;  3OMG A;  4BY6 B;  4E7H A;  3CCR A;  1N6A A;  4M78 C;  5A0D A;  3QO3 A;  1M1F A;  1NE8 A;  5GAM f;  2KDS A;  3SD4 A;  2OTL A;  2EWN A;  4XTY A;  5GAM j;  2P0K A;  3CCU T;  3OS5 A;  4N4G A;  4M78 B;  3E9F A;  1O75 A;  1QW1 A;  4ZN3 A;  5CK9 A;  2WSC E;  4F7U A;  1QVG A;  2RHY A;  3RKW A;  5GAN g;  2DAQ A;  2RA2 A;  3X20 B;  3JSC A;  4C8Q G;  3LWH A;  4JRQ A;  3CME A;  2X4J A;  1XTD A;  4C92 F;  3WVD B;  2HQE A;  3OA6 A;  1BI2 A;  1KQ1 A;  2PUO B;  2RHI A;  4PJO G;  2OTL T;  4IUR A;  2JZ2 A;  2L5Q A;  1BI1 A;  2MWP A;  2O01 E;  4M7A E;  1Q7Y U;  3JCM W;  5FRO A;  1YJ9 A;  3FEO A;  4MZP A;  2KK4 A;  4ATO A;  1H3Z A;  4D6W A;  5GAM g;  2VGM A;  3JCM Q;  2VGN A;  4M77 E;  3I56 A;  4LD6 A;  3HRU A;  4QVC A;  3CXC S;  2WSE E;  5J3B A;  3OMC A;  4ELZ C;  5FU7 B;  3QSU A;  1NJI U;  4B9W A;  1G3S A;  1BI3 A;  1VQ6 A;  4C0D B;  2YHT A;  4M7D E;  4PNO A;  3QKJ A;  3QZ5 B;  3M56 A;  4EDU A;  2F5T X;  3CCL A;  3SWN C;  2R57 A;  2DJZ A;  3OS1 A;  1WNL A;  3EAE A;  2P0Q A;  3RKY A;  5GAN 7;  1YJ9 T;  3DLM A;  2QQA A;  3SWN B;  2E10 A;  4C5E A;  2QQ9 A;  3OYH A;  3I56 T;  1QVP A;  1OZ3 A;  2E1H A;  3BY7 A;  3CBM A;  2XIC A;  3G7Z A;  3OSV A;  3RMQ A;  4M7A D;  2PUK B;  1VQ6 T;  3A5Z B;  3L2V A;  1Q81 U;  3N5B B;  1D3B B;  2KVQ G;  2QDY B;  1M1G A;  3HHT B;  3HSB A;  3CPW S;  3OSS C;  3CCL T;  5GAO q;  5A0G A;  2KMT A;  2O4X A;  2PQW A;  5LJ3 h;  4M77 D;  4M75 G;  4HT8 A;  2RH2 A;  2XDB A;  2MWO A;  3OBW A;  2R5M A;  4MMK A;  4PL6 A;  3OYM A;  3SB2 A;  4E7I A;  1I4K 1;  4ZGJ B;  4M7A A;  2LT1 A;  3TRE A;  1KG1 A;  4O6J A;  3MHX A;  1P92 A;  2CZ7 B;  4C8Q C;  5GAO n;  4M7D D;  2GF7 A;  4ZN1 A;  2DEQ A;  4EMK B;  4LDU A;  1K9M U;  1OZ2 A;  4X34 A;  5DLO A;  2E6Z A;  2JUF A;  3BW1 A;  2EJF A;  3M4G A;  4PJO C;  4QW2 A;  1G3T A;  5I2S A;  2KSS A;  1YIT A;  4ELY C;  3QJY A;  3NTH A;  3KBG A;  4QVZ A;  1X01 A;  1Y71 A;  2XU8 A;  4O5V A;  4PJO B;  2ZPH B;  3M9Q A;  3OB9 A;  4WF2 A;  4M7D A;  1LOJ A;  2FL7 A;  1R8O B;  5GAM d;  3MP8 A;  4HA8 A;  4XQ3 A;  2LNV A;  1OYX A;  1I81 A;  1VUB A;  2G3R A;  1BIA A;  1Y96 A;  2RK2 A;  4M77 C;  4MDX A;  4J7I A;  3BFM A;  1O9S A;  2XI9 A;  3JB9 I;  4JS5 A;  2LCC A;  2LC4 A;  3MP6 A;  5IAY A;  3H8Z A;  3CD6 A;  1UGR B;  4E7K A;  2RHU A;  5I21 A;  3M55 A;  4HKE A;  3R6O A;  2RD1 A;  1JJ2 S;  4BI8 B;  4HCC A;  1WJS A;  4A4H A;  2FB7 A;  4FL6 A;  4A4F A;  4NS5 A;  4JJN K;  3DB3 A;  3VYH B;  5GMK j;  3CCM A;  5CKE A;  3FIF A;  1UB4 A;  1YHQ T;  2DXB A;  2ZGW A;  5C6S A;  3JCM c;  4F7U E;  3CMA A;  1VQM A;  4CRI A;  5HK0 A;  3G71 T;  2A3L A;  2ZPF B;  2V8K A;  4DOW A;  3G6E A;  2EAY A;  3RUX A;  3CBP A;  3NFC A;  1YJN T;  2M1H A;  3CD6 T;  2ZZD A;  4M78 F;  2K5F A;  1KD1 U;  1U1S A;  1VQP A;  2E12 A;  1UGQ B;  2GFA A;  1WJR A;  2MMP A;  3CCJ T;  1M9S A;  2LCL A;  4M75 C;  4QQ6 A;  3CCM T;  3OY9 A;  2XHC A;  1VQM T;  3OW2 S;  4Y91 A;  2QQS A;  3CMA T;  1B34 A;  3KXT A;  3VJP A;  5LJ5 h;  4FT2 A;  1FX7 A;  3L2Z A;  4IUU A;  5KE2 A;  2BUD A;  4DA4 A;  4B9X A;  4A53 A;  2CZ6 B;  2WSF E;  2VC8 A;  3UT1 A;  3G6E T;  1N9S A;  1N8R C;  3QYG B;  3CCE T;  3E1S A;  4KT0 E;  1W4S A;  2QTX A;  3JCM V;  1VQ4 T;  2LQK A;  5FRM A;  1G5V A;  2EJ9 A;  2QQB A;  4FT4 A;  3A8M B;  1K8A C;  1VQK A;  3ASK A;  2DZ9 A;  2D9T A;  5FU6 C;  4OB0 B;  2PU9 B;  3PMT A;  5GAM e;  4DQ2 A;  3JB9 D;  1VQN A;  1VQ8 A;  4V2S A;  1NPP A;  2QQR A;  2EJG A;  4QVD A;  2BKD N;  5CKH A;  1YIJ A;  3CPF A;  5GAN 8;  4XTZ A;  4BB7 A;  5CKD A;  3A8O B;  3J81 E;  3AHU A;  3QBY A;  1QP3 A;  1UGS B;  4C92 E;  3VV0 A;  5KH6 A;  4E7J A;  1RI0 A;  3JCM h;  2X4W A;  5GAO m;  3OYF A;  3G4S T;  1VQK T;  4ME7 A;  5CVI A;  5D6X A;  2K3X A;  3T9N A;  4GY5 A;  3X25 B;  5GMK i;  2K5L A;  2QEX A;  1VQN T;  1VQ8 T;  3CCR T;  3LH0 A;  2DO3 A;  3HKS A;  3M59 A;  1YIJ T;  4J6Y A;  3QYH B;  2DTI A;  2HBP A;  1BYM A;  4FIB A;  3PNW C;  5EG2 A;  3PTA A;  4M7A G;  2X4Y A;  2AHJ B;  3WVE B;  3M58 A;  5LJ3 f;  2KAF A;  3ME9 A;  4C5H A;  5LJ3 j;  2P0P A;  3OYY A;  4JRI A;  1U1T A;  2JTM A;  2F5K A;  4YTL A;  4M77 G;  1H64 1;  1YJW A;  5KCO A;  1M90 C;  3E19 A;  3CME T;  4Q5W A;  2LT4 A;  4J8O A;  2QEX T;  1Q82 C;  2JVV A;  3C12 A;  1VIF A;  1AHJ B;  3P8D A;  2B8A A;  2JOY A;  5CR2 A;  5DM7 R;  5GAN h;  3MET A;  3RIR A;  4XU3 A;  4C92 D;  4M7D G;  5KE3 A;  3FB9 A;  1OI1 A;  2P4T A;  4C8Q F;  3OW2 A;  2XID A;  3S3M A;  4RCB A;  1K73 C;  1BKB A;  5CIU A;  5DY9 A;  1PSF A;  3X24 B;  3ZEH A;  4FM4 B;  4C0Z A;  4LDX A;  1XOV A;  4PJO F;  5IN1 A;  5A2Q E;  4VUB A;  1YJW T;  3L2R A;  2VXF A;  4C92 A;  1YI2 A;  3GF5 A;  2CKK A;  1WGS A;  1Q86 U;  4QQD A;  1KC8 U;  2XD0 A;  4E47 A;  5C0M A;  5LJ3 g;  3OYC A;  1G3W A;  2DXT A;  4HCZ A;  4OF1 A;  2FYK A;  1VQO A;  4L59 A;  2VXE A;  1D3B A;  2DXU A;  5M9O A;  3PGG A;  1LNX A;  2XKO C;  2MF2 A;  2PVD B;  1YCY A;  3RER A;  1RL2 A;  1KQ2 A;  1QVF S;  2X35 A;  3O8V A;  4C92 C;  2MAM A;  5GAN 3;  2Y4X A;  3UWN A;  3PIO A;  3QZ9 B;  3F70 A;  4N0A A;  4X9D A;  1YI2 T;  1N9R A;  4C8Q B;  4EPC A;  2RJC A;  4P5N A;  3JRZ A;  4NL2 A;  2M9U A;  2E70 A;  3VU3 C;  4EMK A;  1VQO T;  1KQS S;  4CI0 C;  1M1K C;  1EIF A;  4LDY A;  3H6Z A;  4XK8 E;  2HD0 A;  2O4X B;  3CBO A;  5D6Y A;  3M5A A;  2K2V A;  3OS0 A;  4KUL A;  3GNG A;  4M7A C;  1M8V A;  4XTV A;  2C06 A;  4IUT A;  2H3J A;  2NLU A;  1M4Z A;  4JLG A;  4M7A B;  4C0G A;  5FRN A;  2BIV A;  1M5Q 1;  2DPP B;  3A8G B;  3OYD A;  2L89 A;  4M75 F;  3CXC A;  5LJ5 f;  2Y4Y A;  2RI3 A;  4M77 B;  3TU4 K;  5LJ5 j;  2OTJ A;  2ZPB B;  1YIT T;  3E9G A;  5GMK e;  3J80 E;  2EFI A;  4M7D C;  2QXF A;  3QPH A;  4XTU A;  3ZBD A;  4XU2 A;  4C0F A;  5GAO p;  4DOV A;  4X9C A;  2YRV A;  3GNF B;  4M7D B;  3HRS A;  5GMK l;  2Y90 A;  2EQK A;  4BI4 A;  2PVG B;  4OB1 B;  4L5G A;  1VQ9 A;  2FHD A;  2KY9 A;  4L6V 5;  4M78 E;  2GCX A;  4F7U G;  3ER0 A;  5CKF A;  3M53 A;  1X75 C;  1Y96 B;  1WJQ A;  2DVE A;  3FJP A;  3SDZ A;  3CCQ A;  3BDU A;  1X6O A;  4FSX A;  2MI6 A;  4JRP A;  2DIG A;  3PT9 A;  5LJ3 d;  3JB9 G;  1K73 U;  1VQ7 A;  2OTJ T;  2XDP A;  4MZT A;  3PFS A;  4J6X A;  1S72 A;  1U8R A;  3VKI A;  2RB6 A;  1UGP B;  3V8J A;  4LD9 K;  3CPW A;  2QA4 A;  3Q1J A;  4XU1 A;  2E64 A;  3JCM f;  2IG0 A;  1SSF A;  1Q7Y C;  2D6F A;  1VIE A;  2E6N A;  4PKC C;  1TH7 A;  4M75 B;  4PLI A;  1VQ9 T;  1VQ5 A;  4J83 A;  3QJ6 A;  3L2Q A;  2ZPE B;  1G3Y A;  3CEY A;  3FC3 A;  5AYF A;  1QP2 A;  2L8D A;  3NTK A;  3CCQ T;  1MGQ A;  3OYE A;  4EMH A;  4OB3 B;  2RI2 A;  1NPR A;  5GAN 5;  1N27 A;  2EYQ A;  3OBY A;  4C5G A;  4KUD K;  2RM4 A;  2XDD A;  4XAX B;  1S72 T;  1NJI C;  2HNI A;  4A54 A;  1VQP T;  1WQ7 A;  2GQV A;  4M78 D;  3L1A A;  3S6W A;  1VQ5 T;  2LVM A;  3M4Y A;  4J7F A;  1JB0 E;  5FU6 B;  3URG A;  1HK9 A;  5HK3 A;  4JLI A;  1UEB A;  4Z02 A;  4Y28 E;  5GAN f;  3CC7 A;  2K3Y A;  5FLX E;  1HXD A;  1YBY A;  3JCM g;  5GAN j;  1I8F A;  3OS2 A;  2DD5 A;  3GLX A;  4M78 A;  3L2W A;  3CCU A;  2DZC A;  3EFR A;  3QXE B;  4C92 G;  3LGF A;  4IUP A;  1Y07 A;  3I55 A;  3PMI A;  1Q81 C;  2M0O A;  4J5Y A;  5GMK h;  1MHN A;  1JJ2 A;  5D6W A;  2LRQ A;  4R56 A;  2DKG A;  3L42 A;  5J39 A;  3LGL A;  3CC7 T;  2XK0 A;  5LJ3 e;  2R5A A;  3MEU A;  4OVA A;  4NL3 A;  3CC4 A;  3MCA B;  4F7U B;  4C5I A;  5CCA A;  2E5Q A;  2RJD A;  3A8L B;  1K9M C;  2EQM A;  2F69 A;  2JTF A;  4JDS A;  3I55 T;  4BAC A;  2IVW A;  4OB2 B;  4BE2 A;  2E65 A;  4J6W A;  4C8Q E;  5LJ5 d;  3MO8 A;  5LL6 S;  2ZPG B;  2RI5 A;  3GPL A;  5CKB A;  3C95 A;  4IUQ A;  4XTW A;  3CCS A;  2X4X A;  3MEV A;  4PJO E;  2PVO B;  1ZBX A;  5J26 A;  3QII A;  3CC4 T;  1FXX A;  3X26 B;  2WAC A;  1JBM A;  2GFU A;  5CQY A;  1LJO A;  2CZ1 B;  2V8J A;  2ZPI B;  3SWN A;  2D0Q B;  2K4Y A;  3INZ A;  3QG1 A;  4II1 A;  4EMG A;  5FU7 C;  1N8R U;  2CS7 A;  3V8L A;  3JB9 H;  4PLL A;  3V7S A;  4M7A F;  5I2M A;  3J7A F;  1IZ6 A;  4ZGD B;  3C94 A;  3HPW A;  4C0D C;  1JRI A;  5KCH A;  5GAM h;  3DLL A;  4RG8 A;  3CCS T;  3PIP A;  4JS4 A;  4M77 F;  4MZM A;  1K8A U;  2EIF A;  3JCM d;  3P8B B;  2RHX A;  3OYJ A;  4BE1 A;  2HQX A;  4IUV A;  3KUF A;  3HRT A;  4MDW A;  4C8Q D;  3UPU A;  4JUV A;  1BI0 A;  3QHS A;  1WPY A;  2CYZ B;  3FRN A;  3FLG A;  1KHI A;  2CZ0 B;  3BDL A;  4TVR A;  3VYG A;  3ZFJ A;  3OYK A;  4M7D F;  2RJE A;  1BIB A;  2DIQ A;  4LDV A;  2RO0 A;  1KD1 C;  4C92 B;  5L8R E;  4PJO D;  2KQW A;  3OYG A;  2E41 A;  3TEE A;  1XNI A;  5GAN 6;  5CAI A;  5GAN 2;  5CO7 A;  2EKO A;  2K57 A;  4RCC A;  3WXM B;  4C8Q A;  4MML A;  3OQ5 A;  3DB4 A;  3LX7 A;  3GIB A;  3RKX A;  4A4K A;  3JCM X;  2V8I A;  4BDZ A;  4M75 E;  3HFN A;  4BD3 A;  3JB9 J;  4PJO A;  4IKF A;  3CCV A;  3UDC A;  2R58 A;  4N0A C;  1XQH A;  3M57 A;  3EFS A;  5GAN d;  5LJ5 e;  3LLR A;  2JN0 A;  1PSE A;  4N4H A;  4EMK C;  5CQX A;  3L2U A;  3QUI A;  4GLK A;  3OYN A;  5HKC A;  2ZCF B;  1IRE B;  2A7Y A;  2VV5 A;  1FWZ A;  2M16 A;  2RK1 A;  4BE0 A;  5GAO r;  3HFO A;  4M77 A;  3MEW A;  4OMF B;  4RG2 A;  1M90 U;  4FU6 A;  3X28 B;  2EQJ A;  1W2B S;  1Q82 U;  2JNG A;  3GOX A;  3JCM P;  1WQW A;  1ZHI A;  3HL8 A;  4OGE A;  4A4E A;  3CCV T;  4JRK A;  3RMS A;  2LTO A;  5DLQ E;  1Y7X A;  1ZQ1 A;  4ZTJ A;  1VQL A;  4M78 G;  1YHQ A;  4ZTF A;  4RMO A;  2OAU A;  1DJ7 B;  4KUI A;  3V7R A;  2XG8 D;  1QVG S;  2YLC A;  3G71 A;  2K5I A;  3DKM A;  4M75 D;  3OYI A;  3JCM e;  4ZGE B;  3JAM E;  1NZ9 A;  3RES A;  4BDY A;  3HP9 A;  1YJN A;  5GAN 4;  4HCB A;  5LJ5 g;  1KHC A;  3JCM J;  3S3N A;  3CCJ A;  3OYL A;  5HY6 A;  2DK3 A;  2LX9 A;  1QVF A;  4HT9 A;  4BI3 A;  4E7L A;  3M54 A;  2RJF A;  2VUB A;  1VQL T;  4M75 A;  3JCM b;  4XTX A;  3GP8 A;  1GXI E;  1VQ7 T;  3LWI A;  3NTI A;  5GAO l;  3CC2 A;  2VYT A;  3P8H A;  3V7C A;  3S3O A;  4R55 A;  3TCJ A;  2QI2 A;  2DD4 A;  3A8H B;  4UC4 A;  3C4S A;  3CCE A;  4F7U F;  1KQS A;  3MP1 A;  4OGC A;  2QA4 T;  1V29 B;  1VQ4 A;  3JB9 F;  2L3R A;  3V8K A;  3LW5 E;  4N4I A;  2I2L A;  4RKU E;  2DTH A;  4KBM B;  5GAN e;  3OYB A;  1B34 B;  4BUG A;  2RHZ A;  1M1K U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...