2RI2A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355a point mutation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
312
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVARMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
total genus 81
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A03
2M16A 1KHCA 3OYAA 2R58A 4QQ6A 3O8VA 2EQMA 4C5HA 2P0KA 2L3RA 3DLMA 3PMTA 1OYXA 2EQKA 3QKJA 3LGLA 4PL6A 3LYIA 4E7IA 2LCCA 5FROA 2JZ2A 3GOXA 3NTIA 4BE0A 3E9FA 4BDZA 2RHUA 1N27A 3NTHA 3OYKA 2LRQA 3FC3A 5CIUA 2D9TA 2HQXA 2X4WA 5C0MA 1WJSA 5KH6A 2B8AA 2FHDA 3OMCA 4N4HA 2E5QA 2JTFA 2PQWA 3L42A 5D6YA 5KE2A 2IG0A 3META 3OYBA 3ZEHA 3UWNA 3OYGA 2O4XA 4PLIA 3OYEA 3KUFA 2HQEA 3OMGA 4IUUA 2BIVA 2RI5A 3LX7A 4FU6A 4QQGA 3LLRA 1WGSA 2YRVA 2CKKA 1RI0A 3C4SA 3MEAA 3OS2A 3OYMA 3S3MA 2R57A 5M9OA 2LVMA 5FRMA 2DIGA 2L8DA 2X35A 4BD3A 2QQSA 3FDRA 3ME9A 3EAEA 3OB9A 5KE3A 3OYDA 2O4XB 2EFIA 4BDYA 3S3OA 2R5AA 2BKDN 3PFSA 2RI3A 2LTOA 3QJ6A 2EQJA 2GFUA 4OVAA 2RO0A 4A4HA 3MP6A 3F70A 3L2RA 3QBYA 5J26A 3MP1A 3S3NA 2VYTA 2EKOA 2X4YA 5D6XA 3H8ZA 4QW2A 3MEVA 2E6NA 2R5MA 3BDLA 3P8DA 4B9WA 5IAYA 2K3XA 4IUPA 4EDUA 5KCOA 3PMIA 2EQUA 4C5IA 3OS1A 4IUTA 4GY5A 2L89A 1OZ3A 4L59A 3L2QA 2GF7A 2RHIA 1OI1A 4ZTFA 3OA6A 2MWPA 1WJQA 4RG2A 1XNIA 3OS0A 1SSFA 2RHZA 4IURA 2QQRA 4E7LA 3LH0A 2NLUA 3SD4A 4BE2A 3MP8A 2RHXA 3E9GA 3FLGA 3DB4A 3P8HA 3OYFA 1MHNA 3L2UA 4QQDA 4A4EA 2DAQA 3MEUA 3OYJA 4N4IA 2RJFA 4IUQA 5D6WA 3CEYA 3OQ5A 3H6ZA 4NS5A 4LD6A 4Z02A 2X4XA 2XK0A 4HCZA 4II1A 4E7KA 4IKFA 3DB3A 3ASKA 3MEWA 4E7HA 2RJEA 4QVZA 5FRNA 4N4GA 2WACA 4A4FA 2XDPA 3OY9A 3UT1A 4A4GA 3L2WA 2BUDA 2G3RA 2RI2A 1H3ZA 3QIIA 4Q5WA 2MWOA 4X34A 1WJRA 2M0OA 3OYCA 2DIQA 2GFAA 2RJCA 4IUVA 4BE1A 4C5GA 2LDMA 3OYLA 4UC4A 1OZ2A 2RJDA 5KCHA 3L2VA 2F5KA 5IN1A 2RHYA 4ZTJA 2K3YA 3OYHA 4BACA 4PLLA 3OYNA 1G5VA 3PNWC 4C5EA 4B9XA 3FEOA 3M9QA 3OYIA 3Q1JA 4CRIA 3NTKA 3MO8A 5C6SA 4FL6A 4E7JA 3LGFA 3S6WA 5J39A 2M1HA
chains in the Genus database with same CATH superfamily
4YTLA 3O8VA 4JRKA 3SEMA 1RLQC 2LCSA 1IREB 3IQLA 4LD9K 1Y96B 2VUBA 1Q82R 2V1QA 2LQKA 2LRQA 2D9TA 2HQXA 4RTXA 1MV3A 4C8QA 1Q81U 2KEAA 1KQ2A 3A1PA 2X3XD 2YRVA 3OYMA 2CGHA 4BD3A 2L3QA 4J9GA 3EAEA 5KE3A 2MCNA 8AT1B 1WQ7A 4EMGA 3QWYA 4NL2A 5HY6A 2A28A 2VYTA 1CKBA 3V7RA 1WX6A 1VQOT 4MDWA 2KXDA 2EQUA 4JDSA 2K9GA 2E3IA 3VUZA 3H9NA 2FRYA 1RAEB 4HKEA 1ZA2B 2EJGA 4KULA 3CCUQ 4B6MA 3INZA 3BW1A 4M7AD 4PJLA 2DM1A 1VQ8T 2CP6A 2CP2A 1Q86U 2RNAA 2X3WD 4N4IA 2MPXC 2LJ3A 3EH2A 2WSFE 4L6V5 2YRDA 2X4XA 4IKFA 1H3HA 3AHUA 1M27C 2RJEA 1SF9A 3TREA 4CI0C 3CBOA 4BY6C 2QQ9A 1WHHA 2LQWA 3M56A 4F14A 1K0XA 3JCMW 1ZSZB 3R6OA 4VUBA 5GAN3 2H8HA 1B34B 3DLLA 2OTJA 4XAXB 3OYAA 1Q7YU 1K9MU 5KYWB 2OX7A 2P0KA 1OPLA 3PMTA 1X2QA 3QKJA 2G6FX 4C92A 2RD1A 1VYUA 3J81E 3RKXA 1VQ6A 2ZPBB 3ZBDA 1QWEA 2DD5A 1MMGA 2QAZA 4ZNXA 4JLIA 3VS3A 5C0MA 4M4ZA 4E47A 1C1AA 1YJ9Q 3OYGA 3GNGA 2BZ8A 3CCUA 3LW5E 2HQEA 2KT8A 3ER0A 4FU6A 3G71Q 1WYXA 3A98A 3C4SA 2A37A 1Z9ZA 4KH0B 2LX7A 2A7YA 4ZGEB 4OMMA 2O4XB 5D7UA 1VQ8A 5GAMd 1RAAB 2WSCE 1MGQA 1NEBA 5GAOr 4EMHA 1TS9A 4RMOA 3CC4Q 3QBYA 4JS5A 2Y90A 1J3TA 2CH4W 1LJOA 2LQNA 3TSWA 3CCMA 1NJIC 4NOYA 1VQ4T 3RUXA 1OZ3A 1X6GA 5HK3A 3JCMd 5CKHA 1ACMB 4J9DA 1VOMA 1PKSA 3G6EA 1BCOA 1VQKT 1TUDA 3G4ST 4M7DC 1BIBA 2RHXA 4CC3A 2DRKA 4A4EA 4C8QF 3MEUA 1PG5B 3VV0A 1TSFA 4ZGDB 4CC7A 4C92E 3JB9I 1FMVA 2GQIA 1XJWB 1N5ZA 2L0AA 2EBPA 2QXFA 3QXEB 3JCMP 2Y4YA 3SHWA 4KT0E 3VJPA 1BU1A 1UHFA 2Y4XA 4FCYA 4M75F 2CYZB 3SFMA 5FU7C 2JT4A 1X43A 5GANh 3TEEA 1OZ2A 2F2WA 1NYFA 1M8MA 4PLLA 1VQ6T 1S72Q 1D3BA 3BFMA 5CKEA 4M75G 1C6VX 2CSQA 5GAOn 3NHNA 3M54A 2FYKA 3NPFA 1M1KU 3TVTA 1Z9QA 3CD6T 4BE0A 5KYWA 4DOWA 2RHUA 2SRCA 1G2BA 4L5GA 1GCQC 1WLPB 3I56A 1YFNA 1B34A 4N4HA 2E5QA 4KUIA 4C8QG 1ZSZA 5GAN4 4PLIA 2MAMA 3LLRA 2CP3A 4C0GA 1MUZA 1RI0A 7AT1B 5CR2A 2HEQA 4FSXA 1VQ9Q 3S3OA 1IRXA 4HT9A 3OBWA 2NUPB 2HKQB 2V1RA 4A4HA 2JS2A 4M78G 2EAYA 2HL3A 3H8ZA 3M0PA 2R5MA 5GAN7 3EG1A 2O88A 1ZUKA 4M7DE 1QCOA 1YI2A 3UA7A 1VQNQ 5GAMh 2K7AA 2RHZA 3CMEQ 3SD4A 4A53A 3E9GA 3X24B 4FYWB 1I07A 2DEQA 5J3BA 3OQ5A 2Z0WA 1VQOQ 1X69A 1G83A 3GPLA 4LUEA 3JRZA 2XDBA 4D8DA 5IXBA 4M78B 4PNOA 3UT1A 3CCEQ 3ZFJA 1QKXA 3TSZA 1PD1A 1M8VA 4C0ZA 1VQMA 2ZGWA 4IUVA 4BE1A 1IB8A 4UC4A 1KJWA 1GBRA 1ZHIA 2XMFA 1TWBA 1PCXA 3FJ5A 2K3YA 4C8QB 1TOVA 4GLMA 5LJ5f 2RH2A 1LNXA 5EG2A 3QHSA 3QYGB 2BZXA 4J9HA 1KC8U 1E6GA 1X6BA 3RESA 1WHLA 2ZPFB 2EJ9A 2LCCA 4EMKC 1ZUUA 4KGVB 1N27A 3J7AF 1HSQA 1X27A 5LJ5j 4M7DB 4LDXA 1UDLA 3EHQA 2CZ1B 3CCJQ 2NUTB 3CC2T 2BIVA 3CMAQ 1BK2A 5M9OA 3CCUT 2LVMA 1D0YA 2XI9A 3RKWA 3PIOA 1TG0A 2EFIA 2R5AA 1U5SA 4RTVA 3L2RA 3I55A 1G3TA 2DO3A 2K4YA 5KYUB 2FL7A 2DX1A 4C5IA 1LVKA 5KYUA 3A8HB 2VGMA 1ZA1B 4M77E 1YP5A 4OB3B 3VS7A 4C8QC 1VQPQ 2DE0X 1UECA 4KGXB 2EYYA 4GBQA 1T0JA 2DLPA 3EFOB 3LWHA 2RJFA 3PE0A 2NUTA 3JCMX 2JNGA 3C95A 4LD6A 3EFRA 2CREA 3CCVQ 4TVRA 2D6FA 4JRQA 1CKAA 1CSKA 4F17A 4XTXA 4C0FA 4QVZA 2E41A 4N4GA 2MYSA 3EG3A 1Q95G 2P4TA 1WXUA 4A4FA 3OY9A 2GTOA 1RADB 4M78F 2V8IA 2KE9A 4HCKA 2DXBA 3OYCA 3VYHB 4PFPA 4C92D 1VQKQ 1KC8R 5GANf 1IO6A 1M4ZA 1GCQA 2RQWA 2M51A 3LGFA 2L5QA 2K3BA 1C0MA 2FPEA 4ME7A 5GMKm 2DTHA 1GBQA 1OU9A 1UGRB 2LZ6B 3QO3A 4LDVA 3JSCA 2RQTA 1KFZA 1M90U 3KFVA 4C0DC 1WJSA 3JAME 3URGA 2RPNA 3GP8A 2NUPA 1YI2Q 3UWNA 2DJQA 2NYSA 1NJIU 4XTVA 2I0NA 3LX7A 1YJWQ 4OMPA 1EFNA 4BDYA 2QGFB 1P92A 2HSPA 2AZVA 2LP5A 2RO0A 2HQHA 2CSIA 1ABQA 3M4GA 2MOXA 3MEVA 2ED1A 4M77C 2IVWA 2CP5A 1BYMA 2FPFA 5DM7R 2DILA 2L89A 3QG1A 4AG2C 1IHWA 4R55A 5KYXA 2CP7A 3RMSA 3SDZA 1SEMA 2C0IA 3I55Q 1YITA 3LH0A 3QZ9B 5GAMf 3MKDA 2FG0A 3EH1A 2DL5A 1BBZA 3HP9A 3EG9B 3PT9A 1QVGP 4DBQA 1GL5A 4FM4B 3H6ZA 1SRMA 1YWPA 2BTTA 4FT2A 2AHJB 3C0CA 4RCBA 1RL2A 4J7FA 5I11A 4A63B 1QVFA 2KMTA 2XDPA 4K11A 1JXMA 3JB9F 5FU6C 3I9QA 2PTKA 2DXTA 2G3RA 3QIIA 4XU2A 1WJRA 3RNJA 2DIQA 2COZA 2JTEA 1PNJA 1TTHB 1AVZC 1KD1R 4C5GA 2LDMA 4EMKA 3QWXX 4BACA 1WI7A 2AK5A 4B9XA 3FEOA 5I21A 2E70A 3CCLQ 1WHGA 3GBQA 5FLXE 4JUVA 3CC4A 1FMKA 1W2BA 3GOXA 1UEBA 3EG2A 1AWWA 1KK7A 2YHTA 3VUBA 3VU3C 3L42A 1PC0A 3QJYA 5LJ3e 3OMGA 2JMCA 3S3MA 2DIGA 2YUQA 2LNHB 3X20B 2VASA 3MP6A 4QT7A 5GANg 3RDVA 4EMKB 3S3NA 4PJOB 4FYXB 3HL8A 1YWOA 2YXYA 1KIKA 3WVDB 5IAYA 4EDUA 3JV3A 3V8LA 2M02A 1QVGA 1ZUYA 1RABB 1RAHB 1PSFA 1WZOA 1QCNA 2DXCA 2MWPA 4OMFB 4HXJA 1V29B 1VQLT 3G71T 1JXOA 1E7OA 1VQKA 4OMOA 1B07A 4PJNA 4HA8A 4MZTA 5D6WA 1KSWA 4RTWA 1B3QA 3RR6A 5IT9E 3MCAB 5LJ5d 1T0HA 2XK0A 1BCMA 4F7UF 3DB3A 4RUGA 4QVDA 1Q81R 2EIFA 2OJ2A 2OTLQ 2XD0A 2WACA 1ZX6A 4AT1B 2QEXT 2KK4A 2CT3A 4LN2A 2F5TX 2DL7A 1H3ZA 1FMWA 1GFCA 1UGPB 5KCHA 5GAOm 2LT4A 2GNCA 5GMKh 2QA4T 1R77A 5GAN6 3FIFA 1KQ1A 3NTKA 1Q82C 5C6SA 4FL6A 1JU5C 3VRYA 2M1HA 1QP2A 5DLQE 1MMNA 3V8KA 2CZ6B 3VS5A 5FU7B 1OYXA 3NGPA 2DL4A 3E9FA 2O2OA 1TXQA 1SSHA 5KYNA 1OX9A 1AWJA 1XTDA 1UUEA 1RI9A 5GAN2 1YJWA 2D0QB 4ELYC 5GAMg 4C92B 5HCKA 3BDUA 2XU8A 4IUUA 1U8RA 1VQ9A 2CKKA 1VQLQ 1QVFS 3RBBB 2CS7A 1XQHA 5GMKj 2DJZA 1WXBA 4M77D 4XQ3A 2QYZA 2RK2A 4FT4A 1N9RA 4JJDA 1Q86C 4M77G 2LMJA 3GIBA 3OW2A 3PVLA 4M77B 1X2KA 2JW4A 3PVQA 4GY5A 5CO7A 2J06A 2RHIA 2LJ0A 1NE8A 4ZTFA 3VS2A 3JB9G 1JEGA 1Y0MA 1KG1A 3CMAT 3UATA 3QDFA 1SHGA 3GNFB 3MP8A 4M77F 1QCFA 3FLGA 1I81A 2JM9A 4OMQA 4ZGJB 5LJ3j 3L2UA 2DAQA 1ZBXA 2RQRA 3OYJA 3H41A 1W6XA 1X6OA 4M75D 1D1BA 4R56A 4RKUE 3CCLA 4HVWA 3M55A 1YBYA 2VVKA 1LPLA 2KGTA 4LE9A 3CCQT 3VS1A 2ESWA 1VQMQ 3C94A 1U1SA 3G7ZA 5FW9A 3N5BB 4F16A 5GANj 3V7CA 4DEYA 4JJNK 3OYLA 1RLPC 2KY9A 3HHTB 1UG1A 1PM3A 1M1KC 4ATOA 2ATCB 3BE3A 4CRIA 2RF0A 5J39A 1PKTA 1SRLA 6AT1B 5CKBA 4IIMA 3CXCP 3CCSQ 3JB9H 1VQ4A 1D0XA 4JZ3A 4MZMA 3CCJT 3OYKA 2FEIA 4M7DA 2HZYA 4KH1B 1AZGB 2NUZA 4BUGA 2B8AA 3OYYA 4OGEA 2PQWA 2X4JA 1Y96A 1NBEB 4Y91A 4RTYA 1AZEA 1JRIA 1KC8C 2DERA 3QYHB 4FIBA 3RMQA 3CBMA 2BZYA 3RERA 5GAMe 4NL3A 3OB9A 2ZPEB 3UPUA 3CCST 3MJXA 1PRLC 1BB9A 2E1HA 5KYXB 2KYBA 3M57A 2VXEA 2X51A 4PK4A 1W2BP 4B9WA 4DBRA 3JCMe 4IUTA 4OF1A 3CCQA 3WVEB 4M78E 4C92C 5GAMj 2KRMA 2FZGB 2QDYB 1WJQA 1D3BB 1SSFA 3T9NA 2FZCB 2PZ1A 2F1LA 1VQ7A 2HKNA 2DVEA 4F7UG 3G4SA 1YHQA 2D8JA 2C06A 2DF6A 2CDTA 2DPPB 2LQ8A 2RB6A 3JB9D 3EGXA 4FYYB 1JJ2A 4II1A 2HDAA 4XU0A 3MEWA 2K2VA 1W4SA 1R0BG 4C0DB 2JTMA 5A2QE 2A36A 2MWOA 2M0OA 1VQNA 2MK5A 2EQIA 5CCAA 2V8KA 2GCXA 3OYNA 2EWNA 1IZ6A 1VQPT 2NWMA 4E7JA 3S6WA 2QDLA 1AT1B 4QQ6A 4C5HA 3G4SQ 1FX7A 4PJOC 3CCRA 3I56T 4XU1A 3CPWP 1LCKA 3X25B 4M7AG 5L23A 5GANe 5GANd 2OTJT 4JJBA 2GQVA 1PRMC 2EGEA 2P0QA 1ZLMA 5AT1B 4R0KA 3CC4T 2JS0A 3EFOA 1VYTA 1DJ7B 4J9BA 1YHQQ 5FRMA 3G71A 2L8DA 1XOVA 4LXCA 4AFZC 2K6DA 4WCIA 3CPWS 3PFSA 2J7IA 1M2VB 4OB2B 1VQPA 1PSEA 1SHFA 3UA6A 4J9EA 3M0SA 2HBWA 2DZCA 2BE9B 4M77A 2EYQA 3A8MB 2C0TA 2FRWA 2KVQG 4V2SA 3HPWA 1BI0A 3A5ZB 1XNIA 2CZ7B 2QTVA 1JJ2P 3TCJA 4E7LA 4LUDA 1T3LA 1D1CA 2A3LA 5IHIA 2PVOB 2SEMA 3VS4A 4FSSA 4F7UB 2DXUA 4OB1B 2YUPA 2O01E 3MPUB 4KRTA 4XTWA 3CCMT 1UGQB 1UGVA 1H8KA 1AD5A 3VKIA 4JLGA 1MV0B 3SWNC 2ED0A 3CCRT 2I2LA 3JCMQ 1M9SA 2J05A 3L2ZA 3LWIA 1WA7A 2O31A 5CQXA 1D1AA 5FU6B 2CP0A 3L2VA 1QQJA 3CPWA 2JVVA 3PNWC 4XTZA 2VV5A 3M9QA 1W2BS 2OTLA 2J6OA 4E7SA 4OGCA 3RIRA 1HJDA 3CC7Q 2F2VA 2ZAEA 2M16A 2R58A 1ABOA 3WXMB 3DLMA 2ZPHB 3LYIA 5L8RE 4BDZA 2E3HA 3D7SB 2CUDA 2KR3A 1OOTA 3E19A 1YI2T 4KGZB 2EVRA 2A08A 5GAN8 2WSEE 3OS2A 1YCSB 1VQOA 2R57A 3CMAA 2K2MA 4CC4B 2LC4A 1EIFA 2RI3A 3QUIA 2MF2A 4OVAA 2HSEB 1NM7A 1D0ZA 2HCKA 4QVCA 3ZL7C 5DY9A 2DVJA 3EG0A 1HYOA 1M3AA 2F2XA 1N9SA 2E6NA 2JXBA 2KDSA 1K8AU 2OTJQ 4M7AC 3PMIA 2AT1B 2LCLA 2D1XA 1SPKA 2YDLA 2QG9B 3CBPA 1JBMA 1U06A 3X26B 4M75E 4AMCA 1VQ5T 4J9CA 1QVPA 2HMAA 5KYYB 8ATCB 5HK0A 2JN0A 2E10A 4XK8E 1YJNT 3OBYA 1YN8A 2GGRA 4X1VA 5GMKi 4QQDA 1S72T 3O5ZA 4WF2A 1ZQ1A 4HVVA 1TU0B 2PVDB 3FB9A 1K1ZA 1I5OB 4IIOA 3M0TA 2M0YA 1Y07A 3CD6Q 3CCVA 1UJ0A 3QZ5B 1X75C 3M0UA 1M1GA 3I56Q 1T3SA 4Z89A 4MDXA 3A8GB 4AFQC 1BIAA 5CVIA 4ZTJA 1UTIA 1M2VA 2QGGA 1M3CA 1R0CB 1Y57A 1BI2A 1FXXA 2JJ9A 1BI3A 1KQSA 1FWZA 4PL6A 5CQYA 3LGLA 3EGUA 4BB7A 2KAFA 2E64A 1TH7A 1QVFP 1YITQ 5LJ5h 1KQSS 3OMCA 3G6EQ 2FVUA 1I8FA 3OYBA 3ZEHA 1HXDA 1I0CA 1UGSB 3FJPA 1JO8A 1Q82U 1AOJA 3OW2P 2D8HA 3OYDA 4J9FA 2CZ0B 4E2FB 2K5FA 3SWNB 2EJFA 2ZPIB 3X28B 4HCBA 4QW2A 4LDYA 4J7IA 3BDLA 2JMAA 1NLOC 4KBMB 3L2QA 4F04B 3VS6A 2QEXQ 3CC2A 1QWFA 1VQNT 1EZZB 3JCMV 1OQKA 2O9VA 2QQBA 1Q7YC 4C92F 1K9MC 1UHCA 1VQ9T 4Y28E 4BI4A 4EPCA 5CAIA 4Z88A 1MMDA 2DRMA 2V26A 4PJOD 3HRUA 3JCMh 2VGNA 3SB2A 3OW2S 2PUKB 5LJ3g 4XTYA 4ELZC 2RMOA 4PJJA 2YUOA 1M3BA 4J6YA 4GLKA 3J80E 2RI2A 5FWBA 4OMNA 3HRTA 4DQ2A 2DYBA 2GTJA 1KQSP 4J8OA 1VIEA 4ESRA 1Q7YR 1K9MR 3CXCA 2RJDA 2L2PA 4Z8AA 5FWCA 1S72A 1UB4A 1N8RR 1K8AC 3MO8A 1G3WA 5LJ3h 1H92A 4N0AC 1QLYA 3E2UA 1WPYA 1NYGA 2W0ZA 4DEXA 2L3RA 4LNPA 2EQKA 3M0RA 1K73U 1FYNA 3NTHA 3H0FA 9ATCB 2X4WA 2K5IA 2GBQA 4M75B 5KH6A 1MMAA 2FHDA 3CC2Q 1OU8A 3CCQQ 3OYEA 3M0QA 1N8RC 1K8AR 2LNVA 4M7AB 2AZSA 2KBTA 2QQSA 3A8OB 4M78D 2EPDA 2ABLA 3M4YA 2ROLA 2RQUA 3M58A 4OMLA 4Y92A 3UF4A 5CK9A 4WTOB 4O6JA 3I55T 5GMKl 2K3XA 1H641 4M78C 5IXFA 4L59A 2GF7A 5I2SA 1ARKA 5ECAA 2H3JA 1M90R 4AFUC 1RAIB 4PJOF 5GAN5 2DL8A 2KRNA 1K9AA 1AWXA 3UDCA 1TUGB 1WDXA 1YIJT 1VUBA 4IUQA 1NG2A 2HD0A 1NZ9A 2KSSA 4M7AF 1LOJA 1IGUA 2KXCA 2J6KA 1QVGS 1K4US 1ZSZC 2ZPGB 2YLCA 3ASKA 4E6RA 2EGAA 5FRNA 4CC2A 1N8RU 4RTTA 2L3PA 2BUDA 1U1TA 4AG1C 2DZ9A 2YRCA 2MMPA 4C92G 2IPOB 3REAB 4MMLA 1IGQA 4ZN3A 2F5KA 3VS0A 3GLXA 1YJNA 2LT1A 2M9UA 2MI6A 3TQ7P 3JCMc 4FW1A 2E65A 2EQMA 2HL5C 4XTUA 4JS4A 4PJOE 1OX8A 2RQVA 3HSBA 4J6WA 2YLBA 3DKMA 2LJ1A 3NTIA 4X9DA 4KUDK 4M78A 2XKOC 2E6ZA 3CCRQ 2OTLT 1GXIE 1B7TA 3SWNA 3QSUA 2RM4A 3HRSA 2JTFA 3KBGA 2EKHA 4RCCA 2QEXA 4DOVA 3HTRA 1G3YA 5LL6S 1RAFB 4LDUA 1NEGA 4DA4A 4OP0A 3E1SA 4MZPA 1Q81C 3MEAA 1U3OA 1Q86R 5GAOp 3JCMJ 2KI7A 2BKDN 1YHQT 2LTOA 3QJ6A 2GFUA 1YIJQ 2KROA 1W70A 3MP1A 4D8KA 1N6AA 1IHVA 3U23A 1RUWA 5EC7A 3JB9J 4IUPA 1JJ2S 2P0PA 3I5RA 5GJWB 5IHKA 2XHCA 1ZBJA 1OPKA 1WQWA 2OAUA 3PTAA 2VXFA 2COWA 4J6XA 1PWTA 2XDDA 5CKDA 2QQRA 1F1BB 4BE2A 2EYXA 3EGDA 3P8HA 3CCMQ 2DEUA 1VQ7Q 5A0LA 2ZZDA 2KNBB 1WHKA 1WHJA 2X9HA 4RG8A 1I4K1 3CC7A 4Z02A 4E7KA 2RA2A 1WNLA 2ECZA 2JM8A 2CH4A 3JCMf 1M30A 1IXDA 1GFDA 2ROTA 2F69A 4BY6B 2EYWA 3EGDB 2RHYA 1YJNQ 3OYHA 2DMOA 4A4KA 2QQAA 2DL3A 1OULA 4MMKA 1W1FA 3HKSA 5KYYA 1VA7A 1G3SA 1HK9A 3ULRB 4D6WA 3QDRB 1VQ6Q 1QW1A 4FW2A 5I22A 2K79A 4E7IA 3FC3A 2P84A 1VQ4Q 2DKGA 3KXTA 2QK0A 4LDWA 5HKCA 1QP3A 1WXTA 5AYFA 2O4XA 1BI1A 2RI5A 2AKKA 4QQGA 4P5NA 2X35A 1EX4A 3ME9A 2QASA 2VB6A 1OEBA 2KQWA 1QKWA 5GMKe 2D0NA 1V76A 4E7ZA 2EQJA 2E4HA 1Y71A 2EW3A 3PIPA 1S1NA 1D09B 2A0FB 1BKBA 2QA4Q 2HNIA 4M7DG 1VQ5Q 3OS5A 3CC7T 4M7AE 1M1KR 2XG8D 2ZCFB 1KHIA 2QTXA 1PD0A 4J83A 4BI3A 2RN8A 3M53A 3OSVA 2PU9B 1ZSGA 3VYGA 3BY7A 3H0IA 1JQQA 3EG9A 3M59A 4J5YA 2E12A 2PNIA 1UE9A 1RAGB 2YWWA 4JZ4A 4C8QE 4O5VA 4ORZA 4HCZA 3OSSC 4JRPA 2O9SA 2FO0A 4E7HA 3TU4K 2OAWA 3CCVT 4M7DD 2RK1A 1YITT 3CPFA 3C12A 4HT8A 4F7UA 3CQTA 4F7UE 3G6ET 3GF5A 2FB7A 1YNZA 4HCCA 1VQLA 4C5EA 3CXCS 3OYIA 2DETA 1I1JA 3JCMg 2DNUA 1YIJA 2H3EB 1M2OA 1NJIR 3THKA 1WHMA 2K5LA 2W10A 3I5SA 5CIUA 2PUOB 3EFSA 2OI3A 1VIFA 2C0OA 1M5Q1 3KUFA 5CKFA 3CMET 5DLOA 1WGSA 3FRNA 3VRZA 1A0NB 1WIEA 1QMCA 3REBB 2XIDA 1NPRA 2P4RA 4JRIA 4DBFA 1HD3A 5GAOq 1KD1C 1AWOA 2E5KA 3L1AA 2KRSA 1SKUB 4C8QD 1VQMT 1AHJB 4PJOA 5GAOl 1OI1A 2XICA 3OA6A 3NFCA 3OS0A 3G1JA 4JJCA 4X9CA 2DBMA 5LJ5g 4J9IA 3DB4A 1MHNA 2AIRB 3CMEA 3CCSA 3CEYA 5IH2A 1GCPA 2DFUA 2DYIA 1G8XA 2CUBA 2FPDA 4ANJA 5A0DA 3H0HA 3M5AA 3CD6A 2J6FA 4QKUA 1MNEA 3NMZC 3L2WA 2IIMA 1YJ9T 2DD4A 2MIOA 1Y7XA 2AKLA 2B86A 4EIKA 1O75A 2VKNA 2RJCA 1M90C 3RKYA 5LJ5e 4DBHA 5IN1A 1TUCA 1VYVA 2VC8A 1YCYA 5GJVB 4N0AA 1O9SA 2QI2A 1KHCA 1M1FA 2PVGB 1X01A 5I2MA 2EYZA 2QA4A 5FROA 2JZ2A 4PFZA 1UJYA 2DTIA 4RTZA 1VQ5A 1K0SA 2JOYA 2ENMA 1MNDA 1K73C 3EGXB 5D6YA 5KE2A 2YT6A 2IG0A 1NPPA 3META 2CT4A 2KT1A 5IHNA 4PJMA 2DTOA 4M7DF 1I5LA 2KYMA 2DA9A 3FDRA 2L3SA 3F70A 4M75C 1YJWT 2DBKA 1WFWA 1OV3A 5J26A 4ZN1A 2DK3A 2EKOA 2X4YA 4A54A 5D6XA 3QPHA 3P8DA 5KCOA 3OS1A 1SG5A 1K73R 4AFSC 1AEYA 4PJOG 4OB0B 2EGCA 3CCET 3CCJA 3I35A 3V7SA 5LJ3f 1JB0E 4RG2A 1NLPC 2V8JA 4JPBW 3AT1B 4IURA 3HFNA 2NLUA 3OYFA 3A8LB 2K57A 3V8JA 3JCMb 4NS5A 2VWFA 5A0GA 1E6HA 3LH5A 1K76A 2JUFA 1V1CA 1UFFA 1R8OB 1PHTA 5LJ3d 2FZKB 3MHXA 4PFOA 2YSQA 2BE7D 4A4GA 4HVUA 4FYVB 2COYA 4Q5WA 4XU3A 4X34A 3EHRA 3R6NA 3CCEA 2GFAA 3HFOA 4M7AA 3P8BB 1VQ8Q 2HAXA 4RTUA 4PKCC 3PGGA 4BI8B 1G5VA 2HBPA 3Q1JA 2LX9A 1VQ7T 4M75A 1KD1U 1YJ9A 3CCLT 2YUNA 1RACB 1GRIA
chains in the Genus database with same CATH topology
2E65A 4QQ6A 4YTLA 3O8VA 4JRKA 2EQMA 4XTUA 4C5HA 4JS4A 4PJOE 4ME7A 5GMKm 1FX7A 1IREB 4LD9K 4PJOC 2DTHA 1Y96B 1UGRB 2VUBA 4J6WA 3QO3A 3I56T 3CCRA 2YLBA 3DKMA 4X9DA 3NTIA 4XU1A 4KUDK 4LDVA 3X25B 4M7AG 4M78A 2LQKA 3JSCA 2LRQA 2XKOC 2E6ZA 5GANe 1M90U 2D9TA 2HQXA 2OTLT 4C0DC 1GXIE 3SWNA 3QSUA 5GANd 1WJSA 4C8QA 2RM4A 3HRSA 1Q81U 2OTJT 3JAME 3URGA 2JTFA 3KBGA 3GP8A 2GQVA 4RCCA 4DOVA 2QEXA 2P0QA 1G3YA 5LL6S 1KQ2A 3UWNA 4LDUA 1NJIU 4DA4A 4OP0A 4XTVA 3E1SA 4MZPA 3LX7A 3CC4T 1Q81C 2YRVA 3OYMA 2CGHA 3MEAA 1DJ7B 5FRMA 3G71A 2L8DA 1XOVA 4BD3A 1Q7YC 1K9MC 5GAOp 3EAEA 4BDYA 5KE3A 3JCMJ 3CPWS 1P92A 2BKDN 3PFSA 1YHQT 2LTOA 3QJ6A 2GFUA 2RO0A 1WQ7A 4EMGA 4OB2B 1VQPA 4NL2A 5HY6A 1PSEA 3M4GA 3MP1A 2VYTA 1N6AA 2DZCA 3V7RA 1VQOT 4M77A 3MEVA 4M77C 2EYQA 2IVWA 3JB9J 3A8MB 4IUPA 4MDWA 1JJ2S 1BYMA 2EQUA 4JDSA 2KVQG 2P0PA 5DM7R 4V2SA 2L89A 3QG1A 2XHCA 3VUZA 4R55A 3HPWA 1WQWA 2OAUA 3PTAA 3RMSA 3SDZA 2VXFA 1BI0A 4HKEA 3A5ZB 2EJGA 4KULA 4J6XA 2XDDA 1XNIA 2CZ7B 3TCJA 1YITA 5CKDA 2QQRA 3INZA 3LH0A 3BW1A 4BE2A 4E7LA 4M7AD 1YJWA 2A3LA 3QZ9B 5GAMf 2PVOB 1VQ8T 3P8HA 4F7UB 3HP9A 3PT9A 2DXUA 4OB1B 1Q86U 4N4IA 5A0LA 4FM4B 2O01E 2ZZDA 3H6ZA 2WSFE 4FT2A 4L6V5 4RG8A 4XTWA 1I4K1 3CC7A 2AHJB 3CCMT 4RCBA 4Z02A 2X4XA 4E7KA 1UGQB 2RA2A 4IKFA 1RL2A 1WNLA 4J7FA 3AHUA 3VKIA 4JLGA 2RJEA 1QVFA 3SWNC 3CCRT 2KMTA 3JCMf 3TREA 2I2LA 3JCMQ 2XDPA 1M9SA 4CI0C 3JB9F 5FU6C 2DXTA 2G3RA 3QIIA 3CBOA 3L2ZA 4XU2A 4BY6C 1WJRA 3LWIA 2QQ9A 2DIQA 2F69A 5CQXA 4BY6B 3M56A 4C5GA 2LDMA 5FU6B 4EMKA 3L2VA 3JCMW 2RHYA 3OYHA 3CPWA 3R6OA 4A4KA 4VUBA 2QQAA 4BACA 2JVVA 3PNWC 4XTZA 4B9XA 5GAN3 2VV5A 3FEOA 3M9QA 5I21A 4MMKA 1W2BS 1B34B 2OTLA 3HKSA 3DLLA 2E70A 4OGCA 3RIRA 1G3SA 1HK9A 2OTJA 2M16A 4XAXB 3OYAA 2R58A 1Q7YU 1K9MU 2P0KA 3WXMB 3DLMA 3PMTA 2ZPHB 3QDRB 1QW1A 3QKJA 4JUVA 5FLXE 3LYIA 4C92A 2RD1A 4E7IA 3CC4A 1W2BA 3GOXA 5L8RE 4BDZA 1UEBA 3J81E 3RKXA 1VQ6A 2ZPBB 3ZBDA 3FC3A 2DD5A 4JLIA 2DKGA 2YHTA 5C0MA 3VUBA 3VU3C 3KXTA 4LDWA 4E47A 3L42A 3QJYA 5LJ3e 5HKCA 3GNGA 3OYGA 3CCUA 1QP3A 3LW5E 5AYFA 2O4XA 1BI1A 3E19A 1YI2T 2HQEA 3OMGA 2RI5A 3ER0A 4FU6A 4QQGA 5GAN8 2WSEE 3OS2A 3C4SA 1VQOA 3S3MA 2R57A 4P5NA 2DIGA 3CMAA 2X35A 2A7YA 4ZGEB 3ME9A 2LC4A 1EIFA 2KQWA 2O4XB 3X20B 5GMKe 5GAMd 1VQ8A 2RI3A 3QUIA 2EQJA 2MF2A 2WSCE 1MGQA 4OVAA 5GAOr 4M7DF 1Y71A 3MP6A 4QVCA 4EMHA 5GANg 3PIPA 4RMOA 3QBYA 4EMKB 4JS5A 2Y90A 5DY9A 3S3NA 1VQ9T 1BKBA 3HL8A 4PJOB 1LJOA 2HNIA 3WVDB 4M7DG 3OS5A 3CCMA 3CC7T 1NJIC 4M7AE 1N9SA 2XG8D 2E6NA 2KDSA 4NOYA 1K8AU 5IAYA 4M7AC 4EDUA 3PMIA 2ZCFB 2LCLA 1VQ4T 1KHIA 2QTXA 3RUXA 1OZ3A 3V8LA 4J83A 4BI3A 1QVGA 5HK3A 3CBPA 1PSFA 1JBMA 5CKHA 4M75E 3X26B 3JCMd 1VQ5T 3G6EA 1VQKT 2DXCA 1QVPA 2MWPA 3M53A 4OMFB 3OSVA 1V29B 5HK0A 2PU9B 3G4ST 1VQLT 4M7DC 1BIBA 2JN0A 3G71T 2E10A 4XK8E 1YJNT 1VQKA 3VYGA 2RHXA 3BY7A 3OBYA 5GMKi 4QQDA 4A4EA 4C8QF 3MEUA 3VV0A 1S72T 4HA8A 3M59A 4J5YA 4ZGDB 2E12A 4MZTA 4WF2A 1ZQ1A 5D6WA 2PVDB 4C92E 3JB9I 3FB9A 5IT9E 3MCAB 4C8QE 5LJ5d 4O5VA 2XK0A 4HCZA 4F7UF 3OSSC 1Y07A 4JRPA 2QXFA 3QXEB 3DB3A 3CCVA 3JCMP 2Y4YA 4QVDA 1M90C 2EIFA 3QZ5B 4E7HA 3TU4K 1X75C 4KT0E 2XD0A 3VJPA 2WACA 1M1GA 2Y4XA 2QEXT 3CCVT 4M75F 2KK4A 2F5TX 2RK1A 4M7DD 1H3ZA 2CYZB 3SFMA 5FU7C 1YITT 3CPFA 3C12A 4MDXA 5GANh 1UGPB 4HT8A 3TEEA 4F7UA 3A8GB 5KCHA 1OZ2A 4F7UE 5GAOm 3G6ET 1BIAA 2LT4A 5GMKh 3GF5A 2QA4T 5CVIA 4ZTJA 2FB7A 4HCCA 1VQLA 4PLLA 1VQ6T 4C5EA 3CXCS 5GAN6 3FIFA 3OYIA 1D3BA 1KQ1A 3NTKA 1BI2A 1Q82C 1FXXA 4FL6A 5C6SA 3BFMA 5CKEA 4M75G 3JCMg 2M1HA 1QP2A 1BI3A 5GAOn 5DLQE 1KQSA 3V8KA 2CZ6B 1YIJA 3M54A 2FYKA 5FU7B 1FWZA 1OYXA 4PL6A 5CQYA 3LGLA 1M1KU 4BB7A 3CD6T 4BE0A 2KAFA 3E9FA 2E64A 2RHUA 4DOWA 1TH7A 2K5LA 4L5GA 5CIUA 2PUOB 3EFSA 5LJ5h 1KQSS 3I56A 1XTDA 1B34A 3OMCA 1VIFA 2E5QA 4N4HA 4KUIA 5GAN2 2FVUA 1I8FA 2D0QB 1M5Q1 4C8QG 4ELYC 3ZEHA 4C92B 5GAMg 5GAN4 3OYBA 4PLIA 1HXDA 2MAMA 2XU8A 3BDUA 3KUFA 4IUUA 5CKFA 1UGSB 1U8RA 1VQ9A 3CMET 3FJPA 5DLOA 3LLRA 1WGSA 3FRNA 4C0GA 2CKKA 1RI0A 5CR2A 1Q82U 1QVFS 4FSXA 2CS7A 3OYDA 1XQHA 5GMKj 3S3OA 2DJZA 2CZ0B 4HT9A 3OBWA 4A4HA 2XIDA 1NPRA 4M77D 4XQ3A 2RK2A 2K5FA 3SWNB 4FT4A 2EJFA 1N9RA 2ZPIB 4JRIA 1Q86C 4M78G 3X28B 2EAYA 4M77G 5GAOq 1KD1C 4HCBA 3H8ZA 4QW2A 4LDYA 4J7IA 3GIBA 2R5MA 3BDLA 3L1AA 5GAN7 3OW2A 4M77B 4GY5A 5CO7A 4KBMB 4C8QD 3L2QA 1VQMT 1AHJB 4M7DE 4PJOA 2RHIA 5GAOl 1OI1A 1YI2A 1NE8A 4ZTFA 3CC2A 2XICA 3OA6A 5GAMh 3JB9G 3NFCA 3OS0A 2RHZA 1VQNT 3JCMV 1KG1A 3SD4A 4X9CA 3CMAT 5LJ5g 4M77F 3GNFB 3MP8A 4A53A 3E9GA 2QQBA 3FLGA 1I81A 3DB4A 3X24B 1MHNA 4C92F 4ZGJB 4D6WA 5LJ3j 3L2UA 2DAQA 1ZBXA 4Y28E 4BI4A 4EPCA 5CAIA 3CMEA 3CCSA 2DEQA 3OYJA 5J3BA 3CEYA 3OQ5A 1X6OA 4M75D 4R56A 4RKUE 3GPLA 3CCLA 4PJOD 3JRZA 3HRUA 3M55A 3JCMh 2VGNA 2XDBA 3SB2A 3OW2S 2PUKB 1YBYA 5LJ3g 4XTYA 4ELZC 5A0DA 3M5AA 4M78B 3CD6A 4PNOA 3CCQT 4J6YA 3UT1A 3L2WA 4GLKA 1YJ9T 3J80E 2RI2A 2DD4A 3C94A 3ZFJA 1U1SA 3HRTA 1Y7XA 3G7ZA 4DQ2A 3N5BB 1M8VA 5GANj 1O75A 4J8OA 2RJCA 3V7CA 4C0ZA 1VQMA 2ZGWA 4IUVA 1VIEA 3RKYA 4BE1A 5LJ5e 4JJNK 3OYLA 4UC4A 3CXCA 2RJDA 1ZHIA 2KY9A 5IN1A 3HHTB 1S72A 2K3YA 1UB4A 1M1KC 4ATOA 1K8AC 2VC8A 4CRIA 1YCYA 4C8QB 3MO8A 4N0AA 1G3WA 5LJ5f 2RH2A 5LJ3h 5J39A 1LNXA 4N0AC 5EG2A 1O9SA 2QI2A 3QHSA 3QYGB 1KHCA 1KC8U 5CKBA 1M1FA 1WPYA 2PVGB 1X01A 5I2MA 2L3RA 3RESA 2EQKA 3JB9H 2ZPFB 2EJ9A 2LCCA 2JZ2A 5FROA 4EMKC 2QA4A 1VQ4A 1K73U 2DTIA 4MZMA 1N27A 3CCJT 3NTHA 3OYKA 1VQ5A 4M7DA 3J7AF 2X4WA 5LJ5j 2K5IA 2JOYA 4BUGA 4M7DB 4LDXA 4M75B 5KH6A 1K73C 2B8AA 3OYYA 2FHDA 4OGEA 5D6YA 5KE2A 2PQWA 3HSBA 2X4JA 2IG0A 1NPPA 3META 1Y96A 2CZ1B 4Y91A 3OYEA 1JRIA 1KC8C 1N8RC 3QYHB 4FIBA 2BIVA 3CC2T 3RMQA 3CBMA 2LNVA 4M7AB 3RERA 5M9OA 3CCUT 2LVMA 2DTOA 2XI9A 3RKWA 5GAMe 3PIOA 1I5LA 2QQSA 3A8OB 3FDRA 3OB9A 4M78D 4NL3A 2EFIA 2R5AA 2ZPEB 3UPUA 3CCST 3F70A 4M75C 1YJWT 3M4YA 3L2RA 3M58A 3I55A 5J26A 1G3TA 4ZN1A 2E1HA 2DK3A 2DO3A 2K4YA 2EKOA 2FL7A 2X4YA 4A54A 3M57A 3QPHA 5D6XA 2VXEA 5CK9A 3I55T 4O6JA 4B9WA 3P8DA 5KCOA 5GMKl 2K3XA 3OS1A 4C5IA 3JCMe 4IUTA 1H641 4M78C 4OB0B 4PJOG 4L59A 3CCET 2GF7A 3A8HB 2VGMA 4OF1A 5I2SA 4M77E 3WVEB 4M78E 3V7SA 4C92C 5LJ3f 3CCJA 3CCQA 4OB3B 5GAMj 2QDYB 2H3JA 4C8QC 1JB0E 1WJQA 4RG2A 1D3BB 2V8JA 1SSFA 3T9NA 4IURA 3HFNA 2NLUA 1VQ7A 4PJOF 5GAN5 4F7UG 2DVEA 3OYFA 3G4SA 1YHQA 3A8LB 2K57A 3UDCA 2C06A 1YIJT 1VUBA 3LWHA 3V8JA 2RJFA 4IUQA 2DPPB 2LQ8A 3JCMb 2RB6A 4NS5A 3JCMX 3JB9D 2JNGA 3C95A 2HD0A 3EFRA 4LD6A 2D6FA 4TVRA 5A0GA 1NZ9A 4JRQA 2KSSA 1JJ2A 2JUFA 1LOJA 4M7AF 4II1A 4XTXA 4XU0A 1QVGS 1R8OB 2ZPGB 2YLCA 3ASKA 3MEWA 4C0FA 2K2VA 1W4SA 4QVZA 5LJ3d 2E41A 3MHXA 4N4GA 5FRNA 2P4TA 1N8RU 4A4FA 3OY9A 4A4GA 4M78F 2V8IA 4C0DB 2JTMA 2BUDA 5A2QE 1U1TA 2DZ9A 4Q5WA 2MMPA 2MWOA 4X34A 4XU3A 2DXBA 4C92G 2M0OA 3OYCA 3VYHB 1VQNA 3CCEA 2GFAA 3HFOA 4C92D 5CCAA 4M7AA 3P8BB 4MMLA 2HAXA 4ZN3A 2F5KA 4PKCC 2V8KA 5GANf 1M4ZA 2GCXA 3PGGA 4BI8B 2EWNA 2HBPA 3OYNA 1IZ6A 1VQPT 3GLXA 1G5VA 1YJNA 3Q1JA 2MI6A 2LT1A 2LX9A 2M9UA 4M75A 1KD1U 1YJ9A 4E7JA 3CCLT 1VQ7T 3LGFA 3S6WA 2L5QA 3JCMc
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M16 A;  1KHC A;  3OYA A;  2R58 A;  4QQ6 A;  3O8V A;  2EQM A;  4C5H A;  2P0K A;  2L3R A;  3DLM A;  3PMT A;  1OYX A;  2EQK A;  3QKJ A;  3LGL A;  4PL6 A;  3LYI A;  4E7I A;  2LCC A;  5FRO A;  2JZ2 A;  3GOX A;  3NTI A;  4BE0 A;  3E9F A;  4BDZ A;  2RHU A;  1N27 A;  3NTH A;  3OYK A;  2LRQ A;  3FC3 A;  5CIU A;  2D9T A;  2HQX A;  2X4W A;  5C0M A;  1WJS A;  5KH6 A;  2B8A A;  2FHD A;  3OMC A;  4N4H A;  2E5Q A;  2JTF A;  2PQW A;  3L42 A;  5D6Y A;  5KE2 A;  2IG0 A;  3MET A;  3OYB A;  3ZEH A;  3UWN A;  3OYG A;  2O4X A;  4PLI A;  3OYE A;  3KUF A;  2HQE A;  3OMG A;  4IUU A;  2BIV A;  2RI5 A;  3LX7 A;  4FU6 A;  4QQG A;  3LLR A;  1WGS A;  2YRV A;  2CKK A;  1RI0 A;  3C4S A;  3MEA A;  3OS2 A;  3OYM A;  3S3M A;  2R57 A;  5M9O A;  2LVM A;  5FRM A;  2DIG A;  2L8D A;  2X35 A;  4BD3 A;  2QQS A;  3FDR A;  3ME9 A;  3EAE A;  3OB9 A;  5KE3 A;  3OYD A;  2O4X B;  2EFI A;  4BDY A;  3S3O A;  2R5A A;  2BKD N;  3PFS A;  2RI3 A;  2LTO A;  3QJ6 A;  2EQJ A;  2GFU A;  4OVA A;  2RO0 A;  4A4H A;  3MP6 A;  3F70 A;  3L2R A;  3QBY A;  5J26 A;  3MP1 A;  3S3N A;  2VYT A;  2EKO A;  2X4Y A;  5D6X A;  3H8Z A;  4QW2 A;  3MEV A;  2E6N A;  2R5M A;  3BDL A;  3P8D A;  4B9W A;  5IAY A;  2K3X A;  4IUP A;  4EDU A;  5KCO A;  3PMI A;  2EQU A;  4C5I A;  3OS1 A;  4IUT A;  4GY5 A;  2L89 A;  1OZ3 A;  4L59 A;  3L2Q A;  2GF7 A;  2RHI A;  1OI1 A;  4ZTF A;  3OA6 A;  2MWP A;  1WJQ A;  4RG2 A;  1XNI A;  3OS0 A;  1SSF A;  2RHZ A;  4IUR A;  2QQR A;  4E7L A;  3LH0 A;  2NLU A;  3SD4 A;  4BE2 A;  3MP8 A;  2RHX A;  3E9G A;  3FLG A;  3DB4 A;  3P8H A;  3OYF A;  1MHN A;  3L2U A;  4QQD A;  4A4E A;  2DAQ A;  3MEU A;  3OYJ A;  4N4I A;  2RJF A;  4IUQ A;  5D6W A;  3CEY A;  3OQ5 A;  3H6Z A;  4NS5 A;  4LD6 A;  4Z02 A;  2X4X A;  2XK0 A;  4HCZ A;  4II1 A;  4E7K A;  4IKF A;  3DB3 A;  3ASK A;  3MEW A;  4E7H A;  2RJE A;  4QVZ A;  5FRN A;  4N4G A;  2WAC A;  4A4F A;  2XDP A;  3OY9 A;  3UT1 A;  4A4G A;  3L2W A;  2BUD A;  2G3R A;  2RI2 A;  1H3Z A;  3QII A;  4Q5W A;  2MWO A;  4X34 A;  1WJR A;  2M0O A;  3OYC A;  2DIQ A;  2GFA A;  2RJC A;  4IUV A;  4BE1 A;  4C5G A;  2LDM A;  3OYL A;  4UC4 A;  1OZ2 A;  2RJD A;  5KCH A;  3L2V A;  2F5K A;  5IN1 A;  2RHY A;  4ZTJ A;  2K3Y A;  3OYH A;  4BAC A;  4PLL A;  3OYN A;  1G5V A;  3PNW C;  4C5E A;  4B9X A;  3FEO A;  3M9Q A;  3OYI A;  3Q1J A;  4CRI A;  3NTK A;  3MO8 A;  5C6S A;  4FL6 A;  4E7J A;  3LGF A;  3S6W A;  5J39 A;  2M1H A; 
#chains in the Genus database with same CATH topology
 4YTL A;  3O8V A;  4JRK A;  3SEM A;  1RLQ C;  2LCS A;  1IRE B;  3IQL A;  4LD9 K;  1Y96 B;  2VUB A;  1Q82 R;  2V1Q A;  2LQK A;  2LRQ A;  2D9T A;  2HQX A;  4RTX A;  1MV3 A;  4C8Q A;  1Q81 U;  2KEA A;  1KQ2 A;  3A1P A;  2X3X D;  2YRV A;  3OYM A;  2CGH A;  4BD3 A;  2L3Q A;  4J9G A;  3EAE A;  5KE3 A;  2MCN A;  8AT1 B;  1WQ7 A;  4EMG A;  3QWY A;  4NL2 A;  5HY6 A;  2A28 A;  2VYT A;  1CKB A;  3V7R A;  1WX6 A;  1VQO T;  4MDW A;  2KXD A;  2EQU A;  4JDS A;  2K9G A;  2E3I A;  3VUZ A;  3H9N A;  2FRY A;  1RAE B;  4HKE A;  1ZA2 B;  2EJG A;  4KUL A;  3CCU Q;  4B6M A;  3INZ A;  3BW1 A;  4M7A D;  4PJL A;  2DM1 A;  1VQ8 T;  2CP6 A;  2CP2 A;  1Q86 U;  2RNA A;  2X3W D;  4N4I A;  2MPX C;  2LJ3 A;  3EH2 A;  2WSF E;  4L6V 5;  2YRD A;  2X4X A;  4IKF A;  1H3H A;  3AHU A;  1M27 C;  2RJE A;  1SF9 A;  3TRE A;  4CI0 C;  3CBO A;  4BY6 C;  2QQ9 A;  1WHH A;  2LQW A;  3M56 A;  4F14 A;  1K0X A;  3JCM W;  1ZSZ B;  3R6O A;  4VUB A;  5GAN 3;  2H8H A;  1B34 B;  3DLL A;  2OTJ A;  4XAX B;  3OYA A;  1Q7Y U;  1K9M U;  5KYW B;  2OX7 A;  2P0K A;  1OPL A;  3PMT A;  1X2Q A;  3QKJ A;  2G6F X;  4C92 A;  2RD1 A;  1VYU A;  3J81 E;  3RKX A;  1VQ6 A;  2ZPB B;  3ZBD A;  1QWE A;  2DD5 A;  1MMG A;  2QAZ A;  4ZNX A;  4JLI A;  3VS3 A;  5C0M A;  4M4Z A;  4E47 A;  1C1A A;  1YJ9 Q;  3OYG A;  3GNG A;  2BZ8 A;  3CCU A;  3LW5 E;  2HQE A;  2KT8 A;  3ER0 A;  4FU6 A;  3G71 Q;  1WYX A;  3A98 A;  3C4S A;  2A37 A;  1Z9Z A;  4KH0 B;  2LX7 A;  2A7Y A;  4ZGE B;  4OMM A;  2O4X B;  5D7U A;  1VQ8 A;  5GAM d;  1RAA B;  2WSC E;  1MGQ A;  1NEB A;  5GAO r;  4EMH A;  1TS9 A;  4RMO A;  3CC4 Q;  3QBY A;  4JS5 A;  2Y90 A;  1J3T A;  2CH4 W;  1LJO A;  2LQN A;  3TSW A;  3CCM A;  1NJI C;  4NOY A;  1VQ4 T;  3RUX A;  1OZ3 A;  1X6G A;  5HK3 A;  3JCM d;  5CKH A;  1ACM B;  4J9D A;  1VOM A;  1PKS A;  3G6E A;  1BCO A;  1VQK T;  1TUD A;  3G4S T;  4M7D C;  1BIB A;  2RHX A;  4CC3 A;  2DRK A;  4A4E A;  4C8Q F;  3MEU A;  1PG5 B;  3VV0 A;  1TSF A;  4ZGD B;  4CC7 A;  4C92 E;  3JB9 I;  1FMV A;  2GQI A;  1XJW B;  1N5Z A;  2L0A A;  2EBP A;  2QXF A;  3QXE B;  3JCM P;  2Y4Y A;  3SHW A;  4KT0 E;  3VJP A;  1BU1 A;  1UHF A;  2Y4X A;  4FCY A;  4M75 F;  2CYZ B;  3SFM A;  5FU7 C;  2JT4 A;  1X43 A;  5GAN h;  3TEE A;  1OZ2 A;  2F2W A;  1NYF A;  1M8M A;  4PLL A;  1VQ6 T;  1S72 Q;  1D3B A;  3BFM A;  5CKE A;  4M75 G;  1C6V X;  2CSQ A;  5GAO n;  3NHN A;  3M54 A;  2FYK A;  3NPF A;  1M1K U;  3TVT A;  1Z9Q A;  3CD6 T;  4BE0 A;  5KYW A;  4DOW A;  2RHU A;  2SRC A;  1G2B A;  4L5G A;  1GCQ C;  1WLP B;  3I56 A;  1YFN A;  1B34 A;  4N4H A;  2E5Q A;  4KUI A;  4C8Q G;  1ZSZ A;  5GAN 4;  4PLI A;  2MAM A;  3LLR A;  2CP3 A;  4C0G A;  1MUZ A;  1RI0 A;  7AT1 B;  5CR2 A;  2HEQ A;  4FSX A;  1VQ9 Q;  3S3O A;  1IRX A;  4HT9 A;  3OBW A;  2NUP B;  2HKQ B;  2V1R A;  4A4H A;  2JS2 A;  4M78 G;  2EAY A;  2HL3 A;  3H8Z A;  3M0P A;  2R5M A;  5GAN 7;  3EG1 A;  2O88 A;  1ZUK A;  4M7D E;  1QCO A;  1YI2 A;  3UA7 A;  1VQN Q;  5GAM h;  2K7A A;  2RHZ A;  3CME Q;  3SD4 A;  4A53 A;  3E9G A;  3X24 B;  4FYW B;  1I07 A;  2DEQ A;  5J3B A;  3OQ5 A;  2Z0W A;  1VQO Q;  1X69 A;  1G83 A;  3GPL A;  4LUE A;  3JRZ A;  2XDB A;  4D8D A;  5IXB A;  4M78 B;  4PNO A;  3UT1 A;  3CCE Q;  3ZFJ A;  1QKX A;  3TSZ A;  1PD1 A;  1M8V A;  4C0Z A;  1VQM A;  2ZGW A;  4IUV A;  4BE1 A;  1IB8 A;  4UC4 A;  1KJW A;  1GBR A;  1ZHI A;  2XMF A;  1TWB A;  1PCX A;  3FJ5 A;  2K3Y A;  4C8Q B;  1TOV A;  4GLM A;  5LJ5 f;  2RH2 A;  1LNX A;  5EG2 A;  3QHS A;  3QYG B;  2BZX A;  4J9H A;  1KC8 U;  1E6G A;  1X6B A;  3RES A;  1WHL A;  2ZPF B;  2EJ9 A;  2LCC A;  4EMK C;  1ZUU A;  4KGV B;  1N27 A;  3J7A F;  1HSQ A;  1X27 A;  5LJ5 j;  4M7D B;  4LDX A;  1UDL A;  3EHQ A;  2CZ1 B;  3CCJ Q;  2NUT B;  3CC2 T;  2BIV A;  3CMA Q;  1BK2 A;  5M9O A;  3CCU T;  2LVM A;  1D0Y A;  2XI9 A;  3RKW A;  3PIO A;  1TG0 A;  2EFI A;  2R5A A;  1U5S A;  4RTV A;  3L2R A;  3I55 A;  1G3T A;  2DO3 A;  2K4Y A;  5KYU B;  2FL7 A;  2DX1 A;  4C5I A;  1LVK A;  5KYU A;  3A8H B;  2VGM A;  1ZA1 B;  4M77 E;  1YP5 A;  4OB3 B;  3VS7 A;  4C8Q C;  1VQP Q;  2DE0 X;  1UEC A;  4KGX B;  2EYY A;  4GBQ A;  1T0J A;  2DLP A;  3EFO B;  3LWH A;  2RJF A;  3PE0 A;  2NUT A;  3JCM X;  2JNG A;  3C95 A;  4LD6 A;  3EFR A;  2CRE A;  3CCV Q;  4TVR A;  2D6F A;  4JRQ A;  1CKA A;  1CSK A;  4F17 A;  4XTX A;  4C0F A;  4QVZ A;  2E41 A;  4N4G A;  2MYS A;  3EG3 A;  1Q95 G;  2P4T A;  1WXU A;  4A4F A;  3OY9 A;  2GTO A;  1RAD B;  4M78 F;  2V8I A;  2KE9 A;  4HCK A;  2DXB A;  3OYC A;  3VYH B;  4PFP A;  4C92 D;  1VQK Q;  1KC8 R;  5GAN f;  1IO6 A;  1M4Z A;  1GCQ A;  2RQW A;  2M51 A;  3LGF A;  2L5Q A;  2K3B A;  1C0M A;  2FPE A;  4ME7 A;  5GMK m;  2DTH A;  1GBQ A;  1OU9 A;  1UGR B;  2LZ6 B;  3QO3 A;  4LDV A;  3JSC A;  2RQT A;  1KFZ A;  1M90 U;  3KFV A;  4C0D C;  1WJS A;  3JAM E;  3URG A;  2RPN A;  3GP8 A;  2NUP A;  1YI2 Q;  3UWN A;  2DJQ A;  2NYS A;  1NJI U;  4XTV A;  2I0N A;  3LX7 A;  1YJW Q;  4OMP A;  1EFN A;  4BDY A;  2QGF B;  1P92 A;  2HSP A;  2AZV A;  2LP5 A;  2RO0 A;  2HQH A;  2CSI A;  1ABQ A;  3M4G A;  2MOX A;  3MEV A;  2ED1 A;  4M77 C;  2IVW A;  2CP5 A;  1BYM A;  2FPF A;  5DM7 R;  2DIL A;  2L89 A;  3QG1 A;  4AG2 C;  1IHW A;  4R55 A;  5KYX A;  2CP7 A;  3RMS A;  3SDZ A;  1SEM A;  2C0I A;  3I55 Q;  1YIT A;  3LH0 A;  3QZ9 B;  5GAM f;  3MKD A;  2FG0 A;  3EH1 A;  2DL5 A;  1BBZ A;  3HP9 A;  3EG9 B;  3PT9 A;  1QVG P;  4DBQ A;  1GL5 A;  4FM4 B;  3H6Z A;  1SRM A;  1YWP A;  2BTT A;  4FT2 A;  2AHJ B;  3C0C A;  4RCB A;  1RL2 A;  4J7F A;  5I11 A;  4A63 B;  1QVF A;  2KMT A;  2XDP A;  4K11 A;  1JXM A;  3JB9 F;  5FU6 C;  3I9Q A;  2PTK A;  2DXT A;  2G3R A;  3QII A;  4XU2 A;  1WJR A;  3RNJ A;  2DIQ A;  2COZ A;  2JTE A;  1PNJ A;  1TTH B;  1AVZ C;  1KD1 R;  4C5G A;  2LDM A;  4EMK A;  3QWX X;  4BAC A;  1WI7 A;  2AK5 A;  4B9X A;  3FEO A;  5I21 A;  2E70 A;  3CCL Q;  1WHG A;  3GBQ A;  5FLX E;  4JUV A;  3CC4 A;  1FMK A;  1W2B A;  3GOX A;  1UEB A;  3EG2 A;  1AWW A;  1KK7 A;  2YHT A;  3VUB A;  3VU3 C;  3L42 A;  1PC0 A;  3QJY A;  5LJ3 e;  3OMG A;  2JMC A;  3S3M A;  2DIG A;  2YUQ A;  2LNH B;  3X20 B;  2VAS A;  3MP6 A;  4QT7 A;  5GAN g;  3RDV A;  4EMK B;  3S3N A;  4PJO B;  4FYX B;  3HL8 A;  1YWO A;  2YXY A;  1KIK A;  3WVD B;  5IAY A;  4EDU A;  3JV3 A;  3V8L A;  2M02 A;  1QVG A;  1ZUY A;  1RAB B;  1RAH B;  1PSF A;  1WZO A;  1QCN A;  2DXC A;  2MWP A;  4OMF B;  4HXJ A;  1V29 B;  1VQL T;  3G71 T;  1JXO A;  1E7O A;  1VQK A;  4OMO A;  1B07 A;  4PJN A;  4HA8 A;  4MZT A;  5D6W A;  1KSW A;  4RTW A;  1B3Q A;  3RR6 A;  5IT9 E;  3MCA B;  5LJ5 d;  1T0H A;  2XK0 A;  1BCM A;  4F7U F;  3DB3 A;  4RUG A;  4QVD A;  1Q81 R;  2EIF A;  2OJ2 A;  2OTL Q;  2XD0 A;  2WAC A;  1ZX6 A;  4AT1 B;  2QEX T;  2KK4 A;  2CT3 A;  4LN2 A;  2F5T X;  2DL7 A;  1H3Z A;  1FMW A;  1GFC A;  1UGP B;  5KCH A;  5GAO m;  2LT4 A;  2GNC A;  5GMK h;  2QA4 T;  1R77 A;  5GAN 6;  3FIF A;  1KQ1 A;  3NTK A;  1Q82 C;  5C6S A;  4FL6 A;  1JU5 C;  3VRY A;  2M1H A;  1QP2 A;  5DLQ E;  1MMN A;  3V8K A;  2CZ6 B;  3VS5 A;  5FU7 B;  1OYX A;  3NGP A;  2DL4 A;  3E9F A;  2O2O A;  1TXQ A;  1SSH A;  5KYN A;  1OX9 A;  1AWJ A;  1XTD A;  1UUE A;  1RI9 A;  5GAN 2;  1YJW A;  2D0Q B;  4ELY C;  5GAM g;  4C92 B;  5HCK A;  3BDU A;  2XU8 A;  4IUU A;  1U8R A;  1VQ9 A;  2CKK A;  1VQL Q;  1QVF S;  3RBB B;  2CS7 A;  1XQH A;  5GMK j;  2DJZ A;  1WXB A;  4M77 D;  4XQ3 A;  2QYZ A;  2RK2 A;  4FT4 A;  1N9R A;  4JJD A;  1Q86 C;  4M77 G;  2LMJ A;  3GIB A;  3OW2 A;  3PVL A;  4M77 B;  1X2K A;  2JW4 A;  3PVQ A;  4GY5 A;  5CO7 A;  2J06 A;  2RHI A;  2LJ0 A;  1NE8 A;  4ZTF A;  3VS2 A;  3JB9 G;  1JEG A;  1Y0M A;  1KG1 A;  3CMA T;  3UAT A;  3QDF A;  1SHG A;  3GNF B;  3MP8 A;  4M77 F;  1QCF A;  3FLG A;  1I81 A;  2JM9 A;  4OMQ A;  4ZGJ B;  5LJ3 j;  3L2U A;  2DAQ A;  1ZBX A;  2RQR A;  3OYJ A;  3H41 A;  1W6X A;  1X6O A;  4M75 D;  1D1B A;  4R56 A;  4RKU E;  3CCL A;  4HVW A;  3M55 A;  1YBY A;  2VVK A;  1LPL A;  2KGT A;  4LE9 A;  3CCQ T;  3VS1 A;  2ESW A;  1VQM Q;  3C94 A;  1U1S A;  3G7Z A;  5FW9 A;  3N5B B;  4F16 A;  5GAN j;  3V7C A;  4DEY A;  4JJN K;  3OYL A;  1RLP C;  2KY9 A;  3HHT B;  1UG1 A;  1PM3 A;  1M1K C;  4ATO A;  2ATC B;  3BE3 A;  4CRI A;  2RF0 A;  5J39 A;  1PKT A;  1SRL A;  6AT1 B;  5CKB A;  4IIM A;  3CXC P;  3CCS Q;  3JB9 H;  1VQ4 A;  1D0X A;  4JZ3 A;  4MZM A;  3CCJ T;  3OYK A;  2FEI A;  4M7D A;  2HZY A;  4KH1 B;  1AZG B;  2NUZ A;  4BUG A;  2B8A A;  3OYY A;  4OGE A;  2PQW A;  2X4J A;  1Y96 A;  1NBE B;  4Y91 A;  4RTY A;  1AZE A;  1JRI A;  1KC8 C;  2DER A;  3QYH B;  4FIB A;  3RMQ A;  3CBM A;  2BZY A;  3RER A;  5GAM e;  4NL3 A;  3OB9 A;  2ZPE B;  3UPU A;  3CCS T;  3MJX A;  1PRL C;  1BB9 A;  2E1H A;  5KYX B;  2KYB A;  3M57 A;  2VXE A;  2X51 A;  4PK4 A;  1W2B P;  4B9W A;  4DBR A;  3JCM e;  4IUT A;  4OF1 A;  3CCQ A;  3WVE B;  4M78 E;  4C92 C;  5GAM j;  2KRM A;  2FZG B;  2QDY B;  1WJQ A;  1D3B B;  1SSF A;  3T9N A;  2FZC B;  2PZ1 A;  2F1L A;  1VQ7 A;  2HKN A;  2DVE A;  4F7U G;  3G4S A;  1YHQ A;  2D8J A;  2C06 A;  2DF6 A;  2CDT A;  2DPP B;  2LQ8 A;  2RB6 A;  3JB9 D;  3EGX A;  4FYY B;  1JJ2 A;  4II1 A;  2HDA A;  4XU0 A;  3MEW A;  2K2V A;  1W4S A;  1R0B G;  4C0D B;  2JTM A;  5A2Q E;  2A36 A;  2MWO A;  2M0O A;  1VQN A;  2MK5 A;  2EQI A;  5CCA A;  2V8K A;  2GCX A;  3OYN A;  2EWN A;  1IZ6 A;  1VQP T;  2NWM A;  4E7J A;  3S6W A;  2QDL A;  1AT1 B;  4QQ6 A;  4C5H A;  3G4S Q;  1FX7 A;  4PJO C;  3CCR A;  3I56 T;  4XU1 A;  3CPW P;  1LCK A;  3X25 B;  4M7A G;  5L23 A;  5GAN e;  5GAN d;  2OTJ T;  4JJB A;  2GQV A;  1PRM C;  2EGE A;  2P0Q A;  1ZLM A;  5AT1 B;  4R0K A;  3CC4 T;  2JS0 A;  3EFO A;  1VYT A;  1DJ7 B;  4J9B A;  1YHQ Q;  5FRM A;  3G71 A;  2L8D A;  1XOV A;  4LXC A;  4AFZ C;  2K6D A;  4WCI A;  3CPW S;  3PFS A;  2J7I A;  1M2V B;  4OB2 B;  1VQP A;  1PSE A;  1SHF A;  3UA6 A;  4J9E A;  3M0S A;  2HBW A;  2DZC A;  2BE9 B;  4M77 A;  2EYQ A;  3A8M B;  2C0T A;  2FRW A;  2KVQ G;  4V2S A;  3HPW A;  1BI0 A;  3A5Z B;  1XNI A;  2CZ7 B;  2QTV A;  1JJ2 P;  3TCJ A;  4E7L A;  4LUD A;  1T3L A;  1D1C A;  2A3L A;  5IHI A;  2PVO B;  2SEM A;  3VS4 A;  4FSS A;  4F7U B;  2DXU A;  4OB1 B;  2YUP A;  2O01 E;  3MPU B;  4KRT A;  4XTW A;  3CCM T;  1UGQ B;  1UGV A;  1H8K A;  1AD5 A;  3VKI A;  4JLG A;  1MV0 B;  3SWN C;  2ED0 A;  3CCR T;  2I2L A;  3JCM Q;  1M9S A;  2J05 A;  3L2Z A;  3LWI A;  1WA7 A;  2O31 A;  5CQX A;  1D1A A;  5FU6 B;  2CP0 A;  3L2V A;  1QQJ A;  3CPW A;  2JVV A;  3PNW C;  4XTZ A;  2VV5 A;  3M9Q A;  1W2B S;  2OTL A;  2J6O A;  4E7S A;  4OGC A;  3RIR A;  1HJD A;  3CC7 Q;  2F2V A;  2ZAE A;  2M16 A;  2R58 A;  1ABO A;  3WXM B;  3DLM A;  2ZPH B;  3LYI A;  5L8R E;  4BDZ A;  2E3H A;  3D7S B;  2CUD A;  2KR3 A;  1OOT A;  3E19 A;  1YI2 T;  4KGZ B;  2EVR A;  2A08 A;  5GAN 8;  2WSE E;  3OS2 A;  1YCS B;  1VQO A;  2R57 A;  3CMA A;  2K2M A;  4CC4 B;  2LC4 A;  1EIF A;  2RI3 A;  3QUI A;  2MF2 A;  4OVA A;  2HSE B;  1NM7 A;  1D0Z A;  2HCK A;  4QVC A;  3ZL7 C;  5DY9 A;  2DVJ A;  3EG0 A;  1HYO A;  1M3A A;  2F2X A;  1N9S A;  2E6N A;  2JXB A;  2KDS A;  1K8A U;  2OTJ Q;  4M7A C;  3PMI A;  2AT1 B;  2LCL A;  2D1X A;  1SPK A;  2YDL A;  2QG9 B;  3CBP A;  1JBM A;  1U06 A;  3X26 B;  4M75 E;  4AMC A;  1VQ5 T;  4J9C A;  1QVP A;  2HMA A;  5KYY B;  8ATC B;  5HK0 A;  2JN0 A;  2E10 A;  4XK8 E;  1YJN T;  3OBY A;  1YN8 A;  2GGR A;  4X1V A;  5GMK i;  4QQD A;  1S72 T;  3O5Z A;  4WF2 A;  1ZQ1 A;  4HVV A;  1TU0 B;  2PVD B;  3FB9 A;  1K1Z A;  1I5O B;  4IIO A;  3M0T A;  2M0Y A;  1Y07 A;  3CD6 Q;  3CCV A;  1UJ0 A;  3QZ5 B;  1X75 C;  3M0U A;  1M1G A;  3I56 Q;  1T3S A;  4Z89 A;  4MDX A;  3A8G B;  4AFQ C;  1BIA A;  5CVI A;  4ZTJ A;  1UTI A;  1M2V A;  2QGG A;  1M3C A;  1R0C B;  1Y57 A;  1BI2 A;  1FXX A;  2JJ9 A;  1BI3 A;  1KQS A;  1FWZ A;  4PL6 A;  5CQY A;  3LGL A;  3EGU A;  4BB7 A;  2KAF A;  2E64 A;  1TH7 A;  1QVF P;  1YIT Q;  5LJ5 h;  1KQS S;  3OMC A;  3G6E Q;  2FVU A;  1I8F A;  3OYB A;  3ZEH A;  1HXD A;  1I0C A;  1UGS B;  3FJP A;  1JO8 A;  1Q82 U;  1AOJ A;  3OW2 P;  2D8H A;  3OYD A;  4J9F A;  2CZ0 B;  4E2F B;  2K5F A;  3SWN B;  2EJF A;  2ZPI B;  3X28 B;  4HCB A;  4QW2 A;  4LDY A;  4J7I A;  3BDL A;  2JMA A;  1NLO C;  4KBM B;  3L2Q A;  4F04 B;  3VS6 A;  2QEX Q;  3CC2 A;  1QWF A;  1VQN T;  1EZZ B;  3JCM V;  1OQK A;  2O9V A;  2QQB A;  1Q7Y C;  4C92 F;  1K9M C;  1UHC A;  1VQ9 T;  4Y28 E;  4BI4 A;  4EPC A;  5CAI A;  4Z88 A;  1MMD A;  2DRM A;  2V26 A;  4PJO D;  3HRU A;  3JCM h;  2VGN A;  3SB2 A;  3OW2 S;  2PUK B;  5LJ3 g;  4XTY A;  4ELZ C;  2RMO A;  4PJJ A;  2YUO A;  1M3B A;  4J6Y A;  4GLK A;  3J80 E;  2RI2 A;  5FWB A;  4OMN A;  3HRT A;  4DQ2 A;  2DYB A;  2GTJ A;  1KQS P;  4J8O A;  1VIE A;  4ESR A;  1Q7Y R;  1K9M R;  3CXC A;  2RJD A;  2L2P A;  4Z8A A;  5FWC A;  1S72 A;  1UB4 A;  1N8R R;  1K8A C;  3MO8 A;  1G3W A;  5LJ3 h;  1H92 A;  4N0A C;  1QLY A;  3E2U A;  1WPY A;  1NYG A;  2W0Z A;  4DEX A;  2L3R A;  4LNP A;  2EQK A;  3M0R A;  1K73 U;  1FYN A;  3NTH A;  3H0F A;  9ATC B;  2X4W A;  2K5I A;  2GBQ A;  4M75 B;  5KH6 A;  1MMA A;  2FHD A;  3CC2 Q;  1OU8 A;  3CCQ Q;  3OYE A;  3M0Q A;  1N8R C;  1K8A R;  2LNV A;  4M7A B;  2AZS A;  2KBT A;  2QQS A;  3A8O B;  4M78 D;  2EPD A;  2ABL A;  3M4Y A;  2ROL A;  2RQU A;  3M58 A;  4OML A;  4Y92 A;  3UF4 A;  5CK9 A;  4WTO B;  4O6J A;  3I55 T;  5GMK l;  2K3X A;  1H64 1;  4M78 C;  5IXF A;  4L59 A;  2GF7 A;  5I2S A;  1ARK A;  5ECA A;  2H3J A;  1M90 R;  4AFU C;  1RAI B;  4PJO F;  5GAN 5;  2DL8 A;  2KRN A;  1K9A A;  1AWX A;  3UDC A;  1TUG B;  1WDX A;  1YIJ T;  1VUB A;  4IUQ A;  1NG2 A;  2HD0 A;  1NZ9 A;  2KSS A;  4M7A F;  1LOJ A;  1IGU A;  2KXC A;  2J6K A;  1QVG S;  1K4U S;  1ZSZ C;  2ZPG B;  2YLC A;  3ASK A;  4E6R A;  2EGA A;  5FRN A;  4CC2 A;  1N8R U;  4RTT A;  2L3P A;  2BUD A;  1U1T A;  4AG1 C;  2DZ9 A;  2YRC A;  2MMP A;  4C92 G;  2IPO B;  3REA B;  4MML A;  1IGQ A;  4ZN3 A;  2F5K A;  3VS0 A;  3GLX A;  1YJN A;  2LT1 A;  2M9U A;  2MI6 A;  3TQ7 P;  3JCM c;  4FW1 A;  2E65 A;  2EQM A;  2HL5 C;  4XTU A;  4JS4 A;  4PJO E;  1OX8 A;  2RQV A;  3HSB A;  4J6W A;  2YLB A;  3DKM A;  2LJ1 A;  3NTI A;  4X9D A;  4KUD K;  4M78 A;  2XKO C;  2E6Z A;  3CCR Q;  2OTL T;  1GXI E;  1B7T A;  3SWN A;  3QSU A;  2RM4 A;  3HRS A;  2JTF A;  3KBG A;  2EKH A;  4RCC A;  2QEX A;  4DOV A;  3HTR A;  1G3Y A;  5LL6 S;  1RAF B;  4LDU A;  1NEG A;  4DA4 A;  4OP0 A;  3E1S A;  4MZP A;  1Q81 C;  3MEA A;  1U3O A;  1Q86 R;  5GAO p;  3JCM J;  2KI7 A;  2BKD N;  1YHQ T;  2LTO A;  3QJ6 A;  2GFU A;  1YIJ Q;  2KRO A;  1W70 A;  3MP1 A;  4D8K A;  1N6A A;  1IHV A;  3U23 A;  1RUW A;  5EC7 A;  3JB9 J;  4IUP A;  1JJ2 S;  2P0P A;  3I5R A;  5GJW B;  5IHK A;  2XHC A;  1ZBJ A;  1OPK A;  1WQW A;  2OAU A;  3PTA A;  2VXF A;  2COW A;  4J6X A;  1PWT A;  2XDD A;  5CKD A;  2QQR A;  1F1B B;  4BE2 A;  2EYX A;  3EGD A;  3P8H A;  3CCM Q;  2DEU A;  1VQ7 Q;  5A0L A;  2ZZD A;  2KNB B;  1WHK A;  1WHJ A;  2X9H A;  4RG8 A;  1I4K 1;  3CC7 A;  4Z02 A;  4E7K A;  2RA2 A;  1WNL A;  2ECZ A;  2JM8 A;  2CH4 A;  3JCM f;  1M30 A;  1IXD A;  1GFD A;  2ROT A;  2F69 A;  4BY6 B;  2EYW A;  3EGD B;  2RHY A;  1YJN Q;  3OYH A;  2DMO A;  4A4K A;  2QQA A;  2DL3 A;  1OUL A;  4MMK A;  1W1F A;  3HKS A;  5KYY A;  1VA7 A;  1G3S A;  1HK9 A;  3ULR B;  4D6W A;  3QDR B;  1VQ6 Q;  1QW1 A;  4FW2 A;  5I22 A;  2K79 A;  4E7I A;  3FC3 A;  2P84 A;  1VQ4 Q;  2DKG A;  3KXT A;  2QK0 A;  4LDW A;  5HKC A;  1QP3 A;  1WXT A;  5AYF A;  2O4X A;  1BI1 A;  2RI5 A;  2AKK A;  4QQG A;  4P5N A;  2X35 A;  1EX4 A;  3ME9 A;  2QAS A;  2VB6 A;  1OEB A;  2KQW A;  1QKW A;  5GMK e;  2D0N A;  1V76 A;  4E7Z A;  2EQJ A;  2E4H A;  1Y71 A;  2EW3 A;  3PIP A;  1S1N A;  1D09 B;  2A0F B;  1BKB A;  2QA4 Q;  2HNI A;  4M7D G;  1VQ5 Q;  3OS5 A;  3CC7 T;  4M7A E;  1M1K R;  2XG8 D;  2ZCF B;  1KHI A;  2QTX A;  1PD0 A;  4J83 A;  4BI3 A;  2RN8 A;  3M53 A;  3OSV A;  2PU9 B;  1ZSG A;  3VYG A;  3BY7 A;  3H0I A;  1JQQ A;  3EG9 A;  3M59 A;  4J5Y A;  2E12 A;  2PNI A;  1UE9 A;  1RAG B;  2YWW A;  4JZ4 A;  4C8Q E;  4O5V A;  4ORZ A;  4HCZ A;  3OSS C;  4JRP A;  2O9S A;  2FO0 A;  4E7H A;  3TU4 K;  2OAW A;  3CCV T;  4M7D D;  2RK1 A;  1YIT T;  3CPF A;  3C12 A;  4HT8 A;  4F7U A;  3CQT A;  4F7U E;  3G6E T;  3GF5 A;  2FB7 A;  1YNZ A;  4HCC A;  1VQL A;  4C5E A;  3CXC S;  3OYI A;  2DET A;  1I1J A;  3JCM g;  2DNU A;  1YIJ A;  2H3E B;  1M2O A;  1NJI R;  3THK A;  1WHM A;  2K5L A;  2W10 A;  3I5S A;  5CIU A;  2PUO B;  3EFS A;  2OI3 A;  1VIF A;  2C0O A;  1M5Q 1;  3KUF A;  5CKF A;  3CME T;  5DLO A;  1WGS A;  3FRN A;  3VRZ A;  1A0N B;  1WIE A;  1QMC A;  3REB B;  2XID A;  1NPR A;  2P4R A;  4JRI A;  4DBF A;  1HD3 A;  5GAO q;  1KD1 C;  1AWO A;  2E5K A;  3L1A A;  2KRS A;  1SKU B;  4C8Q D;  1VQM T;  1AHJ B;  4PJO A;  5GAO l;  1OI1 A;  2XIC A;  3OA6 A;  3NFC A;  3OS0 A;  3G1J A;  4JJC A;  4X9C A;  2DBM A;  5LJ5 g;  4J9I A;  3DB4 A;  1MHN A;  2AIR B;  3CME A;  3CCS A;  3CEY A;  5IH2 A;  1GCP A;  2DFU A;  2DYI A;  1G8X A;  2CUB A;  2FPD A;  4ANJ A;  5A0D A;  3H0H A;  3M5A A;  3CD6 A;  2J6F A;  4QKU A;  1MNE A;  3NMZ C;  3L2W A;  2IIM A;  1YJ9 T;  2DD4 A;  2MIO A;  1Y7X A;  2AKL A;  2B86 A;  4EIK A;  1O75 A;  2VKN A;  2RJC A;  1M90 C;  3RKY A;  5LJ5 e;  4DBH A;  5IN1 A;  1TUC A;  1VYV A;  2VC8 A;  1YCY A;  5GJV B;  4N0A A;  1O9S A;  2QI2 A;  1KHC A;  1M1F A;  2PVG B;  1X01 A;  5I2M A;  2EYZ A;  2QA4 A;  5FRO A;  2JZ2 A;  4PFZ A;  1UJY A;  2DTI A;  4RTZ A;  1VQ5 A;  1K0S A;  2JOY A;  2ENM A;  1MND A;  1K73 C;  3EGX B;  5D6Y A;  5KE2 A;  2YT6 A;  2IG0 A;  1NPP A;  3MET A;  2CT4 A;  2KT1 A;  5IHN A;  4PJM A;  2DTO A;  4M7D F;  1I5L A;  2KYM A;  2DA9 A;  3FDR A;  2L3S A;  3F70 A;  4M75 C;  1YJW T;  2DBK A;  1WFW A;  1OV3 A;  5J26 A;  4ZN1 A;  2DK3 A;  2EKO A;  2X4Y A;  4A54 A;  5D6X A;  3QPH A;  3P8D A;  5KCO A;  3OS1 A;  1SG5 A;  1K73 R;  4AFS C;  1AEY A;  4PJO G;  4OB0 B;  2EGC A;  3CCE T;  3CCJ A;  3I35 A;  3V7S A;  5LJ3 f;  1JB0 E;  4RG2 A;  1NLP C;  2V8J A;  4JPB W;  3AT1 B;  4IUR A;  3HFN A;  2NLU A;  3OYF A;  3A8L B;  2K57 A;  3V8J A;  3JCM b;  4NS5 A;  2VWF A;  5A0G A;  1E6H A;  3LH5 A;  1K76 A;  2JUF A;  1V1C A;  1UFF A;  1R8O B;  1PHT A;  5LJ3 d;  2FZK B;  3MHX A;  4PFO A;  2YSQ A;  2BE7 D;  4A4G A;  4HVU A;  4FYV B;  2COY A;  4Q5W A;  4XU3 A;  4X34 A;  3EHR A;  3R6N A;  3CCE A;  2GFA A;  3HFO A;  4M7A A;  3P8B B;  1VQ8 Q;  2HAX A;  4RTU A;  4PKC C;  3PGG A;  4BI8 B;  1G5V A;  2HBP A;  3Q1J A;  2LX9 A;  1VQ7 T;  4M75 A;  1KD1 U;  1YJ9 A;  3CCL T;  2YUN A;  1RAC B;  1GRI A; 
#chains in the Genus database with same CATH homology
 2E65 A;  4QQ6 A;  4YTL A;  3O8V A;  4JRK A;  2EQM A;  4XTU A;  4C5H A;  4JS4 A;  4PJO E;  4ME7 A;  5GMK m;  1FX7 A;  1IRE B;  4LD9 K;  4PJO C;  2DTH A;  1Y96 B;  1UGR B;  2VUB A;  4J6W A;  3QO3 A;  3I56 T;  3CCR A;  2YLB A;  3DKM A;  4X9D A;  3NTI A;  4XU1 A;  4KUD K;  4LDV A;  3X25 B;  4M7A G;  4M78 A;  2LQK A;  3JSC A;  2LRQ A;  2XKO C;  2E6Z A;  5GAN e;  1M90 U;  2D9T A;  2HQX A;  2OTL T;  4C0D C;  1GXI E;  3SWN A;  3QSU A;  5GAN d;  1WJS A;  4C8Q A;  2RM4 A;  3HRS A;  1Q81 U;  2OTJ T;  3JAM E;  3URG A;  2JTF A;  3KBG A;  3GP8 A;  2GQV A;  4RCC A;  4DOV A;  2QEX A;  2P0Q A;  1G3Y A;  5LL6 S;  1KQ2 A;  3UWN A;  4LDU A;  1NJI U;  4DA4 A;  4OP0 A;  4XTV A;  3E1S A;  4MZP A;  3LX7 A;  3CC4 T;  1Q81 C;  2YRV A;  3OYM A;  2CGH A;  3MEA A;  1DJ7 B;  5FRM A;  3G71 A;  2L8D A;  1XOV A;  4BD3 A;  1Q7Y C;  1K9M C;  5GAO p;  3EAE A;  4BDY A;  5KE3 A;  3JCM J;  3CPW S;  1P92 A;  2BKD N;  3PFS A;  1YHQ T;  2LTO A;  3QJ6 A;  2GFU A;  2RO0 A;  1WQ7 A;  4EMG A;  4OB2 B;  1VQP A;  4NL2 A;  5HY6 A;  1PSE A;  3M4G A;  3MP1 A;  2VYT A;  1N6A A;  2DZC A;  3V7R A;  1VQO T;  4M77 A;  3MEV A;  4M77 C;  2EYQ A;  2IVW A;  3JB9 J;  3A8M B;  4IUP A;  4MDW A;  1JJ2 S;  1BYM A;  2EQU A;  4JDS A;  2KVQ G;  2P0P A;  5DM7 R;  4V2S A;  2L89 A;  3QG1 A;  2XHC A;  3VUZ A;  4R55 A;  3HPW A;  1WQW A;  2OAU A;  3PTA A;  3RMS A;  3SDZ A;  2VXF A;  1BI0 A;  4HKE A;  3A5Z B;  2EJG A;  4KUL A;  4J6X A;  2XDD A;  1XNI A;  2CZ7 B;  3TCJ A;  1YIT A;  5CKD A;  2QQR A;  3INZ A;  3LH0 A;  3BW1 A;  4BE2 A;  4E7L A;  4M7A D;  1YJW A;  2A3L A;  3QZ9 B;  5GAM f;  2PVO B;  1VQ8 T;  3P8H A;  4F7U B;  3HP9 A;  3PT9 A;  2DXU A;  4OB1 B;  1Q86 U;  4N4I A;  5A0L A;  4FM4 B;  2O01 E;  2ZZD A;  3H6Z A;  2WSF E;  4FT2 A;  4L6V 5;  4RG8 A;  4XTW A;  1I4K 1;  3CC7 A;  2AHJ B;  3CCM T;  4RCB A;  4Z02 A;  2X4X A;  4E7K A;  1UGQ B;  2RA2 A;  4IKF A;  1RL2 A;  1WNL A;  4J7F A;  3AHU A;  3VKI A;  4JLG A;  2RJE A;  1QVF A;  3SWN C;  3CCR T;  2KMT A;  3JCM f;  3TRE A;  2I2L A;  3JCM Q;  2XDP A;  1M9S A;  4CI0 C;  3JB9 F;  5FU6 C;  2DXT A;  2G3R A;  3QII A;  3CBO A;  3L2Z A;  4XU2 A;  4BY6 C;  1WJR A;  3LWI A;  2QQ9 A;  2DIQ A;  2F69 A;  5CQX A;  4BY6 B;  3M56 A;  4C5G A;  2LDM A;  5FU6 B;  4EMK A;  3L2V A;  3JCM W;  2RHY A;  3OYH A;  3CPW A;  3R6O A;  4A4K A;  4VUB A;  2QQA A;  4BAC A;  2JVV A;  3PNW C;  4XTZ A;  4B9X A;  5GAN 3;  2VV5 A;  3FEO A;  3M9Q A;  5I21 A;  4MMK A;  1W2B S;  1B34 B;  2OTL A;  3HKS A;  3DLL A;  2E70 A;  4OGC A;  3RIR A;  1G3S A;  1HK9 A;  2OTJ A;  2M16 A;  4XAX B;  3OYA A;  2R58 A;  1Q7Y U;  1K9M U;  2P0K A;  3WXM B;  3DLM A;  3PMT A;  2ZPH B;  3QDR B;  1QW1 A;  3QKJ A;  4JUV A;  5FLX E;  3LYI A;  4C92 A;  2RD1 A;  4E7I A;  3CC4 A;  1W2B A;  3GOX A;  5L8R E;  4BDZ A;  1UEB A;  3J81 E;  3RKX A;  1VQ6 A;  2ZPB B;  3ZBD A;  3FC3 A;  2DD5 A;  4JLI A;  2DKG A;  2YHT A;  5C0M A;  3VUB A;  3VU3 C;  3KXT A;  4LDW A;  4E47 A;  3L42 A;  3QJY A;  5LJ3 e;  5HKC A;  3GNG A;  3OYG A;  3CCU A;  1QP3 A;  3LW5 E;  5AYF A;  2O4X A;  1BI1 A;  3E19 A;  1YI2 T;  2HQE A;  3OMG A;  2RI5 A;  3ER0 A;  4FU6 A;  4QQG A;  5GAN 8;  2WSE E;  3OS2 A;  3C4S A;  1VQO A;  3S3M A;  2R57 A;  4P5N A;  2DIG A;  3CMA A;  2X35 A;  2A7Y A;  4ZGE B;  3ME9 A;  2LC4 A;  1EIF A;  2KQW A;  2O4X B;  3X20 B;  5GMK e;  5GAM d;  1VQ8 A;  2RI3 A;  3QUI A;  2EQJ A;  2MF2 A;  2WSC E;  1MGQ A;  4OVA A;  5GAO r;  4M7D F;  1Y71 A;  3MP6 A;  4QVC A;  4EMH A;  5GAN g;  3PIP A;  4RMO A;  3QBY A;  4EMK B;  4JS5 A;  2Y90 A;  5DY9 A;  3S3N A;  1VQ9 T;  1BKB A;  3HL8 A;  4PJO B;  1LJO A;  2HNI A;  3WVD B;  4M7D G;  3OS5 A;  3CCM A;  3CC7 T;  1NJI C;  4M7A E;  1N9S A;  2XG8 D;  2E6N A;  2KDS A;  4NOY A;  1K8A U;  5IAY A;  4M7A C;  4EDU A;  3PMI A;  2ZCF B;  2LCL A;  1VQ4 T;  1KHI A;  2QTX A;  3RUX A;  1OZ3 A;  3V8L A;  4J83 A;  4BI3 A;  1QVG A;  5HK3 A;  3CBP A;  1PSF A;  1JBM A;  5CKH A;  4M75 E;  3X26 B;  3JCM d;  1VQ5 T;  3G6E A;  1VQK T;  2DXC A;  1QVP A;  2MWP A;  3M53 A;  4OMF B;  3OSV A;  1V29 B;  5HK0 A;  2PU9 B;  3G4S T;  1VQL T;  4M7D C;  1BIB A;  2JN0 A;  3G71 T;  2E10 A;  4XK8 E;  1YJN T;  1VQK A;  3VYG A;  2RHX A;  3BY7 A;  3OBY A;  5GMK i;  4QQD A;  4A4E A;  4C8Q F;  3MEU A;  3VV0 A;  1S72 T;  4HA8 A;  3M59 A;  4J5Y A;  4ZGD B;  2E12 A;  4MZT A;  4WF2 A;  1ZQ1 A;  5D6W A;  2PVD B;  4C92 E;  3JB9 I;  3FB9 A;  5IT9 E;  3MCA B;  4C8Q E;  5LJ5 d;  4O5V A;  2XK0 A;  4HCZ A;  4F7U F;  3OSS C;  1Y07 A;  4JRP A;  2QXF A;  3QXE B;  3DB3 A;  3CCV A;  3JCM P;  2Y4Y A;  4QVD A;  1M90 C;  2EIF A;  3QZ5 B;  4E7H A;  3TU4 K;  1X75 C;  4KT0 E;  2XD0 A;  3VJP A;  2WAC A;  1M1G A;  2Y4X A;  2QEX T;  3CCV T;  4M75 F;  2KK4 A;  2F5T X;  2RK1 A;  4M7D D;  1H3Z A;  2CYZ B;  3SFM A;  5FU7 C;  1YIT T;  3CPF A;  3C12 A;  4MDX A;  5GAN h;  1UGP B;  4HT8 A;  3TEE A;  4F7U A;  3A8G B;  5KCH A;  1OZ2 A;  4F7U E;  5GAO m;  3G6E T;  1BIA A;  2LT4 A;  5GMK h;  3GF5 A;  2QA4 T;  5CVI A;  4ZTJ A;  2FB7 A;  4HCC A;  1VQL A;  4PLL A;  1VQ6 T;  4C5E A;  3CXC S;  5GAN 6;  3FIF A;  3OYI A;  1D3B A;  1KQ1 A;  3NTK A;  1BI2 A;  1Q82 C;  1FXX A;  4FL6 A;  5C6S A;  3BFM A;  5CKE A;  4M75 G;  3JCM g;  2M1H A;  1QP2 A;  1BI3 A;  5GAO n;  5DLQ E;  1KQS A;  3V8K A;  2CZ6 B;  1YIJ A;  3M54 A;  2FYK A;  5FU7 B;  1FWZ A;  1OYX A;  4PL6 A;  5CQY A;  3LGL A;  1M1K U;  4BB7 A;  3CD6 T;  4BE0 A;  2KAF A;  3E9F A;  2E64 A;  2RHU A;  4DOW A;  1TH7 A;  2K5L A;  4L5G A;  5CIU A;  2PUO B;  3EFS A;  5LJ5 h;  1KQS S;  3I56 A;  1XTD A;  1B34 A;  3OMC A;  1VIF A;  2E5Q A;  4N4H A;  4KUI A;  5GAN 2;  2FVU A;  1I8F A;  2D0Q B;  1M5Q 1;  4C8Q G;  4ELY C;  3ZEH A;  4C92 B;  5GAM g;  5GAN 4;  3OYB A;  4PLI A;  1HXD A;  2MAM A;  2XU8 A;  3BDU A;  3KUF A;  4IUU A;  5CKF A;  1UGS B;  1U8R A;  1VQ9 A;  3CME T;  3FJP A;  5DLO A;  3LLR A;  1WGS A;  3FRN A;  4C0G A;  2CKK A;  1RI0 A;  5CR2 A;  1Q82 U;  1QVF S;  4FSX A;  2CS7 A;  3OYD A;  1XQH A;  5GMK j;  3S3O A;  2DJZ A;  2CZ0 B;  4HT9 A;  3OBW A;  4A4H A;  2XID A;  1NPR A;  4M77 D;  4XQ3 A;  2RK2 A;  2K5F A;  3SWN B;  4FT4 A;  2EJF A;  1N9R A;  2ZPI B;  4JRI A;  1Q86 C;  4M78 G;  3X28 B;  2EAY A;  4M77 G;  5GAO q;  1KD1 C;  4HCB A;  3H8Z A;  4QW2 A;  4LDY A;  4J7I A;  3GIB A;  2R5M A;  3BDL A;  3L1A A;  5GAN 7;  3OW2 A;  4M77 B;  4GY5 A;  5CO7 A;  4KBM B;  4C8Q D;  3L2Q A;  1VQM T;  1AHJ B;  4M7D E;  4PJO A;  2RHI A;  5GAO l;  1OI1 A;  1YI2 A;  1NE8 A;  4ZTF A;  3CC2 A;  2XIC A;  3OA6 A;  5GAM h;  3JB9 G;  3NFC A;  3OS0 A;  2RHZ A;  1VQN T;  3JCM V;  1KG1 A;  3SD4 A;  4X9C A;  3CMA T;  5LJ5 g;  4M77 F;  3GNF B;  3MP8 A;  4A53 A;  3E9G A;  2QQB A;  3FLG A;  1I81 A;  3DB4 A;  3X24 B;  1MHN A;  4C92 F;  4ZGJ B;  4D6W A;  5LJ3 j;  3L2U A;  2DAQ A;  1ZBX A;  4Y28 E;  4BI4 A;  4EPC A;  5CAI A;  3CME A;  3CCS A;  2DEQ A;  3OYJ A;  5J3B A;  3CEY A;  3OQ5 A;  1X6O A;  4M75 D;  4R56 A;  4RKU E;  3GPL A;  3CCL A;  4PJO D;  3JRZ A;  3HRU A;  3M55 A;  3JCM h;  2VGN A;  2XDB A;  3SB2 A;  3OW2 S;  2PUK B;  1YBY A;  5LJ3 g;  4XTY A;  4ELZ C;  5A0D A;  3M5A A;  4M78 B;  3CD6 A;  4PNO A;  3CCQ T;  4J6Y A;  3UT1 A;  3L2W A;  4GLK A;  1YJ9 T;  3J80 E;  2RI2 A;  2DD4 A;  3C94 A;  3ZFJ A;  1U1S A;  3HRT A;  1Y7X A;  3G7Z A;  4DQ2 A;  3N5B B;  1M8V A;  5GAN j;  1O75 A;  4J8O A;  2RJC A;  3V7C A;  4C0Z A;  1VQM A;  2ZGW A;  4IUV A;  1VIE A;  3RKY A;  4BE1 A;  5LJ5 e;  4JJN K;  3OYL A;  4UC4 A;  3CXC A;  2RJD A;  1ZHI A;  2KY9 A;  5IN1 A;  3HHT B;  1S72 A;  2K3Y A;  1UB4 A;  1M1K C;  4ATO A;  1K8A C;  2VC8 A;  4CRI A;  1YCY A;  4C8Q B;  3MO8 A;  4N0A A;  1G3W A;  5LJ5 f;  2RH2 A;  5LJ3 h;  5J39 A;  1LNX A;  4N0A C;  5EG2 A;  1O9S A;  2QI2 A;  3QHS A;  3QYG B;  1KHC A;  1KC8 U;  5CKB A;  1M1F A;  1WPY A;  2PVG B;  1X01 A;  5I2M A;  2L3R A;  3RES A;  2EQK A;  3JB9 H;  2ZPF B;  2EJ9 A;  2LCC A;  2JZ2 A;  5FRO A;  4EMK C;  2QA4 A;  1VQ4 A;  1K73 U;  2DTI A;  4MZM A;  1N27 A;  3CCJ T;  3NTH A;  3OYK A;  1VQ5 A;  4M7D A;  3J7A F;  2X4W A;  5LJ5 j;  2K5I A;  2JOY A;  4BUG A;  4M7D B;  4LDX A;  4M75 B;  5KH6 A;  1K73 C;  2B8A A;  3OYY A;  2FHD A;  4OGE A;  5D6Y A;  5KE2 A;  2PQW A;  3HSB A;  2X4J A;  2IG0 A;  1NPP A;  3MET A;  1Y96 A;  2CZ1 B;  4Y91 A;  3OYE A;  1JRI A;  1KC8 C;  1N8R C;  3QYH B;  4FIB A;  2BIV A;  3CC2 T;  3RMQ A;  3CBM A;  2LNV A;  4M7A B;  3RER A;  5M9O A;  3CCU T;  2LVM A;  2DTO A;  2XI9 A;  3RKW A;  5GAM e;  3PIO A;  1I5L A;  2QQS A;  3A8O B;  3FDR A;  3OB9 A;  4M78 D;  4NL3 A;  2EFI A;  2R5A A;  2ZPE B;  3UPU A;  3CCS T;  3F70 A;  4M75 C;  1YJW T;  3M4Y A;  3L2R A;  3M58 A;  3I55 A;  5J26 A;  1G3T A;  4ZN1 A;  2E1H A;  2DK3 A;  2DO3 A;  2K4Y A;  2EKO A;  2FL7 A;  2X4Y A;  4A54 A;  3M57 A;  3QPH A;  5D6X A;  2VXE A;  5CK9 A;  3I55 T;  4O6J A;  4B9W A;  3P8D A;  5KCO A;  5GMK l;  2K3X A;  3OS1 A;  4C5I A;  3JCM e;  4IUT A;  1H64 1;  4M78 C;  4OB0 B;  4PJO G;  4L59 A;  3CCE T;  2GF7 A;  3A8H B;  2VGM A;  4OF1 A;  5I2S A;  4M77 E;  3WVE B;  4M78 E;  3V7S A;  4C92 C;  5LJ3 f;  3CCJ A;  3CCQ A;  4OB3 B;  5GAM j;  2QDY B;  2H3J A;  4C8Q C;  1JB0 E;  1WJQ A;  4RG2 A;  1D3B B;  2V8J A;  1SSF A;  3T9N A;  4IUR A;  3HFN A;  2NLU A;  1VQ7 A;  4PJO F;  5GAN 5;  4F7U G;  2DVE A;  3OYF A;  3G4S A;  1YHQ A;  3A8L B;  2K57 A;  3UDC A;  2C06 A;  1YIJ T;  1VUB A;  3LWH A;  3V8J A;  2RJF A;  4IUQ A;  2DPP B;  2LQ8 A;  3JCM b;  2RB6 A;  4NS5 A;  3JCM X;  3JB9 D;  2JNG A;  3C95 A;  2HD0 A;  3EFR A;  4LD6 A;  2D6F A;  4TVR A;  5A0G A;  1NZ9 A;  4JRQ A;  2KSS A;  1JJ2 A;  2JUF A;  1LOJ A;  4M7A F;  4II1 A;  4XTX A;  4XU0 A;  1QVG S;  1R8O B;  2ZPG B;  2YLC A;  3ASK A;  3MEW A;  4C0F A;  2K2V A;  1W4S A;  4QVZ A;  5LJ3 d;  2E41 A;  3MHX A;  4N4G A;  5FRN A;  2P4T A;  1N8R U;  4A4F A;  3OY9 A;  4A4G A;  4M78 F;  2V8I A;  4C0D B;  2JTM A;  2BUD A;  5A2Q E;  1U1T A;  2DZ9 A;  4Q5W A;  2MMP A;  2MWO A;  4X34 A;  4XU3 A;  2DXB A;  4C92 G;  2M0O A;  3OYC A;  3VYH B;  1VQN A;  3CCE A;  2GFA A;  3HFO A;  4C92 D;  5CCA A;  4M7A A;  3P8B B;  4MML A;  2HAX A;  4ZN3 A;  2F5K A;  4PKC C;  2V8K A;  5GAN f;  1M4Z A;  2GCX A;  3PGG A;  4BI8 B;  2EWN A;  2HBP A;  3OYN A;  1IZ6 A;  1VQP T;  3GLX A;  1G5V A;  1YJN A;  3Q1J A;  2MI6 A;  2LT1 A;  2LX9 A;  2M9U A;  4M75 A;  1KD1 U;  1YJ9 A;  4E7J A;  3CCL T;  1VQ7 T;  3LGF A;  3S6W A;  2L5Q A;  3JCM c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...