2RI2A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355a point mutation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
312
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVARMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 81
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A03
2O4XA 4Z02A 2R5MA 3EAEA 5D6XA 3UT1A 2LDMA 3OA6A 3LLRA 3LYIA 2BKDN 3FDRA 3OYJA 4IUPA 5IN1A 1XNIA 3QBYA 1SSFA 3L42A 3L2WA 4E7KA 4E7LA 3L2RA 2M0OA 3FEOA 3P8DA 3GOXA 5C0MA 2R5AA 3OS0A 4C5EA 5IAYA 3C4SA 1RI0A 4IUTA 3FLGA 2X4YA 3LGFA 4FU6A 3LGLA 4C5HA 2GFUA 2RJFA 4LD6A 4A4FA 4BD3A 2K3XA 2VYTA 1WJSA 1G5VA 3MP6A 4E7HA 2PQWA 3OYMA 2G3RA 4BDYA 4QQGA 4IUUA 3DB4A 5D6YA 5CIUA 2NLUA 5KE2A 3MEVA 2EKOA 3PFSA 4X34A 4CRIA 5FRNA 3P8HA 3MEUA 3OYNA 3OYBA 2X4WA 2RHIA 4QQ6A 3OMCA 3Q1JA 5KH6A 4II1A 3S3NA 3ME9A 2MWOA 2RJCA 4ZTFA 2X4XA 4B9XA 2O4XB 2L3RA 3M9QA 1OZ2A 2XK0A 2E5QA 3OYAA 2HQXA 2EQJA 2R58A 3MP8A 2EQMA 2WACA 3NTKA 3OB9A 4UC4A 2QQSA 3BDLA 2M16A 3OYCA 2EFIA 2X35A 4GY5A 3LX7A 2JTFA 1N27A 3UWNA 4N4IA 4HCZA 2L89A 2LVMA 5KE3A 4QW2A 4A4EA 4QQDA 4IUQA 2P0KA 3MEWA 2L8DA 2BIVA 3PMIA 2RJDA 2D9TA 2GF7A 3MEAA 4QVZA 1OI1A 2LCCA 3OY9A 2XDPA 3OYIA 2RJEA 4E7JA 5D6WA 3QIIA 3NTIA 4NS5A 3FC3A 5M9OA 2RI5A 1KHCA 2DIQA 2FHDA 1MHNA 1WGSA 2F5KA 2EQUA 3QJ6A 4E7IA 2CKKA 3E9GA 3PNWC 4EDUA 5KCHA 4A4HA 2LRQA 5J39A 3S3MA 5FROA 4L59A 1H3ZA 4FL6A 4PL6A 3S6WA 4C5IA 4ZTJA 2K3YA 2IG0A 5FRMA 2DAQA 3E9FA 4IUVA 4BDZA 4IURA 3OS2A 4BE1A 3PMTA 5KCOA 4PLIA 3META 4A4GA 2RI2A 2EQKA 2R57A 3QKJA 4BE0A 4RG2A 4IKFA 4BACA 4OVAA 3OYFA 3OS1A 4N4HA 1OZ3A 3DLMA 3DB3A 2RHUA 3H6ZA 3NTHA 5J26A 4C5GA 2MWPA 3ASKA 2RI3A 2RHYA 3L2UA 1WJQA 3OQ5A 2JZ2A 2LTOA 3OYEA 3OYKA 3LH0A 3S3OA 2B8AA 3MP1A 3OMGA 4PLLA 2YRVA 3MO8A 3H8ZA 2HQEA 3KUFA 3SD4A 4B9WA 3OYLA 5C6SA 3O8VA 2M1HA 2RHXA 4Q5WA 2E6NA 3L2VA 2QQRA 3OYGA 3L2QA 2DIGA 4BE2A 2GFAA 2RO0A 3ZEHA 3OYDA 3OYHA 4N4GA 2BUDA 1OYXA 2RHZA 3CEYA 1WJRA 3F70A
chains in the Genus database with same CATH superfamily
4BI4A 2YWWA 3UT1A 3H0FA 1WHGA 1R0BG 2CGHA 3A8LB 2EBPA 3JCMh 3L2RA 5A0DA 4LDWA 1IREB 3C4SA 2PNIA 4C8QG 1OPKA 2HBWA 4HXJA 1NPPA 4RTTA 1U3OA 4RCBA 4M75C 2MIOA 1M3AA 1UJYA 5CK9A 2DD5A 3JCMQ 4PJOE 1IO6A 1NPRA 2NLUA 2DZ9A 2X4WA 4OMLA 1MGQA 2MWOA 2KAFA 1TXQA 4B9XA 3M9QA 2F69A 3E2UA 2EWNA 3GNFB 2ZPHB 2IVWA 3CPWA 3G1JA 1ZSZC 1BCMA 2YUPA 2DBMA 3JCMc 4AFZC 1Y07A 1K0SA 4QW2A 3V7CA 4LUDA 1NEGA 2D9TA 3RMSA 2A08A 3CBMA 2OAWA 3QIIA 3FC3A 1H3HA 4BI3A 5J39A 4FYYB 3M59A 1U1TA 2RK2A 1MMNA 3A1PA 2KYBA 5CQYA 1QVFP 2WSFE 2CS7A 4QVCA 3M55A 1AT1B 5GANf 1E6GA 2Y90A 3CCQT 5CKEA 3S3OA 3V8JA 4J6XA 5FU7B 2FPDA 3CMAT 1TUGB 2CZ6B 2RHXA 4F7UF 3DKMA 3QZ9B 4C92D 1FYNA 1PRMC 4FCYA 3EGUA 1JJ2P 1VYVA 4IIOA 1S1NA 4LXCA 2QA4A 2P4RA 3FIFA 2R5AA 3OS0A 5CKBA 4JRPA 4IUTA 3KXTA 2DXTA 3EG2A 1SHFA 2E3IA 2XG8D 3CC4Q 2F5TX 4OB3B 1NJIR 2DFUA 2QEXA 4J9BA 4X34A 5I11A 4XTXA 2DXCA 3Q1JA 2O4XB 1OU8A 1VQKT 1VQOQ 4J9FA 3NTKA 3RIRA 1EZZB 2GQIA 2ROLA 4KGZB 4M78E 1WXTA 3OYCA 2IIMA 2JM9A 4N4IA 2DO3A 2X4JA 4C8QA 3RNJA 1VQ5T 1RABB 1QCOA 4IUQA 4J9EA 3SFMA 5IXFA 1X6BA 2DBKA 4M7AB 2RJDA 2GBQA 2RJEA 3M4GA 5GMKl 4NS5A 3INZA 2V26A 1M2VB 4HCKA 5LJ5d 5IH2A 1XOVA 3R6NA 1H3ZA 1PSFA 4L6V5 2HMAA 3E9FA 4M78B 4D8DA 2R57A 3WXMB 2F2VA 3OYFA 3VS5A 2A0FB 2QEXQ 1IZ6A 4ELYC 2RI3A 1WJQA 3OQ5A 4E7SA 4RTXA 1QVFA 1M8MA 1RAHB 2HDAA 3VUBA 1C6VX 2AIRB 1QKWA 2RF0A 1WHLA 2GQVA 4R55A 5KYWA 2YUOA 3V8LA 2KE9A 1M90U 1UFFA 2PVOB 4O6JA 3OYYA 2DYIA 2BE9B 2EJGA 5KYUB 1Q82C 4OB0B 2DILA 2L3PA 1JJ2A 2RM4A 3MJXA 2C0IA 4PFZA 3CCLA 1NBEB 1Y96B 1RI0A 3UA6A 3QXEB 2VB6A 3BFMA 1Q7YU 3SWNB 1G3SA 1TU0B 1K1ZA 4IIMA 3TCJA 1TS9A 1VQ8A 3RESA 1Y71A 3EHRA 1O9SA 2EYZA 3JV3A 2XDBA 2J6FA 1SEMA 3FJPA 2DEUA 1I5LA 1T0JA 4DBRA 2KY9A 5FU6C 2WACA 4C0ZA 5GMKj 2JTFA 3MCAB 5FWCA 4AFSC 2AZSA 4NOYA 2O01E 1KC8R 1TG0A 2ZGWA 3V7RA 1AD5A 2QG9B 1AZEA 2EAYA 4A54A 2FEIA 4PFOA 1D3BB 2EYWA 1WGSA 3I9QA 2HKNA 2E65A 1AEYA 5KCOA 1OULA 1EFNA 1SF9A 6AT1B 1WHMA 3OS1A 3RKYA 3G7ZA 5LJ5h 1VQ8Q 2VVKA 2JZ2A 2KVQG 5J3BA 2ABLA 2B8AA 3MP1A 4PLLA 4M7DD 1QVGS 4HVWA 2KYMA 4AG2C 4B9WA 3CCSA 4XK8E 2DIGA 3ZEHA 3RUXA 3OW2P 4C8QC 3H9NA 3IQLA 3LYIA 2E4HA 3OYJA 1XNIA 1BCOA 3VYGA 1N8RR 3CCQA 5A0LA 1QVFS 5GANe 2RA2A 3LH5A 1D09B 2DF6A 3CMAA 4N0AA 1GRIA 2GCXA 4LD6A 2K3XA 1YN8A 2QQBA 4OB1B 3MP6A 4OGEA 5LJ5f 2XICA 3RBBB 3H0IA 3NMZC 1IB8A 1YJWQ 2VWFA 2JS0A 4PJOD 1ZLMA 1SPKA 4KT0E 2FPFA 1ZSGA 2J05A 4QKUA 4JRKA 2EQJA 2AZVA 1YHQQ 2DERA 3JB9G 2M16A 2YLCA 4OF1A 3M56A 3EGDB 3CCSQ 4HCZA 1W2BP 4A4EA 5CAIA 1RL2A 2YT6A 3RMQA 4OP0A 3RR6A 1NLOC 3GIBA 2HQHA 2JMAA 4M77E 2QDYB 1Q81R 1VQKA 4E7IA 3CC4T 1CKAA 2RQWA 3E9GA 4LE9A 3CCQQ 1G2BA 1YIJT 4NL3A 4E2FB 1RADB 3J81E 1BB9A 5KYXB 1VQ5A 1SKUB 3DLMA 4HVVA 2DE0X 1VQOT 1LCKA 5LJ3j 3CCMT 1AWWA 3M5AA 3QDRB 3X24B 3PIOA 3JCMP 4JJCA 1ABOA 2ZZDA 3O8VA 1BYMA 4M77B 2OJ2A 2DJQA 3BDUA 1YWOA 2MYSA 3NGPA 3OW2A 2RQTA 4C92F 4ME7A 4ZN3A 1Y57A 1VQLQ 5HK0A 2PZ1A 2DVJA 2CP6A 1FMWA 1YWPA 2J6KA 5GAMd 2JUFA 3EFOA 3CXCS 4XU1A 3LGFA 1K9MR 3CD6T 8AT1B 2GFUA 1E6HA 3WVDB 1VQKQ 5FWBA 4XTUA 4ZGDB 5D6YA 4BY6B 2XDDA 4PNOA 3PFSA 4BI8B 1M1FA 5GMKi 2EQIA 4M7AD 2GGRA 2QK0A 2CP0A 4ANJA 3NPFA 1G3TA 1K8AR 2EQMA 3RERA 2KEAA 2DTOA 4LDYA 2X35A 3G6ET 4M75E 4OMPA 2KT1A 2LVMA 4M78D 3GLXA 4J9IA 5DLOA 3BE3A 4VUBA 1QWFA 2K5LA 3J80E 1W2BA 2LX9A 2LNHB 4OMFB 3OY9A 5L23A 1ZHIA 1TWBA 1Q82U 3V8KA 5GAOm 2CZ1B 2ZPBB 4N0AC 4YTLA 1MMAA 4C5IA 1H92A 4JJNK 2PUOB 2DAQA 3CCJQ 1MMDA 2CDTA 1N6AA 1YBYA 1X6GA 4XTWA 5GJWB 4M75B 3DB3A 2MWPA 4QT7A 4KULA 2LTOA 5GAMg 2JTMA 3EGXB 4M7AG 1BU1A 2K79A 3TSWA 3MO8A 4ATOA 1XQHA 3H8ZA 2LQ8A 4DBQA 3KUFA 2QXFA 1ZBJA 2V8IA 1Q7YC 4AFUC 3HSBA 3P8BB 1TH7A 2EJ9A 2HEQA 1WJRA 1G83A 3CEYA 4CC3A 3JB9I 1ZUUA 2ENMA 4Z02A 9ATCB 1I81A 3JCMb 3JRZA 3A8GB 1MV0B 5AT1B 3VRYA 1WHHA 3C0CA 2YSQA 4QVDA 2C0TA 1F1BB 4EPCA 1M5Q1 2DPPB 1KSWA 1NG2A 2VYTA 2G6FX 1WJSA 1NEBA 2XIDA 1WXBA 2QYZA 1QCFA 5FRNA 2MMPA 4DOVA 1OQKA 1OZ2A 1YCYA 5IHNA 1M1KR 2J06A 4M7DB 3FB9A 1K73R 3VV0A 4UC4A 3CCUT 3FRNA 3X28B 2YXYA 1HK9A 4FIBA 3M0UA 4FSSA 1FMVA 4C0FA 5KE3A 2DL5A 2YLBA 2BE7D 5LJ5e 4F7UE 3A8OB 2JTEA 3PT9A 2HL3A 3M0PA 2RNAA 4LDUA 1RAAB 4OB2B 2CKKA 4EDUA 5CO7A 2VUBA 1ZUKA 5GAMf 5GANh 4A4KA 1YJWT 1X75C 2L5QA 2RI2A 3NFCA 3O5ZA 2KDSA 3MKDA 1OOTA 2L2PA 4BACA 2NUPB 4PJOB 1YHQT 2D0NA 1W2BS 2CSIA 1WLPB 2EYXA 2J7IA 5A0GA 5GAN4 2ROTA 2OTJA 1IHVA 4C0DC 3CCRQ 2DKGA 5C6SA 2K2VA 2E12A 3CCST 3L2VA 1WX6A 2CT4A 3CC4A 2QQRA 3JB9F 1KQ2A 4BE2A 2GFAA 2HL5C 2NYSA 1V29B 1YIJA 1QW1A 2O4XA 4RTYA 1VQ9A 2GNCA 1RAIB 2LJ1A 2QAZA 3I5RA 3I56A 1VQOA 3JSCA 3CCMA 5IXBA 1NYFA 2LCSA 1AHJB 4EMKB 4MDWA 3FLGA 1PNJA 5FW9A 3HHTB 2JM8A 3LGLA 4A4FA 1VYUA 4FW2A 4GLMA 4M7AA 2COZA 2PQWA 1JRIA 2ZPIB 3HKSA 3SEMA 5KYNA 1JXOA 2AT1B 2RQUA 5KH6A 2V8JA 2X4XA 4EMGA 2HNIA 4JRIA 1R77A 1UB4A 2EYYA 1TSFA 2ESWA 2ECZA 3CQTA 2KT8A 1RLPC 3J7AF 2OTJQ 2KGTA 3CD6A 3CC2T 1N9SA 4A63B 5GAOn 1VIEA 1VQLT 1YIJQ 4QQDA 2PVDB 4DBHA 2JXBA 3QG1A 1RUWA 1M4ZA 2XHCA 1D0YA 1VQ9Q 5KYYA 3NTIA 2RPNA 1V1CA 3I56Q 1OX8A 2A37A 3CCMQ 4XTZA 3V7SA 4L59A 4M77D 2J6OA 2KRMA 1S72Q 3EG9B 4IURA 1PD0A 4J5YA 1QLYA 3G6EA 1N8RU 2E10A 1GFDA 3M0SA 1AVZC 3QWYA 4C92G 5GAOq 1Y96A 3VS3A 4DEYA 2CZ0B 3SWNA 1BBZA 1NYGA 5AYFA 1VOMA 1UGVA 3OYLA 3MHXA 4Q5WA 2E6NA 3L2QA 4MZPA 4ZN1A 3M58A 3TVTA 3OYHA 2FYKA 4JS4A 2EPDA 3F70A 3HTRA 3UATA 4ELZC 3CD6Q 1IGUA 3T9NA 2R5MA 3CPWS 1W6XA 4MMLA 5FU7C 3OA6A 3HL8A 3FDRA 1AOJA 1QKXA 4E7KA 1UE9A 3SB2A 4E7LA 3PGGA 3GOXA 3AT1B 1T3LA 2HBPA 1TUDA 2DMOA 2MK5A 3CCJT 4Y28E 2GTOA 1G5VA 2DYBA 1KIKA 1Q81U 4C8QE 3KBGA 3EG3A 2MF2A 4Z8AA 1WXUA 3G6EQ 3OYBA 1WNLA 1I4K1 3QHSA 1M30A 3OMCA 3ME9A 1KQSP 2DL3A 4M7AF 2XK0A 3MP8A 3QPHA 4HT8A 3OB9A 1D1CA 2KK4A 2CH4A 2EFIA 3SHWA 1E7OA 1SHGA 3M0QA 1UEBA 1UUEA 5FLXE 4MMKA 1X6OA 3CCEQ 3ULRB 1KD1R 5I21A 1UG1A 4M75D 2LJ3A 3PMIA 4M78F 1MMGA 4C8QB 1AZGB 3OYIA 1NJIC 1VQ6T 2C0OA 2A7YA 2LT4A 1IXDA 2F5KA 1I5OB 2MI6A 1KK7A 4A4HA 5IHKA 3HRTA 4PL6A 3S6WA 3CCUA 3VS1A 2CT3A 3JCMX 4IUVA 3OS2A 2L0AA 1K9MU 2CZ7B 2M9UA 3M4YA 2RHUA 2RHYA 3EG0A 3R6OA 4AFQC 2DL8A 1TUCA 2X51A 4RCCA 1B3QA 1K76A 4RTUA 4FW1A 1VQPQ 1R0CB 2D8JA 2RK1A 2F2WA 2KNBB 1D1BA 1YJWA 2Y4YA 4XU2A 1K8AU 5GAMe 1X43A 1UTIA 4J9GA 2LDMA 2YRDA 1N9RA 4J9CA 2PTKA 5IN1A 4AG1C 2EGCA 3MPUB 1YHQA 3X26B 2LQWA 2DM1A 5I22A 1VQ7Q 3EGDA 4C92A 1U1SA 2BZXA 1C0MA 1W1FA 2K5IA 5CR2A 2D0QB 5GAN3 3VS2A 1M9SA 1GCPA 3CCUQ 5CIUA 5KE2A 1JBMA 4OGCA 3OYNA 5LJ3d 3M54A 4A53A 2KRSA 2RQRA 3E19A 3CCRT 3JCMJ 3SWNC 2DL7A 1KQSA 2E5QA 2W0ZA 1PRLC 2CP5A 3VS4A 2DXUA 3CC7Q 2QQSA 3QDFA 2E41A 4JZ4A 1MNEA 4OMOA 5KYXA 3LX7A 1XJWB 4RTVA 1VA7A 1B34A 4GLKA 2COWA 2L89A 1CKBA 3RKWA 1P92A 1FXXA 3MEWA 2BIVA 1D1AA 2LC4A 4JS5A 1LPLA 1A0NB 1KHCA 1PHTA 1JJ2S 2NUTB 2EQUA 3CMEQ 4XU0A 4M7DG 2DTIA 1FX7A 3VS7A 1UGSB 3CC2A 1K4US 3GNGA 2JNGA 3META 3QKJA 2CSQA 4L5GA 4BE0A 1VQLA 4ZGJB 2ATCB 5GAN7 2DETA 3H6ZA 2OAUA 5IT9E 3ASKA 2KMTA 3GF5A 3OYEA 1KC8C 1RAGB 3OYKA 3OMGA 2OTJT 2FL7A 2HQEA 3G71T 3LWHA 4MDXA 4N4GA 5GAOp 1Q86R 1M1KU 4PJMA 2ZPGB 3LWIA 5LJ3g 1K73U 2A3LA 2EKHA 1WHKA 2DLPA 2K4YA 4JJDA 1VQ9T 3I56T 3TREA 1M90R 3FEOA 5C0MA 4PJOG 1S72T 1YJ9Q 1I0CA 4FU6A 2P4TA 4FYWB 1M3BA 4RG8A 4JPBW 3JAME 3EG1A 1X2KA 1ZQ1A 1UGPB 4FSXA 4ESRA 2KI7A 1V76A 4XTVA 3CC2Q 1PC0A 2X3XD 3HRSA 2MOXA 3CCVQ 4QQ6A 2VV5A 4ZTFA 4RTZA 2H8HA 1PCXA 2LX7A 1Y7XA 2NUZA 5CCAA 4J9DA 1H641 1I1JA 3C12A 3HFNA 1HSQA 1JEGA 3CCJA 2KROA 4TVRA 3UWNA 1N8RC 2ZPFB 2DTHA 1M8VA 3X20B 4FT2A 4LDVA 4Y92A 2FRYA 1Z9ZA 3CBOA 2CREA 2XMFA 2LCCA 3N5BB 4C92C 2DIQA 4LN2A 3JCMd 1BI3A 1KQSS 3PNWC 3S3MA 1RACB 5EC7A 3JCMW 4DOWA 2JN0A 4XTYA 2X9HA 5DY9A 3AHUA 2YHTA 4M77F 1BI2A 3EH2A 2P0QA 4IKFA 4N4HA 4CC7A 2VC8A 4PJJA 3UA7A 3C94A 5LJ3f 1VQ6A 1QVPA 2EGAA 2YRCA 2LNVA 1VQMA 1YCSB 5GAOr 2RO0A 3CCET 4CI0C 1Q81C 1LNXA 1QP2A 2RN8A 1UDLA 1VQ4Q 4LNPA 1B07A 4OMQA 4XU3A 4M7DA 3UPUA 3DLLA 1SSFA 1FMKA 2E3HA 2RB6A 1X27A 5ECAA 4E6RA 2QGGA 4C5EA 1NJIU 2V1RA 2E6ZA 4F04B 3OBWA 4RUGA 1MUZA 5GAN2 3EFOB 2WSCE 4E7HA 1D0ZA 2ZPEB 4NL2A 1YI2T 1NZ9A 1X2QA 1NM7A 1PG5B 1SG5A 2RHIA 4M78G 2NWMA 5GMKm 4II1A 1ZSZB 4C8QD 1UECA 3JCMg 4FYVB 1VQPT 2VKNA 3VYHB 1BKBA 4BY6C 1K9AA 4CC2A 1VQ6Q 5GAN8 3BW1A 1UJ0A 1M27C 1BIBA 2NUPA 2COYA 3A8HB 4C0DB 1VQMQ 4PJOA 1MV3A 1K9MC 4BUGA 3BY7A 5GJVB 1QCNA 2K57A 1ZBXA 1VQ7T 5GAMh 1B7TA 3OW2S 4M75F 3CCRA 1BK2A 3PVLA 4Z88A 1VUBA 2CP2A 4ZTJA 1M3CA 5DLQE 4Z89A 3HPWA 3I55A 1K8AC 1HYOA 2PU9B 1DJ7B 1G8XA 1IHWA 2JOYA 4ZNXA 5GMKe 1QQJA 1WDXA 2FZGB 4EMKA 5GANj 2O9VA 3CC7T 4M4ZA 1R8OB 1GXIE 1YITT 2RQVA 1VQNA 3SD4A 2O2OA 2HZYA 5CKHA 1PM3A 2DL4A 3OYGA 2K3BA 1ZUYA 2AK5A 1JXMA 1ACMB 1QP3A 2PUKB 2VXFA 2V8KA 1PKSA 4KUDK 3LLRA 5I2SA 1UGQB 3THKA 1SRMA 4WCIA 4F7UB 3P8DA 3CMET 1X01A 1H8KA 1YJNQ 2X4YA 1KD1U 2FB7A 3GBQA 3G71A 4M7DF 1MNDA 2YUQA 1EIFA 2AHJB 3JCMf 2G3RA 1ZX6A 2M51A 2XKOC 2H3JA 4KH1B 1QVGP 3P8HA 2FRWA 3I55Q 2DX1A 1GBRA 5IHIA 3PTAA 4HA8A 3SDZA 1TOVA 1YNZA 2R58A 3EG9A 1KC8U 1M2OA 1S72A 4DQ2A 1VQNQ 4HKEA 2KXDA 2LT1A 4PK4A 1ABQA 3EHQA 3VRZA 2JS2A 2QASA 4M7DC 5D7UA 1NLPC 3JCMV 3MEAA 2C06A 1M2VA 4X9CA 2EGEA 1YJ9T 4DEXA 2E64A 4WTOB 4PJOF 1AWXA 4M78A 4JZ3A 3QO3A 1M1KC 2K3YA 4BDZA 1Q82R 1K73C 3CCVT 3G71Q 4A4GA 1SSHA 2DXBA 3RKXA 4C5GA 5GAN6 2HKQB 1W4SA 4JUVA 2V1QA 1OPLA 2L3QA 2SEMA 2HD0A 5GAOl 1TTHB 3D7SB 3GPLA 3QSUA 4M7AE 4PJOC 2BUDA 1UHCA 2KRNA 5KYUA 2XD0A 2FZCB 3FJ5A 3OS5A 3GP8A 1N5ZA 2DNUA 4IUPA 4J7IA 3HP9A 2OTLA 2P84A 2Y4XA 2BZ8A 5IAYA 3VU3C 1LOJA 5LJ3e 2CH4W 2RJFA 2D6FA 4BD3A 3CCEA 4GBQA 3NHNA 5FU6B 4IUUA 3DB4A 1WFWA 1D0XA 2EKOA 3MEVA 2CP3A 2LP5A 4KGXB 4PFPA 4EMKC 2E1HA 2AKKA 1KHIA 1QVGA 2DA9A 3G4ST 2DEQA 4XQ3A 2QA4Q 3EFSA 1GBQA 3LW5E 1PKTA 2JVVA 3BDLA 4RTWA 2M0YA 4R0KA 1VQ4T 4FM4B 1KJWA 4PJNA 1UHFA 3REAB 1GCQA 4M77G 4AMCA 5HKCA 3EH1A 1YI2A 3CXCP 1D3BA 1AWJA 4QVZA 4Y91A 2OX7A 2LQNA 1Q86U 1BIAA 3L1AA 3ZBDA 1VQPA 5EG2A 1MHNA 2LQKA 2VASA 2OTLQ 2DRKA 2CUDA 5KYYB 5KCHA 2P0PA 4FL6A 5FRMA 2DVEA 4HCCA 2QTVA 1WIEA 2VXEA 3OBYA 2HCKA 3L2UA 1VQ7A 3LH0A 1PSEA 4JRQA 3VUZA 2YRVA 4MZTA 1KG1A 4WF2A 4J9HA 1EX4A 1VQMT 2D1XA 2VGNA 2WSEE 4M7AC 1M1GA 2LMJA 3VS0A 3A8MB 4PKCC 2DJZA 2YUNA 5D6XA 2BKDN 4D6WA 1YI2Q 3L2ZA 3L2WA 5LJ5g 3EFRA 2AKLA 3CC7A 4KUIA 2E70A 4M78C 5LL6S 1YITA 4AT1B 4FYXB 5LJ5j 2W10A 2HSPA 2O88A 4KRTA 3OYMA 4E47A 3H41A 4OMNA 4QQGA 5I2MA 2SRCA 3TU4K 5KYWB 3TSZA 1GFCA 4HT9A 1W70A 1WHJA 3S3NA 4JLGA 4B6MA 2NUTA 3VS6A 2ZAEA 5GMKh 2FG0A 4M75G 3VJPA 2EJFA 3CMEA 3E1SA 4C8QF 4KH0B 1WQ7A 5CKFA 3CCLQ 3CPFA 1VYTA 3OSVA 2EW3A 3U23A 4JLIA 3JB9J 1J3TA 1JO8A 2A28A 2FZKB 5CKDA 2QQ9A 2OI3A 4RKUE 2MPXC 3JCMe 4E7ZA 5A2QE 2GF7A 3CXCA 1YJNT 3PVQA 3JB9D 2RI5A 1X69A 2K2MA 4FT4A 5FROA 4HCBA 1WYXA 1YITQ 2RD1A 1ZA1B 4HVUA 1LJOA 1XTDA 3I55T 4JDSA 2GTJA 4BE1A 2K5FA 4OVAA 3NTHA 4XAXB 1YJ9A 4M77A 2LJ0A 4OMMA 1KD1C 2D8HA 1VQNT 1U06A 3QUIA 4C92E 1K0XA 4J6YA 3HRUA 4X9DA 1FWZA 2I2LA 4C0GA 1U8RA 2JT4A 3OYDA 1WA7A 1JQQA 1RAFB 1GCQC 3CCVA 4D8KA 4LDXA 4LUEA 1YFNA 1WZOA 1KQ1A 3QBYA 3L42A 1Z9QA 2M0OA 2EYQA 4RMOA 3CBPA 2JJ9A 2ED1A 4C5HA 3PIPA 1WPYA 4C92B 3A98A 2O31A 2CYZB 4CRIA 2E5KA 3MEUA 2KXCA 1AWOA 2L3RA 1WQWA 2XI9A 3C95A 2QI2A 2LZ6B 1KFZA 1BI0A 2MAMA 2HQXA 4CC4B 1OX9A 2IPOB 4ORZA 1QWEA 2LCLA 2L3SA 3QWXX 2B86A 4F7UG 4GY5A 3ZFJA 3UF4A 1N27A 3CMAQ 3TQ7P 1Y0MA 2YDLA 1I8FA 1RLQC 2P0KA 1B34B 2L8DA 4MZMA 1BI1A 2O9SA 2KQWA 1Q7YR 2Z0WA 2XDPA 1I07A 2K6DA 2FPEA 2ED0A 2QGFB 4DA4A 8ATCB 5M9OA 2DD4A 2FHDA 3G4SA 4EMHA 1YP5A 1RI9A 3ZL7C 2KSSA 1VQ4A 4M75A 1PWTA 2K7AA 2XU8A 5LJ3h 4DBFA 4P5NA 2EQKA 3M0TA 3M53A 4J8OA 2HSEB 4RG2A 1JB0E 3EGXA 1OZ3A 2F2XA 2A36A 2QA4T 1SRLA 3REBB 2I0NA 3PE0A 2FVUA 2PVGB 3QYGB 3QZ5B 1OEBA 3WVEB 2M1HA 4X1VA 2BTTA 2QDLA 2QQAA 3I5SA 4PJLA 2QEXT 1OYXA 4R56A 1CSKA 1T0HA 1ZSZA 2MCNA 4V2SA 4LD9K 3A5ZB 1U5SA 1IGQA 1G3YA 3EAEA 3I35A 4J6WA 2KBTA 2JW4A 2KR3A 3X25B 1VQ5Q 2BZYA 2OTLT 4BB7A 3HFOA 4KBMB 2H3EB 2EIFA 3QYHB 4F14A 4KGVB 3G4SQ 1NE8A 1RAEB 1HXDA 5CVIA 4BDYA 3UDCA 1O75A 5GANd 1ARKA 2ZCFB 2FO0A 2F1LA 1Q86C 2DZCA 2RJCA 1C1AA 3M57A 4M77C 3JB9H 3OYAA 4K11A 2M02A 1LVKA 2EVRA 3CPWP 1OU9A 5HCKA 1M90C 3KFVA 2X3WD 1Q95G 1GL5A 1G3WA 5GAN5 1HJDA 2DRMA 1OI1A 1HD3A 1ZA2B 5D6WA 4E7JA 4JJBA 7AT1B 4J83A 1IRXA 3OSSC 3QJ6A 1QMCA 3TEEA 5GAMj 2LRQA 1VIFA 2K9GA 5DM7R 2IG0A 3PMTA 5L8RE 4PLIA 1OV3A 2HAXA 1UGRB 3QJYA 4F7UA 2QTXA 1WI7A 4M7DE 4EIKA 2CP7A 5J26A 3RDVA 5HY6A 1T3SA 4O5VA 3CCLT 1YJNA 3ER0A 3URGA 2CUBA 2DK3A 3M0RA 3VKIA 2JMCA 5HK3A 3H0HA 4ZGEB 5CQXA 4F16A 2VGMA 4F17A 4J7FA 5GANg 2RH2A 2RHZA 1VQ8T 1PD1A 2RMOA 1JU5C
chains in the Genus database with same CATH topology
4BI4A 1K8AU 2XD0A 5GAMe 3OS5A 3OW2A 3GP8A 3UT1A 4C92F 2LDMA 4ME7A 2CGHA 4ZN3A 1N9RA 3A8LB 5HK0A 4IUPA 5IN1A 3JCMh 4J7IA 3HP9A 2OTLA 3L2RA 5A0DA 4LDWA 1IREB 2Y4XA 3X26B 1YHQA 5GAMd 5IAYA 2JUFA 3C4SA 4C8QG 3VU3C 3CXCS 4C92A 4XU1A 3LGFA 1LOJA 1NPPA 1U1SA 3CD6T 5LJ3e 2GFUA 3WVDB 2K5IA 2RJFA 5CR2A 2D0QB 4M75C 4RCBA 2D6FA 4BD3A 5CK9A 5GAN3 4XTUA 1M9SA 2DD5A 3JCMQ 3CCEA 5FU6B 4IUUA 4PJOE 3DB4A 4ZGDB 5D6YA 4BY6B 1NPRA 2NLUA 5CIUA 3MEVA 2EKOA 3PFSA 4PNOA 2DZ9A 1JBMA 4BI8B 5KE2A 2XDDA 1M1FA 4OGCA 4EMKC 5GMKi 5LJ3d 3M54A 3OYNA 2X4WA 1MGQA 2E1HA 4M7AD 4A53A 2MWOA 1KHIA 2KAFA 1QVGA 4B9XA 3M9QA 3E19A 3CCRT 2F69A 2EWNA 3GNFB 3JCMJ 1G3TA 3SWNC 3G4ST 2DEQA 1KQSA 2E5QA 4XQ3A 3EFSA 2EQMA 2DXUA 3RERA 3LW5E 2JVVA 2ZPHB 2QQSA 3BDLA 2DTOA 2E41A 4LDYA 2X35A 1VQ4T 4FM4B 2IVWA 3LX7A 3G6ET 3CPWA 4M75E 1B34A 4GLKA 3JCMc 2L89A 2LVMA 4M78D 3GLXA 1Y07A 4M77G 3RKWA 4QW2A 1P92A 5DLOA 1FXXA 3V7CA 5HKCA 1YI2A 4VUBA 2K5LA 3J80E 1W2BA 3MEWA 1D3BA 2BIVA 2LX9A 2D9TA 4QVZA 2LC4A 4OMFB 4Y91A 3OY9A 4JS5A 3RMSA 3CBMA 1Q86U 1ZHIA 1BIAA 1Q82U 3L1AA 3QIIA 3FC3A 3V8KA 5GAOm 3ZBDA 2CZ1B 1KHCA 1VQPA 1JJ2S 5EG2A 1MHNA 2LQKA 2EQUA 2ZPBB 4N0AC 4BI3A 5J39A 5KCHA 2P0PA 4XU0A 4M7DG 4YTLA 4FL6A 2DTIA 3M59A 1FX7A 4C5IA 4JJNK 5FRMA 1UGSB 2PUOB 2DAQA 2DVEA 1U1TA 4HCCA 3CC2A 2RK2A 1N6AA 3GNGA 2JNGA 3META 1YBYA 3QKJA 4XTWA 4L5GA 4BE0A 1VQLA 2VXEA 4M75B 4ZGJB 5GAN7 5CQYA 2WSFE 3OBYA 3DB3A 3H6ZA 2OAUA 2MWPA 2CS7A 3ASKA 2KMTA 3GF5A 3M55A 4QVCA 5GANf 3L2UA 4KULA 2LTOA 2Y90A 5GAMg 3OYEA 2JTMA 3LH0A 1PSEA 3OYKA 5CKEA 3CCQT 4JRQA 3S3OA 4M7AG 3OMGA 4J6XA 3V8JA 3VUZA 2YRVA 3MO8A 4MZTA 1XQHA 5FU7B 4ATOA 2FL7A 3H8ZA 2OTJT 2LQ8A 1KG1A 3CMAT 2HQEA 3KUFA 2QXFA 2V8IA 4WF2A 1Q7YC 3G71T 2CZ6B 2RHXA 4F7UF 1VQMT 3HSBA 3LWHA 3P8BB 1TH7A 2EJ9A 4MDXA 2VGNA 2WSEE 3DKMA 4N4GA 4M7AC 5GAOp 1M1GA 1M1KU 3QZ9B 4C92D 2ZPGB 3A8MB 3CEYA 3JB9I 4PKCC 3LWIA 5LJ3g 1K73U 2A3LA 4Z02A 2DJZA 2K4YA 1VQ9T 1I81A 5D6XA 3JCMb 2BKDN 4D6WA 3JRZA 3I56T 3A8GB 3L2ZA 3TREA 3L2WA 2QA4A 5LJ5g 3EFRA 3FEOA 3FIFA 2R5AA 5C0MA 4KUIA 4QVDA 3CC7A 3OS0A 4PJOG 5CKBA 4JRPA 2E70A 4IUTA 1S72T 4M78C 5LL6S 4EPCA 1YITA 4FU6A 2P4TA 1M5Q1 2DXTA 4RG8A 3KXTA 2DPPB 5LJ5j 3JAME 1ZQ1A 2VYTA 1WJSA 2XG8D 3OYMA 1UGPB 2XIDA 4FSXA 4E47A 2F5TX 4QQGA 5I2MA 4OB3B 2QEXA 4XTVA 3TU4K 5FRNA 4X34A 2MMPA 4HT9A 4XTXA 3HRSA 2DXCA 4DOVA 4QQ6A 3Q1JA 3S3NA 2VV5A 4JLGA 4ZTFA 2O4XB 5GMKh 1OZ2A 1YCYA 4M75G 3VJPA 1Y7XA 2EJFA 5CCAA 1VQKT 4M7DB 3FB9A 3CMEA 3E1SA 1H641 4C8QF 3C12A 3VV0A 1WQ7A 3NTKA 3RIRA 4UC4A 5CKFA 3HFNA 3CPFA 4M78E 3CCUT 3OSVA 3OYCA 3FRNA 3CCJA 3X28B 1HK9A 4FIBA 4TVRA 3UWNA 1N8RC 2ZPFB 4JLIA 2DTHA 4N4IA 3JB9J 1M8VA 2DO3A 3X20B 4FT2A 4LDVA 5KE3A 4C0FA 2X4JA 4C8QA 5CKDA 2YLBA 1VQ5T 2QQ9A 4RKUE 4IUQA 3SFMA 5LJ5e 4F7UE 3CBOA 3JCMe 4M7AB 5A2QE 3A8OB 2RJDA 2GF7A 2LCCA 3CXCA 2RJEA 1YJNT 3N5BB 3PT9A 3M4GA 5GMKl 4NS5A 3INZA 3JB9D 2RI5A 4LDUA 4C92C 2DIQA 5LJ5d 3JCMd 4OB2B 1BI3A 2CKKA 4EDUA 3PNWC 1XOVA 4FT4A 5CO7A 3S3MA 1KQSS 1H3ZA 2VUBA 5FROA 4HCBA 1PSFA 4L6V5 5GAMf 5GANh 3JCMW 4A4KA 4DOWA 2RD1A 2JN0A 1YJWT 4XTYA 1LJOA 1XTDA 3E9FA 4JDSA 4M78B 5DY9A 1X75C 3I55T 3AHUA 2YHTA 4BE1A 4M77F 1BI2A 2L5QA 2K5FA 2RI2A 3NFCA 2R57A 2KDSA 2P0QA 3WXMB 4IKFA 4BACA 4OVAA 3OYFA 4N4HA 1IZ6A 3NTHA 4ELYC 4PJOB 2RI3A 1YHQT 1WJQA 3OQ5A 2VC8A 1W2BS 4XAXB 1QVFA 5A0GA 3C94A 1YJ9A 5LJ3f 4M77A 5IT9E 1VQ6A 1KD1C 5GAN4 3VUBA 1VQNT 2OTJA 1QVPA 3QUIA 4C0DC 4C92E 2DKGA 4J6YA 3HRUA 5C6SA 2K2VA 2E12A 3CCST 4X9DA 3L2VA 2LNVA 2GQVA 3CC4A 4R55A 2QQRA 1VQMA 3JB9F 1KQ2A 1FWZA 2I2LA 2GFAA 2RO0A 4C0GA 1V29B 4CI0C 3OYDA 4BE2A 3V8LA 5GAOr 1LNXA 1QP2A 1Q81C 1QW1A 1M90U 2PVOB 3CCVA 2O4XA 4O6JA 4LDXA 3OYYA 1VQ9A 4XU3A 4M7DA 3UPUA 2EJGA 3DLLA 1Q82C 3CCET 1KQ1A 4OB0B 3I56A 3QBYA 1JJ2A 1SSFA 3L42A 2RM4A 1VQOA 3JSCA 2RB6A 2M0OA 3CCMA 2EYQA 3CCLA 1AHJB 1Y96B 4C5EA 4EMKB 1NJIU 4MDWA 4RMOA 1RI0A 3FLGA 3CBPA 2E6ZA 3HHTB 3OBWA 3QXEB 3BFMA 3LGLA 4C5HA 5GAN2 3PIPA 1Q7YU 4A4FA 3SWNB 2WSCE 1WPYA 1G3SA 4C92B 4E7HA 2PQWA 4M7AA 1JRIA 2CYZB 2ZPIB 3TCJA 2ZPEB 4NL2A 1YI2T 3HKSA 1VQ8A 4CRIA 1NZ9A 3RESA 1Y71A 3MEUA 1O9SA 2RHIA 4M78G 5KH6A 5GMKm 4II1A 2V8JA 2XDBA 4C8QD 2X4XA 2L3RA 1WQWA 2XI9A 3C95A 3FJPA 3JCMg 4EMGA 2QI2A 2HNIA 1VQPT 1I5LA 1BI0A 4JRIA 2MAMA 2HQXA 3VYHB 1BKBA 1UB4A 2KY9A 5FU6C 2WACA 2LCLA 4BY6C 4F7UG 5GAN8 3BW1A 4GY5A 3ZFJA 4C0ZA 5GMKj 3CD6A 2JTFA 3J7AF 1N27A 1BIBA 3MCAB 3CC2T 1I8FA 3A8HB 1N9SA 4C0DB 4NOYA 4PJOA 5GAOn 1VIEA 2O01E 1K9MC 4BUGA 1VQLT 3BY7A 4QQDA 2K57A 2ZGWA 2PVDB 2P0KA 1B34B 2L8DA 1ZBXA 3V7RA 4MZMA 1BI1A 1VQ7T 2KQWA 5GAMh 2EAYA 3QG1A 4A54A 1M4ZA 2XDPA 2XHCA 3OW2S 4M75F 3CCRA 1D3BB 3NTIA 4DA4A 5M9OA 2DD4A 2FHDA 3G4SA 4EMHA 1WGSA 4XTZA 3V7SA 1VUBA 4L59A 1U8RA 4M77D 4ZTJA 5DLQE 2KSSA 1VQ4A 4M75A 2E65A 3HPWA 2XU8A 5LJ3h 4IURA 3I55A 4J5YA 3G6EA 1N8RU 1K8AC 2E10A 2PU9B 1DJ7B 5KCOA 4P5NA 2EQKA 3M53A 4J8OA 2JOYA 4RG2A 1JB0E 4C92G 5GMKe 3OS1A 1OZ3A 1Y96A 4EMKA 3RKYA 5GAOq 5GANj 3G7ZA 5LJ5h 2QA4T 2JZ2A 2KVQG 3CC7T 5J3BA 2B8AA 3MP1A 1R8OB 2CZ0B 4PLLA 3SWNA 4M7DD 1GXIE 1YITT 1QVGS 2FVUA 2PVGB 1VQNA 5AYFA 3QYGB 3SD4A 4B9WA 3QZ5B 3OYLA 3WVEB 3MHXA 2M1HA 4Q5WA 5CKHA 2E6NA 3CCSA 3OYGA 3L2QA 4XK8E 2DIGA 4MZPA 2QQAA 3ZEHA 1QP3A 3M58A 3RUXA 4ZN1A 3OYHA 2FYKA 2QEXT 1OYXA 4C8QC 4R56A 4JS4A 4V2SA 3F70A 4ELZC 2PUKB 2VXFA 4LD9K 2V8KA 3T9NA 2R5MA 3A5ZB 3CPWS 4MMLA 4KUDK 1G3YA 3EAEA 5FU7C 3OA6A 3LLRA 3LYIA 4J6WA 5I2SA 3HL8A 1UGQB 3FDRA 3X25B 3OYJA 1XNIA 4E7KA 2OTLT 4BB7A 3SB2A 4E7LA 3PGGA 3VYGA 3HFOA 3P8DA 4KBMB 4F7UB 3GOXA 3CMET 3CCQA 1X01A 2EIFA 2HBPA 5A0LA 1QVFS 5GANe 2RA2A 2X4YA 3QYHB 1KD1U 3CCJT 2FB7A 4Y28E 3CMAA 4N0AA 2GCXA 3G71A 1NE8A 4LD6A 4M7DF 1HXDA 2K3XA 1EIFA 2QQBA 2AHJB 3MP6A 4OB1B 4OGEA 2XICA 5CVIA 3JCMf 5LJ5f 2G3RA 1G5VA 4BDYA 2XKOC 3UDCA 2H3JA 1Q81U 4C8QE 1O75A 3KBGA 5GANd 2MF2A 3P8HA 3OYBA 2ZCFB 1WNLA 1I4K1 3QHSA 3OMCA 1Q86C 3ME9A 2DZCA 2RJCA 4PJOD 3PTAA 4KT0E 4HA8A 3M57A 4M77C 3SDZA 3JB9H 4JRKA 4M7AF 2XK0A 3OYAA 2EQJA 2R58A 3MP8A 1KC8U 3QPHA 4HT8A 3OB9A 1S72A 2KK4A 3JB9G 2M16A 2YLCA 4DQ2A 2EFIA 1M90C 4HKEA 4OF1A 3M56A 2LT1A 1UEBA 1KC8C 4HCZA 5FLXE 4MMKA 4A4EA 1X6OA 1G3WA 4M7DC 5I21A 5GAN5 4M75D 3PMIA 5CAIA 1VQ7A 4M78F 3JCMV 1RL2A 3MEAA 2C06A 1OI1A 4C8QB 3RMQA 4X9CA 4OP0A 1YJ9T 3OYIA 1NJIC 2E64A 1VQ6T 4E7JA 5D6WA 3GIBA 4M77E 2QDYB 2A7YA 1VQKA 4PJOF 2LT4A 4J83A 2F5KA 3OSSC 3QJ6A 2MI6A 3CC4T 4E7IA 3E9GA 4M78A 3TEEA 5GAMj 4A4HA 2LRQA 1VIFA 3HRTA 1YIJT 4NL3A 4PL6A 3S6WA 3QO3A 3CCUA 1M1KC 5DM7R 2K3YA 2IG0A 3JCMX 4IUVA 4BDZA 1K73C 3CCVT 3J81E 3OS2A 3PMTA 5L8RE 4PLIA 4A4GA 2HAXA 1UGRB 3QJYA 4F7UA 2QTXA 1K9MU 1VQ5A 2CZ7B 4M7DE 2M9UA 3DLMA 3M4YA 2DXBA 2RHUA 3RKXA 5J26A 4C5GA 1VQOT 2RHYA 5HY6A 4O5VA 5GAN6 5LJ3j 3CCMT 1W4SA 3CCLT 4JUVA 1YJNA 3M5AA 3ER0A 3QDRB 3R6OA 3URGA 3X24B 3PIOA 3JCMP 2DK3A 4RCCA 2HD0A 3VKIA 2ZZDA 3O8VA 1BYMA 5GAOl 4M77B 5HK3A 4ZGEB 1YIJA 5CQXA 3GPLA 3QSUA 2VGMA 4M7AE 2RK1A 3BDUA 4J7FA 5GANg 2BUDA 2RH2A 4PJOC 2RHZA 1YJWA 1VQ8T 2Y4YA 1WJRA 4XU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X A;  4Z02 A;  2R5M A;  3EAE A;  5D6X A;  3UT1 A;  2LDM A;  3OA6 A;  3LLR A;  3LYI A;  2BKD N;  3FDR A;  3OYJ A;  4IUP A;  5IN1 A;  1XNI A;  3QBY A;  1SSF A;  3L42 A;  3L2W A;  4E7K A;  4E7L A;  3L2R A;  2M0O A;  3FEO A;  3P8D A;  3GOX A;  5C0M A;  2R5A A;  3OS0 A;  4C5E A;  5IAY A;  3C4S A;  1RI0 A;  4IUT A;  3FLG A;  2X4Y A;  3LGF A;  4FU6 A;  3LGL A;  4C5H A;  2GFU A;  2RJF A;  4LD6 A;  4A4F A;  4BD3 A;  2K3X A;  2VYT A;  1WJS A;  1G5V A;  3MP6 A;  4E7H A;  2PQW A;  3OYM A;  2G3R A;  4BDY A;  4QQG A;  4IUU A;  3DB4 A;  5D6Y A;  5CIU A;  2NLU A;  5KE2 A;  3MEV A;  2EKO A;  3PFS A;  4X34 A;  4CRI A;  5FRN A;  3P8H A;  3MEU A;  3OYN A;  3OYB A;  2X4W A;  2RHI A;  4QQ6 A;  3OMC A;  3Q1J A;  5KH6 A;  4II1 A;  3S3N A;  3ME9 A;  2MWO A;  2RJC A;  4ZTF A;  2X4X A;  4B9X A;  2O4X B;  2L3R A;  3M9Q A;  1OZ2 A;  2XK0 A;  2E5Q A;  3OYA A;  2HQX A;  2EQJ A;  2R58 A;  3MP8 A;  2EQM A;  2WAC A;  3NTK A;  3OB9 A;  4UC4 A;  2QQS A;  3BDL A;  2M16 A;  3OYC A;  2EFI A;  2X35 A;  4GY5 A;  3LX7 A;  2JTF A;  1N27 A;  3UWN A;  4N4I A;  4HCZ A;  2L89 A;  2LVM A;  5KE3 A;  4QW2 A;  4A4E A;  4QQD A;  4IUQ A;  2P0K A;  3MEW A;  2L8D A;  2BIV A;  3PMI A;  2RJD A;  2D9T A;  2GF7 A;  3MEA A;  4QVZ A;  1OI1 A;  2LCC A;  3OY9 A;  2XDP A;  3OYI A;  2RJE A;  4E7J A;  5D6W A;  3QII A;  3NTI A;  4NS5 A;  3FC3 A;  5M9O A;  2RI5 A;  1KHC A;  2DIQ A;  2FHD A;  1MHN A;  1WGS A;  2F5K A;  2EQU A;  3QJ6 A;  4E7I A;  2CKK A;  3E9G A;  3PNW C;  4EDU A;  5KCH A;  4A4H A;  2LRQ A;  5J39 A;  3S3M A;  5FRO A;  4L59 A;  1H3Z A;  4FL6 A;  4PL6 A;  3S6W A;  4C5I A;  4ZTJ A;  2K3Y A;  2IG0 A;  5FRM A;  2DAQ A;  3E9F A;  4IUV A;  4BDZ A;  4IUR A;  3OS2 A;  4BE1 A;  3PMT A;  5KCO A;  4PLI A;  3MET A;  4A4G A;  2RI2 A;  2EQK A;  2R57 A;  3QKJ A;  4BE0 A;  4RG2 A;  4IKF A;  4BAC A;  4OVA A;  3OYF A;  3OS1 A;  4N4H A;  1OZ3 A;  3DLM A;  3DB3 A;  2RHU A;  3H6Z A;  3NTH A;  5J26 A;  4C5G A;  2MWP A;  3ASK A;  2RI3 A;  2RHY A;  3L2U A;  1WJQ A;  3OQ5 A;  2JZ2 A;  2LTO A;  3OYE A;  3OYK A;  3LH0 A;  3S3O A;  2B8A A;  3MP1 A;  3OMG A;  4PLL A;  2YRV A;  3MO8 A;  3H8Z A;  2HQE A;  3KUF A;  3SD4 A;  4B9W A;  3OYL A;  5C6S A;  3O8V A;  2M1H A;  2RHX A;  4Q5W A;  2E6N A;  3L2V A;  2QQR A;  3OYG A;  3L2Q A;  2DIG A;  4BE2 A;  2GFA A;  2RO0 A;  3ZEH A;  3OYD A;  3OYH A;  4N4G A;  2BUD A;  1OYX A;  2RHZ A;  3CEY A;  1WJR A;  3F70 A; 
#chains in the Genus database with same CATH topology
 4BI4 A;  2YWW A;  3UT1 A;  3H0F A;  1WHG A;  1R0B G;  2CGH A;  3A8L B;  2EBP A;  3JCM h;  3L2R A;  5A0D A;  4LDW A;  1IRE B;  3C4S A;  2PNI A;  4C8Q G;  1OPK A;  2HBW A;  4HXJ A;  1NPP A;  4RTT A;  1U3O A;  4RCB A;  4M75 C;  2MIO A;  1M3A A;  1UJY A;  5CK9 A;  2DD5 A;  3JCM Q;  4PJO E;  1IO6 A;  1NPR A;  2NLU A;  2DZ9 A;  2X4W A;  4OML A;  1MGQ A;  2MWO A;  2KAF A;  1TXQ A;  4B9X A;  3M9Q A;  2F69 A;  3E2U A;  2EWN A;  3GNF B;  2ZPH B;  2IVW A;  3CPW A;  3G1J A;  1ZSZ C;  1BCM A;  2YUP A;  2DBM A;  3JCM c;  4AFZ C;  1Y07 A;  1K0S A;  4QW2 A;  3V7C A;  4LUD A;  1NEG A;  2D9T A;  3RMS A;  2A08 A;  3CBM A;  2OAW A;  3QII A;  3FC3 A;  1H3H A;  4BI3 A;  5J39 A;  4FYY B;  3M59 A;  1U1T A;  2RK2 A;  1MMN A;  3A1P A;  2KYB A;  5CQY A;  1QVF P;  2WSF E;  2CS7 A;  4QVC A;  3M55 A;  1AT1 B;  5GAN f;  1E6G A;  2Y90 A;  3CCQ T;  5CKE A;  3S3O A;  3V8J A;  4J6X A;  5FU7 B;  2FPD A;  3CMA T;  1TUG B;  2CZ6 B;  2RHX A;  4F7U F;  3DKM A;  3QZ9 B;  4C92 D;  1FYN A;  1PRM C;  4FCY A;  3EGU A;  1JJ2 P;  1VYV A;  4IIO A;  1S1N A;  4LXC A;  2QA4 A;  2P4R A;  3FIF A;  2R5A A;  3OS0 A;  5CKB A;  4JRP A;  4IUT A;  3KXT A;  2DXT A;  3EG2 A;  1SHF A;  2E3I A;  2XG8 D;  3CC4 Q;  2F5T X;  4OB3 B;  1NJI R;  2DFU A;  2QEX A;  4J9B A;  4X34 A;  5I11 A;  4XTX A;  2DXC A;  3Q1J A;  2O4X B;  1OU8 A;  1VQK T;  1VQO Q;  4J9F A;  3NTK A;  3RIR A;  1EZZ B;  2GQI A;  2ROL A;  4KGZ B;  4M78 E;  1WXT A;  3OYC A;  2IIM A;  2JM9 A;  4N4I A;  2DO3 A;  2X4J A;  4C8Q A;  3RNJ A;  1VQ5 T;  1RAB B;  1QCO A;  4IUQ A;  4J9E A;  3SFM A;  5IXF A;  1X6B A;  2DBK A;  4M7A B;  2RJD A;  2GBQ A;  2RJE A;  3M4G A;  5GMK l;  4NS5 A;  3INZ A;  2V26 A;  1M2V B;  4HCK A;  5LJ5 d;  5IH2 A;  1XOV A;  3R6N A;  1H3Z A;  1PSF A;  4L6V 5;  2HMA A;  3E9F A;  4M78 B;  4D8D A;  2R57 A;  3WXM B;  2F2V A;  3OYF A;  3VS5 A;  2A0F B;  2QEX Q;  1IZ6 A;  4ELY C;  2RI3 A;  1WJQ A;  3OQ5 A;  4E7S A;  4RTX A;  1QVF A;  1M8M A;  1RAH B;  2HDA A;  3VUB A;  1C6V X;  2AIR B;  1QKW A;  2RF0 A;  1WHL A;  2GQV A;  4R55 A;  5KYW A;  2YUO A;  3V8L A;  2KE9 A;  1M90 U;  1UFF A;  2PVO B;  4O6J A;  3OYY A;  2DYI A;  2BE9 B;  2EJG A;  5KYU B;  1Q82 C;  4OB0 B;  2DIL A;  2L3P A;  1JJ2 A;  2RM4 A;  3MJX A;  2C0I A;  4PFZ A;  3CCL A;  1NBE B;  1Y96 B;  1RI0 A;  3UA6 A;  3QXE B;  2VB6 A;  3BFM A;  1Q7Y U;  3SWN B;  1G3S A;  1TU0 B;  1K1Z A;  4IIM A;  3TCJ A;  1TS9 A;  1VQ8 A;  3RES A;  1Y71 A;  3EHR A;  1O9S A;  2EYZ A;  3JV3 A;  2XDB A;  2J6F A;  1SEM A;  3FJP A;  2DEU A;  1I5L A;  1T0J A;  4DBR A;  2KY9 A;  5FU6 C;  2WAC A;  4C0Z A;  5GMK j;  2JTF A;  3MCA B;  5FWC A;  4AFS C;  2AZS A;  4NOY A;  2O01 E;  1KC8 R;  1TG0 A;  2ZGW A;  3V7R A;  1AD5 A;  2QG9 B;  1AZE A;  2EAY A;  4A54 A;  2FEI A;  4PFO A;  1D3B B;  2EYW A;  1WGS A;  3I9Q A;  2HKN A;  2E65 A;  1AEY A;  5KCO A;  1OUL A;  1EFN A;  1SF9 A;  6AT1 B;  1WHM A;  3OS1 A;  3RKY A;  3G7Z A;  5LJ5 h;  1VQ8 Q;  2VVK A;  2JZ2 A;  2KVQ G;  5J3B A;  2ABL A;  2B8A A;  3MP1 A;  4PLL A;  4M7D D;  1QVG S;  4HVW A;  2KYM A;  4AG2 C;  4B9W A;  3CCS A;  4XK8 E;  2DIG A;  3ZEH A;  3RUX A;  3OW2 P;  4C8Q C;  3H9N A;  3IQL A;  3LYI A;  2E4H A;  3OYJ A;  1XNI A;  1BCO A;  3VYG A;  1N8R R;  3CCQ A;  5A0L A;  1QVF S;  5GAN e;  2RA2 A;  3LH5 A;  1D09 B;  2DF6 A;  3CMA A;  4N0A A;  1GRI A;  2GCX A;  4LD6 A;  2K3X A;  1YN8 A;  2QQB A;  4OB1 B;  3MP6 A;  4OGE A;  5LJ5 f;  2XIC A;  3RBB B;  3H0I A;  3NMZ C;  1IB8 A;  1YJW Q;  2VWF A;  2JS0 A;  4PJO D;  1ZLM A;  1SPK A;  4KT0 E;  2FPF A;  1ZSG A;  2J05 A;  4QKU A;  4JRK A;  2EQJ A;  2AZV A;  1YHQ Q;  2DER A;  3JB9 G;  2M16 A;  2YLC A;  4OF1 A;  3M56 A;  3EGD B;  3CCS Q;  4HCZ A;  1W2B P;  4A4E A;  5CAI A;  1RL2 A;  2YT6 A;  3RMQ A;  4OP0 A;  3RR6 A;  1NLO C;  3GIB A;  2HQH A;  2JMA A;  4M77 E;  2QDY B;  1Q81 R;  1VQK A;  4E7I A;  3CC4 T;  1CKA A;  2RQW A;  3E9G A;  4LE9 A;  3CCQ Q;  1G2B A;  1YIJ T;  4NL3 A;  4E2F B;  1RAD B;  3J81 E;  1BB9 A;  5KYX B;  1VQ5 A;  1SKU B;  3DLM A;  4HVV A;  2DE0 X;  1VQO T;  1LCK A;  5LJ3 j;  3CCM T;  1AWW A;  3M5A A;  3QDR B;  3X24 B;  3PIO A;  3JCM P;  4JJC A;  1ABO A;  2ZZD A;  3O8V A;  1BYM A;  4M77 B;  2OJ2 A;  2DJQ A;  3BDU A;  1YWO A;  2MYS A;  3NGP A;  3OW2 A;  2RQT A;  4C92 F;  4ME7 A;  4ZN3 A;  1Y57 A;  1VQL Q;  5HK0 A;  2PZ1 A;  2DVJ A;  2CP6 A;  1FMW A;  1YWP A;  2J6K A;  5GAM d;  2JUF A;  3EFO A;  3CXC S;  4XU1 A;  3LGF A;  1K9M R;  3CD6 T;  8AT1 B;  2GFU A;  1E6H A;  3WVD B;  1VQK Q;  5FWB A;  4XTU A;  4ZGD B;  5D6Y A;  4BY6 B;  2XDD A;  4PNO A;  3PFS A;  4BI8 B;  1M1F A;  5GMK i;  2EQI A;  4M7A D;  2GGR A;  2QK0 A;  2CP0 A;  4ANJ A;  3NPF A;  1G3T A;  1K8A R;  2EQM A;  3RER A;  2KEA A;  2DTO A;  4LDY A;  2X35 A;  3G6E T;  4M75 E;  4OMP A;  2KT1 A;  2LVM A;  4M78 D;  3GLX A;  4J9I A;  5DLO A;  3BE3 A;  4VUB A;  1QWF A;  2K5L A;  3J80 E;  1W2B A;  2LX9 A;  2LNH B;  4OMF B;  3OY9 A;  5L23 A;  1ZHI A;  1TWB A;  1Q82 U;  3V8K A;  5GAO m;  2CZ1 B;  2ZPB B;  4N0A C;  4YTL A;  1MMA A;  4C5I A;  1H92 A;  4JJN K;  2PUO B;  2DAQ A;  3CCJ Q;  1MMD A;  2CDT A;  1N6A A;  1YBY A;  1X6G A;  4XTW A;  5GJW B;  4M75 B;  3DB3 A;  2MWP A;  4QT7 A;  4KUL A;  2LTO A;  5GAM g;  2JTM A;  3EGX B;  4M7A G;  1BU1 A;  2K79 A;  3TSW A;  3MO8 A;  4ATO A;  1XQH A;  3H8Z A;  2LQ8 A;  4DBQ A;  3KUF A;  2QXF A;  1ZBJ A;  2V8I A;  1Q7Y C;  4AFU C;  3HSB A;  3P8B B;  1TH7 A;  2EJ9 A;  2HEQ A;  1WJR A;  1G83 A;  3CEY A;  4CC3 A;  3JB9 I;  1ZUU A;  2ENM A;  4Z02 A;  9ATC B;  1I81 A;  3JCM b;  3JRZ A;  3A8G B;  1MV0 B;  5AT1 B;  3VRY A;  1WHH A;  3C0C A;  2YSQ A;  4QVD A;  2C0T A;  1F1B B;  4EPC A;  1M5Q 1;  2DPP B;  1KSW A;  1NG2 A;  2VYT A;  2G6F X;  1WJS A;  1NEB A;  2XID A;  1WXB A;  2QYZ A;  1QCF A;  5FRN A;  2MMP A;  4DOV A;  1OQK A;  1OZ2 A;  1YCY A;  5IHN A;  1M1K R;  2J06 A;  4M7D B;  3FB9 A;  1K73 R;  3VV0 A;  4UC4 A;  3CCU T;  3FRN A;  3X28 B;  2YXY A;  1HK9 A;  4FIB A;  3M0U A;  4FSS A;  1FMV A;  4C0F A;  5KE3 A;  2DL5 A;  2YLB A;  2BE7 D;  5LJ5 e;  4F7U E;  3A8O B;  2JTE A;  3PT9 A;  2HL3 A;  3M0P A;  2RNA A;  4LDU A;  1RAA B;  4OB2 B;  2CKK A;  4EDU A;  5CO7 A;  2VUB A;  1ZUK A;  5GAM f;  5GAN h;  4A4K A;  1YJW T;  1X75 C;  2L5Q A;  2RI2 A;  3NFC A;  3O5Z A;  2KDS A;  3MKD A;  1OOT A;  2L2P A;  4BAC A;  2NUP B;  4PJO B;  1YHQ T;  2D0N A;  1W2B S;  2CSI A;  1WLP B;  2EYX A;  2J7I A;  5A0G A;  5GAN 4;  2ROT A;  2OTJ A;  1IHV A;  4C0D C;  3CCR Q;  2DKG A;  5C6S A;  2K2V A;  2E12 A;  3CCS T;  3L2V A;  1WX6 A;  2CT4 A;  3CC4 A;  2QQR A;  3JB9 F;  1KQ2 A;  4BE2 A;  2GFA A;  2HL5 C;  2NYS A;  1V29 B;  1YIJ A;  1QW1 A;  2O4X A;  4RTY A;  1VQ9 A;  2GNC A;  1RAI B;  2LJ1 A;  2QAZ A;  3I5R A;  3I56 A;  1VQO A;  3JSC A;  3CCM A;  5IXB A;  1NYF A;  2LCS A;  1AHJ B;  4EMK B;  4MDW A;  3FLG A;  1PNJ A;  5FW9 A;  3HHT B;  2JM8 A;  3LGL A;  4A4F A;  1VYU A;  4FW2 A;  4GLM A;  4M7A A;  2COZ A;  2PQW A;  1JRI A;  2ZPI B;  3HKS A;  3SEM A;  5KYN A;  1JXO A;  2AT1 B;  2RQU A;  5KH6 A;  2V8J A;  2X4X A;  4EMG A;  2HNI A;  4JRI A;  1R77 A;  1UB4 A;  2EYY A;  1TSF A;  2ESW A;  2ECZ A;  3CQT A;  2KT8 A;  1RLP C;  3J7A F;  2OTJ Q;  2KGT A;  3CD6 A;  3CC2 T;  1N9S A;  4A63 B;  5GAO n;  1VIE A;  1VQL T;  1YIJ Q;  4QQD A;  2PVD B;  4DBH A;  2JXB A;  3QG1 A;  1RUW A;  1M4Z A;  2XHC A;  1D0Y A;  1VQ9 Q;  5KYY A;  3NTI A;  2RPN A;  1V1C A;  3I56 Q;  1OX8 A;  2A37 A;  3CCM Q;  4XTZ A;  3V7S A;  4L59 A;  4M77 D;  2J6O A;  2KRM A;  1S72 Q;  3EG9 B;  4IUR A;  1PD0 A;  4J5Y A;  1QLY A;  3G6E A;  1N8R U;  2E10 A;  1GFD A;  3M0S A;  1AVZ C;  3QWY A;  4C92 G;  5GAO q;  1Y96 A;  3VS3 A;  4DEY A;  2CZ0 B;  3SWN A;  1BBZ A;  1NYG A;  5AYF A;  1VOM A;  1UGV A;  3OYL A;  3MHX A;  4Q5W A;  2E6N A;  3L2Q A;  4MZP A;  4ZN1 A;  3M58 A;  3TVT A;  3OYH A;  2FYK A;  4JS4 A;  2EPD A;  3F70 A;  3HTR A;  3UAT A;  4ELZ C;  3CD6 Q;  1IGU A;  3T9N A;  2R5M A;  3CPW S;  1W6X A;  4MML A;  5FU7 C;  3OA6 A;  3HL8 A;  3FDR A;  1AOJ A;  1QKX A;  4E7K A;  1UE9 A;  3SB2 A;  4E7L A;  3PGG A;  3GOX A;  3AT1 B;  1T3L A;  2HBP A;  1TUD A;  2DMO A;  2MK5 A;  3CCJ T;  4Y28 E;  2GTO A;  1G5V A;  2DYB A;  1KIK A;  1Q81 U;  4C8Q E;  3KBG A;  3EG3 A;  2MF2 A;  4Z8A A;  1WXU A;  3G6E Q;  3OYB A;  1WNL A;  1I4K 1;  3QHS A;  1M30 A;  3OMC A;  3ME9 A;  1KQS P;  2DL3 A;  4M7A F;  2XK0 A;  3MP8 A;  3QPH A;  4HT8 A;  3OB9 A;  1D1C A;  2KK4 A;  2CH4 A;  2EFI A;  3SHW A;  1E7O A;  1SHG A;  3M0Q A;  1UEB A;  1UUE A;  5FLX E;  4MMK A;  1X6O A;  3CCE Q;  3ULR B;  1KD1 R;  5I21 A;  1UG1 A;  4M75 D;  2LJ3 A;  3PMI A;  4M78 F;  1MMG A;  4C8Q B;  1AZG B;  3OYI A;  1NJI C;  1VQ6 T;  2C0O A;  2A7Y A;  2LT4 A;  1IXD A;  2F5K A;  1I5O B;  2MI6 A;  1KK7 A;  4A4H A;  5IHK A;  3HRT A;  4PL6 A;  3S6W A;  3CCU A;  3VS1 A;  2CT3 A;  3JCM X;  4IUV A;  3OS2 A;  2L0A A;  1K9M U;  2CZ7 B;  2M9U A;  3M4Y A;  2RHU A;  2RHY A;  3EG0 A;  3R6O A;  4AFQ C;  2DL8 A;  1TUC A;  2X51 A;  4RCC A;  1B3Q A;  1K76 A;  4RTU A;  4FW1 A;  1VQP Q;  1R0C B;  2D8J A;  2RK1 A;  2F2W A;  2KNB B;  1D1B A;  1YJW A;  2Y4Y A;  4XU2 A;  1K8A U;  5GAM e;  1X43 A;  1UTI A;  4J9G A;  2LDM A;  2YRD A;  1N9R A;  4J9C A;  2PTK A;  5IN1 A;  4AG1 C;  2EGC A;  3MPU B;  1YHQ A;  3X26 B;  2LQW A;  2DM1 A;  5I22 A;  1VQ7 Q;  3EGD A;  4C92 A;  1U1S A;  2BZX A;  1C0M A;  1W1F A;  2K5I A;  5CR2 A;  2D0Q B;  5GAN 3;  3VS2 A;  1M9S A;  1GCP A;  3CCU Q;  5CIU A;  5KE2 A;  1JBM A;  4OGC A;  3OYN A;  5LJ3 d;  3M54 A;  4A53 A;  2KRS A;  2RQR A;  3E19 A;  3CCR T;  3JCM J;  3SWN C;  2DL7 A;  1KQS A;  2E5Q A;  2W0Z A;  1PRL C;  2CP5 A;  3VS4 A;  2DXU A;  3CC7 Q;  2QQS A;  3QDF A;  2E41 A;  4JZ4 A;  1MNE A;  4OMO A;  5KYX A;  3LX7 A;  1XJW B;  4RTV A;  1VA7 A;  1B34 A;  4GLK A;  2COW A;  2L89 A;  1CKB A;  3RKW A;  1P92 A;  1FXX A;  3MEW A;  2BIV A;  1D1A A;  2LC4 A;  4JS5 A;  1LPL A;  1A0N B;  1KHC A;  1PHT A;  1JJ2 S;  2NUT B;  2EQU A;  3CME Q;  4XU0 A;  4M7D G;  2DTI A;  1FX7 A;  3VS7 A;  1UGS B;  3CC2 A;  1K4U S;  3GNG A;  2JNG A;  3MET A;  3QKJ A;  2CSQ A;  4L5G A;  4BE0 A;  1VQL A;  4ZGJ B;  2ATC B;  5GAN 7;  2DET A;  3H6Z A;  2OAU A;  5IT9 E;  3ASK A;  2KMT A;  3GF5 A;  3OYE A;  1KC8 C;  1RAG B;  3OYK A;  3OMG A;  2OTJ T;  2FL7 A;  2HQE A;  3G71 T;  3LWH A;  4MDX A;  4N4G A;  5GAO p;  1Q86 R;  1M1K U;  4PJM A;  2ZPG B;  3LWI A;  5LJ3 g;  1K73 U;  2A3L A;  2EKH A;  1WHK A;  2DLP A;  2K4Y A;  4JJD A;  1VQ9 T;  3I56 T;  3TRE A;  1M90 R;  3FEO A;  5C0M A;  4PJO G;  1S72 T;  1YJ9 Q;  1I0C A;  4FU6 A;  2P4T A;  4FYW B;  1M3B A;  4RG8 A;  4JPB W;  3JAM E;  3EG1 A;  1X2K A;  1ZQ1 A;  1UGP B;  4FSX A;  4ESR A;  2KI7 A;  1V76 A;  4XTV A;  3CC2 Q;  1PC0 A;  2X3X D;  3HRS A;  2MOX A;  3CCV Q;  4QQ6 A;  2VV5 A;  4ZTF A;  4RTZ A;  2H8H A;  1PCX A;  2LX7 A;  1Y7X A;  2NUZ A;  5CCA A;  4J9D A;  1H64 1;  1I1J A;  3C12 A;  3HFN A;  1HSQ A;  1JEG A;  3CCJ A;  2KRO A;  4TVR A;  3UWN A;  1N8R C;  2ZPF B;  2DTH A;  1M8V A;  3X20 B;  4FT2 A;  4LDV A;  4Y92 A;  2FRY A;  1Z9Z A;  3CBO A;  2CRE A;  2XMF A;  2LCC A;  3N5B B;  4C92 C;  2DIQ A;  4LN2 A;  3JCM d;  1BI3 A;  1KQS S;  3PNW C;  3S3M A;  1RAC B;  5EC7 A;  3JCM W;  4DOW A;  2JN0 A;  4XTY A;  2X9H A;  5DY9 A;  3AHU A;  2YHT A;  4M77 F;  1BI2 A;  3EH2 A;  2P0Q A;  4IKF A;  4N4H A;  4CC7 A;  2VC8 A;  4PJJ A;  3UA7 A;  3C94 A;  5LJ3 f;  1VQ6 A;  1QVP A;  2EGA A;  2YRC A;  2LNV A;  1VQM A;  1YCS B;  5GAO r;  2RO0 A;  3CCE T;  4CI0 C;  1Q81 C;  1LNX A;  1QP2 A;  2RN8 A;  1UDL A;  1VQ4 Q;  4LNP A;  1B07 A;  4OMQ A;  4XU3 A;  4M7D A;  3UPU A;  3DLL A;  1SSF A;  1FMK A;  2E3H A;  2RB6 A;  1X27 A;  5ECA A;  4E6R A;  2QGG A;  4C5E A;  1NJI U;  2V1R A;  2E6Z A;  4F04 B;  3OBW A;  4RUG A;  1MUZ A;  5GAN 2;  3EFO B;  2WSC E;  4E7H A;  1D0Z A;  2ZPE B;  4NL2 A;  1YI2 T;  1NZ9 A;  1X2Q A;  1NM7 A;  1PG5 B;  1SG5 A;  2RHI A;  4M78 G;  2NWM A;  5GMK m;  4II1 A;  1ZSZ B;  4C8Q D;  1UEC A;  3JCM g;  4FYV B;  1VQP T;  2VKN A;  3VYH B;  1BKB A;  4BY6 C;  1K9A A;  4CC2 A;  1VQ6 Q;  5GAN 8;  3BW1 A;  1UJ0 A;  1M27 C;  1BIB A;  2NUP A;  2COY A;  3A8H B;  4C0D B;  1VQM Q;  4PJO A;  1MV3 A;  1K9M C;  4BUG A;  3BY7 A;  5GJV B;  1QCN A;  2K57 A;  1ZBX A;  1VQ7 T;  5GAM h;  1B7T A;  3OW2 S;  4M75 F;  3CCR A;  1BK2 A;  3PVL A;  4Z88 A;  1VUB A;  2CP2 A;  4ZTJ A;  1M3C A;  5DLQ E;  4Z89 A;  3HPW A;  3I55 A;  1K8A C;  1HYO A;  2PU9 B;  1DJ7 B;  1G8X A;  1IHW A;  2JOY A;  4ZNX A;  5GMK e;  1QQJ A;  1WDX A;  2FZG B;  4EMK A;  5GAN j;  2O9V A;  3CC7 T;  4M4Z A;  1R8O B;  1GXI E;  1YIT T;  2RQV A;  1VQN A;  3SD4 A;  2O2O A;  2HZY A;  5CKH A;  1PM3 A;  2DL4 A;  3OYG A;  2K3B A;  1ZUY A;  2AK5 A;  1JXM A;  1ACM B;  1QP3 A;  2PUK B;  2VXF A;  2V8K A;  1PKS A;  4KUD K;  3LLR A;  5I2S A;  1UGQ B;  3THK A;  1SRM A;  4WCI A;  4F7U B;  3P8D A;  3CME T;  1X01 A;  1H8K A;  1YJN Q;  2X4Y A;  1KD1 U;  2FB7 A;  3GBQ A;  3G71 A;  4M7D F;  1MND A;  2YUQ A;  1EIF A;  2AHJ B;  3JCM f;  2G3R A;  1ZX6 A;  2M51 A;  2XKO C;  2H3J A;  4KH1 B;  1QVG P;  3P8H A;  2FRW A;  3I55 Q;  2DX1 A;  1GBR A;  5IHI A;  3PTA A;  4HA8 A;  3SDZ A;  1TOV A;  1YNZ A;  2R58 A;  3EG9 A;  1KC8 U;  1M2O A;  1S72 A;  4DQ2 A;  1VQN Q;  4HKE A;  2KXD A;  2LT1 A;  4PK4 A;  1ABQ A;  3EHQ A;  3VRZ A;  2JS2 A;  2QAS A;  4M7D C;  5D7U A;  1NLP C;  3JCM V;  3MEA A;  2C06 A;  1M2V A;  4X9C A;  2EGE A;  1YJ9 T;  4DEX A;  2E64 A;  4WTO B;  4PJO F;  1AWX A;  4M78 A;  4JZ3 A;  3QO3 A;  1M1K C;  2K3Y A;  4BDZ A;  1Q82 R;  1K73 C;  3CCV T;  3G71 Q;  4A4G A;  1SSH A;  2DXB A;  3RKX A;  4C5G A;  5GAN 6;  2HKQ B;  1W4S A;  4JUV A;  2V1Q A;  1OPL A;  2L3Q A;  2SEM A;  2HD0 A;  5GAO l;  1TTH B;  3D7S B;  3GPL A;  3QSU A;  4M7A E;  4PJO C;  2BUD A;  1UHC A;  2KRN A;  5KYU A;  2XD0 A;  2FZC B;  3FJ5 A;  3OS5 A;  3GP8 A;  1N5Z A;  2DNU A;  4IUP A;  4J7I A;  3HP9 A;  2OTL A;  2P84 A;  2Y4X A;  2BZ8 A;  5IAY A;  3VU3 C;  1LOJ A;  5LJ3 e;  2CH4 W;  2RJF A;  2D6F A;  4BD3 A;  3CCE A;  4GBQ A;  3NHN A;  5FU6 B;  4IUU A;  3DB4 A;  1WFW A;  1D0X A;  2EKO A;  3MEV A;  2CP3 A;  2LP5 A;  4KGX B;  4PFP A;  4EMK C;  2E1H A;  2AKK A;  1KHI A;  1QVG A;  2DA9 A;  3G4S T;  2DEQ A;  4XQ3 A;  2QA4 Q;  3EFS A;  1GBQ A;  3LW5 E;  1PKT A;  2JVV A;  3BDL A;  4RTW A;  2M0Y A;  4R0K A;  1VQ4 T;  4FM4 B;  1KJW A;  4PJN A;  1UHF A;  3REA B;  1GCQ A;  4M77 G;  4AMC A;  5HKC A;  3EH1 A;  1YI2 A;  3CXC P;  1D3B A;  1AWJ A;  4QVZ A;  4Y91 A;  2OX7 A;  2LQN A;  1Q86 U;  1BIA A;  3L1A A;  3ZBD A;  1VQP A;  5EG2 A;  1MHN A;  2LQK A;  2VAS A;  2OTL Q;  2DRK A;  2CUD A;  5KYY B;  5KCH A;  2P0P A;  4FL6 A;  5FRM A;  2DVE A;  4HCC A;  2QTV A;  1WIE A;  2VXE A;  3OBY A;  2HCK A;  3L2U A;  1VQ7 A;  3LH0 A;  1PSE A;  4JRQ A;  3VUZ A;  2YRV A;  4MZT A;  1KG1 A;  4WF2 A;  4J9H A;  1EX4 A;  1VQM T;  2D1X A;  2VGN A;  2WSE E;  4M7A C;  1M1G A;  2LMJ A;  3VS0 A;  3A8M B;  4PKC C;  2DJZ A;  2YUN A;  5D6X A;  2BKD N;  4D6W A;  1YI2 Q;  3L2Z A;  3L2W A;  5LJ5 g;  3EFR A;  2AKL A;  3CC7 A;  4KUI A;  2E70 A;  4M78 C;  5LL6 S;  1YIT A;  4AT1 B;  4FYX B;  5LJ5 j;  2W10 A;  2HSP A;  2O88 A;  4KRT A;  3OYM A;  4E47 A;  3H41 A;  4OMN A;  4QQG A;  5I2M A;  2SRC A;  3TU4 K;  5KYW B;  3TSZ A;  1GFC A;  4HT9 A;  1W70 A;  1WHJ A;  3S3N A;  4JLG A;  4B6M A;  2NUT A;  3VS6 A;  2ZAE A;  5GMK h;  2FG0 A;  4M75 G;  3VJP A;  2EJF A;  3CME A;  3E1S A;  4C8Q F;  4KH0 B;  1WQ7 A;  5CKF A;  3CCL Q;  3CPF A;  1VYT A;  3OSV A;  2EW3 A;  3U23 A;  4JLI A;  3JB9 J;  1J3T A;  1JO8 A;  2A28 A;  2FZK B;  5CKD A;  2QQ9 A;  2OI3 A;  4RKU E;  2MPX C;  3JCM e;  4E7Z A;  5A2Q E;  2GF7 A;  3CXC A;  1YJN T;  3PVQ A;  3JB9 D;  2RI5 A;  1X69 A;  2K2M A;  4FT4 A;  5FRO A;  4HCB A;  1WYX A;  1YIT Q;  2RD1 A;  1ZA1 B;  4HVU A;  1LJO A;  1XTD A;  3I55 T;  4JDS A;  2GTJ A;  4BE1 A;  2K5F A;  4OVA A;  3NTH A;  4XAX B;  1YJ9 A;  4M77 A;  2LJ0 A;  4OMM A;  1KD1 C;  2D8H A;  1VQN T;  1U06 A;  3QUI A;  4C92 E;  1K0X A;  4J6Y A;  3HRU A;  4X9D A;  1FWZ A;  2I2L A;  4C0G A;  1U8R A;  2JT4 A;  3OYD A;  1WA7 A;  1JQQ A;  1RAF B;  1GCQ C;  3CCV A;  4D8K A;  4LDX A;  4LUE A;  1YFN A;  1WZO A;  1KQ1 A;  3QBY A;  3L42 A;  1Z9Q A;  2M0O A;  2EYQ A;  4RMO A;  3CBP A;  2JJ9 A;  2ED1 A;  4C5H A;  3PIP A;  1WPY A;  4C92 B;  3A98 A;  2O31 A;  2CYZ B;  4CRI A;  2E5K A;  3MEU A;  2KXC A;  1AWO A;  2L3R A;  1WQW A;  2XI9 A;  3C95 A;  2QI2 A;  2LZ6 B;  1KFZ A;  1BI0 A;  2MAM A;  2HQX A;  4CC4 B;  1OX9 A;  2IPO B;  4ORZ A;  1QWE A;  2LCL A;  2L3S A;  3QWX X;  2B86 A;  4F7U G;  4GY5 A;  3ZFJ A;  3UF4 A;  1N27 A;  3CMA Q;  3TQ7 P;  1Y0M A;  2YDL A;  1I8F A;  1RLQ C;  2P0K A;  1B34 B;  2L8D A;  4MZM A;  1BI1 A;  2O9S A;  2KQW A;  1Q7Y R;  2Z0W A;  2XDP A;  1I07 A;  2K6D A;  2FPE A;  2ED0 A;  2QGF B;  4DA4 A;  8ATC B;  5M9O A;  2DD4 A;  2FHD A;  3G4S A;  4EMH A;  1YP5 A;  1RI9 A;  3ZL7 C;  2KSS A;  1VQ4 A;  4M75 A;  1PWT A;  2K7A A;  2XU8 A;  5LJ3 h;  4DBF A;  4P5N A;  2EQK A;  3M0T A;  3M53 A;  4J8O A;  2HSE B;  4RG2 A;  1JB0 E;  3EGX A;  1OZ3 A;  2F2X A;  2A36 A;  2QA4 T;  1SRL A;  3REB B;  2I0N A;  3PE0 A;  2FVU A;  2PVG B;  3QYG B;  3QZ5 B;  1OEB A;  3WVE B;  2M1H A;  4X1V A;  2BTT A;  2QDL A;  2QQA A;  3I5S A;  4PJL A;  2QEX T;  1OYX A;  4R56 A;  1CSK A;  1T0H A;  1ZSZ A;  2MCN A;  4V2S A;  4LD9 K;  3A5Z B;  1U5S A;  1IGQ A;  1G3Y A;  3EAE A;  3I35 A;  4J6W A;  2KBT A;  2JW4 A;  2KR3 A;  3X25 B;  1VQ5 Q;  2BZY A;  2OTL T;  4BB7 A;  3HFO A;  4KBM B;  2H3E B;  2EIF A;  3QYH B;  4F14 A;  4KGV B;  3G4S Q;  1NE8 A;  1RAE B;  1HXD A;  5CVI A;  4BDY A;  3UDC A;  1O75 A;  5GAN d;  1ARK A;  2ZCF B;  2FO0 A;  2F1L A;  1Q86 C;  2DZC A;  2RJC A;  1C1A A;  3M57 A;  4M77 C;  3JB9 H;  3OYA A;  4K11 A;  2M02 A;  1LVK A;  2EVR A;  3CPW P;  1OU9 A;  5HCK A;  1M90 C;  3KFV A;  2X3W D;  1Q95 G;  1GL5 A;  1G3W A;  5GAN 5;  1HJD A;  2DRM A;  1OI1 A;  1HD3 A;  1ZA2 B;  5D6W A;  4E7J A;  4JJB A;  7AT1 B;  4J83 A;  1IRX A;  3OSS C;  3QJ6 A;  1QMC A;  3TEE A;  5GAM j;  2LRQ A;  1VIF A;  2K9G A;  5DM7 R;  2IG0 A;  3PMT A;  5L8R E;  4PLI A;  1OV3 A;  2HAX A;  1UGR B;  3QJY A;  4F7U A;  2QTX A;  1WI7 A;  4M7D E;  4EIK A;  2CP7 A;  5J26 A;  3RDV A;  5HY6 A;  1T3S A;  4O5V A;  3CCL T;  1YJN A;  3ER0 A;  3URG A;  2CUB A;  2DK3 A;  3M0R A;  3VKI A;  2JMC A;  5HK3 A;  3H0H A;  4ZGE B;  5CQX A;  4F16 A;  2VGM A;  4F17 A;  4J7F A;  5GAN g;  2RH2 A;  2RHZ A;  1VQ8 T;  1PD1 A;  2RMO A;  1JU5 C; 
#chains in the Genus database with same CATH homology
 4BI4 A;  1K8A U;  2XD0 A;  5GAM e;  3OS5 A;  3OW2 A;  3GP8 A;  3UT1 A;  4C92 F;  2LDM A;  4ME7 A;  2CGH A;  4ZN3 A;  1N9R A;  3A8L B;  5HK0 A;  4IUP A;  5IN1 A;  3JCM h;  4J7I A;  3HP9 A;  2OTL A;  3L2R A;  5A0D A;  4LDW A;  1IRE B;  2Y4X A;  3X26 B;  1YHQ A;  5GAM d;  5IAY A;  2JUF A;  3C4S A;  4C8Q G;  3VU3 C;  3CXC S;  4C92 A;  4XU1 A;  3LGF A;  1LOJ A;  1NPP A;  1U1S A;  3CD6 T;  5LJ3 e;  2GFU A;  3WVD B;  2K5I A;  2RJF A;  5CR2 A;  2D0Q B;  4M75 C;  4RCB A;  2D6F A;  4BD3 A;  5CK9 A;  5GAN 3;  4XTU A;  1M9S A;  2DD5 A;  3JCM Q;  3CCE A;  5FU6 B;  4IUU A;  4PJO E;  3DB4 A;  4ZGD B;  5D6Y A;  4BY6 B;  1NPR A;  2NLU A;  5CIU A;  3MEV A;  2EKO A;  3PFS A;  4PNO A;  2DZ9 A;  1JBM A;  4BI8 B;  5KE2 A;  2XDD A;  1M1F A;  4OGC A;  4EMK C;  5GMK i;  5LJ3 d;  3M54 A;  3OYN A;  2X4W A;  1MGQ A;  2E1H A;  4M7A D;  4A53 A;  2MWO A;  1KHI A;  2KAF A;  1QVG A;  4B9X A;  3M9Q A;  3E19 A;  3CCR T;  2F69 A;  2EWN A;  3GNF B;  3JCM J;  1G3T A;  3SWN C;  3G4S T;  2DEQ A;  1KQS A;  2E5Q A;  4XQ3 A;  3EFS A;  2EQM A;  2DXU A;  3RER A;  3LW5 E;  2JVV A;  2ZPH B;  2QQS A;  3BDL A;  2DTO A;  2E41 A;  4LDY A;  2X35 A;  1VQ4 T;  4FM4 B;  2IVW A;  3LX7 A;  3G6E T;  3CPW A;  4M75 E;  1B34 A;  4GLK A;  3JCM c;  2L89 A;  2LVM A;  4M78 D;  3GLX A;  1Y07 A;  4M77 G;  3RKW A;  4QW2 A;  1P92 A;  5DLO A;  1FXX A;  3V7C A;  5HKC A;  1YI2 A;  4VUB A;  2K5L A;  3J80 E;  1W2B A;  3MEW A;  1D3B A;  2BIV A;  2LX9 A;  2D9T A;  4QVZ A;  2LC4 A;  4OMF B;  4Y91 A;  3OY9 A;  4JS5 A;  3RMS A;  3CBM A;  1Q86 U;  1ZHI A;  1BIA A;  1Q82 U;  3L1A A;  3QII A;  3FC3 A;  3V8K A;  5GAO m;  3ZBD A;  2CZ1 B;  1KHC A;  1VQP A;  1JJ2 S;  5EG2 A;  1MHN A;  2LQK A;  2EQU A;  2ZPB B;  4N0A C;  4BI3 A;  5J39 A;  5KCH A;  2P0P A;  4XU0 A;  4M7D G;  4YTL A;  4FL6 A;  2DTI A;  3M59 A;  1FX7 A;  4C5I A;  4JJN K;  5FRM A;  1UGS B;  2PUO B;  2DAQ A;  2DVE A;  1U1T A;  4HCC A;  3CC2 A;  2RK2 A;  1N6A A;  3GNG A;  2JNG A;  3MET A;  1YBY A;  3QKJ A;  4XTW A;  4L5G A;  4BE0 A;  1VQL A;  2VXE A;  4M75 B;  4ZGJ B;  5GAN 7;  5CQY A;  2WSF E;  3OBY A;  3DB3 A;  3H6Z A;  2OAU A;  2MWP A;  2CS7 A;  3ASK A;  2KMT A;  3GF5 A;  3M55 A;  4QVC A;  5GAN f;  3L2U A;  4KUL A;  2LTO A;  2Y90 A;  5GAM g;  3OYE A;  2JTM A;  3LH0 A;  1PSE A;  3OYK A;  5CKE A;  3CCQ T;  4JRQ A;  3S3O A;  4M7A G;  3OMG A;  4J6X A;  3V8J A;  3VUZ A;  2YRV A;  3MO8 A;  4MZT A;  1XQH A;  5FU7 B;  4ATO A;  2FL7 A;  3H8Z A;  2OTJ T;  2LQ8 A;  1KG1 A;  3CMA T;  2HQE A;  3KUF A;  2QXF A;  2V8I A;  4WF2 A;  1Q7Y C;  3G71 T;  2CZ6 B;  2RHX A;  4F7U F;  1VQM T;  3HSB A;  3LWH A;  3P8B B;  1TH7 A;  2EJ9 A;  4MDX A;  2VGN A;  2WSE E;  3DKM A;  4N4G A;  4M7A C;  5GAO p;  1M1G A;  1M1K U;  3QZ9 B;  4C92 D;  2ZPG B;  3A8M B;  3CEY A;  3JB9 I;  4PKC C;  3LWI A;  5LJ3 g;  1K73 U;  2A3L A;  4Z02 A;  2DJZ A;  2K4Y A;  1VQ9 T;  1I81 A;  5D6X A;  3JCM b;  2BKD N;  4D6W A;  3JRZ A;  3I56 T;  3A8G B;  3L2Z A;  3TRE A;  3L2W A;  2QA4 A;  5LJ5 g;  3EFR A;  3FEO A;  3FIF A;  2R5A A;  5C0M A;  4KUI A;  4QVD A;  3CC7 A;  3OS0 A;  4PJO G;  5CKB A;  4JRP A;  2E70 A;  4IUT A;  1S72 T;  4M78 C;  5LL6 S;  4EPC A;  1YIT A;  4FU6 A;  2P4T A;  1M5Q 1;  2DXT A;  4RG8 A;  3KXT A;  2DPP B;  5LJ5 j;  3JAM E;  1ZQ1 A;  2VYT A;  1WJS A;  2XG8 D;  3OYM A;  1UGP B;  2XID A;  4FSX A;  4E47 A;  2F5T X;  4QQG A;  5I2M A;  4OB3 B;  2QEX A;  4XTV A;  3TU4 K;  5FRN A;  4X34 A;  2MMP A;  4HT9 A;  4XTX A;  3HRS A;  2DXC A;  4DOV A;  4QQ6 A;  3Q1J A;  3S3N A;  2VV5 A;  4JLG A;  4ZTF A;  2O4X B;  5GMK h;  1OZ2 A;  1YCY A;  4M75 G;  3VJP A;  1Y7X A;  2EJF A;  5CCA A;  1VQK T;  4M7D B;  3FB9 A;  3CME A;  3E1S A;  1H64 1;  4C8Q F;  3C12 A;  3VV0 A;  1WQ7 A;  3NTK A;  3RIR A;  4UC4 A;  5CKF A;  3HFN A;  3CPF A;  4M78 E;  3CCU T;  3OSV A;  3OYC A;  3FRN A;  3CCJ A;  3X28 B;  1HK9 A;  4FIB A;  4TVR A;  3UWN A;  1N8R C;  2ZPF B;  4JLI A;  2DTH A;  4N4I A;  3JB9 J;  1M8V A;  2DO3 A;  3X20 B;  4FT2 A;  4LDV A;  5KE3 A;  4C0F A;  2X4J A;  4C8Q A;  5CKD A;  2YLB A;  1VQ5 T;  2QQ9 A;  4RKU E;  4IUQ A;  3SFM A;  5LJ5 e;  4F7U E;  3CBO A;  3JCM e;  4M7A B;  5A2Q E;  3A8O B;  2RJD A;  2GF7 A;  2LCC A;  3CXC A;  2RJE A;  1YJN T;  3N5B B;  3PT9 A;  3M4G A;  5GMK l;  4NS5 A;  3INZ A;  3JB9 D;  2RI5 A;  4LDU A;  4C92 C;  2DIQ A;  5LJ5 d;  3JCM d;  4OB2 B;  1BI3 A;  2CKK A;  4EDU A;  3PNW C;  1XOV A;  4FT4 A;  5CO7 A;  3S3M A;  1KQS S;  1H3Z A;  2VUB A;  5FRO A;  4HCB A;  1PSF A;  4L6V 5;  5GAM f;  5GAN h;  3JCM W;  4A4K A;  4DOW A;  2RD1 A;  2JN0 A;  1YJW T;  4XTY A;  1LJO A;  1XTD A;  3E9F A;  4JDS A;  4M78 B;  5DY9 A;  1X75 C;  3I55 T;  3AHU A;  2YHT A;  4BE1 A;  4M77 F;  1BI2 A;  2L5Q A;  2K5F A;  2RI2 A;  3NFC A;  2R57 A;  2KDS A;  2P0Q A;  3WXM B;  4IKF A;  4BAC A;  4OVA A;  3OYF A;  4N4H A;  1IZ6 A;  3NTH A;  4ELY C;  4PJO B;  2RI3 A;  1YHQ T;  1WJQ A;  3OQ5 A;  2VC8 A;  1W2B S;  4XAX B;  1QVF A;  5A0G A;  3C94 A;  1YJ9 A;  5LJ3 f;  4M77 A;  5IT9 E;  1VQ6 A;  1KD1 C;  5GAN 4;  3VUB A;  1VQN T;  2OTJ A;  1QVP A;  3QUI A;  4C0D C;  4C92 E;  2DKG A;  4J6Y A;  3HRU A;  5C6S A;  2K2V A;  2E12 A;  3CCS T;  4X9D A;  3L2V A;  2LNV A;  2GQV A;  3CC4 A;  4R55 A;  2QQR A;  1VQM A;  3JB9 F;  1KQ2 A;  1FWZ A;  2I2L A;  2GFA A;  2RO0 A;  4C0G A;  1V29 B;  4CI0 C;  3OYD A;  4BE2 A;  3V8L A;  5GAO r;  1LNX A;  1QP2 A;  1Q81 C;  1QW1 A;  1M90 U;  2PVO B;  3CCV A;  2O4X A;  4O6J A;  4LDX A;  3OYY A;  1VQ9 A;  4XU3 A;  4M7D A;  3UPU A;  2EJG A;  3DLL A;  1Q82 C;  3CCE T;  1KQ1 A;  4OB0 B;  3I56 A;  3QBY A;  1JJ2 A;  1SSF A;  3L42 A;  2RM4 A;  1VQO A;  3JSC A;  2RB6 A;  2M0O A;  3CCM A;  2EYQ A;  3CCL A;  1AHJ B;  1Y96 B;  4C5E A;  4EMK B;  1NJI U;  4MDW A;  4RMO A;  1RI0 A;  3FLG A;  3CBP A;  2E6Z A;  3HHT B;  3OBW A;  3QXE B;  3BFM A;  3LGL A;  4C5H A;  5GAN 2;  3PIP A;  1Q7Y U;  4A4F A;  3SWN B;  2WSC E;  1WPY A;  1G3S A;  4C92 B;  4E7H A;  2PQW A;  4M7A A;  1JRI A;  2CYZ B;  2ZPI B;  3TCJ A;  2ZPE B;  4NL2 A;  1YI2 T;  3HKS A;  1VQ8 A;  4CRI A;  1NZ9 A;  3RES A;  1Y71 A;  3MEU A;  1O9S A;  2RHI A;  4M78 G;  5KH6 A;  5GMK m;  4II1 A;  2V8J A;  2XDB A;  4C8Q D;  2X4X A;  2L3R A;  1WQW A;  2XI9 A;  3C95 A;  3FJP A;  3JCM g;  4EMG A;  2QI2 A;  2HNI A;  1VQP T;  1I5L A;  1BI0 A;  4JRI A;  2MAM A;  2HQX A;  3VYH B;  1BKB A;  1UB4 A;  2KY9 A;  5FU6 C;  2WAC A;  2LCL A;  4BY6 C;  4F7U G;  5GAN 8;  3BW1 A;  4GY5 A;  3ZFJ A;  4C0Z A;  5GMK j;  3CD6 A;  2JTF A;  3J7A F;  1N27 A;  1BIB A;  3MCA B;  3CC2 T;  1I8F A;  3A8H B;  1N9S A;  4C0D B;  4NOY A;  4PJO A;  5GAO n;  1VIE A;  2O01 E;  1K9M C;  4BUG A;  1VQL T;  3BY7 A;  4QQD A;  2K57 A;  2ZGW A;  2PVD B;  2P0K A;  1B34 B;  2L8D A;  1ZBX A;  3V7R A;  4MZM A;  1BI1 A;  1VQ7 T;  2KQW A;  5GAM h;  2EAY A;  3QG1 A;  4A54 A;  1M4Z A;  2XDP A;  2XHC A;  3OW2 S;  4M75 F;  3CCR A;  1D3B B;  3NTI A;  4DA4 A;  5M9O A;  2DD4 A;  2FHD A;  3G4S A;  4EMH A;  1WGS A;  4XTZ A;  3V7S A;  1VUB A;  4L59 A;  1U8R A;  4M77 D;  4ZTJ A;  5DLQ E;  2KSS A;  1VQ4 A;  4M75 A;  2E65 A;  3HPW A;  2XU8 A;  5LJ3 h;  4IUR A;  3I55 A;  4J5Y A;  3G6E A;  1N8R U;  1K8A C;  2E10 A;  2PU9 B;  1DJ7 B;  5KCO A;  4P5N A;  2EQK A;  3M53 A;  4J8O A;  2JOY A;  4RG2 A;  1JB0 E;  4C92 G;  5GMK e;  3OS1 A;  1OZ3 A;  1Y96 A;  4EMK A;  3RKY A;  5GAO q;  5GAN j;  3G7Z A;  5LJ5 h;  2QA4 T;  2JZ2 A;  2KVQ G;  3CC7 T;  5J3B A;  2B8A A;  3MP1 A;  1R8O B;  2CZ0 B;  4PLL A;  3SWN A;  4M7D D;  1GXI E;  1YIT T;  1QVG S;  2FVU A;  2PVG B;  1VQN A;  5AYF A;  3QYG B;  3SD4 A;  4B9W A;  3QZ5 B;  3OYL A;  3WVE B;  3MHX A;  2M1H A;  4Q5W A;  5CKH A;  2E6N A;  3CCS A;  3OYG A;  3L2Q A;  4XK8 E;  2DIG A;  4MZP A;  2QQA A;  3ZEH A;  1QP3 A;  3M58 A;  3RUX A;  4ZN1 A;  3OYH A;  2FYK A;  2QEX T;  1OYX A;  4C8Q C;  4R56 A;  4JS4 A;  4V2S A;  3F70 A;  4ELZ C;  2PUK B;  2VXF A;  4LD9 K;  2V8K A;  3T9N A;  2R5M A;  3A5Z B;  3CPW S;  4MML A;  4KUD K;  1G3Y A;  3EAE A;  5FU7 C;  3OA6 A;  3LLR A;  3LYI A;  4J6W A;  5I2S A;  3HL8 A;  1UGQ B;  3FDR A;  3X25 B;  3OYJ A;  1XNI A;  4E7K A;  2OTL T;  4BB7 A;  3SB2 A;  4E7L A;  3PGG A;  3VYG A;  3HFO A;  3P8D A;  4KBM B;  4F7U B;  3GOX A;  3CME T;  3CCQ A;  1X01 A;  2EIF A;  2HBP A;  5A0L A;  1QVF S;  5GAN e;  2RA2 A;  2X4Y A;  3QYH B;  1KD1 U;  3CCJ T;  2FB7 A;  4Y28 E;  3CMA A;  4N0A A;  2GCX A;  3G71 A;  1NE8 A;  4LD6 A;  4M7D F;  1HXD A;  2K3X A;  1EIF A;  2QQB A;  2AHJ B;  3MP6 A;  4OB1 B;  4OGE A;  2XIC A;  5CVI A;  3JCM f;  5LJ5 f;  2G3R A;  1G5V A;  4BDY A;  2XKO C;  3UDC A;  2H3J A;  1Q81 U;  4C8Q E;  1O75 A;  3KBG A;  5GAN d;  2MF2 A;  3P8H A;  3OYB A;  2ZCF B;  1WNL A;  1I4K 1;  3QHS A;  3OMC A;  1Q86 C;  3ME9 A;  2DZC A;  2RJC A;  4PJO D;  3PTA A;  4KT0 E;  4HA8 A;  3M57 A;  4M77 C;  3SDZ A;  3JB9 H;  4JRK A;  4M7A F;  2XK0 A;  3OYA A;  2EQJ A;  2R58 A;  3MP8 A;  1KC8 U;  3QPH A;  4HT8 A;  3OB9 A;  1S72 A;  2KK4 A;  3JB9 G;  2M16 A;  2YLC A;  4DQ2 A;  2EFI A;  1M90 C;  4HKE A;  4OF1 A;  3M56 A;  2LT1 A;  1UEB A;  1KC8 C;  4HCZ A;  5FLX E;  4MMK A;  4A4E A;  1X6O A;  1G3W A;  4M7D C;  5I21 A;  5GAN 5;  4M75 D;  3PMI A;  5CAI A;  1VQ7 A;  4M78 F;  3JCM V;  1RL2 A;  3MEA A;  2C06 A;  1OI1 A;  4C8Q B;  3RMQ A;  4X9C A;  4OP0 A;  1YJ9 T;  3OYI A;  1NJI C;  2E64 A;  1VQ6 T;  4E7J A;  5D6W A;  3GIB A;  4M77 E;  2QDY B;  2A7Y A;  1VQK A;  4PJO F;  2LT4 A;  4J83 A;  2F5K A;  3OSS C;  3QJ6 A;  2MI6 A;  3CC4 T;  4E7I A;  3E9G A;  4M78 A;  3TEE A;  5GAM j;  4A4H A;  2LRQ A;  1VIF A;  3HRT A;  1YIJ T;  4NL3 A;  4PL6 A;  3S6W A;  3QO3 A;  3CCU A;  1M1K C;  5DM7 R;  2K3Y A;  2IG0 A;  3JCM X;  4IUV A;  4BDZ A;  1K73 C;  3CCV T;  3J81 E;  3OS2 A;  3PMT A;  5L8R E;  4PLI A;  4A4G A;  2HAX A;  1UGR B;  3QJY A;  4F7U A;  2QTX A;  1K9M U;  1VQ5 A;  2CZ7 B;  4M7D E;  2M9U A;  3DLM A;  3M4Y A;  2DXB A;  2RHU A;  3RKX A;  5J26 A;  4C5G A;  1VQO T;  2RHY A;  5HY6 A;  4O5V A;  5GAN 6;  5LJ3 j;  3CCM T;  1W4S A;  3CCL T;  4JUV A;  1YJN A;  3M5A A;  3ER0 A;  3QDR B;  3R6O A;  3URG A;  3X24 B;  3PIO A;  3JCM P;  2DK3 A;  4RCC A;  2HD0 A;  3VKI A;  2ZZD A;  3O8V A;  1BYM A;  5GAO l;  4M77 B;  5HK3 A;  4ZGE B;  1YIJ A;  5CQX A;  3GPL A;  3QSU A;  2VGM A;  4M7A E;  2RK1 A;  3BDU A;  4J7F A;  5GAN g;  2BUD A;  2RH2 A;  4PJO C;  2RHZ A;  1YJW A;  1VQ8 T;  2Y4Y A;  1WJR A;  4XU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...