2RI2A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355a point mutation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
312
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVARMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A03
2CKKA 3UT1A 3OYCA 2F5KA 3LYIA 3CEYA 3L42A 1OYXA 2M0OA 4IUUA 4NS5A 4IUTA 3OYDA 4BDZA 3MO8A 2XK0A 2G3RA 2VYTA 4B9XA 4C5IA 5C0MA 1OI1A 3QIIA 1RI0A 4HCZA 4UC4A 1XNIA 2RJFA 4E7HA 1KHCA 3ZEHA 5J39A 4Q5WA 2RHYA 2X4XA 4LD6A 3MP8A 3P8HA 3OYHA 3OS1A 2LCCA 1SSFA 4QQ6A 3L2UA 4BACA 4PL6A 3NTIA 3FDRA 2PQWA 4PLIA 4E7LA 2RJCA 1MHNA 3E9GA 3QKJA 5D6XA 3KUFA 4RG2A 1WJQA 3MP6A 3P8DA 4A4EA 4BD3A 3META 3LGFA 2JZ2A 3QBYA 3L2WA 2K3YA 3F70A 1OZ2A 2EQMA 3S3OA 2L89A 3MEUA 5J26A 2EQKA 2R57A 5D6WA 2K3XA 4IKFA 5D6YA 1WJSA 2L8DA 3LH0A 3MP1A 3S3MA 2LDMA 2L3RA 3OYFA 2GF7A 4BE0A 2DIGA 5FRNA 3FLGA 3PFSA 4OVAA 3OY9A 4CRIA 2QQSA 2HQXA 2JTFA 3EAEA 3LX7A 2R5AA 4X34A 4E7IA 1G5VA 3OYAA 4N4IA 2P0KA 3OB9A 5IN1A 4IUQA 5KCHA 2RJEA 4C5GA 3OYBA 2O4XB 4B9WA 3OMCA 3OA6A 2RHIA 5KH6A 2EQUA 3MEVA 5IAYA 1N27A 1WGSA 5C6SA 3OS0A 4IUVA 1WJRA 2RI5A 5CIUA 3PNWC 4QW2A 3NTHA 2DAQA 4ZTJA 2MWOA 4BE1A 2BUDA 4L59A 4A4HA 2E5QA 3M9QA 2LVMA 3ME9A 3L2QA 3MEAA 2IG0A 4FL6A 3FC3A 3PMIA 3OQ5A 2RI3A 4A4GA 2RHUA 3MEWA 3BDLA 3DLMA 2DIQA 2X4WA 3Q1JA 2YRVA 5FRMA 2E6NA 3DB4A 4N4HA 2RHZA 4PLLA 3S6WA 3OYLA 5M9OA 2GFUA 5KE2A 3DB3A 2LTOA 3SD4A 3L2RA 3OYMA 4E7JA 2QQRA 2EKOA 4E7KA 2HQEA 2BIVA 2R5MA 2RHXA 4Z02A 1OZ3A 4ZTFA 2BKDN 3OYEA 2GFAA 2MWPA 3OYJA 3NTKA 2FHDA 2R58A 2EQJA 2M1HA 2WACA 4IURA 3OS2A 2D9TA 3H8ZA 3UWNA 2M16A 4N4GA 2EFIA 2RI2A 2X35A 3O8VA 2LRQA 3PMTA 3S3NA 4C5HA 3FEOA 4II1A 4BDYA 5KCOA 2XDPA 3H6ZA 3LLRA 3OYKA 2NLUA 2O4XA 4QQDA 3LGLA 1H3ZA 4FU6A 4GY5A 2RO0A 3E9FA 3OYNA 2RJDA 5FROA 3C4SA 4QVZA 5KE3A 4IUPA 3OYIA 3QJ6A 4QQGA 3OMGA 4A4FA 3GOXA 4C5EA 3OYGA 2X4YA 3L2VA 4EDUA 2B8AA 4BE2A 3ASKA
chains in the Genus database with same CATH superfamily
3CCST 3OYCA 5KYXB 3CCLA 1QKXA 4IUUA 1Q95G 4F14A 4C92C 3CCJT 3QIIA 2HQHA 1M8MA 1VA7A 2RHYA 1IHVA 5KYYB 5IT9E 1Y71A 2D0NA 1JXMA 4Z89A 1W6XA 3JRZA 4WTOB 3SWNC 5GAOn 1E6HA 2K3YA 2L3PA 5IHNA 2ZPFB 2HKNA 1BIAA 3OSVA 3H0IA 4XU1A 4Z8AA 3JCMc 4J83A 3EG3A 2VXFA 4N0AA 2LNVA 4A63B 4C0ZA 2QQBA 4HCKA 3H41A 5FRNA 4M75D 3CCSA 3QG1A 2DXCA 2DETA 2O9SA 5IHIA 5LJ5j 3G4ST 1FXXA 3NGPA 1JO8A 2CZ0B 3CCJA 2RHIA 4CC7A 1WGSA 3HL8A 1BBZA 3A8MB 4LUDA 1SG5A 3M0QA 3SFMA 1D0ZA 1KQSS 2IPOB 2OI3A 2O2OA 4M7AG 4C92E 4A4GA 1B7TA 4B6MA 2E4HA 4RTVA 5FRMA 2HMAA 4N4HA 4OP0A 4WCIA 3M4YA 1BYMA 5GAOr 2CSQA 3MPUB 1D3BB 3QDRB 1MMAA 4EMKA 4Z02A 2HNIA 2K2MA 2BKDN 5GJVB 1VQ5T 2WACA 3G4SA 4AT1B 5GAN5 1WHGA 2M16A 5A0DA 1JEGA 1K9MU 1R77A 2NLUA 5GJWB 1H3ZA 2DJQA 4FU6A 4F7UF 5LJ5g 1X43A 2EQIA 3JCMW 1I5LA 4M75G 4M7DD 3FJ5A 4QVDA 4C0DC 3UA6A 3CCRQ 4EIKA 1QVGA 5EG2A 3QWYA 4BDZA 1QP2A 1NYGA 1XNIA 1WA7A 1KHIA 1VQOQ 1YHQQ 2LP5A 2D1XA 4LD6A 2KI7A 1Q86R 1VQ5A 3R6NA 3C12A 3A8HB 4E2FB 3TCJA 1HD3A 2EKHA 1PRMC 2PQWA 1NLOC 1VQ8Q 2NUPA 3P8DA 1VQPT 3META 1EFNA 3F70A 4FW1A 2EYWA 2RQRA 2Z0WA 2Y90A 5J26A 2R57A 1YIJT 4OB0B 1AT1B 4OVAA 1K1ZA 4OB2B 1YJWT 3M53A 2R5AA 2EGAA 3OYAA 1KC8U 4JLIA 1LVKA 4M77B 3VRYA 1W2BA 1RAIB 3I56Q 2JMAA 3M0TA 5I21A 4KH1B 1NE8A 2CP5A 2DRKA 1ABOA 3N5BB 3CCMQ 2VC8A 4FT2A 3OS5A 4MZMA 2P0QA 3OQ5A 3EFSA 2RHUA 1KQ1A 1UEBA 1VQPA 2FG0A 2KSSA 4J9BA 2DYBA 2FRYA 1YIJA 2E5KA 5GAN2 2WSCE 3PGGA 3OYYA 5HCKA 2QA4T 5DM7R 4KBMB 1CKAA 1TG0A 4M77C 2LZ6B 1YJWA 4PFZA 5GAOq 3JCMd 2R58A 3EGDA 4R56A 2M9UA 1VQMT 1W4SA 1Y0MA 3RKYA 1GCQC 1HJDA 1B3QA 4ZGDB 4MDXA 1SSHA 3C4SA 1QWFA 4QQGA 2KYMA 3IQLA 2O01E 3JCMP 4MZTA 3I55Q 3FIFA 4J8OA 1RLQC 3LYIA 3WXMB 4XU0A 3RESA 1HSQA 2JOYA 3EG9B 1WIEA 2QA4A 1Q86C 1YJ9Q 2OAWA 1UFFA 1ZUUA 2CH4A 1HYOA 5HK0A 1PCXA 1S72Q 1VQMA 2RK1A 1ZA2B 2FZCB 2W0ZA 1QVGP 3GBQA 3GNGA 3KUFA 4RCCA 4F7UA 3DLLA 3QBYA 1Z9QA 1UJ0A 4M77E 2DD4A 4PJJA 1UGQB 1MV3A 2X9HA 3V8KA 1DJ7B 1D1AA 1HXDA 4OMMA 4RG8A 1KG1A 5IXFA 5LJ5f 1NYFA 2HZYA 3OMCA 3EGXA 2PVDB 2I0NA 2JTMA 4NL3A 2ESWA 5GAN6 1RADB 1NPRA 2MWOA 2VWFA 3QDFA 4M78D 4RTZA 2OTJT 2LX9A 4PJOF 3QSUA 3V8LA 5CVIA 4JRIA 3CCEQ 4E7JA 2YT6A 1WHKA 2BIVA 2V26A 3ZFJA 1IGQA 3QUIA 3NHNA 3LH5A 8ATCB 4C8QF 3OW2P 1PWTA 1BK2A 5KYYA 2VB6A 4C5HA 2E64A 4II1A 4MDWA 2QG9B 3RBBB 3LLRA 1WI7A 2J6FA 2RMOA 3VS0A 1MMNA 2DPPB 3TSWA 1NJIR 2LT4A 2FL7A 3EG1A 2AT1B 2RA2A 2KDSA 2DZ9A 4EDUA 4QT7A 2OTJA 3HRTA 4DEYA 2KYBA 3MO8A 5C0MA 3EHQA 4JRQA 1AVZC 1O9SA 1D0XA 1BCOA 4Q5WA 2DA9A 3CMAQ 1PKSA 3PIOA 4BACA 1Q81R 4PL6A 4FYYB 2JS0A 4M78G 4M75E 1M90U 2XICA 3M59A 2K4YA 4PLIA 5GAMe 4N0AC 3CC7T 1VQKT 2KVQG 4BUGA 3UPUA 1U5SA 1YITT 3I5RA 1SRMA 3CQTA 1LOJA 3CXCA 3MP1A 2L3RA 1M30A 1WXTA 5FLXE 4LN2A 4PK4A 4NOYA 3G71T 1YCYA 5DLOA 4Z88A 5GANf 3I55T 1ARKA 2E3HA 3CCLQ 5AYFA 2YUPA 1K8AR 1M5Q1 1YJNT 2XU8A 1I0CA 1M2OA 1VQLQ 4A4HA 3M5AA 2BTTA 3E19A 3CC7A 1MV0B 1VQKA 4EMKC 4C92G 2YRDA 2DD5A 1YITA 3TU4K 2K2VA 5KE2A 1BI0A 3CC2T 1Y07A 4BI3A 5FU6B 2CP7A 2CSIA 1M1KR 3D7SB 4EMGA 3M55A 3G71A 4M7DE 2DJZA 3I55A 2YSQA 3H8ZA 2E6ZA 3CCSQ 3AT1B 2LRQA 1GFCA 1YJNA 2CGHA 2QGGA 3OYKA 3EGUA 1NJIC 5GMKi 3CCJQ 1XTDA 4QVZA 3OYIA 5I11A 1QVGS 4XK8E 1TWBA 4PJOA 2QTVA 5FU6C 3JAME 1PNJA 4JDSA 4D6WA 4VUBA 1KFZA 3CC2A 1PSFA 4JS5A 4UC4A 1I5OB 1IRXA 3QYGB 3M4GA 1KSWA 4C8QA 4E7ZA 1KJWA 6AT1B 1Z9ZA 4PJNA 2DXBA 4J7IA 2XIDA 3MJXA 4F16A 3JCMQ 1PHTA 3G4SQ 2JZ2A 2EQMA 1K76A 3E1SA 1I4K1 2L8DA 4JRPA 4BE0A 3EGDB 3OY9A 3M0RA 2ED0A 1AWWA 1W2BS 5IN1A 2XMFA 1T0JA 1BI3A 1K4US 2EJ9A 2F5TX 1FYNA 2DBMA 2JNGA 3RKXA 5GAMh 2EAYA 3VS4A 1K73U 3LW5E 2YWWA 2Y4XA 4J9FA 1VQ5Q 2CP2A 1UJYA 2DYIA 1JJ2P 3I35A 3DLMA 2DIQA 2KQWA 3TEEA 2BE7D 3A8LB 3L2RA 2DX1A 3OYMA 4AFQC 2A08A 4KGVB 3REAB 2CZ7B 3TVTA 4IURA 3EG9A 3PVLA 5I2MA 2QI2A 1TUGB 4FW2A 3MCAB 1AWOA 3JCMb 1VYTA 1TOVA 2FZKB 2AIRB 4XTVA 2DM1A 1ZUYA 1WQ7A 1BB9A 3CCVQ 5KE3A 3OMGA 2QDLA 2V1QA 1KK7A 1VQLT 3JB9D 1PC0A 3L2QA 2YUQA 2AZVA 5GAN3 2F5KA 2M0OA 3CC4T 3JCMX 3EGXB 2DL4A 1VQPQ 4HT8A 4B9XA 4AG1C 5CQXA 1OV3A 1RI0A 1O75A 2J6KA 5J39A 2K3BA 4ORZA 1ZX6A 2X4XA 4QVCA 1YIJQ 4AFUC 3H0HA 2VUBA 1P92A 4GLKA 5LJ3f 3FRNA 4RUGA 1VQ6Q 1M4ZA 1Q82R 2L89A 3GF5A 4M77G 2K3XA 2DLPA 2F1LA 2LQNA 1VQLA 5A0GA 2K9GA 4CRIA 3CC4A 4M78E 3UA7A 1AHJB 3X26B 1C6VX 1Q7YU 1AWXA 2HDAA 2V8JA 3HP9A 2QA4Q 4BE1A 2H3JA 3ME9A 4FM4B 1LJOA 1X27A 1ZBXA 4JPBW 1YI2T 1G2BA 2X4WA 4F7UE 1VQMQ 2H3EB 4KH0B 4LNPA 2ED1A 5A0LA 4LD9K 3FB9A 1OULA 5CKFA 2HSEB 1TXQA 2MF2A 2QQRA 1K0XA 4EMHA 4ZTFA 4KUDK 3OYJA 1YWOA 3VS1A 3G6ET 4EPCA 2QTXA 1BI1A 1KD1U 2EYZA 5HKCA 4PKCC 2DTIA 1VQ7T 3E9FA 1VUBA 5FU7B 3OYNA 4JS4A 3WVEB 3VKIA 5LJ5e 3H9NA 2KT1A 3GOXA 3VV0A 1ABQA 2B8AA 1WLPB 1FMWA 2QAZA 1YI2A 2COWA 2YHTA 4RTXA 3OYDA 1T3LA 1U1TA 2YDLA 2G3RA 2RH2A 3FJPA 1OI1A 1EZZB 3ZL7C 3SHWA 4FCYA 4E7HA 1EX4A 2KXCA 5GAN4 1RAFB 2JJ9A 2RM4A 3L2UA 3G6EA 2C0IA 1OEBA 1GBQA 5FU7C 1NBEB 2QYZA 3CXCS 1Q82C 1VQ7A 4HCCA 4DOVA 4ATOA 1VIFA 3QHSA 1WHHA 2V8KA 3CCVT 3G1JA 2PZ1A 1SF9A 1I07A 2E10A 2LJ3A 1G3YA 4IUQA 1YCSB 2OTJQ 3CBPA 2EQUA 2HL5C 2E65A 2COZA 2A28A 2OTLQ 5FWCA 3SEMA 1D1BA 5HK3A 1SPKA 1X75C 4PJOB 2E5QA 2YXYA 3M9QA 4FT4A 3MEAA 1WYXA 4HCBA 1QCOA 1TS9A 4KUIA 4RTYA 5GANj 3S6WA 2RHZA 4PLLA 1VQ6T 2ATCB 2HL3A 1VYVA 2YLCA 1NG2A 4C8QB 2R5MA 5GMKj 3CCVA 2DL8A 1K9MR 2OJ2A 4OMFB 4M7DG 1X69A 2X35A 3PMTA 4R55A 4PJOC 3OW2A 3VS3A 2X51A 4NL2A 2O31A 3QJ6A 2DFUA 3OYGA 2X4YA 2DL7A 4KRTA 1SHGA 3Q1JA 1SEMA 2L0AA 4C8QC 1M3BA 2VASA 3CC7Q 3WVDB 1VQKQ 2J05A 1VQ6A 1RACB 1ACMB 1IO6A 1YITQ 3HFOA 2JN0A 5GANg 2MPXC 2PTKA 4P5NA 1U3OA 3G71Q 5LJ5h 1WJQA 2WSEE 4DBRA 4ANJA 2BZXA 3R6OA 3HRSA 1N8RU 4PJLA 2FYKA 3JCMV 1YJNQ 1PRLC 3LH0A 5CO7A 4HA8A 2DIGA 3FLGA 3VYGA 1VQ4T 2FEIA 3QXEB 1G5VA 2D8HA 2P0KA 3REBB 4OMOA 1IGUA 2HEQA 1UE9A 1ZLMA 3BY7A 3CC2Q 1K9AA 5J3BA 2FO0A 3PNWC 3NMZC 3UDCA 1JBMA 3I9QA 3PMIA 1SHFA 2M0YA 1J3TA 3QWXX 2HD0A 2YRVA 5IHKA 3KBGA 2FPDA 1UHCA 3THKA 1ZUKA 3GIBA 2GFUA 2D6FA 4J9CA 2MCNA 4DEXA 3UATA 2P4TA 3PTAA 2CUDA 2K7AA 1QKWA 3JCMf 1QVFP 1K9MC 1OZ3A 2NYSA 1VQ4A 2MWPA 2CT4A 3CPWP 3NPFA 2ENMA 2XDBA 3RNJA 3HPWA 4ZGEB 4ZGJB 5CR2A 3LGLA 4KULA 2RJDA 1N5ZA 2DKGA 2OTLT 1Q81U 3GNFB 3L2VA 1AZEA 1U1SA 4DA4A 1ZHIA 2HAXA 2KRMA 1AWJA 1D09B 2VYTA 4Y28E 1OPKA 3X28B 5KYNA 3X24B 2KXDA 2DEQA 3INZA 4DBHA 1WXBA 3FDRA 5GANh 2YUNA 3QKJA 4XTWA 5KYWA 2O9VA 5GAN8 4DQ2A 1I1JA 4LDYA 2DZCA 1K8AU 2CT3A 1X6OA 9ATCB 2EQKA 1H641 2OTLA 2DILA 3X20B 3S3MA 1KC8C 3PFSA 3CCQT 2HQXA 2KK4A 3V7RA 4LDVA 2CUBA 2EYYA 5LJ3j 3OB9A 2LQ8A 1M3CA 2JM8A 2K57A 2JUFA 2KR3A 5IAYA 4ZN3A 2JW4A 1M2VA 2KROA 1WJRA 1WHJA 1X6BA 1M1KU 1UGPB 2ZAEA 4J6XA 5FWBA 1D0YA 3JB9I 3TSZA 4FL6A 2E70A 4R0KA 1I8FA 1QCFA 4CC4B 4F7UG 4X9DA 2JTEA 3V8JA 2DXTA 2LQWA 5CCAA 2RQUA 1JJ2A 2C0OA 2X4JA 3CCQA 4XAXB 1T0HA 5IH2A 3OYEA 5CK9A 4JUVA 2VGMA 4XTUA 2FHDA 4XU2A 4ESRA 2CYZB 1FX7A 3CBMA 3M54A 4M7AF 2HBPA 4HVVA 1C1AA 4OMLA 3CC4Q 1D1CA 5IXBA 2E1HA 2YLBA 1M8VA 4JJCA 1LNXA 4MMKA 5FROA 5LJ3g 3ULRB 1TUDA 3HHTB 3VU3C 1B34A 2VGNA 1YN8A 3JSCA 3V7SA 2CZ1B 3A98A 3LWHA 1C0MA 2CKKA 3UT1A 2BZYA 5CKBA 3CEYA 1PM3A 2IVWA 2KE9A 1UUEA 4HXJA 1JXOA 1S1NA 1VYUA 4E6RA 1OX9A 3PVQA 4O6JA 1WHMA 1QWEA 3NTIA 4M75F 4L5GA 1QMCA 2PUOB 3KXTA 2X3XD 3E9GA 5D6XA 1N9SA 1TH7A 3EFOA 4J7FA 1G3SA 4BI4A 4OMQA 1UHFA 3M56A 1IZ6A 1PD1A 5HY6A 3MEUA 1PSEA 3HSBA 3TQ7P 3RIRA 2ECZA 5D7UA 5GAOp 1X2QA 1X01A 4HVUA 1VQ9T 3LX7A 3U23A 1G3WA 1BCMA 1NM7A 2FPEA 4CC2A 1YI2Q 2QK0A 4M4ZA 2PNIA 1N9RA 2FVUA 4AFZC 2ZPIB 3NTHA 2DAQA 4QW2A 2SEMA 2DRMA 1KQSP 1JRIA 1WXUA 3G6EQ 3QZ5B 3MEWA 3DB4A 2JS2A 2GTJA 2LTOA 3SD4A 1VQ7Q 1W70A 1GCQA 4E7KA 4J9GA 1Y7XA 3GLXA 4Y91A 5GAMd 1VQ9A 1XOVA 3DKMA 3VJPA 2EQJA 4M7DF 1G83A 1IHWA 2D9TA 3OW2S 2EFIA 5LL6S 4PJOD 5KCOA 1KIKA 2K5LA 2O4XA 4JLGA 3CCUT 4GY5A 3PT9A 1GBRA 4A53A 4LXCA 4GLMA 5LJ3h 4FYXB 5GMKl 4C8QD 2LC4A 3M0UA 3ASKA 3J81E 3QPHA 3NFCA 1M3AA 2CREA 4J5YA 5GAN7 4LDXA 1M90C 2RJFA 1MMDA 2CP3A 2NUZA 4FYWB 4J9EA 2DF6A 1JU5C 4XTYA 4M7AA 1MNDA 2AZSA 1OU8A 2Y4YA 3J80E 4BD3A 2GQVA 1X6GA 3SB2A 4A4KA 1VQNT 3CCUA 1AOJA 4XQ3A 4F17A 4AFSC 1YP5A 4HVWA 7AT1B 1BIBA 1QW1A 2PVOB 2FPFA 4OGCA 1XJWB 3CMEA 2CZ6B 2LX7A 4BI8B 5KCHA 1UTIA 3OA6A 4AMCA 3M0SA 2DBKA 4M75A 3CD6T 1WNLA 4LE9A 2L2PA 1ZBJA 4KT0E 3BDLA 4F04B 3TREA 1QLYA 2M51A 1VQNA 2E6NA 2KNBB 2MIOA 5M9OA 3DB3A 3SWNB 1WFWA 3HKSA 4IIOA 2C0TA 4D8DA 3E2UA 2RHXA 4TVRA 4M7AD 2COYA 2P4RA 3EG2A 4PJMA 1VIEA 5KYWB 3JB9G 3EFRA 3VS7A 1QVPA 2RI2A 3S3NA 3M0PA 1OX8A 1W1FA 2QQAA 2XDPA 5CQYA 3C95A 2RO0A 3ZBDA 4JJNK 3CD6A 5CKHA 3SDZA 4LUEA 5CAIA 1YFNA 2EW3A 2OAUA 4RTUA 3H0FA 3P8BB 1TTHB 3L1AA 2FZGB 3C94A 1M2VB 2IIMA 2EWNA 2KRNA 2A0FB 4C5IA 2RNAA 1WHLA 3KFVA 5DY9A 2QEXT 4M7DA 3EHRA 2GTOA 1Q86U 1VQ4Q 1MHNA 5L8RE 4PNOA 2AHJB 3JCMe 2ZZDA 2K5IA 3HRUA 1NEBA 1QP3A 1MNEA 3S3OA 3MHXA 1H8KA 5GMKm 4OF1A 2QXFA 2X3WD 4JRKA 4BY6B 2GF7A 1V76A 4DBQA 4AG2C 3AHUA 2JTFA 4X34A 1K73C 3OBWA 4N4IA 4M78F 2PU9B 1Q7YR 4C0DB 4C5GA 1M27C 3JB9H 3JCMg 2DVJA 1YNZA 1RAEB 3OBYA 2QEXA 3VUBA 1JQQA 2RF0A 2RI5A 2CDTA 1B34B 1TSFA 2EGEA 2DE0X 4HT9A 2BUDA 1M1GA 1LPLA 3OSSC 1T3SA 1JJ2S 4BY6C 2DTOA 2AK5A 2BZ8A 1ZSGA 2EGCA 2DL3A 2QASA 2LJ1A 1OOTA 1Y96A 2LQKA 2HQEA 3I5SA 3RDVA 4IIMA 1KD1R 4YTLA 4C0FA 3EFOB 3J7AF 4FIBA 2KMTA 3RKWA 2QGFB 1QVFA 1NPPA 2RQWA 4C92F 2V8IA 3CPWA 1V29B 5AT1B 1FWZA 1IB8A 3M58A 1NZ9A 1B07A 3QO3A 2EBPA 2OX7A 2QQ9A 2NUTA 2D8JA 2GQIA 4XU3A 3VS6A 1OYXA 2CP6A 2HSPA 2E41A 4NS5A 2ZPEB 3JB9J 1VOMA 4BB7A 3PIPA 4RMOA 2RK2A 3LWIA 2RN8A 1UDLA 3HTRA 5GANe 3GPLA 3CCQQ 2DERA 4HKEA 2RJCA 2FRWA 3MP6A 2L5QA 3L2WA 2ROTA 5GMKe 1ZA1B 3VRZA 1F1BB 4IKFA 5D6YA 4L6V5 2LDMA 1CKBA 1YWPA 3BW1A 4E7IA 1SKUB 3O5ZA 2XHCA 1Q7YC 1GRIA 2MI6A 2RJEA 5KYUA 2O4XB 1RUWA 1ZSZA 3T9NA 1H92A 1N27A 5LJ5d 3BDUA 1WPYA 2E3IA 3OS0A 3JCMh 1GFDA 3X25B 4L59A 1UGSB 3A8GB 2B86A 2IG0A 1RABB 1I81A 5GAOl 2KT8A 3JV3A 2ABLA 4PFOA 1KC8R 4PJOE 4C0GA 2PUKB 4J9DA 2HKQB 5I2SA 4J6YA 2GCXA 1KD1C 3BFMA 4M7AB 1PKTA 2M02A 2MK5A 1MUZA 2NWMA 3M57A 4M78A 1WQWA 4C8QE 2K6DA 3UWNA 4N4GA 1WZOA 1NLPC 1UG1A 4J9HA 4QQDA 2VKNA 4ZN1A 4JJDA 2KY9A 4A4FA 5DLQE 1NJIU 4BE2A 2A7YA 2CH4W 4M7AC 4K11A 2DO3A 2LCLA 2HBWA 1M1FA 3RMQA 3EH1A 4M75B 2J7IA 4RKUE 3RERA 4JZ4A 3ZEHA 1EIFA 1SSFA 4QQ6A 1AZGB 1GCPA 2ROLA 4RTWA 4XTZA 1VQ9Q 1SRLA 2QDYB 4E7LA 3CCRT 1N8RR 4C92A 2K79A 4RG2A 1BI2A 2DVEA 1VQOT 1YHQT 1XQHA 1G8XA 2RQTA 3QYHB 2G6FX 1NEGA 3VYHB 3OYFA 3SWNA 4M75C 1W2BP 2VVKA 1X2KA 1VQ8T 4J6WA 2K5FA 4ELYC 1IREB 3OYBA 5KYXA 5GANd 1UGVA 4RTTA 1TUCA 4ME7A 4X1VA 5C6SA 2PVGB 2ZCFB 5CIUA 2DL5A 2DXUA 5GMKh 4M77F 4M7AE 2XI9A 3BE3A 3RR6A 3EG0A 4LDWA 2CS7A 3FC3A 3CCRA 1ZQ1A 2RI3A 1RLPC 1KQSA 2DNUA 2AKLA 1LCKA 3OYLA 2YRCA 5GAMj 3I56T 2KGTA 1VQOA 2GBQA 1YHQA 4GBQA 2MAMA 1RAGB 4M7DB 2J6OA 3CCUQ 3V7CA 2J06A 3JCMJ 2XD0A 3CCMT 2EPDA 1VQ8A 1UGRB 3JB9F 2F2WA 4C92D 4OB1B 3QZ9B 2F2XA 4DOWA 2EYQA 3CMEQ 1A0NB 2P84A 3PE0A 3FEOA 2JXBA 4BDYA 4KGXB 3H6ZA 3UF4A 5GAOm 1U8RA 4MZPA 3VUZA 1H3HA 2MYSA 5FW9A 2XG8D 4O5VA 5LJ3e 4C5EA 2A37A 1TU0B 2O88A 4M7DC 2EJGA 3L42A 2EJFA 2EIFA 3I56A 4EMKB 4JJBA 2XK0A 2E12A 1VQNQ 1AEYA 4HCZA 4FSXA 5ECAA 3CCMA 3MP8A 3P8HA 1D3BA 1Y57A 2GGRA 1BU1A 5GAMg 1FMVA 1N8RC 1CSKA 2VXEA 4LDUA 3LGFA 1IXDA 1OZ2A 1Y96B 4FSSA 1YJ9T 1V1CA 1WJSA 3GP8A 1RL2A 2MMPA 3CD6Q 3URGA 1S72T 1M90R 2P0PA 2JMCA 2KBTA 2QQSA 4OB3B 1FMKA 2EVRA 1GL5A 2I2LA 4DBFA 5EC7A 5KH6A 4OMNA 4CI0C 1HK9A 2F2VA 4IUVA 2NUTB 2NUPB 3QJYA 1E7OA 2XKOC 2LVMA 3EH2A 2LJ0A 1MMGA 4JZ3A 1R0CB 5CKEA 4X9CA 1N6AA 4FYVB 1KQ2A 4OGEA 3RMSA 2L3QA 2A36A 1YJ9A 2EKOA 3RUXA 2LT1A 2W10A 1S72A 1QVFS 2GFAA 3NTKA 3MKDA 3CPWS 3ER0A 2FB7A 2JVVA 1RI9A 2V1RA 3CCET 4D8KA 2MOXA 1Q81C 2LCSA 4M77A 2LMJA 4IUPA 1GXIE 4MMLA 2QEXQ 5L23A 2RB6A 1U06A 2RD1A 8AT1B 1BKBA 5KYUB 3VS5A 1ZSZB 4IUTA 1RAHB 2LNHB 1PD0A 4KGZB 1KHCA 1RAAB 2H8HA 3OYHA 3OS1A 2LCCA 2SRCA 2ZPHB 2CP0A 3CPFA 1YBYA 1K8AC 2KEAA 4CC3A 4A4EA 3CXCP 3CCEA 5LJ3d 3CMET 2KAFA 2XDDA 4E47A 3CMAT 1R8OB 5D6WA 1ZSZC 2AKKA 2A3LA 2DMOA 1PG5B 4M78B 2JT4A 1Q82U 4V2SA 3CBOA 4QKUA 1K0SA 3HFNA 2DEUA 3EAEA 4E7SA 2ZPGB 1QQJA 4RCBA 1WX6A 1M1KC 2KRSA 4B9WA 1WDXA 2C06A 3MEVA 1UECA 2DK3A 4M77D 3VS2A 5CKDA 3A1PA 3G7ZA 1QCNA 4ZTJA 2BE9B 1E6GA 4F7UB 3L2ZA 1OPLA 5A2QE 1OU9A 4Y92A 3C0CA 1AD5A 2HCKA 4M78C 2ZGWA 2RQVA 4PJOG 3CCLT 4OMPA 3CMAA 4ZNXA 2GNCA 1K73R 5GAMf 4A54A 3A5ZB 2VV5A 4PFPA 4ELZC 1UB4A 2D0QB 4C92B 2F69A 2M1HA 3OS2A 4C8QG 2ZPBB 4XTXA 3O8VA 5I22A 4J9IA 2YUOA 1G3TA 1R0BG 1JB0E 2EYXA 1OQKA 1YJWQ 3A8OB 1M9SA 2DTHA 2WSFE 4WF2A 2RPNA 2JM9A 1MGQA 2L3SA
chains in the Genus database with same CATH topology
3CCST 1U1SA 5FU6C 4XU3A 3JAME 3OYCA 1OYXA 4DA4A 3CCLA 4IUUA 1ZHIA 2E41A 4JDSA 2ZPEB 4NS5A 4D6WA 4VUBA 2HAXA 3JB9J 2VYTA 4Y28E 4BB7A 4C92C 1PSFA 3CCJT 3QIIA 3CC2A 4JS5A 4UC4A 3X28B 3PIPA 2RHYA 3QYGB 4RMOA 2RK2A 3M4GA 3X24B 4C8QA 5IT9E 3LWIA 1Y71A 3INZA 2DEQA 5GANe 3GPLA 4HKEA 3FDRA 5GANh 2DXBA 4J7IA 2XIDA 2RJCA 3JRZA 3QKJA 3JCMQ 4XTWA 3MP6A 3SWNC 5GAOn 2JZ2A 2L5QA 3L2WA 2K3YA 5GAN8 2EQMA 5GMKe 4DQ2A 4LDYA 2DZCA 1K8AU 2ZPFB 1X6OA 2EQKA 3E1SA 1BIAA 1H641 1I4K1 3OSVA 4XU1A 5D6YA 4J83A 2L8DA 4L6V5 3JCMc 2OTLA 3S3MA 3X20B 2LDMA 4JRPA 2VXFA 4N0AA 2LNVA 1KC8C 4BE0A 4C0ZA 5FRNA 2QQBA 3PFSA 3CCQT 3OY9A 4M75D 3CCSA 3QG1A 2HQXA 2KK4A 3V7RA 2DXCA 3BW1A 4E7IA 1W2BS 5LJ5j 4LDVA 2XHCA 1FXXA 3G4ST 2MI6A 5LJ3j 1Q7YC 3OB9A 5IN1A 2RJEA 2CZ0B 2O4XB 1BI3A 2LQ8A 3CCJA 2EJ9A 2F5TX 2JNGA 2RHIA 3RKXA 3T9NA 2K57A 2JUFA 1K9MC 5IAYA 5GAMh 4ZN3A 2EAYA 1N27A 1WGSA 3HL8A 3BDUA 5LJ5d 1K73U 1WPYA 3OS0A 3JCMh 1WJRA 3LW5E 3A8MB 1UGPB 2Y4XA 3X25B 1M1KU 4J6XA 4L59A 1UGSB 3A8GB 3SFMA 1KQSS 3JB9I 4M7AG 2IG0A 4FL6A 1I81A 4C92E 5GAOl 4A4GA 2E70A 3DLMA 2DIQA 4PJOE 4C0GA 2PUKB 1I8FA 2KQWA 4N4HA 4OP0A 3TEEA 4F7UG 5FRMA 3M4YA 4X9DA 1BYMA 5GAOr 3A8LB 3V8JA 2DXTA 5CCAA 3L2RA 1JJ2A 5I2SA 3OYMA 2X4JA 2GCXA 4J6YA 1KD1C 1D3BB 3BFMA 3QDRB 4M7AB 3CCQA 4EMKA 2CZ7B 2HNIA 4XAXB 2BKDN 4Z02A 5CK9A 3OYEA 1VQ5T 4JUVA 4M78A 2VGMA 3M57A 4XTUA 2FHDA 4XU2A 1WQWA 2WACA 4C8QE 2CYZB 4IURA 3G4SA 5GAN5 1FX7A 3CBMA 2M16A 3M54A 4N4GA 3UWNA 4M7AF 5A0DA 2HBPA 5I2MA 1K9MU 2QI2A 3MCAB 3JCMb 2E1HA 2NLUA 2YLBA 4QQDA 4XTVA 1M8VA 1H3ZA 4FU6A 4F7UF 4ZN1A 1WQ7A 5LJ5g 1LNXA 2KY9A 4MMKA 5FROA 5LJ3g 5KE3A 4M75G 3JCMW 1I5LA 3OMGA 3HHTB 3VU3C 4A4FA 1B34A 2VGNA 3JSCA 3V7SA 5DLQE 2CZ1B 1NJIU 3LWHA 3JB9D 1VQLT 4QVDA 3L2QA 4BE2A 4M7DD 4C0DC 2CKKA 3UT1A 2A7YA 5GAN3 2F5KA 5CKBA 3CEYA 1QVGA 4M7AC 2M0OA 3CC4T 3JCMX 5EG2A 2DO3A 4BDZA 4HT8A 1QP2A 2IVWA 2LCLA 1M1FA 3RMQA 4B9XA 5CQXA 1RI0A 4M75B 4RKUE 1O75A 1XNIA 3RERA 1KHIA 3ZEHA 5J39A 2X4XA 4QVCA 4LD6A 1VQ5A 1EIFA 1SSFA 4QQ6A 3C12A 3A8HB 4O6JA 2VUBA 1P92A 3NTIA 4M75F 4L5GA 2PUOB 4XTZA 3TCJA 4GLKA 3KXTA 5LJ3f 2PQWA 2QDYB 3FRNA 3CCRT 4E7LA 3E9GA 4C92A 5D6XA 4RG2A 1N9SA 1TH7A 3P8DA 4J7FA 3META 1BI2A 1VQPT 1G3SA 4BI4A 3F70A 1M4ZA 3M56A 1IZ6A 2L89A 2DVEA 3GF5A 3MEUA 1PSEA 2Y90A 5HY6A 5J26A 4M77G 2R57A 1VQOT 1YHQT 3HSBA 1XQHA 2K3XA 3RIRA 1YIJT 4OB0B 3QYHB 3VYHB 5GAOp 3OYFA 1VQLA 1X01A 4OVAA 4OB2B 5A0GA 3SWNA 1VQ9T 4CRIA 1YJWT 4M75C 3M53A 3LX7A 2R5AA 1G3WA 1VQ8T 3CC4A 4J6WA 4M78E 3OYAA 1KC8U 2K5FA 4ELYC 1AHJB 1IREB 3OYBA 4IKFA 4JLIA 5GANd 4M77B 1N9RA 3X26B 1W2BA 4ME7A 2FVUA 5C6SA 2PVGB 2ZCFB 1Q7YU 5CIUA 5I21A 1NE8A 2V8JA 3HP9A 2ZPIB 3NTHA 2DAQA 4QW2A 2DXUA 4BE1A 3N5BB 4M77F 5GMKh 2XI9A 4M7AE 1JRIA 4MDXA 4LDWA 2H3JA 2VC8A 2CS7A 3ME9A 4FM4B 1LJOA 3OS5A 4FT2A 4MZMA 3FC3A 3CCRA 2P0QA 1ZBXA 1ZQ1A 2RI3A 3EFSA 3OQ5A 2RHUA 1KQ1A 1UEBA 3QZ5B 3MEWA 3G6ET 1VQPA 1YI2T 2X4WA 4F7UE 1KQSA 2KSSA 3DB4A 5A0LA 4LD9K 3OYLA 5GAMj 3FB9A 3I56T 1VQOA 5CKFA 1YHQA 2LTOA 3SD4A 2MAMA 2MF2A 1YIJA 4M7DB 5GAN2 2QQRA 3V7CA 2WSCE 4E7KA 3JCMJ 3PGGA 3OYYA 2QA4T 2XD0A 4EMHA 1Y7XA 3GLXA 5DM7R 4KBMB 3CCMT 4Y91A 4ZTFA 5GAMd 1VQ9A 4KUDK 4M77C 3OYJA 1YJWA 5GAOq 1VQ8A 3JCMd 1UGRB 2R58A 1XOVA 2EQJA 3DKMA 3VJPA 2QTXA 1BI1A 4C92D 4EPCA 4OB1B 3QZ9B 4R56A 2D9TA 3OW2S 2M9UA 1VQMT 1KD1U 4DOWA 1W4SA 2EFIA 2EYQA 5LL6S 4PJOD 5HKCA 3FEOA 3RKYA 4PKCC 4BDYA 5KCOA 2DTIA 3H6ZA 2K5LA 4ZGDB 2O4XA 4JLGA 3CCUT 4GY5A 1VQ7T 3PT9A 3E9FA 1VUBA 5FU7B 5GAOm 3OYNA 4JS4A 1U8RA 4MZPA 4A53A 3C4SA 3VUZA 3WVEB 3VKIA 4QQGA 5LJ5e 2XG8D 3GOXA 2O01E 4O5VA 4C5EA 3VV0A 5LJ3e 3JCMP 4MZTA 5LJ3h 2B8AA 5GMKl 4C8QD 2LC4A 3FIFA 2EJGA 3ASKA 1YI2A 4M7DC 4J8OA 3LYIA 3WXMB 2YHTA 3L42A 3J81E 4XU0A 2EJFA 2EIFA 3QPHA 3I56A 4EMKB 3NFCA 1U1TA 3OYDA 3RESA 2XK0A 4J5YA 2G3RA 2E12A 2RH2A 3FJPA 5GAN7 4LDXA 1OI1A 2JOYA 1M90C 4HCZA 2RJFA 2QA4A 4E7HA 1Q86C 4FSXA 3CCMA 3MP8A 3P8HA 5GAN4 2RM4A 1D3BA 4XTYA 3L2UA 3G6EA 4M7AA 5GAMg 5HK0A 1N8RC 1VQMA 2RK1A 2VXEA 5FU7C 3GNGA 3KUFA 4LDUA 2Y4YA 3J80E 4BD3A 4RCCA 2GQVA 4F7UA 3DLLA 3LGFA 3CXCS 1Q82C 3QBYA 3SB2A 4A4KA 1VQNT 1OZ2A 3CCUA 1Y96B 1VQ7A 4M77E 4XQ3A 2DD4A 4HCCA 4DOVA 1UGQB 1YJ9T 4ATOA 1VIFA 1WJSA 3QHSA 1BIBA 3V8KA 1QW1A 2PVOB 3GP8A 1DJ7B 1RL2A 1HXDA 4OGCA 3JB9F 2MMPA 2V8KA 3URGA 1S72T 3CCVT 2P0PA 3CMEA 2QQSA 2CZ6B 4OB3B 4RG8A 1KG1A 2E10A 4BI8B 1G3YA 2I2LA 4IUQA 5KCHA 5LJ5f 3CBPA 3OMCA 3OA6A 2PVDB 5KH6A 2EQUA 2E65A 2JTMA 4CI0C 1HK9A 4IUVA 4NL3A 4M75A 5HK3A 1X75C 5GAN6 2MWOA 1NPRA 3QJYA 3CD6T 4PJOB 2E5QA 1WNLA 2XKOC 2LVMA 3M9QA 4FT4A 3MEAA 4KT0E 4HCBA 4M78D 4KUIA 3BDLA 3TREA 5CKEA 2LX9A 4PJOF 4X9CA 5GANj 2OTJT 1N6AA 1VQNA 2E6NA 3S6WA 2RHZA 4PLLA 3V8LA 5CVIA 4OGEA 5M9OA 1KQ2A 3QSUA 1VQ6T 3RMSA 4JRIA 3DB3A 1YJ9A 3SWNB 3HKSA 2YLCA 4E7JA 4C8QB 2EKOA 3RUXA 2BIVA 2R5MA 5GMKj 2RHXA 2LT1A 3ZFJA 4TVRA 1S72A 3CCVA 4M7AD 1QVFS 2GFAA 3NTKA 3QUIA 4OMFB 1VIEA 4C8QF 3CPWS 3ER0A 3JB9G 2FB7A 4M7DG 2JVVA 3EFRA 1QVPA 2RI2A 2X35A 3S3NA 3PMTA 4C5HA 4R55A 4PJOC 2E64A 4II1A 4MDWA 2QQAA 3CCET 2XDPA 3LLRA 5CQYA 1Q81C 3C95A 3OW2A 4M77A 2RO0A 4NL2A 2DPPB 3ZBDA 4JJNK 2LT4A 4IUPA 5CKHA 2FL7A 3QJ6A 4MMLA 3CD6A 1GXIE 2RA2A 3SDZA 3OYGA 2X4YA 2KDSA 2RB6A 2DZ9A 4EDUA 3Q1JA 5CAIA 2RD1A 2OAUA 1BKBA 4C8QC 2OTJA 3HRTA 3WVDB 3P8BB 3L1AA 1VQ6A 3C94A 4IUTA 3MO8A 2EWNA 5C0MA 4C5IA 4JRQA 1O9SA 1KHCA 3HFOA 4Q5WA 5DY9A 2QEXT 3OYHA 2JN0A 5GANg 3OS1A 4M7DA 2LCCA 3PIOA 4BACA 2ZPHB 4P5NA 4PL6A 4M78G 4M75E 1M90U 3CPFA 2XICA 3M59A 1Q86U 2K4YA 4PLIA 1YBYA 4N0AC 1MHNA 5GAMe 1K8AC 3CC7T 5L8RE 1VQKT 4PNOA 2AHJB 5LJ5h 1WJQA 2WSEE 2ZZDA 3JCMe 4A4EA 2K5IA 3CCEA 3HRUA 5LJ3d 2KVQG 1QP3A 3R6OA 4BUGA 3HRSA 3UPUA 3CMET 3S3OA 2KAFA 3MHXA 2XDDA 1YITT 1N8RU 4E47A 5GMKm 2FYKA 3JCMV 3CMAT 1R8OB 5D6WA 2A3LA 1LOJA 3CXCA 3LH0A 3MP1A 4OF1A 2QXFA 4HA8A 4M78B 2L3RA 5CO7A 4JRKA 4BY6B 2GF7A 5FLXE 2DIGA 1Q82U 3CBOA 4V2SA 3FLGA 3VYGA 4NOYA 3HFNA 1VQ4T 3AHUA 3G71T 1YCYA 2JTFA 3EAEA 4X34A 5DLOA 2ZPGB 3QXEB 5GANf 1K73C 1G5VA 3OBWA 4N4IA 4M78F 2P0KA 3I55T 2PU9B 4RCBA 4C0DB 4C5GA 3JB9H 1M1KC 3JCMg 4B9WA 2C06A 5AYFA 3MEVA 4M77D 2DK3A 5CKDA 1M5Q1 3OBYA 2QEXA 1YJNT 2XU8A 3BY7A 3VUBA 2RI5A 3G7ZA 5J3BA 1B34B 3PNWC 4ZTJA 4HT9A 2BUDA 4F7UB 4A4HA 3L2ZA 1M1GA 3M5AA 3UDCA 1JBMA 5A2QE 3E19A 3CC7A 3PMIA 1VQKA 4EMKC 3OSSC 4C92G 2HD0A 1JJ2S 2DD5A 4M78C 2YRVA 4BY6C 2DTOA 2ZGWA 3KBGA 4PJOG 3CCLT 3TU4K 1YITA 2K2VA 2GFUA 5KE2A 2D6FA 3GIBA 1BI0A 3CMAA 3CC2T 2P4TA 1Y07A 4BI3A 3PTAA 1Y96A 5GAMf 5FU6B 4A54A 2LQKA 2HQEA 3A5ZB 3JCMf 4M7DF 4EMGA 1OZ3A 2VV5A 3M55A 4YTLA 4C0FA 4ELZC 1UB4A 2MWPA 3G71A 1VQ4A 2D0QB 4C92B 2F69A 4M7DE 2M1HA 2XDBA 2DJZA 3J7AF 3OS2A 4C8QG 3I55A 3H8ZA 3HPWA 2E6ZA 2ZPBB 4XTXA 4FIBA 2KMTA 3RKWA 3O8VA 2LRQA 4ZGEB 1QVFA 1G3TA 1NPPA 4C92F 2V8IA 3CPWA 1V29B 4ZGJB 1JB0E 2CGHA 5CR2A 3OYKA 1FWZA 3LGLA 1YJNA 5GMKi 1NJIC 3M58A 1NZ9A 4KULA 1XTDA 2RJDA 3QO3A 4QVZA 3OYIA 3A8OB 1M9SA 2DKGA 2DTHA 2QQ9A 2WSFE 4WF2A 1QVGS 2OTLT 1Q81U 4XK8E 3GNFB 3L2VA 4PJOA 1MGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CKK A;  3UT1 A;  3OYC A;  2F5K A;  3LYI A;  3CEY A;  3L42 A;  1OYX A;  2M0O A;  4IUU A;  4NS5 A;  4IUT A;  3OYD A;  4BDZ A;  3MO8 A;  2XK0 A;  2G3R A;  2VYT A;  4B9X A;  4C5I A;  5C0M A;  1OI1 A;  3QII A;  1RI0 A;  4HCZ A;  4UC4 A;  1XNI A;  2RJF A;  4E7H A;  1KHC A;  3ZEH A;  5J39 A;  4Q5W A;  2RHY A;  2X4X A;  4LD6 A;  3MP8 A;  3P8H A;  3OYH A;  3OS1 A;  2LCC A;  1SSF A;  4QQ6 A;  3L2U A;  4BAC A;  4PL6 A;  3NTI A;  3FDR A;  2PQW A;  4PLI A;  4E7L A;  2RJC A;  1MHN A;  3E9G A;  3QKJ A;  5D6X A;  3KUF A;  4RG2 A;  1WJQ A;  3MP6 A;  3P8D A;  4A4E A;  4BD3 A;  3MET A;  3LGF A;  2JZ2 A;  3QBY A;  3L2W A;  2K3Y A;  3F70 A;  1OZ2 A;  2EQM A;  3S3O A;  2L89 A;  3MEU A;  5J26 A;  2EQK A;  2R57 A;  5D6W A;  2K3X A;  4IKF A;  5D6Y A;  1WJS A;  2L8D A;  3LH0 A;  3MP1 A;  3S3M A;  2LDM A;  2L3R A;  3OYF A;  2GF7 A;  4BE0 A;  2DIG A;  5FRN A;  3FLG A;  3PFS A;  4OVA A;  3OY9 A;  4CRI A;  2QQS A;  2HQX A;  2JTF A;  3EAE A;  3LX7 A;  2R5A A;  4X34 A;  4E7I A;  1G5V A;  3OYA A;  4N4I A;  2P0K A;  3OB9 A;  5IN1 A;  4IUQ A;  5KCH A;  2RJE A;  4C5G A;  3OYB A;  2O4X B;  4B9W A;  3OMC A;  3OA6 A;  2RHI A;  5KH6 A;  2EQU A;  3MEV A;  5IAY A;  1N27 A;  1WGS A;  5C6S A;  3OS0 A;  4IUV A;  1WJR A;  2RI5 A;  5CIU A;  3PNW C;  4QW2 A;  3NTH A;  2DAQ A;  4ZTJ A;  2MWO A;  4BE1 A;  2BUD A;  4L59 A;  4A4H A;  2E5Q A;  3M9Q A;  2LVM A;  3ME9 A;  3L2Q A;  3MEA A;  2IG0 A;  4FL6 A;  3FC3 A;  3PMI A;  3OQ5 A;  2RI3 A;  4A4G A;  2RHU A;  3MEW A;  3BDL A;  3DLM A;  2DIQ A;  2X4W A;  3Q1J A;  2YRV A;  5FRM A;  2E6N A;  3DB4 A;  4N4H A;  2RHZ A;  4PLL A;  3S6W A;  3OYL A;  5M9O A;  2GFU A;  5KE2 A;  3DB3 A;  2LTO A;  3SD4 A;  3L2R A;  3OYM A;  4E7J A;  2QQR A;  2EKO A;  4E7K A;  2HQE A;  2BIV A;  2R5M A;  2RHX A;  4Z02 A;  1OZ3 A;  4ZTF A;  2BKD N;  3OYE A;  2GFA A;  2MWP A;  3OYJ A;  3NTK A;  2FHD A;  2R58 A;  2EQJ A;  2M1H A;  2WAC A;  4IUR A;  3OS2 A;  2D9T A;  3H8Z A;  3UWN A;  2M16 A;  4N4G A;  2EFI A;  2RI2 A;  2X35 A;  3O8V A;  2LRQ A;  3PMT A;  3S3N A;  4C5H A;  3FEO A;  4II1 A;  4BDY A;  5KCO A;  2XDP A;  3H6Z A;  3LLR A;  3OYK A;  2NLU A;  2O4X A;  4QQD A;  3LGL A;  1H3Z A;  4FU6 A;  4GY5 A;  2RO0 A;  3E9F A;  3OYN A;  2RJD A;  5FRO A;  3C4S A;  4QVZ A;  5KE3 A;  4IUP A;  3OYI A;  3QJ6 A;  4QQG A;  3OMG A;  4A4F A;  3GOX A;  4C5E A;  3OYG A;  2X4Y A;  3L2V A;  4EDU A;  2B8A A;  4BE2 A;  3ASK A; 
#chains in the Genus database with same CATH topology
 3CCS T;  3OYC A;  5KYX B;  3CCL A;  1QKX A;  4IUU A;  1Q95 G;  4F14 A;  4C92 C;  3CCJ T;  3QII A;  2HQH A;  1M8M A;  1VA7 A;  2RHY A;  1IHV A;  5KYY B;  5IT9 E;  1Y71 A;  2D0N A;  1JXM A;  4Z89 A;  1W6X A;  3JRZ A;  4WTO B;  3SWN C;  5GAO n;  1E6H A;  2K3Y A;  2L3P A;  5IHN A;  2ZPF B;  2HKN A;  1BIA A;  3OSV A;  3H0I A;  4XU1 A;  4Z8A A;  3JCM c;  4J83 A;  3EG3 A;  2VXF A;  4N0A A;  2LNV A;  4A63 B;  4C0Z A;  2QQB A;  4HCK A;  3H41 A;  5FRN A;  4M75 D;  3CCS A;  3QG1 A;  2DXC A;  2DET A;  2O9S A;  5IHI A;  5LJ5 j;  3G4S T;  1FXX A;  3NGP A;  1JO8 A;  2CZ0 B;  3CCJ A;  2RHI A;  4CC7 A;  1WGS A;  3HL8 A;  1BBZ A;  3A8M B;  4LUD A;  1SG5 A;  3M0Q A;  3SFM A;  1D0Z A;  1KQS S;  2IPO B;  2OI3 A;  2O2O A;  4M7A G;  4C92 E;  4A4G A;  1B7T A;  4B6M A;  2E4H A;  4RTV A;  5FRM A;  2HMA A;  4N4H A;  4OP0 A;  4WCI A;  3M4Y A;  1BYM A;  5GAO r;  2CSQ A;  3MPU B;  1D3B B;  3QDR B;  1MMA A;  4EMK A;  4Z02 A;  2HNI A;  2K2M A;  2BKD N;  5GJV B;  1VQ5 T;  2WAC A;  3G4S A;  4AT1 B;  5GAN 5;  1WHG A;  2M16 A;  5A0D A;  1JEG A;  1K9M U;  1R77 A;  2NLU A;  5GJW B;  1H3Z A;  2DJQ A;  4FU6 A;  4F7U F;  5LJ5 g;  1X43 A;  2EQI A;  3JCM W;  1I5L A;  4M75 G;  4M7D D;  3FJ5 A;  4QVD A;  4C0D C;  3UA6 A;  3CCR Q;  4EIK A;  1QVG A;  5EG2 A;  3QWY A;  4BDZ A;  1QP2 A;  1NYG A;  1XNI A;  1WA7 A;  1KHI A;  1VQO Q;  1YHQ Q;  2LP5 A;  2D1X A;  4LD6 A;  2KI7 A;  1Q86 R;  1VQ5 A;  3R6N A;  3C12 A;  3A8H B;  4E2F B;  3TCJ A;  1HD3 A;  2EKH A;  1PRM C;  2PQW A;  1NLO C;  1VQ8 Q;  2NUP A;  3P8D A;  1VQP T;  3MET A;  1EFN A;  3F70 A;  4FW1 A;  2EYW A;  2RQR A;  2Z0W A;  2Y90 A;  5J26 A;  2R57 A;  1YIJ T;  4OB0 B;  1AT1 B;  4OVA A;  1K1Z A;  4OB2 B;  1YJW T;  3M53 A;  2R5A A;  2EGA A;  3OYA A;  1KC8 U;  4JLI A;  1LVK A;  4M77 B;  3VRY A;  1W2B A;  1RAI B;  3I56 Q;  2JMA A;  3M0T A;  5I21 A;  4KH1 B;  1NE8 A;  2CP5 A;  2DRK A;  1ABO A;  3N5B B;  3CCM Q;  2VC8 A;  4FT2 A;  3OS5 A;  4MZM A;  2P0Q A;  3OQ5 A;  3EFS A;  2RHU A;  1KQ1 A;  1UEB A;  1VQP A;  2FG0 A;  2KSS A;  4J9B A;  2DYB A;  2FRY A;  1YIJ A;  2E5K A;  5GAN 2;  2WSC E;  3PGG A;  3OYY A;  5HCK A;  2QA4 T;  5DM7 R;  4KBM B;  1CKA A;  1TG0 A;  4M77 C;  2LZ6 B;  1YJW A;  4PFZ A;  5GAO q;  3JCM d;  2R58 A;  3EGD A;  4R56 A;  2M9U A;  1VQM T;  1W4S A;  1Y0M A;  3RKY A;  1GCQ C;  1HJD A;  1B3Q A;  4ZGD B;  4MDX A;  1SSH A;  3C4S A;  1QWF A;  4QQG A;  2KYM A;  3IQL A;  2O01 E;  3JCM P;  4MZT A;  3I55 Q;  3FIF A;  4J8O A;  1RLQ C;  3LYI A;  3WXM B;  4XU0 A;  3RES A;  1HSQ A;  2JOY A;  3EG9 B;  1WIE A;  2QA4 A;  1Q86 C;  1YJ9 Q;  2OAW A;  1UFF A;  1ZUU A;  2CH4 A;  1HYO A;  5HK0 A;  1PCX A;  1S72 Q;  1VQM A;  2RK1 A;  1ZA2 B;  2FZC B;  2W0Z A;  1QVG P;  3GBQ A;  3GNG A;  3KUF A;  4RCC A;  4F7U A;  3DLL A;  3QBY A;  1Z9Q A;  1UJ0 A;  4M77 E;  2DD4 A;  4PJJ A;  1UGQ B;  1MV3 A;  2X9H A;  3V8K A;  1DJ7 B;  1D1A A;  1HXD A;  4OMM A;  4RG8 A;  1KG1 A;  5IXF A;  5LJ5 f;  1NYF A;  2HZY A;  3OMC A;  3EGX A;  2PVD B;  2I0N A;  2JTM A;  4NL3 A;  2ESW A;  5GAN 6;  1RAD B;  1NPR A;  2MWO A;  2VWF A;  3QDF A;  4M78 D;  4RTZ A;  2OTJ T;  2LX9 A;  4PJO F;  3QSU A;  3V8L A;  5CVI A;  4JRI A;  3CCE Q;  4E7J A;  2YT6 A;  1WHK A;  2BIV A;  2V26 A;  3ZFJ A;  1IGQ A;  3QUI A;  3NHN A;  3LH5 A;  8ATC B;  4C8Q F;  3OW2 P;  1PWT A;  1BK2 A;  5KYY A;  2VB6 A;  4C5H A;  2E64 A;  4II1 A;  4MDW A;  2QG9 B;  3RBB B;  3LLR A;  1WI7 A;  2J6F A;  2RMO A;  3VS0 A;  1MMN A;  2DPP B;  3TSW A;  1NJI R;  2LT4 A;  2FL7 A;  3EG1 A;  2AT1 B;  2RA2 A;  2KDS A;  2DZ9 A;  4EDU A;  4QT7 A;  2OTJ A;  3HRT A;  4DEY A;  2KYB A;  3MO8 A;  5C0M A;  3EHQ A;  4JRQ A;  1AVZ C;  1O9S A;  1D0X A;  1BCO A;  4Q5W A;  2DA9 A;  3CMA Q;  1PKS A;  3PIO A;  4BAC A;  1Q81 R;  4PL6 A;  4FYY B;  2JS0 A;  4M78 G;  4M75 E;  1M90 U;  2XIC A;  3M59 A;  2K4Y A;  4PLI A;  5GAM e;  4N0A C;  3CC7 T;  1VQK T;  2KVQ G;  4BUG A;  3UPU A;  1U5S A;  1YIT T;  3I5R A;  1SRM A;  3CQT A;  1LOJ A;  3CXC A;  3MP1 A;  2L3R A;  1M30 A;  1WXT A;  5FLX E;  4LN2 A;  4PK4 A;  4NOY A;  3G71 T;  1YCY A;  5DLO A;  4Z88 A;  5GAN f;  3I55 T;  1ARK A;  2E3H A;  3CCL Q;  5AYF A;  2YUP A;  1K8A R;  1M5Q 1;  1YJN T;  2XU8 A;  1I0C A;  1M2O A;  1VQL Q;  4A4H A;  3M5A A;  2BTT A;  3E19 A;  3CC7 A;  1MV0 B;  1VQK A;  4EMK C;  4C92 G;  2YRD A;  2DD5 A;  1YIT A;  3TU4 K;  2K2V A;  5KE2 A;  1BI0 A;  3CC2 T;  1Y07 A;  4BI3 A;  5FU6 B;  2CP7 A;  2CSI A;  1M1K R;  3D7S B;  4EMG A;  3M55 A;  3G71 A;  4M7D E;  2DJZ A;  3I55 A;  2YSQ A;  3H8Z A;  2E6Z A;  3CCS Q;  3AT1 B;  2LRQ A;  1GFC A;  1YJN A;  2CGH A;  2QGG A;  3OYK A;  3EGU A;  1NJI C;  5GMK i;  3CCJ Q;  1XTD A;  4QVZ A;  3OYI A;  5I11 A;  1QVG S;  4XK8 E;  1TWB A;  4PJO A;  2QTV A;  5FU6 C;  3JAM E;  1PNJ A;  4JDS A;  4D6W A;  4VUB A;  1KFZ A;  3CC2 A;  1PSF A;  4JS5 A;  4UC4 A;  1I5O B;  1IRX A;  3QYG B;  3M4G A;  1KSW A;  4C8Q A;  4E7Z A;  1KJW A;  6AT1 B;  1Z9Z A;  4PJN A;  2DXB A;  4J7I A;  2XID A;  3MJX A;  4F16 A;  3JCM Q;  1PHT A;  3G4S Q;  2JZ2 A;  2EQM A;  1K76 A;  3E1S A;  1I4K 1;  2L8D A;  4JRP A;  4BE0 A;  3EGD B;  3OY9 A;  3M0R A;  2ED0 A;  1AWW A;  1W2B S;  5IN1 A;  2XMF A;  1T0J A;  1BI3 A;  1K4U S;  2EJ9 A;  2F5T X;  1FYN A;  2DBM A;  2JNG A;  3RKX A;  5GAM h;  2EAY A;  3VS4 A;  1K73 U;  3LW5 E;  2YWW A;  2Y4X A;  4J9F A;  1VQ5 Q;  2CP2 A;  1UJY A;  2DYI A;  1JJ2 P;  3I35 A;  3DLM A;  2DIQ A;  2KQW A;  3TEE A;  2BE7 D;  3A8L B;  3L2R A;  2DX1 A;  3OYM A;  4AFQ C;  2A08 A;  4KGV B;  3REA B;  2CZ7 B;  3TVT A;  4IUR A;  3EG9 A;  3PVL A;  5I2M A;  2QI2 A;  1TUG B;  4FW2 A;  3MCA B;  1AWO A;  3JCM b;  1VYT A;  1TOV A;  2FZK B;  2AIR B;  4XTV A;  2DM1 A;  1ZUY A;  1WQ7 A;  1BB9 A;  3CCV Q;  5KE3 A;  3OMG A;  2QDL A;  2V1Q A;  1KK7 A;  1VQL T;  3JB9 D;  1PC0 A;  3L2Q A;  2YUQ A;  2AZV A;  5GAN 3;  2F5K A;  2M0O A;  3CC4 T;  3JCM X;  3EGX B;  2DL4 A;  1VQP Q;  4HT8 A;  4B9X A;  4AG1 C;  5CQX A;  1OV3 A;  1RI0 A;  1O75 A;  2J6K A;  5J39 A;  2K3B A;  4ORZ A;  1ZX6 A;  2X4X A;  4QVC A;  1YIJ Q;  4AFU C;  3H0H A;  2VUB A;  1P92 A;  4GLK A;  5LJ3 f;  3FRN A;  4RUG A;  1VQ6 Q;  1M4Z A;  1Q82 R;  2L89 A;  3GF5 A;  4M77 G;  2K3X A;  2DLP A;  2F1L A;  2LQN A;  1VQL A;  5A0G A;  2K9G A;  4CRI A;  3CC4 A;  4M78 E;  3UA7 A;  1AHJ B;  3X26 B;  1C6V X;  1Q7Y U;  1AWX A;  2HDA A;  2V8J A;  3HP9 A;  2QA4 Q;  4BE1 A;  2H3J A;  3ME9 A;  4FM4 B;  1LJO A;  1X27 A;  1ZBX A;  4JPB W;  1YI2 T;  1G2B A;  2X4W A;  4F7U E;  1VQM Q;  2H3E B;  4KH0 B;  4LNP A;  2ED1 A;  5A0L A;  4LD9 K;  3FB9 A;  1OUL A;  5CKF A;  2HSE B;  1TXQ A;  2MF2 A;  2QQR A;  1K0X A;  4EMH A;  4ZTF A;  4KUD K;  3OYJ A;  1YWO A;  3VS1 A;  3G6E T;  4EPC A;  2QTX A;  1BI1 A;  1KD1 U;  2EYZ A;  5HKC A;  4PKC C;  2DTI A;  1VQ7 T;  3E9F A;  1VUB A;  5FU7 B;  3OYN A;  4JS4 A;  3WVE B;  3VKI A;  5LJ5 e;  3H9N A;  2KT1 A;  3GOX A;  3VV0 A;  1ABQ A;  2B8A A;  1WLP B;  1FMW A;  2QAZ A;  1YI2 A;  2COW A;  2YHT A;  4RTX A;  3OYD A;  1T3L A;  1U1T A;  2YDL A;  2G3R A;  2RH2 A;  3FJP A;  1OI1 A;  1EZZ B;  3ZL7 C;  3SHW A;  4FCY A;  4E7H A;  1EX4 A;  2KXC A;  5GAN 4;  1RAF B;  2JJ9 A;  2RM4 A;  3L2U A;  3G6E A;  2C0I A;  1OEB A;  1GBQ A;  5FU7 C;  1NBE B;  2QYZ A;  3CXC S;  1Q82 C;  1VQ7 A;  4HCC A;  4DOV A;  4ATO A;  1VIF A;  3QHS A;  1WHH A;  2V8K A;  3CCV T;  3G1J A;  2PZ1 A;  1SF9 A;  1I07 A;  2E10 A;  2LJ3 A;  1G3Y A;  4IUQ A;  1YCS B;  2OTJ Q;  3CBP A;  2EQU A;  2HL5 C;  2E65 A;  2COZ A;  2A28 A;  2OTL Q;  5FWC A;  3SEM A;  1D1B A;  5HK3 A;  1SPK A;  1X75 C;  4PJO B;  2E5Q A;  2YXY A;  3M9Q A;  4FT4 A;  3MEA A;  1WYX A;  4HCB A;  1QCO A;  1TS9 A;  4KUI A;  4RTY A;  5GAN j;  3S6W A;  2RHZ A;  4PLL A;  1VQ6 T;  2ATC B;  2HL3 A;  1VYV A;  2YLC A;  1NG2 A;  4C8Q B;  2R5M A;  5GMK j;  3CCV A;  2DL8 A;  1K9M R;  2OJ2 A;  4OMF B;  4M7D G;  1X69 A;  2X35 A;  3PMT A;  4R55 A;  4PJO C;  3OW2 A;  3VS3 A;  2X51 A;  4NL2 A;  2O31 A;  3QJ6 A;  2DFU A;  3OYG A;  2X4Y A;  2DL7 A;  4KRT A;  1SHG A;  3Q1J A;  1SEM A;  2L0A A;  4C8Q C;  1M3B A;  2VAS A;  3CC7 Q;  3WVD B;  1VQK Q;  2J05 A;  1VQ6 A;  1RAC B;  1ACM B;  1IO6 A;  1YIT Q;  3HFO A;  2JN0 A;  5GAN g;  2MPX C;  2PTK A;  4P5N A;  1U3O A;  3G71 Q;  5LJ5 h;  1WJQ A;  2WSE E;  4DBR A;  4ANJ A;  2BZX A;  3R6O A;  3HRS A;  1N8R U;  4PJL A;  2FYK A;  3JCM V;  1YJN Q;  1PRL C;  3LH0 A;  5CO7 A;  4HA8 A;  2DIG A;  3FLG A;  3VYG A;  1VQ4 T;  2FEI A;  3QXE B;  1G5V A;  2D8H A;  2P0K A;  3REB B;  4OMO A;  1IGU A;  2HEQ A;  1UE9 A;  1ZLM A;  3BY7 A;  3CC2 Q;  1K9A A;  5J3B A;  2FO0 A;  3PNW C;  3NMZ C;  3UDC A;  1JBM A;  3I9Q A;  3PMI A;  1SHF A;  2M0Y A;  1J3T A;  3QWX X;  2HD0 A;  2YRV A;  5IHK A;  3KBG A;  2FPD A;  1UHC A;  3THK A;  1ZUK A;  3GIB A;  2GFU A;  2D6F A;  4J9C A;  2MCN A;  4DEX A;  3UAT A;  2P4T A;  3PTA A;  2CUD A;  2K7A A;  1QKW A;  3JCM f;  1QVF P;  1K9M C;  1OZ3 A;  2NYS A;  1VQ4 A;  2MWP A;  2CT4 A;  3CPW P;  3NPF A;  2ENM A;  2XDB A;  3RNJ A;  3HPW A;  4ZGE B;  4ZGJ B;  5CR2 A;  3LGL A;  4KUL A;  2RJD A;  1N5Z A;  2DKG A;  2OTL T;  1Q81 U;  3GNF B;  3L2V A;  1AZE A;  1U1S A;  4DA4 A;  1ZHI A;  2HAX A;  2KRM A;  1AWJ A;  1D09 B;  2VYT A;  4Y28 E;  1OPK A;  3X28 B;  5KYN A;  3X24 B;  2KXD A;  2DEQ A;  3INZ A;  4DBH A;  1WXB A;  3FDR A;  5GAN h;  2YUN A;  3QKJ A;  4XTW A;  5KYW A;  2O9V A;  5GAN 8;  4DQ2 A;  1I1J A;  4LDY A;  2DZC A;  1K8A U;  2CT3 A;  1X6O A;  9ATC B;  2EQK A;  1H64 1;  2OTL A;  2DIL A;  3X20 B;  3S3M A;  1KC8 C;  3PFS A;  3CCQ T;  2HQX A;  2KK4 A;  3V7R A;  4LDV A;  2CUB A;  2EYY A;  5LJ3 j;  3OB9 A;  2LQ8 A;  1M3C A;  2JM8 A;  2K57 A;  2JUF A;  2KR3 A;  5IAY A;  4ZN3 A;  2JW4 A;  1M2V A;  2KRO A;  1WJR A;  1WHJ A;  1X6B A;  1M1K U;  1UGP B;  2ZAE A;  4J6X A;  5FWB A;  1D0Y A;  3JB9 I;  3TSZ A;  4FL6 A;  2E70 A;  4R0K A;  1I8F A;  1QCF A;  4CC4 B;  4F7U G;  4X9D A;  2JTE A;  3V8J A;  2DXT A;  2LQW A;  5CCA A;  2RQU A;  1JJ2 A;  2C0O A;  2X4J A;  3CCQ A;  4XAX B;  1T0H A;  5IH2 A;  3OYE A;  5CK9 A;  4JUV A;  2VGM A;  4XTU A;  2FHD A;  4XU2 A;  4ESR A;  2CYZ B;  1FX7 A;  3CBM A;  3M54 A;  4M7A F;  2HBP A;  4HVV A;  1C1A A;  4OML A;  3CC4 Q;  1D1C A;  5IXB A;  2E1H A;  2YLB A;  1M8V A;  4JJC A;  1LNX A;  4MMK A;  5FRO A;  5LJ3 g;  3ULR B;  1TUD A;  3HHT B;  3VU3 C;  1B34 A;  2VGN A;  1YN8 A;  3JSC A;  3V7S A;  2CZ1 B;  3A98 A;  3LWH A;  1C0M A;  2CKK A;  3UT1 A;  2BZY A;  5CKB A;  3CEY A;  1PM3 A;  2IVW A;  2KE9 A;  1UUE A;  4HXJ A;  1JXO A;  1S1N A;  1VYU A;  4E6R A;  1OX9 A;  3PVQ A;  4O6J A;  1WHM A;  1QWE A;  3NTI A;  4M75 F;  4L5G A;  1QMC A;  2PUO B;  3KXT A;  2X3X D;  3E9G A;  5D6X A;  1N9S A;  1TH7 A;  3EFO A;  4J7F A;  1G3S A;  4BI4 A;  4OMQ A;  1UHF A;  3M56 A;  1IZ6 A;  1PD1 A;  5HY6 A;  3MEU A;  1PSE A;  3HSB A;  3TQ7 P;  3RIR A;  2ECZ A;  5D7U A;  5GAO p;  1X2Q A;  1X01 A;  4HVU A;  1VQ9 T;  3LX7 A;  3U23 A;  1G3W A;  1BCM A;  1NM7 A;  2FPE A;  4CC2 A;  1YI2 Q;  2QK0 A;  4M4Z A;  2PNI A;  1N9R A;  2FVU A;  4AFZ C;  2ZPI B;  3NTH A;  2DAQ A;  4QW2 A;  2SEM A;  2DRM A;  1KQS P;  1JRI A;  1WXU A;  3G6E Q;  3QZ5 B;  3MEW A;  3DB4 A;  2JS2 A;  2GTJ A;  2LTO A;  3SD4 A;  1VQ7 Q;  1W70 A;  1GCQ A;  4E7K A;  4J9G A;  1Y7X A;  3GLX A;  4Y91 A;  5GAM d;  1VQ9 A;  1XOV A;  3DKM A;  3VJP A;  2EQJ A;  4M7D F;  1G83 A;  1IHW A;  2D9T A;  3OW2 S;  2EFI A;  5LL6 S;  4PJO D;  5KCO A;  1KIK A;  2K5L A;  2O4X A;  4JLG A;  3CCU T;  4GY5 A;  3PT9 A;  1GBR A;  4A53 A;  4LXC A;  4GLM A;  5LJ3 h;  4FYX B;  5GMK l;  4C8Q D;  2LC4 A;  3M0U A;  3ASK A;  3J81 E;  3QPH A;  3NFC A;  1M3A A;  2CRE A;  4J5Y A;  5GAN 7;  4LDX A;  1M90 C;  2RJF A;  1MMD A;  2CP3 A;  2NUZ A;  4FYW B;  4J9E A;  2DF6 A;  1JU5 C;  4XTY A;  4M7A A;  1MND A;  2AZS A;  1OU8 A;  2Y4Y A;  3J80 E;  4BD3 A;  2GQV A;  1X6G A;  3SB2 A;  4A4K A;  1VQN T;  3CCU A;  1AOJ A;  4XQ3 A;  4F17 A;  4AFS C;  1YP5 A;  4HVW A;  7AT1 B;  1BIB A;  1QW1 A;  2PVO B;  2FPF A;  4OGC A;  1XJW B;  3CME A;  2CZ6 B;  2LX7 A;  4BI8 B;  5KCH A;  1UTI A;  3OA6 A;  4AMC A;  3M0S A;  2DBK A;  4M75 A;  3CD6 T;  1WNL A;  4LE9 A;  2L2P A;  1ZBJ A;  4KT0 E;  3BDL A;  4F04 B;  3TRE A;  1QLY A;  2M51 A;  1VQN A;  2E6N A;  2KNB B;  2MIO A;  5M9O A;  3DB3 A;  3SWN B;  1WFW A;  3HKS A;  4IIO A;  2C0T A;  4D8D A;  3E2U A;  2RHX A;  4TVR A;  4M7A D;  2COY A;  2P4R A;  3EG2 A;  4PJM A;  1VIE A;  5KYW B;  3JB9 G;  3EFR A;  3VS7 A;  1QVP A;  2RI2 A;  3S3N A;  3M0P A;  1OX8 A;  1W1F A;  2QQA A;  2XDP A;  5CQY A;  3C95 A;  2RO0 A;  3ZBD A;  4JJN K;  3CD6 A;  5CKH A;  3SDZ A;  4LUE A;  5CAI A;  1YFN A;  2EW3 A;  2OAU A;  4RTU A;  3H0F A;  3P8B B;  1TTH B;  3L1A A;  2FZG B;  3C94 A;  1M2V B;  2IIM A;  2EWN A;  2KRN A;  2A0F B;  4C5I A;  2RNA A;  1WHL A;  3KFV A;  5DY9 A;  2QEX T;  4M7D A;  3EHR A;  2GTO A;  1Q86 U;  1VQ4 Q;  1MHN A;  5L8R E;  4PNO A;  2AHJ B;  3JCM e;  2ZZD A;  2K5I A;  3HRU A;  1NEB A;  1QP3 A;  1MNE A;  3S3O A;  3MHX A;  1H8K A;  5GMK m;  4OF1 A;  2QXF A;  2X3W D;  4JRK A;  4BY6 B;  2GF7 A;  1V76 A;  4DBQ A;  4AG2 C;  3AHU A;  2JTF A;  4X34 A;  1K73 C;  3OBW A;  4N4I A;  4M78 F;  2PU9 B;  1Q7Y R;  4C0D B;  4C5G A;  1M27 C;  3JB9 H;  3JCM g;  2DVJ A;  1YNZ A;  1RAE B;  3OBY A;  2QEX A;  3VUB A;  1JQQ A;  2RF0 A;  2RI5 A;  2CDT A;  1B34 B;  1TSF A;  2EGE A;  2DE0 X;  4HT9 A;  2BUD A;  1M1G A;  1LPL A;  3OSS C;  1T3S A;  1JJ2 S;  4BY6 C;  2DTO A;  2AK5 A;  2BZ8 A;  1ZSG A;  2EGC A;  2DL3 A;  2QAS A;  2LJ1 A;  1OOT A;  1Y96 A;  2LQK A;  2HQE A;  3I5S A;  3RDV A;  4IIM A;  1KD1 R;  4YTL A;  4C0F A;  3EFO B;  3J7A F;  4FIB A;  2KMT A;  3RKW A;  2QGF B;  1QVF A;  1NPP A;  2RQW A;  4C92 F;  2V8I A;  3CPW A;  1V29 B;  5AT1 B;  1FWZ A;  1IB8 A;  3M58 A;  1NZ9 A;  1B07 A;  3QO3 A;  2EBP A;  2OX7 A;  2QQ9 A;  2NUT A;  2D8J A;  2GQI A;  4XU3 A;  3VS6 A;  1OYX A;  2CP6 A;  2HSP A;  2E41 A;  4NS5 A;  2ZPE B;  3JB9 J;  1VOM A;  4BB7 A;  3PIP A;  4RMO A;  2RK2 A;  3LWI A;  2RN8 A;  1UDL A;  3HTR A;  5GAN e;  3GPL A;  3CCQ Q;  2DER A;  4HKE A;  2RJC A;  2FRW A;  3MP6 A;  2L5Q A;  3L2W A;  2ROT A;  5GMK e;  1ZA1 B;  3VRZ A;  1F1B B;  4IKF A;  5D6Y A;  4L6V 5;  2LDM A;  1CKB A;  1YWP A;  3BW1 A;  4E7I A;  1SKU B;  3O5Z A;  2XHC A;  1Q7Y C;  1GRI A;  2MI6 A;  2RJE A;  5KYU A;  2O4X B;  1RUW A;  1ZSZ A;  3T9N A;  1H92 A;  1N27 A;  5LJ5 d;  3BDU A;  1WPY A;  2E3I A;  3OS0 A;  3JCM h;  1GFD A;  3X25 B;  4L59 A;  1UGS B;  3A8G B;  2B86 A;  2IG0 A;  1RAB B;  1I81 A;  5GAO l;  2KT8 A;  3JV3 A;  2ABL A;  4PFO A;  1KC8 R;  4PJO E;  4C0G A;  2PUK B;  4J9D A;  2HKQ B;  5I2S A;  4J6Y A;  2GCX A;  1KD1 C;  3BFM A;  4M7A B;  1PKT A;  2M02 A;  2MK5 A;  1MUZ A;  2NWM A;  3M57 A;  4M78 A;  1WQW A;  4C8Q E;  2K6D A;  3UWN A;  4N4G A;  1WZO A;  1NLP C;  1UG1 A;  4J9H A;  4QQD A;  2VKN A;  4ZN1 A;  4JJD A;  2KY9 A;  4A4F A;  5DLQ E;  1NJI U;  4BE2 A;  2A7Y A;  2CH4 W;  4M7A C;  4K11 A;  2DO3 A;  2LCL A;  2HBW A;  1M1F A;  3RMQ A;  3EH1 A;  4M75 B;  2J7I A;  4RKU E;  3RER A;  4JZ4 A;  3ZEH A;  1EIF A;  1SSF A;  4QQ6 A;  1AZG B;  1GCP A;  2ROL A;  4RTW A;  4XTZ A;  1VQ9 Q;  1SRL A;  2QDY B;  4E7L A;  3CCR T;  1N8R R;  4C92 A;  2K79 A;  4RG2 A;  1BI2 A;  2DVE A;  1VQO T;  1YHQ T;  1XQH A;  1G8X A;  2RQT A;  3QYH B;  2G6F X;  1NEG A;  3VYH B;  3OYF A;  3SWN A;  4M75 C;  1W2B P;  2VVK A;  1X2K A;  1VQ8 T;  4J6W A;  2K5F A;  4ELY C;  1IRE B;  3OYB A;  5KYX A;  5GAN d;  1UGV A;  4RTT A;  1TUC A;  4ME7 A;  4X1V A;  5C6S A;  2PVG B;  2ZCF B;  5CIU A;  2DL5 A;  2DXU A;  5GMK h;  4M77 F;  4M7A E;  2XI9 A;  3BE3 A;  3RR6 A;  3EG0 A;  4LDW A;  2CS7 A;  3FC3 A;  3CCR A;  1ZQ1 A;  2RI3 A;  1RLP C;  1KQS A;  2DNU A;  2AKL A;  1LCK A;  3OYL A;  2YRC A;  5GAM j;  3I56 T;  2KGT A;  1VQO A;  2GBQ A;  1YHQ A;  4GBQ A;  2MAM A;  1RAG B;  4M7D B;  2J6O A;  3CCU Q;  3V7C A;  2J06 A;  3JCM J;  2XD0 A;  3CCM T;  2EPD A;  1VQ8 A;  1UGR B;  3JB9 F;  2F2W A;  4C92 D;  4OB1 B;  3QZ9 B;  2F2X A;  4DOW A;  2EYQ A;  3CME Q;  1A0N B;  2P84 A;  3PE0 A;  3FEO A;  2JXB A;  4BDY A;  4KGX B;  3H6Z A;  3UF4 A;  5GAO m;  1U8R A;  4MZP A;  3VUZ A;  1H3H A;  2MYS A;  5FW9 A;  2XG8 D;  4O5V A;  5LJ3 e;  4C5E A;  2A37 A;  1TU0 B;  2O88 A;  4M7D C;  2EJG A;  3L42 A;  2EJF A;  2EIF A;  3I56 A;  4EMK B;  4JJB A;  2XK0 A;  2E12 A;  1VQN Q;  1AEY A;  4HCZ A;  4FSX A;  5ECA A;  3CCM A;  3MP8 A;  3P8H A;  1D3B A;  1Y57 A;  2GGR A;  1BU1 A;  5GAM g;  1FMV A;  1N8R C;  1CSK A;  2VXE A;  4LDU A;  3LGF A;  1IXD A;  1OZ2 A;  1Y96 B;  4FSS A;  1YJ9 T;  1V1C A;  1WJS A;  3GP8 A;  1RL2 A;  2MMP A;  3CD6 Q;  3URG A;  1S72 T;  1M90 R;  2P0P A;  2JMC A;  2KBT A;  2QQS A;  4OB3 B;  1FMK A;  2EVR A;  1GL5 A;  2I2L A;  4DBF A;  5EC7 A;  5KH6 A;  4OMN A;  4CI0 C;  1HK9 A;  2F2V A;  4IUV A;  2NUT B;  2NUP B;  3QJY A;  1E7O A;  2XKO C;  2LVM A;  3EH2 A;  2LJ0 A;  1MMG A;  4JZ3 A;  1R0C B;  5CKE A;  4X9C A;  1N6A A;  4FYV B;  1KQ2 A;  4OGE A;  3RMS A;  2L3Q A;  2A36 A;  1YJ9 A;  2EKO A;  3RUX A;  2LT1 A;  2W10 A;  1S72 A;  1QVF S;  2GFA A;  3NTK A;  3MKD A;  3CPW S;  3ER0 A;  2FB7 A;  2JVV A;  1RI9 A;  2V1R A;  3CCE T;  4D8K A;  2MOX A;  1Q81 C;  2LCS A;  4M77 A;  2LMJ A;  4IUP A;  1GXI E;  4MML A;  2QEX Q;  5L23 A;  2RB6 A;  1U06 A;  2RD1 A;  8AT1 B;  1BKB A;  5KYU B;  3VS5 A;  1ZSZ B;  4IUT A;  1RAH B;  2LNH B;  1PD0 A;  4KGZ B;  1KHC A;  1RAA B;  2H8H A;  3OYH A;  3OS1 A;  2LCC A;  2SRC A;  2ZPH B;  2CP0 A;  3CPF A;  1YBY A;  1K8A C;  2KEA A;  4CC3 A;  4A4E A;  3CXC P;  3CCE A;  5LJ3 d;  3CME T;  2KAF A;  2XDD A;  4E47 A;  3CMA T;  1R8O B;  5D6W A;  1ZSZ C;  2AKK A;  2A3L A;  2DMO A;  1PG5 B;  4M78 B;  2JT4 A;  1Q82 U;  4V2S A;  3CBO A;  4QKU A;  1K0S A;  3HFN A;  2DEU A;  3EAE A;  4E7S A;  2ZPG B;  1QQJ A;  4RCB A;  1WX6 A;  1M1K C;  2KRS A;  4B9W A;  1WDX A;  2C06 A;  3MEV A;  1UEC A;  2DK3 A;  4M77 D;  3VS2 A;  5CKD A;  3A1P A;  3G7Z A;  1QCN A;  4ZTJ A;  2BE9 B;  1E6G A;  4F7U B;  3L2Z A;  1OPL A;  5A2Q E;  1OU9 A;  4Y92 A;  3C0C A;  1AD5 A;  2HCK A;  4M78 C;  2ZGW A;  2RQV A;  4PJO G;  3CCL T;  4OMP A;  3CMA A;  4ZNX A;  2GNC A;  1K73 R;  5GAM f;  4A54 A;  3A5Z B;  2VV5 A;  4PFP A;  4ELZ C;  1UB4 A;  2D0Q B;  4C92 B;  2F69 A;  2M1H A;  3OS2 A;  4C8Q G;  2ZPB B;  4XTX A;  3O8V A;  5I22 A;  4J9I A;  2YUO A;  1G3T A;  1R0B G;  1JB0 E;  2EYX A;  1OQK A;  1YJW Q;  3A8O B;  1M9S A;  2DTH A;  2WSF E;  4WF2 A;  2RPN A;  2JM9 A;  1MGQ A;  2L3S A; 
#chains in the Genus database with same CATH homology
 3CCS T;  1U1S A;  5FU6 C;  4XU3 A;  3JAM E;  3OYC A;  1OYX A;  4DA4 A;  3CCL A;  4IUU A;  1ZHI A;  2E41 A;  4JDS A;  2ZPE B;  4NS5 A;  4D6W A;  4VUB A;  2HAX A;  3JB9 J;  2VYT A;  4Y28 E;  4BB7 A;  4C92 C;  1PSF A;  3CCJ T;  3QII A;  3CC2 A;  4JS5 A;  4UC4 A;  3X28 B;  3PIP A;  2RHY A;  3QYG B;  4RMO A;  2RK2 A;  3M4G A;  3X24 B;  4C8Q A;  5IT9 E;  3LWI A;  1Y71 A;  3INZ A;  2DEQ A;  5GAN e;  3GPL A;  4HKE A;  3FDR A;  5GAN h;  2DXB A;  4J7I A;  2XID A;  2RJC A;  3JRZ A;  3QKJ A;  3JCM Q;  4XTW A;  3MP6 A;  3SWN C;  5GAO n;  2JZ2 A;  2L5Q A;  3L2W A;  2K3Y A;  5GAN 8;  2EQM A;  5GMK e;  4DQ2 A;  4LDY A;  2DZC A;  1K8A U;  2ZPF B;  1X6O A;  2EQK A;  3E1S A;  1BIA A;  1H64 1;  1I4K 1;  3OSV A;  4XU1 A;  5D6Y A;  4J83 A;  2L8D A;  4L6V 5;  3JCM c;  2OTL A;  3S3M A;  3X20 B;  2LDM A;  4JRP A;  2VXF A;  4N0A A;  2LNV A;  1KC8 C;  4BE0 A;  4C0Z A;  5FRN A;  2QQB A;  3PFS A;  3CCQ T;  3OY9 A;  4M75 D;  3CCS A;  3QG1 A;  2HQX A;  2KK4 A;  3V7R A;  2DXC A;  3BW1 A;  4E7I A;  1W2B S;  5LJ5 j;  4LDV A;  2XHC A;  1FXX A;  3G4S T;  2MI6 A;  5LJ3 j;  1Q7Y C;  3OB9 A;  5IN1 A;  2RJE A;  2CZ0 B;  2O4X B;  1BI3 A;  2LQ8 A;  3CCJ A;  2EJ9 A;  2F5T X;  2JNG A;  2RHI A;  3RKX A;  3T9N A;  2K57 A;  2JUF A;  1K9M C;  5IAY A;  5GAM h;  4ZN3 A;  2EAY A;  1N27 A;  1WGS A;  3HL8 A;  3BDU A;  5LJ5 d;  1K73 U;  1WPY A;  3OS0 A;  3JCM h;  1WJR A;  3LW5 E;  3A8M B;  1UGP B;  2Y4X A;  3X25 B;  1M1K U;  4J6X A;  4L59 A;  1UGS B;  3A8G B;  3SFM A;  1KQS S;  3JB9 I;  4M7A G;  2IG0 A;  4FL6 A;  1I81 A;  4C92 E;  5GAO l;  4A4G A;  2E70 A;  3DLM A;  2DIQ A;  4PJO E;  4C0G A;  2PUK B;  1I8F A;  2KQW A;  4N4H A;  4OP0 A;  3TEE A;  4F7U G;  5FRM A;  3M4Y A;  4X9D A;  1BYM A;  5GAO r;  3A8L B;  3V8J A;  2DXT A;  5CCA A;  3L2R A;  1JJ2 A;  5I2S A;  3OYM A;  2X4J A;  2GCX A;  4J6Y A;  1KD1 C;  1D3B B;  3BFM A;  3QDR B;  4M7A B;  3CCQ A;  4EMK A;  2CZ7 B;  2HNI A;  4XAX B;  2BKD N;  4Z02 A;  5CK9 A;  3OYE A;  1VQ5 T;  4JUV A;  4M78 A;  2VGM A;  3M57 A;  4XTU A;  2FHD A;  4XU2 A;  1WQW A;  2WAC A;  4C8Q E;  2CYZ B;  4IUR A;  3G4S A;  5GAN 5;  1FX7 A;  3CBM A;  2M16 A;  3M54 A;  4N4G A;  3UWN A;  4M7A F;  5A0D A;  2HBP A;  5I2M A;  1K9M U;  2QI2 A;  3MCA B;  3JCM b;  2E1H A;  2NLU A;  2YLB A;  4QQD A;  4XTV A;  1M8V A;  1H3Z A;  4FU6 A;  4F7U F;  4ZN1 A;  1WQ7 A;  5LJ5 g;  1LNX A;  2KY9 A;  4MMK A;  5FRO A;  5LJ3 g;  5KE3 A;  4M75 G;  3JCM W;  1I5L A;  3OMG A;  3HHT B;  3VU3 C;  4A4F A;  1B34 A;  2VGN A;  3JSC A;  3V7S A;  5DLQ E;  2CZ1 B;  1NJI U;  3LWH A;  3JB9 D;  1VQL T;  4QVD A;  3L2Q A;  4BE2 A;  4M7D D;  4C0D C;  2CKK A;  3UT1 A;  2A7Y A;  5GAN 3;  2F5K A;  5CKB A;  3CEY A;  1QVG A;  4M7A C;  2M0O A;  3CC4 T;  3JCM X;  5EG2 A;  2DO3 A;  4BDZ A;  4HT8 A;  1QP2 A;  2IVW A;  2LCL A;  1M1F A;  3RMQ A;  4B9X A;  5CQX A;  1RI0 A;  4M75 B;  4RKU E;  1O75 A;  1XNI A;  3RER A;  1KHI A;  3ZEH A;  5J39 A;  2X4X A;  4QVC A;  4LD6 A;  1VQ5 A;  1EIF A;  1SSF A;  4QQ6 A;  3C12 A;  3A8H B;  4O6J A;  2VUB A;  1P92 A;  3NTI A;  4M75 F;  4L5G A;  2PUO B;  4XTZ A;  3TCJ A;  4GLK A;  3KXT A;  5LJ3 f;  2PQW A;  2QDY B;  3FRN A;  3CCR T;  4E7L A;  3E9G A;  4C92 A;  5D6X A;  4RG2 A;  1N9S A;  1TH7 A;  3P8D A;  4J7F A;  3MET A;  1BI2 A;  1VQP T;  1G3S A;  4BI4 A;  3F70 A;  1M4Z A;  3M56 A;  1IZ6 A;  2L89 A;  2DVE A;  3GF5 A;  3MEU A;  1PSE A;  2Y90 A;  5HY6 A;  5J26 A;  4M77 G;  2R57 A;  1VQO T;  1YHQ T;  3HSB A;  1XQH A;  2K3X A;  3RIR A;  1YIJ T;  4OB0 B;  3QYH B;  3VYH B;  5GAO p;  3OYF A;  1VQL A;  1X01 A;  4OVA A;  4OB2 B;  5A0G A;  3SWN A;  1VQ9 T;  4CRI A;  1YJW T;  4M75 C;  3M53 A;  3LX7 A;  2R5A A;  1G3W A;  1VQ8 T;  3CC4 A;  4J6W A;  4M78 E;  3OYA A;  1KC8 U;  2K5F A;  4ELY C;  1AHJ B;  1IRE B;  3OYB A;  4IKF A;  4JLI A;  5GAN d;  4M77 B;  1N9R A;  3X26 B;  1W2B A;  4ME7 A;  2FVU A;  5C6S A;  2PVG B;  2ZCF B;  1Q7Y U;  5CIU A;  5I21 A;  1NE8 A;  2V8J A;  3HP9 A;  2ZPI B;  3NTH A;  2DAQ A;  4QW2 A;  2DXU A;  4BE1 A;  3N5B B;  4M77 F;  5GMK h;  2XI9 A;  4M7A E;  1JRI A;  4MDX A;  4LDW A;  2H3J A;  2VC8 A;  2CS7 A;  3ME9 A;  4FM4 B;  1LJO A;  3OS5 A;  4FT2 A;  4MZM A;  3FC3 A;  3CCR A;  2P0Q A;  1ZBX A;  1ZQ1 A;  2RI3 A;  3EFS A;  3OQ5 A;  2RHU A;  1KQ1 A;  1UEB A;  3QZ5 B;  3MEW A;  3G6E T;  1VQP A;  1YI2 T;  2X4W A;  4F7U E;  1KQS A;  2KSS A;  3DB4 A;  5A0L A;  4LD9 K;  3OYL A;  5GAM j;  3FB9 A;  3I56 T;  1VQO A;  5CKF A;  1YHQ A;  2LTO A;  3SD4 A;  2MAM A;  2MF2 A;  1YIJ A;  4M7D B;  5GAN 2;  2QQR A;  3V7C A;  2WSC E;  4E7K A;  3JCM J;  3PGG A;  3OYY A;  2QA4 T;  2XD0 A;  4EMH A;  1Y7X A;  3GLX A;  5DM7 R;  4KBM B;  3CCM T;  4Y91 A;  4ZTF A;  5GAM d;  1VQ9 A;  4KUD K;  4M77 C;  3OYJ A;  1YJW A;  5GAO q;  1VQ8 A;  3JCM d;  1UGR B;  2R58 A;  1XOV A;  2EQJ A;  3DKM A;  3VJP A;  2QTX A;  1BI1 A;  4C92 D;  4EPC A;  4OB1 B;  3QZ9 B;  4R56 A;  2D9T A;  3OW2 S;  2M9U A;  1VQM T;  1KD1 U;  4DOW A;  1W4S A;  2EFI A;  2EYQ A;  5LL6 S;  4PJO D;  5HKC A;  3FEO A;  3RKY A;  4PKC C;  4BDY A;  5KCO A;  2DTI A;  3H6Z A;  2K5L A;  4ZGD B;  2O4X A;  4JLG A;  3CCU T;  4GY5 A;  1VQ7 T;  3PT9 A;  3E9F A;  1VUB A;  5FU7 B;  5GAO m;  3OYN A;  4JS4 A;  1U8R A;  4MZP A;  4A53 A;  3C4S A;  3VUZ A;  3WVE B;  3VKI A;  4QQG A;  5LJ5 e;  2XG8 D;  3GOX A;  2O01 E;  4O5V A;  4C5E A;  3VV0 A;  5LJ3 e;  3JCM P;  4MZT A;  5LJ3 h;  2B8A A;  5GMK l;  4C8Q D;  2LC4 A;  3FIF A;  2EJG A;  3ASK A;  1YI2 A;  4M7D C;  4J8O A;  3LYI A;  3WXM B;  2YHT A;  3L42 A;  3J81 E;  4XU0 A;  2EJF A;  2EIF A;  3QPH A;  3I56 A;  4EMK B;  3NFC A;  1U1T A;  3OYD A;  3RES A;  2XK0 A;  4J5Y A;  2G3R A;  2E12 A;  2RH2 A;  3FJP A;  5GAN 7;  4LDX A;  1OI1 A;  2JOY A;  1M90 C;  4HCZ A;  2RJF A;  2QA4 A;  4E7H A;  1Q86 C;  4FSX A;  3CCM A;  3MP8 A;  3P8H A;  5GAN 4;  2RM4 A;  1D3B A;  4XTY A;  3L2U A;  3G6E A;  4M7A A;  5GAM g;  5HK0 A;  1N8R C;  1VQM A;  2RK1 A;  2VXE A;  5FU7 C;  3GNG A;  3KUF A;  4LDU A;  2Y4Y A;  3J80 E;  4BD3 A;  4RCC A;  2GQV A;  4F7U A;  3DLL A;  3LGF A;  3CXC S;  1Q82 C;  3QBY A;  3SB2 A;  4A4K A;  1VQN T;  1OZ2 A;  3CCU A;  1Y96 B;  1VQ7 A;  4M77 E;  4XQ3 A;  2DD4 A;  4HCC A;  4DOV A;  1UGQ B;  1YJ9 T;  4ATO A;  1VIF A;  1WJS A;  3QHS A;  1BIB A;  3V8K A;  1QW1 A;  2PVO B;  3GP8 A;  1DJ7 B;  1RL2 A;  1HXD A;  4OGC A;  3JB9 F;  2MMP A;  2V8K A;  3URG A;  1S72 T;  3CCV T;  2P0P A;  3CME A;  2QQS A;  2CZ6 B;  4OB3 B;  4RG8 A;  1KG1 A;  2E10 A;  4BI8 B;  1G3Y A;  2I2L A;  4IUQ A;  5KCH A;  5LJ5 f;  3CBP A;  3OMC A;  3OA6 A;  2PVD B;  5KH6 A;  2EQU A;  2E65 A;  2JTM A;  4CI0 C;  1HK9 A;  4IUV A;  4NL3 A;  4M75 A;  5HK3 A;  1X75 C;  5GAN 6;  2MWO A;  1NPR A;  3QJY A;  3CD6 T;  4PJO B;  2E5Q A;  1WNL A;  2XKO C;  2LVM A;  3M9Q A;  4FT4 A;  3MEA A;  4KT0 E;  4HCB A;  4M78 D;  4KUI A;  3BDL A;  3TRE A;  5CKE A;  2LX9 A;  4PJO F;  4X9C A;  5GAN j;  2OTJ T;  1N6A A;  1VQN A;  2E6N A;  3S6W A;  2RHZ A;  4PLL A;  3V8L A;  5CVI A;  4OGE A;  5M9O A;  1KQ2 A;  3QSU A;  1VQ6 T;  3RMS A;  4JRI A;  3DB3 A;  1YJ9 A;  3SWN B;  3HKS A;  2YLC A;  4E7J A;  4C8Q B;  2EKO A;  3RUX A;  2BIV A;  2R5M A;  5GMK j;  2RHX A;  2LT1 A;  3ZFJ A;  4TVR A;  1S72 A;  3CCV A;  4M7A D;  1QVF S;  2GFA A;  3NTK A;  3QUI A;  4OMF B;  1VIE A;  4C8Q F;  3CPW S;  3ER0 A;  3JB9 G;  2FB7 A;  4M7D G;  2JVV A;  3EFR A;  1QVP A;  2RI2 A;  2X35 A;  3S3N A;  3PMT A;  4C5H A;  4R55 A;  4PJO C;  2E64 A;  4II1 A;  4MDW A;  2QQA A;  3CCE T;  2XDP A;  3LLR A;  5CQY A;  1Q81 C;  3C95 A;  3OW2 A;  4M77 A;  2RO0 A;  4NL2 A;  2DPP B;  3ZBD A;  4JJN K;  2LT4 A;  4IUP A;  5CKH A;  2FL7 A;  3QJ6 A;  4MML A;  3CD6 A;  1GXI E;  2RA2 A;  3SDZ A;  3OYG A;  2X4Y A;  2KDS A;  2RB6 A;  2DZ9 A;  4EDU A;  3Q1J A;  5CAI A;  2RD1 A;  2OAU A;  1BKB A;  4C8Q C;  2OTJ A;  3HRT A;  3WVD B;  3P8B B;  3L1A A;  1VQ6 A;  3C94 A;  4IUT A;  3MO8 A;  2EWN A;  5C0M A;  4C5I A;  4JRQ A;  1O9S A;  1KHC A;  3HFO A;  4Q5W A;  5DY9 A;  2QEX T;  3OYH A;  2JN0 A;  5GAN g;  3OS1 A;  4M7D A;  2LCC A;  3PIO A;  4BAC A;  2ZPH B;  4P5N A;  4PL6 A;  4M78 G;  4M75 E;  1M90 U;  3CPF A;  2XIC A;  3M59 A;  1Q86 U;  2K4Y A;  4PLI A;  1YBY A;  4N0A C;  1MHN A;  5GAM e;  1K8A C;  3CC7 T;  5L8R E;  1VQK T;  4PNO A;  2AHJ B;  5LJ5 h;  1WJQ A;  2WSE E;  2ZZD A;  3JCM e;  4A4E A;  2K5I A;  3CCE A;  3HRU A;  5LJ3 d;  2KVQ G;  1QP3 A;  3R6O A;  4BUG A;  3HRS A;  3UPU A;  3CME T;  3S3O A;  2KAF A;  3MHX A;  2XDD A;  1YIT T;  1N8R U;  4E47 A;  5GMK m;  2FYK A;  3JCM V;  3CMA T;  1R8O B;  5D6W A;  2A3L A;  1LOJ A;  3CXC A;  3LH0 A;  3MP1 A;  4OF1 A;  2QXF A;  4HA8 A;  4M78 B;  2L3R A;  5CO7 A;  4JRK A;  4BY6 B;  2GF7 A;  5FLX E;  2DIG A;  1Q82 U;  3CBO A;  4V2S A;  3FLG A;  3VYG A;  4NOY A;  3HFN A;  1VQ4 T;  3AHU A;  3G71 T;  1YCY A;  2JTF A;  3EAE A;  4X34 A;  5DLO A;  2ZPG B;  3QXE B;  5GAN f;  1K73 C;  1G5V A;  3OBW A;  4N4I A;  4M78 F;  2P0K A;  3I55 T;  2PU9 B;  4RCB A;  4C0D B;  4C5G A;  3JB9 H;  1M1K C;  3JCM g;  4B9W A;  2C06 A;  5AYF A;  3MEV A;  4M77 D;  2DK3 A;  5CKD A;  1M5Q 1;  3OBY A;  2QEX A;  1YJN T;  2XU8 A;  3BY7 A;  3VUB A;  2RI5 A;  3G7Z A;  5J3B A;  1B34 B;  3PNW C;  4ZTJ A;  4HT9 A;  2BUD A;  4F7U B;  4A4H A;  3L2Z A;  1M1G A;  3M5A A;  3UDC A;  1JBM A;  5A2Q E;  3E19 A;  3CC7 A;  3PMI A;  1VQK A;  4EMK C;  3OSS C;  4C92 G;  2HD0 A;  1JJ2 S;  2DD5 A;  4M78 C;  2YRV A;  4BY6 C;  2DTO A;  2ZGW A;  3KBG A;  4PJO G;  3CCL T;  3TU4 K;  1YIT A;  2K2V A;  2GFU A;  5KE2 A;  2D6F A;  3GIB A;  1BI0 A;  3CMA A;  3CC2 T;  2P4T A;  1Y07 A;  4BI3 A;  3PTA A;  1Y96 A;  5GAM f;  5FU6 B;  4A54 A;  2LQK A;  2HQE A;  3A5Z B;  3JCM f;  4M7D F;  4EMG A;  1OZ3 A;  2VV5 A;  3M55 A;  4YTL A;  4C0F A;  4ELZ C;  1UB4 A;  2MWP A;  3G71 A;  1VQ4 A;  2D0Q B;  4C92 B;  2F69 A;  4M7D E;  2M1H A;  2XDB A;  2DJZ A;  3J7A F;  3OS2 A;  4C8Q G;  3I55 A;  3H8Z A;  3HPW A;  2E6Z A;  2ZPB B;  4XTX A;  4FIB A;  2KMT A;  3RKW A;  3O8V A;  2LRQ A;  4ZGE B;  1QVF A;  1G3T A;  1NPP A;  4C92 F;  2V8I A;  3CPW A;  1V29 B;  4ZGJ B;  1JB0 E;  2CGH A;  5CR2 A;  3OYK A;  1FWZ A;  3LGL A;  1YJN A;  5GMK i;  1NJI C;  3M58 A;  1NZ9 A;  4KUL A;  1XTD A;  2RJD A;  3QO3 A;  4QVZ A;  3OYI A;  3A8O B;  1M9S A;  2DKG A;  2DTH A;  2QQ9 A;  2WSF E;  4WF2 A;  1QVG S;  2OTL T;  1Q81 U;  4XK8 E;  3GNF B;  3L2V A;  4PJO A;  1MGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...