2RI2A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355a point mutation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
312
Chain Sequence
b'WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVARMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 81
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A03
3DB4A 4EDUA 3UT1A 3OYMA 3Q1JA 2O4XB 5M9OA 3OYDA 2RI2A 4PLIA 2X4YA 2B8AA 4IKFA 4N4GA 4C5EA 4E7IA 2RJDA 3LGFA 3PFSA 2BIVA 3QJ6A 3S3OA 3FDRA 2LTOA 3OYJA 3KUFA 5D6WA 2JZ2A 3LH0A 2VYTA 2EQJA 3FC3A 4A4GA 3OYEA 3E9FA 1H3ZA 2RHZA 4IUPA 1N27A 2LVMA 3L42A 3UWNA 2E6NA 4B9WA 3H6ZA 4BDYA 2LRQA 3DB3A 3OQ5A 4BE1A 3L2UA 3OYAA 2RI3A 3L2WA 3P8DA 2RHXA 2X4XA 5KCHA 3BDLA 2F5KA 4C5HA 3OYHA 1WGSA 2BUDA 3OYIA 3CEYA 3MP1A 3NTKA 4L59A 4Z02A 4UC4A 2YRVA 3PMTA 3OA6A 2WACA 2JTFA 4IUVA 3MEUA 2CKKA 3NTHA 3MO8A 4GY5A 5D6XA 4E7LA 4BE0A 2RJCA 4LD6A 2R58A 3O8VA 3OYNA 3DLMA 3PNWC 3S3MA 4OVAA 4E7KA 5C0MA 2P0KA 2LCCA 3NTIA 3OYGA 2RJEA 1MHNA 3QBYA 3ZEHA 3OYCA 5IN1A 5FRNA 2EKOA 2RO0A 4C5GA 1OZ3A 4II1A 2NLUA 2RI5A 5KCOA 3META 4IURA 5CIUA 4X34A 2XK0A 1XNIA 2R57A 2BKDN 1KHCA 3C4SA 2LDMA 3E9GA 3LLRA 3M9QA 4QW2A 2GF7A 1WJQA 2XDPA 3EAEA 4PLLA 4HCZA 3SD4A 1SSFA 2MWOA 4QQ6A 2L3RA 2GFAA 4ZTJA 4BD3A 3OYKA 4NS5A 2L8DA 4B9XA 2M16A 2FHDA 2G3RA 3L2VA 2DIGA 5D6YA 2D9TA 4A4EA 3OYLA 5KE2A 4E7JA 3OS1A 1OYXA 4BE2A 2M1HA 3S3NA 2X35A 4N4HA 2E5QA 4BDZA 2RHYA 3MP8A 3FLGA 5IAYA 2K3XA 3OB9A 3QKJA 4Q5WA 3L2QA 4BACA 3F70A 4QQGA 1OZ2A 2O4XA 4FU6A 2EFIA 3OY9A 3OYFA 2QQSA 4C5IA 4PL6A 2DAQA 3OS0A 3FEOA 2PQWA 3LYIA 4N4IA 5J26A 5J39A 3ASKA 3H8ZA 5KH6A 4E7HA 1WJRA 4CRIA 2X4WA 4A4HA 3GOXA 3MEWA 4IUQA 4IUUA 2HQXA 4A4FA 4FL6A 3OMCA 3OYBA 2K3YA 4QVZA 4ZTFA 5FRMA 3L2RA 2QQRA 2RHIA 2R5AA 4IUTA 3MEAA 3ME9A 2DIQA 5C6SA 2GFUA 1WJSA 1RI0A 2RHUA 2EQMA 2HQEA 3PMIA 3OMGA 2R5MA 3LGLA 3MP6A 5FROA 3S6WA 2EQUA 1G5VA 3MEVA 2MWPA 2M0OA 2RJFA 4RG2A 2L89A 1OI1A 3OS2A 2IG0A 3LX7A 3QIIA 5KE3A 3P8HA 2EQKA 4QQDA
chains in the Genus database with same CATH superfamily
2CZ7B 4FSSA 2VXEA 2D6FA 1IGQA 3EG3A 5CKHA 1KC8C 1N5ZA 2GTJA 1D0ZA 5GAMf 1WPYA 4JUVA 1M4ZA 4A4GA 2DEQA 2E6NA 1Q86C 2QEXT 3JRZA 1VA7A 2RK2A 3ZFJA 1MNEA 4IIMA 3X26B 5CAIA 3NFCA 4RCBA 1VQMQ 3CMEA 2YRVA 3TCJA 2K57A 1GXIE 1TU0B 2RJCA 1VQ5A 3QYHB 4M7DD 4R0KA 2KXDA 1RADB 3G4SA 1Y7XA 1A0NB 3EHRA 1ZUUA 3UDCA 2XDPA 3SD4A 2QTXA 4PJMA 2L3RA 1UJYA 4F7UE 1TOVA 2CH4A 1KD1U 1WX6A 1QP3A 1K9MC 5I2SA 4PJOB 2MPXC 3PGGA 1YIJT 4M7AE 1WI7A 1K8AU 1GL5A 1VQ6Q 1U5SA 2A28A 4RTUA 4DQ2A 3CC7T 4M7AG 3TEEA 2IVWA 3SHWA 2E3HA 1OU9A 2JMCA 2O01E 5DLOA 4YTLA 3GOXA 3TSZA 3OMCA 4QVZA 4J6YA 1P92A 2V8JA 3VS7A 5FU7B 3U23A 2PVOB 4RTWA 1VQLQ 1K73U 4HCCA 2HQEA 2ZPIB 2LJ1A 4KRTA 1D1BA 1G5VA 2P4RA 1UUEA 2CP7A 1YJWT 2L89A 2LX9A 2KRSA 3LWIA 2PU9B 5GAN7 3CPFA 2YLBA 4M75C 1ZSZC 4JLIA 1C0MA 3JB9I 3HRTA 3LGFA 1NJIU 2EJFA 1PKTA 1F1BB 2DXCA 4LNPA 3M5AA 2JZ2A 5CQXA 4E7ZA 5CKEA 1Q82U 1TWBA 4JRIA 3THKA 4F16A 1BCOA 3G71Q 1UGQB 4WCIA 1RUWA 3OA6A 1K8AR 4IUVA 1WYXA 4OMPA 1QVGP 3M0TA 3X24B 4M77F 1M90U 2L3QA 3KXTA 3QG1A 5GMKl 1JU5C 2KDSA 2P4TA 4LXCA 4OP0A 4XK8E 4Z88A 3JCMd 2QEXA 3EGDA 5IXFA 3CBOA 4M7DG 4HVWA 3HTRA 4X34A 2QG9B 2GF7A 4KH1B 1QKXA 4NS5A 2QGGA 3H0FA 2COWA 1TH7A 2AHJB 5GAOl 2XKOC 5CVIA 4N4HA 5AT1B 2J6FA 4QQGA 1TSFA 5KYUB 4FU6A 2CUBA 4NOYA 2E6ZA 3CC4T 5EG2A 3FEOA 4M75E 4E7HA 3A8GB 1NJIR 3M59A 2ZCFB 1ZUYA 2K3YA 1YIJA 5A0LA 2HAXA 1AZEA 2FG0A 1X6OA 1Q82R 1UJ0A 4XTVA 3CC7A 4KGZB 3EG9A 1RI0A 2DILA 1KQSP 1K1ZA 5FROA 5GAMg 1PG5B 2MWPA 1VQKT 2F2WA 2QA4Q 1M90R 1G2BA 2X4YA 1JXOA 3V8LA 1MV3A 2DVEA 1S1NA 5HK3A 2BIVA 4F7UB 3OBWA 2YUOA 3GBQA 2DBMA 3FC3A 1X6BA 2X3WD 1YJWA 4BDYA 1QLYA 3CCUQ 3OW2A 2Y4YA 3P8DA 3EG9B 2X4XA 4PFZA 3C94A 4X9DA 1YITQ 2FPDA 1WHKA 2B86A 5D7UA 1M8MA 4Z02A 5FWBA 4UC4A 4HCBA 3I55Q 3FJPA 1M3CA 2P0QA 2RK1A 5LJ3e 3CCQQ 2L3SA 3I9QA 1LNXA 2LC4A 1H92A 2H3EB 4J7IA 2LJ3A 2ED0A 4PJJA 4PJOF 3VYHB 4FCYA 5KCOA 1XQHA 2YSQA 3C4SA 4LUEA 1WJQA 4P5NA 4JRPA 1BI0A 1UGRB 4BY6C 2EQIA 1M2VA 1RAEB 1HD3A 2CSIA 1JBMA 3ER0A 3OYLA 2CYZB 4E7JA 1XTDA 3X28B 3OS1A 3VKIA 4FT4A 2QAZA 4M78C 1X6GA 2DFUA 2HDAA 1AWWA 1QMCA 2HL5C 2LZ6B 5GANg 1VQ9Q 2LQNA 2LT1A 2VASA 2P84A 1VQ7Q 4PJLA 1AWJA 3CC2T 2A3LA 4HT8A 3PT9A 4X9CA 1K0SA 5GAMj 5GANh 2BZ8A 3I56T 1M2VB 3CCSQ 5J3BA 1SKUB 1IREB 8AT1B 1T3SA 3HSBA 1D1CA 2KK4A 2AZVA 3CC4A 2VV5A 2NWMA 4M75A 1ZSZA 4FIBA 4C0DC 5FWCA 4EMGA 3DB4A 1BYMA 2E12A 2QTVA 2LX7A 4RG8A 2NUZA 5D6WA 2E1HA 3VS6A 2CUDA 1U1SA 5LJ3f 2O88A 1Q95G 1VQKA 4F04B 2FPEA 1G3SA 1YHQT 1D0YA 3OYHA 1WGSA 1Q7YC 1JJ2P 1BCMA 2CP2A 2YHTA 5GAN8 2EGCA 2XICA 4M75B 1ZSZB 5HY6A 3BW1A 3JCMb 4M78E 2E65A 4C8QC 1B07A 2DK3A 4KUIA 1E6HA 1LJOA 3UA6A 2VGNA 1W70A 2DTHA 4BE0A 1HXDA 4DOWA 3PVLA 4MZMA 3JCMP 2K3BA 3WVDB 1GRIA 4PJOC 3HP9A 2XDBA 1MMDA 2CREA 1VIEA 3UA7A 2GTOA 3GPLA 3URGA 1WHJA 2JT4A 2OTLT 2HKQB 2AIRB 2EAYA 1D1AA 4XU2A 2D1XA 3M0SA 4J9BA 3L1AA 2PTKA 2KVQG 5IAYA 2ROTA 5LJ5h 1VQ5Q 4ORZA 3HHTB 3F70A 3TU4K 4XTZA 5GANj 2DYIA 3G4SQ 2F2VA 3GNFB 3H9NA 3CXCP 1YCSB 3UATA 3QWYA 1WHMA 2HBPA 1NBEB 4C92E 3MPUB 1WIEA 1YWOA 4OMLA 1QKWA 2QK0A 3MEAA 3ULRB 1RI9A 1WJSA 1SPKA 2M9UA 2EGEA 2EQUA 1KSWA 1BB9A 2JTMA 2IPOB 3OW2S 2NUPA 4F7UF 3QIIA 1RAGB 3CCMQ 3CC2A 1FX7A 4M7AF 2OX7A 3GNGA 1QWEA 3I56A 4C8QE 3NMZC 3VYGA 2EQJA 4CI0C 3E9FA 1NYFA 3VS0A 1RAHB 5CCAA 2DJZA 1GFCA 3L2UA 2FZGB 2KY9A 1N6AA 3RKYA 2A36A 2NUPB 1NM7A 3MEUA 1VQNQ 2KE9A 4OVAA 4OB3B 3J81E 1H3HA 2XU8A 2L2PA 3REAB 1VYTA 3V7RA 3QYGB 2W10A 4QW2A 1YHQA 3LLRA 4FYWB 4HCKA 4PLLA 2RA2A 2K5IA 2O2OA 3OYKA 2FL7A 5GAOr 2YXYA 4JJDA 3SB2A 3VU3C 1PHTA 1Z9ZA 1MGQA 1VQ4T 4M78A 2HEQA 4EMKC 1FMVA 3HRUA 2E5QA 3CCVT 1M1FA 1WHGA 5FW9A 2JN0A 4E6RA 2EFIA 2ESWA 2PQWA 2RM4A 2M0YA 2Y90A 2HD0A 3CCLT 1YJNT 3OYBA 2ZPBB 2OTLA 4BY6B 4JLGA 4IUTA 1OQKA 2JW4A 3NGPA 2YUNA 2RHUA 2RQRA 1HYOA 3MEVA 2DE0X 2DJQA 2DZ9A 4M78B 4B6MA 4EPCA 5LJ3g 2DBKA 2X4JA 3LH5A 2E4HA 5IHIA 1CSKA 2Z0WA 1OOTA 2RJDA 2BE7D 2OTJT 5GAN2 1KG1A 3CQTA 3QPHA 1YIJQ 4ANJA 4AFUC 3QWXX 3RUXA 4M7AC 2EYQA 2KAFA 4LN2A 1N27A 3L42A 1TTHB 1R77A 2MAMA 3JCMf 4M75F 4BE1A 1M2OA 2J05A 2RHXA 3PE0A 2HBWA 2COYA 3WXMB 1X2QA 2CT3A 5HK0A 4C0DB 5I21A 4GY5A 4E7LA 3JB9D 2HZYA 4C8QA 2MIOA 2QASA 3A98A 4J5YA 2KXCA 2RQVA 3QDRB 4C92B 5CIUA 2PUKB 4PJOA 1HK9A 1YJWQ 4RCCA 2BZYA 2CZ1B 3OYYA 2K5FA 4OMFB 1R0BG 2CSQA 4L6V5 5KE2A 3L2ZA 2JTEA 4J83A 2C06A 2Y4XA 4J6WA 2PZ1A 2DXTA 2V8IA 1Q81C 4Q5WA 1QCNA 1RAIB 1B34B 1ZHIA 4DBRA 1OZ2A 2HSPA 4C8QB 1YI2T 2LNVA 2QI2A 4PL6A 3JCMJ 1LPLA 1MMGA 2YWWA 4N4IA 3ASKA 3E1SA 3REBB 1UG1A 4IUQA 4MZPA 4PK4A 1SRMA 1VQ4A 3V8JA 1M1KC 4OMNA 2I0NA 3CCVA 2DTIA 4RUGA 3QZ9B 5LJ3j 4M7DC 1W2BP 4Y92A 1UE9A 1N8RC 2DM1A 2DEUA 4FYXB 1YJNA 3CCLA 4J8OA 2GNCA 4RTVA 2D8JA 2DL8A 1E7OA 2B8AA 1T0HA 3S3OA 1J3TA 4C0ZA 1FXXA 3LH0A 1YFNA 2JUFA 1VQPT 2FVUA 1QVPA 5CKDA 4OMOA 2LRQA 2H3JA 2M02A 2DMOA 3CC4Q 3NTKA 4OB0B 1YCYA 2J06A 2OTJA 1ZSGA 5D6XA 1N9RA 4PNOA 1VQ8T 5C0MA 1KC8U 1B7TA 3CPWP 1U8RA 1MV0B 3ZEHA 3JB9G 2AT1B 1VOMA 2F2XA 9ATCB 1IZ6A 1IHWA 5GMKe 5CQYA 4IURA 4QKUA 2A08A 1VQKQ 3EAEA 1Q86U 2OJ2A 1X43A 3R6NA 1D0XA 1LVKA 5A2QE 1TG0A 2CT4A 4EMKA 3EH1A 1PKSA 2OAUA 4NL2A 5KYUA 1H641 4M7DE 2HKNA 2X35A 4XU1A 4OB2B 4DEXA 4BACA 3EG1A 4JRQA 1YJ9T 5IXBA 3OS0A 3LYIA 3OSVA 1GCPA 1RAFB 1ABQA 1OX9A 4LDXA 2DXUA 2RHIA 4M78F 3M53A 4D8KA 4XTUA 1K9MU 4TVRA 3M4YA 2ABLA 3ME9A 2EYYA 8ATCB 2CP6A 2X51A 2K2MA 1YI2A 3RMQA 4EMKB 2YUPA 3VS2A 4FYVB 3OS2A 1WHLA 1XJWB 3JCMg 4F7UA 2H8HA 2CS7A 3UT1A 2RD1A 4CC4B 1KC8R 1AWOA 2KYBA 5GAOm 4M7AA 3UF4A 4FW2A 2X3XD 2EJGA 3M58A 1Q86R 3NHNA 4LE9A 2KNBB 3DB3A 4N0AC 4OB1B 4AMCA 1KIKA 4J6XA 1NG2A 3A1PA 4C92F 1BI2A 5GAMh 2BTTA 3EGXA 1EZZB 2R58A 3CC2Q 3DLMA 4BB7A 3RR6A 3PNWC 2P0KA 1LOJA 3I56Q 4ME7A 1VQPA 4LDUA 2DL7A 2AZSA 2LQ8A 4M7AB 4A4KA 4J7FA 2MI6A 3M9QA 1LCKA 2ECZA 4ZTJA 1S72Q 1K9MR 4C8QF 2D9TA 4A4EA 2FEIA 2JJ9A 1VQ8A 4M77D 2LCSA 3CCJQ 2RHYA 4RTTA 3EGXB 3MKDA 5IHKA 1BK2A 1H8KA 3C0CA 4WTOB 4JS5A 2BZXA 4C5IA 2E70A 1OULA 1WJRA 1M3BA 3M55A 3JSCA 3JCMW 1M9SA 3JB9J 2GCXA 1OEBA 3FRNA 5FRMA 4F14A 3L2RA 2ATCB 2FO0A 3I5RA 2QYZA 3BFMA 1QCOA 4XAXB 4M7DA 4BUGA 2LMJA 4LDWA 4D6WA 1YJ9A 1FMWA 2XHCA 2YUQA 3D7SB 4C0FA 3CCRT 3LX7A 1D3BA 4CC7A 4C0GA 3O5ZA 2K2VA 3H41A 4PLIA 3VJPA 2RQTA 1QWFA 4AT1B 1WXTA 3KUFA 2K7AA 2VYTA 2EIFA 3OYEA 3M0PA 1IHVA 3ZBDA 4ATOA 2EBPA 5GAOn 5A0DA 3V8KA 4LDYA 1PWTA 4M7DB 3OYAA 3FIFA 2VUBA 2DPPB 4LDVA 4F17A 5DY9A 3CEYA 3MP1A 2JM9A 2YLCA 2EPDA 4QVDA 2O9SA 3EFSA 1D3BB 4C92C 1SG5A 1MHNA 5IN1A 3CCUT 2RO0A 1OZ3A 2LCLA 2HCKA 4HCZA 2MF2A 2JS0A 4JZ4A 3I55T 4AG1C 2FHDA 1UECA 5CKBA 3TREA 4JS4A 1RLPC 3X20B 1NLPC 4BE2A 1QVGA 1O9SA 3S3NA 3QXEB 4ZN1A 4BDZA 4XQ3A 3OB9A 2FYKA 2V26A 2RQUA 1QVFA 5DLQE 4M77G 5LJ5d 2ZAEA 4PJOD 4EIKA 3BY7A 3CCET 4QT7A 1WQ7A 2VC8A 1K9AA 4DBQA 4PJNA 2JMAA 3PIOA 1W6XA 4IIOA 2KYMA 2EYWA 2R5AA 3RMSA 3CMEQ 3DLLA 2MYSA 3M57A 5AYFA 3UPUA 1TS9A 1B3QA 5GAN4 4A63B 2EW3A 1X69A 3DKMA 4Z89A 3PTAA 3FB9A 4HVVA 4JJBA 1WQWA 2MCNA 3JCMX 1YWPA 1NEBA 3QSUA 1JO8A 2RQWA 3FDRA 2EGAA 1VQ4Q 2XIDA 1PRLC 1H3ZA 3CCVQ 2K79A 2L5QA 3H6ZA 4N0AA 2QQ9A 3CCRA 1KQSA 3OQ5A 5L8RE 1R0CB 5IHNA 4Z8AA 1WDXA 2LQKA 1ZBXA 1YJNQ 3NTHA 3CCLQ 1RABB 2JS2A 3BE3A 3O8VA 3S3MA 1Z9QA 3VS5A 2NLUA 3M0RA 2CP5A 4BI8B 2QDYB 1KQ2A 1UGSB 3HKSA 2FZKB 1EIFA 2L8DA 2K6DA 5D6YA 3JV3A 1Q7YU 4L5GA 4ZGEB 3A8LB 1WXBA 2DLPA 2K3XA 3RIRA 3QKJA 3CCUA 2E10A 3TQ7P 3M4GA 1PNJA 5KYXA 3G6ET 1W1FA 2QQSA 1QCFA 5J39A 3I55A 1KQ1A 4A4HA 4PJOG 3JB9F 2EYXA 3M56A 3M54A 1TXQA 4A54A 4HT9A 3J80E 2VB6A 4DEYA 4ZN3A 3HFOA 2JVVA 3IQLA 4QVCA 1KJWA 3KBGA 2KT1A 3LGLA 3MP6A 4GBQA 3CCEA 2VKNA 1SHGA 5IH2A 4RTZA 2QEXQ 2OI3A 2DNUA 5KCHA 2EKHA 4XU0A 4DBHA 1I81A 3SDZA 3Q1JA 5KYXB 2XD0A 2VGMA 2HSEB 3NPFA 4E7IA 3PFSA 2GQVA 3RBBB 4M7DF 3AHUA 1I5LA 3QDFA 4JPBW 3CBMA 1PSFA 4IUPA 3EG0A 1C6VX 4CC3A 1YI2Q 1VQOT 1KD1C 1I0CA 3CCMT 2AKKA 3JAME 1Q7YR 3MCAB 1U1TA 1FYNA 4FW1A 1K8AC 4HVUA 3CCSA 4OGEA 4C92A 5LJ3h 1JRIA 4M7AD 1QVGS 2DKGA 2ZPHB 5FU6C 1T3LA 4E7KA 3OYCA 2PVGB 1QVFS 5FRNA 3FJ5A 1I4K1 1WNLA 1GBQA 3CC7Q 2BKDN 3G1JA 4JDSA 1ZQ1A 2E41A 1O75A 5GAN5 1E6GA 2WSEE 3H0IA 1SSHA 1RL2A 4BI3A 1K73C 1ZA2B 2RN8A 2EJ9A 5GAN6 1JJ2A 2ENMA 1QQJA 2VVKA 1B34A 3QZ5B 1I07A 2JXBA 2XG8D 4PFPA 2WSFE 1FWZA 5GJVB 2ZPEB 4DA4A 1Y0MA 1VQPQ 1G3WA 3H8ZA 3M0UA 1XOVA 2JOYA 5KYYB 4MDXA 4Y28E 1NJIC 2DD5A 3CMAT 3HRSA 3INZA 1ABOA 2NYSA 1C1AA 1BI3A 1QW1A 1UDLA 2BE9B 2V8KA 1Q82C 4KUDK 3GLXA 2NUTB 3E19A 2GFUA 5GANe 2IIMA 1VQ8Q 1VUBA 3OMGA 1GFDA 3G6EA 3OW2P 5HKCA 5DM7R 2RB6A 1KQSS 2M0OA 2RJFA 3X25B 4LUDA 3CD6T 1OU8A 3P8HA 2EQKA 4DOVA 4HKEA 3TSWA 2AKLA 4EDUA 3CXCA 1M90C 4FM4B 4N4GA 1MMAA 1VYUA 4ZGDB 2YT6A 1IGUA 3C95A 4VUBA 3T9NA 2EYZA 3H0HA 5HCKA 5KYWA 1YJ9Q 1BI1A 1UHCA 2JNGA 3RESA 2DD4A 4A53A 4C5HA 2KSSA 5EC7A 2MK5A 2DVJA 2WACA 3JCMc 4F7UG 4LD6A 3GP8A 4XTXA 3OYNA 4XTWA 2EWNA 2V1QA 4J9EA 1FMKA 3V7CA 4O5VA 2AK5A 3VUZA 1VQOA 2RI5A 3VS4A 3CCMA 4XTYA 1NZ9A 4M75D 4J9IA 2GGRA 4QQ6A 4B9XA 2KQWA 4GLMA 5KYWB 5GAOp 2DX1A 1PCXA 2DETA 3QJYA 5GAN3 1BBZA 5LJ5e 5GANf 1PC0A 1I1JA 3LW5E 1AVZC 1V76A 6AT1B 3OS5A 5J26A 1MMNA 5KH6A 1VQMT 4CRIA 1VQNA 3MEWA 1V1CA 4FL6A 2L3PA 1AWXA 2LP5A 4AG2C 5GJWB 3TVTA 4RMOA 4AFSC 3VS1A 1KHIA 1AHJB 2COZA 2QQBA 1AEYA 3BDUA 1UHFA 1PD0A 4MDWA 1I8FA 1KD1R 4Y91A 1Q81U 2IG0A 1WZOA 4E2FB 2DL3A 5KE3A 4RKUE 3M0QA 2DRMA 2PUOB 2DERA 4R55A 2D8HA 3CMAA 1UGPB 1EFNA 4IKFA 4C5EA 4OGCA 1YBYA 1VQ6T 1X75C 1QP2A 2LQWA 2LTOA 4AFQC 5I2MA 1QVFP 1T0JA 5GMKm 1K4US 2GQIA 1M1KU 2RMOA 2DL4A 1PM3A 3GIBA 4J9FA 1TUCA 2CGHA 1KFZA 3CD6A 1BKBA 4J9HA 1GCQC 2DO3A 1UTIA 1N8RU 2LNHB 3OYIA 1K73R 4L59A 4E47A 1SHFA 3PMTA 1JJ2S 2JTFA 4HXJA 1VQLT 1RAAB 5GAMd 1IRXA 2YRCA 3JCMh 2MOXA 3G7ZA 3GF5A 4X1VA 3PIPA 1UGVA 3QO3A 1ZA1B 1ZUKA 4II1A 2LDMA 2MMPA 5LJ5f 2FZCB 3CCRQ 3EGDB 2DF6A 2GFAA 1G83A 4OMMA 4RTXA 1I5OB 2E3IA 2G3RA 3L2VA 5I11A 4M75G 3A5ZB 1RACB 2O9VA 1G3YA 1OYXA 4KGXB 2M1HA 2SRCA 3RNJA 1VIFA 1Q81R 1NLOC 2J6KA 5FU6B 3OY9A 1W4SA 3G71T 2DAQA 1M8VA 3EHQA 2X4WA 3CXCS 2HQXA 1M1KR 3RDVA 1X2KA 1X27A 2SEMA 2O31A 1N8RR 1OI1A 2YDLA 2G6FX 1VQMA 3QHSA 2KMTA 1AZGB 4JJNK 4CC2A 2VXFA 5LL6S 4QQDA 4KBMB 1WLPB 1YHQQ 1N9SA 3N5BB 3VUBA 2E64A 3RKXA 4ZGJB 4M78D 1PD1A 1AD5A 2ROLA 1Y71A 4FSXA 2DL5A 4M77C 3UWNA 2LVMA 5GANd 1JB0E 4JZ3A 3SWNC 1W2BA 1WXUA 4LD9K 2KROA 3A8OB 3RKWA 3BDLA 2F5KA 2F69A 3CCEQ 2P0PA 1UEBA 5ECAA 3P8BB 1G8XA 3A8HB 2K5LA 3WVEB 1VQ6A 1ZLMA 1NPPA 3KFVA 4ELYC 1X01A 2I2LA 2HL3A 2OTLQ 3NTIA 3EFOA 3QBYA 4KH0B 2EKOA 2FRYA 2QA4T 4C5GA 1Y57A 2LT4A 2FB7A 2CZ6B 1HJDA 2CDTA 2CH4W 2JM8A 1VYVA 2F5TX 2KRNA 2FPFA 4K11A 3RERA 2F1LA 3EG2A 1VQLA 4C92D 3HPWA 4ELZC 4PKCC 2K9GA 4AFZC 2HMAA 2PVDB 3HFNA 2M51A 2C0TA 2RNAA 2A37A 3FLGA 2XDDA 3OSSC 3L2QA 2FRWA 2O4XA 3CPWA 3ZL7C 4JRKA 1JEGA 5L23A 1U06A 4DBFA 5A0GA 2J7IA 3EFOB 1S72T 1YITT 1PSEA 2RF0A 1MNDA 4M4ZA 2KEAA 1GBRA 1M27C 1UFFA 4ZTFA 2QQRA 4C8QD 3CCJT 3CCQT 1WFWA 4OF1A 4M77E 3PMIA 1CKBA 3CBPA 3G71A 1Y07A 4JJCA 4MMKA 2QDLA 1NEGA 1AOJA 2EVRA 2YRDA 3JCMV 4WF2A 2O4XB 5M9OA 2RI2A 2WSCE 3JCMQ 1NYGA 1UB4A 5KYNA 3R6OA 1M3AA 4M78G 1SF9A 1Y96A 2A0FB 5I22A 1GCQA 4EMHA 1DJ7B 3L2WA 1VQ9T 3G6EQ 4BI4A 1VQ7T 1BU1A 5LJ5g 2VWFA 1BIBA 2DZCA 2DA9A 1IB8A 3MHXA 2HNIA 1BIAA 1NE8A 2V1RA 1M1GA 2W0ZA 3VV0A 3CCST 4D8DA 5GMKh 2XMFA 1OPKA 3I35A 1PRMC 1ZBJA 3META 3VS3A 2J6OA 2R57A 4XU3A 1KHCA 2ZPFB 3OBYA 4J9GA 1SSFA 2MWOA 5FU7C 4E7SA 1Y96B 4O6JA 3EH2A 2D0QB 1MUZA 2HQHA 2DRKA 4KT0E 4C92G 3MP8A 2KR3A 2QA4A 2KI7A 1WHHA 3OYFA 1KK7A 4ZNXA 1VQOQ 1CKAA 2E5KA 2KT8A 2XI9A 4A4FA 4RTYA 3EFRA 5CKFA 3I5SA 1SRLA 4MZTA 1M30A 1AT1B 4OMQA 2OTJQ 3SFMA 1RLQC 4J9DA 2EQMA 3V7SA 3JB9H 4C8QG 2DTOA 2DYBA 1W2BS 2X9HA 2PNIA 3C12A 4RG2A 3AT1B 2KRMA 2C0IA 1S72A 1YITA 4PJOE 3A8MB 2ZZDA 1OPLA 3J7AF 4KULA 3PVQA 3OYMA 1YP5A 4R56A 3OYDA 4PFOA 1V29B 4MMLA 1D09B 4FT2A 3CCJA 3CMET 2ZGWA 1WA7A 3CCQA 5CO7A 3QJ6A 1JQQA 3OYJA 3SEMA 4M77A 1VQ5T 5GMKi 2CP3A 3JCMe 3E2UA 3SWNA 5FLXE 2RHZA 3G4ST 4B9WA 7AT1B 4FYYB 5LJ5j 1HSQA 3QUIA 2RI3A 5GMKj 1OV3A 4ESRA 3LWHA 2BUDA 1ACMB 1IXDA 2CKKA 3MO8A 3CMAQ 5GAMe 2QGFB 2GBQA 2K4YA 2LCCA 5LJ3d 3OYGA 2RJEA 3CPWS 2OAWA 1IO6A 4V2SA 3HL8A 4KGVB 1VQ9A 2XK0A 1XNIA 3VRZA 4NL3A 4M77B 2QQAA 1K76A 3E9GA 1JXMA 5GAOq 2KGTA 1ZX6A 1VQ7A 3SWNB 3CD6Q 4BD3A 1TUDA 2M16A 2DIGA 2LJ0A 2ZPGB 2C0OA 1YNZA 2CZ0B 5CK9A 4J9CA 5KYYA 3EGUA 2RH2A 1ARKA 4GLKA 1EX4A 2DXBA 2D0NA 1YN8A 1TUGB 2RPNA 4IUUA 2A7YA 1VQNT 2NUTA 1G3TA 2KBTA 1OX8A 3VRYA 1K0XA 1SEMA 2DIQA 1NPRA 5C6SA 1M5Q1 5IT9E 2R5MA 5CR2A 3S6WA 1U3OA 1R8OB 2ED1A 4HA8A 2L0AA 2QXFA 2CP0A 3MJXA
chains in the Genus database with same CATH topology
2CZ7B 4C0GA 3CMAA 2VXEA 1UGPB 2D6FA 2K2VA 3CC2A 4PLIA 4IKFA 1FX7A 5CKHA 4C5EA 4M7AF 3GNGA 1KC8C 4OGCA 3VJPA 1YBYA 1VQ6T 1X75C 3I56A 1QP2A 4C8QE 3CCMA 2LTOA 5I2MA 3KUFA 3VYGA 5GAMf 1WPYA 5GMKm 2VYTA 2EQJA 4JUVA 4CI0C 1M4ZA 2EIFA 4A4GA 3OYEA 1M1KU 2DEQA 3E9FA 3ZBDA 4ATOA 3GIBA 2E6NA 5CCAA 5GAOn 2QEXT 2CGHA 2DJZA 3JRZA 3V8KA 4LDYA 5A0DA 1Q86C 2RK2A 3CD6A 3ZFJA 4M7DB 1BKBA 3L2UA 3OYAA 3FIFA 2VUBA 3X26B 2KY9A 5CAIA 3NFCA 2DO3A 2DPPB 1N6AA 1N8RU 4LDVA 5DY9A 3OYIA 3CEYA 3MP1A 4L59A 4RCBA 4E47A 3RKYA 3CMEA 2YRVA 3PMTA 3TCJA 1JJ2S 2JTFA 2K57A 2YLCA 4QVDA 3MEUA 3EFSA 1VQLT 1GXIE 1D3BB 2RJCA 5GAMd 1VQ5A 3QYHB 4M7DD 3JCMh 4C92C 4OVAA 4OB3B 3J81E 3G7ZA 3G4SA 1Y7XA 1MHNA 2XU8A 3GF5A 3PIPA 5IN1A 3QO3A 3V7RA 3QYGB 2RO0A 3CCUT 1OZ3A 4II1A 2LCLA 4QW2A 1YHQA 3LLRA 2LDMA 3UDCA 2MMPA 4PLLA 2XDPA 5LJ5f 4HCZA 3SD4A 2RA2A 2QTXA 2K5IA 2L3RA 2GFAA 2MF2A 4F7UE 3I55T 3OYKA 2FL7A 5GAOr 1KD1U 2FHDA 2G3RA 3L2VA 1QP3A 5CKBA 1K9MC 4M75G 3SB2A 3A5ZB 3TREA 3VU3C 5I2SA 4JS4A 4PJOB 3PGGA 1MGQA 1YIJT 1G3YA 3X20B 1VQ4T 4M78A 4M7AE 1OYXA 4BE2A 1QVGA 2M1HA 1O9SA 1K8AU 4EMKC 3S3NA 3HRUA 3QXEB 2E5QA 4ZN1A 3CCVT 4BDZA 4XQ3A 1VIFA 4DQ2A 3OB9A 3CC7T 5FU6B 2FYKA 1M1FA 4M7AG 2JN0A 1QVFA 3OY9A 2EFIA 4M77G 1W4SA 5DLQE 5LJ5d 3TEEA 4PJOD 2IVWA 3BY7A 3G71T 3CCET 2DAQA 2PQWA 2RM4A 2O01E 5DLOA 4NL3A 1M8VA 2X4WA 1WQ7A 4YTLA 3CXCS 2VC8A 3GOXA 2HQXA 2Y90A 2HD0A 3CCLT 1YJNT 3OMCA 3OYBA 4QVZA 2ZPBB 3PIOA 4J6YA 1P92A 2V8JA 2OTLA 5FU7B 4BY6B 4JLGA 2PVOB 2R5AA 4IUTA 1K73U 3RMSA 3DLLA 4HCCA 3M57A 2RHUA 5AYFA 3UPUA 2HQEA 2ZPIB 5GAN4 1G5VA 3MEVA 2DZ9A 3DKMA 2L89A 2LX9A 1OI1A 4M78B 1YJWT 4EPCA 5LJ3g 3PTAA 1VQMA 2X4JA 2KMTA 3QHSA 3LWIA 2PU9B 5GAN7 3FB9A 4JJNK 2VXFA 3CPFA 4QQDA 2YLBA 5LL6S 4M75C 4KBMB 4JLIA 1N9SA 3JB9I 3N5BB 1WQWA 3VUBA 3HRTA 2E64A 3JCMX 2RJDA 3QSUA 3LGFA 1NJIU 2OTJT 3RKXA 2EJFA 3FDRA 5GAN2 4ZGJB 4M78D 1KG1A 3QPHA 2DXCA 3M5AA 2JZ2A 3RUXA 2XIDA 5CQXA 4M7AC 1Y71A 2EYQA 2KAFA 4FSXA 5CKEA 4M77C 1Q82U 3UWNA 1N27A 2LVMA 3L42A 5GANd 1H3ZA 2L5QA 3H6ZA 4N0AA 1JB0E 2MAMA 2QQ9A 4JRIA 4M75F 3SWNC 3JCMf 3OQ5A 3CCRA 5L8RE 4BE1A 1W2BA 1KQSA 4LD9K 3A8OB 2RHXA 3RKWA 3BDLA 2F5KA 2F69A 1UGQB 2P0PA 1UEBA 3P8BB 3WXMB 2LQKA 3A8HB 2K5LA 5HK0A 3WVEB 4C0DB 3OA6A 4IUVA 1ZBXA 5I21A 1VQ6A 3NTHA 4GY5A 1NPPA 4E7LA 4ELYC 3JB9D 1X01A 4BE0A 4C8QA 3X24B 3O8VA 4M77F 1M90U 2I2LA 3KXTA 3QG1A 5GMKl 3S3MA 4J5YA 2KDSA 2P4TA 3NTIA 3QDRB 3QBYA 4OP0A 4XK8E 4C92B 2QEXA 3JCMd 2EKOA 3CBOA 2QA4T 4C5GA 4M7DG 2NLUA 5CIUA 2PUKB 4X34A 2LT4A 4BI8B 2QDYB 4PJOA 1HK9A 2GF7A 2FB7A 1KQ2A 1UGSB 3HKSA 4RCCA 2CZ6B 2CZ1B 1EIFA 3OYYA 2K5FA 4NS5A 2L8DA 4OMFB 2F5TX 3RERA 1VQLA 5D6YA 3HPWA 4C92D 4ELZC 1Q7YU 4L5GA 4PKCC 4L6V5 1TH7A 5KE2A 2AHJB 5GAOl 3L2ZA 2XKOC 2PVDB 4J83A 5CVIA 2Y4XA 3HFNA 4J6WA 4N4HA 2DXTA 2V8IA 3A8LB 4ZGEB 2C06A 2XDDA 3FLGA 3RIRA 2K3XA 3CCUA 3QKJA 3OSSC 1Q81C 4Q5WA 3L2QA 2E10A 4QQGA 1B34B 1ZHIA 1YI2T 1OZ2A 2O4XA 3M4GA 4C8QB 3CPWA 4FU6A 4JRKA 3G6ET 2LNVA 2QI2A 2QQSA 4NOYA 4PL6A 3JCMJ 2E6ZA 3CC4T 5EG2A 5A0GA 3FEOA 4M75E 4N4IA 5J39A 1PSEA 4E7HA 3A8GB 3ASKA 3E1SA 3I55A 1YITT 1KQ1A 4A4HA 4MZPA 4IUQA 3M59A 2ZCFB 4PJOG 4ZTFA 3JB9F 2K3YA 3M56A 3M54A 1YIJA 5A0LA 2QQRA 2HAXA 1X6OA 1VQ4A 4C8QD 3CCJT 3V8JA 4A54A 3CCQT 1M1KC 4HT9A 4XTVA 3J80E 3CCVA 2DTIA 4ZN3A 3HFOA 2JVVA 4OF1A 4QVCA 3QZ9B 3CC7A 4M77E 1RI0A 5LJ3j 3KBGA 4M7DC 3PMIA 3LGLA 3MP6A 5FROA 5GAMg 2MWPA 3CBPA 3CCEA 3G71A 1VQKT 1N8RC 1Y07A 4MMKA 5KCHA 4XU0A 1I81A 1YJNA 4J8OA 3SDZA 3JCMV 3CCLA 4WF2A 3Q1JA 2O4XB 5M9OA 2XD0A 2RI2A 2VGMA 2X4YA 2B8AA 1S72T 3V8LA 2DVEA 2WSCE 4E7IA 5HK3A 3JCMQ 3PFSA 2BIVA 1UB4A 2GQVA 3S3OA 4M7DF 4F7UB 3OBWA 3AHUA 4C0ZA 1I5LA 1FXXA 3LH0A 3CBMA 3FC3A 1PSFA 2JUFA 3R6OA 4IUPA 1VQPT 2FVUA 1QVPA 4M78G 5CKDA 1Y96A 4BDYA 1YJWA 4EMHA 2LRQA 1DJ7B 1VQOT 3L2WA 3OW2A 2Y4YA 1KD1C 1VQ9T 3P8DA 2H3JA 4BI4A 3CCMT 2X4XA 3JAME 3C94A 3MCAB 4X9DA 1VQ7T 3NTKA 1U1TA 4Z02A 5LJ5g 4UC4A 4HCBA 1BIBA 2DZCA 4OB0B 1YCYA 1K8AC 3MHXA 3CCSA 2HNIA 2OTJA 4OGEA 3FJPA 5D6XA 4C92A 1BIAA 1NE8A 5LJ3h 1JRIA 4M7AD 1QVGS 1M1GA 3CCST 1N9RA 2DKGA 2ZPHB 5FU6C 3VV0A 2P0QA 4PNOA 2RK1A 5LJ3e 4E7KA 5C0MA 1KC8U 1VQ8T 5GMKh 1U8RA 3ZEHA 1LNXA 2LC4A 2PVGB 3OYCA 3JB9G 4J7IA 1QVFS 5FRNA 1IZ6A 1I4K1 5GMKe 4PJOF 1WNLA 3VYHB 5KCOA 5CQYA 3META 4IURA 1XQHA 2R57A 3C4SA 2BKDN 1KHCA 4XU3A 4JDSA 1ZQ1A 2E41A 2ZPFB 1WJQA 3EAEA 3OBYA 4P5NA 4JRPA 1Q86U 1SSFA 2MWOA 1UGRB 1BI0A 1O75A 5FU7C 4BY6C 5GAN5 2WSEE 1Y96B 5A2QE 4O6JA 1RL2A 2D0QB 4BI3A 1K73C 1JBMA 2EJ9A 3ER0A 5GAN6 1JJ2A 3OYLA 4EMKA 2CYZB 2OAUA 1B34A 4NL2A 3QZ5B 1XTDA 3X28B 3OS1A 4E7JA 3VKIA 4KT0E 1H641 4FT4A 4M7DE 2X35A 4C92G 4XU1A 4OB2B 3MP8A 2XG8D 4M78C 2QA4A 2WSFE 1FWZA 4BACA 4JRQA 1YJ9T 2ZPEB 4DA4A 3OYFA 1G3WA 3OS0A 3LYIA 3OSVA 3H8ZA 1XOVA 2JOYA 5GANg 2XI9A 4MDXA 2LT1A 4Y28E 4A4FA 1NJIC 2DD5A 3EFRA 2DXUA 5CKFA 3CMAT 3HRSA 3INZA 4LDXA 3CC2T 2RHIA 2A3LA 4M78F 4MZTA 3M53A 4HT8A 3PT9A 4X9CA 4XTUA 1K9MU 1BI3A 1QW1A 3M4YA 4TVRA 2V8KA 3ME9A 5GAMj 5GANh 3I56T 1Q82C 3GLXA 4KUDK 3E19A 5J3BA 3SFMA 2GFUA 1IREB 3V7SA 2EQMA 5GANe 1YI2A 1VUBA 3OMGA 4C8QG 3HSBA 3JB9H 2DTOA 2KK4A 3RMQA 4EMKB 5HKCA 2RB6A 5DM7R 3G6EA 1W2BS 2M0OA 2RJFA 3C12A 4RG2A 3X25B 1KQSS 3CC4A 2VV5A 3OS2A 1S72A 1YITA 3CD6T 3A8MB 4M75A 4PJOE 4FIBA 4C0DC 3P8HA 2EQKA 2ZZDA 3JCMg 3J7AF 4KULA 4EMGA 4DOVA 4HKEA 4F7UA 3DB4A 4EDUA 2CS7A 3UT1A 3OYMA 3CXCA 4R56A 1M90C 2RD1A 3OYDA 1V29B 4MMLA 1BYMA 4FT2A 4FM4B 4N4GA 3CMET 2ZGWA 3CCJA 3CCQA 2E12A 5CO7A 3QJ6A 4RG8A 5GAOm 4M7AA 3OYJA 4ZGDB 3C95A 4M77A 5D6WA 1VQ5T 2EJGA 4VUBA 5GMKi 3JCMe 3T9NA 2E1HA 3M58A 3SWNA 1U1SA 5FLXE 2RHZA 5LJ3f 3G4ST 4B9WA 1VQKA 3DB3A 5LJ5j 3QUIA 1G3SA 2RI3A 5GMKj 1BI1A 4N0AC 3LWHA 1YHQT 2JNGA 3RESA 2DD4A 4OB1B 4A53A 4C5HA 3OYHA 1WGSA 2KSSA 2BUDA 1Q7YC 4J6XA 4C92F 2YHTA 1BI2A 5GAMh 2WACA 5GAN8 2XICA 2CKKA 3MO8A 4M75B 3JCMc 4F7UG 5HY6A 5GAMe 4LD6A 2R58A 3GP8A 4XTXA 3BW1A 3OYNA 3DLMA 4BB7A 3JCMb 3PNWC 4M78E 2E65A 2K4YA 4XTWA 4C8QC 2P0KA 2EWNA 2LCCA 5LJ3d 1LOJA 3OYGA 2RJEA 4ME7A 1VQPA 2DK3A 4KUIA 1LJOA 4LDUA 3V7CA 2VGNA 4O5VA 3VUZA 3CPWS 1VQOA 4V2SA 2RI5A 2DTHA 3HL8A 2LQ8A 4M7AB 1VQ9A 2XK0A 1XNIA 4A4KA 4J7FA 2MI6A 3M9QA 2QQAA 3E9GA 1HXDA 1NZ9A 4M75D 4M77B 4MZMA 4DOWA 3JCMP 5GAOq 1VQ7A 4QQ6A 3SWNB 3WVDB 4ZTJA 4BD3A 4PJOC 3HP9A 2XDBA 4B9XA 2KQWA 2M16A 1VIEA 2DIGA 3GPLA 3URGA 4C8QF 2D9TA 4A4EA 5GAOp 2OTLT 2ZPGB 2EAYA 1VQ8A 4XTYA 4XU2A 4M77D 3L1AA 2KVQG 2CZ0B 2RHYA 5IAYA 5LJ5h 3HHTB 3QJYA 3F70A 5CK9A 5GAN3 3TU4K 4XTZA 5GANj 5LJ5e 5GANf 2RH2A 4JS5A 3LW5E 4C5IA 3GNFB 4GLKA 2E70A 2DXBA 3OS5A 5J26A 5KH6A 1VQMT 1WJRA 3M55A 4CRIA 3JSCA 3JCMW 1VQNA 3MEWA 1M9SA 4IUUA 3JB9J 2GCXA 2A7YA 4FL6A 3FRNA 1VQNT 1G3TA 5FRMA 3L2RA 2HBPA 4C92E 4RMOA 1KHIA 1AHJB 3MEAA 2DIQA 1NPRA 3BFMA 4XAXB 5C6SA 1M5Q1 4BUGA 4M7DA 1WJSA 4LDWA 4D6WA 5IT9E 2M9UA 1YJ9A 2R5MA 2XHCA 5CR2A 2QQBA 2EQUA 3S6WA 3BDUA 4MDWA 2JTMA 1I8FA 1R8OB 4Y91A 3OW2S 4C0FA 1Q81U 3CCRT 2IG0A 4F7UF 4HA8A 3LX7A 2QXFA 1D3BA 3QIIA 4RKUE 5KE3A 2PUOB 4R55A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DB4 A;  4EDU A;  3UT1 A;  3OYM A;  3Q1J A;  2O4X B;  5M9O A;  3OYD A;  2RI2 A;  4PLI A;  2X4Y A;  2B8A A;  4IKF A;  4N4G A;  4C5E A;  4E7I A;  2RJD A;  3LGF A;  3PFS A;  2BIV A;  3QJ6 A;  3S3O A;  3FDR A;  2LTO A;  3OYJ A;  3KUF A;  5D6W A;  2JZ2 A;  3LH0 A;  2VYT A;  2EQJ A;  3FC3 A;  4A4G A;  3OYE A;  3E9F A;  1H3Z A;  2RHZ A;  4IUP A;  1N27 A;  2LVM A;  3L42 A;  3UWN A;  2E6N A;  4B9W A;  3H6Z A;  4BDY A;  2LRQ A;  3DB3 A;  3OQ5 A;  4BE1 A;  3L2U A;  3OYA A;  2RI3 A;  3L2W A;  3P8D A;  2RHX A;  2X4X A;  5KCH A;  3BDL A;  2F5K A;  4C5H A;  3OYH A;  1WGS A;  2BUD A;  3OYI A;  3CEY A;  3MP1 A;  3NTK A;  4L59 A;  4Z02 A;  4UC4 A;  2YRV A;  3PMT A;  3OA6 A;  2WAC A;  2JTF A;  4IUV A;  3MEU A;  2CKK A;  3NTH A;  3MO8 A;  4GY5 A;  5D6X A;  4E7L A;  4BE0 A;  2RJC A;  4LD6 A;  2R58 A;  3O8V A;  3OYN A;  3DLM A;  3PNW C;  3S3M A;  4OVA A;  4E7K A;  5C0M A;  2P0K A;  2LCC A;  3NTI A;  3OYG A;  2RJE A;  1MHN A;  3QBY A;  3ZEH A;  3OYC A;  5IN1 A;  5FRN A;  2EKO A;  2RO0 A;  4C5G A;  1OZ3 A;  4II1 A;  2NLU A;  2RI5 A;  5KCO A;  3MET A;  4IUR A;  5CIU A;  4X34 A;  2XK0 A;  1XNI A;  2R57 A;  2BKD N;  1KHC A;  3C4S A;  2LDM A;  3E9G A;  3LLR A;  3M9Q A;  4QW2 A;  2GF7 A;  1WJQ A;  2XDP A;  3EAE A;  4PLL A;  4HCZ A;  3SD4 A;  1SSF A;  2MWO A;  4QQ6 A;  2L3R A;  2GFA A;  4ZTJ A;  4BD3 A;  3OYK A;  4NS5 A;  2L8D A;  4B9X A;  2M16 A;  2FHD A;  2G3R A;  3L2V A;  2DIG A;  5D6Y A;  2D9T A;  4A4E A;  3OYL A;  5KE2 A;  4E7J A;  3OS1 A;  1OYX A;  4BE2 A;  2M1H A;  3S3N A;  2X35 A;  4N4H A;  2E5Q A;  4BDZ A;  2RHY A;  3MP8 A;  3FLG A;  5IAY A;  2K3X A;  3OB9 A;  3QKJ A;  4Q5W A;  3L2Q A;  4BAC A;  3F70 A;  4QQG A;  1OZ2 A;  2O4X A;  4FU6 A;  2EFI A;  3OY9 A;  3OYF A;  2QQS A;  4C5I A;  4PL6 A;  2DAQ A;  3OS0 A;  3FEO A;  2PQW A;  3LYI A;  4N4I A;  5J26 A;  5J39 A;  3ASK A;  3H8Z A;  5KH6 A;  4E7H A;  1WJR A;  4CRI A;  2X4W A;  4A4H A;  3GOX A;  3MEW A;  4IUQ A;  4IUU A;  2HQX A;  4A4F A;  4FL6 A;  3OMC A;  3OYB A;  2K3Y A;  4QVZ A;  4ZTF A;  5FRM A;  3L2R A;  2QQR A;  2RHI A;  2R5A A;  4IUT A;  3MEA A;  3ME9 A;  2DIQ A;  5C6S A;  2GFU A;  1WJS A;  1RI0 A;  2RHU A;  2EQM A;  2HQE A;  3PMI A;  3OMG A;  2R5M A;  3LGL A;  3MP6 A;  5FRO A;  3S6W A;  2EQU A;  1G5V A;  3MEV A;  2MWP A;  2M0O A;  2RJF A;  4RG2 A;  2L89 A;  1OI1 A;  3OS2 A;  2IG0 A;  3LX7 A;  3QII A;  5KE3 A;  3P8H A;  2EQK A;  4QQD A; 
#chains in the Genus database with same CATH topology
 2CZ7 B;  4FSS A;  2VXE A;  2D6F A;  1IGQ A;  3EG3 A;  5CKH A;  1KC8 C;  1N5Z A;  2GTJ A;  1D0Z A;  5GAM f;  1WPY A;  4JUV A;  1M4Z A;  4A4G A;  2DEQ A;  2E6N A;  1Q86 C;  2QEX T;  3JRZ A;  1VA7 A;  2RK2 A;  3ZFJ A;  1MNE A;  4IIM A;  3X26 B;  5CAI A;  3NFC A;  4RCB A;  1VQM Q;  3CME A;  2YRV A;  3TCJ A;  2K57 A;  1GXI E;  1TU0 B;  2RJC A;  1VQ5 A;  3QYH B;  4M7D D;  4R0K A;  2KXD A;  1RAD B;  3G4S A;  1Y7X A;  1A0N B;  3EHR A;  1ZUU A;  3UDC A;  2XDP A;  3SD4 A;  2QTX A;  4PJM A;  2L3R A;  1UJY A;  4F7U E;  1TOV A;  2CH4 A;  1KD1 U;  1WX6 A;  1QP3 A;  1K9M C;  5I2S A;  4PJO B;  2MPX C;  3PGG A;  1YIJ T;  4M7A E;  1WI7 A;  1K8A U;  1GL5 A;  1VQ6 Q;  1U5S A;  2A28 A;  4RTU A;  4DQ2 A;  3CC7 T;  4M7A G;  3TEE A;  2IVW A;  3SHW A;  2E3H A;  1OU9 A;  2JMC A;  2O01 E;  5DLO A;  4YTL A;  3GOX A;  3TSZ A;  3OMC A;  4QVZ A;  4J6Y A;  1P92 A;  2V8J A;  3VS7 A;  5FU7 B;  3U23 A;  2PVO B;  4RTW A;  1VQL Q;  1K73 U;  4HCC A;  2HQE A;  2ZPI B;  2LJ1 A;  4KRT A;  1D1B A;  1G5V A;  2P4R A;  1UUE A;  2CP7 A;  1YJW T;  2L89 A;  2LX9 A;  2KRS A;  3LWI A;  2PU9 B;  5GAN 7;  3CPF A;  2YLB A;  4M75 C;  1ZSZ C;  4JLI A;  1C0M A;  3JB9 I;  3HRT A;  3LGF A;  1NJI U;  2EJF A;  1PKT A;  1F1B B;  2DXC A;  4LNP A;  3M5A A;  2JZ2 A;  5CQX A;  4E7Z A;  5CKE A;  1Q82 U;  1TWB A;  4JRI A;  3THK A;  4F16 A;  1BCO A;  3G71 Q;  1UGQ B;  4WCI A;  1RUW A;  3OA6 A;  1K8A R;  4IUV A;  1WYX A;  4OMP A;  1QVG P;  3M0T A;  3X24 B;  4M77 F;  1M90 U;  2L3Q A;  3KXT A;  3QG1 A;  5GMK l;  1JU5 C;  2KDS A;  2P4T A;  4LXC A;  4OP0 A;  4XK8 E;  4Z88 A;  3JCM d;  2QEX A;  3EGD A;  5IXF A;  3CBO A;  4M7D G;  4HVW A;  3HTR A;  4X34 A;  2QG9 B;  2GF7 A;  4KH1 B;  1QKX A;  4NS5 A;  2QGG A;  3H0F A;  2COW A;  1TH7 A;  2AHJ B;  5GAO l;  2XKO C;  5CVI A;  4N4H A;  5AT1 B;  2J6F A;  4QQG A;  1TSF A;  5KYU B;  4FU6 A;  2CUB A;  4NOY A;  2E6Z A;  3CC4 T;  5EG2 A;  3FEO A;  4M75 E;  4E7H A;  3A8G B;  1NJI R;  3M59 A;  2ZCF B;  1ZUY A;  2K3Y A;  1YIJ A;  5A0L A;  2HAX A;  1AZE A;  2FG0 A;  1X6O A;  1Q82 R;  1UJ0 A;  4XTV A;  3CC7 A;  4KGZ B;  3EG9 A;  1RI0 A;  2DIL A;  1KQS P;  1K1Z A;  5FRO A;  5GAM g;  1PG5 B;  2MWP A;  1VQK T;  2F2W A;  2QA4 Q;  1M90 R;  1G2B A;  2X4Y A;  1JXO A;  3V8L A;  1MV3 A;  2DVE A;  1S1N A;  5HK3 A;  2BIV A;  4F7U B;  3OBW A;  2YUO A;  3GBQ A;  2DBM A;  3FC3 A;  1X6B A;  2X3W D;  1YJW A;  4BDY A;  1QLY A;  3CCU Q;  3OW2 A;  2Y4Y A;  3P8D A;  3EG9 B;  2X4X A;  4PFZ A;  3C94 A;  4X9D A;  1YIT Q;  2FPD A;  1WHK A;  2B86 A;  5D7U A;  1M8M A;  4Z02 A;  5FWB A;  4UC4 A;  4HCB A;  3I55 Q;  3FJP A;  1M3C A;  2P0Q A;  2RK1 A;  5LJ3 e;  3CCQ Q;  2L3S A;  3I9Q A;  1LNX A;  2LC4 A;  1H92 A;  2H3E B;  4J7I A;  2LJ3 A;  2ED0 A;  4PJJ A;  4PJO F;  3VYH B;  4FCY A;  5KCO A;  1XQH A;  2YSQ A;  3C4S A;  4LUE A;  1WJQ A;  4P5N A;  4JRP A;  1BI0 A;  1UGR B;  4BY6 C;  2EQI A;  1M2V A;  1RAE B;  1HD3 A;  2CSI A;  1JBM A;  3ER0 A;  3OYL A;  2CYZ B;  4E7J A;  1XTD A;  3X28 B;  3OS1 A;  3VKI A;  4FT4 A;  2QAZ A;  4M78 C;  1X6G A;  2DFU A;  2HDA A;  1AWW A;  1QMC A;  2HL5 C;  2LZ6 B;  5GAN g;  1VQ9 Q;  2LQN A;  2LT1 A;  2VAS A;  2P84 A;  1VQ7 Q;  4PJL A;  1AWJ A;  3CC2 T;  2A3L A;  4HT8 A;  3PT9 A;  4X9C A;  1K0S A;  5GAM j;  5GAN h;  2BZ8 A;  3I56 T;  1M2V B;  3CCS Q;  5J3B A;  1SKU B;  1IRE B;  8AT1 B;  1T3S A;  3HSB A;  1D1C A;  2KK4 A;  2AZV A;  3CC4 A;  2VV5 A;  2NWM A;  4M75 A;  1ZSZ A;  4FIB A;  4C0D C;  5FWC A;  4EMG A;  3DB4 A;  1BYM A;  2E12 A;  2QTV A;  2LX7 A;  4RG8 A;  2NUZ A;  5D6W A;  2E1H A;  3VS6 A;  2CUD A;  1U1S A;  5LJ3 f;  2O88 A;  1Q95 G;  1VQK A;  4F04 B;  2FPE A;  1G3S A;  1YHQ T;  1D0Y A;  3OYH A;  1WGS A;  1Q7Y C;  1JJ2 P;  1BCM A;  2CP2 A;  2YHT A;  5GAN 8;  2EGC A;  2XIC A;  4M75 B;  1ZSZ B;  5HY6 A;  3BW1 A;  3JCM b;  4M78 E;  2E65 A;  4C8Q C;  1B07 A;  2DK3 A;  4KUI A;  1E6H A;  1LJO A;  3UA6 A;  2VGN A;  1W70 A;  2DTH A;  4BE0 A;  1HXD A;  4DOW A;  3PVL A;  4MZM A;  3JCM P;  2K3B A;  3WVD B;  1GRI A;  4PJO C;  3HP9 A;  2XDB A;  1MMD A;  2CRE A;  1VIE A;  3UA7 A;  2GTO A;  3GPL A;  3URG A;  1WHJ A;  2JT4 A;  2OTL T;  2HKQ B;  2AIR B;  2EAY A;  1D1A A;  4XU2 A;  2D1X A;  3M0S A;  4J9B A;  3L1A A;  2PTK A;  2KVQ G;  5IAY A;  2ROT A;  5LJ5 h;  1VQ5 Q;  4ORZ A;  3HHT B;  3F70 A;  3TU4 K;  4XTZ A;  5GAN j;  2DYI A;  3G4S Q;  2F2V A;  3GNF B;  3H9N A;  3CXC P;  1YCS B;  3UAT A;  3QWY A;  1WHM A;  2HBP A;  1NBE B;  4C92 E;  3MPU B;  1WIE A;  1YWO A;  4OML A;  1QKW A;  2QK0 A;  3MEA A;  3ULR B;  1RI9 A;  1WJS A;  1SPK A;  2M9U A;  2EGE A;  2EQU A;  1KSW A;  1BB9 A;  2JTM A;  2IPO B;  3OW2 S;  2NUP A;  4F7U F;  3QII A;  1RAG B;  3CCM Q;  3CC2 A;  1FX7 A;  4M7A F;  2OX7 A;  3GNG A;  1QWE A;  3I56 A;  4C8Q E;  3NMZ C;  3VYG A;  2EQJ A;  4CI0 C;  3E9F A;  1NYF A;  3VS0 A;  1RAH B;  5CCA A;  2DJZ A;  1GFC A;  3L2U A;  2FZG B;  2KY9 A;  1N6A A;  3RKY A;  2A36 A;  2NUP B;  1NM7 A;  3MEU A;  1VQN Q;  2KE9 A;  4OVA A;  4OB3 B;  3J81 E;  1H3H A;  2XU8 A;  2L2P A;  3REA B;  1VYT A;  3V7R A;  3QYG B;  2W10 A;  4QW2 A;  1YHQ A;  3LLR A;  4FYW B;  4HCK A;  4PLL A;  2RA2 A;  2K5I A;  2O2O A;  3OYK A;  2FL7 A;  5GAO r;  2YXY A;  4JJD A;  3SB2 A;  3VU3 C;  1PHT A;  1Z9Z A;  1MGQ A;  1VQ4 T;  4M78 A;  2HEQ A;  4EMK C;  1FMV A;  3HRU A;  2E5Q A;  3CCV T;  1M1F A;  1WHG A;  5FW9 A;  2JN0 A;  4E6R A;  2EFI A;  2ESW A;  2PQW A;  2RM4 A;  2M0Y A;  2Y90 A;  2HD0 A;  3CCL T;  1YJN T;  3OYB A;  2ZPB B;  2OTL A;  4BY6 B;  4JLG A;  4IUT A;  1OQK A;  2JW4 A;  3NGP A;  2YUN A;  2RHU A;  2RQR A;  1HYO A;  3MEV A;  2DE0 X;  2DJQ A;  2DZ9 A;  4M78 B;  4B6M A;  4EPC A;  5LJ3 g;  2DBK A;  2X4J A;  3LH5 A;  2E4H A;  5IHI A;  1CSK A;  2Z0W A;  1OOT A;  2RJD A;  2BE7 D;  2OTJ T;  5GAN 2;  1KG1 A;  3CQT A;  3QPH A;  1YIJ Q;  4ANJ A;  4AFU C;  3QWX X;  3RUX A;  4M7A C;  2EYQ A;  2KAF A;  4LN2 A;  1N27 A;  3L42 A;  1TTH B;  1R77 A;  2MAM A;  3JCM f;  4M75 F;  4BE1 A;  1M2O A;  2J05 A;  2RHX A;  3PE0 A;  2HBW A;  2COY A;  3WXM B;  1X2Q A;  2CT3 A;  5HK0 A;  4C0D B;  5I21 A;  4GY5 A;  4E7L A;  3JB9 D;  2HZY A;  4C8Q A;  2MIO A;  2QAS A;  3A98 A;  4J5Y A;  2KXC A;  2RQV A;  3QDR B;  4C92 B;  5CIU A;  2PUK B;  4PJO A;  1HK9 A;  1YJW Q;  4RCC A;  2BZY A;  2CZ1 B;  3OYY A;  2K5F A;  4OMF B;  1R0B G;  2CSQ A;  4L6V 5;  5KE2 A;  3L2Z A;  2JTE A;  4J83 A;  2C06 A;  2Y4X A;  4J6W A;  2PZ1 A;  2DXT A;  2V8I A;  1Q81 C;  4Q5W A;  1QCN A;  1RAI B;  1B34 B;  1ZHI A;  4DBR A;  1OZ2 A;  2HSP A;  4C8Q B;  1YI2 T;  2LNV A;  2QI2 A;  4PL6 A;  3JCM J;  1LPL A;  1MMG A;  2YWW A;  4N4I A;  3ASK A;  3E1S A;  3REB B;  1UG1 A;  4IUQ A;  4MZP A;  4PK4 A;  1SRM A;  1VQ4 A;  3V8J A;  1M1K C;  4OMN A;  2I0N A;  3CCV A;  2DTI A;  4RUG A;  3QZ9 B;  5LJ3 j;  4M7D C;  1W2B P;  4Y92 A;  1UE9 A;  1N8R C;  2DM1 A;  2DEU A;  4FYX B;  1YJN A;  3CCL A;  4J8O A;  2GNC A;  4RTV A;  2D8J A;  2DL8 A;  1E7O A;  2B8A A;  1T0H A;  3S3O A;  1J3T A;  4C0Z A;  1FXX A;  3LH0 A;  1YFN A;  2JUF A;  1VQP T;  2FVU A;  1QVP A;  5CKD A;  4OMO A;  2LRQ A;  2H3J A;  2M02 A;  2DMO A;  3CC4 Q;  3NTK A;  4OB0 B;  1YCY A;  2J06 A;  2OTJ A;  1ZSG A;  5D6X A;  1N9R A;  4PNO A;  1VQ8 T;  5C0M A;  1KC8 U;  1B7T A;  3CPW P;  1U8R A;  1MV0 B;  3ZEH A;  3JB9 G;  2AT1 B;  1VOM A;  2F2X A;  9ATC B;  1IZ6 A;  1IHW A;  5GMK e;  5CQY A;  4IUR A;  4QKU A;  2A08 A;  1VQK Q;  3EAE A;  1Q86 U;  2OJ2 A;  1X43 A;  3R6N A;  1D0X A;  1LVK A;  5A2Q E;  1TG0 A;  2CT4 A;  4EMK A;  3EH1 A;  1PKS A;  2OAU A;  4NL2 A;  5KYU A;  1H64 1;  4M7D E;  2HKN A;  2X35 A;  4XU1 A;  4OB2 B;  4DEX A;  4BAC A;  3EG1 A;  4JRQ A;  1YJ9 T;  5IXB A;  3OS0 A;  3LYI A;  3OSV A;  1GCP A;  1RAF B;  1ABQ A;  1OX9 A;  4LDX A;  2DXU A;  2RHI A;  4M78 F;  3M53 A;  4D8K A;  4XTU A;  1K9M U;  4TVR A;  3M4Y A;  2ABL A;  3ME9 A;  2EYY A;  8ATC B;  2CP6 A;  2X51 A;  2K2M A;  1YI2 A;  3RMQ A;  4EMK B;  2YUP A;  3VS2 A;  4FYV B;  3OS2 A;  1WHL A;  1XJW B;  3JCM g;  4F7U A;  2H8H A;  2CS7 A;  3UT1 A;  2RD1 A;  4CC4 B;  1KC8 R;  1AWO A;  2KYB A;  5GAO m;  4M7A A;  3UF4 A;  4FW2 A;  2X3X D;  2EJG A;  3M58 A;  1Q86 R;  3NHN A;  4LE9 A;  2KNB B;  3DB3 A;  4N0A C;  4OB1 B;  4AMC A;  1KIK A;  4J6X A;  1NG2 A;  3A1P A;  4C92 F;  1BI2 A;  5GAM h;  2BTT A;  3EGX A;  1EZZ B;  2R58 A;  3CC2 Q;  3DLM A;  4BB7 A;  3RR6 A;  3PNW C;  2P0K A;  1LOJ A;  3I56 Q;  4ME7 A;  1VQP A;  4LDU A;  2DL7 A;  2AZS A;  2LQ8 A;  4M7A B;  4A4K A;  4J7F A;  2MI6 A;  3M9Q A;  1LCK A;  2ECZ A;  4ZTJ A;  1S72 Q;  1K9M R;  4C8Q F;  2D9T A;  4A4E A;  2FEI A;  2JJ9 A;  1VQ8 A;  4M77 D;  2LCS A;  3CCJ Q;  2RHY A;  4RTT A;  3EGX B;  3MKD A;  5IHK A;  1BK2 A;  1H8K A;  3C0C A;  4WTO B;  4JS5 A;  2BZX A;  4C5I A;  2E70 A;  1OUL A;  1WJR A;  1M3B A;  3M55 A;  3JSC A;  3JCM W;  1M9S A;  3JB9 J;  2GCX A;  1OEB A;  3FRN A;  5FRM A;  4F14 A;  3L2R A;  2ATC B;  2FO0 A;  3I5R A;  2QYZ A;  3BFM A;  1QCO A;  4XAX B;  4M7D A;  4BUG A;  2LMJ A;  4LDW A;  4D6W A;  1YJ9 A;  1FMW A;  2XHC A;  2YUQ A;  3D7S B;  4C0F A;  3CCR T;  3LX7 A;  1D3B A;  4CC7 A;  4C0G A;  3O5Z A;  2K2V A;  3H41 A;  4PLI A;  3VJP A;  2RQT A;  1QWF A;  4AT1 B;  1WXT A;  3KUF A;  2K7A A;  2VYT A;  2EIF A;  3OYE A;  3M0P A;  1IHV A;  3ZBD A;  4ATO A;  2EBP A;  5GAO n;  5A0D A;  3V8K A;  4LDY A;  1PWT A;  4M7D B;  3OYA A;  3FIF A;  2VUB A;  2DPP B;  4LDV A;  4F17 A;  5DY9 A;  3CEY A;  3MP1 A;  2JM9 A;  2YLC A;  2EPD A;  4QVD A;  2O9S A;  3EFS A;  1D3B B;  4C92 C;  1SG5 A;  1MHN A;  5IN1 A;  3CCU T;  2RO0 A;  1OZ3 A;  2LCL A;  2HCK A;  4HCZ A;  2MF2 A;  2JS0 A;  4JZ4 A;  3I55 T;  4AG1 C;  2FHD A;  1UEC A;  5CKB A;  3TRE A;  4JS4 A;  1RLP C;  3X20 B;  1NLP C;  4BE2 A;  1QVG A;  1O9S A;  3S3N A;  3QXE B;  4ZN1 A;  4BDZ A;  4XQ3 A;  3OB9 A;  2FYK A;  2V26 A;  2RQU A;  1QVF A;  5DLQ E;  4M77 G;  5LJ5 d;  2ZAE A;  4PJO D;  4EIK A;  3BY7 A;  3CCE T;  4QT7 A;  1WQ7 A;  2VC8 A;  1K9A A;  4DBQ A;  4PJN A;  2JMA A;  3PIO A;  1W6X A;  4IIO A;  2KYM A;  2EYW A;  2R5A A;  3RMS A;  3CME Q;  3DLL A;  2MYS A;  3M57 A;  5AYF A;  3UPU A;  1TS9 A;  1B3Q A;  5GAN 4;  4A63 B;  2EW3 A;  1X69 A;  3DKM A;  4Z89 A;  3PTA A;  3FB9 A;  4HVV A;  4JJB A;  1WQW A;  2MCN A;  3JCM X;  1YWP A;  1NEB A;  3QSU A;  1JO8 A;  2RQW A;  3FDR A;  2EGA A;  1VQ4 Q;  2XID A;  1PRL C;  1H3Z A;  3CCV Q;  2K79 A;  2L5Q A;  3H6Z A;  4N0A A;  2QQ9 A;  3CCR A;  1KQS A;  3OQ5 A;  5L8R E;  1R0C B;  5IHN A;  4Z8A A;  1WDX A;  2LQK A;  1ZBX A;  1YJN Q;  3NTH A;  3CCL Q;  1RAB B;  2JS2 A;  3BE3 A;  3O8V A;  3S3M A;  1Z9Q A;  3VS5 A;  2NLU A;  3M0R A;  2CP5 A;  4BI8 B;  2QDY B;  1KQ2 A;  1UGS B;  3HKS A;  2FZK B;  1EIF A;  2L8D A;  2K6D A;  5D6Y A;  3JV3 A;  1Q7Y U;  4L5G A;  4ZGE B;  3A8L B;  1WXB A;  2DLP A;  2K3X A;  3RIR A;  3QKJ A;  3CCU A;  2E10 A;  3TQ7 P;  3M4G A;  1PNJ A;  5KYX A;  3G6E T;  1W1F A;  2QQS A;  1QCF A;  5J39 A;  3I55 A;  1KQ1 A;  4A4H A;  4PJO G;  3JB9 F;  2EYX A;  3M56 A;  3M54 A;  1TXQ A;  4A54 A;  4HT9 A;  3J80 E;  2VB6 A;  4DEY A;  4ZN3 A;  3HFO A;  2JVV A;  3IQL A;  4QVC A;  1KJW A;  3KBG A;  2KT1 A;  3LGL A;  3MP6 A;  4GBQ A;  3CCE A;  2VKN A;  1SHG A;  5IH2 A;  4RTZ A;  2QEX Q;  2OI3 A;  2DNU A;  5KCH A;  2EKH A;  4XU0 A;  4DBH A;  1I81 A;  3SDZ A;  3Q1J A;  5KYX B;  2XD0 A;  2VGM A;  2HSE B;  3NPF A;  4E7I A;  3PFS A;  2GQV A;  3RBB B;  4M7D F;  3AHU A;  1I5L A;  3QDF A;  4JPB W;  3CBM A;  1PSF A;  4IUP A;  3EG0 A;  1C6V X;  4CC3 A;  1YI2 Q;  1VQO T;  1KD1 C;  1I0C A;  3CCM T;  2AKK A;  3JAM E;  1Q7Y R;  3MCA B;  1U1T A;  1FYN A;  4FW1 A;  1K8A C;  4HVU A;  3CCS A;  4OGE A;  4C92 A;  5LJ3 h;  1JRI A;  4M7A D;  1QVG S;  2DKG A;  2ZPH B;  5FU6 C;  1T3L A;  4E7K A;  3OYC A;  2PVG B;  1QVF S;  5FRN A;  3FJ5 A;  1I4K 1;  1WNL A;  1GBQ A;  3CC7 Q;  2BKD N;  3G1J A;  4JDS A;  1ZQ1 A;  2E41 A;  1O75 A;  5GAN 5;  1E6G A;  2WSE E;  3H0I A;  1SSH A;  1RL2 A;  4BI3 A;  1K73 C;  1ZA2 B;  2RN8 A;  2EJ9 A;  5GAN 6;  1JJ2 A;  2ENM A;  1QQJ A;  2VVK A;  1B34 A;  3QZ5 B;  1I07 A;  2JXB A;  2XG8 D;  4PFP A;  2WSF E;  1FWZ A;  5GJV B;  2ZPE B;  4DA4 A;  1Y0M A;  1VQP Q;  1G3W A;  3H8Z A;  3M0U A;  1XOV A;  2JOY A;  5KYY B;  4MDX A;  4Y28 E;  1NJI C;  2DD5 A;  3CMA T;  3HRS A;  3INZ A;  1ABO A;  2NYS A;  1C1A A;  1BI3 A;  1QW1 A;  1UDL A;  2BE9 B;  2V8K A;  1Q82 C;  4KUD K;  3GLX A;  2NUT B;  3E19 A;  2GFU A;  5GAN e;  2IIM A;  1VQ8 Q;  1VUB A;  3OMG A;  1GFD A;  3G6E A;  3OW2 P;  5HKC A;  5DM7 R;  2RB6 A;  1KQS S;  2M0O A;  2RJF A;  3X25 B;  4LUD A;  3CD6 T;  1OU8 A;  3P8H A;  2EQK A;  4DOV A;  4HKE A;  3TSW A;  2AKL A;  4EDU A;  3CXC A;  1M90 C;  4FM4 B;  4N4G A;  1MMA A;  1VYU A;  4ZGD B;  2YT6 A;  1IGU A;  3C95 A;  4VUB A;  3T9N A;  2EYZ A;  3H0H A;  5HCK A;  5KYW A;  1YJ9 Q;  1BI1 A;  1UHC A;  2JNG A;  3RES A;  2DD4 A;  4A53 A;  4C5H A;  2KSS A;  5EC7 A;  2MK5 A;  2DVJ A;  2WAC A;  3JCM c;  4F7U G;  4LD6 A;  3GP8 A;  4XTX A;  3OYN A;  4XTW A;  2EWN A;  2V1Q A;  4J9E A;  1FMK A;  3V7C A;  4O5V A;  2AK5 A;  3VUZ A;  1VQO A;  2RI5 A;  3VS4 A;  3CCM A;  4XTY A;  1NZ9 A;  4M75 D;  4J9I A;  2GGR A;  4QQ6 A;  4B9X A;  2KQW A;  4GLM A;  5KYW B;  5GAO p;  2DX1 A;  1PCX A;  2DET A;  3QJY A;  5GAN 3;  1BBZ A;  5LJ5 e;  5GAN f;  1PC0 A;  1I1J A;  3LW5 E;  1AVZ C;  1V76 A;  6AT1 B;  3OS5 A;  5J26 A;  1MMN A;  5KH6 A;  1VQM T;  4CRI A;  1VQN A;  3MEW A;  1V1C A;  4FL6 A;  2L3P A;  1AWX A;  2LP5 A;  4AG2 C;  5GJW B;  3TVT A;  4RMO A;  4AFS C;  3VS1 A;  1KHI A;  1AHJ B;  2COZ A;  2QQB A;  1AEY A;  3BDU A;  1UHF A;  1PD0 A;  4MDW A;  1I8F A;  1KD1 R;  4Y91 A;  1Q81 U;  2IG0 A;  1WZO A;  4E2F B;  2DL3 A;  5KE3 A;  4RKU E;  3M0Q A;  2DRM A;  2PUO B;  2DER A;  4R55 A;  2D8H A;  3CMA A;  1UGP B;  1EFN A;  4IKF A;  4C5E A;  4OGC A;  1YBY A;  1VQ6 T;  1X75 C;  1QP2 A;  2LQW A;  2LTO A;  4AFQ C;  5I2M A;  1QVF P;  1T0J A;  5GMK m;  1K4U S;  2GQI A;  1M1K U;  2RMO A;  2DL4 A;  1PM3 A;  3GIB A;  4J9F A;  1TUC A;  2CGH A;  1KFZ A;  3CD6 A;  1BKB A;  4J9H A;  1GCQ C;  2DO3 A;  1UTI A;  1N8R U;  2LNH B;  3OYI A;  1K73 R;  4L59 A;  4E47 A;  1SHF A;  3PMT A;  1JJ2 S;  2JTF A;  4HXJ A;  1VQL T;  1RAA B;  5GAM d;  1IRX A;  2YRC A;  3JCM h;  2MOX A;  3G7Z A;  3GF5 A;  4X1V A;  3PIP A;  1UGV A;  3QO3 A;  1ZA1 B;  1ZUK A;  4II1 A;  2LDM A;  2MMP A;  5LJ5 f;  2FZC B;  3CCR Q;  3EGD B;  2DF6 A;  2GFA A;  1G83 A;  4OMM A;  4RTX A;  1I5O B;  2E3I A;  2G3R A;  3L2V A;  5I11 A;  4M75 G;  3A5Z B;  1RAC B;  2O9V A;  1G3Y A;  1OYX A;  4KGX B;  2M1H A;  2SRC A;  3RNJ A;  1VIF A;  1Q81 R;  1NLO C;  2J6K A;  5FU6 B;  3OY9 A;  1W4S A;  3G71 T;  2DAQ A;  1M8V A;  3EHQ A;  2X4W A;  3CXC S;  2HQX A;  1M1K R;  3RDV A;  1X2K A;  1X27 A;  2SEM A;  2O31 A;  1N8R R;  1OI1 A;  2YDL A;  2G6F X;  1VQM A;  3QHS A;  2KMT A;  1AZG B;  4JJN K;  4CC2 A;  2VXF A;  5LL6 S;  4QQD A;  4KBM B;  1WLP B;  1YHQ Q;  1N9S A;  3N5B B;  3VUB A;  2E64 A;  3RKX A;  4ZGJ B;  4M78 D;  1PD1 A;  1AD5 A;  2ROL A;  1Y71 A;  4FSX A;  2DL5 A;  4M77 C;  3UWN A;  2LVM A;  5GAN d;  1JB0 E;  4JZ3 A;  3SWN C;  1W2B A;  1WXU A;  4LD9 K;  2KRO A;  3A8O B;  3RKW A;  3BDL A;  2F5K A;  2F69 A;  3CCE Q;  2P0P A;  1UEB A;  5ECA A;  3P8B B;  1G8X A;  3A8H B;  2K5L A;  3WVE B;  1VQ6 A;  1ZLM A;  1NPP A;  3KFV A;  4ELY C;  1X01 A;  2I2L A;  2HL3 A;  2OTL Q;  3NTI A;  3EFO A;  3QBY A;  4KH0 B;  2EKO A;  2FRY A;  2QA4 T;  4C5G A;  1Y57 A;  2LT4 A;  2FB7 A;  2CZ6 B;  1HJD A;  2CDT A;  2CH4 W;  2JM8 A;  1VYV A;  2F5T X;  2KRN A;  2FPF A;  4K11 A;  3RER A;  2F1L A;  3EG2 A;  1VQL A;  4C92 D;  3HPW A;  4ELZ C;  4PKC C;  2K9G A;  4AFZ C;  2HMA A;  2PVD B;  3HFN A;  2M51 A;  2C0T A;  2RNA A;  2A37 A;  3FLG A;  2XDD A;  3OSS C;  3L2Q A;  2FRW A;  2O4X A;  3CPW A;  3ZL7 C;  4JRK A;  1JEG A;  5L23 A;  1U06 A;  4DBF A;  5A0G A;  2J7I A;  3EFO B;  1S72 T;  1YIT T;  1PSE A;  2RF0 A;  1MND A;  4M4Z A;  2KEA A;  1GBR A;  1M27 C;  1UFF A;  4ZTF A;  2QQR A;  4C8Q D;  3CCJ T;  3CCQ T;  1WFW A;  4OF1 A;  4M77 E;  3PMI A;  1CKB A;  3CBP A;  3G71 A;  1Y07 A;  4JJC A;  4MMK A;  2QDL A;  1NEG A;  1AOJ A;  2EVR A;  2YRD A;  3JCM V;  4WF2 A;  2O4X B;  5M9O A;  2RI2 A;  2WSC E;  3JCM Q;  1NYG A;  1UB4 A;  5KYN A;  3R6O A;  1M3A A;  4M78 G;  1SF9 A;  1Y96 A;  2A0F B;  5I22 A;  1GCQ A;  4EMH A;  1DJ7 B;  3L2W A;  1VQ9 T;  3G6E Q;  4BI4 A;  1VQ7 T;  1BU1 A;  5LJ5 g;  2VWF A;  1BIB A;  2DZC A;  2DA9 A;  1IB8 A;  3MHX A;  2HNI A;  1BIA A;  1NE8 A;  2V1R A;  1M1G A;  2W0Z A;  3VV0 A;  3CCS T;  4D8D A;  5GMK h;  2XMF A;  1OPK A;  3I35 A;  1PRM C;  1ZBJ A;  3MET A;  3VS3 A;  2J6O A;  2R57 A;  4XU3 A;  1KHC A;  2ZPF B;  3OBY A;  4J9G A;  1SSF A;  2MWO A;  5FU7 C;  4E7S A;  1Y96 B;  4O6J A;  3EH2 A;  2D0Q B;  1MUZ A;  2HQH A;  2DRK A;  4KT0 E;  4C92 G;  3MP8 A;  2KR3 A;  2QA4 A;  2KI7 A;  1WHH A;  3OYF A;  1KK7 A;  4ZNX A;  1VQO Q;  1CKA A;  2E5K A;  2KT8 A;  2XI9 A;  4A4F A;  4RTY A;  3EFR A;  5CKF A;  3I5S A;  1SRL A;  4MZT A;  1M30 A;  1AT1 B;  4OMQ A;  2OTJ Q;  3SFM A;  1RLQ C;  4J9D A;  2EQM A;  3V7S A;  3JB9 H;  4C8Q G;  2DTO A;  2DYB A;  1W2B S;  2X9H A;  2PNI A;  3C12 A;  4RG2 A;  3AT1 B;  2KRM A;  2C0I A;  1S72 A;  1YIT A;  4PJO E;  3A8M B;  2ZZD A;  1OPL A;  3J7A F;  4KUL A;  3PVQ A;  3OYM A;  1YP5 A;  4R56 A;  3OYD A;  4PFO A;  1V29 B;  4MML A;  1D09 B;  4FT2 A;  3CCJ A;  3CME T;  2ZGW A;  1WA7 A;  3CCQ A;  5CO7 A;  3QJ6 A;  1JQQ A;  3OYJ A;  3SEM A;  4M77 A;  1VQ5 T;  5GMK i;  2CP3 A;  3JCM e;  3E2U A;  3SWN A;  5FLX E;  2RHZ A;  3G4S T;  4B9W A;  7AT1 B;  4FYY B;  5LJ5 j;  1HSQ A;  3QUI A;  2RI3 A;  5GMK j;  1OV3 A;  4ESR A;  3LWH A;  2BUD A;  1ACM B;  1IXD A;  2CKK A;  3MO8 A;  3CMA Q;  5GAM e;  2QGF B;  2GBQ A;  2K4Y A;  2LCC A;  5LJ3 d;  3OYG A;  2RJE A;  3CPW S;  2OAW A;  1IO6 A;  4V2S A;  3HL8 A;  4KGV B;  1VQ9 A;  2XK0 A;  1XNI A;  3VRZ A;  4NL3 A;  4M77 B;  2QQA A;  1K76 A;  3E9G A;  1JXM A;  5GAO q;  2KGT A;  1ZX6 A;  1VQ7 A;  3SWN B;  3CD6 Q;  4BD3 A;  1TUD A;  2M16 A;  2DIG A;  2LJ0 A;  2ZPG B;  2C0O A;  1YNZ A;  2CZ0 B;  5CK9 A;  4J9C A;  5KYY A;  3EGU A;  2RH2 A;  1ARK A;  4GLK A;  1EX4 A;  2DXB A;  2D0N A;  1YN8 A;  1TUG B;  2RPN A;  4IUU A;  2A7Y A;  1VQN T;  2NUT A;  1G3T A;  2KBT A;  1OX8 A;  3VRY A;  1K0X A;  1SEM A;  2DIQ A;  1NPR A;  5C6S A;  1M5Q 1;  5IT9 E;  2R5M A;  5CR2 A;  3S6W A;  1U3O A;  1R8O B;  2ED1 A;  4HA8 A;  2L0A A;  2QXF A;  2CP0 A;  3MJX A; 
#chains in the Genus database with same CATH homology
 2CZ7 B;  4C0G A;  3CMA A;  2VXE A;  1UGP B;  2D6F A;  2K2V A;  3CC2 A;  4PLI A;  4IKF A;  1FX7 A;  5CKH A;  4C5E A;  4M7A F;  3GNG A;  1KC8 C;  4OGC A;  3VJP A;  1YBY A;  1VQ6 T;  1X75 C;  3I56 A;  1QP2 A;  4C8Q E;  3CCM A;  2LTO A;  5I2M A;  3KUF A;  3VYG A;  5GAM f;  1WPY A;  5GMK m;  2VYT A;  2EQJ A;  4JUV A;  4CI0 C;  1M4Z A;  2EIF A;  4A4G A;  3OYE A;  1M1K U;  2DEQ A;  3E9F A;  3ZBD A;  4ATO A;  3GIB A;  2E6N A;  5CCA A;  5GAO n;  2QEX T;  2CGH A;  2DJZ A;  3JRZ A;  3V8K A;  4LDY A;  5A0D A;  1Q86 C;  2RK2 A;  3CD6 A;  3ZFJ A;  4M7D B;  1BKB A;  3L2U A;  3OYA A;  3FIF A;  2VUB A;  3X26 B;  2KY9 A;  5CAI A;  3NFC A;  2DO3 A;  2DPP B;  1N6A A;  1N8R U;  4LDV A;  5DY9 A;  3OYI A;  3CEY A;  3MP1 A;  4L59 A;  4RCB A;  4E47 A;  3RKY A;  3CME A;  2YRV A;  3PMT A;  3TCJ A;  1JJ2 S;  2JTF A;  2K57 A;  2YLC A;  4QVD A;  3MEU A;  3EFS A;  1VQL T;  1GXI E;  1D3B B;  2RJC A;  5GAM d;  1VQ5 A;  3QYH B;  4M7D D;  3JCM h;  4C92 C;  4OVA A;  4OB3 B;  3J81 E;  3G7Z A;  3G4S A;  1Y7X A;  1MHN A;  2XU8 A;  3GF5 A;  3PIP A;  5IN1 A;  3QO3 A;  3V7R A;  3QYG B;  2RO0 A;  3CCU T;  1OZ3 A;  4II1 A;  2LCL A;  4QW2 A;  1YHQ A;  3LLR A;  2LDM A;  3UDC A;  2MMP A;  4PLL A;  2XDP A;  5LJ5 f;  4HCZ A;  3SD4 A;  2RA2 A;  2QTX A;  2K5I A;  2L3R A;  2GFA A;  2MF2 A;  4F7U E;  3I55 T;  3OYK A;  2FL7 A;  5GAO r;  1KD1 U;  2FHD A;  2G3R A;  3L2V A;  1QP3 A;  5CKB A;  1K9M C;  4M75 G;  3SB2 A;  3A5Z B;  3TRE A;  3VU3 C;  5I2S A;  4JS4 A;  4PJO B;  3PGG A;  1MGQ A;  1YIJ T;  1G3Y A;  3X20 B;  1VQ4 T;  4M78 A;  4M7A E;  1OYX A;  4BE2 A;  1QVG A;  2M1H A;  1O9S A;  1K8A U;  4EMK C;  3S3N A;  3HRU A;  3QXE B;  2E5Q A;  4ZN1 A;  3CCV T;  4BDZ A;  4XQ3 A;  1VIF A;  4DQ2 A;  3OB9 A;  3CC7 T;  5FU6 B;  2FYK A;  1M1F A;  4M7A G;  2JN0 A;  1QVF A;  3OY9 A;  2EFI A;  4M77 G;  1W4S A;  5DLQ E;  5LJ5 d;  3TEE A;  4PJO D;  2IVW A;  3BY7 A;  3G71 T;  3CCE T;  2DAQ A;  2PQW A;  2RM4 A;  2O01 E;  5DLO A;  4NL3 A;  1M8V A;  2X4W A;  1WQ7 A;  4YTL A;  3CXC S;  2VC8 A;  3GOX A;  2HQX A;  2Y90 A;  2HD0 A;  3CCL T;  1YJN T;  3OMC A;  3OYB A;  4QVZ A;  2ZPB B;  3PIO A;  4J6Y A;  1P92 A;  2V8J A;  2OTL A;  5FU7 B;  4BY6 B;  4JLG A;  2PVO B;  2R5A A;  4IUT A;  1K73 U;  3RMS A;  3DLL A;  4HCC A;  3M57 A;  2RHU A;  5AYF A;  3UPU A;  2HQE A;  2ZPI B;  5GAN 4;  1G5V A;  3MEV A;  2DZ9 A;  3DKM A;  2L89 A;  2LX9 A;  1OI1 A;  4M78 B;  1YJW T;  4EPC A;  5LJ3 g;  3PTA A;  1VQM A;  2X4J A;  2KMT A;  3QHS A;  3LWI A;  2PU9 B;  5GAN 7;  3FB9 A;  4JJN K;  2VXF A;  3CPF A;  4QQD A;  2YLB A;  5LL6 S;  4M75 C;  4KBM B;  4JLI A;  1N9S A;  3JB9 I;  3N5B B;  1WQW A;  3VUB A;  3HRT A;  2E64 A;  3JCM X;  2RJD A;  3QSU A;  3LGF A;  1NJI U;  2OTJ T;  3RKX A;  2EJF A;  3FDR A;  5GAN 2;  4ZGJ B;  4M78 D;  1KG1 A;  3QPH A;  2DXC A;  3M5A A;  2JZ2 A;  3RUX A;  2XID A;  5CQX A;  4M7A C;  1Y71 A;  2EYQ A;  2KAF A;  4FSX A;  5CKE A;  4M77 C;  1Q82 U;  3UWN A;  1N27 A;  2LVM A;  3L42 A;  5GAN d;  1H3Z A;  2L5Q A;  3H6Z A;  4N0A A;  1JB0 E;  2MAM A;  2QQ9 A;  4JRI A;  4M75 F;  3SWN C;  3JCM f;  3OQ5 A;  3CCR A;  5L8R E;  4BE1 A;  1W2B A;  1KQS A;  4LD9 K;  3A8O B;  2RHX A;  3RKW A;  3BDL A;  2F5K A;  2F69 A;  1UGQ B;  2P0P A;  1UEB A;  3P8B B;  3WXM B;  2LQK A;  3A8H B;  2K5L A;  5HK0 A;  3WVE B;  4C0D B;  3OA6 A;  4IUV A;  1ZBX A;  5I21 A;  1VQ6 A;  3NTH A;  4GY5 A;  1NPP A;  4E7L A;  4ELY C;  3JB9 D;  1X01 A;  4BE0 A;  4C8Q A;  3X24 B;  3O8V A;  4M77 F;  1M90 U;  2I2L A;  3KXT A;  3QG1 A;  5GMK l;  3S3M A;  4J5Y A;  2KDS A;  2P4T A;  3NTI A;  3QDR B;  3QBY A;  4OP0 A;  4XK8 E;  4C92 B;  2QEX A;  3JCM d;  2EKO A;  3CBO A;  2QA4 T;  4C5G A;  4M7D G;  2NLU A;  5CIU A;  2PUK B;  4X34 A;  2LT4 A;  4BI8 B;  2QDY B;  4PJO A;  1HK9 A;  2GF7 A;  2FB7 A;  1KQ2 A;  1UGS B;  3HKS A;  4RCC A;  2CZ6 B;  2CZ1 B;  1EIF A;  3OYY A;  2K5F A;  4NS5 A;  2L8D A;  4OMF B;  2F5T X;  3RER A;  1VQL A;  5D6Y A;  3HPW A;  4C92 D;  4ELZ C;  1Q7Y U;  4L5G A;  4PKC C;  4L6V 5;  1TH7 A;  5KE2 A;  2AHJ B;  5GAO l;  3L2Z A;  2XKO C;  2PVD B;  4J83 A;  5CVI A;  2Y4X A;  3HFN A;  4J6W A;  4N4H A;  2DXT A;  2V8I A;  3A8L B;  4ZGE B;  2C06 A;  2XDD A;  3FLG A;  3RIR A;  2K3X A;  3CCU A;  3QKJ A;  3OSS C;  1Q81 C;  4Q5W A;  3L2Q A;  2E10 A;  4QQG A;  1B34 B;  1ZHI A;  1YI2 T;  1OZ2 A;  2O4X A;  3M4G A;  4C8Q B;  3CPW A;  4FU6 A;  4JRK A;  3G6E T;  2LNV A;  2QI2 A;  2QQS A;  4NOY A;  4PL6 A;  3JCM J;  2E6Z A;  3CC4 T;  5EG2 A;  5A0G A;  3FEO A;  4M75 E;  4N4I A;  5J39 A;  1PSE A;  4E7H A;  3A8G B;  3ASK A;  3E1S A;  3I55 A;  1YIT T;  1KQ1 A;  4A4H A;  4MZP A;  4IUQ A;  3M59 A;  2ZCF B;  4PJO G;  4ZTF A;  3JB9 F;  2K3Y A;  3M56 A;  3M54 A;  1YIJ A;  5A0L A;  2QQR A;  2HAX A;  1X6O A;  1VQ4 A;  4C8Q D;  3CCJ T;  3V8J A;  4A54 A;  3CCQ T;  1M1K C;  4HT9 A;  4XTV A;  3J80 E;  3CCV A;  2DTI A;  4ZN3 A;  3HFO A;  2JVV A;  4OF1 A;  4QVC A;  3QZ9 B;  3CC7 A;  4M77 E;  1RI0 A;  5LJ3 j;  3KBG A;  4M7D C;  3PMI A;  3LGL A;  3MP6 A;  5FRO A;  5GAM g;  2MWP A;  3CBP A;  3CCE A;  3G71 A;  1VQK T;  1N8R C;  1Y07 A;  4MMK A;  5KCH A;  4XU0 A;  1I81 A;  1YJN A;  4J8O A;  3SDZ A;  3JCM V;  3CCL A;  4WF2 A;  3Q1J A;  2O4X B;  5M9O A;  2XD0 A;  2RI2 A;  2VGM A;  2X4Y A;  2B8A A;  1S72 T;  3V8L A;  2DVE A;  2WSC E;  4E7I A;  5HK3 A;  3JCM Q;  3PFS A;  2BIV A;  1UB4 A;  2GQV A;  3S3O A;  4M7D F;  4F7U B;  3OBW A;  3AHU A;  4C0Z A;  1I5L A;  1FXX A;  3LH0 A;  3CBM A;  3FC3 A;  1PSF A;  2JUF A;  3R6O A;  4IUP A;  1VQP T;  2FVU A;  1QVP A;  4M78 G;  5CKD A;  1Y96 A;  4BDY A;  1YJW A;  4EMH A;  2LRQ A;  1DJ7 B;  1VQO T;  3L2W A;  3OW2 A;  2Y4Y A;  1KD1 C;  1VQ9 T;  3P8D A;  2H3J A;  4BI4 A;  3CCM T;  2X4X A;  3JAM E;  3C94 A;  3MCA B;  4X9D A;  1VQ7 T;  3NTK A;  1U1T A;  4Z02 A;  5LJ5 g;  4UC4 A;  4HCB A;  1BIB A;  2DZC A;  4OB0 B;  1YCY A;  1K8A C;  3MHX A;  3CCS A;  2HNI A;  2OTJ A;  4OGE A;  3FJP A;  5D6X A;  4C92 A;  1BIA A;  1NE8 A;  5LJ3 h;  1JRI A;  4M7A D;  1QVG S;  1M1G A;  3CCS T;  1N9R A;  2DKG A;  2ZPH B;  5FU6 C;  3VV0 A;  2P0Q A;  4PNO A;  2RK1 A;  5LJ3 e;  4E7K A;  5C0M A;  1KC8 U;  1VQ8 T;  5GMK h;  1U8R A;  3ZEH A;  1LNX A;  2LC4 A;  2PVG B;  3OYC A;  3JB9 G;  4J7I A;  1QVF S;  5FRN A;  1IZ6 A;  1I4K 1;  5GMK e;  4PJO F;  1WNL A;  3VYH B;  5KCO A;  5CQY A;  3MET A;  4IUR A;  1XQH A;  2R57 A;  3C4S A;  2BKD N;  1KHC A;  4XU3 A;  4JDS A;  1ZQ1 A;  2E41 A;  2ZPF B;  1WJQ A;  3EAE A;  3OBY A;  4P5N A;  4JRP A;  1Q86 U;  1SSF A;  2MWO A;  1UGR B;  1BI0 A;  1O75 A;  5FU7 C;  4BY6 C;  5GAN 5;  2WSE E;  1Y96 B;  5A2Q E;  4O6J A;  1RL2 A;  2D0Q B;  4BI3 A;  1K73 C;  1JBM A;  2EJ9 A;  3ER0 A;  5GAN 6;  1JJ2 A;  3OYL A;  4EMK A;  2CYZ B;  2OAU A;  1B34 A;  4NL2 A;  3QZ5 B;  1XTD A;  3X28 B;  3OS1 A;  4E7J A;  3VKI A;  4KT0 E;  1H64 1;  4FT4 A;  4M7D E;  2X35 A;  4C92 G;  4XU1 A;  4OB2 B;  3MP8 A;  2XG8 D;  4M78 C;  2QA4 A;  2WSF E;  1FWZ A;  4BAC A;  4JRQ A;  1YJ9 T;  2ZPE B;  4DA4 A;  3OYF A;  1G3W A;  3OS0 A;  3LYI A;  3OSV A;  3H8Z A;  1XOV A;  2JOY A;  5GAN g;  2XI9 A;  4MDX A;  2LT1 A;  4Y28 E;  4A4F A;  1NJI C;  2DD5 A;  3EFR A;  2DXU A;  5CKF A;  3CMA T;  3HRS A;  3INZ A;  4LDX A;  3CC2 T;  2RHI A;  2A3L A;  4M78 F;  4MZT A;  3M53 A;  4HT8 A;  3PT9 A;  4X9C A;  4XTU A;  1K9M U;  1BI3 A;  1QW1 A;  3M4Y A;  4TVR A;  2V8K A;  3ME9 A;  5GAM j;  5GAN h;  3I56 T;  1Q82 C;  3GLX A;  4KUD K;  3E19 A;  5J3B A;  3SFM A;  2GFU A;  1IRE B;  3V7S A;  2EQM A;  5GAN e;  1YI2 A;  1VUB A;  3OMG A;  4C8Q G;  3HSB A;  3JB9 H;  2DTO A;  2KK4 A;  3RMQ A;  4EMK B;  5HKC A;  2RB6 A;  5DM7 R;  3G6E A;  1W2B S;  2M0O A;  2RJF A;  3C12 A;  4RG2 A;  3X25 B;  1KQS S;  3CC4 A;  2VV5 A;  3OS2 A;  1S72 A;  1YIT A;  3CD6 T;  3A8M B;  4M75 A;  4PJO E;  4FIB A;  4C0D C;  3P8H A;  2EQK A;  2ZZD A;  3JCM g;  3J7A F;  4KUL A;  4EMG A;  4DOV A;  4HKE A;  4F7U A;  3DB4 A;  4EDU A;  2CS7 A;  3UT1 A;  3OYM A;  3CXC A;  4R56 A;  1M90 C;  2RD1 A;  3OYD A;  1V29 B;  4MML A;  1BYM A;  4FT2 A;  4FM4 B;  4N4G A;  3CME T;  2ZGW A;  3CCJ A;  3CCQ A;  2E12 A;  5CO7 A;  3QJ6 A;  4RG8 A;  5GAO m;  4M7A A;  3OYJ A;  4ZGD B;  3C95 A;  4M77 A;  5D6W A;  1VQ5 T;  2EJG A;  4VUB A;  5GMK i;  3JCM e;  3T9N A;  2E1H A;  3M58 A;  3SWN A;  1U1S A;  5FLX E;  2RHZ A;  5LJ3 f;  3G4S T;  4B9W A;  1VQK A;  3DB3 A;  5LJ5 j;  3QUI A;  1G3S A;  2RI3 A;  5GMK j;  1BI1 A;  4N0A C;  3LWH A;  1YHQ T;  2JNG A;  3RES A;  2DD4 A;  4OB1 B;  4A53 A;  4C5H A;  3OYH A;  1WGS A;  2KSS A;  2BUD A;  1Q7Y C;  4J6X A;  4C92 F;  2YHT A;  1BI2 A;  5GAM h;  2WAC A;  5GAN 8;  2XIC A;  2CKK A;  3MO8 A;  4M75 B;  3JCM c;  4F7U G;  5HY6 A;  5GAM e;  4LD6 A;  2R58 A;  3GP8 A;  4XTX A;  3BW1 A;  3OYN A;  3DLM A;  4BB7 A;  3JCM b;  3PNW C;  4M78 E;  2E65 A;  2K4Y A;  4XTW A;  4C8Q C;  2P0K A;  2EWN A;  2LCC A;  5LJ3 d;  1LOJ A;  3OYG A;  2RJE A;  4ME7 A;  1VQP A;  2DK3 A;  4KUI A;  1LJO A;  4LDU A;  3V7C A;  2VGN A;  4O5V A;  3VUZ A;  3CPW S;  1VQO A;  4V2S A;  2RI5 A;  2DTH A;  3HL8 A;  2LQ8 A;  4M7A B;  1VQ9 A;  2XK0 A;  1XNI A;  4A4K A;  4J7F A;  2MI6 A;  3M9Q A;  2QQA A;  3E9G A;  1HXD A;  1NZ9 A;  4M75 D;  4M77 B;  4MZM A;  4DOW A;  3JCM P;  5GAO q;  1VQ7 A;  4QQ6 A;  3SWN B;  3WVD B;  4ZTJ A;  4BD3 A;  4PJO C;  3HP9 A;  2XDB A;  4B9X A;  2KQW A;  2M16 A;  1VIE A;  2DIG A;  3GPL A;  3URG A;  4C8Q F;  2D9T A;  4A4E A;  5GAO p;  2OTL T;  2ZPG B;  2EAY A;  1VQ8 A;  4XTY A;  4XU2 A;  4M77 D;  3L1A A;  2KVQ G;  2CZ0 B;  2RHY A;  5IAY A;  5LJ5 h;  3HHT B;  3QJY A;  3F70 A;  5CK9 A;  5GAN 3;  3TU4 K;  4XTZ A;  5GAN j;  5LJ5 e;  5GAN f;  2RH2 A;  4JS5 A;  3LW5 E;  4C5I A;  3GNF B;  4GLK A;  2E70 A;  2DXB A;  3OS5 A;  5J26 A;  5KH6 A;  1VQM T;  1WJR A;  3M55 A;  4CRI A;  3JSC A;  3JCM W;  1VQN A;  3MEW A;  1M9S A;  4IUU A;  3JB9 J;  2GCX A;  2A7Y A;  4FL6 A;  3FRN A;  1VQN T;  1G3T A;  5FRM A;  3L2R A;  2HBP A;  4C92 E;  4RMO A;  1KHI A;  1AHJ B;  3MEA A;  2DIQ A;  1NPR A;  3BFM A;  4XAX B;  5C6S A;  1M5Q 1;  4BUG A;  4M7D A;  1WJS A;  4LDW A;  4D6W A;  5IT9 E;  2M9U A;  1YJ9 A;  2R5M A;  2XHC A;  5CR2 A;  2QQB A;  2EQU A;  3S6W A;  3BDU A;  4MDW A;  2JTM A;  1I8F A;  1R8O B;  4Y91 A;  3OW2 S;  4C0F A;  1Q81 U;  3CCR T;  2IG0 A;  4F7U F;  4HA8 A;  3LX7 A;  2QXF A;  1D3B A;  3QII A;  4RKU E;  5KE3 A;  2PUO B;  4R55 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...