2RI2A

Crystal structure of the 3-mbt repeats from human l3mbtl1 with d355a point mutation
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
314
structure length
312
Chain Sequence
WSWESYLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSEHDFWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMKLEAVARMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDNFWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGYDFWIDADHPDIHPAGWCSKTGHPLQPPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lethal(3)malignant brain tumor-like protein
publication title Structural Basis for Lower Lysine Methylation State-Specific Readout by MBT Repeats of L3MBTL1 and an Engineered PHD Finger.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 81
structure length 312
sequence length 314
ec nomenclature
pdb deposition date 2007-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02820 MBT mbt repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A01
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2ri2A03
3PMIA 2D9TA 2RI5A 2MWOA 5KCHA 4II1A 2X4XA 5KH6A 2VYTA 3MEVA 3LGFA 3MP8A 3H6ZA 3OYIA 4A4FA 4FU6A 3QKJA 5C0MA 2O4XA 4BDZA 3ZEHA 3OS2A 2RHIA 3OYNA 5FROA 4PLIA 5J39A 1H3ZA 4BE1A 2XK0A 4GY5A 4N4HA 3L2QA 3MO8A 4C5HA 3OY9A 5M9OA 3Q1JA 4UC4A 4E7KA 4IURA 3LH0A 3P8HA 4IUQA 4N4GA 2E5QA 2M16A 4IUVA 4QQDA 4E7IA 3OMCA 2RI2A 3PNWC 4N4IA 3FC3A 3FLGA 3OS1A 2YRVA 2F5KA 3MEAA 4E7LA 2EQJA 1RI0A 2JTFA 3S6WA 3OYEA 3MEUA 2GF7A 3CEYA 2RHZA 5FRMA 2HQEA 2DAQA 2BUDA 2K3XA 2RHYA 4QQ6A 4A4EA 3OYHA 3OA6A 4ZTJA 1MHNA 2X35A 3P8DA 4BE0A 5KCOA 3OYJA 4LD6A 2K3YA 4L59A 5C6SA 4IKFA 2EKOA 3OQ5A 2RJDA 3H8ZA 2L89A 3NTHA 3O8VA 3LGLA 3E9GA 4E7JA 2BIVA 2WACA 4FL6A 4ZTFA 1KHCA 2HQXA 2E6NA 2B8AA 2R5MA 2X4WA 3E9FA 3SD4A 2MWPA 4Q5WA 2EFIA 2FHDA 2LRQA 3L42A 4IUTA 4BE2A 3QJ6A 3META 4B9XA 2RJEA 3OYMA 3OYGA 3BDLA 3L2UA 4IUUA 3ME9A 4OVAA 5CIUA 4QVZA 3DB3A 2EQMA 3DLMA 4BACA 4E7HA 3C4SA 3S3NA 3LX7A 1OYXA 5D6YA 5FRNA 5IN1A 3OB9A 3QBYA 4A4HA 1G5VA 2RHXA 2CKKA 2RJCA 1SSFA 2LVMA 3LLRA 2IG0A 3OYAA 1OI1A 1WJRA 3DB4A 2BKDN 3EAEA 5D6WA 5J26A 4QQGA 2R58A 2X4YA 3OYLA 2P0KA 3L2RA 3S3MA 1WGSA 5D6XA 4C5GA 2JZ2A 2QQSA 3MEWA 1OZ3A 4EDUA 3F70A 4PL6A 5IAYA 4A4GA 3S3OA 1XNIA 2RJFA 3LYIA 3OYDA 1OZ2A 2PQWA 2O4XB 2DIQA 2XDPA 3MP1A 3PMTA 1WJQA 3OYBA 2EQKA 2R57A 3OYCA 2NLUA 3OYKA 5KE3A 2GFAA 3FDRA 3ASKA 3OMGA 3QIIA 5KE2A 3OYFA 3PFSA 4C5IA 3NTKA 2RI3A 4RG2A 4BD3A 1WJSA 2EQUA 2R5AA 3KUFA 4IUPA 3UWNA 3L2VA 3L2WA 3MP6A 3M9QA 2RO0A 4B9WA 1N27A 3OS0A 4X34A 4Z02A 2LDMA 4PLLA 4CRIA 2LTOA 3UT1A 2RHUA 3GOXA 2M1HA 2DIGA 2QQRA 2G3RA 2L8DA 4C5EA 2GFUA 4BDYA 2LCCA 4NS5A 2L3RA 3NTIA 2M0OA 4HCZA 4QW2A 3FEOA
chains in the Genus database with same CATH superfamily
2QG9B 4LDWA 1VIFA 4C92C 3M54A 1UUEA 4DOVA 3MPUB 2EYZA 3CCSQ 1QVPA 4FSSA 4EMHA 5GAMj 3JB9H 2E70A 4AG2C 1VQNQ 2OJ2A 1GBRA 1NPPA 4RCCA 1IREB 3Q1JA 4RCBA 3LH0A 1X01A 1AD5A 3QYGB 2PTKA 1K76A 5GAN2 3OBWA 2VVKA 1BKBA 4PKCC 4C8QA 2CP0A 5L8RE 4HCBA 9ATCB 2YUOA 1MV3A 3CCEQ 3WVEB 1Q7YC 1O9SA 4C8QG 2WACA 1PD0A 2QA4Q 2P0QA 3JB9J 2EJGA 1YWOA 1ZBXA 1Y7XA 2VB6A 1SF9A 3DLMA 4M75E 2DVEA 4BUGA 4XTVA 2RJCA 3HRTA 4MZTA 4F17A 2HAXA 1OI1A 2K2VA 3CC7Q 2BKDN 4ELYC 1MMGA 5IHKA 4EDUA 5FU7B 3J81E 5FU7C 1KD1U 3QWYA 2RQUA 4M78D 1YI2Q 4J9CA 4Z89A 1JXOA 2RI3A 4E6RA 8ATCB 1WJSA 4XTYA 1I5LA 1HXDA 2K9GA 1RACB 2G3RA 1C6VX 1HD3A 2LCCA 4OGEA 1DJ7B 1B07A 2M0OA 3J80E 2EQIA 3PMIA 1I5OB 2KQWA 5IXBA 3LGFA 5AT1B 3PIPA 2CH4W 3QKJA 1M3AA 4M7AA 3VRYA 1NE8A 2FZGB 1B7TA 3FB9A 1WHGA 1GBQA 2BTTA 4UC4A 1HSQA 1M1FA 1QVFA 1I1JA 1ZA1B 2VV5A 1W6XA 2IVWA 1M3CA 4QQDA 5HKCA 2DXUA 2RI2A 2JS2A 3V8JA 4N4IA 3FC3A 2DERA 1N9SA 4M7AG 1JEGA 4FT4A 4RTYA 1KC8U 4MZMA 2ZPGB 1K9MC 2O2OA 5FLXE 2K3XA 1M4ZA 1BI0A 2XICA 1M9SA 5IHIA 4A54A 1TUCA 4IIOA 2CZ0B 1Q86C 2PZ1A 2E41A 3CCMT 1BK2A 2IIMA 1I0CA 1M2VA 2IPOB 4M7DB 1KHCA 1KSWA 2DTOA 2O01E 2EFIA 3IQLA 3EFSA 4IUTA 5CKFA 5LJ5g 2FZKB 4XTWA 2QQ9A 1JJ2A 2BZXA 4ZNXA 2EAYA 1VQMT 4OMMA 3SDZA 5GAOm 3M0PA 1G5VA 1UFFA 2GNCA 2YSQA 1C1AA 1XJWB 4CC7A 4Y28E 2LQNA 2DD4A 1LCKA 4JJCA 3CCMA 4QQGA 2KBTA 2X4YA 3S3MA 1ZLMA 3NMZC 5GAMg 2CDTA 2HKNA 2JMCA 5DLQE 1OZ2A 2DIQA 4PJOF 3FJ5A 2R57A 1QVGA 4X9CA 2O88A 1BIAA 4JPBW 2ZPBB 1PHTA 1VQMA 3GNGA 1UJYA 1YJ9A 4C92A 1JXMA 4X34A 3VS0A 3A8MB 5HCKA 5IXFA 1PSEA 3RDVA 1YNZA 2V8IA 3M4YA 1J3TA 4V2SA 1QW1A 3HL8A 2RQTA 4C92G 5CQXA 3MEVA 2JW4A 1UECA 3JB9G 2XKOC 1MV0B 4C0GA 4EMGA 2RPNA 1QCOA 2X4JA 1E6GA 3X28B 4M77B 4DBRA 3OY9A 2NUPA 2K57A 2F69A 4R55A 4HKEA 5I2MA 2G6FX 4CC4B 4RG8A 3CCRA 4M78B 2DRMA 3OS1A 1VQ8A 3UF4A 3M56A 3JCMV 4HT9A 4HVWA 1SPKA 1D3BB 1WDXA 5GAOq 2EW3A 2RF0A 4RTVA 4HCKA 1X6BA 2DX1A 3QZ5B 3OQ5A 2VGNA 2M51A 2FEIA 3V7SA 5EG2A 4HVVA 1Q82U 3V7CA 3E9FA 2B8AA 2R5MA 3SD4A 3CPWP 5GAMh 3NHNA 2FHDA 3OW2P 2COYA 2D1XA 2RJEA 1RUWA 5CO7A 4QVZA 5GMKm 4E7HA 5D6YA 3OSVA 2KY9A 2RB6A 1V29B 3RKYA 4RTUA 1ABQA 4JDSA 3VU3C 1G3TA 3CCMQ 4J9EA 5LJ5f 3I5RA 2V8KA 2CH4A 3JRZA 3CCLT 2A36A 2ECZA 2H8HA 1UGQB 1Y96B 2EYQA 4BD3A 5CK9A 1VQMQ 3L2WA 1AVZC 1YJ9Q 1ZX6A 3OS0A 5GAMf 1VQ6T 1KQSP 3UT1A 2EYYA 4BB7A 4DOWA 2DLPA 1AOJA 1VQKT 2CP7A 1UE9A 1R0BG 3BDUA 4M7DE 1Z9QA 2D9TA 2RI5A 3QXEB 4M7AD 4II1A 3CD6T 1KJWA 3MP8A 3CQTA 1M1GA 1SKUB 2DZCA 2Z0WA 4MZPA 4J9DA 2PVGB 2XD0A 4KH0B 3EG1A 1QMCA 1VQ6A 4LDUA 4E7KA 2PNIA 1BIBA 3JCMX 1YHQT 1W1FA 2VC8A 1VQKA 2DXCA 1OV3A 2V26A 3CCRQ 4C0DC 4FSXA 4LDYA 3OYEA 1VQ8Q 3MEUA 3CD6A 4LN2A 1QP3A 4J6XA 3EG2A 1TH7A 3M4GA 3QSUA 2YUQA 4L59A 5C6SA 2E1HA 2SEMA 2QDLA 1P92A 2HZYA 4OMFB 1QCFA 5LL6S 1D0ZA 1OOTA 3MKDA 1XTDA 4J9IA 1YHQA 1SHFA 3OYMA 1WPYA 3JCMe 4MMLA 5KYYA 4FYXB 3H0HA 4HVUA 1AWJA 1YITT 2AHJB 4ZGDB 3EAEA 3TQ7P 5D6WA 4C8QB 1K73R 1S1NA 4PJJA 4ORZA 1RLQC 4MDWA 4M77E 1ZSZC 2O4XB 3REAB 1K0SA 2PVOB 2ZPEB 2NUTA 2A3LA 4BI3A 2CZ1B 1PWTA 4M78E 1Q81R 1R8OB 2L3PA 2RK2A 4C0ZA 1X6OA 2KR3A 2LC4A 2LDMA 3I5SA 1D1CA 4CRIA 4PJOA 1E6HA 5DY9A 3GOXA 3V8KA 5FW9A 2EYXA 2ZZDA 1IZ6A 1G8XA 5IT9E 3CBPA 2JTMA 2XI9A 4QW2A 3HKSA 1JBMA 1ZQ1A 2X4XA 2E64A 2CSQA 1PCXA 2RNAA 2Y4XA 2DYIA 1BCMA 1XOVA 3UDCA 4RMOA 4FCYA 2HEQA 1WQ7A 2JVVA 1VQ6Q 1W2BP 1K8AC 3BFMA 4EMKA 1YBYA 3OMCA 1NYFA 1VQKQ 1LOJA 1T3LA 1PNJA 1UDLA 2GGRA 5HK0A 1OEBA 4ANJA 1M1KC 4IIMA 3CD6Q 2PVDB 1MHNA 1R0CB 2RK1A 1NJIC 3RMQA 1C0MA 2XDBA 1VYVA 1BI2A 1JQQA 3NTHA 2DA9A 5DM7R 2WSFE 2RN8A 5GANd 2GCXA 2HL3A 4VUBA 4M7AB 1YHQQ 2AK5A 1FX7A 3RIRA 5GAN5 3KBGA 2FRYA 3LW5E 1OYXA 5FRNA 4RTZA 5GJVB 4OB1B 1N5ZA 4PJMA 2LVMA 3CC7T 1PSFA 4LXCA 4AFUC 2DMOA 2K79A 2ABLA 2RD1A 3MEWA 4XTUA 3RKXA 3LYIA 2FZCB 2VASA 2DTHA 4KBMB 2QDYB 2NLUA 4HXJA 4J7FA 4D6WA 2GFAA 4CI0C 2JNGA 3A8OB 3NTKA 1M2VB 2CUDA 2EQUA 3PVQA 1HJDA 1LPLA 4XAXB 2C0IA 2M02A 2LTOA 3OSSC 2ED0A 4C5EA 3JAME 1PC0A 1AEYA 2QQAA 1TS9A 1UGPB 4ELZC 1WXUA 1U06A 1QVFS 3H6ZA 2FG0A 2EIFA 5CQYA 4J83A 3OS2A 4OF1A 2KVQG 1YN8A 3E19A 5J39A 4RTXA 2DL8A 2LJ1A 1G3WA 2D0NA 1Q95G 2DBMA 1YJWT 2A08A 1N8RC 2ZCFB 1OU8A 2MPXC 3PNWC 1SEMA 2ZPIB 4C8QE 2KGTA 4KT0E 5I11A 2FB7A 4M7DD 4C92B 1BYMA 4J6WA 5A0DA 1ABOA 5GAN7 3OA6A 4PFPA 3X20B 1BI3A 4IKFA 2DEQA 2ESWA 2DF6A 2RJDA 1JJ2S 2CP5A 1Y0MA 2KDSA 4ESRA 1UB4A 2I0NA 2L0AA 1YJWA 1X75C 3JCMP 2DNUA 4BE2A 2DL3A 2NYSA 5HK3A 3BDLA 2CP3A 2H3EB 1VUBA 4OVAA 1ZSZA 2NUPB 4DBQA 4BI8B 2XDDA 1B34A 1WXBA 1QVGS 1SSFA 3VS5A 3LLRA 3X25B 1WJRA 4Z88A 4J9BA 1WNLA 2F1LA 1WI7A 3QDRB 2QQSA 4JLIA 4L5GA 3OYDA 1RL2A 3OYBA 1WJQA 1PM3A 2EKHA 3WXMB 2VKNA 5KE2A 2KT8A 3M57A 4KH1B 4RG2A 5KYXA 5HY6A 4KGXB 2E6ZA 2ZPHB 2BE7D 1AZGB 2RO0A 3JCMW 1M3BA 2A0FB 1K0XA 3BE3A 3RESA 3DKMA 1AZEA 4M77D 2KXDA 4GLKA 1M90R 3A98A 1WXTA 2JM9A 1VYTA 2M9UA 3I35A 3LWHA 3CMET 2YRDA 1NLOC 4M7AE 5I21A 4FU6A 4JLGA 5GANe 1X43A 2LCLA 1WHJA 5FROA 2XG8D 3J7AF 4BI4A 2XK0A 2D0QB 1R77A 4N4GA 1WHMA 1Y71A 2E3HA 1FMVA 2EWNA 2GTJA 1KD1C 4OMOA 2EBPA 1ZUKA 3CMEA 2HQEA 2K5FA 2RHYA 4QQ6A 3CCQT 1ZBJA 1NPRA 2RQRA 4NL2A 5GJWB 3JV3A 3M59A 3V7RA 2GTOA 2DL4A 4E7SA 3EFRA 1QP2A 3FJPA 3CXCP 1W70A 1D0YA 4OB0B 1YJWQ 1T3SA 1QLYA 2OAUA 4R0KA 2KE9A 5CAIA 4IUUA 5GMKe 3C4SA 3CCQA 5IN1A 1Q86U 2MMPA 2Y90A 4F7UF 1Y57A 4WTOB 2AKLA 1W4SA 4HA8A 1OZ3A 3PIOA 3SWNC 2FO0A 1FWZA 4A63B 2P84A 5L23A 2CYZB 3CMAA 1KC8C 3HTRA 2DFUA 2ROTA 4C92E 2DILA 1YJ9T 3EH2A 2GBQA 1GCQC 2FPEA 4B9WA 4PJLA 1N27A 1U3OA 3TVTA 1X69A 2LCSA 1K4US 4ZGJB 1PKTA 3UPUA 4XTXA 3OS5A 2DE0X 3QUIA 1WA7A 5KYYB 4PFOA 1X6GA 1T0HA 4Z8AA 4DA4A 2EJFA 3VS3A 4A4FA 2QQBA 2LMJA 6AT1B 2AZVA 3ZEHA 5CKHA 2J6KA 2MI6A 2VXFA 1VIEA 1OX9A 5KYNA 2DJZA 2EGCA 4QKUA 1RAHB 3JCMd 5LJ3e 2NUTB 5CKDA 4JZ4A 4EIKA 3RUXA 5FWBA 2AT1B 3CCRT 2CP2A 1UHCA 2CZ6B 5KYUA 1VQ8T 2F5KA 2D6FA 1OX8A 2LQ8A 1Q7YR 1K73U 1CKAA 3HP9A 2HD0A 2DAQA 4PJOB 4Y92A 5FU6C 5FWCA 3CMEQ 4ZTJA 4PJOC 1LVKA 3HPWA 3OYJA 2YT6A 4JS4A 1GRIA 2JT4A 3R6OA 1TU0B 3E9GA 2QASA 2AZSA 1Q81U 5GAOn 4EPCA 4C8QD 4FW2A 3REBB 5LJ5h 3TCJA 2E12A 4OMPA 2RHXA 4DBHA 4EMKB 3CCQQ 1RLPC 3A8HB 4EMKC 1BCOA 2IG0A 5IH2A 2YLCA 3SEMA 1EZZB 2COWA 3OYLA 1H3HA 1WGSA 3PVLA 4OB2B 1KQ2A 2QTXA 1OULA 3CMAQ 2RMOA 3EG9A 3OMGA 3TU4K 3SHWA 3PGGA 3EHRA 5D7UA 1ZA2B 2YUNA 3RERA 1VQOT 1X2QA 2RHUA 3C0CA 4JZ3A 2DVJA 2L8DA 1Q82C 2JMAA 4BDYA 2KXCA 3VRZA 5CVIA 3NTIA 4OMNA 2CT3A 5GAN4 3QYHB 2D8HA 1SRMA 1F1BB 2CZ7B 2J7IA 1D0XA 3M5AA 4F16A 1G3SA 3C95A 1VQ7T 2LQKA 1VQOA 3QJYA 4JJDA 1K9MR 2YUPA 4AFZC 2JJ9A 1FMKA 2YRVA 1Q86R 5GANf 1X2KA 1UGRB 2BUDA 5CR2A 2DM1A 1AWOA 1G3YA 4KUDK 1BBZA 4LD6A 2K3YA 2FPDA 4PFZA 1M2OA 3H8ZA 1VQ7A 1U5SA 3CPWS 3QG1A 4FL6A 3KFVA 2ZPFB 3EFOA 2DEUA 1YP5A 4C0DB 1MUZA 3SWNA 1ZSGA 2HBWA 3M0QA 4A4HA 2V1QA 4WCIA 3GIBA 2DO3A 1LJOA 3OYAA 3EG3A 4GLMA 1GCQA 4NOYA 1BU1A 2HSPA 3MP1A 2PQWA 1RAAB 1IO6A 2EQKA 5AYFA 5GAN6 4KUIA 2NUZA 4F7UA 3CC2T 3FDRA 3R6NA 3OYFA 1KQSS 1N6AA 1IXDA 4IUPA 2X51A 4Z02A 2ATCB 2LT4A 2DIGA 2GFUA 1EIFA 5GAOl 4F7UG 3GF5A 3L1AA 1ZSZB 3FEOA 3SFMA 1B34B 3CC2A 3MHXA 2LT1A 4C92D 4AFQC 3JB9D 2K6DA 3OYNA 3VS1A 2CS7A 2QAZA 3MO8A 1N9RA 4XU2A 3NFCA 4IUQA 4QVDA 1VQOQ 3THKA 4O6JA 3QHSA 3O5ZA 5KYXB 1I07A 4RTTA 4XU0A 3VUBA 3T9NA 2HQHA 3MEAA 1ACMB 2LJ0A 2QYZA 5DLOA 3S6WA 1QKWA 3CEYA 3L2ZA 2RHZA 1I4K1 4PJOG 1FYNA 1K9AA 2DPPB 5KCOA 2O9SA 3CBMA 4Y91A 2RH2A 2C0TA 2DJQA 4M4ZA 1VQ7Q 1CSKA 4M75F 4BY6C 1VQ9T 3H0FA 4YTLA 2MOXA 5GAN8 1EX4A 2LZ6B 3QJ6A 3META 4AG1C 2E5KA 3VJPA 2QK0A 1RAIB 4J8OA 5GAOp 1TUDA 1M90U 2YHTA 2JS0A 1VOMA 3A1PA 1JU5C 1TOVA 4N0AC 2R58A 1H92A 5D6XA 3M0RA 2HKQB 1UJ0A 4J9GA 1VQ9A 3S3OA 2E65A 3EGDA 1SHGA 1WZOA 4M75C 1FXXA 3QWXX 1NG2A 1OPLA 3CPWA 3JCMg 4P5NA 3OW2A 4A4KA 1QVFP 2YLBA 3PTAA 2DTIA 4OMQA 7AT1B 4PLLA 5GMKl 2QQRA 4X1VA 4OMLA 2FPFA 1UTIA 5GAOr 1WLPB 2L3RA 5A0GA 3C12A 2X9HA 5KYWA 4D8DA 2QTVA 3EGXA 1ZUUA 3OYIA 1IRXA 3A8GB 3CC2Q 4BDZA 4LNPA 4L6V5 4BE1A 1W2BS 2KMTA 3E2UA 2OTLT 2GQIA 2SRCA 5I22A 3P8HA 1JJ2P 2M0YA 3PT9A 1KQSA 5J3BA 2KI7A 2K4YA 2OTJT 1RI0A 1U8RA 3M0UA 2DRKA 3U23A 2RQVA 1QVGP 2OTLA 2F2XA 2X4WA 2KEAA 3QZ9B 4JRQA 3L42A 5A2QE 1M8MA 4OGCA 2OTJA 4ME7A 1OQKA 3S3NA 2KRNA 4ZN1A 1YCYA 1M27C 5IHNA 2MF2A 4J9FA 2CKKA 1OPKA 2DL5A 4ZN3A 2ENMA 5KYUB 1GXIE 4FYYB 5ECAA 4JRPA 3X24B 5IAYA 2MK5A 4A4GA 2VUBA 1YCSB 2YDLA 1WHHA 2XDPA 5GANj 1VQ9Q 1NM7A 5KE3A 4QVCA 2OX7A 2KNBB 1BB9A 1TSFA 3VS2A 5LJ3d 2JM8A 1TXQA 4OP0A 3M9QA 1H641 3RNJA 1Q7YU 4X9DA 3TSWA 3GPLA 3G71T 5CCAA 2CP6A 2HSEB 4LDXA 3M58A 1WFWA 3NPFA 3JCMf 1VQ5T 1RAGB 4KULA 2O4XA 3I55T 2X3WD 1K8AR 2QGFB 2RHIA 4PJOD 3G4ST 1PKSA 3L2QA 1VA7A 2K2MA 3CBOA 2QGGA 2L5QA 1KFZA 2E5QA 2M16A 2X3XD 1M1KR 4IUVA 3EG9B 3G71A 1EFNA 3EH1A 2DYBA 5GMKj 2PUOB 1NEGA 1NYGA 3FLGA 3URGA 5LJ5e 1NJIR 1KQ1A 1T0JA 1VQ5A 2GF7A 3FIFA 1D09B 4PJNA 1GFDA 4A4EA 3I55A 8AT1B 2H3JA 3JCMJ 2K3BA 3G4SA 2L89A 1ARKA 2XMFA 2BIVA 5GAMe 2JOYA 2XHCA 1MMAA 3C94A 2OTLQ 2K7AA 3H41A 4N0AA 3JB9I 2COZA 2D8JA 2DL7A 2FRWA 1W2BA 2KRSA 3G6ET 3QO3A 3H0IA 2KAFA 2OTJQ 3DB3A 2ZGWA 4M75A 3OB9A 3QBYA 2KRMA 3ULRB 2DETA 3AHUA 2L3QA 1QKXA 1QWEA 2L2PA 3BW1A 2LNVA 1VYUA 2MIOA 3INZA 2BE9B 3CMAT 2VWFA 4M75G 4JJBA 3TSZA 3G6EA 1K9MU 2DZ9A 2V8JA 1SG5A 2FVUA 5GMKi 1WX6A 4LD9K 5LJ3j 4WF2A 4M7DF 2A7YA 2QI2A 3EFOB 4KGVB 3VS7A 4LDVA 3SWNB 2LNHB 3HFNA 4RTWA 2KROA 1MGQA 2I2LA 3UA6A 2EYWA 5KCHA 2VXEA 2EPDA 2KSSA 4AT1B 3H9NA 1RI9A 1N8RR 1KIKA 1WYXA 3VYGA 4N4HA 2HCKA 1UGVA 2J06A 4J6YA 4R56A 4AMCA 4IURA 2YWWA 4F04B 1G2BA 1MMNA 4F7UB 2MCNA 4M7DC 1AHJB 1H8KA 4E7IA 3HHTB 3G71Q 1CKBA 2JTFA 4C0FA 1WQWA 3G7ZA 5I2SA 1VQ5Q 5GANg 2DK3A 3I55Q 2EKOA 3CXCS 3MCAB 4GBQA 3CCVT 3TREA 4F14A 2P4RA 1RADB 3G4SQ 3HRSA 1U1TA 1XQHA 2HL5C 3FRNA 4O5VA 4ZTFA 2WSCE 2E6NA 5CKEA 2AIRB 2LRQA 3EHQA 2FL7A 3A5ZB 3OYGA 2C0OA 3M0SA 1NLPC 5FU6B 3M55A 2EGEA 4MMKA 1FMWA 4M77F 2HNIA 3HSBA 2HMAA 1V1CA 2PUKB 3CCVA 1AT1B 3GBQA 4XU3A 3AT1B 3L2RA 2P0KA 4CC3A 2CSIA 4DEYA 4M78F 2JZ2A 1NBEB 2LP5A 2WSEE 2OI3A 3HRUA 2OAWA 4RUGA 2QEXT 1K73C 2DKGA 1IB8A 3G6EQ 1UEBA 4CC2A 3MJXA 1SSHA 3EGUA 3KUFA 3HFOA 3BY7A 2V1RA 1VQPT 4J7IA 4M77C 1UG1A 1PG5B 1Q81C 4DBFA 1QQJA 2VGMA 4M78C 2DXBA 4JRKA 4HT8A 2QEXA 1JRIA 2VYTA 1S72T 3P8BB 2XIDA 1MMDA 2F2VA 5GANh 1I81A 1H3ZA 2W10A 4GY5A 1KD1R 1YFNA 5CKBA 3EGDB 2KK4A 1VQPA 1NZ9A 4ATOA 1MNDA 4JJNK 4FW1A 3OYYA 1TWBA 1YWPA 3VS6A 1M30A 2W0ZA 3CCUT 1ZUYA 4E7LA 2JTEA 1K1ZA 4TVRA 3OYHA 3CC4T 1S72A 2X35A 1B3QA 5GAN3 4DQ2A 4E47A 1A0NB 1UGSB 2RQWA 5KYWB 1WHLA 3EGXB 2HQXA 5LJ3g 4XU1A 3QPHA 4K11A 4KRTA 3I9QA 3CCUA 2GQVA 4LE9A 1IGQA 2E4HA 3I56T 1QCNA 3V8LA 2F5TX 4M75D 5CIUA 3CC4A 5GMKh 3RR6A 1KC8R 3JCMb 1M5Q1 3CCVQ 4J5YA 3LH5A 4JS5A 3OW2S 4FYWB 1IHVA 4OB3B 1GFCA 3F70A 1TG0A 3TEEA 3CCLA 1LNXA 1WHKA 4F7UE 3OYKA 3CXCA 3OBYA 2EVRA 3I56A 1HYOA 1TTHB 2NWMA 3PFSA 2RM4A 2KYMA 3JCMQ 2P0PA 3UWNA 3N5BB 3L2VA 1KG1A 3MP6A 3SB2A 1PRLC 2DBKA 2LX9A 2BZ8A 3KXTA 5A0LA 4XK8E 4HCZA 3E1SA 2MYSA 3VV0A 2MWOA 4B6MA 4M7DA 5KH6A 3GP8A 2QEXQ 1AWWA 2LQWA 4E7ZA 1BI1A 4C8QF 3CCJT 4PLIA 1HK9A 1QWFA 4PJOE 4FYVB 1X27A 3NGPA 1VQPQ 4M7DG 5LJ3h 1SRLA 2YRCA 3RMSA 1PD1A 2EQJA 2O31A 1NEBA 4QT7A 1UHFA 4RKUE 5FRMA 1U1SA 3VKIA 3P8DA 4BE0A 2EJ9A 1S72Q 1YJNT 2J6FA 3CCJA 4E7JA 3LGLA 1D1AA 4C8QC 3VYHB 2JN0A 4HCCA 2MWPA 4Q5WA 2LX7A 3VUZA 4DEXA 4MDXA 3CCUQ 1Y07A 1VQ4T 4PNOA 1I8FA 1YIJT 2F2WA 4NL3A 1RABB 2B86A 2L3SA 1MNEA 3LX7A 2A28A 3CC4Q 1YJNA 2E10A 5LJ3f 1YITA 1M8VA 1ZHIA 2K5IA 2CT4A 4BY6B 3G1JA 2LJ3A 5EC7A 1K8AU 1VQLT 1JB0E 4PL6A 2RJFA 4M77A 1KK7A 3OYCA 2HDAA 1RAEB 3CCLQ 4A53A 1GCPA 1IHWA 3CCST 1VQ4A 3ASKA 2JUFA 3QIIA 1YIJA 1M1KU 1Q82R 3I56Q 4AFSC 4M78A 3D7SB 2PU9B 1VQNT 3VS4A 1OU9A 1NJIU 2DD5A 5LJ5d 2K5LA 1G83A 2A37A 3M0TA 1D3BA 2M1HA 4M77G 1WIEA 2YXYA 4M7AF 2P4TA 1VQLA 4NS5A 3PE0A 2KT1A 2XU8A 2O9VA 3EG0A 4M75B 4LUEA 4M78G 3UA7A 1PRMC 3CCET 3CCSA 3RBBB 2E3IA 3DLLA 1AWXA 5C0MA 5GAMd 3ZBDA 1JO8A 2EGAA 1M90C 1IGUA 3M53A 1VQNA 3X26B 4E2FB 2ZAEA 2QXFA 4JRIA 3GNFB 4C5HA 5M9OA 2QA4T 2KYBA 4D8KA 3JSCA 3RKWA 2AKKA 4FT2A 2RA2A 2J05A 4M7AC 1GL5A 2MAMA 4JUVA 3CCEA 2JXBA 1Z9ZA 3GLXA 4XTZA 4LUDA 3CPFA 2Y4YA 2C06A 3QDFA 3CCJQ 3O8VA 1Y96A 2QA4A 2BZYA 4J9HA 1KHIA 2CREA 1RAFB 2HBPA 4B9XA 1YI2T 3LWIA 2J6OA 3L2UA 3ME9A 1V76A 4BACA 2EQMA 3ER0A 3UATA 2FYKA 2DXTA 3CC7A 1YJNQ 3DB4A 5J26A 4XQ3A 1YITQ 1O75A 4C5GA 1E7OA 1N8RU 4C92F 1XNIA 3JB9F 1TUGB 3PMTA 2ROLA 1YI2A 4C5IA 2ED1A 1VQ4Q 1YIJQ 3A8LB 4FIBA 3JCMh 2R5AA 1D1BA 4KGZB 5LJ5j 3JCMc 2CUBA 4FM4B 3WVDB 4ZGEB 3ZFJA 3ZL7C 2CGHA 1VQLQ 4PK4A
chains in the Genus database with same CATH topology
4LDWA 2I2LA 3HKSA 1JBMA 1VIFA 1ZQ1A 4C92C 2X4XA 2E64A 2VXEA 3M54A 2KSSA 3QYHB 4DOVA 5KCHA 2CZ7B 2Y4XA 1QVPA 4EMHA 1XOVA 3M5AA 5GAMj 3VYGA 3JB9H 3UDCA 1G3SA 2E70A 3C95A 1VQ7T 4N4HA 4RMOA 1NPPA 4R56A 4J6YA 2JVVA 1IREB 1WQ7A 2LQKA 3Q1JA 4RCBA 4RCCA 1VQOA 4IURA 3LH0A 1X01A 3QJYA 4F7UB 1K8AC 3BFMA 4EMKA 4M7DC 1YBYA 3QYGB 1AHJB 5GAN2 3OBWA 3HHTB 3OMCA 4E7IA 1BKBA 4PKCC 4C8QA 2YRVA 1LOJA 5GANf 5L8RE 4HCBA 2JTFA 1UGRB 4C0FA 1WQWA 5HK0A 3G7ZA 5I2SA 1M1KC 2BUDA 5CR2A 5GANg 2PVDB 1G3YA 1MHNA 4KUDK 2DK3A 4LD6A 2K3YA 2RK1A 2EKOA 1NJIC 3CXCS 3RMQA 3WVEB 3MCAB 3CCVT 2XDBA 1BI2A 3TREA 3H8ZA 1Q7YC 1VQ7A 3CPWS 3NTHA 1O9SA 5DM7R 2WSFE 3HRSA 1U1TA 1XQHA 3FRNA 3QG1A 2WACA 4FL6A 4C8QG 4O5VA 4ZTFA 2WSCE 2P0QA 2E6NA 5GANd 3JB9J 5CKEA 2GCXA 2EJGA 2ZPFB 4VUBA 2LRQA 4M7AB 1ZBXA 1Y7XA 2FL7A 4C0DB 3A5ZB 1FX7A 3OYGA 3RIRA 3SWNA 5GAN5 3KBGA 1YJNA 5FU6B 3LW5E 3M55A 3DLMA 4M75E 4MMKA 1OYXA 2DVEA 4M77F 4A4HA 4BUGA 2HNIA 5FRNA 4XTVA 3HSBA 3GIBA 2DO3A 2RJCA 4OB1B 2LVMA 3HRTA 1PSFA 4MZTA 3CC7T 1LJOA 3OYAA 2PUKB 2HAXA 3CCVA 1OI1A 2K2VA 2BKDN 4XU3A 4ELYC 3L2RA 2P0KA 2RD1A 4M78F 2JZ2A 3MEWA 4NOYA 4EDUA 4XTUA 5FU7B 3RKXA 2WSEE 3J81E 3HRUA 3LYIA 3MP1A 2PQWA 5FU7C 1KD1U 2DTHA 5AYFA 2EQKA 4KBMB 2QDYB 2NLUA 4D6WA 4J7FA 4KUIA 5GAN6 4F7UA 2GFAA 4CI0C 2JNGA 2QEXT 1K73C 4M78D 3FDRA 3CC2T 2DKGA 3OYFA 3A8OB 3NTKA 1UEBA 2RI3A 1KQSS 1N6AA 1WJSA 2EQUA 3KUFA 4IUPA 4XTYA 3HFOA 4XAXB 1I5LA 4Z02A 3BY7A 1HXDA 2LTOA 1VQPT 4J7IA 2LT4A 4M77C 2DIGA 3OSSC 2G3RA 4C5EA 3JAME 1Q81C 2GFUA 1EIFA 5GAOl 2LCCA 2QQAA 4OGEA 1DJ7B 4F7UG 1UGPB 3GF5A 3L1AA 2VGMA 2M0OA 3J80E 4ELZC 3FEOA 4M78C 3PMIA 3SFMA 2KQWA 2DXBA 4JRKA 3CCUT 2QEXA 1JRIA 1B34B 2VYTA 3LGFA 3CC2A 4HT8A 3H6ZA 1QVFS 3PIPA 2EIFA 3MHXA 5CQYA 3QKJA 2LT1A 1S72T 4M7AA 3P8BB 4C92D 2XIDA 4J83A 3OS2A 4OF1A 1NE8A 5GANh 3OYNA 2KVQG 3JB9D 1I81A 3E19A 5J39A 1H3ZA 2CS7A 3FB9A 4GY5A 1G3WA 3MO8A 5CKBA 1N9RA 2KK4A 4XU2A 4UC4A 1VQPA 3NFCA 1M1FA 4IUQA 1NZ9A 1QVFA 4QVDA 1YJWT 4ATOA 4JJNK 1N8RC 2VV5A 2IVWA 4O6JA 3OYYA 4QQDA 5HKCA 2DXUA 2ZCFB 2RI2A 3PNWC 2ZPIB 3QHSA 4N4IA 3V8JA 4KT0E 4C8QE 1N9SA 2FB7A 4XU0A 3VUBA 3FC3A 3T9NA 4M7AG 4M7DD 4E7LA 3MEAA 4FT4A 4C92B 5DLOA 1KC8U 1BYMA 4TVRA 4J6WA 3S6WA 3CEYA 3L2ZA 2ZPGB 4MZMA 2RHZA 5A0DA 5GAN7 1K9MC 5FLXE 1I4K1 2K3XA 1M4ZA 3OYHA 3OA6A 3CC4T 1S72A 1BI0A 2X35A 4PJOG 3X20B 2XICA 1M9SA 4A54A 5GAN3 2DPPB 1BI3A 4DQ2A 5KCOA 4IKFA 2CZ0B 4E47A 2DEQA 1Q86C 3CBMA 1UGSB 4Y91A 2RJDA 2E41A 2RH2A 3CCMT 1JJ2S 2KDSA 1UB4A 4M7DB 1KHCA 2HQXA 5LJ3g 4M75F 4BY6C 1YJWA 2DTOA 1VQ9T 1X75C 3JCMP 2O01E 3QPHA 2EFIA 4XU1A 4YTLA 3EFSA 4IUTA 5CKFA 5GAN8 3CCUA 4BE2A 3QJ6A 2GQVA 3META 5LJ5g 4XTWA 2QQ9A 5HK3A 3VJPA 3I56T 1JJ2A 3V8LA 2F5TX 2EAYA 3BDLA 4M75D 1VUBA 4OVAA 4J8OA 5CIUA 1VQMT 5GAOp 3CC4A 3SDZA 5GMKh 5GAOm 1M90U 1G5VA 4BI8B 2XDDA 1B34A 1QVGS 1SSFA 2YHTA 4Y28E 3LLRA 2DD4A 3X25B 1WJRA 3CCMA 4N0AC 4QQGA 2R58A 2X4YA 3JCMb 3S3MA 1M5Q1 1WNLA 4J5YA 5D6XA 3QDRB 5GAMg 2QQSA 4JS5A 3OW2S 4OB3B 4JLIA 3F70A 3S3OA 4L5GA 3TEEA 1VQ9A 3OYDA 1RL2A 5DLQE 2E65A 1OZ2A 1LNXA 3CCLA 2DIQA 3OYBA 4PJOF 1WJQA 2R57A 4F7UE 4X9CA 3OYKA 4M75C 1BIAA 3CXCA 1FXXA 1QVGA 3OBYA 3WXMB 3I56A 5KE2A 3CPWA 3JCMg 3PFSA 2ZPBB 3M57A 2RM4A 4P5NA 1VQMA 4RG2A 3GNGA 5HY6A 2E6ZA 3JCMQ 4A4KA 3OW2A 2YLBA 2ZPHB 1YJ9A 4C92A 3PTAA 2DTIA 2P0PA 3UWNA 3N5BB 3L2VA 1KG1A 3MP6A 2RO0A 3JCMW 3SB2A 4X34A 4PLLA 3A8MB 5GMKl 2QQRA 2LX9A 1PSEA 3RESA 3DKMA 5GAOr 4M77D 2V8IA 2L3RA 3M4YA 4GLKA 3KXTA 5A0LA 4XK8E 5A0GA 3C12A 4HCZA 4V2SA 3E1SA 1QW1A 3HL8A 3VV0A 2MWOA 4M7DA 2M9UA 4C92G 5KH6A 5CQXA 3MEVA 3LWHA 3CMET 3OYIA 4M7AE 5I21A 4FU6A 4JLGA 3GP8A 3A8GB 4BDZA 3JB9G 5GANe 2XKOC 2LCLA 4C0GA 4EMGA 1BI1A 4C8QF 5FROA 2XG8D 4PLIA 3CCJT 1HK9A 2X4JA 4L6V5 4BE1A 4BI4A 2KMTA 2XK0A 1W2BS 3J7AF 3X28B 4PJOE 4M77B 3OY9A 2OTLT 2D0QB 3P8HA 4N4GA 2K57A 2F69A 4R55A 1Y71A 4M7DG 3PT9A 4HKEA 5I2MA 5LJ3h 2EWNA 4RG8A 3CCRA 1KQSA 5J3BA 4M78B 3RMSA 1KD1C 3OS1A 1VQ8A 2K4YA 2EQJA 1RI0A 2OTJT 3M56A 1U8RA 3CMEA 4RKUE 3JCMV 5FRMA 2HQEA 1U1SA 4HT9A 2K5FA 3VKIA 2RHYA 4QQ6A 3CCQT 1D3BB 5GAOq 3P8DA 4BE0A 1NPRA 4NL2A 2EJ9A 3M59A 1YJNT 3V7RA 3QZ5B 3OQ5A 3CCJA 2VGNA 3V7SA 3EFRA 1QP2A 3FJPA 5EG2A 4E7JA 3LGLA 4C8QC 2OTLA 1Q82U 3VYHB 2JN0A 2X4WA 2B8AA 2R5MA 3E9FA 3SD4A 3V7CA 2MWPA 4Q5WA 3QZ9B 4OB0B 5GAMh 4HCCA 2FHDA 3L42A 4JRQA 3VUZA 5A2QE 2OAUA 4MDXA 4OGCA 2RJEA 1Y07A 1VQ4T 4PNOA 2OTJA 1I8FA 5CAIA 1YIJT 4ME7A 4NL3A 4IUUA 5CO7A 5GMKe 4QVZA 5GMKm 4E7HA 3C4SA 3CCQA 3S3NA 3LX7A 5D6YA 4ZN1A 1YCYA 5IN1A 3OSVA 1Q86U 2MF2A 2CKKA 2KY9A 2MMPA 2RB6A 2Y90A 1V29B 4F7UF 2E10A 5LJ3f 1YITA 3RKYA 4ZN3A 1M8VA 1W4SA 1ZHIA 2K5IA 4JDSA 4HA8A 1GXIE 3VU3C 1G3TA 4BY6B 5LJ5f 1K8AU 1VQLT 1JB0E 1OZ3A 3PIOA 3SWNC 2V8KA 4JRPA 4PL6A 3X24B 4A4GA 1FWZA 3JRZA 5IAYA 2VUBA 2RJFA 4M77A 3CCLT 2XDPA 5GANj 3OYCA 2CYZB 4A53A 3CMAA 5KE3A 1KC8C 4QVCA 3CCST 1VQ4A 3ASKA 2JUFA 3QIIA 1YIJA 1M1KU 1UGQB 1Y96B 5LJ3d 2EYQA 4M78A 4BD3A 4C92E 5GAN4 5CK9A 2PU9B 1YJ9T 1VQNT 3L2WA 4OP0A 3M9QA 1NJIU 1H641 4B9WA 1N27A 2DD5A 5LJ5d 2K5LA 5GAMf 3OS0A 1VQ6T 3UT1A 1Q7YU 1D3BA 2M1HA 4M77G 4X9DA 4BB7A 2P4TA 4DOWA 4ZGJB 4M7AF 3GPLA 3G71T 1VQKT 3UPUA 4XTXA 5CCAA 1VQLA 3OS5A 4NS5A 4LDXA 3M58A 3QUIA 2XU8A 3JCMf 4M75B 3BDUA 4M78G 4M7DE 2D9TA 2RI5A 3QXEB 1VQ5T 4II1A 4DA4A 3CD6T 4M7AD 3CCET 2EJFA 3MP8A 3CCSA 4A4FA 2QQBA 1M1GA 3DLLA 2DZCA 2O4XA 4KULA 5C0MA 5GAMd 3I55T 3ZBDA 3ZEHA 2RHIA 4MZPA 5CKHA 3M53A 1M90C 1VQNA 3X26B 2MI6A 2VXFA 2PVGB 1VIEA 4PJOD 2XD0A 3G4ST 2DJZA 3L2QA 2QXFA 4JRIA 3GNFB 4LDUA 4C5HA 5M9OA 2QA4T 3CBOA 1VQ6A 4E7KA 1BIBA 3JCMX 2L5QA 2E5QA 3JCMd 3JSCA 2M16A 5LJ3e 1YHQT 3RKWA 2VC8A 4IUVA 5CKDA 3G71A 4FT2A 3RUXA 2DXCA 1VQKA 2RA2A 3CCRT 5GMKj 2PUOB 2CZ6B 4M7AC 3URGA 3FLGA 5LJ5e 1VQ8T 2MAMA 1KQ1A 2F5KA 2D6FA 4C0DC 2LQ8A 4FSXA 4LDYA 4JUVA 3OYEA 3HP9A 2GF7A 3MEUA 3FIFA 1K73U 2HD0A 1VQ5A 3CCEA 2DAQA 3CD6A 4PJOB 1QP3A 4A4EA 5FU6C 4ZTJA 4J6XA 3I55A 3GLXA 1TH7A 2H3JA 3HPWA 3M4GA 3QSUA 4PJOC 3OYJA 4L59A 4XTZA 5C6SA 4JS4A 2E1HA 3JCMJ 3CPFA 2Y4YA 1P92A 3G4SA 2C06A 2L89A 4OMFB 3O8VA 3R6OA 1Y96A 3E9GA 5LL6S 2QA4A 2BIVA 1Q81U 1KHIA 1XTDA 5GAMe 2JOYA 5GAOn 2XHCA 4EPCA 1YHQA 3C94A 4C8QD 2HBPA 4N0AA 3JB9I 4B9XA 1YI2T 3LWIA 1W2BA 3G6ET 3OYMA 3QO3A 2KAFA 5LJ5h 3L2UA 1WPYA 3JCMe 3ME9A 4MMLA 3TCJA 4BACA 3DB3A 2EQMA 3ER0A 2ZGWA 2FYKA 4M75A 2E12A 3OB9A 3QBYA 2RHXA 4EMKB 2DXTA 3CC7A 3A8HB 4EMKC 1YITT 2IG0A 3AHUA 2AHJB 2YLCA 3DB4A 4ZGDB 3EAEA 5J26A 4XQ3A 5D6WA 1O75A 4C8QB 3OYLA 1WGSA 4C5GA 3BW1A 4C92F 1N8RU 2LNVA 4M77E 4MDWA 1XNIA 2O4XB 3JB9F 3PMTA 4OB2B 3INZA 1KQ2A 2QTXA 3CMAT 2PVOB 4M75G 1YI2A 2ZPEB 2A3LA 3G6EA 3OMGA 3TU4K 1K9MU 4BI3A 2CZ1B 2DZ9A 2V8JA 4M78E 1R8OB 4C5IA 2FVUA 2RK2A 4C0ZA 1X6OA 3A8LB 4FIBA 3PGGA 3JCMh 2R5AA 2LC4A 5GMKi 4LD9K 5LJ3j 4WF2A 4M7DF 2LDMA 4CRIA 4PJOA 3RERA 1VQOT 2A7YA 2RHUA 2QI2A 5DY9A 3GOXA 3V8KA 5LJ5j 3JCMc 2L8DA 1Q82C 2ZZDA 4LDVA 4BDYA 4FM4B 1IZ6A 3SWNB 3HFNA 3WVDB 4ZGEB 5CVIA 3ZFJA 2CGHA 3NTIA 5IT9E 3CBPA 1MGQA 2JTMA 2XI9A 4QW2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMI A;  2D9T A;  2RI5 A;  2MWO A;  5KCH A;  4II1 A;  2X4X A;  5KH6 A;  2VYT A;  3MEV A;  3LGF A;  3MP8 A;  3H6Z A;  3OYI A;  4A4F A;  4FU6 A;  3QKJ A;  5C0M A;  2O4X A;  4BDZ A;  3ZEH A;  3OS2 A;  2RHI A;  3OYN A;  5FRO A;  4PLI A;  5J39 A;  1H3Z A;  4BE1 A;  2XK0 A;  4GY5 A;  4N4H A;  3L2Q A;  3MO8 A;  4C5H A;  3OY9 A;  5M9O A;  3Q1J A;  4UC4 A;  4E7K A;  4IUR A;  3LH0 A;  3P8H A;  4IUQ A;  4N4G A;  2E5Q A;  2M16 A;  4IUV A;  4QQD A;  4E7I A;  3OMC A;  2RI2 A;  3PNW C;  4N4I A;  3FC3 A;  3FLG A;  3OS1 A;  2YRV A;  2F5K A;  3MEA A;  4E7L A;  2EQJ A;  1RI0 A;  2JTF A;  3S6W A;  3OYE A;  3MEU A;  2GF7 A;  3CEY A;  2RHZ A;  5FRM A;  2HQE A;  2DAQ A;  2BUD A;  2K3X A;  2RHY A;  4QQ6 A;  4A4E A;  3OYH A;  3OA6 A;  4ZTJ A;  1MHN A;  2X35 A;  3P8D A;  4BE0 A;  5KCO A;  3OYJ A;  4LD6 A;  2K3Y A;  4L59 A;  5C6S A;  4IKF A;  2EKO A;  3OQ5 A;  2RJD A;  3H8Z A;  2L89 A;  3NTH A;  3O8V A;  3LGL A;  3E9G A;  4E7J A;  2BIV A;  2WAC A;  4FL6 A;  4ZTF A;  1KHC A;  2HQX A;  2E6N A;  2B8A A;  2R5M A;  2X4W A;  3E9F A;  3SD4 A;  2MWP A;  4Q5W A;  2EFI A;  2FHD A;  2LRQ A;  3L42 A;  4IUT A;  4BE2 A;  3QJ6 A;  3MET A;  4B9X A;  2RJE A;  3OYM A;  3OYG A;  3BDL A;  3L2U A;  4IUU A;  3ME9 A;  4OVA A;  5CIU A;  4QVZ A;  3DB3 A;  2EQM A;  3DLM A;  4BAC A;  4E7H A;  3C4S A;  3S3N A;  3LX7 A;  1OYX A;  5D6Y A;  5FRN A;  5IN1 A;  3OB9 A;  3QBY A;  4A4H A;  1G5V A;  2RHX A;  2CKK A;  2RJC A;  1SSF A;  2LVM A;  3LLR A;  2IG0 A;  3OYA A;  1OI1 A;  1WJR A;  3DB4 A;  2BKD N;  3EAE A;  5D6W A;  5J26 A;  4QQG A;  2R58 A;  2X4Y A;  3OYL A;  2P0K A;  3L2R A;  3S3M A;  1WGS A;  5D6X A;  4C5G A;  2JZ2 A;  2QQS A;  3MEW A;  1OZ3 A;  4EDU A;  3F70 A;  4PL6 A;  5IAY A;  4A4G A;  3S3O A;  1XNI A;  2RJF A;  3LYI A;  3OYD A;  1OZ2 A;  2PQW A;  2O4X B;  2DIQ A;  2XDP A;  3MP1 A;  3PMT A;  1WJQ A;  3OYB A;  2EQK A;  2R57 A;  3OYC A;  2NLU A;  3OYK A;  5KE3 A;  2GFA A;  3FDR A;  3ASK A;  3OMG A;  3QII A;  5KE2 A;  3OYF A;  3PFS A;  4C5I A;  3NTK A;  2RI3 A;  4RG2 A;  4BD3 A;  1WJS A;  2EQU A;  2R5A A;  3KUF A;  4IUP A;  3UWN A;  3L2V A;  3L2W A;  3MP6 A;  3M9Q A;  2RO0 A;  4B9W A;  1N27 A;  3OS0 A;  4X34 A;  4Z02 A;  2LDM A;  4PLL A;  4CRI A;  2LTO A;  3UT1 A;  2RHU A;  3GOX A;  2M1H A;  2DIG A;  2QQR A;  2G3R A;  2L8D A;  4C5E A;  2GFU A;  4BDY A;  2LCC A;  4NS5 A;  2L3R A;  3NTI A;  2M0O A;  4HCZ A;  4QW2 A;  3FEO A; 
#chains in the Genus database with same CATH topology
 2QG9 B;  4LDW A;  1VIF A;  4C92 C;  3M54 A;  1UUE A;  4DOV A;  3MPU B;  2EYZ A;  3CCS Q;  1QVP A;  4FSS A;  4EMH A;  5GAM j;  3JB9 H;  2E70 A;  4AG2 C;  1VQN Q;  2OJ2 A;  1GBR A;  1NPP A;  4RCC A;  1IRE B;  3Q1J A;  4RCB A;  3LH0 A;  1X01 A;  1AD5 A;  3QYG B;  2PTK A;  1K76 A;  5GAN 2;  3OBW A;  2VVK A;  1BKB A;  4PKC C;  4C8Q A;  2CP0 A;  5L8R E;  4HCB A;  9ATC B;  2YUO A;  1MV3 A;  3CCE Q;  3WVE B;  1Q7Y C;  1O9S A;  4C8Q G;  2WAC A;  1PD0 A;  2QA4 Q;  2P0Q A;  3JB9 J;  2EJG A;  1YWO A;  1ZBX A;  1Y7X A;  2VB6 A;  1SF9 A;  3DLM A;  4M75 E;  2DVE A;  4BUG A;  4XTV A;  2RJC A;  3HRT A;  4MZT A;  4F17 A;  2HAX A;  1OI1 A;  2K2V A;  3CC7 Q;  2BKD N;  4ELY C;  1MMG A;  5IHK A;  4EDU A;  5FU7 B;  3J81 E;  5FU7 C;  1KD1 U;  3QWY A;  2RQU A;  4M78 D;  1YI2 Q;  4J9C A;  4Z89 A;  1JXO A;  2RI3 A;  4E6R A;  8ATC B;  1WJS A;  4XTY A;  1I5L A;  1HXD A;  2K9G A;  1RAC B;  2G3R A;  1C6V X;  1HD3 A;  2LCC A;  4OGE A;  1DJ7 B;  1B07 A;  2M0O A;  3J80 E;  2EQI A;  3PMI A;  1I5O B;  2KQW A;  5IXB A;  3LGF A;  5AT1 B;  3PIP A;  2CH4 W;  3QKJ A;  1M3A A;  4M7A A;  3VRY A;  1NE8 A;  2FZG B;  1B7T A;  3FB9 A;  1WHG A;  1GBQ A;  2BTT A;  4UC4 A;  1HSQ A;  1M1F A;  1QVF A;  1I1J A;  1ZA1 B;  2VV5 A;  1W6X A;  2IVW A;  1M3C A;  4QQD A;  5HKC A;  2DXU A;  2RI2 A;  2JS2 A;  3V8J A;  4N4I A;  3FC3 A;  2DER A;  1N9S A;  4M7A G;  1JEG A;  4FT4 A;  4RTY A;  1KC8 U;  4MZM A;  2ZPG B;  1K9M C;  2O2O A;  5FLX E;  2K3X A;  1M4Z A;  1BI0 A;  2XIC A;  1M9S A;  5IHI A;  4A54 A;  1TUC A;  4IIO A;  2CZ0 B;  1Q86 C;  2PZ1 A;  2E41 A;  3CCM T;  1BK2 A;  2IIM A;  1I0C A;  1M2V A;  2IPO B;  4M7D B;  1KHC A;  1KSW A;  2DTO A;  2O01 E;  2EFI A;  3IQL A;  3EFS A;  4IUT A;  5CKF A;  5LJ5 g;  2FZK B;  4XTW A;  2QQ9 A;  1JJ2 A;  2BZX A;  4ZNX A;  2EAY A;  1VQM T;  4OMM A;  3SDZ A;  5GAO m;  3M0P A;  1G5V A;  1UFF A;  2GNC A;  2YSQ A;  1C1A A;  1XJW B;  4CC7 A;  4Y28 E;  2LQN A;  2DD4 A;  1LCK A;  4JJC A;  3CCM A;  4QQG A;  2KBT A;  2X4Y A;  3S3M A;  1ZLM A;  3NMZ C;  5GAM g;  2CDT A;  2HKN A;  2JMC A;  5DLQ E;  1OZ2 A;  2DIQ A;  4PJO F;  3FJ5 A;  2R57 A;  1QVG A;  4X9C A;  2O88 A;  1BIA A;  4JPB W;  2ZPB B;  1PHT A;  1VQM A;  3GNG A;  1UJY A;  1YJ9 A;  4C92 A;  1JXM A;  4X34 A;  3VS0 A;  3A8M B;  5HCK A;  5IXF A;  1PSE A;  3RDV A;  1YNZ A;  2V8I A;  3M4Y A;  1J3T A;  4V2S A;  1QW1 A;  3HL8 A;  2RQT A;  4C92 G;  5CQX A;  3MEV A;  2JW4 A;  1UEC A;  3JB9 G;  2XKO C;  1MV0 B;  4C0G A;  4EMG A;  2RPN A;  1QCO A;  2X4J A;  1E6G A;  3X28 B;  4M77 B;  4DBR A;  3OY9 A;  2NUP A;  2K57 A;  2F69 A;  4R55 A;  4HKE A;  5I2M A;  2G6F X;  4CC4 B;  4RG8 A;  3CCR A;  4M78 B;  2DRM A;  3OS1 A;  1VQ8 A;  3UF4 A;  3M56 A;  3JCM V;  4HT9 A;  4HVW A;  1SPK A;  1D3B B;  1WDX A;  5GAO q;  2EW3 A;  2RF0 A;  4RTV A;  4HCK A;  1X6B A;  2DX1 A;  3QZ5 B;  3OQ5 A;  2VGN A;  2M51 A;  2FEI A;  3V7S A;  5EG2 A;  4HVV A;  1Q82 U;  3V7C A;  3E9F A;  2B8A A;  2R5M A;  3SD4 A;  3CPW P;  5GAM h;  3NHN A;  2FHD A;  3OW2 P;  2COY A;  2D1X A;  2RJE A;  1RUW A;  5CO7 A;  4QVZ A;  5GMK m;  4E7H A;  5D6Y A;  3OSV A;  2KY9 A;  2RB6 A;  1V29 B;  3RKY A;  4RTU A;  1ABQ A;  4JDS A;  3VU3 C;  1G3T A;  3CCM Q;  4J9E A;  5LJ5 f;  3I5R A;  2V8K A;  2CH4 A;  3JRZ A;  3CCL T;  2A36 A;  2ECZ A;  2H8H A;  1UGQ B;  1Y96 B;  2EYQ A;  4BD3 A;  5CK9 A;  1VQM Q;  3L2W A;  1AVZ C;  1YJ9 Q;  1ZX6 A;  3OS0 A;  5GAM f;  1VQ6 T;  1KQS P;  3UT1 A;  2EYY A;  4BB7 A;  4DOW A;  2DLP A;  1AOJ A;  1VQK T;  2CP7 A;  1UE9 A;  1R0B G;  3BDU A;  4M7D E;  1Z9Q A;  2D9T A;  2RI5 A;  3QXE B;  4M7A D;  4II1 A;  3CD6 T;  1KJW A;  3MP8 A;  3CQT A;  1M1G A;  1SKU B;  2DZC A;  2Z0W A;  4MZP A;  4J9D A;  2PVG B;  2XD0 A;  4KH0 B;  3EG1 A;  1QMC A;  1VQ6 A;  4LDU A;  4E7K A;  2PNI A;  1BIB A;  3JCM X;  1YHQ T;  1W1F A;  2VC8 A;  1VQK A;  2DXC A;  1OV3 A;  2V26 A;  3CCR Q;  4C0D C;  4FSX A;  4LDY A;  3OYE A;  1VQ8 Q;  3MEU A;  3CD6 A;  4LN2 A;  1QP3 A;  4J6X A;  3EG2 A;  1TH7 A;  3M4G A;  3QSU A;  2YUQ A;  4L59 A;  5C6S A;  2E1H A;  2SEM A;  2QDL A;  1P92 A;  2HZY A;  4OMF B;  1QCF A;  5LL6 S;  1D0Z A;  1OOT A;  3MKD A;  1XTD A;  4J9I A;  1YHQ A;  1SHF A;  3OYM A;  1WPY A;  3JCM e;  4MML A;  5KYY A;  4FYX B;  3H0H A;  4HVU A;  1AWJ A;  1YIT T;  2AHJ B;  4ZGD B;  3EAE A;  3TQ7 P;  5D6W A;  4C8Q B;  1K73 R;  1S1N A;  4PJJ A;  4ORZ A;  1RLQ C;  4MDW A;  4M77 E;  1ZSZ C;  2O4X B;  3REA B;  1K0S A;  2PVO B;  2ZPE B;  2NUT A;  2A3L A;  4BI3 A;  2CZ1 B;  1PWT A;  4M78 E;  1Q81 R;  1R8O B;  2L3P A;  2RK2 A;  4C0Z A;  1X6O A;  2KR3 A;  2LC4 A;  2LDM A;  3I5S A;  1D1C A;  4CRI A;  4PJO A;  1E6H A;  5DY9 A;  3GOX A;  3V8K A;  5FW9 A;  2EYX A;  2ZZD A;  1IZ6 A;  1G8X A;  5IT9 E;  3CBP A;  2JTM A;  2XI9 A;  4QW2 A;  3HKS A;  1JBM A;  1ZQ1 A;  2X4X A;  2E64 A;  2CSQ A;  1PCX A;  2RNA A;  2Y4X A;  2DYI A;  1BCM A;  1XOV A;  3UDC A;  4RMO A;  4FCY A;  2HEQ A;  1WQ7 A;  2JVV A;  1VQ6 Q;  1W2B P;  1K8A C;  3BFM A;  4EMK A;  1YBY A;  3OMC A;  1NYF A;  1VQK Q;  1LOJ A;  1T3L A;  1PNJ A;  1UDL A;  2GGR A;  5HK0 A;  1OEB A;  4ANJ A;  1M1K C;  4IIM A;  3CD6 Q;  2PVD B;  1MHN A;  1R0C B;  2RK1 A;  1NJI C;  3RMQ A;  1C0M A;  2XDB A;  1VYV A;  1BI2 A;  1JQQ A;  3NTH A;  2DA9 A;  5DM7 R;  2WSF E;  2RN8 A;  5GAN d;  2GCX A;  2HL3 A;  4VUB A;  4M7A B;  1YHQ Q;  2AK5 A;  1FX7 A;  3RIR A;  5GAN 5;  3KBG A;  2FRY A;  3LW5 E;  1OYX A;  5FRN A;  4RTZ A;  5GJV B;  4OB1 B;  1N5Z A;  4PJM A;  2LVM A;  3CC7 T;  1PSF A;  4LXC A;  4AFU C;  2DMO A;  2K79 A;  2ABL A;  2RD1 A;  3MEW A;  4XTU A;  3RKX A;  3LYI A;  2FZC B;  2VAS A;  2DTH A;  4KBM B;  2QDY B;  2NLU A;  4HXJ A;  4J7F A;  4D6W A;  2GFA A;  4CI0 C;  2JNG A;  3A8O B;  3NTK A;  1M2V B;  2CUD A;  2EQU A;  3PVQ A;  1HJD A;  1LPL A;  4XAX B;  2C0I A;  2M02 A;  2LTO A;  3OSS C;  2ED0 A;  4C5E A;  3JAM E;  1PC0 A;  1AEY A;  2QQA A;  1TS9 A;  1UGP B;  4ELZ C;  1WXU A;  1U06 A;  1QVF S;  3H6Z A;  2FG0 A;  2EIF A;  5CQY A;  4J83 A;  3OS2 A;  4OF1 A;  2KVQ G;  1YN8 A;  3E19 A;  5J39 A;  4RTX A;  2DL8 A;  2LJ1 A;  1G3W A;  2D0N A;  1Q95 G;  2DBM A;  1YJW T;  2A08 A;  1N8R C;  2ZCF B;  1OU8 A;  2MPX C;  3PNW C;  1SEM A;  2ZPI B;  4C8Q E;  2KGT A;  4KT0 E;  5I11 A;  2FB7 A;  4M7D D;  4C92 B;  1BYM A;  4J6W A;  5A0D A;  1ABO A;  5GAN 7;  3OA6 A;  4PFP A;  3X20 B;  1BI3 A;  4IKF A;  2DEQ A;  2ESW A;  2DF6 A;  2RJD A;  1JJ2 S;  2CP5 A;  1Y0M A;  2KDS A;  4ESR A;  1UB4 A;  2I0N A;  2L0A A;  1YJW A;  1X75 C;  3JCM P;  2DNU A;  4BE2 A;  2DL3 A;  2NYS A;  5HK3 A;  3BDL A;  2CP3 A;  2H3E B;  1VUB A;  4OVA A;  1ZSZ A;  2NUP B;  4DBQ A;  4BI8 B;  2XDD A;  1B34 A;  1WXB A;  1QVG S;  1SSF A;  3VS5 A;  3LLR A;  3X25 B;  1WJR A;  4Z88 A;  4J9B A;  1WNL A;  2F1L A;  1WI7 A;  3QDR B;  2QQS A;  4JLI A;  4L5G A;  3OYD A;  1RL2 A;  3OYB A;  1WJQ A;  1PM3 A;  2EKH A;  3WXM B;  2VKN A;  5KE2 A;  2KT8 A;  3M57 A;  4KH1 B;  4RG2 A;  5KYX A;  5HY6 A;  4KGX B;  2E6Z A;  2ZPH B;  2BE7 D;  1AZG B;  2RO0 A;  3JCM W;  1M3B A;  2A0F B;  1K0X A;  3BE3 A;  3RES A;  3DKM A;  1AZE A;  4M77 D;  2KXD A;  4GLK A;  1M90 R;  3A98 A;  1WXT A;  2JM9 A;  1VYT A;  2M9U A;  3I35 A;  3LWH A;  3CME T;  2YRD A;  1NLO C;  4M7A E;  5I21 A;  4FU6 A;  4JLG A;  5GAN e;  1X43 A;  2LCL A;  1WHJ A;  5FRO A;  2XG8 D;  3J7A F;  4BI4 A;  2XK0 A;  2D0Q B;  1R77 A;  4N4G A;  1WHM A;  1Y71 A;  2E3H A;  1FMV A;  2EWN A;  2GTJ A;  1KD1 C;  4OMO A;  2EBP A;  1ZUK A;  3CME A;  2HQE A;  2K5F A;  2RHY A;  4QQ6 A;  3CCQ T;  1ZBJ A;  1NPR A;  2RQR A;  4NL2 A;  5GJW B;  3JV3 A;  3M59 A;  3V7R A;  2GTO A;  2DL4 A;  4E7S A;  3EFR A;  1QP2 A;  3FJP A;  3CXC P;  1W70 A;  1D0Y A;  4OB0 B;  1YJW Q;  1T3S A;  1QLY A;  2OAU A;  4R0K A;  2KE9 A;  5CAI A;  4IUU A;  5GMK e;  3C4S A;  3CCQ A;  5IN1 A;  1Q86 U;  2MMP A;  2Y90 A;  4F7U F;  1Y57 A;  4WTO B;  2AKL A;  1W4S A;  4HA8 A;  1OZ3 A;  3PIO A;  3SWN C;  2FO0 A;  1FWZ A;  4A63 B;  2P84 A;  5L23 A;  2CYZ B;  3CMA A;  1KC8 C;  3HTR A;  2DFU A;  2ROT A;  4C92 E;  2DIL A;  1YJ9 T;  3EH2 A;  2GBQ A;  1GCQ C;  2FPE A;  4B9W A;  4PJL A;  1N27 A;  1U3O A;  3TVT A;  1X69 A;  2LCS A;  1K4U S;  4ZGJ B;  1PKT A;  3UPU A;  4XTX A;  3OS5 A;  2DE0 X;  3QUI A;  1WA7 A;  5KYY B;  4PFO A;  1X6G A;  1T0H A;  4Z8A A;  4DA4 A;  2EJF A;  3VS3 A;  4A4F A;  2QQB A;  2LMJ A;  6AT1 B;  2AZV A;  3ZEH A;  5CKH A;  2J6K A;  2MI6 A;  2VXF A;  1VIE A;  1OX9 A;  5KYN A;  2DJZ A;  2EGC A;  4QKU A;  1RAH B;  3JCM d;  5LJ3 e;  2NUT B;  5CKD A;  4JZ4 A;  4EIK A;  3RUX A;  5FWB A;  2AT1 B;  3CCR T;  2CP2 A;  1UHC A;  2CZ6 B;  5KYU A;  1VQ8 T;  2F5K A;  2D6F A;  1OX8 A;  2LQ8 A;  1Q7Y R;  1K73 U;  1CKA A;  3HP9 A;  2HD0 A;  2DAQ A;  4PJO B;  4Y92 A;  5FU6 C;  5FWC A;  3CME Q;  4ZTJ A;  4PJO C;  1LVK A;  3HPW A;  3OYJ A;  2YT6 A;  4JS4 A;  1GRI A;  2JT4 A;  3R6O A;  1TU0 B;  3E9G A;  2QAS A;  2AZS A;  1Q81 U;  5GAO n;  4EPC A;  4C8Q D;  4FW2 A;  3REB B;  5LJ5 h;  3TCJ A;  2E12 A;  4OMP A;  2RHX A;  4DBH A;  4EMK B;  3CCQ Q;  1RLP C;  3A8H B;  4EMK C;  1BCO A;  2IG0 A;  5IH2 A;  2YLC A;  3SEM A;  1EZZ B;  2COW A;  3OYL A;  1H3H A;  1WGS A;  3PVL A;  4OB2 B;  1KQ2 A;  2QTX A;  1OUL A;  3CMA Q;  2RMO A;  3EG9 A;  3OMG A;  3TU4 K;  3SHW A;  3PGG A;  3EHR A;  5D7U A;  1ZA2 B;  2YUN A;  3RER A;  1VQO T;  1X2Q A;  2RHU A;  3C0C A;  4JZ3 A;  2DVJ A;  2L8D A;  1Q82 C;  2JMA A;  4BDY A;  2KXC A;  3VRZ A;  5CVI A;  3NTI A;  4OMN A;  2CT3 A;  5GAN 4;  3QYH B;  2D8H A;  1SRM A;  1F1B B;  2CZ7 B;  2J7I A;  1D0X A;  3M5A A;  4F16 A;  1G3S A;  3C95 A;  1VQ7 T;  2LQK A;  1VQO A;  3QJY A;  4JJD A;  1K9M R;  2YUP A;  4AFZ C;  2JJ9 A;  1FMK A;  2YRV A;  1Q86 R;  5GAN f;  1X2K A;  1UGR B;  2BUD A;  5CR2 A;  2DM1 A;  1AWO A;  1G3Y A;  4KUD K;  1BBZ A;  4LD6 A;  2K3Y A;  2FPD A;  4PFZ A;  1M2O A;  3H8Z A;  1VQ7 A;  1U5S A;  3CPW S;  3QG1 A;  4FL6 A;  3KFV A;  2ZPF B;  3EFO A;  2DEU A;  1YP5 A;  4C0D B;  1MUZ A;  3SWN A;  1ZSG A;  2HBW A;  3M0Q A;  4A4H A;  2V1Q A;  4WCI A;  3GIB A;  2DO3 A;  1LJO A;  3OYA A;  3EG3 A;  4GLM A;  1GCQ A;  4NOY A;  1BU1 A;  2HSP A;  3MP1 A;  2PQW A;  1RAA B;  1IO6 A;  2EQK A;  5AYF A;  5GAN 6;  4KUI A;  2NUZ A;  4F7U A;  3CC2 T;  3FDR A;  3R6N A;  3OYF A;  1KQS S;  1N6A A;  1IXD A;  4IUP A;  2X51 A;  4Z02 A;  2ATC B;  2LT4 A;  2DIG A;  2GFU A;  1EIF A;  5GAO l;  4F7U G;  3GF5 A;  3L1A A;  1ZSZ B;  3FEO A;  3SFM A;  1B34 B;  3CC2 A;  3MHX A;  2LT1 A;  4C92 D;  4AFQ C;  3JB9 D;  2K6D A;  3OYN A;  3VS1 A;  2CS7 A;  2QAZ A;  3MO8 A;  1N9R A;  4XU2 A;  3NFC A;  4IUQ A;  4QVD A;  1VQO Q;  3THK A;  4O6J A;  3QHS A;  3O5Z A;  5KYX B;  1I07 A;  4RTT A;  4XU0 A;  3VUB A;  3T9N A;  2HQH A;  3MEA A;  1ACM B;  2LJ0 A;  2QYZ A;  5DLO A;  3S6W A;  1QKW A;  3CEY A;  3L2Z A;  2RHZ A;  1I4K 1;  4PJO G;  1FYN A;  1K9A A;  2DPP B;  5KCO A;  2O9S A;  3CBM A;  4Y91 A;  2RH2 A;  2C0T A;  2DJQ A;  4M4Z A;  1VQ7 Q;  1CSK A;  4M75 F;  4BY6 C;  1VQ9 T;  3H0F A;  4YTL A;  2MOX A;  5GAN 8;  1EX4 A;  2LZ6 B;  3QJ6 A;  3MET A;  4AG1 C;  2E5K A;  3VJP A;  2QK0 A;  1RAI B;  4J8O A;  5GAO p;  1TUD A;  1M90 U;  2YHT A;  2JS0 A;  1VOM A;  3A1P A;  1JU5 C;  1TOV A;  4N0A C;  2R58 A;  1H92 A;  5D6X A;  3M0R A;  2HKQ B;  1UJ0 A;  4J9G A;  1VQ9 A;  3S3O A;  2E65 A;  3EGD A;  1SHG A;  1WZO A;  4M75 C;  1FXX A;  3QWX X;  1NG2 A;  1OPL A;  3CPW A;  3JCM g;  4P5N A;  3OW2 A;  4A4K A;  1QVF P;  2YLB A;  3PTA A;  2DTI A;  4OMQ A;  7AT1 B;  4PLL A;  5GMK l;  2QQR A;  4X1V A;  4OML A;  2FPF A;  1UTI A;  5GAO r;  1WLP B;  2L3R A;  5A0G A;  3C12 A;  2X9H A;  5KYW A;  4D8D A;  2QTV A;  3EGX A;  1ZUU A;  3OYI A;  1IRX A;  3A8G B;  3CC2 Q;  4BDZ A;  4LNP A;  4L6V 5;  4BE1 A;  1W2B S;  2KMT A;  3E2U A;  2OTL T;  2GQI A;  2SRC A;  5I22 A;  3P8H A;  1JJ2 P;  2M0Y A;  3PT9 A;  1KQS A;  5J3B A;  2KI7 A;  2K4Y A;  2OTJ T;  1RI0 A;  1U8R A;  3M0U A;  2DRK A;  3U23 A;  2RQV A;  1QVG P;  2OTL A;  2F2X A;  2X4W A;  2KEA A;  3QZ9 B;  4JRQ A;  3L42 A;  5A2Q E;  1M8M A;  4OGC A;  2OTJ A;  4ME7 A;  1OQK A;  3S3N A;  2KRN A;  4ZN1 A;  1YCY A;  1M27 C;  5IHN A;  2MF2 A;  4J9F A;  2CKK A;  1OPK A;  2DL5 A;  4ZN3 A;  2ENM A;  5KYU B;  1GXI E;  4FYY B;  5ECA A;  4JRP A;  3X24 B;  5IAY A;  2MK5 A;  4A4G A;  2VUB A;  1YCS B;  2YDL A;  1WHH A;  2XDP A;  5GAN j;  1VQ9 Q;  1NM7 A;  5KE3 A;  4QVC A;  2OX7 A;  2KNB B;  1BB9 A;  1TSF A;  3VS2 A;  5LJ3 d;  2JM8 A;  1TXQ A;  4OP0 A;  3M9Q A;  1H64 1;  3RNJ A;  1Q7Y U;  4X9D A;  3TSW A;  3GPL A;  3G71 T;  5CCA A;  2CP6 A;  2HSE B;  4LDX A;  3M58 A;  1WFW A;  3NPF A;  3JCM f;  1VQ5 T;  1RAG B;  4KUL A;  2O4X A;  3I55 T;  2X3W D;  1K8A R;  2QGF B;  2RHI A;  4PJO D;  3G4S T;  1PKS A;  3L2Q A;  1VA7 A;  2K2M A;  3CBO A;  2QGG A;  2L5Q A;  1KFZ A;  2E5Q A;  2M16 A;  2X3X D;  1M1K R;  4IUV A;  3EG9 B;  3G71 A;  1EFN A;  3EH1 A;  2DYB A;  5GMK j;  2PUO B;  1NEG A;  1NYG A;  3FLG A;  3URG A;  5LJ5 e;  1NJI R;  1KQ1 A;  1T0J A;  1VQ5 A;  2GF7 A;  3FIF A;  1D09 B;  4PJN A;  1GFD A;  4A4E A;  3I55 A;  8AT1 B;  2H3J A;  3JCM J;  2K3B A;  3G4S A;  2L89 A;  1ARK A;  2XMF A;  2BIV A;  5GAM e;  2JOY A;  2XHC A;  1MMA A;  3C94 A;  2OTL Q;  2K7A A;  3H41 A;  4N0A A;  3JB9 I;  2COZ A;  2D8J A;  2DL7 A;  2FRW A;  1W2B A;  2KRS A;  3G6E T;  3QO3 A;  3H0I A;  2KAF A;  2OTJ Q;  3DB3 A;  2ZGW A;  4M75 A;  3OB9 A;  3QBY A;  2KRM A;  3ULR B;  2DET A;  3AHU A;  2L3Q A;  1QKX A;  1QWE A;  2L2P A;  3BW1 A;  2LNV A;  1VYU A;  2MIO A;  3INZ A;  2BE9 B;  3CMA T;  2VWF A;  4M75 G;  4JJB A;  3TSZ A;  3G6E A;  1K9M U;  2DZ9 A;  2V8J A;  1SG5 A;  2FVU A;  5GMK i;  1WX6 A;  4LD9 K;  5LJ3 j;  4WF2 A;  4M7D F;  2A7Y A;  2QI2 A;  3EFO B;  4KGV B;  3VS7 A;  4LDV A;  3SWN B;  2LNH B;  3HFN A;  4RTW A;  2KRO A;  1MGQ A;  2I2L A;  3UA6 A;  2EYW A;  5KCH A;  2VXE A;  2EPD A;  2KSS A;  4AT1 B;  3H9N A;  1RI9 A;  1N8R R;  1KIK A;  1WYX A;  3VYG A;  4N4H A;  2HCK A;  1UGV A;  2J06 A;  4J6Y A;  4R56 A;  4AMC A;  4IUR A;  2YWW A;  4F04 B;  1G2B A;  1MMN A;  4F7U B;  2MCN A;  4M7D C;  1AHJ B;  1H8K A;  4E7I A;  3HHT B;  3G71 Q;  1CKB A;  2JTF A;  4C0F A;  1WQW A;  3G7Z A;  5I2S A;  1VQ5 Q;  5GAN g;  2DK3 A;  3I55 Q;  2EKO A;  3CXC S;  3MCA B;  4GBQ A;  3CCV T;  3TRE A;  4F14 A;  2P4R A;  1RAD B;  3G4S Q;  3HRS A;  1U1T A;  1XQH A;  2HL5 C;  3FRN A;  4O5V A;  4ZTF A;  2WSC E;  2E6N A;  5CKE A;  2AIR B;  2LRQ A;  3EHQ A;  2FL7 A;  3A5Z B;  3OYG A;  2C0O A;  3M0S A;  1NLP C;  5FU6 B;  3M55 A;  2EGE A;  4MMK A;  1FMW A;  4M77 F;  2HNI A;  3HSB A;  2HMA A;  1V1C A;  2PUK B;  3CCV A;  1AT1 B;  3GBQ A;  4XU3 A;  3AT1 B;  3L2R A;  2P0K A;  4CC3 A;  2CSI A;  4DEY A;  4M78 F;  2JZ2 A;  1NBE B;  2LP5 A;  2WSE E;  2OI3 A;  3HRU A;  2OAW A;  4RUG A;  2QEX T;  1K73 C;  2DKG A;  1IB8 A;  3G6E Q;  1UEB A;  4CC2 A;  3MJX A;  1SSH A;  3EGU A;  3KUF A;  3HFO A;  3BY7 A;  2V1R A;  1VQP T;  4J7I A;  4M77 C;  1UG1 A;  1PG5 B;  1Q81 C;  4DBF A;  1QQJ A;  2VGM A;  4M78 C;  2DXB A;  4JRK A;  4HT8 A;  2QEX A;  1JRI A;  2VYT A;  1S72 T;  3P8B B;  2XID A;  1MMD A;  2F2V A;  5GAN h;  1I81 A;  1H3Z A;  2W10 A;  4GY5 A;  1KD1 R;  1YFN A;  5CKB A;  3EGD B;  2KK4 A;  1VQP A;  1NZ9 A;  4ATO A;  1MND A;  4JJN K;  4FW1 A;  3OYY A;  1TWB A;  1YWP A;  3VS6 A;  1M30 A;  2W0Z A;  3CCU T;  1ZUY A;  4E7L A;  2JTE A;  1K1Z A;  4TVR A;  3OYH A;  3CC4 T;  1S72 A;  2X35 A;  1B3Q A;  5GAN 3;  4DQ2 A;  4E47 A;  1A0N B;  1UGS B;  2RQW A;  5KYW B;  1WHL A;  3EGX B;  2HQX A;  5LJ3 g;  4XU1 A;  3QPH A;  4K11 A;  4KRT A;  3I9Q A;  3CCU A;  2GQV A;  4LE9 A;  1IGQ A;  2E4H A;  3I56 T;  1QCN A;  3V8L A;  2F5T X;  4M75 D;  5CIU A;  3CC4 A;  5GMK h;  3RR6 A;  1KC8 R;  3JCM b;  1M5Q 1;  3CCV Q;  4J5Y A;  3LH5 A;  4JS5 A;  3OW2 S;  4FYW B;  1IHV A;  4OB3 B;  1GFC A;  3F70 A;  1TG0 A;  3TEE A;  3CCL A;  1LNX A;  1WHK A;  4F7U E;  3OYK A;  3CXC A;  3OBY A;  2EVR A;  3I56 A;  1HYO A;  1TTH B;  2NWM A;  3PFS A;  2RM4 A;  2KYM A;  3JCM Q;  2P0P A;  3UWN A;  3N5B B;  3L2V A;  1KG1 A;  3MP6 A;  3SB2 A;  1PRL C;  2DBK A;  2LX9 A;  2BZ8 A;  3KXT A;  5A0L A;  4XK8 E;  4HCZ A;  3E1S A;  2MYS A;  3VV0 A;  2MWO A;  4B6M A;  4M7D A;  5KH6 A;  3GP8 A;  2QEX Q;  1AWW A;  2LQW A;  4E7Z A;  1BI1 A;  4C8Q F;  3CCJ T;  4PLI A;  1HK9 A;  1QWF A;  4PJO E;  4FYV B;  1X27 A;  3NGP A;  1VQP Q;  4M7D G;  5LJ3 h;  1SRL A;  2YRC A;  3RMS A;  1PD1 A;  2EQJ A;  2O31 A;  1NEB A;  4QT7 A;  1UHF A;  4RKU E;  5FRM A;  1U1S A;  3VKI A;  3P8D A;  4BE0 A;  2EJ9 A;  1S72 Q;  1YJN T;  2J6F A;  3CCJ A;  4E7J A;  3LGL A;  1D1A A;  4C8Q C;  3VYH B;  2JN0 A;  4HCC A;  2MWP A;  4Q5W A;  2LX7 A;  3VUZ A;  4DEX A;  4MDX A;  3CCU Q;  1Y07 A;  1VQ4 T;  4PNO A;  1I8F A;  1YIJ T;  2F2W A;  4NL3 A;  1RAB B;  2B86 A;  2L3S A;  1MNE A;  3LX7 A;  2A28 A;  3CC4 Q;  1YJN A;  2E10 A;  5LJ3 f;  1YIT A;  1M8V A;  1ZHI A;  2K5I A;  2CT4 A;  4BY6 B;  3G1J A;  2LJ3 A;  5EC7 A;  1K8A U;  1VQL T;  1JB0 E;  4PL6 A;  2RJF A;  4M77 A;  1KK7 A;  3OYC A;  2HDA A;  1RAE B;  3CCL Q;  4A53 A;  1GCP A;  1IHW A;  3CCS T;  1VQ4 A;  3ASK A;  2JUF A;  3QII A;  1YIJ A;  1M1K U;  1Q82 R;  3I56 Q;  4AFS C;  4M78 A;  3D7S B;  2PU9 B;  1VQN T;  3VS4 A;  1OU9 A;  1NJI U;  2DD5 A;  5LJ5 d;  2K5L A;  1G83 A;  2A37 A;  3M0T A;  1D3B A;  2M1H A;  4M77 G;  1WIE A;  2YXY A;  4M7A F;  2P4T A;  1VQL A;  4NS5 A;  3PE0 A;  2KT1 A;  2XU8 A;  2O9V A;  3EG0 A;  4M75 B;  4LUE A;  4M78 G;  3UA7 A;  1PRM C;  3CCE T;  3CCS A;  3RBB B;  2E3I A;  3DLL A;  1AWX A;  5C0M A;  5GAM d;  3ZBD A;  1JO8 A;  2EGA A;  1M90 C;  1IGU A;  3M53 A;  1VQN A;  3X26 B;  4E2F B;  2ZAE A;  2QXF A;  4JRI A;  3GNF B;  4C5H A;  5M9O A;  2QA4 T;  2KYB A;  4D8K A;  3JSC A;  3RKW A;  2AKK A;  4FT2 A;  2RA2 A;  2J05 A;  4M7A C;  1GL5 A;  2MAM A;  4JUV A;  3CCE A;  2JXB A;  1Z9Z A;  3GLX A;  4XTZ A;  4LUD A;  3CPF A;  2Y4Y A;  2C06 A;  3QDF A;  3CCJ Q;  3O8V A;  1Y96 A;  2QA4 A;  2BZY A;  4J9H A;  1KHI A;  2CRE A;  1RAF B;  2HBP A;  4B9X A;  1YI2 T;  3LWI A;  2J6O A;  3L2U A;  3ME9 A;  1V76 A;  4BAC A;  2EQM A;  3ER0 A;  3UAT A;  2FYK A;  2DXT A;  3CC7 A;  1YJN Q;  3DB4 A;  5J26 A;  4XQ3 A;  1YIT Q;  1O75 A;  4C5G A;  1E7O A;  1N8R U;  4C92 F;  1XNI A;  3JB9 F;  1TUG B;  3PMT A;  2ROL A;  1YI2 A;  4C5I A;  2ED1 A;  1VQ4 Q;  1YIJ Q;  3A8L B;  4FIB A;  3JCM h;  2R5A A;  1D1B A;  4KGZ B;  5LJ5 j;  3JCM c;  2CUB A;  4FM4 B;  3WVD B;  4ZGE B;  3ZFJ A;  3ZL7 C;  2CGH A;  1VQL Q;  4PK4 A; 
#chains in the Genus database with same CATH homology
 4LDW A;  2I2L A;  3HKS A;  1JBM A;  1VIF A;  1ZQ1 A;  4C92 C;  2X4X A;  2E64 A;  2VXE A;  3M54 A;  2KSS A;  3QYH B;  4DOV A;  5KCH A;  2CZ7 B;  2Y4X A;  1QVP A;  4EMH A;  1XOV A;  3M5A A;  5GAM j;  3VYG A;  3JB9 H;  3UDC A;  1G3S A;  2E70 A;  3C95 A;  1VQ7 T;  4N4H A;  4RMO A;  1NPP A;  4R56 A;  4J6Y A;  2JVV A;  1IRE B;  1WQ7 A;  2LQK A;  3Q1J A;  4RCB A;  4RCC A;  1VQO A;  4IUR A;  3LH0 A;  1X01 A;  3QJY A;  4F7U B;  1K8A C;  3BFM A;  4EMK A;  4M7D C;  1YBY A;  3QYG B;  1AHJ B;  5GAN 2;  3OBW A;  3HHT B;  3OMC A;  4E7I A;  1BKB A;  4PKC C;  4C8Q A;  2YRV A;  1LOJ A;  5GAN f;  5L8R E;  4HCB A;  2JTF A;  1UGR B;  4C0F A;  1WQW A;  5HK0 A;  3G7Z A;  5I2S A;  1M1K C;  2BUD A;  5CR2 A;  5GAN g;  2PVD B;  1G3Y A;  1MHN A;  4KUD K;  2DK3 A;  4LD6 A;  2K3Y A;  2RK1 A;  2EKO A;  1NJI C;  3CXC S;  3RMQ A;  3WVE B;  3MCA B;  3CCV T;  2XDB A;  1BI2 A;  3TRE A;  3H8Z A;  1Q7Y C;  1VQ7 A;  3CPW S;  3NTH A;  1O9S A;  5DM7 R;  2WSF E;  3HRS A;  1U1T A;  1XQH A;  3FRN A;  3QG1 A;  2WAC A;  4FL6 A;  4C8Q G;  4O5V A;  4ZTF A;  2WSC E;  2P0Q A;  2E6N A;  5GAN d;  3JB9 J;  5CKE A;  2GCX A;  2EJG A;  2ZPF B;  4VUB A;  2LRQ A;  4M7A B;  1ZBX A;  1Y7X A;  2FL7 A;  4C0D B;  3A5Z B;  1FX7 A;  3OYG A;  3RIR A;  3SWN A;  5GAN 5;  3KBG A;  1YJN A;  5FU6 B;  3LW5 E;  3M55 A;  3DLM A;  4M75 E;  4MMK A;  1OYX A;  2DVE A;  4M77 F;  4A4H A;  4BUG A;  2HNI A;  5FRN A;  4XTV A;  3HSB A;  3GIB A;  2DO3 A;  2RJC A;  4OB1 B;  2LVM A;  3HRT A;  1PSF A;  4MZT A;  3CC7 T;  1LJO A;  3OYA A;  2PUK B;  2HAX A;  3CCV A;  1OI1 A;  2K2V A;  2BKD N;  4XU3 A;  4ELY C;  3L2R A;  2P0K A;  2RD1 A;  4M78 F;  2JZ2 A;  3MEW A;  4NOY A;  4EDU A;  4XTU A;  5FU7 B;  3RKX A;  2WSE E;  3J81 E;  3HRU A;  3LYI A;  3MP1 A;  2PQW A;  5FU7 C;  1KD1 U;  2DTH A;  5AYF A;  2EQK A;  4KBM B;  2QDY B;  2NLU A;  4D6W A;  4J7F A;  4KUI A;  5GAN 6;  4F7U A;  2GFA A;  4CI0 C;  2JNG A;  2QEX T;  1K73 C;  4M78 D;  3FDR A;  3CC2 T;  2DKG A;  3OYF A;  3A8O B;  3NTK A;  1UEB A;  2RI3 A;  1KQS S;  1N6A A;  1WJS A;  2EQU A;  3KUF A;  4IUP A;  4XTY A;  3HFO A;  4XAX B;  1I5L A;  4Z02 A;  3BY7 A;  1HXD A;  2LTO A;  1VQP T;  4J7I A;  2LT4 A;  4M77 C;  2DIG A;  3OSS C;  2G3R A;  4C5E A;  3JAM E;  1Q81 C;  2GFU A;  1EIF A;  5GAO l;  2LCC A;  2QQA A;  4OGE A;  1DJ7 B;  4F7U G;  1UGP B;  3GF5 A;  3L1A A;  2VGM A;  2M0O A;  3J80 E;  4ELZ C;  3FEO A;  4M78 C;  3PMI A;  3SFM A;  2KQW A;  2DXB A;  4JRK A;  3CCU T;  2QEX A;  1JRI A;  1B34 B;  2VYT A;  3LGF A;  3CC2 A;  4HT8 A;  3H6Z A;  1QVF S;  3PIP A;  2EIF A;  3MHX A;  5CQY A;  3QKJ A;  2LT1 A;  1S72 T;  4M7A A;  3P8B B;  4C92 D;  2XID A;  4J83 A;  3OS2 A;  4OF1 A;  1NE8 A;  5GAN h;  3OYN A;  2KVQ G;  3JB9 D;  1I81 A;  3E19 A;  5J39 A;  1H3Z A;  2CS7 A;  3FB9 A;  4GY5 A;  1G3W A;  3MO8 A;  5CKB A;  1N9R A;  2KK4 A;  4XU2 A;  4UC4 A;  1VQP A;  3NFC A;  1M1F A;  4IUQ A;  1NZ9 A;  1QVF A;  4QVD A;  1YJW T;  4ATO A;  4JJN K;  1N8R C;  2VV5 A;  2IVW A;  4O6J A;  3OYY A;  4QQD A;  5HKC A;  2DXU A;  2ZCF B;  2RI2 A;  3PNW C;  2ZPI B;  3QHS A;  4N4I A;  3V8J A;  4KT0 E;  4C8Q E;  1N9S A;  2FB7 A;  4XU0 A;  3VUB A;  3FC3 A;  3T9N A;  4M7A G;  4M7D D;  4E7L A;  3MEA A;  4FT4 A;  4C92 B;  5DLO A;  1KC8 U;  1BYM A;  4TVR A;  4J6W A;  3S6W A;  3CEY A;  3L2Z A;  2ZPG B;  4MZM A;  2RHZ A;  5A0D A;  5GAN 7;  1K9M C;  5FLX E;  1I4K 1;  2K3X A;  1M4Z A;  3OYH A;  3OA6 A;  3CC4 T;  1S72 A;  1BI0 A;  2X35 A;  4PJO G;  3X20 B;  2XIC A;  1M9S A;  4A54 A;  5GAN 3;  2DPP B;  1BI3 A;  4DQ2 A;  5KCO A;  4IKF A;  2CZ0 B;  4E47 A;  2DEQ A;  1Q86 C;  3CBM A;  1UGS B;  4Y91 A;  2RJD A;  2E41 A;  2RH2 A;  3CCM T;  1JJ2 S;  2KDS A;  1UB4 A;  4M7D B;  1KHC A;  2HQX A;  5LJ3 g;  4M75 F;  4BY6 C;  1YJW A;  2DTO A;  1VQ9 T;  1X75 C;  3JCM P;  2O01 E;  3QPH A;  2EFI A;  4XU1 A;  4YTL A;  3EFS A;  4IUT A;  5CKF A;  5GAN 8;  3CCU A;  4BE2 A;  3QJ6 A;  2GQV A;  3MET A;  5LJ5 g;  4XTW A;  2QQ9 A;  5HK3 A;  3VJP A;  3I56 T;  1JJ2 A;  3V8L A;  2F5T X;  2EAY A;  3BDL A;  4M75 D;  1VUB A;  4OVA A;  4J8O A;  5CIU A;  1VQM T;  5GAO p;  3CC4 A;  3SDZ A;  5GMK h;  5GAO m;  1M90 U;  1G5V A;  4BI8 B;  2XDD A;  1B34 A;  1QVG S;  1SSF A;  2YHT A;  4Y28 E;  3LLR A;  2DD4 A;  3X25 B;  1WJR A;  3CCM A;  4N0A C;  4QQG A;  2R58 A;  2X4Y A;  3JCM b;  3S3M A;  1M5Q 1;  1WNL A;  4J5Y A;  5D6X A;  3QDR B;  5GAM g;  2QQS A;  4JS5 A;  3OW2 S;  4OB3 B;  4JLI A;  3F70 A;  3S3O A;  4L5G A;  3TEE A;  1VQ9 A;  3OYD A;  1RL2 A;  5DLQ E;  2E65 A;  1OZ2 A;  1LNX A;  3CCL A;  2DIQ A;  3OYB A;  4PJO F;  1WJQ A;  2R57 A;  4F7U E;  4X9C A;  3OYK A;  4M75 C;  1BIA A;  3CXC A;  1FXX A;  1QVG A;  3OBY A;  3WXM B;  3I56 A;  5KE2 A;  3CPW A;  3JCM g;  3PFS A;  2ZPB B;  3M57 A;  2RM4 A;  4P5N A;  1VQM A;  4RG2 A;  3GNG A;  5HY6 A;  2E6Z A;  3JCM Q;  4A4K A;  3OW2 A;  2YLB A;  2ZPH B;  1YJ9 A;  4C92 A;  3PTA A;  2DTI A;  2P0P A;  3UWN A;  3N5B B;  3L2V A;  1KG1 A;  3MP6 A;  2RO0 A;  3JCM W;  3SB2 A;  4X34 A;  4PLL A;  3A8M B;  5GMK l;  2QQR A;  2LX9 A;  1PSE A;  3RES A;  3DKM A;  5GAO r;  4M77 D;  2V8I A;  2L3R A;  3M4Y A;  4GLK A;  3KXT A;  5A0L A;  4XK8 E;  5A0G A;  3C12 A;  4HCZ A;  4V2S A;  3E1S A;  1QW1 A;  3HL8 A;  3VV0 A;  2MWO A;  4M7D A;  2M9U A;  4C92 G;  5KH6 A;  5CQX A;  3MEV A;  3LWH A;  3CME T;  3OYI A;  4M7A E;  5I21 A;  4FU6 A;  4JLG A;  3GP8 A;  3A8G B;  4BDZ A;  3JB9 G;  5GAN e;  2XKO C;  2LCL A;  4C0G A;  4EMG A;  1BI1 A;  4C8Q F;  5FRO A;  2XG8 D;  4PLI A;  3CCJ T;  1HK9 A;  2X4J A;  4L6V 5;  4BE1 A;  4BI4 A;  2KMT A;  2XK0 A;  1W2B S;  3J7A F;  3X28 B;  4PJO E;  4M77 B;  3OY9 A;  2OTL T;  2D0Q B;  3P8H A;  4N4G A;  2K57 A;  2F69 A;  4R55 A;  1Y71 A;  4M7D G;  3PT9 A;  4HKE A;  5I2M A;  5LJ3 h;  2EWN A;  4RG8 A;  3CCR A;  1KQS A;  5J3B A;  4M78 B;  3RMS A;  1KD1 C;  3OS1 A;  1VQ8 A;  2K4Y A;  2EQJ A;  1RI0 A;  2OTJ T;  3M56 A;  1U8R A;  3CME A;  4RKU E;  3JCM V;  5FRM A;  2HQE A;  1U1S A;  4HT9 A;  2K5F A;  3VKI A;  2RHY A;  4QQ6 A;  3CCQ T;  1D3B B;  5GAO q;  3P8D A;  4BE0 A;  1NPR A;  4NL2 A;  2EJ9 A;  3M59 A;  1YJN T;  3V7R A;  3QZ5 B;  3OQ5 A;  3CCJ A;  2VGN A;  3V7S A;  3EFR A;  1QP2 A;  3FJP A;  5EG2 A;  4E7J A;  3LGL A;  4C8Q C;  2OTL A;  1Q82 U;  3VYH B;  2JN0 A;  2X4W A;  2B8A A;  2R5M A;  3E9F A;  3SD4 A;  3V7C A;  2MWP A;  4Q5W A;  3QZ9 B;  4OB0 B;  5GAM h;  4HCC A;  2FHD A;  3L42 A;  4JRQ A;  3VUZ A;  5A2Q E;  2OAU A;  4MDX A;  4OGC A;  2RJE A;  1Y07 A;  1VQ4 T;  4PNO A;  2OTJ A;  1I8F A;  5CAI A;  1YIJ T;  4ME7 A;  4NL3 A;  4IUU A;  5CO7 A;  5GMK e;  4QVZ A;  5GMK m;  4E7H A;  3C4S A;  3CCQ A;  3S3N A;  3LX7 A;  5D6Y A;  4ZN1 A;  1YCY A;  5IN1 A;  3OSV A;  1Q86 U;  2MF2 A;  2CKK A;  2KY9 A;  2MMP A;  2RB6 A;  2Y90 A;  1V29 B;  4F7U F;  2E10 A;  5LJ3 f;  1YIT A;  3RKY A;  4ZN3 A;  1M8V A;  1W4S A;  1ZHI A;  2K5I A;  4JDS A;  4HA8 A;  1GXI E;  3VU3 C;  1G3T A;  4BY6 B;  5LJ5 f;  1K8A U;  1VQL T;  1JB0 E;  1OZ3 A;  3PIO A;  3SWN C;  2V8K A;  4JRP A;  4PL6 A;  3X24 B;  4A4G A;  1FWZ A;  3JRZ A;  5IAY A;  2VUB A;  2RJF A;  4M77 A;  3CCL T;  2XDP A;  5GAN j;  3OYC A;  2CYZ B;  4A53 A;  3CMA A;  5KE3 A;  1KC8 C;  4QVC A;  3CCS T;  1VQ4 A;  3ASK A;  2JUF A;  3QII A;  1YIJ A;  1M1K U;  1UGQ B;  1Y96 B;  5LJ3 d;  2EYQ A;  4M78 A;  4BD3 A;  4C92 E;  5GAN 4;  5CK9 A;  2PU9 B;  1YJ9 T;  1VQN T;  3L2W A;  4OP0 A;  3M9Q A;  1NJI U;  1H64 1;  4B9W A;  1N27 A;  2DD5 A;  5LJ5 d;  2K5L A;  5GAM f;  3OS0 A;  1VQ6 T;  3UT1 A;  1Q7Y U;  1D3B A;  2M1H A;  4M77 G;  4X9D A;  4BB7 A;  2P4T A;  4DOW A;  4ZGJ B;  4M7A F;  3GPL A;  3G71 T;  1VQK T;  3UPU A;  4XTX A;  5CCA A;  1VQL A;  3OS5 A;  4NS5 A;  4LDX A;  3M58 A;  3QUI A;  2XU8 A;  3JCM f;  4M75 B;  3BDU A;  4M78 G;  4M7D E;  2D9T A;  2RI5 A;  3QXE B;  1VQ5 T;  4II1 A;  4DA4 A;  3CD6 T;  4M7A D;  3CCE T;  2EJF A;  3MP8 A;  3CCS A;  4A4F A;  2QQB A;  1M1G A;  3DLL A;  2DZC A;  2O4X A;  4KUL A;  5C0M A;  5GAM d;  3I55 T;  3ZBD A;  3ZEH A;  2RHI A;  4MZP A;  5CKH A;  3M53 A;  1M90 C;  1VQN A;  3X26 B;  2MI6 A;  2VXF A;  2PVG B;  1VIE A;  4PJO D;  2XD0 A;  3G4S T;  2DJZ A;  3L2Q A;  2QXF A;  4JRI A;  3GNF B;  4LDU A;  4C5H A;  5M9O A;  2QA4 T;  3CBO A;  1VQ6 A;  4E7K A;  1BIB A;  3JCM X;  2L5Q A;  2E5Q A;  3JCM d;  3JSC A;  2M16 A;  5LJ3 e;  1YHQ T;  3RKW A;  2VC8 A;  4IUV A;  5CKD A;  3G71 A;  4FT2 A;  3RUX A;  2DXC A;  1VQK A;  2RA2 A;  3CCR T;  5GMK j;  2PUO B;  2CZ6 B;  4M7A C;  3URG A;  3FLG A;  5LJ5 e;  1VQ8 T;  2MAM A;  1KQ1 A;  2F5K A;  2D6F A;  4C0D C;  2LQ8 A;  4FSX A;  4LDY A;  4JUV A;  3OYE A;  3HP9 A;  2GF7 A;  3MEU A;  3FIF A;  1K73 U;  2HD0 A;  1VQ5 A;  3CCE A;  2DAQ A;  3CD6 A;  4PJO B;  1QP3 A;  4A4E A;  5FU6 C;  4ZTJ A;  4J6X A;  3I55 A;  3GLX A;  1TH7 A;  2H3J A;  3HPW A;  3M4G A;  3QSU A;  4PJO C;  3OYJ A;  4L59 A;  4XTZ A;  5C6S A;  4JS4 A;  2E1H A;  3JCM J;  3CPF A;  2Y4Y A;  1P92 A;  3G4S A;  2C06 A;  2L89 A;  4OMF B;  3O8V A;  3R6O A;  1Y96 A;  3E9G A;  5LL6 S;  2QA4 A;  2BIV A;  1Q81 U;  1KHI A;  1XTD A;  5GAM e;  2JOY A;  5GAO n;  2XHC A;  4EPC A;  1YHQ A;  3C94 A;  4C8Q D;  2HBP A;  4N0A A;  3JB9 I;  4B9X A;  1YI2 T;  3LWI A;  1W2B A;  3G6E T;  3OYM A;  3QO3 A;  2KAF A;  5LJ5 h;  3L2U A;  1WPY A;  3JCM e;  3ME9 A;  4MML A;  3TCJ A;  4BAC A;  3DB3 A;  2EQM A;  3ER0 A;  2ZGW A;  2FYK A;  4M75 A;  2E12 A;  3OB9 A;  3QBY A;  2RHX A;  4EMK B;  2DXT A;  3CC7 A;  3A8H B;  4EMK C;  1YIT T;  2IG0 A;  3AHU A;  2AHJ B;  2YLC A;  3DB4 A;  4ZGD B;  3EAE A;  5J26 A;  4XQ3 A;  5D6W A;  1O75 A;  4C8Q B;  3OYL A;  1WGS A;  4C5G A;  3BW1 A;  4C92 F;  1N8R U;  2LNV A;  4M77 E;  4MDW A;  1XNI A;  2O4X B;  3JB9 F;  3PMT A;  4OB2 B;  3INZ A;  1KQ2 A;  2QTX A;  3CMA T;  2PVO B;  4M75 G;  1YI2 A;  2ZPE B;  2A3L A;  3G6E A;  3OMG A;  3TU4 K;  1K9M U;  4BI3 A;  2CZ1 B;  2DZ9 A;  2V8J A;  4M78 E;  1R8O B;  4C5I A;  2FVU A;  2RK2 A;  4C0Z A;  1X6O A;  3A8L B;  4FIB A;  3PGG A;  3JCM h;  2R5A A;  2LC4 A;  5GMK i;  4LD9 K;  5LJ3 j;  4WF2 A;  4M7D F;  2LDM A;  4CRI A;  4PJO A;  3RER A;  1VQO T;  2A7Y A;  2RHU A;  2QI2 A;  5DY9 A;  3GOX A;  3V8K A;  5LJ5 j;  3JCM c;  2L8D A;  1Q82 C;  2ZZD A;  4LDV A;  4BDY A;  4FM4 B;  1IZ6 A;  3SWN B;  3HFN A;  3WVD B;  4ZGE B;  5CVI A;  3ZFJ A;  2CGH A;  3NTI A;  5IT9 E;  3CBP A;  1MGQ A;  2JTM A;  2XI9 A;  4QW2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...