2E4HA

Solution structure of cytoskeletal protein in complex with tubulin tail
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Restin
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e4hA00
2HL5C 4B6MA 1WHGA 3TQ7P 2M02A 1WHLA 2QK0A 2CP2A 2CP3A 2HL3A 2CP0A 1TXQA 2CP6A 1WHHA 2COYA 2MPXC 3E2UA 1WHKA 2Z0WA 2E4HA 2HKQB 1WHJA 2HQHA 1WHMA 1TOVA 2CP5A 2E3IA 3RDVA 2CP7A 2COZA 1LPLA 2COWA 2HKNA 1IXDA 2E3HA
chains in the Genus database with same CATH superfamily
4N0AC 1P92A 1VUBA 1UFFA 4R55A 1SRMA 2EKHA 3VUBA 3JCMe 1VQPT 3I56Q 2RI5A 2GQIA 3FB9A 2WSEE 5GANe 1S72A 3M55A 3AT1B 3JCMd 2EJ9A 1WJSA 2XICA 1D1BA 4B9XA 5FU7B 1G83A 2J6OA 3JCMV 2RQVA 4J6YA 4B6MA 4AFQC 4DA4A 2X3WD 1WIEA 5GJWB 1OZ2A 2RD1A 2KVQG 1KG1A 4E47A 4XTYA 3VS5A 1KC8U 5J3BA 1Y07A 2W0ZA 1YITQ 3F70A 3REAB 3RKYA 1RAFB 2K5FA 4KGXB 4BACA 1NLOC 5LJ3j 1K1ZA 2AKKA 1RLPC 3NPFA 4AT1B 4F17A 3REBB 3CCRA 2FPEA 2ZCFB 4LUDA 4HXJA 1NPPA 4RTVA 2QQBA 4Q5WA 2LZ6B 4GLKA 5FWBA 1PKTA 2VB6A 1Q86U 5D6YA 5FW9A 1M1KU 2AHJB 3C95A 1YN8A 1KQSA 1VYUA 4ESRA 4OMNA 4ELYC 3CC4Q 2E5QA 1N6AA 2FB7A 2MYSA 3QUIA 4OMOA 5DLQE 2E41A 3UA6A 5LJ3f 3M59A 3J80E 3S6WA 5CCAA 1BK2A 1Q7YR 1DJ7B 1G3YA 3OYFA 2QQRA 4KH0B 4KUIA 2YHTA 3PE0A 1ZA2B 4KULA 1KQ2A 2VGNA 2HBWA 5I21A 5J26A 1RADB 4JJCA 3CCUQ 2CYZB 4LDWA 2YUPA 1WHLA 2EYYA 1M3AA 2ZZDA 1QKXA 3GBQA 1CKBA 2L89A 4BI4A 3JCMc 4IKFA 4A4HA 4OMQA 3JB9F 5GANg 3M0UA 3A8HB 5HY6A 2KT8A 3I55A 1ZA1B 4UC4A 2EWNA 3INZA 1SPKA 1YP5A 2SRCA 2PTKA 1M3BA 1VQ8Q 1FYNA 2CP6A 2EIFA 3MP1A 1VQOT 4FYWB 4M77A 2M51A 1WJQA 3SHWA 3CC7T 4BY6C 2F1LA 4ZGDB 3L2RA 2RM4A 4XU3A 2X4YA 1VQ7T 2DK3A 3OS1A 2O88A 4FYYB 3SB2A 4RG2A 1M1FA 1RI9A 2DL7A 4JJDA 5GMKl 5GAOl 4HVUA 1C1AA 3CXCS 1Y96B 2ZPFB 3G71T 4F16A 1VQ7A 4TVRA 4PJLA 4RTZA 5IH2A 4BDYA 2M9UA 2RHYA 3HP9A 1PWTA 2YUOA 4XAXB 3AHUA 3EGXA 1W6XA 5GAMd 1PRMC 3HRTA 5I11A 3RESA 2JUFA 4BDZA 1VQ9Q 3MHXA 1EIFA 5GAMe 1M2OA 2EYZA 1I81A 2F2WA 3VV0A 2L3SA 2HQHA 3RKWA 2OTJA 4M7AB 2QQ9A 1WZOA 3I35A 2GFAA 1NJIR 1T3SA 2B86A 3CC4T 1AWOA 2L3QA 1Y0MA 1TXQA 5M9OA 4R0KA 3DLMA 2QGGA 2HKNA 4XU2A 2E3HA 2J6KA 1TUDA 5GAMh 3G1JA 5GAOp 2DX1A 1Q81R 3QBYA 4C8QG 4LXCA 2K3XA 2O4XA 1SHFA 2DYIA 3P8BB 5AT1B 4XU1A 3OQ5A 1KQ1A 3OYGA 2EBPA 3U23A 2ED1A 4C8QF 1GRIA 1M2VA 5GMKm 1VQ9A 5A0LA 4JJBA 3M4GA 4Y91A 4NL2A 1M90R 1UGRB 5GAN5 2LQNA 2SEMA 2OAUA 2JOYA 2R5MA 1K8AU 1ZSGA 2RB6A 5KCOA 4M75B 2CH4A 2KRMA 2RI2A 5GAOq 2EJGA 2PVDB 3HHTB 5KCHA 5KYWA 1ZSZA 2A08A 2JS0A 3SEMA 2D1XA 4M78E 1KSWA 4ZTFA 1R0CB 3OYNA 5AYFA 2QA4Q 4F7UA 2CP2A 4CC2A 4C0DB 1AWXA 3OMGA 5CQYA 4KBMB 5LJ3d 5HK0A 3QWXX 2KROA 2GBQA 4M78C 1MMDA 2OJ2A 2DVEA 5GAMg 4XTXA 3CCQA 4AG2C 4J9CA 2BE7D 3VU3C 4C8QD 1V29B 1O75A 2F5TX 3RKXA 1MMGA 1D0ZA 3PVQA 1RL2A 3MKDA 1E6GA 2CKKA 2K3BA 3C0CA 2HAXA 1PSFA 2CUDA 3H0IA 3CXCA 3I5SA 4M78D 3G4ST 3UATA 1YWOA 4NL3A 4RTTA 1U8RA 2RK2A 2NWMA 1VQLA 4QQ6A 1ARKA 3H8ZA 1VYVA 2RJDA 1B7TA 3EGDB 2DNUA 1N5ZA 1UUEA 2CREA 1X27A 3URGA 1JBMA 2HCKA 2QK0A 3VRYA 2Y4XA 2K57A 4IIOA 3V7CA 1WHHA 2P84A 2Y4YA 5LJ3h 2X4XA 2BUDA 1TWBA 1Y71A 1FXXA 3VUZA 2CDTA 2YRCA 4PJOG 1YIJT 3MEVA 1WI7A 3L2VA 1LOJA 5GAN8 4ZGJB 2DFUA 3FRNA 2ZPIB 4MDWA 4M7DD 2ZPBB 1FX7A 3CCJA 5ECAA 2OTLQ 4ME7A 2C0OA 2H3EB 2GF7A 4GBQA 4J9HA 1WHJA 2KR3A 1KQSP 2E6NA 3GF5A 2ENMA 4XTZA 5DLOA 4M7DB 1TUCA 4M4ZA 4OMPA 2LRQA 2VASA 1X6GA 3RMSA 1VQKT 4XK8E 4M77D 4WCIA 1TH7A 3G4SQ 2ECZA 1VQOA 1OOTA 2JMAA 4DOWA 2QDYB 1JJ2S 2IVWA 1K73C 3ZFJA 2V1QA 3A8LB 4DBQA 1AEYA 3QIIA 3VS2A 1H3ZA 1OPLA 5IAYA 1VQ8T 2FHDA 2VXEA 2A0FB 2NUTB 4IIMA 5DY9A 3JCMJ 2K9GA 2DL5A 4KRTA 1KD1R 4JZ3A 2P4RA 2VV5A 1TS9A 3LW5E 1OV3A 2K79A 1MUZA 1M30A 1YITT 2RJCA 3MPUB 2FVUA 1KD1U 2LCCA 2BIVA 2DYBA 1MV3A 3NHNA 1W1FA 2CZ0B 2EGEA 4RTXA 1BB9A 5GMKe 1UJYA 3H0FA 4PFZA 1H8KA 3QDFA 1Y7XA 3JB9J 2D6FA 1RLQC 3NTIA 3RNJA 3LH5A 2O2OA 1VA7A 2BZ8A 1VYTA 2FZKB 1YI2A 2J6FA 3PIOA 3OB9A 4JJNK 2RH2A 1R77A 3CPFA 4A54A 2JXBA 1WX6A 3OBYA 1Q82U 2ED0A 4QVDA 1IGQA 3L2WA 3NMZC 1H92A 4IUPA 1ABOA 1BU1A 3BDUA 5CKHA 5IXFA 3PIPA 3DKMA 3EHRA 2DAQA 2EJFA 1NEBA 2RI3A 1AWJA 4PK4A 3SWNC 2VC8A 1Q86C 1EX4A 4JRQA 3J7AF 4R56A 3MEUA 4OB2B 1WJRA 2DPPB 4J5YA 1BI0A 2HSPA 5LJ5j 3OYCA 3GP8A 2DIQA 2XDDA 1GXIE 1MMNA 3CMEA 3CBOA 1T3LA 2QG9B 7AT1B 4F7UG 2CT4A 4J6XA 5GAN7 4YTLA 1Q7YC 2COZA 3UPUA 1HD3A 1K73R 4E7JA 4Y92A 4VUBA 1VQ5A 1I5OB 1Z9QA 2DVJA 4P5NA 2C0TA 1KK7A 3CCSQ 2BE9B 4C0FA 2EKOA 1I5LA 3EFRA 1KC8C 3QSUA 2NLUA 1OYXA 4IUVA 1U06A 1OQKA 3CD6T 3CCUT 1ABQA 3QDRB 3GLXA 2JT4A 4E7IA 1ZHIA 4D6WA 3IQLA 4FSSA 3VYGA 3CPWS 2QEXT 1PM3A 4KGZB 1VIFA 4C92C 1HJDA 3QYGB 4PJOD 4PLIA 1OU9A 3QZ5B 2LT1A 2OTLT 2B8AA 1UE9A 3SDZA 4M78G 4C92E 2QEXQ 4HT9A 1IO6A 1VQKQ 4O6JA 4GLMA 1JO8A 1JJ2A 5EC7A 3FIFA 1H3HA 1OI1A 2JW4A 1XNIA 4LDYA 2EQJA 4FU6A 4CC7A 2OX7A 3H9NA 1QCFA 5C0MA 1LCKA 4BB7A 3S3NA 1WGSA 1PHTA 3JAME 2GNCA 3PNWC 3PT9A 1XJWB 2KRNA 5IHIA 3OSVA 1C6VX 2QQAA 5HKCA 1PCXA 4M7DA 2DXCA 2A28A 2RJEA 1U1TA 1MGQA 4RG8A 1M8MA 2XHCA 1IHWA 4OGCA 2CP5A 2H8HA 3MO8A 2M1HA 4LE9A 3CCEQ 1KIKA 2L3PA 5FWCA 3EGUA 8ATCB 1BI3A 2M02A 3QYHB 2VKNA 4M78F 3RBBB 1KHIA 1MNDA 4C92A 3L1AA 2K2MA 4C8QC 3CCLQ 5FU6B 4A4GA 2DEUA 4DEXA 5C6SA 1M4ZA 1QW1A 2LQ8A 1WNLA 2O9VA 2MWOA 1ZX6A 2V1RA 1ZLMA 3GPLA 2JTEA 4PKCC 1YWPA 1ZUUA 4OB3B 4M77G 3CC7Q 3GNGA 4IUQA 4A4KA 1KC8R 5D7UA 1K4US 1RACB 3EH1A 2IG0A 2JTMA 2JS2A 1Q81U 2P4TA 1S1NA 1QMCA 3I56T 3HRUA 1YI2Q 3MP8A 1WQ7A 3CCLA 4LD9K 3BE3A 2E4HA 3VS7A 4M7AG 4RKUE 1M1KC 1QKWA 2CUBA 4PJOB 1GL5A 4BE2A 6AT1B 3CCVQ 1VQMQ 2R5AA 1NZ9A 1BCOA 3CEYA 4FT2A 2KQWA 3WVDB 3CPWP 2CS7A 2OTJQ 2HQXA 2O9SA 2LP5A 3M53A 3X26B 1YHQT 3CC2Q 2ABLA 2QTXA 3OS5A 3QXEB 3LWHA 4GY5A 4OP0A 3CBMA 1M9SA 2G6FX 1G5VA 4E7ZA 3CCMQ 4M77C 1KJWA 3HPWA 2E5KA 3ZEHA 3C12A 2C0IA 1GCPA 2H3JA 2X35A 1W70A 5GAN3 1ZSZC 5GAN4 1D09B 2HBPA 4E6RA 5LJ5g 1RABB 1WFWA 3EGDA 5IXBA 4X9CA 1W2BA 5GAOr 4M75A 2JN0A 4DBHA 2K5IA 4PJNA 3H41A 3OYKA 1CKAA 2BZXA 1M1GA 1UHFA 4M78A 1YJ9Q 2EYWA 1VQ6Q 2YT6A 2ZPGB 4FW1A 1OZ3A 1D0XA 2DLPA 1M8VA 3CCUA 2JM8A 1M90U 4L5GA 2RHZA 2M0YA 2EPDA 2G3RA 2VWFA 1OPKA 2CGHA 5LJ5e 2QQSA 3ME9A 2RA2A 1U3OA 2MK5A 4RTYA 1VQ4T 4OGEA 2XG8D 2OTLA 4AG1C 4RCBA 4RTUA 4CC3A 3OYLA 5LJ5d 5CKEA 1X43A 1WLPB 1UJ0A 2CP3A 3L2QA 2HZYA 1VQ6A 3G71Q 5KH6A 1WQWA 3X25B 4NOYA 3CD6Q 2BKDN 3L2UA 5CVIA 1TOVA 3CQTA 3E9FA 2YRDA 2O01E 3ER0A 5EG2A 1G8XA 2XI9A 2A36A 5CKDA 1S72Q 2KBTA 2P0PA 2OAWA 4LD6A 2ZAEA 4JPBW 1QVGA 5GANj 4L59A 1YJWQ 2HL3A 4HCCA 2XMFA 1IZ6A 1JB0E 2LCSA 3PTAA 3RMQA 2ZGWA 1MNEA 3JSCA 3PVLA 1MV0B 1QWEA 2QAZA 3O5ZA 4II1A 3UDCA 4DOVA 2EYXA 4EMKC 4M7DG 2E6ZA 3OYAA 3KXTA 2MIOA 1X6BA 3FLGA 1OX8A 3ZL7C 2HEQA 2HQEA 1VQLT 2KXDA 3QJYA 2FRYA 1MMAA 1NEGA 2IPOB 3J81E 1QVFA 2GTJA 4PJOE 2QASA 1AD5A 3D7SB 2V8IA 3P8HA 1NYFA 2YRVA 1HXDA 3V8JA 1X01A 2ESWA 3L2ZA 4HA8A 4X9DA 3X20B 4RUGA 1PC0A 5GANf 4JS4A 5FU7C 3E19A 4JS5A 3SFMA 3EAEA 2DA9A 3M0QA 1YNZA 2MCNA 3UA7A 2VUBA 4JUVA 4OB1B 2DL3A 3HKSA 5L8RE 1LNXA 2ZPHB 2ATCB 5CQXA 4KT0E 3WVEB 3SWNA 4J8OA 2DZCA 5GMKh 1BI1A 3OBWA 4PFPA 2KI7A 4EMKA 2W10A 1E7OA 3QHSA 5KYWB 1G3SA 3OYYA 5KYXB 5KYUA 2LQKA 3JCMQ 1NPRA 4OMLA 3OYJA 1WXBA 4RMOA 1PSEA 3O8VA 3JB9G 4A4FA 4M7AF 2CSIA 3RERA 2X3XD 1YCYA 1UGVA 2AIRB 2FO0A 3MEAA 1WDXA 4CRIA 2QI2A 2VXFA 4ANJA 3VS6A 3PMIA 2LMJA 2E65A 4PFOA 3M54A 2EQIA 2LQWA 2RQRA 4M75G 1ACMB 3RR6A 1NM7A 2HKQB 2DBKA 2KYMA 5GAOn 2PUKB 3MP6A 3LYIA 1OX9A 3L42A 3RDVA 3I55Q 2KMTA 2RQWA 4OB0B 3E1SA 1LJOA 4N4IA 5LJ3e 1SKUB 1YHQQ 1K9MU 2NUZA 4KGVB 3V7RA 5IHKA 1Q86R 4J9BA 5FLXE 3QWYA 2M16A 3A8GB 4FT4A 2AZVA 4AFZC 2KRSA 2JJ9A 3A1PA 3M0TA 1K0SA 1FMKA 5IHNA 4ZN3A 3JCMg 2K7AA 1Q82R 1AZEA 3A5ZB 1QVPA 3BFMA 2DF6A 2V8KA 2PNIA 5LJ5h 3H6ZA 1YHQA 1QP2A 4LDXA 4ORZA 2DZ9A 3GNFB 4Z8AA 2COYA 3CCSA 2E1HA 4BY6B 4QQDA 3OYBA 1D1AA 1N9SA 2DRMA 2O4XB 1F1BB 1PG5B 2COWA 4N4GA 1IXDA 5IN1A 2PZ1A 3M9QA 3CMEQ 4EPCA 3JCMb 4ZN1A 4WF2A 4PJOF 1Q81C 1I07A 2AK5A 1M2VB 4JDSA 3TEEA 1IREB 3E9GA 4C8QE 1BI2A 1WPYA 2A3LA 1Q95G 4OMMA 2D9TA 1GBRA 2EQKA 4BUGA 3G7ZA 3UT1A 4M7AA 5J39A 2XDBA 3BW1A 1AT1B 4QVCA 3FEOA 4J83A 3EFOB 2KK4A 2DILA 3CCRT 3EG9B 4C5GA 5A2QE 4PNOA 5LJ5f 4FSXA 4N4HA 1WA7A 4ELZC 4HCZA 1ZUYA 1VQ8A 4J9EA 1N8RR 2FPFA 4M7AC 1VQLQ 1EFNA 1N9RA 2RNAA 1Z9ZA 3OY9A 1U1SA 5KYYA 1K9MR 3CC2A 4XU0A 5GANd 1W2BP 4JRKA 2RQTA 3VS1A 2GGRA 2YLCA 4MMKA 2DBMA 3Q1JA 1VQKA 5I22A 1X2QA 4JZ4A 5A0GA 4C92F 3MCAB 4F7UF 2ROTA 1S72T 3DB4A 1GBQA 4C8QA 2CP7A 1QCOA 5GMKi 1NJIU 1C0MA 3TQ7P 2LX9A 3LH0A 1B34B 2DL4A 2LNHB 1AHJB 4M77E 2LTOA 4LDVA 3NTHA 1I8FA 5HCKA 4E2FB 2PU9B 3CCQQ 2CZ1B 3CCJQ 2RHXA 3META 4FCYA 2VVKA 3OYMA 3CPWA 2JMCA 3QPHA 3C94A 1SSHA 4BD3A 5A0DA 4ZNXA 1HK9A 3OYHA 2JVVA 1K9MC 5FRNA 2DXBA 2L8DA 2QYZA 2R57A 4EMHA 3EFOA 2QA4T 4Z89A 2JTFA 4C0GA 3EG3A 3EG9A 4J7IA 4M75C 3CCEA 2DXUA 1W4SA 3NGPA 2EGAA 4FM4B 3TSWA 4QQGA 2FRWA 2K2VA 1YJNQ 1IHVA 2QTVA 3QZ9B 1QCNA 2XDPA 1M5Q1 3M0SA 5GAN2 2EGCA 3A98A 2KNBB 2D8HA 1YJ9A 4N0AA 4J9IA 2L5QA 3DB3A 5CKBA 1EZZB 1ZBXA 2WSFE 2RF0A 2A37A 4QW2A 1D3BB 4IUUA 4C0DC 2CP0A 1GCQC 2NYSA 3X28B 3CXCP 4M7AD 2P0QA 1VQ5T 2KAFA 3TVTA 2QDLA 4M78B 3PMTA 3M0RA 3T9NA 4M7AE 1N8RU 2DTOA 4LDUA 2DJZA 3QKJA 1K76A 3HL8A 2EAYA 3CMAA 1XTDA 3KBGA 2D8JA 2RN8A 2MF2A 4HCKA 1IB8A 1FMWA 3G71A 2LJ3A 1RAHB 1GFDA 2WACA 1UGSB 3CD6A 1O9SA 1VQ4Q 3VRZA 2EVRA 3FC3A 3TCJA 4EDUA 4CI0C 3EHQA 3HTRA 1AWWA 1RAGB 3CMET 3M0PA 1JEGA 3QG1A 1Q82C 2DEQA 1SRLA 2QGFB 4HKEA 3BY7A 3OS0A 1OU8A 1QVGS 4QT7A 2E70A 5GJVB 3CCMA 3JCMW 1AVZC 3JB9D 1FWZA 4F7UB 1KFZA 2DJQA 3I56A 3TU4K 3MJXA 3JCMP 1VQ9T 5GAOm 3UWNA 1B34A 1ZBJA 4M75E 1PD0A 2WSCE 2R58A 4BE0A 1J3TA 2E12A 5CKFA 3GIBA 1JRIA 4FYVB 2X9HA 4F04B 1K8AC 1M3CA 3V7SA 4M7DC 1GCQA 2DTIA 2FYKA 1BCMA 1VQNQ 1PNJA 1JQQA 3CCMT 1UGPB 2XK0A 2OI3A 4E7SA 1G3WA 4X1VA 2DE0X 2F2VA 4FYXB 9ATCB 3VS4A 2DD5A 1QWFA 1IGUA 3M58A 4JRPA 4QVZA 3ASKA 4DBRA 5GANh 4ATOA 4C5HA 3M5AA 4J9GA 1D3BA 2CT3A 1K9AA 1QP3A 4PLLA 4ZTJA 3OA6A 2XKOC 1Q7YU 4D8DA 2DIGA 2MWPA 1WHMA 2YXYA 2XD0A 3JCMf 2M0OA 1RAAB 1KQSS 2HL5C 3VJPA 3S3OA 2NUTA 1BIBA 2BTTA 3HRSA 1PRLC 1Y57A 2LDMA 1I4K1 3EH2A 1JU5C 4J9DA 3R6NA 4J9FA 3GOXA 3OMCA 4RTWA 3HFNA 2LJ1A 1WHKA 1FMVA 2PUOB 2EYQA 3BDLA 4EIKA 5HK3A 1LVKA 4M75D 2VGMA 4IUTA 4DEYA 2MAMA 2I2LA 4B9WA 4XTUA 4Z88A 1I0CA 2FZCB 1YJNT 3M56A 1TSFA 1ZQ1A 3N5BB 1YJNA 4XTVA 4PJJA 4OF1A 3JCMX 2K6DA 3CCVA 1R8OB 1VQMA 2GQVA 5CAIA 1CSKA 2F5KA 4HCBA 1B07A 2K5LA 3ULRB 1N27A 3M57A 4MDXA 1HSQA 1NLPC 1OULA 1YCSB 2AT1B 3CCLT 3HFOA 1QVFS 3VKIA 2EW3A 1VQ5Q 1R0BG 4AMCA 4QKUA 3OYIA 2J06A 3SWNB 4A53A 1KD1C 2DXTA 1IRXA 4PL6A 3V8LA 1YFNA 1NJIC 2KSSA 1T0HA 1AZGB 3LLRA 4LUEA 3OW2S 3CC2T 2KDSA 1N8RC 2DRKA 5GMKj 4HVWA 3NFCA 1JJ2P 1QLYA 4M7DF 4E7HA 2KY9A 4RCCA 1X75C 3V8KA 2PQWA 5I2SA 1TU0B 2CZ6B 4DBFA 2F69A 2FG0A 3G4SA 2A7YA 2KGTA 1VQOQ 4ZGEB 1G2BA 1H641 4E7LA 1UDLA 1RAEB 1UTIA 4C92D 1YIJQ 3R6OA 4J6WA 5D6WA 4C0ZA 2X51A 1VIEA 2DKGA 1U5SA 3P8DA 1K8AR 1VQPQ 3TREA 1GFCA 5FRMA 3PGGA 4C92B 1VQ7Q 4J7FA 8AT1B 3CCST 3QO3A 4CC4B 4AFSC 3ZBDA 1V76A 3E2UA 2LC4A 2YUQA 2MI6A 2NUPB 2MOXA 2PVGB 4K11A 4D8KA 2XU8A 1RAIB 2HSEB 2X4JA 3JB9I 4F14A 1UG1A 4KUDK 1YITA 3VS3A 1WXTA 4V2SA 3RUXA 2CZ7B 4XQ3A 3X24B 4F7UE 4FIBA 3VS0A 1KHCA 2V26A 5IT9E 1VQ6T 2HD0A 3CCRQ 1PD1A 1UECA 4NS5A 1BKBA 2FL7A 5KYNA 3EFSA 2QEXA 3CMAQ 5LJ3g 3WXMB 5KE2A 1VOMA 1VQNA 2HMAA 5CR2A 2GTOA 1TG0A 1K73U 3EG2A 1HYOA 1VQ4A 1XQHA 4XTWA 1TTHB 4LN2A 3JRZA 1VQNT 1NBEB 4MZPA 4X34A 2J7IA 4JLIA 3FJ5A 1RUWA 1M1KR 4C8QB 2DMOA 5FU6C 2DERA 3OW2P 3EGXB 3NTKA 2C06A 2MPXC 5L23A 3FJPA 4C92G 1WXUA 2L0AA 3JCMh 1NE8A 3I55T 2QXFA 5KYUB 2PVOB 5CK9A 1BYMA 3KUFA 3CCJT 2JM9A 2RJFA 3I5RA 4Y28E 5LL6S 1YJ9T 2JNGA 1D0YA 2KXCA 1YIJA 3TSZA 1M90C 4JLGA 4HT8A 3C4SA 1YBYA 3SD4A 2LT4A 3CBPA 1X2KA 2E10A 2YUNA 1XOVA 4PJOC 2GFUA 3G6ET 4WTOB 2RMOA 1OEBA 1SSFA 4JRIA 2QA4A 4A63B 4AFUC 3H0HA 4BI3A 3EG0A 3OS2A 2D0NA 3MEWA 3CC7A 2YDLA 3DLLA 1W2BS 1QQJA 3EG1A 4C5IA 1YI2T 3LGLA 4EMGA 3CCQT 2FEIA 1UB4A 2E64A 2JZ2A 2KT1A 4DQ2A 2RPNA 2L3RA 1LPLA 4M77B 5D6XA 2KYBA 2P0KA 1NG2A 3OYDA 1ZSZB 2D0QB 1G3TA 4C5EA 1SHGA 2AZSA 3OSSC 3PFSA 1MHNA 1X6OA 2EFIA 1E6HA 2LNVA 4O5VA 1T0JA 5DM7R 3JV3A 3VYHB 3S3MA 4OMFB 1WYXA 2YLBA 2XIDA 1BBZA 4PJMA 2O31A 3M4YA 2RHUA 3QJ6A 1UHCA 2GCXA 3JB9H 4M7DE 4PJOA 3HSBA 1BIAA 3LGFA 2RO0A 2RQUA 2BZYA 2DL8A 4Z02A 1A0NB 2LJ0A 3OYEA 4FW2A 3UF4A 1PKSA 2MMPA 2RK1A 1NYGA 2J05A 3THKA 3CCVT 2X4WA 1VQMT 3A8OB 1TUGB 2DTHA 2KEAA 2AKLA 3I9QA 2DETA 2DO3A 1YJWA 2KE9A 1M27C 2HNIA 1Y96A 5GAMj 3FDRA 2V8JA 3G6EQ 1YJWT 4OVAA 2K4YA 1VQPA 4LNPA 4MZTA 1QVFP 5GAN6 1SG5A 2L2PA 1JXOA 2E3IA 2CH4W 2LCLA 2DM1A 4M75F 3LX7A 2DD4A 2EQMA 1WHGA 2K3YA 1UGQB 2FZGB 5I2MA 2YSQA 3CMAT 4FL6A 3CC4A 1I1JA 1SEMA 1AOJA 4HVVA 4IURA 2LX7A 4BI8B 3KFVA 5CIUA 2CSQA 2RHIA 5KYYB 2NUPA 2EQUA 4E7KA 5KYXA 3LWIA 2ZPEB 4KH1B 1V1CA 3CCET 4BE1A 1SF9A 1D1CA 1X69A 4EMKB 2YWWA 5KE3A 4MMLA 3A8MB 3RIRA 1K0XA 2Y90A 1ZUKA 1QVGP 2FPDA 2OTJT 1B3QA 1UEBA 4MZMA 3OW2A 2Z0WA 5FROA 2LVMA 1JXMA 2ROLA 2I0NA 1RI0A 2F2XA 2HDAA 5CO7A 5GAMf 2IIMA 2VYTA 3G6EA 4L6V5 4M77F 4A4EA
chains in the Genus database with same CATH topology
2HL5C 4B6MA 1WHGA 3TQ7P 2M02A 1WHLA 2QK0A 2CP2A 2CP3A 2HL3A 2CP0A 1TXQA 2CP6A 1WHHA 2COYA 2MPXC 3E2UA 1WHKA 2Z0WA 2E4HA 2HKQB 1WHJA 2HQHA 1WHMA 1TOVA 2CP5A 2E3IA 3RDVA 2CP7A 2COZA 1LPLA 2COWA 2HKNA 1IXDA 2E3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HL5 C;  4B6M A;  1WHG A;  3TQ7 P;  2M02 A;  1WHL A;  2QK0 A;  2CP2 A;  2CP3 A;  2HL3 A;  2CP0 A;  1TXQ A;  2CP6 A;  1WHH A;  2COY A;  2MPX C;  3E2U A;  1WHK A;  2Z0W A;  2E4H A;  2HKQ B;  1WHJ A;  2HQH A;  1WHM A;  1TOV A;  2CP5 A;  2E3I A;  3RDV A;  2CP7 A;  2COZ A;  1LPL A;  2COW A;  2HKN A;  1IXD A;  2E3H A; 
#chains in the Genus database with same CATH topology
 4N0A C;  1P92 A;  1VUB A;  1UFF A;  4R55 A;  1SRM A;  2EKH A;  3VUB A;  3JCM e;  1VQP T;  3I56 Q;  2RI5 A;  2GQI A;  3FB9 A;  2WSE E;  5GAN e;  1S72 A;  3M55 A;  3AT1 B;  3JCM d;  2EJ9 A;  1WJS A;  2XIC A;  1D1B A;  4B9X A;  5FU7 B;  1G83 A;  2J6O A;  3JCM V;  2RQV A;  4J6Y A;  4B6M A;  4AFQ C;  4DA4 A;  2X3W D;  1WIE A;  5GJW B;  1OZ2 A;  2RD1 A;  2KVQ G;  1KG1 A;  4E47 A;  4XTY A;  3VS5 A;  1KC8 U;  5J3B A;  1Y07 A;  2W0Z A;  1YIT Q;  3F70 A;  3REA B;  3RKY A;  1RAF B;  2K5F A;  4KGX B;  4BAC A;  1NLO C;  5LJ3 j;  1K1Z A;  2AKK A;  1RLP C;  3NPF A;  4AT1 B;  4F17 A;  3REB B;  3CCR A;  2FPE A;  2ZCF B;  4LUD A;  4HXJ A;  1NPP A;  4RTV A;  2QQB A;  4Q5W A;  2LZ6 B;  4GLK A;  5FWB A;  1PKT A;  2VB6 A;  1Q86 U;  5D6Y A;  5FW9 A;  1M1K U;  2AHJ B;  3C95 A;  1YN8 A;  1KQS A;  1VYU A;  4ESR A;  4OMN A;  4ELY C;  3CC4 Q;  2E5Q A;  1N6A A;  2FB7 A;  2MYS A;  3QUI A;  4OMO A;  5DLQ E;  2E41 A;  3UA6 A;  5LJ3 f;  3M59 A;  3J80 E;  3S6W A;  5CCA A;  1BK2 A;  1Q7Y R;  1DJ7 B;  1G3Y A;  3OYF A;  2QQR A;  4KH0 B;  4KUI A;  2YHT A;  3PE0 A;  1ZA2 B;  4KUL A;  1KQ2 A;  2VGN A;  2HBW A;  5I21 A;  5J26 A;  1RAD B;  4JJC A;  3CCU Q;  2CYZ B;  4LDW A;  2YUP A;  1WHL A;  2EYY A;  1M3A A;  2ZZD A;  1QKX A;  3GBQ A;  1CKB A;  2L89 A;  4BI4 A;  3JCM c;  4IKF A;  4A4H A;  4OMQ A;  3JB9 F;  5GAN g;  3M0U A;  3A8H B;  5HY6 A;  2KT8 A;  3I55 A;  1ZA1 B;  4UC4 A;  2EWN A;  3INZ A;  1SPK A;  1YP5 A;  2SRC A;  2PTK A;  1M3B A;  1VQ8 Q;  1FYN A;  2CP6 A;  2EIF A;  3MP1 A;  1VQO T;  4FYW B;  4M77 A;  2M51 A;  1WJQ A;  3SHW A;  3CC7 T;  4BY6 C;  2F1L A;  4ZGD B;  3L2R A;  2RM4 A;  4XU3 A;  2X4Y A;  1VQ7 T;  2DK3 A;  3OS1 A;  2O88 A;  4FYY B;  3SB2 A;  4RG2 A;  1M1F A;  1RI9 A;  2DL7 A;  4JJD A;  5GMK l;  5GAO l;  4HVU A;  1C1A A;  3CXC S;  1Y96 B;  2ZPF B;  3G71 T;  4F16 A;  1VQ7 A;  4TVR A;  4PJL A;  4RTZ A;  5IH2 A;  4BDY A;  2M9U A;  2RHY A;  3HP9 A;  1PWT A;  2YUO A;  4XAX B;  3AHU A;  3EGX A;  1W6X A;  5GAM d;  1PRM C;  3HRT A;  5I11 A;  3RES A;  2JUF A;  4BDZ A;  1VQ9 Q;  3MHX A;  1EIF A;  5GAM e;  1M2O A;  2EYZ A;  1I81 A;  2F2W A;  3VV0 A;  2L3S A;  2HQH A;  3RKW A;  2OTJ A;  4M7A B;  2QQ9 A;  1WZO A;  3I35 A;  2GFA A;  1NJI R;  1T3S A;  2B86 A;  3CC4 T;  1AWO A;  2L3Q A;  1Y0M A;  1TXQ A;  5M9O A;  4R0K A;  3DLM A;  2QGG A;  2HKN A;  4XU2 A;  2E3H A;  2J6K A;  1TUD A;  5GAM h;  3G1J A;  5GAO p;  2DX1 A;  1Q81 R;  3QBY A;  4C8Q G;  4LXC A;  2K3X A;  2O4X A;  1SHF A;  2DYI A;  3P8B B;  5AT1 B;  4XU1 A;  3OQ5 A;  1KQ1 A;  3OYG A;  2EBP A;  3U23 A;  2ED1 A;  4C8Q F;  1GRI A;  1M2V A;  5GMK m;  1VQ9 A;  5A0L A;  4JJB A;  3M4G A;  4Y91 A;  4NL2 A;  1M90 R;  1UGR B;  5GAN 5;  2LQN A;  2SEM A;  2OAU A;  2JOY A;  2R5M A;  1K8A U;  1ZSG A;  2RB6 A;  5KCO A;  4M75 B;  2CH4 A;  2KRM A;  2RI2 A;  5GAO q;  2EJG A;  2PVD B;  3HHT B;  5KCH A;  5KYW A;  1ZSZ A;  2A08 A;  2JS0 A;  3SEM A;  2D1X A;  4M78 E;  1KSW A;  4ZTF A;  1R0C B;  3OYN A;  5AYF A;  2QA4 Q;  4F7U A;  2CP2 A;  4CC2 A;  4C0D B;  1AWX A;  3OMG A;  5CQY A;  4KBM B;  5LJ3 d;  5HK0 A;  3QWX X;  2KRO A;  2GBQ A;  4M78 C;  1MMD A;  2OJ2 A;  2DVE A;  5GAM g;  4XTX A;  3CCQ A;  4AG2 C;  4J9C A;  2BE7 D;  3VU3 C;  4C8Q D;  1V29 B;  1O75 A;  2F5T X;  3RKX A;  1MMG A;  1D0Z A;  3PVQ A;  1RL2 A;  3MKD A;  1E6G A;  2CKK A;  2K3B A;  3C0C A;  2HAX A;  1PSF A;  2CUD A;  3H0I A;  3CXC A;  3I5S A;  4M78 D;  3G4S T;  3UAT A;  1YWO A;  4NL3 A;  4RTT A;  1U8R A;  2RK2 A;  2NWM A;  1VQL A;  4QQ6 A;  1ARK A;  3H8Z A;  1VYV A;  2RJD A;  1B7T A;  3EGD B;  2DNU A;  1N5Z A;  1UUE A;  2CRE A;  1X27 A;  3URG A;  1JBM A;  2HCK A;  2QK0 A;  3VRY A;  2Y4X A;  2K57 A;  4IIO A;  3V7C A;  1WHH A;  2P84 A;  2Y4Y A;  5LJ3 h;  2X4X A;  2BUD A;  1TWB A;  1Y71 A;  1FXX A;  3VUZ A;  2CDT A;  2YRC A;  4PJO G;  1YIJ T;  3MEV A;  1WI7 A;  3L2V A;  1LOJ A;  5GAN 8;  4ZGJ B;  2DFU A;  3FRN A;  2ZPI B;  4MDW A;  4M7D D;  2ZPB B;  1FX7 A;  3CCJ A;  5ECA A;  2OTL Q;  4ME7 A;  2C0O A;  2H3E B;  2GF7 A;  4GBQ A;  4J9H A;  1WHJ A;  2KR3 A;  1KQS P;  2E6N A;  3GF5 A;  2ENM A;  4XTZ A;  5DLO A;  4M7D B;  1TUC A;  4M4Z A;  4OMP A;  2LRQ A;  2VAS A;  1X6G A;  3RMS A;  1VQK T;  4XK8 E;  4M77 D;  4WCI A;  1TH7 A;  3G4S Q;  2ECZ A;  1VQO A;  1OOT A;  2JMA A;  4DOW A;  2QDY B;  1JJ2 S;  2IVW A;  1K73 C;  3ZFJ A;  2V1Q A;  3A8L B;  4DBQ A;  1AEY A;  3QII A;  3VS2 A;  1H3Z A;  1OPL A;  5IAY A;  1VQ8 T;  2FHD A;  2VXE A;  2A0F B;  2NUT B;  4IIM A;  5DY9 A;  3JCM J;  2K9G A;  2DL5 A;  4KRT A;  1KD1 R;  4JZ3 A;  2P4R A;  2VV5 A;  1TS9 A;  3LW5 E;  1OV3 A;  2K79 A;  1MUZ A;  1M30 A;  1YIT T;  2RJC A;  3MPU B;  2FVU A;  1KD1 U;  2LCC A;  2BIV A;  2DYB A;  1MV3 A;  3NHN A;  1W1F A;  2CZ0 B;  2EGE A;  4RTX A;  1BB9 A;  5GMK e;  1UJY A;  3H0F A;  4PFZ A;  1H8K A;  3QDF A;  1Y7X A;  3JB9 J;  2D6F A;  1RLQ C;  3NTI A;  3RNJ A;  3LH5 A;  2O2O A;  1VA7 A;  2BZ8 A;  1VYT A;  2FZK B;  1YI2 A;  2J6F A;  3PIO A;  3OB9 A;  4JJN K;  2RH2 A;  1R77 A;  3CPF A;  4A54 A;  2JXB A;  1WX6 A;  3OBY A;  1Q82 U;  2ED0 A;  4QVD A;  1IGQ A;  3L2W A;  3NMZ C;  1H92 A;  4IUP A;  1ABO A;  1BU1 A;  3BDU A;  5CKH A;  5IXF A;  3PIP A;  3DKM A;  3EHR A;  2DAQ A;  2EJF A;  1NEB A;  2RI3 A;  1AWJ A;  4PK4 A;  3SWN C;  2VC8 A;  1Q86 C;  1EX4 A;  4JRQ A;  3J7A F;  4R56 A;  3MEU A;  4OB2 B;  1WJR A;  2DPP B;  4J5Y A;  1BI0 A;  2HSP A;  5LJ5 j;  3OYC A;  3GP8 A;  2DIQ A;  2XDD A;  1GXI E;  1MMN A;  3CME A;  3CBO A;  1T3L A;  2QG9 B;  7AT1 B;  4F7U G;  2CT4 A;  4J6X A;  5GAN 7;  4YTL A;  1Q7Y C;  2COZ A;  3UPU A;  1HD3 A;  1K73 R;  4E7J A;  4Y92 A;  4VUB A;  1VQ5 A;  1I5O B;  1Z9Q A;  2DVJ A;  4P5N A;  2C0T A;  1KK7 A;  3CCS Q;  2BE9 B;  4C0F A;  2EKO A;  1I5L A;  3EFR A;  1KC8 C;  3QSU A;  2NLU A;  1OYX A;  4IUV A;  1U06 A;  1OQK A;  3CD6 T;  3CCU T;  1ABQ A;  3QDR B;  3GLX A;  2JT4 A;  4E7I A;  1ZHI A;  4D6W A;  3IQL A;  4FSS A;  3VYG A;  3CPW S;  2QEX T;  1PM3 A;  4KGZ B;  1VIF A;  4C92 C;  1HJD A;  3QYG B;  4PJO D;  4PLI A;  1OU9 A;  3QZ5 B;  2LT1 A;  2OTL T;  2B8A A;  1UE9 A;  3SDZ A;  4M78 G;  4C92 E;  2QEX Q;  4HT9 A;  1IO6 A;  1VQK Q;  4O6J A;  4GLM A;  1JO8 A;  1JJ2 A;  5EC7 A;  3FIF A;  1H3H A;  1OI1 A;  2JW4 A;  1XNI A;  4LDY A;  2EQJ A;  4FU6 A;  4CC7 A;  2OX7 A;  3H9N A;  1QCF A;  5C0M A;  1LCK A;  4BB7 A;  3S3N A;  1WGS A;  1PHT A;  3JAM E;  2GNC A;  3PNW C;  3PT9 A;  1XJW B;  2KRN A;  5IHI A;  3OSV A;  1C6V X;  2QQA A;  5HKC A;  1PCX A;  4M7D A;  2DXC A;  2A28 A;  2RJE A;  1U1T A;  1MGQ A;  4RG8 A;  1M8M A;  2XHC A;  1IHW A;  4OGC A;  2CP5 A;  2H8H A;  3MO8 A;  2M1H A;  4LE9 A;  3CCE Q;  1KIK A;  2L3P A;  5FWC A;  3EGU A;  8ATC B;  1BI3 A;  2M02 A;  3QYH B;  2VKN A;  4M78 F;  3RBB B;  1KHI A;  1MND A;  4C92 A;  3L1A A;  2K2M A;  4C8Q C;  3CCL Q;  5FU6 B;  4A4G A;  2DEU A;  4DEX A;  5C6S A;  1M4Z A;  1QW1 A;  2LQ8 A;  1WNL A;  2O9V A;  2MWO A;  1ZX6 A;  2V1R A;  1ZLM A;  3GPL A;  2JTE A;  4PKC C;  1YWP A;  1ZUU A;  4OB3 B;  4M77 G;  3CC7 Q;  3GNG A;  4IUQ A;  4A4K A;  1KC8 R;  5D7U A;  1K4U S;  1RAC B;  3EH1 A;  2IG0 A;  2JTM A;  2JS2 A;  1Q81 U;  2P4T A;  1S1N A;  1QMC A;  3I56 T;  3HRU A;  1YI2 Q;  3MP8 A;  1WQ7 A;  3CCL A;  4LD9 K;  3BE3 A;  2E4H A;  3VS7 A;  4M7A G;  4RKU E;  1M1K C;  1QKW A;  2CUB A;  4PJO B;  1GL5 A;  4BE2 A;  6AT1 B;  3CCV Q;  1VQM Q;  2R5A A;  1NZ9 A;  1BCO A;  3CEY A;  4FT2 A;  2KQW A;  3WVD B;  3CPW P;  2CS7 A;  2OTJ Q;  2HQX A;  2O9S A;  2LP5 A;  3M53 A;  3X26 B;  1YHQ T;  3CC2 Q;  2ABL A;  2QTX A;  3OS5 A;  3QXE B;  3LWH A;  4GY5 A;  4OP0 A;  3CBM A;  1M9S A;  2G6F X;  1G5V A;  4E7Z A;  3CCM Q;  4M77 C;  1KJW A;  3HPW A;  2E5K A;  3ZEH A;  3C12 A;  2C0I A;  1GCP A;  2H3J A;  2X35 A;  1W70 A;  5GAN 3;  1ZSZ C;  5GAN 4;  1D09 B;  2HBP A;  4E6R A;  5LJ5 g;  1RAB B;  1WFW A;  3EGD A;  5IXB A;  4X9C A;  1W2B A;  5GAO r;  4M75 A;  2JN0 A;  4DBH A;  2K5I A;  4PJN A;  3H41 A;  3OYK A;  1CKA A;  2BZX A;  1M1G A;  1UHF A;  4M78 A;  1YJ9 Q;  2EYW A;  1VQ6 Q;  2YT6 A;  2ZPG B;  4FW1 A;  1OZ3 A;  1D0X A;  2DLP A;  1M8V A;  3CCU A;  2JM8 A;  1M90 U;  4L5G A;  2RHZ A;  2M0Y A;  2EPD A;  2G3R A;  2VWF A;  1OPK A;  2CGH A;  5LJ5 e;  2QQS A;  3ME9 A;  2RA2 A;  1U3O A;  2MK5 A;  4RTY A;  1VQ4 T;  4OGE A;  2XG8 D;  2OTL A;  4AG1 C;  4RCB A;  4RTU A;  4CC3 A;  3OYL A;  5LJ5 d;  5CKE A;  1X43 A;  1WLP B;  1UJ0 A;  2CP3 A;  3L2Q A;  2HZY A;  1VQ6 A;  3G71 Q;  5KH6 A;  1WQW A;  3X25 B;  4NOY A;  3CD6 Q;  2BKD N;  3L2U A;  5CVI A;  1TOV A;  3CQT A;  3E9F A;  2YRD A;  2O01 E;  3ER0 A;  5EG2 A;  1G8X A;  2XI9 A;  2A36 A;  5CKD A;  1S72 Q;  2KBT A;  2P0P A;  2OAW A;  4LD6 A;  2ZAE A;  4JPB W;  1QVG A;  5GAN j;  4L59 A;  1YJW Q;  2HL3 A;  4HCC A;  2XMF A;  1IZ6 A;  1JB0 E;  2LCS A;  3PTA A;  3RMQ A;  2ZGW A;  1MNE A;  3JSC A;  3PVL A;  1MV0 B;  1QWE A;  2QAZ A;  3O5Z A;  4II1 A;  3UDC A;  4DOV A;  2EYX A;  4EMK C;  4M7D G;  2E6Z A;  3OYA A;  3KXT A;  2MIO A;  1X6B A;  3FLG A;  1OX8 A;  3ZL7 C;  2HEQ A;  2HQE A;  1VQL T;  2KXD A;  3QJY A;  2FRY A;  1MMA A;  1NEG A;  2IPO B;  3J81 E;  1QVF A;  2GTJ A;  4PJO E;  2QAS A;  1AD5 A;  3D7S B;  2V8I A;  3P8H A;  1NYF A;  2YRV A;  1HXD A;  3V8J A;  1X01 A;  2ESW A;  3L2Z A;  4HA8 A;  4X9D A;  3X20 B;  4RUG A;  1PC0 A;  5GAN f;  4JS4 A;  5FU7 C;  3E19 A;  4JS5 A;  3SFM A;  3EAE A;  2DA9 A;  3M0Q A;  1YNZ A;  2MCN A;  3UA7 A;  2VUB A;  4JUV A;  4OB1 B;  2DL3 A;  3HKS A;  5L8R E;  1LNX A;  2ZPH B;  2ATC B;  5CQX A;  4KT0 E;  3WVE B;  3SWN A;  4J8O A;  2DZC A;  5GMK h;  1BI1 A;  3OBW A;  4PFP A;  2KI7 A;  4EMK A;  2W10 A;  1E7O A;  3QHS A;  5KYW B;  1G3S A;  3OYY A;  5KYX B;  5KYU A;  2LQK A;  3JCM Q;  1NPR A;  4OML A;  3OYJ A;  1WXB A;  4RMO A;  1PSE A;  3O8V A;  3JB9 G;  4A4F A;  4M7A F;  2CSI A;  3RER A;  2X3X D;  1YCY A;  1UGV A;  2AIR B;  2FO0 A;  3MEA A;  1WDX A;  4CRI A;  2QI2 A;  2VXF A;  4ANJ A;  3VS6 A;  3PMI A;  2LMJ A;  2E65 A;  4PFO A;  3M54 A;  2EQI A;  2LQW A;  2RQR A;  4M75 G;  1ACM B;  3RR6 A;  1NM7 A;  2HKQ B;  2DBK A;  2KYM A;  5GAO n;  2PUK B;  3MP6 A;  3LYI A;  1OX9 A;  3L42 A;  3RDV A;  3I55 Q;  2KMT A;  2RQW A;  4OB0 B;  3E1S A;  1LJO A;  4N4I A;  5LJ3 e;  1SKU B;  1YHQ Q;  1K9M U;  2NUZ A;  4KGV B;  3V7R A;  5IHK A;  1Q86 R;  4J9B A;  5FLX E;  3QWY A;  2M16 A;  3A8G B;  4FT4 A;  2AZV A;  4AFZ C;  2KRS A;  2JJ9 A;  3A1P A;  3M0T A;  1K0S A;  1FMK A;  5IHN A;  4ZN3 A;  3JCM g;  2K7A A;  1Q82 R;  1AZE A;  3A5Z B;  1QVP A;  3BFM A;  2DF6 A;  2V8K A;  2PNI A;  5LJ5 h;  3H6Z A;  1YHQ A;  1QP2 A;  4LDX A;  4ORZ A;  2DZ9 A;  3GNF B;  4Z8A A;  2COY A;  3CCS A;  2E1H A;  4BY6 B;  4QQD A;  3OYB A;  1D1A A;  1N9S A;  2DRM A;  2O4X B;  1F1B B;  1PG5 B;  2COW A;  4N4G A;  1IXD A;  5IN1 A;  2PZ1 A;  3M9Q A;  3CME Q;  4EPC A;  3JCM b;  4ZN1 A;  4WF2 A;  4PJO F;  1Q81 C;  1I07 A;  2AK5 A;  1M2V B;  4JDS A;  3TEE A;  1IRE B;  3E9G A;  4C8Q E;  1BI2 A;  1WPY A;  2A3L A;  1Q95 G;  4OMM A;  2D9T A;  1GBR A;  2EQK A;  4BUG A;  3G7Z A;  3UT1 A;  4M7A A;  5J39 A;  2XDB A;  3BW1 A;  1AT1 B;  4QVC A;  3FEO A;  4J83 A;  3EFO B;  2KK4 A;  2DIL A;  3CCR T;  3EG9 B;  4C5G A;  5A2Q E;  4PNO A;  5LJ5 f;  4FSX A;  4N4H A;  1WA7 A;  4ELZ C;  4HCZ A;  1ZUY A;  1VQ8 A;  4J9E A;  1N8R R;  2FPF A;  4M7A C;  1VQL Q;  1EFN A;  1N9R A;  2RNA A;  1Z9Z A;  3OY9 A;  1U1S A;  5KYY A;  1K9M R;  3CC2 A;  4XU0 A;  5GAN d;  1W2B P;  4JRK A;  2RQT A;  3VS1 A;  2GGR A;  2YLC A;  4MMK A;  2DBM A;  3Q1J A;  1VQK A;  5I22 A;  1X2Q A;  4JZ4 A;  5A0G A;  4C92 F;  3MCA B;  4F7U F;  2ROT A;  1S72 T;  3DB4 A;  1GBQ A;  4C8Q A;  2CP7 A;  1QCO A;  5GMK i;  1NJI U;  1C0M A;  3TQ7 P;  2LX9 A;  3LH0 A;  1B34 B;  2DL4 A;  2LNH B;  1AHJ B;  4M77 E;  2LTO A;  4LDV A;  3NTH A;  1I8F A;  5HCK A;  4E2F B;  2PU9 B;  3CCQ Q;  2CZ1 B;  3CCJ Q;  2RHX A;  3MET A;  4FCY A;  2VVK A;  3OYM A;  3CPW A;  2JMC A;  3QPH A;  3C94 A;  1SSH A;  4BD3 A;  5A0D A;  4ZNX A;  1HK9 A;  3OYH A;  2JVV A;  1K9M C;  5FRN A;  2DXB A;  2L8D A;  2QYZ A;  2R57 A;  4EMH A;  3EFO A;  2QA4 T;  4Z89 A;  2JTF A;  4C0G A;  3EG3 A;  3EG9 A;  4J7I A;  4M75 C;  3CCE A;  2DXU A;  1W4S A;  3NGP A;  2EGA A;  4FM4 B;  3TSW A;  4QQG A;  2FRW A;  2K2V A;  1YJN Q;  1IHV A;  2QTV A;  3QZ9 B;  1QCN A;  2XDP A;  1M5Q 1;  3M0S A;  5GAN 2;  2EGC A;  3A98 A;  2KNB B;  2D8H A;  1YJ9 A;  4N0A A;  4J9I A;  2L5Q A;  3DB3 A;  5CKB A;  1EZZ B;  1ZBX A;  2WSF E;  2RF0 A;  2A37 A;  4QW2 A;  1D3B B;  4IUU A;  4C0D C;  2CP0 A;  1GCQ C;  2NYS A;  3X28 B;  3CXC P;  4M7A D;  2P0Q A;  1VQ5 T;  2KAF A;  3TVT A;  2QDL A;  4M78 B;  3PMT A;  3M0R A;  3T9N A;  4M7A E;  1N8R U;  2DTO A;  4LDU A;  2DJZ A;  3QKJ A;  1K76 A;  3HL8 A;  2EAY A;  3CMA A;  1XTD A;  3KBG A;  2D8J A;  2RN8 A;  2MF2 A;  4HCK A;  1IB8 A;  1FMW A;  3G71 A;  2LJ3 A;  1RAH B;  1GFD A;  2WAC A;  1UGS B;  3CD6 A;  1O9S A;  1VQ4 Q;  3VRZ A;  2EVR A;  3FC3 A;  3TCJ A;  4EDU A;  4CI0 C;  3EHQ A;  3HTR A;  1AWW A;  1RAG B;  3CME T;  3M0P A;  1JEG A;  3QG1 A;  1Q82 C;  2DEQ A;  1SRL A;  2QGF B;  4HKE A;  3BY7 A;  3OS0 A;  1OU8 A;  1QVG S;  4QT7 A;  2E70 A;  5GJV B;  3CCM A;  3JCM W;  1AVZ C;  3JB9 D;  1FWZ A;  4F7U B;  1KFZ A;  2DJQ A;  3I56 A;  3TU4 K;  3MJX A;  3JCM P;  1VQ9 T;  5GAO m;  3UWN A;  1B34 A;  1ZBJ A;  4M75 E;  1PD0 A;  2WSC E;  2R58 A;  4BE0 A;  1J3T A;  2E12 A;  5CKF A;  3GIB A;  1JRI A;  4FYV B;  2X9H A;  4F04 B;  1K8A C;  1M3C A;  3V7S A;  4M7D C;  1GCQ A;  2DTI A;  2FYK A;  1BCM A;  1VQN Q;  1PNJ A;  1JQQ A;  3CCM T;  1UGP B;  2XK0 A;  2OI3 A;  4E7S A;  1G3W A;  4X1V A;  2DE0 X;  2F2V A;  4FYX B;  9ATC B;  3VS4 A;  2DD5 A;  1QWF A;  1IGU A;  3M58 A;  4JRP A;  4QVZ A;  3ASK A;  4DBR A;  5GAN h;  4ATO A;  4C5H A;  3M5A A;  4J9G A;  1D3B A;  2CT3 A;  1K9A A;  1QP3 A;  4PLL A;  4ZTJ A;  3OA6 A;  2XKO C;  1Q7Y U;  4D8D A;  2DIG A;  2MWP A;  1WHM A;  2YXY A;  2XD0 A;  3JCM f;  2M0O A;  1RAA B;  1KQS S;  2HL5 C;  3VJP A;  3S3O A;  2NUT A;  1BIB A;  2BTT A;  3HRS A;  1PRL C;  1Y57 A;  2LDM A;  1I4K 1;  3EH2 A;  1JU5 C;  4J9D A;  3R6N A;  4J9F A;  3GOX A;  3OMC A;  4RTW A;  3HFN A;  2LJ1 A;  1WHK A;  1FMV A;  2PUO B;  2EYQ A;  3BDL A;  4EIK A;  5HK3 A;  1LVK A;  4M75 D;  2VGM A;  4IUT A;  4DEY A;  2MAM A;  2I2L A;  4B9W A;  4XTU A;  4Z88 A;  1I0C A;  2FZC B;  1YJN T;  3M56 A;  1TSF A;  1ZQ1 A;  3N5B B;  1YJN A;  4XTV A;  4PJJ A;  4OF1 A;  3JCM X;  2K6D A;  3CCV A;  1R8O B;  1VQM A;  2GQV A;  5CAI A;  1CSK A;  2F5K A;  4HCB A;  1B07 A;  2K5L A;  3ULR B;  1N27 A;  3M57 A;  4MDX A;  1HSQ A;  1NLP C;  1OUL A;  1YCS B;  2AT1 B;  3CCL T;  3HFO A;  1QVF S;  3VKI A;  2EW3 A;  1VQ5 Q;  1R0B G;  4AMC A;  4QKU A;  3OYI A;  2J06 A;  3SWN B;  4A53 A;  1KD1 C;  2DXT A;  1IRX A;  4PL6 A;  3V8L A;  1YFN A;  1NJI C;  2KSS A;  1T0H A;  1AZG B;  3LLR A;  4LUE A;  3OW2 S;  3CC2 T;  2KDS A;  1N8R C;  2DRK A;  5GMK j;  4HVW A;  3NFC A;  1JJ2 P;  1QLY A;  4M7D F;  4E7H A;  2KY9 A;  4RCC A;  1X75 C;  3V8K A;  2PQW A;  5I2S A;  1TU0 B;  2CZ6 B;  4DBF A;  2F69 A;  2FG0 A;  3G4S A;  2A7Y A;  2KGT A;  1VQO Q;  4ZGE B;  1G2B A;  1H64 1;  4E7L A;  1UDL A;  1RAE B;  1UTI A;  4C92 D;  1YIJ Q;  3R6O A;  4J6W A;  5D6W A;  4C0Z A;  2X51 A;  1VIE A;  2DKG A;  1U5S A;  3P8D A;  1K8A R;  1VQP Q;  3TRE A;  1GFC A;  5FRM A;  3PGG A;  4C92 B;  1VQ7 Q;  4J7F A;  8AT1 B;  3CCS T;  3QO3 A;  4CC4 B;  4AFS C;  3ZBD A;  1V76 A;  3E2U A;  2LC4 A;  2YUQ A;  2MI6 A;  2NUP B;  2MOX A;  2PVG B;  4K11 A;  4D8K A;  2XU8 A;  1RAI B;  2HSE B;  2X4J A;  3JB9 I;  4F14 A;  1UG1 A;  4KUD K;  1YIT A;  3VS3 A;  1WXT A;  4V2S A;  3RUX A;  2CZ7 B;  4XQ3 A;  3X24 B;  4F7U E;  4FIB A;  3VS0 A;  1KHC A;  2V26 A;  5IT9 E;  1VQ6 T;  2HD0 A;  3CCR Q;  1PD1 A;  1UEC A;  4NS5 A;  1BKB A;  2FL7 A;  5KYN A;  3EFS A;  2QEX A;  3CMA Q;  5LJ3 g;  3WXM B;  5KE2 A;  1VOM A;  1VQN A;  2HMA A;  5CR2 A;  2GTO A;  1TG0 A;  1K73 U;  3EG2 A;  1HYO A;  1VQ4 A;  1XQH A;  4XTW A;  1TTH B;  4LN2 A;  3JRZ A;  1VQN T;  1NBE B;  4MZP A;  4X34 A;  2J7I A;  4JLI A;  3FJ5 A;  1RUW A;  1M1K R;  4C8Q B;  2DMO A;  5FU6 C;  2DER A;  3OW2 P;  3EGX B;  3NTK A;  2C06 A;  2MPX C;  5L23 A;  3FJP A;  4C92 G;  1WXU A;  2L0A A;  3JCM h;  1NE8 A;  3I55 T;  2QXF A;  5KYU B;  2PVO B;  5CK9 A;  1BYM A;  3KUF A;  3CCJ T;  2JM9 A;  2RJF A;  3I5R A;  4Y28 E;  5LL6 S;  1YJ9 T;  2JNG A;  1D0Y A;  2KXC A;  1YIJ A;  3TSZ A;  1M90 C;  4JLG A;  4HT8 A;  3C4S A;  1YBY A;  3SD4 A;  2LT4 A;  3CBP A;  1X2K A;  2E10 A;  2YUN A;  1XOV A;  4PJO C;  2GFU A;  3G6E T;  4WTO B;  2RMO A;  1OEB A;  1SSF A;  4JRI A;  2QA4 A;  4A63 B;  4AFU C;  3H0H A;  4BI3 A;  3EG0 A;  3OS2 A;  2D0N A;  3MEW A;  3CC7 A;  2YDL A;  3DLL A;  1W2B S;  1QQJ A;  3EG1 A;  4C5I A;  1YI2 T;  3LGL A;  4EMG A;  3CCQ T;  2FEI A;  1UB4 A;  2E64 A;  2JZ2 A;  2KT1 A;  4DQ2 A;  2RPN A;  2L3R A;  1LPL A;  4M77 B;  5D6X A;  2KYB A;  2P0K A;  1NG2 A;  3OYD A;  1ZSZ B;  2D0Q B;  1G3T A;  4C5E A;  1SHG A;  2AZS A;  3OSS C;  3PFS A;  1MHN A;  1X6O A;  2EFI A;  1E6H A;  2LNV A;  4O5V A;  1T0J A;  5DM7 R;  3JV3 A;  3VYH B;  3S3M A;  4OMF B;  1WYX A;  2YLB A;  2XID A;  1BBZ A;  4PJM A;  2O31 A;  3M4Y A;  2RHU A;  3QJ6 A;  1UHC A;  2GCX A;  3JB9 H;  4M7D E;  4PJO A;  3HSB A;  1BIA A;  3LGF A;  2RO0 A;  2RQU A;  2BZY A;  2DL8 A;  4Z02 A;  1A0N B;  2LJ0 A;  3OYE A;  4FW2 A;  3UF4 A;  1PKS A;  2MMP A;  2RK1 A;  1NYG A;  2J05 A;  3THK A;  3CCV T;  2X4W A;  1VQM T;  3A8O B;  1TUG B;  2DTH A;  2KEA A;  2AKL A;  3I9Q A;  2DET A;  2DO3 A;  1YJW A;  2KE9 A;  1M27 C;  2HNI A;  1Y96 A;  5GAM j;  3FDR A;  2V8J A;  3G6E Q;  1YJW T;  4OVA A;  2K4Y A;  1VQP A;  4LNP A;  4MZT A;  1QVF P;  5GAN 6;  1SG5 A;  2L2P A;  1JXO A;  2E3I A;  2CH4 W;  2LCL A;  2DM1 A;  4M75 F;  3LX7 A;  2DD4 A;  2EQM A;  1WHG A;  2K3Y A;  1UGQ B;  2FZG B;  5I2M A;  2YSQ A;  3CMA T;  4FL6 A;  3CC4 A;  1I1J A;  1SEM A;  1AOJ A;  4HVV A;  4IUR A;  2LX7 A;  4BI8 B;  3KFV A;  5CIU A;  2CSQ A;  2RHI A;  5KYY B;  2NUP A;  2EQU A;  4E7K A;  5KYX A;  3LWI A;  2ZPE B;  4KH1 B;  1V1C A;  3CCE T;  4BE1 A;  1SF9 A;  1D1C A;  1X69 A;  4EMK B;  2YWW A;  5KE3 A;  4MML A;  3A8M B;  3RIR A;  1K0X A;  2Y90 A;  1ZUK A;  1QVG P;  2FPD A;  2OTJ T;  1B3Q A;  1UEB A;  4MZM A;  3OW2 A;  2Z0W A;  5FRO A;  2LVM A;  1JXM A;  2ROL A;  2I0N A;  1RI0 A;  2F2X A;  2HDA A;  5CO7 A;  5GAM f;  2IIM A;  2VYT A;  3G6E A;  4L6V 5;  4M77 F;  4A4E A; 
#chains in the Genus database with same CATH homology
 2HL5 C;  4B6M A;  1WHG A;  3TQ7 P;  2M02 A;  1WHL A;  2QK0 A;  2CP2 A;  2CP3 A;  2HL3 A;  2CP0 A;  1TXQ A;  2CP6 A;  1WHH A;  2COY A;  2MPX C;  3E2U A;  1WHK A;  2Z0W A;  2E4H A;  2HKQ B;  1WHJ A;  2HQH A;  1WHM A;  1TOV A;  2CP5 A;  2E3I A;  3RDV A;  2CP7 A;  2COZ A;  1LPL A;  2COW A;  2HKN A;  1IXD A;  2E3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...