2E4HA

Solution structure of cytoskeletal protein in complex with tubulin tail
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
b'RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e4hA00
1TOVA 2E4HA 2M02A 1WHHA 1WHLA 4B6MA 1WHGA 2COWA 2HL5C 2CP5A 3E2UA 2MPXC 2CP0A 3TQ7P 1WHMA 2E3HA 2HL3A 2HKNA 2HQHA 2Z0WA 1TXQA 2CP2A 1WHJA 1IXDA 2COZA 2CP6A 2COYA 2E3IA 2HKQB 1LPLA 2CP3A 2QK0A 3RDVA 1WHKA 2CP7A
chains in the Genus database with same CATH superfamily
1EFNA 3A98A 2RPNA 4Z88A 2DK3A 1O9SA 1OV3A 2FZGB 5GAN8 1E6GA 2K2MA 3UT1A 4IUQA 1V29B 1VQ4Q 2DL8A 1B3QA 3EGDB 1JJ2P 1X69A 1JJ2A 1KQSP 4LDXA 4FYXB 1N9RA 1BU1A 2L5QA 1WGSA 3OYMA 4FM4B 1Y96A 2EGEA 3ZFJA 3M4GA 3URGA 3OYCA 3NTHA 4AMCA 2CS7A 3G71A 2DNUA 3OYAA 1K0SA 2FPFA 4PL6A 3JCMf 3OS2A 1IGUA 4BE0A 1FXXA 1D1CA 4QVDA 2GNCA 4FW2A 3REBB 1PKTA 3PFSA 1OX9A 1OU8A 3OYNA 4F17A 1JQQA 3ZEHA 1F1BB 4D8KA 4B9WA 2V1QA 1T3SA 1XQHA 4C0FA 3SFMA 2HKQB 2LQNA 2HNIA 2EFIA 2YDLA 4L6V5 5AYFA 2M02A 2M51A 3LW5E 5GAMg 2L3QA 4ATOA 2J6OA 3DKMA 3M4YA 4N4HA 3PMIA 4AFUC 3OSSC 3NMZC 4J8OA 3VS5A 2QQ9A 4JJCA 3VYHB 1X01A 5FLXE 2MIOA 4M77D 4XTVA 2IPOB 1D0ZA 5A0GA 3CCUQ 1KC8C 1G3SA 1QKXA 3PVLA 2F69A 4JJBA 5IHKA 1NLPC 4J9EA 3FJPA 4ZGEB 2RJFA 1SG5A 2CSQA 2MWPA 3I56Q 3J7AF 3GBQA 3HFOA 4F7UA 1VQNA 1AZGB 3LH5A 4FU6A 5DLQE 3OYGA 5KYXB 1WDXA 2QQSA 3MEAA 4PJOB 3NTKA 2RHZA 2ZPHB 2RJCA 1QW1A 1U1SA 4M78F 1CKBA 2KVQG 4FCYA 1EX4A 4PJOE 4J9FA 3G6EA 4IUVA 1AD5A 1KIKA 2MWOA 3CCQA 3VJPA 2A37A 4BACA 3I55T 4C92A 1UB4A 2H3EB 4E7KA 3ASKA 2P4RA 1UECA 3X26B 1S72Q 4M77A 1WXTA 3RNJA 3S3MA 1M27C 3JV3A 3VRZA 5LJ5f 3QG1A 1X6GA 3FB9A 5GMKm 2ED1A 1K9AA 4PFPA 4KH0B 5L8RE 3G4SQ 2NUTA 1Q82C 1RAIB 3D7SB 3JCMh 4CRIA 2PZ1A 1VQKA 2EW3A 4IUUA 1LPLA 1X6OA 2RNAA 3P8BB 4D6WA 3INZA 1Q81C 1W2BP 1W2BA 2JZ2A 1VIEA 3CCST 2RA2A 2XG8D 4OB2B 2LCLA 2A0FB 1RAGB 2V26A 1VQPQ 1BI1A 3S3NA 2EQKA 1GXIE 4JRQA 1ABOA 2DLPA 3EG9A 2LJ3A 2RI2A 1K1ZA 3HRTA 3TCJA 5D6YA 3EG2A 1VQOA 4J7FA 2RHYA 3OW2P 2VWFA 3OW2A 3RMQA 5J26A 1GFDA 1Z9ZA 1SEMA 3SEMA 4GBQA 4JPBW 3CBMA 4C8QF 3H0FA 4X1VA 5GAMd 3PE0A 3TEEA 2P0PA 2JM8A 2F5TX 3QDRB 1M2VA 1D3BB 1D1AA 5CO7A 2COZA 2DAQA 4FL6A 4QQDA 2O4XA 5KYYA 1KQ2A 1M90C 1ZSGA 2FEIA 2DEUA 4FW1A 2ECZA 1VQ8A 1B34B 2HCKA 3WXMB 3QWYA 1MV3A 1VQ7A 3VUBA 2FHDA 1MNDA 1PWTA 2R58A 3OY9A 3JB9J 1KHIA 1YIJQ 3H8ZA 3EG0A 3OA6A 1WIEA 3H0IA 2EKOA 1A0NB 1YHQT 3P8DA 4BI8B 4A4HA 4CC4B 1ZUUA 2DJZA 3CMEA 2JS0A 4KUDK 2OJ2A 1D09B 4KT0E 3CC7Q 3GLXA 2EVRA 4Y28E 1B07A 2DO3A 1KC8U 2C0OA 4F16A 2AHJB 5LJ5h 5IN1A 1JRIA 4P5NA 2ZGWA 1E7OA 3UA6A 4K11A 4KBMB 3OYEA 4R55A 3WVEB 3JB9G 1AHJB 2DRKA 1KSWA 2CKKA 4PJJA 4ANJA 5IXFA 3QKJA 5CCAA 4RUGA 3HSBA 3MKDA 4OMNA 2PVGB 1JXMA 4OB1B 5FWCA 2JW4A 1BKBA 5GAMj 3CCEA 3OYFA 3C95A 2IVWA 2XD0A 2LX7A 2P0KA 3CC4Q 2RQUA 3RMSA 2KDSA 2K5LA 1VQLQ 1UDLA 1M1GA 2JT4A 1GL5A 1AWOA 2DBMA 1I8FA 4KRTA 2DZCA 3THKA 2EWNA 1OZ3A 1T0JA 2LZ6B 2PU9B 4JJNK 1WYXA 4RCCA 1X2QA 4RG8A 2DD4A 3VS6A 3CD6A 3LX7A 1WJQA 1RLPC 2KSSA 2D6FA 5GAOl 3CCJA 1VQPT 1Q82U 2YUNA 3NGPA 4C0DC 1YI2Q 1YFNA 4A4GA 4E7LA 1M1KR 2ESWA 5LL6S 1Q81U 3H41A 4HT9A 2X35A 1TG0A 4BE2A 4GLKA 2ZPIB 2VASA 4ZNXA 2DL5A 1WX6A 2BZXA 1Y96B 7AT1B 3MP8A 4ZTFA 3QPHA 3C12A 2DYBA 2RD1A 3VS4A 3TREA 3P8HA 3L42A 2F5KA 5IXBA 3BE3A 2KE9A 4V2SA 3HRUA 1Q7YR 1K0XA 4O6JA 4M78D 2E4HA 2QA4Q 5KCOA 3HHTB 1SRMA 1I4K1 3CCMQ 4HT8A 1JXOA 2DPPB 1PM3A 2M16A 2XMFA 3RKYA 5HY6A 2HKNA 4J9BA 4DEYA 2DE0X 1NEGA 2MCNA 1VQ6Q 1YJ9T 4R56A 1YJNA 3KXTA 2LMJA 2XK0A 2B86A 1M90U 4FSXA 2YT6A 4EMKC 3BFMA 1YITQ 3M0SA 3NFCA 3O5ZA 2R5MA 3TSZA 3MEVA 3QIIA 2JVVA 3TQ7P 4JS4A 4PJOG 2RM4A 1X6BA 2QEXQ 2HAXA 4EMKB 2OAWA 2DL3A 1YCYA 1W4SA 3OYIA 2LJ0A 3HP9A 2CP3A 4M7DG 4J83A 4E47A 1R8OB 1JEGA 4M78A 3G71Q 3OS5A 1VQMA 2RF0A 1WHMA 3LWHA 1I07A 4BD3A 1RUWA 1Y57A 2RO0A 4KGVB 2AK5A 2YSQA 3M57A 4VUBA 4OMFB 3OB9A 3E9FA 4BDZA 2EKHA 4F7UB 2JM9A 3DLLA 2K3YA 4MMLA 3HTRA 2M0OA 4M7AA 3VS1A 2OTLT 4F7UE 5GAOp 2PUKB 2NWMA 1H641 2QGFB 3NPFA 3OYLA 1SKUB 2FO0A 1NJIR 4ZN3A 2ZPBB 4CI0C 1P92A 5ECAA 4C8QD 1WJRA 1K8AR 3U23A 3EFRA 2ZZDA 4C92B 2DIQA 1GFCA 4KULA 3C94A 1PD1A 1M8VA 4C92E 1Q86U 2YUOA 5AT1B 1IRXA 4M77B 5FU6C 1BCOA 3I5RA 2OTJA 3CCRT 3DLMA 4ESRA 4M77E 3TSWA 3CBOA 1S1NA 1UUEA 1NEBA 2BUDA 3CCVQ 1IZ6A 3SWNC 5FU6B 2ZPEB 2NUTB 3E9GA 2FZKB 2EYXA 2GFAA 3OMGA 5GMKl 8ATCB 1HK9A 1OOTA 2DZ9A 1VQNQ 1PCXA 4RTTA 3T9NA 3SWNB 4N0AA 2E3HA 2GCXA 4J6YA 2JTMA 4XU3A 1I5OB 2DILA 4JUVA 1M2OA 4C8QA 5HCKA 2F2XA 3CXCS 3G6EQ 3EG9B 3CC2T 2L0AA 1IXDA 3OYKA 3CCQQ 2J05A 1QKWA 1UGSB 2K2VA 2FPDA 2QGGA 2EJFA 1HD3A 5KYUB 3S6WA 4J9DA 5LJ3j 3QJYA 4C5HA 5GAMf 5A0LA 2J7IA 2QA4T 4X9DA 2DM1A 2DD5A 1ZSZB 1W1FA 2EQUA 5KH6A 2RK1A 1PHTA 1VQ6T 2CP2A 3VYGA 2HMAA 5KYYB 2CZ7B 3JCMW 3QO3A 2O2OA 4EDUA 2GQIA 2EQMA 1YITT 1KG1A 1WHGA 1D1BA 3LGLA 2AZSA 2HQEA 1ZA2B 5IH2A 1ZUYA 2B8AA 2X4YA 3M0QA 1WNLA 4LE9A 1TH7A 2DTHA 5J39A 5HK3A 1RI0A 2VKNA 4J7IA 4A4KA 2JS2A 2RQWA 1NZ9A 4MDXA 2LT4A 2QG9B 1YJWQ 5CK9A 2CH4A 4M75G 1D0YA 2X4XA 2EYQA 2KROA 2MK5A 2GQVA 2CP5A 4RG2A 1RADB 4LD6A 1WPYA 2D0NA 4RCBA 3AHUA 4IIOA 1VQOQ 4J6WA 1WLPB 1SHGA 2KMTA 4OP0A 3M59A 2DETA 1U5SA 3I35A 3MEWA 4XTZA 3F70A 2MOXA 1AWWA 4JDSA 1K4US 2EGCA 2HZYA 3JRZA 5C0MA 4RTVA 3LGFA 2KRNA 4PFZA 1UHFA 2KXDA 4OMPA 4Y92A 2MYSA 1UTIA 2DF6A 2LTOA 2PTKA 2ZAEA 1VIFA 3KUFA 1WJSA 5GANj 2J6FA 1VQ8Q 3X24B 2L3PA 3V7RA 2L3RA 1VQ7Q 3CCLT 2D0QB 4EIKA 1AZEA 4QT7A 4A54A 1QVGS 4PJOC 5LJ3e 2ZPFB 1NLOC 2W0ZA 4WCIA 1ZQ1A 3M53A 3V8KA 3FDRA 3HFNA 3CMAQ 1G83A 2NLUA 4QQGA 2EPDA 2A36A 2LQKA 2ATCB 4JRIA 3CCVT 3CMEQ 4M7DC 4PJLA 1ZBXA 2EYWA 1VYVA 1Z9QA 4A4EA 4XAXB 1PRMC 5KYWA 1T0HA 3BW1A 2V8JA 2DERA 2DVJA 1JU5C 4M7DB 1CSKA 4BUGA 3RUXA 1X75C 3EH2A 1X27A 4M7DE 1U06A 2K3BA 1OU9A 3I55A 2PQWA 4F04B 2E3IA 2YRVA 1H3ZA 1PSEA 2EBPA 3RERA 3VS7A 1M3AA 2J06A 4PJNA 4JS5A 2KI7A 3QZ5B 3EFOA 2RMOA 2HEQA 2LCSA 4HVVA 1Q7YC 2YRCA 2L2PA 2BZ8A 4BDYA 4EPCA 3CCEQ 1N8RC 4PKCC 1QWEA 1KD1R 4J5YA 1VQ9Q 2YUQA 3EAEA 1VQ4T 3FJ5A 3JB9H 1OULA 2QDLA 4RTUA 2YLBA 1ZBJA 2GF7A 5CKDA 3UATA 3EGUA 2O9VA 5CAIA 5KCHA 2CYZB 2DTIA 3CCSA 2DTOA 2LVMA 3OSVA 4A4FA 2ROLA 1OPKA 1V76A 2KYBA 1TUDA 5GANe 3CD6Q 3RIRA 2V8IA 2EAYA 3GIBA 5HKCA 5GMKe 3CCJQ 5DM7R 1YJWT 2DVEA 2QAZA 3UPUA 2LCCA 1TWBA 1BB9A 2XKOC 2RK2A 4DBRA 4F7UG 4LD9K 4TVRA 3LWIA 3A8OB 4BI3A 2KNBB 1UGPB 2VXFA 2P0QA 2BIVA 2DMOA 3KBGA 3LYIA 1R0CB 3CXCP 3CXCA 1NPRA 4C5EA 1GBRA 1IREB 1E6HA 2RQRA 2C0TA 3DB3A 4C92G 4N4IA 1ZA1B 4M78B 2JMAA 5I11A 2MI6A 4M78E 2O88A 5I22A 4M77G 4OB3B 1YP5A 1GBQA 4JZ4A 2YRDA 1NJIC 1H92A 3VS3A 4XU0A 2DXCA 2ENMA 4M7AB 1OQKA 1UFFA 4HXJA 1G5VA 2WSFE 4JRPA 2H3JA 2KQWA 2OI3A 1YJNQ 4M7AE 3CCUT 2EYZA 2LQWA 3REAB 1VQ5Q 2KRSA 2QQBA 1YHQA 1Y0MA 2HD0A 1KJWA 3MP1A 4R0KA 2JOYA 4LUDA 3SHWA 3I56T 3FIFA 2DBKA 1W6XA 3CMAT 4II1A 3L1AA 4M75C 1NYFA 1HSQA 5GAN2 4HCZA 1RAAB 3PTAA 4BI4A 1Y71A 5GJWB 4DEXA 1GCQC 3LLRA 1JB0E 2Z0WA 3GF5A 4M75B 4MZPA 2RB6A 3ZL7C 4PJOD 5EC7A 2R5AA 1VQMQ 4M75E 2KEAA 4XU1A 2JTFA 1WHKA 4HCBA 1Y7XA 1Q86C 2JXBA 5GJVB 1S72T 2WSCE 5LJ3g 1RAEB 3N5BB 3QHSA 2HL3A 4XTYA 4ZN1A 4C8QB 4ZGDB 1I5LA 1NYGA 4A53A 4MZMA 3VU3C 2CZ0B 4C8QE 2QI2A 1KHCA 4RKUE 1QVFS 3G4ST 1U1TA 1N6AA 5GMKi 1VQ9T 3JAME 1JBMA 3QYGB 4Q5WA 1Q7YU 1C0MA 2E64A 4RTWA 3NHNA 1BI3A 1QVGA 3RR6A 1W70A 1N8RU 4OGCA 3VS0A 1HXDA 3BDLA 2OTJQ 2FRWA 1UHCA 3OMCA 1KQSS 1WHJA 3E19A 2QQRA 3R6NA 1RACB 3QSUA 4AFSC 4DBHA 1VQPA 3MJXA 2DL7A 2MF2A 1I1JA 3GNFB 1K9MR 1BIAA 1XJWB 2WACA 4BB7A 4AFZC 5J3BA 1I0CA 3JSCA 1ZX6A 2JJ9A 1IGQA 2YLCA 1OX8A 2E5KA 2CT4A 1ACMB 2AIRB 4MZTA 1EIFA 2LDMA 1PSFA 2K57A 3RESA 2CP0A 4C5GA 4C92F 5C6SA 3CPWS 2PVDB 4NS5A 4KUIA 3JCMV 5GANg 4ORZA 1PC0A 4XK8E 1N27A 1YJ9A 4QQ6A 1YIJT 2RJEA 5GAOr 2SEMA 1Q82R 1YIJA 2A7YA 5CIUA 3L2RA 2A28A 2LJ1A 2KGTA 1VQ5T 1XTDA 2ED0A 2CUBA 4IURA 1M3BA 2DRMA 1NJIU 3GPLA 2DYIA 1C6VX 2GTJA 2XICA 2X9HA 1K73R 1M4ZA 3GNGA 2XDDA 2L8DA 3CC7T 1QCNA 4HVUA 2QASA 4KGXB 2LP5A 2QQAA 5GAOq 3M9QA 2QTVA 1MNEA 3JCMc 5GAN3 5LJ3d 1JO8A 1D3BA 1MUZA 2LC4A 3JB9F 3OBWA 1RL2A 2FYKA 4Z89A 3RKWA 4J6XA 4PLIA 3C4SA 2LX9A 2DX1A 3I9QA 4DOWA 4C92C 2KBTA 5GAOn 1RAFB 4BY6B 2PVOB 1B34A 1B7TA 5KYWB 2OTLA 5KYNA 1TUGB 2K4YA 4M77C 1WFWA 4L5GA 5CKBA 1M90R 3CC4T 3EFSA 3OYJA 3META 1NPPA 1OZ2A 2R57A 1BI0A 2AKKA 1VQLT 4C5IA 2EJ9A 2GBQA 3CC4A 2E6NA 3NTIA 1TTHB 3M5AA 5I2SA 1UJYA 5DY9A 5LJ5j 3A8HB 4B9XA 2DIGA 3JCMe 2G3RA 5GAN5 4E7SA 2NUZA 2FRYA 1KD1C 3MEUA 4IUTA 5CQXA 3EFOB 5IT9E 1VA7A 3CCRA 4EMGA 2W10A 4FYYB 1MHNA 4CC7A 2CSIA 5FW9A 2K9GA 2FPEA 1SSFA 2EQIA 4OF1A 1FMWA 1WI7A 1YI2T 4NOYA 2O9SA 3FLGA 2OX7A 1GRIA 1TS9A 4HCCA 4RTXA 2MPXC 4E7HA 3MO8A 3EG1A 2VB6A 2L3SA 2LQ8A 3L2WA 4UC4A 1AWJA 4M78G 3OW2S 3ER0A 4PLLA 1ZSZC 4MMKA 3QZ9B 2C0IA 5GANd 3CC2A 2D1XA 1TOVA 1BK2A 1MMGA 2IIMA 3MHXA 2RJDA 1FMKA 2OAUA 3QDFA 4PNOA 4C0GA 4C0ZA 5FU7C 1DJ7B 2KR3A 3I55Q 1SHFA 3A1PA 4E7JA 2DA9A 2E6ZA 2CREA 2EIFA 4M7AG 1H3HA 3CCMT 2IG0A 4J9IA 2QA4A 1IHWA 1OI1A 4FSSA 1O75A 2YUPA 1M2VB 3H9NA 3IQLA 2O4XB 4J9CA 5FU7B 4OMMA 2D9TA 1QVFP 1VQ6A 1QVFA 2DJQA 3M54A 3FEOA 5CKFA 1VYTA 1FMVA 1QWFA 2HSEB 1M5Q1 4ZTJA 1VQKQ 3X28B 2QYZA 2SRCA 1LJOA 4X34A 5CVIA 1YITA 2ROTA 4Y91A 5FRMA 3A8LB 2V1RA 3G1JA 4PJOF 2QEXT 3VV0A 3FRNA 1QCOA 1PRLC 3H6ZA 2QEXA 1KQSA 2BE9B 3CCSQ 2EQJA 4HKEA 1G3TA 3VS2A 2F1LA 2V8KA 1NE8A 2JUFA 2ABLA 3EGXA 4M7DF 2COWA 2HL5C 5LJ5e 3V7CA 3G71T 2P4TA 1UGVA 2NYSA 3LH0A 3PIPA 1X2KA 3ZBDA 1LOJA 2LT1A 2K3XA 5IAYA 2Y4XA 4O5VA 3ULRB 1SSHA 4RTZA 4QKUA 2QK0A 8AT1B 1QQJA 4MDWA 5DLOA 4FYVB 1RAHB 3QXEB 4C8QG 4M4ZA 2RH2A 4AG2C 5I2MA 2YXYA 2DFUA 4DBQA 2VGNA 4WTOB 4N4GA 1G3WA 3PMTA 3JCMP 1HYOA 1VYUA 4OGEA 2E1HA 3CPWP 5CKHA 3VUZA 3CPWA 5D7UA 1ABQA 2KAFA 5GMKj 4NL3A 4LDYA 1HJDA 3HRSA 4XTUA 2Y90A 1R77A 3R6OA 3CCLA 2KT1A 1MV0B 2QXFA 1PG5B 4Z8AA 4C92D 5HK0A 4EMKA 1CKAA 2XIDA 4IUPA 2FG0A 1TSFA 2J6KA 4ZGJB 2NUPA 1YHQQ 3EH1A 2QTXA 1ZLMA 1ARKA 5GAMh 2EJGA 4OMOA 1BYMA 1NBEB 4OVAA 2D8HA 3CCVA 1M1FA 2H8HA 1KD1U 2JN0A 1M9SA 2O31A 2VGMA 5FWBA 3C0CA 4DBFA 1M1KC 1VQNT 3SB2A 3EHRA 1T3LA 1TUCA 4JRKA 3JCMJ 1YNZA 1K9MC 4FT4A 4PK4A 5FRNA 2CZ1B 2O01E 3G6ET 1MMNA 1MGQA 4AT1B 2HBPA 3CCQT 3JCMg 4A63B 2X3XD 3DB4A 4LDWA 1M3CA 2KT8A 3E2UA 3PVQA 2G6FX 3GOXA 3CQTA 4OMLA 1OEBA 1YCSB 3J80E 2GTOA 2JNGA 3JB9D 5CQYA 4M7AF 3CPFA 1LVKA 1QVPA 4BE1A 2M1HA 4F14A 1VQ4A 4LXCA 2CT3A 2BKDN 5GAN4 4CC2A 4DQ2A 4IKFA 5EG2A 2E65A 5FROA 1VQKT 2CGHA 2KXCA 1QP2A 4XTWA 3L2UA 1UGRB 1WXBA 3A8MB 2DXUA 3ME9A 3EG3A 1K73C 3S3OA 3SWNA 4IIMA 1K76A 3OYDA 2CUDA 2YWWA 4M75F 5D6XA 2C06A 1YJWA 1BCMA 2RQTA 3HPWA 2E5QA 3PIOA 1R0BG 2E41A 4M78C 1VQOT 4YTLA 1XNIA 1MMAA 5KYUA 4FIBA 1VUBA 1M8MA 3X25B 2FVUA 1ZHIA 5LJ3f 1FYNA 1XOVA 2K79A 4M7AC 4LUEA 1ZSZA 2GFUA 3RBBB 1KK7A 2K6DA 1MMDA 4DA4A 1LNXA 2E10A 2HQXA 2XU8A 2RHUA 3EGDA 1BBZA 1VQ8T 2COYA 3RKXA 2A3LA 1K8AC 2LNHB 1VQ7T 4EMHA 2VV5A 5LJ5g 2XDPA 2XI9A 1NG2A 2I0NA 1YJ9Q 2F2WA 1PNJA 3CCUA 3I5SA 3L2QA 2I2LA 2RN8A 3EHQA 1GCPA 4JLIA 4KH1B 2ZPGB 3I56A 3RDVA 1U8RA 3CMET 3WVDB 2KYMA 3CMAA 2XDBA 1BIBA 1V1CA 2MAMA 1SPKA 3OQ5A 3JCMd 4XQ3A 1AOJA 4HVWA 9ATCB 2HQHA 3OS0A 2F2VA 2AKLA 2K5FA 5GAN7 3QJ6A 1PKSA 4N0AC 4CC3A 4LNPA 3V8JA 4C8QC 3QUIA 2BTTA 2KRMA 3FC3A 1YWOA 3E1SA 3M0UA 1M1KU 4M7DD 1SRLA 3GP8A 3M0TA 1UEBA 2DKGA 1S72A 1K9MU 5I21A 4PFOA 3CEYA 2CZ6B 4ME7A 2OTLQ 5GANf 1X43A 1LCKA 4E7IA 3CCET 1PD0A 5A0DA 1RABB 1BI2A 4QVZA 3QBYA 3OYBA 3O8VA 3A8GB 1U3OA 1UGQB 2WSEE 5A2QE 2X3WD 3G4SA 4J9HA 1IB8A 1VQ9A 3SDZA 2RI3A 2HSPA 1AVZC 3M0RA 2PUOB 1KC8R 1QVGP 3A5ZB 5IHIA 1WZOA 3X20B 1QCFA 1WQWA 4QW2A 2L89A 1JJ2S 1UG1A 4LDVA 5KYXA 2LNVA 1IHVA 1ZUKA 3OS1A 4PJOA 5LJ3h 3CCRQ 4XTXA 3CD6T 3JB9I 4B6MA 2DXTA 4E6RA 2PNIA 2VYTA 4OMQA 2RQVA 3CCJT 1G2BA 4JJDA 5CKEA 4M7DA 5CR2A 2DEQA 2XHCA 2AZVA 3PGGA 4F7UF 1TU0B 1WA7A 3J81E 3QYHB 2VVKA 4HA8A 1WQ7A 1Y07A 4HCKA 2KK4A 4E2FB 5KE3A 2BZYA 1G8XA 1K73U 3VKIA 3EGXB 4C0DB 1N5ZA 5LJ5d 3CC2Q 3PT9A 4OB0B 2EYYA 1YBYA 1M30A 2RI5A 4M77F 3AT1B 3MPUB 3Q1JA 3M55A 1FX7A 1IO6A 1N8RR 1WHLA 3TVTA 4GY5A 4DOVA 1YJNT 2HBWA 3BDUA 2VC8A 1Q81R 1Q95G 4RMOA 2VXEA 4M7AD 1VQ5A 1K8AU 4AG1C 2M9UA 2X4JA 2CDTA 2JMCA 4WF2A 2BE7D 2X4WA 2D8JA 3CC7A 2YHTA 5GAMe 3L2ZA 1OYXA 1J3TA 1UE9A 2EGAA 4PJMA 5GANh 3MP6A 4BY6C 3QWXX 2P84A 2DXBA 1AWXA 4D8DA 3PNWC 3H0HA 5GMKh 2NUPB 1UJ0A 2LRQA 1SF9A 3UF4A 2KY9A 2E12A 1VQMT 4JLGA 2CP7A 1VOMA 4KGZB 6AT1B 2AT1B 3OYYA 1QLYA 1YN8A 1G3YA 1QP3A 4FT2A 5L23A 3TU4K 4M75D 4AFQC 1NM7A 4JZ3A 1EZZB 2GGRA 3G7ZA 4GLMA 3VRYA 4XU2A 2QDYB 4ELZC 1VQLA 1RI9A 4FYWB 3JCMQ 1WHHA 1I81A 2ZCFB 3HKSA 2FB7A 1KFZA 3SD4A 4L59A 1OPLA 2RHIA 1WXUA 1FWZA 2K5IA 4LDUA 3CCLQ 1W2BS 2OTJT 4ELYC 4QVCA 3M58A 4E7ZA 3V8LA 3M56A 3M0PA 1AT1B 2FL7A 2MMPA 3OBYA 1KQ1A 4X9CA 1C1AA 1YI2A 3KFVA 3UDCA 1AEYA 4RTYA 4M75A 1YWPA 1RLQC 1TXQA 2E70A 3L2VA 3MCAB 4Z02A 1GCQA 3JCMb 2DL4A 3BY7A 5KE2A 2K7AA 4NL2A 3HL8A 1N9SA 2X51A 2A08A 3JCMX 1D0XA 2RHXA 3UWNA 3V7SA 4LN2A 5IHNA 2CH4W 2VUBA 3OYHA 1QMCA 1Q86R 5GAN6 2FZCB 5D6WA 2JTEA 2CP6A 3CCMA 2M0YA 3CBPA 5M9OA 1H8KA 5GAOm 2Y4YA 4J9GA 3UA7A 2HDAA
chains in the Genus database with same CATH topology
1TOVA 2E4HA 2M02A 1WHHA 1WHLA 4B6MA 1WHGA 2COWA 2HL5C 2CP5A 3E2UA 2MPXC 2CP0A 3TQ7P 1WHMA 2E3HA 2HL3A 2HKNA 2HQHA 2Z0WA 1TXQA 2CP2A 1WHJA 1IXDA 2COZA 2CP6A 2COYA 2E3IA 2HKQB 1LPLA 2CP3A 2QK0A 3RDVA 1WHKA 2CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TOV A;  2E4H A;  2M02 A;  1WHH A;  1WHL A;  4B6M A;  1WHG A;  2COW A;  2HL5 C;  2CP5 A;  3E2U A;  2MPX C;  2CP0 A;  3TQ7 P;  1WHM A;  2E3H A;  2HL3 A;  2HKN A;  2HQH A;  2Z0W A;  1TXQ A;  2CP2 A;  1WHJ A;  1IXD A;  2COZ A;  2CP6 A;  2COY A;  2E3I A;  2HKQ B;  1LPL A;  2CP3 A;  2QK0 A;  3RDV A;  1WHK A;  2CP7 A; 
#chains in the Genus database with same CATH topology
 1EFN A;  3A98 A;  2RPN A;  4Z88 A;  2DK3 A;  1O9S A;  1OV3 A;  2FZG B;  5GAN 8;  1E6G A;  2K2M A;  3UT1 A;  4IUQ A;  1V29 B;  1VQ4 Q;  2DL8 A;  1B3Q A;  3EGD B;  1JJ2 P;  1X69 A;  1JJ2 A;  1KQS P;  4LDX A;  4FYX B;  1N9R A;  1BU1 A;  2L5Q A;  1WGS A;  3OYM A;  4FM4 B;  1Y96 A;  2EGE A;  3ZFJ A;  3M4G A;  3URG A;  3OYC A;  3NTH A;  4AMC A;  2CS7 A;  3G71 A;  2DNU A;  3OYA A;  1K0S A;  2FPF A;  4PL6 A;  3JCM f;  3OS2 A;  1IGU A;  4BE0 A;  1FXX A;  1D1C A;  4QVD A;  2GNC A;  4FW2 A;  3REB B;  1PKT A;  3PFS A;  1OX9 A;  1OU8 A;  3OYN A;  4F17 A;  1JQQ A;  3ZEH A;  1F1B B;  4D8K A;  4B9W A;  2V1Q A;  1T3S A;  1XQH A;  4C0F A;  3SFM A;  2HKQ B;  2LQN A;  2HNI A;  2EFI A;  2YDL A;  4L6V 5;  5AYF A;  2M02 A;  2M51 A;  3LW5 E;  5GAM g;  2L3Q A;  4ATO A;  2J6O A;  3DKM A;  3M4Y A;  4N4H A;  3PMI A;  4AFU C;  3OSS C;  3NMZ C;  4J8O A;  3VS5 A;  2QQ9 A;  4JJC A;  3VYH B;  1X01 A;  5FLX E;  2MIO A;  4M77 D;  4XTV A;  2IPO B;  1D0Z A;  5A0G A;  3CCU Q;  1KC8 C;  1G3S A;  1QKX A;  3PVL A;  2F69 A;  4JJB A;  5IHK A;  1NLP C;  4J9E A;  3FJP A;  4ZGE B;  2RJF A;  1SG5 A;  2CSQ A;  2MWP A;  3I56 Q;  3J7A F;  3GBQ A;  3HFO A;  4F7U A;  1VQN A;  1AZG B;  3LH5 A;  4FU6 A;  5DLQ E;  3OYG A;  5KYX B;  1WDX A;  2QQS A;  3MEA A;  4PJO B;  3NTK A;  2RHZ A;  2ZPH B;  2RJC A;  1QW1 A;  1U1S A;  4M78 F;  1CKB A;  2KVQ G;  4FCY A;  1EX4 A;  4PJO E;  4J9F A;  3G6E A;  4IUV A;  1AD5 A;  1KIK A;  2MWO A;  3CCQ A;  3VJP A;  2A37 A;  4BAC A;  3I55 T;  4C92 A;  1UB4 A;  2H3E B;  4E7K A;  3ASK A;  2P4R A;  1UEC A;  3X26 B;  1S72 Q;  4M77 A;  1WXT A;  3RNJ A;  3S3M A;  1M27 C;  3JV3 A;  3VRZ A;  5LJ5 f;  3QG1 A;  1X6G A;  3FB9 A;  5GMK m;  2ED1 A;  1K9A A;  4PFP A;  4KH0 B;  5L8R E;  3G4S Q;  2NUT A;  1Q82 C;  1RAI B;  3D7S B;  3JCM h;  4CRI A;  2PZ1 A;  1VQK A;  2EW3 A;  4IUU A;  1LPL A;  1X6O A;  2RNA A;  3P8B B;  4D6W A;  3INZ A;  1Q81 C;  1W2B P;  1W2B A;  2JZ2 A;  1VIE A;  3CCS T;  2RA2 A;  2XG8 D;  4OB2 B;  2LCL A;  2A0F B;  1RAG B;  2V26 A;  1VQP Q;  1BI1 A;  3S3N A;  2EQK A;  1GXI E;  4JRQ A;  1ABO A;  2DLP A;  3EG9 A;  2LJ3 A;  2RI2 A;  1K1Z A;  3HRT A;  3TCJ A;  5D6Y A;  3EG2 A;  1VQO A;  4J7F A;  2RHY A;  3OW2 P;  2VWF A;  3OW2 A;  3RMQ A;  5J26 A;  1GFD A;  1Z9Z A;  1SEM A;  3SEM A;  4GBQ A;  4JPB W;  3CBM A;  4C8Q F;  3H0F A;  4X1V A;  5GAM d;  3PE0 A;  3TEE A;  2P0P A;  2JM8 A;  2F5T X;  3QDR B;  1M2V A;  1D3B B;  1D1A A;  5CO7 A;  2COZ A;  2DAQ A;  4FL6 A;  4QQD A;  2O4X A;  5KYY A;  1KQ2 A;  1M90 C;  1ZSG A;  2FEI A;  2DEU A;  4FW1 A;  2ECZ A;  1VQ8 A;  1B34 B;  2HCK A;  3WXM B;  3QWY A;  1MV3 A;  1VQ7 A;  3VUB A;  2FHD A;  1MND A;  1PWT A;  2R58 A;  3OY9 A;  3JB9 J;  1KHI A;  1YIJ Q;  3H8Z A;  3EG0 A;  3OA6 A;  1WIE A;  3H0I A;  2EKO A;  1A0N B;  1YHQ T;  3P8D A;  4BI8 B;  4A4H A;  4CC4 B;  1ZUU A;  2DJZ A;  3CME A;  2JS0 A;  4KUD K;  2OJ2 A;  1D09 B;  4KT0 E;  3CC7 Q;  3GLX A;  2EVR A;  4Y28 E;  1B07 A;  2DO3 A;  1KC8 U;  2C0O A;  4F16 A;  2AHJ B;  5LJ5 h;  5IN1 A;  1JRI A;  4P5N A;  2ZGW A;  1E7O A;  3UA6 A;  4K11 A;  4KBM B;  3OYE A;  4R55 A;  3WVE B;  3JB9 G;  1AHJ B;  2DRK A;  1KSW A;  2CKK A;  4PJJ A;  4ANJ A;  5IXF A;  3QKJ A;  5CCA A;  4RUG A;  3HSB A;  3MKD A;  4OMN A;  2PVG B;  1JXM A;  4OB1 B;  5FWC A;  2JW4 A;  1BKB A;  5GAM j;  3CCE A;  3OYF A;  3C95 A;  2IVW A;  2XD0 A;  2LX7 A;  2P0K A;  3CC4 Q;  2RQU A;  3RMS A;  2KDS A;  2K5L A;  1VQL Q;  1UDL A;  1M1G A;  2JT4 A;  1GL5 A;  1AWO A;  2DBM A;  1I8F A;  4KRT A;  2DZC A;  3THK A;  2EWN A;  1OZ3 A;  1T0J A;  2LZ6 B;  2PU9 B;  4JJN K;  1WYX A;  4RCC A;  1X2Q A;  4RG8 A;  2DD4 A;  3VS6 A;  3CD6 A;  3LX7 A;  1WJQ A;  1RLP C;  2KSS A;  2D6F A;  5GAO l;  3CCJ A;  1VQP T;  1Q82 U;  2YUN A;  3NGP A;  4C0D C;  1YI2 Q;  1YFN A;  4A4G A;  4E7L A;  1M1K R;  2ESW A;  5LL6 S;  1Q81 U;  3H41 A;  4HT9 A;  2X35 A;  1TG0 A;  4BE2 A;  4GLK A;  2ZPI B;  2VAS A;  4ZNX A;  2DL5 A;  1WX6 A;  2BZX A;  1Y96 B;  7AT1 B;  3MP8 A;  4ZTF A;  3QPH A;  3C12 A;  2DYB A;  2RD1 A;  3VS4 A;  3TRE A;  3P8H A;  3L42 A;  2F5K A;  5IXB A;  3BE3 A;  2KE9 A;  4V2S A;  3HRU A;  1Q7Y R;  1K0X A;  4O6J A;  4M78 D;  2E4H A;  2QA4 Q;  5KCO A;  3HHT B;  1SRM A;  1I4K 1;  3CCM Q;  4HT8 A;  1JXO A;  2DPP B;  1PM3 A;  2M16 A;  2XMF A;  3RKY A;  5HY6 A;  2HKN A;  4J9B A;  4DEY A;  2DE0 X;  1NEG A;  2MCN A;  1VQ6 Q;  1YJ9 T;  4R56 A;  1YJN A;  3KXT A;  2LMJ A;  2XK0 A;  2B86 A;  1M90 U;  4FSX A;  2YT6 A;  4EMK C;  3BFM A;  1YIT Q;  3M0S A;  3NFC A;  3O5Z A;  2R5M A;  3TSZ A;  3MEV A;  3QII A;  2JVV A;  3TQ7 P;  4JS4 A;  4PJO G;  2RM4 A;  1X6B A;  2QEX Q;  2HAX A;  4EMK B;  2OAW A;  2DL3 A;  1YCY A;  1W4S A;  3OYI A;  2LJ0 A;  3HP9 A;  2CP3 A;  4M7D G;  4J83 A;  4E47 A;  1R8O B;  1JEG A;  4M78 A;  3G71 Q;  3OS5 A;  1VQM A;  2RF0 A;  1WHM A;  3LWH A;  1I07 A;  4BD3 A;  1RUW A;  1Y57 A;  2RO0 A;  4KGV B;  2AK5 A;  2YSQ A;  3M57 A;  4VUB A;  4OMF B;  3OB9 A;  3E9F A;  4BDZ A;  2EKH A;  4F7U B;  2JM9 A;  3DLL A;  2K3Y A;  4MML A;  3HTR A;  2M0O A;  4M7A A;  3VS1 A;  2OTL T;  4F7U E;  5GAO p;  2PUK B;  2NWM A;  1H64 1;  2QGF B;  3NPF A;  3OYL A;  1SKU B;  2FO0 A;  1NJI R;  4ZN3 A;  2ZPB B;  4CI0 C;  1P92 A;  5ECA A;  4C8Q D;  1WJR A;  1K8A R;  3U23 A;  3EFR A;  2ZZD A;  4C92 B;  2DIQ A;  1GFC A;  4KUL A;  3C94 A;  1PD1 A;  1M8V A;  4C92 E;  1Q86 U;  2YUO A;  5AT1 B;  1IRX A;  4M77 B;  5FU6 C;  1BCO A;  3I5R A;  2OTJ A;  3CCR T;  3DLM A;  4ESR A;  4M77 E;  3TSW A;  3CBO A;  1S1N A;  1UUE A;  1NEB A;  2BUD A;  3CCV Q;  1IZ6 A;  3SWN C;  5FU6 B;  2ZPE B;  2NUT B;  3E9G A;  2FZK B;  2EYX A;  2GFA A;  3OMG A;  5GMK l;  8ATC B;  1HK9 A;  1OOT A;  2DZ9 A;  1VQN Q;  1PCX A;  4RTT A;  3T9N A;  3SWN B;  4N0A A;  2E3H A;  2GCX A;  4J6Y A;  2JTM A;  4XU3 A;  1I5O B;  2DIL A;  4JUV A;  1M2O A;  4C8Q A;  5HCK A;  2F2X A;  3CXC S;  3G6E Q;  3EG9 B;  3CC2 T;  2L0A A;  1IXD A;  3OYK A;  3CCQ Q;  2J05 A;  1QKW A;  1UGS B;  2K2V A;  2FPD A;  2QGG A;  2EJF A;  1HD3 A;  5KYU B;  3S6W A;  4J9D A;  5LJ3 j;  3QJY A;  4C5H A;  5GAM f;  5A0L A;  2J7I A;  2QA4 T;  4X9D A;  2DM1 A;  2DD5 A;  1ZSZ B;  1W1F A;  2EQU A;  5KH6 A;  2RK1 A;  1PHT A;  1VQ6 T;  2CP2 A;  3VYG A;  2HMA A;  5KYY B;  2CZ7 B;  3JCM W;  3QO3 A;  2O2O A;  4EDU A;  2GQI A;  2EQM A;  1YIT T;  1KG1 A;  1WHG A;  1D1B A;  3LGL A;  2AZS A;  2HQE A;  1ZA2 B;  5IH2 A;  1ZUY A;  2B8A A;  2X4Y A;  3M0Q A;  1WNL A;  4LE9 A;  1TH7 A;  2DTH A;  5J39 A;  5HK3 A;  1RI0 A;  2VKN A;  4J7I A;  4A4K A;  2JS2 A;  2RQW A;  1NZ9 A;  4MDX A;  2LT4 A;  2QG9 B;  1YJW Q;  5CK9 A;  2CH4 A;  4M75 G;  1D0Y A;  2X4X A;  2EYQ A;  2KRO A;  2MK5 A;  2GQV A;  2CP5 A;  4RG2 A;  1RAD B;  4LD6 A;  1WPY A;  2D0N A;  4RCB A;  3AHU A;  4IIO A;  1VQO Q;  4J6W A;  1WLP B;  1SHG A;  2KMT A;  4OP0 A;  3M59 A;  2DET A;  1U5S A;  3I35 A;  3MEW A;  4XTZ A;  3F70 A;  2MOX A;  1AWW A;  4JDS A;  1K4U S;  2EGC A;  2HZY A;  3JRZ A;  5C0M A;  4RTV A;  3LGF A;  2KRN A;  4PFZ A;  1UHF A;  2KXD A;  4OMP A;  4Y92 A;  2MYS A;  1UTI A;  2DF6 A;  2LTO A;  2PTK A;  2ZAE A;  1VIF A;  3KUF A;  1WJS A;  5GAN j;  2J6F A;  1VQ8 Q;  3X24 B;  2L3P A;  3V7R A;  2L3R A;  1VQ7 Q;  3CCL T;  2D0Q B;  4EIK A;  1AZE A;  4QT7 A;  4A54 A;  1QVG S;  4PJO C;  5LJ3 e;  2ZPF B;  1NLO C;  2W0Z A;  4WCI A;  1ZQ1 A;  3M53 A;  3V8K A;  3FDR A;  3HFN A;  3CMA Q;  1G83 A;  2NLU A;  4QQG A;  2EPD A;  2A36 A;  2LQK A;  2ATC B;  4JRI A;  3CCV T;  3CME Q;  4M7D C;  4PJL A;  1ZBX A;  2EYW A;  1VYV A;  1Z9Q A;  4A4E A;  4XAX B;  1PRM C;  5KYW A;  1T0H A;  3BW1 A;  2V8J A;  2DER A;  2DVJ A;  1JU5 C;  4M7D B;  1CSK A;  4BUG A;  3RUX A;  1X75 C;  3EH2 A;  1X27 A;  4M7D E;  1U06 A;  2K3B A;  1OU9 A;  3I55 A;  2PQW A;  4F04 B;  2E3I A;  2YRV A;  1H3Z A;  1PSE A;  2EBP A;  3RER A;  3VS7 A;  1M3A A;  2J06 A;  4PJN A;  4JS5 A;  2KI7 A;  3QZ5 B;  3EFO A;  2RMO A;  2HEQ A;  2LCS A;  4HVV A;  1Q7Y C;  2YRC A;  2L2P A;  2BZ8 A;  4BDY A;  4EPC A;  3CCE Q;  1N8R C;  4PKC C;  1QWE A;  1KD1 R;  4J5Y A;  1VQ9 Q;  2YUQ A;  3EAE A;  1VQ4 T;  3FJ5 A;  3JB9 H;  1OUL A;  2QDL A;  4RTU A;  2YLB A;  1ZBJ A;  2GF7 A;  5CKD A;  3UAT A;  3EGU A;  2O9V A;  5CAI A;  5KCH A;  2CYZ B;  2DTI A;  3CCS A;  2DTO A;  2LVM A;  3OSV A;  4A4F A;  2ROL A;  1OPK A;  1V76 A;  2KYB A;  1TUD A;  5GAN e;  3CD6 Q;  3RIR A;  2V8I A;  2EAY A;  3GIB A;  5HKC A;  5GMK e;  3CCJ Q;  5DM7 R;  1YJW T;  2DVE A;  2QAZ A;  3UPU A;  2LCC A;  1TWB A;  1BB9 A;  2XKO C;  2RK2 A;  4DBR A;  4F7U G;  4LD9 K;  4TVR A;  3LWI A;  3A8O B;  4BI3 A;  2KNB B;  1UGP B;  2VXF A;  2P0Q A;  2BIV A;  2DMO A;  3KBG A;  3LYI A;  1R0C B;  3CXC P;  3CXC A;  1NPR A;  4C5E A;  1GBR A;  1IRE B;  1E6H A;  2RQR A;  2C0T A;  3DB3 A;  4C92 G;  4N4I A;  1ZA1 B;  4M78 B;  2JMA A;  5I11 A;  2MI6 A;  4M78 E;  2O88 A;  5I22 A;  4M77 G;  4OB3 B;  1YP5 A;  1GBQ A;  4JZ4 A;  2YRD A;  1NJI C;  1H92 A;  3VS3 A;  4XU0 A;  2DXC A;  2ENM A;  4M7A B;  1OQK A;  1UFF A;  4HXJ A;  1G5V A;  2WSF E;  4JRP A;  2H3J A;  2KQW A;  2OI3 A;  1YJN Q;  4M7A E;  3CCU T;  2EYZ A;  2LQW A;  3REA B;  1VQ5 Q;  2KRS A;  2QQB A;  1YHQ A;  1Y0M A;  2HD0 A;  1KJW A;  3MP1 A;  4R0K A;  2JOY A;  4LUD A;  3SHW A;  3I56 T;  3FIF A;  2DBK A;  1W6X A;  3CMA T;  4II1 A;  3L1A A;  4M75 C;  1NYF A;  1HSQ A;  5GAN 2;  4HCZ A;  1RAA B;  3PTA A;  4BI4 A;  1Y71 A;  5GJW B;  4DEX A;  1GCQ C;  3LLR A;  1JB0 E;  2Z0W A;  3GF5 A;  4M75 B;  4MZP A;  2RB6 A;  3ZL7 C;  4PJO D;  5EC7 A;  2R5A A;  1VQM Q;  4M75 E;  2KEA A;  4XU1 A;  2JTF A;  1WHK A;  4HCB A;  1Y7X A;  1Q86 C;  2JXB A;  5GJV B;  1S72 T;  2WSC E;  5LJ3 g;  1RAE B;  3N5B B;  3QHS A;  2HL3 A;  4XTY A;  4ZN1 A;  4C8Q B;  4ZGD B;  1I5L A;  1NYG A;  4A53 A;  4MZM A;  3VU3 C;  2CZ0 B;  4C8Q E;  2QI2 A;  1KHC A;  4RKU E;  1QVF S;  3G4S T;  1U1T A;  1N6A A;  5GMK i;  1VQ9 T;  3JAM E;  1JBM A;  3QYG B;  4Q5W A;  1Q7Y U;  1C0M A;  2E64 A;  4RTW A;  3NHN A;  1BI3 A;  1QVG A;  3RR6 A;  1W70 A;  1N8R U;  4OGC A;  3VS0 A;  1HXD A;  3BDL A;  2OTJ Q;  2FRW A;  1UHC A;  3OMC A;  1KQS S;  1WHJ A;  3E19 A;  2QQR A;  3R6N A;  1RAC B;  3QSU A;  4AFS C;  4DBH A;  1VQP A;  3MJX A;  2DL7 A;  2MF2 A;  1I1J A;  3GNF B;  1K9M R;  1BIA A;  1XJW B;  2WAC A;  4BB7 A;  4AFZ C;  5J3B A;  1I0C A;  3JSC A;  1ZX6 A;  2JJ9 A;  1IGQ A;  2YLC A;  1OX8 A;  2E5K A;  2CT4 A;  1ACM B;  2AIR B;  4MZT A;  1EIF A;  2LDM A;  1PSF A;  2K57 A;  3RES A;  2CP0 A;  4C5G A;  4C92 F;  5C6S A;  3CPW S;  2PVD B;  4NS5 A;  4KUI A;  3JCM V;  5GAN g;  4ORZ A;  1PC0 A;  4XK8 E;  1N27 A;  1YJ9 A;  4QQ6 A;  1YIJ T;  2RJE A;  5GAO r;  2SEM A;  1Q82 R;  1YIJ A;  2A7Y A;  5CIU A;  3L2R A;  2A28 A;  2LJ1 A;  2KGT A;  1VQ5 T;  1XTD A;  2ED0 A;  2CUB A;  4IUR A;  1M3B A;  2DRM A;  1NJI U;  3GPL A;  2DYI A;  1C6V X;  2GTJ A;  2XIC A;  2X9H A;  1K73 R;  1M4Z A;  3GNG A;  2XDD A;  2L8D A;  3CC7 T;  1QCN A;  4HVU A;  2QAS A;  4KGX B;  2LP5 A;  2QQA A;  5GAO q;  3M9Q A;  2QTV A;  1MNE A;  3JCM c;  5GAN 3;  5LJ3 d;  1JO8 A;  1D3B A;  1MUZ A;  2LC4 A;  3JB9 F;  3OBW A;  1RL2 A;  2FYK A;  4Z89 A;  3RKW A;  4J6X A;  4PLI A;  3C4S A;  2LX9 A;  2DX1 A;  3I9Q A;  4DOW A;  4C92 C;  2KBT A;  5GAO n;  1RAF B;  4BY6 B;  2PVO B;  1B34 A;  1B7T A;  5KYW B;  2OTL A;  5KYN A;  1TUG B;  2K4Y A;  4M77 C;  1WFW A;  4L5G A;  5CKB A;  1M90 R;  3CC4 T;  3EFS A;  3OYJ A;  3MET A;  1NPP A;  1OZ2 A;  2R57 A;  1BI0 A;  2AKK A;  1VQL T;  4C5I A;  2EJ9 A;  2GBQ A;  3CC4 A;  2E6N A;  3NTI A;  1TTH B;  3M5A A;  5I2S A;  1UJY A;  5DY9 A;  5LJ5 j;  3A8H B;  4B9X A;  2DIG A;  3JCM e;  2G3R A;  5GAN 5;  4E7S A;  2NUZ A;  2FRY A;  1KD1 C;  3MEU A;  4IUT A;  5CQX A;  3EFO B;  5IT9 E;  1VA7 A;  3CCR A;  4EMG A;  2W10 A;  4FYY B;  1MHN A;  4CC7 A;  2CSI A;  5FW9 A;  2K9G A;  2FPE A;  1SSF A;  2EQI A;  4OF1 A;  1FMW A;  1WI7 A;  1YI2 T;  4NOY A;  2O9S A;  3FLG A;  2OX7 A;  1GRI A;  1TS9 A;  4HCC A;  4RTX A;  2MPX C;  4E7H A;  3MO8 A;  3EG1 A;  2VB6 A;  2L3S A;  2LQ8 A;  3L2W A;  4UC4 A;  1AWJ A;  4M78 G;  3OW2 S;  3ER0 A;  4PLL A;  1ZSZ C;  4MMK A;  3QZ9 B;  2C0I A;  5GAN d;  3CC2 A;  2D1X A;  1TOV A;  1BK2 A;  1MMG A;  2IIM A;  3MHX A;  2RJD A;  1FMK A;  2OAU A;  3QDF A;  4PNO A;  4C0G A;  4C0Z A;  5FU7 C;  1DJ7 B;  2KR3 A;  3I55 Q;  1SHF A;  3A1P A;  4E7J A;  2DA9 A;  2E6Z A;  2CRE A;  2EIF A;  4M7A G;  1H3H A;  3CCM T;  2IG0 A;  4J9I A;  2QA4 A;  1IHW A;  1OI1 A;  4FSS A;  1O75 A;  2YUP A;  1M2V B;  3H9N A;  3IQL A;  2O4X B;  4J9C A;  5FU7 B;  4OMM A;  2D9T A;  1QVF P;  1VQ6 A;  1QVF A;  2DJQ A;  3M54 A;  3FEO A;  5CKF A;  1VYT A;  1FMV A;  1QWF A;  2HSE B;  1M5Q 1;  4ZTJ A;  1VQK Q;  3X28 B;  2QYZ A;  2SRC A;  1LJO A;  4X34 A;  5CVI A;  1YIT A;  2ROT A;  4Y91 A;  5FRM A;  3A8L B;  2V1R A;  3G1J A;  4PJO F;  2QEX T;  3VV0 A;  3FRN A;  1QCO A;  1PRL C;  3H6Z A;  2QEX A;  1KQS A;  2BE9 B;  3CCS Q;  2EQJ A;  4HKE A;  1G3T A;  3VS2 A;  2F1L A;  2V8K A;  1NE8 A;  2JUF A;  2ABL A;  3EGX A;  4M7D F;  2COW A;  2HL5 C;  5LJ5 e;  3V7C A;  3G71 T;  2P4T A;  1UGV A;  2NYS A;  3LH0 A;  3PIP A;  1X2K A;  3ZBD A;  1LOJ A;  2LT1 A;  2K3X A;  5IAY A;  2Y4X A;  4O5V A;  3ULR B;  1SSH A;  4RTZ A;  4QKU A;  2QK0 A;  8AT1 B;  1QQJ A;  4MDW A;  5DLO A;  4FYV B;  1RAH B;  3QXE B;  4C8Q G;  4M4Z A;  2RH2 A;  4AG2 C;  5I2M A;  2YXY A;  2DFU A;  4DBQ A;  2VGN A;  4WTO B;  4N4G A;  1G3W A;  3PMT A;  3JCM P;  1HYO A;  1VYU A;  4OGE A;  2E1H A;  3CPW P;  5CKH A;  3VUZ A;  3CPW A;  5D7U A;  1ABQ A;  2KAF A;  5GMK j;  4NL3 A;  4LDY A;  1HJD A;  3HRS A;  4XTU A;  2Y90 A;  1R77 A;  3R6O A;  3CCL A;  2KT1 A;  1MV0 B;  2QXF A;  1PG5 B;  4Z8A A;  4C92 D;  5HK0 A;  4EMK A;  1CKA A;  2XID A;  4IUP A;  2FG0 A;  1TSF A;  2J6K A;  4ZGJ B;  2NUP A;  1YHQ Q;  3EH1 A;  2QTX A;  1ZLM A;  1ARK A;  5GAM h;  2EJG A;  4OMO A;  1BYM A;  1NBE B;  4OVA A;  2D8H A;  3CCV A;  1M1F A;  2H8H A;  1KD1 U;  2JN0 A;  1M9S A;  2O31 A;  2VGM A;  5FWB A;  3C0C A;  4DBF A;  1M1K C;  1VQN T;  3SB2 A;  3EHR A;  1T3L A;  1TUC A;  4JRK A;  3JCM J;  1YNZ A;  1K9M C;  4FT4 A;  4PK4 A;  5FRN A;  2CZ1 B;  2O01 E;  3G6E T;  1MMN A;  1MGQ A;  4AT1 B;  2HBP A;  3CCQ T;  3JCM g;  4A63 B;  2X3X D;  3DB4 A;  4LDW A;  1M3C A;  2KT8 A;  3E2U A;  3PVQ A;  2G6F X;  3GOX A;  3CQT A;  4OML A;  1OEB A;  1YCS B;  3J80 E;  2GTO A;  2JNG A;  3JB9 D;  5CQY A;  4M7A F;  3CPF A;  1LVK A;  1QVP A;  4BE1 A;  2M1H A;  4F14 A;  1VQ4 A;  4LXC A;  2CT3 A;  2BKD N;  5GAN 4;  4CC2 A;  4DQ2 A;  4IKF A;  5EG2 A;  2E65 A;  5FRO A;  1VQK T;  2CGH A;  2KXC A;  1QP2 A;  4XTW A;  3L2U A;  1UGR B;  1WXB A;  3A8M B;  2DXU A;  3ME9 A;  3EG3 A;  1K73 C;  3S3O A;  3SWN A;  4IIM A;  1K76 A;  3OYD A;  2CUD A;  2YWW A;  4M75 F;  5D6X A;  2C06 A;  1YJW A;  1BCM A;  2RQT A;  3HPW A;  2E5Q A;  3PIO A;  1R0B G;  2E41 A;  4M78 C;  1VQO T;  4YTL A;  1XNI A;  1MMA A;  5KYU A;  4FIB A;  1VUB A;  1M8M A;  3X25 B;  2FVU A;  1ZHI A;  5LJ3 f;  1FYN A;  1XOV A;  2K79 A;  4M7A C;  4LUE A;  1ZSZ A;  2GFU A;  3RBB B;  1KK7 A;  2K6D A;  1MMD A;  4DA4 A;  1LNX A;  2E10 A;  2HQX A;  2XU8 A;  2RHU A;  3EGD A;  1BBZ A;  1VQ8 T;  2COY A;  3RKX A;  2A3L A;  1K8A C;  2LNH B;  1VQ7 T;  4EMH A;  2VV5 A;  5LJ5 g;  2XDP A;  2XI9 A;  1NG2 A;  2I0N A;  1YJ9 Q;  2F2W A;  1PNJ A;  3CCU A;  3I5S A;  3L2Q A;  2I2L A;  2RN8 A;  3EHQ A;  1GCP A;  4JLI A;  4KH1 B;  2ZPG B;  3I56 A;  3RDV A;  1U8R A;  3CME T;  3WVD B;  2KYM A;  3CMA A;  2XDB A;  1BIB A;  1V1C A;  2MAM A;  1SPK A;  3OQ5 A;  3JCM d;  4XQ3 A;  1AOJ A;  4HVW A;  9ATC B;  2HQH A;  3OS0 A;  2F2V A;  2AKL A;  2K5F A;  5GAN 7;  3QJ6 A;  1PKS A;  4N0A C;  4CC3 A;  4LNP A;  3V8J A;  4C8Q C;  3QUI A;  2BTT A;  2KRM A;  3FC3 A;  1YWO A;  3E1S A;  3M0U A;  1M1K U;  4M7D D;  1SRL A;  3GP8 A;  3M0T A;  1UEB A;  2DKG A;  1S72 A;  1K9M U;  5I21 A;  4PFO A;  3CEY A;  2CZ6 B;  4ME7 A;  2OTL Q;  5GAN f;  1X43 A;  1LCK A;  4E7I A;  3CCE T;  1PD0 A;  5A0D A;  1RAB B;  1BI2 A;  4QVZ A;  3QBY A;  3OYB A;  3O8V A;  3A8G B;  1U3O A;  1UGQ B;  2WSE E;  5A2Q E;  2X3W D;  3G4S A;  4J9H A;  1IB8 A;  1VQ9 A;  3SDZ A;  2RI3 A;  2HSP A;  1AVZ C;  3M0R A;  2PUO B;  1KC8 R;  1QVG P;  3A5Z B;  5IHI A;  1WZO A;  3X20 B;  1QCF A;  1WQW A;  4QW2 A;  2L89 A;  1JJ2 S;  1UG1 A;  4LDV A;  5KYX A;  2LNV A;  1IHV A;  1ZUK A;  3OS1 A;  4PJO A;  5LJ3 h;  3CCR Q;  4XTX A;  3CD6 T;  3JB9 I;  4B6M A;  2DXT A;  4E6R A;  2PNI A;  2VYT A;  4OMQ A;  2RQV A;  3CCJ T;  1G2B A;  4JJD A;  5CKE A;  4M7D A;  5CR2 A;  2DEQ A;  2XHC A;  2AZV A;  3PGG A;  4F7U F;  1TU0 B;  1WA7 A;  3J81 E;  3QYH B;  2VVK A;  4HA8 A;  1WQ7 A;  1Y07 A;  4HCK A;  2KK4 A;  4E2F B;  5KE3 A;  2BZY A;  1G8X A;  1K73 U;  3VKI A;  3EGX B;  4C0D B;  1N5Z A;  5LJ5 d;  3CC2 Q;  3PT9 A;  4OB0 B;  2EYY A;  1YBY A;  1M30 A;  2RI5 A;  4M77 F;  3AT1 B;  3MPU B;  3Q1J A;  3M55 A;  1FX7 A;  1IO6 A;  1N8R R;  1WHL A;  3TVT A;  4GY5 A;  4DOV A;  1YJN T;  2HBW A;  3BDU A;  2VC8 A;  1Q81 R;  1Q95 G;  4RMO A;  2VXE A;  4M7A D;  1VQ5 A;  1K8A U;  4AG1 C;  2M9U A;  2X4J A;  2CDT A;  2JMC A;  4WF2 A;  2BE7 D;  2X4W A;  2D8J A;  3CC7 A;  2YHT A;  5GAM e;  3L2Z A;  1OYX A;  1J3T A;  1UE9 A;  2EGA A;  4PJM A;  5GAN h;  3MP6 A;  4BY6 C;  3QWX X;  2P84 A;  2DXB A;  1AWX A;  4D8D A;  3PNW C;  3H0H A;  5GMK h;  2NUP B;  1UJ0 A;  2LRQ A;  1SF9 A;  3UF4 A;  2KY9 A;  2E12 A;  1VQM T;  4JLG A;  2CP7 A;  1VOM A;  4KGZ B;  6AT1 B;  2AT1 B;  3OYY A;  1QLY A;  1YN8 A;  1G3Y A;  1QP3 A;  4FT2 A;  5L23 A;  3TU4 K;  4M75 D;  4AFQ C;  1NM7 A;  4JZ3 A;  1EZZ B;  2GGR A;  3G7Z A;  4GLM A;  3VRY A;  4XU2 A;  2QDY B;  4ELZ C;  1VQL A;  1RI9 A;  4FYW B;  3JCM Q;  1WHH A;  1I81 A;  2ZCF B;  3HKS A;  2FB7 A;  1KFZ A;  3SD4 A;  4L59 A;  1OPL A;  2RHI A;  1WXU A;  1FWZ A;  2K5I A;  4LDU A;  3CCL Q;  1W2B S;  2OTJ T;  4ELY C;  4QVC A;  3M58 A;  4E7Z A;  3V8L A;  3M56 A;  3M0P A;  1AT1 B;  2FL7 A;  2MMP A;  3OBY A;  1KQ1 A;  4X9C A;  1C1A A;  1YI2 A;  3KFV A;  3UDC A;  1AEY A;  4RTY A;  4M75 A;  1YWP A;  1RLQ C;  1TXQ A;  2E70 A;  3L2V A;  3MCA B;  4Z02 A;  1GCQ A;  3JCM b;  2DL4 A;  3BY7 A;  5KE2 A;  2K7A A;  4NL2 A;  3HL8 A;  1N9S A;  2X51 A;  2A08 A;  3JCM X;  1D0X A;  2RHX A;  3UWN A;  3V7S A;  4LN2 A;  5IHN A;  2CH4 W;  2VUB A;  3OYH A;  1QMC A;  1Q86 R;  5GAN 6;  2FZC B;  5D6W A;  2JTE A;  2CP6 A;  3CCM A;  2M0Y A;  3CBP A;  5M9O A;  1H8K A;  5GAO m;  2Y4Y A;  4J9G A;  3UA7 A;  2HDA A; 
#chains in the Genus database with same CATH homology
 1TOV A;  2E4H A;  2M02 A;  1WHH A;  1WHL A;  4B6M A;  1WHG A;  2COW A;  2HL5 C;  2CP5 A;  3E2U A;  2MPX C;  2CP0 A;  3TQ7 P;  1WHM A;  2E3H A;  2HL3 A;  2HKN A;  2HQH A;  2Z0W A;  1TXQ A;  2CP2 A;  1WHJ A;  1IXD A;  2COZ A;  2CP6 A;  2COY A;  2E3I A;  2HKQ B;  1LPL A;  2CP3 A;  2QK0 A;  3RDV A;  1WHK A;  2CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...