2E4HA

Solution structure of cytoskeletal protein in complex with tubulin tail
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords Restin
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e4hA00
1LPLA 2CP0A 2HQHA 2Z0WA 1WHHA 3E2UA 2HL3A 2QK0A 2COYA 1IXDA 2E3HA 2COWA 2CP5A 1WHGA 2E4HA 2CP2A 2HKNA 4B6MA 1TXQA 1WHMA 2HKQB 1WHJA 2MPXC 2M02A 1TOVA 2CP7A 1WHKA 2CP6A 2COZA 2HL5C 1WHLA 2CP3A 3TQ7P 3RDVA 2E3IA
chains in the Genus database with same CATH superfamily
1HJDA 2K7AA 3JB9H 1LNXA 3ER0A 3FC3A 2NWMA 4HCBA 3EHRA 1PD0A 1G5VA 2P0PA 2QG9B 2LCSA 2KYMA 2XI9A 3LGLA 1WHJA 2J06A 2K57A 4KUDK 3EFOB 3LWHA 2EYWA 2NYSA 1GCQC 2RQRA 4QQ6A 1SRLA 4XTWA 2NUTB 3L1AA 4PJOD 5GANh 5L8RE 3PMTA 1UGQB 5HK3A 4PJOC 4J8OA 3M5AA 1C1AA 1ZUUA 2DPPB 3RMSA 1WJQA 4PJOE 3M9QA 4BACA 4IUUA 2HKQB 2MF2A 1YJ9A 2CH4W 4XU3A 3TQ7P 1JU5C 2P4TA 4Z89A 1YHQQ 5GMKe 3CCQQ 1JB0E 4WCIA 4M4ZA 1M2VB 1VQ5A 5GAOn 1F1BB 3GBQA 4ELYC 1NLPC 3FDRA 2MYSA 4QW2A 1KJWA 3M54A 2LQNA 3SD4A 1Q7YC 4EIKA 4C8QF 3JB9F 3RKWA 5IN1A 2MIOA 4M78A 4RUGA 8AT1B 1H92A 2JW4A 2LCCA 3QSUA 2P0QA 3CCMT 2DL7A 3RNJA 1HSQA 2VV5A 2DYIA 2O9SA 3UA6A 3EFRA 1Q81R 2K2VA 2ROTA 2RJEA 1QVGA 4M78D 4KH1B 1CKAA 9ATCB 2X4WA 4RCCA 2MCNA 1WJRA 1IB8A 2O4XA 1C0MA 3ASKA 2W0ZA 3CCMQ 1JBMA 2ED1A 2JXBA 2JVVA 4C8QB 2AHJB 4C8QG 1QWFA 3JB9G 2L2PA 2C0TA 4BI3A 3CD6A 3VS7A 5FRMA 4N4HA 2QQ9A 3G6EQ 4C0DB 1BK2A 3UT1A 2L89A 2B8AA 4LXCA 4M7DA 3M56A 2GNCA 1X43A 4M77E 2KROA 5IXBA 2KXCA 2OI3A 3OBWA 2X4XA 1YI2T 2O01E 3H0FA 1WIEA 2P84A 4B9XA 3A8MB 2EQKA 2GFAA 2RPNA 1YN8A 1Y57A 2DIGA 2BIVA 3CC4T 1YITA 2PZ1A 3UATA 1UGPB 2X3XD 4KGZB 1GFDA 3BDUA 2XDDA 1W1FA 4XTXA 1ZSZB 4DA4A 2KRMA 3H41A 4OMNA 3ULRB 1S72Q 4WTOB 2QI2A 3CPWA 5LJ3j 2V8KA 1TUCA 4OB0B 5DLOA 3CXCP 1G3YA 3OW2A 5D6XA 3MP6A 2BE9B 2HBPA 3QKJA 1VQ7Q 4C0FA 1XQHA 3JCMg 1J3TA 3JCMe 2QEXQ 1VQPA 1AHJB 1JJ2A 3PNWC 2QEXT 3G4ST 3FJ5A 5GANg 3OW2S 2X9HA 1AOJA 2DFUA 5LJ3g 2KAFA 2ECZA 3OYNA 4DOVA 1KC8C 4J6WA 1JRIA 3JAME 3RESA 3A8HB 4M77C 1PC0A 1NJIR 1FYNA 4PJMA 2EYQA 3EGXA 2KGTA 1MHNA 2JMCA 4M7DC 5FWCA 2XIDA 3M0TA 4F7UE 2GCXA 2VKNA 1WHHA 2AT1B 2X3WD 2DERA 1QKWA 1XOVA 1W2BA 2VXEA 1N8RC 2E5KA 3CCUQ 1FMKA 4BY6B 4MZTA 3JCMb 2OTLT 2J05A 2K79A 1YJNA 1M90C 1ZQ1A 1QVFS 3WVDB 1UE9A 2LTOA 2QA4A 1WFWA 2A7YA 4C92A 5GANe 4HCKA 2YSQA 2A0FB 5DLQE 4LUDA 2FPFA 4M78G 1UDLA 5GMKh 4FW2A 4OMQA 4CRIA 4E47A 5GANd 1SEMA 2CSQA 5GAN2 2L8DA 2CGHA 2ZGWA 4XU1A 3X24B 1UFFA 4PL6A 5DM7R 1U5SA 2D1XA 2VYTA 3OMCA 2KE9A 3QO3A 1WXUA 2LNHB 4JRKA 4RCBA 1PRMC 4EMKB 1M8MA 2L3PA 1LOJA 4Q5WA 5CR2A 2LC4A 1S72T 3DKMA 2FZCB 5FW9A 5CKDA 3A1PA 1YWOA 1Q7YU 2WSEE 4KGXB 2MWOA 3JB9I 5KYUB 4IUPA 2CH4A 4C5IA 1K9MR 2DEUA 1D3BB 3BE3A 3S3MA 1AVZC 1TWBA 2CZ6B 4JZ4A 2V1RA 3CC4Q 3M0QA 1IRXA 1BI3A 1JXMA 5EG2A 1I5OB 1EFNA 3TREA 1G2BA 1Y96A 3OS2A 4IKFA 5IH2A 3PVLA 1VQOA 1VQLQ 2KK4A 5GAMe 1QCFA 3EGUA 1Y07A 2L3SA 4AG1C 4CC2A 3CCLA 1G83A 5FU7B 1T0JA 2JT4A 1PSEA 3RDVA 2HSEB 5LJ3h 2DTOA 3KXTA 3JCMJ 4Z02A 4M75D 1YIJT 2DAQA 5A0LA 4A4HA 1WXBA 3VJPA 5LJ5d 2X4YA 5KYNA 1Y0MA 4JJCA 3HHTB 3FJPA 1RUWA 1M3AA 1LVKA 2RM4A 2COZA 4BE1A 1T3LA 3QWYA 3L2VA 4RKUE 5J3BA 2F2WA 4M75A 3JB9J 3WVEB 2DXBA 1YITT 4RMOA 3CC4A 3TVTA 2EFIA 4LDWA 1W70A 1OPLA 2K4YA 4JS4A 2A3LA 5GAN4 2EWNA 3OYEA 5KYWA 1IHVA 1VIFA 2EJGA 3SEMA 5L23A 2PQWA 2ZZDA 2QTXA 1TSFA 1RAHB 1WHLA 1WNLA 2VGNA 2L0AA 2JS2A 4OP0A 2FZGB 3V7SA 1W6XA 3OYBA 3HSBA 4FT2A 3Q1JA 1VQ6Q 3FIFA 4XTYA 3HL8A 3OYJA 2RHIA 3TSZA 2BZ8A 4IUQA 4RTTA 2FO0A 3SWNB 2BTTA 4OF1A 4EMHA 3RMQA 1QW1A 3MEAA 3QDFA 1SPKA 4LUEA 3VS5A 4HA8A 3TCJA 2RJCA 4L59A 2E10A 4PNOA 3V8LA 5GAOr 5LJ5e 1SG5A 3OYYA 1ZA2B 2V26A 1M4ZA 1OPKA 1NBEB 3N5BB 1JO8A 4E7SA 2DILA 2QYZA 4L5GA 4HVVA 4AT1B 1QCNA 1GBQA 2COYA 3OY9A 1VQMQ 5CKBA 3GF5A 2J6FA 4XAXB 2YUNA 2NUZA 2ZPGB 2DVJA 2K9GA 2DXUA 1OEBA 4XU0A 1BIAA 2VUBA 2K5LA 3BDLA 2SRCA 2M16A 4MMLA 4QQGA 2I2LA 2CP0A 4BD3A 2DMOA 1E6HA 2BZXA 2X35A 3JCMW 2P0KA 1GL5A 1BB9A 2RA2A 1IHWA 2VASA 1D1CA 2R58A 3AT1B 5GANf 4NS5A 1IREB 2LRQA 5GJVB 2EIFA 1D0XA 1GCQA 1YITQ 3VRZA 3JCMc 2DXTA 1RL2A 3CCLT 1HD3A 2RHXA 2KVQG 4ZN3A 2M0OA 3KFVA 2E3IA 1LPLA 3V8JA 1LCKA 1G3TA 3LGFA 2QXFA 1WQ7A 1U06A 5CKFA 5KE3A 1AT1B 1AWXA 2CYZB 3EFSA 3NTHA 2QQBA 5IT9E 4PLIA 2DIQA 1AWWA 1OZ2A 3EHQA 2ZPBB 4HVWA 3C0CA 2LT4A 3CCEQ 4XTVA 3GNGA 5GAMj 2FEIA 2LX9A 2OTJA 4E2FB 4M78B 1M3CA 1UGRB 2RI3A 4JRIA 1TXQA 5EC7A 1ARKA 2MPXC 4LDUA 2F5KA 4R0KA 4C92C 2CUDA 5FU7C 4KGVB 2KT1A 1K73R 4M77F 2OAWA 4C92E 2OTLA 1M1KR 3X20B 4PFZA 3VYHB 3JCMP 2CP5A 4J7IA 1MV0B 1X2KA 4E7IA 3H9NA 1NE8A 2KYBA 3RKXA 3VS6A 4JZ3A 8ATCB 2YLBA 4PFPA 3QZ9B 3QJ6A 5GAN8 4J6YA 2DK3A 2DETA 1NEGA 2JTMA 3I55T 1SF9A 2RN8A 3I55Q 4J9BA 3MHXA 2E64A 2QAZA 3EGDA 3J7AF 2R5AA 3HKSA 3OYCA 2H3JA 1I1JA 4IUVA 2DL3A 4M77G 4N0AC 3VS2A 2R5MA 6AT1B 1K8AU 3EG9A 4E7KA 3MKDA 2FB7A 3BY7A 1PWTA 2HQEA 1ZUKA 3CCRT 1UGVA 1R0CB 1YCYA 3A8GB 4PJOF 3OYHA 3NTKA 3UDCA 3H8ZA 1Q7YR 1JXOA 4ZNXA 3CPWP 4C8QA 2XHCA 1U8RA 5KE2A 4GLMA 2QGFB 1KFZA 2NUPA 1R8OB 2J6KA 3V7CA 2CSIA 4FYYB 1D0YA 2K3BA 2JZ2A 3OYGA 4PJJA 4LD6A 2DZ9A 1YP5A 3MEWA 1Q82U 3S6WA 5CKHA 1FWZA 2JTFA 3JCMd 2F2XA 2PNIA 2P4RA 3CCQA 1WI7A 2KSSA 3QDRB 5M9OA 2GGRA 1Y96B 2YWWA 2CS7A 3I5RA 2DD5A 2D0QB 1MMNA 1TTHB 3CC7Q 2QQSA 4QVCA 1Q82C 1B7TA 1UHCA 1K9MU 3G6ET 3RIRA 2VC8A 2W10A 4ME7A 1SRMA 1QVFP 2DVEA 5LJ5g 3RERA 3LW5E 1WYXA 5CVIA 2YUPA 4F7UB 1H641 1KHCA 4M75C 1RI9A 2QDLA 3EH1A 4OB1B 1AWJA 4FIBA 4FCYA 2E41A 3CCSQ 2GF7A 1BI0A 1VA7A 1ZA1B 2JTEA 4II1A 4DQ2A 5GAOq 5GAMh 3VS0A 4NOYA 5A2QE 3C95A 1S1NA 2KBTA 3P8HA 1ZX6A 3SDZA 2K3YA 3E19A 3KBGA 3PMIA 5KYYA 4DBFA 4CI0C 5GAN7 4M7DB 1VYUA 4Z88A 3FEOA 2DZCA 5IAYA 2EQUA 4DBHA 1NEBA 2J7IA 4BE0A 4ANJA 3WXMB 1ZUYA 1YJNQ 3I5SA 3MJXA 1I81A 2JUFA 7AT1B 1M90U 3L2UA 1UUEA 1Q86U 2KDSA 2I0NA 3RR6A 1TUDA 2OTJQ 3SWNA 3OYMA 5FU6C 2A28A 2HZYA 1UJYA 1QP3A 4LD9K 3EG0A 2PUKB 3OSVA 1BCOA 1QWEA 4J7FA 1U1TA 3PIOA 1OX9A 4FSSA 2CKKA 3CCUT 4QT7A 5GMKm 3JCMQ 2QGGA 4QQDA 2FRYA 2OTLQ 4D8KA 3CC2A 1IXDA 2GFUA 2YRCA 2DRKA 5GAOp 2ZPHB 4KBMB 1RADB 3I56T 3P8DA 3CCUA 3CMEQ 3OYKA 2E5QA 3OS1A 5KYXB 2LQKA 3QBYA 1MNDA 1TU0B 1B3QA 2DLPA 2FHDA 4QVDA 3CD6Q 3CBPA 2KNBB 1YJ9T 2QA4Q 1PG5B 3PGGA 5FWBA 3G4SA 1KD1U 2XU8A 1NYGA 3O5ZA 1MMGA 4J9CA 3R6NA 3DLLA 1XJWB 2DM1A 1T0HA 2LJ0A 2HSPA 1M1GA 3VYGA 4LDXA 2MMPA 3EFOA 5GAOm 1VQKT 5D6WA 2DF6A 2DA9A 4LDVA 4MDWA 4K11A 1EZZB 2EQJA 3CBOA 1KQ2A 1M1KU 2QQAA 2COWA 1K8AC 3HP9A 2PVOB 2CT3A 3A8OB 3META 4PK4A 4AMCA 1VQ8Q 2M0YA 2AZSA 5GMKj 3G4SQ 1TS9A 2KRNA 1O9SA 4DEXA 3JCMV 1X6GA 2AIRB 2QEXA 5CK9A 3A98A 4KH0B 4R55A 2F1LA 1RAIB 5CO7A 2RJDA 2RNAA 1M2VA 4YTLA 3OYLA 3G71Q 3L42A 2HNIA 3QJYA 2FPEA 2BKDN 2JJ9A 5LL6S 3PIPA 1FX7A 2DTHA 4FM4B 3VV0A 1Z9QA 2D6FA 2LJ1A 4ZTFA 3GIBA 2XKOC 1VQ9T 4O5VA 3NGPA 3X26B 2HEQA 1KQSA 3L2QA 1VQ9Q 4FYXB 1V1CA 1FMWA 2QK0A 1QVFA 1XTDA 1K76A 1QVGP 3CCRQ 4HT9A 3UA7A 1X01A 3CXCA 3OW2P 2JM9A 1QVPA 4C5EA 3PTAA 3VKIA 5A0GA 4BE2A 3C4SA 3L2WA 3MO8A 2FVUA 3NMZC 5GJWB 3CEYA 4M75G 4OGCA 2HL3A 2YXYA 2E6NA 2ZAEA 2Y4YA 1D3BA 1WLPB 4JJDA 2E70A 3VS1A 2VB6A 1MMAA 2F5TX 2F2VA 4TVRA 4NL3A 4M7AF 4OB2B 2KMTA 5HY6A 3QZ5B 2GQVA 4JJNK 1VQ9A 3IQLA 2PU9B 2G6FX 1HXDA 4AFZC 5GAMd 3QG1A 1NJIC 2RHYA 3CCST 1BIBA 2AKLA 2CZ1B 3ZBDA 2RD1A 3HPWA 4AFUC 1OI1A 1VQ7A 4RTXA 4C92D 3NFCA 4EDUA 3GNFB 2JS0A 1RAGB 1VQKA 3CBMA 4DOWA 3LH0A 1OU8A 3QYGB 3M4YA 1P92A 4RTVA 2EW3A 1Z9ZA 1PKTA 3LH5A 1H3ZA 1AZEA 2D8JA 4ZGJB 3OQ5A 2DXCA 3PFSA 1OX8A 1NG2A 2K2MA 1VQOT 1N9RA 2HQXA 4FU6A 1HK9A 3G1JA 2GBQA 1G3WA 1RAFB 1UB4A 1EIFA 1GFCA 2AK5A 2O9VA 1GXIE 5J26A 2ZPIB 1ZSZA 2NLUA 3E1SA 1AWOA 3EH2A 4M75E 1NZ9A 2EBPA 1KSWA 1RACB 3CC2T 2E4HA 3CMEA 4PJOG 5KCOA 4LDYA 2EQIA 4PKCC 1ZSZC 2AZVA 5KYWB 3JRZA 1K0SA 1CKBA 2DJQA 4HCZA 3I9QA 2DNUA 2VGMA 4EMKA 5LJ5j 3M0SA 2IG0A 2R57A 1YJNT 3E9FA 3I56Q 3EG9B 1PKSA 4E6RA 3MCAB 4A54A 1ZHIA 4X34A 2C06A 5GAN5 2X4JA 2XD0A 5LJ3f 1KD1R 2YHTA 4RTZA 1QQJA 1YJ9Q 1BBZA 3OA6A 4M78E 2O4XB 1X75C 5D7UA 1VQNA 4RG8A 2RI2A 1K4US 4GBQA 1OULA 3CC7T 5IHNA 2CP2A 4M7AE 1Q82R 1QMCA 1H3HA 3QPHA 1WPYA 4AG2C 1LJOA 2LZ6B 5LJ5f 1I8FA 5GMKl 4BDZA 1WJSA 2HQHA 3I56A 2ENMA 2E3HA 1VQ4Q 1JJ2P 3OYDA 1M9SA 1JEGA 4C8QE 1V76A 1I4K1 2CP7A 1R0BG 1V29B 2QDYB 5FLXE 2Y90A 1WXTA 3L2ZA 2CP3A 4PLLA 4EMKC 1UJ0A 1PM3A 4OMPA 3H0IA 1UTIA 5KYYB 1Q86R 4M7DE 1YBYA 2K6DA 5IHKA 4M77A 3CC2Q 1VQMA 1NM7A 2MWPA 2O31A 1I0CA 1G3SA 2KXDA 4AFSC 3INZA 2CZ7B 3KUFA 2EGAA 4BUGA 5GAMg 2YDLA 2LQ8A 2M9UA 2X51A 4UC4A 4N4IA 2DO3A 3S3NA 1I5LA 4C92F 3PE0A 1KHIA 3RUXA 3C94A 3QYHB 4ZGDB 3CCJQ 3THKA 4J83A 2EGEA 3JCMh 1VQ4A 1MMDA 4PJOB 2LCLA 2FRWA 5I2MA 1Q86C 1OV3A 2KRSA 1R77A 1HYOA 1BI2A 1X6BA 2EVRA 4KUIA 3QHSA 3CCQT 2J6OA 3CPWS 1N27A 3O8VA 3CMAT 4E7JA 3M58A 2KY9A 1VQPT 2CREA 4L6V5 2VXFA 1H8KA 4PJOA 5KYXA 2AKKA 3CD6T 4BI4A 1VQ8A 1EX4A 2DE0X 4F17A 1YJWQ 3GOXA 4JJBA 2LP5A 4M7DG 3L2RA 2EJ9A 3EG3A 1M27C 1W4SA 4HVUA 1VQPQ 1GRIA 3JV3A 5CAIA 2RQWA 4E7LA 4CC3A 3M57A 3HRSA 3SB2A 2RHUA 1SSHA 3M0UA 4B6MA 4NL2A 3VUZA 1ZBJA 5GAN6 3VS3A 4DBQA 2BZYA 2QQRA 1U3OA 3H0HA 1N5ZA 4C0ZA 1YI2A 4A53A 3CCMA 1N6AA 1WX6A 4M77B 3BW1A 1RAEB 3M55A 4LE9A 3CQTA 2Y4XA 3M59A 1YIJA 4ESRA 1VQ6A 2D0NA 2OJ2A 1M8VA 4OMLA 2EAYA 4KRTA 1WHMA 4C0GA 1D1AA 4M7AB 4PJNA 4WF2A 4P5NA 1VQMT 3M53A 4M7DF 4RG2A 2KI7A 4F14A 3LX7A 1QLYA 1UHFA 1YNZA 4XTUA 4E7ZA 1K8AR 1K9AA 3PVQA 1Y7XA 5CCAA 1K73U 2L3RA 5FRNA 2D8HA 2RK2A 1TH7A 1YFNA 1E6GA 4F16A 1B34A 1YHQT 3QUIA 1VQNT 1IGUA 2IIMA 2QASA 2NUTA 1BKBA 2HD0A 3CC7A 5LJ3d 1DJ7B 1VOMA 3UF4A 2RJFA 1W2BS 2L3QA 3UWNA 1E7OA 5LJ3e 1RAAB 3BFMA 2ZCFB 1Q81C 1S72A 4HT8A 1KQSP 3NPFA 4M7DD 2ZPEB 3ZL7C 1ZSGA 1UECA 1YJWT 2DL8A 1GBRA 1SHGA 4IURA 1N9SA 4JLGA 1WDXA 1Q81U 2EYZA 4FYVB 2XDBA 2Z0WA 2OTJT 4Y92A 1D09B 5J39A 3AHUA 3URGA 1IO6A 1PSFA 1NPPA 5IHIA 3MP1A 3CMAQ 3MEVA 1RABB 1BU1A 5CKEA 2RQVA 2MAMA 2RO0A 5KYUA 2MK5A 1QP2A 4Y91A 1YHQA 4XQ3A 4J5YA 4ELZC 3M0RA 4C5GA 4E7HA 2OAUA 1PHTA 1M1KC 2HAXA 5DY9A 1WZOA 3HFOA 4AFQC 3QXEB 2RI5A 3REAB 2PUOB 4ZGEB 4FT4A 2QA4T 3ME9A 1T3SA 2A36A 4LN2A 4F7UA 4JUVA 1K0XA 4MDXA 1SKUB 3HRTA 1UGSB 1M5Q1 4OMMA 2DRMA 2DJZA 4ORZA 2F69A 3M4GA 3G71A 4M7AA 2ZPFB 1Y71A 3CMAA 5KH6A 3CCSA 2RF0A 2WACA 4QKUA 1AD5A 5I2SA 4M75B 2EYXA 3NHNA 4HKEA 3EAEA 2M51A 4EPCA 1OOTA 1VQ4T 4VUBA 2KR3A 1D0ZA 2PVDB 2VVKA 2CZ0B 2K3XA 1WQWA 2E12A 4M78C 1OYXA 2DEQA 3RBBB 2QTVA 1K9MC 2C0OA 4GLKA 2LJ3A 2DL5A 2YRVA 2RQUA 3CCJT 4EMGA 2DL4A 2RH2A 1NYFA 3G6EA 1FMVA 2HMAA 4ZN1A 3E9GA 1OQKA 1QKXA 2XMFA 2XDPA 2WSFE 3E2UA 1VQOQ 1VQLA 2IPOB 2CDTA 1VQLT 2E1HA 3CCJA 3OSSC 3I35A 2ROLA 2H8HA 4OB3B 1C6VX 2KQWA 2XG8D 2LQWA 5CQXA 2YLCA 1BCMA 3P8BB 3CCVQ 1WA7A 5GAMf 2EJFA 3G71T 3X25B 2DD4A 3OS0A 4FW1A 1PCXA 1VQ5Q 1JQQA 2JNGA 1X6OA 4Y28E 5GAOl 4RTYA 4M77D 2ED0A 2RQTA 2M1HA 3CCEA 5HK0A 1A0NB 2XICA 4BI8B 5HKCA 2RK1A 4M75F 4ZTJA 2WSCE 5D6YA 4DBRA 3T9NA 4JRQA 3GPLA 1KC8R 2DKGA 3GLXA 3LYIA 5I11A 1ABQA 4M7AG 4JDSA 2L5QA 5FROA 4FL6A 1NPRA 1ZLMA 3CCVA 4JRPA 2EYYA 1QCOA 2RHZA 3HFNA 4HXJA 1M1FA 3VRYA 1YI2Q 3CCRA 4JS5A 1N8RU 4C8QC 1Q95G 1G8XA 2EKOA 1WHGA 3HTRA 4A4KA 4J9DA 4X9DA 2FZKB 5AT1B 3TSWA 4V2SA 3EG2A 3TEEA 1AZGB 4RTUA 3G7ZA 4J9HA 1YJWA 3OBYA 2O88A 3EG1A 1TG0A 3CPFA 4FSXA 4C92G 4ATOA 1PRLC 4J6XA 5ECAA 2K5IA 3MEUA 3SWNC 3I55A 2NUPB 2PVGB 3ZEHA 4DEYA 1GCPA 3JCMf 3EGXB 2LDMA 4MZPA 5HCKA 3JB9D 2JOYA 4IIOA 1W2BP 1YWPA 2B86A 3JSCA 1PD1A 4J9EA 3OYAA 4BDYA 2PTKA 4OGEA 1ABOA 4D8DA 3TU4K 3CCVT 2A37A 1YIJQ 3FLGA 1YCSB 2LNVA 5CIUA 1XNIA 1X69A 2O2OA 4F7UG 1TOVA 1IZ6A 2LMJA 3SHWA 5IXFA 4BB7A 5C6SA 3OS5A 4J9IA 4X9CA 2GTJA 4N0AA 3SFMA 4A4FA 2MOXA 1M2OA 2MI6A 3FRNA 4PFOA 3A8LB 5GAN3 3A5ZB 3EGDB 2LX7A 2ABLA 3U23A 4JLIA 1I07A 3QIIA 1KD1C 1M90R 4OVAA 3UPUA 1PNJA 2CT4A 2H3EB 3H6ZA 1QVGS 2SEMA 4MMKA 2YRDA 4C8QD 4XU2A 1BI1A 3C12A 4QVZA 2RMOA 1RI0A 2CUBA 1O75A 4IIMA 4B9WA 3J81E 1VYTA 3CMET 3CCET 1BYMA 3V7RA 4XK8E 1FXXA 1SHFA 1MNEA 4CC4B 1VQKQ 1NLOC 1VYVA 3MP8A 3R6OA 4A4EA 5GANj 4FYWB 2DBMA 2JMAA 5LJ5h 1MUZA 4M78F 2ESWA 3X28B 1VQ6T 1SSFA 2FYKA 4KULA 5AYFA 4A4GA 3HRUA 3OMGA 2LVMA 1KK7A 2FPDA 2HCKA 1IGQA 4X1VA 1CSKA 1KIKA 2DTIA 1X2QA 1KQSS 3JCMX 2D9TA 1VQNQ 4OMOA 1VIEA 4MZMA 4OMFB 2YUOA 2JN0A 3FB9A 1ZBXA 3DLMA 4N4GA 4JPBW 3D7SB 1N8RR 4D6WA 2V8IA 1VQ7T 2KT8A 2FG0A 1U1SA 3M0PA 1K1ZA 2G3RA 2HBWA 4GY5A 2DX1A 1KG1A 4F04B 1RLQC 3VS4A 2YUQA 1RLPC 3MPUB 2VWFA 4O6JA 3LLRA 3OYFA 1VQ8T 2A08A 3GP8A 1ACMB 4PJLA 4C5HA 4F7UF 3S3OA 2JM8A 2K5FA 5FU6B 3V8KA 3CXCS 4J9FA 4KT0E 4LNPA 3RKYA 1JJ2S 3VU3C 2BE7D 4IUTA 2ATCB 4C0DC 4BY6C 1UEBA 2OX7A 2FL7A 1M30A 1X27A 1UG1A 1MGQA 2EQMA 3VUBA 5KCHA 2IVWA 3CCLQ 2C0IA 1VUBA 2M02A 2CP6A 5GMKi 3F70A 2HL5C 3ZFJA 1B07A 1B34B 2HDAA 4RTWA 5I21A 1D1BA 4M7AC 2EKHA 1M3BA 4M7AD 2E6ZA 1VQ5T 5A0DA 4C92B 2LT1A 4CC7A 2RB6A 4A63B 1NJIU 1K73C 3LWIA 2EPDA 3REBB 1KC8U 2XK0A 2E65A 4R56A 1KQ1A 2EGCA 2DBKA 3QWXX 2BUDA 1OZ3A 3NTIA 3OYIA 2GTOA 2GQIA 2V8JA 1AEYA 2DYBA 2HKNA 3DB3A 3J80E 2V1QA 5CQYA 1WGSA 1WHKA 3OB9A 5C0MA 2YT6A 1MV3A 4Z8AA 3DB4A 3PT9A 2KEAA 4XTZA 5I22A 4J9GA 4HCCA 1TUGB 1OU9A
chains in the Genus database with same CATH topology
1LPLA 2CP0A 2HQHA 2Z0WA 1WHHA 3E2UA 2HL3A 2QK0A 2COYA 1IXDA 2E3HA 2COWA 2CP5A 1WHGA 2E4HA 2CP2A 2HKNA 4B6MA 1TXQA 1WHMA 2HKQB 1WHJA 2MPXC 2M02A 1TOVA 2CP7A 1WHKA 2CP6A 2COZA 2HL5C 1WHLA 2CP3A 3TQ7P 3RDVA 2E3IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LPL A;  2CP0 A;  2HQH A;  2Z0W A;  1WHH A;  3E2U A;  2HL3 A;  2QK0 A;  2COY A;  1IXD A;  2E3H A;  2COW A;  2CP5 A;  1WHG A;  2E4H A;  2CP2 A;  2HKN A;  4B6M A;  1TXQ A;  1WHM A;  2HKQ B;  1WHJ A;  2MPX C;  2M02 A;  1TOV A;  2CP7 A;  1WHK A;  2CP6 A;  2COZ A;  2HL5 C;  1WHL A;  2CP3 A;  3TQ7 P;  3RDV A;  2E3I A; 
#chains in the Genus database with same CATH topology
 1HJD A;  2K7A A;  3JB9 H;  1LNX A;  3ER0 A;  3FC3 A;  2NWM A;  4HCB A;  3EHR A;  1PD0 A;  1G5V A;  2P0P A;  2QG9 B;  2LCS A;  2KYM A;  2XI9 A;  3LGL A;  1WHJ A;  2J06 A;  2K57 A;  4KUD K;  3EFO B;  3LWH A;  2EYW A;  2NYS A;  1GCQ C;  2RQR A;  4QQ6 A;  1SRL A;  4XTW A;  2NUT B;  3L1A A;  4PJO D;  5GAN h;  5L8R E;  3PMT A;  1UGQ B;  5HK3 A;  4PJO C;  4J8O A;  3M5A A;  1C1A A;  1ZUU A;  2DPP B;  3RMS A;  1WJQ A;  4PJO E;  3M9Q A;  4BAC A;  4IUU A;  2HKQ B;  2MF2 A;  1YJ9 A;  2CH4 W;  4XU3 A;  3TQ7 P;  1JU5 C;  2P4T A;  4Z89 A;  1YHQ Q;  5GMK e;  3CCQ Q;  1JB0 E;  4WCI A;  4M4Z A;  1M2V B;  1VQ5 A;  5GAO n;  1F1B B;  3GBQ A;  4ELY C;  1NLP C;  3FDR A;  2MYS A;  4QW2 A;  1KJW A;  3M54 A;  2LQN A;  3SD4 A;  1Q7Y C;  4EIK A;  4C8Q F;  3JB9 F;  3RKW A;  5IN1 A;  2MIO A;  4M78 A;  4RUG A;  8AT1 B;  1H92 A;  2JW4 A;  2LCC A;  3QSU A;  2P0Q A;  3CCM T;  2DL7 A;  3RNJ A;  1HSQ A;  2VV5 A;  2DYI A;  2O9S A;  3UA6 A;  3EFR A;  1Q81 R;  2K2V A;  2ROT A;  2RJE A;  1QVG A;  4M78 D;  4KH1 B;  1CKA A;  9ATC B;  2X4W A;  4RCC A;  2MCN A;  1WJR A;  1IB8 A;  2O4X A;  1C0M A;  3ASK A;  2W0Z A;  3CCM Q;  1JBM A;  2ED1 A;  2JXB A;  2JVV A;  4C8Q B;  2AHJ B;  4C8Q G;  1QWF A;  3JB9 G;  2L2P A;  2C0T A;  4BI3 A;  3CD6 A;  3VS7 A;  5FRM A;  4N4H A;  2QQ9 A;  3G6E Q;  4C0D B;  1BK2 A;  3UT1 A;  2L89 A;  2B8A A;  4LXC A;  4M7D A;  3M56 A;  2GNC A;  1X43 A;  4M77 E;  2KRO A;  5IXB A;  2KXC A;  2OI3 A;  3OBW A;  2X4X A;  1YI2 T;  2O01 E;  3H0F A;  1WIE A;  2P84 A;  4B9X A;  3A8M B;  2EQK A;  2GFA A;  2RPN A;  1YN8 A;  1Y57 A;  2DIG A;  2BIV A;  3CC4 T;  1YIT A;  2PZ1 A;  3UAT A;  1UGP B;  2X3X D;  4KGZ B;  1GFD A;  3BDU A;  2XDD A;  1W1F A;  4XTX A;  1ZSZ B;  4DA4 A;  2KRM A;  3H41 A;  4OMN A;  3ULR B;  1S72 Q;  4WTO B;  2QI2 A;  3CPW A;  5LJ3 j;  2V8K A;  1TUC A;  4OB0 B;  5DLO A;  3CXC P;  1G3Y A;  3OW2 A;  5D6X A;  3MP6 A;  2BE9 B;  2HBP A;  3QKJ A;  1VQ7 Q;  4C0F A;  1XQH A;  3JCM g;  1J3T A;  3JCM e;  2QEX Q;  1VQP A;  1AHJ B;  1JJ2 A;  3PNW C;  2QEX T;  3G4S T;  3FJ5 A;  5GAN g;  3OW2 S;  2X9H A;  1AOJ A;  2DFU A;  5LJ3 g;  2KAF A;  2ECZ A;  3OYN A;  4DOV A;  1KC8 C;  4J6W A;  1JRI A;  3JAM E;  3RES A;  3A8H B;  4M77 C;  1PC0 A;  1NJI R;  1FYN A;  4PJM A;  2EYQ A;  3EGX A;  2KGT A;  1MHN A;  2JMC A;  4M7D C;  5FWC A;  2XID A;  3M0T A;  4F7U E;  2GCX A;  2VKN A;  1WHH A;  2AT1 B;  2X3W D;  2DER A;  1QKW A;  1XOV A;  1W2B A;  2VXE A;  1N8R C;  2E5K A;  3CCU Q;  1FMK A;  4BY6 B;  4MZT A;  3JCM b;  2OTL T;  2J05 A;  2K79 A;  1YJN A;  1M90 C;  1ZQ1 A;  1QVF S;  3WVD B;  1UE9 A;  2LTO A;  2QA4 A;  1WFW A;  2A7Y A;  4C92 A;  5GAN e;  4HCK A;  2YSQ A;  2A0F B;  5DLQ E;  4LUD A;  2FPF A;  4M78 G;  1UDL A;  5GMK h;  4FW2 A;  4OMQ A;  4CRI A;  4E47 A;  5GAN d;  1SEM A;  2CSQ A;  5GAN 2;  2L8D A;  2CGH A;  2ZGW A;  4XU1 A;  3X24 B;  1UFF A;  4PL6 A;  5DM7 R;  1U5S A;  2D1X A;  2VYT A;  3OMC A;  2KE9 A;  3QO3 A;  1WXU A;  2LNH B;  4JRK A;  4RCB A;  1PRM C;  4EMK B;  1M8M A;  2L3P A;  1LOJ A;  4Q5W A;  5CR2 A;  2LC4 A;  1S72 T;  3DKM A;  2FZC B;  5FW9 A;  5CKD A;  3A1P A;  1YWO A;  1Q7Y U;  2WSE E;  4KGX B;  2MWO A;  3JB9 I;  5KYU B;  4IUP A;  2CH4 A;  4C5I A;  1K9M R;  2DEU A;  1D3B B;  3BE3 A;  3S3M A;  1AVZ C;  1TWB A;  2CZ6 B;  4JZ4 A;  2V1R A;  3CC4 Q;  3M0Q A;  1IRX A;  1BI3 A;  1JXM A;  5EG2 A;  1I5O B;  1EFN A;  3TRE A;  1G2B A;  1Y96 A;  3OS2 A;  4IKF A;  5IH2 A;  3PVL A;  1VQO A;  1VQL Q;  2KK4 A;  5GAM e;  1QCF A;  3EGU A;  1Y07 A;  2L3S A;  4AG1 C;  4CC2 A;  3CCL A;  1G83 A;  5FU7 B;  1T0J A;  2JT4 A;  1PSE A;  3RDV A;  2HSE B;  5LJ3 h;  2DTO A;  3KXT A;  3JCM J;  4Z02 A;  4M75 D;  1YIJ T;  2DAQ A;  5A0L A;  4A4H A;  1WXB A;  3VJP A;  5LJ5 d;  2X4Y A;  5KYN A;  1Y0M A;  4JJC A;  3HHT B;  3FJP A;  1RUW A;  1M3A A;  1LVK A;  2RM4 A;  2COZ A;  4BE1 A;  1T3L A;  3QWY A;  3L2V A;  4RKU E;  5J3B A;  2F2W A;  4M75 A;  3JB9 J;  3WVE B;  2DXB A;  1YIT T;  4RMO A;  3CC4 A;  3TVT A;  2EFI A;  4LDW A;  1W70 A;  1OPL A;  2K4Y A;  4JS4 A;  2A3L A;  5GAN 4;  2EWN A;  3OYE A;  5KYW A;  1IHV A;  1VIF A;  2EJG A;  3SEM A;  5L23 A;  2PQW A;  2ZZD A;  2QTX A;  1TSF A;  1RAH B;  1WHL A;  1WNL A;  2VGN A;  2L0A A;  2JS2 A;  4OP0 A;  2FZG B;  3V7S A;  1W6X A;  3OYB A;  3HSB A;  4FT2 A;  3Q1J A;  1VQ6 Q;  3FIF A;  4XTY A;  3HL8 A;  3OYJ A;  2RHI A;  3TSZ A;  2BZ8 A;  4IUQ A;  4RTT A;  2FO0 A;  3SWN B;  2BTT A;  4OF1 A;  4EMH A;  3RMQ A;  1QW1 A;  3MEA A;  3QDF A;  1SPK A;  4LUE A;  3VS5 A;  4HA8 A;  3TCJ A;  2RJC A;  4L59 A;  2E10 A;  4PNO A;  3V8L A;  5GAO r;  5LJ5 e;  1SG5 A;  3OYY A;  1ZA2 B;  2V26 A;  1M4Z A;  1OPK A;  1NBE B;  3N5B B;  1JO8 A;  4E7S A;  2DIL A;  2QYZ A;  4L5G A;  4HVV A;  4AT1 B;  1QCN A;  1GBQ A;  2COY A;  3OY9 A;  1VQM Q;  5CKB A;  3GF5 A;  2J6F A;  4XAX B;  2YUN A;  2NUZ A;  2ZPG B;  2DVJ A;  2K9G A;  2DXU A;  1OEB A;  4XU0 A;  1BIA A;  2VUB A;  2K5L A;  3BDL A;  2SRC A;  2M16 A;  4MML A;  4QQG A;  2I2L A;  2CP0 A;  4BD3 A;  2DMO A;  1E6H A;  2BZX A;  2X35 A;  3JCM W;  2P0K A;  1GL5 A;  1BB9 A;  2RA2 A;  1IHW A;  2VAS A;  1D1C A;  2R58 A;  3AT1 B;  5GAN f;  4NS5 A;  1IRE B;  2LRQ A;  5GJV B;  2EIF A;  1D0X A;  1GCQ A;  1YIT Q;  3VRZ A;  3JCM c;  2DXT A;  1RL2 A;  3CCL T;  1HD3 A;  2RHX A;  2KVQ G;  4ZN3 A;  2M0O A;  3KFV A;  2E3I A;  1LPL A;  3V8J A;  1LCK A;  1G3T A;  3LGF A;  2QXF A;  1WQ7 A;  1U06 A;  5CKF A;  5KE3 A;  1AT1 B;  1AWX A;  2CYZ B;  3EFS A;  3NTH A;  2QQB A;  5IT9 E;  4PLI A;  2DIQ A;  1AWW A;  1OZ2 A;  3EHQ A;  2ZPB B;  4HVW A;  3C0C A;  2LT4 A;  3CCE Q;  4XTV A;  3GNG A;  5GAM j;  2FEI A;  2LX9 A;  2OTJ A;  4E2F B;  4M78 B;  1M3C A;  1UGR B;  2RI3 A;  4JRI A;  1TXQ A;  5EC7 A;  1ARK A;  2MPX C;  4LDU A;  2F5K A;  4R0K A;  4C92 C;  2CUD A;  5FU7 C;  4KGV B;  2KT1 A;  1K73 R;  4M77 F;  2OAW A;  4C92 E;  2OTL A;  1M1K R;  3X20 B;  4PFZ A;  3VYH B;  3JCM P;  2CP5 A;  4J7I A;  1MV0 B;  1X2K A;  4E7I A;  3H9N A;  1NE8 A;  2KYB A;  3RKX A;  3VS6 A;  4JZ3 A;  8ATC B;  2YLB A;  4PFP A;  3QZ9 B;  3QJ6 A;  5GAN 8;  4J6Y A;  2DK3 A;  2DET A;  1NEG A;  2JTM A;  3I55 T;  1SF9 A;  2RN8 A;  3I55 Q;  4J9B A;  3MHX A;  2E64 A;  2QAZ A;  3EGD A;  3J7A F;  2R5A A;  3HKS A;  3OYC A;  2H3J A;  1I1J A;  4IUV A;  2DL3 A;  4M77 G;  4N0A C;  3VS2 A;  2R5M A;  6AT1 B;  1K8A U;  3EG9 A;  4E7K A;  3MKD A;  2FB7 A;  3BY7 A;  1PWT A;  2HQE A;  1ZUK A;  3CCR T;  1UGV A;  1R0C B;  1YCY A;  3A8G B;  4PJO F;  3OYH A;  3NTK A;  3UDC A;  3H8Z A;  1Q7Y R;  1JXO A;  4ZNX A;  3CPW P;  4C8Q A;  2XHC A;  1U8R A;  5KE2 A;  4GLM A;  2QGF B;  1KFZ A;  2NUP A;  1R8O B;  2J6K A;  3V7C A;  2CSI A;  4FYY B;  1D0Y A;  2K3B A;  2JZ2 A;  3OYG A;  4PJJ A;  4LD6 A;  2DZ9 A;  1YP5 A;  3MEW A;  1Q82 U;  3S6W A;  5CKH A;  1FWZ A;  2JTF A;  3JCM d;  2F2X A;  2PNI A;  2P4R A;  3CCQ A;  1WI7 A;  2KSS A;  3QDR B;  5M9O A;  2GGR A;  1Y96 B;  2YWW A;  2CS7 A;  3I5R A;  2DD5 A;  2D0Q B;  1MMN A;  1TTH B;  3CC7 Q;  2QQS A;  4QVC A;  1Q82 C;  1B7T A;  1UHC A;  1K9M U;  3G6E T;  3RIR A;  2VC8 A;  2W10 A;  4ME7 A;  1SRM A;  1QVF P;  2DVE A;  5LJ5 g;  3RER A;  3LW5 E;  1WYX A;  5CVI A;  2YUP A;  4F7U B;  1H64 1;  1KHC A;  4M75 C;  1RI9 A;  2QDL A;  3EH1 A;  4OB1 B;  1AWJ A;  4FIB A;  4FCY A;  2E41 A;  3CCS Q;  2GF7 A;  1BI0 A;  1VA7 A;  1ZA1 B;  2JTE A;  4II1 A;  4DQ2 A;  5GAO q;  5GAM h;  3VS0 A;  4NOY A;  5A2Q E;  3C95 A;  1S1N A;  2KBT A;  3P8H A;  1ZX6 A;  3SDZ A;  2K3Y A;  3E19 A;  3KBG A;  3PMI A;  5KYY A;  4DBF A;  4CI0 C;  5GAN 7;  4M7D B;  1VYU A;  4Z88 A;  3FEO A;  2DZC A;  5IAY A;  2EQU A;  4DBH A;  1NEB A;  2J7I A;  4BE0 A;  4ANJ A;  3WXM B;  1ZUY A;  1YJN Q;  3I5S A;  3MJX A;  1I81 A;  2JUF A;  7AT1 B;  1M90 U;  3L2U A;  1UUE A;  1Q86 U;  2KDS A;  2I0N A;  3RR6 A;  1TUD A;  2OTJ Q;  3SWN A;  3OYM A;  5FU6 C;  2A28 A;  2HZY A;  1UJY A;  1QP3 A;  4LD9 K;  3EG0 A;  2PUK B;  3OSV A;  1BCO A;  1QWE A;  4J7F A;  1U1T A;  3PIO A;  1OX9 A;  4FSS A;  2CKK A;  3CCU T;  4QT7 A;  5GMK m;  3JCM Q;  2QGG A;  4QQD A;  2FRY A;  2OTL Q;  4D8K A;  3CC2 A;  1IXD A;  2GFU A;  2YRC A;  2DRK A;  5GAO p;  2ZPH B;  4KBM B;  1RAD B;  3I56 T;  3P8D A;  3CCU A;  3CME Q;  3OYK A;  2E5Q A;  3OS1 A;  5KYX B;  2LQK A;  3QBY A;  1MND A;  1TU0 B;  1B3Q A;  2DLP A;  2FHD A;  4QVD A;  3CD6 Q;  3CBP A;  2KNB B;  1YJ9 T;  2QA4 Q;  1PG5 B;  3PGG A;  5FWB A;  3G4S A;  1KD1 U;  2XU8 A;  1NYG A;  3O5Z A;  1MMG A;  4J9C A;  3R6N A;  3DLL A;  1XJW B;  2DM1 A;  1T0H A;  2LJ0 A;  2HSP A;  1M1G A;  3VYG A;  4LDX A;  2MMP A;  3EFO A;  5GAO m;  1VQK T;  5D6W A;  2DF6 A;  2DA9 A;  4LDV A;  4MDW A;  4K11 A;  1EZZ B;  2EQJ A;  3CBO A;  1KQ2 A;  1M1K U;  2QQA A;  2COW A;  1K8A C;  3HP9 A;  2PVO B;  2CT3 A;  3A8O B;  3MET A;  4PK4 A;  4AMC A;  1VQ8 Q;  2M0Y A;  2AZS A;  5GMK j;  3G4S Q;  1TS9 A;  2KRN A;  1O9S A;  4DEX A;  3JCM V;  1X6G A;  2AIR B;  2QEX A;  5CK9 A;  3A98 A;  4KH0 B;  4R55 A;  2F1L A;  1RAI B;  5CO7 A;  2RJD A;  2RNA A;  1M2V A;  4YTL A;  3OYL A;  3G71 Q;  3L42 A;  2HNI A;  3QJY A;  2FPE A;  2BKD N;  2JJ9 A;  5LL6 S;  3PIP A;  1FX7 A;  2DTH A;  4FM4 B;  3VV0 A;  1Z9Q A;  2D6F A;  2LJ1 A;  4ZTF A;  3GIB A;  2XKO C;  1VQ9 T;  4O5V A;  3NGP A;  3X26 B;  2HEQ A;  1KQS A;  3L2Q A;  1VQ9 Q;  4FYX B;  1V1C A;  1FMW A;  2QK0 A;  1QVF A;  1XTD A;  1K76 A;  1QVG P;  3CCR Q;  4HT9 A;  3UA7 A;  1X01 A;  3CXC A;  3OW2 P;  2JM9 A;  1QVP A;  4C5E A;  3PTA A;  3VKI A;  5A0G A;  4BE2 A;  3C4S A;  3L2W A;  3MO8 A;  2FVU A;  3NMZ C;  5GJW B;  3CEY A;  4M75 G;  4OGC A;  2HL3 A;  2YXY A;  2E6N A;  2ZAE A;  2Y4Y A;  1D3B A;  1WLP B;  4JJD A;  2E70 A;  3VS1 A;  2VB6 A;  1MMA A;  2F5T X;  2F2V A;  4TVR A;  4NL3 A;  4M7A F;  4OB2 B;  2KMT A;  5HY6 A;  3QZ5 B;  2GQV A;  4JJN K;  1VQ9 A;  3IQL A;  2PU9 B;  2G6F X;  1HXD A;  4AFZ C;  5GAM d;  3QG1 A;  1NJI C;  2RHY A;  3CCS T;  1BIB A;  2AKL A;  2CZ1 B;  3ZBD A;  2RD1 A;  3HPW A;  4AFU C;  1OI1 A;  1VQ7 A;  4RTX A;  4C92 D;  3NFC A;  4EDU A;  3GNF B;  2JS0 A;  1RAG B;  1VQK A;  3CBM A;  4DOW A;  3LH0 A;  1OU8 A;  3QYG B;  3M4Y A;  1P92 A;  4RTV A;  2EW3 A;  1Z9Z A;  1PKT A;  3LH5 A;  1H3Z A;  1AZE A;  2D8J A;  4ZGJ B;  3OQ5 A;  2DXC A;  3PFS A;  1OX8 A;  1NG2 A;  2K2M A;  1VQO T;  1N9R A;  2HQX A;  4FU6 A;  1HK9 A;  3G1J A;  2GBQ A;  1G3W A;  1RAF B;  1UB4 A;  1EIF A;  1GFC A;  2AK5 A;  2O9V A;  1GXI E;  5J26 A;  2ZPI B;  1ZSZ A;  2NLU A;  3E1S A;  1AWO A;  3EH2 A;  4M75 E;  1NZ9 A;  2EBP A;  1KSW A;  1RAC B;  3CC2 T;  2E4H A;  3CME A;  4PJO G;  5KCO A;  4LDY A;  2EQI A;  4PKC C;  1ZSZ C;  2AZV A;  5KYW B;  3JRZ A;  1K0S A;  1CKB A;  2DJQ A;  4HCZ A;  3I9Q A;  2DNU A;  2VGM A;  4EMK A;  5LJ5 j;  3M0S A;  2IG0 A;  2R57 A;  1YJN T;  3E9F A;  3I56 Q;  3EG9 B;  1PKS A;  4E6R A;  3MCA B;  4A54 A;  1ZHI A;  4X34 A;  2C06 A;  5GAN 5;  2X4J A;  2XD0 A;  5LJ3 f;  1KD1 R;  2YHT A;  4RTZ A;  1QQJ A;  1YJ9 Q;  1BBZ A;  3OA6 A;  4M78 E;  2O4X B;  1X75 C;  5D7U A;  1VQN A;  4RG8 A;  2RI2 A;  1K4U S;  4GBQ A;  1OUL A;  3CC7 T;  5IHN A;  2CP2 A;  4M7A E;  1Q82 R;  1QMC A;  1H3H A;  3QPH A;  1WPY A;  4AG2 C;  1LJO A;  2LZ6 B;  5LJ5 f;  1I8F A;  5GMK l;  4BDZ A;  1WJS A;  2HQH A;  3I56 A;  2ENM A;  2E3H A;  1VQ4 Q;  1JJ2 P;  3OYD A;  1M9S A;  1JEG A;  4C8Q E;  1V76 A;  1I4K 1;  2CP7 A;  1R0B G;  1V29 B;  2QDY B;  5FLX E;  2Y90 A;  1WXT A;  3L2Z A;  2CP3 A;  4PLL A;  4EMK C;  1UJ0 A;  1PM3 A;  4OMP A;  3H0I A;  1UTI A;  5KYY B;  1Q86 R;  4M7D E;  1YBY A;  2K6D A;  5IHK A;  4M77 A;  3CC2 Q;  1VQM A;  1NM7 A;  2MWP A;  2O31 A;  1I0C A;  1G3S A;  2KXD A;  4AFS C;  3INZ A;  2CZ7 B;  3KUF A;  2EGA A;  4BUG A;  5GAM g;  2YDL A;  2LQ8 A;  2M9U A;  2X51 A;  4UC4 A;  4N4I A;  2DO3 A;  3S3N A;  1I5L A;  4C92 F;  3PE0 A;  1KHI A;  3RUX A;  3C94 A;  3QYH B;  4ZGD B;  3CCJ Q;  3THK A;  4J83 A;  2EGE A;  3JCM h;  1VQ4 A;  1MMD A;  4PJO B;  2LCL A;  2FRW A;  5I2M A;  1Q86 C;  1OV3 A;  2KRS A;  1R77 A;  1HYO A;  1BI2 A;  1X6B A;  2EVR A;  4KUI A;  3QHS A;  3CCQ T;  2J6O A;  3CPW S;  1N27 A;  3O8V A;  3CMA T;  4E7J A;  3M58 A;  2KY9 A;  1VQP T;  2CRE A;  4L6V 5;  2VXF A;  1H8K A;  4PJO A;  5KYX A;  2AKK A;  3CD6 T;  4BI4 A;  1VQ8 A;  1EX4 A;  2DE0 X;  4F17 A;  1YJW Q;  3GOX A;  4JJB A;  2LP5 A;  4M7D G;  3L2R A;  2EJ9 A;  3EG3 A;  1M27 C;  1W4S A;  4HVU A;  1VQP Q;  1GRI A;  3JV3 A;  5CAI A;  2RQW A;  4E7L A;  4CC3 A;  3M57 A;  3HRS A;  3SB2 A;  2RHU A;  1SSH A;  3M0U A;  4B6M A;  4NL2 A;  3VUZ A;  1ZBJ A;  5GAN 6;  3VS3 A;  4DBQ A;  2BZY A;  2QQR A;  1U3O A;  3H0H A;  1N5Z A;  4C0Z A;  1YI2 A;  4A53 A;  3CCM A;  1N6A A;  1WX6 A;  4M77 B;  3BW1 A;  1RAE B;  3M55 A;  4LE9 A;  3CQT A;  2Y4X A;  3M59 A;  1YIJ A;  4ESR A;  1VQ6 A;  2D0N A;  2OJ2 A;  1M8V A;  4OML A;  2EAY A;  4KRT A;  1WHM A;  4C0G A;  1D1A A;  4M7A B;  4PJN A;  4WF2 A;  4P5N A;  1VQM T;  3M53 A;  4M7D F;  4RG2 A;  2KI7 A;  4F14 A;  3LX7 A;  1QLY A;  1UHF A;  1YNZ A;  4XTU A;  4E7Z A;  1K8A R;  1K9A A;  3PVQ A;  1Y7X A;  5CCA A;  1K73 U;  2L3R A;  5FRN A;  2D8H A;  2RK2 A;  1TH7 A;  1YFN A;  1E6G A;  4F16 A;  1B34 A;  1YHQ T;  3QUI A;  1VQN T;  1IGU A;  2IIM A;  2QAS A;  2NUT A;  1BKB A;  2HD0 A;  3CC7 A;  5LJ3 d;  1DJ7 B;  1VOM A;  3UF4 A;  2RJF A;  1W2B S;  2L3Q A;  3UWN A;  1E7O A;  5LJ3 e;  1RAA B;  3BFM A;  2ZCF B;  1Q81 C;  1S72 A;  4HT8 A;  1KQS P;  3NPF A;  4M7D D;  2ZPE B;  3ZL7 C;  1ZSG A;  1UEC A;  1YJW T;  2DL8 A;  1GBR A;  1SHG A;  4IUR A;  1N9S A;  4JLG A;  1WDX A;  1Q81 U;  2EYZ A;  4FYV B;  2XDB A;  2Z0W A;  2OTJ T;  4Y92 A;  1D09 B;  5J39 A;  3AHU A;  3URG A;  1IO6 A;  1PSF A;  1NPP A;  5IHI A;  3MP1 A;  3CMA Q;  3MEV A;  1RAB B;  1BU1 A;  5CKE A;  2RQV A;  2MAM A;  2RO0 A;  5KYU A;  2MK5 A;  1QP2 A;  4Y91 A;  1YHQ A;  4XQ3 A;  4J5Y A;  4ELZ C;  3M0R A;  4C5G A;  4E7H A;  2OAU A;  1PHT A;  1M1K C;  2HAX A;  5DY9 A;  1WZO A;  3HFO A;  4AFQ C;  3QXE B;  2RI5 A;  3REA B;  2PUO B;  4ZGE B;  4FT4 A;  2QA4 T;  3ME9 A;  1T3S A;  2A36 A;  4LN2 A;  4F7U A;  4JUV A;  1K0X A;  4MDX A;  1SKU B;  3HRT A;  1UGS B;  1M5Q 1;  4OMM A;  2DRM A;  2DJZ A;  4ORZ A;  2F69 A;  3M4G A;  3G71 A;  4M7A A;  2ZPF B;  1Y71 A;  3CMA A;  5KH6 A;  3CCS A;  2RF0 A;  2WAC A;  4QKU A;  1AD5 A;  5I2S A;  4M75 B;  2EYX A;  3NHN A;  4HKE A;  3EAE A;  2M51 A;  4EPC A;  1OOT A;  1VQ4 T;  4VUB A;  2KR3 A;  1D0Z A;  2PVD B;  2VVK A;  2CZ0 B;  2K3X A;  1WQW A;  2E12 A;  4M78 C;  1OYX A;  2DEQ A;  3RBB B;  2QTV A;  1K9M C;  2C0O A;  4GLK A;  2LJ3 A;  2DL5 A;  2YRV A;  2RQU A;  3CCJ T;  4EMG A;  2DL4 A;  2RH2 A;  1NYF A;  3G6E A;  1FMV A;  2HMA A;  4ZN1 A;  3E9G A;  1OQK A;  1QKX A;  2XMF A;  2XDP A;  2WSF E;  3E2U A;  1VQO Q;  1VQL A;  2IPO B;  2CDT A;  1VQL T;  2E1H A;  3CCJ A;  3OSS C;  3I35 A;  2ROL A;  2H8H A;  4OB3 B;  1C6V X;  2KQW A;  2XG8 D;  2LQW A;  5CQX A;  2YLC A;  1BCM A;  3P8B B;  3CCV Q;  1WA7 A;  5GAM f;  2EJF A;  3G71 T;  3X25 B;  2DD4 A;  3OS0 A;  4FW1 A;  1PCX A;  1VQ5 Q;  1JQQ A;  2JNG A;  1X6O A;  4Y28 E;  5GAO l;  4RTY A;  4M77 D;  2ED0 A;  2RQT A;  2M1H A;  3CCE A;  5HK0 A;  1A0N B;  2XIC A;  4BI8 B;  5HKC A;  2RK1 A;  4M75 F;  4ZTJ A;  2WSC E;  5D6Y A;  4DBR A;  3T9N A;  4JRQ A;  3GPL A;  1KC8 R;  2DKG A;  3GLX A;  3LYI A;  5I11 A;  1ABQ A;  4M7A G;  4JDS A;  2L5Q A;  5FRO A;  4FL6 A;  1NPR A;  1ZLM A;  3CCV A;  4JRP A;  2EYY A;  1QCO A;  2RHZ A;  3HFN A;  4HXJ A;  1M1F A;  3VRY A;  1YI2 Q;  3CCR A;  4JS5 A;  1N8R U;  4C8Q C;  1Q95 G;  1G8X A;  2EKO A;  1WHG A;  3HTR A;  4A4K A;  4J9D A;  4X9D A;  2FZK B;  5AT1 B;  3TSW A;  4V2S A;  3EG2 A;  3TEE A;  1AZG B;  4RTU A;  3G7Z A;  4J9H A;  1YJW A;  3OBY A;  2O88 A;  3EG1 A;  1TG0 A;  3CPF A;  4FSX A;  4C92 G;  4ATO A;  1PRL C;  4J6X A;  5ECA A;  2K5I A;  3MEU A;  3SWN C;  3I55 A;  2NUP B;  2PVG B;  3ZEH A;  4DEY A;  1GCP A;  3JCM f;  3EGX B;  2LDM A;  4MZP A;  5HCK A;  3JB9 D;  2JOY A;  4IIO A;  1W2B P;  1YWP A;  2B86 A;  3JSC A;  1PD1 A;  4J9E A;  3OYA A;  4BDY A;  2PTK A;  4OGE A;  1ABO A;  4D8D A;  3TU4 K;  3CCV T;  2A37 A;  1YIJ Q;  3FLG A;  1YCS B;  2LNV A;  5CIU A;  1XNI A;  1X69 A;  2O2O A;  4F7U G;  1TOV A;  1IZ6 A;  2LMJ A;  3SHW A;  5IXF A;  4BB7 A;  5C6S A;  3OS5 A;  4J9I A;  4X9C A;  2GTJ A;  4N0A A;  3SFM A;  4A4F A;  2MOX A;  1M2O A;  2MI6 A;  3FRN A;  4PFO A;  3A8L B;  5GAN 3;  3A5Z B;  3EGD B;  2LX7 A;  2ABL A;  3U23 A;  4JLI A;  1I07 A;  3QII A;  1KD1 C;  1M90 R;  4OVA A;  3UPU A;  1PNJ A;  2CT4 A;  2H3E B;  3H6Z A;  1QVG S;  2SEM A;  4MMK A;  2YRD A;  4C8Q D;  4XU2 A;  1BI1 A;  3C12 A;  4QVZ A;  2RMO A;  1RI0 A;  2CUB A;  1O75 A;  4IIM A;  4B9W A;  3J81 E;  1VYT A;  3CME T;  3CCE T;  1BYM A;  3V7R A;  4XK8 E;  1FXX A;  1SHF A;  1MNE A;  4CC4 B;  1VQK Q;  1NLO C;  1VYV A;  3MP8 A;  3R6O A;  4A4E A;  5GAN j;  4FYW B;  2DBM A;  2JMA A;  5LJ5 h;  1MUZ A;  4M78 F;  2ESW A;  3X28 B;  1VQ6 T;  1SSF A;  2FYK A;  4KUL A;  5AYF A;  4A4G A;  3HRU A;  3OMG A;  2LVM A;  1KK7 A;  2FPD A;  2HCK A;  1IGQ A;  4X1V A;  1CSK A;  1KIK A;  2DTI A;  1X2Q A;  1KQS S;  3JCM X;  2D9T A;  1VQN Q;  4OMO A;  1VIE A;  4MZM A;  4OMF B;  2YUO A;  2JN0 A;  3FB9 A;  1ZBX A;  3DLM A;  4N4G A;  4JPB W;  3D7S B;  1N8R R;  4D6W A;  2V8I A;  1VQ7 T;  2KT8 A;  2FG0 A;  1U1S A;  3M0P A;  1K1Z A;  2G3R A;  2HBW A;  4GY5 A;  2DX1 A;  1KG1 A;  4F04 B;  1RLQ C;  3VS4 A;  2YUQ A;  1RLP C;  3MPU B;  2VWF A;  4O6J A;  3LLR A;  3OYF A;  1VQ8 T;  2A08 A;  3GP8 A;  1ACM B;  4PJL A;  4C5H A;  4F7U F;  3S3O A;  2JM8 A;  2K5F A;  5FU6 B;  3V8K A;  3CXC S;  4J9F A;  4KT0 E;  4LNP A;  3RKY A;  1JJ2 S;  3VU3 C;  2BE7 D;  4IUT A;  2ATC B;  4C0D C;  4BY6 C;  1UEB A;  2OX7 A;  2FL7 A;  1M30 A;  1X27 A;  1UG1 A;  1MGQ A;  2EQM A;  3VUB A;  5KCH A;  2IVW A;  3CCL Q;  2C0I A;  1VUB A;  2M02 A;  2CP6 A;  5GMK i;  3F70 A;  2HL5 C;  3ZFJ A;  1B07 A;  1B34 B;  2HDA A;  4RTW A;  5I21 A;  1D1B A;  4M7A C;  2EKH A;  1M3B A;  4M7A D;  2E6Z A;  1VQ5 T;  5A0D A;  4C92 B;  2LT1 A;  4CC7 A;  2RB6 A;  4A63 B;  1NJI U;  1K73 C;  3LWI A;  2EPD A;  3REB B;  1KC8 U;  2XK0 A;  2E65 A;  4R56 A;  1KQ1 A;  2EGC A;  2DBK A;  3QWX X;  2BUD A;  1OZ3 A;  3NTI A;  3OYI A;  2GTO A;  2GQI A;  2V8J A;  1AEY A;  2DYB A;  2HKN A;  3DB3 A;  3J80 E;  2V1Q A;  5CQY A;  1WGS A;  1WHK A;  3OB9 A;  5C0M A;  2YT6 A;  1MV3 A;  4Z8A A;  3DB4 A;  3PT9 A;  2KEA A;  4XTZ A;  5I22 A;  4J9G A;  4HCC A;  1TUG B;  1OU9 A; 
#chains in the Genus database with same CATH homology
 1LPL A;  2CP0 A;  2HQH A;  2Z0W A;  1WHH A;  3E2U A;  2HL3 A;  2QK0 A;  2COY A;  1IXD A;  2E3H A;  2COW A;  2CP5 A;  1WHG A;  2E4H A;  2CP2 A;  2HKN A;  4B6M A;  1TXQ A;  1WHM A;  2HKQ B;  1WHJ A;  2MPX C;  2M02 A;  1TOV A;  2CP7 A;  1WHK A;  2CP6 A;  2COZ A;  2HL5 C;  1WHL A;  2CP3 A;  3TQ7 P;  3RDV A;  2E3I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...