2E4HA

Solution structure of cytoskeletal protein in complex with tubulin tail
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural protein
molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e4hA00
2Z0WA 1WHKA 1TXQA 3TQ7P 2MPXC 2COZA 2QK0A 1WHMA 2E3IA 1WHLA 2HL5C 2CP7A 4B6MA 1WHHA 1LPLA 2CP3A 3RDVA 2HKQB 2COWA 2E3HA 2CP0A 3E2UA 1IXDA 2CP5A 2CP6A 2M02A 1WHGA 2HQHA 2HKNA 2E4HA 2COYA 2CP2A 2HL3A 1TOVA 1WHJA
chains in the Genus database with same CATH superfamily
2K4YA 3M54A 4Z89A 1K73U 4DOWA 4VUBA 3KBGA 2OTJA 4C0DC 2DE0X 1VQ5A 2VWFA 4HCBA 1OPKA 2QQBA 2EW3A 2D9TA 3E19A 1D1AA 2LMJA 1ZQ1A 3DB3A 4XK8E 2QQAA 4M77C 3QSUA 3CD6Q 4FM4B 2BE9B 4ORZA 2CZ7B 3HP9A 4C92D 3VS1A 2FEIA 4EMKC 1H92A 1CKBA 2MIOA 1K9AA 3TQ7P 3X25B 2MMPA 2FHDA 1M90U 2FRYA 1W4SA 4E7IA 2YSQA 4X34A 2DO3A 2X4XA 2R58A 5IHIA 3U23A 5LJ5d 1PHTA 3PNWC 2O4XB 1VQKQ 5GAMf 4C92B 1X2KA 3OW2A 2OTJT 7AT1B 2I2LA 3G1JA 4NL2A 1N8RC 2QEXA 1VQ5T 4IUUA 4M7DC 3MKDA 4RKUE 3CC2Q 1WI7A 4PFOA 1KHIA 2PVOB 2EVRA 2VXFA 2CSIA 1WJQA 3I56T 2LJ3A 2QASA 5CKHA 5FU7C 1S72Q 3M4YA 3QBYA 2ED0A 1YNZA 4ELZC 1YITA 3NTKA 5GAMg 4M77E 2JMCA 1WHKA 2VVKA 2ZPEB 1IRXA 3GP8A 5D6XA 2LX7A 3OY9A 3EGDA 4KRTA 4IUQA 4RMOA 3OS5A 2EQIA 1M3AA 2XDBA 4JS4A 2DL4A 3ER0A 4DOVA 1BIBA 2NYSA 3H0IA 1WHGA 2WSCE 3OS1A 3L2RA 2I0NA 3GLXA 5FRMA 2EYWA 1RUWA 2FPEA 4QW2A 2JNGA 3JB9J 3GNGA 1GBRA 5CKBA 1KSWA 4FT4A 4LXCA 3SWNC 4FCYA 4PJLA 1QVFS 4M7AG 4M7DE 4A4HA 4R55A 1ZSZC 3EAEA 1SRMA 1IO6A 4V2SA 1IHVA 3VKIA 4M77D 1VQOQ 4HT8A 2KT8A 3X28B 3QIIA 3PFSA 4IUVA 3RKYA 4R56A 4C0DB 1U06A 3TREA 1X01A 2MCNA 4Y28E 1QVGA 1N8RU 5GAN6 1WX6A 4PJJA 2J6FA 2YRCA 1T0JA 4BUGA 2ZPBB 2KMTA 2DJZA 4M77B 2GTJA 1NZ9A 2RHZA 2HKQB 1UFFA 4JRIA 1NEGA 2FYKA 4EMKB 4CC7A 3A8GB 4JJCA 4A4GA 3OYEA 2ROTA 3JB9D 4M7DD 3I55T 4XU3A 5GAMd 1LJOA 1AWJA 3SB2A 4KUDK 1NLOC 2IPOB 2R5AA 3UPUA 3OBYA 1MNEA 2VKNA 3PVLA 1IGQA 5L23A 2DJQA 2X35A 4M7DB 2GNCA 2RJEA 2XG8D 2K79A 2XHCA 2BE7D 2HL3A 1M4ZA 1TUGB 4CC2A 3UWNA 4C5HA 2YUOA 1QP3A 1PRMC 2KVQG 5FU7B 1VQ7A 4XTUA 1YI2A 1QWFA 1Y57A 4JJBA 1WJRA 3HRSA 4BE0A 3I5SA 2DVJA 4J83A 4QQDA 2EJ9A 3M0UA 5KYYA 4JJNK 3FEOA 2A08A 3HPWA 3O8VA 3RR6A 2AKLA 2D6FA 4OGCA 4E7SA 5GAOp 3OA6A 2O9VA 1XNIA 1BI0A 4J9GA 4F16A 3MCAB 6AT1B 4F04B 5M9OA 3CCLA 5FLXE 2VXEA 3DLLA 2P0PA 3OW2S 3EGDB 2BUDA 1SHGA 2DTHA 2H8HA 2LT4A 3E2UA 2NUPA 1KC8C 1YI2T 2AIRB 3QG1A 4M75A 2V1QA 1VQPA 1T3SA 2IG0A 1K0SA 2DBKA 4M7AC 3SHWA 1G5VA 2JTEA 1FXXA 3P8BB 1AZGB 1ZLMA 3JCMc 4RTVA 3G4SQ 1VQ9Q 1M1KR 3H9NA 5HKCA 1FYNA 1Q82R 1QVFP 5HCKA 3EGUA 1WPYA 2KDSA 4F7UA 4EPCA 1W1FA 2CKKA 1WDXA 3CCJA 4GY5A 3J7AF 1WHHA 2YT6A 1D3BB 3IQLA 3RBBB 1VQPT 3GNFB 2O31A 4JJDA 4OVAA 2CP0A 4II1A 3CCSA 1H641 1WXBA 4EMHA 2KE9A 5L8RE 3OYBA 2D1XA 1K8AC 1ACMB 3CPWA 3C0CA 1BK2A 1U1SA 4C92F 4LDVA 4M7AE 1VQKA 2XMFA 3OSVA 2CP7A 1M30A 3V8LA 5KH6A 5CVIA 1E6HA 1UJ0A 5CKFA 3FLGA 1R8OB 2AT1B 2QTVA 3QWXX 4ZGEB 1QVGS 3CC2A 5I22A 3FB9A 4AG2C 2E12A 4ZN1A 3CD6T 4AFQC 3M4GA 5A0LA 1KC8U 1PG5B 3OYIA 4AMCA 3V8JA 1LCKA 2LQWA 4B9WA 4OB3B 5GAN4 2CH4A 9ATCB 3L2QA 1H8KA 3VS0A 1BI1A 4OMOA 1TUCA 3LGLA 5GAOq 2JT4A 2W10A 1VQKT 4M7AD 2MAMA 3T9NA 1JU5C 2XD0A 2XICA 2FZCB 4L6V5 3CC2T 5CK9A 3HHTB 3VRYA 2OAUA 1PKTA 2LCSA 2ED1A 2OI3A 3JCMP 1S72T 3OW2P 2JTFA 2M02A 2K3BA 2L8DA 5J3BA 5IN1A 3OYAA 2ZPFB 4J9DA 3ZFJA 4M75B 3CCQA 2GFAA 1YIJQ 5DLQE 3OB9A 3LX7A 2E3IA 4A63B 4RTUA 2K57A 4QQGA 1NPRA 2E5KA 3CCUQ 4N4GA 3EFOB 4Y91A 1KQ1A 3UA7A 1X6BA 2K5IA 4XTVA 4Q5WA 4P5NA 1AWWA 2C0TA 1TWBA 4KH1B 1OV3A 2E65A 5C0MA 1MMDA 2HBPA 2XDPA 4OF1A 1RAAB 1RACB 4FW1A 1OULA 4WTOB 1I5LA 4HT9A 4QQ6A 1QVPA 4PJOG 2EYQA 1VQOT 2E4HA 1VQMQ 1YJWQ 3J80E 1WHJA 1T3LA 3INZA 3JB9F 2YHTA 1PSEA 1WNLA 2RI2A 4E7JA 1YJ9Q 2DEUA 4JZ3A 4N0AC 2GTOA 2BIVA 1SSFA 3CBPA 4MDWA 4RG2A 3HFNA 3QUIA 4BI3A 2D8JA 3EG9B 1VQ4Q 2GQIA 3A8HB 5GAN2 1WQ7A 1QVGP 4FL6A 2DXCA 1S1NA 1JJ2A 4LE9A 3LLRA 5DY9A 4HCCA 2ZPIB 1KIKA 4LDXA 3VYHB 3CPWS 2K2MA 2G6FX 3R6NA 5CQYA 1TSFA 3MEWA 1PC0A 1D0XA 3EH2A 3H6ZA 1KD1R 5I2MA 1NEBA 1KG1A 3JCMe 4E6RA 2CT4A 2ZGWA 1X6GA 1GRIA 2QGFB 3JB9H 5HY6A 4OMFB 5KE2A 3OBWA 1RI0A 1SG5A 5KCHA 1I07A 2BKDN 2JM8A 2F5TX 4J7IA 1ZUYA 2DK3A 2VYTA 4KGZB 1D1CA 1VYTA 1JXOA 2LNVA 1UE9A 2MWOA 1M90C 2M1HA 1ZHIA 1VQ9A 3V7SA 3JCMd 2FG0A 3HRTA 3TSZA 2XIDA 1G2BA 2H3JA 4PFZA 4J9CA 4FW2A 2DL3A 2V8JA 2LCLA 1IHWA 1AVZC 3LH0A 4CRIA 3P8DA 2E41A 4JUVA 4GLMA 4XU2A 4J9EA 3H0FA 1U8RA 1Q82C 4B9XA 2R57A 1WQWA 4BE1A 1TXQA 1YP5A 2MPXC 2QQSA 3GBQA 1M3BA 1Q95G 2D0QB 5KYWB 1N5ZA 4PJOC 3C95A 5LJ5h 4C0GA 2GF7A 3G4ST 4MZMA 1VQ9T 2VB6A 3VS2A 1I8FA 4J6WA 3JCMf 4FYYB 3ZBDA 2RJDA 4ZTJA 2ZZDA 4ME7A 4IURA 2KXCA 3UATA 1RL2A 5GAOm 2YUPA 4LN2A 1PD1A 4LUEA 2LRQA 3V7RA 4IIMA 2HNIA 4N4IA 4A4FA 3CC4Q 2RQRA 1NJIR 1UHFA 2X51A 2E10A 1N9SA 1U5SA 3L2VA 3VS7A 3NTHA 1MHNA 1D0YA 1QP2A 3I56A 2VASA 4MZTA 2V26A 4MMLA 3JCMg 3GIBA 2K5FA 2RHUA 2C0IA 1TU0B 1XOVA 2W0ZA 3FDRA 5GMKm 3NFCA 2JUFA 2P0QA 4PJOE 4L59A 2DTIA 4HCZA 2XKOC 5GANh 2DYBA 1VQLQ 2XDDA 2YRDA 1XQHA 1B34A 2RQTA 2DVEA 2DL8A 3CPWP 2J06A 4M7AF 1Z9ZA 3PVQA 4WCIA 5FWBA 1Q82U 2CDTA 1NE8A 2OX7A 1YHQQ 4AT1B 1AEYA 3EGXA 1XJWB 2QA4Q 2KK4A 2QYZA 2YXYA 1KK7A 3RDVA 5AT1B 2KGTA 3SFMA 2PU9B 3VS3A 1M2VA 1GFCA 5IHKA 1YIJA 1UUEA 2KYMA 1JJ2S 3KUFA 8AT1B 2Z0WA 2FPDA 4HXJA 2MK5A 1OPLA 4PJOD 4KUIA 4AFUC 5GMKh 1YCYA 3MP1A 3WVEB 1X2QA 3RKWA 1WFWA 5KYNA 4E7KA 2DD5A 3E9GA 2AHJB 3EG2A 1CSKA 5I11A 3RERA 3TCJA 1YN8A 4OB0B 5J26A 5D6WA 2DILA 5HK3A 4UC4A 4PJOB 4OMMA 1UEBA 2KROA 1HXDA 4OMNA 3LW5E 1YIJT 3I55A 3ME9A 3JCMJ 1KFZA 1VQMA 2JN0A 3QXEB 1QWEA 4HKEA 3CCUT 4M75G 4JDSA 3AHUA 3VV0A 3CMEQ 1OZ3A 1UB4A 2A0FB 4KT0E 1JBMA 2EQKA 2PUOB 1Q86R 1OZ2A 1IREB 2HDAA 2JMAA 4RUGA 4D8KA 1RAHB 3EH1A 2DL5A 4NS5A 2NLUA 3JCMb 4ELYC 4E7LA 1TUDA 2AK5A 2YLBA 4F7UG 4J9BA 3EG0A 2QXFA 2RM4A 1FWZA 2DXUA 1VQMT 2KXDA 3MP6A 2E5QA 1YJWT 3QZ5B 3RIRA 4LUDA 4RTZA 2RF0A 5CAIA 5FW9A 1M3CA 1VIFA 5I21A 3PGGA 2A28A 4HVUA 2CGHA 2EQUA 5IXFA 1YJ9T 1B7TA 3S3NA 4JZ4A 3KXTA 1KHCA 1ABOA 3C4SA 1VQ4T 4FYWB 3JCMW 4C8QA 1KD1C 1VOMA 1KQSP 1WHLA 2ATCB 1G3YA 3EFSA 2PQWA 3CEYA 5LJ3h 4FSXA 3NGPA 2RH2A 1PCXA 2EPDA 4FIBA 3CCMQ 1SRLA 1BI2A 3CXCP 1HYOA 3E9FA 3OS2A 3CMAQ 2XK0A 3QHSA 3ZL7C 2V1RA 3RMQA 2NUZA 1C6VX 5FROA 1GCQA 5GAN3 1H3ZA 1JJ2P 3M57A 2LQKA 3QYHB 3QO3A 1PM3A 2JVVA 2O2OA 2O88A 4M78F 1YWPA 1N9RA 5CKDA 2FO0A 2M9UA 2CZ6B 3PTAA 1OX9A 3V8KA 3CBMA 4FT2A 3CCVQ 2PVDB 3GF5A 2DIQA 4FSSA 5LJ3e 3CCRQ 1Q7YC 1G83A 4C5GA 2L3QA 4FYXB 2QQ9A 2C0OA 3HKSA 1OYXA 4M75C 1NM7A 1WIEA 3GOXA 3A98A 3MO8A 1GL5A 1OX8A 3OS0A 2MYSA 1EZZB 2GCXA 2DLPA 1K9MR 4RTXA 2YUQA 4OB1B 4OP0A 3C12A 3CC4A 2L3RA 2COZA 1WHMA 2PZ1A 1X43A 1UGRB 2LNHB 1T0HA 1BBZA 3CD6A 1KD1U 1HD3A 2JJ9A 1G3WA 1Y07A 4NOYA 5CIUA 1NJIC 2HKNA 2CS7A 3FJPA 4PJMA 5CR2A 1MMGA 4J9HA 4HCKA 4A4EA 2DZ9A 1AD5A 3M55A 1ZBXA 1M8MA 2FRWA 1M8VA 2M51A 2K6DA 3A5ZB 2SEMA 4AFSC 1YWOA 5DM7R 3NTIA 1VQ8Q 1M1GA 1VQLA 1X75C 5GAOl 1KJWA 3FJ5A 1WA7A 3CC4T 2M0OA 2ESWA 4PK4A 4M75E 1OEBA 2YRVA 2NUTA 2DETA 1YHQA 3THKA 2JS0A 3AT1B 2QA4A 1QCOA 3X20B 1OOTA 3FRNA 1S72A 1MV3A 2DBMA 2LCCA 2V8IA 3EFRA 5GAOr 1BI3A 4QVZA 4D6WA 3TEEA 1Q7YU 4ZTFA 3QDRB 1V1CA 4D8DA 4XQ3A 2KT1A 4AFZC 3QYGB 2LQ8A 5ECAA 5GMKl 2CP6A 2F2WA 5KYYB 4F7UE 2X3XD 4WF2A 1NYFA 3HTRA 1TOVA 1VQLT 4HA8A 5LJ3g 1GFDA 1X6OA 1MV0B 2LP5A 5CQXA 3JCMV 2RN8A 3BY7A 1IGUA 4M75D 1NYGA 2EKHA 1YHQT 1N8RR 4KULA 2A36A 4J6XA 2CSQA 2DM1A 1GBQA 2QA4T 2CP5A 4BY6C 1R0CB 2CUBA 3VRZA 1BKBA 2QG9B 2K3YA 2VGNA 1VA7A 1LVKA 1MMNA 3JCMQ 2NUPB 1NJIU 2K3XA 1Y96A 2QEXQ 2FZGB 2HL5C 4DBRA 2FB7A 4R0KA 1LOJA 5GAOn 1VQOA 3PMIA 1YJNQ 4OMLA 2DL7A 3NMZC 4O6JA 3GPLA 3URGA 1WXTA 2QTXA 1ZSGA 4BDYA 2PNIA 4M77F 1PWTA 1B3QA 3VYGA 3G7ZA 2F2VA 1V76A 3CC7Q 1VQNQ 4E7HA 2EKOA 2DIGA 2RD1A 4F7UB 3L2ZA 1PD0A 1SPKA 2ROLA 2EWNA 2L3SA 2RHXA 4M78A 4DQ2A 1IB8A 2DEQA 1JQQA 2DX1A 3PIPA 3SD4A 1TTHB 1OI1A 1BB9A 5GMKi 3CMET 4M7DF 3OSSC 2HMAA 2PVGB 1W2BP 4RTWA 1KQSA 4PLIA 5CKEA 1QKWA 3O5ZA 4KGXB 4MDXA 5KYXA 1RADB 5KE3A 2AZVA 5C6SA 3CXCA 4JRPA 5KYUA 5A2QE 4LD9K 2X4WA 2HSEB 1PKSA 3R6OA 4XTXA 3META 1FMWA 4LDYA 3CCMA 4C0ZA 1O9SA 1ZUUA 2YDLA 4PLLA 2DRMA 4MMKA 3MEVA 1G3SA 1F1BB 2RPNA 4IUTA 1HJDA 2HZYA 4BI8B 4BB7A 3L1AA 4HVWA 4ANJA 1K0XA 3BDLA 2P84A 4OMPA 1BCMA 2VC8A 2EYYA 2CH4W 4O5VA 2ZCFB 3CPFA 2FPFA 2F69A 5J39A 2M16A 1G3TA 2DZCA 4QVCA 2DMOA 4YTLA 2O4XA 3HSBA 2EYZA 1QCFA 2LT1A 4C92A 4BY6B 2COWA 3DKMA 4BD3A 1W6XA 3BDUA 4J7FA 3SDZA 2HQHA 2C06A 3CCMT 4EDUA 3M0TA 5EC7A 1VYVA 2EGCA 5I2SA 4AG1C 3CMAT 2ECZA 5GAMh 3G4SA 1BYMA 3OYMA 1JRIA 4X9DA 4ZNXA 3Q1JA 5IXBA 1D1BA 3QPHA 3L2WA 1VQ7Q 2RI5A 1Q81R 4RG8A 2GFUA 2WACA 4N4HA 2RHYA 4IUPA 2DXTA 2RJCA 3WXMB 3I5RA 1M1KC 4XAXB 1VQ6Q 1UGPB 1NLPC 2HD0A 2MF2A 3CCVT 1WGSA 1MGQA 1MMAA 1Z9QA 3MEAA 3H8ZA 3CCRT 1BCOA 1M1FA 2E70A 3JSCA 2DYIA 2KRMA 2SRCA 1HSQA 2X3WD 3CCLQ 1X27A 1EX4A 2K9GA 4J9FA 3S6WA 5FU6C 2CUDA 3X24B 4E7ZA 4X9CA 2EGEA 4DEXA 2HSPA 4GLKA 2JS2A 1RAGB 2GBQA 3OYLA 2QI2A 2P4TA 3H41A 3BW1A 3VS4A 2CP3A 4ZN3A 1UGQB 2EJGA 4CC3A 2JTMA 5FWCA 3QZ9B 5IHNA 2IIMA 1YBYA 2YLCA 2EQJA 5KYUB 2YWWA 4M77A 1I0CA 2KYBA 1SHFA 3CQTA 5IT9E 5IH2A 3JRZA 2YUNA 4EMKA 1ABQA 4OGEA 2RMOA 3MJXA 4JLGA 5LJ5e 3VUBA 5IAYA 4QKUA 2KRSA 2V8KA 3CCJQ 1VQ8T 1K8AR 1QMCA 3EG1A 3I9QA 1ZX6A 2G3RA 3QKJA 1KQSS 5LJ5j 2KY9A 1UDLA 4JRKA 3CCSQ 5CCAA 3DB4A 1M1KU 4CI0C 2RHIA 4CC4B 1K9MU 3CXCS 4M7DA 1NG2A 1B07A 3G6EQ 3G71Q 5D7UA 2R5MA 4M75F 4A4KA 1Y7XA 4DBFA 1DJ7B 3CBOA 3PE0A 2DRKA 1HK9A 3M0RA 1TS9A 2CT3A 1YJNA 4C8QG 2IVWA 3CCUA 4EMGA 1JB0E 4TVRA 1N27A 2NWMA 3M59A 1E6GA 2EGAA 3ASKA 1R77A 5GANe 1H3HA 4RCCA 2BZ8A 4F7UF 1J3TA 2HQEA 3CC7A 2K5LA 1VQNA 5GAN5 3TU4K 3UT1A 2LC4A 3MP8A 2J6KA 5GANj 5AYFA 5LJ5f 2JM9A 3RKXA 2H3EB 3I35A 2A7YA 4OMQA 1W2BA 3A8MB 3F70A 1ZA2B 3CCEQ 5FU6B 2QEXT 1PRLC 4PKCC 2KQWA 1QQJA 1WYXA 2P4RA 3SWNA 5EG2A 2EAYA 1YJWA 1M2OA 3MHXA 1YJNT 5GANd 2EJFA 2LJ1A 1ZSZA 2DXBA 5GAN8 3SEMA 1RAFB 1M9SA 1C0MA 1TG0A 4KGVB 5GMKe 2J7IA 2QAZA 1YJ9A 4Y92A 5A0DA 3OYCA 3CC7T 1VQNT 1YITT 5LJ5g 2DD4A 3CCQQ 2OTLQ 1I1JA 2RQWA 1PNJA 2EYXA 3X26B 1VQ4A 2KSSA 1UHCA 3UA6A 5GMKj 1ARKA 4KBMB 3MEUA 2RQUA 1FX7A 2FZKB 4E47A 2RO0A 1D3BA 3BE3A 3UF4A 5GANf 2DNUA 1I4K1 2QGGA 4BI4A 1M5Q1 1AOJA 4ATOA 2BZYA 3VJPA 3VUZA 1O75A 4FU6A 3HL8A 2KI7A 2MI6A 2K2VA 4J9IA 2RK1A 2FVUA 1FMVA 2KNBB 1B34B 4LDUA 2K7AA 1VYUA 3EHQA 2KAFA 2GQVA 2L2PA 1UG1A 5GANg 4M4ZA 3EGXB 2LJ0A 1QW1A 4EIKA 2X4YA 2A3LA 1E7OA 4C8QC 1ZBJA 1OU8A 3N5BB 2LTOA 1M2VB 4BDZA 3LH5A 1VIEA 1NPPA 4XTWA 4BE2A 2RK2A 2DTOA 5GJWB 3OYFA 1VQ6A 1PSFA 4DEYA 1WXUA 2E64A 1K73R 2E3HA 1GXIE 2X9HA 1GCQC 2AZSA 1Q81C 4F14A 1RI9A 2L89A 3NPFA 3M56A 2O9SA 2QQRA 3NHNA 3HRUA 1JO8A 3REBB 5FRNA 4M7AA 1D0ZA 4ESRA 1BU1A 3QJYA 3OYYA 2VGMA 1M90R 2CYZB 5LJ3j 1VQ7T 1AHJB 1Y0MA 1A0NB 3SWNB 1GCPA 1EFNA 1AWOA 4K11A 3A1PA 2OAWA 2HBWA 1ZSZB 1KQ2A 3M0QA 2CZ1B 4C8QE 3LWIA 1VQ6T 1WJSA 2LX9A 2E1HA 3EFOA 5LJ3d 3A8LB 3JAME 2DF6A 1UTIA 3PMTA 2CZ0B 3A8OB 2LQNA 2LZ6B 4ZGJB 1QLYA 4Z8AA 3BFMA 2VV5A 2BZXA 4OB2B 4BACA 1ZA1B 2JOYA 3CCLT 2COYA 1W2BS 2PTKA 3OYKA 2QK0A 4XU0A 2EQMA 1LPLA 4DA4A 1UECA 1M27C 2GGRA 1AZEA 4M78G 2HEQA 1WLPB 1X69A 1U1TA 4C8QD 4JS5A 1RAIB 3OYDA 1I81A 5LJ3f 1D09B 1RLPC 3M5AA 4FYVB 1Q81U 3VU3C 2KBTA 1UGVA 2B8AA 3G6EA 3G71A 1K4US 4E2FB 3M58A 4QVDA 1YCSB 3RESA 3QWYA 2D0NA 4F17A 2RI3A 1SKUB 4RCBA 4C8QB 2PUKB 3EG9A 2OTJQ 3WVDB 4GBQA 1VQ5Q 4NL3A 4C5EA 2VUBA 1SEMA 3CCJT 2FL7A 1G8XA 1AWXA 1VUBA 3OMCA 1EIFA 4XTYA 3I56Q 3CCST 1C1AA 1QKXA 1XTDA 3QJ6A 4PJOF 4IKFA 2DAQA 3JB9I 2Y4XA 2RJFA 2L3PA 3G6ET 3G71T 5LL6S 5DLOA 1U3OA 2CREA 3CCEA 3REAB 2F2XA 1UGSB 1TH7A 1NBEB 2JXBA 4C92G 1LNXA 2E6NA 1MNDA 2AKKA 3E1SA 3RNJA 2KRNA 4M7AB 3ZEHA 3CMEA 4RTYA 2OJ2A 4JLIA 3KFVA 5GJVB 3S3OA 3OMGA 4C5IA 4J5YA 2Y90A 3RUXA 1AT1B 2OTLA 5KCOA 1YITQ 1K8AU 3QDFA 2DA9A 3ULRB 2F5KA 1OQKA 2MWPA 3OYJA 4A53A 1Q86C 3CCET 2QDYB 2WSFE 2DERA 2EBPA 5KYWA 3LWHA 3L2UA 4Z02A 4DBHA 3TVTA 2BTTA 1QCNA 3TSWA 5GAN7 4M78C 3V7CA 2DKGA 4PNOA 3VS6A 3CCQT 3OQ5A 3I55Q 2OTLT 3OYNA 2RA2A 4PJNA 1YFNA 2LDMA 3DLMA 4N0AA 3FIFA 4KH0B 4J6YA 3EHRA 3P8HA 2Y4YA 2L5QA 2NUTB 1MUZA 3JCMh 3PT9A 2X4JA 3FC3A 4A54A 3VS5A 4XTZA 3CMAA 4PFPA 4HVVA 4LNPA 1BIAA 1SSHA 2HQXA 2L0AA 2MOXA 1RABB 4M77G 1CKAA 3D7SB 3J81E 5D6YA 4QT7A 1N6AA 3H0HA 2HCKA 4Z88A 3S3MA 2P0KA 1RLQC 2M0YA 2XI9A 3CCVA 4M78E 2RB6A 1P92A 2WSEE 1K1ZA 4X1VA 3CCRA 2JZ2A 1K73C 1Q86U 2ABLA 1IZ6A 4JRQA 2JW4A 5HK0A 2D8HA 3L42A 2DFUA 2B86A 1Y71A 4C92C 1FMKA 2E6ZA 5A0GA 3JB9G 4M7DG 1JXMA 3EG3A 2ENMA 4PL6A 4MZPA 2RQVA 1Y96B 3C94A 1YI2Q 2KEAA 2ZPHB 1QVFA 3M9QA 1JEGA 1OU9A 3HFOA 2KR3A 3MPUB 3JV3A 1K9MC 2F1LA 3M53A 4M78D 4RTTA 8ATCB 1W70A 2LVMA 4B6MA 3OYHA 2O01E 4DBQA 4JPBW 1KC8R 1RAEB 1ZUKA 4PJOA 4LD6A 1UJYA 2XU8A 4L5GA 1Q7YR 3LGFA 4ZGDB 2CP2A 1K76A 4IIOA 4LDWA 2J6OA 5GAMe 2HAXA 1SF9A 4M78B 1WZOA 5CO7A 2EFIA 3M0SA 1VQ8A 2A37A 1I5OB 3RMSA 1R0BG 2RNAA 1VQPQ 4C92E 3OYGA 2ZAEA 2DPPB 5GAMj 3JCMX 3LYIA 2QDLA 4XU1A 2J05A 3UDCA 1IXDA 3PIOA 2ZPGB 5KYXB 4C0FA 2EIFA 4C8QF 3M0PA 1V29B 4J8OA
chains in the Genus database with same CATH topology
2Z0WA 1WHKA 1TXQA 3TQ7P 2MPXC 2COZA 2QK0A 1WHMA 2E3IA 1WHLA 2HL5C 2CP7A 4B6MA 1WHHA 1LPLA 2CP3A 3RDVA 2HKQB 2COWA 2E3HA 2CP0A 3E2UA 1IXDA 2CP5A 2CP6A 2M02A 1WHGA 2HQHA 2HKNA 2E4HA 2COYA 2CP2A 2HL3A 1TOVA 1WHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0W A;  1WHK A;  1TXQ A;  3TQ7 P;  2MPX C;  2COZ A;  2QK0 A;  1WHM A;  2E3I A;  1WHL A;  2HL5 C;  2CP7 A;  4B6M A;  1WHH A;  1LPL A;  2CP3 A;  3RDV A;  2HKQ B;  2COW A;  2E3H A;  2CP0 A;  3E2U A;  1IXD A;  2CP5 A;  2CP6 A;  2M02 A;  1WHG A;  2HQH A;  2HKN A;  2E4H A;  2COY A;  2CP2 A;  2HL3 A;  1TOV A;  1WHJ A; 
#chains in the Genus database with same CATH topology
 2K4Y A;  3M54 A;  4Z89 A;  1K73 U;  4DOW A;  4VUB A;  3KBG A;  2OTJ A;  4C0D C;  2DE0 X;  1VQ5 A;  2VWF A;  4HCB A;  1OPK A;  2QQB A;  2EW3 A;  2D9T A;  3E19 A;  1D1A A;  2LMJ A;  1ZQ1 A;  3DB3 A;  4XK8 E;  2QQA A;  4M77 C;  3QSU A;  3CD6 Q;  4FM4 B;  2BE9 B;  4ORZ A;  2CZ7 B;  3HP9 A;  4C92 D;  3VS1 A;  2FEI A;  4EMK C;  1H92 A;  1CKB A;  2MIO A;  1K9A A;  3TQ7 P;  3X25 B;  2MMP A;  2FHD A;  1M90 U;  2FRY A;  1W4S A;  4E7I A;  2YSQ A;  4X34 A;  2DO3 A;  2X4X A;  2R58 A;  5IHI A;  3U23 A;  5LJ5 d;  1PHT A;  3PNW C;  2O4X B;  1VQK Q;  5GAM f;  4C92 B;  1X2K A;  3OW2 A;  2OTJ T;  7AT1 B;  2I2L A;  3G1J A;  4NL2 A;  1N8R C;  2QEX A;  1VQ5 T;  4IUU A;  4M7D C;  3MKD A;  4RKU E;  3CC2 Q;  1WI7 A;  4PFO A;  1KHI A;  2PVO B;  2EVR A;  2VXF A;  2CSI A;  1WJQ A;  3I56 T;  2LJ3 A;  2QAS A;  5CKH A;  5FU7 C;  1S72 Q;  3M4Y A;  3QBY A;  2ED0 A;  1YNZ A;  4ELZ C;  1YIT A;  3NTK A;  5GAM g;  4M77 E;  2JMC A;  1WHK A;  2VVK A;  2ZPE B;  1IRX A;  3GP8 A;  5D6X A;  2LX7 A;  3OY9 A;  3EGD A;  4KRT A;  4IUQ A;  4RMO A;  3OS5 A;  2EQI A;  1M3A A;  2XDB A;  4JS4 A;  2DL4 A;  3ER0 A;  4DOV A;  1BIB A;  2NYS A;  3H0I A;  1WHG A;  2WSC E;  3OS1 A;  3L2R A;  2I0N A;  3GLX A;  5FRM A;  2EYW A;  1RUW A;  2FPE A;  4QW2 A;  2JNG A;  3JB9 J;  3GNG A;  1GBR A;  5CKB A;  1KSW A;  4FT4 A;  4LXC A;  3SWN C;  4FCY A;  4PJL A;  1QVF S;  4M7A G;  4M7D E;  4A4H A;  4R55 A;  1ZSZ C;  3EAE A;  1SRM A;  1IO6 A;  4V2S A;  1IHV A;  3VKI A;  4M77 D;  1VQO Q;  4HT8 A;  2KT8 A;  3X28 B;  3QII A;  3PFS A;  4IUV A;  3RKY A;  4R56 A;  4C0D B;  1U06 A;  3TRE A;  1X01 A;  2MCN A;  4Y28 E;  1QVG A;  1N8R U;  5GAN 6;  1WX6 A;  4PJJ A;  2J6F A;  2YRC A;  1T0J A;  4BUG A;  2ZPB B;  2KMT A;  2DJZ A;  4M77 B;  2GTJ A;  1NZ9 A;  2RHZ A;  2HKQ B;  1UFF A;  4JRI A;  1NEG A;  2FYK A;  4EMK B;  4CC7 A;  3A8G B;  4JJC A;  4A4G A;  3OYE A;  2ROT A;  3JB9 D;  4M7D D;  3I55 T;  4XU3 A;  5GAM d;  1LJO A;  1AWJ A;  3SB2 A;  4KUD K;  1NLO C;  2IPO B;  2R5A A;  3UPU A;  3OBY A;  1MNE A;  2VKN A;  3PVL A;  1IGQ A;  5L23 A;  2DJQ A;  2X35 A;  4M7D B;  2GNC A;  2RJE A;  2XG8 D;  2K79 A;  2XHC A;  2BE7 D;  2HL3 A;  1M4Z A;  1TUG B;  4CC2 A;  3UWN A;  4C5H A;  2YUO A;  1QP3 A;  1PRM C;  2KVQ G;  5FU7 B;  1VQ7 A;  4XTU A;  1YI2 A;  1QWF A;  1Y57 A;  4JJB A;  1WJR A;  3HRS A;  4BE0 A;  3I5S A;  2DVJ A;  4J83 A;  4QQD A;  2EJ9 A;  3M0U A;  5KYY A;  4JJN K;  3FEO A;  2A08 A;  3HPW A;  3O8V A;  3RR6 A;  2AKL A;  2D6F A;  4OGC A;  4E7S A;  5GAO p;  3OA6 A;  2O9V A;  1XNI A;  1BI0 A;  4J9G A;  4F16 A;  3MCA B;  6AT1 B;  4F04 B;  5M9O A;  3CCL A;  5FLX E;  2VXE A;  3DLL A;  2P0P A;  3OW2 S;  3EGD B;  2BUD A;  1SHG A;  2DTH A;  2H8H A;  2LT4 A;  3E2U A;  2NUP A;  1KC8 C;  1YI2 T;  2AIR B;  3QG1 A;  4M75 A;  2V1Q A;  1VQP A;  1T3S A;  2IG0 A;  1K0S A;  2DBK A;  4M7A C;  3SHW A;  1G5V A;  2JTE A;  1FXX A;  3P8B B;  1AZG B;  1ZLM A;  3JCM c;  4RTV A;  3G4S Q;  1VQ9 Q;  1M1K R;  3H9N A;  5HKC A;  1FYN A;  1Q82 R;  1QVF P;  5HCK A;  3EGU A;  1WPY A;  2KDS A;  4F7U A;  4EPC A;  1W1F A;  2CKK A;  1WDX A;  3CCJ A;  4GY5 A;  3J7A F;  1WHH A;  2YT6 A;  1D3B B;  3IQL A;  3RBB B;  1VQP T;  3GNF B;  2O31 A;  4JJD A;  4OVA A;  2CP0 A;  4II1 A;  3CCS A;  1H64 1;  1WXB A;  4EMH A;  2KE9 A;  5L8R E;  3OYB A;  2D1X A;  1K8A C;  1ACM B;  3CPW A;  3C0C A;  1BK2 A;  1U1S A;  4C92 F;  4LDV A;  4M7A E;  1VQK A;  2XMF A;  3OSV A;  2CP7 A;  1M30 A;  3V8L A;  5KH6 A;  5CVI A;  1E6H A;  1UJ0 A;  5CKF A;  3FLG A;  1R8O B;  2AT1 B;  2QTV A;  3QWX X;  4ZGE B;  1QVG S;  3CC2 A;  5I22 A;  3FB9 A;  4AG2 C;  2E12 A;  4ZN1 A;  3CD6 T;  4AFQ C;  3M4G A;  5A0L A;  1KC8 U;  1PG5 B;  3OYI A;  4AMC A;  3V8J A;  1LCK A;  2LQW A;  4B9W A;  4OB3 B;  5GAN 4;  2CH4 A;  9ATC B;  3L2Q A;  1H8K A;  3VS0 A;  1BI1 A;  4OMO A;  1TUC A;  3LGL A;  5GAO q;  2JT4 A;  2W10 A;  1VQK T;  4M7A D;  2MAM A;  3T9N A;  1JU5 C;  2XD0 A;  2XIC A;  2FZC B;  4L6V 5;  3CC2 T;  5CK9 A;  3HHT B;  3VRY A;  2OAU A;  1PKT A;  2LCS A;  2ED1 A;  2OI3 A;  3JCM P;  1S72 T;  3OW2 P;  2JTF A;  2M02 A;  2K3B A;  2L8D A;  5J3B A;  5IN1 A;  3OYA A;  2ZPF B;  4J9D A;  3ZFJ A;  4M75 B;  3CCQ A;  2GFA A;  1YIJ Q;  5DLQ E;  3OB9 A;  3LX7 A;  2E3I A;  4A63 B;  4RTU A;  2K57 A;  4QQG A;  1NPR A;  2E5K A;  3CCU Q;  4N4G A;  3EFO B;  4Y91 A;  1KQ1 A;  3UA7 A;  1X6B A;  2K5I A;  4XTV A;  4Q5W A;  4P5N A;  1AWW A;  2C0T A;  1TWB A;  4KH1 B;  1OV3 A;  2E65 A;  5C0M A;  1MMD A;  2HBP A;  2XDP A;  4OF1 A;  1RAA B;  1RAC B;  4FW1 A;  1OUL A;  4WTO B;  1I5L A;  4HT9 A;  4QQ6 A;  1QVP A;  4PJO G;  2EYQ A;  1VQO T;  2E4H A;  1VQM Q;  1YJW Q;  3J80 E;  1WHJ A;  1T3L A;  3INZ A;  3JB9 F;  2YHT A;  1PSE A;  1WNL A;  2RI2 A;  4E7J A;  1YJ9 Q;  2DEU A;  4JZ3 A;  4N0A C;  2GTO A;  2BIV A;  1SSF A;  3CBP A;  4MDW A;  4RG2 A;  3HFN A;  3QUI A;  4BI3 A;  2D8J A;  3EG9 B;  1VQ4 Q;  2GQI A;  3A8H B;  5GAN 2;  1WQ7 A;  1QVG P;  4FL6 A;  2DXC A;  1S1N A;  1JJ2 A;  4LE9 A;  3LLR A;  5DY9 A;  4HCC A;  2ZPI B;  1KIK A;  4LDX A;  3VYH B;  3CPW S;  2K2M A;  2G6F X;  3R6N A;  5CQY A;  1TSF A;  3MEW A;  1PC0 A;  1D0X A;  3EH2 A;  3H6Z A;  1KD1 R;  5I2M A;  1NEB A;  1KG1 A;  3JCM e;  4E6R A;  2CT4 A;  2ZGW A;  1X6G A;  1GRI A;  2QGF B;  3JB9 H;  5HY6 A;  4OMF B;  5KE2 A;  3OBW A;  1RI0 A;  1SG5 A;  5KCH A;  1I07 A;  2BKD N;  2JM8 A;  2F5T X;  4J7I A;  1ZUY A;  2DK3 A;  2VYT A;  4KGZ B;  1D1C A;  1VYT A;  1JXO A;  2LNV A;  1UE9 A;  2MWO A;  1M90 C;  2M1H A;  1ZHI A;  1VQ9 A;  3V7S A;  3JCM d;  2FG0 A;  3HRT A;  3TSZ A;  2XID A;  1G2B A;  2H3J A;  4PFZ A;  4J9C A;  4FW2 A;  2DL3 A;  2V8J A;  2LCL A;  1IHW A;  1AVZ C;  3LH0 A;  4CRI A;  3P8D A;  2E41 A;  4JUV A;  4GLM A;  4XU2 A;  4J9E A;  3H0F A;  1U8R A;  1Q82 C;  4B9X A;  2R57 A;  1WQW A;  4BE1 A;  1TXQ A;  1YP5 A;  2MPX C;  2QQS A;  3GBQ A;  1M3B A;  1Q95 G;  2D0Q B;  5KYW B;  1N5Z A;  4PJO C;  3C95 A;  5LJ5 h;  4C0G A;  2GF7 A;  3G4S T;  4MZM A;  1VQ9 T;  2VB6 A;  3VS2 A;  1I8F A;  4J6W A;  3JCM f;  4FYY B;  3ZBD A;  2RJD A;  4ZTJ A;  2ZZD A;  4ME7 A;  4IUR A;  2KXC A;  3UAT A;  1RL2 A;  5GAO m;  2YUP A;  4LN2 A;  1PD1 A;  4LUE A;  2LRQ A;  3V7R A;  4IIM A;  2HNI A;  4N4I A;  4A4F A;  3CC4 Q;  2RQR A;  1NJI R;  1UHF A;  2X51 A;  2E10 A;  1N9S A;  1U5S A;  3L2V A;  3VS7 A;  3NTH A;  1MHN A;  1D0Y A;  1QP2 A;  3I56 A;  2VAS A;  4MZT A;  2V26 A;  4MML A;  3JCM g;  3GIB A;  2K5F A;  2RHU A;  2C0I A;  1TU0 B;  1XOV A;  2W0Z A;  3FDR A;  5GMK m;  3NFC A;  2JUF A;  2P0Q A;  4PJO E;  4L59 A;  2DTI A;  4HCZ A;  2XKO C;  5GAN h;  2DYB A;  1VQL Q;  2XDD A;  2YRD A;  1XQH A;  1B34 A;  2RQT A;  2DVE A;  2DL8 A;  3CPW P;  2J06 A;  4M7A F;  1Z9Z A;  3PVQ A;  4WCI A;  5FWB A;  1Q82 U;  2CDT A;  1NE8 A;  2OX7 A;  1YHQ Q;  4AT1 B;  1AEY A;  3EGX A;  1XJW B;  2QA4 Q;  2KK4 A;  2QYZ A;  2YXY A;  1KK7 A;  3RDV A;  5AT1 B;  2KGT A;  3SFM A;  2PU9 B;  3VS3 A;  1M2V A;  1GFC A;  5IHK A;  1YIJ A;  1UUE A;  2KYM A;  1JJ2 S;  3KUF A;  8AT1 B;  2Z0W A;  2FPD A;  4HXJ A;  2MK5 A;  1OPL A;  4PJO D;  4KUI A;  4AFU C;  5GMK h;  1YCY A;  3MP1 A;  3WVE B;  1X2Q A;  3RKW A;  1WFW A;  5KYN A;  4E7K A;  2DD5 A;  3E9G A;  2AHJ B;  3EG2 A;  1CSK A;  5I11 A;  3RER A;  3TCJ A;  1YN8 A;  4OB0 B;  5J26 A;  5D6W A;  2DIL A;  5HK3 A;  4UC4 A;  4PJO B;  4OMM A;  1UEB A;  2KRO A;  1HXD A;  4OMN A;  3LW5 E;  1YIJ T;  3I55 A;  3ME9 A;  3JCM J;  1KFZ A;  1VQM A;  2JN0 A;  3QXE B;  1QWE A;  4HKE A;  3CCU T;  4M75 G;  4JDS A;  3AHU A;  3VV0 A;  3CME Q;  1OZ3 A;  1UB4 A;  2A0F B;  4KT0 E;  1JBM A;  2EQK A;  2PUO B;  1Q86 R;  1OZ2 A;  1IRE B;  2HDA A;  2JMA A;  4RUG A;  4D8K A;  1RAH B;  3EH1 A;  2DL5 A;  4NS5 A;  2NLU A;  3JCM b;  4ELY C;  4E7L A;  1TUD A;  2AK5 A;  2YLB A;  4F7U G;  4J9B A;  3EG0 A;  2QXF A;  2RM4 A;  1FWZ A;  2DXU A;  1VQM T;  2KXD A;  3MP6 A;  2E5Q A;  1YJW T;  3QZ5 B;  3RIR A;  4LUD A;  4RTZ A;  2RF0 A;  5CAI A;  5FW9 A;  1M3C A;  1VIF A;  5I21 A;  3PGG A;  2A28 A;  4HVU A;  2CGH A;  2EQU A;  5IXF A;  1YJ9 T;  1B7T A;  3S3N A;  4JZ4 A;  3KXT A;  1KHC A;  1ABO A;  3C4S A;  1VQ4 T;  4FYW B;  3JCM W;  4C8Q A;  1KD1 C;  1VOM A;  1KQS P;  1WHL A;  2ATC B;  1G3Y A;  3EFS A;  2PQW A;  3CEY A;  5LJ3 h;  4FSX A;  3NGP A;  2RH2 A;  1PCX A;  2EPD A;  4FIB A;  3CCM Q;  1SRL A;  1BI2 A;  3CXC P;  1HYO A;  3E9F A;  3OS2 A;  3CMA Q;  2XK0 A;  3QHS A;  3ZL7 C;  2V1R A;  3RMQ A;  2NUZ A;  1C6V X;  5FRO A;  1GCQ A;  5GAN 3;  1H3Z A;  1JJ2 P;  3M57 A;  2LQK A;  3QYH B;  3QO3 A;  1PM3 A;  2JVV A;  2O2O A;  2O88 A;  4M78 F;  1YWP A;  1N9R A;  5CKD A;  2FO0 A;  2M9U A;  2CZ6 B;  3PTA A;  1OX9 A;  3V8K A;  3CBM A;  4FT2 A;  3CCV Q;  2PVD B;  3GF5 A;  2DIQ A;  4FSS A;  5LJ3 e;  3CCR Q;  1Q7Y C;  1G83 A;  4C5G A;  2L3Q A;  4FYX B;  2QQ9 A;  2C0O A;  3HKS A;  1OYX A;  4M75 C;  1NM7 A;  1WIE A;  3GOX A;  3A98 A;  3MO8 A;  1GL5 A;  1OX8 A;  3OS0 A;  2MYS A;  1EZZ B;  2GCX A;  2DLP A;  1K9M R;  4RTX A;  2YUQ A;  4OB1 B;  4OP0 A;  3C12 A;  3CC4 A;  2L3R A;  2COZ A;  1WHM A;  2PZ1 A;  1X43 A;  1UGR B;  2LNH B;  1T0H A;  1BBZ A;  3CD6 A;  1KD1 U;  1HD3 A;  2JJ9 A;  1G3W A;  1Y07 A;  4NOY A;  5CIU A;  1NJI C;  2HKN A;  2CS7 A;  3FJP A;  4PJM A;  5CR2 A;  1MMG A;  4J9H A;  4HCK A;  4A4E A;  2DZ9 A;  1AD5 A;  3M55 A;  1ZBX A;  1M8M A;  2FRW A;  1M8V A;  2M51 A;  2K6D A;  3A5Z B;  2SEM A;  4AFS C;  1YWO A;  5DM7 R;  3NTI A;  1VQ8 Q;  1M1G A;  1VQL A;  1X75 C;  5GAO l;  1KJW A;  3FJ5 A;  1WA7 A;  3CC4 T;  2M0O A;  2ESW A;  4PK4 A;  4M75 E;  1OEB A;  2YRV A;  2NUT A;  2DET A;  1YHQ A;  3THK A;  2JS0 A;  3AT1 B;  2QA4 A;  1QCO A;  3X20 B;  1OOT A;  3FRN A;  1S72 A;  1MV3 A;  2DBM A;  2LCC A;  2V8I A;  3EFR A;  5GAO r;  1BI3 A;  4QVZ A;  4D6W A;  3TEE A;  1Q7Y U;  4ZTF A;  3QDR B;  1V1C A;  4D8D A;  4XQ3 A;  2KT1 A;  4AFZ C;  3QYG B;  2LQ8 A;  5ECA A;  5GMK l;  2CP6 A;  2F2W A;  5KYY B;  4F7U E;  2X3X D;  4WF2 A;  1NYF A;  3HTR A;  1TOV A;  1VQL T;  4HA8 A;  5LJ3 g;  1GFD A;  1X6O A;  1MV0 B;  2LP5 A;  5CQX A;  3JCM V;  2RN8 A;  3BY7 A;  1IGU A;  4M75 D;  1NYG A;  2EKH A;  1YHQ T;  1N8R R;  4KUL A;  2A36 A;  4J6X A;  2CSQ A;  2DM1 A;  1GBQ A;  2QA4 T;  2CP5 A;  4BY6 C;  1R0C B;  2CUB A;  3VRZ A;  1BKB A;  2QG9 B;  2K3Y A;  2VGN A;  1VA7 A;  1LVK A;  1MMN A;  3JCM Q;  2NUP B;  1NJI U;  2K3X A;  1Y96 A;  2QEX Q;  2FZG B;  2HL5 C;  4DBR A;  2FB7 A;  4R0K A;  1LOJ A;  5GAO n;  1VQO A;  3PMI A;  1YJN Q;  4OML A;  2DL7 A;  3NMZ C;  4O6J A;  3GPL A;  3URG A;  1WXT A;  2QTX A;  1ZSG A;  4BDY A;  2PNI A;  4M77 F;  1PWT A;  1B3Q A;  3VYG A;  3G7Z A;  2F2V A;  1V76 A;  3CC7 Q;  1VQN Q;  4E7H A;  2EKO A;  2DIG A;  2RD1 A;  4F7U B;  3L2Z A;  1PD0 A;  1SPK A;  2ROL A;  2EWN A;  2L3S A;  2RHX A;  4M78 A;  4DQ2 A;  1IB8 A;  2DEQ A;  1JQQ A;  2DX1 A;  3PIP A;  3SD4 A;  1TTH B;  1OI1 A;  1BB9 A;  5GMK i;  3CME T;  4M7D F;  3OSS C;  2HMA A;  2PVG B;  1W2B P;  4RTW A;  1KQS A;  4PLI A;  5CKE A;  1QKW A;  3O5Z A;  4KGX B;  4MDX A;  5KYX A;  1RAD B;  5KE3 A;  2AZV A;  5C6S A;  3CXC A;  4JRP A;  5KYU A;  5A2Q E;  4LD9 K;  2X4W A;  2HSE B;  1PKS A;  3R6O A;  4XTX A;  3MET A;  1FMW A;  4LDY A;  3CCM A;  4C0Z A;  1O9S A;  1ZUU A;  2YDL A;  4PLL A;  2DRM A;  4MMK A;  3MEV A;  1G3S A;  1F1B B;  2RPN A;  4IUT A;  1HJD A;  2HZY A;  4BI8 B;  4BB7 A;  3L1A A;  4HVW A;  4ANJ A;  1K0X A;  3BDL A;  2P84 A;  4OMP A;  1BCM A;  2VC8 A;  2EYY A;  2CH4 W;  4O5V A;  2ZCF B;  3CPF A;  2FPF A;  2F69 A;  5J39 A;  2M16 A;  1G3T A;  2DZC A;  4QVC A;  2DMO A;  4YTL A;  2O4X A;  3HSB A;  2EYZ A;  1QCF A;  2LT1 A;  4C92 A;  4BY6 B;  2COW A;  3DKM A;  4BD3 A;  1W6X A;  3BDU A;  4J7F A;  3SDZ A;  2HQH A;  2C06 A;  3CCM T;  4EDU A;  3M0T A;  5EC7 A;  1VYV A;  2EGC A;  5I2S A;  4AG1 C;  3CMA T;  2ECZ A;  5GAM h;  3G4S A;  1BYM A;  3OYM A;  1JRI A;  4X9D A;  4ZNX A;  3Q1J A;  5IXB A;  1D1B A;  3QPH A;  3L2W A;  1VQ7 Q;  2RI5 A;  1Q81 R;  4RG8 A;  2GFU A;  2WAC A;  4N4H A;  2RHY A;  4IUP A;  2DXT A;  2RJC A;  3WXM B;  3I5R A;  1M1K C;  4XAX B;  1VQ6 Q;  1UGP B;  1NLP C;  2HD0 A;  2MF2 A;  3CCV T;  1WGS A;  1MGQ A;  1MMA A;  1Z9Q A;  3MEA A;  3H8Z A;  3CCR T;  1BCO A;  1M1F A;  2E70 A;  3JSC A;  2DYI A;  2KRM A;  2SRC A;  1HSQ A;  2X3W D;  3CCL Q;  1X27 A;  1EX4 A;  2K9G A;  4J9F A;  3S6W A;  5FU6 C;  2CUD A;  3X24 B;  4E7Z A;  4X9C A;  2EGE A;  4DEX A;  2HSP A;  4GLK A;  2JS2 A;  1RAG B;  2GBQ A;  3OYL A;  2QI2 A;  2P4T A;  3H41 A;  3BW1 A;  3VS4 A;  2CP3 A;  4ZN3 A;  1UGQ B;  2EJG A;  4CC3 A;  2JTM A;  5FWC A;  3QZ9 B;  5IHN A;  2IIM A;  1YBY A;  2YLC A;  2EQJ A;  5KYU B;  2YWW A;  4M77 A;  1I0C A;  2KYB A;  1SHF A;  3CQT A;  5IT9 E;  5IH2 A;  3JRZ A;  2YUN A;  4EMK A;  1ABQ A;  4OGE A;  2RMO A;  3MJX A;  4JLG A;  5LJ5 e;  3VUB A;  5IAY A;  4QKU A;  2KRS A;  2V8K A;  3CCJ Q;  1VQ8 T;  1K8A R;  1QMC A;  3EG1 A;  3I9Q A;  1ZX6 A;  2G3R A;  3QKJ A;  1KQS S;  5LJ5 j;  2KY9 A;  1UDL A;  4JRK A;  3CCS Q;  5CCA A;  3DB4 A;  1M1K U;  4CI0 C;  2RHI A;  4CC4 B;  1K9M U;  3CXC S;  4M7D A;  1NG2 A;  1B07 A;  3G6E Q;  3G71 Q;  5D7U A;  2R5M A;  4M75 F;  4A4K A;  1Y7X A;  4DBF A;  1DJ7 B;  3CBO A;  3PE0 A;  2DRK A;  1HK9 A;  3M0R A;  1TS9 A;  2CT3 A;  1YJN A;  4C8Q G;  2IVW A;  3CCU A;  4EMG A;  1JB0 E;  4TVR A;  1N27 A;  2NWM A;  3M59 A;  1E6G A;  2EGA A;  3ASK A;  1R77 A;  5GAN e;  1H3H A;  4RCC A;  2BZ8 A;  4F7U F;  1J3T A;  2HQE A;  3CC7 A;  2K5L A;  1VQN A;  5GAN 5;  3TU4 K;  3UT1 A;  2LC4 A;  3MP8 A;  2J6K A;  5GAN j;  5AYF A;  5LJ5 f;  2JM9 A;  3RKX A;  2H3E B;  3I35 A;  2A7Y A;  4OMQ A;  1W2B A;  3A8M B;  3F70 A;  1ZA2 B;  3CCE Q;  5FU6 B;  2QEX T;  1PRL C;  4PKC C;  2KQW A;  1QQJ A;  1WYX A;  2P4R A;  3SWN A;  5EG2 A;  2EAY A;  1YJW A;  1M2O A;  3MHX A;  1YJN T;  5GAN d;  2EJF A;  2LJ1 A;  1ZSZ A;  2DXB A;  5GAN 8;  3SEM A;  1RAF B;  1M9S A;  1C0M A;  1TG0 A;  4KGV B;  5GMK e;  2J7I A;  2QAZ A;  1YJ9 A;  4Y92 A;  5A0D A;  3OYC A;  3CC7 T;  1VQN T;  1YIT T;  5LJ5 g;  2DD4 A;  3CCQ Q;  2OTL Q;  1I1J A;  2RQW A;  1PNJ A;  2EYX A;  3X26 B;  1VQ4 A;  2KSS A;  1UHC A;  3UA6 A;  5GMK j;  1ARK A;  4KBM B;  3MEU A;  2RQU A;  1FX7 A;  2FZK B;  4E47 A;  2RO0 A;  1D3B A;  3BE3 A;  3UF4 A;  5GAN f;  2DNU A;  1I4K 1;  2QGG A;  4BI4 A;  1M5Q 1;  1AOJ A;  4ATO A;  2BZY A;  3VJP A;  3VUZ A;  1O75 A;  4FU6 A;  3HL8 A;  2KI7 A;  2MI6 A;  2K2V A;  4J9I A;  2RK1 A;  2FVU A;  1FMV A;  2KNB B;  1B34 B;  4LDU A;  2K7A A;  1VYU A;  3EHQ A;  2KAF A;  2GQV A;  2L2P A;  1UG1 A;  5GAN g;  4M4Z A;  3EGX B;  2LJ0 A;  1QW1 A;  4EIK A;  2X4Y A;  2A3L A;  1E7O A;  4C8Q C;  1ZBJ A;  1OU8 A;  3N5B B;  2LTO A;  1M2V B;  4BDZ A;  3LH5 A;  1VIE A;  1NPP A;  4XTW A;  4BE2 A;  2RK2 A;  2DTO A;  5GJW B;  3OYF A;  1VQ6 A;  1PSF A;  4DEY A;  1WXU A;  2E64 A;  1K73 R;  2E3H A;  1GXI E;  2X9H A;  1GCQ C;  2AZS A;  1Q81 C;  4F14 A;  1RI9 A;  2L89 A;  3NPF A;  3M56 A;  2O9S A;  2QQR A;  3NHN A;  3HRU A;  1JO8 A;  3REB B;  5FRN A;  4M7A A;  1D0Z A;  4ESR A;  1BU1 A;  3QJY A;  3OYY A;  2VGM A;  1M90 R;  2CYZ B;  5LJ3 j;  1VQ7 T;  1AHJ B;  1Y0M A;  1A0N B;  3SWN B;  1GCP A;  1EFN A;  1AWO A;  4K11 A;  3A1P A;  2OAW A;  2HBW A;  1ZSZ B;  1KQ2 A;  3M0Q A;  2CZ1 B;  4C8Q E;  3LWI A;  1VQ6 T;  1WJS A;  2LX9 A;  2E1H A;  3EFO A;  5LJ3 d;  3A8L B;  3JAM E;  2DF6 A;  1UTI A;  3PMT A;  2CZ0 B;  3A8O B;  2LQN A;  2LZ6 B;  4ZGJ B;  1QLY A;  4Z8A A;  3BFM A;  2VV5 A;  2BZX A;  4OB2 B;  4BAC A;  1ZA1 B;  2JOY A;  3CCL T;  2COY A;  1W2B S;  2PTK A;  3OYK A;  2QK0 A;  4XU0 A;  2EQM A;  1LPL A;  4DA4 A;  1UEC A;  1M27 C;  2GGR A;  1AZE A;  4M78 G;  2HEQ A;  1WLP B;  1X69 A;  1U1T A;  4C8Q D;  4JS5 A;  1RAI B;  3OYD A;  1I81 A;  5LJ3 f;  1D09 B;  1RLP C;  3M5A A;  4FYV B;  1Q81 U;  3VU3 C;  2KBT A;  1UGV A;  2B8A A;  3G6E A;  3G71 A;  1K4U S;  4E2F B;  3M58 A;  4QVD A;  1YCS B;  3RES A;  3QWY A;  2D0N A;  4F17 A;  2RI3 A;  1SKU B;  4RCB A;  4C8Q B;  2PUK B;  3EG9 A;  2OTJ Q;  3WVD B;  4GBQ A;  1VQ5 Q;  4NL3 A;  4C5E A;  2VUB A;  1SEM A;  3CCJ T;  2FL7 A;  1G8X A;  1AWX A;  1VUB A;  3OMC A;  1EIF A;  4XTY A;  3I56 Q;  3CCS T;  1C1A A;  1QKX A;  1XTD A;  3QJ6 A;  4PJO F;  4IKF A;  2DAQ A;  3JB9 I;  2Y4X A;  2RJF A;  2L3P A;  3G6E T;  3G71 T;  5LL6 S;  5DLO A;  1U3O A;  2CRE A;  3CCE A;  3REA B;  2F2X A;  1UGS B;  1TH7 A;  1NBE B;  2JXB A;  4C92 G;  1LNX A;  2E6N A;  1MND A;  2AKK A;  3E1S A;  3RNJ A;  2KRN A;  4M7A B;  3ZEH A;  3CME A;  4RTY A;  2OJ2 A;  4JLI A;  3KFV A;  5GJV B;  3S3O A;  3OMG A;  4C5I A;  4J5Y A;  2Y90 A;  3RUX A;  1AT1 B;  2OTL A;  5KCO A;  1YIT Q;  1K8A U;  3QDF A;  2DA9 A;  3ULR B;  2F5K A;  1OQK A;  2MWP A;  3OYJ A;  4A53 A;  1Q86 C;  3CCE T;  2QDY B;  2WSF E;  2DER A;  2EBP A;  5KYW A;  3LWH A;  3L2U A;  4Z02 A;  4DBH A;  3TVT A;  2BTT A;  1QCN A;  3TSW A;  5GAN 7;  4M78 C;  3V7C A;  2DKG A;  4PNO A;  3VS6 A;  3CCQ T;  3OQ5 A;  3I55 Q;  2OTL T;  3OYN A;  2RA2 A;  4PJN A;  1YFN A;  2LDM A;  3DLM A;  4N0A A;  3FIF A;  4KH0 B;  4J6Y A;  3EHR A;  3P8H A;  2Y4Y A;  2L5Q A;  2NUT B;  1MUZ A;  3JCM h;  3PT9 A;  2X4J A;  3FC3 A;  4A54 A;  3VS5 A;  4XTZ A;  3CMA A;  4PFP A;  4HVV A;  4LNP A;  1BIA A;  1SSH A;  2HQX A;  2L0A A;  2MOX A;  1RAB B;  4M77 G;  1CKA A;  3D7S B;  3J81 E;  5D6Y A;  4QT7 A;  1N6A A;  3H0H A;  2HCK A;  4Z88 A;  3S3M A;  2P0K A;  1RLQ C;  2M0Y A;  2XI9 A;  3CCV A;  4M78 E;  2RB6 A;  1P92 A;  2WSE E;  1K1Z A;  4X1V A;  3CCR A;  2JZ2 A;  1K73 C;  1Q86 U;  2ABL A;  1IZ6 A;  4JRQ A;  2JW4 A;  5HK0 A;  2D8H A;  3L42 A;  2DFU A;  2B86 A;  1Y71 A;  4C92 C;  1FMK A;  2E6Z A;  5A0G A;  3JB9 G;  4M7D G;  1JXM A;  3EG3 A;  2ENM A;  4PL6 A;  4MZP A;  2RQV A;  1Y96 B;  3C94 A;  1YI2 Q;  2KEA A;  2ZPH B;  1QVF A;  3M9Q A;  1JEG A;  1OU9 A;  3HFO A;  2KR3 A;  3MPU B;  3JV3 A;  1K9M C;  2F1L A;  3M53 A;  4M78 D;  4RTT A;  8ATC B;  1W70 A;  2LVM A;  4B6M A;  3OYH A;  2O01 E;  4DBQ A;  4JPB W;  1KC8 R;  1RAE B;  1ZUK A;  4PJO A;  4LD6 A;  1UJY A;  2XU8 A;  4L5G A;  1Q7Y R;  3LGF A;  4ZGD B;  2CP2 A;  1K76 A;  4IIO A;  4LDW A;  2J6O A;  5GAM e;  2HAX A;  1SF9 A;  4M78 B;  1WZO A;  5CO7 A;  2EFI A;  3M0S A;  1VQ8 A;  2A37 A;  1I5O B;  3RMS A;  1R0B G;  2RNA A;  1VQP Q;  4C92 E;  3OYG A;  2ZAE A;  2DPP B;  5GAM j;  3JCM X;  3LYI A;  2QDL A;  4XU1 A;  2J05 A;  3UDC A;  1IXD A;  3PIO A;  2ZPG B;  5KYX B;  4C0F A;  2EIF A;  4C8Q F;  3M0P A;  1V29 B;  4J8O A; 
#chains in the Genus database with same CATH homology
 2Z0W A;  1WHK A;  1TXQ A;  3TQ7 P;  2MPX C;  2COZ A;  2QK0 A;  1WHM A;  2E3I A;  1WHL A;  2HL5 C;  2CP7 A;  4B6M A;  1WHH A;  1LPL A;  2CP3 A;  3RDV A;  2HKQ B;  2COW A;  2E3H A;  2CP0 A;  3E2U A;  1IXD A;  2CP5 A;  2CP6 A;  2M02 A;  1WHG A;  2HQH A;  2HKN A;  2E4H A;  2COY A;  2CP2 A;  2HL3 A;  1TOV A;  1WHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...