2E4HA

Solution structure of cytoskeletal protein in complex with tubulin tail
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
74
structure length
74
Chain Sequence
RELKIGDRVLVGGTKAGVVRFLGETDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCQPKYGLFAPVHKVTKIGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Restin
publication title Structural basis for tubulin recognition by cytoplasmic linker protein 170 and its autoinhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 7
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2e4hA00
2CP5A 2COZA 1WHHA 3RDVA 2HL3A 2COWA 2HQHA 1WHJA 1LPLA 2E3HA 1TXQA 2HKNA 2QK0A 2HL5C 1WHMA 2E4HA 2E3IA 1IXDA 1TOVA 2CP3A 2CP7A 2CP0A 2CP6A 2CP2A 2Z0WA 3E2UA 1WHGA 2M02A 2MPXC 1WHLA 1WHKA 4B6MA 2HKQB 2COYA 3TQ7P
chains in the Genus database with same CATH superfamily
2DD4A 4HXJA 2KT8A 2FL7A 3E9FA 2PVDB 4M78F 2JZ2A 5KYUB 5IHIA 1WQWA 2M16A 3CC2A 1FXXA 3L42A 2JN0A 1H92A 2QAZA 4PFPA 1KQ2A 1VQOA 3H0HA 4JRQA 1YIJT 1UUEA 1GRIA 2DVEA 3G71T 2DFUA 2EAYA 2GFUA 1SRMA 1SPKA 2XDDA 3JCMW 5CVIA 2DJQA 4JLGA 6AT1B 3M56A 1XQHA 2GNCA 1BI1A 1N8RU 2RK2A 2FRWA 5GAOp 2EVRA 2IIMA 1QMCA 1Q81U 3CCVA 4C8QD 4AFSC 3F70A 1MHNA 3OYEA 1RAFB 4JDSA 4C92G 2HL3A 1GXIE 1NPPA 2JTMA 1M2OA 2AZVA 3QIIA 3X24B 3PE0A 2QK0A 4N0AC 2F2XA 4J9EA 3ZBDA 2GFAA 1VQ5A 1UHCA 2EGCA 4OMFB 1H641 1G2BA 1BIAA 1G3SA 1YP5A 1YJWA 5LJ5g 1IGQA 2FO0A 4J6WA 2QQRA 3E19A 4M7AC 1PSEA 2KSSA 4J5YA 2CUDA 2P4RA 1X01A 1X2QA 4E7ZA 2L3QA 3KXTA 5LJ5h 3BW1A 4N0AA 3CMEQ 1UJ0A 1S1NA 4XQ3A 8ATCB 1XJWB 5EG2A 1ZSZA 2M9UA 1X2KA 1UTIA 3JB9F 5CR2A 3QBYA 5IXBA 4Z8AA 5GANe 4M7AD 3G1JA 3REBB 1KHIA 5GAMe 2VB6A 1TXQA 2BE9B 1AWOA 4M7AA 3CCST 2DBKA 1KQ1A 3UF4A 2LDMA 3I55A 3L1AA 4XTYA 3OYFA 4OB2B 3PGGA 1YJ9A 4DBRA 4BE2A 2K4YA 2LNVA 4Y92A 3QYHB 1GL5A 1D1BA 4C8QG 2DVJA 3RKXA 3KUFA 3I56T 3QHSA 1PSFA 4M75D 1H3HA 2FPDA 2J06A 3EG2A 4M75A 2SRCA 3FRNA 4QQGA 2C0OA 4A54A 1UG1A 2M0OA 3AHUA 1JU5C 1CSKA 1VA7A 2ZCFB 2E1HA 2KT1A 1K0SA 1N27A 2CUBA 5KE2A 3CCMA 4N4GA 2X51A 3QO3A 2CZ0B 2KAFA 3NTIA 2MAMA 1PM3A 4DEYA 5GMKm 2X3XD 2QQSA 2ECZA 3PFSA 3HRSA 7AT1B 1TS9A 4QT7A 2MK5A 3G6EQ 1U06A 2YLBA 3EH1A 4M7DB 4LD6A 3QYGB 2BIVA 1Q81C 2MYSA 2XG8D 4M77B 3MP6A 3EFOB 4GLMA 3PTAA 1QCOA 5LJ3d 4AFZC 9ATCB 4N4IA 4OB0B 1U1SA 2DYBA 1Y96A 1IO6A 4RG8A 3VS6A 1VOMA 5FU7C 5HCKA 1VQ8A 2D9TA 1QKXA 5D6XA 2EIFA 2KYBA 2YT6A 3FEOA 1D0YA 2PQWA 3INZA 2CKKA 4JS4A 1YHQA 3LX7A 1FX7A 3HPWA 4C0GA 4CC3A 1YIJQ 3QZ5B 3G71Q 2EQJA 3QZ9B 5FU6C 4KBMB 3RERA 5LJ5j 1G8XA 5I11A 3H0IA 4M7AG 1TUDA 2J7IA 4RCBA 1NPRA 2D6FA 1KD1U 1OPKA 1AWXA 1OX8A 3VS7A 2RJCA 1VQ6A 3Q1JA 3JCMQ 1K4US 2DZ9A 2LRQA 3M54A 4JZ4A 4ZTFA 3CC7A 2R5AA 4M7DE 2GQVA 2LZ6B 2K5LA 1TUCA 1UECA 1M2VB 3I5RA 1AVZC 3JAME 4RUGA 3O8VA 4M77E 4M78B 4ELYC 4JZ3A 4XAXB 3JCMc 5FRNA 2QTVA 3OYNA 2JS2A 4AFQC 1X43A 3CBMA 4OMPA 1M1FA 1W70A 2ZPEB 2VKNA 3SDZA 4ZN1A 3PIPA 2RMOA 1MGQA 1U1TA 5CQXA 2QA4A 1ACMB 2RN8A 2EFIA 3LW5E 2HNIA 1NJIU 2EKOA 3QXEB 3JRZA 4HT9A 2E10A 4LDWA 1OZ3A 3EGUA 4MZPA 8AT1B 1XOVA 2WACA 2H3JA 4MDWA 4LD9K 1QLYA 1M27C 1W2BA 3S3NA 4C5EA 1D3BA 2J6FA 3A8GB 1WHHA 3PMTA 4ZN3A 3J80E 5GAN8 1ABOA 2PUOB 1LCKA 1WA7A 3SEMA 1WXBA 1B3QA 1R77A 3JCMe 3CCSQ 3MJXA 4J83A 3A8OB 1VQLQ 2NWMA 2JOYA 2JW4A 3MEVA 5CCAA 1VQ7Q 3HSBA 5FW9A 4A4GA 5FWBA 1K9MU 2P84A 2BE7D 3CCJA 1M8MA 3VUBA 5GAN7 4OMLA 4LNPA 4M78E 1O9SA 3DLMA 3I56Q 3EGXA 5GMKl 3A5ZB 2QQBA 3CMAQ 2EQUA 1ZX6A 2CP0A 3OW2A 2EQKA 3CC2T 4GLKA 1RAGB 4XU0A 4FYVB 2HBWA 1YCYA 1H8KA 3RMSA 3I35A 5GMKh 4FT4A 2QI2A 4XTWA 1VQKQ 1W2BP 2EPDA 4B9XA 2OTJA 1VQOT 2KNBB 2X4JA 4FW2A 1E6HA 2DX1A 3CCLA 2G6FX 3QG1A 2LJ1A 4HVUA 5KCOA 3HHTB 4K11A 2ENMA 2D1XA 3JB9I 3M5AA 5CAIA 3C0CA 4PK4A 5CIUA 1KD1C 4OB1B 3CCVT 4M75F 3A8MB 5GAMf 3GP8A 4LUEA 1NBEB 4PJOF 2XU8A 3NGPA 2EBPA 1RACB 4Y28E 2P0KA 2RQVA 4MZMA 1S72Q 4CRIA 4DEXA 3CQTA 3ASKA 2DL4A 3REAB 3ZL7C 3NPFA 2RQTA 2LP5A 1EZZB 1JQQA 2E6NA 2K6DA 5GAOl 3C4SA 3FLGA 4KUIA 4BI4A 3OW2P 3EG9B 4MDXA 4BE1A 2X4WA 1NZ9A 1UGQB 2JS0A 2RHZA 1UGVA 1PKSA 1M3AA 5HK3A 1FMKA 5AYFA 5I21A 2DYIA 5KYWB 4EPCA 3J7AF 1MV3A 3EHQA 2KEAA 2CH4W 3CMET 4BY6B 2QQAA 2KR3A 3RKWA 3CCUT 1VQ4A 4JUVA 1NJIC 2E41A 1BK2A 1WJQA 1PG5B 1DJ7B 3FB9A 2COWA 2XHCA 3VYHB 3SWNC 2LCLA 5GAOr 1OI1A 3VS0A 1G3YA 1M4ZA 5GAOn 4E47A 2VYTA 1UGRB 1SEMA 1M90R 2DEQA 1WHGA 1Q95G 4XU3A 4PNOA 2DBMA 2F2VA 4J7FA 1KG1A 4L5GA 1YJ9T 4UC4A 3SWNA 1K9MC 1WYXA 3HRUA 4D8KA 4WTOB 5LJ5d 3GIBA 2O4XA 2JT4A 3CCEQ 2DD5A 1PWTA 4F04B 2RI2A 4PFOA 5D7UA 4F7UG 4AMCA 1N8RR 2NUPB 4BACA 2PNIA 4E7IA 1Q81R 4XU2A 3M0QA 3SFMA 5KE3A 4OGCA 3RKYA 1ARKA 1MNEA 1EFNA 3CCMT 1I07A 1RI0A 5GMKj 1KSWA 2HD0A 4KGXB 3OYAA 2R57A 2SEMA 1RABB 3QJYA 2YDLA 2YLCA 1IZ6A 1XNIA 1Y57A 1ZA2B 2YXYA 4FIBA 1K0XA 2WSCE 5LJ5e 3LWIA 2DRKA 1ZUUA 4PJJA 2EQMA 3OS5A 4LDVA 2KQWA 1KQSS 2FHDA 2CZ6B 2HKQB 1GFCA 2AHJB 2FPEA 4HT8A 3GLXA 2ZPFB 2K79A 4C8QA 1YI2A 1G3TA 1AOJA 1QVGA 2DL8A 4JJBA 4DOVA 5J39A 2DTIA 4F14A 1JJ2S 1WLPB 2VV5A 4II1A 5DY9A 1VQNA 1PHTA 3CC2Q 4EDUA 1N6AA 2AKKA 2CDTA 3C12A 2CREA 1G3WA 1I0CA 2DE0X 3OYJA 1NEGA 1SSFA 2VXEA 5KYNA 1VIEA 2A7YA 1QVFS 1YHQT 2QGGA 1NM7A 5L23A 1VQOQ 3FJPA 1OU8A 3DB3A 2EGEA 1F1BB 2RNAA 1AHJB 2WSFE 2BUDA 4XTUA 2HEQA 3OSSC 2DM1A 2F5TX 4DQ2A 1VQ6T 3CCVQ 2DXUA 2X4XA 3LYIA 4OVAA 3OB9A 4DBQA 3OMGA 4ZGDB 2CYZB 2CZ7B 3PT9A 3CC7T 3QDFA 1IHWA 1WHMA 5GAN6 1GBRA 3CC4A 2MCNA 4Q5WA 3M58A 1ZSZB 1QVGP 1Y71A 2A28A 3CPWS 3OYBA 1OZ2A 2KRSA 1VQ5Q 2EYZA 2BKDN 2YSQA 4PL6A 1AZGB 3EHRA 4BDZA 5HY6A 1YJWQ 1D1AA 4N4HA 1TWBA 3CCUQ 2ED0A 2CP5A 1KC8U 3VJPA 2NUTA 5GAN5 3LH0A 1WPYA 2HCKA 3EFSA 2EJGA 1KHCA 4M4ZA 4J9BA 2JMCA 2X3WD 4CI0C 3OYIA 1OEBA 4M75B 4PJOB 1WJSA 1U5SA 1VQLT 3LGLA 1NEBA 1KFZA 5J3BA 1VQ7T 1WGSA 4A63B 4F17A 2EWNA 4IIMA 5GAN4 2LVMA 3NTHA 4PJLA 3BDLA 1WDXA 2DXTA 2EYWA 2JM9A 1WX6A 1VQMT 5DLOA 2H8HA 3I55Q 2FG0A 2X35A 1YJ9Q 2V1RA 3CCJT 4IURA 3BE3A 3PMIA 4OF1A 3CD6T 4FYWB 5AT1B 1M1KR 2RA2A 3CMAT 4J7IA 5FLXE 1OU9A 1CKAA 2YUOA 3MHXA 1MUZA 5I22A 1YWOA 2DAQA 2RF0A 1B34A 2VVKA 2Y4YA 2QTXA 3G4SA 4LDUA 1LPLA 2LX9A 3EG0A 1VYUA 1K73R 2IVWA 2O88A 1VQKT 1BI0A 2RHYA 3SD4A 3VRZA 4BDYA 3OBWA 1YCSB 1PD1A 3HFNA 1VQ9A 1WJRA 1X27A 1YITA 2KGTA 3L2VA 3CCMQ 1ZQ1A 4C92F 3OYYA 2CP6A 3EAEA 4XK8E 5CKFA 1Y96B 2F69A 1R0BG 1BCMA 1X6BA 1GFDA 4C5HA 1RLQC 2RK1A 4LDXA 2Y4XA 4PJOE 2DJZA 4JRKA 3META 3OYDA 5KYXB 1RAEB 5IT9E 3CXCS 2HAXA 1QKWA 1FMVA 2K5IA 4R0KA 2D0QB 1S72T 2DETA 3PVLA 1NJIR 2KDSA 3TEEA 1OPLA 4M7DC 2O2OA 3URGA 4JRPA 3FDRA 1WHJA 3V7SA 1K8AR 2P0QA 3G7ZA 2DKGA 2D8HA 2L89A 5FRMA 4M77C 5HKCA 2QASA 2YRCA 1IXDA 2G3RA 3ME9A 2X9HA 3UT1A 3GOXA 3A1PA 5ECAA 1VQ8Q 1V29B 2EYQA 3U23A 4ORZA 5GAMg 1W1FA 5GAN2 5CKDA 5A2QE 3CEYA 2LNHB 1JXOA 4JLIA 4M7DD 4J9IA 1YHQQ 1QCFA 4C5IA 3RBBB 4M7DA 1PKTA 2FPFA 2QGFB 3EGDB 1K9MR 5GAOm 2HSEB 1VQ4T 1KK7A 4M77D 4DOWA 3HP9A 5GAMh 5C6SA 1GCQC 2DNUA 2PU9B 2RJDA 2ROLA 2L5QA 4M77A 4BD3A 2JM8A 3O5ZA 3CCQA 4LDYA 1KC8C 2LQKA 2E64A 1U3OA 5LJ3e 2K5FA 4OGEA 4C8QF 4KT0E 1K1ZA 5GMKe 1R0CB 1ZUKA 1M1GA 1VQ6Q 4HVWA 4KH0B 3GNFB 3C95A 2LJ0A 1YN8A 1SSHA 3CC7Q 4EMKB 1YFNA 1AZEA 3J81E 4BI3A 5CKEA 1C6VX 3M59A 5IN1A 3H0FA 2EJ9A 3CCET 3S6WA 4BE0A 5DM7R 1D3BB 2JMAA 2F2WA 1RAAB 1TU0B 2MI6A 2O9SA 1JO8A 2E6ZA 2DO3A 4M78C 4ATOA 3LGFA 4E7HA 2BZYA 1AWJA 1Q82R 3VS2A 2QA4Q 1TSFA 2PUKB 2LQ8A 5KH6A 1K76A 1WHLA 4J6XA 2ZPBB 2JVVA 3MO8A 2LX7A 5KYYB 2QQ9A 3QWXX 4QW2A 4J9DA 4ELZC 3EGXB 2CSIA 2JJ9A 4M78D 3R6OA 3MEUA 2M51A 4E6RA 4M78A 2E4HA 4FU6A 2QG9B 4BB7A 3UATA 1ZLMA 3M4YA 4QVZA 3TVTA 2HMAA 2E65A 2L3PA 1PRLC 1R8OB 1E6GA 1OV3A 4QQ6A 1VQMQ 3NHNA 1B07A 5IHKA 1PRMC 2GTJA 4LUDA 4O6JA 3CCJQ 2V1QA 3DKMA 1QP3A 3CD6Q 3MP8A 2GBQA 3A98A 2R5MA 5EC7A 1JB0E 1QVPA 3JCMb 2OAWA 1K9AA 1WI7A 2KBTA 1M8VA 2QEXA 5CQYA 2DK3A 3L2QA 1YI2T 1YJNA 4F7UA 4Z89A 1MMGA 1UDLA 4M7AF 2O31A 3OQ5A 4M7DG 3JCMV 2K57A 4A4KA 1QP2A 1HD3A 5CK9A 2OX7A 2DPPB 2L3RA 4NL2A 3BDUA 2BZ8A 2RI5A 4M77G 3VKIA 2OTJQ 2M02A 2LQNA 2DILA 2RI3A 3QWYA 2FZGB 5GAMj 4RTYA 5A0GA 3CCLQ 2PZ1A 4X9CA 3T9NA 1BCOA 3H8ZA 5GANf 1HYOA 4CC2A 1ZSGA 4LN2A 3NMZC 4IIOA 4PLIA 1YNZA 1Y0MA 2O01E 2P4TA 2ED1A 2L8DA 1VUBA 2QXFA 4IUVA 4CC7A 2A0FB 4NL3A 2DEUA 1QQJA 3JB9D 2BZXA 3VV0A 2HQHA 1VQ5T 1QWEA 2LC4A 3S3OA 1T0HA 1BYMA 4X1VA 2RM4A 3VU3C 3OS2A 3L2UA 3P8DA 4XTXA 1YJWT 3RMQA 2DTOA 2DL3A 4IKFA 4C0ZA 4C92B 3OYGA 1X75C 3QKJA 3OS1A 2A08A 1VQ4Q 1SRLA 2CGHA 3X26B 3RUXA 4M78G 2O4XB 2K7AA 2XI9A 3D7SB 1VIFA 3OYLA 4BY6C 3KBGA 1QWFA 2EYYA 1WXUA 4HCCA 2L2PA 3V7RA 1ZBXA 3HL8A 2FZCB 5I2SA 3FC3A 5LL6S 1BI2A 1V76A 3GNGA 4C0DB 3EG9A 3I55T 4JPBW 3ZFJA 4OB3B 2YWWA 1Q86U 4ZTJA 4LE9A 1WNLA 1MV0B 2JUFA 2QYZA 5KYWA 4V2SA 5GJWB 4FSXA 4O5VA 1QW1A 1YBYA 3JV3A 3IQLA 1TUGB 3GPLA 1UFFA 2M0YA 3PNWC 3VS1A 1GBQA 3VS4A 1SF9A 4OMMA 5D6YA 2XK0A 1VQPA 2XKOC 1SHGA 1AT1B 1Y07A 4B9WA 4ESRA 3L2ZA 2OTLA 2KXDA 2A3LA 4C92E 4ZGEB 1J3TA 1MMAA 2DERA 1VQ9T 4C8QB 4KGVB 1TH7A 2DA9A 2L3SA 1JXMA 2DF6A 2JTEA 2H3EB 2KRNA 2MIOA 4QQDA 2GTOA 3UA6A 4E7SA 3VUZA 2E3IA 3DLLA 3JSCA 2M1HA 3M0RA 3JCMJ 1BBZA 2ROTA 3QUIA 3HFOA 2YUQA 2MPXC 1WHKA 5LJ3f 1IGUA 3CCRA 2EQIA 1OYXA 3X25B 3A8HB 1M9SA 2W0ZA 3LWHA 1D0XA 4EMHA 3JB9G 4Y91A 4QVDA 1ZUYA 3MKDA 1LJOA 2AK5A 2P0PA 4QVCA 2LTOA 3M55A 3RNJA 1RUWA 4RKUE 1YI2Q 1VQ8T 1RAIB 2CZ1B 2VASA 1PNJA 4J9GA 3H41A 2COYA 2ZPHB 1Q7YU 3OYCA 3RDVA 1SHFA 1HXDA 1W4SA 3HTRA 1M90U 2K9GA 1VQNQ 2J05A 4RTUA 2E5QA 2YUPA 2YUNA 1ABQA 2NYSA 5IHNA 3THKA 2KE9A 4PJNA 5CO7A 3WVDB 1NYGA 2GGRA 1TG0A 2KRMA 1VYVA 4C8QE 1M30A 3MEWA 3QJ6A 3V8KA 4JJNK 3CCQT 2QDLA 5KYUA 5GMKi 2D8JA 2FRYA 3CPFA 3JCMf 1I8FA 1LOJA 4ZGJB 3DB4A 4FW1A 4E2FB 5FROA 4F7UF 3RR6A 1BKBA 1OX9A 2NUTB 1Q86C 4CC4B 3CC4Q 3E9GA 2NLUA 2DRMA 3H9NA 5GANd 1V1CA 4D6WA 1T3SA 3GBQA 5GAMd 2BTTA 4RTXA 4RCCA 4M7AB 1TTHB 3TREA 2ABLA 2YHTA 4XTVA 4ANJA 1D1CA 1U8RA 3GF5A 2QA4T 1I1JA 2CP7A 1ZSZC 2RD1A 3BY7A 3HKSA 2EW3A 1I5LA 2MWOA 3ER0A 2LCSA 1P92A 2J6KA 1RAHB 2E3HA 2DIGA 3CMEA 5C0MA 3CCUA 2GF7A 2RJFA 4FCYA 5KCHA 4OMNA 2K3BA 2CSQA 1UJYA 2JTFA 2CH4A 3RESA 4BI8B 1G83A 5GAN3 1B34B 4B6MA 2DL5A 4PFZA 3V8JA 4HA8A 2KXCA 1NE8A 1KQSA 1PD0A 2XDBA 1YWPA 1Z9QA 5GJVB 1X6GA 2RH2A 4A4EA 4M75C 2HL5C 1Y7XA 4PJOC 1UHFA 1UGSB 1FMWA 2XIDA 1M3CA 4IUTA 2VGNA 2R58A 3JB9J 1IB8A 2VGMA 4L6V5 1WIEA 4QKUA 3C94A 3M53A 3OYKA 1QCNA 3L2WA 1IRXA 3S3MA 2ZPGB 1JJ2A 1KD1R 4M7AE 1W6XA 1LNXA 2QEXT 1UEBA 4HCZA 1X69A 2ZGWA 5CKHA 5DLQE 1YJNT 4PJOD 2ATCB 4WF2A 2XMFA 4DA4A 1NG2A 2FEIA 3M0UA 3G4SQ 1QVFA 3EG1A 1Q7YC 4PJOA 2ESWA 3FIFA 1M90C 4PJMA 2OTJT 3TSZA 4E7KA 1VQ9Q 1YITQ 1FWZA 3PIOA 2F5KA 4HKEA 3CCLT 4GY5A 2C0IA 1RLPC 4JJDA 1NYFA 1N9SA 4M75E 2HBPA 4L59A 4F16A 1W2BS 4RTTA 1KQSP 2FZKB 3G6EA 2K2VA 4ZNXA 4BUGA 4FT2A 2WSEE 4NS5A 1BU1A 4J8OA 1SG5A 1N8RC 2OAUA 4J9FA 5FU7B 2HQEA 2EYXA 3SHWA 3CPWA 1JJ2P 2RHUA 1OOTA 3E1SA 2D0NA 4HCKA 1I81A 4YTLA 1T0JA 1TOVA 3EH2A 2LQWA 1WXTA 2V8KA 4VUBA 3VYGA 4A4HA 5GANg 4AT1B 1QVFP 2DZCA 1LVKA 3MCAB 3V7CA 2RJEA 2O9VA 2RQRA 1HK9A 5FU6B 5GANh 2PVOB 5D6WA 2FB7A 3OW2S 3I5SA 2KYMA 3OBYA 3PVQA 5KYXA 1YIJA 4KUDK 3ZEHA 4PLLA 4R56A 3G71A 2GQIA 4FYXB 1WQ7A 3EFOA 1H3ZA 3TU4K 1M1KU 2HDAA 3KFVA 2RQUA 3CCQQ 4E7JA 3AT1B 3L2RA 3M0TA 2YRDA 3CBPA 1M3BA 4MZTA 3M0PA 1N9RA 5LJ5f 2I0NA 1JRIA 3M4GA 4J9HA 2DXCA 1GCQA 4WCIA 3ULRB 1K73U 1C0MA 2Y90A 3CPWP 1UGPB 4E7LA 4FYYB 4EMGA 2QDYB 4RTVA 1O75A 4EMKC 2LT1A 1GCPA 4A53A 3EGDA 3JCMd 1I4K1 4A4FA 4RTWA 2JNGA 4M75G 2FYKA 3VS5A 4X34A 4PJOG 3RIRA 1VQPT 2CS7A 2OJ2A 2VUBA 3EG3A 2K3XA 3TCJA 2ZAEA 2OTLT 2JXBA 4JJCA 1A0NB 2KROA 1JEGA 1M2VA 1RL2A 4X9DA 4EMKA 4NOYA 4IUUA 1Z9ZA 4C0FA 1EIFA 5GAOq 1K8AU 4AG1C 4RG2A 2MOXA 3JCMP 4AG2C 3OYMA 4F7UB 2L0AA 3V8LA 3CXCA 3CCSA 1BI3A 5A0DA 2DMOA 4RMOA 2PTKA 1VQLA 1VQ7A 3OSVA 2VWFA 4JS5A 3A8LB 3MEAA 4OP0A 2MF2A 3CCRT 2E12A 2KY9A 2NUZA 3HRTA 1VQMA 2B86A 2KVQG 3OY9A 1BIBA 4DBFA 3E2UA 3I56A 4P5NA 4KGZB 3CD6A 1T3LA 1JBMA 2B8AA 5KYYA 3CMAA 4XTZA 1UE9A 1BB9A 4HCBA 2QEXQ 2AZSA 2FVUA 2ZPIB 4DBHA 1VQNT 1I5OB 5M9OA 1N5ZA 1YJNQ 2X4YA 5LJ3g 2V8IA 4KULA 3NFCA 4JRIA 3MP1A 2K2MA 3P8BB 4J6YA 2KMTA 4Z88A 2CP2A 1VQKA 2RHXA 1Q86R 1WZOA 5LJ3h 5GANj 1CKBA 3I9QA 2AKLA 4J9CA 5HK0A 3QPHA 1B7TA 1M5Q1 3CXCP 4MMLA 4EIKA 3OA6A 2A36A 1FYNA 2F1LA 3UWNA 1M1KC 1HSQA 3MPUB 3P8HA 1PC0A 2RO0A 4F7UE 1Q82U 2W10A 4KRTA 1MMNA 3JB9H 2HQXA 2COZA 3R6NA 3UPUA 3X20B 2I2LA 3CC4T 2LCCA 1S72A 2J6OA 2RHIA 1E7OA 1K73C 2C0TA 5L8RE 1EX4A 1WFWA 1ZBJA 3SB2A 4OMOA 2GCXA 2Z0WA 2XDPA 2CT3A 2C06A 3JCMg 1QVGS 1RADB 2AT1B 2LMJA 2EGAA 3M9QA 4R55A 3SWNB 1D0ZA 4AFUC 2VXFA 2DXBA 4KH1B 3JCMh 2MMPA 4LXCA 2YRVA 2CP3A 4D8DA 3LLRA 1KIKA 4C92C 1HJDA 3OS0A 5I2MA 4GBQA 1ZHIA 3VS3A 1AD5A 2EJFA 3OMCA 1G5VA 5IXFA 1K8AC 1IHVA 3CBOA 3JCMX 1RI9A 2RB6A 3EFRA 1Q7YR 3QDRB 4ME7A 2XD0A 4C92D 2XICA 4Z02A 3UA7A 1AEYA 4C92A 3WVEB 1SKUB 5CKBA 4C5GA 4M7DF 4IUPA 2V26A 4C0DC 1VYTA 3UDCA 2OI3A 2A37A 1OULA 3CCEA 3M57A 1MMDA 1D09B 2HKNA 4M77F 1NLOC 3QSUA 4FM4B 2DLPA 2LJ3A 5A0LA 4PKCC 3G4ST 3FJ5A 4OMQA 1VQPQ 2V8JA 2DL7A 3TSWA 5J26A 1NLPC 4HVVA 1XTDA 2VC8A 4RTZA 3TQ7P 2CT4A 2OTLQ 1MNDA 1YITT 3NTKA 3OYHA 4XU1A 3H6ZA 2PVGB 1AWWA 3WXMB 3VRYA 5IAYA 2MWPA 5LJ3j 2KK4A 2EKHA 2K3YA 5FWCA 2ZZDA 2HZYA 2IG0A 4C8QC 4FL6A 3LH5A 2E5KA 3X28B 3G6ET 1PCXA 2NUPA 4IUQA 2DIQA 2HSPA 2E70A 3CCRQ 3N5BB 2RPNA 1Q82C 4MMKA 1IREB 1ZA1B 2IPOB 1X6OA 2AIRB 1KC8R 2DTHA 4TVRA 4FSSA 3M0SA 3BFMA 1KJWA 2RQWA 2KI7A 2LT4A 5IH2A 1C1AA 1OQKA 1UB4A
chains in the Genus database with same CATH topology
2CP5A 2COZA 1WHHA 3RDVA 2HL3A 2COWA 2HQHA 1WHJA 1LPLA 2E3HA 1TXQA 2HKNA 2QK0A 2HL5C 1WHMA 2E4HA 2E3IA 1IXDA 1TOVA 2CP3A 2CP7A 2CP0A 2CP6A 2CP2A 2Z0WA 3E2UA 1WHGA 2M02A 2MPXC 1WHLA 1WHKA 4B6MA 2HKQB 2COYA 3TQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP5 A;  2COZ A;  1WHH A;  3RDV A;  2HL3 A;  2COW A;  2HQH A;  1WHJ A;  1LPL A;  2E3H A;  1TXQ A;  2HKN A;  2QK0 A;  2HL5 C;  1WHM A;  2E4H A;  2E3I A;  1IXD A;  1TOV A;  2CP3 A;  2CP7 A;  2CP0 A;  2CP6 A;  2CP2 A;  2Z0W A;  3E2U A;  1WHG A;  2M02 A;  2MPX C;  1WHL A;  1WHK A;  4B6M A;  2HKQ B;  2COY A;  3TQ7 P; 
#chains in the Genus database with same CATH topology
 2DD4 A;  4HXJ A;  2KT8 A;  2FL7 A;  3E9F A;  2PVD B;  4M78 F;  2JZ2 A;  5KYU B;  5IHI A;  1WQW A;  2M16 A;  3CC2 A;  1FXX A;  3L42 A;  2JN0 A;  1H92 A;  2QAZ A;  4PFP A;  1KQ2 A;  1VQO A;  3H0H A;  4JRQ A;  1YIJ T;  1UUE A;  1GRI A;  2DVE A;  3G71 T;  2DFU A;  2EAY A;  2GFU A;  1SRM A;  1SPK A;  2XDD A;  3JCM W;  5CVI A;  2DJQ A;  4JLG A;  6AT1 B;  3M56 A;  1XQH A;  2GNC A;  1BI1 A;  1N8R U;  2RK2 A;  2FRW A;  5GAO p;  2EVR A;  2IIM A;  1QMC A;  1Q81 U;  3CCV A;  4C8Q D;  4AFS C;  3F70 A;  1MHN A;  3OYE A;  1RAF B;  4JDS A;  4C92 G;  2HL3 A;  1GXI E;  1NPP A;  2JTM A;  1M2O A;  2AZV A;  3QII A;  3X24 B;  3PE0 A;  2QK0 A;  4N0A C;  2F2X A;  4J9E A;  3ZBD A;  2GFA A;  1VQ5 A;  1UHC A;  2EGC A;  4OMF B;  1H64 1;  1G2B A;  1BIA A;  1G3S A;  1YP5 A;  1YJW A;  5LJ5 g;  1IGQ A;  2FO0 A;  4J6W A;  2QQR A;  3E19 A;  4M7A C;  1PSE A;  2KSS A;  4J5Y A;  2CUD A;  2P4R A;  1X01 A;  1X2Q A;  4E7Z A;  2L3Q A;  3KXT A;  5LJ5 h;  3BW1 A;  4N0A A;  3CME Q;  1UJ0 A;  1S1N A;  4XQ3 A;  8ATC B;  1XJW B;  5EG2 A;  1ZSZ A;  2M9U A;  1X2K A;  1UTI A;  3JB9 F;  5CR2 A;  3QBY A;  5IXB A;  4Z8A A;  5GAN e;  4M7A D;  3G1J A;  3REB B;  1KHI A;  5GAM e;  2VB6 A;  1TXQ A;  2BE9 B;  1AWO A;  4M7A A;  3CCS T;  2DBK A;  1KQ1 A;  3UF4 A;  2LDM A;  3I55 A;  3L1A A;  4XTY A;  3OYF A;  4OB2 B;  3PGG A;  1YJ9 A;  4DBR A;  4BE2 A;  2K4Y A;  2LNV A;  4Y92 A;  3QYH B;  1GL5 A;  1D1B A;  4C8Q G;  2DVJ A;  3RKX A;  3KUF A;  3I56 T;  3QHS A;  1PSF A;  4M75 D;  1H3H A;  2FPD A;  2J06 A;  3EG2 A;  4M75 A;  2SRC A;  3FRN A;  4QQG A;  2C0O A;  4A54 A;  1UG1 A;  2M0O A;  3AHU A;  1JU5 C;  1CSK A;  1VA7 A;  2ZCF B;  2E1H A;  2KT1 A;  1K0S A;  1N27 A;  2CUB A;  5KE2 A;  3CCM A;  4N4G A;  2X51 A;  3QO3 A;  2CZ0 B;  2KAF A;  3NTI A;  2MAM A;  1PM3 A;  4DEY A;  5GMK m;  2X3X D;  2QQS A;  2ECZ A;  3PFS A;  3HRS A;  7AT1 B;  1TS9 A;  4QT7 A;  2MK5 A;  3G6E Q;  1U06 A;  2YLB A;  3EH1 A;  4M7D B;  4LD6 A;  3QYG B;  2BIV A;  1Q81 C;  2MYS A;  2XG8 D;  4M77 B;  3MP6 A;  3EFO B;  4GLM A;  3PTA A;  1QCO A;  5LJ3 d;  4AFZ C;  9ATC B;  4N4I A;  4OB0 B;  1U1S A;  2DYB A;  1Y96 A;  1IO6 A;  4RG8 A;  3VS6 A;  1VOM A;  5FU7 C;  5HCK A;  1VQ8 A;  2D9T A;  1QKX A;  5D6X A;  2EIF A;  2KYB A;  2YT6 A;  3FEO A;  1D0Y A;  2PQW A;  3INZ A;  2CKK A;  4JS4 A;  1YHQ A;  3LX7 A;  1FX7 A;  3HPW A;  4C0G A;  4CC3 A;  1YIJ Q;  3QZ5 B;  3G71 Q;  2EQJ A;  3QZ9 B;  5FU6 C;  4KBM B;  3RER A;  5LJ5 j;  1G8X A;  5I11 A;  3H0I A;  4M7A G;  1TUD A;  2J7I A;  4RCB A;  1NPR A;  2D6F A;  1KD1 U;  1OPK A;  1AWX A;  1OX8 A;  3VS7 A;  2RJC A;  1VQ6 A;  3Q1J A;  3JCM Q;  1K4U S;  2DZ9 A;  2LRQ A;  3M54 A;  4JZ4 A;  4ZTF A;  3CC7 A;  2R5A A;  4M7D E;  2GQV A;  2LZ6 B;  2K5L A;  1TUC A;  1UEC A;  1M2V B;  3I5R A;  1AVZ C;  3JAM E;  4RUG A;  3O8V A;  4M77 E;  4M78 B;  4ELY C;  4JZ3 A;  4XAX B;  3JCM c;  5FRN A;  2QTV A;  3OYN A;  2JS2 A;  4AFQ C;  1X43 A;  3CBM A;  4OMP A;  1M1F A;  1W70 A;  2ZPE B;  2VKN A;  3SDZ A;  4ZN1 A;  3PIP A;  2RMO A;  1MGQ A;  1U1T A;  5CQX A;  2QA4 A;  1ACM B;  2RN8 A;  2EFI A;  3LW5 E;  2HNI A;  1NJI U;  2EKO A;  3QXE B;  3JRZ A;  4HT9 A;  2E10 A;  4LDW A;  1OZ3 A;  3EGU A;  4MZP A;  8AT1 B;  1XOV A;  2WAC A;  2H3J A;  4MDW A;  4LD9 K;  1QLY A;  1M27 C;  1W2B A;  3S3N A;  4C5E A;  1D3B A;  2J6F A;  3A8G B;  1WHH A;  3PMT A;  4ZN3 A;  3J80 E;  5GAN 8;  1ABO A;  2PUO B;  1LCK A;  1WA7 A;  3SEM A;  1WXB A;  1B3Q A;  1R77 A;  3JCM e;  3CCS Q;  3MJX A;  4J83 A;  3A8O B;  1VQL Q;  2NWM A;  2JOY A;  2JW4 A;  3MEV A;  5CCA A;  1VQ7 Q;  3HSB A;  5FW9 A;  4A4G A;  5FWB A;  1K9M U;  2P84 A;  2BE7 D;  3CCJ A;  1M8M A;  3VUB A;  5GAN 7;  4OML A;  4LNP A;  4M78 E;  1O9S A;  3DLM A;  3I56 Q;  3EGX A;  5GMK l;  3A5Z B;  2QQB A;  3CMA Q;  2EQU A;  1ZX6 A;  2CP0 A;  3OW2 A;  2EQK A;  3CC2 T;  4GLK A;  1RAG B;  4XU0 A;  4FYV B;  2HBW A;  1YCY A;  1H8K A;  3RMS A;  3I35 A;  5GMK h;  4FT4 A;  2QI2 A;  4XTW A;  1VQK Q;  1W2B P;  2EPD A;  4B9X A;  2OTJ A;  1VQO T;  2KNB B;  2X4J A;  4FW2 A;  1E6H A;  2DX1 A;  3CCL A;  2G6F X;  3QG1 A;  2LJ1 A;  4HVU A;  5KCO A;  3HHT B;  4K11 A;  2ENM A;  2D1X A;  3JB9 I;  3M5A A;  5CAI A;  3C0C A;  4PK4 A;  5CIU A;  1KD1 C;  4OB1 B;  3CCV T;  4M75 F;  3A8M B;  5GAM f;  3GP8 A;  4LUE A;  1NBE B;  4PJO F;  2XU8 A;  3NGP A;  2EBP A;  1RAC B;  4Y28 E;  2P0K A;  2RQV A;  4MZM A;  1S72 Q;  4CRI A;  4DEX A;  3CQT A;  3ASK A;  2DL4 A;  3REA B;  3ZL7 C;  3NPF A;  2RQT A;  2LP5 A;  1EZZ B;  1JQQ A;  2E6N A;  2K6D A;  5GAO l;  3C4S A;  3FLG A;  4KUI A;  4BI4 A;  3OW2 P;  3EG9 B;  4MDX A;  4BE1 A;  2X4W A;  1NZ9 A;  1UGQ B;  2JS0 A;  2RHZ A;  1UGV A;  1PKS A;  1M3A A;  5HK3 A;  1FMK A;  5AYF A;  5I21 A;  2DYI A;  5KYW B;  4EPC A;  3J7A F;  1MV3 A;  3EHQ A;  2KEA A;  2CH4 W;  3CME T;  4BY6 B;  2QQA A;  2KR3 A;  3RKW A;  3CCU T;  1VQ4 A;  4JUV A;  1NJI C;  2E41 A;  1BK2 A;  1WJQ A;  1PG5 B;  1DJ7 B;  3FB9 A;  2COW A;  2XHC A;  3VYH B;  3SWN C;  2LCL A;  5GAO r;  1OI1 A;  3VS0 A;  1G3Y A;  1M4Z A;  5GAO n;  4E47 A;  2VYT A;  1UGR B;  1SEM A;  1M90 R;  2DEQ A;  1WHG A;  1Q95 G;  4XU3 A;  4PNO A;  2DBM A;  2F2V A;  4J7F A;  1KG1 A;  4L5G A;  1YJ9 T;  4UC4 A;  3SWN A;  1K9M C;  1WYX A;  3HRU A;  4D8K A;  4WTO B;  5LJ5 d;  3GIB A;  2O4X A;  2JT4 A;  3CCE Q;  2DD5 A;  1PWT A;  4F04 B;  2RI2 A;  4PFO A;  5D7U A;  4F7U G;  4AMC A;  1N8R R;  2NUP B;  4BAC A;  2PNI A;  4E7I A;  1Q81 R;  4XU2 A;  3M0Q A;  3SFM A;  5KE3 A;  4OGC A;  3RKY A;  1ARK A;  1MNE A;  1EFN A;  3CCM T;  1I07 A;  1RI0 A;  5GMK j;  1KSW A;  2HD0 A;  4KGX B;  3OYA A;  2R57 A;  2SEM A;  1RAB B;  3QJY A;  2YDL A;  2YLC A;  1IZ6 A;  1XNI A;  1Y57 A;  1ZA2 B;  2YXY A;  4FIB A;  1K0X A;  2WSC E;  5LJ5 e;  3LWI A;  2DRK A;  1ZUU A;  4PJJ A;  2EQM A;  3OS5 A;  4LDV A;  2KQW A;  1KQS S;  2FHD A;  2CZ6 B;  2HKQ B;  1GFC A;  2AHJ B;  2FPE A;  4HT8 A;  3GLX A;  2ZPF B;  2K79 A;  4C8Q A;  1YI2 A;  1G3T A;  1AOJ A;  1QVG A;  2DL8 A;  4JJB A;  4DOV A;  5J39 A;  2DTI A;  4F14 A;  1JJ2 S;  1WLP B;  2VV5 A;  4II1 A;  5DY9 A;  1VQN A;  1PHT A;  3CC2 Q;  4EDU A;  1N6A A;  2AKK A;  2CDT A;  3C12 A;  2CRE A;  1G3W A;  1I0C A;  2DE0 X;  3OYJ A;  1NEG A;  1SSF A;  2VXE A;  5KYN A;  1VIE A;  2A7Y A;  1QVF S;  1YHQ T;  2QGG A;  1NM7 A;  5L23 A;  1VQO Q;  3FJP A;  1OU8 A;  3DB3 A;  2EGE A;  1F1B B;  2RNA A;  1AHJ B;  2WSF E;  2BUD A;  4XTU A;  2HEQ A;  3OSS C;  2DM1 A;  2F5T X;  4DQ2 A;  1VQ6 T;  3CCV Q;  2DXU A;  2X4X A;  3LYI A;  4OVA A;  3OB9 A;  4DBQ A;  3OMG A;  4ZGD B;  2CYZ B;  2CZ7 B;  3PT9 A;  3CC7 T;  3QDF A;  1IHW A;  1WHM A;  5GAN 6;  1GBR A;  3CC4 A;  2MCN A;  4Q5W A;  3M58 A;  1ZSZ B;  1QVG P;  1Y71 A;  2A28 A;  3CPW S;  3OYB A;  1OZ2 A;  2KRS A;  1VQ5 Q;  2EYZ A;  2BKD N;  2YSQ A;  4PL6 A;  1AZG B;  3EHR A;  4BDZ A;  5HY6 A;  1YJW Q;  1D1A A;  4N4H A;  1TWB A;  3CCU Q;  2ED0 A;  2CP5 A;  1KC8 U;  3VJP A;  2NUT A;  5GAN 5;  3LH0 A;  1WPY A;  2HCK A;  3EFS A;  2EJG A;  1KHC A;  4M4Z A;  4J9B A;  2JMC A;  2X3W D;  4CI0 C;  3OYI A;  1OEB A;  4M75 B;  4PJO B;  1WJS A;  1U5S A;  1VQL T;  3LGL A;  1NEB A;  1KFZ A;  5J3B A;  1VQ7 T;  1WGS A;  4A63 B;  4F17 A;  2EWN A;  4IIM A;  5GAN 4;  2LVM A;  3NTH A;  4PJL A;  3BDL A;  1WDX A;  2DXT A;  2EYW A;  2JM9 A;  1WX6 A;  1VQM T;  5DLO A;  2H8H A;  3I55 Q;  2FG0 A;  2X35 A;  1YJ9 Q;  2V1R A;  3CCJ T;  4IUR A;  3BE3 A;  3PMI A;  4OF1 A;  3CD6 T;  4FYW B;  5AT1 B;  1M1K R;  2RA2 A;  3CMA T;  4J7I A;  5FLX E;  1OU9 A;  1CKA A;  2YUO A;  3MHX A;  1MUZ A;  5I22 A;  1YWO A;  2DAQ A;  2RF0 A;  1B34 A;  2VVK A;  2Y4Y A;  2QTX A;  3G4S A;  4LDU A;  1LPL A;  2LX9 A;  3EG0 A;  1VYU A;  1K73 R;  2IVW A;  2O88 A;  1VQK T;  1BI0 A;  2RHY A;  3SD4 A;  3VRZ A;  4BDY A;  3OBW A;  1YCS B;  1PD1 A;  3HFN A;  1VQ9 A;  1WJR A;  1X27 A;  1YIT A;  2KGT A;  3L2V A;  3CCM Q;  1ZQ1 A;  4C92 F;  3OYY A;  2CP6 A;  3EAE A;  4XK8 E;  5CKF A;  1Y96 B;  2F69 A;  1R0B G;  1BCM A;  1X6B A;  1GFD A;  4C5H A;  1RLQ C;  2RK1 A;  4LDX A;  2Y4X A;  4PJO E;  2DJZ A;  4JRK A;  3MET A;  3OYD A;  5KYX B;  1RAE B;  5IT9 E;  3CXC S;  2HAX A;  1QKW A;  1FMV A;  2K5I A;  4R0K A;  2D0Q B;  1S72 T;  2DET A;  3PVL A;  1NJI R;  2KDS A;  3TEE A;  1OPL A;  4M7D C;  2O2O A;  3URG A;  4JRP A;  3FDR A;  1WHJ A;  3V7S A;  1K8A R;  2P0Q A;  3G7Z A;  2DKG A;  2D8H A;  2L89 A;  5FRM A;  4M77 C;  5HKC A;  2QAS A;  2YRC A;  1IXD A;  2G3R A;  3ME9 A;  2X9H A;  3UT1 A;  3GOX A;  3A1P A;  5ECA A;  1VQ8 Q;  1V29 B;  2EYQ A;  3U23 A;  4ORZ A;  5GAM g;  1W1F A;  5GAN 2;  5CKD A;  5A2Q E;  3CEY A;  2LNH B;  1JXO A;  4JLI A;  4M7D D;  4J9I A;  1YHQ Q;  1QCF A;  4C5I A;  3RBB B;  4M7D A;  1PKT A;  2FPF A;  2QGF B;  3EGD B;  1K9M R;  5GAO m;  2HSE B;  1VQ4 T;  1KK7 A;  4M77 D;  4DOW A;  3HP9 A;  5GAM h;  5C6S A;  1GCQ C;  2DNU A;  2PU9 B;  2RJD A;  2ROL A;  2L5Q A;  4M77 A;  4BD3 A;  2JM8 A;  3O5Z A;  3CCQ A;  4LDY A;  1KC8 C;  2LQK A;  2E64 A;  1U3O A;  5LJ3 e;  2K5F A;  4OGE A;  4C8Q F;  4KT0 E;  1K1Z A;  5GMK e;  1R0C B;  1ZUK A;  1M1G A;  1VQ6 Q;  4HVW A;  4KH0 B;  3GNF B;  3C95 A;  2LJ0 A;  1YN8 A;  1SSH A;  3CC7 Q;  4EMK B;  1YFN A;  1AZE A;  3J81 E;  4BI3 A;  5CKE A;  1C6V X;  3M59 A;  5IN1 A;  3H0F A;  2EJ9 A;  3CCE T;  3S6W A;  4BE0 A;  5DM7 R;  1D3B B;  2JMA A;  2F2W A;  1RAA B;  1TU0 B;  2MI6 A;  2O9S A;  1JO8 A;  2E6Z A;  2DO3 A;  4M78 C;  4ATO A;  3LGF A;  4E7H A;  2BZY A;  1AWJ A;  1Q82 R;  3VS2 A;  2QA4 Q;  1TSF A;  2PUK B;  2LQ8 A;  5KH6 A;  1K76 A;  1WHL A;  4J6X A;  2ZPB B;  2JVV A;  3MO8 A;  2LX7 A;  5KYY B;  2QQ9 A;  3QWX X;  4QW2 A;  4J9D A;  4ELZ C;  3EGX B;  2CSI A;  2JJ9 A;  4M78 D;  3R6O A;  3MEU A;  2M51 A;  4E6R A;  4M78 A;  2E4H A;  4FU6 A;  2QG9 B;  4BB7 A;  3UAT A;  1ZLM A;  3M4Y A;  4QVZ A;  3TVT A;  2HMA A;  2E65 A;  2L3P A;  1PRL C;  1R8O B;  1E6G A;  1OV3 A;  4QQ6 A;  1VQM Q;  3NHN A;  1B07 A;  5IHK A;  1PRM C;  2GTJ A;  4LUD A;  4O6J A;  3CCJ Q;  2V1Q A;  3DKM A;  1QP3 A;  3CD6 Q;  3MP8 A;  2GBQ A;  3A98 A;  2R5M A;  5EC7 A;  1JB0 E;  1QVP A;  3JCM b;  2OAW A;  1K9A A;  1WI7 A;  2KBT A;  1M8V A;  2QEX A;  5CQY A;  2DK3 A;  3L2Q A;  1YI2 T;  1YJN A;  4F7U A;  4Z89 A;  1MMG A;  1UDL A;  4M7A F;  2O31 A;  3OQ5 A;  4M7D G;  3JCM V;  2K57 A;  4A4K A;  1QP2 A;  1HD3 A;  5CK9 A;  2OX7 A;  2DPP B;  2L3R A;  4NL2 A;  3BDU A;  2BZ8 A;  2RI5 A;  4M77 G;  3VKI A;  2OTJ Q;  2M02 A;  2LQN A;  2DIL A;  2RI3 A;  3QWY A;  2FZG B;  5GAM j;  4RTY A;  5A0G A;  3CCL Q;  2PZ1 A;  4X9C A;  3T9N A;  1BCO A;  3H8Z A;  5GAN f;  1HYO A;  4CC2 A;  1ZSG A;  4LN2 A;  3NMZ C;  4IIO A;  4PLI A;  1YNZ A;  1Y0M A;  2O01 E;  2P4T A;  2ED1 A;  2L8D A;  1VUB A;  2QXF A;  4IUV A;  4CC7 A;  2A0F B;  4NL3 A;  2DEU A;  1QQJ A;  3JB9 D;  2BZX A;  3VV0 A;  2HQH A;  1VQ5 T;  1QWE A;  2LC4 A;  3S3O A;  1T0H A;  1BYM A;  4X1V A;  2RM4 A;  3VU3 C;  3OS2 A;  3L2U A;  3P8D A;  4XTX A;  1YJW T;  3RMQ A;  2DTO A;  2DL3 A;  4IKF A;  4C0Z A;  4C92 B;  3OYG A;  1X75 C;  3QKJ A;  3OS1 A;  2A08 A;  1VQ4 Q;  1SRL A;  2CGH A;  3X26 B;  3RUX A;  4M78 G;  2O4X B;  2K7A A;  2XI9 A;  3D7S B;  1VIF A;  3OYL A;  4BY6 C;  3KBG A;  1QWF A;  2EYY A;  1WXU A;  4HCC A;  2L2P A;  3V7R A;  1ZBX A;  3HL8 A;  2FZC B;  5I2S A;  3FC3 A;  5LL6 S;  1BI2 A;  1V76 A;  3GNG A;  4C0D B;  3EG9 A;  3I55 T;  4JPB W;  3ZFJ A;  4OB3 B;  2YWW A;  1Q86 U;  4ZTJ A;  4LE9 A;  1WNL A;  1MV0 B;  2JUF A;  2QYZ A;  5KYW A;  4V2S A;  5GJW B;  4FSX A;  4O5V A;  1QW1 A;  1YBY A;  3JV3 A;  3IQL A;  1TUG B;  3GPL A;  1UFF A;  2M0Y A;  3PNW C;  3VS1 A;  1GBQ A;  3VS4 A;  1SF9 A;  4OMM A;  5D6Y A;  2XK0 A;  1VQP A;  2XKO C;  1SHG A;  1AT1 B;  1Y07 A;  4B9W A;  4ESR A;  3L2Z A;  2OTL A;  2KXD A;  2A3L A;  4C92 E;  4ZGE B;  1J3T A;  1MMA A;  2DER A;  1VQ9 T;  4C8Q B;  4KGV B;  1TH7 A;  2DA9 A;  2L3S A;  1JXM A;  2DF6 A;  2JTE A;  2H3E B;  2KRN A;  2MIO A;  4QQD A;  2GTO A;  3UA6 A;  4E7S A;  3VUZ A;  2E3I A;  3DLL A;  3JSC A;  2M1H A;  3M0R A;  3JCM J;  1BBZ A;  2ROT A;  3QUI A;  3HFO A;  2YUQ A;  2MPX C;  1WHK A;  5LJ3 f;  1IGU A;  3CCR A;  2EQI A;  1OYX A;  3X25 B;  3A8H B;  1M9S A;  2W0Z A;  3LWH A;  1D0X A;  4EMH A;  3JB9 G;  4Y91 A;  4QVD A;  1ZUY A;  3MKD A;  1LJO A;  2AK5 A;  2P0P A;  4QVC A;  2LTO A;  3M55 A;  3RNJ A;  1RUW A;  4RKU E;  1YI2 Q;  1VQ8 T;  1RAI B;  2CZ1 B;  2VAS A;  1PNJ A;  4J9G A;  3H41 A;  2COY A;  2ZPH B;  1Q7Y U;  3OYC A;  3RDV A;  1SHF A;  1HXD A;  1W4S A;  3HTR A;  1M90 U;  2K9G A;  1VQN Q;  2J05 A;  4RTU A;  2E5Q A;  2YUP A;  2YUN A;  1ABQ A;  2NYS A;  5IHN A;  3THK A;  2KE9 A;  4PJN A;  5CO7 A;  3WVD B;  1NYG A;  2GGR A;  1TG0 A;  2KRM A;  1VYV A;  4C8Q E;  1M30 A;  3MEW A;  3QJ6 A;  3V8K A;  4JJN K;  3CCQ T;  2QDL A;  5KYU A;  5GMK i;  2D8J A;  2FRY A;  3CPF A;  3JCM f;  1I8F A;  1LOJ A;  4ZGJ B;  3DB4 A;  4FW1 A;  4E2F B;  5FRO A;  4F7U F;  3RR6 A;  1BKB A;  1OX9 A;  2NUT B;  1Q86 C;  4CC4 B;  3CC4 Q;  3E9G A;  2NLU A;  2DRM A;  3H9N A;  5GAN d;  1V1C A;  4D6W A;  1T3S A;  3GBQ A;  5GAM d;  2BTT A;  4RTX A;  4RCC A;  4M7A B;  1TTH B;  3TRE A;  2ABL A;  2YHT A;  4XTV A;  4ANJ A;  1D1C A;  1U8R A;  3GF5 A;  2QA4 T;  1I1J A;  2CP7 A;  1ZSZ C;  2RD1 A;  3BY7 A;  3HKS A;  2EW3 A;  1I5L A;  2MWO A;  3ER0 A;  2LCS A;  1P92 A;  2J6K A;  1RAH B;  2E3H A;  2DIG A;  3CME A;  5C0M A;  3CCU A;  2GF7 A;  2RJF A;  4FCY A;  5KCH A;  4OMN A;  2K3B A;  2CSQ A;  1UJY A;  2JTF A;  2CH4 A;  3RES A;  4BI8 B;  1G83 A;  5GAN 3;  1B34 B;  4B6M A;  2DL5 A;  4PFZ A;  3V8J A;  4HA8 A;  2KXC A;  1NE8 A;  1KQS A;  1PD0 A;  2XDB A;  1YWP A;  1Z9Q A;  5GJV B;  1X6G A;  2RH2 A;  4A4E A;  4M75 C;  2HL5 C;  1Y7X A;  4PJO C;  1UHF A;  1UGS B;  1FMW A;  2XID A;  1M3C A;  4IUT A;  2VGN A;  2R58 A;  3JB9 J;  1IB8 A;  2VGM A;  4L6V 5;  1WIE A;  4QKU A;  3C94 A;  3M53 A;  3OYK A;  1QCN A;  3L2W A;  1IRX A;  3S3M A;  2ZPG B;  1JJ2 A;  1KD1 R;  4M7A E;  1W6X A;  1LNX A;  2QEX T;  1UEB A;  4HCZ A;  1X69 A;  2ZGW A;  5CKH A;  5DLQ E;  1YJN T;  4PJO D;  2ATC B;  4WF2 A;  2XMF A;  4DA4 A;  1NG2 A;  2FEI A;  3M0U A;  3G4S Q;  1QVF A;  3EG1 A;  1Q7Y C;  4PJO A;  2ESW A;  3FIF A;  1M90 C;  4PJM A;  2OTJ T;  3TSZ A;  4E7K A;  1VQ9 Q;  1YIT Q;  1FWZ A;  3PIO A;  2F5K A;  4HKE A;  3CCL T;  4GY5 A;  2C0I A;  1RLP C;  4JJD A;  1NYF A;  1N9S A;  4M75 E;  2HBP A;  4L59 A;  4F16 A;  1W2B S;  4RTT A;  1KQS P;  2FZK B;  3G6E A;  2K2V A;  4ZNX A;  4BUG A;  4FT2 A;  2WSE E;  4NS5 A;  1BU1 A;  4J8O A;  1SG5 A;  1N8R C;  2OAU A;  4J9F A;  5FU7 B;  2HQE A;  2EYX A;  3SHW A;  3CPW A;  1JJ2 P;  2RHU A;  1OOT A;  3E1S A;  2D0N A;  4HCK A;  1I81 A;  4YTL A;  1T0J A;  1TOV A;  3EH2 A;  2LQW A;  1WXT A;  2V8K A;  4VUB A;  3VYG A;  4A4H A;  5GAN g;  4AT1 B;  1QVF P;  2DZC A;  1LVK A;  3MCA B;  3V7C A;  2RJE A;  2O9V A;  2RQR A;  1HK9 A;  5FU6 B;  5GAN h;  2PVO B;  5D6W A;  2FB7 A;  3OW2 S;  3I5S A;  2KYM A;  3OBY A;  3PVQ A;  5KYX A;  1YIJ A;  4KUD K;  3ZEH A;  4PLL A;  4R56 A;  3G71 A;  2GQI A;  4FYX B;  1WQ7 A;  3EFO A;  1H3Z A;  3TU4 K;  1M1K U;  2HDA A;  3KFV A;  2RQU A;  3CCQ Q;  4E7J A;  3AT1 B;  3L2R A;  3M0T A;  2YRD A;  3CBP A;  1M3B A;  4MZT A;  3M0P A;  1N9R A;  5LJ5 f;  2I0N A;  1JRI A;  3M4G A;  4J9H A;  2DXC A;  1GCQ A;  4WCI A;  3ULR B;  1K73 U;  1C0M A;  2Y90 A;  3CPW P;  1UGP B;  4E7L A;  4FYY B;  4EMG A;  2QDY B;  4RTV A;  1O75 A;  4EMK C;  2LT1 A;  1GCP A;  4A53 A;  3EGD A;  3JCM d;  1I4K 1;  4A4F A;  4RTW A;  2JNG A;  4M75 G;  2FYK A;  3VS5 A;  4X34 A;  4PJO G;  3RIR A;  1VQP T;  2CS7 A;  2OJ2 A;  2VUB A;  3EG3 A;  2K3X A;  3TCJ A;  2ZAE A;  2OTL T;  2JXB A;  4JJC A;  1A0N B;  2KRO A;  1JEG A;  1M2V A;  1RL2 A;  4X9D A;  4EMK A;  4NOY A;  4IUU A;  1Z9Z A;  4C0F A;  1EIF A;  5GAO q;  1K8A U;  4AG1 C;  4RG2 A;  2MOX A;  3JCM P;  4AG2 C;  3OYM A;  4F7U B;  2L0A A;  3V8L A;  3CXC A;  3CCS A;  1BI3 A;  5A0D A;  2DMO A;  4RMO A;  2PTK A;  1VQL A;  1VQ7 A;  3OSV A;  2VWF A;  4JS5 A;  3A8L B;  3MEA A;  4OP0 A;  2MF2 A;  3CCR T;  2E12 A;  2KY9 A;  2NUZ A;  3HRT A;  1VQM A;  2B86 A;  2KVQ G;  3OY9 A;  1BIB A;  4DBF A;  3E2U A;  3I56 A;  4P5N A;  4KGZ B;  3CD6 A;  1T3L A;  1JBM A;  2B8A A;  5KYY A;  3CMA A;  4XTZ A;  1UE9 A;  1BB9 A;  4HCB A;  2QEX Q;  2AZS A;  2FVU A;  2ZPI B;  4DBH A;  1VQN T;  1I5O B;  5M9O A;  1N5Z A;  1YJN Q;  2X4Y A;  5LJ3 g;  2V8I A;  4KUL A;  3NFC A;  4JRI A;  3MP1 A;  2K2M A;  3P8B B;  4J6Y A;  2KMT A;  4Z88 A;  2CP2 A;  1VQK A;  2RHX A;  1Q86 R;  1WZO A;  5LJ3 h;  5GAN j;  1CKB A;  3I9Q A;  2AKL A;  4J9C A;  5HK0 A;  3QPH A;  1B7T A;  1M5Q 1;  3CXC P;  4MML A;  4EIK A;  3OA6 A;  2A36 A;  1FYN A;  2F1L A;  3UWN A;  1M1K C;  1HSQ A;  3MPU B;  3P8H A;  1PC0 A;  2RO0 A;  4F7U E;  1Q82 U;  2W10 A;  4KRT A;  1MMN A;  3JB9 H;  2HQX A;  2COZ A;  3R6N A;  3UPU A;  3X20 B;  2I2L A;  3CC4 T;  2LCC A;  1S72 A;  2J6O A;  2RHI A;  1E7O A;  1K73 C;  2C0T A;  5L8R E;  1EX4 A;  1WFW A;  1ZBJ A;  3SB2 A;  4OMO A;  2GCX A;  2Z0W A;  2XDP A;  2CT3 A;  2C06 A;  3JCM g;  1QVG S;  1RAD B;  2AT1 B;  2LMJ A;  2EGA A;  3M9Q A;  4R55 A;  3SWN B;  1D0Z A;  4AFU C;  2VXF A;  2DXB A;  4KH1 B;  3JCM h;  2MMP A;  4LXC A;  2YRV A;  2CP3 A;  4D8D A;  3LLR A;  1KIK A;  4C92 C;  1HJD A;  3OS0 A;  5I2M A;  4GBQ A;  1ZHI A;  3VS3 A;  1AD5 A;  2EJF A;  3OMC A;  1G5V A;  5IXF A;  1K8A C;  1IHV A;  3CBO A;  3JCM X;  1RI9 A;  2RB6 A;  3EFR A;  1Q7Y R;  3QDR B;  4ME7 A;  2XD0 A;  4C92 D;  2XIC A;  4Z02 A;  3UA7 A;  1AEY A;  4C92 A;  3WVE B;  1SKU B;  5CKB A;  4C5G A;  4M7D F;  4IUP A;  2V26 A;  4C0D C;  1VYT A;  3UDC A;  2OI3 A;  2A37 A;  1OUL A;  3CCE A;  3M57 A;  1MMD A;  1D09 B;  2HKN A;  4M77 F;  1NLO C;  3QSU A;  4FM4 B;  2DLP A;  2LJ3 A;  5A0L A;  4PKC C;  3G4S T;  3FJ5 A;  4OMQ A;  1VQP Q;  2V8J A;  2DL7 A;  3TSW A;  5J26 A;  1NLP C;  4HVV A;  1XTD A;  2VC8 A;  4RTZ A;  3TQ7 P;  2CT4 A;  2OTL Q;  1MND A;  1YIT T;  3NTK A;  3OYH A;  4XU1 A;  3H6Z A;  2PVG B;  1AWW A;  3WXM B;  3VRY A;  5IAY A;  2MWP A;  5LJ3 j;  2KK4 A;  2EKH A;  2K3Y A;  5FWC A;  2ZZD A;  2HZY A;  2IG0 A;  4C8Q C;  4FL6 A;  3LH5 A;  2E5K A;  3X28 B;  3G6E T;  1PCX A;  2NUP A;  4IUQ A;  2DIQ A;  2HSP A;  2E70 A;  3CCR Q;  3N5B B;  2RPN A;  1Q82 C;  4MMK A;  1IRE B;  1ZA1 B;  2IPO B;  1X6O A;  2AIR B;  1KC8 R;  2DTH A;  4TVR A;  4FSS A;  3M0S A;  3BFM A;  1KJW A;  2RQW A;  2KI7 A;  2LT4 A;  5IH2 A;  1C1A A;  1OQK A;  1UB4 A; 
#chains in the Genus database with same CATH homology
 2CP5 A;  2COZ A;  1WHH A;  3RDV A;  2HL3 A;  2COW A;  2HQH A;  1WHJ A;  1LPL A;  2E3H A;  1TXQ A;  2HKN A;  2QK0 A;  2HL5 C;  1WHM A;  2E4H A;  2E3I A;  1IXD A;  1TOV A;  2CP3 A;  2CP7 A;  2CP0 A;  2CP6 A;  2CP2 A;  2Z0W A;  3E2U A;  1WHG A;  2M02 A;  2MPX C;  1WHL A;  1WHK A;  4B6M A;  2HKQ B;  2COY A;  3TQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...