1GFDA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Adaptor protein containing sh2 and sh3
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfdA00
2PTKA 2J6KA 2YSQA 2K3BA 1J3TA 1K1ZA 5L23A 4RTXA 3NMZC 1WI7A 2DYBA 1TUCA 2X3XD 2GQIA 2M51A 1SRLA 1B3QA 4HCKA 4FSSA 3VS1A 2JW4A 2DE0X 1N5ZA 3PVLA 1K4US 1RI9A 2C0TA 3SHWA 2RQUA 3H41A 3EG1A 1GCQC 2O2OA 2F2WA 3ZL7C 5IH2A 1CKAA 1S1NA 2K7AA 1UECA 1AD5A 1SRMA 1PKTA 4OMPA 4IIMA 1QWEA 1U5SA 3M0TA 1OPLA 2KT1A 2RPNA 4RTTA 2O9VA 1UDLA 2PZ1A 2AZVA 2DILA 3EHQA 4DEXA 3PVQA 2CH4W 1WXBA 4M4ZA 4D8KA 4J9IA 4A63B 1KSWA 2CT4A 2HDAA 1RLPC 3JV3A 2B86A 1M8MA 2J6OA 1E6GA 2DL7A 2E5KA 5I22A 1ZLMA 2EGCA 1VYVA 3I5RA 3KFVA 1BBZA 3VS3A 1M3BA 1WDXA 1M3CA 1SPKA 1ZUKA 1NLOC 3TVTA 2EYXA 3NHNA 5IHNA 1E6HA 2M0YA 2EW3A 4OMNA 3RBBB 1TUDA 2J06A 2H8HA 4GBQA 2RQWA 1OOTA 2AK5A 4IIOA 3TSWA 1HJDA 1WYXA 2ROLA 1WXTA 4CC2A 2JMAA 3VS4A 1K0XA 3I35A 2DL4A 3EHRA 2JM8A 1HD3A 2I0NA 2NWMA 2J6FA 1AWOA 1H92A 1UTIA 1KJWA 2JT4A 3UATA 1BU1A 1LCKA 2YDLA 1MV3A 2YUPA 1YCSB 3SEMA 2VWFA 2FO0A 3THKA 1JU5C 3LH5A 4RTZA 1Y0MA 1JXOA 2HBWA 1KIKA 4F14A 4LUDA 2RNAA 1UGVA 3A98A 1CKBA 2DX1A 1QKXA 2YUQA 1ZBJA 1NYFA 2YT6A 2BZYA 4J9CA 1PNJA 2KR3A 2V1QA 4RTYA 1PKSA 3VS0A 1H8KA 3CQTA 1MV0B 3NGPA 2BTTA 1IO6A 1A0NB 1QLYA 2DJQA 1NLPC 4AFSC 2GGRA 2LQNA 3H0IA 1PRMC 4F17A 2RQTA 1YN8A 1V1CA 2K9GA 2FEIA 2J7IA 5IXBA 3NPFA 4J9FA 1Z9QA 2DL8A 1OEBA 1X6GA 4OMOA 1GCPA 1NM7A 4KRTA 2KRMA 1JXMA 2DNUA 4CC7A 5GJWB 1XOVA 1BK2A 2DM1A 3C0CA 2RQVA 4HVWA 4AG2C 1W70A 2D8JA 2ED1A 2KXCA 2A37A 1NEBA 1TG0A 2NUZA 4JZ3A 1UFFA 1NYGA 4ZNXA 2W10A 1X6BA 3M0UA 2OAWA 1G2BA 3EG0A 2DRMA 1AZGB 2KRSA 2L2PA 2FG0A 5I11A 2L0AA 2JS2A 2GTOA 1I0CA 1ABOA 5GJVB 3VRYA 4J9BA 2ENMA 4HVVA 1GBRA 3U23A 4X1VA 2CT3A 2PNIA 2XMFA 2LZ6B 3H0FA 2F2VA 1ZX6A 1T3LA 2YUOA 1SEMA 2D0NA 2G6FX 1WIEA 1SSHA 1X69A 1K9AA 1WXUA 5IXFA 1ABQA 3VS6A 1RLQC 1WX6A 5HCKA 2DRKA 1T3SA 3M0PA 2LCSA 2FRWA 2DMOA 1YNZA 2CSQA 1PRLC 2J05A 2SEMA 4JJDA 2AKKA 4J9EA 1ZSGA 2LNHB 1GBQA 2ESWA 1M27C 3IQLA 2JS0A 4AG1C 1U3OA 2HEQA 2V1RA 3GBQA 2EPDA 4LNPA 2KYBA 4E6RA 3M0QA 2K6DA 1X43A 3QWXX 2DL3A 2JTEA 4CC3A 1GFCA 2KXDA 4J9DA 1X2KA 1GL5A 4OMMA 4RTVA 1X27A 2SRCA 2LX7A 2LMJA 4J9HA 4WCIA 1QKWA 3RNJA 2MIOA 1AWJA 5IHIA 4HXJA 1UUEA 2GNCA 2O9SA 1PWTA 1ZUUA 2EYZA 4ESRA 2JM9A 2MOXA 2DA9A 2JMCA 4JPBW 1WA7A 4K11A 2YUNA 2MCNA 2RMOA 2RN8A 4QT7A 1U06A 4RUGA 1K76A 2P4RA 2F2XA 4JJBA 3UA6A 2BZXA 3I5SA 3PE0A 3VS5A 2LJ1A 2C0IA 4JZ4A 2AKLA 3VS7A 2AZSA 3UA7A 1UJYA 2C0OA 2DL5A 1YP5A 4R0KA 3O5ZA 2W0ZA 2A36A 1NG2A 1I1JA 1WLPB 2LJ3A 3ULRB 2O88A 1JQQA 4Y92A 3I9QA 2CREA 4GLMA 4D8DA 1KFZA 1T0HA 2EYWA 4Z89A 4RTUA 1T0JA 1BB9A 1FMKA 1OV3A 1UJ0A 2GTJA 1H3HA 4CC4B 1AZEA 1W1FA 2D8HA 4Z8AA 2QDLA 4ORZA 4OMQA 1YWOA 2X3WD 2KBTA 1AEYA 3REBB 4AFUC 1X2QA 3TSZA 2CUDA 1SHFA 1QCFA 1AVZC 2KE9A 2FPFA 1UHCA 3M0SA 1W6XA 2VVKA 2L3SA 1AWWA 2GBQA 1RUWA 2OI3A 1GCQA 2DF6A 5FWCA 4HVUA 1AOJA 4LN2A 2KEAA 1EFNA 2DVJA 2FPDA 4J9GA 4RTWA 1NEGA 2ECZA 1UHFA 2KGTA 3FJ5A 1YWPA 2CSIA 1HSQA 2L3PA 5IHKA 2RQRA 2ED0A 2K2MA 3QWYA 3EGUA 2KROA 3EG2A 1E7OA 2EGAA 1MUZA 1ARKA 2HCKA 1VA7A 1CSKA 2LQWA 3H0HA 4JJCA 3VRZA 2RF0A 3VS2A 2K79A 2IIMA 3UF4A 4LE9A 1I07A 2A28A 2JXBA 4AFZC 2LP5A 1GRIA 1ZUYA 1B07A 5FWBA 2KYMA 2CUBA 4OMLA 2VKNA 3REAB 1UE9A 4DEYA 2EGEA 2DBMA 2OJ2A 2DBKA 1PHTA 3EG3A 3M0RA 1JO8A 1Z9ZA 2EVRA 1JEGA 2ROTA 2EBPA 1AWXA 1QWFA 2EYYA 4LUEA 2CH4A 4EIKA 5EC7A 5ECAA 4Z88A 3R6NA 2DLPA 4F16A 1M3AA 5FW9A 2FPEA 1Y57A 2CDTA 2D1XA 2KT8A 2LJ0A 1GFDA 1SHGA 2KRNA 1VYUA 1VYTA 2EKHA 1G83A 2EQIA 2L3QA 4AFQC 2BZ8A 1WFWA 2KNBB 1UG1A 1OPKA 2O31A 2ABLA 1K0SA 2A08A 2FRYA 2HSPA 1FYNA 1M30A
chains in the Genus database with same CATH superfamily
1ZSZB 2J6KA 4QVCA 3QDFA 3NMZC 1WI7A 1YFNA 2M51A 1B3QA 1N8RC 5AT1B 1YIJA 2DE0X 1YJ9A 4WTOB 2YRCA 3OW2S 2K2VA 3OMCA 4KUIA 5DM7R 3L1AA 5CR2A 2FL7A 1YCYA 2F2WA 3TEEA 4DBRA 1UECA 1AD5A 4M77E 1M4ZA 3M0TA 4JLGA 1M5Q1 5GAN5 2AZVA 2DXUA 5GAN7 3CBMA 1PC0A 1KHIA 4J9IA 1VQOT 5GAN8 1VQLT 1M8MA 1W2BS 1E6GA 1OX9A 4C92G 1K73R 2QA4T 3MJXA 2Y4XA 1YJWT 2EGCA 1VYVA 4KUDK 2E6NA 3VS3A 3CCST 1NPRA 1WDXA 2KQWA 1ZUKA 2KY9A 1NLOC 4F7UA 3OYLA 2EYXA 3MP1A 3NHNA 5DLQE 2EAYA 2MK5A 1RACB 1PCXA 1TUDA 2RM4A 3G4ST 1QVPA 1JJ2P 4IIOA 3JCMW 4CC2A 1VQ8T 1VQOA 2PUOB 1G3WA 2K5LA 1VQLA 1Q7YC 4DQ2A 1VQ6A 4TVRA 5CO7A 1HD3A 2I0NA 2J6FA 1YI2Q 1QVGS 3M9QA 1Y96A 1MV3A 2VGMA 2YUPA 3SEMA 1YJWA 2AT1B 3THKA 3LH5A 3CCSA 3TQ7P 3CCVT 2QTVA 1KIKA 2M02A 3FEOA 4X9DA 3RESA 1UGVA 2OTLQ 2QDYB 2EJFA 2YT6A 2BZYA 2CZ0B 4J9CA 2KR3A 4RTYA 4GY5A 1PKSA 3ER0A 1Q81R 1VQ8A 3NGPA 2D6FA 5GAMh 1QLYA 3TREA 1NLPC 5KYUB 2LQNA 3L2QA 3DKMA 3JAME 3OYYA 1QCOA 1MGQA 1PRMC 3EGDA 3WXMB 5KYYB 2RQTA 4E7HA 5FLXE 2JTMA 4E7SA 3NPFA 2DL8A 1OEBA 5IAYA 3CCVA 4HKEA 5HY6A 1X6GA 3OS2A 1GCPA 1NM7A 3PNWC 4KRTA 2JJ9A 1JXMA 5GJWB 4M7AB 3HRUA 1M90R 4HVWA 4X9CA 5GAN3 3EAEA 1H641 1VQ4A 2DVEA 2ED1A 2K57A 2A37A 1NEBA 3CCEA 3ZFJA 4PFOA 2VGNA 2NUTA 2OAWA 3PTAA 1W4SA 2DFUA 3JB9F 2KRSA 2XIDA 3OBWA 1VQNQ 2L0AA 4ZN1A 4KH0B 3C12A 5CAIA 1LNXA 4OGEA 4PJJA 2LRQA 4MDWA 3A8OB 3H0FA 3HSBA 3NTKA 1M1GA 1SEMA 5HK0A 2PVOB 2QQBA 1WXUA 1Q86U 3L2UA 2EIFA 2RHUA 1K73U 3VS6A 1RLQC 3M58A 2KVQG 1YNZA 4JJDA 3E9GA 1PRLC 2AKKA 2DTOA 1P92A 4E7KA 3EGXB 4M78A 5KYWA 3DLLA 1U1SA 3CCMT 4DA4A 4BUGA 1QVFP 4A4FA 1Q86C 4LNPA 2DERA 4ZN3A 4IUVA 2KAFA 3M0QA 3A8GB 2DL3A 2JTEA 4OB0B 4BB7A 2SRCA 2LX7A 3OS1A 2JZ2A 4XTVA 2O9SA 3T9NA 1PWTA 4ESRA 4F7UG 3JB9G 3HKSA 1MMDA 2MOXA 3H6ZA 1XTDA 2DIQA 4X34A 2RN8A 2QYZA 3CCMA 4RUGA 2P4RA 1IREB 4JJBA 1NZ9A 3LGFA 3NTHA 4IUTA 3P8DA 4N0AA 4JZ4A 2AKLA 2AZSA 1R0BG 2CP0A 2AIRB 1Q81U 3UA7A 5EG2A 1YP5A 4MZTA 1PD1A 4QVZA 2W0ZA 2A36A 2QASA 3JCMV 1JJ2S 1I1JA 2RD1A 3P8BB 4OP0A 3JCMQ 3CMET 3ULRB 2LC4A 2EYWA 4MMKA 4O6JA 1T0JA 1FMKA 1OV3A 2P0KA 4RMOA 3JCMe 1H3HA 1AZEA 1W1FA 2D8HA 5LJ3e 3G6EQ 2QDLA 3QG1A 4OMQA 2DPPB 3REBB 1M90U 1VQ9Q 1SHFA 1UGRB 1RI0A 2HZYA 5L8RE 1JB0E 2E4HA 1ZBXA 4FT2A 1TSFA 4M75A 2R5AA 1Q82R 1BI3A 5D6YA 2YLBA 1U8RA 5FWCA 4JRQA 3H9NA 4LN2A 4Y28E 4M78C 5I21A 1NEGA 1UHFA 4C0GA 1TWBA 1D3BB 2GF7A 3E2UA 3QUIA 5IHKA 1KD1U 2R5MA 3HPWA 5LJ3j 3EG2A 2OTLT 5LJ5e 4LD9K 2EGAA 2HCKA 1WGSA 3H0HA 4C92B 5CKDA 3VRZA 5FROA 3G71Q 4A4EA 2RF0A 4IUQA 2K79A 2IIMA 3UF4A 1I07A 2QGGA 4QQ6A 4XU2A 1B07A 5FWBA 2KYMA 1VQ6Q 4OMLA 2VKNA 3QJ6A 2G3RA 3M59A 1UE9A 1ZQ1A 4OVAA 2DJZA 2OJ2A 1WHJA 1YI2A 1NJIU 4HCBA 1N8RR 4ELYC 1JO8A 3S6WA 5GMKl 4M77A 3M57A 4C0DB 2H3EB 3EG9B 4N0AC 4OB2B 2RJCA 3OYJA 2EYYA 5CKHA 2BUDA 2OTLA 3HTRA 3MEVA 3OSVA 2X4WA 1KK7A 5LJ5j 4F16A 1M3AA 5LL6S 1C6VX 1NJIC 1H3ZA 2LJ0A 5GMKi 1SHGA 4C8QF 1VYUA 1M1KC 2VYTA 4M7DE 1G83A 3JB9J 4O5VA 1UG1A 4M7DD 3QO3A 5C6SA 3ZBDA 1WHGA 3A8LB 4ZGEB 1M30A 4LDWA 4RTXA 1VQNT 3LWHA 2DYBA 2K4YA 3LGLA 4M78E 2X3XD 1V29B 1SRLA 4M78D 4BY6C 1RADB 4HCZA 3L2ZA 1N5ZA 1GXIE 3MEAA 1F1BB 1K4US 5FU6C 2NYSA 2RQUA 1QVFS 2O2OA 1WZOA 2NUPB 4M7AE 5IH2A 1CKAA 1S1NA 3UDCA 1QWEA 2RHXA 2DILA 2WSCE 1WXBA 4FL6A 1VQNA 4FYWB 3QKJA 2P4TA 3KBGA 1LJOA 1NBEB 4PJOE 5GANe 3OYBA 1SG5A 2J6OA 4PJOD 4FIBA 1WJRA 3RKWA 3GP8A 2IPOB 2E5KA 2LQ8A 1OQKA 2ZPEB 5I22A 3KFVA 2HSEB 1MMAA 2QAZA 1D1BA 2M9UA 1M3CA 2VUBA 3DLMA 5IHNA 3M54A 4M77C 2LT4A 1Y07A 2H8HA 2O4XB 1RAAB 2LX9A 1WYXA 5D7UA 1WXTA 2PVDB 2RHYA 1PD0A 5GANj 3AT1B 5CQYA 4AMCA 2JM8A 4EMKB 3OBYA 2EYQA 3UATA 2L5QA 2YDLA 2H3JA 2VWFA 2FO0A 2XI9A 4M75E 2YLCA 1JU5C 1TUGB 4Z02A 3PT9A 4RTZA 5I2MA 1JXOA 4M75D 3CCRQ 4BE0A 2L3RA 2MAMA 2RI3A 1ZBJA 1LOJA 4NL3A 4VUBA 1PNJA 1Y71A 4L5GA 2V1QA 3PFSA 4E47A 3G6ET 3VS0A 1M2VB 3CQTA 3L42A 1VQ9T 4R56A 3M4GA 4RCBA 1RAGB 3X25B 1A0NB 2DJQA 3CC7Q 2A7YA 5FU7B 4AFSC 1N27A 2XKOC 2E64A 2HBPA 1XNIA 2OX7A 3QZ9B 5IXBA 8AT1B 4C0FA 2E70A 3RUXA 4LXCA 2FB7A 5KE2A 4M77G 5GAOn 3JRZA 3MPUB 3V8JA 2P84A 2DM1A 4AG2C 3OYDA 2DZ9A 4MDXA 3GF5A 2D8JA 3G6EA 4M77D 1B34B 3OYNA 2QGFB 1O75A 2MYSA 2CP2A 1VQ9A 1TG0A 2YXYA 4JZ3A 2LTOA 2KDSA 3JCMf 3G71T 4LDUA 3HL8A 1X6BA 2ZZDA 1AZGB 4PJNA 2BKDN 4MMLA 3CCQQ 3QYGB 5KYXA 1VQ6T 2JS2A 3JCMd 2GTOA 1Q86R 4WF2A 3FLGA 2COZA 5GJVB 1FMVA 3VRYA 3X28B 3CCUQ 2QXFA 2O01E 2EKOA 4X1VA 1R77A 4NS5A 1Q7YU 2F2VA 3NFCA 1K8AU 2G6FX 2BIVA 2RO0A 2R57A 4XU1A 1X69A 1K9AA 2CP3A 1BKBA 2WSFE 1MMNA 1ABQA 3G71A 4FYVB 2LCSA 1ZSZA 2DMOA 5LJ5f 2J05A 2XDPA 3CC2Q 4J9EA 1RAHB 1VQPQ 3VUBA 2LCLA 3IQLA 1S72Q 4AG1C 1U3OA 2M1HA 1K8AC 3GBQA 5LJ5d 2HKQB 1VIFA 4XQ3A 2EPDA 1C1AA 4LDXA 1X2KA 1GL5A 3PIOA 4J9HA 4WCIA 1QKWA 3RNJA 2DO3A 1KQ2A 5IHIA 4HXJA 1UUEA 2GNCA 1VQ4T 1YITQ 1ZUUA 2ZPFB 4HCCA 2DA9A 3CCET 1OZ2A 3RMQA 4C5GA 2YUNA 5DLOA 1U06A 1IXDA 5DY9A 2RK2A 2BZXA 3VS5A 2LJ1A 2XK0A 2M16A 3OYKA 2DKGA 3MEWA 3L2VA 2COYA 4PNOA 3OYIA 4R0KA 3O5ZA 4L59A 2HMAA 2EJ9A 2LJ3A 5KYWB 2O88A 2D9TA 4UC4A 3I9QA 2CREA 4GLMA 4Y92A 1KFZA 1T0HA 3OB9A 2WSEE 1BCMA 4JUVA 4A53A 4E7ZA 4JLIA 4Z8AA 2X3WD 2KBTA 4AFUC 2OTJQ 3TSZA 4F7UF 4XU3A 1LPLA 1AVZC 2X4YA 4ZTJA 4RG2A 1WNLA 2VASA 2JUFA 4P5NA 1UHCA 3QJYA 1M2OA 3MCAB 3EFOB 1QQJA 1KD1R 2QI2A 1G3SA 2OI3A 1N6AA 5A0LA 4HVUA 1ZSZC 3L2RA 3OYEA 3SWNB 4Q5WA 1I5OB 1I5LA 5GANf 2FPDA 1FMWA 4V2SA 2ECZA 4EMHA 4M7DA 3FRNA 3FJ5A 4IKFA 1HK9A 2L3PA 3JSCA 3EGUA 2KROA 5GANd 1E7OA 1NJIR 1VA7A 1CSKA 2LQWA 5C0MA 5KYUA 2ZPIB 5GAOp 3VS2A 1BYMA 4DBHA 5KYYA 3HRSA 4C8QB 2LP5A 4HA8A 1QP2A 3M56A 4QVDA 3REAB 4DEYA 1SSFA 2BE9B 4PLLA 2Z0WA 4QQGA 3QZ5B 3JCMh 5M9OA 4M7AA 3CD6Q 1Z9ZA 3CCJQ 2QQRA 1JEGA 2ROTA 1AWXA 3HRTA 5FRMA 9ATCB 2DXBA 3CCRA 3I55Q 1VQKQ 2QEXQ 2CH4A 4GLKA 2A3LA 4JDSA 4E7LA 5EC7A 5ECAA 1KQSA 3CC4Q 1D1CA 1YBYA 4PJOA 4BDZA 2KT8A 5KYNA 1GFDA 2R58A 3SB2A 3RDVA 3VUZA 2EQIA 2L3QA 4ME7A 2BZ8A 3QIIA 3CC7A 2KNBB 1OPKA 3VYHB 2O31A 3CPWA 3KXTA 2FRYA 4KH1B 2HSPA 4RCCA 1G5VA 2X4XA 2YSQA 2K3BA 5L23A 3CCQT 2DTHA 2DD4A 2WACA 5KH6A 3BDUA 5LJ5h 4XAXB 4HCKA 4JRKA 3CCUT 3VS1A 1R0CB 2JW4A 2EQUA 3PVLA 1YJNQ 4N4IA 2C0TA 4N4GA 2GFAA 3BDLA 3J7AF 5HKCA 2F5TX 4ZGDB 3EG1A 4ZTFA 5A2QE 3ZL7C 2VC8A 3EGXA 1IGUA 2MPXC 3V7CA 5GAOq 2RK1A 1PKTA 2GFUA 4OMPA 2K5IA 1U5SA 3DB4A 1HXDA 4M7DC 2V26A 4RTTA 2PQWA 2PZ1A 3PGGA 5KCHA 3EHQA 3CC2T 3CCQA 2CH4W 2HQHA 1QCNA 1S72T 4BD3A 1YI2T 2E1HA 4M78F 6AT1B 3CEYA 3CCUA 1KSWA 2CT4A 3H8ZA 2HDAA 1RLPC 2B86A 1WPYA 3HFNA 4PL6A 5GAN2 1D1AA 3X24B 3JCMP 4N4HA 1OI1A 1BBZA 4B9WA 1WHLA 2CP7A 5A0DA 2CP6A 1M3BA 2E5QA 2E6ZA 3LX7A 4M7AC 3TVTA 3Q1JA 2HQEA 5GAOr 1YITT 1NE8A 2EW3A 1PM3A 3RBBB 1VQ5Q 2J06A 3CC2A 2RQWA 2AK5A 4RKUE 1VQPA 3V7SA 3TSWA 3R6OA 2RH2A 2ROLA 1S72A 3MKDA 3EFSA 2CGHA 1D0XA 2MWOA 3VS4A 3SD4A 2Y90A 1FWZA 2F69A 2E10A 5GAOm 2L89A 1M1KU 3EHRA 2NWMA 4PJOC 1M8VA 3CMAQ 1UTIA 3HFOA 1QP3A 2M0OA 3LH0A 2X4JA 3A5ZB 3MHXA 2HBWA 2DXTA 2QA4Q 4KBMB 4M7DG 3OS0A 2XICA 2RNAA 1G3YA 3A98A 4XTYA 3GOXA 1CKBA 1YITA 3GIBA 3MEUA 5GANh 4EPCA 3J80E 1H8KA 4M78G 1MV0B 2OTJT 2BTTA 2EQKA 2YRDA 3V8LA 3G4SQ 5I2SA 3CBOA 1VUBA 1D0ZA 5J39A 2LT1A 3OS5A 4OB1B 3M53A 2K9GA 3ME9A 2FEIA 1D3BA 1Z9QA 3BY7A 4M7AG 4M75F 2KI7A 4M75C 4C5HA 5GAN6 2AHJB 4CC7A 4C92A 2FVUA 2E41A 4A4HA 1XOVA 4M7AD 3QYHB 1W70A 2ATCB 4PFZA 4LDYA 2OTJA 2KXCA 3OYFA 4PJOG 5CKBA 1HYOA 1UFFA 1NYGA 4ZNXA 1Q7YR 2W10A 2MWPA 2FZKB 3WVEB 1G2BA 1K8AR 4XTUA 2NLUA 5I11A 1C0MA 4A4GA 3EG9A 3LLRA 2HL5C 1I0CA 1ABOA 4J9BA 2ENMA 3M55A 4D6WA 2QG9B 1GBRA 2CT3A 1SKUB 3CD6T 2XMFA 3CCJT 2LZ6B 4Y91A 7AT1B 4KGZB 3CXCA 1T3LA 2PVGB 2YUOA 4HT8A 4RG8A 3I55T 4M77F 2JTFA 2EWNA 5IXFA 1M9SA 2RHZA 4AT1B 4DBQA 2QQAA 1WX6A 2DZCA 5HCKA 3CC4T 2RJEA 4BE1A 1N9RA 1TOVA 2ZPHB 2FRWA 1WHHA 3FJPA 4C0ZA 1IGQA 1VOMA 3DB3A 5AYFA 4BE2A 1UGQB 2ESWA 1M27C 4M75G 2JS0A 4C8QE 2HEQA 2V1RA 2QQ9A 3JB9H 4OMFB 4FW2A 4ATOA 3OSSC 4E6RA 3CD6A 2JVVA 4LDVA 1SF9A 3CCJA 2RB6A 2K6DA 5IN1A 1X43A 2RI2A 4CC3A 2DTIA 3I55A 3QBYA 2X51A 1VQKA 4OMMA 2QEXA 3OQ5A 3PMIA 5KYXB 2XD0A 2LMJA 2DAQA 4PK4A 3VV0A 5GMKe 1AWJA 3LYIA 3CC4A 5CQXA 2EYZA 2GQVA 4FU6A 1UB4A 2JMCA 1WA7A 4K11A 2PUKB 2IVWA 3JCMg 2L8DA 2RHIA 4F7UB 2B8AA 3RR6A 5LJ3g 1K76A 2F2XA 4HT9A 1YHQQ 1U1TA 4BI8B 3ASKA 2C0IA 4YTLA 3A8MB 1OYXA 2DL5A 4PLIA 1O9SA 2C06A 2CKKA 1Y7XA 3HHTB 1MNDA 1YJNA 1WLPB 2HQXA 5GMKj 5KE3A 4C0DC 4D8DA 3CPFA 4A54A 1VQ7Q 1PG5B 1Y96B 4Z89A 3E9FA 5D6XA 1BB9A 2O4XA 1UJ0A 4PJLA 1KQSP 5CIUA 4ORZA 5LJ3f 3PIPA 1QCFA 5D6WA 5LJ5g 3OW2A 2V8KA 1VQ5T 4EMKA 3JB9I 3C94A 3M0SA 4II1A 1BI0A 3E1SA 5LJ3d 3O8VA 1D09B 3EFRA 4L6V5 3CPWP 3OA6A 4QKUA 1AWWA 4FW1A 1GCQA 2ZPBB 1AOJA 3CMAT 2KEAA 4KULA 4EDUA 3EGDB 4J9GA 2QK0A 3META 2DYIA 2KGTA 3CMEQ 2CSIA 1BIBA 4J6YA 2F5KA 2K5FA 2COWA 1M2VA 2RQRA 2ED0A 2K2MA 3OYHA 3D7SB 1MUZA 1ARKA 3LW5E 4C92E 1W2BA 4QQDA 1VQ5A 2IG0A 4C92D 4LE9A 3F70A 1PSEA 2JXBA 2MMPA 1EIFA 1ZUYA 1I8FA 4IUPA 5CK9A 2CUBA 1RABB 2DEQA 3CMAA 1VQMQ 2DBMA 2QQSA 2NUTB 1Q95G 2DBKA 3FB9A 3EG3A 1UEBA 4XTXA 2A0FB 2HAXA 3C4SA 2EVRA 1NPPA 2XDDA 3OYCA 2JOYA 2EBPA 3GLXA 4DBFA 3QHSA 2QA4A 1B34A 1KC8U 2JN0A 3FDRA 1RL2A 3P8HA 3MP6A 5FRNA 3R6NA 3X26B 4FYXB 1JRIA 4OB3B 1QVGA 2XDBA 1Y57A 2CDTA 2HL3A 4J7FA 3BE3A 1RAFB 1VYTA 4M7DB 2VB6A 2ZGWA 2ZPGB 4JS4A 4AFQC 3G4SA 2RJDA 2MF2A 1K0SA 4KGXB 1X01A 1KC8C 2PTKA 1G3TA 4KT0E 1J3TA 1I81A 1K1ZA 1QMCA 1TUCA 4M78B 5HK3A 3OYMA 2GQIA 4FSSA 4MZMA 4EMKC 2MI6A 1K9MU 2XU8A 4J8OA 5GANg 1DJ7B 1OX8A 1RI9A 2KSSA 3MO8A 3SHWA 3H41A 1GCQC 4NL2A 2K7AA 3CBPA 1SRMA 4QW2A 4IIMA 4BI3A 1OPLA 2KT1A 1EX4A 2RPNA 2O9VA 1UDLA 3QSUA 4CRIA 3A8HB 1K9MC 4DEXA 3PVQA 4M4ZA 4D8KA 5FU7C 4PJOB 4A63B 3JV3A 1V76A 1IHVA 2X9HA 2CZ6B 3EH2A 2CP5A 5GAMe 2DL7A 2E65A 3CCRT 2FYKA 2RA2A 1ZLMA 3I5RA 4E7JA 4ANJA 5GMKm 2BE7D 3PMTA 2V8IA 1MNEA 2DEUA 1SPKA 1KQ1A 2KMTA 1M1KR 3WVDB 3CCLQ 1E6HA 1D0YA 4IURA 1VIEA 2M0YA 1OU8A 1KG1A 4OMNA 3M4YA 4GBQA 3SDZA 2LCCA 1WHKA 1OOTA 2K3XA 3CC7T 2VXEA 1HJDA 2JMAA 1K0XA 4XU0A 1YHQT 3I35A 2DL4A 5LJ3h 1KQSS 1AWOA 1H92A 5A0GA 4BY6B 1KJWA 4J5YA 2JT4A 5GAMj 1BU1A 1LCKA 5FU6B 1YCSB 4OGCA 4M75B 3FIFA 1X75C 1K73C 1Y0MA 1WJQA 1R8OB 4F14A 2I2LA 3NTIA 4LUDA 3CXCP 1TH7A 3CPWS 1VQ7T 5IT9E 3OY9A 3A1PA 2DX1A 1QKXA 2YUQA 3UT1A 1QW1A 3MP8A 1NYFA 3JCMb 5CCAA 3QPHA 5CKEA 3EFOA 3I56Q 2E12A 3TCJA 4MZPA 2E3HA 2CZ7B 1IO6A 1YHQA 1X6OA 1PSFA 2GGRA 1ACMB 4JRIA 1FX7A 3SWNA 4F7UE 3H0IA 8ATCB 4F17A 2XG8D 2E3IA 1I4K1 1YN8A 3JB9D 1V1CA 2J7IA 4J9FA 3S3MA 4J7IA 4OMOA 4XTZA 3S3NA 2KRMA 4FCYA 1YIJQ 1RAIB 2DNUA 1VQ7A 1YJ9Q 2LQKA 2V8JA 1BK2A 3C0CA 2RQVA 4M77B 4J83A 4C8QA 4M7DF 3C95A 3M5AA 2NUZA 1JJ2A 1B7TA 3QXEB 1VQPT 3V7RA 4JRPA 1Q81C 2CZ1B 3M0UA 1WQ7A 3EG0A 2DRMA 2CS7A 2L2PA 2FG0A 5KCOA 3OYGA 4BI4A 1VQMT 4HVVA 4C5IA 1FXXA 1UGPB 3U23A 2YWWA 2PNIA 2VV5A 2RJFA 4M7AF 3JCMJ 1ZX6A 3CMEA 1OZ3A 1KHCA 2EJGA 2XHCA 2D0NA 4PKCC 1M90C 1TXQA 1WIEA 1WHMA 1SSHA 3G1JA 1IHWA 1WQWA 2ZAEA 5J26A 2DRKA 1T3SA 3M0PA 4ELZC 2CSQA 2SEMA 2X35A 1ZSGA 2LNHB 3GNGA 4PJOF 1GBQA 3OW2P 1BIAA 2DK3A 4DOVA 3LWIA 3N5BB 1VQOQ 4E2FB 1VQMA 3E19A 2LDMA 1VQLQ 4OF1A 2KYBA 1N9SA 3G7ZA 3RKYA 1XJWB 2KK4A 1LVKA 2F1LA 3ZEHA 3X20B 3V8KA 2DIGA 1KD1C 3QWXX 4EMGA 1GFCA 2PU9B 1XQHA 2KXDA 4J9DA 1YJWQ 3JCMc 4RTVA 1X27A 4XTWA 3SWNC 3VKIA 3CCSQ 2P0QA 3J81E 2JNGA 4B9XA 2MIOA 4DOWA 2VXFA 2FZCB 2RI5A 2JM9A 2GCXA 4JPBW 1W2BP 2MCNA 2RMOA 3VJPA 4QT7A 2HD0A 1VQ8Q 3RMSA 3UA6A 3I5SA 3PE0A 4C8QC 4PFPA 3VS7A 1TS9A 2HNIA 1JBMA 2OAUA 1UJYA 2C0OA 1TTHB 2DETA 5CKFA 4JS5A 2ZCFB 3CCVQ 1UGSB 4IUUA 3UWNA 1NG2A 1ZHIA 1JQQA 3TU4K 3OMGA 4RTUA 2GTJA 2D0QB 4R55A 4J6WA 4C5EA 4CC4B 3S3OA 1VQ4Q 5GAMg 1QVGP 1YWOA 1AEYA 3CCLT 4A4KA 1X2QA 3URGA 2CUDA 3CCEQ 2YHTA 3KUFA 4E7IA 1TU0B 2KE9A 2FPFA 3RIRA 3CXCS 1QVFA 1W6XA 2VVKA 3QDRB 3HP9A 1EZZB 2L3SA 5GMKh 2GBQA 3BFMA 1RUWA 4ZGJB 2DF6A 2LNVA 2HKNA 3SFMA 4FM4B 1IRXA 1EFNA 1IB8A 2DVJA 2Y4YA 3EH1A 4KGVB 3VU3C 1VQKT 4RTWA 2QEXT 4J6XA 3AHUA 1YWPA 1MHNA 3GNFB 2FZGB 1MMGA 5GAMf 1HSQA 4BACA 1Q82U 3QWYA 1M1FA 3CCLA 4C8QG 1OU9A 4JJCA 1BI1A 4XK8E 4F04B 3OYAA 3FC3A 2EQJA 5GAMd 4B6MA 2A28A 4AFZC 3I56T 1GRIA 1ZA2B 4C8QD 3RERA 1KC8R 4NOYA 3INZA 2EGEA 3BW1A 1Q82C 5GAN4 2QTXA 5J3BA 3JCMX 2NUPA 1PHTA 4LD6A 3M0RA 4FSXA 1BCOA 2DXCA 1YJNT 4BDYA 2K3YA 3GPLA 1QWFA 1IZ6A 2LVMA 4FT4A 2DD5A 1RAEB 4LUEA 1YIJT 1YJ9T 2FHDA 4EIKA 2CYZB 4Z88A 3L2WA 2DLPA 5FW9A 4FYYB 2FPEA 1AT1B 4C92F 4CI0C 4C92C 2D1XA 1N8RU 3VYGA 1G8XA 3I56A 5CVIA 4PJMA 1BI2A 1AHJB 2KRNA 5GAOl 1WJSA 2EQMA 3UPUA 2EKHA 3RKXA 1K9MR 1OULA 2EFIA 1WFWA 2YRVA 2P0PA 3CCMQ 2ABLA 2A08A 1FYNA 4JJNK 1ZA1B
chains in the Genus database with same CATH topology
2PTKA 2J6KA 2YSQA 2K3BA 1J3TA 1K1ZA 5L23A 4RTXA 3NMZC 1WI7A 2DYBA 1TUCA 2X3XD 2GQIA 2M51A 1SRLA 1B3QA 4HCKA 4FSSA 3VS1A 2JW4A 2DE0X 1N5ZA 3PVLA 1K4US 1RI9A 2C0TA 3SHWA 2RQUA 3H41A 3EG1A 1GCQC 2O2OA 2F2WA 3ZL7C 5IH2A 1CKAA 1S1NA 2K7AA 1UECA 1AD5A 1SRMA 1PKTA 4OMPA 4IIMA 1QWEA 1U5SA 3M0TA 1OPLA 2KT1A 2RPNA 4RTTA 2O9VA 1UDLA 2PZ1A 2AZVA 2DILA 3EHQA 4DEXA 3PVQA 2CH4W 1WXBA 4M4ZA 4D8KA 4J9IA 4A63B 1KSWA 2CT4A 2HDAA 1RLPC 3JV3A 2B86A 1M8MA 2J6OA 1E6GA 2DL7A 2E5KA 5I22A 1ZLMA 2EGCA 1VYVA 3I5RA 3KFVA 1BBZA 3VS3A 1M3BA 1WDXA 1M3CA 1SPKA 1ZUKA 1NLOC 3TVTA 2EYXA 3NHNA 5IHNA 1E6HA 2M0YA 2EW3A 4OMNA 3RBBB 1TUDA 2J06A 2H8HA 4GBQA 2RQWA 1OOTA 2AK5A 4IIOA 3TSWA 1HJDA 1WYXA 2ROLA 1WXTA 4CC2A 2JMAA 3VS4A 1K0XA 3I35A 2DL4A 3EHRA 2JM8A 1HD3A 2I0NA 2NWMA 2J6FA 1AWOA 1H92A 1UTIA 1KJWA 2JT4A 3UATA 1BU1A 1LCKA 2YDLA 1MV3A 2YUPA 1YCSB 3SEMA 2VWFA 2FO0A 3THKA 1JU5C 3LH5A 4RTZA 1Y0MA 1JXOA 2HBWA 1KIKA 4F14A 4LUDA 2RNAA 1UGVA 3A98A 1CKBA 2DX1A 1QKXA 2YUQA 1ZBJA 1NYFA 2YT6A 2BZYA 4J9CA 1PNJA 2KR3A 2V1QA 4RTYA 1PKSA 3VS0A 1H8KA 3CQTA 1MV0B 3NGPA 2BTTA 1IO6A 1A0NB 1QLYA 2DJQA 1NLPC 4AFSC 2GGRA 2LQNA 3H0IA 1PRMC 4F17A 2RQTA 1YN8A 1V1CA 2K9GA 2FEIA 2J7IA 5IXBA 3NPFA 4J9FA 1Z9QA 2DL8A 1OEBA 1X6GA 4OMOA 1GCPA 1NM7A 4KRTA 2KRMA 1JXMA 2DNUA 4CC7A 5GJWB 1XOVA 1BK2A 2DM1A 3C0CA 2RQVA 4HVWA 4AG2C 1W70A 2D8JA 2ED1A 2KXCA 2A37A 1NEBA 1TG0A 2NUZA 4JZ3A 1UFFA 1NYGA 4ZNXA 2W10A 1X6BA 3M0UA 2OAWA 1G2BA 3EG0A 2DRMA 1AZGB 2KRSA 2L2PA 2FG0A 5I11A 2L0AA 2JS2A 2GTOA 1I0CA 1ABOA 5GJVB 3VRYA 4J9BA 2ENMA 4HVVA 1GBRA 3U23A 4X1VA 2CT3A 2PNIA 2XMFA 2LZ6B 3H0FA 2F2VA 1ZX6A 1T3LA 2YUOA 1SEMA 2D0NA 2G6FX 1WIEA 1SSHA 1X69A 1K9AA 1WXUA 5IXFA 1ABQA 3VS6A 1RLQC 1WX6A 5HCKA 2DRKA 1T3SA 3M0PA 2LCSA 2FRWA 2DMOA 1YNZA 2CSQA 1PRLC 2J05A 2SEMA 4JJDA 2AKKA 4J9EA 1ZSGA 2LNHB 1GBQA 2ESWA 1M27C 3IQLA 2JS0A 4AG1C 1U3OA 2HEQA 2V1RA 3GBQA 2EPDA 4LNPA 2KYBA 4E6RA 3M0QA 2K6DA 1X43A 3QWXX 2DL3A 2JTEA 4CC3A 1GFCA 2KXDA 4J9DA 1X2KA 1GL5A 4OMMA 4RTVA 1X27A 2SRCA 2LX7A 2LMJA 4J9HA 4WCIA 1QKWA 3RNJA 2MIOA 1AWJA 5IHIA 4HXJA 1UUEA 2GNCA 2O9SA 1PWTA 1ZUUA 2EYZA 4ESRA 2JM9A 2MOXA 2DA9A 2JMCA 4JPBW 1WA7A 4K11A 2YUNA 2MCNA 2RMOA 2RN8A 4QT7A 1U06A 4RUGA 1K76A 2P4RA 2F2XA 4JJBA 3UA6A 2BZXA 3I5SA 3PE0A 3VS5A 2LJ1A 2C0IA 4JZ4A 2AKLA 3VS7A 2AZSA 3UA7A 1UJYA 2C0OA 2DL5A 1YP5A 4R0KA 3O5ZA 2W0ZA 2A36A 1NG2A 1I1JA 1WLPB 2LJ3A 3ULRB 2O88A 1JQQA 4Y92A 3I9QA 2CREA 4GLMA 4D8DA 1KFZA 1T0HA 2EYWA 4Z89A 4RTUA 1T0JA 1BB9A 1FMKA 1OV3A 1UJ0A 2GTJA 1H3HA 4CC4B 1AZEA 1W1FA 2D8HA 4Z8AA 2QDLA 4ORZA 4OMQA 1YWOA 2X3WD 2KBTA 1AEYA 3REBB 4AFUC 1X2QA 3TSZA 2CUDA 1SHFA 1QCFA 1AVZC 2KE9A 2FPFA 1UHCA 3M0SA 1W6XA 2VVKA 2L3SA 1AWWA 2GBQA 1RUWA 2OI3A 1GCQA 2DF6A 5FWCA 4HVUA 1AOJA 4LN2A 2KEAA 1EFNA 2DVJA 2FPDA 4J9GA 4RTWA 1NEGA 2ECZA 1UHFA 2KGTA 3FJ5A 1YWPA 2CSIA 1HSQA 2L3PA 5IHKA 2RQRA 2ED0A 2K2MA 3QWYA 3EGUA 2KROA 3EG2A 1E7OA 2EGAA 1MUZA 1ARKA 2HCKA 1VA7A 1CSKA 2LQWA 3H0HA 4JJCA 3VRZA 2RF0A 3VS2A 2K79A 2IIMA 3UF4A 4LE9A 1I07A 2A28A 2JXBA 4AFZC 2LP5A 1GRIA 1ZUYA 1B07A 5FWBA 2KYMA 2CUBA 4OMLA 2VKNA 3REAB 1UE9A 4DEYA 2EGEA 2DBMA 2OJ2A 2DBKA 1PHTA 3EG3A 3M0RA 1JO8A 1Z9ZA 2EVRA 1JEGA 2ROTA 2EBPA 1AWXA 1QWFA 2EYYA 4LUEA 2CH4A 4EIKA 5EC7A 5ECAA 4Z88A 3R6NA 2DLPA 4F16A 1M3AA 5FW9A 2FPEA 1Y57A 2CDTA 2D1XA 2KT8A 2LJ0A 1GFDA 1SHGA 2KRNA 1VYUA 1VYTA 2EKHA 1G83A 2EQIA 2L3QA 4AFQC 2BZ8A 1WFWA 2KNBB 1UG1A 1OPKA 2O31A 2ABLA 1K0SA 2A08A 2FRYA 2HSPA 1FYNA 1M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PTK A;  2J6K A;  2YSQ A;  2K3B A;  1J3T A;  1K1Z A;  5L23 A;  4RTX A;  3NMZ C;  1WI7 A;  2DYB A;  1TUC A;  2X3X D;  2GQI A;  2M51 A;  1SRL A;  1B3Q A;  4HCK A;  4FSS A;  3VS1 A;  2JW4 A;  2DE0 X;  1N5Z A;  3PVL A;  1K4U S;  1RI9 A;  2C0T A;  3SHW A;  2RQU A;  3H41 A;  3EG1 A;  1GCQ C;  2O2O A;  2F2W A;  3ZL7 C;  5IH2 A;  1CKA A;  1S1N A;  2K7A A;  1UEC A;  1AD5 A;  1SRM A;  1PKT A;  4OMP A;  4IIM A;  1QWE A;  1U5S A;  3M0T A;  1OPL A;  2KT1 A;  2RPN A;  4RTT A;  2O9V A;  1UDL A;  2PZ1 A;  2AZV A;  2DIL A;  3EHQ A;  4DEX A;  3PVQ A;  2CH4 W;  1WXB A;  4M4Z A;  4D8K A;  4J9I A;  4A63 B;  1KSW A;  2CT4 A;  2HDA A;  1RLP C;  3JV3 A;  2B86 A;  1M8M A;  2J6O A;  1E6G A;  2DL7 A;  2E5K A;  5I22 A;  1ZLM A;  2EGC A;  1VYV A;  3I5R A;  3KFV A;  1BBZ A;  3VS3 A;  1M3B A;  1WDX A;  1M3C A;  1SPK A;  1ZUK A;  1NLO C;  3TVT A;  2EYX A;  3NHN A;  5IHN A;  1E6H A;  2M0Y A;  2EW3 A;  4OMN A;  3RBB B;  1TUD A;  2J06 A;  2H8H A;  4GBQ A;  2RQW A;  1OOT A;  2AK5 A;  4IIO A;  3TSW A;  1HJD A;  1WYX A;  2ROL A;  1WXT A;  4CC2 A;  2JMA A;  3VS4 A;  1K0X A;  3I35 A;  2DL4 A;  3EHR A;  2JM8 A;  1HD3 A;  2I0N A;  2NWM A;  2J6F A;  1AWO A;  1H92 A;  1UTI A;  1KJW A;  2JT4 A;  3UAT A;  1BU1 A;  1LCK A;  2YDL A;  1MV3 A;  2YUP A;  1YCS B;  3SEM A;  2VWF A;  2FO0 A;  3THK A;  1JU5 C;  3LH5 A;  4RTZ A;  1Y0M A;  1JXO A;  2HBW A;  1KIK A;  4F14 A;  4LUD A;  2RNA A;  1UGV A;  3A98 A;  1CKB A;  2DX1 A;  1QKX A;  2YUQ A;  1ZBJ A;  1NYF A;  2YT6 A;  2BZY A;  4J9C A;  1PNJ A;  2KR3 A;  2V1Q A;  4RTY A;  1PKS A;  3VS0 A;  1H8K A;  3CQT A;  1MV0 B;  3NGP A;  2BTT A;  1IO6 A;  1A0N B;  1QLY A;  2DJQ A;  1NLP C;  4AFS C;  2GGR A;  2LQN A;  3H0I A;  1PRM C;  4F17 A;  2RQT A;  1YN8 A;  1V1C A;  2K9G A;  2FEI A;  2J7I A;  5IXB A;  3NPF A;  4J9F A;  1Z9Q A;  2DL8 A;  1OEB A;  1X6G A;  4OMO A;  1GCP A;  1NM7 A;  4KRT A;  2KRM A;  1JXM A;  2DNU A;  4CC7 A;  5GJW B;  1XOV A;  1BK2 A;  2DM1 A;  3C0C A;  2RQV A;  4HVW A;  4AG2 C;  1W70 A;  2D8J A;  2ED1 A;  2KXC A;  2A37 A;  1NEB A;  1TG0 A;  2NUZ A;  4JZ3 A;  1UFF A;  1NYG A;  4ZNX A;  2W10 A;  1X6B A;  3M0U A;  2OAW A;  1G2B A;  3EG0 A;  2DRM A;  1AZG B;  2KRS A;  2L2P A;  2FG0 A;  5I11 A;  2L0A A;  2JS2 A;  2GTO A;  1I0C A;  1ABO A;  5GJV B;  3VRY A;  4J9B A;  2ENM A;  4HVV A;  1GBR A;  3U23 A;  4X1V A;  2CT3 A;  2PNI A;  2XMF A;  2LZ6 B;  3H0F A;  2F2V A;  1ZX6 A;  1T3L A;  2YUO A;  1SEM A;  2D0N A;  2G6F X;  1WIE A;  1SSH A;  1X69 A;  1K9A A;  1WXU A;  5IXF A;  1ABQ A;  3VS6 A;  1RLQ C;  1WX6 A;  5HCK A;  2DRK A;  1T3S A;  3M0P A;  2LCS A;  2FRW A;  2DMO A;  1YNZ A;  2CSQ A;  1PRL C;  2J05 A;  2SEM A;  4JJD A;  2AKK A;  4J9E A;  1ZSG A;  2LNH B;  1GBQ A;  2ESW A;  1M27 C;  3IQL A;  2JS0 A;  4AG1 C;  1U3O A;  2HEQ A;  2V1R A;  3GBQ A;  2EPD A;  4LNP A;  2KYB A;  4E6R A;  3M0Q A;  2K6D A;  1X43 A;  3QWX X;  2DL3 A;  2JTE A;  4CC3 A;  1GFC A;  2KXD A;  4J9D A;  1X2K A;  1GL5 A;  4OMM A;  4RTV A;  1X27 A;  2SRC A;  2LX7 A;  2LMJ A;  4J9H A;  4WCI A;  1QKW A;  3RNJ A;  2MIO A;  1AWJ A;  5IHI A;  4HXJ A;  1UUE A;  2GNC A;  2O9S A;  1PWT A;  1ZUU A;  2EYZ A;  4ESR A;  2JM9 A;  2MOX A;  2DA9 A;  2JMC A;  4JPB W;  1WA7 A;  4K11 A;  2YUN A;  2MCN A;  2RMO A;  2RN8 A;  4QT7 A;  1U06 A;  4RUG A;  1K76 A;  2P4R A;  2F2X A;  4JJB A;  3UA6 A;  2BZX A;  3I5S A;  3PE0 A;  3VS5 A;  2LJ1 A;  2C0I A;  4JZ4 A;  2AKL A;  3VS7 A;  2AZS A;  3UA7 A;  1UJY A;  2C0O A;  2DL5 A;  1YP5 A;  4R0K A;  3O5Z A;  2W0Z A;  2A36 A;  1NG2 A;  1I1J A;  1WLP B;  2LJ3 A;  3ULR B;  2O88 A;  1JQQ A;  4Y92 A;  3I9Q A;  2CRE A;  4GLM A;  4D8D A;  1KFZ A;  1T0H A;  2EYW A;  4Z89 A;  4RTU A;  1T0J A;  1BB9 A;  1FMK A;  1OV3 A;  1UJ0 A;  2GTJ A;  1H3H A;  4CC4 B;  1AZE A;  1W1F A;  2D8H A;  4Z8A A;  2QDL A;  4ORZ A;  4OMQ A;  1YWO A;  2X3W D;  2KBT A;  1AEY A;  3REB B;  4AFU C;  1X2Q A;  3TSZ A;  2CUD A;  1SHF A;  1QCF A;  1AVZ C;  2KE9 A;  2FPF A;  1UHC A;  3M0S A;  1W6X A;  2VVK A;  2L3S A;  1AWW A;  2GBQ A;  1RUW A;  2OI3 A;  1GCQ A;  2DF6 A;  5FWC A;  4HVU A;  1AOJ A;  4LN2 A;  2KEA A;  1EFN A;  2DVJ A;  2FPD A;  4J9G A;  4RTW A;  1NEG A;  2ECZ A;  1UHF A;  2KGT A;  3FJ5 A;  1YWP A;  2CSI A;  1HSQ A;  2L3P A;  5IHK A;  2RQR A;  2ED0 A;  2K2M A;  3QWY A;  3EGU A;  2KRO A;  3EG2 A;  1E7O A;  2EGA A;  1MUZ A;  1ARK A;  2HCK A;  1VA7 A;  1CSK A;  2LQW A;  3H0H A;  4JJC A;  3VRZ A;  2RF0 A;  3VS2 A;  2K79 A;  2IIM A;  3UF4 A;  4LE9 A;  1I07 A;  2A28 A;  2JXB A;  4AFZ C;  2LP5 A;  1GRI A;  1ZUY A;  1B07 A;  5FWB A;  2KYM A;  2CUB A;  4OML A;  2VKN A;  3REA B;  1UE9 A;  4DEY A;  2EGE A;  2DBM A;  2OJ2 A;  2DBK A;  1PHT A;  3EG3 A;  3M0R A;  1JO8 A;  1Z9Z A;  2EVR A;  1JEG A;  2ROT A;  2EBP A;  1AWX A;  1QWF A;  2EYY A;  4LUE A;  2CH4 A;  4EIK A;  5EC7 A;  5ECA A;  4Z88 A;  3R6N A;  2DLP A;  4F16 A;  1M3A A;  5FW9 A;  2FPE A;  1Y57 A;  2CDT A;  2D1X A;  2KT8 A;  2LJ0 A;  1GFD A;  1SHG A;  2KRN A;  1VYU A;  1VYT A;  2EKH A;  1G83 A;  2EQI A;  2L3Q A;  4AFQ C;  2BZ8 A;  1WFW A;  2KNB B;  1UG1 A;  1OPK A;  2O31 A;  2ABL A;  1K0S A;  2A08 A;  2FRY A;  2HSP A;  1FYN A;  1M30 A; 
#chains in the Genus database with same CATH topology
 1ZSZ B;  2J6K A;  4QVC A;  3QDF A;  3NMZ C;  1WI7 A;  1YFN A;  2M51 A;  1B3Q A;  1N8R C;  5AT1 B;  1YIJ A;  2DE0 X;  1YJ9 A;  4WTO B;  2YRC A;  3OW2 S;  2K2V A;  3OMC A;  4KUI A;  5DM7 R;  3L1A A;  5CR2 A;  2FL7 A;  1YCY A;  2F2W A;  3TEE A;  4DBR A;  1UEC A;  1AD5 A;  4M77 E;  1M4Z A;  3M0T A;  4JLG A;  1M5Q 1;  5GAN 5;  2AZV A;  2DXU A;  5GAN 7;  3CBM A;  1PC0 A;  1KHI A;  4J9I A;  1VQO T;  5GAN 8;  1VQL T;  1M8M A;  1W2B S;  1E6G A;  1OX9 A;  4C92 G;  1K73 R;  2QA4 T;  3MJX A;  2Y4X A;  1YJW T;  2EGC A;  1VYV A;  4KUD K;  2E6N A;  3VS3 A;  3CCS T;  1NPR A;  1WDX A;  2KQW A;  1ZUK A;  2KY9 A;  1NLO C;  4F7U A;  3OYL A;  2EYX A;  3MP1 A;  3NHN A;  5DLQ E;  2EAY A;  2MK5 A;  1RAC B;  1PCX A;  1TUD A;  2RM4 A;  3G4S T;  1QVP A;  1JJ2 P;  4IIO A;  3JCM W;  4CC2 A;  1VQ8 T;  1VQO A;  2PUO B;  1G3W A;  2K5L A;  1VQL A;  1Q7Y C;  4DQ2 A;  1VQ6 A;  4TVR A;  5CO7 A;  1HD3 A;  2I0N A;  2J6F A;  1YI2 Q;  1QVG S;  3M9Q A;  1Y96 A;  1MV3 A;  2VGM A;  2YUP A;  3SEM A;  1YJW A;  2AT1 B;  3THK A;  3LH5 A;  3CCS A;  3TQ7 P;  3CCV T;  2QTV A;  1KIK A;  2M02 A;  3FEO A;  4X9D A;  3RES A;  1UGV A;  2OTL Q;  2QDY B;  2EJF A;  2YT6 A;  2BZY A;  2CZ0 B;  4J9C A;  2KR3 A;  4RTY A;  4GY5 A;  1PKS A;  3ER0 A;  1Q81 R;  1VQ8 A;  3NGP A;  2D6F A;  5GAM h;  1QLY A;  3TRE A;  1NLP C;  5KYU B;  2LQN A;  3L2Q A;  3DKM A;  3JAM E;  3OYY A;  1QCO A;  1MGQ A;  1PRM C;  3EGD A;  3WXM B;  5KYY B;  2RQT A;  4E7H A;  5FLX E;  2JTM A;  4E7S A;  3NPF A;  2DL8 A;  1OEB A;  5IAY A;  3CCV A;  4HKE A;  5HY6 A;  1X6G A;  3OS2 A;  1GCP A;  1NM7 A;  3PNW C;  4KRT A;  2JJ9 A;  1JXM A;  5GJW B;  4M7A B;  3HRU A;  1M90 R;  4HVW A;  4X9C A;  5GAN 3;  3EAE A;  1H64 1;  1VQ4 A;  2DVE A;  2ED1 A;  2K57 A;  2A37 A;  1NEB A;  3CCE A;  3ZFJ A;  4PFO A;  2VGN A;  2NUT A;  2OAW A;  3PTA A;  1W4S A;  2DFU A;  3JB9 F;  2KRS A;  2XID A;  3OBW A;  1VQN Q;  2L0A A;  4ZN1 A;  4KH0 B;  3C12 A;  5CAI A;  1LNX A;  4OGE A;  4PJJ A;  2LRQ A;  4MDW A;  3A8O B;  3H0F A;  3HSB A;  3NTK A;  1M1G A;  1SEM A;  5HK0 A;  2PVO B;  2QQB A;  1WXU A;  1Q86 U;  3L2U A;  2EIF A;  2RHU A;  1K73 U;  3VS6 A;  1RLQ C;  3M58 A;  2KVQ G;  1YNZ A;  4JJD A;  3E9G A;  1PRL C;  2AKK A;  2DTO A;  1P92 A;  4E7K A;  3EGX B;  4M78 A;  5KYW A;  3DLL A;  1U1S A;  3CCM T;  4DA4 A;  4BUG A;  1QVF P;  4A4F A;  1Q86 C;  4LNP A;  2DER A;  4ZN3 A;  4IUV A;  2KAF A;  3M0Q A;  3A8G B;  2DL3 A;  2JTE A;  4OB0 B;  4BB7 A;  2SRC A;  2LX7 A;  3OS1 A;  2JZ2 A;  4XTV A;  2O9S A;  3T9N A;  1PWT A;  4ESR A;  4F7U G;  3JB9 G;  3HKS A;  1MMD A;  2MOX A;  3H6Z A;  1XTD A;  2DIQ A;  4X34 A;  2RN8 A;  2QYZ A;  3CCM A;  4RUG A;  2P4R A;  1IRE B;  4JJB A;  1NZ9 A;  3LGF A;  3NTH A;  4IUT A;  3P8D A;  4N0A A;  4JZ4 A;  2AKL A;  2AZS A;  1R0B G;  2CP0 A;  2AIR B;  1Q81 U;  3UA7 A;  5EG2 A;  1YP5 A;  4MZT A;  1PD1 A;  4QVZ A;  2W0Z A;  2A36 A;  2QAS A;  3JCM V;  1JJ2 S;  1I1J A;  2RD1 A;  3P8B B;  4OP0 A;  3JCM Q;  3CME T;  3ULR B;  2LC4 A;  2EYW A;  4MMK A;  4O6J A;  1T0J A;  1FMK A;  1OV3 A;  2P0K A;  4RMO A;  3JCM e;  1H3H A;  1AZE A;  1W1F A;  2D8H A;  5LJ3 e;  3G6E Q;  2QDL A;  3QG1 A;  4OMQ A;  2DPP B;  3REB B;  1M90 U;  1VQ9 Q;  1SHF A;  1UGR B;  1RI0 A;  2HZY A;  5L8R E;  1JB0 E;  2E4H A;  1ZBX A;  4FT2 A;  1TSF A;  4M75 A;  2R5A A;  1Q82 R;  1BI3 A;  5D6Y A;  2YLB A;  1U8R A;  5FWC A;  4JRQ A;  3H9N A;  4LN2 A;  4Y28 E;  4M78 C;  5I21 A;  1NEG A;  1UHF A;  4C0G A;  1TWB A;  1D3B B;  2GF7 A;  3E2U A;  3QUI A;  5IHK A;  1KD1 U;  2R5M A;  3HPW A;  5LJ3 j;  3EG2 A;  2OTL T;  5LJ5 e;  4LD9 K;  2EGA A;  2HCK A;  1WGS A;  3H0H A;  4C92 B;  5CKD A;  3VRZ A;  5FRO A;  3G71 Q;  4A4E A;  2RF0 A;  4IUQ A;  2K79 A;  2IIM A;  3UF4 A;  1I07 A;  2QGG A;  4QQ6 A;  4XU2 A;  1B07 A;  5FWB A;  2KYM A;  1VQ6 Q;  4OML A;  2VKN A;  3QJ6 A;  2G3R A;  3M59 A;  1UE9 A;  1ZQ1 A;  4OVA A;  2DJZ A;  2OJ2 A;  1WHJ A;  1YI2 A;  1NJI U;  4HCB A;  1N8R R;  4ELY C;  1JO8 A;  3S6W A;  5GMK l;  4M77 A;  3M57 A;  4C0D B;  2H3E B;  3EG9 B;  4N0A C;  4OB2 B;  2RJC A;  3OYJ A;  2EYY A;  5CKH A;  2BUD A;  2OTL A;  3HTR A;  3MEV A;  3OSV A;  2X4W A;  1KK7 A;  5LJ5 j;  4F16 A;  1M3A A;  5LL6 S;  1C6V X;  1NJI C;  1H3Z A;  2LJ0 A;  5GMK i;  1SHG A;  4C8Q F;  1VYU A;  1M1K C;  2VYT A;  4M7D E;  1G83 A;  3JB9 J;  4O5V A;  1UG1 A;  4M7D D;  3QO3 A;  5C6S A;  3ZBD A;  1WHG A;  3A8L B;  4ZGE B;  1M30 A;  4LDW A;  4RTX A;  1VQN T;  3LWH A;  2DYB A;  2K4Y A;  3LGL A;  4M78 E;  2X3X D;  1V29 B;  1SRL A;  4M78 D;  4BY6 C;  1RAD B;  4HCZ A;  3L2Z A;  1N5Z A;  1GXI E;  3MEA A;  1F1B B;  1K4U S;  5FU6 C;  2NYS A;  2RQU A;  1QVF S;  2O2O A;  1WZO A;  2NUP B;  4M7A E;  5IH2 A;  1CKA A;  1S1N A;  3UDC A;  1QWE A;  2RHX A;  2DIL A;  2WSC E;  1WXB A;  4FL6 A;  1VQN A;  4FYW B;  3QKJ A;  2P4T A;  3KBG A;  1LJO A;  1NBE B;  4PJO E;  5GAN e;  3OYB A;  1SG5 A;  2J6O A;  4PJO D;  4FIB A;  1WJR A;  3RKW A;  3GP8 A;  2IPO B;  2E5K A;  2LQ8 A;  1OQK A;  2ZPE B;  5I22 A;  3KFV A;  2HSE B;  1MMA A;  2QAZ A;  1D1B A;  2M9U A;  1M3C A;  2VUB A;  3DLM A;  5IHN A;  3M54 A;  4M77 C;  2LT4 A;  1Y07 A;  2H8H A;  2O4X B;  1RAA B;  2LX9 A;  1WYX A;  5D7U A;  1WXT A;  2PVD B;  2RHY A;  1PD0 A;  5GAN j;  3AT1 B;  5CQY A;  4AMC A;  2JM8 A;  4EMK B;  3OBY A;  2EYQ A;  3UAT A;  2L5Q A;  2YDL A;  2H3J A;  2VWF A;  2FO0 A;  2XI9 A;  4M75 E;  2YLC A;  1JU5 C;  1TUG B;  4Z02 A;  3PT9 A;  4RTZ A;  5I2M A;  1JXO A;  4M75 D;  3CCR Q;  4BE0 A;  2L3R A;  2MAM A;  2RI3 A;  1ZBJ A;  1LOJ A;  4NL3 A;  4VUB A;  1PNJ A;  1Y71 A;  4L5G A;  2V1Q A;  3PFS A;  4E47 A;  3G6E T;  3VS0 A;  1M2V B;  3CQT A;  3L42 A;  1VQ9 T;  4R56 A;  3M4G A;  4RCB A;  1RAG B;  3X25 B;  1A0N B;  2DJQ A;  3CC7 Q;  2A7Y A;  5FU7 B;  4AFS C;  1N27 A;  2XKO C;  2E64 A;  2HBP A;  1XNI A;  2OX7 A;  3QZ9 B;  5IXB A;  8AT1 B;  4C0F A;  2E70 A;  3RUX A;  4LXC A;  2FB7 A;  5KE2 A;  4M77 G;  5GAO n;  3JRZ A;  3MPU B;  3V8J A;  2P84 A;  2DM1 A;  4AG2 C;  3OYD A;  2DZ9 A;  4MDX A;  3GF5 A;  2D8J A;  3G6E A;  4M77 D;  1B34 B;  3OYN A;  2QGF B;  1O75 A;  2MYS A;  2CP2 A;  1VQ9 A;  1TG0 A;  2YXY A;  4JZ3 A;  2LTO A;  2KDS A;  3JCM f;  3G71 T;  4LDU A;  3HL8 A;  1X6B A;  2ZZD A;  1AZG B;  4PJN A;  2BKD N;  4MML A;  3CCQ Q;  3QYG B;  5KYX A;  1VQ6 T;  2JS2 A;  3JCM d;  2GTO A;  1Q86 R;  4WF2 A;  3FLG A;  2COZ A;  5GJV B;  1FMV A;  3VRY A;  3X28 B;  3CCU Q;  2QXF A;  2O01 E;  2EKO A;  4X1V A;  1R77 A;  4NS5 A;  1Q7Y U;  2F2V A;  3NFC A;  1K8A U;  2G6F X;  2BIV A;  2RO0 A;  2R57 A;  4XU1 A;  1X69 A;  1K9A A;  2CP3 A;  1BKB A;  2WSF E;  1MMN A;  1ABQ A;  3G71 A;  4FYV B;  2LCS A;  1ZSZ A;  2DMO A;  5LJ5 f;  2J05 A;  2XDP A;  3CC2 Q;  4J9E A;  1RAH B;  1VQP Q;  3VUB A;  2LCL A;  3IQL A;  1S72 Q;  4AG1 C;  1U3O A;  2M1H A;  1K8A C;  3GBQ A;  5LJ5 d;  2HKQ B;  1VIF A;  4XQ3 A;  2EPD A;  1C1A A;  4LDX A;  1X2K A;  1GL5 A;  3PIO A;  4J9H A;  4WCI A;  1QKW A;  3RNJ A;  2DO3 A;  1KQ2 A;  5IHI A;  4HXJ A;  1UUE A;  2GNC A;  1VQ4 T;  1YIT Q;  1ZUU A;  2ZPF B;  4HCC A;  2DA9 A;  3CCE T;  1OZ2 A;  3RMQ A;  4C5G A;  2YUN A;  5DLO A;  1U06 A;  1IXD A;  5DY9 A;  2RK2 A;  2BZX A;  3VS5 A;  2LJ1 A;  2XK0 A;  2M16 A;  3OYK A;  2DKG A;  3MEW A;  3L2V A;  2COY A;  4PNO A;  3OYI A;  4R0K A;  3O5Z A;  4L59 A;  2HMA A;  2EJ9 A;  2LJ3 A;  5KYW B;  2O88 A;  2D9T A;  4UC4 A;  3I9Q A;  2CRE A;  4GLM A;  4Y92 A;  1KFZ A;  1T0H A;  3OB9 A;  2WSE E;  1BCM A;  4JUV A;  4A53 A;  4E7Z A;  4JLI A;  4Z8A A;  2X3W D;  2KBT A;  4AFU C;  2OTJ Q;  3TSZ A;  4F7U F;  4XU3 A;  1LPL A;  1AVZ C;  2X4Y A;  4ZTJ A;  4RG2 A;  1WNL A;  2VAS A;  2JUF A;  4P5N A;  1UHC A;  3QJY A;  1M2O A;  3MCA B;  3EFO B;  1QQJ A;  1KD1 R;  2QI2 A;  1G3S A;  2OI3 A;  1N6A A;  5A0L A;  4HVU A;  1ZSZ C;  3L2R A;  3OYE A;  3SWN B;  4Q5W A;  1I5O B;  1I5L A;  5GAN f;  2FPD A;  1FMW A;  4V2S A;  2ECZ A;  4EMH A;  4M7D A;  3FRN A;  3FJ5 A;  4IKF A;  1HK9 A;  2L3P A;  3JSC A;  3EGU A;  2KRO A;  5GAN d;  1E7O A;  1NJI R;  1VA7 A;  1CSK A;  2LQW A;  5C0M A;  5KYU A;  2ZPI B;  5GAO p;  3VS2 A;  1BYM A;  4DBH A;  5KYY A;  3HRS A;  4C8Q B;  2LP5 A;  4HA8 A;  1QP2 A;  3M56 A;  4QVD A;  3REA B;  4DEY A;  1SSF A;  2BE9 B;  4PLL A;  2Z0W A;  4QQG A;  3QZ5 B;  3JCM h;  5M9O A;  4M7A A;  3CD6 Q;  1Z9Z A;  3CCJ Q;  2QQR A;  1JEG A;  2ROT A;  1AWX A;  3HRT A;  5FRM A;  9ATC B;  2DXB A;  3CCR A;  3I55 Q;  1VQK Q;  2QEX Q;  2CH4 A;  4GLK A;  2A3L A;  4JDS A;  4E7L A;  5EC7 A;  5ECA A;  1KQS A;  3CC4 Q;  1D1C A;  1YBY A;  4PJO A;  4BDZ A;  2KT8 A;  5KYN A;  1GFD A;  2R58 A;  3SB2 A;  3RDV A;  3VUZ A;  2EQI A;  2L3Q A;  4ME7 A;  2BZ8 A;  3QII A;  3CC7 A;  2KNB B;  1OPK A;  3VYH B;  2O31 A;  3CPW A;  3KXT A;  2FRY A;  4KH1 B;  2HSP A;  4RCC A;  1G5V A;  2X4X A;  2YSQ A;  2K3B A;  5L23 A;  3CCQ T;  2DTH A;  2DD4 A;  2WAC A;  5KH6 A;  3BDU A;  5LJ5 h;  4XAX B;  4HCK A;  4JRK A;  3CCU T;  3VS1 A;  1R0C B;  2JW4 A;  2EQU A;  3PVL A;  1YJN Q;  4N4I A;  2C0T A;  4N4G A;  2GFA A;  3BDL A;  3J7A F;  5HKC A;  2F5T X;  4ZGD B;  3EG1 A;  4ZTF A;  5A2Q E;  3ZL7 C;  2VC8 A;  3EGX A;  1IGU A;  2MPX C;  3V7C A;  5GAO q;  2RK1 A;  1PKT A;  2GFU A;  4OMP A;  2K5I A;  1U5S A;  3DB4 A;  1HXD A;  4M7D C;  2V26 A;  4RTT A;  2PQW A;  2PZ1 A;  3PGG A;  5KCH A;  3EHQ A;  3CC2 T;  3CCQ A;  2CH4 W;  2HQH A;  1QCN A;  1S72 T;  4BD3 A;  1YI2 T;  2E1H A;  4M78 F;  6AT1 B;  3CEY A;  3CCU A;  1KSW A;  2CT4 A;  3H8Z A;  2HDA A;  1RLP C;  2B86 A;  1WPY A;  3HFN A;  4PL6 A;  5GAN 2;  1D1A A;  3X24 B;  3JCM P;  4N4H A;  1OI1 A;  1BBZ A;  4B9W A;  1WHL A;  2CP7 A;  5A0D A;  2CP6 A;  1M3B A;  2E5Q A;  2E6Z A;  3LX7 A;  4M7A C;  3TVT A;  3Q1J A;  2HQE A;  5GAO r;  1YIT T;  1NE8 A;  2EW3 A;  1PM3 A;  3RBB B;  1VQ5 Q;  2J06 A;  3CC2 A;  2RQW A;  2AK5 A;  4RKU E;  1VQP A;  3V7S A;  3TSW A;  3R6O A;  2RH2 A;  2ROL A;  1S72 A;  3MKD A;  3EFS A;  2CGH A;  1D0X A;  2MWO A;  3VS4 A;  3SD4 A;  2Y90 A;  1FWZ A;  2F69 A;  2E10 A;  5GAO m;  2L89 A;  1M1K U;  3EHR A;  2NWM A;  4PJO C;  1M8V A;  3CMA Q;  1UTI A;  3HFO A;  1QP3 A;  2M0O A;  3LH0 A;  2X4J A;  3A5Z B;  3MHX A;  2HBW A;  2DXT A;  2QA4 Q;  4KBM B;  4M7D G;  3OS0 A;  2XIC A;  2RNA A;  1G3Y A;  3A98 A;  4XTY A;  3GOX A;  1CKB A;  1YIT A;  3GIB A;  3MEU A;  5GAN h;  4EPC A;  3J80 E;  1H8K A;  4M78 G;  1MV0 B;  2OTJ T;  2BTT A;  2EQK A;  2YRD A;  3V8L A;  3G4S Q;  5I2S A;  3CBO A;  1VUB A;  1D0Z A;  5J39 A;  2LT1 A;  3OS5 A;  4OB1 B;  3M53 A;  2K9G A;  3ME9 A;  2FEI A;  1D3B A;  1Z9Q A;  3BY7 A;  4M7A G;  4M75 F;  2KI7 A;  4M75 C;  4C5H A;  5GAN 6;  2AHJ B;  4CC7 A;  4C92 A;  2FVU A;  2E41 A;  4A4H A;  1XOV A;  4M7A D;  3QYH B;  1W70 A;  2ATC B;  4PFZ A;  4LDY A;  2OTJ A;  2KXC A;  3OYF A;  4PJO G;  5CKB A;  1HYO A;  1UFF A;  1NYG A;  4ZNX A;  1Q7Y R;  2W10 A;  2MWP A;  2FZK B;  3WVE B;  1G2B A;  1K8A R;  4XTU A;  2NLU A;  5I11 A;  1C0M A;  4A4G A;  3EG9 A;  3LLR A;  2HL5 C;  1I0C A;  1ABO A;  4J9B A;  2ENM A;  3M55 A;  4D6W A;  2QG9 B;  1GBR A;  2CT3 A;  1SKU B;  3CD6 T;  2XMF A;  3CCJ T;  2LZ6 B;  4Y91 A;  7AT1 B;  4KGZ B;  3CXC A;  1T3L A;  2PVG B;  2YUO A;  4HT8 A;  4RG8 A;  3I55 T;  4M77 F;  2JTF A;  2EWN A;  5IXF A;  1M9S A;  2RHZ A;  4AT1 B;  4DBQ A;  2QQA A;  1WX6 A;  2DZC A;  5HCK A;  3CC4 T;  2RJE A;  4BE1 A;  1N9R A;  1TOV A;  2ZPH B;  2FRW A;  1WHH A;  3FJP A;  4C0Z A;  1IGQ A;  1VOM A;  3DB3 A;  5AYF A;  4BE2 A;  1UGQ B;  2ESW A;  1M27 C;  4M75 G;  2JS0 A;  4C8Q E;  2HEQ A;  2V1R A;  2QQ9 A;  3JB9 H;  4OMF B;  4FW2 A;  4ATO A;  3OSS C;  4E6R A;  3CD6 A;  2JVV A;  4LDV A;  1SF9 A;  3CCJ A;  2RB6 A;  2K6D A;  5IN1 A;  1X43 A;  2RI2 A;  4CC3 A;  2DTI A;  3I55 A;  3QBY A;  2X51 A;  1VQK A;  4OMM A;  2QEX A;  3OQ5 A;  3PMI A;  5KYX B;  2XD0 A;  2LMJ A;  2DAQ A;  4PK4 A;  3VV0 A;  5GMK e;  1AWJ A;  3LYI A;  3CC4 A;  5CQX A;  2EYZ A;  2GQV A;  4FU6 A;  1UB4 A;  2JMC A;  1WA7 A;  4K11 A;  2PUK B;  2IVW A;  3JCM g;  2L8D A;  2RHI A;  4F7U B;  2B8A A;  3RR6 A;  5LJ3 g;  1K76 A;  2F2X A;  4HT9 A;  1YHQ Q;  1U1T A;  4BI8 B;  3ASK A;  2C0I A;  4YTL A;  3A8M B;  1OYX A;  2DL5 A;  4PLI A;  1O9S A;  2C06 A;  2CKK A;  1Y7X A;  3HHT B;  1MND A;  1YJN A;  1WLP B;  2HQX A;  5GMK j;  5KE3 A;  4C0D C;  4D8D A;  3CPF A;  4A54 A;  1VQ7 Q;  1PG5 B;  1Y96 B;  4Z89 A;  3E9F A;  5D6X A;  1BB9 A;  2O4X A;  1UJ0 A;  4PJL A;  1KQS P;  5CIU A;  4ORZ A;  5LJ3 f;  3PIP A;  1QCF A;  5D6W A;  5LJ5 g;  3OW2 A;  2V8K A;  1VQ5 T;  4EMK A;  3JB9 I;  3C94 A;  3M0S A;  4II1 A;  1BI0 A;  3E1S A;  5LJ3 d;  3O8V A;  1D09 B;  3EFR A;  4L6V 5;  3CPW P;  3OA6 A;  4QKU A;  1AWW A;  4FW1 A;  1GCQ A;  2ZPB B;  1AOJ A;  3CMA T;  2KEA A;  4KUL A;  4EDU A;  3EGD B;  4J9G A;  2QK0 A;  3MET A;  2DYI A;  2KGT A;  3CME Q;  2CSI A;  1BIB A;  4J6Y A;  2F5K A;  2K5F A;  2COW A;  1M2V A;  2RQR A;  2ED0 A;  2K2M A;  3OYH A;  3D7S B;  1MUZ A;  1ARK A;  3LW5 E;  4C92 E;  1W2B A;  4QQD A;  1VQ5 A;  2IG0 A;  4C92 D;  4LE9 A;  3F70 A;  1PSE A;  2JXB A;  2MMP A;  1EIF A;  1ZUY A;  1I8F A;  4IUP A;  5CK9 A;  2CUB A;  1RAB B;  2DEQ A;  3CMA A;  1VQM Q;  2DBM A;  2QQS A;  2NUT B;  1Q95 G;  2DBK A;  3FB9 A;  3EG3 A;  1UEB A;  4XTX A;  2A0F B;  2HAX A;  3C4S A;  2EVR A;  1NPP A;  2XDD A;  3OYC A;  2JOY A;  2EBP A;  3GLX A;  4DBF A;  3QHS A;  2QA4 A;  1B34 A;  1KC8 U;  2JN0 A;  3FDR A;  1RL2 A;  3P8H A;  3MP6 A;  5FRN A;  3R6N A;  3X26 B;  4FYX B;  1JRI A;  4OB3 B;  1QVG A;  2XDB A;  1Y57 A;  2CDT A;  2HL3 A;  4J7F A;  3BE3 A;  1RAF B;  1VYT A;  4M7D B;  2VB6 A;  2ZGW A;  2ZPG B;  4JS4 A;  4AFQ C;  3G4S A;  2RJD A;  2MF2 A;  1K0S A;  4KGX B;  1X01 A;  1KC8 C;  2PTK A;  1G3T A;  4KT0 E;  1J3T A;  1I81 A;  1K1Z A;  1QMC A;  1TUC A;  4M78 B;  5HK3 A;  3OYM A;  2GQI A;  4FSS A;  4MZM A;  4EMK C;  2MI6 A;  1K9M U;  2XU8 A;  4J8O A;  5GAN g;  1DJ7 B;  1OX8 A;  1RI9 A;  2KSS A;  3MO8 A;  3SHW A;  3H41 A;  1GCQ C;  4NL2 A;  2K7A A;  3CBP A;  1SRM A;  4QW2 A;  4IIM A;  4BI3 A;  1OPL A;  2KT1 A;  1EX4 A;  2RPN A;  2O9V A;  1UDL A;  3QSU A;  4CRI A;  3A8H B;  1K9M C;  4DEX A;  3PVQ A;  4M4Z A;  4D8K A;  5FU7 C;  4PJO B;  4A63 B;  3JV3 A;  1V76 A;  1IHV A;  2X9H A;  2CZ6 B;  3EH2 A;  2CP5 A;  5GAM e;  2DL7 A;  2E65 A;  3CCR T;  2FYK A;  2RA2 A;  1ZLM A;  3I5R A;  4E7J A;  4ANJ A;  5GMK m;  2BE7 D;  3PMT A;  2V8I A;  1MNE A;  2DEU A;  1SPK A;  1KQ1 A;  2KMT A;  1M1K R;  3WVD B;  3CCL Q;  1E6H A;  1D0Y A;  4IUR A;  1VIE A;  2M0Y A;  1OU8 A;  1KG1 A;  4OMN A;  3M4Y A;  4GBQ A;  3SDZ A;  2LCC A;  1WHK A;  1OOT A;  2K3X A;  3CC7 T;  2VXE A;  1HJD A;  2JMA A;  1K0X A;  4XU0 A;  1YHQ T;  3I35 A;  2DL4 A;  5LJ3 h;  1KQS S;  1AWO A;  1H92 A;  5A0G A;  4BY6 B;  1KJW A;  4J5Y A;  2JT4 A;  5GAM j;  1BU1 A;  1LCK A;  5FU6 B;  1YCS B;  4OGC A;  4M75 B;  3FIF A;  1X75 C;  1K73 C;  1Y0M A;  1WJQ A;  1R8O B;  4F14 A;  2I2L A;  3NTI A;  4LUD A;  3CXC P;  1TH7 A;  3CPW S;  1VQ7 T;  5IT9 E;  3OY9 A;  3A1P A;  2DX1 A;  1QKX A;  2YUQ A;  3UT1 A;  1QW1 A;  3MP8 A;  1NYF A;  3JCM b;  5CCA A;  3QPH A;  5CKE A;  3EFO A;  3I56 Q;  2E12 A;  3TCJ A;  4MZP A;  2E3H A;  2CZ7 B;  1IO6 A;  1YHQ A;  1X6O A;  1PSF A;  2GGR A;  1ACM B;  4JRI A;  1FX7 A;  3SWN A;  4F7U E;  3H0I A;  8ATC B;  4F17 A;  2XG8 D;  2E3I A;  1I4K 1;  1YN8 A;  3JB9 D;  1V1C A;  2J7I A;  4J9F A;  3S3M A;  4J7I A;  4OMO A;  4XTZ A;  3S3N A;  2KRM A;  4FCY A;  1YIJ Q;  1RAI B;  2DNU A;  1VQ7 A;  1YJ9 Q;  2LQK A;  2V8J A;  1BK2 A;  3C0C A;  2RQV A;  4M77 B;  4J83 A;  4C8Q A;  4M7D F;  3C95 A;  3M5A A;  2NUZ A;  1JJ2 A;  1B7T A;  3QXE B;  1VQP T;  3V7R A;  4JRP A;  1Q81 C;  2CZ1 B;  3M0U A;  1WQ7 A;  3EG0 A;  2DRM A;  2CS7 A;  2L2P A;  2FG0 A;  5KCO A;  3OYG A;  4BI4 A;  1VQM T;  4HVV A;  4C5I A;  1FXX A;  1UGP B;  3U23 A;  2YWW A;  2PNI A;  2VV5 A;  2RJF A;  4M7A F;  3JCM J;  1ZX6 A;  3CME A;  1OZ3 A;  1KHC A;  2EJG A;  2XHC A;  2D0N A;  4PKC C;  1M90 C;  1TXQ A;  1WIE A;  1WHM A;  1SSH A;  3G1J A;  1IHW A;  1WQW A;  2ZAE A;  5J26 A;  2DRK A;  1T3S A;  3M0P A;  4ELZ C;  2CSQ A;  2SEM A;  2X35 A;  1ZSG A;  2LNH B;  3GNG A;  4PJO F;  1GBQ A;  3OW2 P;  1BIA A;  2DK3 A;  4DOV A;  3LWI A;  3N5B B;  1VQO Q;  4E2F B;  1VQM A;  3E19 A;  2LDM A;  1VQL Q;  4OF1 A;  2KYB A;  1N9S A;  3G7Z A;  3RKY A;  1XJW B;  2KK4 A;  1LVK A;  2F1L A;  3ZEH A;  3X20 B;  3V8K A;  2DIG A;  1KD1 C;  3QWX X;  4EMG A;  1GFC A;  2PU9 B;  1XQH A;  2KXD A;  4J9D A;  1YJW Q;  3JCM c;  4RTV A;  1X27 A;  4XTW A;  3SWN C;  3VKI A;  3CCS Q;  2P0Q A;  3J81 E;  2JNG A;  4B9X A;  2MIO A;  4DOW A;  2VXF A;  2FZC B;  2RI5 A;  2JM9 A;  2GCX A;  4JPB W;  1W2B P;  2MCN A;  2RMO A;  3VJP A;  4QT7 A;  2HD0 A;  1VQ8 Q;  3RMS A;  3UA6 A;  3I5S A;  3PE0 A;  4C8Q C;  4PFP A;  3VS7 A;  1TS9 A;  2HNI A;  1JBM A;  2OAU A;  1UJY A;  2C0O A;  1TTH B;  2DET A;  5CKF A;  4JS5 A;  2ZCF B;  3CCV Q;  1UGS B;  4IUU A;  3UWN A;  1NG2 A;  1ZHI A;  1JQQ A;  3TU4 K;  3OMG A;  4RTU A;  2GTJ A;  2D0Q B;  4R55 A;  4J6W A;  4C5E A;  4CC4 B;  3S3O A;  1VQ4 Q;  5GAM g;  1QVG P;  1YWO A;  1AEY A;  3CCL T;  4A4K A;  1X2Q A;  3URG A;  2CUD A;  3CCE Q;  2YHT A;  3KUF A;  4E7I A;  1TU0 B;  2KE9 A;  2FPF A;  3RIR A;  3CXC S;  1QVF A;  1W6X A;  2VVK A;  3QDR B;  3HP9 A;  1EZZ B;  2L3S A;  5GMK h;  2GBQ A;  3BFM A;  1RUW A;  4ZGJ B;  2DF6 A;  2LNV A;  2HKN A;  3SFM A;  4FM4 B;  1IRX A;  1EFN A;  1IB8 A;  2DVJ A;  2Y4Y A;  3EH1 A;  4KGV B;  3VU3 C;  1VQK T;  4RTW A;  2QEX T;  4J6X A;  3AHU A;  1YWP A;  1MHN A;  3GNF B;  2FZG B;  1MMG A;  5GAM f;  1HSQ A;  4BAC A;  1Q82 U;  3QWY A;  1M1F A;  3CCL A;  4C8Q G;  1OU9 A;  4JJC A;  1BI1 A;  4XK8 E;  4F04 B;  3OYA A;  3FC3 A;  2EQJ A;  5GAM d;  4B6M A;  2A28 A;  4AFZ C;  3I56 T;  1GRI A;  1ZA2 B;  4C8Q D;  3RER A;  1KC8 R;  4NOY A;  3INZ A;  2EGE A;  3BW1 A;  1Q82 C;  5GAN 4;  2QTX A;  5J3B A;  3JCM X;  2NUP A;  1PHT A;  4LD6 A;  3M0R A;  4FSX A;  1BCO A;  2DXC A;  1YJN T;  4BDY A;  2K3Y A;  3GPL A;  1QWF A;  1IZ6 A;  2LVM A;  4FT4 A;  2DD5 A;  1RAE B;  4LUE A;  1YIJ T;  1YJ9 T;  2FHD A;  4EIK A;  2CYZ B;  4Z88 A;  3L2W A;  2DLP A;  5FW9 A;  4FYY B;  2FPE A;  1AT1 B;  4C92 F;  4CI0 C;  4C92 C;  2D1X A;  1N8R U;  3VYG A;  1G8X A;  3I56 A;  5CVI A;  4PJM A;  1BI2 A;  1AHJ B;  2KRN A;  5GAO l;  1WJS A;  2EQM A;  3UPU A;  2EKH A;  3RKX A;  1K9M R;  1OUL A;  2EFI A;  1WFW A;  2YRV A;  2P0P A;  3CCM Q;  2ABL A;  2A08 A;  1FYN A;  4JJN K;  1ZA1 B; 
#chains in the Genus database with same CATH homology
 2PTK A;  2J6K A;  2YSQ A;  2K3B A;  1J3T A;  1K1Z A;  5L23 A;  4RTX A;  3NMZ C;  1WI7 A;  2DYB A;  1TUC A;  2X3X D;  2GQI A;  2M51 A;  1SRL A;  1B3Q A;  4HCK A;  4FSS A;  3VS1 A;  2JW4 A;  2DE0 X;  1N5Z A;  3PVL A;  1K4U S;  1RI9 A;  2C0T A;  3SHW A;  2RQU A;  3H41 A;  3EG1 A;  1GCQ C;  2O2O A;  2F2W A;  3ZL7 C;  5IH2 A;  1CKA A;  1S1N A;  2K7A A;  1UEC A;  1AD5 A;  1SRM A;  1PKT A;  4OMP A;  4IIM A;  1QWE A;  1U5S A;  3M0T A;  1OPL A;  2KT1 A;  2RPN A;  4RTT A;  2O9V A;  1UDL A;  2PZ1 A;  2AZV A;  2DIL A;  3EHQ A;  4DEX A;  3PVQ A;  2CH4 W;  1WXB A;  4M4Z A;  4D8K A;  4J9I A;  4A63 B;  1KSW A;  2CT4 A;  2HDA A;  1RLP C;  3JV3 A;  2B86 A;  1M8M A;  2J6O A;  1E6G A;  2DL7 A;  2E5K A;  5I22 A;  1ZLM A;  2EGC A;  1VYV A;  3I5R A;  3KFV A;  1BBZ A;  3VS3 A;  1M3B A;  1WDX A;  1M3C A;  1SPK A;  1ZUK A;  1NLO C;  3TVT A;  2EYX A;  3NHN A;  5IHN A;  1E6H A;  2M0Y A;  2EW3 A;  4OMN A;  3RBB B;  1TUD A;  2J06 A;  2H8H A;  4GBQ A;  2RQW A;  1OOT A;  2AK5 A;  4IIO A;  3TSW A;  1HJD A;  1WYX A;  2ROL A;  1WXT A;  4CC2 A;  2JMA A;  3VS4 A;  1K0X A;  3I35 A;  2DL4 A;  3EHR A;  2JM8 A;  1HD3 A;  2I0N A;  2NWM A;  2J6F A;  1AWO A;  1H92 A;  1UTI A;  1KJW A;  2JT4 A;  3UAT A;  1BU1 A;  1LCK A;  2YDL A;  1MV3 A;  2YUP A;  1YCS B;  3SEM A;  2VWF A;  2FO0 A;  3THK A;  1JU5 C;  3LH5 A;  4RTZ A;  1Y0M A;  1JXO A;  2HBW A;  1KIK A;  4F14 A;  4LUD A;  2RNA A;  1UGV A;  3A98 A;  1CKB A;  2DX1 A;  1QKX A;  2YUQ A;  1ZBJ A;  1NYF A;  2YT6 A;  2BZY A;  4J9C A;  1PNJ A;  2KR3 A;  2V1Q A;  4RTY A;  1PKS A;  3VS0 A;  1H8K A;  3CQT A;  1MV0 B;  3NGP A;  2BTT A;  1IO6 A;  1A0N B;  1QLY A;  2DJQ A;  1NLP C;  4AFS C;  2GGR A;  2LQN A;  3H0I A;  1PRM C;  4F17 A;  2RQT A;  1YN8 A;  1V1C A;  2K9G A;  2FEI A;  2J7I A;  5IXB A;  3NPF A;  4J9F A;  1Z9Q A;  2DL8 A;  1OEB A;  1X6G A;  4OMO A;  1GCP A;  1NM7 A;  4KRT A;  2KRM A;  1JXM A;  2DNU A;  4CC7 A;  5GJW B;  1XOV A;  1BK2 A;  2DM1 A;  3C0C A;  2RQV A;  4HVW A;  4AG2 C;  1W70 A;  2D8J A;  2ED1 A;  2KXC A;  2A37 A;  1NEB A;  1TG0 A;  2NUZ A;  4JZ3 A;  1UFF A;  1NYG A;  4ZNX A;  2W10 A;  1X6B A;  3M0U A;  2OAW A;  1G2B A;  3EG0 A;  2DRM A;  1AZG B;  2KRS A;  2L2P A;  2FG0 A;  5I11 A;  2L0A A;  2JS2 A;  2GTO A;  1I0C A;  1ABO A;  5GJV B;  3VRY A;  4J9B A;  2ENM A;  4HVV A;  1GBR A;  3U23 A;  4X1V A;  2CT3 A;  2PNI A;  2XMF A;  2LZ6 B;  3H0F A;  2F2V A;  1ZX6 A;  1T3L A;  2YUO A;  1SEM A;  2D0N A;  2G6F X;  1WIE A;  1SSH A;  1X69 A;  1K9A A;  1WXU A;  5IXF A;  1ABQ A;  3VS6 A;  1RLQ C;  1WX6 A;  5HCK A;  2DRK A;  1T3S A;  3M0P A;  2LCS A;  2FRW A;  2DMO A;  1YNZ A;  2CSQ A;  1PRL C;  2J05 A;  2SEM A;  4JJD A;  2AKK A;  4J9E A;  1ZSG A;  2LNH B;  1GBQ A;  2ESW A;  1M27 C;  3IQL A;  2JS0 A;  4AG1 C;  1U3O A;  2HEQ A;  2V1R A;  3GBQ A;  2EPD A;  4LNP A;  2KYB A;  4E6R A;  3M0Q A;  2K6D A;  1X43 A;  3QWX X;  2DL3 A;  2JTE A;  4CC3 A;  1GFC A;  2KXD A;  4J9D A;  1X2K A;  1GL5 A;  4OMM A;  4RTV A;  1X27 A;  2SRC A;  2LX7 A;  2LMJ A;  4J9H A;  4WCI A;  1QKW A;  3RNJ A;  2MIO A;  1AWJ A;  5IHI A;  4HXJ A;  1UUE A;  2GNC A;  2O9S A;  1PWT A;  1ZUU A;  2EYZ A;  4ESR A;  2JM9 A;  2MOX A;  2DA9 A;  2JMC A;  4JPB W;  1WA7 A;  4K11 A;  2YUN A;  2MCN A;  2RMO A;  2RN8 A;  4QT7 A;  1U06 A;  4RUG A;  1K76 A;  2P4R A;  2F2X A;  4JJB A;  3UA6 A;  2BZX A;  3I5S A;  3PE0 A;  3VS5 A;  2LJ1 A;  2C0I A;  4JZ4 A;  2AKL A;  3VS7 A;  2AZS A;  3UA7 A;  1UJY A;  2C0O A;  2DL5 A;  1YP5 A;  4R0K A;  3O5Z A;  2W0Z A;  2A36 A;  1NG2 A;  1I1J A;  1WLP B;  2LJ3 A;  3ULR B;  2O88 A;  1JQQ A;  4Y92 A;  3I9Q A;  2CRE A;  4GLM A;  4D8D A;  1KFZ A;  1T0H A;  2EYW A;  4Z89 A;  4RTU A;  1T0J A;  1BB9 A;  1FMK A;  1OV3 A;  1UJ0 A;  2GTJ A;  1H3H A;  4CC4 B;  1AZE A;  1W1F A;  2D8H A;  4Z8A A;  2QDL A;  4ORZ A;  4OMQ A;  1YWO A;  2X3W D;  2KBT A;  1AEY A;  3REB B;  4AFU C;  1X2Q A;  3TSZ A;  2CUD A;  1SHF A;  1QCF A;  1AVZ C;  2KE9 A;  2FPF A;  1UHC A;  3M0S A;  1W6X A;  2VVK A;  2L3S A;  1AWW A;  2GBQ A;  1RUW A;  2OI3 A;  1GCQ A;  2DF6 A;  5FWC A;  4HVU A;  1AOJ A;  4LN2 A;  2KEA A;  1EFN A;  2DVJ A;  2FPD A;  4J9G A;  4RTW A;  1NEG A;  2ECZ A;  1UHF A;  2KGT A;  3FJ5 A;  1YWP A;  2CSI A;  1HSQ A;  2L3P A;  5IHK A;  2RQR A;  2ED0 A;  2K2M A;  3QWY A;  3EGU A;  2KRO A;  3EG2 A;  1E7O A;  2EGA A;  1MUZ A;  1ARK A;  2HCK A;  1VA7 A;  1CSK A;  2LQW A;  3H0H A;  4JJC A;  3VRZ A;  2RF0 A;  3VS2 A;  2K79 A;  2IIM A;  3UF4 A;  4LE9 A;  1I07 A;  2A28 A;  2JXB A;  4AFZ C;  2LP5 A;  1GRI A;  1ZUY A;  1B07 A;  5FWB A;  2KYM A;  2CUB A;  4OML A;  2VKN A;  3REA B;  1UE9 A;  4DEY A;  2EGE A;  2DBM A;  2OJ2 A;  2DBK A;  1PHT A;  3EG3 A;  3M0R A;  1JO8 A;  1Z9Z A;  2EVR A;  1JEG A;  2ROT A;  2EBP A;  1AWX A;  1QWF A;  2EYY A;  4LUE A;  2CH4 A;  4EIK A;  5EC7 A;  5ECA A;  4Z88 A;  3R6N A;  2DLP A;  4F16 A;  1M3A A;  5FW9 A;  2FPE A;  1Y57 A;  2CDT A;  2D1X A;  2KT8 A;  2LJ0 A;  1GFD A;  1SHG A;  2KRN A;  1VYU A;  1VYT A;  2EKH A;  1G83 A;  2EQI A;  2L3Q A;  4AFQ C;  2BZ8 A;  1WFW A;  2KNB B;  1UG1 A;  1OPK A;  2O31 A;  2ABL A;  1K0S A;  2A08 A;  2FRY A;  2HSP A;  1FYN A;  1M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...