1GFDA

Solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
59
structure length
59
Chain Sequence
b'GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Solution structure and ligand-binding site of the carboxy-terminal SH3 domain of GRB2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Adaptor protein containing sh2 and sh3
total genus 9
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 1994-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1gfdA00
1WYXA 2LJ0A 4OMPA 3EHRA 4Z89A 1MUZA 1WXBA 4RUGA 2KNBB 2CREA 2OJ2A 1OPLA 1M3AA 4EIKA 1S1NA 4OMOA 2RQUA 1AWOA 4F16A 1PKSA 5I11A 2DNUA 1K76A 5FW9A 4AFUC 1NG2A 4OMLA 1LCKA 5IH2A 1QKWA 2F2VA 1UHCA 2FPFA 2PZ1A 4RTUA 1KFZA 2LQWA 1WFWA 1X2KA 4RTZA 2O9SA 2HEQA 2DX1A 1UGVA 3KFVA 2KXDA 1I0CA 1RI9A 3O5ZA 2ABLA 3I5SA 1JXOA 2J6FA 2LCSA 3EG3A 1K0SA 4R0KA 2KR3A 1ABOA 4HCKA 4RTTA 1QWFA 1B3QA 1UJYA 2L3PA 2KE9A 1QWEA 1K0XA 1KSWA 1YWPA 2KRSA 2GGRA 2LX7A 2YUQA 4CC4B 1VA7A 5FWCA 1PRLC 4JJBA 1M30A 4HXJA 4RTVA 1AWXA 4J9EA 1W6XA 3PVLA 5L23A 1M27C 2EW3A 1FMKA 2DM1A 2BZ8A 5ECAA 1G83A 2B86A 1JQQA 1X2QA 1YNZA 3EG0A 1RLPC 1U5SA 1SPKA 2CH4W 3EGUA 1Z9QA 1UFFA 5GJWB 2D1XA 1MV0B 2EBPA 2W0ZA 2C0TA 1UTIA 4LUEA 2ROTA 3C0CA 2EQIA 4OMMA 4HVVA 5IXBA 2MIOA 2GTJA 5EC7A 2LJ1A 2C0OA 4J9CA 1ZBJA 4IIMA 4LNPA 1ZUKA 4JJCA 4K11A 2LQNA 2V1RA 1UUEA 2FPDA 2AKLA 1I07A 2GNCA 1ZSGA 1OOTA 4RTWA 1ZX6A 2A28A 2QDLA 1KIKA 3QWXX 2FRWA 3NMZC 1T0JA 1WX6A 3TSWA 1E6HA 3REBB 2YDLA 3PE0A 1TUDA 2GBQA 4JPBW 4QT7A 1SEMA 5IHIA 3ULRB 3JV3A 4CC3A 2RQVA 3TSZA 1VYVA 1V1CA 2EYWA 1GFDA 2M0YA 5HCKA 2KRMA 1AEYA 3UF4A 3TVTA 1G2BA 2YT6A 1I1JA 3H41A 1AOJA 3RBBB 1X6BA 2MOXA 1SHFA 1GCPA 3UATA 1X69A 3H0HA 2CUDA 2D8HA 4JZ3A 2RF0A 2JXBA 1A0NB 4J9BA 1M3BA 3RNJA 1X43A 1YWOA 2EGAA 2DL3A 2KT8A 1PRMC 2K7AA 2DL7A 3QWYA 1TG0A 2CSQA 2E5KA 2YUOA 2K2MA 3M0TA 2J6KA 2HCKA 2LMJA 1T3SA 2H8HA 4X1VA 2KRNA 2I0NA 1QKXA 5GJVB 4Z88A 2ESWA 2O9VA 4Y92A 1PWTA 1BB9A 1H3HA 1WLPB 2DMOA 3ZL7C 2DA9A 4CC2A 2JTEA 2CSIA 2RPNA 2JMCA 1ABQA 4LN2A 2JS0A 1AWJA 2O88A 2VWFA 3PVQA 4M4ZA 1OV3A 1YCSB 4LE9A 1GBQA 2JM9A 2AZVA 2YSQA 4Z8AA 2CT3A 3CQTA 2X3WD 2LZ6B 2EYZA 2J05A 2JT4A 2L3SA 2K6DA 4AFZC 1WIEA 3I5RA 1Y0MA 2BZYA 1ARKA 4AFSC 3A98A 5IHKA 2EGEA 2XMFA 3UA7A 2HDAA 4LUDA 2MCNA 3THKA 4KRTA 2GQIA 1JO8A 1SHGA 2ED1A 3R6NA 2DE0X 2YUPA 1NYGA 2ED0A 3EG1A 2D8JA 2BZXA 2KROA 2RQWA 1UECA 2RMOA 2FRYA 2HSPA 2C0IA 4OMNA 3VS6A 2JS2A 1GCQA 4IIOA 2YUNA 2JW4A 4WCIA 1AVZC 2RNAA 2PTKA 2KYBA 3GBQA 3H0FA 2CT4A 1UG1A 1ZLMA 3IQLA 2L2PA 2O2OA 2LJ3A 2RN8A 2EPDA 3SHWA 4DEYA 2EKHA 2AK5A 1GBRA 3VS3A 4FSSA 1HSQA 1SRLA 5I22A 2JMAA 1PNJA 2F2XA 4HVUA 3M0SA 2IIMA 3NHNA 4ESRA 2KYMA 1QLYA 3SEMA 3VS5A 1UDLA 1SSHA 3VS7A 4HVWA 5IXFA 3VS2A 2ECZA 2JM8A 3M0QA 3I35A 2RQRA 2KGTA 1JXMA 3I9QA 2DBKA 2DILA 4ORZA 3U23A 1XOVA 1JU5C 2KT1A 2A36A 1TUCA 2K79A 2L0AA 2DL8A 2LNHB 4AG2C 2DRMA 2PNIA 3M0UA 1WXTA 4A63B 1Y57A 1CSKA 3LH5A 1NM7A 2VKNA 2CDTA 4RTYA 2ROLA 2OI3A 2G6FX 3VRZA 2DL5A 2DLPA 2K9GA 1BK2A 2D0NA 4JZ4A 2DRKA 1OEBA 4GLMA 1WA7A 3EHQA 1HJDA 1H92A 3FJ5A 1GFCA 1PHTA 3NGPA 1UE9A 2DF6A 2FPEA 1H8KA 1N5ZA 2CH4A 1MV3A 4RTXA 1AZEA 1T0HA 4J9GA 1OPKA 1AD5A 2DVJA 2LP5A 3M0PA 1KJWA 1UJ0A 2X3XD 1NLOC 1GRIA 1WXUA 2M51A 4J9FA 2GTOA 1E6GA 2BTTA 2AKKA 4GBQA 4ZNXA 1GL5A 2NWMA 1CKBA 1M8MA 3VS1A 2KBTA 2J06A 1HD3A 2FEIA 1SRMA 3REAB 4D8DA 2KXCA 1EFNA 2FG0A 4J9HA 1RLQC 1E7OA 3VS0A 1NEBA 1K9AA 2HBWA 1T3LA 2P4RA 3NPFA 2OAWA 2DL4A 3VS4A 2DJQA 1YP5A 2DYBA 3VRYA 1NLPC 4J9IA 2A37A 2L3QA 4OMQA 1U06A 1FYNA 3EG2A 1IO6A 1NYFA 4E6RA 4F17A 1B07A 2NUZA 1BU1A 2O31A 1M3CA 2SRCA 1JEGA 1U3OA 1X6GA 2DBMA 2J6OA 2F2WA 3H0IA 4CC7A 1YN8A 4F14A 2EVRA 3M0RA 1RUWA 1J3TA 1VYUA 1AWWA 2KEAA 1QCFA 1PKTA 2CUBA 1BBZA 1X27A 1W1FA 1GCQC 2EGCA 1K1ZA 4DEXA 1CKAA 1VYTA 1W70A 2W10A 2J7IA 4AFQC 2FO0A 5IHNA 3UA6A 2AZSA 1K4US 2V1QA 1WI7A 1ZUYA 2ENMA 1WDXA 4AG1C 1Z9ZA 4JJDA 2EYXA 1ZUUA 1UHFA 2SEMA 2K3BA 4D8KA 5FWBA 2RQTA 1NEGA 4J9DA 2A08A 2VVKA 2EYYA 1AZGB
chains in the Genus database with same CATH superfamily
2LJ0A 4M7DA 2HZYA 3L2UA 5LJ5j 1D0YA 2VXFA 1OPLA 1S1NA 2DXCA 3X26B 4OMOA 1PSEA 2RQUA 4XU3A 3V8KA 1K76A 5IH2A 1YJ9T 4BDZA 2F2VA 5KYNA 2PZ1A 1MHNA 2K4YA 2LQWA 2HAXA 3EG9A 4RTZA 3L2WA 2HEQA 2HSEB 2KXDA 1I0CA 5GMKi 2J6FA 3O8VA 2LCSA 3EG3A 4XU2A 1K0SA 2EAYA 1RAEB 1K8AC 5FROA 1QWFA 1ZSZB 1K0XA 3AHUA 1DJ7B 2OTJA 2RJDA 5KE3A 4WTOB 2IVWA 3CCVQ 2DZCA 3G7ZA 1M30A 5GAOn 4EMKB 3JB9G 1W6XA 3PVLA 3TQ7P 3MP8A 2RK1A 1M27C 3CPWP 5ECAA 3CCLQ 1YNZA 1OZ2A 3EG0A 1MMDA 2CH4W 4BB7A 3CCVT 1Z9QA 5LJ3j 2V26A 2VASA 3OA6A 2C0TA 1UTIA 4PL6A 4PJOF 1QVPA 2LNVA 4LDWA 3CCLT 4PLLA 2JOYA 5GMKl 5AT1B 2GF7A 4NL2A 1Q7YR 3M55A 4QVDA 3H6ZA 1VQ9Q 2AKLA 1I07A 1ZSGA 2NLUA 1OOTA 4RTWA 2DZ9A 4FT4A 5GAMf 3OS0A 2K5IA 1WX6A 2RHZA 2L8DA 2V8JA 1WHJA 4M77C 4C8QF 5DY9A 2HBPA 1VQ9T 5A0LA 5GAOm 3CPWS 5D6WA 2RHYA 2FZCB 4HCZA 2RQVA 4OGEA 2F1LA 5GAN8 1YBYA 4DBQA 4C8QE 1QMCA 1OYXA 3MEWA 2HD0A 2EYWA 3G4SQ 2KRMA 1AEYA 4PK4A 2RHIA 3T9NA 1BKBA 3EGDA 1G2BA 4EDUA 2DYIA 1AOJA 5J26A 1TH7A 2L3RA 1X6BA 2MOXA 1SHFA 4MZPA 5A0DA 2C06A 3CCUA 1VIFA 3CCMA 1VQMQ 4VUBA 2PU9B 4MMKA 1A0NB 1M3BA 2DTOA 2DL3A 2KSSA 4J6XA 3RKWA 3G4ST 3JSCA 4PJOC 3QWYA 1Y07A 1K73C 2YUOA 4FW2A 3PNWC 2EFIA 2HCKA 2LMJA 1VQMT 4BY6C 4KUIA 4IKFA 1D09B 4ME7A 3JCMf 4B9WA 2G3RA 4CC2A 1N9SA 1WZOA 2JTEA 2YLBA 3JB9D 2JS0A 2VWFA 2ZPHB 4Z8AA 2H3EB 3CQTA 3MP6A 2EYZA 4PJOG 1YHQT 3FC3A 2K6DA 4AFZC 4RCCA 2KY9A 1ARKA 2K57A 3A98A 2XMFA 3A1PA 1IGUA 4QQDA 2MCNA 1JRIA 3F70A 3HHTB 2BKDN 2YRCA 2RO0A 1NYGA 3CCSA 3RESA 3CMEQ 4PJNA 2BZXA 2RQWA 2RMOA 1P92A 2FRYA 2C0IA 3SWNA 3VS6A 4C8QG 3OYCA 4WCIA 3CEYA 4BE1A 1O75A 2KYBA 2V8KA 3GBQA 4N0AA 1W2BP 4XTUA 4FCYA 1ZLMA 2ZPFB 3OYJA 5I2MA 2L2PA 3CMET 2EPDA 1KD1U 2EWNA 1IHVA 1YJ9A 2EKHA 2AK5A 1M1KC 4FSSA 3E1SA 2QTXA 4LDXA 1PNJA 2E3IA 3DLMA 3QO3A 3M9QA 4PNOA 1UDLA 3MEVA 3MHXA 2Y4XA 3JB9I 4Z02A 3GNGA 4ORZA 1KC8C 1TUCA 2L0AA 3QJ6A 4AG2C 2R58A 2DVEA 3I56Q 1Y57A 1CSKA 4ZGEB 4C8QB 4NS5A 4RG2A 5CKHA 3CC7Q 3L2RA 3CC4Q 2JJ9A 4C0DB 1EX4A 1G3SA 2ROLA 2OI3A 3L2QA 3CCVA 2DLPA 4QKUA 2JN0A 1W2BS 5C6SA 5LJ3f 2VYTA 3INZA 3I56T 4GLMA 1VQ7Q 3GOXA 3EHQA 2LQ8A 2QGFB 4FIBA 3FJ5A 1PHTA 1TU0B 3CC7T 2CZ6B 3CCLA 3RUXA 4RTXA 1T0HA 4C92F 3JAME 4J9GA 3QIIA 1KJWA 1D1BA 1UJ0A 2RM4A 3PT9A 1VQ7T 3LH0A 1M2VB 1WHGA 4J9FA 4YTLA 4C92E 5KYXB 4GBQA 1GL5A 1Q82R 2ZGWA 5HKCA 2VGMA 3REAB 1VQ9A 2GQVA 1QP3A 1EFNA 2FG0A 2E70A 4J9HA 1X75C 3VS0A 3HFNA 3X20B 4BDYA 2HBWA 5HY6A 4C5HA 3NPFA 4J6YA 3MEAA 4QVCA 5KYUA 4C8QD 2DYBA 2KI7A 1FX7A 2L3QA 3FEOA 5D7UA 2D6FA 1FYNA 2DEUA 1VQ8Q 1NYFA 3CCRQ 1NE8A 3BE3A 2NUZA 3LYIA 5CK9A 2O31A 1M3CA 3S3NA 1XJWB 2HMAA 1QVFP 3G4SA 3PMIA 2DBMA 2J6OA 4MZMA 3OMCA 3RKXA 4CC7A 1M2OA 5GAN6 2Z0WA 5GAMe 2FVUA 3OYMA 1VQ8T 1KQ2A 4PFOA 3CCRT 2QEXQ 1VQMA 1VYUA 4QQGA 1AWWA 2KEAA 1PSFA 1WQ7A 3QG1A 1BBZA 2LC4A 1PD1A 1WPYA 1K9MU 1K1ZA 4M75E 3CC2Q 1IGQA 1G5VA 3OQ5A 2E12A 4JRIA 3EGXB 3QPHA 4GY5A 2QEXT 2GCXA 2CP2A 2F5KA 1V29B 4E7IA 2V1QA 2M0OA 1I5OB 4PJOA 1WDXA 5GAN3 3JCMd 1Y96B 2BE7D 4HKEA 4N4HA 1YHQA 5D6YA 2XKOC 3CC2T 2SEMA 4ZN3A 2NUPB 4C92G 4ELZC 4Q5WA 1TTHB 2AT1B 3E9GA 5GANj 4PFPA 2E3HA 4OMPA 4Z89A 3E2UA 1MUZA 1WXBA 5C0MA 3JCMQ 4RUGA 2KNBB 1I8FA 2OJ2A 1QVFS 1M3AA 4EIKA 2RH2A 3CBMA 2E41A 5GMKe 4F16A 2XHCA 4E7JA 5FW9A 5LL6S 1NG2A 3QZ9B 3OYFA 2RJFA 3JCMe 1UHCA 1RAIB 4C8QA 4EPCA 5GAMh 1RI9A 4FYWB 4OF1A 2ABLA 3CMEA 4R0KA 3OS5A 1WGSA 4RTTA 1B3QA 4M78E 2L3PA 1QWEA 2OAUA 4DA4A 2KRSA 2GGRA 2YUQA 1OX9A 2DXUA 4C92B 4CC4B 1PRLC 3WVDB 4M7AF 3BDLA 4HXJA 4E2FB 4J9EA 2O4XB 2HNIA 3CPWA 3G6EQ 2EW3A 2RB6A 4DQ2A 3MJXA 2B86A 1X2QA 2PVDB 4M7AE 4OVAA 3MP1A 4A4HA 3EGUA 2CP6A 3GP8A 3QKJA 1HXDA 2EBPA 1YCYA 2W0ZA 2OTLQ 5LJ5e 1FXXA 2ROTA 1MNDA 2CP0A 3EH2A 3G6ET 1N8RR 4HVVA 5GMKh 1ZSZC 1G3TA 2MIOA 3A8MB 4L59A 2LJ1A 4PFZA 2IG0A 1PC0A 1ZBJA 4IIMA 4LNPA 5GAMg 1NJIU 1M90U 3JCMh 3I56A 2JTFA 3V7SA 2EQKA 1I5LA 2V1RA 5GAN7 2OTLT 2FPDA 5CAIA 2GNCA 4ATOA 3OW2P 3CC7A 1NZ9A 4Y28E 4EMKC 3DLLA 1UB4A 2R5AA 3CCJQ 2KVQG 3JCMc 3ASKA 2CKKA 4N0AC 1SKUB 1Q95G 4A4FA 1VQ7A 4AT1B 1E6HA 4IUPA 3ZFJA 2YDLA 5CQXA 4C92D 4QT7A 4M75B 3JV3A 5J39A 1IREB 3V7RA 4C5IA 1UGSB 3TSZA 3CCJT 5KYWA 2DKGA 2M0YA 5HCKA 2V8IA 4A54A 2CP7A 3RBBB 6AT1B 5LJ3e 1GCPA 2FYKA 3QBYA 2CUDA 2RF0A 4J9BA 5LJ5h 4FSXA 2EGAA 2KT8A 2HL5C 2K7AA 4X34A 2FHDA 3JCMg 3PIPA 1TG0A 1Y96A 3OW2S 4FYYB 2J6KA 1IRXA 1D0XA 5FRNA 1VQ5Q 3OYDA 2NUTB 4PJLA 4M7AG 2I0NA 1D3BB 5FRMA 2CP5A 2O9VA 2P0KA 1BB9A 3P8HA 2DA9A 3CD6Q 1VQ8A 1RAAB 1ABQA 3CCRA 4MMLA 4DOVA 1K8AU 1GBQA 1VQ5T 2X3WD 1MMNA 2LZ6B 4OGCA 2DXBA 1BI0A 4KGVB 1AHJB 4M78B 2L3SA 5FU7B 3NTKA 2XICA 1WIEA 3CD6T 3OYGA 2QEXA 2PVOB 2O01E 2GQIA 2KDSA 1Q86C 5CCAA 1JO8A 4JRKA 3OBWA 1VIEA 2LTOA 4FYXB 5LJ5g 3LLRA 5LJ3h 5KCHA 2YUPA 3CC2A 2ED0A 1RAFB 1RI0A 2BUDA 4M7AB 2D8JA 2KROA 3GIBA 4HT9A 1H3ZA 2O4XA 2LDMA 2JS2A 4J6WA 2RA2A 2YUNA 4XU1A 3C12A 3PFSA 5KE2A 2WACA 1W2BA 4AMCA 5I21A 2LJ3A 3MO8A 3TCJA 1KQ1A 2D0QB 4DEYA 1BIAA 2DTIA 1TXQA 2EIFA 4OB2B 4KBMB 4Y91A 1GBRA 3VS3A 5IN1A 1TWBA 3H9NA 3HKSA 2GFUA 2F2XA 4HVUA 1MNEA 2KYMA 1QLYA 1G8XA 3SEMA 1M4ZA 1TSFA 4OB3B 4HVWA 5IXFA 2KK4A 2QDYB 3VS2A 2JM8A 4KULA 2MI6A 4MZTA 2RQRA 3QYHB 1R0BG 3I9QA 2JNGA 2ZPBB 4J83A 4F7UF 1KQSP 3U23A 1XOVA 2KT1A 3G71Q 7AT1B 1LNXA 4RMOA 2DRMA 5LJ3g 5CQYA 4A63B 1NM7A 1NJIR 4F7UE 1M90R 3HRSA 4OP0A 2CDTA 1O9SA 1Q82C 4MDXA 3X24B 3BW1A 3G71T 4M7AD 5A2QE 2DL5A 3CXCP 3CCQQ 4RG8A 3ME9A 4JZ4A 2DRKA 2M16A 3JCMW 4XAXB 1WA7A 4LDYA 1UGRB 3X25B 1K73U 3G6EA 3NGPA 2AHJB 4FM4B 1YHQQ 1AZEA 3ZBDA 1OPKA 1Y7XA 4DOWA 2DVJA 2LP5A 3M58A 3ER0A 3CCQT 3BFMA 4RKUE 1Y71A 1GRIA 2OTLA 1WXUA 3META 2M51A 4B9XA 2RJCA 1KQSS 4C8QC 2DEQA 2AKKA 4QQ6A 2QQBA 5L8RE 4A4EA 4PLIA 1CKBA 2A0FB 4C0DC 2QI2A 3GLXA 3VS1A 2QQRA 3SB2A 3PTAA 2M02A 3RMSA 1QCOA 3WXMB 2KXCA 1M5Q1 1ZSZA 1NEBA 3A8LB 4ZGDB 4C5GA 1OQKA 4XU0A 2QXFA 4DBRA 3CCJA 3CXCS 2DL4A 3VS4A 1VQPQ 3LGLA 5IAYA 1NLPC 1VOMA 4EMKA 1U06A 3EG2A 3V7CA 3MKDA 1V76A 1B07A 5LJ5f 2XDBA 1BU1A 1QCNA 1JEGA 2HKNA 2QQ9A 5HK0A 1VQPT 1QVFA 2CZ7B 2YRDA 3H0IA 3PGGA 2EVRA 3M0RA 4F7UG 2VUBA 1JJ2P 2P4TA 4M7DF 5CKFA 1KHIA 4XTZA 4M7AA 4V2SA 1ACMB 3M5AA 1M1KU 2LT4A 2WSCE 1X27A 3A8GB 4QW2A 3GPLA 1GCQC 2EGCA 4M7DE 2FZGB 2MWPA 1CKAA 5CKEA 5CR2A 1VYTA 3OYHA 2W10A 2J7IA 3DB4A 2FO0A 5IHNA 4E7ZA 3M57A 1VQ5A 1K4US 5GAN4 4X9CA 1KC8U 2EYXA 1YFNA 3CBOA 1SG5A 2K3BA 2A7YA 5FWBA 2RQTA 3CD6A 3OS1A 1Q81C 4BI8B 3FIFA 2EYYA 1WYXA 1B7TA 4BI3A 2MF2A 3EHRA 3M59A 4F7UB 1RAGB 1AWOA 1W4SA 1PKSA 1JJ2S 2HKQB 4MDWA 4BUGA 2P0PA 4NOYA 4OMLA 2FPFA 4RTUA 1BIBA 2B8AA 1X2KA 2DIQA 1UGVA 2DTHA 1JXOA 4GLKA 1I4K1 1N8RC 3JCMb 1F1BB 2MAMA 2KR3A 1OU8A 1ABOA 4HCKA 2KE9A 3M4GA 2XDPA 2WSEE 4XTXA 1C1AA 2QGGA 5KCOA 1YWPA 2EKOA 4JJBA 1RL2A 4RTVA 5L23A 5GAMd 3QDFA 3RDVA 2DM1A 3OYAA 3AT1B 1RLPC 4DBFA 1U5SA 1SPKA 1YITQ 2DXTA 4M7DG 1MV0B 4IUTA 1IXDA 4N4GA 4XTVA 1SSFA 4LUEA 3C0CA 4OMMA 1YIJQ 4KGZB 4C0GA 5IXBA 1WNLA 2DJZA 3CPFA 3J81E 4FYVB 3G71A 3HFOA 5CKDA 1YITT 4UC4A 1ZUKA 4JJCA 4M75F 3UT1A 4K11A 4PJMA 4C92C 4XTYA 5KYYB 2AIRB 3EFOB 4FW1A 1YJ9Q 1YIJT 2QA4Q 4FT2A 2RI3A 2A28A 5KH6A 3DKMA 1KIKA 3QWXX 3CCQA 1NBEB 3QDRB 3NMZC 1T0JA 3VKIA 8AT1B 2KQWA 2YXYA 1KHCA 3OYYA 2IPOB 3PE0A 1VQ6Q 5IHIA 2L5QA 4J7IA 4M7DB 2QA4T 2DAQA 4JS5A 1V1CA 1GFDA 2LX9A 4C0FA 3TVTA 4JJNK 3H41A 1KD1R 3VYGA 5DM7R 3V8JA 2M1HA 1VQ6T 3H0HA 2D8HA 3EG9B 1X43A 1NPRA 3M56A 2DL7A 2YRVA 2CP3A 2K5LA 4F04B 1VQLQ 2CSQA 1ZA2B 2E5KA 3M0TA 2XI9A 4M78F 3HTRA 3RKYA 1VQ4Q 2H8HA 4X1VA 2HQHA 2KRNA 1QKXA 1VQPA 4M75C 5GJVB 1BCOA 4Z88A 4Y92A 4PKCC 2K3XA 2DMOA 3ZL7C 1VQLT 5LJ5d 2JMCA 4LN2A 1OV3A 1YCSB 3KBGA 1VQ4T 3X28B 2YSQA 1RAHB 2CT3A 1Q7YC 2X4JA 1HYOA 4DBHA 1BI1A 2BE9B 4BE0A 3MCAB 2E64A 1U1TA 4M7DD 1M2VA 3A8OB 2EGEA 3N5BB 5KYXA 5GAN5 4NL3A 4LDVA 4KRTA 5GANg 4M75G 1VQKQ 2KAFA 1SHGA 2ED1A 3R6NA 2DE0X 3G1JA 4BD3A 2FB7A 3LW5E 1UECA 2ZPEB 3QYGB 3OYLA 4OMNA 2XG8D 2E4HA 1VQKT 1GCQA 4IIOA 1RABB 2JW4A 1AVZC 2RNAA 2PTKA 3H0FA 3OB9A 1UG1A 3IQLA 4XQ3A 2MPXC 3UWNA 2O2OA 1PCXA 3SHWA 5LJ3d 3R6OA 3TREA 3SD4A 3RERA 1HSQA 1SRLA 5I22A 2JMAA 4O5VA 3BY7A 3M0SA 2IIMA 3NHNA 4ESRA 5EG2A 3VS5A 3HRUA 2P0QA 3CCEQ 3VS7A 1WHKA 3EGDB 1FMVA 3VJPA 4KH1B 3I35A 2KGTA 1JXMA 4M7AC 1C6VX 1WHLA 2DILA 1KQSA 2XU8A 2HL3A 1JU5C 2A36A 4D6WA 2K79A 3WVEB 2DL8A 4ELYC 3TU4K 2F69A 4M78G 2OX7A 3M0UA 3CCET 3CMAQ 3EGXA 3LH5A 3OYKA 4P5NA 2ZAEA 2DD4A 2YLCA 3JB9J 4RTYA 1OX8A 5I2SA 3E9FA 3LGFA 2YHTA 3P8DA 4J8OA 3VRZA 3CXCA 3QSUA 2K9GA 4LXCA 1K9MR 1BK2A 2D0NA 3S3MA 2XK0A 3CMAT 1OEBA 2NUPA 5FU6B 1WHMA 1H92A 2E10A 1YI2Q 3NTIA 1TS9A 1UE9A 2DF6A 1JB0E 2FPEA 3I55Q 2CZ1B 2CH4A 3DB3A 1MV3A 2PUKB 5GMKm 3OY9A 1YITA 3M0PA 2Y90A 2EJGA 3VV0A 1YJNQ 1NLOC 4IUVA 4KUDK 1WQWA 9ATCB 2X9HA 1YI2T 3JB9H 1YIJA 2GTOA 2CZ0B 1E6GA 2BTTA 5CIUA 3I55T 1R0CB 2NWMA 4M75D 4M77F 1M8MA 2J06A 1YJNT 2L89A 2FEIA 2PQWA 1SRMA 1QVGP 4D8DA 4M77E 2QA4A 4HCBA 4XTWA 2P4RA 3SWNB 4E7SA 2OAWA 2EQJA 2LT1A 4C92A 1Q86U 1YP5A 3VRYA 2A37A 4BE2A 1LVKA 2XIDA 4OMQA 3HL8A 5GANf 1EIFA 3OS2A 3A5ZB 3TEEA 2K5FA 1XNIA 1VQ6A 4X9DA 4HCCA 2D9TA 2GFAA 1U3OA 1TUGB 1X6GA 2QQSA 3JRZA 2JVVA 2F2WA 2K3YA 1YN8A 1FMWA 4F14A 1JJ2A 3HPWA 4PJOE 1J3TA 2A3LA 3EAEA 1X01A 4BI4A 1PKTA 2CUBA 1N6AA 1IB8A 2VV5A 1ZA1B 3MPUB 4WF2A 1R77A 1M9SA 2QG9B 1QVGS 4M78D 1VQLA 2KMTA 3QXEB 1W70A 3J7AF 4AFQC 1VQ4A 3UA6A 2AZSA 2M9UA 2ZPIB 3C94A 4OMFB 4HT8A 2ENMA 4C5EA 4AG1C 3LWIA 1Z9ZA 4JJDA 1OZ3A 4CRIA 1ZUUA 1VQOQ 2EQUA 1NEGA 2HQXA 3OBYA 2VVKA 4J9IA 4PJJA 4M75A 1AZGB 2E5QA 3EFRA 1NPPA 1HK9A 2R57A 5GAN2 2CREA 1Q82U 3RMQA 4L6V5 3SFMA 2R5MA 5I11A 1VQOT 2DNUA 4E7LA 1OU9A 1RADB 1ZBXA 2BIVA 4M77G 4AFUC 1LCKA 5GAOq 1QKWA 1VQKA 1KFZA 1WFWA 2O9SA 2DX1A 3KFVA 1M1GA 4IUQA 3O5ZA 3I5SA 5DLQE 3L2VA 5GAOl 4FL6A 2XDDA 1UJYA 1QP2A 2JTMA 1FWZA 4IUUA 2NUTA 1D3BA 1KSWA 3GF5A 1D0ZA 2E6ZA 2P84A 2LX7A 4BACA 1VUBA 2DIGA 2RI2A 3L2ZA 2Y4YA 5KYUB 1VA7A 2DK3A 4JUVA 5FWCA 1S72Q 4LD9K 4R55A 3UDCA 1MGQA 3HP9A 1AWXA 3FLGA 3V8LA 1FMKA 2BZ8A 2ZCFB 1G83A 1JQQA 2EJ9A 3OYBA 1XTDA 1M8VA 4M78A 1UFFA 4M77B 5GJWB 1S72T 2LQKA 2D1XA 5CVIA 3CCEA 3HRTA 5HK3A 3S3OA 1AT1B 1WJSA 2EQIA 3FJPA 3D7SB 1K8AR 3PIOA 2DERA 2I2LA 1MMGA 2GTJA 5EC7A 1UGPB 2C0OA 4J9CA 5CKBA 4HA8A 2X4WA 1JBMA 2LCCA 3CMAA 2LQNA 1KD1C 1UUEA 3KUFA 1YJWQ 2CGHA 1VQNQ 5DLOA 1N27A 1KG1A 1ZX6A 2QDLA 1H641 4PJOB 2FRWA 3JCMP 3QHSA 1Q86R 3TSWA 5J3BA 3REBB 4BY6B 1YI2A 1ZQ1A 1YJWT 1TUDA 2LRQA 3FDRA 2GBQA 4JPBW 3I55A 1SEMA 3ULRB 4CC3A 3RR6A 1B34B 1VQNT 3QZ5B 2X4XA 1VYVA 1LOJA 2QASA 2QQAA 5GAOr 1YJNA 1PD0A 3UF4A 2YT6A 1I1JA 4JLIA 3CBPA 4M77D 1Q81U 3UATA 1X69A 4JZ3A 1OULA 4ZGJB 2JXBA 3RNJA 1YWOA 2COYA 1PRMC 3M54A 1BCMA 4R56A 3M53A 3QUIA 2K2MA 5AYFA 1XQHA 2PVGB 4II1A 2COZA 1IZ6A 1T3SA 2DPPB 3E19A 4M7DC 2X35A 1BI2A 3PMTA 2ESWA 3CC4T 1PWTA 2QAZA 5GANd 4A4GA 1H3HA 1WLPB 3OMGA 4J7FA 2CSIA 2RPNA 2FZKB 4PJOD 1AWJA 3KXTA 2MK5A 4RCBA 1N8RU 3PVQA 4M4ZA 2O88A 1UGQB 4LE9A 5IT9E 2JM9A 2AZVA 1RACB 1TOVA 2CYZB 1G3WA 2J05A 2JT4A 3NFCA 1KK7A 3I5RA 1Y0MA 2BZYA 1UEBA 3JCMX 1K73R 4AFSC 5IHKA 4A53A 3UA7A 2HDAA 4LUDA 2DO3A 3THKA 5GANe 1LPLA 2ZZDA 2H3JA 4EMHA 4XK8E 4E7HA 5GAOp 1U8RA 3EG1A 4KGXB 3EH1A 2DD5A 1EZZB 4ANJA 3FRNA 2HSPA 2LCLA 4LD6A 4LDUA 5CO7A 4E7KA 2X51A 2OTJQ 1BYMA 2F5TX 3OW2A 2X4YA 4ZTJA 3EFSA 1VQOA 2CT4A 4M77A 3VUBA 2RN8A 1D1AA 2QYZA 1IHWA 1ZHIA 5M9OA 2K2VA 2OTJT 1K9MC 4N4IA 5KYWB 4OB0B 1SSHA 1G3YA 2PUOB 4A4KA 3JCMJ 3VU3C 2ECZA 3M0QA 2CS7A 5FLXE 2ZPGB 2DBKA 2XD0A 2JUFA 2MWOA 1WHHA 3GNFB 2DFUA 3LWHA 2LNHB 4B6MA 3C95A 1QW1A 2WSFE 2PNIA 1D1CA 3UPUA 1WXTA 5GANh 1BI3A 2VKNA 4JS4A 1LJOA 2QK0A 3C4SA 3HSBA 3VUZA 2EYQA 3L42A 2QTVA 1M1KR 4OB1B 3FB9A 2G6FX 2MYSA 2EQMA 1S72A 1B34A 1WJRA 2LVMA 2E1HA 1HJDA 1SF9A 4ZN1A 1GFCA 1X6OA 4IURA 4KH0B 3VYHB 1H8KA 1N5ZA 3M4YA 5D6XA 4C0ZA 4F7UA 5GAMj 2ATCB 1AD5A 8ATCB 1KC8R 1M1FA 2VC8A 2X3XD 3QJYA 1QQJA 1OI1A 3P8BB 3J80E 4E47A 3CCUQ 2COWA 3CCMQ 3Q1JA 1PM3A 3BDUA 4ZNXA 3A8HB 4JRQA 3OYEA 1Q81R 1Q7YU 3SDZA 3RIRA 2RI5A 2KBTA 1HD3A 4JLGA 1QVGA 1RLQC 1E7OA 1YJWA 2RK2A 4JDSA 5FU6C 3CCUT 3CCMT 1VQNA 1K9AA 1T3LA 1PG5B 2VXEA 2YWWA 2DJQA 3OSSC 5A0GA 4QVZA 2EJFA 1IO6A 4E6RA 5GMKj 4F17A 2E6NA 3L1AA 3JCMV 3JB9F 2SRCA 1NJIC 1M90C 4M78C 2RHXA 2VGNA 5FU7C 2HQEA 3OSVA 2RD1A 4J5YA 3MEUA 2MMPA 1RUWA 1N9RA 1R8OB 2NYSA 3LX7A 1WJQA 2RJEA 1QCFA 4EMGA 4ZTFA 4L5GA 1C0MA 3S6WA 1W1FA 3CC4A 3SWNC 1MMAA 4KT0E 4DEXA 5KYYA 3CCSQ 2DETA 4FU6A 3EFOA 2FL7A 1GXIE 1I81A 3ZEHA 2RHUA 1WI7A 1ZUYA 4O6JA 3OYNA 3URGA 4TVRA 1UHFA 1U1SA 3CCST 2VB6A 3H8ZA 4D8KA 2E65A 2JZ2A 4CI0C 3NTHA 4J9DA 2A08A 3OYIA 4JRPA
chains in the Genus database with same CATH topology
1WYXA 2LJ0A 4OMPA 3EHRA 4Z89A 1MUZA 1WXBA 4RUGA 2KNBB 2CREA 2OJ2A 1OPLA 1M3AA 4EIKA 1S1NA 4OMOA 2RQUA 1AWOA 4F16A 1PKSA 5I11A 2DNUA 1K76A 5FW9A 4AFUC 1NG2A 4OMLA 1LCKA 5IH2A 1QKWA 2F2VA 1UHCA 2FPFA 2PZ1A 4RTUA 1KFZA 2LQWA 1WFWA 1X2KA 4RTZA 2O9SA 2HEQA 2DX1A 1UGVA 3KFVA 2KXDA 1I0CA 1RI9A 3O5ZA 2ABLA 3I5SA 1JXOA 2J6FA 2LCSA 3EG3A 1K0SA 4R0KA 2KR3A 1ABOA 4HCKA 4RTTA 1QWFA 1B3QA 1UJYA 2L3PA 2KE9A 1QWEA 1K0XA 1KSWA 1YWPA 2KRSA 2GGRA 2LX7A 2YUQA 4CC4B 1VA7A 5FWCA 1PRLC 4JJBA 1M30A 4HXJA 4RTVA 1AWXA 4J9EA 1W6XA 3PVLA 5L23A 1M27C 2EW3A 1FMKA 2DM1A 2BZ8A 5ECAA 1G83A 2B86A 1JQQA 1X2QA 1YNZA 3EG0A 1RLPC 1U5SA 1SPKA 2CH4W 3EGUA 1Z9QA 1UFFA 5GJWB 2D1XA 1MV0B 2EBPA 2W0ZA 2C0TA 1UTIA 4LUEA 2ROTA 3C0CA 2EQIA 4OMMA 4HVVA 5IXBA 2MIOA 2GTJA 5EC7A 2LJ1A 2C0OA 4J9CA 1ZBJA 4IIMA 4LNPA 1ZUKA 4JJCA 4K11A 2LQNA 2V1RA 1UUEA 2FPDA 2AKLA 1I07A 2GNCA 1ZSGA 1OOTA 4RTWA 1ZX6A 2A28A 2QDLA 1KIKA 3QWXX 2FRWA 3NMZC 1T0JA 1WX6A 3TSWA 1E6HA 3REBB 2YDLA 3PE0A 1TUDA 2GBQA 4JPBW 4QT7A 1SEMA 5IHIA 3ULRB 3JV3A 4CC3A 2RQVA 3TSZA 1VYVA 1V1CA 2EYWA 1GFDA 2M0YA 5HCKA 2KRMA 1AEYA 3UF4A 3TVTA 1G2BA 2YT6A 1I1JA 3H41A 1AOJA 3RBBB 1X6BA 2MOXA 1SHFA 1GCPA 3UATA 1X69A 3H0HA 2CUDA 2D8HA 4JZ3A 2RF0A 2JXBA 1A0NB 4J9BA 1M3BA 3RNJA 1X43A 1YWOA 2EGAA 2DL3A 2KT8A 1PRMC 2K7AA 2DL7A 3QWYA 1TG0A 2CSQA 2E5KA 2YUOA 2K2MA 3M0TA 2J6KA 2HCKA 2LMJA 1T3SA 2H8HA 4X1VA 2KRNA 2I0NA 1QKXA 5GJVB 4Z88A 2ESWA 2O9VA 4Y92A 1PWTA 1BB9A 1H3HA 1WLPB 2DMOA 3ZL7C 2DA9A 4CC2A 2JTEA 2CSIA 2RPNA 2JMCA 1ABQA 4LN2A 2JS0A 1AWJA 2O88A 2VWFA 3PVQA 4M4ZA 1OV3A 1YCSB 4LE9A 1GBQA 2JM9A 2AZVA 2YSQA 4Z8AA 2CT3A 3CQTA 2X3WD 2LZ6B 2EYZA 2J05A 2JT4A 2L3SA 2K6DA 4AFZC 1WIEA 3I5RA 1Y0MA 2BZYA 1ARKA 4AFSC 3A98A 5IHKA 2EGEA 2XMFA 3UA7A 2HDAA 4LUDA 2MCNA 3THKA 4KRTA 2GQIA 1JO8A 1SHGA 2ED1A 3R6NA 2DE0X 2YUPA 1NYGA 2ED0A 3EG1A 2D8JA 2BZXA 2KROA 2RQWA 1UECA 2RMOA 2FRYA 2HSPA 2C0IA 4OMNA 3VS6A 2JS2A 1GCQA 4IIOA 2YUNA 2JW4A 4WCIA 1AVZC 2RNAA 2PTKA 2KYBA 3GBQA 3H0FA 2CT4A 1UG1A 1ZLMA 3IQLA 2L2PA 2O2OA 2LJ3A 2RN8A 2EPDA 3SHWA 4DEYA 2EKHA 2AK5A 1GBRA 3VS3A 4FSSA 1HSQA 1SRLA 5I22A 2JMAA 1PNJA 2F2XA 4HVUA 3M0SA 2IIMA 3NHNA 4ESRA 2KYMA 1QLYA 3SEMA 3VS5A 1UDLA 1SSHA 3VS7A 4HVWA 5IXFA 3VS2A 2ECZA 2JM8A 3M0QA 3I35A 2RQRA 2KGTA 1JXMA 3I9QA 2DBKA 2DILA 4ORZA 3U23A 1XOVA 1JU5C 2KT1A 2A36A 1TUCA 2K79A 2L0AA 2DL8A 2LNHB 4AG2C 2DRMA 2PNIA 3M0UA 1WXTA 4A63B 1Y57A 1CSKA 3LH5A 1NM7A 2VKNA 2CDTA 4RTYA 2ROLA 2OI3A 2G6FX 3VRZA 2DL5A 2DLPA 2K9GA 1BK2A 2D0NA 4JZ4A 2DRKA 1OEBA 4GLMA 1WA7A 3EHQA 1HJDA 1H92A 3FJ5A 1GFCA 1PHTA 3NGPA 1UE9A 2DF6A 2FPEA 1H8KA 1N5ZA 2CH4A 1MV3A 4RTXA 1AZEA 1T0HA 4J9GA 1OPKA 1AD5A 2DVJA 2LP5A 3M0PA 1KJWA 1UJ0A 2X3XD 1NLOC 1GRIA 1WXUA 2M51A 4J9FA 2GTOA 1E6GA 2BTTA 2AKKA 4GBQA 4ZNXA 1GL5A 2NWMA 1CKBA 1M8MA 3VS1A 2KBTA 2J06A 1HD3A 2FEIA 1SRMA 3REAB 4D8DA 2KXCA 1EFNA 2FG0A 4J9HA 1RLQC 1E7OA 3VS0A 1NEBA 1K9AA 2HBWA 1T3LA 2P4RA 3NPFA 2OAWA 2DL4A 3VS4A 2DJQA 1YP5A 2DYBA 3VRYA 1NLPC 4J9IA 2A37A 2L3QA 4OMQA 1U06A 1FYNA 3EG2A 1IO6A 1NYFA 4E6RA 4F17A 1B07A 2NUZA 1BU1A 2O31A 1M3CA 2SRCA 1JEGA 1U3OA 1X6GA 2DBMA 2J6OA 2F2WA 3H0IA 4CC7A 1YN8A 4F14A 2EVRA 3M0RA 1RUWA 1J3TA 1VYUA 1AWWA 2KEAA 1QCFA 1PKTA 2CUBA 1BBZA 1X27A 1W1FA 1GCQC 2EGCA 1K1ZA 4DEXA 1CKAA 1VYTA 1W70A 2W10A 2J7IA 4AFQC 2FO0A 5IHNA 3UA6A 2AZSA 1K4US 2V1QA 1WI7A 1ZUYA 2ENMA 1WDXA 4AG1C 1Z9ZA 4JJDA 2EYXA 1ZUUA 1UHFA 2SEMA 2K3BA 4D8KA 5FWBA 2RQTA 1NEGA 4J9DA 2A08A 2VVKA 2EYYA 1AZGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYX A;  2LJ0 A;  4OMP A;  3EHR A;  4Z89 A;  1MUZ A;  1WXB A;  4RUG A;  2KNB B;  2CRE A;  2OJ2 A;  1OPL A;  1M3A A;  4EIK A;  1S1N A;  4OMO A;  2RQU A;  1AWO A;  4F16 A;  1PKS A;  5I11 A;  2DNU A;  1K76 A;  5FW9 A;  4AFU C;  1NG2 A;  4OML A;  1LCK A;  5IH2 A;  1QKW A;  2F2V A;  1UHC A;  2FPF A;  2PZ1 A;  4RTU A;  1KFZ A;  2LQW A;  1WFW A;  1X2K A;  4RTZ A;  2O9S A;  2HEQ A;  2DX1 A;  1UGV A;  3KFV A;  2KXD A;  1I0C A;  1RI9 A;  3O5Z A;  2ABL A;  3I5S A;  1JXO A;  2J6F A;  2LCS A;  3EG3 A;  1K0S A;  4R0K A;  2KR3 A;  1ABO A;  4HCK A;  4RTT A;  1QWF A;  1B3Q A;  1UJY A;  2L3P A;  2KE9 A;  1QWE A;  1K0X A;  1KSW A;  1YWP A;  2KRS A;  2GGR A;  2LX7 A;  2YUQ A;  4CC4 B;  1VA7 A;  5FWC A;  1PRL C;  4JJB A;  1M30 A;  4HXJ A;  4RTV A;  1AWX A;  4J9E A;  1W6X A;  3PVL A;  5L23 A;  1M27 C;  2EW3 A;  1FMK A;  2DM1 A;  2BZ8 A;  5ECA A;  1G83 A;  2B86 A;  1JQQ A;  1X2Q A;  1YNZ A;  3EG0 A;  1RLP C;  1U5S A;  1SPK A;  2CH4 W;  3EGU A;  1Z9Q A;  1UFF A;  5GJW B;  2D1X A;  1MV0 B;  2EBP A;  2W0Z A;  2C0T A;  1UTI A;  4LUE A;  2ROT A;  3C0C A;  2EQI A;  4OMM A;  4HVV A;  5IXB A;  2MIO A;  2GTJ A;  5EC7 A;  2LJ1 A;  2C0O A;  4J9C A;  1ZBJ A;  4IIM A;  4LNP A;  1ZUK A;  4JJC A;  4K11 A;  2LQN A;  2V1R A;  1UUE A;  2FPD A;  2AKL A;  1I07 A;  2GNC A;  1ZSG A;  1OOT A;  4RTW A;  1ZX6 A;  2A28 A;  2QDL A;  1KIK A;  3QWX X;  2FRW A;  3NMZ C;  1T0J A;  1WX6 A;  3TSW A;  1E6H A;  3REB B;  2YDL A;  3PE0 A;  1TUD A;  2GBQ A;  4JPB W;  4QT7 A;  1SEM A;  5IHI A;  3ULR B;  3JV3 A;  4CC3 A;  2RQV A;  3TSZ A;  1VYV A;  1V1C A;  2EYW A;  1GFD A;  2M0Y A;  5HCK A;  2KRM A;  1AEY A;  3UF4 A;  3TVT A;  1G2B A;  2YT6 A;  1I1J A;  3H41 A;  1AOJ A;  3RBB B;  1X6B A;  2MOX A;  1SHF A;  1GCP A;  3UAT A;  1X69 A;  3H0H A;  2CUD A;  2D8H A;  4JZ3 A;  2RF0 A;  2JXB A;  1A0N B;  4J9B A;  1M3B A;  3RNJ A;  1X43 A;  1YWO A;  2EGA A;  2DL3 A;  2KT8 A;  1PRM C;  2K7A A;  2DL7 A;  3QWY A;  1TG0 A;  2CSQ A;  2E5K A;  2YUO A;  2K2M A;  3M0T A;  2J6K A;  2HCK A;  2LMJ A;  1T3S A;  2H8H A;  4X1V A;  2KRN A;  2I0N A;  1QKX A;  5GJV B;  4Z88 A;  2ESW A;  2O9V A;  4Y92 A;  1PWT A;  1BB9 A;  1H3H A;  1WLP B;  2DMO A;  3ZL7 C;  2DA9 A;  4CC2 A;  2JTE A;  2CSI A;  2RPN A;  2JMC A;  1ABQ A;  4LN2 A;  2JS0 A;  1AWJ A;  2O88 A;  2VWF A;  3PVQ A;  4M4Z A;  1OV3 A;  1YCS B;  4LE9 A;  1GBQ A;  2JM9 A;  2AZV A;  2YSQ A;  4Z8A A;  2CT3 A;  3CQT A;  2X3W D;  2LZ6 B;  2EYZ A;  2J05 A;  2JT4 A;  2L3S A;  2K6D A;  4AFZ C;  1WIE A;  3I5R A;  1Y0M A;  2BZY A;  1ARK A;  4AFS C;  3A98 A;  5IHK A;  2EGE A;  2XMF A;  3UA7 A;  2HDA A;  4LUD A;  2MCN A;  3THK A;  4KRT A;  2GQI A;  1JO8 A;  1SHG A;  2ED1 A;  3R6N A;  2DE0 X;  2YUP A;  1NYG A;  2ED0 A;  3EG1 A;  2D8J A;  2BZX A;  2KRO A;  2RQW A;  1UEC A;  2RMO A;  2FRY A;  2HSP A;  2C0I A;  4OMN A;  3VS6 A;  2JS2 A;  1GCQ A;  4IIO A;  2YUN A;  2JW4 A;  4WCI A;  1AVZ C;  2RNA A;  2PTK A;  2KYB A;  3GBQ A;  3H0F A;  2CT4 A;  1UG1 A;  1ZLM A;  3IQL A;  2L2P A;  2O2O A;  2LJ3 A;  2RN8 A;  2EPD A;  3SHW A;  4DEY A;  2EKH A;  2AK5 A;  1GBR A;  3VS3 A;  4FSS A;  1HSQ A;  1SRL A;  5I22 A;  2JMA A;  1PNJ A;  2F2X A;  4HVU A;  3M0S A;  2IIM A;  3NHN A;  4ESR A;  2KYM A;  1QLY A;  3SEM A;  3VS5 A;  1UDL A;  1SSH A;  3VS7 A;  4HVW A;  5IXF A;  3VS2 A;  2ECZ A;  2JM8 A;  3M0Q A;  3I35 A;  2RQR A;  2KGT A;  1JXM A;  3I9Q A;  2DBK A;  2DIL A;  4ORZ A;  3U23 A;  1XOV A;  1JU5 C;  2KT1 A;  2A36 A;  1TUC A;  2K79 A;  2L0A A;  2DL8 A;  2LNH B;  4AG2 C;  2DRM A;  2PNI A;  3M0U A;  1WXT A;  4A63 B;  1Y57 A;  1CSK A;  3LH5 A;  1NM7 A;  2VKN A;  2CDT A;  4RTY A;  2ROL A;  2OI3 A;  2G6F X;  3VRZ A;  2DL5 A;  2DLP A;  2K9G A;  1BK2 A;  2D0N A;  4JZ4 A;  2DRK A;  1OEB A;  4GLM A;  1WA7 A;  3EHQ A;  1HJD A;  1H92 A;  3FJ5 A;  1GFC A;  1PHT A;  3NGP A;  1UE9 A;  2DF6 A;  2FPE A;  1H8K A;  1N5Z A;  2CH4 A;  1MV3 A;  4RTX A;  1AZE A;  1T0H A;  4J9G A;  1OPK A;  1AD5 A;  2DVJ A;  2LP5 A;  3M0P A;  1KJW A;  1UJ0 A;  2X3X D;  1NLO C;  1GRI A;  1WXU A;  2M51 A;  4J9F A;  2GTO A;  1E6G A;  2BTT A;  2AKK A;  4GBQ A;  4ZNX A;  1GL5 A;  2NWM A;  1CKB A;  1M8M A;  3VS1 A;  2KBT A;  2J06 A;  1HD3 A;  2FEI A;  1SRM A;  3REA B;  4D8D A;  2KXC A;  1EFN A;  2FG0 A;  4J9H A;  1RLQ C;  1E7O A;  3VS0 A;  1NEB A;  1K9A A;  2HBW A;  1T3L A;  2P4R A;  3NPF A;  2OAW A;  2DL4 A;  3VS4 A;  2DJQ A;  1YP5 A;  2DYB A;  3VRY A;  1NLP C;  4J9I A;  2A37 A;  2L3Q A;  4OMQ A;  1U06 A;  1FYN A;  3EG2 A;  1IO6 A;  1NYF A;  4E6R A;  4F17 A;  1B07 A;  2NUZ A;  1BU1 A;  2O31 A;  1M3C A;  2SRC A;  1JEG A;  1U3O A;  1X6G A;  2DBM A;  2J6O A;  2F2W A;  3H0I A;  4CC7 A;  1YN8 A;  4F14 A;  2EVR A;  3M0R A;  1RUW A;  1J3T A;  1VYU A;  1AWW A;  2KEA A;  1QCF A;  1PKT A;  2CUB A;  1BBZ A;  1X27 A;  1W1F A;  1GCQ C;  2EGC A;  1K1Z A;  4DEX A;  1CKA A;  1VYT A;  1W70 A;  2W10 A;  2J7I A;  4AFQ C;  2FO0 A;  5IHN A;  3UA6 A;  2AZS A;  1K4U S;  2V1Q A;  1WI7 A;  1ZUY A;  2ENM A;  1WDX A;  4AG1 C;  1Z9Z A;  4JJD A;  2EYX A;  1ZUU A;  1UHF A;  2SEM A;  2K3B A;  4D8K A;  5FWB A;  2RQT A;  1NEG A;  4J9D A;  2A08 A;  2VVK A;  2EYY A;  1AZG B; 
#chains in the Genus database with same CATH topology
 2LJ0 A;  4M7D A;  2HZY A;  3L2U A;  5LJ5 j;  1D0Y A;  2VXF A;  1OPL A;  1S1N A;  2DXC A;  3X26 B;  4OMO A;  1PSE A;  2RQU A;  4XU3 A;  3V8K A;  1K76 A;  5IH2 A;  1YJ9 T;  4BDZ A;  2F2V A;  5KYN A;  2PZ1 A;  1MHN A;  2K4Y A;  2LQW A;  2HAX A;  3EG9 A;  4RTZ A;  3L2W A;  2HEQ A;  2HSE B;  2KXD A;  1I0C A;  5GMK i;  2J6F A;  3O8V A;  2LCS A;  3EG3 A;  4XU2 A;  1K0S A;  2EAY A;  1RAE B;  1K8A C;  5FRO A;  1QWF A;  1ZSZ B;  1K0X A;  3AHU A;  1DJ7 B;  2OTJ A;  2RJD A;  5KE3 A;  4WTO B;  2IVW A;  3CCV Q;  2DZC A;  3G7Z A;  1M30 A;  5GAO n;  4EMK B;  3JB9 G;  1W6X A;  3PVL A;  3TQ7 P;  3MP8 A;  2RK1 A;  1M27 C;  3CPW P;  5ECA A;  3CCL Q;  1YNZ A;  1OZ2 A;  3EG0 A;  1MMD A;  2CH4 W;  4BB7 A;  3CCV T;  1Z9Q A;  5LJ3 j;  2V26 A;  2VAS A;  3OA6 A;  2C0T A;  1UTI A;  4PL6 A;  4PJO F;  1QVP A;  2LNV A;  4LDW A;  3CCL T;  4PLL A;  2JOY A;  5GMK l;  5AT1 B;  2GF7 A;  4NL2 A;  1Q7Y R;  3M55 A;  4QVD A;  3H6Z A;  1VQ9 Q;  2AKL A;  1I07 A;  1ZSG A;  2NLU A;  1OOT A;  4RTW A;  2DZ9 A;  4FT4 A;  5GAM f;  3OS0 A;  2K5I A;  1WX6 A;  2RHZ A;  2L8D A;  2V8J A;  1WHJ A;  4M77 C;  4C8Q F;  5DY9 A;  2HBP A;  1VQ9 T;  5A0L A;  5GAO m;  3CPW S;  5D6W A;  2RHY A;  2FZC B;  4HCZ A;  2RQV A;  4OGE A;  2F1L A;  5GAN 8;  1YBY A;  4DBQ A;  4C8Q E;  1QMC A;  1OYX A;  3MEW A;  2HD0 A;  2EYW A;  3G4S Q;  2KRM A;  1AEY A;  4PK4 A;  2RHI A;  3T9N A;  1BKB A;  3EGD A;  1G2B A;  4EDU A;  2DYI A;  1AOJ A;  5J26 A;  1TH7 A;  2L3R A;  1X6B A;  2MOX A;  1SHF A;  4MZP A;  5A0D A;  2C06 A;  3CCU A;  1VIF A;  3CCM A;  1VQM Q;  4VUB A;  2PU9 B;  4MMK A;  1A0N B;  1M3B A;  2DTO A;  2DL3 A;  2KSS A;  4J6X A;  3RKW A;  3G4S T;  3JSC A;  4PJO C;  3QWY A;  1Y07 A;  1K73 C;  2YUO A;  4FW2 A;  3PNW C;  2EFI A;  2HCK A;  2LMJ A;  1VQM T;  4BY6 C;  4KUI A;  4IKF A;  1D09 B;  4ME7 A;  3JCM f;  4B9W A;  2G3R A;  4CC2 A;  1N9S A;  1WZO A;  2JTE A;  2YLB A;  3JB9 D;  2JS0 A;  2VWF A;  2ZPH B;  4Z8A A;  2H3E B;  3CQT A;  3MP6 A;  2EYZ A;  4PJO G;  1YHQ T;  3FC3 A;  2K6D A;  4AFZ C;  4RCC A;  2KY9 A;  1ARK A;  2K57 A;  3A98 A;  2XMF A;  3A1P A;  1IGU A;  4QQD A;  2MCN A;  1JRI A;  3F70 A;  3HHT B;  2BKD N;  2YRC A;  2RO0 A;  1NYG A;  3CCS A;  3RES A;  3CME Q;  4PJN A;  2BZX A;  2RQW A;  2RMO A;  1P92 A;  2FRY A;  2C0I A;  3SWN A;  3VS6 A;  4C8Q G;  3OYC A;  4WCI A;  3CEY A;  4BE1 A;  1O75 A;  2KYB A;  2V8K A;  3GBQ A;  4N0A A;  1W2B P;  4XTU A;  4FCY A;  1ZLM A;  2ZPF B;  3OYJ A;  5I2M A;  2L2P A;  3CME T;  2EPD A;  1KD1 U;  2EWN A;  1IHV A;  1YJ9 A;  2EKH A;  2AK5 A;  1M1K C;  4FSS A;  3E1S A;  2QTX A;  4LDX A;  1PNJ A;  2E3I A;  3DLM A;  3QO3 A;  3M9Q A;  4PNO A;  1UDL A;  3MEV A;  3MHX A;  2Y4X A;  3JB9 I;  4Z02 A;  3GNG A;  4ORZ A;  1KC8 C;  1TUC A;  2L0A A;  3QJ6 A;  4AG2 C;  2R58 A;  2DVE A;  3I56 Q;  1Y57 A;  1CSK A;  4ZGE B;  4C8Q B;  4NS5 A;  4RG2 A;  5CKH A;  3CC7 Q;  3L2R A;  3CC4 Q;  2JJ9 A;  4C0D B;  1EX4 A;  1G3S A;  2ROL A;  2OI3 A;  3L2Q A;  3CCV A;  2DLP A;  4QKU A;  2JN0 A;  1W2B S;  5C6S A;  5LJ3 f;  2VYT A;  3INZ A;  3I56 T;  4GLM A;  1VQ7 Q;  3GOX A;  3EHQ A;  2LQ8 A;  2QGF B;  4FIB A;  3FJ5 A;  1PHT A;  1TU0 B;  3CC7 T;  2CZ6 B;  3CCL A;  3RUX A;  4RTX A;  1T0H A;  4C92 F;  3JAM E;  4J9G A;  3QII A;  1KJW A;  1D1B A;  1UJ0 A;  2RM4 A;  3PT9 A;  1VQ7 T;  3LH0 A;  1M2V B;  1WHG A;  4J9F A;  4YTL A;  4C92 E;  5KYX B;  4GBQ A;  1GL5 A;  1Q82 R;  2ZGW A;  5HKC A;  2VGM A;  3REA B;  1VQ9 A;  2GQV A;  1QP3 A;  1EFN A;  2FG0 A;  2E70 A;  4J9H A;  1X75 C;  3VS0 A;  3HFN A;  3X20 B;  4BDY A;  2HBW A;  5HY6 A;  4C5H A;  3NPF A;  4J6Y A;  3MEA A;  4QVC A;  5KYU A;  4C8Q D;  2DYB A;  2KI7 A;  1FX7 A;  2L3Q A;  3FEO A;  5D7U A;  2D6F A;  1FYN A;  2DEU A;  1VQ8 Q;  1NYF A;  3CCR Q;  1NE8 A;  3BE3 A;  2NUZ A;  3LYI A;  5CK9 A;  2O31 A;  1M3C A;  3S3N A;  1XJW B;  2HMA A;  1QVF P;  3G4S A;  3PMI A;  2DBM A;  2J6O A;  4MZM A;  3OMC A;  3RKX A;  4CC7 A;  1M2O A;  5GAN 6;  2Z0W A;  5GAM e;  2FVU A;  3OYM A;  1VQ8 T;  1KQ2 A;  4PFO A;  3CCR T;  2QEX Q;  1VQM A;  1VYU A;  4QQG A;  1AWW A;  2KEA A;  1PSF A;  1WQ7 A;  3QG1 A;  1BBZ A;  2LC4 A;  1PD1 A;  1WPY A;  1K9M U;  1K1Z A;  4M75 E;  3CC2 Q;  1IGQ A;  1G5V A;  3OQ5 A;  2E12 A;  4JRI A;  3EGX B;  3QPH A;  4GY5 A;  2QEX T;  2GCX A;  2CP2 A;  2F5K A;  1V29 B;  4E7I A;  2V1Q A;  2M0O A;  1I5O B;  4PJO A;  1WDX A;  5GAN 3;  3JCM d;  1Y96 B;  2BE7 D;  4HKE A;  4N4H A;  1YHQ A;  5D6Y A;  2XKO C;  3CC2 T;  2SEM A;  4ZN3 A;  2NUP B;  4C92 G;  4ELZ C;  4Q5W A;  1TTH B;  2AT1 B;  3E9G A;  5GAN j;  4PFP A;  2E3H A;  4OMP A;  4Z89 A;  3E2U A;  1MUZ A;  1WXB A;  5C0M A;  3JCM Q;  4RUG A;  2KNB B;  1I8F A;  2OJ2 A;  1QVF S;  1M3A A;  4EIK A;  2RH2 A;  3CBM A;  2E41 A;  5GMK e;  4F16 A;  2XHC A;  4E7J A;  5FW9 A;  5LL6 S;  1NG2 A;  3QZ9 B;  3OYF A;  2RJF A;  3JCM e;  1UHC A;  1RAI B;  4C8Q A;  4EPC A;  5GAM h;  1RI9 A;  4FYW B;  4OF1 A;  2ABL A;  3CME A;  4R0K A;  3OS5 A;  1WGS A;  4RTT A;  1B3Q A;  4M78 E;  2L3P A;  1QWE A;  2OAU A;  4DA4 A;  2KRS A;  2GGR A;  2YUQ A;  1OX9 A;  2DXU A;  4C92 B;  4CC4 B;  1PRL C;  3WVD B;  4M7A F;  3BDL A;  4HXJ A;  4E2F B;  4J9E A;  2O4X B;  2HNI A;  3CPW A;  3G6E Q;  2EW3 A;  2RB6 A;  4DQ2 A;  3MJX A;  2B86 A;  1X2Q A;  2PVD B;  4M7A E;  4OVA A;  3MP1 A;  4A4H A;  3EGU A;  2CP6 A;  3GP8 A;  3QKJ A;  1HXD A;  2EBP A;  1YCY A;  2W0Z A;  2OTL Q;  5LJ5 e;  1FXX A;  2ROT A;  1MND A;  2CP0 A;  3EH2 A;  3G6E T;  1N8R R;  4HVV A;  5GMK h;  1ZSZ C;  1G3T A;  2MIO A;  3A8M B;  4L59 A;  2LJ1 A;  4PFZ A;  2IG0 A;  1PC0 A;  1ZBJ A;  4IIM A;  4LNP A;  5GAM g;  1NJI U;  1M90 U;  3JCM h;  3I56 A;  2JTF A;  3V7S A;  2EQK A;  1I5L A;  2V1R A;  5GAN 7;  2OTL T;  2FPD A;  5CAI A;  2GNC A;  4ATO A;  3OW2 P;  3CC7 A;  1NZ9 A;  4Y28 E;  4EMK C;  3DLL A;  1UB4 A;  2R5A A;  3CCJ Q;  2KVQ G;  3JCM c;  3ASK A;  2CKK A;  4N0A C;  1SKU B;  1Q95 G;  4A4F A;  1VQ7 A;  4AT1 B;  1E6H A;  4IUP A;  3ZFJ A;  2YDL A;  5CQX A;  4C92 D;  4QT7 A;  4M75 B;  3JV3 A;  5J39 A;  1IRE B;  3V7R A;  4C5I A;  1UGS B;  3TSZ A;  3CCJ T;  5KYW A;  2DKG A;  2M0Y A;  5HCK A;  2V8I A;  4A54 A;  2CP7 A;  3RBB B;  6AT1 B;  5LJ3 e;  1GCP A;  2FYK A;  3QBY A;  2CUD A;  2RF0 A;  4J9B A;  5LJ5 h;  4FSX A;  2EGA A;  2KT8 A;  2HL5 C;  2K7A A;  4X34 A;  2FHD A;  3JCM g;  3PIP A;  1TG0 A;  1Y96 A;  3OW2 S;  4FYY B;  2J6K A;  1IRX A;  1D0X A;  5FRN A;  1VQ5 Q;  3OYD A;  2NUT B;  4PJL A;  4M7A G;  2I0N A;  1D3B B;  5FRM A;  2CP5 A;  2O9V A;  2P0K A;  1BB9 A;  3P8H A;  2DA9 A;  3CD6 Q;  1VQ8 A;  1RAA B;  1ABQ A;  3CCR A;  4MML A;  4DOV A;  1K8A U;  1GBQ A;  1VQ5 T;  2X3W D;  1MMN A;  2LZ6 B;  4OGC A;  2DXB A;  1BI0 A;  4KGV B;  1AHJ B;  4M78 B;  2L3S A;  5FU7 B;  3NTK A;  2XIC A;  1WIE A;  3CD6 T;  3OYG A;  2QEX A;  2PVO B;  2O01 E;  2GQI A;  2KDS A;  1Q86 C;  5CCA A;  1JO8 A;  4JRK A;  3OBW A;  1VIE A;  2LTO A;  4FYX B;  5LJ5 g;  3LLR A;  5LJ3 h;  5KCH A;  2YUP A;  3CC2 A;  2ED0 A;  1RAF B;  1RI0 A;  2BUD A;  4M7A B;  2D8J A;  2KRO A;  3GIB A;  4HT9 A;  1H3Z A;  2O4X A;  2LDM A;  2JS2 A;  4J6W A;  2RA2 A;  2YUN A;  4XU1 A;  3C12 A;  3PFS A;  5KE2 A;  2WAC A;  1W2B A;  4AMC A;  5I21 A;  2LJ3 A;  3MO8 A;  3TCJ A;  1KQ1 A;  2D0Q B;  4DEY A;  1BIA A;  2DTI A;  1TXQ A;  2EIF A;  4OB2 B;  4KBM B;  4Y91 A;  1GBR A;  3VS3 A;  5IN1 A;  1TWB A;  3H9N A;  3HKS A;  2GFU A;  2F2X A;  4HVU A;  1MNE A;  2KYM A;  1QLY A;  1G8X A;  3SEM A;  1M4Z A;  1TSF A;  4OB3 B;  4HVW A;  5IXF A;  2KK4 A;  2QDY B;  3VS2 A;  2JM8 A;  4KUL A;  2MI6 A;  4MZT A;  2RQR A;  3QYH B;  1R0B G;  3I9Q A;  2JNG A;  2ZPB B;  4J83 A;  4F7U F;  1KQS P;  3U23 A;  1XOV A;  2KT1 A;  3G71 Q;  7AT1 B;  1LNX A;  4RMO A;  2DRM A;  5LJ3 g;  5CQY A;  4A63 B;  1NM7 A;  1NJI R;  4F7U E;  1M90 R;  3HRS A;  4OP0 A;  2CDT A;  1O9S A;  1Q82 C;  4MDX A;  3X24 B;  3BW1 A;  3G71 T;  4M7A D;  5A2Q E;  2DL5 A;  3CXC P;  3CCQ Q;  4RG8 A;  3ME9 A;  4JZ4 A;  2DRK A;  2M16 A;  3JCM W;  4XAX B;  1WA7 A;  4LDY A;  1UGR B;  3X25 B;  1K73 U;  3G6E A;  3NGP A;  2AHJ B;  4FM4 B;  1YHQ Q;  1AZE A;  3ZBD A;  1OPK A;  1Y7X A;  4DOW A;  2DVJ A;  2LP5 A;  3M58 A;  3ER0 A;  3CCQ T;  3BFM A;  4RKU E;  1Y71 A;  1GRI A;  2OTL A;  1WXU A;  3MET A;  2M51 A;  4B9X A;  2RJC A;  1KQS S;  4C8Q C;  2DEQ A;  2AKK A;  4QQ6 A;  2QQB A;  5L8R E;  4A4E A;  4PLI A;  1CKB A;  2A0F B;  4C0D C;  2QI2 A;  3GLX A;  3VS1 A;  2QQR A;  3SB2 A;  3PTA A;  2M02 A;  3RMS A;  1QCO A;  3WXM B;  2KXC A;  1M5Q 1;  1ZSZ A;  1NEB A;  3A8L B;  4ZGD B;  4C5G A;  1OQK A;  4XU0 A;  2QXF A;  4DBR A;  3CCJ A;  3CXC S;  2DL4 A;  3VS4 A;  1VQP Q;  3LGL A;  5IAY A;  1NLP C;  1VOM A;  4EMK A;  1U06 A;  3EG2 A;  3V7C A;  3MKD A;  1V76 A;  1B07 A;  5LJ5 f;  2XDB A;  1BU1 A;  1QCN A;  1JEG A;  2HKN A;  2QQ9 A;  5HK0 A;  1VQP T;  1QVF A;  2CZ7 B;  2YRD A;  3H0I A;  3PGG A;  2EVR A;  3M0R A;  4F7U G;  2VUB A;  1JJ2 P;  2P4T A;  4M7D F;  5CKF A;  1KHI A;  4XTZ A;  4M7A A;  4V2S A;  1ACM B;  3M5A A;  1M1K U;  2LT4 A;  2WSC E;  1X27 A;  3A8G B;  4QW2 A;  3GPL A;  1GCQ C;  2EGC A;  4M7D E;  2FZG B;  2MWP A;  1CKA A;  5CKE A;  5CR2 A;  1VYT A;  3OYH A;  2W10 A;  2J7I A;  3DB4 A;  2FO0 A;  5IHN A;  4E7Z A;  3M57 A;  1VQ5 A;  1K4U S;  5GAN 4;  4X9C A;  1KC8 U;  2EYX A;  1YFN A;  3CBO A;  1SG5 A;  2K3B A;  2A7Y A;  5FWB A;  2RQT A;  3CD6 A;  3OS1 A;  1Q81 C;  4BI8 B;  3FIF A;  2EYY A;  1WYX A;  1B7T A;  4BI3 A;  2MF2 A;  3EHR A;  3M59 A;  4F7U B;  1RAG B;  1AWO A;  1W4S A;  1PKS A;  1JJ2 S;  2HKQ B;  4MDW A;  4BUG A;  2P0P A;  4NOY A;  4OML A;  2FPF A;  4RTU A;  1BIB A;  2B8A A;  1X2K A;  2DIQ A;  1UGV A;  2DTH A;  1JXO A;  4GLK A;  1I4K 1;  1N8R C;  3JCM b;  1F1B B;  2MAM A;  2KR3 A;  1OU8 A;  1ABO A;  4HCK A;  2KE9 A;  3M4G A;  2XDP A;  2WSE E;  4XTX A;  1C1A A;  2QGG A;  5KCO A;  1YWP A;  2EKO A;  4JJB A;  1RL2 A;  4RTV A;  5L23 A;  5GAM d;  3QDF A;  3RDV A;  2DM1 A;  3OYA A;  3AT1 B;  1RLP C;  4DBF A;  1U5S A;  1SPK A;  1YIT Q;  2DXT A;  4M7D G;  1MV0 B;  4IUT A;  1IXD A;  4N4G A;  4XTV A;  1SSF A;  4LUE A;  3C0C A;  4OMM A;  1YIJ Q;  4KGZ B;  4C0G A;  5IXB A;  1WNL A;  2DJZ A;  3CPF A;  3J81 E;  4FYV B;  3G71 A;  3HFO A;  5CKD A;  1YIT T;  4UC4 A;  1ZUK A;  4JJC A;  4M75 F;  3UT1 A;  4K11 A;  4PJM A;  4C92 C;  4XTY A;  5KYY B;  2AIR B;  3EFO B;  4FW1 A;  1YJ9 Q;  1YIJ T;  2QA4 Q;  4FT2 A;  2RI3 A;  2A28 A;  5KH6 A;  3DKM A;  1KIK A;  3QWX X;  3CCQ A;  1NBE B;  3QDR B;  3NMZ C;  1T0J A;  3VKI A;  8AT1 B;  2KQW A;  2YXY A;  1KHC A;  3OYY A;  2IPO B;  3PE0 A;  1VQ6 Q;  5IHI A;  2L5Q A;  4J7I A;  4M7D B;  2QA4 T;  2DAQ A;  4JS5 A;  1V1C A;  1GFD A;  2LX9 A;  4C0F A;  3TVT A;  4JJN K;  3H41 A;  1KD1 R;  3VYG A;  5DM7 R;  3V8J A;  2M1H A;  1VQ6 T;  3H0H A;  2D8H A;  3EG9 B;  1X43 A;  1NPR A;  3M56 A;  2DL7 A;  2YRV A;  2CP3 A;  2K5L A;  4F04 B;  1VQL Q;  2CSQ A;  1ZA2 B;  2E5K A;  3M0T A;  2XI9 A;  4M78 F;  3HTR A;  3RKY A;  1VQ4 Q;  2H8H A;  4X1V A;  2HQH A;  2KRN A;  1QKX A;  1VQP A;  4M75 C;  5GJV B;  1BCO A;  4Z88 A;  4Y92 A;  4PKC C;  2K3X A;  2DMO A;  3ZL7 C;  1VQL T;  5LJ5 d;  2JMC A;  4LN2 A;  1OV3 A;  1YCS B;  3KBG A;  1VQ4 T;  3X28 B;  2YSQ A;  1RAH B;  2CT3 A;  1Q7Y C;  2X4J A;  1HYO A;  4DBH A;  1BI1 A;  2BE9 B;  4BE0 A;  3MCA B;  2E64 A;  1U1T A;  4M7D D;  1M2V A;  3A8O B;  2EGE A;  3N5B B;  5KYX A;  5GAN 5;  4NL3 A;  4LDV A;  4KRT A;  5GAN g;  4M75 G;  1VQK Q;  2KAF A;  1SHG A;  2ED1 A;  3R6N A;  2DE0 X;  3G1J A;  4BD3 A;  2FB7 A;  3LW5 E;  1UEC A;  2ZPE B;  3QYG B;  3OYL A;  4OMN A;  2XG8 D;  2E4H A;  1VQK T;  1GCQ A;  4IIO A;  1RAB B;  2JW4 A;  1AVZ C;  2RNA A;  2PTK A;  3H0F A;  3OB9 A;  1UG1 A;  3IQL A;  4XQ3 A;  2MPX C;  3UWN A;  2O2O A;  1PCX A;  3SHW A;  5LJ3 d;  3R6O A;  3TRE A;  3SD4 A;  3RER A;  1HSQ A;  1SRL A;  5I22 A;  2JMA A;  4O5V A;  3BY7 A;  3M0S A;  2IIM A;  3NHN A;  4ESR A;  5EG2 A;  3VS5 A;  3HRU A;  2P0Q A;  3CCE Q;  3VS7 A;  1WHK A;  3EGD B;  1FMV A;  3VJP A;  4KH1 B;  3I35 A;  2KGT A;  1JXM A;  4M7A C;  1C6V X;  1WHL A;  2DIL A;  1KQS A;  2XU8 A;  2HL3 A;  1JU5 C;  2A36 A;  4D6W A;  2K79 A;  3WVE B;  2DL8 A;  4ELY C;  3TU4 K;  2F69 A;  4M78 G;  2OX7 A;  3M0U A;  3CCE T;  3CMA Q;  3EGX A;  3LH5 A;  3OYK A;  4P5N A;  2ZAE A;  2DD4 A;  2YLC A;  3JB9 J;  4RTY A;  1OX8 A;  5I2S A;  3E9F A;  3LGF A;  2YHT A;  3P8D A;  4J8O A;  3VRZ A;  3CXC A;  3QSU A;  2K9G A;  4LXC A;  1K9M R;  1BK2 A;  2D0N A;  3S3M A;  2XK0 A;  3CMA T;  1OEB A;  2NUP A;  5FU6 B;  1WHM A;  1H92 A;  2E10 A;  1YI2 Q;  3NTI A;  1TS9 A;  1UE9 A;  2DF6 A;  1JB0 E;  2FPE A;  3I55 Q;  2CZ1 B;  2CH4 A;  3DB3 A;  1MV3 A;  2PUK B;  5GMK m;  3OY9 A;  1YIT A;  3M0P A;  2Y90 A;  2EJG A;  3VV0 A;  1YJN Q;  1NLO C;  4IUV A;  4KUD K;  1WQW A;  9ATC B;  2X9H A;  1YI2 T;  3JB9 H;  1YIJ A;  2GTO A;  2CZ0 B;  1E6G A;  2BTT A;  5CIU A;  3I55 T;  1R0C B;  2NWM A;  4M75 D;  4M77 F;  1M8M A;  2J06 A;  1YJN T;  2L89 A;  2FEI A;  2PQW A;  1SRM A;  1QVG P;  4D8D A;  4M77 E;  2QA4 A;  4HCB A;  4XTW A;  2P4R A;  3SWN B;  4E7S A;  2OAW A;  2EQJ A;  2LT1 A;  4C92 A;  1Q86 U;  1YP5 A;  3VRY A;  2A37 A;  4BE2 A;  1LVK A;  2XID A;  4OMQ A;  3HL8 A;  5GAN f;  1EIF A;  3OS2 A;  3A5Z B;  3TEE A;  2K5F A;  1XNI A;  1VQ6 A;  4X9D A;  4HCC A;  2D9T A;  2GFA A;  1U3O A;  1TUG B;  1X6G A;  2QQS A;  3JRZ A;  2JVV A;  2F2W A;  2K3Y A;  1YN8 A;  1FMW A;  4F14 A;  1JJ2 A;  3HPW A;  4PJO E;  1J3T A;  2A3L A;  3EAE A;  1X01 A;  4BI4 A;  1PKT A;  2CUB A;  1N6A A;  1IB8 A;  2VV5 A;  1ZA1 B;  3MPU B;  4WF2 A;  1R77 A;  1M9S A;  2QG9 B;  1QVG S;  4M78 D;  1VQL A;  2KMT A;  3QXE B;  1W70 A;  3J7A F;  4AFQ C;  1VQ4 A;  3UA6 A;  2AZS A;  2M9U A;  2ZPI B;  3C94 A;  4OMF B;  4HT8 A;  2ENM A;  4C5E A;  4AG1 C;  3LWI A;  1Z9Z A;  4JJD A;  1OZ3 A;  4CRI A;  1ZUU A;  1VQO Q;  2EQU A;  1NEG A;  2HQX A;  3OBY A;  2VVK A;  4J9I A;  4PJJ A;  4M75 A;  1AZG B;  2E5Q A;  3EFR A;  1NPP A;  1HK9 A;  2R57 A;  5GAN 2;  2CRE A;  1Q82 U;  3RMQ A;  4L6V 5;  3SFM A;  2R5M A;  5I11 A;  1VQO T;  2DNU A;  4E7L A;  1OU9 A;  1RAD B;  1ZBX A;  2BIV A;  4M77 G;  4AFU C;  1LCK A;  5GAO q;  1QKW A;  1VQK A;  1KFZ A;  1WFW A;  2O9S A;  2DX1 A;  3KFV A;  1M1G A;  4IUQ A;  3O5Z A;  3I5S A;  5DLQ E;  3L2V A;  5GAO l;  4FL6 A;  2XDD A;  1UJY A;  1QP2 A;  2JTM A;  1FWZ A;  4IUU A;  2NUT A;  1D3B A;  1KSW A;  3GF5 A;  1D0Z A;  2E6Z A;  2P84 A;  2LX7 A;  4BAC A;  1VUB A;  2DIG A;  2RI2 A;  3L2Z A;  2Y4Y A;  5KYU B;  1VA7 A;  2DK3 A;  4JUV A;  5FWC A;  1S72 Q;  4LD9 K;  4R55 A;  3UDC A;  1MGQ A;  3HP9 A;  1AWX A;  3FLG A;  3V8L A;  1FMK A;  2BZ8 A;  2ZCF B;  1G83 A;  1JQQ A;  2EJ9 A;  3OYB A;  1XTD A;  1M8V A;  4M78 A;  1UFF A;  4M77 B;  5GJW B;  1S72 T;  2LQK A;  2D1X A;  5CVI A;  3CCE A;  3HRT A;  5HK3 A;  3S3O A;  1AT1 B;  1WJS A;  2EQI A;  3FJP A;  3D7S B;  1K8A R;  3PIO A;  2DER A;  2I2L A;  1MMG A;  2GTJ A;  5EC7 A;  1UGP B;  2C0O A;  4J9C A;  5CKB A;  4HA8 A;  2X4W A;  1JBM A;  2LCC A;  3CMA A;  2LQN A;  1KD1 C;  1UUE A;  3KUF A;  1YJW Q;  2CGH A;  1VQN Q;  5DLO A;  1N27 A;  1KG1 A;  1ZX6 A;  2QDL A;  1H64 1;  4PJO B;  2FRW A;  3JCM P;  3QHS A;  1Q86 R;  3TSW A;  5J3B A;  3REB B;  4BY6 B;  1YI2 A;  1ZQ1 A;  1YJW T;  1TUD A;  2LRQ A;  3FDR A;  2GBQ A;  4JPB W;  3I55 A;  1SEM A;  3ULR B;  4CC3 A;  3RR6 A;  1B34 B;  1VQN T;  3QZ5 B;  2X4X A;  1VYV A;  1LOJ A;  2QAS A;  2QQA A;  5GAO r;  1YJN A;  1PD0 A;  3UF4 A;  2YT6 A;  1I1J A;  4JLI A;  3CBP A;  4M77 D;  1Q81 U;  3UAT A;  1X69 A;  4JZ3 A;  1OUL A;  4ZGJ B;  2JXB A;  3RNJ A;  1YWO A;  2COY A;  1PRM C;  3M54 A;  1BCM A;  4R56 A;  3M53 A;  3QUI A;  2K2M A;  5AYF A;  1XQH A;  2PVG B;  4II1 A;  2COZ A;  1IZ6 A;  1T3S A;  2DPP B;  3E19 A;  4M7D C;  2X35 A;  1BI2 A;  3PMT A;  2ESW A;  3CC4 T;  1PWT A;  2QAZ A;  5GAN d;  4A4G A;  1H3H A;  1WLP B;  3OMG A;  4J7F A;  2CSI A;  2RPN A;  2FZK B;  4PJO D;  1AWJ A;  3KXT A;  2MK5 A;  4RCB A;  1N8R U;  3PVQ A;  4M4Z A;  2O88 A;  1UGQ B;  4LE9 A;  5IT9 E;  2JM9 A;  2AZV A;  1RAC B;  1TOV A;  2CYZ B;  1G3W A;  2J05 A;  2JT4 A;  3NFC A;  1KK7 A;  3I5R A;  1Y0M A;  2BZY A;  1UEB A;  3JCM X;  1K73 R;  4AFS C;  5IHK A;  4A53 A;  3UA7 A;  2HDA A;  4LUD A;  2DO3 A;  3THK A;  5GAN e;  1LPL A;  2ZZD A;  2H3J A;  4EMH A;  4XK8 E;  4E7H A;  5GAO p;  1U8R A;  3EG1 A;  4KGX B;  3EH1 A;  2DD5 A;  1EZZ B;  4ANJ A;  3FRN A;  2HSP A;  2LCL A;  4LD6 A;  4LDU A;  5CO7 A;  4E7K A;  2X51 A;  2OTJ Q;  1BYM A;  2F5T X;  3OW2 A;  2X4Y A;  4ZTJ A;  3EFS A;  1VQO A;  2CT4 A;  4M77 A;  3VUB A;  2RN8 A;  1D1A A;  2QYZ A;  1IHW A;  1ZHI A;  5M9O A;  2K2V A;  2OTJ T;  1K9M C;  4N4I A;  5KYW B;  4OB0 B;  1SSH A;  1G3Y A;  2PUO B;  4A4K A;  3JCM J;  3VU3 C;  2ECZ A;  3M0Q A;  2CS7 A;  5FLX E;  2ZPG B;  2DBK A;  2XD0 A;  2JUF A;  2MWO A;  1WHH A;  3GNF B;  2DFU A;  3LWH A;  2LNH B;  4B6M A;  3C95 A;  1QW1 A;  2WSF E;  2PNI A;  1D1C A;  3UPU A;  1WXT A;  5GAN h;  1BI3 A;  2VKN A;  4JS4 A;  1LJO A;  2QK0 A;  3C4S A;  3HSB A;  3VUZ A;  2EYQ A;  3L42 A;  2QTV A;  1M1K R;  4OB1 B;  3FB9 A;  2G6F X;  2MYS A;  2EQM A;  1S72 A;  1B34 A;  1WJR A;  2LVM A;  2E1H A;  1HJD A;  1SF9 A;  4ZN1 A;  1GFC A;  1X6O A;  4IUR A;  4KH0 B;  3VYH B;  1H8K A;  1N5Z A;  3M4Y A;  5D6X A;  4C0Z A;  4F7U A;  5GAM j;  2ATC B;  1AD5 A;  8ATC B;  1KC8 R;  1M1F A;  2VC8 A;  2X3X D;  3QJY A;  1QQJ A;  1OI1 A;  3P8B B;  3J80 E;  4E47 A;  3CCU Q;  2COW A;  3CCM Q;  3Q1J A;  1PM3 A;  3BDU A;  4ZNX A;  3A8H B;  4JRQ A;  3OYE A;  1Q81 R;  1Q7Y U;  3SDZ A;  3RIR A;  2RI5 A;  2KBT A;  1HD3 A;  4JLG A;  1QVG A;  1RLQ C;  1E7O A;  1YJW A;  2RK2 A;  4JDS A;  5FU6 C;  3CCU T;  3CCM T;  1VQN A;  1K9A A;  1T3L A;  1PG5 B;  2VXE A;  2YWW A;  2DJQ A;  3OSS C;  5A0G A;  4QVZ A;  2EJF A;  1IO6 A;  4E6R A;  5GMK j;  4F17 A;  2E6N A;  3L1A A;  3JCM V;  3JB9 F;  2SRC A;  1NJI C;  1M90 C;  4M78 C;  2RHX A;  2VGN A;  5FU7 C;  2HQE A;  3OSV A;  2RD1 A;  4J5Y A;  3MEU A;  2MMP A;  1RUW A;  1N9R A;  1R8O B;  2NYS A;  3LX7 A;  1WJQ A;  2RJE A;  1QCF A;  4EMG A;  4ZTF A;  4L5G A;  1C0M A;  3S6W A;  1W1F A;  3CC4 A;  3SWN C;  1MMA A;  4KT0 E;  4DEX A;  5KYY A;  3CCS Q;  2DET A;  4FU6 A;  3EFO A;  2FL7 A;  1GXI E;  1I81 A;  3ZEH A;  2RHU A;  1WI7 A;  1ZUY A;  4O6J A;  3OYN A;  3URG A;  4TVR A;  1UHF A;  1U1S A;  3CCS T;  2VB6 A;  3H8Z A;  4D8K A;  2E65 A;  2JZ2 A;  4CI0 C;  3NTH A;  4J9D A;  2A08 A;  3OYI A;  4JRP A; 
#chains in the Genus database with same CATH homology
 1WYX A;  2LJ0 A;  4OMP A;  3EHR A;  4Z89 A;  1MUZ A;  1WXB A;  4RUG A;  2KNB B;  2CRE A;  2OJ2 A;  1OPL A;  1M3A A;  4EIK A;  1S1N A;  4OMO A;  2RQU A;  1AWO A;  4F16 A;  1PKS A;  5I11 A;  2DNU A;  1K76 A;  5FW9 A;  4AFU C;  1NG2 A;  4OML A;  1LCK A;  5IH2 A;  1QKW A;  2F2V A;  1UHC A;  2FPF A;  2PZ1 A;  4RTU A;  1KFZ A;  2LQW A;  1WFW A;  1X2K A;  4RTZ A;  2O9S A;  2HEQ A;  2DX1 A;  1UGV A;  3KFV A;  2KXD A;  1I0C A;  1RI9 A;  3O5Z A;  2ABL A;  3I5S A;  1JXO A;  2J6F A;  2LCS A;  3EG3 A;  1K0S A;  4R0K A;  2KR3 A;  1ABO A;  4HCK A;  4RTT A;  1QWF A;  1B3Q A;  1UJY A;  2L3P A;  2KE9 A;  1QWE A;  1K0X A;  1KSW A;  1YWP A;  2KRS A;  2GGR A;  2LX7 A;  2YUQ A;  4CC4 B;  1VA7 A;  5FWC A;  1PRL C;  4JJB A;  1M30 A;  4HXJ A;  4RTV A;  1AWX A;  4J9E A;  1W6X A;  3PVL A;  5L23 A;  1M27 C;  2EW3 A;  1FMK A;  2DM1 A;  2BZ8 A;  5ECA A;  1G83 A;  2B86 A;  1JQQ A;  1X2Q A;  1YNZ A;  3EG0 A;  1RLP C;  1U5S A;  1SPK A;  2CH4 W;  3EGU A;  1Z9Q A;  1UFF A;  5GJW B;  2D1X A;  1MV0 B;  2EBP A;  2W0Z A;  2C0T A;  1UTI A;  4LUE A;  2ROT A;  3C0C A;  2EQI A;  4OMM A;  4HVV A;  5IXB A;  2MIO A;  2GTJ A;  5EC7 A;  2LJ1 A;  2C0O A;  4J9C A;  1ZBJ A;  4IIM A;  4LNP A;  1ZUK A;  4JJC A;  4K11 A;  2LQN A;  2V1R A;  1UUE A;  2FPD A;  2AKL A;  1I07 A;  2GNC A;  1ZSG A;  1OOT A;  4RTW A;  1ZX6 A;  2A28 A;  2QDL A;  1KIK A;  3QWX X;  2FRW A;  3NMZ C;  1T0J A;  1WX6 A;  3TSW A;  1E6H A;  3REB B;  2YDL A;  3PE0 A;  1TUD A;  2GBQ A;  4JPB W;  4QT7 A;  1SEM A;  5IHI A;  3ULR B;  3JV3 A;  4CC3 A;  2RQV A;  3TSZ A;  1VYV A;  1V1C A;  2EYW A;  1GFD A;  2M0Y A;  5HCK A;  2KRM A;  1AEY A;  3UF4 A;  3TVT A;  1G2B A;  2YT6 A;  1I1J A;  3H41 A;  1AOJ A;  3RBB B;  1X6B A;  2MOX A;  1SHF A;  1GCP A;  3UAT A;  1X69 A;  3H0H A;  2CUD A;  2D8H A;  4JZ3 A;  2RF0 A;  2JXB A;  1A0N B;  4J9B A;  1M3B A;  3RNJ A;  1X43 A;  1YWO A;  2EGA A;  2DL3 A;  2KT8 A;  1PRM C;  2K7A A;  2DL7 A;  3QWY A;  1TG0 A;  2CSQ A;  2E5K A;  2YUO A;  2K2M A;  3M0T A;  2J6K A;  2HCK A;  2LMJ A;  1T3S A;  2H8H A;  4X1V A;  2KRN A;  2I0N A;  1QKX A;  5GJV B;  4Z88 A;  2ESW A;  2O9V A;  4Y92 A;  1PWT A;  1BB9 A;  1H3H A;  1WLP B;  2DMO A;  3ZL7 C;  2DA9 A;  4CC2 A;  2JTE A;  2CSI A;  2RPN A;  2JMC A;  1ABQ A;  4LN2 A;  2JS0 A;  1AWJ A;  2O88 A;  2VWF A;  3PVQ A;  4M4Z A;  1OV3 A;  1YCS B;  4LE9 A;  1GBQ A;  2JM9 A;  2AZV A;  2YSQ A;  4Z8A A;  2CT3 A;  3CQT A;  2X3W D;  2LZ6 B;  2EYZ A;  2J05 A;  2JT4 A;  2L3S A;  2K6D A;  4AFZ C;  1WIE A;  3I5R A;  1Y0M A;  2BZY A;  1ARK A;  4AFS C;  3A98 A;  5IHK A;  2EGE A;  2XMF A;  3UA7 A;  2HDA A;  4LUD A;  2MCN A;  3THK A;  4KRT A;  2GQI A;  1JO8 A;  1SHG A;  2ED1 A;  3R6N A;  2DE0 X;  2YUP A;  1NYG A;  2ED0 A;  3EG1 A;  2D8J A;  2BZX A;  2KRO A;  2RQW A;  1UEC A;  2RMO A;  2FRY A;  2HSP A;  2C0I A;  4OMN A;  3VS6 A;  2JS2 A;  1GCQ A;  4IIO A;  2YUN A;  2JW4 A;  4WCI A;  1AVZ C;  2RNA A;  2PTK A;  2KYB A;  3GBQ A;  3H0F A;  2CT4 A;  1UG1 A;  1ZLM A;  3IQL A;  2L2P A;  2O2O A;  2LJ3 A;  2RN8 A;  2EPD A;  3SHW A;  4DEY A;  2EKH A;  2AK5 A;  1GBR A;  3VS3 A;  4FSS A;  1HSQ A;  1SRL A;  5I22 A;  2JMA A;  1PNJ A;  2F2X A;  4HVU A;  3M0S A;  2IIM A;  3NHN A;  4ESR A;  2KYM A;  1QLY A;  3SEM A;  3VS5 A;  1UDL A;  1SSH A;  3VS7 A;  4HVW A;  5IXF A;  3VS2 A;  2ECZ A;  2JM8 A;  3M0Q A;  3I35 A;  2RQR A;  2KGT A;  1JXM A;  3I9Q A;  2DBK A;  2DIL A;  4ORZ A;  3U23 A;  1XOV A;  1JU5 C;  2KT1 A;  2A36 A;  1TUC A;  2K79 A;  2L0A A;  2DL8 A;  2LNH B;  4AG2 C;  2DRM A;  2PNI A;  3M0U A;  1WXT A;  4A63 B;  1Y57 A;  1CSK A;  3LH5 A;  1NM7 A;  2VKN A;  2CDT A;  4RTY A;  2ROL A;  2OI3 A;  2G6F X;  3VRZ A;  2DL5 A;  2DLP A;  2K9G A;  1BK2 A;  2D0N A;  4JZ4 A;  2DRK A;  1OEB A;  4GLM A;  1WA7 A;  3EHQ A;  1HJD A;  1H92 A;  3FJ5 A;  1GFC A;  1PHT A;  3NGP A;  1UE9 A;  2DF6 A;  2FPE A;  1H8K A;  1N5Z A;  2CH4 A;  1MV3 A;  4RTX A;  1AZE A;  1T0H A;  4J9G A;  1OPK A;  1AD5 A;  2DVJ A;  2LP5 A;  3M0P A;  1KJW A;  1UJ0 A;  2X3X D;  1NLO C;  1GRI A;  1WXU A;  2M51 A;  4J9F A;  2GTO A;  1E6G A;  2BTT A;  2AKK A;  4GBQ A;  4ZNX A;  1GL5 A;  2NWM A;  1CKB A;  1M8M A;  3VS1 A;  2KBT A;  2J06 A;  1HD3 A;  2FEI A;  1SRM A;  3REA B;  4D8D A;  2KXC A;  1EFN A;  2FG0 A;  4J9H A;  1RLQ C;  1E7O A;  3VS0 A;  1NEB A;  1K9A A;  2HBW A;  1T3L A;  2P4R A;  3NPF A;  2OAW A;  2DL4 A;  3VS4 A;  2DJQ A;  1YP5 A;  2DYB A;  3VRY A;  1NLP C;  4J9I A;  2A37 A;  2L3Q A;  4OMQ A;  1U06 A;  1FYN A;  3EG2 A;  1IO6 A;  1NYF A;  4E6R A;  4F17 A;  1B07 A;  2NUZ A;  1BU1 A;  2O31 A;  1M3C A;  2SRC A;  1JEG A;  1U3O A;  1X6G A;  2DBM A;  2J6O A;  2F2W A;  3H0I A;  4CC7 A;  1YN8 A;  4F14 A;  2EVR A;  3M0R A;  1RUW A;  1J3T A;  1VYU A;  1AWW A;  2KEA A;  1QCF A;  1PKT A;  2CUB A;  1BBZ A;  1X27 A;  1W1F A;  1GCQ C;  2EGC A;  1K1Z A;  4DEX A;  1CKA A;  1VYT A;  1W70 A;  2W10 A;  2J7I A;  4AFQ C;  2FO0 A;  5IHN A;  3UA6 A;  2AZS A;  1K4U S;  2V1Q A;  1WI7 A;  1ZUY A;  2ENM A;  1WDX A;  4AG1 C;  1Z9Z A;  4JJD A;  2EYX A;  1ZUU A;  1UHF A;  2SEM A;  2K3B A;  4D8K A;  5FWB A;  2RQT A;  1NEG A;  4J9D A;  2A08 A;  2VVK A;  2EYY A;  1AZG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...