1VQ9Q

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq9Q00
3CCVQ 2QEXQ 1VQ5Q 1Q81R 1VQ9Q 3I55Q 1QVGP 3CMEQ 1QVFP 3CCUQ 1VQKQ 3CC7Q 1VQMQ 1VQLQ 3CCRQ 2OTJQ 1M1KR 3I56Q 3CC4Q 1Q86R 3G6EQ 3CC2Q 1K8AR 1JJ2P 1VQPQ 1Q7YR 3CMAQ 1S72Q 1VQ4Q 1Q82R 1KD1R 1VQNQ 3CCSQ 2OTLQ 1VQ7Q 3CCJQ 3CD6Q 1W2BP 1NJIR 1K73R 1KC8R 1YHQQ 1YJ9Q 3G71Q 1YJNQ 3CXCP 1YI2Q 1KQSP 1M90R 1VQ6Q 1YJWQ 3OW2P 1N8RR 1K9MR 3CCQQ 3CCEQ 3G4SQ 3CPWP 1VQ8Q 1YIJQ 1YITQ 2QA4Q 3CCMQ 1VQOQ 3CCLQ
chains in the Genus database with same CATH superfamily
4E7ZA 3KBGA 2QTVA 3OQ5A 3H8ZA 1ZSZC 4FW1A 4GBQA 4DEXA 4RCCA 2DVJA 1YJWT 4Z88A 2K4YA 2RPNA 2VWFA 2PQWA 2PVOB 4IUQA 4DOWA 2VXFA 2VV5A 1G3WA 2X4JA 1UJYA 3OY9A 1TTHB 2QTXA 4C5HA 5GAN2 4M78G 1OYXA 3A8LB 3BW1A 2AK5A 2CP6A 1AWJA 4PL6A 2MK5A 4MZMA 1MV3A 1YHQA 1JO8A 4LDUA 2DO3A 2DD4A 1WHGA 4J7FA 1GBRA 2JN0A 2FZCB 4MDXA 2COZA 2J05A 1JXOA 3VS6A 5IXFA 2R57A 5KE3A 4FM4B 2DTOA 5EC7A 3HRSA 2IPOB 1UFFA 4J9CA 2KEAA 2RHIA 4BE0A 1M2VB 5FWBA 3UATA 2F5TX 1K9MC 2KMTA 4JLGA 1UGQB 1UTIA 2X3XD 2LCCA 3HP9A 1YJWA 4IIOA 3OBWA 5FU6C 2EJ9A 4M75B 3A5ZB 4FCYA 2J6KA 5DLQE 4E7KA 1JRIA 1KC8C 3V7CA 1M2VA 1OZ2A 4NL2A 1CKAA 2XKOC 3X24B 3QJYA 4M77E 3G4SQ 1TU0B 2DL4A 2LX9A 1VQ8Q 4LUDA 1XJWB 1X6BA 3EG9B 2DK3A 3UWNA 2DF6A 5LL6S 4M75A 4XAXB 2FPEA 3URGA 3CCQT 2DL5A 2DL7A 3MHXA 1UB4A 1UUEA 4C92C 2XK0A 2LQKA 8AT1B 3VV0A 1OULA 2B86A 3I56T 3IQLA 4QW2A 1K9MR 1M5Q1 2K3BA 1R0BG 3O8VA 2F2WA 1I5OB 1PM3A 3EG9A 4EMGA 1PWTA 3CMEQ 2VGMA 1U8RA 4LD6A 3VRZA 4F04B 1K8AC 3OMGA 2KGTA 4II1A 2DL8A 4OMLA 1KC8R 2OX7A 4KH1B 3DB3A 3CCSA 2O01E 1QLYA 5KCHA 3H41A 1I81A 1VQ9Q 3QSUA 1PRMC 3TQ7P 3GOXA 1E6HA 4YTLA 3CCQA 2DXBA 3SB2A 2G3RA 2LT1A 3E9GA 1RUWA 4PFPA 3CCJQ 4M7DG 2ENMA 2EQJA 3I56A 4QVCA 1QWFA 1YJNQ 4PJOB 1M9SA 2R5MA 2XG8D 1WJSA 4EDUA 1VQ6Q 2MAMA 3CC2T 2KROA 4TVRA 2QGGA 4IUPA 1VQOQ 1VQ5Q 4FT4A 5KYNA 4NS5A 1M3CA 1SHGA 5CKDA 2F5KA 4NL3A 3M55A 2LQ8A 1K8AR 4XTYA 3ZEHA 2PUKB 2K5LA 1WA7A 1K76A 2V8KA 4PJOA 4JRPA 5GAOm 2LDMA 2DE0X 2WSCE 5GAN8 2I2LA 3CC4T 4Z02A 1UECA 1IGQA 4LUEA 1PD0A 4AFZC 1OPLA 2JUFA 4B9WA 1KQSA 3J7AF 4FIBA 3VKIA 3JB9D 2RHYA 2RQTA 3CPWA 2C06A 1U1SA 1IXDA 1NPRA 4M4ZA 1RADB 3CC2A 4M78F 3X26B 2M16A 3ZL7C 4KULA 1WZOA 4J9FA 1WPYA 2RHXA 3PTAA 1QVFP 1BKBA 3PGGA 1JQQA 4A54A 4DBFA 1ABQA 1VQNQ 2HL5C 2K2MA 2QA4T 1ZUUA 4OMPA 3P8DA 5GANh 2XDDA 3CCVT 3CC4A 3EAEA 1PHTA 1RI0A 4ZN3A 4EMHA 3VJPA 1BYMA 4VUBA 3ZFJA 2J6OA 2JTFA 4F7UE 3GPLA 2EGEA 1TUCA 1WXTA 3JCMd 3L2RA 4PKCC 5I11A 1K9MU 3QPHA 5KYYB 3PVLA 3BE3A 2E64A 3LWHA 1ARKA 2YUNA 4X9DA 4OB0B 2NUZA 2YUPA 2EWNA 4GLKA 5LJ3e 1ZLMA 2EQKA 4P5NA 4J9EA 4DEYA 4KT0E 1WX6A 1KC8U 2XIDA 4BE2A 1M3BA 3SD4A 2OJ2A 2D0NA 3NTKA 2QA4A 5KYYA 1K0XA 3GBQA 3CCVA 2FYKA 2L3SA 2BTTA 2E70A 3EH1A 5J26A 2C0OA 4WF2A 1YHQQ 5LJ5d 1Z9ZA 1K73C 3WVEB 3A8MB 4N0AC 3HRUA 4C92E 4EMKB 4ZN1A 3EHQA 3LH5A 4J9GA 7AT1B 2CT4A 2JJ9A 3RUXA 2LJ0A 2GQVA 4AG1C 3G1JA 2ZPBB 4XU0A 3V8JA 1TXQA 1RAGB 2LNVA 3BDUA 1NJIC 2LC4A 4M7AG 1K8AU 3JCMg 1VQPT 2YUOA 4EMKA 3H9NA 5LJ5j 2YWWA 1X69A 5A0GA 1VIFA 1BK2A 3M0RA 3QJ6A 1PNJA 1X2KA 1VQLQ 4Q5WA 4MZTA 1YN8A 4M7DF 4X34A 2EGCA 2DAQA 3SDZA 3CCLT 2DKGA 1K73R 3LLRA 2QI2A 1AWWA 1X75C 4BI4A 2MWPA 5FRMA 4L5GA 3A98A 1VYTA 1PSFA 5LJ3f 3EFOB 5LJ5g 3M0TA 2RH2A 1YITA 2F69A 4OMMA 4E7JA 1QKWA 2P0KA 1NJIR 1WJRA 2HSEB 1KFZA 2E6ZA 4E7IA 1LVKA 3WXMB 3V8KA 3G71Q 4JJCA 1QVFS 2E10A 4J83A 3TU4K 2A7YA 2AHJB 3PMIA 4HVUA 3RESA 4AFQC 3MP6A 3UDCA 1I1JA 4M7AA 3CBPA 3CCMQ 2CH4W 3EFOA 3UA6A 4JS4A 4QT7A 3JCMb 1WFWA 3MJXA 1N6AA 5HK3A 2DILA 3CCLA 1GFDA 3CCSQ 2GQIA 3OBYA 1WHHA 2K3XA 1K4US 2HBWA 2DYBA 2V8JA 1KQ2A 2X3WD 1WIEA 4F7UF 1KHCA 3CCQQ 1VQ4T 2YRVA 1C0MA 2OI3A 4ESRA 4PJOD 5CKHA 1B34B 3I56Q 1F1BB 3AHUA 1J3TA 3OW2S 3S6WA 2JTEA 2HMAA 2W0ZA 1MNEA 4ME7A 3MP1A 1IHVA 4MZPA 2Y90A 4Z8AA 4M75C 3L1AA 1B34A 4XU3A 4DBQA 1IZ6A 1KG1A 1PCXA 1NYFA 6AT1B 2XDBA 2ZAEA 4KH0B 2CT3A 9ATCB 3M0UA 5GAOp 4C92F 2HZYA 1VQMT 1VQ4A 1VQKT 1NG2A 4D8KA 4ELZC 4F16A 3G6ET 4EPCA 4OGCA 1YIJQ 2FG0A 2OAUA 1M1FA 2ZPHB 1PD1A 1X6OA 2ROLA 1K1ZA 3OMCA 3CC2Q 4J6XA 2ZPEB 3E9FA 3TCJA 2EYYA 1FXXA 2ROTA 2XICA 2KVQG 2H3JA 3JB9G 2XU8A 1MNDA 3OYBA 1Y7XA 3OYNA 3JB9J 1BI0A 2ZPFB 2DRKA 3MPUB 1IRXA 4BB7A 2EJFA 1K73U 3MCAB 3Q1JA 3CC4Q 1WHLA 3L2WA 1Q86C 1Y07A 1MHNA 1I4K1 3JCMW 1VQMA 1VQKA 4OF1A 4OMFB 3OYKA 3G6EA 1SHFA 3A8OB 4OGEA 2LCSA 1VYUA 3VYGA 4A63B 2KRMA 3PNWC 4QKUA 1NJIU 2QEXQ 2BIVA 1TUGB 3I55Q 1WQWA 1O75A 4PJOC 3EG3A 2LZ6B 4JZ4A 1D1BA 2FZKB 3M0PA 5GAN7 2E3IA 2DL3A 1HJDA 3QO3A 1ZUYA 5C6SA 2QQRA 1A0NB 1OQKA 2CS7A 3QWXX 2GTOA 2JTMA 2A37A 2CZ0B 2DD5A 1Y57A 2MYSA 5GMKj 1RAHB 3X20B 2XDPA 4LD9K 3CCVQ 2ZPIB 3CXCA 4FW2A 4OMQA 1V29B 1Q86R 4R0KA 2YRDA 2EGAA 1YP5A 2GFAA 2XD0A 2Y4XA 2QASA 3KFVA 3MEUA 4A4HA 1EIFA 1MGQA 2A0FB 2QDLA 3CEYA 1K9AA 2AT1B 1BBZA 2C0TA 3OYLA 5CQXA 4J6YA 4FT2A 5I2MA 2C0IA 4C8QB 1SSHA 4ELYC 3PE0A 3VRYA 3DLLA 1YI2T 3QYGB 3VS2A 1U06A 1BCMA 3OYYA 1O9SA 4LE9A 1QVGS 1M2OA 4J9BA 4WTOB 2BZXA 1JJ2A 1NEGA 2AIRB 4F14A 2X4YA 2KAFA 2X51A 4C8QA 1D0XA 1KHIA 4RTVA 4M75G 4LDVA 2K3YA 5GJWB 2RI2A 2CREA 4AFSC 4BDYA 1FMKA 4M7AD 1HK9A 3QZ9B 2L89A 2CUBA 3HKSA 4OMNA 5GANf 3LGFA 3CMAT 3FRNA 3JSCA 3JCMX 1YITQ 2WSFE 4M78E 4E47A 1NEBA 1Q81R 3TREA 1YI2A 5IAYA 1QVPA 1Y96B 1MMDA 2QAZA 2DBMA 2HSPA 3LWIA 5HY6A 5GMKm 2DZCA 2GNCA 4IUVA 3L2ZA 1NPPA 4FYXB 2JVVA 2O9VA 2ZPGB 1Y96A 4ZGJB 1KQ1A 1MMNA 3OA6A 1XOVA 3JRZA 4V2SA 2RJDA 3JB9F 3REBB 2E41A 2MMPA 3CMAA 1W4SA 3I35A 1WI7A 1OV3A 4M77B 2BE7D 3BDLA 4GLMA 1FMVA 3L2QA 3OSSC 3SHWA 3LX7A 4ZGEB 1RAIB 1N8RC 3WVDB 4KGVB 1OEBA 3DB4A 3OYAA 1PKSA 3CBMA 3U23A 5IN1A 5KH6A 4PLIA 4XK8E 4PJOG 2VGNA 4Y92A 4BD3A 1UGPB 3M0SA 1RABB 4ORZA 2EYWA 4C0ZA 3CCRT 1LCKA 4M77A 1Q86U 2DRMA 2DYIA 1VQ7T 2HD0A 1W2BA 5KCOA 4J9DA 4HVWA 5A0LA 3OSVA 1LPLA 3EFSA 1VQ4Q 1S1NA 1Q7YC 4F17A 3HTRA 4M7AC 3MP8A 5GAN6 2HL3A 2EYZA 1OPKA 2JW4A 4PJLA 1AWXA 2OTJT 5GAMd 1YCSB 2V1RA 1N8RR 3M59A 2YHTA 1WHMA 2DXTA 3V8LA 2X9HA 3NMZC 8ATCB 2RQVA 2D9TA 2K7AA 1ZSGA 5I22A 4M7DE 3CCRA 4EIKA 2K6DA 2CZ1B 3EFRA 3FJPA 1OOTA 2K79A 1H3ZA 4RG8A 4KBMB 3JCMQ 3L2VA 3AT1B 2QGFB 3FDRA 2AZSA 2D6FA 1NBEB 2JMCA 5GAMj 1VQKQ 2QYZA 1T3SA 2QG9B 3G6EQ 1Q7YR 2MPXC 1ACMB 3HRTA 2EAYA 3JCMe 2BZYA 2D0QB 2BKDN 2XMFA 2HBPA 2VYTA 2OTJA 5FLXE 2NUTB 2DTIA 1SPKA 4OP0A 4CC7A 3OYHA 3QHSA 4M75F 5GAN4 2FVUA 2RN8A 5CKEA 5D7UA 4CC3A 1G2BA 2L3RA 2PUOB 3RKXA 4NOYA 5GAMg 4FL6A 3THKA 2NUTA 2LRQA 5IHNA 1N9RA 5LJ5e 4E2FB 2RO0A 2KR3A 1U1TA 4KUIA 3S3MA 2NLUA 1AZEA 1X43A 2ABLA 3MEWA 3OS1A 1WNLA 2LCLA 2LVMA 3EG2A 3A1PA 2CSQA 2QK0A 2E5QA 4JJDA 2KY9A 4C8QD 2A36A 3PT9A 2YDLA 3CCUT 1AOJA 1TWBA 3OW2P 1UEBA 4IKFA 2CP2A 1M4ZA 1RL2A 4GY5A 4F7UB 3M4YA 2DPPB 2DEQA 4MDWA 4C5EA 3EGDB 2EKOA 1WHKA 1HSQA 4HCBA 3JCMf 2LT4A 4PLLA 2ZZDA 5A2QE 4MMLA 3PIPA 2RMOA 1OI1A 2FB7A 3GP8A 1SSFA 4KGZB 2DERA 4AMCA 3R6OA 3EGDA 1MMGA 4PJOF 4RTXA 4HCKA 4IIMA 1D0ZA 1N8RU 3CCUA 4PFZA 2P0QA 4JJNK 5HCKA 1YI2Q 1YJWQ 2E5KA 4M75D 3OYFA 2HKQB 2EKHA 4C92B 5LJ5f 1MUZA 2BE9B 1BB9A 1YJ9T 5D6XA 3PMTA 2D8HA 2L5QA 1OU8A 1C1AA 1SF9A 3OYMA 3CCET 3CPFA 2HDAA 5CR2A 4JRQA 3VU3C 2EQMA 1KSWA 1R8OB 3C95A 1AZGB 4XTUA 2RJFA 3VS1A 1Q7YU 4IUTA 4M7AE 1UHFA 4JPBW 3VS5A 5ECAA 1AD5A 1M1KR 3SFMA 1IGUA 4M77D 4CI0C 2BZ8A 2JMAA 3NFCA 1X6GA 2FPDA 1G3SA 2CSIA 2E65A 1VQPA 2YRCA 3M56A 4C8QC 2HQHA 4R56A 3QKJA 3E2UA 4DA4A 4XTZA 5LJ3j 1YJ9A 1JB0E 1WQ7A 1X27A 2FPFA 1M27C 2CGHA 4OB1B 3CCEA 4ZNXA 5A0DA 3OB9A 2M0OA 3FB9A 3V7SA 1U5SA 2P0PA 1YWPA 2I0NA 1NM7A 2GCXA 3CMET 2E6NA 2LJ1A 5GAOq 4ZTJA 1NYGA 3ZBDA 4WCIA 2KSSA 2LQNA 1MMAA 2RD1A 2FZGB 1GFCA 2A08A 5LJ3g 2PZ1A 1QWEA 4JRIA 2YUQA 2VC8A 3M4GA 4XQ3A 4B9XA 2L3PA 2IVWA 1VQ9T 3M54A 1GCQA 1AT1B 4LN2A 1ZX6A 4RTZA 4HCCA 2DETA 3CCJT 1I8FA 1JU5C 1H8KA 1QVGP 1YJNT 4HT9A 3CCRQ 5HK0A 1QW1A 2MWOA 4FSXA 1VQ6T 4E7LA 3P8HA 3JCMJ 1ZQ1A 3CMEA 1VQOT 2GFUA 1NZ9A 3HHTB 3ULRB 4Z89A 5GMKe 1FMWA 1JBMA 3NPFA 5CVIA 3CD6T 4MMKA 2KT8A 1T0HA 2DFUA 4C0DB 2OTJQ 4C0GA 1WXBA 3RMQA 3RERA 3RKYA 4M77C 1VQ9A 4KGXB 3SEMA 3JCMh 2OTLT 2HAXA 4Y91A 3E1SA 3CCJA 4E7HA 3ER0A 2QQBA 3RIRA 2D8JA 5IHIA 2JT4A 3HL8A 5EG2A 4XTXA 3M57A 1VQ6A 1BIAA 3FIFA 4N4GA 1GRIA 4DBHA 3CBOA 1VQOA 5IHKA 1ZA1B 3P8BB 4HA8A 4PJMA 1T3LA 2H8HA 3MO8A 1UHCA 5FU7B 2O4XB 4M7AF 1V76A 2LMJA 1P92A 1M1KU 2KXCA 3QDFA 2K57A 5CKBA 2B8AA 1WDXA 3CD6A 5LJ5h 2COWA 3R6NA 1SKUB 2R58A 2YLCA 2COYA 2J06A 3E19A 2RB6A 3EGUA 3OS5A 5IH2A 1WXUA 5GAOl 2OTLA 2O4XA 3O5ZA 2MF2A 4C5IA 3L42A 2M1HA 2CP7A 2CP0A 2RHZA 3JCMP 2QA4Q 4IUUA 2NYSA 2F2VA 3DKMA 4C8QG 1YNZA 4HXJA 2KNBB 2EVRA 2M9UA 4B6MA 2Z0WA 4A4KA 4A53A 1VYVA 1AHJB 2FEIA 3N5BB 4LDXA 1GXIE 2KT1A 3HSBA 3I5RA 4JZ3A 3VS7A 1RI9A 1RAAB 1SRLA 2DA9A 3RMSA 3SWNB 3INZA 2LTOA 4PK4A 5IXBA 2KDSA 2CP5A 1N27A 2JXBA 4XTWA 3CCUQ 2LX7A 1Q81C 3C94A 5FWCA 3L2UA 3C12A 3VS4A 1Q82C 5GMKi 5CIUA 1QCNA 3SWNA 3META 3JB9H 5CQYA 3NTHA 4N4HA 2JZ2A 1E6GA 3VYHB 2EPDA 1TSFA 2ZCFB 3NGPA 2ED0A 2RJEA 5GANd 2GF7A 3C4SA 1KIKA 3C0CA 2IG0A 4AG2C 3JCMc 2X35A 2AZVA 1V1CA 3EG1A 5DY9A 3OYCA 1VQLT 1PKTA 1H641 2W10A 2KQWA 2A3LA 4X9CA 2L3QA 5J39A 4XU1A 2VXEA 2ESWA 1T0JA 2VKNA 2O88A 1JJ2P 1VQPQ 3LGLA 1Q82R 4M75E 5I21A 3GNFB 1BU1A 2DM1A 1ZBXA 5KYUB 1NLOC 5GANj 1YJ9Q 1IHWA 4M77G 4R55A 4DBRA 1X01A 2M0YA 1TH7A 2DXCA 3GF5A 5CKFA 3CCEQ 1M90C 1UE9A 2DLPA 4M78B 3CCLQ 2HNIA 2ED1A 4J9HA 1C6VX 3VUZA 4IURA 4QQ6A 3X25B 3G71T 2P4RA 1Y71A 2EYQA 4LDWA 5KYUA 3CCMT 1KD1C 2HEQA 2IIMA 1VQLA 4EMKC 2KBTA 3HPWA 4J8OA 4ANJA 3FC3A 3EH2A 2PU9B 2CZ6B 3A8HB 2KYMA 5GANg 4M78A 3CCST 4QVDA 3HFNA 5GAMe 2HKNA 1RAEB 2K9GA 2ZGWA 2MCNA 2JM9A 3MEAA 3X28B 1JXMA 2O9SA 4JRKA 3S3NA 1ZBJA 2VASA 3T9NA 3NHNA 4J7IA 3M0QA 2RM4A 1N5ZA 3M9QA 1M90R 4UC4A 2O2OA 2GGRA 1N9SA 1YCYA 2FO0A 3J81E 4LDYA 3TSZA 2DZ9A 3G71A 1X2QA 1UJ0A 2YT6A 2DTHA 1XQHA 3M5AA 4O6JA 2X4XA 2F2XA 3CCMA 4E6RA 1KD1R 3JCMV 5C0MA 3OS0A 3OS2A 5FRNA 3HFOA 5AT1B 4PJOE 1W6XA 4XU2A 1TUDA 2RK2A 2XI9A 1WJQA 4PFOA 5GMKh 4C8QF 2M02A 2VUBA 2LP5A 4BY6B 4JS5A 2NWMA 1ZA2B 3CXCS 2HCKA 3RKWA 1M1GA 1UDLA 4L6V5 1LNXA 3S3OA 3OYJA 1YIJT 1UGVA 1W2BP 4ZTFA 1D1CA 1RAFB 4D8DA 2P84A 5GAN5 1G3TA 3FEOA 3QG1A 3CC7T 3RBBB 4RTYA 1VQ7A 3ME9A 2JS2A 3KUFA 1R77A 2M51A 4A4EA 2J7IA 1VQMQ 5GAMf 4E7SA 1GCQC 2RQWA 2RA2A 1QQJA 3OYEA 3BFMA 4FSSA 3CD6Q 2D1XA 4L59A 2V26A 1YFNA 1QVFA 4M7DB 1Q81U 2MI6A 3EHRA 1VA7A 3EGXB 1JJ2S 2RJCA 1KK7A 1Q82U 2VB6A 1KJWA 1UGRB 2OTLQ 3QIIA 1ZUKA 2EYXA 1B7TA 3KXTA 3DLMA 1PRLC 1YIJA 2RI5A 4J5YA 3V7RA 5J3BA 1IREB 3ASKA 4OMOA 1ZHIA 1SRMA 3QDRB 4M7DA 1ABOA 2QEXT 2KI7A 3CC7A 2MIOA 3I55T 3VS3A 3EGXA 1ZSZB 4RTUA 3UA7A 4RUGA 4A4FA 1KQSP 1SG5A 2AKKA 2Y4YA 4HT8A 1DJ7B 1S72T 3CPWP 4F7UG 2E4HA 3FJ5A 3LH0A 2X4WA 4C5GA 2DMOA 5CK9A 5FROA 2AKLA 4PNOA 2EQIA 2EW3A 4BUGA 1BI3A 2V1QA 3OW2A 3RR6A 4M77F 4JLIA 1ZSZA 5D6YA 3H0HA 1BCOA 1JEGA 1PC0A 3QBYA 1OX9A 4C0DC 4CRIA 2ECZA 1G3YA 2DNUA 1U3OA 2JOYA 2YSQA 3GNGA 1LJOA 1TS9A 2KXDA 1Z9QA 2FRWA 5I2SA 4BE1A 2JNGA 4JUVA 1M90U 2QEXA 3M53A 2R5AA 3I55A 3FLGA 3PIOA 1XTDA 1GBQA 2XHCA 1HXDA 1QMCA 4OVAA 2CUDA 3H0FA 2OAWA 4XTVA 1S72A 5FU6B 4C92G 3JB9I 2QQAA 1TOVA 1KD1U 1D09B 4KRTA 1IB8A 5FW9A 2G6FX 3RDVA 4F7UA 2DIQA 5FU7C 3GLXA 4BACA 2DEUA 1OU9A 1I0CA 2DBKA 2RF0A 1IO6A 1M1KC 1Q95G 2EFIA 2YXYA 2L8DA 1RLQC 4DOVA 2ATCB 2KYBA 5HKCA 2EQUA 1PG5B 2FHDA 1Y0MA 4HKEA 1CSKA 2QXFA 1BI1A 1W2BS 2FRYA 2GBQA 4RTWA 2DXUA 5CAIA 4ATOA 2LQWA 4M78D 1WGSA 4BI3A 4HCZA 1YITT 3BY7A 4RTTA 3MKDA 1VIEA 5DLOA 3PFSA 5LJ3d 4PJJA 3VS0A 1BI2A 1BIBA 4QQDA 2EJGA 2QQSA 3MEVA 4C92A 4HVVA 2WACA 2PTKA 1I5LA 3TSWA 4RCBA 1CKBA 4N4IA 1YWOA 4PJNA 2YLBA 1OX8A 2CZ7B 2H3EB 3SWNC 3OYIA 2LJ3A 3CMAQ 1LOJA 2CYZB 4KUDK 3M58A 3G4ST 1VQ8T 1WYXA 1M30A 1VUBA 2DVEA 2SEMA 4O5VA 2K5FA 1OZ3A 2WSEE 1G8XA 2HQEA 2PVGB 1B07A 4M7AB 5L23A 3QZ5B 4C0FA 5GAMh 3I9QA 1D3BB 5KYXB 1EZZB 1KQSS 4J9IA 1GL5A 3CPWS 4CC2A 1UGSB 2CH4A 3LYIA 4FYVB 2CKKA 4AT1B 1M8MA 2RHUA 2LNHB 1D3BA 5KYXA 3JV3A 4RG2A 2K2VA 5KYWB 1AVZC 5GMKl 5GAN3 4QVZA 3G4SA 2EBPA 1VQ8A 1QCOA 2HQXA 2PNIA 1QVGA 2MOXA 1QP3A 4AFUC 1MV0B 2E3HA 1WHJA 2P4TA 4BDZA 3EG0A 1VOMA 5L8RE 1R0CB 5AYFA 5KYWA 3TEEA 2BUDA 4X1VA 3QUIA 3OYGA 1EFNA 2QQ9A 1QCFA 1FWZA 1E7OA 1SEMA 1VQ7Q 1G83A 1VQ5T 3RNJA 4M78C 3TVTA 2J6FA 3OYDA 5D6WA 2CDTA 3H0IA 2NUPB 1XNIA 3GIBA 2DX1A 1RLPC 4M7DD 4JJBA 3QXEB 4ZGDB 1NE8A 2L2PA 4FYYB 5CCAA 4OB3B 5IT9E 4J6WA 1TG0A 1W70A 5KE2A 2NUPA 1D0YA 1AWOA 3PVQA 2DIGA 1FX7A 1YJNA 4OB2B 3CC7Q 1QKXA 4CC4B 3UT1A 2KE9A 1YBYA 2RQRA 3F70A 2VVKA 1VQ5A 1I07A 1FYNA 3CQTA 2KRNA 1W1FA 2RK1A 3REAB 2QDYB 4FYWB 3NTIA 1H92A 2FL7A 2CP3A 2E12A 2E1HA 3JAME 3UF4A 1VQNT 2EIFA 2F1LA 3LW5E 1WLPB 2DJZA 2GTJA 4A4GA 1PSEA 5CO7A 3QWYA 4Y28E 1NLPC 3UPUA 3H6ZA 4LXCA 2RI3A 1EX4A 1UG1A 2RQUA 2SRCA 1K0SA 4BY6C 4FU6A 2O31A 1QP2A 2PVDB 2KK4A 5GAOr 4LNPA 2JM8A 1HYOA 3QYHB 4D6WA 4N0AA 3VUBA 3G7ZA 1RACB 1M3AA 2V8IA 1S72Q 5DM7R 2L0AA 3I5SA 2K5IA 5GANe 1D1AA 5GJVB 1VQNA 3A8GB 3D7SB 2A28A 5LJ3h 4JDSA 1G5VA 1GCPA 4M7DC 5GAOn 4C8QE 1YHQT 2JS0A 1HD3A 1B3QA 2KRSA 3J80E 4QQGA 1H3HA 4RMOA 4C92D 5M9OA 1AEYA 3CXCP 1M8VA 2RNAA 4DQ2A 2DJQA 4K11A 4BI8B 4RKUE
chains in the Genus database with same CATH topology
3CCVQ 2QEXQ 1VQ5Q 1Q81R 1VQ9Q 3I55Q 1QVGP 3CMEQ 1QVFP 3CCUQ 1VQKQ 3CC7Q 1VQMQ 1VQLQ 3CCRQ 2OTJQ 1M1KR 3I56Q 3CC4Q 1Q86R 3G6EQ 3CC2Q 1K8AR 1JJ2P 1VQPQ 1Q7YR 3CMAQ 1S72Q 1VQ4Q 1Q82R 1KD1R 1VQNQ 3CCSQ 2OTLQ 1VQ7Q 3CCJQ 3CD6Q 1W2BP 1NJIR 1K73R 1KC8R 1YHQQ 1YJ9Q 3G71Q 1YJNQ 3CXCP 1YI2Q 1KQSP 1M90R 1VQ6Q 1YJWQ 3OW2P 1N8RR 1K9MR 3CCQQ 3CCEQ 3G4SQ 3CPWP 1VQ8Q 1YIJQ 1YITQ 2QA4Q 3CCMQ 1VQOQ 3CCLQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCV Q;  2QEX Q;  1VQ5 Q;  1Q81 R;  1VQ9 Q;  3I55 Q;  1QVG P;  3CME Q;  1QVF P;  3CCU Q;  1VQK Q;  3CC7 Q;  1VQM Q;  1VQL Q;  3CCR Q;  2OTJ Q;  1M1K R;  3I56 Q;  3CC4 Q;  1Q86 R;  3G6E Q;  3CC2 Q;  1K8A R;  1JJ2 P;  1VQP Q;  1Q7Y R;  3CMA Q;  1S72 Q;  1VQ4 Q;  1Q82 R;  1KD1 R;  1VQN Q;  3CCS Q;  2OTL Q;  1VQ7 Q;  3CCJ Q;  3CD6 Q;  1W2B P;  1NJI R;  1K73 R;  1KC8 R;  1YHQ Q;  1YJ9 Q;  3G71 Q;  1YJN Q;  3CXC P;  1YI2 Q;  1KQS P;  1M90 R;  1VQ6 Q;  1YJW Q;  3OW2 P;  1N8R R;  1K9M R;  3CCQ Q;  3CCE Q;  3G4S Q;  3CPW P;  1VQ8 Q;  1YIJ Q;  1YIT Q;  2QA4 Q;  3CCM Q;  1VQO Q;  3CCL Q; 
#chains in the Genus database with same CATH topology
 4E7Z A;  3KBG A;  2QTV A;  3OQ5 A;  3H8Z A;  1ZSZ C;  4FW1 A;  4GBQ A;  4DEX A;  4RCC A;  2DVJ A;  1YJW T;  4Z88 A;  2K4Y A;  2RPN A;  2VWF A;  2PQW A;  2PVO B;  4IUQ A;  4DOW A;  2VXF A;  2VV5 A;  1G3W A;  2X4J A;  1UJY A;  3OY9 A;  1TTH B;  2QTX A;  4C5H A;  5GAN 2;  4M78 G;  1OYX A;  3A8L B;  3BW1 A;  2AK5 A;  2CP6 A;  1AWJ A;  4PL6 A;  2MK5 A;  4MZM A;  1MV3 A;  1YHQ A;  1JO8 A;  4LDU A;  2DO3 A;  2DD4 A;  1WHG A;  4J7F A;  1GBR A;  2JN0 A;  2FZC B;  4MDX A;  2COZ A;  2J05 A;  1JXO A;  3VS6 A;  5IXF A;  2R57 A;  5KE3 A;  4FM4 B;  2DTO A;  5EC7 A;  3HRS A;  2IPO B;  1UFF A;  4J9C A;  2KEA A;  2RHI A;  4BE0 A;  1M2V B;  5FWB A;  3UAT A;  2F5T X;  1K9M C;  2KMT A;  4JLG A;  1UGQ B;  1UTI A;  2X3X D;  2LCC A;  3HP9 A;  1YJW A;  4IIO A;  3OBW A;  5FU6 C;  2EJ9 A;  4M75 B;  3A5Z B;  4FCY A;  2J6K A;  5DLQ E;  4E7K A;  1JRI A;  1KC8 C;  3V7C A;  1M2V A;  1OZ2 A;  4NL2 A;  1CKA A;  2XKO C;  3X24 B;  3QJY A;  4M77 E;  3G4S Q;  1TU0 B;  2DL4 A;  2LX9 A;  1VQ8 Q;  4LUD A;  1XJW B;  1X6B A;  3EG9 B;  2DK3 A;  3UWN A;  2DF6 A;  5LL6 S;  4M75 A;  4XAX B;  2FPE A;  3URG A;  3CCQ T;  2DL5 A;  2DL7 A;  3MHX A;  1UB4 A;  1UUE A;  4C92 C;  2XK0 A;  2LQK A;  8AT1 B;  3VV0 A;  1OUL A;  2B86 A;  3I56 T;  3IQL A;  4QW2 A;  1K9M R;  1M5Q 1;  2K3B A;  1R0B G;  3O8V A;  2F2W A;  1I5O B;  1PM3 A;  3EG9 A;  4EMG A;  1PWT A;  3CME Q;  2VGM A;  1U8R A;  4LD6 A;  3VRZ A;  4F04 B;  1K8A C;  3OMG A;  2KGT A;  4II1 A;  2DL8 A;  4OML A;  1KC8 R;  2OX7 A;  4KH1 B;  3DB3 A;  3CCS A;  2O01 E;  1QLY A;  5KCH A;  3H41 A;  1I81 A;  1VQ9 Q;  3QSU A;  1PRM C;  3TQ7 P;  3GOX A;  1E6H A;  4YTL A;  3CCQ A;  2DXB A;  3SB2 A;  2G3R A;  2LT1 A;  3E9G A;  1RUW A;  4PFP A;  3CCJ Q;  4M7D G;  2ENM A;  2EQJ A;  3I56 A;  4QVC A;  1QWF A;  1YJN Q;  4PJO B;  1M9S A;  2R5M A;  2XG8 D;  1WJS A;  4EDU A;  1VQ6 Q;  2MAM A;  3CC2 T;  2KRO A;  4TVR A;  2QGG A;  4IUP A;  1VQO Q;  1VQ5 Q;  4FT4 A;  5KYN A;  4NS5 A;  1M3C A;  1SHG A;  5CKD A;  2F5K A;  4NL3 A;  3M55 A;  2LQ8 A;  1K8A R;  4XTY A;  3ZEH A;  2PUK B;  2K5L A;  1WA7 A;  1K76 A;  2V8K A;  4PJO A;  4JRP A;  5GAO m;  2LDM A;  2DE0 X;  2WSC E;  5GAN 8;  2I2L A;  3CC4 T;  4Z02 A;  1UEC A;  1IGQ A;  4LUE A;  1PD0 A;  4AFZ C;  1OPL A;  2JUF A;  4B9W A;  1KQS A;  3J7A F;  4FIB A;  3VKI A;  3JB9 D;  2RHY A;  2RQT A;  3CPW A;  2C06 A;  1U1S A;  1IXD A;  1NPR A;  4M4Z A;  1RAD B;  3CC2 A;  4M78 F;  3X26 B;  2M16 A;  3ZL7 C;  4KUL A;  1WZO A;  4J9F A;  1WPY A;  2RHX A;  3PTA A;  1QVF P;  1BKB A;  3PGG A;  1JQQ A;  4A54 A;  4DBF A;  1ABQ A;  1VQN Q;  2HL5 C;  2K2M A;  2QA4 T;  1ZUU A;  4OMP A;  3P8D A;  5GAN h;  2XDD A;  3CCV T;  3CC4 A;  3EAE A;  1PHT A;  1RI0 A;  4ZN3 A;  4EMH A;  3VJP A;  1BYM A;  4VUB A;  3ZFJ A;  2J6O A;  2JTF A;  4F7U E;  3GPL A;  2EGE A;  1TUC A;  1WXT A;  3JCM d;  3L2R A;  4PKC C;  5I11 A;  1K9M U;  3QPH A;  5KYY B;  3PVL A;  3BE3 A;  2E64 A;  3LWH A;  1ARK A;  2YUN A;  4X9D A;  4OB0 B;  2NUZ A;  2YUP A;  2EWN A;  4GLK A;  5LJ3 e;  1ZLM A;  2EQK A;  4P5N A;  4J9E A;  4DEY A;  4KT0 E;  1WX6 A;  1KC8 U;  2XID A;  4BE2 A;  1M3B A;  3SD4 A;  2OJ2 A;  2D0N A;  3NTK A;  2QA4 A;  5KYY A;  1K0X A;  3GBQ A;  3CCV A;  2FYK A;  2L3S A;  2BTT A;  2E70 A;  3EH1 A;  5J26 A;  2C0O A;  4WF2 A;  1YHQ Q;  5LJ5 d;  1Z9Z A;  1K73 C;  3WVE B;  3A8M B;  4N0A C;  3HRU A;  4C92 E;  4EMK B;  4ZN1 A;  3EHQ A;  3LH5 A;  4J9G A;  7AT1 B;  2CT4 A;  2JJ9 A;  3RUX A;  2LJ0 A;  2GQV A;  4AG1 C;  3G1J A;  2ZPB B;  4XU0 A;  3V8J A;  1TXQ A;  1RAG B;  2LNV A;  3BDU A;  1NJI C;  2LC4 A;  4M7A G;  1K8A U;  3JCM g;  1VQP T;  2YUO A;  4EMK A;  3H9N A;  5LJ5 j;  2YWW A;  1X69 A;  5A0G A;  1VIF A;  1BK2 A;  3M0R A;  3QJ6 A;  1PNJ A;  1X2K A;  1VQL Q;  4Q5W A;  4MZT A;  1YN8 A;  4M7D F;  4X34 A;  2EGC A;  2DAQ A;  3SDZ A;  3CCL T;  2DKG A;  1K73 R;  3LLR A;  2QI2 A;  1AWW A;  1X75 C;  4BI4 A;  2MWP A;  5FRM A;  4L5G A;  3A98 A;  1VYT A;  1PSF A;  5LJ3 f;  3EFO B;  5LJ5 g;  3M0T A;  2RH2 A;  1YIT A;  2F69 A;  4OMM A;  4E7J A;  1QKW A;  2P0K A;  1NJI R;  1WJR A;  2HSE B;  1KFZ A;  2E6Z A;  4E7I A;  1LVK A;  3WXM B;  3V8K A;  3G71 Q;  4JJC A;  1QVF S;  2E10 A;  4J83 A;  3TU4 K;  2A7Y A;  2AHJ B;  3PMI A;  4HVU A;  3RES A;  4AFQ C;  3MP6 A;  3UDC A;  1I1J A;  4M7A A;  3CBP A;  3CCM Q;  2CH4 W;  3EFO A;  3UA6 A;  4JS4 A;  4QT7 A;  3JCM b;  1WFW A;  3MJX A;  1N6A A;  5HK3 A;  2DIL A;  3CCL A;  1GFD A;  3CCS Q;  2GQI A;  3OBY A;  1WHH A;  2K3X A;  1K4U S;  2HBW A;  2DYB A;  2V8J A;  1KQ2 A;  2X3W D;  1WIE A;  4F7U F;  1KHC A;  3CCQ Q;  1VQ4 T;  2YRV A;  1C0M A;  2OI3 A;  4ESR A;  4PJO D;  5CKH A;  1B34 B;  3I56 Q;  1F1B B;  3AHU A;  1J3T A;  3OW2 S;  3S6W A;  2JTE A;  2HMA A;  2W0Z A;  1MNE A;  4ME7 A;  3MP1 A;  1IHV A;  4MZP A;  2Y90 A;  4Z8A A;  4M75 C;  3L1A A;  1B34 A;  4XU3 A;  4DBQ A;  1IZ6 A;  1KG1 A;  1PCX A;  1NYF A;  6AT1 B;  2XDB A;  2ZAE A;  4KH0 B;  2CT3 A;  9ATC B;  3M0U A;  5GAO p;  4C92 F;  2HZY A;  1VQM T;  1VQ4 A;  1VQK T;  1NG2 A;  4D8K A;  4ELZ C;  4F16 A;  3G6E T;  4EPC A;  4OGC A;  1YIJ Q;  2FG0 A;  2OAU A;  1M1F A;  2ZPH B;  1PD1 A;  1X6O A;  2ROL A;  1K1Z A;  3OMC A;  3CC2 Q;  4J6X A;  2ZPE B;  3E9F A;  3TCJ A;  2EYY A;  1FXX A;  2ROT A;  2XIC A;  2KVQ G;  2H3J A;  3JB9 G;  2XU8 A;  1MND A;  3OYB A;  1Y7X A;  3OYN A;  3JB9 J;  1BI0 A;  2ZPF B;  2DRK A;  3MPU B;  1IRX A;  4BB7 A;  2EJF A;  1K73 U;  3MCA B;  3Q1J A;  3CC4 Q;  1WHL A;  3L2W A;  1Q86 C;  1Y07 A;  1MHN A;  1I4K 1;  3JCM W;  1VQM A;  1VQK A;  4OF1 A;  4OMF B;  3OYK A;  3G6E A;  1SHF A;  3A8O B;  4OGE A;  2LCS A;  1VYU A;  3VYG A;  4A63 B;  2KRM A;  3PNW C;  4QKU A;  1NJI U;  2QEX Q;  2BIV A;  1TUG B;  3I55 Q;  1WQW A;  1O75 A;  4PJO C;  3EG3 A;  2LZ6 B;  4JZ4 A;  1D1B A;  2FZK B;  3M0P A;  5GAN 7;  2E3I A;  2DL3 A;  1HJD A;  3QO3 A;  1ZUY A;  5C6S A;  2QQR A;  1A0N B;  1OQK A;  2CS7 A;  3QWX X;  2GTO A;  2JTM A;  2A37 A;  2CZ0 B;  2DD5 A;  1Y57 A;  2MYS A;  5GMK j;  1RAH B;  3X20 B;  2XDP A;  4LD9 K;  3CCV Q;  2ZPI B;  3CXC A;  4FW2 A;  4OMQ A;  1V29 B;  1Q86 R;  4R0K A;  2YRD A;  2EGA A;  1YP5 A;  2GFA A;  2XD0 A;  2Y4X A;  2QAS A;  3KFV A;  3MEU A;  4A4H A;  1EIF A;  1MGQ A;  2A0F B;  2QDL A;  3CEY A;  1K9A A;  2AT1 B;  1BBZ A;  2C0T A;  3OYL A;  5CQX A;  4J6Y A;  4FT2 A;  5I2M A;  2C0I A;  4C8Q B;  1SSH A;  4ELY C;  3PE0 A;  3VRY A;  3DLL A;  1YI2 T;  3QYG B;  3VS2 A;  1U06 A;  1BCM A;  3OYY A;  1O9S A;  4LE9 A;  1QVG S;  1M2O A;  4J9B A;  4WTO B;  2BZX A;  1JJ2 A;  1NEG A;  2AIR B;  4F14 A;  2X4Y A;  2KAF A;  2X51 A;  4C8Q A;  1D0X A;  1KHI A;  4RTV A;  4M75 G;  4LDV A;  2K3Y A;  5GJW B;  2RI2 A;  2CRE A;  4AFS C;  4BDY A;  1FMK A;  4M7A D;  1HK9 A;  3QZ9 B;  2L89 A;  2CUB A;  3HKS A;  4OMN A;  5GAN f;  3LGF A;  3CMA T;  3FRN A;  3JSC A;  3JCM X;  1YIT Q;  2WSF E;  4M78 E;  4E47 A;  1NEB A;  1Q81 R;  3TRE A;  1YI2 A;  5IAY A;  1QVP A;  1Y96 B;  1MMD A;  2QAZ A;  2DBM A;  2HSP A;  3LWI A;  5HY6 A;  5GMK m;  2DZC A;  2GNC A;  4IUV A;  3L2Z A;  1NPP A;  4FYX B;  2JVV A;  2O9V A;  2ZPG B;  1Y96 A;  4ZGJ B;  1KQ1 A;  1MMN A;  3OA6 A;  1XOV A;  3JRZ A;  4V2S A;  2RJD A;  3JB9 F;  3REB B;  2E41 A;  2MMP A;  3CMA A;  1W4S A;  3I35 A;  1WI7 A;  1OV3 A;  4M77 B;  2BE7 D;  3BDL A;  4GLM A;  1FMV A;  3L2Q A;  3OSS C;  3SHW A;  3LX7 A;  4ZGE B;  1RAI B;  1N8R C;  3WVD B;  4KGV B;  1OEB A;  3DB4 A;  3OYA A;  1PKS A;  3CBM A;  3U23 A;  5IN1 A;  5KH6 A;  4PLI A;  4XK8 E;  4PJO G;  2VGN A;  4Y92 A;  4BD3 A;  1UGP B;  3M0S A;  1RAB B;  4ORZ A;  2EYW A;  4C0Z A;  3CCR T;  1LCK A;  4M77 A;  1Q86 U;  2DRM A;  2DYI A;  1VQ7 T;  2HD0 A;  1W2B A;  5KCO A;  4J9D A;  4HVW A;  5A0L A;  3OSV A;  1LPL A;  3EFS A;  1VQ4 Q;  1S1N A;  1Q7Y C;  4F17 A;  3HTR A;  4M7A C;  3MP8 A;  5GAN 6;  2HL3 A;  2EYZ A;  1OPK A;  2JW4 A;  4PJL A;  1AWX A;  2OTJ T;  5GAM d;  1YCS B;  2V1R A;  1N8R R;  3M59 A;  2YHT A;  1WHM A;  2DXT A;  3V8L A;  2X9H A;  3NMZ C;  8ATC B;  2RQV A;  2D9T A;  2K7A A;  1ZSG A;  5I22 A;  4M7D E;  3CCR A;  4EIK A;  2K6D A;  2CZ1 B;  3EFR A;  3FJP A;  1OOT A;  2K79 A;  1H3Z A;  4RG8 A;  4KBM B;  3JCM Q;  3L2V A;  3AT1 B;  2QGF B;  3FDR A;  2AZS A;  2D6F A;  1NBE B;  2JMC A;  5GAM j;  1VQK Q;  2QYZ A;  1T3S A;  2QG9 B;  3G6E Q;  1Q7Y R;  2MPX C;  1ACM B;  3HRT A;  2EAY A;  3JCM e;  2BZY A;  2D0Q B;  2BKD N;  2XMF A;  2HBP A;  2VYT A;  2OTJ A;  5FLX E;  2NUT B;  2DTI A;  1SPK A;  4OP0 A;  4CC7 A;  3OYH A;  3QHS A;  4M75 F;  5GAN 4;  2FVU A;  2RN8 A;  5CKE A;  5D7U A;  4CC3 A;  1G2B A;  2L3R A;  2PUO B;  3RKX A;  4NOY A;  5GAM g;  4FL6 A;  3THK A;  2NUT A;  2LRQ A;  5IHN A;  1N9R A;  5LJ5 e;  4E2F B;  2RO0 A;  2KR3 A;  1U1T A;  4KUI A;  3S3M A;  2NLU A;  1AZE A;  1X43 A;  2ABL A;  3MEW A;  3OS1 A;  1WNL A;  2LCL A;  2LVM A;  3EG2 A;  3A1P A;  2CSQ A;  2QK0 A;  2E5Q A;  4JJD A;  2KY9 A;  4C8Q D;  2A36 A;  3PT9 A;  2YDL A;  3CCU T;  1AOJ A;  1TWB A;  3OW2 P;  1UEB A;  4IKF A;  2CP2 A;  1M4Z A;  1RL2 A;  4GY5 A;  4F7U B;  3M4Y A;  2DPP B;  2DEQ A;  4MDW A;  4C5E A;  3EGD B;  2EKO A;  1WHK A;  1HSQ A;  4HCB A;  3JCM f;  2LT4 A;  4PLL A;  2ZZD A;  5A2Q E;  4MML A;  3PIP A;  2RMO A;  1OI1 A;  2FB7 A;  3GP8 A;  1SSF A;  4KGZ B;  2DER A;  4AMC A;  3R6O A;  3EGD A;  1MMG A;  4PJO F;  4RTX A;  4HCK A;  4IIM A;  1D0Z A;  1N8R U;  3CCU A;  4PFZ A;  2P0Q A;  4JJN K;  5HCK A;  1YI2 Q;  1YJW Q;  2E5K A;  4M75 D;  3OYF A;  2HKQ B;  2EKH A;  4C92 B;  5LJ5 f;  1MUZ A;  2BE9 B;  1BB9 A;  1YJ9 T;  5D6X A;  3PMT A;  2D8H A;  2L5Q A;  1OU8 A;  1C1A A;  1SF9 A;  3OYM A;  3CCE T;  3CPF A;  2HDA A;  5CR2 A;  4JRQ A;  3VU3 C;  2EQM A;  1KSW A;  1R8O B;  3C95 A;  1AZG B;  4XTU A;  2RJF A;  3VS1 A;  1Q7Y U;  4IUT A;  4M7A E;  1UHF A;  4JPB W;  3VS5 A;  5ECA A;  1AD5 A;  1M1K R;  3SFM A;  1IGU A;  4M77 D;  4CI0 C;  2BZ8 A;  2JMA A;  3NFC A;  1X6G A;  2FPD A;  1G3S A;  2CSI A;  2E65 A;  1VQP A;  2YRC A;  3M56 A;  4C8Q C;  2HQH A;  4R56 A;  3QKJ A;  3E2U A;  4DA4 A;  4XTZ A;  5LJ3 j;  1YJ9 A;  1JB0 E;  1WQ7 A;  1X27 A;  2FPF A;  1M27 C;  2CGH A;  4OB1 B;  3CCE A;  4ZNX A;  5A0D A;  3OB9 A;  2M0O A;  3FB9 A;  3V7S A;  1U5S A;  2P0P A;  1YWP A;  2I0N A;  1NM7 A;  2GCX A;  3CME T;  2E6N A;  2LJ1 A;  5GAO q;  4ZTJ A;  1NYG A;  3ZBD A;  4WCI A;  2KSS A;  2LQN A;  1MMA A;  2RD1 A;  2FZG B;  1GFC A;  2A08 A;  5LJ3 g;  2PZ1 A;  1QWE A;  4JRI A;  2YUQ A;  2VC8 A;  3M4G A;  4XQ3 A;  4B9X A;  2L3P A;  2IVW A;  1VQ9 T;  3M54 A;  1GCQ A;  1AT1 B;  4LN2 A;  1ZX6 A;  4RTZ A;  4HCC A;  2DET A;  3CCJ T;  1I8F A;  1JU5 C;  1H8K A;  1QVG P;  1YJN T;  4HT9 A;  3CCR Q;  5HK0 A;  1QW1 A;  2MWO A;  4FSX A;  1VQ6 T;  4E7L A;  3P8H A;  3JCM J;  1ZQ1 A;  3CME A;  1VQO T;  2GFU A;  1NZ9 A;  3HHT B;  3ULR B;  4Z89 A;  5GMK e;  1FMW A;  1JBM A;  3NPF A;  5CVI A;  3CD6 T;  4MMK A;  2KT8 A;  1T0H A;  2DFU A;  4C0D B;  2OTJ Q;  4C0G A;  1WXB A;  3RMQ A;  3RER A;  3RKY A;  4M77 C;  1VQ9 A;  4KGX B;  3SEM A;  3JCM h;  2OTL T;  2HAX A;  4Y91 A;  3E1S A;  3CCJ A;  4E7H A;  3ER0 A;  2QQB A;  3RIR A;  2D8J A;  5IHI A;  2JT4 A;  3HL8 A;  5EG2 A;  4XTX A;  3M57 A;  1VQ6 A;  1BIA A;  3FIF A;  4N4G A;  1GRI A;  4DBH A;  3CBO A;  1VQO A;  5IHK A;  1ZA1 B;  3P8B B;  4HA8 A;  4PJM A;  1T3L A;  2H8H A;  3MO8 A;  1UHC A;  5FU7 B;  2O4X B;  4M7A F;  1V76 A;  2LMJ A;  1P92 A;  1M1K U;  2KXC A;  3QDF A;  2K57 A;  5CKB A;  2B8A A;  1WDX A;  3CD6 A;  5LJ5 h;  2COW A;  3R6N A;  1SKU B;  2R58 A;  2YLC A;  2COY A;  2J06 A;  3E19 A;  2RB6 A;  3EGU A;  3OS5 A;  5IH2 A;  1WXU A;  5GAO l;  2OTL A;  2O4X A;  3O5Z A;  2MF2 A;  4C5I A;  3L42 A;  2M1H A;  2CP7 A;  2CP0 A;  2RHZ A;  3JCM P;  2QA4 Q;  4IUU A;  2NYS A;  2F2V A;  3DKM A;  4C8Q G;  1YNZ A;  4HXJ A;  2KNB B;  2EVR A;  2M9U A;  4B6M A;  2Z0W A;  4A4K A;  4A53 A;  1VYV A;  1AHJ B;  2FEI A;  3N5B B;  4LDX A;  1GXI E;  2KT1 A;  3HSB A;  3I5R A;  4JZ3 A;  3VS7 A;  1RI9 A;  1RAA B;  1SRL A;  2DA9 A;  3RMS A;  3SWN B;  3INZ A;  2LTO A;  4PK4 A;  5IXB A;  2KDS A;  2CP5 A;  1N27 A;  2JXB A;  4XTW A;  3CCU Q;  2LX7 A;  1Q81 C;  3C94 A;  5FWC A;  3L2U A;  3C12 A;  3VS4 A;  1Q82 C;  5GMK i;  5CIU A;  1QCN A;  3SWN A;  3MET A;  3JB9 H;  5CQY A;  3NTH A;  4N4H A;  2JZ2 A;  1E6G A;  3VYH B;  2EPD A;  1TSF A;  2ZCF B;  3NGP A;  2ED0 A;  2RJE A;  5GAN d;  2GF7 A;  3C4S A;  1KIK A;  3C0C A;  2IG0 A;  4AG2 C;  3JCM c;  2X35 A;  2AZV A;  1V1C A;  3EG1 A;  5DY9 A;  3OYC A;  1VQL T;  1PKT A;  1H64 1;  2W10 A;  2KQW A;  2A3L A;  4X9C A;  2L3Q A;  5J39 A;  4XU1 A;  2VXE A;  2ESW A;  1T0J A;  2VKN A;  2O88 A;  1JJ2 P;  1VQP Q;  3LGL A;  1Q82 R;  4M75 E;  5I21 A;  3GNF B;  1BU1 A;  2DM1 A;  1ZBX A;  5KYU B;  1NLO C;  5GAN j;  1YJ9 Q;  1IHW A;  4M77 G;  4R55 A;  4DBR A;  1X01 A;  2M0Y A;  1TH7 A;  2DXC A;  3GF5 A;  5CKF A;  3CCE Q;  1M90 C;  1UE9 A;  2DLP A;  4M78 B;  3CCL Q;  2HNI A;  2ED1 A;  4J9H A;  1C6V X;  3VUZ A;  4IUR A;  4QQ6 A;  3X25 B;  3G71 T;  2P4R A;  1Y71 A;  2EYQ A;  4LDW A;  5KYU A;  3CCM T;  1KD1 C;  2HEQ A;  2IIM A;  1VQL A;  4EMK C;  2KBT A;  3HPW A;  4J8O A;  4ANJ A;  3FC3 A;  3EH2 A;  2PU9 B;  2CZ6 B;  3A8H B;  2KYM A;  5GAN g;  4M78 A;  3CCS T;  4QVD A;  3HFN A;  5GAM e;  2HKN A;  1RAE B;  2K9G A;  2ZGW A;  2MCN A;  2JM9 A;  3MEA A;  3X28 B;  1JXM A;  2O9S A;  4JRK A;  3S3N A;  1ZBJ A;  2VAS A;  3T9N A;  3NHN A;  4J7I A;  3M0Q A;  2RM4 A;  1N5Z A;  3M9Q A;  1M90 R;  4UC4 A;  2O2O A;  2GGR A;  1N9S A;  1YCY A;  2FO0 A;  3J81 E;  4LDY A;  3TSZ A;  2DZ9 A;  3G71 A;  1X2Q A;  1UJ0 A;  2YT6 A;  2DTH A;  1XQH A;  3M5A A;  4O6J A;  2X4X A;  2F2X A;  3CCM A;  4E6R A;  1KD1 R;  3JCM V;  5C0M A;  3OS0 A;  3OS2 A;  5FRN A;  3HFO A;  5AT1 B;  4PJO E;  1W6X A;  4XU2 A;  1TUD A;  2RK2 A;  2XI9 A;  1WJQ A;  4PFO A;  5GMK h;  4C8Q F;  2M02 A;  2VUB A;  2LP5 A;  4BY6 B;  4JS5 A;  2NWM A;  1ZA2 B;  3CXC S;  2HCK A;  3RKW A;  1M1G A;  1UDL A;  4L6V 5;  1LNX A;  3S3O A;  3OYJ A;  1YIJ T;  1UGV A;  1W2B P;  4ZTF A;  1D1C A;  1RAF B;  4D8D A;  2P84 A;  5GAN 5;  1G3T A;  3FEO A;  3QG1 A;  3CC7 T;  3RBB B;  4RTY A;  1VQ7 A;  3ME9 A;  2JS2 A;  3KUF A;  1R77 A;  2M51 A;  4A4E A;  2J7I A;  1VQM Q;  5GAM f;  4E7S A;  1GCQ C;  2RQW A;  2RA2 A;  1QQJ A;  3OYE A;  3BFM A;  4FSS A;  3CD6 Q;  2D1X A;  4L59 A;  2V26 A;  1YFN A;  1QVF A;  4M7D B;  1Q81 U;  2MI6 A;  3EHR A;  1VA7 A;  3EGX B;  1JJ2 S;  2RJC A;  1KK7 A;  1Q82 U;  2VB6 A;  1KJW A;  1UGR B;  2OTL Q;  3QII A;  1ZUK A;  2EYX A;  1B7T A;  3KXT A;  3DLM A;  1PRL C;  1YIJ A;  2RI5 A;  4J5Y A;  3V7R A;  5J3B A;  1IRE B;  3ASK A;  4OMO A;  1ZHI A;  1SRM A;  3QDR B;  4M7D A;  1ABO A;  2QEX T;  2KI7 A;  3CC7 A;  2MIO A;  3I55 T;  3VS3 A;  3EGX A;  1ZSZ B;  4RTU A;  3UA7 A;  4RUG A;  4A4F A;  1KQS P;  1SG5 A;  2AKK A;  2Y4Y A;  4HT8 A;  1DJ7 B;  1S72 T;  3CPW P;  4F7U G;  2E4H A;  3FJ5 A;  3LH0 A;  2X4W A;  4C5G A;  2DMO A;  5CK9 A;  5FRO A;  2AKL A;  4PNO A;  2EQI A;  2EW3 A;  4BUG A;  1BI3 A;  2V1Q A;  3OW2 A;  3RR6 A;  4M77 F;  4JLI A;  1ZSZ A;  5D6Y A;  3H0H A;  1BCO A;  1JEG A;  1PC0 A;  3QBY A;  1OX9 A;  4C0D C;  4CRI A;  2ECZ A;  1G3Y A;  2DNU A;  1U3O A;  2JOY A;  2YSQ A;  3GNG A;  1LJO A;  1TS9 A;  2KXD A;  1Z9Q A;  2FRW A;  5I2S A;  4BE1 A;  2JNG A;  4JUV A;  1M90 U;  2QEX A;  3M53 A;  2R5A A;  3I55 A;  3FLG A;  3PIO A;  1XTD A;  1GBQ A;  2XHC A;  1HXD A;  1QMC A;  4OVA A;  2CUD A;  3H0F A;  2OAW A;  4XTV A;  1S72 A;  5FU6 B;  4C92 G;  3JB9 I;  2QQA A;  1TOV A;  1KD1 U;  1D09 B;  4KRT A;  1IB8 A;  5FW9 A;  2G6F X;  3RDV A;  4F7U A;  2DIQ A;  5FU7 C;  3GLX A;  4BAC A;  2DEU A;  1OU9 A;  1I0C A;  2DBK A;  2RF0 A;  1IO6 A;  1M1K C;  1Q95 G;  2EFI A;  2YXY A;  2L8D A;  1RLQ C;  4DOV A;  2ATC B;  2KYB A;  5HKC A;  2EQU A;  1PG5 B;  2FHD A;  1Y0M A;  4HKE A;  1CSK A;  2QXF A;  1BI1 A;  1W2B S;  2FRY A;  2GBQ A;  4RTW A;  2DXU A;  5CAI A;  4ATO A;  2LQW A;  4M78 D;  1WGS A;  4BI3 A;  4HCZ A;  1YIT T;  3BY7 A;  4RTT A;  3MKD A;  1VIE A;  5DLO A;  3PFS A;  5LJ3 d;  4PJJ A;  3VS0 A;  1BI2 A;  1BIB A;  4QQD A;  2EJG A;  2QQS A;  3MEV A;  4C92 A;  4HVV A;  2WAC A;  2PTK A;  1I5L A;  3TSW A;  4RCB A;  1CKB A;  4N4I A;  1YWO A;  4PJN A;  2YLB A;  1OX8 A;  2CZ7 B;  2H3E B;  3SWN C;  3OYI A;  2LJ3 A;  3CMA Q;  1LOJ A;  2CYZ B;  4KUD K;  3M58 A;  3G4S T;  1VQ8 T;  1WYX A;  1M30 A;  1VUB A;  2DVE A;  2SEM A;  4O5V A;  2K5F A;  1OZ3 A;  2WSE E;  1G8X A;  2HQE A;  2PVG B;  1B07 A;  4M7A B;  5L23 A;  3QZ5 B;  4C0F A;  5GAM h;  3I9Q A;  1D3B B;  5KYX B;  1EZZ B;  1KQS S;  4J9I A;  1GL5 A;  3CPW S;  4CC2 A;  1UGS B;  2CH4 A;  3LYI A;  4FYV B;  2CKK A;  4AT1 B;  1M8M A;  2RHU A;  2LNH B;  1D3B A;  5KYX A;  3JV3 A;  4RG2 A;  2K2V A;  5KYW B;  1AVZ C;  5GMK l;  5GAN 3;  4QVZ A;  3G4S A;  2EBP A;  1VQ8 A;  1QCO A;  2HQX A;  2PNI A;  1QVG A;  2MOX A;  1QP3 A;  4AFU C;  1MV0 B;  2E3H A;  1WHJ A;  2P4T A;  4BDZ A;  3EG0 A;  1VOM A;  5L8R E;  1R0C B;  5AYF A;  5KYW A;  3TEE A;  2BUD A;  4X1V A;  3QUI A;  3OYG A;  1EFN A;  2QQ9 A;  1QCF A;  1FWZ A;  1E7O A;  1SEM A;  1VQ7 Q;  1G83 A;  1VQ5 T;  3RNJ A;  4M78 C;  3TVT A;  2J6F A;  3OYD A;  5D6W A;  2CDT A;  3H0I A;  2NUP B;  1XNI A;  3GIB A;  2DX1 A;  1RLP C;  4M7D D;  4JJB A;  3QXE B;  4ZGD B;  1NE8 A;  2L2P A;  4FYY B;  5CCA A;  4OB3 B;  5IT9 E;  4J6W A;  1TG0 A;  1W70 A;  5KE2 A;  2NUP A;  1D0Y A;  1AWO A;  3PVQ A;  2DIG A;  1FX7 A;  1YJN A;  4OB2 B;  3CC7 Q;  1QKX A;  4CC4 B;  3UT1 A;  2KE9 A;  1YBY A;  2RQR A;  3F70 A;  2VVK A;  1VQ5 A;  1I07 A;  1FYN A;  3CQT A;  2KRN A;  1W1F A;  2RK1 A;  3REA B;  2QDY B;  4FYW B;  3NTI A;  1H92 A;  2FL7 A;  2CP3 A;  2E12 A;  2E1H A;  3JAM E;  3UF4 A;  1VQN T;  2EIF A;  2F1L A;  3LW5 E;  1WLP B;  2DJZ A;  2GTJ A;  4A4G A;  1PSE A;  5CO7 A;  3QWY A;  4Y28 E;  1NLP C;  3UPU A;  3H6Z A;  4LXC A;  2RI3 A;  1EX4 A;  1UG1 A;  2RQU A;  2SRC A;  1K0S A;  4BY6 C;  4FU6 A;  2O31 A;  1QP2 A;  2PVD B;  2KK4 A;  5GAO r;  4LNP A;  2JM8 A;  1HYO A;  3QYH B;  4D6W A;  4N0A A;  3VUB A;  3G7Z A;  1RAC B;  1M3A A;  2V8I A;  1S72 Q;  5DM7 R;  2L0A A;  3I5S A;  2K5I A;  5GAN e;  1D1A A;  5GJV B;  1VQN A;  3A8G B;  3D7S B;  2A28 A;  5LJ3 h;  4JDS A;  1G5V A;  1GCP A;  4M7D C;  5GAO n;  4C8Q E;  1YHQ T;  2JS0 A;  1HD3 A;  1B3Q A;  2KRS A;  3J80 E;  4QQG A;  1H3H A;  4RMO A;  4C92 D;  5M9O A;  1AEY A;  3CXC P;  1M8V A;  2RNA A;  4DQ2 A;  2DJQ A;  4K11 A;  4BI8 B;  4RKU E; 
#chains in the Genus database with same CATH homology
 3CCV Q;  2QEX Q;  1VQ5 Q;  1Q81 R;  1VQ9 Q;  3I55 Q;  1QVG P;  3CME Q;  1QVF P;  3CCU Q;  1VQK Q;  3CC7 Q;  1VQM Q;  1VQL Q;  3CCR Q;  2OTJ Q;  1M1K R;  3I56 Q;  3CC4 Q;  1Q86 R;  3G6E Q;  3CC2 Q;  1K8A R;  1JJ2 P;  1VQP Q;  1Q7Y R;  3CMA Q;  1S72 Q;  1VQ4 Q;  1Q82 R;  1KD1 R;  1VQN Q;  3CCS Q;  2OTL Q;  1VQ7 Q;  3CCJ Q;  3CD6 Q;  1W2B P;  1NJI R;  1K73 R;  1KC8 R;  1YHQ Q;  1YJ9 Q;  3G71 Q;  1YJN Q;  3CXC P;  1YI2 Q;  1KQS P;  1M90 R;  1VQ6 Q;  1YJW Q;  3OW2 P;  1N8R R;  1K9M R;  3CCQ Q;  3CCE Q;  3G4S Q;  3CPW P;  1VQ8 Q;  1YIJ Q;  1YIT Q;  2QA4 Q;  3CCM Q;  1VQO Q;  3CCL Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...