1VQ9Q

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq9Q00
3G71Q 3I55Q 1VQ4Q 1VQLQ 1YITQ 1KD1R 3CCSQ 1Q81R 3CCEQ 3CCVQ 1Q7YR 1M90R 3I56Q 1NJIR 2QEXQ 1VQ7Q 1YI2Q 1K8AR 1VQ9Q 3CC2Q 3OW2P 1QVFP 3CD6Q 3CC4Q 1VQKQ 1K73R 1YIJQ 2QA4Q 1VQOQ 1VQPQ 1QVGP 1M1KR 2OTJQ 3CMAQ 1W2BP 1YHQQ 1YJNQ 1VQNQ 1YJWQ 3CC7Q 3G4SQ 3CPWP 3CCQQ 3CXCP 1VQ5Q 3CMEQ 1VQ6Q 1Q86R 3CCRQ 1N8RR 1KQSP 2OTLQ 3CCLQ 3CCJQ 1VQ8Q 3CCMQ 1Q82R 1YJ9Q 1VQMQ 1KC8R 1S72Q 3G6EQ 3CCUQ 1K9MR 1JJ2P
chains in the Genus database with same CATH superfamily
1G8XA 2ZPGB 1D0XA 5CR2A 1Q7YR 3OY9A 3A8OB 4J6XA 3V8KA 1Y71A 2SRCA 3V8JA 4F7UG 2OTJA 1FMWA 3T9NA 4C92A 1ZUYA 2HMAA 2LCLA 2NUTB 5LJ3g 1NG2A 4AFUC 1GBRA 3CCJQ 4C8QB 3ASKA 4L6V5 5KE3A 4IUPA 3KXTA 1SPKA 1FMKA 1M3CA 2KAFA 3OYDA 2CP3A 2HL5C 2WSFE 5A0GA 4M7DD 1EZZB 1VQOA 2GBQA 4C92F 1CSKA 3LYIA 2CSQA 4R55A 3UPUA 2E70A 2M16A 3OB9A 4KUDK 1VQKT 3VUZA 1IREB 1B34B 1V1CA 2JM8A 3NPFA 1KHCA 2FPDA 1N8RU 3NHNA 2K3XA 4LDVA 1K73R 3CC2A 4N0AA 1SRMA 3JRZA 3JCMd 2LQNA 1VQPA 1KIKA 1OQKA 2FRWA 4N0AC 3CCVT 4RKUE 2QQSA 2EFIA 3GF5A 1RAHB 2MMPA 2RJCA 3CCJA 3QO3A 1ABQA 4C0DB 5FRMA 1OZ2A 1UGPB 4J6YA 2H8HA 1Q82C 3LWHA 3MEVA 4BE1A 4XTVA 4BDYA 4M7AG 1M90C 5A0DA 1QKWA 1PKTA 2XMFA 5KYXB 2J6OA 2FPFA 1TOVA 1B3QA 2LCCA 4ZTJA 3FEOA 5KYNA 3OYHA 1BI3A 4D8DA 3G71Q 1WHLA 1YJWT 2EPDA 5GAOn 4IUTA 1PG5B 4FT2A 3PIOA 3FIFA 3QWXX 2E6ZA 3V7SA 1X69A 2CP7A 5FU7C 1LCKA 3SD4A 1IGUA 1SSHA 5DLQE 4KH1B 5M9OA 3OYLA 4QQ6A 2ROLA 5CIUA 3BW1A 1RAEB 2FL7A 2DD4A 1YWPA 3CMET 1WHKA 2OTLT 2KRMA 3F70A 2RHUA 1KC8U 4RG2A 2KGTA 1OPKA 1MMAA 2DXCA 4P5NA 3RUXA 4M7DF 2RHIA 3G4SQ 4D6WA 1M27C 2E64A 2VVKA 4KRTA 3M0RA 2E6NA 1AWOA 1U3OA 1B07A 5CO7A 2D6FA 3CCUQ 2DE0X 3EGXB 1BCOA 4AFQC 1VQNT 3JAME 1YI2Q 1NPPA 2K5LA 3A1PA 2X51A 1Y96B 1WXUA 2FG0A 1KD1C 3WXMB 5CVIA 3FJ5A 4KGVB 2SEMA 5GANf 3QG1A 3G1JA 3QUIA 4DEXA 4WF2A 2AHJB 2EGEA 3FJPA 1PCXA 4N4GA 2RA2A 2RI5A 2X9HA 3H6ZA 3A8MB 3PFSA 4EMGA 4EMHA 3OS2A 4B9XA 2XU8A 4OB1B 4PFZA 4BE2A 4EPCA 1IZ6A 3A8GB 3L2RA 1PKSA 4QQGA 1ZBXA 1LPLA 4E7IA 1K8AC 2M51A 4EDUA 1TUGB 3RESA 3FB9A 3G4SA 1TSFA 3CCRQ 3RDVA 1K9MR 3R6OA 3CCUA 4OB0B 1UHCA 5GAOm 4HCKA 2YT6A 3TSZA 4J9FA 3OYEA 4O5VA 3JB9D 1QKXA 1YI2A 1T0HA 1VQ9A 3QHSA 2WSEE 1HXDA 2ENMA 1WIEA 2BZXA 2DFUA 1WJQA 1AWWA 1QVFP 5GAMh 1N9RA 1YCSB 1YJNT 2RMOA 1H3HA 1WXBA 3URGA 2HCKA 2RPNA 4J6WA 2CKKA 4OMQA 2E3IA 1H8KA 2Y4YA 4FYYB 4JRQA 4FIBA 2L89A 1YITT 4IURA 5GMKm 2DL4A 1JBMA 1C1AA 1UGSB 3CCRA 3OSVA 3TEEA 3NFCA 1U1TA 1NEGA 3GNFB 4Q5WA 1ABOA 3VS5A 1VQ6T 4DA4A 1YIJQ 4HCCA 1VQKA 3OYNA 2IIMA 1YJWQ 2AZVA 3LH0A 1W4SA 3J81E 2DVJA 3JCMb 1Q82R 4X34A 1S72Q 5IXBA 1Y07A 3GOXA 2DL8A 4QVZA 4BDZA 1M90R 4C0FA 3QZ9B 4EMKB 3EG1A 4IUQA 2KNBB 3UT1A 1OYXA 2CP5A 2F5KA 4XQ3A 5GAMf 3CMEQ 4PLLA 2OTLQ 3I56T 1SKUB 3A5ZB 1RL2A 2K5IA 5CKDA 2GQIA 2PZ1A 1I81A 5KYWA 5GANe 5GAN5 3MCAB 1VQ7Q 1IB8A 5LJ5f 4R56A 3JB9F 1X75C 2EAYA 1NPRA 4M7DB 2GFAA 1YIJA 2YHTA 1VQNQ 1N27A 2DKGA 2DEQA 4N4IA 4XU3A 1YJWA 4BD3A 4WTOB 2O9VA 2LCSA 2GNCA 2VGMA 5HKCA 4L5GA 2OTJT 1S72A 4OB3B 5KYYA 2PQWA 2L3SA 3OQ5A 4XU0A 3VRZA 4PJOD 1AHJB 2VXEA 2RB6A 4B9WA 1K1ZA 3QBYA 1MMGA 3EG9B 1WA7A 3CMEA 2OTLA 3AHUA 4C0ZA 2NUTA 1G3TA 1KD1R 2DM1A 4C8QA 4HCBA 3R6NA 4Y91A 1G5VA 1OU8A 1VQ7A 1BKBA 2PVOB 4C8QC 4AG2C 1G3SA 4FW1A 3X24B 2A08A 2MWOA 3H0IA 1VQNA 3E1SA 3V7RA 4E7KA 1NBEB 4RMOA 2XDDA 5GAOp 2LJ0A 4ZGDB 1HYOA 3L2ZA 2RQRA 3VKIA 3GIBA 1JB0E 1T3SA 1H3ZA 1K8AR 2C06A 1B34A 2YLBA 1Q86U 1PHTA 4FSXA 4QT7A 2BZ8A 3CCJT 4XU1A 5FU6B 2NUZA 1NJIC 1X2KA 1WJSA 3HFNA 2PU9B 3EG2A 4JLIA 4LDWA 4A53A 1FXXA 5FRNA 3X25B 3ZFJA 1YITQ 1UHFA 1EIFA 1OX8A 2YDLA 5CKFA 2ZPFB 4LUDA 2LT1A 3JSCA 4J8OA 2HAXA 2MF2A 3EGUA 4M78D 3NTKA 4C0DC 1T0JA 4DBHA 2DZCA 3SB2A 4RTXA 4F16A 5IXFA 4FL6A 3VRYA 3LLRA 2JS0A 2KEAA 2DYIA 4AFZC 2DJQA 2MI6A 2KQWA 2RI3A 2ZPHB 2O2OA 5KYXA 2QXFA 1RAAB 2GTJA 4JRIA 3OYJA 4QVDA 1SSFA 1ZSZC 2CUBA 1PWTA 1ZUUA 3MP6A 2HDAA 4Z8AA 3OYMA 5FWBA 1YBYA 2DK3A 4PJOF 3M56A 3JCMX 1X43A 4M75D 2LTOA 4J9GA 2EGAA 1UGQB 2XDPA 4PJLA 2QEXT 5LJ5e 4XK8E 1V76A 4D8KA 3CCMQ 2EQMA 2ABLA 2D1XA 4EIKA 2DXBA 2RO0A 2DL7A 1YITA 3O5ZA 2L8DA 2LMJA 3QKJA 1OU9A 2K6DA 1JJ2S 3M53A 3VUBA 3G71T 3LWIA 1TH7A 2JNGA 2NUPB 1X6BA 1QWFA 3OW2S 3C94A 2OAUA 3RKWA 3P8DA 3M57A 3SWNB 2DBMA 1OEBA 2ESWA 3CPWS 2K57A 3CXCS 4RTZA 2KR3A 3EGXA 5CQYA 5LJ3e 2RJDA 4B6MA 2EYZA 1M30A 1Y96A 1VQ4T 4CC3A 2OX7A 3OS0A 3QSUA 4N4HA 5KCOA 2FEIA 2ZAEA 3G6EQ 2Z0WA 3CCMA 3VS6A 1M1KU 2BE7D 3ZL7C 2CZ6B 3UA6A 5GAMg 1GFCA 3LW5E 4C92G 4MDXA 3WVEB 1AD5A 4M78F 3CCUT 1U1SA 5IAYA 1JJ2A 4VUBA 4M4ZA 1YI2T 1QP3A 5GANd 1JO8A 2CREA 3OW2A 1J3TA 1M2VB 2A0FB 3HSBA 3L42A 3H0HA 2MAMA 2HQXA 2FVUA 3CPWA 3CXCA 1K9MC 2BIVA 4M77E 1WZOA 2AZSA 1X27A 1ACMB 2DF6A 4J83A 1M1FA 2QQRA 1QWEA 4C92C 4J9CA 2C0OA 1WQ7A 4PNOA 2P0KA 8ATCB 3G6EA 3LGLA 5ECAA 5D7UA 3QYGB 1PSFA 3CCRT 2YLCA 2L3RA 4OMPA 1EX4A 2NWMA 3A98A 3CCQQ 1I8FA 1PNJA 3E2UA 1GCQA 2AK5A 1NYFA 2QYZA 2JMCA 1YFNA 1QCNA 2A7YA 5CK9A 3UA7A 2V1QA 1N8RC 1NJIR 4JRKA 1IGQA 1ZUKA 3ZBDA 2X3WD 2FZGB 1YJ9T 4C5IA 3X26B 1R0CB 4M7AD 2F69A 1AWJA 2H3JA 1NYGA 1VQ8Q 4LUEA 4M78E 2LNVA 2JJ9A 2XI9A 4MMKA 3M4YA 3HRSA 1ZBJA 1WI7A 3CCEQ 2HQEA 1NLOC 2QEXQ 2CZ7B 1XQHA 2DPPB 1RACB 1AVZC 4PJOB 2EQKA 4RTYA 4ZGJB 2V1RA 3H8ZA 2QTVA 4M7DG 4EMKA 2CH4A 1QVPA 1PRLC 1VIFA 2RQVA 3CCST 1WHGA 3CCQA 1BI2A 4EMKC 1IXDA 2Y4XA 1YIJT 4X1VA 4M75E 4M77B 5FROA 2LVMA 2CDTA 5GANh 2EYYA 4F14A 2MK5A 1W2BA 1ARKA 4FYXB 5C6SA 4FM4B 2PVGB 5D6YA 2PVDB 2K7AA 4BI8B 1N5ZA 2QI2A 1S72T 1VYUA 1FX7A 2E5QA 4M7DA 2FZCB 1MMNA 3HHTB 5DLOA 2FRYA 2O9SA 5GAMd 4M7DC 1M3AA 2X35A 2RD1A 3TVTA 1VQ4Q 4C0GA 2EYXA 2DD5A 3A8HB 4CI0C 3CCEA 1KC8C 2QEXA 2AT1B 5GMKj 2DO3A 2K2MA 5D6WA 5LJ5d 2YWWA 3HKSA 2A3LA 2L5QA 2KT8A 2NYSA 4PLIA 1JEGA 3H9NA 1X6GA 1VQ7T 1XTDA 2CSIA 2IPOB 2XK0A 3EG9A 2VGNA 5KH6A 2M02A 2BTTA 2MCNA 3I5SA 3HL8A 3G71A 4M78B 4NL3A 1M1KR 4O6JA 2P84A 1UEBA 4IIOA 2D0NA 4CC4B 4M7AF 1TWBA 2YRDA 3RR6A 1D0YA 2MPXC 2DL3A 2L2PA 2K9GA 2KRNA 1AWXA 2CT3A 2E3HA 1LOJA 4F7UE 3CPFA 4LNPA 1OI1A 1UJYA 1VQ4A 3TREA 5I2MA 2QASA 1IRXA 4OMLA 3PVLA 3BDUA 2KROA 4M75B 3Q1JA 1JU5C 2JT4A 5DY9A 4HT9A 1B7TA 1K4US 1ZHIA 4LDYA 1WPYA 1S1NA 1D1AA 2D9TA 1SHGA 5CKBA 1VYTA 1RLQC 2KE9A 2W10A 2CZ1B 3HRTA 3WVDB 1OV3A 1CKBA 5AYFA 3OYFA 3MP8A 3SHWA 3HTRA 3L2QA 2VV5A 3L2VA 2K79A 3PNWC 4KBMB 2EBPA 2RJFA 4DOWA 4LD6A 1I1JA 4HVVA 1UE9A 5GJVB 4CC7A 3JCMP 4JJCA 3E19A 3VS3A 3EGDB 2OJ2A 1YJ9Q 5IHNA 2RNAA 3TQ7P 5KYUB 3GNGA 2LQKA 3S3NA 1W1FA 3EFOB 2EIFA 1TUCA 4JUVA 1KG1A 4J9HA 1U06A 4QQDA 4PJMA 1PRMC 1G83A 1W6XA 4A63B 1TS9A 3SEMA 2VC8A 2LRQA 5LJ5h 1N8RR 2YRCA 1ZA1B 2DLPA 4UC4A 1X6OA 2EJFA 2MYSA 1IHWA 4NL2A 4M7AE 1WXTA 4HVWA 5GAN6 3CCSQ 1E6GA 1WLPB 2P0PA 2HNIA 2QTXA 1Y0MA 2EGCA 2K3YA 2ZPBB 3CQTA 4F7UB 1RAIB 2F1LA 2HSEB 2JTEA 3MJXA 3META 5LL6S 1E6HA 3LX7A 1EFNA 3FC3A 1M9SA 2KK4A 1D09B 2PNIA 1LNXA 1U5SA 2KT1A 5GAN3 1W70A 2LDMA 1I5LA 3P8HA 4XU2A 1YJ9A 4NOYA 2NUPA 1AZEA 2K2VA 4ZTFA 2LQWA 1MMDA 1OULA 5DM7R 4BACA 3SWNA 4OMNA 1BIAA 5LJ3h 1DJ7B 4BI4A 3CCMT 5D6XA 2JUFA 3QWYA 5HK3A 1K76A 3JCMJ 2F2VA 3OMGA 1WQWA 3EHQA 5C0MA 4A54A 3JCMc 2DRMA 3JV3A 4MZTA 1QVGA 2O88A 2VUBA 3SFMA 2LT4A 2DTHA 3CCSA 3CEYA 1N6AA 3M58A 3QPHA 4XTUA 4IKFA 1WFWA 1UGVA 4Y92A 3BFMA 4R0KA 3OYIA 3PMTA 1KC8R 4C8QG 2RHYA 3I9QA 2L0AA 1JJ2P 3I5RA 1VQLQ 1KFZA 2J6FA 3VS2A 1M2VA 3OW2P 2RQUA 2RI2A 1U8RA 3CC4Q 4PJJA 4KGXB 3QXEB 3H0FA 4M7AB 3G6ET 1RAGB 2HL3A 5FLXE 5I21A 3CPWP 1KQ1A 3CXCP 1Q81U 3CBOA 4RTTA 1GXIE 4J5YA 2KRSA 2EKOA 4ZNXA 5LJ3f 1I07A 1WX6A 2KBTA 2DA9A 3VYHB 3SDZA 3RBBB 2ZPEB 4M77D 5I11A 1D0ZA 1YCYA 1MGQA 3INZA 3DLMA 2F5TX 4XTZA 2D0QB 3VV0A 4AFSC 2C0TA 3M5AA 2VXFA 1AZGB 4GLKA 3PGGA 1Q7YU 2KXDA 2PUKB 2JW4A 3GBQA 4JJBA 4LD9K 1QCOA 4XAXB 1MV3A 3MKDA 4PFPA 4YTLA 3OA6A 1KK7A 2GTOA 2VB6A 1Q86C 1WHJA 2MWPA 4BB7A 1VQLA 2O01E 4PJOG 1YNZA 1OPLA 2RK2A 2EYWA 2IG0A 2B86A 3CC4A 3RNJA 3RKYA 5GANg 2PUOB 3KBGA 3QDFA 1AEYA 3BE3A 2V8KA 3JCMe 1UG1A 3OYYA 2K5FA 3DB4A 1VQMQ 2EVRA 3OYCA 5J26A 3S6WA 4HKEA 2MIOA 2LP5A 2M9UA 2M0YA 2AKLA 1VIEA 3CCQT 3PVQA 1NM7A 3E9FA 8AT1B 1M8MA 4OMMA 1JQQA 4BE0A 1WYXA 4J9BA 4LXCA 5IHIA 2DJZA 4ATOA 4PJOA 2K3BA 3AT1B 2HKNA 4QW2A 4FYVB 4MMLA 1KQ2A 3FLGA 1G2BA 2DZ9A 4PJOC 2O4XB 5L23A 3M0UA 3KFVA 2CUDA 1K73U 3U23A 4Z89A 2FYKA 2G6FX 2QQ9A 3CC7T 4DOVA 2E41A 5GAMj 3VYGA 1A0NB 4M77A 1YWOA 2VWFA 2QAZA 2CZ0B 1VQ8T 2A36A 4LE9A 1ZSGA 5KCHA 3CCET 4DBRA 4ZGEB 3MEUA 3M0PA 1VQMA 2YUOA 1YHQT 5CQXA 1M8VA 1RI0A 1FMVA 1SHFA 4M77F 2DL5A 4ESRA 3CD6Q 4M78G 3CBMA 4F17A 4J9IA 3M0QA 2GF7A 3PT9A 3VU3C 1T3LA 4RCCA 1Z9ZA 2HD0A 3PIPA 2HBWA 2E4HA 2KMTA 2XD0A 1HK9A 1UDLA 1XJWB 1RUWA 5CKEA 1UTIA 3DLLA 1KQSS 2R58A 4ZN1A 2F2XA 4M78A 2DRKA 3EG3A 2FB7A 1C0MA 4M78C 1M1KC 2VASA 4IUVA 1SRLA 3RIRA 2CS7A 3MPUB 3I55Q 5HY6A 1BCMA 3OMCA 2HEQA 4E6RA 3CD6A 2DETA 1ZLMA 1HJDA 2V8IA 4M75A 1D3BB 1KJWA 2QQAA 4PK4A 3REAB 4C5GA 5IT9E 4FW2A 2OI3A 2XDBA 4M75C 2DTIA 5LJ5g 4OGEA 2JXBA 2ZZDA 1IHVA 4C5EA 4JZ3A 1Q95G 1KQSA 1QMCA 2P4RA 2DIGA 4V2SA 1P92A 2VYTA 1GCPA 5EG2A 4M75F 1QP2A 5A2QE 3IQLA 4FSSA 1WGSA 2RH2A 3RKXA 2EJ9A 4ANJA 3EGDA 3I55A 3JB9H 3CC2Q 1Z9QA 4MZMA 5KYUA 1VQPQ 3EFOA 1K9MU 1WHHA 4DEYA 1SG5A 2Y90A 4J7IA 3PMIA 2CP0A 2RN8A 4KT0E 5CAIA 1Q86R 1BYMA 1TTHB 3M59A 3VJPA 3GLXA 4A4HA 3MP1A 1GCQC 4OMFB 1D1CA 5GAOq 1W2BS 4IIMA 3EFRA 1M4ZA 4WCIA 1UB4A 1X2QA 2DXTA 2X4JA 3D7SB 3OBYA 4AMCA 3CC7Q 3NTIA 5AT1B 3QJYA 4F7UA 1VQ5Q 2X4YA 1NLPC 4BY6B 4FYWB 4KGZB 2RM4A 3CMAT 3KUFA 1TU0B 2JVVA 1BIBA 2LJ3A 4DBQA 2YUQA 4F04B 2K4YA 1YHQQ 1GRIA 1OX9A 4F7UF 4LN2A 2O31A 1O75A 2FHDA 2NLUA 3MEWA 3HRUA 3V8LA 1YN8A 2FPEA 4ORZA 3QYHB 2DERA 4JS5A 2DNUA 1WJRA 2DVEA 3TCJA 1Q82U 1QVGP 1YP5A 2RJEA 2JS2A 4JRPA 1OOTA 1BK2A 1N9SA 1ZSZB 3BDLA 1M90U 5CKHA 3PE0A 3GPLA 3CC7A 2EWNA 3CCLQ 2GCXA 4AG1C 1VQ5A 2EW3A 4E7ZA 1M1GA 3EH2A 5IN1A 1CKAA 2HZYA 1VQ8A 2EYQA 2DIQA 2XICA 1H92A 3QJ6A 2HSPA 3UATA 2E65A 2KI7A 3HP9A 2ATCB 1JRIA 3S3MA 2JTFA 2KY9A 5GAOr 1O9SA 1RAFB 2QK0A 2OAWA 1YHQA 4XTXA 1MV0B 4M7AA 4DQ2A 2YUPA 2P4TA 1TUDA 2E5KA 5CCAA 1HD3A 4C92E 5L8RE 3P8BB 4M7AC 4ELZC 2FZKB 1I5OB 2X4WA 5GAN2 3JCMV 2L3QA 5GMKe 1K0XA 1C6VX 1AOJA 1VQLT 3OYGA 2CP2A 2W0ZA 3JB9J 1LVKA 2D8JA 3CC4T 3CCLA 2BUDA 4ME7A 4PJNA 2IVWA 3X20B 2DXUA 5LJ3d 1VQ9Q 3I35A 4PL6A 2AIRB 2JTMA 1F1BB 2COYA 1BBZA 4JS4A 4RTVA 2J05A 4RTUA 2D8HA 3BY7A 1KD1U 4GY5A 3JCMh 3S3OA 3UF4A 5KE2A 4PFOA 4RTWA 4DBFA 3FRNA 2HKQB 3ME9A 4MDWA 5FU6C 4OGCA 2JM9A 3HFOA 3REBB 3UWNA 3M55A 1I4K1 2HQHA 3OYBA 4TVRA 4CRIA 1K8AU 3QZ5B 4FU6A 1ZQ1A 2G3RA 1FWZA 4JZ4A 4ELYC 4OB2B 2O4XA 3M54A 2FO0A 4IUUA 2LX9A 2KSSA 2LC4A 2VKNA 1I0CA 1V29B 1M3BA 1UECA 1VQKQ 4C92B 3CMAQ 1PD1A 1VQMT 2B8AA 3VS7A 4HCZA 4QKUA 4BUGA 4GBQA 4XTWA 1PC0A 1VUBA 4M7DE 2R5AA 2GQVA 4KULA 4PKCC 3L1AA 4GLMA 1RADB 1QVGS 2DX1A 3CCVQ 2DILA 1PD0A 3JB9G 3OS1A 2EQIA 3JCMf 4NS5A 2WACA 1VOMA 2QDLA 3MHXA 4CC2A 2J06A 3ULRB 2J7IA 2QG9B 5J3BA 2KXCA 3OSSC 2QA4T 3JCMW 1R8OB 3L2WA 3GP8A 1SEMA 4A4EA 2JZ2A 4K11A 2RK1A 3EFSA 3QIIA 1QQJA 2BZYA 3MO8A 2DTOA 4Z88A 3NGPA 4JLGA 4HA8A 3CMAA 2COZA 2I0NA 3SWNC 1MNEA 3RERA 2WSCE 2ROTA 3CD6T 4LDXA 3VS1A 2CGHA 4J9EA 1MNDA 4C8QD 2DYBA 2L3PA 2ZPIB 2GGRA 1QW1A 3M4GA 2C0IA 2YSQA 3CCVA 5GANj 3VS4A 1UFFA 2QQBA 4XTYA 2P0QA 2E10A 2KDSA 5IHKA 3ER0A 4E7HA 4Z02A 1D3BA 4LDUA 3V7CA 6AT1B 1UGRB 4JJNK 4II1A 4E7LA 1PM3A 2KYBA 5FU7B 1MHNA 5J39A 2CYZB 1AT1B 1H641 2LJ1A 1R0BG 3J7AF 1Q81C 1X01A 3I55T 2EQUA 4X9DA 1KSWA 1KQSP 1VYVA 2DEUA 4OVAA 2BE9B 1WHMA 1NEBA 5I2SA 1BU1A 4A4GA 5A0LA 1QCFA 2V8JA 3M0TA 1Q7YC 5IH2A 2J6KA 2QGGA 2YRVA 2H3EB 1TG0A 3LH5A 2EJGA 3CBPA 1VQOT 3QDRB 3X28B 2RHXA 4E47A 1BI1A 3JCMQ 5GAN7 4E7JA 1BI0A 2HBPA 1IO6A 1K0SA 2RQTA 2E12A 3HPWA 5HCKA 1QVFS 5I22A 2XKOC 2KVQG 3J80E 4BI3A 1XNIA 2X3XD 3UDCA 3CC2T 3RMSA 3N5BB 3DKMA 2QGFB 4ZN3A 3M9QA 1VQPT 4M77G 4C8QF 5EC7A 4C5HA 2LX7A 4E2FB 1LJOA 1WNLA 3OYKA 2A28A 4BY6C 4JDSA 1YJNQ 2LQ8A 2R57A 1NJIU 3PTAA 4HT8A 4J7FA 2ZGWA 5GAN4 5GAOl 1K73C 5GMKi 2DMOA 3C12A 2XG8D 2AKKA 2BKDN 2M0OA 1R77A 4RUGA 3A8LB 3DB3A 1K9AA 2I2LA 3EH1A 1TXQA 4MZPA 1E7OA 2M1HA 4FCYA 1VQ5T 3G7ZA 2QA4Q 4JJDA 5HK0A 2KYMA 4KUIA 1W2BP 1FYNA 4M77C 2JN0A 1GFDA 3JB9I 2XHCA 4HVUA 3C0CA 1QVFA 4Y28E 1VQ6Q 3OBWA 2A37A 4OF1A 2YXYA 1QLYA 4J9DA 5LJ5j 1ZSZA 1NE8A 5GAMe 2JOYA 4HXJA 1PSEA 2V26A 5GMKl 1KHIA 4JPBW 1BB9A 3C95A 1G3YA 4A4FA 1M5Q1 2CP6A 3L2UA 1NZ9A 7AT1B 1YJNA 3THKA 1RI9A 2QDYB 2ED1A 2COWA 1GBQA 1ZA2B 3MEAA 1UJ0A 3ZEHA 3O8VA 4KH0B 3JCMg 4QVCA 1WDXA 1Y7XA 2CH4W 3I56Q 1UUEA 2MOXA 5GMKh 3VS0A 3CCLT 1SF9A 3OS5A 4M75G 4C8QE 3NMZC 2QA4A 5LJ3j 4C92D 3TSWA 1RLPC 1VA7A 1GL5A 3FDRA 2XIDA 1OZ3A 2PTKA 3H41A 4A4KA 1HSQA 1XOVA 4L59A 1VQ6A 2CT4A 1M2OA 5FW9A 4OMOA 4AT1B 3C4SA 3EG0A 2RQWA 2R5MA 3LGFA 1ZX6A 4FT4A 3NTHA 3RMQA 3TU4K 2DAQA 2OTJQ 4RCBA 2EKHA 3OYAA 2DBKA 3EHRA 2GFUA 9ATCB 5FWCA 4OP0A 1JXMA 5KYWB 2E1HA 2JMAA 2ED0A 2X4XA 2F2WA 1JXOA 3EAEA 2EQJA 2RF0A 2LZ6B 1Q81R 3G4ST 2RHZA 4E7SA 3I56A 1MUZA 1RABB 2YUNA 4RG8A 1VQOQ 5GAN8 3E9GA 3M0SA 1Y57A 2ECZA 1D1BA 4PJOE 2LNHB 1VQ9T 4X9CA 1G3WA 5KYYB 2ZCFB 5GJWB
chains in the Genus database with same CATH topology
3G71Q 3I55Q 1VQ4Q 1VQLQ 1YITQ 1KD1R 3CCSQ 1Q81R 3CCEQ 3CCVQ 1Q7YR 1M90R 3I56Q 1NJIR 2QEXQ 1VQ7Q 1YI2Q 1K8AR 1VQ9Q 3CC2Q 3OW2P 1QVFP 3CD6Q 3CC4Q 1VQKQ 1K73R 1YIJQ 2QA4Q 1VQOQ 1VQPQ 1QVGP 1M1KR 2OTJQ 3CMAQ 1W2BP 1YHQQ 1YJNQ 1VQNQ 1YJWQ 3CC7Q 3G4SQ 3CPWP 3CCQQ 3CXCP 1VQ5Q 3CMEQ 1VQ6Q 1Q86R 3CCRQ 1N8RR 1KQSP 2OTLQ 3CCLQ 3CCJQ 1VQ8Q 3CCMQ 1Q82R 1YJ9Q 1VQMQ 1KC8R 1S72Q 3G6EQ 3CCUQ 1K9MR 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G71 Q;  3I55 Q;  1VQ4 Q;  1VQL Q;  1YIT Q;  1KD1 R;  3CCS Q;  1Q81 R;  3CCE Q;  3CCV Q;  1Q7Y R;  1M90 R;  3I56 Q;  1NJI R;  2QEX Q;  1VQ7 Q;  1YI2 Q;  1K8A R;  1VQ9 Q;  3CC2 Q;  3OW2 P;  1QVF P;  3CD6 Q;  3CC4 Q;  1VQK Q;  1K73 R;  1YIJ Q;  2QA4 Q;  1VQO Q;  1VQP Q;  1QVG P;  1M1K R;  2OTJ Q;  3CMA Q;  1W2B P;  1YHQ Q;  1YJN Q;  1VQN Q;  1YJW Q;  3CC7 Q;  3G4S Q;  3CPW P;  3CCQ Q;  3CXC P;  1VQ5 Q;  3CME Q;  1VQ6 Q;  1Q86 R;  3CCR Q;  1N8R R;  1KQS P;  2OTL Q;  3CCL Q;  3CCJ Q;  1VQ8 Q;  3CCM Q;  1Q82 R;  1YJ9 Q;  1VQM Q;  1KC8 R;  1S72 Q;  3G6E Q;  3CCU Q;  1K9M R;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 1G8X A;  2ZPG B;  1D0X A;  5CR2 A;  1Q7Y R;  3OY9 A;  3A8O B;  4J6X A;  3V8K A;  1Y71 A;  2SRC A;  3V8J A;  4F7U G;  2OTJ A;  1FMW A;  3T9N A;  4C92 A;  1ZUY A;  2HMA A;  2LCL A;  2NUT B;  5LJ3 g;  1NG2 A;  4AFU C;  1GBR A;  3CCJ Q;  4C8Q B;  3ASK A;  4L6V 5;  5KE3 A;  4IUP A;  3KXT A;  1SPK A;  1FMK A;  1M3C A;  2KAF A;  3OYD A;  2CP3 A;  2HL5 C;  2WSF E;  5A0G A;  4M7D D;  1EZZ B;  1VQO A;  2GBQ A;  4C92 F;  1CSK A;  3LYI A;  2CSQ A;  4R55 A;  3UPU A;  2E70 A;  2M16 A;  3OB9 A;  4KUD K;  1VQK T;  3VUZ A;  1IRE B;  1B34 B;  1V1C A;  2JM8 A;  3NPF A;  1KHC A;  2FPD A;  1N8R U;  3NHN A;  2K3X A;  4LDV A;  1K73 R;  3CC2 A;  4N0A A;  1SRM A;  3JRZ A;  3JCM d;  2LQN A;  1VQP A;  1KIK A;  1OQK A;  2FRW A;  4N0A C;  3CCV T;  4RKU E;  2QQS A;  2EFI A;  3GF5 A;  1RAH B;  2MMP A;  2RJC A;  3CCJ A;  3QO3 A;  1ABQ A;  4C0D B;  5FRM A;  1OZ2 A;  1UGP B;  4J6Y A;  2H8H A;  1Q82 C;  3LWH A;  3MEV A;  4BE1 A;  4XTV A;  4BDY A;  4M7A G;  1M90 C;  5A0D A;  1QKW A;  1PKT A;  2XMF A;  5KYX B;  2J6O A;  2FPF A;  1TOV A;  1B3Q A;  2LCC A;  4ZTJ A;  3FEO A;  5KYN A;  3OYH A;  1BI3 A;  4D8D A;  3G71 Q;  1WHL A;  1YJW T;  2EPD A;  5GAO n;  4IUT A;  1PG5 B;  4FT2 A;  3PIO A;  3FIF A;  3QWX X;  2E6Z A;  3V7S A;  1X69 A;  2CP7 A;  5FU7 C;  1LCK A;  3SD4 A;  1IGU A;  1SSH A;  5DLQ E;  4KH1 B;  5M9O A;  3OYL A;  4QQ6 A;  2ROL A;  5CIU A;  3BW1 A;  1RAE B;  2FL7 A;  2DD4 A;  1YWP A;  3CME T;  1WHK A;  2OTL T;  2KRM A;  3F70 A;  2RHU A;  1KC8 U;  4RG2 A;  2KGT A;  1OPK A;  1MMA A;  2DXC A;  4P5N A;  3RUX A;  4M7D F;  2RHI A;  3G4S Q;  4D6W A;  1M27 C;  2E64 A;  2VVK A;  4KRT A;  3M0R A;  2E6N A;  1AWO A;  1U3O A;  1B07 A;  5CO7 A;  2D6F A;  3CCU Q;  2DE0 X;  3EGX B;  1BCO A;  4AFQ C;  1VQN T;  3JAM E;  1YI2 Q;  1NPP A;  2K5L A;  3A1P A;  2X51 A;  1Y96 B;  1WXU A;  2FG0 A;  1KD1 C;  3WXM B;  5CVI A;  3FJ5 A;  4KGV B;  2SEM A;  5GAN f;  3QG1 A;  3G1J A;  3QUI A;  4DEX A;  4WF2 A;  2AHJ B;  2EGE A;  3FJP A;  1PCX A;  4N4G A;  2RA2 A;  2RI5 A;  2X9H A;  3H6Z A;  3A8M B;  3PFS A;  4EMG A;  4EMH A;  3OS2 A;  4B9X A;  2XU8 A;  4OB1 B;  4PFZ A;  4BE2 A;  4EPC A;  1IZ6 A;  3A8G B;  3L2R A;  1PKS A;  4QQG A;  1ZBX A;  1LPL A;  4E7I A;  1K8A C;  2M51 A;  4EDU A;  1TUG B;  3RES A;  3FB9 A;  3G4S A;  1TSF A;  3CCR Q;  3RDV A;  1K9M R;  3R6O A;  3CCU A;  4OB0 B;  1UHC A;  5GAO m;  4HCK A;  2YT6 A;  3TSZ A;  4J9F A;  3OYE A;  4O5V A;  3JB9 D;  1QKX A;  1YI2 A;  1T0H A;  1VQ9 A;  3QHS A;  2WSE E;  1HXD A;  2ENM A;  1WIE A;  2BZX A;  2DFU A;  1WJQ A;  1AWW A;  1QVF P;  5GAM h;  1N9R A;  1YCS B;  1YJN T;  2RMO A;  1H3H A;  1WXB A;  3URG A;  2HCK A;  2RPN A;  4J6W A;  2CKK A;  4OMQ A;  2E3I A;  1H8K A;  2Y4Y A;  4FYY B;  4JRQ A;  4FIB A;  2L89 A;  1YIT T;  4IUR A;  5GMK m;  2DL4 A;  1JBM A;  1C1A A;  1UGS B;  3CCR A;  3OSV A;  3TEE A;  3NFC A;  1U1T A;  1NEG A;  3GNF B;  4Q5W A;  1ABO A;  3VS5 A;  1VQ6 T;  4DA4 A;  1YIJ Q;  4HCC A;  1VQK A;  3OYN A;  2IIM A;  1YJW Q;  2AZV A;  3LH0 A;  1W4S A;  3J81 E;  2DVJ A;  3JCM b;  1Q82 R;  4X34 A;  1S72 Q;  5IXB A;  1Y07 A;  3GOX A;  2DL8 A;  4QVZ A;  4BDZ A;  1M90 R;  4C0F A;  3QZ9 B;  4EMK B;  3EG1 A;  4IUQ A;  2KNB B;  3UT1 A;  1OYX A;  2CP5 A;  2F5K A;  4XQ3 A;  5GAM f;  3CME Q;  4PLL A;  2OTL Q;  3I56 T;  1SKU B;  3A5Z B;  1RL2 A;  2K5I A;  5CKD A;  2GQI A;  2PZ1 A;  1I81 A;  5KYW A;  5GAN e;  5GAN 5;  3MCA B;  1VQ7 Q;  1IB8 A;  5LJ5 f;  4R56 A;  3JB9 F;  1X75 C;  2EAY A;  1NPR A;  4M7D B;  2GFA A;  1YIJ A;  2YHT A;  1VQN Q;  1N27 A;  2DKG A;  2DEQ A;  4N4I A;  4XU3 A;  1YJW A;  4BD3 A;  4WTO B;  2O9V A;  2LCS A;  2GNC A;  2VGM A;  5HKC A;  4L5G A;  2OTJ T;  1S72 A;  4OB3 B;  5KYY A;  2PQW A;  2L3S A;  3OQ5 A;  4XU0 A;  3VRZ A;  4PJO D;  1AHJ B;  2VXE A;  2RB6 A;  4B9W A;  1K1Z A;  3QBY A;  1MMG A;  3EG9 B;  1WA7 A;  3CME A;  2OTL A;  3AHU A;  4C0Z A;  2NUT A;  1G3T A;  1KD1 R;  2DM1 A;  4C8Q A;  4HCB A;  3R6N A;  4Y91 A;  1G5V A;  1OU8 A;  1VQ7 A;  1BKB A;  2PVO B;  4C8Q C;  4AG2 C;  1G3S A;  4FW1 A;  3X24 B;  2A08 A;  2MWO A;  3H0I A;  1VQN A;  3E1S A;  3V7R A;  4E7K A;  1NBE B;  4RMO A;  2XDD A;  5GAO p;  2LJ0 A;  4ZGD B;  1HYO A;  3L2Z A;  2RQR A;  3VKI A;  3GIB A;  1JB0 E;  1T3S A;  1H3Z A;  1K8A R;  2C06 A;  1B34 A;  2YLB A;  1Q86 U;  1PHT A;  4FSX A;  4QT7 A;  2BZ8 A;  3CCJ T;  4XU1 A;  5FU6 B;  2NUZ A;  1NJI C;  1X2K A;  1WJS A;  3HFN A;  2PU9 B;  3EG2 A;  4JLI A;  4LDW A;  4A53 A;  1FXX A;  5FRN A;  3X25 B;  3ZFJ A;  1YIT Q;  1UHF A;  1EIF A;  1OX8 A;  2YDL A;  5CKF A;  2ZPF B;  4LUD A;  2LT1 A;  3JSC A;  4J8O A;  2HAX A;  2MF2 A;  3EGU A;  4M78 D;  3NTK A;  4C0D C;  1T0J A;  4DBH A;  2DZC A;  3SB2 A;  4RTX A;  4F16 A;  5IXF A;  4FL6 A;  3VRY A;  3LLR A;  2JS0 A;  2KEA A;  2DYI A;  4AFZ C;  2DJQ A;  2MI6 A;  2KQW A;  2RI3 A;  2ZPH B;  2O2O A;  5KYX A;  2QXF A;  1RAA B;  2GTJ A;  4JRI A;  3OYJ A;  4QVD A;  1SSF A;  1ZSZ C;  2CUB A;  1PWT A;  1ZUU A;  3MP6 A;  2HDA A;  4Z8A A;  3OYM A;  5FWB A;  1YBY A;  2DK3 A;  4PJO F;  3M56 A;  3JCM X;  1X43 A;  4M75 D;  2LTO A;  4J9G A;  2EGA A;  1UGQ B;  2XDP A;  4PJL A;  2QEX T;  5LJ5 e;  4XK8 E;  1V76 A;  4D8K A;  3CCM Q;  2EQM A;  2ABL A;  2D1X A;  4EIK A;  2DXB A;  2RO0 A;  2DL7 A;  1YIT A;  3O5Z A;  2L8D A;  2LMJ A;  3QKJ A;  1OU9 A;  2K6D A;  1JJ2 S;  3M53 A;  3VUB A;  3G71 T;  3LWI A;  1TH7 A;  2JNG A;  2NUP B;  1X6B A;  1QWF A;  3OW2 S;  3C94 A;  2OAU A;  3RKW A;  3P8D A;  3M57 A;  3SWN B;  2DBM A;  1OEB A;  2ESW A;  3CPW S;  2K57 A;  3CXC S;  4RTZ A;  2KR3 A;  3EGX A;  5CQY A;  5LJ3 e;  2RJD A;  4B6M A;  2EYZ A;  1M30 A;  1Y96 A;  1VQ4 T;  4CC3 A;  2OX7 A;  3OS0 A;  3QSU A;  4N4H A;  5KCO A;  2FEI A;  2ZAE A;  3G6E Q;  2Z0W A;  3CCM A;  3VS6 A;  1M1K U;  2BE7 D;  3ZL7 C;  2CZ6 B;  3UA6 A;  5GAM g;  1GFC A;  3LW5 E;  4C92 G;  4MDX A;  3WVE B;  1AD5 A;  4M78 F;  3CCU T;  1U1S A;  5IAY A;  1JJ2 A;  4VUB A;  4M4Z A;  1YI2 T;  1QP3 A;  5GAN d;  1JO8 A;  2CRE A;  3OW2 A;  1J3T A;  1M2V B;  2A0F B;  3HSB A;  3L42 A;  3H0H A;  2MAM A;  2HQX A;  2FVU A;  3CPW A;  3CXC A;  1K9M C;  2BIV A;  4M77 E;  1WZO A;  2AZS A;  1X27 A;  1ACM B;  2DF6 A;  4J83 A;  1M1F A;  2QQR A;  1QWE A;  4C92 C;  4J9C A;  2C0O A;  1WQ7 A;  4PNO A;  2P0K A;  8ATC B;  3G6E A;  3LGL A;  5ECA A;  5D7U A;  3QYG B;  1PSF A;  3CCR T;  2YLC A;  2L3R A;  4OMP A;  1EX4 A;  2NWM A;  3A98 A;  3CCQ Q;  1I8F A;  1PNJ A;  3E2U A;  1GCQ A;  2AK5 A;  1NYF A;  2QYZ A;  2JMC A;  1YFN A;  1QCN A;  2A7Y A;  5CK9 A;  3UA7 A;  2V1Q A;  1N8R C;  1NJI R;  4JRK A;  1IGQ A;  1ZUK A;  3ZBD A;  2X3W D;  2FZG B;  1YJ9 T;  4C5I A;  3X26 B;  1R0C B;  4M7A D;  2F69 A;  1AWJ A;  2H3J A;  1NYG A;  1VQ8 Q;  4LUE A;  4M78 E;  2LNV A;  2JJ9 A;  2XI9 A;  4MMK A;  3M4Y A;  3HRS A;  1ZBJ A;  1WI7 A;  3CCE Q;  2HQE A;  1NLO C;  2QEX Q;  2CZ7 B;  1XQH A;  2DPP B;  1RAC B;  1AVZ C;  4PJO B;  2EQK A;  4RTY A;  4ZGJ B;  2V1R A;  3H8Z A;  2QTV A;  4M7D G;  4EMK A;  2CH4 A;  1QVP A;  1PRL C;  1VIF A;  2RQV A;  3CCS T;  1WHG A;  3CCQ A;  1BI2 A;  4EMK C;  1IXD A;  2Y4X A;  1YIJ T;  4X1V A;  4M75 E;  4M77 B;  5FRO A;  2LVM A;  2CDT A;  5GAN h;  2EYY A;  4F14 A;  2MK5 A;  1W2B A;  1ARK A;  4FYX B;  5C6S A;  4FM4 B;  2PVG B;  5D6Y A;  2PVD B;  2K7A A;  4BI8 B;  1N5Z A;  2QI2 A;  1S72 T;  1VYU A;  1FX7 A;  2E5Q A;  4M7D A;  2FZC B;  1MMN A;  3HHT B;  5DLO A;  2FRY A;  2O9S A;  5GAM d;  4M7D C;  1M3A A;  2X35 A;  2RD1 A;  3TVT A;  1VQ4 Q;  4C0G A;  2EYX A;  2DD5 A;  3A8H B;  4CI0 C;  3CCE A;  1KC8 C;  2QEX A;  2AT1 B;  5GMK j;  2DO3 A;  2K2M A;  5D6W A;  5LJ5 d;  2YWW A;  3HKS A;  2A3L A;  2L5Q A;  2KT8 A;  2NYS A;  4PLI A;  1JEG A;  3H9N A;  1X6G A;  1VQ7 T;  1XTD A;  2CSI A;  2IPO B;  2XK0 A;  3EG9 A;  2VGN A;  5KH6 A;  2M02 A;  2BTT A;  2MCN A;  3I5S A;  3HL8 A;  3G71 A;  4M78 B;  4NL3 A;  1M1K R;  4O6J A;  2P84 A;  1UEB A;  4IIO A;  2D0N A;  4CC4 B;  4M7A F;  1TWB A;  2YRD A;  3RR6 A;  1D0Y A;  2MPX C;  2DL3 A;  2L2P A;  2K9G A;  2KRN A;  1AWX A;  2CT3 A;  2E3H A;  1LOJ A;  4F7U E;  3CPF A;  4LNP A;  1OI1 A;  1UJY A;  1VQ4 A;  3TRE A;  5I2M A;  2QAS A;  1IRX A;  4OML A;  3PVL A;  3BDU A;  2KRO A;  4M75 B;  3Q1J A;  1JU5 C;  2JT4 A;  5DY9 A;  4HT9 A;  1B7T A;  1K4U S;  1ZHI A;  4LDY A;  1WPY A;  1S1N A;  1D1A A;  2D9T A;  1SHG A;  5CKB A;  1VYT A;  1RLQ C;  2KE9 A;  2W10 A;  2CZ1 B;  3HRT A;  3WVD B;  1OV3 A;  1CKB A;  5AYF A;  3OYF A;  3MP8 A;  3SHW A;  3HTR A;  3L2Q A;  2VV5 A;  3L2V A;  2K79 A;  3PNW C;  4KBM B;  2EBP A;  2RJF A;  4DOW A;  4LD6 A;  1I1J A;  4HVV A;  1UE9 A;  5GJV B;  4CC7 A;  3JCM P;  4JJC A;  3E19 A;  3VS3 A;  3EGD B;  2OJ2 A;  1YJ9 Q;  5IHN A;  2RNA A;  3TQ7 P;  5KYU B;  3GNG A;  2LQK A;  3S3N A;  1W1F A;  3EFO B;  2EIF A;  1TUC A;  4JUV A;  1KG1 A;  4J9H A;  1U06 A;  4QQD A;  4PJM A;  1PRM C;  1G83 A;  1W6X A;  4A63 B;  1TS9 A;  3SEM A;  2VC8 A;  2LRQ A;  5LJ5 h;  1N8R R;  2YRC A;  1ZA1 B;  2DLP A;  4UC4 A;  1X6O A;  2EJF A;  2MYS A;  1IHW A;  4NL2 A;  4M7A E;  1WXT A;  4HVW A;  5GAN 6;  3CCS Q;  1E6G A;  1WLP B;  2P0P A;  2HNI A;  2QTX A;  1Y0M A;  2EGC A;  2K3Y A;  2ZPB B;  3CQT A;  4F7U B;  1RAI B;  2F1L A;  2HSE B;  2JTE A;  3MJX A;  3MET A;  5LL6 S;  1E6H A;  3LX7 A;  1EFN A;  3FC3 A;  1M9S A;  2KK4 A;  1D09 B;  2PNI A;  1LNX A;  1U5S A;  2KT1 A;  5GAN 3;  1W70 A;  2LDM A;  1I5L A;  3P8H A;  4XU2 A;  1YJ9 A;  4NOY A;  2NUP A;  1AZE A;  2K2V A;  4ZTF A;  2LQW A;  1MMD A;  1OUL A;  5DM7 R;  4BAC A;  3SWN A;  4OMN A;  1BIA A;  5LJ3 h;  1DJ7 B;  4BI4 A;  3CCM T;  5D6X A;  2JUF A;  3QWY A;  5HK3 A;  1K76 A;  3JCM J;  2F2V A;  3OMG A;  1WQW A;  3EHQ A;  5C0M A;  4A54 A;  3JCM c;  2DRM A;  3JV3 A;  4MZT A;  1QVG A;  2O88 A;  2VUB A;  3SFM A;  2LT4 A;  2DTH A;  3CCS A;  3CEY A;  1N6A A;  3M58 A;  3QPH A;  4XTU A;  4IKF A;  1WFW A;  1UGV A;  4Y92 A;  3BFM A;  4R0K A;  3OYI A;  3PMT A;  1KC8 R;  4C8Q G;  2RHY A;  3I9Q A;  2L0A A;  1JJ2 P;  3I5R A;  1VQL Q;  1KFZ A;  2J6F A;  3VS2 A;  1M2V A;  3OW2 P;  2RQU A;  2RI2 A;  1U8R A;  3CC4 Q;  4PJJ A;  4KGX B;  3QXE B;  3H0F A;  4M7A B;  3G6E T;  1RAG B;  2HL3 A;  5FLX E;  5I21 A;  3CPW P;  1KQ1 A;  3CXC P;  1Q81 U;  3CBO A;  4RTT A;  1GXI E;  4J5Y A;  2KRS A;  2EKO A;  4ZNX A;  5LJ3 f;  1I07 A;  1WX6 A;  2KBT A;  2DA9 A;  3VYH B;  3SDZ A;  3RBB B;  2ZPE B;  4M77 D;  5I11 A;  1D0Z A;  1YCY A;  1MGQ A;  3INZ A;  3DLM A;  2F5T X;  4XTZ A;  2D0Q B;  3VV0 A;  4AFS C;  2C0T A;  3M5A A;  2VXF A;  1AZG B;  4GLK A;  3PGG A;  1Q7Y U;  2KXD A;  2PUK B;  2JW4 A;  3GBQ A;  4JJB A;  4LD9 K;  1QCO A;  4XAX B;  1MV3 A;  3MKD A;  4PFP A;  4YTL A;  3OA6 A;  1KK7 A;  2GTO A;  2VB6 A;  1Q86 C;  1WHJ A;  2MWP A;  4BB7 A;  1VQL A;  2O01 E;  4PJO G;  1YNZ A;  1OPL A;  2RK2 A;  2EYW A;  2IG0 A;  2B86 A;  3CC4 A;  3RNJ A;  3RKY A;  5GAN g;  2PUO B;  3KBG A;  3QDF A;  1AEY A;  3BE3 A;  2V8K A;  3JCM e;  1UG1 A;  3OYY A;  2K5F A;  3DB4 A;  1VQM Q;  2EVR A;  3OYC A;  5J26 A;  3S6W A;  4HKE A;  2MIO A;  2LP5 A;  2M9U A;  2M0Y A;  2AKL A;  1VIE A;  3CCQ T;  3PVQ A;  1NM7 A;  3E9F A;  8AT1 B;  1M8M A;  4OMM A;  1JQQ A;  4BE0 A;  1WYX A;  4J9B A;  4LXC A;  5IHI A;  2DJZ A;  4ATO A;  4PJO A;  2K3B A;  3AT1 B;  2HKN A;  4QW2 A;  4FYV B;  4MML A;  1KQ2 A;  3FLG A;  1G2B A;  2DZ9 A;  4PJO C;  2O4X B;  5L23 A;  3M0U A;  3KFV A;  2CUD A;  1K73 U;  3U23 A;  4Z89 A;  2FYK A;  2G6F X;  2QQ9 A;  3CC7 T;  4DOV A;  2E41 A;  5GAM j;  3VYG A;  1A0N B;  4M77 A;  1YWO A;  2VWF A;  2QAZ A;  2CZ0 B;  1VQ8 T;  2A36 A;  4LE9 A;  1ZSG A;  5KCH A;  3CCE T;  4DBR A;  4ZGE B;  3MEU A;  3M0P A;  1VQM A;  2YUO A;  1YHQ T;  5CQX A;  1M8V A;  1RI0 A;  1FMV A;  1SHF A;  4M77 F;  2DL5 A;  4ESR A;  3CD6 Q;  4M78 G;  3CBM A;  4F17 A;  4J9I A;  3M0Q A;  2GF7 A;  3PT9 A;  3VU3 C;  1T3L A;  4RCC A;  1Z9Z A;  2HD0 A;  3PIP A;  2HBW A;  2E4H A;  2KMT A;  2XD0 A;  1HK9 A;  1UDL A;  1XJW B;  1RUW A;  5CKE A;  1UTI A;  3DLL A;  1KQS S;  2R58 A;  4ZN1 A;  2F2X A;  4M78 A;  2DRK A;  3EG3 A;  2FB7 A;  1C0M A;  4M78 C;  1M1K C;  2VAS A;  4IUV A;  1SRL A;  3RIR A;  2CS7 A;  3MPU B;  3I55 Q;  5HY6 A;  1BCM A;  3OMC A;  2HEQ A;  4E6R A;  3CD6 A;  2DET A;  1ZLM A;  1HJD A;  2V8I A;  4M75 A;  1D3B B;  1KJW A;  2QQA A;  4PK4 A;  3REA B;  4C5G A;  5IT9 E;  4FW2 A;  2OI3 A;  2XDB A;  4M75 C;  2DTI A;  5LJ5 g;  4OGE A;  2JXB A;  2ZZD A;  1IHV A;  4C5E A;  4JZ3 A;  1Q95 G;  1KQS A;  1QMC A;  2P4R A;  2DIG A;  4V2S A;  1P92 A;  2VYT A;  1GCP A;  5EG2 A;  4M75 F;  1QP2 A;  5A2Q E;  3IQL A;  4FSS A;  1WGS A;  2RH2 A;  3RKX A;  2EJ9 A;  4ANJ A;  3EGD A;  3I55 A;  3JB9 H;  3CC2 Q;  1Z9Q A;  4MZM A;  5KYU A;  1VQP Q;  3EFO A;  1K9M U;  1WHH A;  4DEY A;  1SG5 A;  2Y90 A;  4J7I A;  3PMI A;  2CP0 A;  2RN8 A;  4KT0 E;  5CAI A;  1Q86 R;  1BYM A;  1TTH B;  3M59 A;  3VJP A;  3GLX A;  4A4H A;  3MP1 A;  1GCQ C;  4OMF B;  1D1C A;  5GAO q;  1W2B S;  4IIM A;  3EFR A;  1M4Z A;  4WCI A;  1UB4 A;  1X2Q A;  2DXT A;  2X4J A;  3D7S B;  3OBY A;  4AMC A;  3CC7 Q;  3NTI A;  5AT1 B;  3QJY A;  4F7U A;  1VQ5 Q;  2X4Y A;  1NLP C;  4BY6 B;  4FYW B;  4KGZ B;  2RM4 A;  3CMA T;  3KUF A;  1TU0 B;  2JVV A;  1BIB A;  2LJ3 A;  4DBQ A;  2YUQ A;  4F04 B;  2K4Y A;  1YHQ Q;  1GRI A;  1OX9 A;  4F7U F;  4LN2 A;  2O31 A;  1O75 A;  2FHD A;  2NLU A;  3MEW A;  3HRU A;  3V8L A;  1YN8 A;  2FPE A;  4ORZ A;  3QYH B;  2DER A;  4JS5 A;  2DNU A;  1WJR A;  2DVE A;  3TCJ A;  1Q82 U;  1QVG P;  1YP5 A;  2RJE A;  2JS2 A;  4JRP A;  1OOT A;  1BK2 A;  1N9S A;  1ZSZ B;  3BDL A;  1M90 U;  5CKH A;  3PE0 A;  3GPL A;  3CC7 A;  2EWN A;  3CCL Q;  2GCX A;  4AG1 C;  1VQ5 A;  2EW3 A;  4E7Z A;  1M1G A;  3EH2 A;  5IN1 A;  1CKA A;  2HZY A;  1VQ8 A;  2EYQ A;  2DIQ A;  2XIC A;  1H92 A;  3QJ6 A;  2HSP A;  3UAT A;  2E65 A;  2KI7 A;  3HP9 A;  2ATC B;  1JRI A;  3S3M A;  2JTF A;  2KY9 A;  5GAO r;  1O9S A;  1RAF B;  2QK0 A;  2OAW A;  1YHQ A;  4XTX A;  1MV0 B;  4M7A A;  4DQ2 A;  2YUP A;  2P4T A;  1TUD A;  2E5K A;  5CCA A;  1HD3 A;  4C92 E;  5L8R E;  3P8B B;  4M7A C;  4ELZ C;  2FZK B;  1I5O B;  2X4W A;  5GAN 2;  3JCM V;  2L3Q A;  5GMK e;  1K0X A;  1C6V X;  1AOJ A;  1VQL T;  3OYG A;  2CP2 A;  2W0Z A;  3JB9 J;  1LVK A;  2D8J A;  3CC4 T;  3CCL A;  2BUD A;  4ME7 A;  4PJN A;  2IVW A;  3X20 B;  2DXU A;  5LJ3 d;  1VQ9 Q;  3I35 A;  4PL6 A;  2AIR B;  2JTM A;  1F1B B;  2COY A;  1BBZ A;  4JS4 A;  4RTV A;  2J05 A;  4RTU A;  2D8H A;  3BY7 A;  1KD1 U;  4GY5 A;  3JCM h;  3S3O A;  3UF4 A;  5KE2 A;  4PFO A;  4RTW A;  4DBF A;  3FRN A;  2HKQ B;  3ME9 A;  4MDW A;  5FU6 C;  4OGC A;  2JM9 A;  3HFO A;  3REB B;  3UWN A;  3M55 A;  1I4K 1;  2HQH A;  3OYB A;  4TVR A;  4CRI A;  1K8A U;  3QZ5 B;  4FU6 A;  1ZQ1 A;  2G3R A;  1FWZ A;  4JZ4 A;  4ELY C;  4OB2 B;  2O4X A;  3M54 A;  2FO0 A;  4IUU A;  2LX9 A;  2KSS A;  2LC4 A;  2VKN A;  1I0C A;  1V29 B;  1M3B A;  1UEC A;  1VQK Q;  4C92 B;  3CMA Q;  1PD1 A;  1VQM T;  2B8A A;  3VS7 A;  4HCZ A;  4QKU A;  4BUG A;  4GBQ A;  4XTW A;  1PC0 A;  1VUB A;  4M7D E;  2R5A A;  2GQV A;  4KUL A;  4PKC C;  3L1A A;  4GLM A;  1RAD B;  1QVG S;  2DX1 A;  3CCV Q;  2DIL A;  1PD0 A;  3JB9 G;  3OS1 A;  2EQI A;  3JCM f;  4NS5 A;  2WAC A;  1VOM A;  2QDL A;  3MHX A;  4CC2 A;  2J06 A;  3ULR B;  2J7I A;  2QG9 B;  5J3B A;  2KXC A;  3OSS C;  2QA4 T;  3JCM W;  1R8O B;  3L2W A;  3GP8 A;  1SEM A;  4A4E A;  2JZ2 A;  4K11 A;  2RK1 A;  3EFS A;  3QII A;  1QQJ A;  2BZY A;  3MO8 A;  2DTO A;  4Z88 A;  3NGP A;  4JLG A;  4HA8 A;  3CMA A;  2COZ A;  2I0N A;  3SWN C;  1MNE A;  3RER A;  2WSC E;  2ROT A;  3CD6 T;  4LDX A;  3VS1 A;  2CGH A;  4J9E A;  1MND A;  4C8Q D;  2DYB A;  2L3P A;  2ZPI B;  2GGR A;  1QW1 A;  3M4G A;  2C0I A;  2YSQ A;  3CCV A;  5GAN j;  3VS4 A;  1UFF A;  2QQB A;  4XTY A;  2P0Q A;  2E10 A;  2KDS A;  5IHK A;  3ER0 A;  4E7H A;  4Z02 A;  1D3B A;  4LDU A;  3V7C A;  6AT1 B;  1UGR B;  4JJN K;  4II1 A;  4E7L A;  1PM3 A;  2KYB A;  5FU7 B;  1MHN A;  5J39 A;  2CYZ B;  1AT1 B;  1H64 1;  2LJ1 A;  1R0B G;  3J7A F;  1Q81 C;  1X01 A;  3I55 T;  2EQU A;  4X9D A;  1KSW A;  1KQS P;  1VYV A;  2DEU A;  4OVA A;  2BE9 B;  1WHM A;  1NEB A;  5I2S A;  1BU1 A;  4A4G A;  5A0L A;  1QCF A;  2V8J A;  3M0T A;  1Q7Y C;  5IH2 A;  2J6K A;  2QGG A;  2YRV A;  2H3E B;  1TG0 A;  3LH5 A;  2EJG A;  3CBP A;  1VQO T;  3QDR B;  3X28 B;  2RHX A;  4E47 A;  1BI1 A;  3JCM Q;  5GAN 7;  4E7J A;  1BI0 A;  2HBP A;  1IO6 A;  1K0S A;  2RQT A;  2E12 A;  3HPW A;  5HCK A;  1QVF S;  5I22 A;  2XKO C;  2KVQ G;  3J80 E;  4BI3 A;  1XNI A;  2X3X D;  3UDC A;  3CC2 T;  3RMS A;  3N5B B;  3DKM A;  2QGF B;  4ZN3 A;  3M9Q A;  1VQP T;  4M77 G;  4C8Q F;  5EC7 A;  4C5H A;  2LX7 A;  4E2F B;  1LJO A;  1WNL A;  3OYK A;  2A28 A;  4BY6 C;  4JDS A;  1YJN Q;  2LQ8 A;  2R57 A;  1NJI U;  3PTA A;  4HT8 A;  4J7F A;  2ZGW A;  5GAN 4;  5GAO l;  1K73 C;  5GMK i;  2DMO A;  3C12 A;  2XG8 D;  2AKK A;  2BKD N;  2M0O A;  1R77 A;  4RUG A;  3A8L B;  3DB3 A;  1K9A A;  2I2L A;  3EH1 A;  1TXQ A;  4MZP A;  1E7O A;  2M1H A;  4FCY A;  1VQ5 T;  3G7Z A;  2QA4 Q;  4JJD A;  5HK0 A;  2KYM A;  4KUI A;  1W2B P;  1FYN A;  4M77 C;  2JN0 A;  1GFD A;  3JB9 I;  2XHC A;  4HVU A;  3C0C A;  1QVF A;  4Y28 E;  1VQ6 Q;  3OBW A;  2A37 A;  4OF1 A;  2YXY A;  1QLY A;  4J9D A;  5LJ5 j;  1ZSZ A;  1NE8 A;  5GAM e;  2JOY A;  4HXJ A;  1PSE A;  2V26 A;  5GMK l;  1KHI A;  4JPB W;  1BB9 A;  3C95 A;  1G3Y A;  4A4F A;  1M5Q 1;  2CP6 A;  3L2U A;  1NZ9 A;  7AT1 B;  1YJN A;  3THK A;  1RI9 A;  2QDY B;  2ED1 A;  2COW A;  1GBQ A;  1ZA2 B;  3MEA A;  1UJ0 A;  3ZEH A;  3O8V A;  4KH0 B;  3JCM g;  4QVC A;  1WDX A;  1Y7X A;  2CH4 W;  3I56 Q;  1UUE A;  2MOX A;  5GMK h;  3VS0 A;  3CCL T;  1SF9 A;  3OS5 A;  4M75 G;  4C8Q E;  3NMZ C;  2QA4 A;  5LJ3 j;  4C92 D;  3TSW A;  1RLP C;  1VA7 A;  1GL5 A;  3FDR A;  2XID A;  1OZ3 A;  2PTK A;  3H41 A;  4A4K A;  1HSQ A;  1XOV A;  4L59 A;  1VQ6 A;  2CT4 A;  1M2O A;  5FW9 A;  4OMO A;  4AT1 B;  3C4S A;  3EG0 A;  2RQW A;  2R5M A;  3LGF A;  1ZX6 A;  4FT4 A;  3NTH A;  3RMQ A;  3TU4 K;  2DAQ A;  2OTJ Q;  4RCB A;  2EKH A;  3OYA A;  2DBK A;  3EHR A;  2GFU A;  9ATC B;  5FWC A;  4OP0 A;  1JXM A;  5KYW B;  2E1H A;  2JMA A;  2ED0 A;  2X4X A;  2F2W A;  1JXO A;  3EAE A;  2EQJ A;  2RF0 A;  2LZ6 B;  1Q81 R;  3G4S T;  2RHZ A;  4E7S A;  3I56 A;  1MUZ A;  1RAB B;  2YUN A;  4RG8 A;  1VQO Q;  5GAN 8;  3E9G A;  3M0S A;  1Y57 A;  2ECZ A;  1D1B A;  4PJO E;  2LNH B;  1VQ9 T;  4X9C A;  1G3W A;  5KYY B;  2ZCF B;  5GJW B; 
#chains in the Genus database with same CATH homology
 3G71 Q;  3I55 Q;  1VQ4 Q;  1VQL Q;  1YIT Q;  1KD1 R;  3CCS Q;  1Q81 R;  3CCE Q;  3CCV Q;  1Q7Y R;  1M90 R;  3I56 Q;  1NJI R;  2QEX Q;  1VQ7 Q;  1YI2 Q;  1K8A R;  1VQ9 Q;  3CC2 Q;  3OW2 P;  1QVF P;  3CD6 Q;  3CC4 Q;  1VQK Q;  1K73 R;  1YIJ Q;  2QA4 Q;  1VQO Q;  1VQP Q;  1QVG P;  1M1K R;  2OTJ Q;  3CMA Q;  1W2B P;  1YHQ Q;  1YJN Q;  1VQN Q;  1YJW Q;  3CC7 Q;  3G4S Q;  3CPW P;  3CCQ Q;  3CXC P;  1VQ5 Q;  3CME Q;  1VQ6 Q;  1Q86 R;  3CCR Q;  1N8R R;  1KQS P;  2OTL Q;  3CCL Q;  3CCJ Q;  1VQ8 Q;  3CCM Q;  1Q82 R;  1YJ9 Q;  1VQM Q;  1KC8 R;  1S72 Q;  3G6E Q;  3CCU Q;  1K9M R;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...