1VQ9Q

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S ribosomal rna
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq9Q00
1VQ7Q 1NJIR 3CD6Q 3G6EQ 3CCJQ 3G4SQ 3CMAQ 2QEXQ 1KQSP 2OTLQ 1VQNQ 3CCSQ 3I56Q 3G71Q 1M1KR 1K73R 3CCQQ 3CC4Q 2QA4Q 1VQ8Q 1KD1R 3CMEQ 3CCLQ 1YJNQ 1YJWQ 1YHQQ 1VQ6Q 1VQ9Q 1VQMQ 1YJ9Q 1VQPQ 1VQ4Q 1VQKQ 1W2BP 3CCRQ 3CCEQ 1YITQ 1YI2Q 1VQ5Q 1S72Q 1Q7YR 1KC8R 1N8RR 3CC7Q 2OTJQ 3I55Q 3CCVQ 1Q82R 1QVGP 1M90R 3CC2Q 1YIJQ 1Q81R 1VQOQ 1K9MR 1K8AR 3CXCP 3CCUQ 3CCMQ 3OW2P 1JJ2P 1VQLQ 3CPWP 1QVFP 1Q86R
chains in the Genus database with same CATH superfamily
3MP6A 4MMKA 2OTLQ 5CCAA 3HRSA 4DBHA 1Y07A 2KY9A 3E9FA 4M7AA 3EH1A 1OOTA 2ED0A 3GLXA 2X35A 2X3WD 4KUIA 1U3OA 3SEMA 1KD1C 4DBFA 1K8AU 3CCUA 2GNCA 4M77F 1NZ9A 4E7ZA 3JB9G 1BI2A 4E7IA 2O2OA 2FG0A 2DXBA 4J9DA 1PNJA 1VQNT 1VQLA 3L2ZA 1WI7A 5CK9A 3CBPA 3JCMd 3P8HA 2RK2A 3X25B 2VKNA 1WHGA 1QP3A 3FJPA 1UGRB 1TS9A 4M7AB 3I56Q 2KT8A 3CC4Q 2DF6A 4KT0E 2QI2A 3LWIA 2H3JA 1I8FA 4AMCA 3JCMe 1LOJA 3HTRA 5LJ5g 4NL3A 4XAXB 1UEBA 2LQWA 4L6V5 3CCVT 3OYKA 4C92A 1Q7YC 9ATCB 4KH1B 1JBMA 2YXYA 1FXXA 3OYYA 3QJ6A 2P84A 3AHUA 3CCQT 1QVGA 1KQ2A 3RKYA 4IUPA 2E64A 2J05A 4A4HA 1BYMA 2FO0A 5GAN7 2CP0A 2HKQB 2QAZA 2XHCA 3RMSA 4ORZA 5KCHA 4M78B 3CMEA 4QQDA 5CKEA 1X2KA 1X6BA 3V8JA 5L8RE 1KFZA 2KXCA 3M55A 2YUPA 1WHMA 2CP2A 2ZZDA 1PKTA 3HFOA 3VU3C 3A98A 2OX7A 2XDPA 1K8AC 1G83A 2KRNA 1M90C 2M51A 1ZBXA 5I22A 4Z02A 4ZGJB 2QG9B 1WHHA 2LNVA 2QEXA 2DTIA 1VQMQ 4PJOD 1LPLA 2KE9A 3UPUA 2LQNA 1NE8A 3PVQA 4BI4A 4R55A 1E6HA 1WJSA 4CC2A 1HD3A 5GMKj 2OI3A 3OS5A 4DEYA 1NJIR 2X51A 3CCJQ 3OA6A 2XDDA 5D6YA 3CMAQ 5GAN2 2VB6A 1NEBA 1NLOC 2DL5A 2YRVA 5GAMh 1WYXA 2EGCA 1TG0A 5HY6A 2EYZA 2LVMA 4OB3B 1HJDA 1Q7YU 2M16A 5LJ3d 4AT1B 3EFSA 3IQLA 2DE0X 1Q81R 1C0MA 1D0YA 5C0MA 3JSCA 4HA8A 2ECZA 2RQRA 2X4WA 4JRIA 4E7JA 2BZXA 3M53A 3L2UA 1VQMT 5GAMf 2DZ9A 2WSFE 2D1XA 3EG9A 4PJOF 4C92E 3VS5A 2CP7A 4J83A 1OX9A 2EYWA 4OMQA 3FDRA 3G7ZA 3PIOA 5A0GA 4JJNK 1H3ZA 3CCMT 2LDMA 5I2MA 3DLLA 3J80E 2IG0A 2LMJA 1M3AA 4LD6A 2P4TA 3TCJA 2RI3A 2A36A 2V1QA 1YCYA 3CD6A 1VQ4Q 4C8QA 3L2QA 3TU4K 5CKFA 1ZA1B 1M5Q1 4QT7A 1OV3A 1CKBA 2L3RA 1IREB 2NWMA 3A8OB 1EZZB 1LCKA 2CZ7B 4M77A 1RUWA 1MHNA 1PG5B 2LQ8A 2I0NA 3I35A 3QHSA 1M8MA 4V2SA 5GANf 3MHXA 4RG8A 1YI2T 2JMCA 1VIEA 2E5QA 1ACMB 1UGSB 1WHJA 3OY9A 5CKDA 1VQ8Q 4HCCA 2MWPA 1RAEB 1AOJA 3OS2A 4C5HA 1RAAB 1W70A 1BKBA 2KGTA 2NYSA 4JRPA 5GAN6 3REBB 4A4FA 1K9MR 1RL2A 2CDTA 1CKAA 3INZA 3SWNA 1EX4A 4IIMA 3C94A 3MEUA 1VQ6A 2F2VA 2HSEB 5CQYA 1M1KR 2JJ9A 3SDZA 1YN8A 4B6MA 5J39A 5CO7A 2RH2A 1B3QA 2AKLA 4X9DA 4XTVA 1ZQ1A 1N8RR 2OTJQ 2M0OA 3HPWA 2RMOA 4C92F 1TXQA 1YP5A 3CC7A 5AT1B 3QDRB 4M78A 2QGGA 1XJWB 2K2VA 4QVZA 4DA4A 4IURA 1K73U 4BY6C 3VS0A 2D8HA 1AZEA 4AG2C 2DXUA 1QVGS 2DEUA 2V8KA 4F7UE 3G4ST 2CREA 2DERA 3JB9J 1AT1B 2R5AA 4R56A 1WJQA 5CQXA 1GFDA 3HRTA 4ZN3A 4OGEA 1PD0A 2CZ1B 2HKNA 2GQVA 1WA7A 1GCQA 2DAQA 2KROA 4M7DD 3VV0A 5FROA 1VQ5T 4JJBA 1M9SA 3VYHB 2M1HA 3OMGA 3FB9A 3QO3A 3ER0A 2WSCE 2E41A 1Q86U 2COZA 3BFMA 4E7SA 4PKCC 4FW2A 4PFPA 3LX7A 3A8MB 2EBPA 1T3SA 1X6GA 1O9SA 3JCMP 3G4SQ 1CSKA 4N0AC 5HCKA 1TH7A 5KYXB 1TOVA 2CUDA 3QYGB 1VQ6Q 1MV0B 3L2RA 1KQSS 2BZYA 1M1KC 3DKMA 2EYXA 4C0DC 3ASKA 3PNWC 2PVGB 5KYXA 4C5IA 3JCMg 2BE7D 3LWHA 2FRWA 2K5LA 4BUGA 2PUKB 2FPFA 1TU0B 1GFCA 3G71Q 1Y71A 3M59A 3NMZC 3OYGA 1AZGB 1RLPC 3SFMA 3JCMV 4HCBA 4II1A 2BZ8A 3MPUB 1R77A 2LCLA 2OJ2A 3CC2A 4LUEA 1RI9A 4BY6B 4C0GA 1R0CB 3WVEB 4OMOA 3RKWA 2VGNA 5LJ3j 1NBEB 1YJNA 3JAME 2A7YA 3CC4A 3CCRT 1K73R 3I56A 2EKOA 4BDYA 2DKGA 1UHFA 1YJWQ 5CIUA 2DL8A 2RJFA 2QQSA 2JS0A 2KK4A 4M78E 3ULRB 1OI1A 1S72Q 3L1AA 2J6KA 1ZSZA 1TWBA 2YUNA 5HK3A 4XTZA 4O5VA 2EGEA 5ECAA 4M7AG 5GAOl 2MYSA 3CCET 4M75G 4FYWB 2KRMA 2XIDA 1AHJB 4KUDK 5J26A 2EWNA 2KBTA 5LJ5h 3H0IA 2DYBA 4OMFB 1SHGA 2W0ZA 4M4ZA 3OQ5A 3CCMQ 4KH0B 2JW4A 1Q81C 4CC7A 1Q86R 2FZKB 2WACA 4LDVA 3X20B 1K76A 1VA7A 1D1AA 1SHFA 4C92D 1B34A 1VYVA 1KQ1A 3VS7A 4FM4B 4BI8B 2EIFA 1NJIC 2L2PA 2O01E 1VYUA 4J7FA 3JCMJ 2BKDN 2NUPB 2OTJT 4EMKA 2QEXQ 4PJOA 3CPWS 4OB1B 2F2XA 1AWOA 1Y7XA 4MDWA 3DLMA 5L23A 2D0NA 5IT9E 4LDXA 2RPNA 5KH6A 3CCJT 3C12A 4Y28E 3LW5E 3VKIA 2DJQA 1M90R 2QQ9A 2ZCFB 3M0PA 3ZFJA 1U1SA 4ESRA 3JB9D 1K8AR 2FL7A 2CZ0B 2LRQA 1FYNA 1QW1A 3SHWA 1RADB 2VVKA 1PRMC 3CMEQ 1YJNQ 1JXOA 1UB4A 2ZPFB 1H8KA 2GBQA 2IIMA 3M5AA 3OYAA 1BU1A 4ZGDB 1YWPA 2LX7A 4PLIA 2DTHA 3CCQA 2RN8A 3LH5A 3HP9A 2LC4A 3G6EA 4DOVA 4NOYA 1ZA2B 4PLLA 4M77D 4WF2A 1WHLA 3CCJA 3EFOA 2LX9A 3PT9A 3R6OA 2GF7A 3BE3A 4C92G 1BB9A 2SEMA 3ZBDA 1Q7YR 4M7DE 1N9RA 1ZLMA 1JRIA 4F7UF 3E1SA 5GMKl 4GBQA 1GXIE 2QDYB 2QK0A 4PNOA 3BDUA 5IXFA 5IAYA 1M1FA 4A4GA 5HK0A 1V29B 2K3XA 4NL2A 1YJ9Q 3A1PA 3MKDA 1PC0A 2ZPEB 1VQKA 3OYJA 3VRZA 4ELYC 4JRKA 2YDLA 1RI0A 1W2BA 2VC8A 3BY7A 4A53A 5GMKe 5GAOm 1HYOA 1K0SA 3M0UA 4RTVA 2QA4Q 1O75A 1RAIB 1VQKT 2LQKA 5IHNA 1E7OA 1IO6A 1VQKQ 3HKSA 2LT4A 3QSUA 5DY9A 2XICA 3J7AF 4XU1A 4O6JA 2K9GA 3CCEA 4Y92A 4FT4A 2K3BA 1TUCA 4IUTA 4ME7A 3CCLA 2EKHA 5LJ5f 1QWFA 1H641 2CKKA 4JPBW 3EAEA 2HSPA 4GLKA 4QW2A 4QVCA 1K0XA 4E2FB 3I55Q 4M75B 1K9MU 4OB0B 4LXCA 2RD1A 1VQLT 3KUFA 5GJVB 1HXDA 1JEGA 2DVJA 5LJ3g 2V26A 2YRCA 1MNDA 1M30A 2MPXC 3G6EQ 2FPEA 2QTXA 3S3OA 4BACA 2GTJA 1NYFA 2MWOA 2JXBA 4X1VA 2YUQA 1OU9A 2EJGA 2R5MA 3SB2A 4M7AF 1PSEA 2YSQA 2ABLA 1OULA 5LJ5d 1VQ7Q 3GP8A 3KBGA 2EYYA 4M7DC 2RHYA 1Q86C 4IUQA 1B07A 4MZMA 2F1LA 2RK1A 1M2VA 4OB2B 1NM7A 3QXEB 5KYNA 1VQPA 2LCCA 1QVFS 4F04B 2EJFA 4JLGA 2LJ1A 2O88A 2V1RA 4JZ3A 3FLGA 4LN2A 5DLOA 3QWYA 5FU7B 4C8QG 3FIFA 2K5FA 1WPYA 2RJDA 2A28A 3JCMW 2KRSA 1FX7A 1VUBA 2YT6A 4JRQA 2DILA 1W1FA 4UC4A 4M7DB 3H8ZA 1VQOA 2LCSA 5A2QE 1VQNA 1X2QA 4C0ZA 4JDSA 3CCLQ 1VQ9Q 2XMFA 2R58A 3OSSC 1N9SA 2E5KA 2GCXA 2PNIA 4FL6A 5GMKm 5GANe 4M75D 2DBMA 1IB8A 1UHCA 1P92A 4IIOA 4J9CA 5FW9A 2HAXA 4VUBA 2QTVA 4ZGEB 1X69A 2A08A 5LJ3e 4QKUA 3VS6A 1QKXA 1WQWA 2DMOA 3AT1B 2P0PA 3A8LB 2G3RA 2VUBA 1ZSZC 4XTWA 4FIBA 3VRYA 1JJ2P 4M7DA 1XQHA 2DIQA 3UA7A 1U1TA 2MI6A 2YRDA 2AT1B 1WXTA 1K9AA 3JCMX 2MOXA 4A4KA 3HHTB 3OBWA 2EAYA 1W2BP 1M2OA 4P5NA 4M78G 3GBQA 2OTLT 5HKCA 2KYMA 1VQ8A 4J7IA 3FEOA 4XTUA 1QKWA 4J9GA 2EQKA 2QDLA 1X43A 3M0SA 5GAOp 4LE9A 1KJWA 1W6XA 2L3QA 1X6OA 1QMCA 1X27A 1XOVA 2EGAA 3M4YA 3CXCA 1KC8C 2COYA 3EH2A 2GQIA 4J9BA 3META 1MV3A 4OF1A 4BE0A 1G3SA 4AG1C 1KHCA 2E1HA 3PMIA 4BE2A 4HVWA 3VS3A 2VASA 1KIKA 4C8QF 1UGQB 3M54A 4DBQA 1H92A 3QPHA 2COWA 1NPRA 1QCOA 4JS4A 1RAGB 2SRCA 5J3BA 2CS7A 1I5LA 2JUFA 4AFSC 1KQSP 2RM4A 2A3LA 3WVDB 4Z8AA 1MMGA 2J6FA 3QDFA 2MCNA 1VQ7A 2RJEA 3SD4A 3QUIA 4M77G 1SRMA 1U5SA 1YJWA 4LD9K 1Y96B 1JB0E 2JTEA 2ZPBB 4B9XA 1GRIA 1TSFA 3EG0A 2DEQA 1OEBA 2CH4A 1SF9A 2EQUA 3PIPA 4WCIA 1VQ6T 1OU8A 1UUEA 1N8RC 2DD4A 4FSSA 2LZ6B 3EHRA 1K4US 1PSFA 1IGQA 3J81E 1FWZA 1WXUA 2GFUA 3UT1A 2FZCB 5FLXE 1NLPC 3EG2A 1ABOA 4DOWA 1M2VB 2H8HA 1VQ4T 2VXEA 2HQEA 1JQQA 2GFAA 5KYWB 3O8VA 1VQ5Q 1WHKA 1KC8R 3C0CA 3G6ET 2ZGWA 2FZGB 1Q82R 4XU0A 2QQAA 3X28B 2L89A 1VQLQ 2XKOC 4A63B 2DPPB 2KMTA 4CI0C 1AWJA 1OPKA 1Y57A 2LP5A 1EIFA 4M75F 4RTXA 5EC7A 1XTDA 1M8VA 1JU5C 4XTYA 4OMPA 2NUTA 1IRXA 5LJ3h 1I0CA 1WQ7A 3RERA 5KE3A 1MMNA 2A0FB 2HDAA 2HBWA 2PVDB 2J06A 3TEEA 4N4HA 3VS1A 3UA6A 3NTKA 5GMKh 1YITT 1MUZA 2GTOA 2FPDA 2CT3A 4FYYB 3H6ZA 1MGQA 2IVWA 3CMAT 1OPLA 2JS2A 5GAN4 2KQWA 3GOXA 1NYGA 2RB6A 1ZSZB 4N4IA 4PJOE 3HSBA 4K11A 3OB9A 3OSVA 5CVIA 4C8QB 3O5ZA 1M4ZA 3LGLA 5IN1A 2MMPA 2PU9B 4J6YA 3U23A 4M7AD 5D6WA 3OMCA 4XK8E 5CR2A 3CMAA 4JJCA 3GNGA 1D1CA 1RABB 1M3CA 3RKXA 2QQRA 4M77C 1YI2Q 5I21A 3CD6T 2K5IA 1RAHB 4Z89A 1H3HA 2M9UA 2K57A 1QVFP 4C8QC 3MEWA 4X34A 1IHWA 1A0NB 1NJIU 1DJ7B 2DL7A 4GY5A 2RQWA 1BI0A 1ZUKA 4HXJA 4BI3A 2JN0A 4EDUA 1SSFA 5GAOr 5FU7C 1PD1A 2EJ9A 2OTJA 2FB7A 1V76A 2R57A 4XTXA 3CCQQ 2RQVA 2VGMA 1ZUUA 1WFWA 2AIRB 1RAFB 1YJNT 3CMET 1BCMA 2FHDA 4OMMA 5FU6C 2L3SA 2E6ZA 5GAN8 1MMAA 3M56A 2CYZB 1QVGP 1U06A 3CCUT 3EHQA 4TVRA 5KYUA 5D6XA 5GMKi 2WSEE 4M78C 4F7UG 2J7IA 4C0FA 3G71A 3H0HA 4B9WA 1S1NA 2E6NA 4EMKB 2QA4T 4CC4B 1Q95G 1N5ZA 1UDLA 2QEXT 4E7LA 4NS5A 4M7DF 2X4JA 1KQSA 2DFUA 2DD5A 6AT1B 1BBZA 3EFRA 3G1JA 4M75E 8AT1B 1JJ2S 3TSZA 1VQNQ 1KSWA 5FWBA 3CPFA 1VQPT 4HT8A 5GANg 3N5BB 4F16A 4R0KA 5LJ5e 1SSHA 2L8DA 4HKEA 3OYNA 3M58A 4ATOA 1G3YA 1WGSA 2HMAA 2RHZA 1UGPB 3F70A 2PTKA 3A8HB 1EFNA 4C8QD 2QQBA 2RI2A 3PE0A 3BW1A 4E7KA 3CCEQ 4QVDA 3EG3A 2QGFB 4J8OA 1NEGA 1QVPA 2JM9A 5C6SA 1Q82U 3ZEHA 2B86A 4RTWA 1I1JA 1G5VA 2M02A 4C0DB 1JO8A 2ED1A 4MZTA 3TREA 3CD6Q 5FWCA 3HRUA 1AD5A 1IXDA 1TUGB 2O9VA 2OTLA 1KD1R 1AEYA 2RF0A 2JZ2A 3QYHB 2XDBA 2L0AA 1AWXA 5GAN3 2D6FA 1N6AA 2E4HA 3TQ7P 3EGDB 3A8GB 3RUXA 1BI1A 1IHVA 1NG2A 3DB4A 4E47A 5IH2A 2YLBA 3OYLA 2RI5A 1FMKA 3V8KA 2RQTA 3QJYA 3E2UA 3JB9H 2HQXA 1ZUYA 3S6WA 3FJ5A 4IUUA 3G4SA 1LNXA 3CPWA 4ANJA 3C4SA 3CC4T 1PHTA 3G71T 2ESWA 3OW2A 2KYBA 4A4EA 3V8LA 4HT9A 2D8JA 1B34B 2DETA 1ARKA 4EMHA 1FMVA 2F5TX 1GBQA 4D8DA 4LDYA 1D09B 3OYHA 1PWTA 3NTIA 3ME9A 4RKUE 2JVVA 1M27C 3CCRA 2P0QA 3CBOA 4KRTA 3H41A 3VJPA 2EVRA 1UE9A 1YCSB 3M4GA 5I11A 1VQOQ 2HEQA 4M75A 2V8IA 2K7AA 4IUVA 2D9TA 1IGUA 1BCOA 1TTHB 2O9SA 3CC7T 5LJ3f 1KK7A 2ROLA 5A0LA 2CP6A 4RCBA 3JCMf 1LVKA 2O4XB 2RHUA 4JZ4A 1QVFA 2MIOA 3QKJA 2LTOA 2E70A 2EFIA 3OS1A 1KG1A 2M0YA 2JMAA 3TVTA 2DXCA 1YBYA 2OAWA 2W10A 4RTTA 4J5YA 2FRYA 3JV3A 1WIEA 1VQOT 3P8BB 1YFNA 3CXCS 2ZPIB 4QQGA 1OQKA 3CBMA 1S72T 2B8AA 3C95A 2YWWA 4PJOC 1VIFA 4PL6A 4LUDA 4FT2A 1VQ5A 1JXMA 5GAOq 3CCRQ 3OYIA 4LDWA 4F17A 4F7UB 1HSQA 2EQJA 3EFOB 1I81A 4LNPA 3CXCP 2DL3A 1D0XA 2BUDA 2DVEA 1UFFA 3V7CA 2CT4A 5CAIA 4M78D 2QA4A 3RNJA 2X9HA 3M0QA 2GGRA 4FSXA 3URGA 5GAMj 2K2MA 1VQ9T 2ZPGB 4FCYA 2F69A 3M9QA 1K73C 4J9HA 4XU2A 3M57A 3PFSA 2VXFA 1WDXA 1Q81U 1OX8A 4EMGA 2C0OA 4MMLA 3GF5A 7AT1B 1JJ2A 4C5GA 4FYVB 3EGXB 3HFNA 2AKKA 4M7DG 1IZ6A 5GJWB 4OGCA 2PVOB 4PJNA 1VQ8T 2CUBA 3M0RA 2DBKA 4MZPA 1GL5A 1YIJA 2JOYA 3EGXA 1BK2A 4PJOG 2L3PA 3JB9F 3L2WA 3CPWP 3UATA 4M7AC 4C92B 3NHNA 1VQ9A 1GCPA 4WTOB 4ZN1A 2XK0A 2Y90A 4HCKA 1WX6A 5GAOn 2HBPA 2E3IA 3LLRA 2ZAEA 1YI2A 2E3HA 2HD0A 3OYMA 3WXMB 1T0HA 4ELZC 3SWNB 2JTMA 2DA9A 4XU3A 4DQ2A 1QLYA 2V8JA 5GAMg 1SEMA 2ROTA 3X26B 2ATCB 5FU6B 4RCCA 2KR3A 3M0TA 1ZX6A 3OS0A 1PCXA 1M3BA 2F5KA 2NLUA 2Z0WA 1VQPQ 3VS4A 4AFZC 1R8OB 2HZYA 4KGXB 3CCMA 1C6VX 1WZOA 4ZNXA 4FU6A 4E6RA 4D8KA 1YWOA 2DL4A 5IXBA 3JCMb 1GCQC 4OMNA 2I2LA 1GBRA 3X24B 1ABQA 2DO3A 3KXTA 1E6GA 2KEAA 1VQMA 4CC3A 1Y0MA 1F1BB 3LYIA 1UECA 3L42A 3CCLT 3GPLA 1M1GA 2EYQA 2FVUA 4M78F 1HK9A 4KULA 3CC2Q 4XQ3A 1FMWA 4RG2A 2EQIA 2X4XA 3CCUQ 1Y96A 1TUDA 3OYCA 3E19A 3MEVA 4AFUC 1PKSA 2PQWA 5M9OA 4HVUA 1SPKA 3BDLA 2CSIA 2XG8D 1YJ9T 1AWWA 2IPOB 2ZPHB 5I2SA 2BE9B 4Z88A 1B7TA 4GLMA 3QZ9B 3THKA 1VQ7T 1PRLC 3UF4A 2C06A 2QXFA 5GAN5 4BE1A 1X75C 2DRMA 2KVQG 1K9MC 1BIAA 1G2BA 1X01A 2DLPA 3EGUA 5LJ5j 2CH4W 4RMOA 2C0IA 4KGVB 4QQ6A 3EG9B 3I5RA 4C8QE 3OYFA 4M7AE 1OZ3A 1T0JA 3QIIA 2DJZA 3OYDA 1NPPA 3RESA 4HCZA 2F2WA 2DX1A 2RHIA 2YHTA 3H0FA 3I55T 2AZSA 2RNAA 3RDVA 1V1CA 2CP5A 3D7SB 1MMDA 3JB9I 4OMLA 3V7RA 3JCMh 4PK4A 3MCAB 2LJ0A 1VOMA 2OAUA 1N27A 2NUTB 2EPDA 3CCVQ 1VYTA 3A5ZB 4RTZA 2DXTA 5KYYB 1Z9QA 1QCNA 3CC2T 2CP3A 4A54A 3RR6A 3NTHA 2HL5C 2K3YA 2X4YA 4ZTJA 3PMTA 3RMQA 2DNUA 3FRNA 4OVAA 1YHQQ 1YHQT 4L59A 2NUZA 5EG2A 2FEIA 2K4YA 1AVZC 5KYYA 1UTIA 3I56T 4PJJA 1YITQ 3EG1A 3JRZA 2EQMA 2KAFA 8ATCB 1T3LA 3VUBA 3Q1JA 1M90U 4RUGA 4DBRA 2L5QA 1WNLA 4C92C 1J3TA 1Q82C 4M77B 4EIKA 3LH0A 5KCOA 3CEYA 3RIRA 4BB7A 3VYGA 4N0AA 3UWNA 2DRKA 4IKFA 4Q5WA 3VS2A 5KE2A 1KHIA 3MJXA 4FW1A 2LT1A 2NUPA 3I9QA 5CKBA 1ZSGA 4M75C 2KDSA 4BDZA 3OYBA 2KT1A 2LNHB 4AFQC 2CZ6B 2H3EB 3E9GA 1M1KU 1C1AA 1SKUB 1UJYA 3I5SA 4D6WA 3MO8A 5FRMA 1OZ2A 2CSQA 4FYXB 2EW3A 1Z9ZA 4J6WA 5A0DA 2KNBB 1G8XA 2AHJB 2PZ1A 4PJOB 1D3BA 1OYXA 1KD1U 2VYTA 4PJLA 5KYUB 3CQTA 3L2VA 2P4RA 2XI9A 3CCSQ 4J9FA 2D0QB 3NGPA 4C5EA 3I55A 5LL6S 1XNIA 1D3BB 4PFZA 4CRIA 3SWNC 1LJOA 2PUOB 3JCMQ 2E10A 5CKHA 5GANd 1QCFA 2HQHA 1D1BA 1BI3A 3UDCA 3OBYA 1WLPB 4PJMA 5KYWA 1S72A 5GAMd 3JCMc 4MDXA 2JM8A 2RA2A 1UJ0A 4M77E 4EPCA 1SG5A 2DYIA 1ZBJA 1W2BS 1G3WA 1N8RU 2YUOA 3FC3A 2KSSA 5FRNA 1I5OB 1D0ZA 2G6FX 4PFOA 2JT4A 3ZL7C 1RACB 3NPFA 3R6NA 2E65A 2FYKA 2XD0A 1YITA 2O31A 2QYZA 2YLCA 3RBBB 3PGGA 4L5GA 2P0KA 3QBYA 2KXDA 2HCKA 1YNZA 3CCSA 3CCVA 2K6DA 2DIGA 3QWXX 2DTOA 3QG1A 1VQ4A 3V7SA 3T9NA 3P8DA 2AK5A 2RO0A 2X3XD 2BIVA 4EMKC 1UGVA 2ENMA 4RTUA 3VUZA 3GNFB 2MF2A 5GAMe 2C0TA 4J6XA 3OYEA 4X9CA 5GANj 3MEAA 5IHIA 2MAMA 2HL3A 3DB3A 2A37A 1SRLA 2JTFA 4Y91A 1QQJA 2VWFA 3KFVA 3CC7Q 3MP8A 4DEXA 2RQUA 1YIJQ 3LGFA 3EGDA 1K1ZA 1I07A 5DLQE 3GIBA 2Y4XA 4J9IA 4JUVA 3PTAA 4BD3A 1G3TA 5DM7R 3QZ5B 2AZVA 5GANh 4J9EA 1YJWT 3PVLA 2RJCA 2DZCA 2DM1A 1WXBA 4JJDA 1YJ9A 1ZHIA 2K79A 1MNEA 3OW2P 4F14A 3NFCA 1U8RA 2VV5A 2LJ3A 1YHQA 2MK5A 3S3MA 2E12A 2JNGA 2CGHA 1BIBA 4N4GA 2J6OA 2QASA 1KC8U 1I4K1 4ZTFA 2RHXA 1RLQC 1WJRA 4E7HA 4YTLA 2KI7A 2BTTA 4HVVA 1QWEA 2XU8A 3S3NA 3HL8A 1R0BG 3REAB 1W4SA 4OP0A 4KBMB 4RTYA 3TSWA 2Y4YA 3H9NA 3MP1A 4JS5A 5D7UA 2O4XA 4F7UA 2HNIA 5AYFA 3CCST 1QP2A 4JLIA 3OW2S 4LDUA 4KGZB 2DK3A 5IHKA 1PM3A 1UG1A 1YIJT
chains in the Genus database with same CATH topology
1VQ7Q 1NJIR 3CD6Q 3G6EQ 3CCJQ 3G4SQ 3CMAQ 2QEXQ 1KQSP 2OTLQ 1VQNQ 3CCSQ 3I56Q 3G71Q 1M1KR 1K73R 3CCQQ 3CC4Q 2QA4Q 1VQ8Q 1KD1R 3CMEQ 3CCLQ 1YJNQ 1YJWQ 1YHQQ 1VQ6Q 1VQ9Q 1VQMQ 1YJ9Q 1VQPQ 1VQ4Q 1VQKQ 1W2BP 3CCRQ 3CCEQ 1YITQ 1YI2Q 1VQ5Q 1S72Q 1Q7YR 1KC8R 1N8RR 3CC7Q 2OTJQ 3I55Q 3CCVQ 1Q82R 1QVGP 1M90R 3CC2Q 1YIJQ 1Q81R 1VQOQ 1K9MR 1K8AR 3CXCP 3CCUQ 3CCMQ 3OW2P 1JJ2P 1VQLQ 3CPWP 1QVFP 1Q86R
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 Q;  1NJI R;  3CD6 Q;  3G6E Q;  3CCJ Q;  3G4S Q;  3CMA Q;  2QEX Q;  1KQS P;  2OTL Q;  1VQN Q;  3CCS Q;  3I56 Q;  3G71 Q;  1M1K R;  1K73 R;  3CCQ Q;  3CC4 Q;  2QA4 Q;  1VQ8 Q;  1KD1 R;  3CME Q;  3CCL Q;  1YJN Q;  1YJW Q;  1YHQ Q;  1VQ6 Q;  1VQ9 Q;  1VQM Q;  1YJ9 Q;  1VQP Q;  1VQ4 Q;  1VQK Q;  1W2B P;  3CCR Q;  3CCE Q;  1YIT Q;  1YI2 Q;  1VQ5 Q;  1S72 Q;  1Q7Y R;  1KC8 R;  1N8R R;  3CC7 Q;  2OTJ Q;  3I55 Q;  3CCV Q;  1Q82 R;  1QVG P;  1M90 R;  3CC2 Q;  1YIJ Q;  1Q81 R;  1VQO Q;  1K9M R;  1K8A R;  3CXC P;  3CCU Q;  3CCM Q;  3OW2 P;  1JJ2 P;  1VQL Q;  3CPW P;  1QVF P;  1Q86 R; 
#chains in the Genus database with same CATH topology
 3MP6 A;  4MMK A;  2OTL Q;  5CCA A;  3HRS A;  4DBH A;  1Y07 A;  2KY9 A;  3E9F A;  4M7A A;  3EH1 A;  1OOT A;  2ED0 A;  3GLX A;  2X35 A;  2X3W D;  4KUI A;  1U3O A;  3SEM A;  1KD1 C;  4DBF A;  1K8A U;  3CCU A;  2GNC A;  4M77 F;  1NZ9 A;  4E7Z A;  3JB9 G;  1BI2 A;  4E7I A;  2O2O A;  2FG0 A;  2DXB A;  4J9D A;  1PNJ A;  1VQN T;  1VQL A;  3L2Z A;  1WI7 A;  5CK9 A;  3CBP A;  3JCM d;  3P8H A;  2RK2 A;  3X25 B;  2VKN A;  1WHG A;  1QP3 A;  3FJP A;  1UGR B;  1TS9 A;  4M7A B;  3I56 Q;  2KT8 A;  3CC4 Q;  2DF6 A;  4KT0 E;  2QI2 A;  3LWI A;  2H3J A;  1I8F A;  4AMC A;  3JCM e;  1LOJ A;  3HTR A;  5LJ5 g;  4NL3 A;  4XAX B;  1UEB A;  2LQW A;  4L6V 5;  3CCV T;  3OYK A;  4C92 A;  1Q7Y C;  9ATC B;  4KH1 B;  1JBM A;  2YXY A;  1FXX A;  3OYY A;  3QJ6 A;  2P84 A;  3AHU A;  3CCQ T;  1QVG A;  1KQ2 A;  3RKY A;  4IUP A;  2E64 A;  2J05 A;  4A4H A;  1BYM A;  2FO0 A;  5GAN 7;  2CP0 A;  2HKQ B;  2QAZ A;  2XHC A;  3RMS A;  4ORZ A;  5KCH A;  4M78 B;  3CME A;  4QQD A;  5CKE A;  1X2K A;  1X6B A;  3V8J A;  5L8R E;  1KFZ A;  2KXC A;  3M55 A;  2YUP A;  1WHM A;  2CP2 A;  2ZZD A;  1PKT A;  3HFO A;  3VU3 C;  3A98 A;  2OX7 A;  2XDP A;  1K8A C;  1G83 A;  2KRN A;  1M90 C;  2M51 A;  1ZBX A;  5I22 A;  4Z02 A;  4ZGJ B;  2QG9 B;  1WHH A;  2LNV A;  2QEX A;  2DTI A;  1VQM Q;  4PJO D;  1LPL A;  2KE9 A;  3UPU A;  2LQN A;  1NE8 A;  3PVQ A;  4BI4 A;  4R55 A;  1E6H A;  1WJS A;  4CC2 A;  1HD3 A;  5GMK j;  2OI3 A;  3OS5 A;  4DEY A;  1NJI R;  2X51 A;  3CCJ Q;  3OA6 A;  2XDD A;  5D6Y A;  3CMA Q;  5GAN 2;  2VB6 A;  1NEB A;  1NLO C;  2DL5 A;  2YRV A;  5GAM h;  1WYX A;  2EGC A;  1TG0 A;  5HY6 A;  2EYZ A;  2LVM A;  4OB3 B;  1HJD A;  1Q7Y U;  2M16 A;  5LJ3 d;  4AT1 B;  3EFS A;  3IQL A;  2DE0 X;  1Q81 R;  1C0M A;  1D0Y A;  5C0M A;  3JSC A;  4HA8 A;  2ECZ A;  2RQR A;  2X4W A;  4JRI A;  4E7J A;  2BZX A;  3M53 A;  3L2U A;  1VQM T;  5GAM f;  2DZ9 A;  2WSF E;  2D1X A;  3EG9 A;  4PJO F;  4C92 E;  3VS5 A;  2CP7 A;  4J83 A;  1OX9 A;  2EYW A;  4OMQ A;  3FDR A;  3G7Z A;  3PIO A;  5A0G A;  4JJN K;  1H3Z A;  3CCM T;  2LDM A;  5I2M A;  3DLL A;  3J80 E;  2IG0 A;  2LMJ A;  1M3A A;  4LD6 A;  2P4T A;  3TCJ A;  2RI3 A;  2A36 A;  2V1Q A;  1YCY A;  3CD6 A;  1VQ4 Q;  4C8Q A;  3L2Q A;  3TU4 K;  5CKF A;  1ZA1 B;  1M5Q 1;  4QT7 A;  1OV3 A;  1CKB A;  2L3R A;  1IRE B;  2NWM A;  3A8O B;  1EZZ B;  1LCK A;  2CZ7 B;  4M77 A;  1RUW A;  1MHN A;  1PG5 B;  2LQ8 A;  2I0N A;  3I35 A;  3QHS A;  1M8M A;  4V2S A;  5GAN f;  3MHX A;  4RG8 A;  1YI2 T;  2JMC A;  1VIE A;  2E5Q A;  1ACM B;  1UGS B;  1WHJ A;  3OY9 A;  5CKD A;  1VQ8 Q;  4HCC A;  2MWP A;  1RAE B;  1AOJ A;  3OS2 A;  4C5H A;  1RAA B;  1W70 A;  1BKB A;  2KGT A;  2NYS A;  4JRP A;  5GAN 6;  3REB B;  4A4F A;  1K9M R;  1RL2 A;  2CDT A;  1CKA A;  3INZ A;  3SWN A;  1EX4 A;  4IIM A;  3C94 A;  3MEU A;  1VQ6 A;  2F2V A;  2HSE B;  5CQY A;  1M1K R;  2JJ9 A;  3SDZ A;  1YN8 A;  4B6M A;  5J39 A;  5CO7 A;  2RH2 A;  1B3Q A;  2AKL A;  4X9D A;  4XTV A;  1ZQ1 A;  1N8R R;  2OTJ Q;  2M0O A;  3HPW A;  2RMO A;  4C92 F;  1TXQ A;  1YP5 A;  3CC7 A;  5AT1 B;  3QDR B;  4M78 A;  2QGG A;  1XJW B;  2K2V A;  4QVZ A;  4DA4 A;  4IUR A;  1K73 U;  4BY6 C;  3VS0 A;  2D8H A;  1AZE A;  4AG2 C;  2DXU A;  1QVG S;  2DEU A;  2V8K A;  4F7U E;  3G4S T;  2CRE A;  2DER A;  3JB9 J;  1AT1 B;  2R5A A;  4R56 A;  1WJQ A;  5CQX A;  1GFD A;  3HRT A;  4ZN3 A;  4OGE A;  1PD0 A;  2CZ1 B;  2HKN A;  2GQV A;  1WA7 A;  1GCQ A;  2DAQ A;  2KRO A;  4M7D D;  3VV0 A;  5FRO A;  1VQ5 T;  4JJB A;  1M9S A;  3VYH B;  2M1H A;  3OMG A;  3FB9 A;  3QO3 A;  3ER0 A;  2WSC E;  2E41 A;  1Q86 U;  2COZ A;  3BFM A;  4E7S A;  4PKC C;  4FW2 A;  4PFP A;  3LX7 A;  3A8M B;  2EBP A;  1T3S A;  1X6G A;  1O9S A;  3JCM P;  3G4S Q;  1CSK A;  4N0A C;  5HCK A;  1TH7 A;  5KYX B;  1TOV A;  2CUD A;  3QYG B;  1VQ6 Q;  1MV0 B;  3L2R A;  1KQS S;  2BZY A;  1M1K C;  3DKM A;  2EYX A;  4C0D C;  3ASK A;  3PNW C;  2PVG B;  5KYX A;  4C5I A;  3JCM g;  2BE7 D;  3LWH A;  2FRW A;  2K5L A;  4BUG A;  2PUK B;  2FPF A;  1TU0 B;  1GFC A;  3G71 Q;  1Y71 A;  3M59 A;  3NMZ C;  3OYG A;  1AZG B;  1RLP C;  3SFM A;  3JCM V;  4HCB A;  4II1 A;  2BZ8 A;  3MPU B;  1R77 A;  2LCL A;  2OJ2 A;  3CC2 A;  4LUE A;  1RI9 A;  4BY6 B;  4C0G A;  1R0C B;  3WVE B;  4OMO A;  3RKW A;  2VGN A;  5LJ3 j;  1NBE B;  1YJN A;  3JAM E;  2A7Y A;  3CC4 A;  3CCR T;  1K73 R;  3I56 A;  2EKO A;  4BDY A;  2DKG A;  1UHF A;  1YJW Q;  5CIU A;  2DL8 A;  2RJF A;  2QQS A;  2JS0 A;  2KK4 A;  4M78 E;  3ULR B;  1OI1 A;  1S72 Q;  3L1A A;  2J6K A;  1ZSZ A;  1TWB A;  2YUN A;  5HK3 A;  4XTZ A;  4O5V A;  2EGE A;  5ECA A;  4M7A G;  5GAO l;  2MYS A;  3CCE T;  4M75 G;  4FYW B;  2KRM A;  2XID A;  1AHJ B;  4KUD K;  5J26 A;  2EWN A;  2KBT A;  5LJ5 h;  3H0I A;  2DYB A;  4OMF B;  1SHG A;  2W0Z A;  4M4Z A;  3OQ5 A;  3CCM Q;  4KH0 B;  2JW4 A;  1Q81 C;  4CC7 A;  1Q86 R;  2FZK B;  2WAC A;  4LDV A;  3X20 B;  1K76 A;  1VA7 A;  1D1A A;  1SHF A;  4C92 D;  1B34 A;  1VYV A;  1KQ1 A;  3VS7 A;  4FM4 B;  4BI8 B;  2EIF A;  1NJI C;  2L2P A;  2O01 E;  1VYU A;  4J7F A;  3JCM J;  2BKD N;  2NUP B;  2OTJ T;  4EMK A;  2QEX Q;  4PJO A;  3CPW S;  4OB1 B;  2F2X A;  1AWO A;  1Y7X A;  4MDW A;  3DLM A;  5L23 A;  2D0N A;  5IT9 E;  4LDX A;  2RPN A;  5KH6 A;  3CCJ T;  3C12 A;  4Y28 E;  3LW5 E;  3VKI A;  2DJQ A;  1M90 R;  2QQ9 A;  2ZCF B;  3M0P A;  3ZFJ A;  1U1S A;  4ESR A;  3JB9 D;  1K8A R;  2FL7 A;  2CZ0 B;  2LRQ A;  1FYN A;  1QW1 A;  3SHW A;  1RAD B;  2VVK A;  1PRM C;  3CME Q;  1YJN Q;  1JXO A;  1UB4 A;  2ZPF B;  1H8K A;  2GBQ A;  2IIM A;  3M5A A;  3OYA A;  1BU1 A;  4ZGD B;  1YWP A;  2LX7 A;  4PLI A;  2DTH A;  3CCQ A;  2RN8 A;  3LH5 A;  3HP9 A;  2LC4 A;  3G6E A;  4DOV A;  4NOY A;  1ZA2 B;  4PLL A;  4M77 D;  4WF2 A;  1WHL A;  3CCJ A;  3EFO A;  2LX9 A;  3PT9 A;  3R6O A;  2GF7 A;  3BE3 A;  4C92 G;  1BB9 A;  2SEM A;  3ZBD A;  1Q7Y R;  4M7D E;  1N9R A;  1ZLM A;  1JRI A;  4F7U F;  3E1S A;  5GMK l;  4GBQ A;  1GXI E;  2QDY B;  2QK0 A;  4PNO A;  3BDU A;  5IXF A;  5IAY A;  1M1F A;  4A4G A;  5HK0 A;  1V29 B;  2K3X A;  4NL2 A;  1YJ9 Q;  3A1P A;  3MKD A;  1PC0 A;  2ZPE B;  1VQK A;  3OYJ A;  3VRZ A;  4ELY C;  4JRK A;  2YDL A;  1RI0 A;  1W2B A;  2VC8 A;  3BY7 A;  4A53 A;  5GMK e;  5GAO m;  1HYO A;  1K0S A;  3M0U A;  4RTV A;  2QA4 Q;  1O75 A;  1RAI B;  1VQK T;  2LQK A;  5IHN A;  1E7O A;  1IO6 A;  1VQK Q;  3HKS A;  2LT4 A;  3QSU A;  5DY9 A;  2XIC A;  3J7A F;  4XU1 A;  4O6J A;  2K9G A;  3CCE A;  4Y92 A;  4FT4 A;  2K3B A;  1TUC A;  4IUT A;  4ME7 A;  3CCL A;  2EKH A;  5LJ5 f;  1QWF A;  1H64 1;  2CKK A;  4JPB W;  3EAE A;  2HSP A;  4GLK A;  4QW2 A;  4QVC A;  1K0X A;  4E2F B;  3I55 Q;  4M75 B;  1K9M U;  4OB0 B;  4LXC A;  2RD1 A;  1VQL T;  3KUF A;  5GJV B;  1HXD A;  1JEG A;  2DVJ A;  5LJ3 g;  2V26 A;  2YRC A;  1MND A;  1M30 A;  2MPX C;  3G6E Q;  2FPE A;  2QTX A;  3S3O A;  4BAC A;  2GTJ A;  1NYF A;  2MWO A;  2JXB A;  4X1V A;  2YUQ A;  1OU9 A;  2EJG A;  2R5M A;  3SB2 A;  4M7A F;  1PSE A;  2YSQ A;  2ABL A;  1OUL A;  5LJ5 d;  1VQ7 Q;  3GP8 A;  3KBG A;  2EYY A;  4M7D C;  2RHY A;  1Q86 C;  4IUQ A;  1B07 A;  4MZM A;  2F1L A;  2RK1 A;  1M2V A;  4OB2 B;  1NM7 A;  3QXE B;  5KYN A;  1VQP A;  2LCC A;  1QVF S;  4F04 B;  2EJF A;  4JLG A;  2LJ1 A;  2O88 A;  2V1R A;  4JZ3 A;  3FLG A;  4LN2 A;  5DLO A;  3QWY A;  5FU7 B;  4C8Q G;  3FIF A;  2K5F A;  1WPY A;  2RJD A;  2A28 A;  3JCM W;  2KRS A;  1FX7 A;  1VUB A;  2YT6 A;  4JRQ A;  2DIL A;  1W1F A;  4UC4 A;  4M7D B;  3H8Z A;  1VQO A;  2LCS A;  5A2Q E;  1VQN A;  1X2Q A;  4C0Z A;  4JDS A;  3CCL Q;  1VQ9 Q;  2XMF A;  2R58 A;  3OSS C;  1N9S A;  2E5K A;  2GCX A;  2PNI A;  4FL6 A;  5GMK m;  5GAN e;  4M75 D;  2DBM A;  1IB8 A;  1UHC A;  1P92 A;  4IIO A;  4J9C A;  5FW9 A;  2HAX A;  4VUB A;  2QTV A;  4ZGE B;  1X69 A;  2A08 A;  5LJ3 e;  4QKU A;  3VS6 A;  1QKX A;  1WQW A;  2DMO A;  3AT1 B;  2P0P A;  3A8L B;  2G3R A;  2VUB A;  1ZSZ C;  4XTW A;  4FIB A;  3VRY A;  1JJ2 P;  4M7D A;  1XQH A;  2DIQ A;  3UA7 A;  1U1T A;  2MI6 A;  2YRD A;  2AT1 B;  1WXT A;  1K9A A;  3JCM X;  2MOX A;  4A4K A;  3HHT B;  3OBW A;  2EAY A;  1W2B P;  1M2O A;  4P5N A;  4M78 G;  3GBQ A;  2OTL T;  5HKC A;  2KYM A;  1VQ8 A;  4J7I A;  3FEO A;  4XTU A;  1QKW A;  4J9G A;  2EQK A;  2QDL A;  1X43 A;  3M0S A;  5GAO p;  4LE9 A;  1KJW A;  1W6X A;  2L3Q A;  1X6O A;  1QMC A;  1X27 A;  1XOV A;  2EGA A;  3M4Y A;  3CXC A;  1KC8 C;  2COY A;  3EH2 A;  2GQI A;  4J9B A;  3MET A;  1MV3 A;  4OF1 A;  4BE0 A;  1G3S A;  4AG1 C;  1KHC A;  2E1H A;  3PMI A;  4BE2 A;  4HVW A;  3VS3 A;  2VAS A;  1KIK A;  4C8Q F;  1UGQ B;  3M54 A;  4DBQ A;  1H92 A;  3QPH A;  2COW A;  1NPR A;  1QCO A;  4JS4 A;  1RAG B;  2SRC A;  5J3B A;  2CS7 A;  1I5L A;  2JUF A;  4AFS C;  1KQS P;  2RM4 A;  2A3L A;  3WVD B;  4Z8A A;  1MMG A;  2J6F A;  3QDF A;  2MCN A;  1VQ7 A;  2RJE A;  3SD4 A;  3QUI A;  4M77 G;  1SRM A;  1U5S A;  1YJW A;  4LD9 K;  1Y96 B;  1JB0 E;  2JTE A;  2ZPB B;  4B9X A;  1GRI A;  1TSF A;  3EG0 A;  2DEQ A;  1OEB A;  2CH4 A;  1SF9 A;  2EQU A;  3PIP A;  4WCI A;  1VQ6 T;  1OU8 A;  1UUE A;  1N8R C;  2DD4 A;  4FSS A;  2LZ6 B;  3EHR A;  1K4U S;  1PSF A;  1IGQ A;  3J81 E;  1FWZ A;  1WXU A;  2GFU A;  3UT1 A;  2FZC B;  5FLX E;  1NLP C;  3EG2 A;  1ABO A;  4DOW A;  1M2V B;  2H8H A;  1VQ4 T;  2VXE A;  2HQE A;  1JQQ A;  2GFA A;  5KYW B;  3O8V A;  1VQ5 Q;  1WHK A;  1KC8 R;  3C0C A;  3G6E T;  2ZGW A;  2FZG B;  1Q82 R;  4XU0 A;  2QQA A;  3X28 B;  2L89 A;  1VQL Q;  2XKO C;  4A63 B;  2DPP B;  2KMT A;  4CI0 C;  1AWJ A;  1OPK A;  1Y57 A;  2LP5 A;  1EIF A;  4M75 F;  4RTX A;  5EC7 A;  1XTD A;  1M8V A;  1JU5 C;  4XTY A;  4OMP A;  2NUT A;  1IRX A;  5LJ3 h;  1I0C A;  1WQ7 A;  3RER A;  5KE3 A;  1MMN A;  2A0F B;  2HDA A;  2HBW A;  2PVD B;  2J06 A;  3TEE A;  4N4H A;  3VS1 A;  3UA6 A;  3NTK A;  5GMK h;  1YIT T;  1MUZ A;  2GTO A;  2FPD A;  2CT3 A;  4FYY B;  3H6Z A;  1MGQ A;  2IVW A;  3CMA T;  1OPL A;  2JS2 A;  5GAN 4;  2KQW A;  3GOX A;  1NYG A;  2RB6 A;  1ZSZ B;  4N4I A;  4PJO E;  3HSB A;  4K11 A;  3OB9 A;  3OSV A;  5CVI A;  4C8Q B;  3O5Z A;  1M4Z A;  3LGL A;  5IN1 A;  2MMP A;  2PU9 B;  4J6Y A;  3U23 A;  4M7A D;  5D6W A;  3OMC A;  4XK8 E;  5CR2 A;  3CMA A;  4JJC A;  3GNG A;  1D1C A;  1RAB B;  1M3C A;  3RKX A;  2QQR A;  4M77 C;  1YI2 Q;  5I21 A;  3CD6 T;  2K5I A;  1RAH B;  4Z89 A;  1H3H A;  2M9U A;  2K57 A;  1QVF P;  4C8Q C;  3MEW A;  4X34 A;  1IHW A;  1A0N B;  1NJI U;  1DJ7 B;  2DL7 A;  4GY5 A;  2RQW A;  1BI0 A;  1ZUK A;  4HXJ A;  4BI3 A;  2JN0 A;  4EDU A;  1SSF A;  5GAO r;  5FU7 C;  1PD1 A;  2EJ9 A;  2OTJ A;  2FB7 A;  1V76 A;  2R57 A;  4XTX A;  3CCQ Q;  2RQV A;  2VGM A;  1ZUU A;  1WFW A;  2AIR B;  1RAF B;  1YJN T;  3CME T;  1BCM A;  2FHD A;  4OMM A;  5FU6 C;  2L3S A;  2E6Z A;  5GAN 8;  1MMA A;  3M56 A;  2CYZ B;  1QVG P;  1U06 A;  3CCU T;  3EHQ A;  4TVR A;  5KYU A;  5D6X A;  5GMK i;  2WSE E;  4M78 C;  4F7U G;  2J7I A;  4C0F A;  3G71 A;  3H0H A;  4B9W A;  1S1N A;  2E6N A;  4EMK B;  2QA4 T;  4CC4 B;  1Q95 G;  1N5Z A;  1UDL A;  2QEX T;  4E7L A;  4NS5 A;  4M7D F;  2X4J A;  1KQS A;  2DFU A;  2DD5 A;  6AT1 B;  1BBZ A;  3EFR A;  3G1J A;  4M75 E;  8AT1 B;  1JJ2 S;  3TSZ A;  1VQN Q;  1KSW A;  5FWB A;  3CPF A;  1VQP T;  4HT8 A;  5GAN g;  3N5B B;  4F16 A;  4R0K A;  5LJ5 e;  1SSH A;  2L8D A;  4HKE A;  3OYN A;  3M58 A;  4ATO A;  1G3Y A;  1WGS A;  2HMA A;  2RHZ A;  1UGP B;  3F70 A;  2PTK A;  3A8H B;  1EFN A;  4C8Q D;  2QQB A;  2RI2 A;  3PE0 A;  3BW1 A;  4E7K A;  3CCE Q;  4QVD A;  3EG3 A;  2QGF B;  4J8O A;  1NEG A;  1QVP A;  2JM9 A;  5C6S A;  1Q82 U;  3ZEH A;  2B86 A;  4RTW A;  1I1J A;  1G5V A;  2M02 A;  4C0D B;  1JO8 A;  2ED1 A;  4MZT A;  3TRE A;  3CD6 Q;  5FWC A;  3HRU A;  1AD5 A;  1IXD A;  1TUG B;  2O9V A;  2OTL A;  1KD1 R;  1AEY A;  2RF0 A;  2JZ2 A;  3QYH B;  2XDB A;  2L0A A;  1AWX A;  5GAN 3;  2D6F A;  1N6A A;  2E4H A;  3TQ7 P;  3EGD B;  3A8G B;  3RUX A;  1BI1 A;  1IHV A;  1NG2 A;  3DB4 A;  4E47 A;  5IH2 A;  2YLB A;  3OYL A;  2RI5 A;  1FMK A;  3V8K A;  2RQT A;  3QJY A;  3E2U A;  3JB9 H;  2HQX A;  1ZUY A;  3S6W A;  3FJ5 A;  4IUU A;  3G4S A;  1LNX A;  3CPW A;  4ANJ A;  3C4S A;  3CC4 T;  1PHT A;  3G71 T;  2ESW A;  3OW2 A;  2KYB A;  4A4E A;  3V8L A;  4HT9 A;  2D8J A;  1B34 B;  2DET A;  1ARK A;  4EMH A;  1FMV A;  2F5T X;  1GBQ A;  4D8D A;  4LDY A;  1D09 B;  3OYH A;  1PWT A;  3NTI A;  3ME9 A;  4RKU E;  2JVV A;  1M27 C;  3CCR A;  2P0Q A;  3CBO A;  4KRT A;  3H41 A;  3VJP A;  2EVR A;  1UE9 A;  1YCS B;  3M4G A;  5I11 A;  1VQO Q;  2HEQ A;  4M75 A;  2V8I A;  2K7A A;  4IUV A;  2D9T A;  1IGU A;  1BCO A;  1TTH B;  2O9S A;  3CC7 T;  5LJ3 f;  1KK7 A;  2ROL A;  5A0L A;  2CP6 A;  4RCB A;  3JCM f;  1LVK A;  2O4X B;  2RHU A;  4JZ4 A;  1QVF A;  2MIO A;  3QKJ A;  2LTO A;  2E70 A;  2EFI A;  3OS1 A;  1KG1 A;  2M0Y A;  2JMA A;  3TVT A;  2DXC A;  1YBY A;  2OAW A;  2W10 A;  4RTT A;  4J5Y A;  2FRY A;  3JV3 A;  1WIE A;  1VQO T;  3P8B B;  1YFN A;  3CXC S;  2ZPI B;  4QQG A;  1OQK A;  3CBM A;  1S72 T;  2B8A A;  3C95 A;  2YWW A;  4PJO C;  1VIF A;  4PL6 A;  4LUD A;  4FT2 A;  1VQ5 A;  1JXM A;  5GAO q;  3CCR Q;  3OYI A;  4LDW A;  4F17 A;  4F7U B;  1HSQ A;  2EQJ A;  3EFO B;  1I81 A;  4LNP A;  3CXC P;  2DL3 A;  1D0X A;  2BUD A;  2DVE A;  1UFF A;  3V7C A;  2CT4 A;  5CAI A;  4M78 D;  2QA4 A;  3RNJ A;  2X9H A;  3M0Q A;  2GGR A;  4FSX A;  3URG A;  5GAM j;  2K2M A;  1VQ9 T;  2ZPG B;  4FCY A;  2F69 A;  3M9Q A;  1K73 C;  4J9H A;  4XU2 A;  3M57 A;  3PFS A;  2VXF A;  1WDX A;  1Q81 U;  1OX8 A;  4EMG A;  2C0O A;  4MML A;  3GF5 A;  7AT1 B;  1JJ2 A;  4C5G A;  4FYV B;  3EGX B;  3HFN A;  2AKK A;  4M7D G;  1IZ6 A;  5GJW B;  4OGC A;  2PVO B;  4PJN A;  1VQ8 T;  2CUB A;  3M0R A;  2DBK A;  4MZP A;  1GL5 A;  1YIJ A;  2JOY A;  3EGX A;  1BK2 A;  4PJO G;  2L3P A;  3JB9 F;  3L2W A;  3CPW P;  3UAT A;  4M7A C;  4C92 B;  3NHN A;  1VQ9 A;  1GCP A;  4WTO B;  4ZN1 A;  2XK0 A;  2Y90 A;  4HCK A;  1WX6 A;  5GAO n;  2HBP A;  2E3I A;  3LLR A;  2ZAE A;  1YI2 A;  2E3H A;  2HD0 A;  3OYM A;  3WXM B;  1T0H A;  4ELZ C;  3SWN B;  2JTM A;  2DA9 A;  4XU3 A;  4DQ2 A;  1QLY A;  2V8J A;  5GAM g;  1SEM A;  2ROT A;  3X26 B;  2ATC B;  5FU6 B;  4RCC A;  2KR3 A;  3M0T A;  1ZX6 A;  3OS0 A;  1PCX A;  1M3B A;  2F5K A;  2NLU A;  2Z0W A;  1VQP Q;  3VS4 A;  4AFZ C;  1R8O B;  2HZY A;  4KGX B;  3CCM A;  1C6V X;  1WZO A;  4ZNX A;  4FU6 A;  4E6R A;  4D8K A;  1YWO A;  2DL4 A;  5IXB A;  3JCM b;  1GCQ C;  4OMN A;  2I2L A;  1GBR A;  3X24 B;  1ABQ A;  2DO3 A;  3KXT A;  1E6G A;  2KEA A;  1VQM A;  4CC3 A;  1Y0M A;  1F1B B;  3LYI A;  1UEC A;  3L42 A;  3CCL T;  3GPL A;  1M1G A;  2EYQ A;  2FVU A;  4M78 F;  1HK9 A;  4KUL A;  3CC2 Q;  4XQ3 A;  1FMW A;  4RG2 A;  2EQI A;  2X4X A;  3CCU Q;  1Y96 A;  1TUD A;  3OYC A;  3E19 A;  3MEV A;  4AFU C;  1PKS A;  2PQW A;  5M9O A;  4HVU A;  1SPK A;  3BDL A;  2CSI A;  2XG8 D;  1YJ9 T;  1AWW A;  2IPO B;  2ZPH B;  5I2S A;  2BE9 B;  4Z88 A;  1B7T A;  4GLM A;  3QZ9 B;  3THK A;  1VQ7 T;  1PRL C;  3UF4 A;  2C06 A;  2QXF A;  5GAN 5;  4BE1 A;  1X75 C;  2DRM A;  2KVQ G;  1K9M C;  1BIA A;  1G2B A;  1X01 A;  2DLP A;  3EGU A;  5LJ5 j;  2CH4 W;  4RMO A;  2C0I A;  4KGV B;  4QQ6 A;  3EG9 B;  3I5R A;  4C8Q E;  3OYF A;  4M7A E;  1OZ3 A;  1T0J A;  3QII A;  2DJZ A;  3OYD A;  1NPP A;  3RES A;  4HCZ A;  2F2W A;  2DX1 A;  2RHI A;  2YHT A;  3H0F A;  3I55 T;  2AZS A;  2RNA A;  3RDV A;  1V1C A;  2CP5 A;  3D7S B;  1MMD A;  3JB9 I;  4OML A;  3V7R A;  3JCM h;  4PK4 A;  3MCA B;  2LJ0 A;  1VOM A;  2OAU A;  1N27 A;  2NUT B;  2EPD A;  3CCV Q;  1VYT A;  3A5Z B;  4RTZ A;  2DXT A;  5KYY B;  1Z9Q A;  1QCN A;  3CC2 T;  2CP3 A;  4A54 A;  3RR6 A;  3NTH A;  2HL5 C;  2K3Y A;  2X4Y A;  4ZTJ A;  3PMT A;  3RMQ A;  2DNU A;  3FRN A;  4OVA A;  1YHQ Q;  1YHQ T;  4L59 A;  2NUZ A;  5EG2 A;  2FEI A;  2K4Y A;  1AVZ C;  5KYY A;  1UTI A;  3I56 T;  4PJJ A;  1YIT Q;  3EG1 A;  3JRZ A;  2EQM A;  2KAF A;  8ATC B;  1T3L A;  3VUB A;  3Q1J A;  1M90 U;  4RUG A;  4DBR A;  2L5Q A;  1WNL A;  4C92 C;  1J3T A;  1Q82 C;  4M77 B;  4EIK A;  3LH0 A;  5KCO A;  3CEY A;  3RIR A;  4BB7 A;  3VYG A;  4N0A A;  3UWN A;  2DRK A;  4IKF A;  4Q5W A;  3VS2 A;  5KE2 A;  1KHI A;  3MJX A;  4FW1 A;  2LT1 A;  2NUP A;  3I9Q A;  5CKB A;  1ZSG A;  4M75 C;  2KDS A;  4BDZ A;  3OYB A;  2KT1 A;  2LNH B;  4AFQ C;  2CZ6 B;  2H3E B;  3E9G A;  1M1K U;  1C1A A;  1SKU B;  1UJY A;  3I5S A;  4D6W A;  3MO8 A;  5FRM A;  1OZ2 A;  2CSQ A;  4FYX B;  2EW3 A;  1Z9Z A;  4J6W A;  5A0D A;  2KNB B;  1G8X A;  2AHJ B;  2PZ1 A;  4PJO B;  1D3B A;  1OYX A;  1KD1 U;  2VYT A;  4PJL A;  5KYU B;  3CQT A;  3L2V A;  2P4R A;  2XI9 A;  3CCS Q;  4J9F A;  2D0Q B;  3NGP A;  4C5E A;  3I55 A;  5LL6 S;  1XNI A;  1D3B B;  4PFZ A;  4CRI A;  3SWN C;  1LJO A;  2PUO B;  3JCM Q;  2E10 A;  5CKH A;  5GAN d;  1QCF A;  2HQH A;  1D1B A;  1BI3 A;  3UDC A;  3OBY A;  1WLP B;  4PJM A;  5KYW A;  1S72 A;  5GAM d;  3JCM c;  4MDX A;  2JM8 A;  2RA2 A;  1UJ0 A;  4M77 E;  4EPC A;  1SG5 A;  2DYI A;  1ZBJ A;  1W2B S;  1G3W A;  1N8R U;  2YUO A;  3FC3 A;  2KSS A;  5FRN A;  1I5O B;  1D0Z A;  2G6F X;  4PFO A;  2JT4 A;  3ZL7 C;  1RAC B;  3NPF A;  3R6N A;  2E65 A;  2FYK A;  2XD0 A;  1YIT A;  2O31 A;  2QYZ A;  2YLC A;  3RBB B;  3PGG A;  4L5G A;  2P0K A;  3QBY A;  2KXD A;  2HCK A;  1YNZ A;  3CCS A;  3CCV A;  2K6D A;  2DIG A;  3QWX X;  2DTO A;  3QG1 A;  1VQ4 A;  3V7S A;  3T9N A;  3P8D A;  2AK5 A;  2RO0 A;  2X3X D;  2BIV A;  4EMK C;  1UGV A;  2ENM A;  4RTU A;  3VUZ A;  3GNF B;  2MF2 A;  5GAM e;  2C0T A;  4J6X A;  3OYE A;  4X9C A;  5GAN j;  3MEA A;  5IHI A;  2MAM A;  2HL3 A;  3DB3 A;  2A37 A;  1SRL A;  2JTF A;  4Y91 A;  1QQJ A;  2VWF A;  3KFV A;  3CC7 Q;  3MP8 A;  4DEX A;  2RQU A;  1YIJ Q;  3LGF A;  3EGD A;  1K1Z A;  1I07 A;  5DLQ E;  3GIB A;  2Y4X A;  4J9I A;  4JUV A;  3PTA A;  4BD3 A;  1G3T A;  5DM7 R;  3QZ5 B;  2AZV A;  5GAN h;  4J9E A;  1YJW T;  3PVL A;  2RJC A;  2DZC A;  2DM1 A;  1WXB A;  4JJD A;  1YJ9 A;  1ZHI A;  2K79 A;  1MNE A;  3OW2 P;  4F14 A;  3NFC A;  1U8R A;  2VV5 A;  2LJ3 A;  1YHQ A;  2MK5 A;  3S3M A;  2E12 A;  2JNG A;  2CGH A;  1BIB A;  4N4G A;  2J6O A;  2QAS A;  1KC8 U;  1I4K 1;  4ZTF A;  2RHX A;  1RLQ C;  1WJR A;  4E7H A;  4YTL A;  2KI7 A;  2BTT A;  4HVV A;  1QWE A;  2XU8 A;  3S3N A;  3HL8 A;  1R0B G;  3REA B;  1W4S A;  4OP0 A;  4KBM B;  4RTY A;  3TSW A;  2Y4Y A;  3H9N A;  3MP1 A;  4JS5 A;  5D7U A;  2O4X A;  4F7U A;  2HNI A;  5AYF A;  3CCS T;  1QP2 A;  4JLI A;  3OW2 S;  4LDU A;  4KGZ B;  2DK3 A;  5IHK A;  1PM3 A;  1UG1 A;  1YIJ T; 
#chains in the Genus database with same CATH homology
 1VQ7 Q;  1NJI R;  3CD6 Q;  3G6E Q;  3CCJ Q;  3G4S Q;  3CMA Q;  2QEX Q;  1KQS P;  2OTL Q;  1VQN Q;  3CCS Q;  3I56 Q;  3G71 Q;  1M1K R;  1K73 R;  3CCQ Q;  3CC4 Q;  2QA4 Q;  1VQ8 Q;  1KD1 R;  3CME Q;  3CCL Q;  1YJN Q;  1YJW Q;  1YHQ Q;  1VQ6 Q;  1VQ9 Q;  1VQM Q;  1YJ9 Q;  1VQP Q;  1VQ4 Q;  1VQK Q;  1W2B P;  3CCR Q;  3CCE Q;  1YIT Q;  1YI2 Q;  1VQ5 Q;  1S72 Q;  1Q7Y R;  1KC8 R;  1N8R R;  3CC7 Q;  2OTJ Q;  3I55 Q;  3CCV Q;  1Q82 R;  1QVG P;  1M90 R;  3CC2 Q;  1YIJ Q;  1Q81 R;  1VQO Q;  1K9M R;  1K8A R;  3CXC P;  3CCU Q;  3CCM Q;  3OW2 P;  1JJ2 P;  1VQL Q;  3CPW P;  1QVF P;  1Q86 R; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...