1VQ9Q

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq9Q00
3I56Q 3CCEQ 3G6EQ 1YJWQ 2QA4Q 1Q81R 1QVFP 3CCLQ 3CC7Q 1VQKQ 3CC4Q 1K73R 1VQPQ 3CC2Q 3CCMQ 1Q7YR 1KC8R 2OTJQ 1N8RR 1K8AR 1VQ5Q 3CCSQ 2QEXQ 1VQ7Q 3CCRQ 1VQOQ 1K9MR 1KQSP 1VQ6Q 3CMAQ 3CCJQ 1JJ2P 2OTLQ 1VQMQ 1YITQ 3I55Q 3CXCP 3CCUQ 1NJIR 1S72Q 1M1KR 3CMEQ 1YIJQ 1Q86R 1M90R 1Q82R 1QVGP 1VQLQ 3G71Q 1VQ4Q 3CCVQ 1VQ8Q 1VQNQ 1KD1R 3CPWP 3CD6Q 1VQ9Q 1YJNQ 3OW2P 1YJ9Q 1YHQQ 1YI2Q 3G4SQ 3CCQQ 1W2BP
chains in the Genus database with same CATH superfamily
2DMOA 4C8QG 2Y4YA 3CC7A 4WF2A 2NLUA 2D0NA 2KYBA 3C12A 2QK0A 2OTJQ 1SKUB 2MI6A 3M58A 1JJ2P 3OQ5A 2VASA 1AT1B 2YWWA 3VS6A 2FPFA 2BZYA 4J9CA 4HT9A 1BB9A 3NGPA 2E64A 4J5YA 4C8QE 2F5TX 2DRKA 2R5MA 4OB2B 2DL4A 1VYVA 5CKFA 3V8LA 1BKBA 3TSWA 3G6EQ 5GAMh 1MNDA 1Y57A 1ZBJA 1U3OA 3BE3A 2F2XA 1RACB 2MYSA 3CCJT 1K9MU 1VQOA 3J7AF 4MMKA 3OMCA 1BK2A 2YRDA 5LJ5g 2E65A 1WZOA 2IPOB 4LDUA 5DLOA 4FYXB 4J8OA 3JCMf 3JCMb 1YI2Q 1RI0A 3UA7A 4M75F 2K5LA 3M59A 3G6EA 1KQSS 3PVLA 1BIAA 2EAYA 3KFVA 5GAMe 1KG1A 2OTJT 1W6XA 1GCPA 1UGVA 2RMOA 2COWA 2JM8A 2DXUA 3NMZC 2KEAA 4R56A 3MP8A 3FIFA 1TUGB 4E7JA 5I11A 1YI2A 2QA4Q 1NM7A 1QCNA 5I21A 2LNHB 4PLLA 1OYXA 4PK4A 3OY9A 4NOYA 2QEXQ 3D7SB 9ATCB 4E2FB 3A8HB 1JRIA 1QVFA 3LW5E 5GMKl 1X75C 4M78A 4MZTA 3NPFA 2XDPA 4OMQA 4OMMA 4IIOA 3ZEHA 2QYZA 5GAN7 5CKEA 4YTLA 4X34A 2FPDA 3OS2A 1TOVA 4PJOA 3FC3A 1E7OA 1LVKA 4PJOB 2H3EB 3EGUA 2RJEA 4EDUA 4C0FA 2VGMA 5GAOq 2QEXA 1AWWA 2QQ9A 1AWJA 2K79A 2LCLA 4J6XA 4J9IA 3OW2S 4Z89A 6AT1B 3BW1A 2LQNA 4RCCA 2KK4A 2GTOA 4PFPA 4J7IA 1G2BA 1K73C 1D0ZA 1LCKA 1SF9A 3SWNC 3INZA 2DEUA 2NUZA 2XICA 4M4ZA 4BE1A 4FU6A 1TUCA 2YUQA 2DVEA 4C0DC 1WGSA 1RLQC 1VQLQ 4BB7A 1ZLMA 4DBFA 2E70A 2K9GA 2LQ8A 1N9RA 5GAN4 1WHMA 4FW1A 4RG8A 1B34A 1VQKT 1B34B 1R8OB 2JJ9A 5CR2A 1QCOA 3QZ9B 2MPXC 4LN2A 3L2VA 1QKXA 2OTLQ 2D6FA 1PRLC 2H3JA 1G5VA 3M4YA 5LJ3h 2M9UA 2RD1A 1VQLA 1M90R 5IHIA 1AWXA 2ABLA 4FSSA 2LDMA 4RTZA 3TU4K 4RCBA 5CO7A 2EQJA 1UJ0A 4LXCA 4OVAA 1ZA2B 1ZHIA 3GNGA 3RKXA 1N8RC 3CCLQ 1M1FA 4L6V5 4F7UA 4OMPA 4F7UB 5A0DA 1M1KC 1T3SA 5D6XA 2Y4XA 2OTLA 2XK0A 3CXCP 1SEMA 2ESWA 5LJ3e 1VQ4T 3H0FA 4M7AG 3FJ5A 2HMAA 1YHQT 1D1AA 2OX7A 4HVVA 1D0XA 3V8JA 5AT1B 2K7AA 5CVIA 4C5EA 4Y28E 8ATCB 3MEWA 3THKA 1ARKA 2QASA 3V7SA 5KYWA 1YJWA 5GJVB 5KYWB 4OB1B 1NLOC 4X1VA 1MHNA 2GFAA 2KXCA 1G83A 4PNOA 2EQKA 2F69A 1QVPA 2DE0X 2P4RA 2DPPB 3M0QA 5FU6B 1ZX6A 1OZ3A 2LT1A 1ZUUA 3GBQA 3L2WA 2JOYA 2YT6A 1WX6A 1BI2A 4CC2A 3CCQT 2K4YA 3RMQA 2E3HA 3EHQA 3MEAA 2RQRA 3CCLT 2JXBA 2BE9B 1QP3A 4Y92A 1HD3A 1VQPA 4BI4A 4IUVA 3RNJA 3LH5A 3P8HA 3CMET 4M78C 3H9NA 1TH7A 5CIUA 3ZL7C 2M1HA 1FMWA 2KQWA 1JU5C 2EVRA 2CP7A 3QSUA 3MP6A 4PJOC 4C92E 2KR3A 2MOXA 5EG2A 5I22A 1LOJA 3M9QA 2PZ1A 4GBQA 1K8AR 1K0XA 2ZPBB 5CKDA 1KQSP 3OYGA 4AFQC 1D09B 3BDUA 4QVCA 2JN0A 1YJNT 2QQBA 2MWOA 1VQ9A 3OYFA 3HTRA 2A36A 1UDLA 2L0AA 1PSEA 2OAWA 3CC2Q 3BY7A 2KDSA 1U06A 2EJ9A 1AEYA 4PJJA 4A63B 3CCUA 2X51A 3SB2A 2O88A 3E2UA 1V76A 4LDWA 3EGDA 2DBKA 1K0SA 4A53A 1X6GA 3M4GA 4M78F 1M27C 4DBRA 1G8XA 1WJQA 3CC2A 1CKAA 2DD4A 1TU0B 2GGRA 3M0RA 1SRLA 4PJOF 3U23A 5KYXA 2HQXA 5KYXB 1GFDA 1Y96A 1Y96B 2P0PA 3V8KA 3JSCA 3M56A 2DXCA 3VYHB 2E6ZA 5HY6A 3OW2P 1TWBA 2FL7A 2FRWA 4ORZA 4JJDA 1BI0A 3ULRB 3CPFA 2O9VA 1UEBA 4OGCA 1XQHA 1WNLA 1UGPB 3VUZA 4M77D 2NUPB 1UTIA 2RF0A 5FU7B 1UB4A 2CP6A 1S72Q 5GANf 4JZ4A 1J3TA 4IUQA 2WSFE 1KIKA 1RAFB 2M0OA 2EW3A 2A28A 2RJCA 2ZPEB 4IUTA 2LQWA 3OYNA 4M75E 2C0OA 3E1SA 5HK0A 4J9FA 4MZPA 1P92A 1RI9A 5FU6C 1ABOA 2JT4A 4XTYA 3JCMJ 1YITT 1SPKA 2KRNA 4PFZA 2DZCA 1M90C 4J9DA 1BYMA 2JUFA 1E6GA 3VU3C 3VKIA 2YLBA 1QVFS 2D8JA 2HD0A 2ROTA 1IHWA 2D0QB 2LQKA 5A0GA 3C0CA 4HCBA 2RQVA 3JCMd 2J06A 4L59A 4J9GA 2CT3A 2DA9A 4Q5WA 1GXIE 2DK3A 1QMCA 1S72T 3A8MB 4F7UF 4NS5A 2DZ9A 3REBB 2KRMA 2LCCA 3C95A 4QQ6A 4WTOB 3GIBA 3PVQA 1R0CB 5GAN6 1MNEA 1WHGA 1H8KA 1WXTA 2DXTA 3PIPA 3NTIA 1BU1A 4FT4A 1M4ZA 1R0BG 1HJDA 4KGXB 1WXBA 4E7LA 1I8FA 1IZ6A 4XQ3A 5I2MA 1MV3A 2NUTA 1H3HA 2NUTB 3HRSA 4XU1A 1OULA 3RKWA 3VS1A 2P84A 4J6YA 2JTEA 1IHVA 2EYZA 1M8MA 4C8QD 4M7DA 2RA2A 4XTWA 3TSZA 2VWFA 3EG9A 2L2PA 1I5OB 2PVOB 1ZUKA 2PNIA 2E4HA 8AT1B 3EG0A 2J6FA 1KSWA 2O4XA 2PVGB 2O4XB 5D7UA 1K8AC 1K73U 2K2VA 4DQ2A 4ATOA 1X6BA 1QQJA 3MEVA 1BIBA 3JCMV 1MMNA 1YCSB 2BE7D 1YIJT 2LVMA 1YWPA 2L3SA 4J6WA 3BDLA 4XTZA 1W2BS 2E3IA 2OI3A 1PWTA 4HVWA 4RTWA 4ZN3A 2O01E 1M8VA 2JM9A 3GF5A 4KBMB 1RAHB 1IGUA 2RJDA 2KY9A 1X2QA 4K11A 3S3NA 1GL5A 3CCST 1K76A 1R77A 4OMLA 4M77A 4M77B 4LUEA 2DX1A 3VV0A 5GAN8 1NYFA 3MCAB 1GCQA 3PMTA 3LGLA 1Q86R 1U1TA 2E12A 3ASKA 1O75A 4AMCA 1U1SA 4X9DA 1WJSA 2DD5A 3CCMT 1K1ZA 1N8RU 5LL6S 2ROLA 2LJ0A 4O6JA 3CCJQ 2YUPA 1M1KU 1IXDA 3C4SA 2X4JA 3RIRA 3G71T 4MDWA 1SG5A 2BTTA 5GAMf 3VUBA 4JJCA 4OMOA 4LUDA 3FB9A 2WACA 2KROA 2FG0A 2YHTA 4PJNA 1WI7A 1T0HA 1QLYA 5KYYA 2LX7A 5KYYB 2XDDA 1FXXA 3V7RA 4E6RA 3OYYA 3N5BB 2DIQA 2HL3A 3QIIA 2RHYA 3MEUA 2KXDA 3NHNA 4LD9K 2AKLA 2FVUA 3M0UA 2EQUA 2MAMA 3VS4A 2JZ2A 3A8GB 2VC8A 4NL2A 2ZAEA 3JCMg 3OSVA 1G3WA 3KBGA 2XDBA 2OTJA 3OBWA 2XI9A 3NTKA 3SD4A 5LJ3j 2CT4A 2QI2A 1UJYA 2YXYA 2DF6A 1QWEA 1KFZA 2FEIA 4F14A 1WHJA 4HA8A 1QVFP 4M7DC 2RB6A 3CC4Q 2KYMA 2YUOA 3H41A 4OGEA 1BCMA 3OYBA 1K9MR 4M78G 4B9WA 2F5KA 4RTUA 2D9TA 4LDYA 1I1JA 3S6WA 1WFWA 5FLXE 1D3BB 2X3WD 1SHGA 1T3LA 4JS5A 5GAOm 1WDXA 4M78E 1YCYA 3TCJA 3X24B 4ZGEB 5IH2A 1VYUA 4HKEA 3X26B 1EFNA 1IO6A 1W4SA 4KUIA 2RHUA 1U5SA 4JRIA 4PJOE 2XMFA 4OF1A 3VS5A 1M3CA 1M3AA 2CDTA 4M7AD 4DOVA 2X9HA 3EAEA 2BKDN 1NEBA 3IQLA 4QW2A 2RO0A 1O9SA 2FRYA 3CC4T 2QA4A 3G1JA 1VQKQ 4M77C 2DJQA 4FCYA 3NTHA 2CSQA 2RPNA 2MWPA 2DIGA 1GCQC 2QQRA 3LYIA 3JCMc 3RERA 3QDFA 4M7DF 4KULA 1LPLA 1QKWA 5LJ5h 4VUBA 3UF4A 2CP2A 1KQ1A 2K3XA 3M0PA 4RMOA 3HKSA 5LJ3f 3L2RA 4JJNK 1VQ7T 2I0NA 3G7ZA 3CMAT 1OX9A 4ZNXA 2QAZA 2R57A 1Q82C 3OYCA 1V29B 1VYTA 3QUIA 3T9NA 3ER0A 1C0MA 4FIBA 2C0IA 1N27A 1VQ4Q 1NPPA 5LJ5e 1NPRA 1YHQQ 3DB3A 5FWCA 5GANd 2KRSA 3CPWA 1VIEA 2H8HA 1Q7YR 2A08A 4C5HA 5AYFA 3ME9A 2E1HA 1Q86C 2O9SA 1M90U 1EX4A 4N4GA 4F7UE 4A54A 4M77F 2EYQA 1YHQA 4J9EA 3HPWA 3JRZA 3CCQQ 2ZPHB 2FHDA 1X01A 3PFSA 3S3MA 3MPUB 1KC8U 1JXMA 2OAUA 1W2BA 2JS0A 4QKUA 2QG9B 1GBQA 2GFUA 4GLKA 4NL3A 4BDZA 3CMEQ 1WPYA 4EMGA 1B3QA 2BZ8A 4JLIA 3CCQA 4R55A 2DYBA 2LC4A 1QVGA 2V1RA 3RDVA 4CC7A 1RL2A 2P0KA 2GF7A 3FEOA 3CCLA 1TTHB 4E7ZA 2LT4A 2FB7A 1X6OA 3BFMA 2QTVA 1WQ7A 3CCVT 3CMEA 3QJ6A 2AIRB 1ZSGA 1YJNQ 1AWOA 1UGQB 3I56T 2C0TA 2COZA 5CK9A 2ZPFB 1HYOA 4C92G 2P0QA 4JS4A 2W10A 1KK7A 2KNBB 3O8VA 2C06A 2QDLA 1DJ7B 1AHJB 3META 4FM4B 4E7HA 1YJNA 2P4TA 4M7AA 1YJWT 4M7AB 4V2SA 2BZXA 4HXJA 1PC0A 1WA7A 1WQWA 1ZSZB 4A4EA 5GANj 1K9MC 5GMKh 5M9OA 1I07A 1C6VX 2DJZA 4TVRA 2ENMA 3CBPA 1AZEA 2E10A 4C0ZA 2X4XA 1X69A 2RI2A 2DL3A 1YJ9Q 1OX8A 2D1XA 5FW9A 1PG5B 3L1AA 2HQHA 4BUGA 2LCSA 1VQPT 2FZGB 3EFOA 2QXFA 3EFOB 5GMKe 3JB9F 1ACMB 5J39A 1W1FA 1NLPC 2VYTA 3E9FA 4A4HA 1N6AA 1NJIR 2JW4A 2MMPA 2RI3A 5IT9E 1QP2A 2RM4A 5GMKi 1PD0A 2OJ2A 2EKHA 1ZA1B 3JCMX 2J05A 1H3ZA 1Q81U 4RTVA 3LGFA 4IURA 2QDYB 1SRMA 2LRQA 4D8KA 2KT1A 3H0IA 3O5ZA 1YITQ 2DBMA 3I55Q 2RJFA 3WVEB 4ME7A 2CZ0B 3R6NA 1ZBXA 1YJ9T 3G4ST 5GJWB 1B7TA 2EJGA 5GANg 5GAMd 3MP1A 1IB8A 4DEXA 3KUFA 4GY5A 4ZTFA 1UECA 2KSSA 1I0CA 2FPEA 2E41A 2NUPA 1OU9A 4M75G 1MMAA 2EPDA 4DBHA 2L5QA 1EZZB 1VA7A 3PMIA 1UGSB 2QQSA 1Q7YC 4ELYC 3VS2A 2RK1A 3I55T 1PSFA 3FDRA 2HAXA 3OS5A 3LX7A 1S72A 1VQ8T 1A0NB 5KYUB 2J7IA 4LD6A 4XTUA 4PJLA 1VUBA 1BI3A 4RUGA 4PKCC 2LTOA 4RKUE 1PNJA 4XTVA 3HRTA 4BY6B 1WJRA 3UATA 1G3TA 1OQKA 3X28B 2PQWA 4QQDA 2G3RA 4OP0A 5CCAA 2DLPA 3VRZA 1VQNT 3DLMA 3AHUA 1LJOA 4F17A 4M7AC 4XU2A 4MDXA 3QWYA 4E7IA 4QQGA 2CP5A 2LP5A 5GAN3 2ED0A 4M7DG 1I4K1 1VOMA 5CAIA 3HFOA 1JO8A 4KUDK 1D1CA 3PNWC 1VQMT 1HK9A 2DTOA 1K9AA 3JCMQ 3JV3A 1RAEB 2XG8D 2K5FA 1NBEB 1RAIB 1YIJQ 2M02A 3EH1A 4M7DE 2LNVA 2Z0WA 1YN8A 3A5ZB 2XIDA 4BD3A 1I5LA 5GAMj 4O5VA 3OB9A 3OYJA 2HEQA 4DOWA 4DA4A 1VQ6T 2E6NA 3OYEA 1OZ2A 3V7CA 3CCSQ 1S1NA 3CPWS 4UC4A 1WXUA 1YIJA 1QCFA 1M9SA 1ABQA 2K57A 3TEEA 2YUNA 2R58A 2K3YA 4WCIA 4HCZA 5I2SA 1K4US 3OYHA 2RHZA 1MGQA 4E7KA 4Z02A 1OV3A 3LWIA 4M7AF 3CCRT 1NG2A 2V8KA 3CCMQ 2X4YA 2JTMA 4XTXA 5LJ3d 1EIFA 2DVJA 2KE9A 5CQYA 1Q82R 3G71Q 2XHCA 3HRUA 1KD1R 4M77E 1PKTA 3LWHA 4PLIA 4Y91A 4J7FA 2CYZB 3F70A 2AT1B 4AFUC 3L2UA 4AT1B 2VGNA 2DYIA 3CCMA 2CZ7B 1NJIC 5FU7C 4XU3A 1QVGS 4A4GA 4OB3B 4DEYA 3FJPA 4M78D 4C0GA 1Q86U 2M16A 4FSXA 3G71A 3MKDA 5IXFA 4IKFA 2DAQA 2ZPIB 4A4KA 5GAMg 3ZBDA 1OU8A 3ZFJA 2KI7A 2EFIA 5C6SA 2L8DA 3Q1JA 3OS1A 2ZGWA 2DFUA 5D6WA 4ANJA 2ZPGB 1OI1A 4BI8B 1PCXA 5LJ5j 4BE2A 4CI0C 1YNZA 2PTKA 3CD6Q 5IN1A 4C5GA 3L2QA 5GAOl 5J26A 4BY6C 2E5KA 1G3SA 2V1QA 3CCJA 3EFSA 2VVKA 3E9GA 3TQ7P 2KT8A 4ESRA 1VIFA 2BIVA 4BDYA 1BI1A 4OMFB 3CCET 1QWFA 4LE9A 3A98A 4MMLA 3OYMA 1YFNA 1KHIA 4PJMA 2LZ6B 3A8LB 5HKCA 1VQ5T 1Y7XA 3GP8A 4OB0B 1VQOQ 3VRYA 4IIMA 1Y0MA 2YRCA 5KH6A 2NYSA 2V26A 3FRNA 1GRIA 1Y07A 3JB9G 4GLMA 3CD6T 3HHTB 2L89A 2RQWA 2VXFA 5A0LA 1M1GA 1IRXA 3PT9A 1MUZA 1M30A 3CC7T 2DEQA 1H92A 2RNAA 3UDCA 1W70A 1FWZA 4JDSA 4JPBW 2E5QA 2RQUA 4QVDA 2RHXA 5CKHA 1M5Q1 4C8QA 3MJXA 4C8QB 1UHCA 1E6HA 4ZGJB 5IHKA 1JJ2A 3EGXA 2V8IA 3EGXB 1D3BA 4PJOG 3HFNA 2IVWA 2RK2A 2HDAA 2HKNA 3EFRA 1AZGB 5GAN5 1QW1A 4IUUA 3CC4A 1VQOT 1VQ7Q 4LDVA 5LJ5f 3OS0A 3CMAQ 1XJWB 4Z88A 2RQTA 2O2OA 4A4FA 2ZZDA 3DKMA 3RUXA 2W0ZA 5GAN2 5KCHA 1UUEA 4F16A 4KH1B 2FZKB 2LJ1A 3G6ET 3M0TA 2HBPA 2CSIA 1PM3A 2KAFA 2X4WA 3JCMh 5CQXA 3SFMA 1VQ7A 3CMAA 3QG1A 4FYYB 5LJ3g 1NYGA 3CQTA 2K6DA 2CZ6B 3QO3A 4M78B 5J3BA 1YI2T 3CPWP 3PTAA 2EGCA 1SSHA 2MCNA 2WSEE 4OMNA 1LNXA 2F2VA 2KMTA 4J9HA 5IAYA 2LX9A 5IHNA 3DLLA 5GMKj 3PE0A 1XTDA 1U8RA 2X35A 1VQKA 3WVDB 3JCMe 1X43A 3QPHA 4J83A 2EIFA 2CUBA 1ZUYA 2EQMA 4ZTJA 2EWNA 3EG2A 1GBRA 2JVVA 4C92D 3UA6A 4ZN1A 1Y71A 1KD1C 2JMCA 5L23A 1JB0E 4QT7A 4KGZB 5FRNA 2GQIA 2QA4T 1W2BP 4F7UG 4KRTA 4AFZC 3RKYA 2NWMA 1M3BA 2O31A 3NFCA 4FYWB 2EYWA 1Q7YU 2VV5A 2QEXT 4E47A 3SHWA 5DY9A 4HT8A 1WIEA 3OYLA 3OSSC 2J6KA 2B8AA 2JTFA 3M53A 2CH4W 1QVGP 3CCVQ 3QJYA 1VQ4A 1AD5A 4F04B 3QBYA 1PD1A 2ZCFB 1TUDA 3H0HA 4EPCA 3GOXA 1NZ9A 3PIOA 3I56Q 1UHFA 2J6OA 2EQIA 4AFSC 2GQVA 3RESA 1AVZC 3M55A 3E19A 4AG1C 2B86A 4E7SA 2DTIA 2GNCA 1FMVA 3CBMA 3CCVA 5KYNA 5GMKm 3UT1A 3M0SA 3H8ZA 1RABB 3QXEB 1MV0B 2D8HA 1JBMA 4J9BA 3M5AA 3I56A 2V8JA 1YJWQ 3QDRB 1TS9A 3KXTA 1JEGA 4C8QC 3GPLA 1KC8R 5FWBA 4BE0A 3P8BB 3MHXA 2K3BA 4JZ3A 3OMGA 1VQLT 2ATCB 2JNGA 2CP3A 2DRMA 3VS3A 1RADB 3X25B 2A0FB 3R6OA 1WLPB 2YLCA 2DETA 2DILA 2FZCB 3GNFB 3MO8A 3UWNA 2DL7A 3I5SA 4EMKA 1TSFA 4ZGDB 3WXMB 4EMKB 1VQPQ 1MMDA 4XU0A 2OTLT 4M7AE 3X20B 2XD0A 4JRQA 2EYXA 4M75D 1TG0A 2HSPA 3GLXA 1B07A 3URGA 2XU8A 3CXCA 1C1AA 2BUDA 2HSEB 5FRMA 2EKOA 4D8DA 2EJFA 1ZSZA 2F2WA 2EYYA 2CREA 3CEYA 2L3PA 1JXOA 3VJPA 1K8AU 4LDXA 3QZ5B 5D6YA 1WHHA 2HL5C 2GBQA 5CKBA 4C8QF 2AZVA 4JLGA 3HP9A 1RUWA 1VQ9Q 1WYXA 2CZ1B 3JCMW 2XKOC 4LNPA 3G4SQ 4X9CA 2LJ3A 4FT2A 2K2MA 4JRPA 3OYDA 2EBPA 2MK5A 3RR6A 2DO3A 5EC7A 2KGTA 1NJIU 3CCUQ 2CS7A 2I2LA 4C92A 3LH0A 1KHCA 4C92B 2RN8A 2HZYA 2DKGA 1Z9QA 4D6WA 2DXBA 2RI5A 1YJ9A 3G4SA 2IIMA 2SEMA 2CP0A 2IG0A 2EGEA 4M7DD 2FYKA 4RTYA 2VUBA 1PRMC 2COYA 4IUPA 1SSFA 3SDZA 4XAXB 3EG1A 3VS7A 2G6FX 1KQSA 1VQ8Q 1VQ9T 2L3QA 5HK3A 3EGDB 3OYIA 1Q81R 4HCKA 1CSKA 3A1PA 2AZSA 3RBBB 3I5RA 2CH4A 2CGHA 3CBOA 5L8RE 3EHRA 3CCUT 1YITA 5HCKA 4BACA 3I55A 3C94A 1VQ8A 4FL6A 3S3OA 2GTJA 1VQNQ 4N0AA 4B6MA 1OPLA 2A3LA 2HQEA 2DL5A 1D0YA 2K5IA 2M51A 4KGVB 2PU9B 4QVZA 1JJ2S 3CC2T 3I35A 1FMKA 2MIOA 3SEMA 4N4HA 4ELZC 1HXDA 1TXQA 4RG2A 1G3YA 3DB4A 3RMSA 5KCOA 1VQMQ 1RAAB 3A8OB 4JJBA 7AT1B 5KYUA 4FYVB 3FLGA 4CRIA 1VQNA 4L5GA 4HCCA 1I81A 2QTXA 2HBWA 2EGAA 3EH2A 4PL6A 5KE2A 3TVTA 4EMKC 3OW2A 1YBYA 4KH0B 1VQ6Q 1VQMA 3M54A 2A7YA 4P5NA 2HCKA 4M75A 2MF2A 4M75B 1F1BB 3AT1B 4EMHA 1M2OA 3UPUA 1ZSZC 4Z8AA 2CUDA 2JS2A 1KC8C 5GANh 4MZMA 3JCMP 2HKQB 2AK5A 3L42A 2GCXA 3QWXX 2ECZA 2ED1A 2YDLA 1VQ6A 3LLRA 3CCRQ 2X3XD 1IREB 4EIKA 5GAOn 3QYHB 4DBQA 5LJ5d 4CC3A 1FYNA 1UFFA 2PUOB 1XNIA 2AHJB 5GANe 3JAME 3HL8A 2QQAA 1WHLA 1GFCA 1V1CA 2KBTA 2M0YA 2VKNA 3CCRA 5DM7R 2LMJA 4HVUA 4C92C 2QGFB 1X2KA 5GAOr 2QGGA 3J81E 1AOJA 1ZQ1A 4RTXA 4R0KA 1Z9ZA 4II1A 1HSQA 2CKKA 2VB6A 1BBZA 3HSBA 1WHKA 1N9SA 2AKKA 1YP5A 4JUVA 2KVQG 4M77G 2JMAA 5FROA 1OPKA 4KT0E 4M7DB 3CCSA 1JQQA 3EG9B 1UE9A 2DTHA 1OEBA 1Q82U 1KD1U 1UGRB 5ECAA 4XK8E 3H6ZA 2RHIA 3JB9D 2PUKB 5KE3A 2HNIA 3P8DA 2A37A 2DERA 4FW2A 1NE8A 1YWOA 3VYGA 2DM1A 1K73R 3VS0A 3TREA 1H641 5DLQE 2DL8A 2YRVA 4CC4B 4RTTA 2L3RA 4PFOA 1M2VA 1CKBA 1M2VB 4N0AC 3JB9H 1UG1A 3QYGB 3JB9I 4C92F 2FO0A 4PJOD 1KQ2A 4AG2C 3CCEQ 5C0MA 3QKJA 1T0JA 4JRKA 4B9XA 1KJWA 3J80E 2VXEA 2Y90A 2YSQA 2RH2A 2WSCE 1VQ5Q 3PGGA 1MMGA 3L2ZA 5GAOp 3OYKA 2SRCA 1XOVA 3QHSA 2R5AA 3EG3A 3OYAA 1D1BA 1Q81C 3OBYA 1SHFA 3I9QA 3CCEA 4C5IA 1Q95G 1N5ZA 1BCOA 1RLPC 3CC7Q 1RAGB 3CXCS 2DNUA 1VQ5A 1N8RR 2PVDB 1IGQA 1X27A 3SWNA 1FX7A 3SWNB 1PKSA 4M75C 4N4IA 1M1KR 3OA6A 1PHTA 4C0DB 3REAB 1NEGA 5IXBA 2F1LA 3CD6A 3JB9J 3M57A 4BI3A 5A2QE 1OOTA
chains in the Genus database with same CATH topology
3I56Q 3CCEQ 3G6EQ 1YJWQ 2QA4Q 1Q81R 1QVFP 3CCLQ 3CC7Q 1VQKQ 3CC4Q 1K73R 1VQPQ 3CC2Q 3CCMQ 1Q7YR 1KC8R 2OTJQ 1N8RR 1K8AR 1VQ5Q 3CCSQ 2QEXQ 1VQ7Q 3CCRQ 1VQOQ 1K9MR 1KQSP 1VQ6Q 3CMAQ 3CCJQ 1JJ2P 2OTLQ 1VQMQ 1YITQ 3I55Q 3CXCP 3CCUQ 1NJIR 1S72Q 1M1KR 3CMEQ 1YIJQ 1Q86R 1M90R 1Q82R 1QVGP 1VQLQ 3G71Q 1VQ4Q 3CCVQ 1VQ8Q 1VQNQ 1KD1R 3CPWP 3CD6Q 1VQ9Q 1YJNQ 3OW2P 1YJ9Q 1YHQQ 1YI2Q 3G4SQ 3CCQQ 1W2BP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I56 Q;  3CCE Q;  3G6E Q;  1YJW Q;  2QA4 Q;  1Q81 R;  1QVF P;  3CCL Q;  3CC7 Q;  1VQK Q;  3CC4 Q;  1K73 R;  1VQP Q;  3CC2 Q;  3CCM Q;  1Q7Y R;  1KC8 R;  2OTJ Q;  1N8R R;  1K8A R;  1VQ5 Q;  3CCS Q;  2QEX Q;  1VQ7 Q;  3CCR Q;  1VQO Q;  1K9M R;  1KQS P;  1VQ6 Q;  3CMA Q;  3CCJ Q;  1JJ2 P;  2OTL Q;  1VQM Q;  1YIT Q;  3I55 Q;  3CXC P;  3CCU Q;  1NJI R;  1S72 Q;  1M1K R;  3CME Q;  1YIJ Q;  1Q86 R;  1M90 R;  1Q82 R;  1QVG P;  1VQL Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  1VQ8 Q;  1VQN Q;  1KD1 R;  3CPW P;  3CD6 Q;  1VQ9 Q;  1YJN Q;  3OW2 P;  1YJ9 Q;  1YHQ Q;  1YI2 Q;  3G4S Q;  3CCQ Q;  1W2B P; 
#chains in the Genus database with same CATH topology
 2DMO A;  4C8Q G;  2Y4Y A;  3CC7 A;  4WF2 A;  2NLU A;  2D0N A;  2KYB A;  3C12 A;  2QK0 A;  2OTJ Q;  1SKU B;  2MI6 A;  3M58 A;  1JJ2 P;  3OQ5 A;  2VAS A;  1AT1 B;  2YWW A;  3VS6 A;  2FPF A;  2BZY A;  4J9C A;  4HT9 A;  1BB9 A;  3NGP A;  2E64 A;  4J5Y A;  4C8Q E;  2F5T X;  2DRK A;  2R5M A;  4OB2 B;  2DL4 A;  1VYV A;  5CKF A;  3V8L A;  1BKB A;  3TSW A;  3G6E Q;  5GAM h;  1MND A;  1Y57 A;  1ZBJ A;  1U3O A;  3BE3 A;  2F2X A;  1RAC B;  2MYS A;  3CCJ T;  1K9M U;  1VQO A;  3J7A F;  4MMK A;  3OMC A;  1BK2 A;  2YRD A;  5LJ5 g;  2E65 A;  1WZO A;  2IPO B;  4LDU A;  5DLO A;  4FYX B;  4J8O A;  3JCM f;  3JCM b;  1YI2 Q;  1RI0 A;  3UA7 A;  4M75 F;  2K5L A;  3M59 A;  3G6E A;  1KQS S;  3PVL A;  1BIA A;  2EAY A;  3KFV A;  5GAM e;  1KG1 A;  2OTJ T;  1W6X A;  1GCP A;  1UGV A;  2RMO A;  2COW A;  2JM8 A;  2DXU A;  3NMZ C;  2KEA A;  4R56 A;  3MP8 A;  3FIF A;  1TUG B;  4E7J A;  5I11 A;  1YI2 A;  2QA4 Q;  1NM7 A;  1QCN A;  5I21 A;  2LNH B;  4PLL A;  1OYX A;  4PK4 A;  3OY9 A;  4NOY A;  2QEX Q;  3D7S B;  9ATC B;  4E2F B;  3A8H B;  1JRI A;  1QVF A;  3LW5 E;  5GMK l;  1X75 C;  4M78 A;  4MZT A;  3NPF A;  2XDP A;  4OMQ A;  4OMM A;  4IIO A;  3ZEH A;  2QYZ A;  5GAN 7;  5CKE A;  4YTL A;  4X34 A;  2FPD A;  3OS2 A;  1TOV A;  4PJO A;  3FC3 A;  1E7O A;  1LVK A;  4PJO B;  2H3E B;  3EGU A;  2RJE A;  4EDU A;  4C0F A;  2VGM A;  5GAO q;  2QEX A;  1AWW A;  2QQ9 A;  1AWJ A;  2K79 A;  2LCL A;  4J6X A;  4J9I A;  3OW2 S;  4Z89 A;  6AT1 B;  3BW1 A;  2LQN A;  4RCC A;  2KK4 A;  2GTO A;  4PFP A;  4J7I A;  1G2B A;  1K73 C;  1D0Z A;  1LCK A;  1SF9 A;  3SWN C;  3INZ A;  2DEU A;  2NUZ A;  2XIC A;  4M4Z A;  4BE1 A;  4FU6 A;  1TUC A;  2YUQ A;  2DVE A;  4C0D C;  1WGS A;  1RLQ C;  1VQL Q;  4BB7 A;  1ZLM A;  4DBF A;  2E70 A;  2K9G A;  2LQ8 A;  1N9R A;  5GAN 4;  1WHM A;  4FW1 A;  4RG8 A;  1B34 A;  1VQK T;  1B34 B;  1R8O B;  2JJ9 A;  5CR2 A;  1QCO A;  3QZ9 B;  2MPX C;  4LN2 A;  3L2V A;  1QKX A;  2OTL Q;  2D6F A;  1PRL C;  2H3J A;  1G5V A;  3M4Y A;  5LJ3 h;  2M9U A;  2RD1 A;  1VQL A;  1M90 R;  5IHI A;  1AWX A;  2ABL A;  4FSS A;  2LDM A;  4RTZ A;  3TU4 K;  4RCB A;  5CO7 A;  2EQJ A;  1UJ0 A;  4LXC A;  4OVA A;  1ZA2 B;  1ZHI A;  3GNG A;  3RKX A;  1N8R C;  3CCL Q;  1M1F A;  4L6V 5;  4F7U A;  4OMP A;  4F7U B;  5A0D A;  1M1K C;  1T3S A;  5D6X A;  2Y4X A;  2OTL A;  2XK0 A;  3CXC P;  1SEM A;  2ESW A;  5LJ3 e;  1VQ4 T;  3H0F A;  4M7A G;  3FJ5 A;  2HMA A;  1YHQ T;  1D1A A;  2OX7 A;  4HVV A;  1D0X A;  3V8J A;  5AT1 B;  2K7A A;  5CVI A;  4C5E A;  4Y28 E;  8ATC B;  3MEW A;  3THK A;  1ARK A;  2QAS A;  3V7S A;  5KYW A;  1YJW A;  5GJV B;  5KYW B;  4OB1 B;  1NLO C;  4X1V A;  1MHN A;  2GFA A;  2KXC A;  1G83 A;  4PNO A;  2EQK A;  2F69 A;  1QVP A;  2DE0 X;  2P4R A;  2DPP B;  3M0Q A;  5FU6 B;  1ZX6 A;  1OZ3 A;  2LT1 A;  1ZUU A;  3GBQ A;  3L2W A;  2JOY A;  2YT6 A;  1WX6 A;  1BI2 A;  4CC2 A;  3CCQ T;  2K4Y A;  3RMQ A;  2E3H A;  3EHQ A;  3MEA A;  2RQR A;  3CCL T;  2JXB A;  2BE9 B;  1QP3 A;  4Y92 A;  1HD3 A;  1VQP A;  4BI4 A;  4IUV A;  3RNJ A;  3LH5 A;  3P8H A;  3CME T;  4M78 C;  3H9N A;  1TH7 A;  5CIU A;  3ZL7 C;  2M1H A;  1FMW A;  2KQW A;  1JU5 C;  2EVR A;  2CP7 A;  3QSU A;  3MP6 A;  4PJO C;  4C92 E;  2KR3 A;  2MOX A;  5EG2 A;  5I22 A;  1LOJ A;  3M9Q A;  2PZ1 A;  4GBQ A;  1K8A R;  1K0X A;  2ZPB B;  5CKD A;  1KQS P;  3OYG A;  4AFQ C;  1D09 B;  3BDU A;  4QVC A;  2JN0 A;  1YJN T;  2QQB A;  2MWO A;  1VQ9 A;  3OYF A;  3HTR A;  2A36 A;  1UDL A;  2L0A A;  1PSE A;  2OAW A;  3CC2 Q;  3BY7 A;  2KDS A;  1U06 A;  2EJ9 A;  1AEY A;  4PJJ A;  4A63 B;  3CCU A;  2X51 A;  3SB2 A;  2O88 A;  3E2U A;  1V76 A;  4LDW A;  3EGD A;  2DBK A;  1K0S A;  4A53 A;  1X6G A;  3M4G A;  4M78 F;  1M27 C;  4DBR A;  1G8X A;  1WJQ A;  3CC2 A;  1CKA A;  2DD4 A;  1TU0 B;  2GGR A;  3M0R A;  1SRL A;  4PJO F;  3U23 A;  5KYX A;  2HQX A;  5KYX B;  1GFD A;  1Y96 A;  1Y96 B;  2P0P A;  3V8K A;  3JSC A;  3M56 A;  2DXC A;  3VYH B;  2E6Z A;  5HY6 A;  3OW2 P;  1TWB A;  2FL7 A;  2FRW A;  4ORZ A;  4JJD A;  1BI0 A;  3ULR B;  3CPF A;  2O9V A;  1UEB A;  4OGC A;  1XQH A;  1WNL A;  1UGP B;  3VUZ A;  4M77 D;  2NUP B;  1UTI A;  2RF0 A;  5FU7 B;  1UB4 A;  2CP6 A;  1S72 Q;  5GAN f;  4JZ4 A;  1J3T A;  4IUQ A;  2WSF E;  1KIK A;  1RAF B;  2M0O A;  2EW3 A;  2A28 A;  2RJC A;  2ZPE B;  4IUT A;  2LQW A;  3OYN A;  4M75 E;  2C0O A;  3E1S A;  5HK0 A;  4J9F A;  4MZP A;  1P92 A;  1RI9 A;  5FU6 C;  1ABO A;  2JT4 A;  4XTY A;  3JCM J;  1YIT T;  1SPK A;  2KRN A;  4PFZ A;  2DZC A;  1M90 C;  4J9D A;  1BYM A;  2JUF A;  1E6G A;  3VU3 C;  3VKI A;  2YLB A;  1QVF S;  2D8J A;  2HD0 A;  2ROT A;  1IHW A;  2D0Q B;  2LQK A;  5A0G A;  3C0C A;  4HCB A;  2RQV A;  3JCM d;  2J06 A;  4L59 A;  4J9G A;  2CT3 A;  2DA9 A;  4Q5W A;  1GXI E;  2DK3 A;  1QMC A;  1S72 T;  3A8M B;  4F7U F;  4NS5 A;  2DZ9 A;  3REB B;  2KRM A;  2LCC A;  3C95 A;  4QQ6 A;  4WTO B;  3GIB A;  3PVQ A;  1R0C B;  5GAN 6;  1MNE A;  1WHG A;  1H8K A;  1WXT A;  2DXT A;  3PIP A;  3NTI A;  1BU1 A;  4FT4 A;  1M4Z A;  1R0B G;  1HJD A;  4KGX B;  1WXB A;  4E7L A;  1I8F A;  1IZ6 A;  4XQ3 A;  5I2M A;  1MV3 A;  2NUT A;  1H3H A;  2NUT B;  3HRS A;  4XU1 A;  1OUL A;  3RKW A;  3VS1 A;  2P84 A;  4J6Y A;  2JTE A;  1IHV A;  2EYZ A;  1M8M A;  4C8Q D;  4M7D A;  2RA2 A;  4XTW A;  3TSZ A;  2VWF A;  3EG9 A;  2L2P A;  1I5O B;  2PVO B;  1ZUK A;  2PNI A;  2E4H A;  8AT1 B;  3EG0 A;  2J6F A;  1KSW A;  2O4X A;  2PVG B;  2O4X B;  5D7U A;  1K8A C;  1K73 U;  2K2V A;  4DQ2 A;  4ATO A;  1X6B A;  1QQJ A;  3MEV A;  1BIB A;  3JCM V;  1MMN A;  1YCS B;  2BE7 D;  1YIJ T;  2LVM A;  1YWP A;  2L3S A;  4J6W A;  3BDL A;  4XTZ A;  1W2B S;  2E3I A;  2OI3 A;  1PWT A;  4HVW A;  4RTW A;  4ZN3 A;  2O01 E;  1M8V A;  2JM9 A;  3GF5 A;  4KBM B;  1RAH B;  1IGU A;  2RJD A;  2KY9 A;  1X2Q A;  4K11 A;  3S3N A;  1GL5 A;  3CCS T;  1K76 A;  1R77 A;  4OML A;  4M77 A;  4M77 B;  4LUE A;  2DX1 A;  3VV0 A;  5GAN 8;  1NYF A;  3MCA B;  1GCQ A;  3PMT A;  3LGL A;  1Q86 R;  1U1T A;  2E12 A;  3ASK A;  1O75 A;  4AMC A;  1U1S A;  4X9D A;  1WJS A;  2DD5 A;  3CCM T;  1K1Z A;  1N8R U;  5LL6 S;  2ROL A;  2LJ0 A;  4O6J A;  3CCJ Q;  2YUP A;  1M1K U;  1IXD A;  3C4S A;  2X4J A;  3RIR A;  3G71 T;  4MDW A;  1SG5 A;  2BTT A;  5GAM f;  3VUB A;  4JJC A;  4OMO A;  4LUD A;  3FB9 A;  2WAC A;  2KRO A;  2FG0 A;  2YHT A;  4PJN A;  1WI7 A;  1T0H A;  1QLY A;  5KYY A;  2LX7 A;  5KYY B;  2XDD A;  1FXX A;  3V7R A;  4E6R A;  3OYY A;  3N5B B;  2DIQ A;  2HL3 A;  3QII A;  2RHY A;  3MEU A;  2KXD A;  3NHN A;  4LD9 K;  2AKL A;  2FVU A;  3M0U A;  2EQU A;  2MAM A;  3VS4 A;  2JZ2 A;  3A8G B;  2VC8 A;  4NL2 A;  2ZAE A;  3JCM g;  3OSV A;  1G3W A;  3KBG A;  2XDB A;  2OTJ A;  3OBW A;  2XI9 A;  3NTK A;  3SD4 A;  5LJ3 j;  2CT4 A;  2QI2 A;  1UJY A;  2YXY A;  2DF6 A;  1QWE A;  1KFZ A;  2FEI A;  4F14 A;  1WHJ A;  4HA8 A;  1QVF P;  4M7D C;  2RB6 A;  3CC4 Q;  2KYM A;  2YUO A;  3H41 A;  4OGE A;  1BCM A;  3OYB A;  1K9M R;  4M78 G;  4B9W A;  2F5K A;  4RTU A;  2D9T A;  4LDY A;  1I1J A;  3S6W A;  1WFW A;  5FLX E;  1D3B B;  2X3W D;  1SHG A;  1T3L A;  4JS5 A;  5GAO m;  1WDX A;  4M78 E;  1YCY A;  3TCJ A;  3X24 B;  4ZGE B;  5IH2 A;  1VYU A;  4HKE A;  3X26 B;  1EFN A;  1IO6 A;  1W4S A;  4KUI A;  2RHU A;  1U5S A;  4JRI A;  4PJO E;  2XMF A;  4OF1 A;  3VS5 A;  1M3C A;  1M3A A;  2CDT A;  4M7A D;  4DOV A;  2X9H A;  3EAE A;  2BKD N;  1NEB A;  3IQL A;  4QW2 A;  2RO0 A;  1O9S A;  2FRY A;  3CC4 T;  2QA4 A;  3G1J A;  1VQK Q;  4M77 C;  2DJQ A;  4FCY A;  3NTH A;  2CSQ A;  2RPN A;  2MWP A;  2DIG A;  1GCQ C;  2QQR A;  3LYI A;  3JCM c;  3RER A;  3QDF A;  4M7D F;  4KUL A;  1LPL A;  1QKW A;  5LJ5 h;  4VUB A;  3UF4 A;  2CP2 A;  1KQ1 A;  2K3X A;  3M0P A;  4RMO A;  3HKS A;  5LJ3 f;  3L2R A;  4JJN K;  1VQ7 T;  2I0N A;  3G7Z A;  3CMA T;  1OX9 A;  4ZNX A;  2QAZ A;  2R57 A;  1Q82 C;  3OYC A;  1V29 B;  1VYT A;  3QUI A;  3T9N A;  3ER0 A;  1C0M A;  4FIB A;  2C0I A;  1N27 A;  1VQ4 Q;  1NPP A;  5LJ5 e;  1NPR A;  1YHQ Q;  3DB3 A;  5FWC A;  5GAN d;  2KRS A;  3CPW A;  1VIE A;  2H8H A;  1Q7Y R;  2A08 A;  4C5H A;  5AYF A;  3ME9 A;  2E1H A;  1Q86 C;  2O9S A;  1M90 U;  1EX4 A;  4N4G A;  4F7U E;  4A54 A;  4M77 F;  2EYQ A;  1YHQ A;  4J9E A;  3HPW A;  3JRZ A;  3CCQ Q;  2ZPH B;  2FHD A;  1X01 A;  3PFS A;  3S3M A;  3MPU B;  1KC8 U;  1JXM A;  2OAU A;  1W2B A;  2JS0 A;  4QKU A;  2QG9 B;  1GBQ A;  2GFU A;  4GLK A;  4NL3 A;  4BDZ A;  3CME Q;  1WPY A;  4EMG A;  1B3Q A;  2BZ8 A;  4JLI A;  3CCQ A;  4R55 A;  2DYB A;  2LC4 A;  1QVG A;  2V1R A;  3RDV A;  4CC7 A;  1RL2 A;  2P0K A;  2GF7 A;  3FEO A;  3CCL A;  1TTH B;  4E7Z A;  2LT4 A;  2FB7 A;  1X6O A;  3BFM A;  2QTV A;  1WQ7 A;  3CCV T;  3CME A;  3QJ6 A;  2AIR B;  1ZSG A;  1YJN Q;  1AWO A;  1UGQ B;  3I56 T;  2C0T A;  2COZ A;  5CK9 A;  2ZPF B;  1HYO A;  4C92 G;  2P0Q A;  4JS4 A;  2W10 A;  1KK7 A;  2KNB B;  3O8V A;  2C06 A;  2QDL A;  1DJ7 B;  1AHJ B;  3MET A;  4FM4 B;  4E7H A;  1YJN A;  2P4T A;  4M7A A;  1YJW T;  4M7A B;  4V2S A;  2BZX A;  4HXJ A;  1PC0 A;  1WA7 A;  1WQW A;  1ZSZ B;  4A4E A;  5GAN j;  1K9M C;  5GMK h;  5M9O A;  1I07 A;  1C6V X;  2DJZ A;  4TVR A;  2ENM A;  3CBP A;  1AZE A;  2E10 A;  4C0Z A;  2X4X A;  1X69 A;  2RI2 A;  2DL3 A;  1YJ9 Q;  1OX8 A;  2D1X A;  5FW9 A;  1PG5 B;  3L1A A;  2HQH A;  4BUG A;  2LCS A;  1VQP T;  2FZG B;  3EFO A;  2QXF A;  3EFO B;  5GMK e;  3JB9 F;  1ACM B;  5J39 A;  1W1F A;  1NLP C;  2VYT A;  3E9F A;  4A4H A;  1N6A A;  1NJI R;  2JW4 A;  2MMP A;  2RI3 A;  5IT9 E;  1QP2 A;  2RM4 A;  5GMK i;  1PD0 A;  2OJ2 A;  2EKH A;  1ZA1 B;  3JCM X;  2J05 A;  1H3Z A;  1Q81 U;  4RTV A;  3LGF A;  4IUR A;  2QDY B;  1SRM A;  2LRQ A;  4D8K A;  2KT1 A;  3H0I A;  3O5Z A;  1YIT Q;  2DBM A;  3I55 Q;  2RJF A;  3WVE B;  4ME7 A;  2CZ0 B;  3R6N A;  1ZBX A;  1YJ9 T;  3G4S T;  5GJW B;  1B7T A;  2EJG A;  5GAN g;  5GAM d;  3MP1 A;  1IB8 A;  4DEX A;  3KUF A;  4GY5 A;  4ZTF A;  1UEC A;  2KSS A;  1I0C A;  2FPE A;  2E41 A;  2NUP A;  1OU9 A;  4M75 G;  1MMA A;  2EPD A;  4DBH A;  2L5Q A;  1EZZ B;  1VA7 A;  3PMI A;  1UGS B;  2QQS A;  1Q7Y C;  4ELY C;  3VS2 A;  2RK1 A;  3I55 T;  1PSF A;  3FDR A;  2HAX A;  3OS5 A;  3LX7 A;  1S72 A;  1VQ8 T;  1A0N B;  5KYU B;  2J7I A;  4LD6 A;  4XTU A;  4PJL A;  1VUB A;  1BI3 A;  4RUG A;  4PKC C;  2LTO A;  4RKU E;  1PNJ A;  4XTV A;  3HRT A;  4BY6 B;  1WJR A;  3UAT A;  1G3T A;  1OQK A;  3X28 B;  2PQW A;  4QQD A;  2G3R A;  4OP0 A;  5CCA A;  2DLP A;  3VRZ A;  1VQN T;  3DLM A;  3AHU A;  1LJO A;  4F17 A;  4M7A C;  4XU2 A;  4MDX A;  3QWY A;  4E7I A;  4QQG A;  2CP5 A;  2LP5 A;  5GAN 3;  2ED0 A;  4M7D G;  1I4K 1;  1VOM A;  5CAI A;  3HFO A;  1JO8 A;  4KUD K;  1D1C A;  3PNW C;  1VQM T;  1HK9 A;  2DTO A;  1K9A A;  3JCM Q;  3JV3 A;  1RAE B;  2XG8 D;  2K5F A;  1NBE B;  1RAI B;  1YIJ Q;  2M02 A;  3EH1 A;  4M7D E;  2LNV A;  2Z0W A;  1YN8 A;  3A5Z B;  2XID A;  4BD3 A;  1I5L A;  5GAM j;  4O5V A;  3OB9 A;  3OYJ A;  2HEQ A;  4DOW A;  4DA4 A;  1VQ6 T;  2E6N A;  3OYE A;  1OZ2 A;  3V7C A;  3CCS Q;  1S1N A;  3CPW S;  4UC4 A;  1WXU A;  1YIJ A;  1QCF A;  1M9S A;  1ABQ A;  2K57 A;  3TEE A;  2YUN A;  2R58 A;  2K3Y A;  4WCI A;  4HCZ A;  5I2S A;  1K4U S;  3OYH A;  2RHZ A;  1MGQ A;  4E7K A;  4Z02 A;  1OV3 A;  3LWI A;  4M7A F;  3CCR T;  1NG2 A;  2V8K A;  3CCM Q;  2X4Y A;  2JTM A;  4XTX A;  5LJ3 d;  1EIF A;  2DVJ A;  2KE9 A;  5CQY A;  1Q82 R;  3G71 Q;  2XHC A;  3HRU A;  1KD1 R;  4M77 E;  1PKT A;  3LWH A;  4PLI A;  4Y91 A;  4J7F A;  2CYZ B;  3F70 A;  2AT1 B;  4AFU C;  3L2U A;  4AT1 B;  2VGN A;  2DYI A;  3CCM A;  2CZ7 B;  1NJI C;  5FU7 C;  4XU3 A;  1QVG S;  4A4G A;  4OB3 B;  4DEY A;  3FJP A;  4M78 D;  4C0G A;  1Q86 U;  2M16 A;  4FSX A;  3G71 A;  3MKD A;  5IXF A;  4IKF A;  2DAQ A;  2ZPI B;  4A4K A;  5GAM g;  3ZBD A;  1OU8 A;  3ZFJ A;  2KI7 A;  2EFI A;  5C6S A;  2L8D A;  3Q1J A;  3OS1 A;  2ZGW A;  2DFU A;  5D6W A;  4ANJ A;  2ZPG B;  1OI1 A;  4BI8 B;  1PCX A;  5LJ5 j;  4BE2 A;  4CI0 C;  1YNZ A;  2PTK A;  3CD6 Q;  5IN1 A;  4C5G A;  3L2Q A;  5GAO l;  5J26 A;  4BY6 C;  2E5K A;  1G3S A;  2V1Q A;  3CCJ A;  3EFS A;  2VVK A;  3E9G A;  3TQ7 P;  2KT8 A;  4ESR A;  1VIF A;  2BIV A;  4BDY A;  1BI1 A;  4OMF B;  3CCE T;  1QWF A;  4LE9 A;  3A98 A;  4MML A;  3OYM A;  1YFN A;  1KHI A;  4PJM A;  2LZ6 B;  3A8L B;  5HKC A;  1VQ5 T;  1Y7X A;  3GP8 A;  4OB0 B;  1VQO Q;  3VRY A;  4IIM A;  1Y0M A;  2YRC A;  5KH6 A;  2NYS A;  2V26 A;  3FRN A;  1GRI A;  1Y07 A;  3JB9 G;  4GLM A;  3CD6 T;  3HHT B;  2L89 A;  2RQW A;  2VXF A;  5A0L A;  1M1G A;  1IRX A;  3PT9 A;  1MUZ A;  1M30 A;  3CC7 T;  2DEQ A;  1H92 A;  2RNA A;  3UDC A;  1W70 A;  1FWZ A;  4JDS A;  4JPB W;  2E5Q A;  2RQU A;  4QVD A;  2RHX A;  5CKH A;  1M5Q 1;  4C8Q A;  3MJX A;  4C8Q B;  1UHC A;  1E6H A;  4ZGJ B;  5IHK A;  1JJ2 A;  3EGX A;  2V8I A;  3EGX B;  1D3B A;  4PJO G;  3HFN A;  2IVW A;  2RK2 A;  2HDA A;  2HKN A;  3EFR A;  1AZG B;  5GAN 5;  1QW1 A;  4IUU A;  3CC4 A;  1VQO T;  1VQ7 Q;  4LDV A;  5LJ5 f;  3OS0 A;  3CMA Q;  1XJW B;  4Z88 A;  2RQT A;  2O2O A;  4A4F A;  2ZZD A;  3DKM A;  3RUX A;  2W0Z A;  5GAN 2;  5KCH A;  1UUE A;  4F16 A;  4KH1 B;  2FZK B;  2LJ1 A;  3G6E T;  3M0T A;  2HBP A;  2CSI A;  1PM3 A;  2KAF A;  2X4W A;  3JCM h;  5CQX A;  3SFM A;  1VQ7 A;  3CMA A;  3QG1 A;  4FYY B;  5LJ3 g;  1NYG A;  3CQT A;  2K6D A;  2CZ6 B;  3QO3 A;  4M78 B;  5J3B A;  1YI2 T;  3CPW P;  3PTA A;  2EGC A;  1SSH A;  2MCN A;  2WSE E;  4OMN A;  1LNX A;  2F2V A;  2KMT A;  4J9H A;  5IAY A;  2LX9 A;  5IHN A;  3DLL A;  5GMK j;  3PE0 A;  1XTD A;  1U8R A;  2X35 A;  1VQK A;  3WVD B;  3JCM e;  1X43 A;  3QPH A;  4J83 A;  2EIF A;  2CUB A;  1ZUY A;  2EQM A;  4ZTJ A;  2EWN A;  3EG2 A;  1GBR A;  2JVV A;  4C92 D;  3UA6 A;  4ZN1 A;  1Y71 A;  1KD1 C;  2JMC A;  5L23 A;  1JB0 E;  4QT7 A;  4KGZ B;  5FRN A;  2GQI A;  2QA4 T;  1W2B P;  4F7U G;  4KRT A;  4AFZ C;  3RKY A;  2NWM A;  1M3B A;  2O31 A;  3NFC A;  4FYW B;  2EYW A;  1Q7Y U;  2VV5 A;  2QEX T;  4E47 A;  3SHW A;  5DY9 A;  4HT8 A;  1WIE A;  3OYL A;  3OSS C;  2J6K A;  2B8A A;  2JTF A;  3M53 A;  2CH4 W;  1QVG P;  3CCV Q;  3QJY A;  1VQ4 A;  1AD5 A;  4F04 B;  3QBY A;  1PD1 A;  2ZCF B;  1TUD A;  3H0H A;  4EPC A;  3GOX A;  1NZ9 A;  3PIO A;  3I56 Q;  1UHF A;  2J6O A;  2EQI A;  4AFS C;  2GQV A;  3RES A;  1AVZ C;  3M55 A;  3E19 A;  4AG1 C;  2B86 A;  4E7S A;  2DTI A;  2GNC A;  1FMV A;  3CBM A;  3CCV A;  5KYN A;  5GMK m;  3UT1 A;  3M0S A;  3H8Z A;  1RAB B;  3QXE B;  1MV0 B;  2D8H A;  1JBM A;  4J9B A;  3M5A A;  3I56 A;  2V8J A;  1YJW Q;  3QDR B;  1TS9 A;  3KXT A;  1JEG A;  4C8Q C;  3GPL A;  1KC8 R;  5FWB A;  4BE0 A;  3P8B B;  3MHX A;  2K3B A;  4JZ3 A;  3OMG A;  1VQL T;  2ATC B;  2JNG A;  2CP3 A;  2DRM A;  3VS3 A;  1RAD B;  3X25 B;  2A0F B;  3R6O A;  1WLP B;  2YLC A;  2DET A;  2DIL A;  2FZC B;  3GNF B;  3MO8 A;  3UWN A;  2DL7 A;  3I5S A;  4EMK A;  1TSF A;  4ZGD B;  3WXM B;  4EMK B;  1VQP Q;  1MMD A;  4XU0 A;  2OTL T;  4M7A E;  3X20 B;  2XD0 A;  4JRQ A;  2EYX A;  4M75 D;  1TG0 A;  2HSP A;  3GLX A;  1B07 A;  3URG A;  2XU8 A;  3CXC A;  1C1A A;  2BUD A;  2HSE B;  5FRM A;  2EKO A;  4D8D A;  2EJF A;  1ZSZ A;  2F2W A;  2EYY A;  2CRE A;  3CEY A;  2L3P A;  1JXO A;  3VJP A;  1K8A U;  4LDX A;  3QZ5 B;  5D6Y A;  1WHH A;  2HL5 C;  2GBQ A;  5CKB A;  4C8Q F;  2AZV A;  4JLG A;  3HP9 A;  1RUW A;  1VQ9 Q;  1WYX A;  2CZ1 B;  3JCM W;  2XKO C;  4LNP A;  3G4S Q;  4X9C A;  2LJ3 A;  4FT2 A;  2K2M A;  4JRP A;  3OYD A;  2EBP A;  2MK5 A;  3RR6 A;  2DO3 A;  5EC7 A;  2KGT A;  1NJI U;  3CCU Q;  2CS7 A;  2I2L A;  4C92 A;  3LH0 A;  1KHC A;  4C92 B;  2RN8 A;  2HZY A;  2DKG A;  1Z9Q A;  4D6W A;  2DXB A;  2RI5 A;  1YJ9 A;  3G4S A;  2IIM A;  2SEM A;  2CP0 A;  2IG0 A;  2EGE A;  4M7D D;  2FYK A;  4RTY A;  2VUB A;  1PRM C;  2COY A;  4IUP A;  1SSF A;  3SDZ A;  4XAX B;  3EG1 A;  3VS7 A;  2G6F X;  1KQS A;  1VQ8 Q;  1VQ9 T;  2L3Q A;  5HK3 A;  3EGD B;  3OYI A;  1Q81 R;  4HCK A;  1CSK A;  3A1P A;  2AZS A;  3RBB B;  3I5R A;  2CH4 A;  2CGH A;  3CBO A;  5L8R E;  3EHR A;  3CCU T;  1YIT A;  5HCK A;  4BAC A;  3I55 A;  3C94 A;  1VQ8 A;  4FL6 A;  3S3O A;  2GTJ A;  1VQN Q;  4N0A A;  4B6M A;  1OPL A;  2A3L A;  2HQE A;  2DL5 A;  1D0Y A;  2K5I A;  2M51 A;  4KGV B;  2PU9 B;  4QVZ A;  1JJ2 S;  3CC2 T;  3I35 A;  1FMK A;  2MIO A;  3SEM A;  4N4H A;  4ELZ C;  1HXD A;  1TXQ A;  4RG2 A;  1G3Y A;  3DB4 A;  3RMS A;  5KCO A;  1VQM Q;  1RAA B;  3A8O B;  4JJB A;  7AT1 B;  5KYU A;  4FYV B;  3FLG A;  4CRI A;  1VQN A;  4L5G A;  4HCC A;  1I81 A;  2QTX A;  2HBW A;  2EGA A;  3EH2 A;  4PL6 A;  5KE2 A;  3TVT A;  4EMK C;  3OW2 A;  1YBY A;  4KH0 B;  1VQ6 Q;  1VQM A;  3M54 A;  2A7Y A;  4P5N A;  2HCK A;  4M75 A;  2MF2 A;  4M75 B;  1F1B B;  3AT1 B;  4EMH A;  1M2O A;  3UPU A;  1ZSZ C;  4Z8A A;  2CUD A;  2JS2 A;  1KC8 C;  5GAN h;  4MZM A;  3JCM P;  2HKQ B;  2AK5 A;  3L42 A;  2GCX A;  3QWX X;  2ECZ A;  2ED1 A;  2YDL A;  1VQ6 A;  3LLR A;  3CCR Q;  2X3X D;  1IRE B;  4EIK A;  5GAO n;  3QYH B;  4DBQ A;  5LJ5 d;  4CC3 A;  1FYN A;  1UFF A;  2PUO B;  1XNI A;  2AHJ B;  5GAN e;  3JAM E;  3HL8 A;  2QQA A;  1WHL A;  1GFC A;  1V1C A;  2KBT A;  2M0Y A;  2VKN A;  3CCR A;  5DM7 R;  2LMJ A;  4HVU A;  4C92 C;  2QGF B;  1X2K A;  5GAO r;  2QGG A;  3J81 E;  1AOJ A;  1ZQ1 A;  4RTX A;  4R0K A;  1Z9Z A;  4II1 A;  1HSQ A;  2CKK A;  2VB6 A;  1BBZ A;  3HSB A;  1WHK A;  1N9S A;  2AKK A;  1YP5 A;  4JUV A;  2KVQ G;  4M77 G;  2JMA A;  5FRO A;  1OPK A;  4KT0 E;  4M7D B;  3CCS A;  1JQQ A;  3EG9 B;  1UE9 A;  2DTH A;  1OEB A;  1Q82 U;  1KD1 U;  1UGR B;  5ECA A;  4XK8 E;  3H6Z A;  2RHI A;  3JB9 D;  2PUK B;  5KE3 A;  2HNI A;  3P8D A;  2A37 A;  2DER A;  4FW2 A;  1NE8 A;  1YWO A;  3VYG A;  2DM1 A;  1K73 R;  3VS0 A;  3TRE A;  1H64 1;  5DLQ E;  2DL8 A;  2YRV A;  4CC4 B;  4RTT A;  2L3R A;  4PFO A;  1M2V A;  1CKB A;  1M2V B;  4N0A C;  3JB9 H;  1UG1 A;  3QYG B;  3JB9 I;  4C92 F;  2FO0 A;  4PJO D;  1KQ2 A;  4AG2 C;  3CCE Q;  5C0M A;  3QKJ A;  1T0J A;  4JRK A;  4B9X A;  1KJW A;  3J80 E;  2VXE A;  2Y90 A;  2YSQ A;  2RH2 A;  2WSC E;  1VQ5 Q;  3PGG A;  1MMG A;  3L2Z A;  5GAO p;  3OYK A;  2SRC A;  1XOV A;  3QHS A;  2R5A A;  3EG3 A;  3OYA A;  1D1B A;  1Q81 C;  3OBY A;  1SHF A;  3I9Q A;  3CCE A;  4C5I A;  1Q95 G;  1N5Z A;  1BCO A;  1RLP C;  3CC7 Q;  1RAG B;  3CXC S;  2DNU A;  1VQ5 A;  1N8R R;  2PVD B;  1IGQ A;  1X27 A;  3SWN A;  1FX7 A;  3SWN B;  1PKS A;  4M75 C;  4N4I A;  1M1K R;  3OA6 A;  1PHT A;  4C0D B;  3REA B;  1NEG A;  5IXB A;  2F1L A;  3CD6 A;  3JB9 J;  3M57 A;  4BI3 A;  5A2Q E;  1OOT A; 
#chains in the Genus database with same CATH homology
 3I56 Q;  3CCE Q;  3G6E Q;  1YJW Q;  2QA4 Q;  1Q81 R;  1QVF P;  3CCL Q;  3CC7 Q;  1VQK Q;  3CC4 Q;  1K73 R;  1VQP Q;  3CC2 Q;  3CCM Q;  1Q7Y R;  1KC8 R;  2OTJ Q;  1N8R R;  1K8A R;  1VQ5 Q;  3CCS Q;  2QEX Q;  1VQ7 Q;  3CCR Q;  1VQO Q;  1K9M R;  1KQS P;  1VQ6 Q;  3CMA Q;  3CCJ Q;  1JJ2 P;  2OTL Q;  1VQM Q;  1YIT Q;  3I55 Q;  3CXC P;  3CCU Q;  1NJI R;  1S72 Q;  1M1K R;  3CME Q;  1YIJ Q;  1Q86 R;  1M90 R;  1Q82 R;  1QVG P;  1VQL Q;  3G71 Q;  1VQ4 Q;  3CCV Q;  1VQ8 Q;  1VQN Q;  1KD1 R;  3CPW P;  3CD6 Q;  1VQ9 Q;  1YJN Q;  3OW2 P;  1YJ9 Q;  1YHQ Q;  1YI2 Q;  3G4S Q;  3CCQ Q;  1W2B P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...