1VQ9Q

The structure of cca-phe-cap-bio and the antibiotic sparsomycin bound to the large ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S ribosomal rna
publication title Structural Insights into the Roles of Water and the 2' Hydroxyl of the P Site tRNA in the Peptidyl Transferase Reaction.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF01157 Ribosomal_L21e Ribosomal protein L21e
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1vq9Q00
3CPWP 3CMAQ 1VQPQ 3CCUQ 1YJNQ 1N8RR 1Q86R 1K8AR 3CC7Q 3CCRQ 1KD1R 1NJIR 3OW2P 1Q82R 3CCQQ 3CCSQ 3CC4Q 1VQ4Q 1YJ9Q 3CD6Q 2QEXQ 1M1KR 1VQ9Q 3CCVQ 3I56Q 3CMEQ 1YJWQ 3CC2Q 1K9MR 3CXCP 2OTJQ 3G71Q 1YIJQ 1JJ2P 1VQMQ 1YITQ 1VQLQ 1VQOQ 2QA4Q 3CCEQ 3G6EQ 3CCMQ 1M90R 3CCJQ 1VQ7Q 1VQ5Q 1VQNQ 1QVFP 1VQ6Q 1W2BP 1Q7YR 3I55Q 1K73R 1VQKQ 3CCLQ 1YI2Q 1S72Q 1KQSP 2OTLQ 1YHQQ 1Q81R 1KC8R 3G4SQ 1VQ8Q 1QVGP
chains in the Genus database with same CATH superfamily
1G5VA 2BTTA 2XD0A 2O9VA 1E6GA 3MEVA 4M78D 2QG9B 4PJOF 4J6WA 3M54A 1IREB 3OYMA 2X35A 1CKBA 4BY6B 1F1BB 1YBYA 1QKWA 3CBOA 4JJBA 2JT4A 1Q7YR 3HRSA 1IB8A 2FZKB 4J9GA 3OYEA 3M59A 4B6MA 2QA4A 2VXEA 4LNPA 2YUNA 2HMAA 1E7OA 2V8JA 3CCST 2A08A 2ZCFB 3EAEA 3ZFJA 1YWPA 5IXFA 1M8MA 1VIFA 3JB9G 2EQIA 4IUPA 2A7YA 2L2PA 1YN8A 4J9EA 1Q82C 1WI7A 3FEOA 2F5TX 2XMFA 1W1FA 3EHQA 4Z88A 1SPKA 2OTJA 4QW2A 4PL6A 1GBQA 2CT4A 3I5RA 3OYGA 5GAN6 3VS1A 2VKNA 2K9GA 3CC4T 2KVQG 1SF9A 3CCQT 1AZGB 1TTHB 2MMPA 1MGQA 3UATA 3VJPA 1VQ4Q 3VV0A 1QLYA 1RAEB 4J6YA 2GFAA 1WX6A 2KE9A 1OZ2A 3FDRA 5GAMg 3EG2A 4PJLA 4RCBA 4QQDA 3V8JA 2DF6A 4RUGA 4E7JA 4M75E 1N6AA 3QWXX 1ZQ1A 2EQJA 1KC8R 4Z02A 1PM3A 3H9NA 4CC4B 3H6ZA 3TEEA 3OS1A 3OSSC 3QZ5B 4E7ZA 1QQJA 5GMKh 1ZBJA 1QP2A 1X6GA 2H3EB 2DXBA 1YCYA 4HCCA 2F1LA 3CC7A 2FPFA 3PTAA 1ZSZC 4FU6A 2AKLA 2HKQB 3ULRB 3OYCA 4C92G 1P92A 2EYQA 4IUQA 2OTLQ 4MZPA 1O75A 1VQ8Q 3F70A 3H0FA 3RMSA 1VQ5A 2LP5A 4RKUE 1D3BA 2DYIA 4F04B 1D0XA 1KD1C 4L6V5 3CCJT 3QKJA 2KRSA 2PNIA 4D8DA 3I35A 1ZA1B 4OB1B 4Q5WA 2YRCA 2G6FX 4ZTFA 4OMMA 4FIBA 3CMAT 4BUGA 3PIOA 3CCRT 2DBKA 2OAWA 3HP9A 5FRNA 2HL3A 1UGSB 3OW2P 2YUQA 1UDLA 1QCOA 1GCPA 3R6OA 1K76A 4N4IA 4M7DF 5LJ3f 1I8FA 4HCBA 1UGRB 4X9DA 2YLCA 1WA7A 4DBQA 1G3WA 2QGFB 4FYVB 1LPLA 1ZSZA 1ABOA 1QMCA 3OYDA 3I56T 2JM8A 2JS0A 1Y96B 5LJ3d 4C92E 3CMEQ 1KQ1A 2E5QA 2HZYA 1RI9A 4ESRA 3VKIA 2M1HA 1FX7A 3CC2A 2QTVA 4JJDA 4OMNA 2LQNA 1WIEA 2LC4A 2EQKA 3QO3A 2L3QA 2W0ZA 2L8DA 1MMGA 1PRMC 4PLIA 2D9TA 5CR2A 3M0SA 1VQLQ 2CZ0B 3MO8A 2ZGWA 2V8IA 3PVLA 4R0KA 3S3OA 3C0CA 2M16A 2QQBA 4C8QC 1I5LA 3OS5A 2VC8A 1JEGA 1VQOA 4EMKB 2E12A 4QQGA 1KK7A 4DEXA 2EGCA 3A8HB 1YITT 2NUPB 2YSQA 3E9GA 5I2MA 3JCMg 3I56Q 4XTUA 1PNJA 2M9UA 3PGGA 4AMCA 5FU7B 1M4ZA 4M7AA 4FT4A 4PLLA 2X4YA 1BCOA 2MYSA 2QQSA 3NTHA 4RTTA 2CUDA 1AHJB 5GANe 2DNUA 3GIBA 2MWOA 3EFSA 5LJ5j 2K79A 3CPFA 3RDVA 4MZTA 1RLPC 2QXFA 1JO8A 2AHJB 4F7UG 3S6WA 3A8MB 5CAIA 2E5KA 3P8DA 1O9SA 4OF1A 2RJEA 5GAN8 1YFNA 4WTOB 5CKDA 3M56A 1IO6A 1BB9A 4KH0B 3GLXA 4LN2A 1KIKA 3UWNA 2CSIA 3GNFB 1K73C 3M4GA 2JTEA 5GAOr 1TUCA 2EFIA 4JS4A 3BDUA 4M78G 3UA7A 5CK9A 1K9MR 4RTZA 3VS4A 1YITQ 2AKKA 1NPPA 1M90R 1QVFP 4A63B 4M75B 2CS7A 4C0ZA 1ZX6A 3UA6A 2XI9A 2V26A 4M75F 4QVZA 3JCMb 3VRYA 4E47A 5IAYA 1S72A 2COZA 2IVWA 4J9DA 1C6VX 1QVGA 2DRKA 1YJNA 2P4RA 4ZNXA 2YT6A 8ATCB 1W70A 3OYFA 1JB0E 4KGXB 1BI0A 1M1KU 5GANh 1QCNA 2A37A 1YI2Q 1VQ9A 3MJXA 3V8KA 2X51A 5KYUB 3CPWP 2HNIA 4F7UE 1PHTA 3CD6T 1MMNA 4FYXB 4XTVA 2XG8D 2MF2A 2QEXQ 5KE2A 1VQPA 2FPEA 4HVVA 3NMZC 4JUVA 3GBQA 2KEAA 2QYZA 1I5OB 1UHCA 1Q7YC 4M78E 5KYYA 3M5AA 5KYXA 3CBMA 4N0AA 3CPWS 2HKNA 4O6JA 5D7UA 3LWIA 4AFUC 2KY9A 3NTKA 3CCMQ 3R6NA 4B9WA 3EG9B 1GCQC 3CCSA 2ROTA 4OB0B 2RO0A 4LDUA 1ZSGA 3ASKA 1AEYA 4EIKA 3G7ZA 4HVUA 1XQHA 4GBQA 4M4ZA 1PKTA 4RTVA 1UGPB 5KE3A 5DLOA 2BZXA 5A0GA 1WQWA 2MAMA 5FU6B 4C92B 2LCSA 3CXCP 2DD4A 5GAOn 4R56A 1VQ7T 2KQWA 1RAFB 3BY7A 4C92F 3CCQA 5I21A 3CC4A 4AG2C 2DJQA 2JW4A 3MP8A 4J9BA 4DA4A 3IQLA 2OI3A 4XU0A 1K8AR 4FCYA 2CP3A 1KC8C 2NUTB 1M8VA 1JQQA 5CIUA 3PIPA 1WJSA 1MMAA 2A36A 1WZOA 3SFMA 2BZYA 1JJ2P 2YHTA 1WDXA 2PQWA 2V1RA 4M77C 2YUOA 2HQEA 1VQKT 2IG0A 5HKCA 4XTYA 3RKWA 3BW1A 9ATCB 1M3BA 2BIVA 1Q86R 1K9AA 3SDZA 2FEIA 3CCVT 3PFSA 4J5YA 1GFCA 5DM7R 1KJWA 3SHWA 5IHKA 2EYYA 2ABLA 2O4XA 2LCCA 2O31A 1VQ6Q 2A3LA 4QVDA 1NBEB 4DBRA 1K0SA 3CCJA 2GNCA 3OYBA 3M0QA 1U1SA 2NLUA 3CCLA 4FW2A 3VS3A 5J39A 2DLPA 5GAN2 1X2QA 1UUEA 3CMAA 4LD9K 1WNLA 3CCRA 3EGDB 4A4EA 3REAB 3QUIA 5D6XA 3HRTA 4M77A 2VGNA 2LJ1A 1W2BA 1X69A 2E65A 2QQRA 1PC0A 2MI6A 2ZPFB 4GLMA 3LWHA 1M2VB 2XDDA 5LJ5g 3AHUA 4PJOC 4FYWB 5I2SA 2JMAA 1OPLA 3CCEQ 3M57A 1R0BG 3E9FA 3E1SA 1HSQA 3VS7A 3SWNB 4E2FB 4E7SA 2KGTA 4J83A 1OQKA 3OYKA 2D8HA 5I11A 5GJWB 1IRXA 5DLQE 2DX1A 3NFCA 1T0HA 2HQXA 3DLMA 3C12A 3MKDA 3JB9I 4K11A 3X26B 2YUPA 1VQMQ 1HXDA 1BBZA 1WJRA 3H0HA 4XU1A 2MOXA 4QKUA 3JAME 1C1AA 4LXCA 2R5MA 3GF5A 5KH6A 2DKGA 4OB2B 4LDXA 4XTZA 5GANj 4F7UB 1NJIR 1FYNA 2QK0A 3BDLA 2LJ3A 4DEYA 4F7UF 1TOVA 3M0TA 2HD0A 1BK2A 3GOXA 2CP0A 3NPFA 5HY6A 4PJOA 3CQTA 1CSKA 3DKMA 4RMOA 2RQTA 2HSPA 1BIAA 4M75G 4CRIA 4IUUA 4XK8E 1VQ4T 4M78B 1G3TA 5IHNA 1NLPC 2EVRA 2X4WA 4M78F 2DTIA 5GMKe 3L2RA 1I07A 4VUBA 2Y4YA 3FLGA 1WFWA 2DVEA 2YRVA 4EMGA 2L89A 4MZMA 2XDPA 2KYMA 3M4YA 1EFNA 2PUOB 2WSEE 2CGHA 4BE1A 2JS2A 3I5SA 1ZUYA 3RMQA 2DILA 3FC3A 2H8HA 2L5QA 2RI2A 4KUIA 5LJ5f 1KQSS 1UGQB 2JMCA 4E7KA 5LL6S 1V1CA 2COWA 3HPWA 2P0QA 2OTLT 3MPUB 3QXEB 2DIGA 1K9MC 2JVVA 2L3RA 1VQ8T 1I4K1 5HK3A 5LJ5d 1M90C 4E6RA 3A8LB 1TWBA 2V8KA 2EGEA 4FSXA 3VUBA 1SHFA 2O88A 2PVDB 2ZPBB 1SSFA 1YNZA 3LGLA 4AFQC 1GXIE 2LTOA 2DPPB 3M58A 1T0JA 1H92A 2CKKA 1T3LA 2RH2A 4L5GA 1BI1A 4WF2A 4M7DC 2CP6A 4CC2A 4MMLA 1J3TA 1YIJA 5EG2A 1JBMA 5FRMA 1WHGA 4PFOA 5LJ3e 3REBB 1TUGB 2RPNA 1HD3A 3RKXA 6AT1B 3H8ZA 1Y0MA 4C8QE 4HCZA 3JCMX 1NEGA 3M53A 1SRMA 2NWMA 3C95A 3CD6A 4N4HA 1XJWB 2DZ9A 3QDRB 2JXBA 2EJ9A 2VVKA 2I2LA 4JRQA 3CMET 1OX8A 4IIMA 1YHQA 1B34B 2V1QA 3EH2A 1D0ZA 1X27A 3A8OB 2KBTA 1PD1A 2KI7A 3EGUA 1RUWA 3RESA 1TH7A 2E3IA 5CKFA 2GTOA 2NUZA 1Y71A 1N9SA 1VYTA 2KK4A 3G71A 2AIRB 4ZN1A 4M7DA 3ER0A 1AWWA 3OMGA 1Q7YU 1H3ZA 3TCJA 4ELZC 2R58A 4II1A 4HXJA 1SHGA 1VQLT 2C0OA 4OMLA 3GP8A 3PNWC 1NYFA 2EIFA 4P5NA 1IHVA 1WGSA 2FB7A 2HBWA 1MNEA 1VA7A 3EH1A 4XTWA 2CUBA 1RL2A 4HCKA 2FVUA 1Y96A 4F16A 3M0UA 1NZ9A 5GAOq 1PRLC 1QVGP 3AT1B 5LJ3h 1VQ7A 4KGVB 3ZEHA 1A0NB 4M7AC 5AYFA 1K8AC 5GAMf 3VU3C 2A0FB 2K2MA 3OYNA 1ARKA 3OW2S 2GF7A 2RHZA 3RIRA 1ZHIA 2JTFA 1HYOA 2VWFA 1Q81R 3OYHA 1WXTA 1RAIB 5GAMd 1BCMA 2YWWA 4BDYA 3P8BB 4FW1A 1VQKA 2D8JA 1ZSZB 3EGXB 5GMKl 4KRTA 1QVGS 1Q86C 1PG5B 1S1NA 2QASA 1MMDA 1M27C 2J6FA 2R5AA 4EMKA 4BB7A 4C5EA 2KSSA 3CCVA 1IHWA 1PKSA 2RK2A 1TU0B 2NUPA 2JTMA 2MPXC 5C0MA 1EX4A 1OEBA 2LT4A 1OPKA 3BE3A 4IIOA 2RQUA 5J3BA 4C0GA 1M1KR 5GANg 1C0MA 1M1FA 2WACA 1YJWQ 3A5ZB 3I55T 4J9HA 4RTXA 2I0NA 1QVPA 1VUBA 2HDAA 2OX7A 2DTOA 2EYXA 2RMOA 3TREA 3CCUQ 1G3YA 3JCMP 3VS5A 4AT1B 3MEAA 2OJ2A 1WHLA 5D6YA 2LX7A 1YI2T 3SEMA 1UECA 3TVTA 2KT8A 1RACB 5KYNA 1JXOA 2L0AA 3OS2A 5A2QE 4BI3A 2RB6A 3G4SQ 1QWEA 1UFFA 2CT3A 1WHJA 2VASA 4M7AD 4RTUA 2QEXT 4GY5A 2ECZA 2F2WA 2IIMA 3QG1A 2CP2A 1YP5A 8AT1B 4HA8A 4OGEA 1AWXA 2E6NA 3O5ZA 2RN8A 4M75A 3I9QA 3RKYA 3OS0A 2ZPIB 2BUDA 1LCKA 1Z9QA 3I55Q 1VYUA 2G3RA 4OP0A 4N0AC 4JRIA 2NYSA 2DERA 4JLGA 1U1TA 5A0DA 2LJ0A 4ZGJB 1KQ2A 3CCMT 2PVOB 4C8QB 1N8RU 1NJIC 2GQVA 3HFOA 1NG2A 5FWBA 2EWNA 1H3HA 5KYUA 4C8QD 4AFZC 4C8QF 5GMKj 1BKBA 4AG1C 4C92C 2DD5A 3U23A 3M0PA 5HCKA 2LMJA 4FYYB 1QVFS 1Q95G 2EYZA 3VS2A 3QYHB 4KULA 4O5VA 4J7FA 3JCMf 5GANf 1OULA 1V29B 2F69A 1QKXA 2QA4Q 3HL8A 2CSQA 2AK5A 2E70A 1BI3A 3HHTB 3L1AA 4HKEA 1VQ4A 1G2BA 1FMVA 2HBPA 3JCMd 1EIFA 3EFOB 4BDZA 4C0DC 3E19A 3QBYA 4C5HA 1R8OB 2P0PA 1HK9A 1ABQA 3EG9A 1M3AA 3JCMc 1ZUKA 5GMKm 2OTJQ 5FWCA 2RD1A 2EQUA 3RBBB 2DL5A 2PZ1A 4DQ2A 1R0CB 3L2UA 3TSWA 3ME9A 5KYWB 1ZLMA 2PUKB 2XK0A 4LDYA 4C92A 1I1JA 2OTLA 1VYVA 1VQ8A 2FRYA 4TVRA 1VQ6T 1PSEA 2JM9A 2COYA 2DAQA 4XAXB 1Q82U 2VGMA 3GPLA 1FWZA 2CREA 3JCMJ 2NUTA 4QT7A 4XU3A 3WVDB 1OOTA 2QQ9A 3J7AF 3JSCA 2E3HA 2X4XA 4WCIA 2RNAA 3CC7Q 1BI2A 3DLLA 1D1BA 2K2VA 2PTKA 3HSBA 2PVGB 1XTDA 1VQNT 4QVCA 1QCFA 3A1PA 3FRNA 2FRWA 4LDWA 4LE9A 3ZL7C 1VQ5Q 1PWTA 1WHHA 3V7RA 4LD6A 3CXCS 2KR3A 4ZGDB 3SB2A 2GQIA 1ZUUA 1BYMA 3FJ5A 2KT1A 1WXUA 2K7AA 5CQYA 3CCET 2FL7A 2YXYA 5CKHA 2JNGA 2X3WD 3DB4A 3NGPA 4KH1B 2QAZA 4B9XA 1M5Q1 1LJOA 1TUDA 1QP3A 4QQ6A 4EPCA 3CMEA 1Y57A 1JJ2S 4OMQA 2A28A 2GGRA 4PKCC 1QWFA 4OGCA 3MEWA 2DJZA 1X6OA 1OV3A 2DO3A 1VQMT 1UJYA 1KD1U 2MK5A 1RI0A 3QPHA 1VQNQ 2RHXA 1H8KA 2Z0WA 5AT1B 1VQLA 3VS6A 1M2VA 4PFZA 1GRIA 2LQ8A 5I22A 4GLKA 4XU2A 3N5BB 3RNJA 3SWNA 3CPWA 3URGA 3EHRA 4M78C 2DEQA 1TXQA 3CC2Q 3META 2KMTA 4NL2A 1KSWA 2ZPHB 1FMWA 1VOMA 5IH2A 4PJMA 2CP7A 3PE0A 3I56A 4BY6C 2LQWA 2K57A 1K4US 1Q81C 1K1ZA 4J9FA 1AZEA 1G8XA 4DBFA 4D6WA 2FZGB 1PSFA 4M77D 1GFDA 4PFPA 1VQOQ 5L23A 2CDTA 1SRLA 2HL5C 1X2KA 2DXTA 2GCXA 3EFRA 4JJNK 4F7UA 2VV5A 3KXTA 1OYXA 2XU8A 1TSFA 4CI0C 4DOWA 2HAXA 2J05A 2XHCA 2DRMA 5FROA 1Q86U 2LX9A 1AD5A 2MWPA 4JRKA 4Z8AA 1M1KC 5KCHA 2CP5A 5GAOl 4JRPA 2EKOA 4M78A 1BU1A 3T9NA 1YITA 3EG1A 3PMTA 1ZBXA 2E1HA 3CBPA 4J7IA 2R57A 2YDLA 4BI8B 2RQWA 3GNGA 4J6XA 1LOJA 1YWOA 4C8QG 2E41A 1TS9A 3NTIA 4PJOB 4OMOA 2EBPA 5IN1A 5KCOA 1KHIA 1BIBA 3L2VA 1YI2A 3VYHB 2B86A 1ZA2B 4PJOD 1G83A 1MHNA 2E6ZA 1XNIA 5CCAA 1UJ0A 1W4SA 5LJ5h 2MIOA 1N5ZA 1UGVA 2O01E 2QEXA 2KXDA 3HTRA 1B07A 1S72Q 1WQ7A 1WPYA 4M7AE 2DEUA 3D7SB 1NEBA 1YJNQ 3UPUA 1RAGB 4JLIA 1B3QA 1JRIA 1K73U 1U3OA 1D1CA 3FB9A 1VQ9Q 1Y7XA 1M1GA 1XOVA 2EW3A 3SD4A 3L2QA 2DZCA 3M0RA 5LJ3g 4AFSC 2XKOC 2PU9B 1U8RA 1UB4A 3CCMA 2J6KA 2LT1A 1VQPQ 2QDYB 1OX9A 2FYKA 1SKUB 1WJQA 3OYLA 4KGZB 4KT0E 1CKAA 2J7IA 3FJPA 2FO0A 4Z89A 2LRQA 1NJIU 4RG8A 4KUDK 1WYXA 5CVIA 3BFMA 3KUFA 2LDMA 4Y28E 5GAMe 1B34A 3JRZA 3OYIA 1PD0A 1N27A 2K3BA 1WHMA 3LLRA 4RTWA 2LZ6B 3J81E 3G6ET 3CCSQ 4OVAA 5GAOp 3UT1A 4BE2A 1PCXA 2BE7D 4JDSA 4A4KA 3L2WA 1M3CA 1IXDA 2DXUA 2JZ2A 3OYJA 2ZPGB 3JCMQ 3OQ5A 1M9SA 1MUZA 4FM4B 2QI2A 1FXXA 3CCQQ 3CC4Q 4EMKC 4BI4A 2GBQA 3HKSA 3QDFA 2M51A 1I0CA 5C6SA 4A4FA 2DL7A 3CCLT 2DVJA 1D3BB 4EMHA 3MHXA 5GJVB 3EG0A 2EQMA 2H3JA 5FU7C 1D09B 3V7SA 2E64A 5GAOm 2CZ7B 1VQ6A 1IZ6A 2D0QB 2EKHA 1YJWT 1KQSA 4M7DB 1W6XA 2KAFA 4YTLA 3S3MA 3NHNA 4M7DD 2DMOA 3G6EQ 1LNXA 4ATOA 2FHDA 3M55A 4N4GA 1UHFA 3TQ7P 4JPBW 3CCUT 3WVEB 5GAMh 3EGXA 1JU5C 1RAAB 1MV3A 1HJDA 2WSCE 4A4GA 1VQNA 1YJ9T 3O8VA 2M02A 2P4TA 1X01A 2HCKA 3PMIA 4E7HA 2RJCA 3H0IA 1KC8U 4RTYA 3HRUA 1OI1A 2GFUA 4J8OA 1U06A 2EJFA 3LYIA 1AWOA 3LH5A 2C0IA 5L8RE 4DBHA 4PNOA 5FW9A 3CCJQ 2P0KA 3G4ST 4RCCA 4JZ4A 3QIIA 2AZSA 3CCLQ 2JOYA 4DOVA 3CCEA 3TU4K 1YCSB 3CMAQ 1AOJA 2E4HA 1N8RR 2RHYA 4A54A 2MCNA 4M75C 3CCRQ 2D1XA 4OMFB 2GTJA 3OYAA 1WHKA 3WXMB 4JS5A 4M77G 1OU9A 1H641 2ZZDA 2P84A 2F2XA 4MDWA 4D8KA 1VQMA 5A0LA 5J26A 2KXCA 4KBMB 4RG2A 5FLXE 4HVWA 4PJNA 1U5SA 5IHIA 3KBGA 2DE0X 4Y92A 1YJ9Q 4LUEA 3OB9A 4LUDA 4C0FA 2VYTA 4IUVA 2JUFA 1IGQA 3JCMe 2D0NA 2F5KA 2RHUA 4M7AB 3X20B 4CC7A 2XDBA 2KNBB 2RJFA 2F2VA 4NOYA 3QWYA 2J06A 3RR6A 4M7AF 2DFUA 3OA6A 2FZCB 4BACA 3OY9A 1K0XA 2QA4T 2ED1A 4X9CA 2RI5A 3L42A 3V8LA 4EDUA 2ZPEB 2XIDA 2K3XA 2X4JA 3H41A 3MEUA 4ZGEB 4F14A 4XQ3A 3THKA 1X75C 2IPOB 3EG3A 2M0YA 1E6HA 3QJYA 4C8QA 3J80E 1KG1A 2DA9A 3X28B 4M77E 2RHIA 4JZ3A 1Q81U 2OTJT 1Q82R 4PJOG 2LCLA 3PT9A 1D0YA 1WXBA 3OW2A 3PVQA 5CO7A 3ZBDA 1SSHA 2RK1A 5FU6C 3OMCA 3RUXA 1M30A 3L2ZA 4M75D 4NS5A 3C94A 4F17A 1QW1A 2K4YA 2FPDA 2KRMA 1SG5A 2QDLA 3JB9J 2VUBA 1YIJT 2HSEB 2K5FA 2EGAA 3P8HA 3QHSA 2ESWA 5GAN4 4CC3A 3EFOA 2VXFA 3JCMh 3X25B 1W2BP 2CYZB 2WSFE 1N9RA 3LH0A 4UC4A 3FIFA 2EYWA 3CC7T 2JN0A 5GANd 4ANJA 5M9OA 2O9SA 4E7IA 1UTIA 2HEQA 2D6FA 1RLQC 3JB9D 3JB9F 2ZAEA 2J6OA 1VQ5T 1MV0B 2M0OA 1X6BA 3VUZA 1YHQT 4PK4A 5CQXA 5KYWA 3OBWA 5ECAA 2SEMA 4MMKA 1RADB 5IT9E 4OB3B 2KDSA 4A4HA 2K3YA 4PJOE 1M2OA 2SRCA 1W2BS 1OZ3A 4E7LA 2BKDN 1KD1R 2LNVA 2RA2A 3G71T 4ZTJA 3TSZA 1D1AA 5GAN7 1UE9A 1NE8A 2DM1A 2BZ8A 5KYYB 2DL3A 5GAN3 5LJ3j 1YIJQ 1Z9ZA 5KYXB 3DB3A 3HFNA 3JCMW 1ACMB 3UF4A 3RERA 1FMKA 2EJGA 1G3SA 5GMKi 1K9MU 1RABB 4HT8A 2CZ1B 4L59A 1M90U 5D6WA 2CZ6B 3X24B 4PJJA 1MNDA 5GAMj 5IXBA 2L3SA 1NLOC 2RI3A 4IUTA 3CD6Q 1I81A 1SEMA 3LW5E 3INZA 3OYYA 1NM7A 2XICA 4FSSA 5CKEA 4C92D 2X9HA 1WLPB 2FG0A 2LVMA 1YHQQ 3QYGB 3Q1JA 2RJDA 2K6DA 4X34A 3SWNC 3V7CA 2YRDA 2RF0A 4FL6A 2RQRA 2K5LA 3CC2T 4MDXA 3JB9H 3G71Q 4M7DG 3MP1A 1X43A 2OAUA 4C0DB 1OU8A 3E2UA 4ME7A 2O2OA 2VB6A 2W10A 3G6EA 2X3XD 1GCQA 2RQVA 1DJ7B 2AT1B 1QVFA 1AVZC 2C06A 3VYGA 5GAN5 3EGDA 1VQOT 4BD3A 1GBRA 2HQHA 2B8AA 2DL8A 2ED0A 1VQ7Q 2JJ9A 3G1JA 1T3SA 2AZVA 2O4XB 4J9IA 3OBYA 4ORZA 5HK0A 4OMPA 2LQKA 2DK3A 3A98A 4LDVA 3UDCA 3OSVA 1UG1A 1IGUA 2RM4A 1RAHB 5CKBA 3A8GB 3MCAB 2BE9B 1VQKQ 1YJWA 4ELYC 1NPRA 2E10A 4X1VA 4XTXA 4V2SA 3MP6A 1VIEA 1NYGA 2K5IA 5EC7A 1JXMA 4M77B 4M7DE 2KRNA 2DL4A 3CCVQ 2KYBA 3CCUA 1KHCA 3QSUA 4M77F 1K8AU 1LVKA 3M9QA 4NL3A 3QZ9B 1TG0A 2ENMA 4A53A 1YJ9A 2DTHA 1K73R 4JJCA 5DY9A 5LJ5e 2DETA 2QQAA 2YLBA 4BE0A 1GL5A 3QJ6A 3KFVA 4M7AG 2L3PA 2CH4W 3G4SA 1N8RC 7AT1B 3VS0A 2ROLA 1B7TA 2LNHB 3LX7A 3JV3A 1Y07A 4C5GA 4ZN3A 1S72T 4C5IA 1AT1B 2Y90A 2DBMA 3S3NA 1YJNT 3CEYA 3JCMV 3CXCA 2DYBA 4J9CA 2DIQA 2C0TA 4Y91A 2EPDA 3VRZA 2ATCB 2CH4A 1EZZB 2Y4XA 3LGFA 1AWJA 3I55A 1VQ9T 2EAYA 2DXCA 4IURA 1KFZA 2QGGA 4HT9A 2QTXA 1UEBA 3C4SA 4R55A 1V76A 4IKFA 1VQPT 1R77A 1KQSP 1JJ2A 2KROA 4FT2A
chains in the Genus database with same CATH topology
3CPWP 3CMAQ 1VQPQ 3CCUQ 1YJNQ 1N8RR 1Q86R 1K8AR 3CC7Q 3CCRQ 1KD1R 1NJIR 3OW2P 1Q82R 3CCQQ 3CCSQ 3CC4Q 1VQ4Q 1YJ9Q 3CD6Q 2QEXQ 1M1KR 1VQ9Q 3CCVQ 3I56Q 3CMEQ 1YJWQ 3CC2Q 1K9MR 3CXCP 2OTJQ 3G71Q 1YIJQ 1JJ2P 1VQMQ 1YITQ 1VQLQ 1VQOQ 2QA4Q 3CCEQ 3G6EQ 3CCMQ 1M90R 3CCJQ 1VQ7Q 1VQ5Q 1VQNQ 1QVFP 1VQ6Q 1W2BP 1Q7YR 3I55Q 1K73R 1VQKQ 3CCLQ 1YI2Q 1S72Q 1KQSP 2OTLQ 1YHQQ 1Q81R 1KC8R 3G4SQ 1VQ8Q 1QVGP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPW P;  3CMA Q;  1VQP Q;  3CCU Q;  1YJN Q;  1N8R R;  1Q86 R;  1K8A R;  3CC7 Q;  3CCR Q;  1KD1 R;  1NJI R;  3OW2 P;  1Q82 R;  3CCQ Q;  3CCS Q;  3CC4 Q;  1VQ4 Q;  1YJ9 Q;  3CD6 Q;  2QEX Q;  1M1K R;  1VQ9 Q;  3CCV Q;  3I56 Q;  3CME Q;  1YJW Q;  3CC2 Q;  1K9M R;  3CXC P;  2OTJ Q;  3G71 Q;  1YIJ Q;  1JJ2 P;  1VQM Q;  1YIT Q;  1VQL Q;  1VQO Q;  2QA4 Q;  3CCE Q;  3G6E Q;  3CCM Q;  1M90 R;  3CCJ Q;  1VQ7 Q;  1VQ5 Q;  1VQN Q;  1QVF P;  1VQ6 Q;  1W2B P;  1Q7Y R;  3I55 Q;  1K73 R;  1VQK Q;  3CCL Q;  1YI2 Q;  1S72 Q;  1KQS P;  2OTL Q;  1YHQ Q;  1Q81 R;  1KC8 R;  3G4S Q;  1VQ8 Q;  1QVG P; 
#chains in the Genus database with same CATH topology
 1G5V A;  2BTT A;  2XD0 A;  2O9V A;  1E6G A;  3MEV A;  4M78 D;  2QG9 B;  4PJO F;  4J6W A;  3M54 A;  1IRE B;  3OYM A;  2X35 A;  1CKB A;  4BY6 B;  1F1B B;  1YBY A;  1QKW A;  3CBO A;  4JJB A;  2JT4 A;  1Q7Y R;  3HRS A;  1IB8 A;  2FZK B;  4J9G A;  3OYE A;  3M59 A;  4B6M A;  2QA4 A;  2VXE A;  4LNP A;  2YUN A;  2HMA A;  1E7O A;  2V8J A;  3CCS T;  2A08 A;  2ZCF B;  3EAE A;  3ZFJ A;  1YWP A;  5IXF A;  1M8M A;  1VIF A;  3JB9 G;  2EQI A;  4IUP A;  2A7Y A;  2L2P A;  1YN8 A;  4J9E A;  1Q82 C;  1WI7 A;  3FEO A;  2F5T X;  2XMF A;  1W1F A;  3EHQ A;  4Z88 A;  1SPK A;  2OTJ A;  4QW2 A;  4PL6 A;  1GBQ A;  2CT4 A;  3I5R A;  3OYG A;  5GAN 6;  3VS1 A;  2VKN A;  2K9G A;  3CC4 T;  2KVQ G;  1SF9 A;  3CCQ T;  1AZG B;  1TTH B;  2MMP A;  1MGQ A;  3UAT A;  3VJP A;  1VQ4 Q;  3VV0 A;  1QLY A;  1RAE B;  4J6Y A;  2GFA A;  1WX6 A;  2KE9 A;  1OZ2 A;  3FDR A;  5GAM g;  3EG2 A;  4PJL A;  4RCB A;  4QQD A;  3V8J A;  2DF6 A;  4RUG A;  4E7J A;  4M75 E;  1N6A A;  3QWX X;  1ZQ1 A;  2EQJ A;  1KC8 R;  4Z02 A;  1PM3 A;  3H9N A;  4CC4 B;  3H6Z A;  3TEE A;  3OS1 A;  3OSS C;  3QZ5 B;  4E7Z A;  1QQJ A;  5GMK h;  1ZBJ A;  1QP2 A;  1X6G A;  2H3E B;  2DXB A;  1YCY A;  4HCC A;  2F1L A;  3CC7 A;  2FPF A;  3PTA A;  1ZSZ C;  4FU6 A;  2AKL A;  2HKQ B;  3ULR B;  3OYC A;  4C92 G;  1P92 A;  2EYQ A;  4IUQ A;  2OTL Q;  4MZP A;  1O75 A;  1VQ8 Q;  3F70 A;  3H0F A;  3RMS A;  1VQ5 A;  2LP5 A;  4RKU E;  1D3B A;  2DYI A;  4F04 B;  1D0X A;  1KD1 C;  4L6V 5;  3CCJ T;  3QKJ A;  2KRS A;  2PNI A;  4D8D A;  3I35 A;  1ZA1 B;  4OB1 B;  4Q5W A;  2YRC A;  2G6F X;  4ZTF A;  4OMM A;  4FIB A;  3CMA T;  4BUG A;  3PIO A;  3CCR T;  2DBK A;  2OAW A;  3HP9 A;  5FRN A;  2HL3 A;  1UGS B;  3OW2 P;  2YUQ A;  1UDL A;  1QCO A;  1GCP A;  3R6O A;  1K76 A;  4N4I A;  4M7D F;  5LJ3 f;  1I8F A;  4HCB A;  1UGR B;  4X9D A;  2YLC A;  1WA7 A;  4DBQ A;  1G3W A;  2QGF B;  4FYV B;  1LPL A;  1ZSZ A;  1ABO A;  1QMC A;  3OYD A;  3I56 T;  2JM8 A;  2JS0 A;  1Y96 B;  5LJ3 d;  4C92 E;  3CME Q;  1KQ1 A;  2E5Q A;  2HZY A;  1RI9 A;  4ESR A;  3VKI A;  2M1H A;  1FX7 A;  3CC2 A;  2QTV A;  4JJD A;  4OMN A;  2LQN A;  1WIE A;  2LC4 A;  2EQK A;  3QO3 A;  2L3Q A;  2W0Z A;  2L8D A;  1MMG A;  1PRM C;  4PLI A;  2D9T A;  5CR2 A;  3M0S A;  1VQL Q;  2CZ0 B;  3MO8 A;  2ZGW A;  2V8I A;  3PVL A;  4R0K A;  3S3O A;  3C0C A;  2M16 A;  2QQB A;  4C8Q C;  1I5L A;  3OS5 A;  2VC8 A;  1JEG A;  1VQO A;  4EMK B;  2E12 A;  4QQG A;  1KK7 A;  4DEX A;  2EGC A;  3A8H B;  1YIT T;  2NUP B;  2YSQ A;  3E9G A;  5I2M A;  3JCM g;  3I56 Q;  4XTU A;  1PNJ A;  2M9U A;  3PGG A;  4AMC A;  5FU7 B;  1M4Z A;  4M7A A;  4FT4 A;  4PLL A;  2X4Y A;  1BCO A;  2MYS A;  2QQS A;  3NTH A;  4RTT A;  2CUD A;  1AHJ B;  5GAN e;  2DNU A;  3GIB A;  2MWO A;  3EFS A;  5LJ5 j;  2K79 A;  3CPF A;  3RDV A;  4MZT A;  1RLP C;  2QXF A;  1JO8 A;  2AHJ B;  4F7U G;  3S6W A;  3A8M B;  5CAI A;  2E5K A;  3P8D A;  1O9S A;  4OF1 A;  2RJE A;  5GAN 8;  1YFN A;  4WTO B;  5CKD A;  3M56 A;  1IO6 A;  1BB9 A;  4KH0 B;  3GLX A;  4LN2 A;  1KIK A;  3UWN A;  2CSI A;  3GNF B;  1K73 C;  3M4G A;  2JTE A;  5GAO r;  1TUC A;  2EFI A;  4JS4 A;  3BDU A;  4M78 G;  3UA7 A;  5CK9 A;  1K9M R;  4RTZ A;  3VS4 A;  1YIT Q;  2AKK A;  1NPP A;  1M90 R;  1QVF P;  4A63 B;  4M75 B;  2CS7 A;  4C0Z A;  1ZX6 A;  3UA6 A;  2XI9 A;  2V26 A;  4M75 F;  4QVZ A;  3JCM b;  3VRY A;  4E47 A;  5IAY A;  1S72 A;  2COZ A;  2IVW A;  4J9D A;  1C6V X;  1QVG A;  2DRK A;  1YJN A;  2P4R A;  4ZNX A;  2YT6 A;  8ATC B;  1W70 A;  3OYF A;  1JB0 E;  4KGX B;  1BI0 A;  1M1K U;  5GAN h;  1QCN A;  2A37 A;  1YI2 Q;  1VQ9 A;  3MJX A;  3V8K A;  2X51 A;  5KYU B;  3CPW P;  2HNI A;  4F7U E;  1PHT A;  3CD6 T;  1MMN A;  4FYX B;  4XTV A;  2XG8 D;  2MF2 A;  2QEX Q;  5KE2 A;  1VQP A;  2FPE A;  4HVV A;  3NMZ C;  4JUV A;  3GBQ A;  2KEA A;  2QYZ A;  1I5O B;  1UHC A;  1Q7Y C;  4M78 E;  5KYY A;  3M5A A;  5KYX A;  3CBM A;  4N0A A;  3CPW S;  2HKN A;  4O6J A;  5D7U A;  3LWI A;  4AFU C;  2KY9 A;  3NTK A;  3CCM Q;  3R6N A;  4B9W A;  3EG9 B;  1GCQ C;  3CCS A;  2ROT A;  4OB0 B;  2RO0 A;  4LDU A;  1ZSG A;  3ASK A;  1AEY A;  4EIK A;  3G7Z A;  4HVU A;  1XQH A;  4GBQ A;  4M4Z A;  1PKT A;  4RTV A;  1UGP B;  5KE3 A;  5DLO A;  2BZX A;  5A0G A;  1WQW A;  2MAM A;  5FU6 B;  4C92 B;  2LCS A;  3CXC P;  2DD4 A;  5GAO n;  4R56 A;  1VQ7 T;  2KQW A;  1RAF B;  3BY7 A;  4C92 F;  3CCQ A;  5I21 A;  3CC4 A;  4AG2 C;  2DJQ A;  2JW4 A;  3MP8 A;  4J9B A;  4DA4 A;  3IQL A;  2OI3 A;  4XU0 A;  1K8A R;  4FCY A;  2CP3 A;  1KC8 C;  2NUT B;  1M8V A;  1JQQ A;  5CIU A;  3PIP A;  1WJS A;  1MMA A;  2A36 A;  1WZO A;  3SFM A;  2BZY A;  1JJ2 P;  2YHT A;  1WDX A;  2PQW A;  2V1R A;  4M77 C;  2YUO A;  2HQE A;  1VQK T;  2IG0 A;  5HKC A;  4XTY A;  3RKW A;  3BW1 A;  9ATC B;  1M3B A;  2BIV A;  1Q86 R;  1K9A A;  3SDZ A;  2FEI A;  3CCV T;  3PFS A;  4J5Y A;  1GFC A;  5DM7 R;  1KJW A;  3SHW A;  5IHK A;  2EYY A;  2ABL A;  2O4X A;  2LCC A;  2O31 A;  1VQ6 Q;  2A3L A;  4QVD A;  1NBE B;  4DBR A;  1K0S A;  3CCJ A;  2GNC A;  3OYB A;  3M0Q A;  1U1S A;  2NLU A;  3CCL A;  4FW2 A;  3VS3 A;  5J39 A;  2DLP A;  5GAN 2;  1X2Q A;  1UUE A;  3CMA A;  4LD9 K;  1WNL A;  3CCR A;  3EGD B;  4A4E A;  3REA B;  3QUI A;  5D6X A;  3HRT A;  4M77 A;  2VGN A;  2LJ1 A;  1W2B A;  1X69 A;  2E65 A;  2QQR A;  1PC0 A;  2MI6 A;  2ZPF B;  4GLM A;  3LWH A;  1M2V B;  2XDD A;  5LJ5 g;  3AHU A;  4PJO C;  4FYW B;  5I2S A;  2JMA A;  1OPL A;  3CCE Q;  3M57 A;  1R0B G;  3E9F A;  3E1S A;  1HSQ A;  3VS7 A;  3SWN B;  4E2F B;  4E7S A;  2KGT A;  4J83 A;  1OQK A;  3OYK A;  2D8H A;  5I11 A;  5GJW B;  1IRX A;  5DLQ E;  2DX1 A;  3NFC A;  1T0H A;  2HQX A;  3DLM A;  3C12 A;  3MKD A;  3JB9 I;  4K11 A;  3X26 B;  2YUP A;  1VQM Q;  1HXD A;  1BBZ A;  1WJR A;  3H0H A;  4XU1 A;  2MOX A;  4QKU A;  3JAM E;  1C1A A;  4LXC A;  2R5M A;  3GF5 A;  5KH6 A;  2DKG A;  4OB2 B;  4LDX A;  4XTZ A;  5GAN j;  4F7U B;  1NJI R;  1FYN A;  2QK0 A;  3BDL A;  2LJ3 A;  4DEY A;  4F7U F;  1TOV A;  3M0T A;  2HD0 A;  1BK2 A;  3GOX A;  2CP0 A;  3NPF A;  5HY6 A;  4PJO A;  3CQT A;  1CSK A;  3DKM A;  4RMO A;  2RQT A;  2HSP A;  1BIA A;  4M75 G;  4CRI A;  4IUU A;  4XK8 E;  1VQ4 T;  4M78 B;  1G3T A;  5IHN A;  1NLP C;  2EVR A;  2X4W A;  4M78 F;  2DTI A;  5GMK e;  3L2R A;  1I07 A;  4VUB A;  2Y4Y A;  3FLG A;  1WFW A;  2DVE A;  2YRV A;  4EMG A;  2L89 A;  4MZM A;  2XDP A;  2KYM A;  3M4Y A;  1EFN A;  2PUO B;  2WSE E;  2CGH A;  4BE1 A;  2JS2 A;  3I5S A;  1ZUY A;  3RMQ A;  2DIL A;  3FC3 A;  2H8H A;  2L5Q A;  2RI2 A;  4KUI A;  5LJ5 f;  1KQS S;  1UGQ B;  2JMC A;  4E7K A;  5LL6 S;  1V1C A;  2COW A;  3HPW A;  2P0Q A;  2OTL T;  3MPU B;  3QXE B;  2DIG A;  1K9M C;  2JVV A;  2L3R A;  1VQ8 T;  1I4K 1;  5HK3 A;  5LJ5 d;  1M90 C;  4E6R A;  3A8L B;  1TWB A;  2V8K A;  2EGE A;  4FSX A;  3VUB A;  1SHF A;  2O88 A;  2PVD B;  2ZPB B;  1SSF A;  1YNZ A;  3LGL A;  4AFQ C;  1GXI E;  2LTO A;  2DPP B;  3M58 A;  1T0J A;  1H92 A;  2CKK A;  1T3L A;  2RH2 A;  4L5G A;  1BI1 A;  4WF2 A;  4M7D C;  2CP6 A;  4CC2 A;  4MML A;  1J3T A;  1YIJ A;  5EG2 A;  1JBM A;  5FRM A;  1WHG A;  4PFO A;  5LJ3 e;  3REB B;  1TUG B;  2RPN A;  1HD3 A;  3RKX A;  6AT1 B;  3H8Z A;  1Y0M A;  4C8Q E;  4HCZ A;  3JCM X;  1NEG A;  3M53 A;  1SRM A;  2NWM A;  3C95 A;  3CD6 A;  4N4H A;  1XJW B;  2DZ9 A;  3QDR B;  2JXB A;  2EJ9 A;  2VVK A;  2I2L A;  4JRQ A;  3CME T;  1OX8 A;  4IIM A;  1YHQ A;  1B34 B;  2V1Q A;  3EH2 A;  1D0Z A;  1X27 A;  3A8O B;  2KBT A;  1PD1 A;  2KI7 A;  3EGU A;  1RUW A;  3RES A;  1TH7 A;  2E3I A;  5CKF A;  2GTO A;  2NUZ A;  1Y71 A;  1N9S A;  1VYT A;  2KK4 A;  3G71 A;  2AIR B;  4ZN1 A;  4M7D A;  3ER0 A;  1AWW A;  3OMG A;  1Q7Y U;  1H3Z A;  3TCJ A;  4ELZ C;  2R58 A;  4II1 A;  4HXJ A;  1SHG A;  1VQL T;  2C0O A;  4OML A;  3GP8 A;  3PNW C;  1NYF A;  2EIF A;  4P5N A;  1IHV A;  1WGS A;  2FB7 A;  2HBW A;  1MNE A;  1VA7 A;  3EH1 A;  4XTW A;  2CUB A;  1RL2 A;  4HCK A;  2FVU A;  1Y96 A;  4F16 A;  3M0U A;  1NZ9 A;  5GAO q;  1PRL C;  1QVG P;  3AT1 B;  5LJ3 h;  1VQ7 A;  4KGV B;  3ZEH A;  1A0N B;  4M7A C;  5AYF A;  1K8A C;  5GAM f;  3VU3 C;  2A0F B;  2K2M A;  3OYN A;  1ARK A;  3OW2 S;  2GF7 A;  2RHZ A;  3RIR A;  1ZHI A;  2JTF A;  1HYO A;  2VWF A;  1Q81 R;  3OYH A;  1WXT A;  1RAI B;  5GAM d;  1BCM A;  2YWW A;  4BDY A;  3P8B B;  4FW1 A;  1VQK A;  2D8J A;  1ZSZ B;  3EGX B;  5GMK l;  4KRT A;  1QVG S;  1Q86 C;  1PG5 B;  1S1N A;  2QAS A;  1MMD A;  1M27 C;  2J6F A;  2R5A A;  4EMK A;  4BB7 A;  4C5E A;  2KSS A;  3CCV A;  1IHW A;  1PKS A;  2RK2 A;  1TU0 B;  2NUP A;  2JTM A;  2MPX C;  5C0M A;  1EX4 A;  1OEB A;  2LT4 A;  1OPK A;  3BE3 A;  4IIO A;  2RQU A;  5J3B A;  4C0G A;  1M1K R;  5GAN g;  1C0M A;  1M1F A;  2WAC A;  1YJW Q;  3A5Z B;  3I55 T;  4J9H A;  4RTX A;  2I0N A;  1QVP A;  1VUB A;  2HDA A;  2OX7 A;  2DTO A;  2EYX A;  2RMO A;  3TRE A;  3CCU Q;  1G3Y A;  3JCM P;  3VS5 A;  4AT1 B;  3MEA A;  2OJ2 A;  1WHL A;  5D6Y A;  2LX7 A;  1YI2 T;  3SEM A;  1UEC A;  3TVT A;  2KT8 A;  1RAC B;  5KYN A;  1JXO A;  2L0A A;  3OS2 A;  5A2Q E;  4BI3 A;  2RB6 A;  3G4S Q;  1QWE A;  1UFF A;  2CT3 A;  1WHJ A;  2VAS A;  4M7A D;  4RTU A;  2QEX T;  4GY5 A;  2ECZ A;  2F2W A;  2IIM A;  3QG1 A;  2CP2 A;  1YP5 A;  8AT1 B;  4HA8 A;  4OGE A;  1AWX A;  2E6N A;  3O5Z A;  2RN8 A;  4M75 A;  3I9Q A;  3RKY A;  3OS0 A;  2ZPI B;  2BUD A;  1LCK A;  1Z9Q A;  3I55 Q;  1VYU A;  2G3R A;  4OP0 A;  4N0A C;  4JRI A;  2NYS A;  2DER A;  4JLG A;  1U1T A;  5A0D A;  2LJ0 A;  4ZGJ B;  1KQ2 A;  3CCM T;  2PVO B;  4C8Q B;  1N8R U;  1NJI C;  2GQV A;  3HFO A;  1NG2 A;  5FWB A;  2EWN A;  1H3H A;  5KYU A;  4C8Q D;  4AFZ C;  4C8Q F;  5GMK j;  1BKB A;  4AG1 C;  4C92 C;  2DD5 A;  3U23 A;  3M0P A;  5HCK A;  2LMJ A;  4FYY B;  1QVF S;  1Q95 G;  2EYZ A;  3VS2 A;  3QYH B;  4KUL A;  4O5V A;  4J7F A;  3JCM f;  5GAN f;  1OUL A;  1V29 B;  2F69 A;  1QKX A;  2QA4 Q;  3HL8 A;  2CSQ A;  2AK5 A;  2E70 A;  1BI3 A;  3HHT B;  3L1A A;  4HKE A;  1VQ4 A;  1G2B A;  1FMV A;  2HBP A;  3JCM d;  1EIF A;  3EFO B;  4BDZ A;  4C0D C;  3E19 A;  3QBY A;  4C5H A;  1R8O B;  2P0P A;  1HK9 A;  1ABQ A;  3EG9 A;  1M3A A;  3JCM c;  1ZUK A;  5GMK m;  2OTJ Q;  5FWC A;  2RD1 A;  2EQU A;  3RBB B;  2DL5 A;  2PZ1 A;  4DQ2 A;  1R0C B;  3L2U A;  3TSW A;  3ME9 A;  5KYW B;  1ZLM A;  2PUK B;  2XK0 A;  4LDY A;  4C92 A;  1I1J A;  2OTL A;  1VYV A;  1VQ8 A;  2FRY A;  4TVR A;  1VQ6 T;  1PSE A;  2JM9 A;  2COY A;  2DAQ A;  4XAX B;  1Q82 U;  2VGM A;  3GPL A;  1FWZ A;  2CRE A;  3JCM J;  2NUT A;  4QT7 A;  4XU3 A;  3WVD B;  1OOT A;  2QQ9 A;  3J7A F;  3JSC A;  2E3H A;  2X4X A;  4WCI A;  2RNA A;  3CC7 Q;  1BI2 A;  3DLL A;  1D1B A;  2K2V A;  2PTK A;  3HSB A;  2PVG B;  1XTD A;  1VQN T;  4QVC A;  1QCF A;  3A1P A;  3FRN A;  2FRW A;  4LDW A;  4LE9 A;  3ZL7 C;  1VQ5 Q;  1PWT A;  1WHH A;  3V7R A;  4LD6 A;  3CXC S;  2KR3 A;  4ZGD B;  3SB2 A;  2GQI A;  1ZUU A;  1BYM A;  3FJ5 A;  2KT1 A;  1WXU A;  2K7A A;  5CQY A;  3CCE T;  2FL7 A;  2YXY A;  5CKH A;  2JNG A;  2X3W D;  3DB4 A;  3NGP A;  4KH1 B;  2QAZ A;  4B9X A;  1M5Q 1;  1LJO A;  1TUD A;  1QP3 A;  4QQ6 A;  4EPC A;  3CME A;  1Y57 A;  1JJ2 S;  4OMQ A;  2A28 A;  2GGR A;  4PKC C;  1QWF A;  4OGC A;  3MEW A;  2DJZ A;  1X6O A;  1OV3 A;  2DO3 A;  1VQM T;  1UJY A;  1KD1 U;  2MK5 A;  1RI0 A;  3QPH A;  1VQN Q;  2RHX A;  1H8K A;  2Z0W A;  5AT1 B;  1VQL A;  3VS6 A;  1M2V A;  4PFZ A;  1GRI A;  2LQ8 A;  5I22 A;  4GLK A;  4XU2 A;  3N5B B;  3RNJ A;  3SWN A;  3CPW A;  3URG A;  3EHR A;  4M78 C;  2DEQ A;  1TXQ A;  3CC2 Q;  3MET A;  2KMT A;  4NL2 A;  1KSW A;  2ZPH B;  1FMW A;  1VOM A;  5IH2 A;  4PJM A;  2CP7 A;  3PE0 A;  3I56 A;  4BY6 C;  2LQW A;  2K57 A;  1K4U S;  1Q81 C;  1K1Z A;  4J9F A;  1AZE A;  1G8X A;  4DBF A;  4D6W A;  2FZG B;  1PSF A;  4M77 D;  1GFD A;  4PFP A;  1VQO Q;  5L23 A;  2CDT A;  1SRL A;  2HL5 C;  1X2K A;  2DXT A;  2GCX A;  3EFR A;  4JJN K;  4F7U A;  2VV5 A;  3KXT A;  1OYX A;  2XU8 A;  1TSF A;  4CI0 C;  4DOW A;  2HAX A;  2J05 A;  2XHC A;  2DRM A;  5FRO A;  1Q86 U;  2LX9 A;  1AD5 A;  2MWP A;  4JRK A;  4Z8A A;  1M1K C;  5KCH A;  2CP5 A;  5GAO l;  4JRP A;  2EKO A;  4M78 A;  1BU1 A;  3T9N A;  1YIT A;  3EG1 A;  3PMT A;  1ZBX A;  2E1H A;  3CBP A;  4J7I A;  2R57 A;  2YDL A;  4BI8 B;  2RQW A;  3GNG A;  4J6X A;  1LOJ A;  1YWO A;  4C8Q G;  2E41 A;  1TS9 A;  3NTI A;  4PJO B;  4OMO A;  2EBP A;  5IN1 A;  5KCO A;  1KHI A;  1BIB A;  3L2V A;  1YI2 A;  3VYH B;  2B86 A;  1ZA2 B;  4PJO D;  1G83 A;  1MHN A;  2E6Z A;  1XNI A;  5CCA A;  1UJ0 A;  1W4S A;  5LJ5 h;  2MIO A;  1N5Z A;  1UGV A;  2O01 E;  2QEX A;  2KXD A;  3HTR A;  1B07 A;  1S72 Q;  1WQ7 A;  1WPY A;  4M7A E;  2DEU A;  3D7S B;  1NEB A;  1YJN Q;  3UPU A;  1RAG B;  4JLI A;  1B3Q A;  1JRI A;  1K73 U;  1U3O A;  1D1C A;  3FB9 A;  1VQ9 Q;  1Y7X A;  1M1G A;  1XOV A;  2EW3 A;  3SD4 A;  3L2Q A;  2DZC A;  3M0R A;  5LJ3 g;  4AFS C;  2XKO C;  2PU9 B;  1U8R A;  1UB4 A;  3CCM A;  2J6K A;  2LT1 A;  1VQP Q;  2QDY B;  1OX9 A;  2FYK A;  1SKU B;  1WJQ A;  3OYL A;  4KGZ B;  4KT0 E;  1CKA A;  2J7I A;  3FJP A;  2FO0 A;  4Z89 A;  2LRQ A;  1NJI U;  4RG8 A;  4KUD K;  1WYX A;  5CVI A;  3BFM A;  3KUF A;  2LDM A;  4Y28 E;  5GAM e;  1B34 A;  3JRZ A;  3OYI A;  1PD0 A;  1N27 A;  2K3B A;  1WHM A;  3LLR A;  4RTW A;  2LZ6 B;  3J81 E;  3G6E T;  3CCS Q;  4OVA A;  5GAO p;  3UT1 A;  4BE2 A;  1PCX A;  2BE7 D;  4JDS A;  4A4K A;  3L2W A;  1M3C A;  1IXD A;  2DXU A;  2JZ2 A;  3OYJ A;  2ZPG B;  3JCM Q;  3OQ5 A;  1M9S A;  1MUZ A;  4FM4 B;  2QI2 A;  1FXX A;  3CCQ Q;  3CC4 Q;  4EMK C;  4BI4 A;  2GBQ A;  3HKS A;  3QDF A;  2M51 A;  1I0C A;  5C6S A;  4A4F A;  2DL7 A;  3CCL T;  2DVJ A;  1D3B B;  4EMH A;  3MHX A;  5GJV B;  3EG0 A;  2EQM A;  2H3J A;  5FU7 C;  1D09 B;  3V7S A;  2E64 A;  5GAO m;  2CZ7 B;  1VQ6 A;  1IZ6 A;  2D0Q B;  2EKH A;  1YJW T;  1KQS A;  4M7D B;  1W6X A;  2KAF A;  4YTL A;  3S3M A;  3NHN A;  4M7D D;  2DMO A;  3G6E Q;  1LNX A;  4ATO A;  2FHD A;  3M55 A;  4N4G A;  1UHF A;  3TQ7 P;  4JPB W;  3CCU T;  3WVE B;  5GAM h;  3EGX A;  1JU5 C;  1RAA B;  1MV3 A;  1HJD A;  2WSC E;  4A4G A;  1VQN A;  1YJ9 T;  3O8V A;  2M02 A;  2P4T A;  1X01 A;  2HCK A;  3PMI A;  4E7H A;  2RJC A;  3H0I A;  1KC8 U;  4RTY A;  3HRU A;  1OI1 A;  2GFU A;  4J8O A;  1U06 A;  2EJF A;  3LYI A;  1AWO A;  3LH5 A;  2C0I A;  5L8R E;  4DBH A;  4PNO A;  5FW9 A;  3CCJ Q;  2P0K A;  3G4S T;  4RCC A;  4JZ4 A;  3QII A;  2AZS A;  3CCL Q;  2JOY A;  4DOV A;  3CCE A;  3TU4 K;  1YCS B;  3CMA Q;  1AOJ A;  2E4H A;  1N8R R;  2RHY A;  4A54 A;  2MCN A;  4M75 C;  3CCR Q;  2D1X A;  4OMF B;  2GTJ A;  3OYA A;  1WHK A;  3WXM B;  4JS5 A;  4M77 G;  1OU9 A;  1H64 1;  2ZZD A;  2P84 A;  2F2X A;  4MDW A;  4D8K A;  1VQM A;  5A0L A;  5J26 A;  2KXC A;  4KBM B;  4RG2 A;  5FLX E;  4HVW A;  4PJN A;  1U5S A;  5IHI A;  3KBG A;  2DE0 X;  4Y92 A;  1YJ9 Q;  4LUE A;  3OB9 A;  4LUD A;  4C0F A;  2VYT A;  4IUV A;  2JUF A;  1IGQ A;  3JCM e;  2D0N A;  2F5K A;  2RHU A;  4M7A B;  3X20 B;  4CC7 A;  2XDB A;  2KNB B;  2RJF A;  2F2V A;  4NOY A;  3QWY A;  2J06 A;  3RR6 A;  4M7A F;  2DFU A;  3OA6 A;  2FZC B;  4BAC A;  3OY9 A;  1K0X A;  2QA4 T;  2ED1 A;  4X9C A;  2RI5 A;  3L42 A;  3V8L A;  4EDU A;  2ZPE B;  2XID A;  2K3X A;  2X4J A;  3H41 A;  3MEU A;  4ZGE B;  4F14 A;  4XQ3 A;  3THK A;  1X75 C;  2IPO B;  3EG3 A;  2M0Y A;  1E6H A;  3QJY A;  4C8Q A;  3J80 E;  1KG1 A;  2DA9 A;  3X28 B;  4M77 E;  2RHI A;  4JZ3 A;  1Q81 U;  2OTJ T;  1Q82 R;  4PJO G;  2LCL A;  3PT9 A;  1D0Y A;  1WXB A;  3OW2 A;  3PVQ A;  5CO7 A;  3ZBD A;  1SSH A;  2RK1 A;  5FU6 C;  3OMC A;  3RUX A;  1M30 A;  3L2Z A;  4M75 D;  4NS5 A;  3C94 A;  4F17 A;  1QW1 A;  2K4Y A;  2FPD A;  2KRM A;  1SG5 A;  2QDL A;  3JB9 J;  2VUB A;  1YIJ T;  2HSE B;  2K5F A;  2EGA A;  3P8H A;  3QHS A;  2ESW A;  5GAN 4;  4CC3 A;  3EFO A;  2VXF A;  3JCM h;  3X25 B;  1W2B P;  2CYZ B;  2WSF E;  1N9R A;  3LH0 A;  4UC4 A;  3FIF A;  2EYW A;  3CC7 T;  2JN0 A;  5GAN d;  4ANJ A;  5M9O A;  2O9S A;  4E7I A;  1UTI A;  2HEQ A;  2D6F A;  1RLQ C;  3JB9 D;  3JB9 F;  2ZAE A;  2J6O A;  1VQ5 T;  1MV0 B;  2M0O A;  1X6B A;  3VUZ A;  1YHQ T;  4PK4 A;  5CQX A;  5KYW A;  3OBW A;  5ECA A;  2SEM A;  4MMK A;  1RAD B;  5IT9 E;  4OB3 B;  2KDS A;  4A4H A;  2K3Y A;  4PJO E;  1M2O A;  2SRC A;  1W2B S;  1OZ3 A;  4E7L A;  2BKD N;  1KD1 R;  2LNV A;  2RA2 A;  3G71 T;  4ZTJ A;  3TSZ A;  1D1A A;  5GAN 7;  1UE9 A;  1NE8 A;  2DM1 A;  2BZ8 A;  5KYY B;  2DL3 A;  5GAN 3;  5LJ3 j;  1YIJ Q;  1Z9Z A;  5KYX B;  3DB3 A;  3HFN A;  3JCM W;  1ACM B;  3UF4 A;  3RER A;  1FMK A;  2EJG A;  1G3S A;  5GMK i;  1K9M U;  1RAB B;  4HT8 A;  2CZ1 B;  4L59 A;  1M90 U;  5D6W A;  2CZ6 B;  3X24 B;  4PJJ A;  1MND A;  5GAM j;  5IXB A;  2L3S A;  1NLO C;  2RI3 A;  4IUT A;  3CD6 Q;  1I81 A;  1SEM A;  3LW5 E;  3INZ A;  3OYY A;  1NM7 A;  2XIC A;  4FSS A;  5CKE A;  4C92 D;  2X9H A;  1WLP B;  2FG0 A;  2LVM A;  1YHQ Q;  3QYG B;  3Q1J A;  2RJD A;  2K6D A;  4X34 A;  3SWN C;  3V7C A;  2YRD A;  2RF0 A;  4FL6 A;  2RQR A;  2K5L A;  3CC2 T;  4MDX A;  3JB9 H;  3G71 Q;  4M7D G;  3MP1 A;  1X43 A;  2OAU A;  4C0D B;  1OU8 A;  3E2U A;  4ME7 A;  2O2O A;  2VB6 A;  2W10 A;  3G6E A;  2X3X D;  1GCQ A;  2RQV A;  1DJ7 B;  2AT1 B;  1QVF A;  1AVZ C;  2C06 A;  3VYG A;  5GAN 5;  3EGD A;  1VQO T;  4BD3 A;  1GBR A;  2HQH A;  2B8A A;  2DL8 A;  2ED0 A;  1VQ7 Q;  2JJ9 A;  3G1J A;  1T3S A;  2AZV A;  2O4X B;  4J9I A;  3OBY A;  4ORZ A;  5HK0 A;  4OMP A;  2LQK A;  2DK3 A;  3A98 A;  4LDV A;  3UDC A;  3OSV A;  1UG1 A;  1IGU A;  2RM4 A;  1RAH B;  5CKB A;  3A8G B;  3MCA B;  2BE9 B;  1VQK Q;  1YJW A;  4ELY C;  1NPR A;  2E10 A;  4X1V A;  4XTX A;  4V2S A;  3MP6 A;  1VIE A;  1NYG A;  2K5I A;  5EC7 A;  1JXM A;  4M77 B;  4M7D E;  2KRN A;  2DL4 A;  3CCV Q;  2KYB A;  3CCU A;  1KHC A;  3QSU A;  4M77 F;  1K8A U;  1LVK A;  3M9Q A;  4NL3 A;  3QZ9 B;  1TG0 A;  2ENM A;  4A53 A;  1YJ9 A;  2DTH A;  1K73 R;  4JJC A;  5DY9 A;  5LJ5 e;  2DET A;  2QQA A;  2YLB A;  4BE0 A;  1GL5 A;  3QJ6 A;  3KFV A;  4M7A G;  2L3P A;  2CH4 W;  3G4S A;  1N8R C;  7AT1 B;  3VS0 A;  2ROL A;  1B7T A;  2LNH B;  3LX7 A;  3JV3 A;  1Y07 A;  4C5G A;  4ZN3 A;  1S72 T;  4C5I A;  1AT1 B;  2Y90 A;  2DBM A;  3S3N A;  1YJN T;  3CEY A;  3JCM V;  3CXC A;  2DYB A;  4J9C A;  2DIQ A;  2C0T A;  4Y91 A;  2EPD A;  3VRZ A;  2ATC B;  2CH4 A;  1EZZ B;  2Y4X A;  3LGF A;  1AWJ A;  3I55 A;  1VQ9 T;  2EAY A;  2DXC A;  4IUR A;  1KFZ A;  2QGG A;  4HT9 A;  2QTX A;  1UEB A;  3C4S A;  4R55 A;  1V76 A;  4IKF A;  1VQP T;  1R77 A;  1KQS P;  1JJ2 A;  2KRO A;  4FT2 A; 
#chains in the Genus database with same CATH homology
 3CPW P;  3CMA Q;  1VQP Q;  3CCU Q;  1YJN Q;  1N8R R;  1Q86 R;  1K8A R;  3CC7 Q;  3CCR Q;  1KD1 R;  1NJI R;  3OW2 P;  1Q82 R;  3CCQ Q;  3CCS Q;  3CC4 Q;  1VQ4 Q;  1YJ9 Q;  3CD6 Q;  2QEX Q;  1M1K R;  1VQ9 Q;  3CCV Q;  3I56 Q;  3CME Q;  1YJW Q;  3CC2 Q;  1K9M R;  3CXC P;  2OTJ Q;  3G71 Q;  1YIJ Q;  1JJ2 P;  1VQM Q;  1YIT Q;  1VQL Q;  1VQO Q;  2QA4 Q;  3CCE Q;  3G6E Q;  3CCM Q;  1M90 R;  3CCJ Q;  1VQ7 Q;  1VQ5 Q;  1VQN Q;  1QVF P;  1VQ6 Q;  1W2B P;  1Q7Y R;  3I55 Q;  1K73 R;  1VQK Q;  3CCL Q;  1YI2 Q;  1S72 Q;  1KQS P;  2OTL Q;  1YHQ Q;  1Q81 R;  1KC8 R;  3G4S Q;  1VQ8 Q;  1QVG P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...