3SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein/inhibitor
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3semA00
1AWJA 2C0IA 4HCKA 4J9GA 2EBPA 3M0PA 4OMNA 1OOTA 4Y92A 1UFFA 1M30A 2EGCA 2GTOA 1UHFA 2KNBB 2KRNA 3VRYA 2M51A 2A08A 4D8KA 2KRSA 3O5ZA 2GBQA 2CUBA 2K2MA 2JMAA 1BB9A 4AFZC 2P4RA 1I07A 5HCKA 1WXBA 2KXDA 3NGPA 1MV0B 4Z88A 2LCSA 2YUOA 3FJ5A 4Z8AA 1Z9ZA 2C0OA 3REAB 1WXTA 3SEMA 2W10A 3CQTA 2ESWA 1SRMA 1M3CA 1Z9QA 2L3PA 4DEYA 1CKAA 3TSZA 4J9DA 2FPEA 5IH2A 4CC4B 2DE0X 1WI7A 2DL5A 3TVTA 2LQWA 1K0SA 1W6XA 4KRTA 1RUWA 2W0ZA 1RLQC 2K9GA 2LP5A 1WLPB 1E6GA 2LX7A 2RMOA 1H3HA 4RTWA 1W1FA 3H0IA 2FG0A 1NLPC 2PZ1A 1ZUKA 4HXJA 1BU1A 3H0HA 2RQWA 2JT4A 3RBBB 4F14A 1E6HA 2AZSA 2EGAA 2CH4A 2BZ8A 3EG2A 1YCSB 2JW4A 1YN8A 2DBKA 1AEYA 1I0CA 4J9EA 3EG0A 5I22A 2K79A 2L3QA 3I9QA 4OMQA 3VS6A 2CUDA 1SRLA 1HD3A 2RQTA 5FW9A 2HEQA 1SPKA 2FRYA 1KIKA 1UDLA 3VS2A 2AKLA 4HVWA 1U5SA 1ABOA 1NYGA 1JQQA 2C0TA 2LMJA 1K9AA 3VS1A 1AWWA 3I5RA 2K6DA 1UJ0A 1T3LA 1UHCA 1ARKA 2AZVA 1WDXA 1YP5A 2DLPA 1QWEA 2EVRA 3IQLA 1BBZA 5FWCA 1H92A 2KYBA 2O31A 1LCKA 2EYWA 1GBRA 1TUDA 3VS5A 2PNIA 3VS7A 4RTZA 1UTIA 2OI3A 2J05A 2CH4W 2DA9A 3ULRB 2DMOA 2DF6A 1JO8A 1K0XA 1X69A 4RUGA 4AG2C 2CREA 4RTXA 3I35A 1UUEA 1BK2A 2ROTA 3M0QA 1M27C 1GL5A 1GFCA 1GFDA 2GNCA 3QWYA 1WYXA 4J9FA 2B86A 5IXFA 2KXCA 1G2BA 3UF4A 4E6RA 2ENMA 2FO0A 2DM1A 2I0NA 2DL8A 2VKNA 4RTVA 2GGRA 2IIMA 1K4US 2AK5A 4R0KA 1ABQA 2GQIA 2CSQA 2BZXA 1YNZA 3EHRA 4Z89A 2AKKA 3I5SA 3UATA 2JMCA 2L2PA 4IIOA 2EPDA 2KE9A 2D8HA 2BZYA 1PHTA 2DL4A 1PWTA 1QLYA 2CSIA 2EYXA 2FRWA 1OV3A 1Y0MA 2DL3A 2ED1A 2NWMA 1T0HA 2JM8A 1WFWA 3C0CA 2KT1A 2SRCA 2PTKA 2KBTA 2HDAA 1VYUA 1Y57A 4LUEA 1SHFA 3VS4A 2DJQA 1FYNA 1YWPA 2KT8A 1CSKA 2KGTA 4JPBW 3UA6A 2K7AA 1U3OA 1RLPC 1T0JA 2LJ1A 1S1NA 1X6GA 5IXBA 1AZEA 1IO6A 4ZNXA 2EW3A 1CKBA 4JJBA 1UG1A 2M0YA 4LNPA 2ABLA 4RTYA 1OPKA 2CT3A 1HJDA 1ZUYA 1PRMC 3NPFA 1W70A 2CT4A 4A63B 2RN8A 3QWXX 2YUPA 1VYTA 2RPNA 3H0FA 2EYZA 1OPLA 1KJWA 1N5ZA 1K76A 1NEBA 2XMFA 2J7IA 4F16A 2F2WA 1E7OA 2KYMA 1FMKA 1K1ZA 1UJYA 2DYBA 2ECZA 3EG3A 2VWFA 2LJ3A 2LQNA 2HSPA 3VS3A 4AFUC 4LE9A 2E5KA 1PRLC 1AOJA 2J06A 2KR3A 5L23A 4WCIA 4RTUA 1GCQC 1NG2A 4GBQA 2FEIA 2L0AA 2O9VA 1WIEA 1ZUUA 2YSQA 2YUQA 2O2OA 4CC2A 4ESRA 2RQUA 1VYVA 1JU5C 2HBWA 5FWBA 4M4ZA 1TUCA 1G83A 1X2KA 2MOXA 4LUDA 1PKTA 2J6KA 1T3SA 4EIKA 2FPDA 2JXBA 4DEXA 1AWOA 2RF0A 5EC7A 4AFSC 1WXUA 1NEGA 4ORZA 1MV3A 1JXMA 3NHNA 4QT7A 1QWFA 1X43A 2EYYA 2VVKA 2A36A 1OEBA 1UGVA 1I1JA 4CC7A 5IHIA 1YWOA 3U23A 1X27A 4OMLA 2OJ2A 1SSHA 2F2VA 3TSWA 2DNUA 1AD5A 2G6FX 1UE9A 2YT6A 2NUZA 3JV3A 2KEAA 4HVUA 3VS0A 2DX1A 1RI9A 2X3XD 1B3QA 2ROLA 2JTEA 5GJVB 1NLOC 5I11A 2F2XA 2DBMA 3EGUA 3KFVA 4OMMA 3SHWA 1A0NB 2MIOA 2MCNA 1B07A 1AVZC 1HSQA 2D0NA 2V1RA 4OMOA 3LH5A 1M8MA 4IIMA 2H8HA 1JXOA 2JM9A 2O9SA 5IHKA 1UECA 3EG1A 4HVVA 4K11A 4LN2A 1JEGA 4J9HA 4JJCA 2RQVA 4J9IA 2HCKA 4CC3A 1PNJA 1SEMA 1GCQA 1V1CA 1KFZA 2BTTA 1GBQA 3NMZC 2L3SA 1QKXA 1ZSGA 1AWXA 3A98A 4FSSA 1QCFA 4X1VA 1J3TA 4F17A 2RQRA 2LNHB 4JZ3A 1VA7A 4J9BA 3THKA 1ZBJA 1GCPA 2YUNA 2DILA 2EGEA 2LZ6B 1SHGA 2GTJA 1GRIA 1ZX6A 2DVJA 3M0UA 3PE0A 1M3AA 2O88A 2DL7A 2CDTA 2JS0A 2KROA 3VRZA 3PVQA 2A28A 4RTTA 3M0RA 2DRMA 1WA7A 4AG1C 2J6OA 1NM7A 3PVLA 2ED0A 2YDLA 2J6FA 5IHNA 2K3BA 2D8JA 1U06A 2RNAA 2D1XA 1PKSA 2LJ0A 2DRKA 3M0TA 1TG0A 4GLMA 2A37A 4AFQC 1X6BA 2X3WD 3REBB 1EFNA 5GJWB 2QDLA 4OMPA 1MUZA 1ZLMA 2EQIA 3ZL7C 3UA7A 4JJDA 1WX6A 1M3BA 1AZGB 2SEMA 1QKWA 2JS2A 4JZ4A 3RNJA 2FPFA 1XOVA 2EKHA 2KRMA 1H8KA 4D8DA 1NYFA 2OAWA 3R6NA 2V1QA 3M0SA 1X2QA 4J9CA 3H41A 3GBQA 1KSWA 5ECAA 3EHQA
chains in the Genus database with same CATH superfamily
1WHHA 4HCKA 1VIFA 3QHSA 5IAYA 2EYQA 1R0BG 1VQOQ 4OVAA 1N6AA 1YJ9T 2QGGA 3QXEB 3CCQT 2GTOA 1UHFA 3OBYA 4M78E 3VRYA 2I2LA 1N8RR 4BDYA 3X24B 5IT9E 1M1KU 3HTRA 4D8KA 4Y91A 2O4XB 3INZA 3JB9F 2WSCE 2JMAA 4AFZC 2P4RA 4XK8E 5HCKA 4TVRA 1K9MR 4X9CA 1MV0B 2LCSA 3PT9A 4BI3A 3ER0A 4PJNA 2E64A 3NTHA 3C4SA 2COWA 2XD0A 2K2VA 1M3CA 1Z9QA 1MMDA 3EGDB 3CCEQ 4J7IA 1K73R 1W4SA 4LD9K 4CC4B 2DKGA 4A4GA 2LQWA 4A54A 4KRTA 1DJ7B 2LTOA 4JS5A 2W0ZA 4BE1A 2DERA 1OU8A 1RAIB 2QTVA 3LX7A 2X4JA 3JCMc 3JB9G 3H0IA 3CBMA 4QVCA 1VQ6Q 3TREA 2PZ1A 4M7DE 1BU1A 4FM4B 2AZSA 3GF5A 2CH4A 4XTYA 1HYOA 2BZ8A 5CKBA 1O75A 1PC0A 3CCJQ 2DBKA 5KYYA 1VQKQ 5GANh 2L3QA 3QYHB 5CKHA 2CUDA 5FW9A 1QCOA 4KH0B 1KIKA 1XJWB 4HVWA 3OYJA 1IREB 4DOVA 3PIOA 2QGFB 1AWWA 3I5RA 3M4GA 3V7CA 2OX7A 1U1SA 1WDXA 1YP5A 4M78F 1QWEA 5HKCA 2RH2A 2NUTB 5FWCA 3A8HB 3P8BB 3EAEA 1LCKA 1TUDA 3S3OA 2XHCA 4XTVA 4RTZA 2ZPGB 1PM3A 3BDLA 4FL6A 5J26A 2DMOA 4KGZB 2EQKA 4AG2C 4RTXA 4OB2B 1UUEA 1BK2A 2ROTA 3M0QA 3RMQA 4M7AB 2KVQG 1GFDA 3GNFB 2RI3A 4J9FA 2IPOB 4ATOA 3WXMB 4E6RA 4E7KA 4R0KA 1ABQA 3JB9J 2CZ0B 2E6ZA 3A8GB 3OYLA 1TH7A 3EHRA 4Z89A 1U1TA 3CC7T 4MZPA 3CMAT 2JMCA 4IIOA 2EPDA 2VXEA 4M7DF 1KD1C 2QASA 2MYSA 4O5VA 3EFOA 4EMHA 2FZGB 2EYXA 2FRWA 1FMWA 4C8QB 1H3ZA 2DL3A 1VQ4Q 5HK0A 2JM8A 2YRDA 4BE0A 5KYUA 2KT1A 3LWHA 2HD0A 3L2WA 3VS4A 1TOVA 2RI2A 1NJIR 3CEYA 4BE2A 1K8AU 3SD4A 4BB7A 1MMGA 2JJ9A 1D3BB 2KT8A 2KGTA 3G7ZA 3UA6A 1UGPB 5GAOq 5J39A 3E9FA 4PLLA 1W2BA 4ELZC 2X4YA 3ME9A 2BUDA 2LJ1A 3TCJA 4C92C 1AZEA 4ZNXA 1WHGA 2EW3A 4M7DG 5D6WA 4JJBA 3CCUQ 3S6WA 1ZA2B 2CT3A 4DA4A 5LJ5j 3NPFA 1IB8A 4UC4A 2RN8A 2EKOA 3RKYA 8AT1B 3FC3A 2ZCFB 1KJWA 1N5ZA 2J7IA 4ZGDB 1UJYA 2ECZA 2VWFA 1BCMA 1X6OA 4BUGA 2LJ3A 5LJ3f 4M77D 1YJWQ 4M75E 1Q95G 4OB0B 5GMKh 1JJ2S 4AFUC 4LE9A 2L8DA 2CP2A 4EMKC 1AOJA 5FU7B 1SG5A 1GCQC 3GNGA 4C92B 4GBQA 3QUIA 1YCYA 2X35A 4J6YA 3JCMg 1XQHA 4ELYC 4NL3A 2DTIA 4ESRA 4JS4A 3H8ZA 3L2ZA 4KGXB 2HMAA 3HRUA 4LUDA 1PKTA 1VQLQ 3UPUA 2FPDA 1SKUB 2RF0A 1WXUA 1VQ9Q 4FYVB 1I4K1 4FCYA 2QAZA 3CMEA 3BFMA 1K8AC 3OMCA 3E19A 4B6MA 2HKNA 4EMKB 5KE2A 1OEBA 1UGVA 3ZEHA 1RAGB 1I1JA 4BDZA 3H6ZA 3KBGA 2OJ2A 3HFOA 2A0FB 3I55A 5GAMg 2RD1A 2RHZA 2MK5A 3CCSA 2G6FX 2ZGWA 4JRPA 2DX1A 1M2OA 1B34B 1RI9A 2X3XD 5GAOr 1QVPA 2BE7D 4M7AD 2JZ2A 2JTEA 2QQAA 2ZPEB 1G3TA 4MMLA 5IN1A 4BY6B 4JDSA 1IHVA 1FMVA 3FRNA 2ZPHB 3L1AA 2MCNA 3A8OB 3FDRA 2V1RA 2VC8A 4JJNK 4OMOA 2DETA 3PTAA 2E1HA 2DIGA 2GFAA 2XI9A 2F5KA 4M75F 2OTLA 1JEGA 2V8IA 3L2VA 2P0QA 2RQVA 4J9IA 5DLQE 4C5EA 4C8QD 2L3SA 1QKXA 4J6WA 3A98A 1J3TA 1YJ9A 3JCMf 4F17A 3RESA 1WHKA 3QSUA 2LNHB 4ZGEB 3CCQA 1VA7A 5GANg 3PIPA 4OB3B 5LJ3d 2DILA 2EGEA 2LZ6B 2NUPB 5GAN7 3JCMV 2GTJA 1W2BS 3M0UA 1M3AA 2O88A 2DL7A 4GLKA 3QJ6A 3CC4T 2FVUA 3PVQA 2A28A 2O4XA 5A2QE 1OYXA 4XTWA 3M57A 3GP8A 2K3BA 1U06A 2D1XA 3I55Q 1KQ2A 3CCSQ 2RHUA 4AFQC 3OB9A 1X6BA 3REBB 2DJZA 1EFNA 3EGDA 5GJWB 3ZFJA 3QO3A 5GAMf 2L5QA 5J3BA 3V8KA 1ZLMA 2EQIA 2X51A 2DK3A 2RJFA 2MMPA 3BDUA 4JJDA 2YXYA 3RNJA 2SEMA 1QKWA 3X20B 3M55A 3RKXA 2FPFA 3V8LA 1H8KA 4D8DA 4M77A 3R6NA 2F69A 3H41A 3GBQA 1F1BB 1KSWA 4HKEA 4L5GA 4F7UE 2C0IA 1WQ7A 1Y7XA 4IURA 3M0PA 5GANe 3PMTA 4HCZA 4Y92A 4PJJA 1YHQA 2OTLQ 1G3YA 3R6OA 2B8AA 3RKWA 1LOJA 4M78C 1AT1B 2KRNA 1KD1R 4E2FB 5GMKi 3SWNC 2M1HA 1EZZB 1C0MA 3UT1A 1YJ9Q 3O5ZA 2E12A 1R0CB 3CCQQ 1BB9A 1VUBA 2JNGA 4NL2A 2YUOA 3L2UA 3MCAB 3SEMA 2NUTA 2ESWA 1Y07A 3EH1A 4DEYA 4J9DA 1OX8A 4M78B 2DE0X 2LQKA 2PQWA 2K5FA 3TVTA 3G71A 1D1CA 1I81A 4OB1B 3JCMd 3PNWC 3E9GA 3SWNB 1RLQC 2K9GA 4C92G 2PUOB 2RMOA 3MP6A 1QW1A 2FG0A 3CMET 1Q81U 4M7AA 1NLPC 3QIIA 3RDVA 4M7DC 1NPRA 2RQWA 5GAOl 1HK9A 3ZBDA 3G1JA 4OGEA 3C12A 2V8JA 4BD3A 2KMTA 1RAHB 2DXBA 3EG2A 3MP8A 2JW4A 3OYGA 1AEYA 2JVVA 3LLRA 5I22A 3CC7A 2Z0WA 1V29B 4C0GA 2FRYA 4MDWA 3LH0A 3GOXA 5FRMA 1U5SA 1M90C 2YRVA 3TEEA 4QVZA 1ZSZB 4F7UF 4PJOE 5GAMd 2FYKA 2CP7A 1K9AA 3HFNA 4C8QA 1UJ0A 3M54A 4AMCA 4M7DB 2EIFA 3IQLA 3TU4K 4JLGA 1QCNA 2KYBA 5GAN2 2O31A 1GBRA 2VB6A 2C06A 2JTFA 1W2BP 1K8AR 2XICA 1D3BA 1PG5B 2CH4W 4RCBA 2RJCA 4ANJA 1UGRB 2YRCA 5AYFA 4KGVB 3J81E 1X69A 3JB9D 2RO0A 3M4YA 4F7UG 3KUFA 1IHWA 1GL5A 2LVMA 2O01E 3EG9A 4DBRA 1Y71A 3LYIA 2EFIA 2RJDA 2ENMA 2FO0A 2I0NA 2IIMA 4KH1B 3QZ5B 1K4US 2AK5A 3CBOA 2HL3A 4DBHA 5GMKe 3GPLA 2CSQA 1WHJA 1YNZA 3EGXB 2V8KA 3CC2A 3M59A 4BI4A 2DXUA 2ZZDA 2KAFA 1PWTA 1QLYA 5GAN6 2ZPBB 4RG8A 3MHXA 5LJ5h 1OULA 4ZN3A 2ED1A 1PSEA 3CC7Q 2KSSA 2NWMA 2QK0A 3CCVT 3CMAQ 3C0CA 1VQ5A 4XTZA 3DLLA 2E70A 2SRCA 9ATCB 1VQPA 1SHFA 1WGSA 5LJ3j 1NBEB 5C0MA 1WJSA 2VYTA 4PJOF 4JPBW 2K7AA 1U3OA 1RLPC 1T0JA 4EMKA 2KY9A 1EX4A 5KCHA 2XU8A 3MKDA 4C5HA 5CK9A 1UG1A 3MEWA 4DBFA 4PNOA 5D6XA 1YHQT 4LNPA 2ABLA 3GIBA 2M16A 4RTYA 2EWNA 1OPKA 1ZUYA 1PRMC 3QG1A 3QWXX 3X26B 2PVDB 2YUPA 2XIDA 3DB3A 4OMFB 5KYWB 2EYZA 4A4FA 4F16A 2F2WA 1E7OA 2KYMA 1KQ1A 3VKIA 1G3SA 2CZ1B 3CPWA 3MJXA 5L8RE 2CKKA 1WHMA 2LQNA 1M1KC 2RJEA 4M75C 1VQ7A 4PJOG 1D09B 4KUIA 4II1A 1PRLC 2F5TX 2KR3A 1TS9A 2QI2A 4LDXA 1NG2A 2HQEA 2DFUA 3JB9I 2L0AA 3OYCA 1ZUUA 2YUQA 3I56A 2QQ9A 3DKMA 4CC2A 4VUBA 1VYVA 3BE3A 2VGNA 2EJ9A 3G71T 2X9HA 5GAOm 4E7SA 1AWOA 1KG1A 4AFSC 5DLOA 4F04B 4ORZA 4M75B 3NHNA 2QQSA 4M7DD 4ZTJA 2DTOA 2CP3A 1WJRA 2XKOC 4M78G 2QXFA 4CC7A 2LCLA 4C0DC 4BACA 1M4ZA 4FT2A 1X27A 2X4WA 4OMLA 1Q82U 1BI1A 1SSHA 3CC4A 2WACA 2DPPB 4E47A 5KYXB 4ZTFA 3RUXA 4C5IA 1AD5A 2H3JA 4HCCA 1UE9A 1EIFA 2YT6A 3QJYA 3CXCA 2K5IA 2NUZA 1KK7A 3FIFA 3VS0A 3LGLA 1B3QA 2CGHA 2ROLA 4EPCA 1RABB 5CKFA 4LXCA 3OS5A 4M77E 3VYGA 4IUUA 5I11A 2F2XA 1Y96B 4OMMA 2AHJB 3EGUA 3E2UA 3KFVA 1KC8U 3G6ET 1IGQA 3SHWA 2MIOA 1RACB 4A4HA 1B07A 1AVZC 1M5Q1 2PVGB 4OGCA 4C0DB 5CQXA 1KQSA 3LH5A 4E7IA 4IIMA 2H8HA 4HVVA 1I8FA 4K11A 4LN2A 4J9HA 4JJCA 5CKDA 4CC3A 1OQKA 1KFZA 1G5VA 3OSSC 3OS2A 2QA4A 2M9UA 5GAMj 4JZ3A 3CCLA 1GCPA 2YUNA 2VGMA 1PSFA 1RAAB 2IVWA 1M90R 1M1FA 5CIUA 1GRIA 1ZX6A 3PE0A 3RERA 5I2SA 1TSFA 1KHCA 2E10A 2JS0A 1RADB 1ZHIA 2KROA 2RK1A 3VRZA 4RTTA 3G4SA 3CC2T 1WA7A 1RL2A 4AG1C 2DZCA 1N8RU 5KYNA 3F70A 2ED0A 2YDLA 3FEOA 4ZN1A 2E5QA 4XQ3A 3CC4Q 1LPLA 1PKSA 3CPWS 4M7AE 2MF2A 2A37A 2X3WD 1VQ5T 1TTHB 2P0PA 3MEAA 4E7LA 1MUZA 4JRIA 1VQPT 3QDRB 1OZ3A 3ZL7C 3UA7A 3VUBA 5I2MA 5FLXE 2HSEB 2GQVA 3SWNA 4JZ4A 1K73U 1XOVA 2KRMA 2OAWA 3V7RA 2V1QA 4CI0C 3M0SA 4M77F 4C5GA 5D6YA 3EFSA 3L2RA 1C6VX 3URGA 3EHQA 1AWJA 4J9GA 4DOWA 3L2QA 1BKBA 1OOTA 2MPXC 4C8QE 5GMKl 1VQ8T 2OAUA 2EGCA 5CO7A 2KNBB 4XU1A 3M58A 2M51A 2LCCA 4IUQA 2A08A 2KRSA 8ATCB 2DAQA 1ZSZA 3CCMA 2K2MA 1VQ7T 3C94A 1IGUA 1I07A 1M9SA 1B7TA 4B9WA 2KXDA 2DXCA 4Z88A 3P8DA 4M7DA 4F7UB 2QEXT 1Z9ZA 2C0OA 2M0OA 3I56T 2W10A 1SRMA 4MMKA 3VUZA 2P0KA 4XU2A 3JCMP 2FPEA 2DL5A 1K0SA 1RUWA 1XNIA 4V2SA 1WLPB 1YJNT 4FW1A 3OW2A 4DBQA 2RHIA 4HCBA 2HQXA 3OYHA 2LDMA 4HA8A 4M7AF 4O6JA 5A0GA 1BI3A 2FB7A 2JT4A 3S3MA 2E65A 3HRTA 2EGAA 2XDDA 2LT4A 4PK4A 1ZQ1A 3QZ9B 1YBYA 2EQUA 2XDBA 1M1KR 3CMEQ 1WQWA 1QQJA 1ZA1B 1I0CA 2GCXA 3QPHA 3EG0A 2K79A 3EGXA 1MGQA 3VS6A 1SRLA 4M75G 1Q7YU 3CPFA 5LJ5e 1OZ2A 4PJOC 1ABOA 1NYGA 2C0TA 2MI6A 2LMJA 2P84A 3OYAA 4C8QF 1UHCA 3OSVA 3CCVA 1G8XA 1ARKA 4EMGA 4A4KA 1VQNT 2K3XA 1KHIA 4BI8B 1TXQA 2GF7A 1BBZA 2DTHA 2RK2A 1H92A 3M53A 2EYWA 1TUGB 3VS5A 2PNIA 3VS7A 2RB6A 4A4EA 1UTIA 2OI3A 5KYUB 4LD6A 5D7UA 4RMOA 2NLUA 2DA9A 2OTJA 1QMCA 2DF6A 2IG0A 4C92D 1YI2T 5LL6S 4PJLA 2HL5C 1QP2A 3HSBA 4PJOB 3I35A 2QA4T 1M27C 3META 1WPYA 4Y28E 3LW5E 3OYMA 4FYXB 3CCLT 1WYXA 3CPWP 2EQMA 1G2BA 3UF4A 4JRQA 5LJ3h 1LNXA 1VOMA 2DL8A 5KYWA 2GGRA 3CD6A 3OYYA 3CCRT 1SF9A 2BZXA 2LC4A 1PCXA 3G4ST 4IKFA 3I5SA 2L2PA 4LDYA 2KE9A 5GANf 1YITA 2DL4A 2CSIA 1TWBA 1OV3A 1Y0MA 5HK3A 3GLXA 4FSXA 4MZMA 5M9OA 1T0HA 2ZPIB 2V26A 2AT1B 2HDAA 1WZOA 4LUEA 2CZ6B 2EJFA 3KXTA 2A3LA 1FYNA 1YWPA 1IZ6A 3CCVQ 2LNVA 5CVIA 1VQOA 5GAOn 2JUFA 5EG2A 2E6NA 2GFUA 5GMKm 1TU0B 4E7HA 2QDYB 1S1NA 5A0DA 5IXBA 4X34A 3E1SA 1JRIA 4HT9A 1SSFA 1HJDA 2X4XA 2DZ9A 2DEQA 1HXDA 1M1GA 3M5AA 3CXCP 3OW2S 4A63B 5KYXA 1YFNA 2RPNA 3H0FA 1OPLA 1NEBA 2XMFA 2VUBA 1K1ZA 2DYBA 1YHQQ 3EG3A 2K57A 1QVGA 2JOYA 5C6SA 2YHTA 2RHYA 3CCMT 3MO8A 1BYMA 3VS3A 3NFCA 3HP9A 5CR2A 2HQHA 2E5KA 2QYZA 4J5YA 3JAME 2J06A 3G6EA 1Y96A 4QQ6A 1ZBXA 4WCIA 5L23A 4L6V5 1KQSP 2F1LA 2FEIA 2O9VA 2YSQA 1OX9A 2O2OA 2K4YA 1JU5C 2PU9B 5FWBA 4M4ZA 1TUCA 2Y4XA 1X2KA 3AHUA 3VYHB 1XTDA 1T3SA 5KH6A 3JCMh 1FWZA 4N4HA 1JBMA 2JXBA 5EC7A 1MV3A 4FYYB 1JXMA 4JUVA 4QT7A 3G71Q 4HT8A 1X43A 2FZKB 1Q81C 2D0QB 2VVKA 2A36A 3QKJA 2YLCA 4J83A 1YWOA 3U23A 2HNIA 5GANd 1MHNA 3C95A 1MMNA 2RM4A 1MNEA 5DM7R 2KI7A 3RIRA 5GAN3 4QQGA 4C92A 4PJOD 4RG2A 5GAMh 3VV0A 4M77C 1S72T 2DBMA 4J7FA 4MDXA 2CP5A 3OS1A 2QG9B 2XK0A 3N5BB 1A0NB 4RKUE 2D0NA 4N0AC 3OMGA 4FIBA 1JXOA 2JM9A 2O9SA 3M9QA 2DXTA 1YIJT 3WVEB 1D1BA 3G6EQ 4QQDA 2OTJT 2JTMA 1PNJA 1SEMA 4NOYA 3TQ7P 1GCQA 5GAOp 5FRNA 3M56A 4ME7A 1VIEA 2BTTA 4OP0A 2XG8D 3NMZC 3HKSA 4FSSA 1QCFA 4DQ2A 4M77B 4IUVA 2RQRA 1VQ8A 4M78D 1ZBJA 3LGFA 3JCMQ 3OYBA 1PD1A 3CD6T 1B34A 1JJ2A 1NZ9A 4Q5WA 2R58A 4PFZA 2DYIA 1VQ4A 1KD1U 2A7YA 1YITT 1NM7A 2QQRA 2EAYA 2QEXA 4F7UA 2D8JA 2DO3A 2VXFA 1UGSB 2LJ0A 2COYA 1MMAA 2DRKA 3FB9A 3CC2Q 7AT1B 1QVGS 4M7AC 3OYKA 3Q1JA 4GLMA 2HBPA 2JN0A 5CQYA 1VQMT 2QDLA 4OMPA 3V8JA 1V76A 3OW2P 1FX7A 4MZTA 3RMSA 3A5ZB 1WX6A 1M3BA 1YJNA 1D1AA 4LDVA 2MWOA 2FHDA 3CCUA 5FU6C 2EKHA 4PKCC 4JRKA 1VQOT 1VQ5Q 1X2QA 1VQPQ 4J9CA 2LT1A 3LWIA 1LVKA 5FROA 1GXIE 2KK4A 2QTXA 2NUPA 5LJ3g 2EBPA 4OMNA 4QW2A 1M2VB 1X01A 4KBMB 4C8QC 2XDPA 1UFFA 1M30A 2DVEA 4WF2A 1YJWA 2E41A 1Q7YR 1Q86U 3MEUA 3MPUB 5I21A 3AT1B 5A0LA 2GBQA 2CUBA 4ZGJB 1VQ8Q 2K3YA 5FU6B 1BIBA 3UDCA 3BY7A 3CCET 1WXBA 1VQNA 3HL8A 1BI2A 3NGPA 2E3HA 3FJ5A 1VQLA 4Z8AA 3REAB 1WXTA 1NE8A 2D9TA 3CQTA 1VQ7Q 3OA6A 4FYWB 2LRQA 2L3PA 1R77A 1CKAA 1VQ9A 3TSZA 1O9SA 5IH2A 1IXDA 1WI7A 1YI2A 1VQ6T 5CCAA 2QEXQ 1W6XA 3I56Q 4N4IA 1QVFA 4YTLA 2LP5A 1E6GA 2LX7A 3BW1A 4PJOA 1D0XA 4FU6A 4A53A 1H3HA 4RTWA 1W1FA 3OYFA 3CCJT 4E7ZA 4RCCA 1VQKT 5LJ3e 1ZUKA 4HXJA 3H0HA 1BI0A 3RBBB 3PFSA 5FU7C 3UWNA 4F14A 1UB4A 1E6HA 4FT4A 2LQ8A 1YJNQ 4PLIA 3CCRA 2HKQB 3FLGA 1YCSB 3EG9B 1YN8A 2EQJA 4GY5A 4J9EA 4XU0A 3I9QA 3NTIA 1Q82C 4OMQA 1HD3A 2RQTA 2HEQA 1SPKA 2KDSA 2DEUA 1UDLA 3VS2A 2AKLA 3HRSA 4QKUA 3J7AF 4NS5A 1Q86C 1JQQA 3VS1A 2CZ7B 4PFPA 2K6DA 3X25B 1T3LA 3PGGA 1K9MU 4X9DA 2D6FA 2AZVA 4M78A 2YWWA 2DLPA 2EVRA 1KC8C 1RAEB 4L59A 1ACMB 3OYEA 4C0FA 1VQNQ 2J05A 3FJPA 1Q81R 5GANj 3MP1A 3ULRB 1JO8A 3T9NA 1K0XA 4LDUA 3EFRA 2BIVA 4RUGA 2ZAEA 5HY6A 2AIRB 1H641 2CREA 1GFCA 3JB9H 3S3NA 4IUPA 2GNCA 3QWYA 1YI2Q 1X75C 2B86A 5IXFA 4BY6C 2KXCA 1QVGP 3VJPA 2KQWA 2DM1A 4LDWA 2VKNA 3JRZA 4RTVA 2QA4Q 5KCOA 5KYYB 2GQIA 2E3IA 4M75D 4IUTA 3NTKA 4FW2A 5LJ5g 3CCLQ 4C0ZA 3OBWA 1UEBA 1VQ4T 2AKKA 3UATA 4M77G 2D8HA 2BZYA 1PHTA 1BCOA 3CCRQ 3ASKA 1D0ZA 1AHJB 1N8RC 2PUKB 2R57A 4J8OA 5AT1B 3CXCS 1RAFB 3G4SQ 2BE9B 1WFWA 1RI0A 3JCMe 2PTKA 3X28B 2KBTA 1VYUA 1Y57A 3L42A 4JLIA 3H9NA 1K9MC 2YLBA 1M8VA 4PJMA 2DJQA 4QVDA 2RHXA 2CP0A 1I5OB 3CCUT 2DD5A 1KQSS 1CSKA 3SB2A 1I5LA 1K73C 1P92A 5GAN8 3DLMA 1R8OB 1X6GA 3MEVA 4C92E 1IO6A 1CKBA 3WVDB 4KUDK 1WNLA 1C1AA 2M0YA 1QVFS 2ZPFB 2LX9A 1W70A 2CT4A 3OYIA 1YJWT 1VYTA 4XU3A 1K76A 4J6XA 2CP6A 1FMKA 4XTXA 5GAMe 1MNDA 3CBPA 2HSPA 1S72A 2K5LA 4M7AG 2M02A 3OS0A 4RTUA 4R55A 3EFOB 2DIQA 1VQLT 4R56A 2HZYA 3CCMQ 1WIEA 2COZA 3O8VA 2HAXA 2EJGA 5CAIA 3PMIA 2RQUA 2HBWA 3HPWA 3VU3C 1VQ9T 1YIJA 1G83A 2MOXA 1NPPA 5LJ5f 5GAN5 2J6KA 1NJIU 4EIKA 4DEXA 1NEGA 1D0YA 3JCMb 3P8HA 4B9XA 5CKEA 4C8QG 3OY9A 1QWFA 2EYYA 1BIAA 2NYSA 5GMKj 3HHTB 1JJ2P 2PVOB 5IHIA 3SDZA 2VV5A 4N0AA 2H3EB 1WHLA 5GAN4 2F2VA 3TSWA 2DNUA 2WSFE 1IRXA 1M90U 2WSEE 4E7JA 3JV3A 1Q7YC 2KEAA 4HVUA 1N9SA 3EH2A 4C92F 5DY9A 3SFMA 4CRIA 5GJVB 4Z02A 3JCMW 1NLOC 2Y4YA 3OQ5A 1FXXA 4PL6A 1VQMA 3JSCA 1HSQA 3V7SA 1N9RA 1UGQB 1M8MA 1S72Q 1JB0E 4XAXB 5IHKA 1UECA 3QYGB 4M75A 1U8RA 3EG1A 4PFOA 4N4GA 1N27A 2L89A 2HCKA 1V1CA 2E4HA 2FZCB 4OF1A 1GBQA 1ZSZC 4P5NA 1NJIC 1ZSGA 1AWXA 4KULA 1YIJQ 4X1VA 4KT0E 2RI5A 1PD0A 3A1PA 1Q82R 2OTJQ 1M2VA 4WTOB 1QP3A 2CS7A 2G3RA 2BKDN 2FL7A 4J9BA 3THKA 2R5MA 1SHGA 2DVJA 1Q86R 4D6WA 2CDTA 3A8LB 2CYZB 3I55T 2P4TA 3M0RA 2ATCB 3CCST 2MAMA 2DRMA 2QQBA 3CCEA 3CMAA 2J6OA 3CD6Q 1KC8R 3J80E 3PVLA 2MWPA 2RA2A 2J6FA 5IHNA 5KE3A 4EDUA 3QBYA 4XTUA 5LJ5d 3RR6A 4AT1B 2RNAA 2VASA 3OYNA 1OU9A 3JCMX 3M0TA 1TG0A 1QVFP 6AT1B 1YITQ 3D7SB 2R5AA 1VQ6A 3QDFA 3JCMJ 3OYDA 1OI1A 2L3RA 1AZGB 1G3WA 2JS2A 3CCJA 2DD4A 1WJQA 3DB4A 1VQKA 1NYFA 1VQMQ 2OTLT 1LJOA 3A8MB 2Y90A 5ECAA
chains in the Genus database with same CATH topology
1AWJA 2C0IA 4HCKA 4J9GA 2EBPA 3M0PA 4OMNA 1OOTA 4Y92A 1UFFA 1M30A 2EGCA 2GTOA 1UHFA 2KNBB 2KRNA 3VRYA 2M51A 2A08A 4D8KA 2KRSA 3O5ZA 2GBQA 2CUBA 2K2MA 2JMAA 1BB9A 4AFZC 2P4RA 1I07A 5HCKA 1WXBA 2KXDA 3NGPA 1MV0B 4Z88A 2LCSA 2YUOA 3FJ5A 4Z8AA 1Z9ZA 2C0OA 3REAB 1WXTA 3SEMA 2W10A 3CQTA 2ESWA 1SRMA 1M3CA 1Z9QA 2L3PA 4DEYA 1CKAA 3TSZA 4J9DA 2FPEA 5IH2A 4CC4B 2DE0X 1WI7A 2DL5A 3TVTA 2LQWA 1K0SA 1W6XA 4KRTA 1RUWA 2W0ZA 1RLQC 2K9GA 2LP5A 1WLPB 1E6GA 2LX7A 2RMOA 1H3HA 4RTWA 1W1FA 3H0IA 2FG0A 1NLPC 2PZ1A 1ZUKA 4HXJA 1BU1A 3H0HA 2RQWA 2JT4A 3RBBB 4F14A 1E6HA 2AZSA 2EGAA 2CH4A 2BZ8A 3EG2A 1YCSB 2JW4A 1YN8A 2DBKA 1AEYA 1I0CA 4J9EA 3EG0A 5I22A 2K79A 2L3QA 3I9QA 4OMQA 3VS6A 2CUDA 1SRLA 1HD3A 2RQTA 5FW9A 2HEQA 1SPKA 2FRYA 1KIKA 1UDLA 3VS2A 2AKLA 4HVWA 1U5SA 1ABOA 1NYGA 1JQQA 2C0TA 2LMJA 1K9AA 3VS1A 1AWWA 3I5RA 2K6DA 1UJ0A 1T3LA 1UHCA 1ARKA 2AZVA 1WDXA 1YP5A 2DLPA 1QWEA 2EVRA 3IQLA 1BBZA 5FWCA 1H92A 2KYBA 2O31A 1LCKA 2EYWA 1GBRA 1TUDA 3VS5A 2PNIA 3VS7A 4RTZA 1UTIA 2OI3A 2J05A 2CH4W 2DA9A 3ULRB 2DMOA 2DF6A 1JO8A 1K0XA 1X69A 4RUGA 4AG2C 2CREA 4RTXA 3I35A 1UUEA 1BK2A 2ROTA 3M0QA 1M27C 1GL5A 1GFCA 1GFDA 2GNCA 3QWYA 1WYXA 4J9FA 2B86A 5IXFA 2KXCA 1G2BA 3UF4A 4E6RA 2ENMA 2FO0A 2DM1A 2I0NA 2DL8A 2VKNA 4RTVA 2GGRA 2IIMA 1K4US 2AK5A 4R0KA 1ABQA 2GQIA 2CSQA 2BZXA 1YNZA 3EHRA 4Z89A 2AKKA 3I5SA 3UATA 2JMCA 2L2PA 4IIOA 2EPDA 2KE9A 2D8HA 2BZYA 1PHTA 2DL4A 1PWTA 1QLYA 2CSIA 2EYXA 2FRWA 1OV3A 1Y0MA 2DL3A 2ED1A 2NWMA 1T0HA 2JM8A 1WFWA 3C0CA 2KT1A 2SRCA 2PTKA 2KBTA 2HDAA 1VYUA 1Y57A 4LUEA 1SHFA 3VS4A 2DJQA 1FYNA 1YWPA 2KT8A 1CSKA 2KGTA 4JPBW 3UA6A 2K7AA 1U3OA 1RLPC 1T0JA 2LJ1A 1S1NA 1X6GA 5IXBA 1AZEA 1IO6A 4ZNXA 2EW3A 1CKBA 4JJBA 1UG1A 2M0YA 4LNPA 2ABLA 4RTYA 1OPKA 2CT3A 1HJDA 1ZUYA 1PRMC 3NPFA 1W70A 2CT4A 4A63B 2RN8A 3QWXX 2YUPA 1VYTA 2RPNA 3H0FA 2EYZA 1OPLA 1KJWA 1N5ZA 1K76A 1NEBA 2XMFA 2J7IA 4F16A 2F2WA 1E7OA 2KYMA 1FMKA 1K1ZA 1UJYA 2DYBA 2ECZA 3EG3A 2VWFA 2LJ3A 2LQNA 2HSPA 3VS3A 4AFUC 4LE9A 2E5KA 1PRLC 1AOJA 2J06A 2KR3A 5L23A 4WCIA 4RTUA 1GCQC 1NG2A 4GBQA 2FEIA 2L0AA 2O9VA 1WIEA 1ZUUA 2YSQA 2YUQA 2O2OA 4CC2A 4ESRA 2RQUA 1VYVA 1JU5C 2HBWA 5FWBA 4M4ZA 1TUCA 1G83A 1X2KA 2MOXA 4LUDA 1PKTA 2J6KA 1T3SA 4EIKA 2FPDA 2JXBA 4DEXA 1AWOA 2RF0A 5EC7A 4AFSC 1WXUA 1NEGA 4ORZA 1MV3A 1JXMA 3NHNA 4QT7A 1QWFA 1X43A 2EYYA 2VVKA 2A36A 1OEBA 1UGVA 1I1JA 4CC7A 5IHIA 1YWOA 3U23A 1X27A 4OMLA 2OJ2A 1SSHA 2F2VA 3TSWA 2DNUA 1AD5A 2G6FX 1UE9A 2YT6A 2NUZA 3JV3A 2KEAA 4HVUA 3VS0A 2DX1A 1RI9A 2X3XD 1B3QA 2ROLA 2JTEA 5GJVB 1NLOC 5I11A 2F2XA 2DBMA 3EGUA 3KFVA 4OMMA 3SHWA 1A0NB 2MIOA 2MCNA 1B07A 1AVZC 1HSQA 2D0NA 2V1RA 4OMOA 3LH5A 1M8MA 4IIMA 2H8HA 1JXOA 2JM9A 2O9SA 5IHKA 1UECA 3EG1A 4HVVA 4K11A 4LN2A 1JEGA 4J9HA 4JJCA 2RQVA 4J9IA 2HCKA 4CC3A 1PNJA 1SEMA 1GCQA 1V1CA 1KFZA 2BTTA 1GBQA 3NMZC 2L3SA 1QKXA 1ZSGA 1AWXA 3A98A 4FSSA 1QCFA 4X1VA 1J3TA 4F17A 2RQRA 2LNHB 4JZ3A 1VA7A 4J9BA 3THKA 1ZBJA 1GCPA 2YUNA 2DILA 2EGEA 2LZ6B 1SHGA 2GTJA 1GRIA 1ZX6A 2DVJA 3M0UA 3PE0A 1M3AA 2O88A 2DL7A 2CDTA 2JS0A 2KROA 3VRZA 3PVQA 2A28A 4RTTA 3M0RA 2DRMA 1WA7A 4AG1C 2J6OA 1NM7A 3PVLA 2ED0A 2YDLA 2J6FA 5IHNA 2K3BA 2D8JA 1U06A 2RNAA 2D1XA 1PKSA 2LJ0A 2DRKA 3M0TA 1TG0A 4GLMA 2A37A 4AFQC 1X6BA 2X3WD 3REBB 1EFNA 5GJWB 2QDLA 4OMPA 1MUZA 1ZLMA 2EQIA 3ZL7C 3UA7A 4JJDA 1WX6A 1M3BA 1AZGB 2SEMA 1QKWA 2JS2A 4JZ4A 3RNJA 2FPFA 1XOVA 2EKHA 2KRMA 1H8KA 4D8DA 1NYFA 2OAWA 3R6NA 2V1QA 3M0SA 1X2QA 4J9CA 3H41A 3GBQA 1KSWA 5ECAA 3EHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AWJ A;  2C0I A;  4HCK A;  4J9G A;  2EBP A;  3M0P A;  4OMN A;  1OOT A;  4Y92 A;  1UFF A;  1M30 A;  2EGC A;  2GTO A;  1UHF A;  2KNB B;  2KRN A;  3VRY A;  2M51 A;  2A08 A;  4D8K A;  2KRS A;  3O5Z A;  2GBQ A;  2CUB A;  2K2M A;  2JMA A;  1BB9 A;  4AFZ C;  2P4R A;  1I07 A;  5HCK A;  1WXB A;  2KXD A;  3NGP A;  1MV0 B;  4Z88 A;  2LCS A;  2YUO A;  3FJ5 A;  4Z8A A;  1Z9Z A;  2C0O A;  3REA B;  1WXT A;  3SEM A;  2W10 A;  3CQT A;  2ESW A;  1SRM A;  1M3C A;  1Z9Q A;  2L3P A;  4DEY A;  1CKA A;  3TSZ A;  4J9D A;  2FPE A;  5IH2 A;  4CC4 B;  2DE0 X;  1WI7 A;  2DL5 A;  3TVT A;  2LQW A;  1K0S A;  1W6X A;  4KRT A;  1RUW A;  2W0Z A;  1RLQ C;  2K9G A;  2LP5 A;  1WLP B;  1E6G A;  2LX7 A;  2RMO A;  1H3H A;  4RTW A;  1W1F A;  3H0I A;  2FG0 A;  1NLP C;  2PZ1 A;  1ZUK A;  4HXJ A;  1BU1 A;  3H0H A;  2RQW A;  2JT4 A;  3RBB B;  4F14 A;  1E6H A;  2AZS A;  2EGA A;  2CH4 A;  2BZ8 A;  3EG2 A;  1YCS B;  2JW4 A;  1YN8 A;  2DBK A;  1AEY A;  1I0C A;  4J9E A;  3EG0 A;  5I22 A;  2K79 A;  2L3Q A;  3I9Q A;  4OMQ A;  3VS6 A;  2CUD A;  1SRL A;  1HD3 A;  2RQT A;  5FW9 A;  2HEQ A;  1SPK A;  2FRY A;  1KIK A;  1UDL A;  3VS2 A;  2AKL A;  4HVW A;  1U5S A;  1ABO A;  1NYG A;  1JQQ A;  2C0T A;  2LMJ A;  1K9A A;  3VS1 A;  1AWW A;  3I5R A;  2K6D A;  1UJ0 A;  1T3L A;  1UHC A;  1ARK A;  2AZV A;  1WDX A;  1YP5 A;  2DLP A;  1QWE A;  2EVR A;  3IQL A;  1BBZ A;  5FWC A;  1H92 A;  2KYB A;  2O31 A;  1LCK A;  2EYW A;  1GBR A;  1TUD A;  3VS5 A;  2PNI A;  3VS7 A;  4RTZ A;  1UTI A;  2OI3 A;  2J05 A;  2CH4 W;  2DA9 A;  3ULR B;  2DMO A;  2DF6 A;  1JO8 A;  1K0X A;  1X69 A;  4RUG A;  4AG2 C;  2CRE A;  4RTX A;  3I35 A;  1UUE A;  1BK2 A;  2ROT A;  3M0Q A;  1M27 C;  1GL5 A;  1GFC A;  1GFD A;  2GNC A;  3QWY A;  1WYX A;  4J9F A;  2B86 A;  5IXF A;  2KXC A;  1G2B A;  3UF4 A;  4E6R A;  2ENM A;  2FO0 A;  2DM1 A;  2I0N A;  2DL8 A;  2VKN A;  4RTV A;  2GGR A;  2IIM A;  1K4U S;  2AK5 A;  4R0K A;  1ABQ A;  2GQI A;  2CSQ A;  2BZX A;  1YNZ A;  3EHR A;  4Z89 A;  2AKK A;  3I5S A;  3UAT A;  2JMC A;  2L2P A;  4IIO A;  2EPD A;  2KE9 A;  2D8H A;  2BZY A;  1PHT A;  2DL4 A;  1PWT A;  1QLY A;  2CSI A;  2EYX A;  2FRW A;  1OV3 A;  1Y0M A;  2DL3 A;  2ED1 A;  2NWM A;  1T0H A;  2JM8 A;  1WFW A;  3C0C A;  2KT1 A;  2SRC A;  2PTK A;  2KBT A;  2HDA A;  1VYU A;  1Y57 A;  4LUE A;  1SHF A;  3VS4 A;  2DJQ A;  1FYN A;  1YWP A;  2KT8 A;  1CSK A;  2KGT A;  4JPB W;  3UA6 A;  2K7A A;  1U3O A;  1RLP C;  1T0J A;  2LJ1 A;  1S1N A;  1X6G A;  5IXB A;  1AZE A;  1IO6 A;  4ZNX A;  2EW3 A;  1CKB A;  4JJB A;  1UG1 A;  2M0Y A;  4LNP A;  2ABL A;  4RTY A;  1OPK A;  2CT3 A;  1HJD A;  1ZUY A;  1PRM C;  3NPF A;  1W70 A;  2CT4 A;  4A63 B;  2RN8 A;  3QWX X;  2YUP A;  1VYT A;  2RPN A;  3H0F A;  2EYZ A;  1OPL A;  1KJW A;  1N5Z A;  1K76 A;  1NEB A;  2XMF A;  2J7I A;  4F16 A;  2F2W A;  1E7O A;  2KYM A;  1FMK A;  1K1Z A;  1UJY A;  2DYB A;  2ECZ A;  3EG3 A;  2VWF A;  2LJ3 A;  2LQN A;  2HSP A;  3VS3 A;  4AFU C;  4LE9 A;  2E5K A;  1PRL C;  1AOJ A;  2J06 A;  2KR3 A;  5L23 A;  4WCI A;  4RTU A;  1GCQ C;  1NG2 A;  4GBQ A;  2FEI A;  2L0A A;  2O9V A;  1WIE A;  1ZUU A;  2YSQ A;  2YUQ A;  2O2O A;  4CC2 A;  4ESR A;  2RQU A;  1VYV A;  1JU5 C;  2HBW A;  5FWB A;  4M4Z A;  1TUC A;  1G83 A;  1X2K A;  2MOX A;  4LUD A;  1PKT A;  2J6K A;  1T3S A;  4EIK A;  2FPD A;  2JXB A;  4DEX A;  1AWO A;  2RF0 A;  5EC7 A;  4AFS C;  1WXU A;  1NEG A;  4ORZ A;  1MV3 A;  1JXM A;  3NHN A;  4QT7 A;  1QWF A;  1X43 A;  2EYY A;  2VVK A;  2A36 A;  1OEB A;  1UGV A;  1I1J A;  4CC7 A;  5IHI A;  1YWO A;  3U23 A;  1X27 A;  4OML A;  2OJ2 A;  1SSH A;  2F2V A;  3TSW A;  2DNU A;  1AD5 A;  2G6F X;  1UE9 A;  2YT6 A;  2NUZ A;  3JV3 A;  2KEA A;  4HVU A;  3VS0 A;  2DX1 A;  1RI9 A;  2X3X D;  1B3Q A;  2ROL A;  2JTE A;  5GJV B;  1NLO C;  5I11 A;  2F2X A;  2DBM A;  3EGU A;  3KFV A;  4OMM A;  3SHW A;  1A0N B;  2MIO A;  2MCN A;  1B07 A;  1AVZ C;  1HSQ A;  2D0N A;  2V1R A;  4OMO A;  3LH5 A;  1M8M A;  4IIM A;  2H8H A;  1JXO A;  2JM9 A;  2O9S A;  5IHK A;  1UEC A;  3EG1 A;  4HVV A;  4K11 A;  4LN2 A;  1JEG A;  4J9H A;  4JJC A;  2RQV A;  4J9I A;  2HCK A;  4CC3 A;  1PNJ A;  1SEM A;  1GCQ A;  1V1C A;  1KFZ A;  2BTT A;  1GBQ A;  3NMZ C;  2L3S A;  1QKX A;  1ZSG A;  1AWX A;  3A98 A;  4FSS A;  1QCF A;  4X1V A;  1J3T A;  4F17 A;  2RQR A;  2LNH B;  4JZ3 A;  1VA7 A;  4J9B A;  3THK A;  1ZBJ A;  1GCP A;  2YUN A;  2DIL A;  2EGE A;  2LZ6 B;  1SHG A;  2GTJ A;  1GRI A;  1ZX6 A;  2DVJ A;  3M0U A;  3PE0 A;  1M3A A;  2O88 A;  2DL7 A;  2CDT A;  2JS0 A;  2KRO A;  3VRZ A;  3PVQ A;  2A28 A;  4RTT A;  3M0R A;  2DRM A;  1WA7 A;  4AG1 C;  2J6O A;  1NM7 A;  3PVL A;  2ED0 A;  2YDL A;  2J6F A;  5IHN A;  2K3B A;  2D8J A;  1U06 A;  2RNA A;  2D1X A;  1PKS A;  2LJ0 A;  2DRK A;  3M0T A;  1TG0 A;  4GLM A;  2A37 A;  4AFQ C;  1X6B A;  2X3W D;  3REB B;  1EFN A;  5GJW B;  2QDL A;  4OMP A;  1MUZ A;  1ZLM A;  2EQI A;  3ZL7 C;  3UA7 A;  4JJD A;  1WX6 A;  1M3B A;  1AZG B;  2SEM A;  1QKW A;  2JS2 A;  4JZ4 A;  3RNJ A;  2FPF A;  1XOV A;  2EKH A;  2KRM A;  1H8K A;  4D8D A;  1NYF A;  2OAW A;  3R6N A;  2V1Q A;  3M0S A;  1X2Q A;  4J9C A;  3H41 A;  3GBQ A;  1KSW A;  5ECA A;  3EHQ A; 
#chains in the Genus database with same CATH topology
 1WHH A;  4HCK A;  1VIF A;  3QHS A;  5IAY A;  2EYQ A;  1R0B G;  1VQO Q;  4OVA A;  1N6A A;  1YJ9 T;  2QGG A;  3QXE B;  3CCQ T;  2GTO A;  1UHF A;  3OBY A;  4M78 E;  3VRY A;  2I2L A;  1N8R R;  4BDY A;  3X24 B;  5IT9 E;  1M1K U;  3HTR A;  4D8K A;  4Y91 A;  2O4X B;  3INZ A;  3JB9 F;  2WSC E;  2JMA A;  4AFZ C;  2P4R A;  4XK8 E;  5HCK A;  4TVR A;  1K9M R;  4X9C A;  1MV0 B;  2LCS A;  3PT9 A;  4BI3 A;  3ER0 A;  4PJN A;  2E64 A;  3NTH A;  3C4S A;  2COW A;  2XD0 A;  2K2V A;  1M3C A;  1Z9Q A;  1MMD A;  3EGD B;  3CCE Q;  4J7I A;  1K73 R;  1W4S A;  4LD9 K;  4CC4 B;  2DKG A;  4A4G A;  2LQW A;  4A54 A;  4KRT A;  1DJ7 B;  2LTO A;  4JS5 A;  2W0Z A;  4BE1 A;  2DER A;  1OU8 A;  1RAI B;  2QTV A;  3LX7 A;  2X4J A;  3JCM c;  3JB9 G;  3H0I A;  3CBM A;  4QVC A;  1VQ6 Q;  3TRE A;  2PZ1 A;  4M7D E;  1BU1 A;  4FM4 B;  2AZS A;  3GF5 A;  2CH4 A;  4XTY A;  1HYO A;  2BZ8 A;  5CKB A;  1O75 A;  1PC0 A;  3CCJ Q;  2DBK A;  5KYY A;  1VQK Q;  5GAN h;  2L3Q A;  3QYH B;  5CKH A;  2CUD A;  5FW9 A;  1QCO A;  4KH0 B;  1KIK A;  1XJW B;  4HVW A;  3OYJ A;  1IRE B;  4DOV A;  3PIO A;  2QGF B;  1AWW A;  3I5R A;  3M4G A;  3V7C A;  2OX7 A;  1U1S A;  1WDX A;  1YP5 A;  4M78 F;  1QWE A;  5HKC A;  2RH2 A;  2NUT B;  5FWC A;  3A8H B;  3P8B B;  3EAE A;  1LCK A;  1TUD A;  3S3O A;  2XHC A;  4XTV A;  4RTZ A;  2ZPG B;  1PM3 A;  3BDL A;  4FL6 A;  5J26 A;  2DMO A;  4KGZ B;  2EQK A;  4AG2 C;  4RTX A;  4OB2 B;  1UUE A;  1BK2 A;  2ROT A;  3M0Q A;  3RMQ A;  4M7A B;  2KVQ G;  1GFD A;  3GNF B;  2RI3 A;  4J9F A;  2IPO B;  4ATO A;  3WXM B;  4E6R A;  4E7K A;  4R0K A;  1ABQ A;  3JB9 J;  2CZ0 B;  2E6Z A;  3A8G B;  3OYL A;  1TH7 A;  3EHR A;  4Z89 A;  1U1T A;  3CC7 T;  4MZP A;  3CMA T;  2JMC A;  4IIO A;  2EPD A;  2VXE A;  4M7D F;  1KD1 C;  2QAS A;  2MYS A;  4O5V A;  3EFO A;  4EMH A;  2FZG B;  2EYX A;  2FRW A;  1FMW A;  4C8Q B;  1H3Z A;  2DL3 A;  1VQ4 Q;  5HK0 A;  2JM8 A;  2YRD A;  4BE0 A;  5KYU A;  2KT1 A;  3LWH A;  2HD0 A;  3L2W A;  3VS4 A;  1TOV A;  2RI2 A;  1NJI R;  3CEY A;  4BE2 A;  1K8A U;  3SD4 A;  4BB7 A;  1MMG A;  2JJ9 A;  1D3B B;  2KT8 A;  2KGT A;  3G7Z A;  3UA6 A;  1UGP B;  5GAO q;  5J39 A;  3E9F A;  4PLL A;  1W2B A;  4ELZ C;  2X4Y A;  3ME9 A;  2BUD A;  2LJ1 A;  3TCJ A;  4C92 C;  1AZE A;  4ZNX A;  1WHG A;  2EW3 A;  4M7D G;  5D6W A;  4JJB A;  3CCU Q;  3S6W A;  1ZA2 B;  2CT3 A;  4DA4 A;  5LJ5 j;  3NPF A;  1IB8 A;  4UC4 A;  2RN8 A;  2EKO A;  3RKY A;  8AT1 B;  3FC3 A;  2ZCF B;  1KJW A;  1N5Z A;  2J7I A;  4ZGD B;  1UJY A;  2ECZ A;  2VWF A;  1BCM A;  1X6O A;  4BUG A;  2LJ3 A;  5LJ3 f;  4M77 D;  1YJW Q;  4M75 E;  1Q95 G;  4OB0 B;  5GMK h;  1JJ2 S;  4AFU C;  4LE9 A;  2L8D A;  2CP2 A;  4EMK C;  1AOJ A;  5FU7 B;  1SG5 A;  1GCQ C;  3GNG A;  4C92 B;  4GBQ A;  3QUI A;  1YCY A;  2X35 A;  4J6Y A;  3JCM g;  1XQH A;  4ELY C;  4NL3 A;  2DTI A;  4ESR A;  4JS4 A;  3H8Z A;  3L2Z A;  4KGX B;  2HMA A;  3HRU A;  4LUD A;  1PKT A;  1VQL Q;  3UPU A;  2FPD A;  1SKU B;  2RF0 A;  1WXU A;  1VQ9 Q;  4FYV B;  1I4K 1;  4FCY A;  2QAZ A;  3CME A;  3BFM A;  1K8A C;  3OMC A;  3E19 A;  4B6M A;  2HKN A;  4EMK B;  5KE2 A;  1OEB A;  1UGV A;  3ZEH A;  1RAG B;  1I1J A;  4BDZ A;  3H6Z A;  3KBG A;  2OJ2 A;  3HFO A;  2A0F B;  3I55 A;  5GAM g;  2RD1 A;  2RHZ A;  2MK5 A;  3CCS A;  2G6F X;  2ZGW A;  4JRP A;  2DX1 A;  1M2O A;  1B34 B;  1RI9 A;  2X3X D;  5GAO r;  1QVP A;  2BE7 D;  4M7A D;  2JZ2 A;  2JTE A;  2QQA A;  2ZPE B;  1G3T A;  4MML A;  5IN1 A;  4BY6 B;  4JDS A;  1IHV A;  1FMV A;  3FRN A;  2ZPH B;  3L1A A;  2MCN A;  3A8O B;  3FDR A;  2V1R A;  2VC8 A;  4JJN K;  4OMO A;  2DET A;  3PTA A;  2E1H A;  2DIG A;  2GFA A;  2XI9 A;  2F5K A;  4M75 F;  2OTL A;  1JEG A;  2V8I A;  3L2V A;  2P0Q A;  2RQV A;  4J9I A;  5DLQ E;  4C5E A;  4C8Q D;  2L3S A;  1QKX A;  4J6W A;  3A98 A;  1J3T A;  1YJ9 A;  3JCM f;  4F17 A;  3RES A;  1WHK A;  3QSU A;  2LNH B;  4ZGE B;  3CCQ A;  1VA7 A;  5GAN g;  3PIP A;  4OB3 B;  5LJ3 d;  2DIL A;  2EGE A;  2LZ6 B;  2NUP B;  5GAN 7;  3JCM V;  2GTJ A;  1W2B S;  3M0U A;  1M3A A;  2O88 A;  2DL7 A;  4GLK A;  3QJ6 A;  3CC4 T;  2FVU A;  3PVQ A;  2A28 A;  2O4X A;  5A2Q E;  1OYX A;  4XTW A;  3M57 A;  3GP8 A;  2K3B A;  1U06 A;  2D1X A;  3I55 Q;  1KQ2 A;  3CCS Q;  2RHU A;  4AFQ C;  3OB9 A;  1X6B A;  3REB B;  2DJZ A;  1EFN A;  3EGD A;  5GJW B;  3ZFJ A;  3QO3 A;  5GAM f;  2L5Q A;  5J3B A;  3V8K A;  1ZLM A;  2EQI A;  2X51 A;  2DK3 A;  2RJF A;  2MMP A;  3BDU A;  4JJD A;  2YXY A;  3RNJ A;  2SEM A;  1QKW A;  3X20 B;  3M55 A;  3RKX A;  2FPF A;  3V8L A;  1H8K A;  4D8D A;  4M77 A;  3R6N A;  2F69 A;  3H41 A;  3GBQ A;  1F1B B;  1KSW A;  4HKE A;  4L5G A;  4F7U E;  2C0I A;  1WQ7 A;  1Y7X A;  4IUR A;  3M0P A;  5GAN e;  3PMT A;  4HCZ A;  4Y92 A;  4PJJ A;  1YHQ A;  2OTL Q;  1G3Y A;  3R6O A;  2B8A A;  3RKW A;  1LOJ A;  4M78 C;  1AT1 B;  2KRN A;  1KD1 R;  4E2F B;  5GMK i;  3SWN C;  2M1H A;  1EZZ B;  1C0M A;  3UT1 A;  1YJ9 Q;  3O5Z A;  2E12 A;  1R0C B;  3CCQ Q;  1BB9 A;  1VUB A;  2JNG A;  4NL2 A;  2YUO A;  3L2U A;  3MCA B;  3SEM A;  2NUT A;  2ESW A;  1Y07 A;  3EH1 A;  4DEY A;  4J9D A;  1OX8 A;  4M78 B;  2DE0 X;  2LQK A;  2PQW A;  2K5F A;  3TVT A;  3G71 A;  1D1C A;  1I81 A;  4OB1 B;  3JCM d;  3PNW C;  3E9G A;  3SWN B;  1RLQ C;  2K9G A;  4C92 G;  2PUO B;  2RMO A;  3MP6 A;  1QW1 A;  2FG0 A;  3CME T;  1Q81 U;  4M7A A;  1NLP C;  3QII A;  3RDV A;  4M7D C;  1NPR A;  2RQW A;  5GAO l;  1HK9 A;  3ZBD A;  3G1J A;  4OGE A;  3C12 A;  2V8J A;  4BD3 A;  2KMT A;  1RAH B;  2DXB A;  3EG2 A;  3MP8 A;  2JW4 A;  3OYG A;  1AEY A;  2JVV A;  3LLR A;  5I22 A;  3CC7 A;  2Z0W A;  1V29 B;  4C0G A;  2FRY A;  4MDW A;  3LH0 A;  3GOX A;  5FRM A;  1U5S A;  1M90 C;  2YRV A;  3TEE A;  4QVZ A;  1ZSZ B;  4F7U F;  4PJO E;  5GAM d;  2FYK A;  2CP7 A;  1K9A A;  3HFN A;  4C8Q A;  1UJ0 A;  3M54 A;  4AMC A;  4M7D B;  2EIF A;  3IQL A;  3TU4 K;  4JLG A;  1QCN A;  2KYB A;  5GAN 2;  2O31 A;  1GBR A;  2VB6 A;  2C06 A;  2JTF A;  1W2B P;  1K8A R;  2XIC A;  1D3B A;  1PG5 B;  2CH4 W;  4RCB A;  2RJC A;  4ANJ A;  1UGR B;  2YRC A;  5AYF A;  4KGV B;  3J81 E;  1X69 A;  3JB9 D;  2RO0 A;  3M4Y A;  4F7U G;  3KUF A;  1IHW A;  1GL5 A;  2LVM A;  2O01 E;  3EG9 A;  4DBR A;  1Y71 A;  3LYI A;  2EFI A;  2RJD A;  2ENM A;  2FO0 A;  2I0N A;  2IIM A;  4KH1 B;  3QZ5 B;  1K4U S;  2AK5 A;  3CBO A;  2HL3 A;  4DBH A;  5GMK e;  3GPL A;  2CSQ A;  1WHJ A;  1YNZ A;  3EGX B;  2V8K A;  3CC2 A;  3M59 A;  4BI4 A;  2DXU A;  2ZZD A;  2KAF A;  1PWT A;  1QLY A;  5GAN 6;  2ZPB B;  4RG8 A;  3MHX A;  5LJ5 h;  1OUL A;  4ZN3 A;  2ED1 A;  1PSE A;  3CC7 Q;  2KSS A;  2NWM A;  2QK0 A;  3CCV T;  3CMA Q;  3C0C A;  1VQ5 A;  4XTZ A;  3DLL A;  2E70 A;  2SRC A;  9ATC B;  1VQP A;  1SHF A;  1WGS A;  5LJ3 j;  1NBE B;  5C0M A;  1WJS A;  2VYT A;  4PJO F;  4JPB W;  2K7A A;  1U3O A;  1RLP C;  1T0J A;  4EMK A;  2KY9 A;  1EX4 A;  5KCH A;  2XU8 A;  3MKD A;  4C5H A;  5CK9 A;  1UG1 A;  3MEW A;  4DBF A;  4PNO A;  5D6X A;  1YHQ T;  4LNP A;  2ABL A;  3GIB A;  2M16 A;  4RTY A;  2EWN A;  1OPK A;  1ZUY A;  1PRM C;  3QG1 A;  3QWX X;  3X26 B;  2PVD B;  2YUP A;  2XID A;  3DB3 A;  4OMF B;  5KYW B;  2EYZ A;  4A4F A;  4F16 A;  2F2W A;  1E7O A;  2KYM A;  1KQ1 A;  3VKI A;  1G3S A;  2CZ1 B;  3CPW A;  3MJX A;  5L8R E;  2CKK A;  1WHM A;  2LQN A;  1M1K C;  2RJE A;  4M75 C;  1VQ7 A;  4PJO G;  1D09 B;  4KUI A;  4II1 A;  1PRL C;  2F5T X;  2KR3 A;  1TS9 A;  2QI2 A;  4LDX A;  1NG2 A;  2HQE A;  2DFU A;  3JB9 I;  2L0A A;  3OYC A;  1ZUU A;  2YUQ A;  3I56 A;  2QQ9 A;  3DKM A;  4CC2 A;  4VUB A;  1VYV A;  3BE3 A;  2VGN A;  2EJ9 A;  3G71 T;  2X9H A;  5GAO m;  4E7S A;  1AWO A;  1KG1 A;  4AFS C;  5DLO A;  4F04 B;  4ORZ A;  4M75 B;  3NHN A;  2QQS A;  4M7D D;  4ZTJ A;  2DTO A;  2CP3 A;  1WJR A;  2XKO C;  4M78 G;  2QXF A;  4CC7 A;  2LCL A;  4C0D C;  4BAC A;  1M4Z A;  4FT2 A;  1X27 A;  2X4W A;  4OML A;  1Q82 U;  1BI1 A;  1SSH A;  3CC4 A;  2WAC A;  2DPP B;  4E47 A;  5KYX B;  4ZTF A;  3RUX A;  4C5I A;  1AD5 A;  2H3J A;  4HCC A;  1UE9 A;  1EIF A;  2YT6 A;  3QJY A;  3CXC A;  2K5I A;  2NUZ A;  1KK7 A;  3FIF A;  3VS0 A;  3LGL A;  1B3Q A;  2CGH A;  2ROL A;  4EPC A;  1RAB B;  5CKF A;  4LXC A;  3OS5 A;  4M77 E;  3VYG A;  4IUU A;  5I11 A;  2F2X A;  1Y96 B;  4OMM A;  2AHJ B;  3EGU A;  3E2U A;  3KFV A;  1KC8 U;  3G6E T;  1IGQ A;  3SHW A;  2MIO A;  1RAC B;  4A4H A;  1B07 A;  1AVZ C;  1M5Q 1;  2PVG B;  4OGC A;  4C0D B;  5CQX A;  1KQS A;  3LH5 A;  4E7I A;  4IIM A;  2H8H A;  4HVV A;  1I8F A;  4K11 A;  4LN2 A;  4J9H A;  4JJC A;  5CKD A;  4CC3 A;  1OQK A;  1KFZ A;  1G5V A;  3OSS C;  3OS2 A;  2QA4 A;  2M9U A;  5GAM j;  4JZ3 A;  3CCL A;  1GCP A;  2YUN A;  2VGM A;  1PSF A;  1RAA B;  2IVW A;  1M90 R;  1M1F A;  5CIU A;  1GRI A;  1ZX6 A;  3PE0 A;  3RER A;  5I2S A;  1TSF A;  1KHC A;  2E10 A;  2JS0 A;  1RAD B;  1ZHI A;  2KRO A;  2RK1 A;  3VRZ A;  4RTT A;  3G4S A;  3CC2 T;  1WA7 A;  1RL2 A;  4AG1 C;  2DZC A;  1N8R U;  5KYN A;  3F70 A;  2ED0 A;  2YDL A;  3FEO A;  4ZN1 A;  2E5Q A;  4XQ3 A;  3CC4 Q;  1LPL A;  1PKS A;  3CPW S;  4M7A E;  2MF2 A;  2A37 A;  2X3W D;  1VQ5 T;  1TTH B;  2P0P A;  3MEA A;  4E7L A;  1MUZ A;  4JRI A;  1VQP T;  3QDR B;  1OZ3 A;  3ZL7 C;  3UA7 A;  3VUB A;  5I2M A;  5FLX E;  2HSE B;  2GQV A;  3SWN A;  4JZ4 A;  1K73 U;  1XOV A;  2KRM A;  2OAW A;  3V7R A;  2V1Q A;  4CI0 C;  3M0S A;  4M77 F;  4C5G A;  5D6Y A;  3EFS A;  3L2R A;  1C6V X;  3URG A;  3EHQ A;  1AWJ A;  4J9G A;  4DOW A;  3L2Q A;  1BKB A;  1OOT A;  2MPX C;  4C8Q E;  5GMK l;  1VQ8 T;  2OAU A;  2EGC A;  5CO7 A;  2KNB B;  4XU1 A;  3M58 A;  2M51 A;  2LCC A;  4IUQ A;  2A08 A;  2KRS A;  8ATC B;  2DAQ A;  1ZSZ A;  3CCM A;  2K2M A;  1VQ7 T;  3C94 A;  1IGU A;  1I07 A;  1M9S A;  1B7T A;  4B9W A;  2KXD A;  2DXC A;  4Z88 A;  3P8D A;  4M7D A;  4F7U B;  2QEX T;  1Z9Z A;  2C0O A;  2M0O A;  3I56 T;  2W10 A;  1SRM A;  4MMK A;  3VUZ A;  2P0K A;  4XU2 A;  3JCM P;  2FPE A;  2DL5 A;  1K0S A;  1RUW A;  1XNI A;  4V2S A;  1WLP B;  1YJN T;  4FW1 A;  3OW2 A;  4DBQ A;  2RHI A;  4HCB A;  2HQX A;  3OYH A;  2LDM A;  4HA8 A;  4M7A F;  4O6J A;  5A0G A;  1BI3 A;  2FB7 A;  2JT4 A;  3S3M A;  2E65 A;  3HRT A;  2EGA A;  2XDD A;  2LT4 A;  4PK4 A;  1ZQ1 A;  3QZ9 B;  1YBY A;  2EQU A;  2XDB A;  1M1K R;  3CME Q;  1WQW A;  1QQJ A;  1ZA1 B;  1I0C A;  2GCX A;  3QPH A;  3EG0 A;  2K79 A;  3EGX A;  1MGQ A;  3VS6 A;  1SRL A;  4M75 G;  1Q7Y U;  3CPF A;  5LJ5 e;  1OZ2 A;  4PJO C;  1ABO A;  1NYG A;  2C0T A;  2MI6 A;  2LMJ A;  2P84 A;  3OYA A;  4C8Q F;  1UHC A;  3OSV A;  3CCV A;  1G8X A;  1ARK A;  4EMG A;  4A4K A;  1VQN T;  2K3X A;  1KHI A;  4BI8 B;  1TXQ A;  2GF7 A;  1BBZ A;  2DTH A;  2RK2 A;  1H92 A;  3M53 A;  2EYW A;  1TUG B;  3VS5 A;  2PNI A;  3VS7 A;  2RB6 A;  4A4E A;  1UTI A;  2OI3 A;  5KYU B;  4LD6 A;  5D7U A;  4RMO A;  2NLU A;  2DA9 A;  2OTJ A;  1QMC A;  2DF6 A;  2IG0 A;  4C92 D;  1YI2 T;  5LL6 S;  4PJL A;  2HL5 C;  1QP2 A;  3HSB A;  4PJO B;  3I35 A;  2QA4 T;  1M27 C;  3MET A;  1WPY A;  4Y28 E;  3LW5 E;  3OYM A;  4FYX B;  3CCL T;  1WYX A;  3CPW P;  2EQM A;  1G2B A;  3UF4 A;  4JRQ A;  5LJ3 h;  1LNX A;  1VOM A;  2DL8 A;  5KYW A;  2GGR A;  3CD6 A;  3OYY A;  3CCR T;  1SF9 A;  2BZX A;  2LC4 A;  1PCX A;  3G4S T;  4IKF A;  3I5S A;  2L2P A;  4LDY A;  2KE9 A;  5GAN f;  1YIT A;  2DL4 A;  2CSI A;  1TWB A;  1OV3 A;  1Y0M A;  5HK3 A;  3GLX A;  4FSX A;  4MZM A;  5M9O A;  1T0H A;  2ZPI B;  2V26 A;  2AT1 B;  2HDA A;  1WZO A;  4LUE A;  2CZ6 B;  2EJF A;  3KXT A;  2A3L A;  1FYN A;  1YWP A;  1IZ6 A;  3CCV Q;  2LNV A;  5CVI A;  1VQO A;  5GAO n;  2JUF A;  5EG2 A;  2E6N A;  2GFU A;  5GMK m;  1TU0 B;  4E7H A;  2QDY B;  1S1N A;  5A0D A;  5IXB A;  4X34 A;  3E1S A;  1JRI A;  4HT9 A;  1SSF A;  1HJD A;  2X4X A;  2DZ9 A;  2DEQ A;  1HXD A;  1M1G A;  3M5A A;  3CXC P;  3OW2 S;  4A63 B;  5KYX A;  1YFN A;  2RPN A;  3H0F A;  1OPL A;  1NEB A;  2XMF A;  2VUB A;  1K1Z A;  2DYB A;  1YHQ Q;  3EG3 A;  2K57 A;  1QVG A;  2JOY A;  5C6S A;  2YHT A;  2RHY A;  3CCM T;  3MO8 A;  1BYM A;  3VS3 A;  3NFC A;  3HP9 A;  5CR2 A;  2HQH A;  2E5K A;  2QYZ A;  4J5Y A;  3JAM E;  2J06 A;  3G6E A;  1Y96 A;  4QQ6 A;  1ZBX A;  4WCI A;  5L23 A;  4L6V 5;  1KQS P;  2F1L A;  2FEI A;  2O9V A;  2YSQ A;  1OX9 A;  2O2O A;  2K4Y A;  1JU5 C;  2PU9 B;  5FWB A;  4M4Z A;  1TUC A;  2Y4X A;  1X2K A;  3AHU A;  3VYH B;  1XTD A;  1T3S A;  5KH6 A;  3JCM h;  1FWZ A;  4N4H A;  1JBM A;  2JXB A;  5EC7 A;  1MV3 A;  4FYY B;  1JXM A;  4JUV A;  4QT7 A;  3G71 Q;  4HT8 A;  1X43 A;  2FZK B;  1Q81 C;  2D0Q B;  2VVK A;  2A36 A;  3QKJ A;  2YLC A;  4J83 A;  1YWO A;  3U23 A;  2HNI A;  5GAN d;  1MHN A;  3C95 A;  1MMN A;  2RM4 A;  1MNE A;  5DM7 R;  2KI7 A;  3RIR A;  5GAN 3;  4QQG A;  4C92 A;  4PJO D;  4RG2 A;  5GAM h;  3VV0 A;  4M77 C;  1S72 T;  2DBM A;  4J7F A;  4MDX A;  2CP5 A;  3OS1 A;  2QG9 B;  2XK0 A;  3N5B B;  1A0N B;  4RKU E;  2D0N A;  4N0A C;  3OMG A;  4FIB A;  1JXO A;  2JM9 A;  2O9S A;  3M9Q A;  2DXT A;  1YIJ T;  3WVE B;  1D1B A;  3G6E Q;  4QQD A;  2OTJ T;  2JTM A;  1PNJ A;  1SEM A;  4NOY A;  3TQ7 P;  1GCQ A;  5GAO p;  5FRN A;  3M56 A;  4ME7 A;  1VIE A;  2BTT A;  4OP0 A;  2XG8 D;  3NMZ C;  3HKS A;  4FSS A;  1QCF A;  4DQ2 A;  4M77 B;  4IUV A;  2RQR A;  1VQ8 A;  4M78 D;  1ZBJ A;  3LGF A;  3JCM Q;  3OYB A;  1PD1 A;  3CD6 T;  1B34 A;  1JJ2 A;  1NZ9 A;  4Q5W A;  2R58 A;  4PFZ A;  2DYI A;  1VQ4 A;  1KD1 U;  2A7Y A;  1YIT T;  1NM7 A;  2QQR A;  2EAY A;  2QEX A;  4F7U A;  2D8J A;  2DO3 A;  2VXF A;  1UGS B;  2LJ0 A;  2COY A;  1MMA A;  2DRK A;  3FB9 A;  3CC2 Q;  7AT1 B;  1QVG S;  4M7A C;  3OYK A;  3Q1J A;  4GLM A;  2HBP A;  2JN0 A;  5CQY A;  1VQM T;  2QDL A;  4OMP A;  3V8J A;  1V76 A;  3OW2 P;  1FX7 A;  4MZT A;  3RMS A;  3A5Z B;  1WX6 A;  1M3B A;  1YJN A;  1D1A A;  4LDV A;  2MWO A;  2FHD A;  3CCU A;  5FU6 C;  2EKH A;  4PKC C;  4JRK A;  1VQO T;  1VQ5 Q;  1X2Q A;  1VQP Q;  4J9C A;  2LT1 A;  3LWI A;  1LVK A;  5FRO A;  1GXI E;  2KK4 A;  2QTX A;  2NUP A;  5LJ3 g;  2EBP A;  4OMN A;  4QW2 A;  1M2V B;  1X01 A;  4KBM B;  4C8Q C;  2XDP A;  1UFF A;  1M30 A;  2DVE A;  4WF2 A;  1YJW A;  2E41 A;  1Q7Y R;  1Q86 U;  3MEU A;  3MPU B;  5I21 A;  3AT1 B;  5A0L A;  2GBQ A;  2CUB A;  4ZGJ B;  1VQ8 Q;  2K3Y A;  5FU6 B;  1BIB A;  3UDC A;  3BY7 A;  3CCE T;  1WXB A;  1VQN A;  3HL8 A;  1BI2 A;  3NGP A;  2E3H A;  3FJ5 A;  1VQL A;  4Z8A A;  3REA B;  1WXT A;  1NE8 A;  2D9T A;  3CQT A;  1VQ7 Q;  3OA6 A;  4FYW B;  2LRQ A;  2L3P A;  1R77 A;  1CKA A;  1VQ9 A;  3TSZ A;  1O9S A;  5IH2 A;  1IXD A;  1WI7 A;  1YI2 A;  1VQ6 T;  5CCA A;  2QEX Q;  1W6X A;  3I56 Q;  4N4I A;  1QVF A;  4YTL A;  2LP5 A;  1E6G A;  2LX7 A;  3BW1 A;  4PJO A;  1D0X A;  4FU6 A;  4A53 A;  1H3H A;  4RTW A;  1W1F A;  3OYF A;  3CCJ T;  4E7Z A;  4RCC A;  1VQK T;  5LJ3 e;  1ZUK A;  4HXJ A;  3H0H A;  1BI0 A;  3RBB B;  3PFS A;  5FU7 C;  3UWN A;  4F14 A;  1UB4 A;  1E6H A;  4FT4 A;  2LQ8 A;  1YJN Q;  4PLI A;  3CCR A;  2HKQ B;  3FLG A;  1YCS B;  3EG9 B;  1YN8 A;  2EQJ A;  4GY5 A;  4J9E A;  4XU0 A;  3I9Q A;  3NTI A;  1Q82 C;  4OMQ A;  1HD3 A;  2RQT A;  2HEQ A;  1SPK A;  2KDS A;  2DEU A;  1UDL A;  3VS2 A;  2AKL A;  3HRS A;  4QKU A;  3J7A F;  4NS5 A;  1Q86 C;  1JQQ A;  3VS1 A;  2CZ7 B;  4PFP A;  2K6D A;  3X25 B;  1T3L A;  3PGG A;  1K9M U;  4X9D A;  2D6F A;  2AZV A;  4M78 A;  2YWW A;  2DLP A;  2EVR A;  1KC8 C;  1RAE B;  4L59 A;  1ACM B;  3OYE A;  4C0F A;  1VQN Q;  2J05 A;  3FJP A;  1Q81 R;  5GAN j;  3MP1 A;  3ULR B;  1JO8 A;  3T9N A;  1K0X A;  4LDU A;  3EFR A;  2BIV A;  4RUG A;  2ZAE A;  5HY6 A;  2AIR B;  1H64 1;  2CRE A;  1GFC A;  3JB9 H;  3S3N A;  4IUP A;  2GNC A;  3QWY A;  1YI2 Q;  1X75 C;  2B86 A;  5IXF A;  4BY6 C;  2KXC A;  1QVG P;  3VJP A;  2KQW A;  2DM1 A;  4LDW A;  2VKN A;  3JRZ A;  4RTV A;  2QA4 Q;  5KCO A;  5KYY B;  2GQI A;  2E3I A;  4M75 D;  4IUT A;  3NTK A;  4FW2 A;  5LJ5 g;  3CCL Q;  4C0Z A;  3OBW A;  1UEB A;  1VQ4 T;  2AKK A;  3UAT A;  4M77 G;  2D8H A;  2BZY A;  1PHT A;  1BCO A;  3CCR Q;  3ASK A;  1D0Z A;  1AHJ B;  1N8R C;  2PUK B;  2R57 A;  4J8O A;  5AT1 B;  3CXC S;  1RAF B;  3G4S Q;  2BE9 B;  1WFW A;  1RI0 A;  3JCM e;  2PTK A;  3X28 B;  2KBT A;  1VYU A;  1Y57 A;  3L42 A;  4JLI A;  3H9N A;  1K9M C;  2YLB A;  1M8V A;  4PJM A;  2DJQ A;  4QVD A;  2RHX A;  2CP0 A;  1I5O B;  3CCU T;  2DD5 A;  1KQS S;  1CSK A;  3SB2 A;  1I5L A;  1K73 C;  1P92 A;  5GAN 8;  3DLM A;  1R8O B;  1X6G A;  3MEV A;  4C92 E;  1IO6 A;  1CKB A;  3WVD B;  4KUD K;  1WNL A;  1C1A A;  2M0Y A;  1QVF S;  2ZPF B;  2LX9 A;  1W70 A;  2CT4 A;  3OYI A;  1YJW T;  1VYT A;  4XU3 A;  1K76 A;  4J6X A;  2CP6 A;  1FMK A;  4XTX A;  5GAM e;  1MND A;  3CBP A;  2HSP A;  1S72 A;  2K5L A;  4M7A G;  2M02 A;  3OS0 A;  4RTU A;  4R55 A;  3EFO B;  2DIQ A;  1VQL T;  4R56 A;  2HZY A;  3CCM Q;  1WIE A;  2COZ A;  3O8V A;  2HAX A;  2EJG A;  5CAI A;  3PMI A;  2RQU A;  2HBW A;  3HPW A;  3VU3 C;  1VQ9 T;  1YIJ A;  1G83 A;  2MOX A;  1NPP A;  5LJ5 f;  5GAN 5;  2J6K A;  1NJI U;  4EIK A;  4DEX A;  1NEG A;  1D0Y A;  3JCM b;  3P8H A;  4B9X A;  5CKE A;  4C8Q G;  3OY9 A;  1QWF A;  2EYY A;  1BIA A;  2NYS A;  5GMK j;  3HHT B;  1JJ2 P;  2PVO B;  5IHI A;  3SDZ A;  2VV5 A;  4N0A A;  2H3E B;  1WHL A;  5GAN 4;  2F2V A;  3TSW A;  2DNU A;  2WSF E;  1IRX A;  1M90 U;  2WSE E;  4E7J A;  3JV3 A;  1Q7Y C;  2KEA A;  4HVU A;  1N9S A;  3EH2 A;  4C92 F;  5DY9 A;  3SFM A;  4CRI A;  5GJV B;  4Z02 A;  3JCM W;  1NLO C;  2Y4Y A;  3OQ5 A;  1FXX A;  4PL6 A;  1VQM A;  3JSC A;  1HSQ A;  3V7S A;  1N9R A;  1UGQ B;  1M8M A;  1S72 Q;  1JB0 E;  4XAX B;  5IHK A;  1UEC A;  3QYG B;  4M75 A;  1U8R A;  3EG1 A;  4PFO A;  4N4G A;  1N27 A;  2L89 A;  2HCK A;  1V1C A;  2E4H A;  2FZC B;  4OF1 A;  1GBQ A;  1ZSZ C;  4P5N A;  1NJI C;  1ZSG A;  1AWX A;  4KUL A;  1YIJ Q;  4X1V A;  4KT0 E;  2RI5 A;  1PD0 A;  3A1P A;  1Q82 R;  2OTJ Q;  1M2V A;  4WTO B;  1QP3 A;  2CS7 A;  2G3R A;  2BKD N;  2FL7 A;  4J9B A;  3THK A;  2R5M A;  1SHG A;  2DVJ A;  1Q86 R;  4D6W A;  2CDT A;  3A8L B;  2CYZ B;  3I55 T;  2P4T A;  3M0R A;  2ATC B;  3CCS T;  2MAM A;  2DRM A;  2QQB A;  3CCE A;  3CMA A;  2J6O A;  3CD6 Q;  1KC8 R;  3J80 E;  3PVL A;  2MWP A;  2RA2 A;  2J6F A;  5IHN A;  5KE3 A;  4EDU A;  3QBY A;  4XTU A;  5LJ5 d;  3RR6 A;  4AT1 B;  2RNA A;  2VAS A;  3OYN A;  1OU9 A;  3JCM X;  3M0T A;  1TG0 A;  1QVF P;  6AT1 B;  1YIT Q;  3D7S B;  2R5A A;  1VQ6 A;  3QDF A;  3JCM J;  3OYD A;  1OI1 A;  2L3R A;  1AZG B;  1G3W A;  2JS2 A;  3CCJ A;  2DD4 A;  1WJQ A;  3DB4 A;  1VQK A;  1NYF A;  1VQM Q;  2OTL T;  1LJO A;  3A8M B;  2Y90 A;  5ECA A; 
#chains in the Genus database with same CATH homology
 1AWJ A;  2C0I A;  4HCK A;  4J9G A;  2EBP A;  3M0P A;  4OMN A;  1OOT A;  4Y92 A;  1UFF A;  1M30 A;  2EGC A;  2GTO A;  1UHF A;  2KNB B;  2KRN A;  3VRY A;  2M51 A;  2A08 A;  4D8K A;  2KRS A;  3O5Z A;  2GBQ A;  2CUB A;  2K2M A;  2JMA A;  1BB9 A;  4AFZ C;  2P4R A;  1I07 A;  5HCK A;  1WXB A;  2KXD A;  3NGP A;  1MV0 B;  4Z88 A;  2LCS A;  2YUO A;  3FJ5 A;  4Z8A A;  1Z9Z A;  2C0O A;  3REA B;  1WXT A;  3SEM A;  2W10 A;  3CQT A;  2ESW A;  1SRM A;  1M3C A;  1Z9Q A;  2L3P A;  4DEY A;  1CKA A;  3TSZ A;  4J9D A;  2FPE A;  5IH2 A;  4CC4 B;  2DE0 X;  1WI7 A;  2DL5 A;  3TVT A;  2LQW A;  1K0S A;  1W6X A;  4KRT A;  1RUW A;  2W0Z A;  1RLQ C;  2K9G A;  2LP5 A;  1WLP B;  1E6G A;  2LX7 A;  2RMO A;  1H3H A;  4RTW A;  1W1F A;  3H0I A;  2FG0 A;  1NLP C;  2PZ1 A;  1ZUK A;  4HXJ A;  1BU1 A;  3H0H A;  2RQW A;  2JT4 A;  3RBB B;  4F14 A;  1E6H A;  2AZS A;  2EGA A;  2CH4 A;  2BZ8 A;  3EG2 A;  1YCS B;  2JW4 A;  1YN8 A;  2DBK A;  1AEY A;  1I0C A;  4J9E A;  3EG0 A;  5I22 A;  2K79 A;  2L3Q A;  3I9Q A;  4OMQ A;  3VS6 A;  2CUD A;  1SRL A;  1HD3 A;  2RQT A;  5FW9 A;  2HEQ A;  1SPK A;  2FRY A;  1KIK A;  1UDL A;  3VS2 A;  2AKL A;  4HVW A;  1U5S A;  1ABO A;  1NYG A;  1JQQ A;  2C0T A;  2LMJ A;  1K9A A;  3VS1 A;  1AWW A;  3I5R A;  2K6D A;  1UJ0 A;  1T3L A;  1UHC A;  1ARK A;  2AZV A;  1WDX A;  1YP5 A;  2DLP A;  1QWE A;  2EVR A;  3IQL A;  1BBZ A;  5FWC A;  1H92 A;  2KYB A;  2O31 A;  1LCK A;  2EYW A;  1GBR A;  1TUD A;  3VS5 A;  2PNI A;  3VS7 A;  4RTZ A;  1UTI A;  2OI3 A;  2J05 A;  2CH4 W;  2DA9 A;  3ULR B;  2DMO A;  2DF6 A;  1JO8 A;  1K0X A;  1X69 A;  4RUG A;  4AG2 C;  2CRE A;  4RTX A;  3I35 A;  1UUE A;  1BK2 A;  2ROT A;  3M0Q A;  1M27 C;  1GL5 A;  1GFC A;  1GFD A;  2GNC A;  3QWY A;  1WYX A;  4J9F A;  2B86 A;  5IXF A;  2KXC A;  1G2B A;  3UF4 A;  4E6R A;  2ENM A;  2FO0 A;  2DM1 A;  2I0N A;  2DL8 A;  2VKN A;  4RTV A;  2GGR A;  2IIM A;  1K4U S;  2AK5 A;  4R0K A;  1ABQ A;  2GQI A;  2CSQ A;  2BZX A;  1YNZ A;  3EHR A;  4Z89 A;  2AKK A;  3I5S A;  3UAT A;  2JMC A;  2L2P A;  4IIO A;  2EPD A;  2KE9 A;  2D8H A;  2BZY A;  1PHT A;  2DL4 A;  1PWT A;  1QLY A;  2CSI A;  2EYX A;  2FRW A;  1OV3 A;  1Y0M A;  2DL3 A;  2ED1 A;  2NWM A;  1T0H A;  2JM8 A;  1WFW A;  3C0C A;  2KT1 A;  2SRC A;  2PTK A;  2KBT A;  2HDA A;  1VYU A;  1Y57 A;  4LUE A;  1SHF A;  3VS4 A;  2DJQ A;  1FYN A;  1YWP A;  2KT8 A;  1CSK A;  2KGT A;  4JPB W;  3UA6 A;  2K7A A;  1U3O A;  1RLP C;  1T0J A;  2LJ1 A;  1S1N A;  1X6G A;  5IXB A;  1AZE A;  1IO6 A;  4ZNX A;  2EW3 A;  1CKB A;  4JJB A;  1UG1 A;  2M0Y A;  4LNP A;  2ABL A;  4RTY A;  1OPK A;  2CT3 A;  1HJD A;  1ZUY A;  1PRM C;  3NPF A;  1W70 A;  2CT4 A;  4A63 B;  2RN8 A;  3QWX X;  2YUP A;  1VYT A;  2RPN A;  3H0F A;  2EYZ A;  1OPL A;  1KJW A;  1N5Z A;  1K76 A;  1NEB A;  2XMF A;  2J7I A;  4F16 A;  2F2W A;  1E7O A;  2KYM A;  1FMK A;  1K1Z A;  1UJY A;  2DYB A;  2ECZ A;  3EG3 A;  2VWF A;  2LJ3 A;  2LQN A;  2HSP A;  3VS3 A;  4AFU C;  4LE9 A;  2E5K A;  1PRL C;  1AOJ A;  2J06 A;  2KR3 A;  5L23 A;  4WCI A;  4RTU A;  1GCQ C;  1NG2 A;  4GBQ A;  2FEI A;  2L0A A;  2O9V A;  1WIE A;  1ZUU A;  2YSQ A;  2YUQ A;  2O2O A;  4CC2 A;  4ESR A;  2RQU A;  1VYV A;  1JU5 C;  2HBW A;  5FWB A;  4M4Z A;  1TUC A;  1G83 A;  1X2K A;  2MOX A;  4LUD A;  1PKT A;  2J6K A;  1T3S A;  4EIK A;  2FPD A;  2JXB A;  4DEX A;  1AWO A;  2RF0 A;  5EC7 A;  4AFS C;  1WXU A;  1NEG A;  4ORZ A;  1MV3 A;  1JXM A;  3NHN A;  4QT7 A;  1QWF A;  1X43 A;  2EYY A;  2VVK A;  2A36 A;  1OEB A;  1UGV A;  1I1J A;  4CC7 A;  5IHI A;  1YWO A;  3U23 A;  1X27 A;  4OML A;  2OJ2 A;  1SSH A;  2F2V A;  3TSW A;  2DNU A;  1AD5 A;  2G6F X;  1UE9 A;  2YT6 A;  2NUZ A;  3JV3 A;  2KEA A;  4HVU A;  3VS0 A;  2DX1 A;  1RI9 A;  2X3X D;  1B3Q A;  2ROL A;  2JTE A;  5GJV B;  1NLO C;  5I11 A;  2F2X A;  2DBM A;  3EGU A;  3KFV A;  4OMM A;  3SHW A;  1A0N B;  2MIO A;  2MCN A;  1B07 A;  1AVZ C;  1HSQ A;  2D0N A;  2V1R A;  4OMO A;  3LH5 A;  1M8M A;  4IIM A;  2H8H A;  1JXO A;  2JM9 A;  2O9S A;  5IHK A;  1UEC A;  3EG1 A;  4HVV A;  4K11 A;  4LN2 A;  1JEG A;  4J9H A;  4JJC A;  2RQV A;  4J9I A;  2HCK A;  4CC3 A;  1PNJ A;  1SEM A;  1GCQ A;  1V1C A;  1KFZ A;  2BTT A;  1GBQ A;  3NMZ C;  2L3S A;  1QKX A;  1ZSG A;  1AWX A;  3A98 A;  4FSS A;  1QCF A;  4X1V A;  1J3T A;  4F17 A;  2RQR A;  2LNH B;  4JZ3 A;  1VA7 A;  4J9B A;  3THK A;  1ZBJ A;  1GCP A;  2YUN A;  2DIL A;  2EGE A;  2LZ6 B;  1SHG A;  2GTJ A;  1GRI A;  1ZX6 A;  2DVJ A;  3M0U A;  3PE0 A;  1M3A A;  2O88 A;  2DL7 A;  2CDT A;  2JS0 A;  2KRO A;  3VRZ A;  3PVQ A;  2A28 A;  4RTT A;  3M0R A;  2DRM A;  1WA7 A;  4AG1 C;  2J6O A;  1NM7 A;  3PVL A;  2ED0 A;  2YDL A;  2J6F A;  5IHN A;  2K3B A;  2D8J A;  1U06 A;  2RNA A;  2D1X A;  1PKS A;  2LJ0 A;  2DRK A;  3M0T A;  1TG0 A;  4GLM A;  2A37 A;  4AFQ C;  1X6B A;  2X3W D;  3REB B;  1EFN A;  5GJW B;  2QDL A;  4OMP A;  1MUZ A;  1ZLM A;  2EQI A;  3ZL7 C;  3UA7 A;  4JJD A;  1WX6 A;  1M3B A;  1AZG B;  2SEM A;  1QKW A;  2JS2 A;  4JZ4 A;  3RNJ A;  2FPF A;  1XOV A;  2EKH A;  2KRM A;  1H8K A;  4D8D A;  1NYF A;  2OAW A;  3R6N A;  2V1Q A;  3M0S A;  1X2Q A;  4J9C A;  3H41 A;  3GBQ A;  1KSW A;  5ECA A;  3EHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...