3SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3semA00
2AZVA 2J7IA 2QDLA 1BB9A 5FWBA 3REAB 2CUBA 1OOTA 2ROTA 1GBQA 2YUQA 2JMAA 3M0UA 5HCKA 1BU1A 1K76A 2X3XD 2JM9A 1Y0MA 2O88A 2E5KA 4AFQC 3VS7A 3RNJA 4RTZA 1AWOA 4IIMA 3TSWA 4J9HA 3A98A 1X6GA 2FPFA 4OMOA 2LX7A 2DA9A 3VS3A 1PWTA 2DNUA 2ENMA 1N5ZA 1WI7A 2ED0A 1VYTA 2JS2A 1HJDA 4OMLA 1K9AA 1WXUA 4GLMA 2J6FA 1WA7A 1SRMA 2J06A 2KE9A 2DL4A 2EPDA 2O2OA 2JXBA 2SRCA 2DE0X 2DJQA 3KFVA 2KT1A 3JV3A 1NYGA 3QWYA 1ABOA 3VS0A 1JU5C 3GBQA 2LQWA 1ZSGA 2F2WA 2GGRA 4LNPA 1KIKA 2CT3A 2YDLA 1Y57A 1YWOA 2KROA 4JJDA 4Z88A 2V1RA 2C0OA 1SEMA 5GJWB 4E6RA 1K0SA 3QWXX 1E7OA 3SHWA 2DMOA 1S1NA 1UE9A 3NHNA 1GCQC 3VRYA 2DBMA 3VS2A 1JXOA 1PKTA 2ABLA 1GCPA 1YCSB 1M30A 2AKKA 1E6GA 1AZEA 2CSIA 2M0YA 2P4RA 2CUDA 3RBBB 3H41A 2KRNA 4X1VA 2K2MA 1ARKA 1ABQA 4ESRA 1ZBJA 2BZYA 1SPKA 1X27A 2JS0A 1PRLC 1LCKA 1ZLMA 2GBQA 4KRTA 2EBPA 2J6OA 1KFZA 2KNBB 1GFDA 2YUPA 5IHKA 4Z89A 2PTKA 1M3AA 3CQTA 1PRMC 4CC2A 1GRIA 1T0JA 2RF0A 1B3QA 1B07A 1JXMA 5ECAA 1AWWA 2BZXA 1H3HA 2RQVA 2K6DA 2BZ8A 2CREA 2O9SA 2M51A 1UHFA 4F16A 4JZ3A 1GCQA 4EIKA 3VRZA 4OMNA 2W0ZA 2GTOA 1K4US 2L3SA 3O5ZA 3I5SA 2LNHB 3EG0A 3EG2A 1W6XA 2EQIA 1X43A 4AG2C 4RTYA 2RNAA 1M8MA 2BTTA 2A28A 2L0AA 2DRKA 2L2PA 4RTTA 3UA6A 4F14A 2YUNA 2KEAA 2A37A 4R0KA 2RN8A 1QKWA 1WXTA 2DVJA 1RI9A 4IIOA 1SHGA 1H8KA 2EW3A 1MUZA 1T3SA 2K3BA 1X6BA 1AOJA 1K1ZA 4OMPA 4M4ZA 1W1FA 1UGVA 2DX1A 2B86A 1Z9ZA 2F2XA 3REBB 1AZGB 2HCKA 2EGEA 1X69A 2EYZA 3UF4A 4K11A 4RTXA 5GJVB 2NWMA 2X3WD 1QLYA 1ZUUA 1XOVA 4D8KA 1JQQA 2DL7A 1GL5A 1GFCA 2HSPA 4AG1C 1K0XA 4J9IA 1PHTA 2RQRA 1WX6A 2EYWA 4HCKA 4HXJA 2LP5A 2O31A 4LE9A 1I0CA 4ORZA 4AFSC 1UECA 1UJYA 1T0HA 4LUEA 1VYUA 3EGUA 2CDTA 2KRMA 3UA7A 4F17A 3I35A 2LJ3A 5IHNA 3PVLA 2EYYA 3U23A 4AFUC 1M3BA 1PNJA 1CSKA 1BK2A 5EC7A 2JW4A 2EGCA 2LZ6B 3VS1A 3C0CA 5I11A 4QT7A 1G2BA 2ROLA 2LJ1A 1QWEA 3NGPA 2FEIA 1A0NB 3H0HA 3EG3A 3TSZA 2A36A 2YSQA 1UTIA 2DBKA 1GBRA 3H0IA 1I1JA 3I9QA 4JPBW 1W70A 2HBWA 2V1QA 4RTWA 2RQTA 1BBZA 2VWFA 3H0FA 2RPNA 4J9CA 1M27C 1OEBA 2NUZA 3LH5A 4Y92A 3PVQA 3IQLA 2AK5A 4JJBA 5I22A 2F2VA 1AD5A 1TG0A 5FWCA 4DEXA 4J9EA 1HD3A 3M0QA 1KJWA 2PNIA 1U3OA 2CH4A 2K9GA 2VVKA 2IIMA 4WCIA 3NPFA 3VS5A 1UG1A 3NMZC 1NEGA 1VA7A 2D8JA 2LJ0A 2DLPA 1JO8A 1AVZC 2SEMA 2FG0A 1FMKA 1NM7A 2AKLA 3R6NA 1U5SA 4GBQA 2J05A 1IO6A 2W10A 1YNZA 2KR3A 2EGAA 1CKAA 3PE0A 3SEMA 4JZ4A 4CC3A 3UATA 3M0PA 2I0NA 2JM8A 2J6KA 5FW9A 5IHIA 2EYXA 1MV0B 1YWPA 1SSHA 2HDAA 1MV3A 3VS6A 1VYVA 2C0IA 4CC4B 4HVVA 1T3LA 1QKXA 1ZUKA 2AZSA 1KSWA 1AWJA 2DM1A 2RQWA 4OMQA 1J3TA 2DL8A 2XMFA 4FSSA 4HVWA 2FRWA 2O9VA 4J9DA 2A08A 1WXBA 2DILA 2MIOA 2D0NA 2HEQA 1UDLA 4RTVA 3EHRA 2OJ2A 1YN8A 1X2QA 3ULRB 1NYFA 1E6HA 2JTEA 4LN2A 4DEYA 2FPEA 2YUOA 2D1XA 2KYBA 4OMMA 1Z9QA 2KXDA 1RUWA 1I07A 2ED1A 2DL5A 1UHCA 2LCSA 1ZX6A 4D8DA 5IXFA 3I5RA 1OPKA 1WYXA 1QCFA 3VS4A 1HSQA 1NLPC 1X2KA 3ZL7C 3EG1A 2FPDA 2KGTA 2YT6A 2C0TA 1FYNA 2DRMA 1WDXA 2OAWA 1WFWA 1PKSA 2D8HA 1TUDA 4CC7A 1AEYA 2KYMA 2G6FX 2RMOA 1WIEA 1EFNA 2EKHA 3TVTA 1RLPC 3M0SA 2OI3A 2DYBA 2DL3A 4J9GA 1G83A 2KRSA 4AFZC 5IXBA 2PZ1A 2DF6A 3EHQA 2KBTA 2K79A 2CSQA 2ESWA 4Z8AA 4LUDA 4J9BA 2LMJA 2LQNA 1AWXA 2L3PA 3FJ5A 2EVRA 1UJ0A 1SHFA 1NEBA 1UUEA 1WLPB 2VKNA 4J9FA 2GQIA 4HVUA 5L23A 1YP5A 4RUGA 2ECZA 2MOXA 3THKA 1OPLA 4ZNXA 2FO0A 2JMCA 4RTUA 5IH2A 1UFFA 2KT8A 2KXCA 2H8HA 2GTJA 2MCNA 2L3QA 2RQUA 2CT4A 1OV3A 1CKBA 1NLOC 1V1CA 1U06A 3M0RA 1M3CA 1TUCA 2K7AA 1JEGA 1H92A 2JT4A 4A63B 1ZUYA 2GNCA 1SRLA 1RLQC 4JJCA 1NG2A 2CH4W 1QWFA 2FRYA 3M0TA
chains in the Genus database with same CATH superfamily
2AZVA 5GAN4 1VQ8A 1BB9A 5FWBA 3REAB 2EJFA 3M0UA 1GBQA 3CCLQ 3C95A 1BU1A 3CXCA 2X3XD 4GY5A 1XQHA 5LJ5f 2AHJB 1Y0MA 2CP6A 4M75C 2A0FB 4OMFB 3VS7A 4RTZA 3A98A 3G4ST 2DZCA 4JS4A 2RJEA 1QVPA 2FPFA 2FZKB 2LX7A 1KD1U 5GAMe 5LJ5j 3EG9A 4KGVB 1VQ5A 1VYTA 4HA8A 1VQPT 4OMLA 1OZ2A 1SRMA 3H6ZA 2V8JA 4PNOA 2EPDA 5GAN2 3M59A 3KFVA 2C06A 1BI2A 1LPLA 1KG1A 1HYOA 5KYYA 2OTLA 3JCMP 3QWYA 4PJOC 3GBQA 1ZSGA 4FSXA 4F7UF 1Y57A 2KROA 4JJDA 2GCXA 2V1RA 4OB0B 1VQKT 3EFSA 1VQ6T 2HBPA 3ME9A 3OYLA 1K8AC 2F1LA 5GJWB 1K0SA 1RABB 2E10A 5HY6A 3P8HA 2B8AA 1B34B 1GCQC 5A0LA 3E9FA 3VRYA 3VS2A 5KH6A 2ABLA 5KYUB 2LCCA 2AKKA 5LL6S 4AMCA 4LDUA 1N8RC 1E6GA 1VQ9T 3RMSA 5DLQE 4EMKB 5J39A 2M0YA 3A8GB 2CUDA 4QQ6A 1K8AR 2BZYA 1SPKA 2VC8A 2FVUA 5LJ5g 1U8RA 2QQSA 2JS0A 3FC3A 3RR6A 2OAUA 1C1AA 1ZLMA 2J6OA 1ZSZA 3S3MA 3E1SA 2XG8D 1GFDA 3PT9A 3MEWA 2QGGA 5IHKA 1N8RR 2K2VA 1M3AA 2PTKA 3CQTA 1PRMC 4PJOB 3P8DA 1GRIA 4XU3A 1Y96B 2DETA 3H9NA 1BI3A 1T0JA 1RAEB 1SKUB 1JXMA 4XAXB 2BZXA 2K6DA 2BZ8A 1C6VX 2O9SA 5L8RE 1UHFA 4PJOD 5DM7R 4IUPA 3PGGA 4ME7A 4OMNA 2W0ZA 4E7ZA 5IN1A 3JCMh 3OYBA 3RKYA 1W6XA 2EQIA 2RA2A 1NPRA 3OS2A 3CPFA 4AG2C 2RNAA 4ZTFA 2HAXA 4F14A 3UA6A 2OTJA 2KEAA 4HKEA 4JRPA 1TS9A 3NTKA 1U1TA 2RN8A 4NL3A 4C0FA 2M1HA 1NZ9A 3MO8A 1M8VA 1H8KA 2K3BA 4M7AE 5CIUA 1M5Q1 2L5QA 2RH2A 2FYKA 2RB6A 2O4XB 2L89A 2HCKA 4C8QB 3DLMA 2XICA 4K11A 1WHKA 1VQNQ 2CZ1B 2NWMA 3PIOA 2CZ0B 2H3EB 1YITT 2X3WD 3MP6A 4JRQA 2EAYA 3QUIA 4J9IA 1PHTA 2RQRA 1WX6A 2BE7D 4J6XA 4HXJA 2LP5A 2O31A 1YJWQ 4LE9A 2XDDA 1I0CA 3WVDB 2XD0A 1MMGA 3ZEHA 7AT1B 4LUEA 1D0ZA 3SWNB 1D1BA 5GAOr 1D1AA 3EGUA 2CDTA 2DZ9A 4RG8A 2KRMA 2K5LA 1WJQA 3G4SA 4C92A 4C0DC 1VQOQ 4M7AA 4AFUC 4OVAA 1S72Q 3HSBA 2M02A 3CMEA 3M55A 5I11A 3JCMJ 2ROLA 2LJ1A 3DB3A 3M5AA 3H8ZA 4LXCA 1MGQA 4KH1B 2QTXA 1WHJA 2K3YA 4M75G 2CP7A 1GBRA 3CCRQ 3JCMf 4PLLA 1I1JA 3I9QA 4JPBW 2HBWA 1WJRA 4IUTA 3G71A 2RPNA 4B9XA 5CKDA 3F70A 2NUZA 4D6WA 1VQ6A 3LH5A 4QVCA 4J6WA 1D3BB 2LCLA 2CYZB 1M90U 1RAGB 1M1KU 3JCMb 2PNIA 2K9GA 4PJOG 4M7DB 1I81A 1XJWB 3HTRA 2MAMA 3I55T 3P8BB 3EFOB 1KQSS 4C0DB 2DLPA 1JBMA 2VASA 2OX7A 4M7DD 1U5SA 4GBQA 2J05A 4DBHA 1IO6A 2CGHA 2EGAA 3OMGA 2E41A 3PE0A 4KUDK 1PG5B 1QVFA 4JZ4A 3G1JA 2RHUA 2QXFA 4CC3A 3QHSA 1OYXA 2ZAEA 4RMOA 5FW9A 1Y71A 5IHIA 1MV0B 2NLUA 2GFUA 1K9MU 2RHXA 2YLCA 3QBYA 1VYVA 4J7IA 1WZOA 2X4WA 2FB7A 4N4HA 2YLBA 4M77B 2KAFA 4A4EA 4MDXA 3C4SA 4IURA 2RQWA 1J3TA 2DL8A 3MP8A 1TUGB 4KULA 3HFOA 4J9DA 3JCMg 3JCMe 4M77D 3QYGB 1YHQT 1UDLA 2OJ2A 1YN8A 3V7CA 3ZFJA 3JB9D 4FL6A 5AYFA 3ZBDA 4C92F 1E6HA 4UC4A 2VGNA 4M7AF 2A7YA 2FPEA 2YUOA 4QVZA 1I07A 1OZ3A 3VUZA 1ZX6A 3UT1A 1NJIU 3X28B 1VIEA 3I56T 3HP9A 1VOMA 2JVVA 3EG1A 2FPDA 2YT6A 4XTYA 2RO0A 1BIAA 4LD9K 1HXDA 4PJOE 2D8HA 3INZA 1AEYA 2V8KA 2RMOA 5GAOn 1B34A 1WIEA 3L2WA 1EFNA 3WXMB 4OGEA 1VQLT 2PVDB 1PC0A 1O75A 1QCNA 1KQSP 3FRNA 1Q86R 5KYUA 2DYBA 2XHCA 4DBFA 2E6NA 4J9GA 3PMTA 2KRSA 1BCMA 3L2ZA 5LJ3j 3EHQA 2KBTA 4EMKA 3M56A 4BY6B 3OYIA 1WPYA 1VIFA 3G6ET 1BKBA 4LUDA 5FU7B 4J9BA 4XTWA 1BCOA 3JB9H 4LDXA 2X4XA 3FB9A 2EVRA 1OULA 2RHIA 4Z02A 3OS0A 1O9SA 1NEBA 1UUEA 4J9FA 5L23A 1Q82C 4L5GA 3C94A 1Y96A 4RUGA 2ECZA 1F1BB 4DOVA 1IB8A 4DQ2A 4Y91A 3EGDB 1UFFA 2KXCA 2H8HA 3RKWA 3JCMd 4A4HA 2MCNA 4FIBA 5GAMh 4HT8A 2F5TX 3M0RA 2ZPEB 1TUCA 1JEGA 2JT4A 4A63B 1ZUYA 1SRLA 2CH4W 3I55A 3OBYA 2VYTA 1JJ2A 3CMAT 4CI0C 1Q95G 3L2UA 1YBYA 1U1SA 2YUQA 2E12A 2JMAA 5GMKl 1QVGA 1TU0B 2K5FA 3LGFA 4C8QA 1VQ7T 1K76A 1UGPB 2DEUA 2ZGWA 5FROA 1Y07A 4HT9A 2O88A 2E5KA 1QVFS 4AFQC 1B7TA 2OTJQ 1AWOA 4J9HA 3X20B 4OMOA 2DA9A 1FMVA 4JLGA 3E19A 1D0XA 1M1FA 3S3NA 3FIFA 3VU3C 3MCAB 3C12A 5GANe 1SG5A 1WA7A 3QJYA 2KE9A 2DL4A 3OSSC 4E7IA 1M1KR 3SWNA 2DE0X 2COYA 4BE0A 3M58A 3OW2S 1JU5C 1YHQA 1RI0A 1FX7A 1Q7YU 3VV0A 2CT3A 2IVWA 1YWOA 4Z88A 3QDFA 1Q81C 3NTHA 4PLIA 3T9NA 4E6RA 2QQAA 2VUBA 1ACMB 2P0KA 1JXOA 2E4HA 3I56A 4PJJA 1M30A 5GAMf 2XU8A 1UGRB 2HL5C 1NBEB 1AZEA 5J26A 3UPUA 1W2BP 3CMEQ 2CSIA 4PJOF 3QIIA 1QQJA 1ARKA 2KRNA 2K2MA 3MKDA 4E7KA 5GAMj 4ESRA 4PFOA 5D6WA 2EQMA 4DOWA 2FZCB 1X27A 4JLIA 1VQLA 3A8OB 4M77E 2JN0A 1LCKA 1YJNT 4KRTA 2EBPA 1MHNA 4M7DA 1KFZA 2KNBB 1I5OB 3G71Q 1WQ7A 3BY7A 3EFOA 1I8FA 4MZPA 2EQJA 2QQBA 4FYXB 4EMGA 1B07A 2DKGA 1AWWA 5ECAA 2DXUA 4MDWA 4J5YA 3RUXA 4EIKA 2FL7A 4MMLA 2E65A 4ZN3A 1K4US 3O5ZA 3CCJT 3I5SA 2LNHB 3EG0A 3EG2A 1NJIR 4QW2A 4HCZA 4RTYA 1M8MA 2VV5A 1IGUA 1YI2A 3RIRA 3A8LB 3RERA 4HCBA 3ASKA 1WXTA 1SHGA 2RK2A 4M77A 1X6BA 2DIGA 4JJNK 3CC2T 3OW2P 4OMPA 1OI1A 2F5KA 4M4ZA 3EFRA 3CCST 2CZ6B 4OB3B 3REBB 1AZGB 1TH7A 2DIQA 1VQ4Q 2EYZA 2EIFA 4RTXA 5GAMg 4NL2A 5FRMA 1XOVA 1JQQA 1GL5A 1K0XA 1ZHIA 2X9HA 3CMAA 3QXEB 5GAN5 4HCKA 4II1A 2HZYA 4PKCC 4XTVA 3CD6T 1N6AA 1PD1A 3KBGA 1VQ7A 2JNGA 4AFSC 1UECA 3V8JA 4KH0B 1G3YA 2CP0A 1QVGS 3QZ5B 1VYUA 5GMKm 4A53A 1V29B 2QGFB 1OU8A 5CK9A 5FU6B 3I35A 3UDCA 5IHNA 1G3WA 3PVLA 2JJ9A 3U23A 1GXIE 1M3BA 3L2RA 1PNJA 1BK2A 4X34A 4BACA 3VS1A 3C0CA 5A0GA 1TXQA 2DTHA 5A2QE 1A0NB 6AT1B 2YSQA 1UTIA 4M75B 2JOYA 3META 2DBKA 3H0IA 3KXTA 2E6ZA 3HL8A 4J7FA 4M7DF 4M75D 2ZPFB 2G3RA 4J9CA 1EZZB 2MWPA 3CCUA 4ZTJA 1KQ1A 2MK5A 2ZZDA 1MMDA 3JCMW 1BYMA 1HD3A 2DVEA 1TWBA 1VQMA 2CH4A 1ZQ1A 2RJFA 2MF2A 3NPFA 3CCLT 4N4IA 2COZA 4R56A 1VA7A 1UEBA 3VUBA 2R5MA 2LQKA 1JO8A 1AVZC 2SEMA 2FG0A 3R6NA 1MMAA 3OBWA 2QA4A 2KQWA 5GAMd 1K73C 2KSSA 4M77F 3SEMA 4PJNA 3JB9F 3CCQA 2JM8A 2J6KA 3CCVQ 2EYXA 1LJOA 1ZA1B 1SSHA 2QK0A 2HDAA 2COWA 4N0AC 1WHMA 3Q1JA 3D7SB 1K73R 4PFZA 2AZSA 2EFIA 1KSWA 1MNDA 1AWJA 2M9UA 3CCJA 2WSFE 2P84A 2DXCA 5I2SA 2K4YA 2LNVA 1M2OA 2A08A 2KMTA 1WXBA 2MIOA 2D0NA 2EJ9A 2HEQA 3OYAA 2L8DA 1X2QA 3ULRB 4KT0E 3BDUA 4M78C 4LN2A 3CC2A 3TEEA 2D9TA 3CCSA 2D1XA 3CXCS 5I2MA 1Z9QA 4E7SA 2LCSA 5IXFA 3I5RA 1QMCA 1WYXA 4BI8B 4E7JA 4NOYA 3AT1B 3LW5E 4P5NA 1VQPA 2JZ2A 3ZL7C 1OX9A 4DBQA 4J8OA 4FU6A 3OYMA 4LDWA 2HQEA 3OS1A 1YFNA 1PKSA 5CVIA 1G8XA 1IGQA 2EWNA 4JRIA 4A4KA 1KC8U 3CD6A 4C5EA 1Q82U 1YIJQ 1UGQB 1RAFB 1WHGA 1RLPC 1YHQQ 2KY9A 3JRZA 5KCOA 5IXBA 2PZ1A 1VQKA 1MMNA 3CPWA 3SFMA 1D09B 5HK0A 4IUVA 4XTXA 3VYHB 4V2SA 2XDBA 3S6WA 5IAYA 5HKCA 3CBMA 4FW1A 2LMJA 4BUGA 3OY9A 3EH2A 4M78B 3FJ5A 1UJ0A 4FCYA 3I56Q 1VQ9A 2DYIA 1KD1R 4FYYB 4X9DA 4M78D 2MOXA 3THKA 2QAZA 3HRSA 3CCMQ 2Y4XA 1IHWA 2Y90A 1YJ9Q 4RTUA 2F69A 3L1AA 1VQLQ 2L3QA 2O01E 4BDZA 5J3BA 4ELYC 2CT4A 2NUPA 1CKBA 4OGCA 3MEUA 3BE3A 4WTOB 1M3CA 2E5QA 3J80E 1H92A 5GANh 3OMCA 3HPWA 1RLQC 5CKBA 3CXCP 4BE2A 2X51A 2FRYA 5CKFA 2J7IA 2DTIA 3A5ZB 1D1CA 2EYQA 1OOTA 2ROTA 2Y4YA 4MMKA 2IPOB 1VQOT 2KK4A 1I5LA 2JM9A 2GQVA 1S72T 5GAOl 5FRNA 3RESA 2QASA 1EIFA 1YI2Q 1VQ8Q 3A8HB 4IIMA 3N5BB 4M75E 5C6SA 3A1PA 4OB1B 1X6GA 3GF5A 2K57A 4F04B 4XQ3A 3VS3A 1PWTA 1QCOA 2ENMA 1N5ZA 1WI7A 2JS2A 1HJDA 1WXUA 1BI1A 2RK1A 3CCRT 4GLMA 1X6OA 3LWHA 1Q86C 1YITA 5A0DA 4RKUE 1VQ5Q 1TTHB 1ABOA 2P0PA 3VS0A 4E7LA 3SB2A 1G5VA 2PVOB 3CMAQ 1ZSZC 5CAIA 2F2WA 2YWWA 1NPPA 2GGRA 4LNPA 1KIKA 2YDLA 5KYYB 4AT1B 2DXBA 2C0OA 2OTLQ 1SEMA 1W4SA 2QTVA 3QWXX 2PUOB 3SHWA 2K3XA 1S1NA 1UE9A 2XIDA 4M75A 4C5GA 4EMHA 1N27A 1PKTA 4B6MA 1YCSB 4F7UG 4C0ZA 5GAN7 5GANf 3X25B 2P4RA 3RBBB 4M78G 3H41A 2FHDA 1RAHB 2PQWA 5AT1B 3L42A 3RKXA 5GANj 4PJOA 1PRLC 4FT4A 3QO3A 2GBQA 1DJ7B 3DB4A 2H3JA 2RI5A 2V8IA 2YUPA 4Z89A 2P0QA 5EG2A 4CC2A 1B3QA 3LX7A 1ZSZB 3CPWS 3CCUQ 2VB6A 3V7SA 1H3HA 4QQGA 2CP3A 4F16A 4JZ3A 1GCQA 3VRZA 2RI2A 4XTZA 3OYEA 2L3SA 1TSFA 1VQMQ 3BDLA 3RDVA 2QI2A 1X43A 2A28A 2L0AA 4MZTA 4PK4A 2A37A 4C92C 4RCBA 1QKWA 2DVJA 4M7AC 1M90C 2QA4Q 1KC8R 2O4XA 2EW3A 3PMIA 1MUZA 1T3SA 2HD0A 1VUBA 1M1KC 1K1ZA 1YCYA 1W1FA 2DX1A 2QQ9A 4ZN1A 1Z9ZA 2XKOC 3R6OA 1ZBXA 5KYWB 2EGEA 1K8AU 3UF4A 4JUVA 3CCQQ 2ZCFB 3RMQA 5GJVB 2RJDA 4MZMA 1WQWA 4D8KA 4E7HA 4ZGDB 1GFCA 2HSPA 5GANg 2LDMA 4ELZC 1M90R 1N8RU 3TCJA 4N4GA 4F7UE 3M53A 4O6JA 4LD6A 4ORZA 3MHXA 2EKOA 1S72A 4M78E 2DEQA 1K9MC 3UA7A 4F17A 4M75F 5GAOm 2LJ3A 2EYYA 2NUTB 2LT1A 3CCSQ 4VUBA 3OSVA 3CCRA 5EC7A 3OYJA 2JW4A 4XK8E 5KCHA 4QT7A 1V76A 3G4SQ 1QWEA 2FEIA 3H0HA 4J6YA 3TSZA 2A36A 1QP3A 3O8VA 5LJ5h 4DBRA 2ZPIB 1K9MR 1VQPQ 3A8MB 3E9GA 3MEAA 1SF9A 2V1QA 3OS5A 1D3BA 4RTWA 4EPCA 2RQTA 1BBZA 2VWFA 1JB0E 4KUIA 4Y92A 2LT4A 2YHTA 3PVQA 4R55A 5KE3A 2LC4A 1AD5A 1NJIC 1TG0A 5FWCA 2ZPBB 3JSCA 5DY9A 1VQKQ 1U3OA 2BE9B 2KVQG 2VVKA 4BI4A 2IIMA 1VQ6Q 3G6EA 3VS5A 3FJPA 1UG1A 3GNGA 1QVFP 1MNEA 1NEGA 2YXYA 2D8JA 2LJ0A 2HMAA 2BIVA 2DD4A 1NM7A 2M16A 2OTJT 3FEOA 2QEXT 1YNZA 2KR3A 2R58A 1VQ9Q 1AT1B 1CKAA 4PJMA 4BI3A 2X35A 3SDZA 5GMKe 5GANd 3UATA 2XK0A 4BDYA 4E2FB 3GP8A 8AT1B 3LH0A 1AHJB 1YWPA 3URGA 1MV3A 2YRDA 3CEYA 3OYFA 4FYVB 5CQXA 3OYYA 2C0IA 3CC7T 5CCAA 4A54A 3V8LA 2A3LA 4CC4B 1QKXA 1PCXA 1QW1A 4FM4B 3KUFA 5GMKi 5HK3A 3CCET 2CP2A 1PSFA 3M9QA 3QZ9B 5D7UA 2LX9A 1IXDA 4RTVA 2D6FA 1JJ2S 1KQ2A 3DKMA 4RCCA 4EMKC 2JTEA 2KYBA 2NYSA 5GAN3 4OMMA 1FMWA 1RUWA 2ED1A 3EGXB 3CMET 2LTOA 1QP2A 1UHCA 2ATCB 4NS5A 4D8DA 2WSCE 3OYCA 2LRQA 4L59A 1OPKA 3NFCA 1QCFA 2QG9B 3VS4A 1HSQA 1X2KA 4E47A 4J83A 3TREA 1SSFA 4C92G 1IRXA 3CC4T 2V26A 2DRMA 1WDXA 4M7AG 1H641 4CC7A 1RL2A 2KYMA 1YITQ 3G71T 2MWOA 2KI7A 2XI9A 3TVTA 1KHIA 4M78F 3M0SA 2OI3A 2BKDN 2DL3A 4OF1A 1BIBA 2YRCA 2GFAA 4QQDA 2PU9B 4RG2A 3JCMQ 4Z8AA 1KQSA 5GAOq 1AWXA 2L3PA 1SHFA 4C8QC 1Q7YC 1WLPB 5CKEA 2VKNA 3EGDA 5LJ5e 3OB9A 4OP0A 2WACA 3QYHB 2EQUA 1VQ4T 1Y7XA 2FO0A 4XTUA 2JMCA 2AT1B 3V7RA 4JDSA 1YJNA 3LGLA 3MJXA 2HKQB 2RQUA 2CS7A 1Q7YR 1JJ2P 1NLOC 4A4GA 3SWNC 4ATOA 2R57A 3GLXA 4C5HA 2QYZA 2GNCA 1QVGP 2GF7A 4JJCA 1Q86U 1WHHA 4EDUA 2I2LA 2CP5A 1P92A 3WVEB 1R77A 4KGZB 2QDLA 3OYNA 4ANJA 3JCMV 2CUBA 2QEXA 2D0QB 3QSUA 5HCKA 3DLLA 3OA6A 5KYWA 4C92E 1R0CB 3I55Q 2KDSA 2ZPGB 1RAAB 3AHUA 3OYHA 3RNJA 2RJCA 3M57A 4A4FA 3TSWA 5IT9E 4QKUA 2EJGA 2DNUA 3HHTB 2ED0A 4PL6A 3CC7A 5KYXB 1K9AA 4C8QD 2J6FA 2RD1A 4ZGJB 2J06A 1X01A 4TVRA 3OYGA 3GIBA 2O2OA 2JXBA 2SRCA 2DJQA 1OU9A 2KT1A 3JV3A 3CCEA 1NYGA 3MP1A 4Y28E 4LDYA 3MPUB 3CBOA 1WHLA 1M2VB 1N9RA 2LQWA 4M7DC 1UGSB 2NUTA 3QG1A 1XNIA 3NTIA 4X9CA 1IREB 4BE1A 2HSEB 3JB9I 3QJ6A 5LJ5d 1E7OA 2DMOA 1KD1C 3NHNA 5C0MA 2PUKB 2DD5A 2HKNA 2DBMA 1GCPA 1RACB 4F7UB 1G3TA 3JCMX 4L6V5 1H3ZA 3E2UA 4O5VA 2BUDA 3CC4A 2DJZA 3HRUA 4X1VA 2WSEE 1ABQA 3JCMc 3CCVT 4FT2A 1ZBJA 2R5AA 4M77C 2X4YA 4FYWB 1X75C 1NE8A 1W2BA 2FZGB 3TQ7P 1OX8A 3X26B 5KE2A 3SD4A 1TOVA 1KHCA 1VQNT 5GAN6 2RF0A 1M4ZA 2DAQA 1LVKA 1BI0A 2RQVA 2E3HA 2AIRB 2CREA 2M51A 1D0YA 3L2QA 5LJ3h 3TU4K 1YJWT 2GTOA 4JS5A 3CCLA 1EX4A 4Q5WA 2P4TA 3G6EQ 4KGXB 2HNIA 2BTTA 4B9WA 2DRKA 3UWNA 2L2PA 4RTTA 2YUNA 5CR2A 2L3RA 3FDRA 1VQ4A 3HFNA 4R0KA 1KK7A 3GPLA 4QVDA 1RI9A 4IIOA 3GOXA 1AOJA 1UGVA 2LQ8A 2B86A 1Q81U 2F2XA 2E70A 4IUUA 1X69A 4C8QG 3EAEA 1QLYA 1ZUUA 2RI3A 3OW2A 5D6YA 1YIJT 2DL7A 4AG1C 2DPPB 3G7ZA 3V8KA 4BY6C 2EYWA 3EG9B 3LLRA 5FU7C 4ZGEB 3EGXA 1UJYA 1T0HA 3CBPA 3QDRB 2ZPHB 2VGMA 1VQ7Q 3OYDA 1CSKA 2XDPA 2EGCA 1R8OB 2LZ6B 1G2BA 1R0BG 2HQXA 3NGPA 4JRKA 3EG3A 1M1GA 3CCMT 1YJ9T 5LJ3f 1I4K1 1W70A 3OQ5A 2DFUA 4XU1A 2HQHA 5M9OA 2IG0A 3H0FA 1RAIB 4XU0A 5DLOA 5GMKh 4BB7A 1M27C 1OEBA 3IQLA 2AK5A 4JJBA 5I22A 2F2VA 2E3IA 4KBMB 4DEXA 4J9EA 1ZA2B 3M0QA 1KJWA 1LNXA 4XU2A 4WCIA 2M0OA 4M7DG 1KC8C 4GLKA 3NMZC 4C8QE 3ER0A 5D6XA 3VJPA 1YI2T 1FMKA 1VQ8T 3CCVA 2AKLA 4IKFA 2LVMA 1WJSA 2W10A 2RM4A 1C0MA 1IHVA 3GNFB 4OB2B 1N9SA 2Z0WA 1JRIA 5CQYA 8ATCB 3M0PA 1W2BS 2I0NA 3PFSA 1VQNA 3JAME 3M4GA 3VYGA 1Q82R 4FW2A 2DERA 2MMPA 2MYSA 3BFMA 3VS6A 1VQ5T 1YJNQ 4HVVA 1T3LA 5CKHA 4IUQA 1ZUKA 1YJWA 4M77G 2DM1A 2QDYB 4OMQA 5LJ3g 5LJ3e 2XMFA 3JB9J 4FSSA 4HVWA 2FRWA 2O9VA 3JB9G 2DILA 3L2VA 2OTLT 2MPXC 5FLXE 4DA4A 2E64A 5I21A 3EHRA 1NYFA 5KYXA 3CCJQ 1VQOA 2QEXQ 1M9SA 3LWIA 4DEYA 2RHYA 4WF2A 2KXDA 1UB4A 3M54A 2DL5A 2JUFA 1PD0A 1G3SA 4BD3A 1M2VA 3LYIA 1YIJA 1NLPC 1HK9A 2YRVA 3CC2Q 5GMKj 1FXXA 4N0AA 4C92B 2K5IA 3CC7Q 2KGTA 2DO3A 2HL3A 3FLGA 2C0TA 1FYNA 3MEVA 4M7AB 3PNWC 2JTFA 3EH1A 2OAWA 2E1HA 1WFWA 1RADB 3QPHA 1TUDA 4M7DE 1WGSA 2G6FX 3BW1A 3CPWP 4C92D 3CCEQ 4LDVA 4M7AD 3J7AF 2DK3A 2EKHA 3CCUT 2CZ7B 1K73U 2MI6A 4F7UA 2DXTA 1G83A 4AFZC 5KYNA 2VXFA 1WNLA 3CD6Q 1FWZA 2DF6A 2DTOA 2K79A 1VQMT 2CSQA 4M78A 2RHZA 2ESWA 3PIPA 4PJLA 2LQNA 1IZ6A 1Q81R 2PVGB 3J81E 4C0GA 4PFPA 3CCMA 1YJ9A 4HCCA 2QA4T 3PTAA 2GQIA 4HVUA 4YTLA 1YP5A 2JTMA 2VXEA 2CKKA 3CC4Q 1OPLA 4C5IA 3QKJA 4ZNXA 3OYKA 3CCQT 1PM3A 1OQKA 5LJ3d 4CRIA 5IH2A 2KT8A 1PSEA 3S3OA 2GTJA 3HKSA 3X24B 5GAOp 1XTDA 2EQKA 3VKIA 5GAN8 1OV3A 1V1CA 1U06A 1LOJA 2X4JA 2QQRA 2K7AA 3HRTA 3M4YA 9ATCB 5CO7A 5FU6C 1NG2A 2NUPB 4C8QF 1QWFA 3M0TA
chains in the Genus database with same CATH topology
2AZVA 2J7IA 2QDLA 1BB9A 5FWBA 3REAB 2CUBA 1OOTA 2ROTA 1GBQA 2YUQA 2JMAA 3M0UA 5HCKA 1BU1A 1K76A 2X3XD 2JM9A 1Y0MA 2O88A 2E5KA 4AFQC 3VS7A 3RNJA 4RTZA 1AWOA 4IIMA 3TSWA 4J9HA 3A98A 1X6GA 2FPFA 4OMOA 2LX7A 2DA9A 3VS3A 1PWTA 2DNUA 2ENMA 1N5ZA 1WI7A 2ED0A 1VYTA 2JS2A 1HJDA 4OMLA 1K9AA 1WXUA 4GLMA 2J6FA 1WA7A 1SRMA 2J06A 2KE9A 2DL4A 2EPDA 2O2OA 2JXBA 2SRCA 2DE0X 2DJQA 3KFVA 2KT1A 3JV3A 1NYGA 3QWYA 1ABOA 3VS0A 1JU5C 3GBQA 2LQWA 1ZSGA 2F2WA 2GGRA 4LNPA 1KIKA 2CT3A 2YDLA 1Y57A 1YWOA 2KROA 4JJDA 4Z88A 2V1RA 2C0OA 1SEMA 5GJWB 4E6RA 1K0SA 3QWXX 1E7OA 3SHWA 2DMOA 1S1NA 1UE9A 3NHNA 1GCQC 3VRYA 2DBMA 3VS2A 1JXOA 1PKTA 2ABLA 1GCPA 1YCSB 1M30A 2AKKA 1E6GA 1AZEA 2CSIA 2M0YA 2P4RA 2CUDA 3RBBB 3H41A 2KRNA 4X1VA 2K2MA 1ARKA 1ABQA 4ESRA 1ZBJA 2BZYA 1SPKA 1X27A 2JS0A 1PRLC 1LCKA 1ZLMA 2GBQA 4KRTA 2EBPA 2J6OA 1KFZA 2KNBB 1GFDA 2YUPA 5IHKA 4Z89A 2PTKA 1M3AA 3CQTA 1PRMC 4CC2A 1GRIA 1T0JA 2RF0A 1B3QA 1B07A 1JXMA 5ECAA 1AWWA 2BZXA 1H3HA 2RQVA 2K6DA 2BZ8A 2CREA 2O9SA 2M51A 1UHFA 4F16A 4JZ3A 1GCQA 4EIKA 3VRZA 4OMNA 2W0ZA 2GTOA 1K4US 2L3SA 3O5ZA 3I5SA 2LNHB 3EG0A 3EG2A 1W6XA 2EQIA 1X43A 4AG2C 4RTYA 2RNAA 1M8MA 2BTTA 2A28A 2L0AA 2DRKA 2L2PA 4RTTA 3UA6A 4F14A 2YUNA 2KEAA 2A37A 4R0KA 2RN8A 1QKWA 1WXTA 2DVJA 1RI9A 4IIOA 1SHGA 1H8KA 2EW3A 1MUZA 1T3SA 2K3BA 1X6BA 1AOJA 1K1ZA 4OMPA 4M4ZA 1W1FA 1UGVA 2DX1A 2B86A 1Z9ZA 2F2XA 3REBB 1AZGB 2HCKA 2EGEA 1X69A 2EYZA 3UF4A 4K11A 4RTXA 5GJVB 2NWMA 2X3WD 1QLYA 1ZUUA 1XOVA 4D8KA 1JQQA 2DL7A 1GL5A 1GFCA 2HSPA 4AG1C 1K0XA 4J9IA 1PHTA 2RQRA 1WX6A 2EYWA 4HCKA 4HXJA 2LP5A 2O31A 4LE9A 1I0CA 4ORZA 4AFSC 1UECA 1UJYA 1T0HA 4LUEA 1VYUA 3EGUA 2CDTA 2KRMA 3UA7A 4F17A 3I35A 2LJ3A 5IHNA 3PVLA 2EYYA 3U23A 4AFUC 1M3BA 1PNJA 1CSKA 1BK2A 5EC7A 2JW4A 2EGCA 2LZ6B 3VS1A 3C0CA 5I11A 4QT7A 1G2BA 2ROLA 2LJ1A 1QWEA 3NGPA 2FEIA 1A0NB 3H0HA 3EG3A 3TSZA 2A36A 2YSQA 1UTIA 2DBKA 1GBRA 3H0IA 1I1JA 3I9QA 4JPBW 1W70A 2HBWA 2V1QA 4RTWA 2RQTA 1BBZA 2VWFA 3H0FA 2RPNA 4J9CA 1M27C 1OEBA 2NUZA 3LH5A 4Y92A 3PVQA 3IQLA 2AK5A 4JJBA 5I22A 2F2VA 1AD5A 1TG0A 5FWCA 4DEXA 4J9EA 1HD3A 3M0QA 1KJWA 2PNIA 1U3OA 2CH4A 2K9GA 2VVKA 2IIMA 4WCIA 3NPFA 3VS5A 1UG1A 3NMZC 1NEGA 1VA7A 2D8JA 2LJ0A 2DLPA 1JO8A 1AVZC 2SEMA 2FG0A 1FMKA 1NM7A 2AKLA 3R6NA 1U5SA 4GBQA 2J05A 1IO6A 2W10A 1YNZA 2KR3A 2EGAA 1CKAA 3PE0A 3SEMA 4JZ4A 4CC3A 3UATA 3M0PA 2I0NA 2JM8A 2J6KA 5FW9A 5IHIA 2EYXA 1MV0B 1YWPA 1SSHA 2HDAA 1MV3A 3VS6A 1VYVA 2C0IA 4CC4B 4HVVA 1T3LA 1QKXA 1ZUKA 2AZSA 1KSWA 1AWJA 2DM1A 2RQWA 4OMQA 1J3TA 2DL8A 2XMFA 4FSSA 4HVWA 2FRWA 2O9VA 4J9DA 2A08A 1WXBA 2DILA 2MIOA 2D0NA 2HEQA 1UDLA 4RTVA 3EHRA 2OJ2A 1YN8A 1X2QA 3ULRB 1NYFA 1E6HA 2JTEA 4LN2A 4DEYA 2FPEA 2YUOA 2D1XA 2KYBA 4OMMA 1Z9QA 2KXDA 1RUWA 1I07A 2ED1A 2DL5A 1UHCA 2LCSA 1ZX6A 4D8DA 5IXFA 3I5RA 1OPKA 1WYXA 1QCFA 3VS4A 1HSQA 1NLPC 1X2KA 3ZL7C 3EG1A 2FPDA 2KGTA 2YT6A 2C0TA 1FYNA 2DRMA 1WDXA 2OAWA 1WFWA 1PKSA 2D8HA 1TUDA 4CC7A 1AEYA 2KYMA 2G6FX 2RMOA 1WIEA 1EFNA 2EKHA 3TVTA 1RLPC 3M0SA 2OI3A 2DYBA 2DL3A 4J9GA 1G83A 2KRSA 4AFZC 5IXBA 2PZ1A 2DF6A 3EHQA 2KBTA 2K79A 2CSQA 2ESWA 4Z8AA 4LUDA 4J9BA 2LMJA 2LQNA 1AWXA 2L3PA 3FJ5A 2EVRA 1UJ0A 1SHFA 1NEBA 1UUEA 1WLPB 2VKNA 4J9FA 2GQIA 4HVUA 5L23A 1YP5A 4RUGA 2ECZA 2MOXA 3THKA 1OPLA 4ZNXA 2FO0A 2JMCA 4RTUA 5IH2A 1UFFA 2KT8A 2KXCA 2H8HA 2GTJA 2MCNA 2L3QA 2RQUA 2CT4A 1OV3A 1CKBA 1NLOC 1V1CA 1U06A 3M0RA 1M3CA 1TUCA 2K7AA 1JEGA 1H92A 2JT4A 4A63B 1ZUYA 2GNCA 1SRLA 1RLQC 4JJCA 1NG2A 2CH4W 1QWFA 2FRYA 3M0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZV A;  2J7I A;  2QDL A;  1BB9 A;  5FWB A;  3REA B;  2CUB A;  1OOT A;  2ROT A;  1GBQ A;  2YUQ A;  2JMA A;  3M0U A;  5HCK A;  1BU1 A;  1K76 A;  2X3X D;  2JM9 A;  1Y0M A;  2O88 A;  2E5K A;  4AFQ C;  3VS7 A;  3RNJ A;  4RTZ A;  1AWO A;  4IIM A;  3TSW A;  4J9H A;  3A98 A;  1X6G A;  2FPF A;  4OMO A;  2LX7 A;  2DA9 A;  3VS3 A;  1PWT A;  2DNU A;  2ENM A;  1N5Z A;  1WI7 A;  2ED0 A;  1VYT A;  2JS2 A;  1HJD A;  4OML A;  1K9A A;  1WXU A;  4GLM A;  2J6F A;  1WA7 A;  1SRM A;  2J06 A;  2KE9 A;  2DL4 A;  2EPD A;  2O2O A;  2JXB A;  2SRC A;  2DE0 X;  2DJQ A;  3KFV A;  2KT1 A;  3JV3 A;  1NYG A;  3QWY A;  1ABO A;  3VS0 A;  1JU5 C;  3GBQ A;  2LQW A;  1ZSG A;  2F2W A;  2GGR A;  4LNP A;  1KIK A;  2CT3 A;  2YDL A;  1Y57 A;  1YWO A;  2KRO A;  4JJD A;  4Z88 A;  2V1R A;  2C0O A;  1SEM A;  5GJW B;  4E6R A;  1K0S A;  3QWX X;  1E7O A;  3SHW A;  2DMO A;  1S1N A;  1UE9 A;  3NHN A;  1GCQ C;  3VRY A;  2DBM A;  3VS2 A;  1JXO A;  1PKT A;  2ABL A;  1GCP A;  1YCS B;  1M30 A;  2AKK A;  1E6G A;  1AZE A;  2CSI A;  2M0Y A;  2P4R A;  2CUD A;  3RBB B;  3H41 A;  2KRN A;  4X1V A;  2K2M A;  1ARK A;  1ABQ A;  4ESR A;  1ZBJ A;  2BZY A;  1SPK A;  1X27 A;  2JS0 A;  1PRL C;  1LCK A;  1ZLM A;  2GBQ A;  4KRT A;  2EBP A;  2J6O A;  1KFZ A;  2KNB B;  1GFD A;  2YUP A;  5IHK A;  4Z89 A;  2PTK A;  1M3A A;  3CQT A;  1PRM C;  4CC2 A;  1GRI A;  1T0J A;  2RF0 A;  1B3Q A;  1B07 A;  1JXM A;  5ECA A;  1AWW A;  2BZX A;  1H3H A;  2RQV A;  2K6D A;  2BZ8 A;  2CRE A;  2O9S A;  2M51 A;  1UHF A;  4F16 A;  4JZ3 A;  1GCQ A;  4EIK A;  3VRZ A;  4OMN A;  2W0Z A;  2GTO A;  1K4U S;  2L3S A;  3O5Z A;  3I5S A;  2LNH B;  3EG0 A;  3EG2 A;  1W6X A;  2EQI A;  1X43 A;  4AG2 C;  4RTY A;  2RNA A;  1M8M A;  2BTT A;  2A28 A;  2L0A A;  2DRK A;  2L2P A;  4RTT A;  3UA6 A;  4F14 A;  2YUN A;  2KEA A;  2A37 A;  4R0K A;  2RN8 A;  1QKW A;  1WXT A;  2DVJ A;  1RI9 A;  4IIO A;  1SHG A;  1H8K A;  2EW3 A;  1MUZ A;  1T3S A;  2K3B A;  1X6B A;  1AOJ A;  1K1Z A;  4OMP A;  4M4Z A;  1W1F A;  1UGV A;  2DX1 A;  2B86 A;  1Z9Z A;  2F2X A;  3REB B;  1AZG B;  2HCK A;  2EGE A;  1X69 A;  2EYZ A;  3UF4 A;  4K11 A;  4RTX A;  5GJV B;  2NWM A;  2X3W D;  1QLY A;  1ZUU A;  1XOV A;  4D8K A;  1JQQ A;  2DL7 A;  1GL5 A;  1GFC A;  2HSP A;  4AG1 C;  1K0X A;  4J9I A;  1PHT A;  2RQR A;  1WX6 A;  2EYW A;  4HCK A;  4HXJ A;  2LP5 A;  2O31 A;  4LE9 A;  1I0C A;  4ORZ A;  4AFS C;  1UEC A;  1UJY A;  1T0H A;  4LUE A;  1VYU A;  3EGU A;  2CDT A;  2KRM A;  3UA7 A;  4F17 A;  3I35 A;  2LJ3 A;  5IHN A;  3PVL A;  2EYY A;  3U23 A;  4AFU C;  1M3B A;  1PNJ A;  1CSK A;  1BK2 A;  5EC7 A;  2JW4 A;  2EGC A;  2LZ6 B;  3VS1 A;  3C0C A;  5I11 A;  4QT7 A;  1G2B A;  2ROL A;  2LJ1 A;  1QWE A;  3NGP A;  2FEI A;  1A0N B;  3H0H A;  3EG3 A;  3TSZ A;  2A36 A;  2YSQ A;  1UTI A;  2DBK A;  1GBR A;  3H0I A;  1I1J A;  3I9Q A;  4JPB W;  1W70 A;  2HBW A;  2V1Q A;  4RTW A;  2RQT A;  1BBZ A;  2VWF A;  3H0F A;  2RPN A;  4J9C A;  1M27 C;  1OEB A;  2NUZ A;  3LH5 A;  4Y92 A;  3PVQ A;  3IQL A;  2AK5 A;  4JJB A;  5I22 A;  2F2V A;  1AD5 A;  1TG0 A;  5FWC A;  4DEX A;  4J9E A;  1HD3 A;  3M0Q A;  1KJW A;  2PNI A;  1U3O A;  2CH4 A;  2K9G A;  2VVK A;  2IIM A;  4WCI A;  3NPF A;  3VS5 A;  1UG1 A;  3NMZ C;  1NEG A;  1VA7 A;  2D8J A;  2LJ0 A;  2DLP A;  1JO8 A;  1AVZ C;  2SEM A;  2FG0 A;  1FMK A;  1NM7 A;  2AKL A;  3R6N A;  1U5S A;  4GBQ A;  2J05 A;  1IO6 A;  2W10 A;  1YNZ A;  2KR3 A;  2EGA A;  1CKA A;  3PE0 A;  3SEM A;  4JZ4 A;  4CC3 A;  3UAT A;  3M0P A;  2I0N A;  2JM8 A;  2J6K A;  5FW9 A;  5IHI A;  2EYX A;  1MV0 B;  1YWP A;  1SSH A;  2HDA A;  1MV3 A;  3VS6 A;  1VYV A;  2C0I A;  4CC4 B;  4HVV A;  1T3L A;  1QKX A;  1ZUK A;  2AZS A;  1KSW A;  1AWJ A;  2DM1 A;  2RQW A;  4OMQ A;  1J3T A;  2DL8 A;  2XMF A;  4FSS A;  4HVW A;  2FRW A;  2O9V A;  4J9D A;  2A08 A;  1WXB A;  2DIL A;  2MIO A;  2D0N A;  2HEQ A;  1UDL A;  4RTV A;  3EHR A;  2OJ2 A;  1YN8 A;  1X2Q A;  3ULR B;  1NYF A;  1E6H A;  2JTE A;  4LN2 A;  4DEY A;  2FPE A;  2YUO A;  2D1X A;  2KYB A;  4OMM A;  1Z9Q A;  2KXD A;  1RUW A;  1I07 A;  2ED1 A;  2DL5 A;  1UHC A;  2LCS A;  1ZX6 A;  4D8D A;  5IXF A;  3I5R A;  1OPK A;  1WYX A;  1QCF A;  3VS4 A;  1HSQ A;  1NLP C;  1X2K A;  3ZL7 C;  3EG1 A;  2FPD A;  2KGT A;  2YT6 A;  2C0T A;  1FYN A;  2DRM A;  1WDX A;  2OAW A;  1WFW A;  1PKS A;  2D8H A;  1TUD A;  4CC7 A;  1AEY A;  2KYM A;  2G6F X;  2RMO A;  1WIE A;  1EFN A;  2EKH A;  3TVT A;  1RLP C;  3M0S A;  2OI3 A;  2DYB A;  2DL3 A;  4J9G A;  1G83 A;  2KRS A;  4AFZ C;  5IXB A;  2PZ1 A;  2DF6 A;  3EHQ A;  2KBT A;  2K79 A;  2CSQ A;  2ESW A;  4Z8A A;  4LUD A;  4J9B A;  2LMJ A;  2LQN A;  1AWX A;  2L3P A;  3FJ5 A;  2EVR A;  1UJ0 A;  1SHF A;  1NEB A;  1UUE A;  1WLP B;  2VKN A;  4J9F A;  2GQI A;  4HVU A;  5L23 A;  1YP5 A;  4RUG A;  2ECZ A;  2MOX A;  3THK A;  1OPL A;  4ZNX A;  2FO0 A;  2JMC A;  4RTU A;  5IH2 A;  1UFF A;  2KT8 A;  2KXC A;  2H8H A;  2GTJ A;  2MCN A;  2L3Q A;  2RQU A;  2CT4 A;  1OV3 A;  1CKB A;  1NLO C;  1V1C A;  1U06 A;  3M0R A;  1M3C A;  1TUC A;  2K7A A;  1JEG A;  1H92 A;  2JT4 A;  4A63 B;  1ZUY A;  2GNC A;  1SRL A;  1RLQ C;  4JJC A;  1NG2 A;  2CH4 W;  1QWF A;  2FRY A;  3M0T A; 
#chains in the Genus database with same CATH topology
 2AZV A;  5GAN 4;  1VQ8 A;  1BB9 A;  5FWB A;  3REA B;  2EJF A;  3M0U A;  1GBQ A;  3CCL Q;  3C95 A;  1BU1 A;  3CXC A;  2X3X D;  4GY5 A;  1XQH A;  5LJ5 f;  2AHJ B;  1Y0M A;  2CP6 A;  4M75 C;  2A0F B;  4OMF B;  3VS7 A;  4RTZ A;  3A98 A;  3G4S T;  2DZC A;  4JS4 A;  2RJE A;  1QVP A;  2FPF A;  2FZK B;  2LX7 A;  1KD1 U;  5GAM e;  5LJ5 j;  3EG9 A;  4KGV B;  1VQ5 A;  1VYT A;  4HA8 A;  1VQP T;  4OML A;  1OZ2 A;  1SRM A;  3H6Z A;  2V8J A;  4PNO A;  2EPD A;  5GAN 2;  3M59 A;  3KFV A;  2C06 A;  1BI2 A;  1LPL A;  1KG1 A;  1HYO A;  5KYY A;  2OTL A;  3JCM P;  3QWY A;  4PJO C;  3GBQ A;  1ZSG A;  4FSX A;  4F7U F;  1Y57 A;  2KRO A;  4JJD A;  2GCX A;  2V1R A;  4OB0 B;  1VQK T;  3EFS A;  1VQ6 T;  2HBP A;  3ME9 A;  3OYL A;  1K8A C;  2F1L A;  5GJW B;  1K0S A;  1RAB B;  2E10 A;  5HY6 A;  3P8H A;  2B8A A;  1B34 B;  1GCQ C;  5A0L A;  3E9F A;  3VRY A;  3VS2 A;  5KH6 A;  2ABL A;  5KYU B;  2LCC A;  2AKK A;  5LL6 S;  4AMC A;  4LDU A;  1N8R C;  1E6G A;  1VQ9 T;  3RMS A;  5DLQ E;  4EMK B;  5J39 A;  2M0Y A;  3A8G B;  2CUD A;  4QQ6 A;  1K8A R;  2BZY A;  1SPK A;  2VC8 A;  2FVU A;  5LJ5 g;  1U8R A;  2QQS A;  2JS0 A;  3FC3 A;  3RR6 A;  2OAU A;  1C1A A;  1ZLM A;  2J6O A;  1ZSZ A;  3S3M A;  3E1S A;  2XG8 D;  1GFD A;  3PT9 A;  3MEW A;  2QGG A;  5IHK A;  1N8R R;  2K2V A;  1M3A A;  2PTK A;  3CQT A;  1PRM C;  4PJO B;  3P8D A;  1GRI A;  4XU3 A;  1Y96 B;  2DET A;  3H9N A;  1BI3 A;  1T0J A;  1RAE B;  1SKU B;  1JXM A;  4XAX B;  2BZX A;  2K6D A;  2BZ8 A;  1C6V X;  2O9S A;  5L8R E;  1UHF A;  4PJO D;  5DM7 R;  4IUP A;  3PGG A;  4ME7 A;  4OMN A;  2W0Z A;  4E7Z A;  5IN1 A;  3JCM h;  3OYB A;  3RKY A;  1W6X A;  2EQI A;  2RA2 A;  1NPR A;  3OS2 A;  3CPF A;  4AG2 C;  2RNA A;  4ZTF A;  2HAX A;  4F14 A;  3UA6 A;  2OTJ A;  2KEA A;  4HKE A;  4JRP A;  1TS9 A;  3NTK A;  1U1T A;  2RN8 A;  4NL3 A;  4C0F A;  2M1H A;  1NZ9 A;  3MO8 A;  1M8V A;  1H8K A;  2K3B A;  4M7A E;  5CIU A;  1M5Q 1;  2L5Q A;  2RH2 A;  2FYK A;  2RB6 A;  2O4X B;  2L89 A;  2HCK A;  4C8Q B;  3DLM A;  2XIC A;  4K11 A;  1WHK A;  1VQN Q;  2CZ1 B;  2NWM A;  3PIO A;  2CZ0 B;  2H3E B;  1YIT T;  2X3W D;  3MP6 A;  4JRQ A;  2EAY A;  3QUI A;  4J9I A;  1PHT A;  2RQR A;  1WX6 A;  2BE7 D;  4J6X A;  4HXJ A;  2LP5 A;  2O31 A;  1YJW Q;  4LE9 A;  2XDD A;  1I0C A;  3WVD B;  2XD0 A;  1MMG A;  3ZEH A;  7AT1 B;  4LUE A;  1D0Z A;  3SWN B;  1D1B A;  5GAO r;  1D1A A;  3EGU A;  2CDT A;  2DZ9 A;  4RG8 A;  2KRM A;  2K5L A;  1WJQ A;  3G4S A;  4C92 A;  4C0D C;  1VQO Q;  4M7A A;  4AFU C;  4OVA A;  1S72 Q;  3HSB A;  2M02 A;  3CME A;  3M55 A;  5I11 A;  3JCM J;  2ROL A;  2LJ1 A;  3DB3 A;  3M5A A;  3H8Z A;  4LXC A;  1MGQ A;  4KH1 B;  2QTX A;  1WHJ A;  2K3Y A;  4M75 G;  2CP7 A;  1GBR A;  3CCR Q;  3JCM f;  4PLL A;  1I1J A;  3I9Q A;  4JPB W;  2HBW A;  1WJR A;  4IUT A;  3G71 A;  2RPN A;  4B9X A;  5CKD A;  3F70 A;  2NUZ A;  4D6W A;  1VQ6 A;  3LH5 A;  4QVC A;  4J6W A;  1D3B B;  2LCL A;  2CYZ B;  1M90 U;  1RAG B;  1M1K U;  3JCM b;  2PNI A;  2K9G A;  4PJO G;  4M7D B;  1I81 A;  1XJW B;  3HTR A;  2MAM A;  3I55 T;  3P8B B;  3EFO B;  1KQS S;  4C0D B;  2DLP A;  1JBM A;  2VAS A;  2OX7 A;  4M7D D;  1U5S A;  4GBQ A;  2J05 A;  4DBH A;  1IO6 A;  2CGH A;  2EGA A;  3OMG A;  2E41 A;  3PE0 A;  4KUD K;  1PG5 B;  1QVF A;  4JZ4 A;  3G1J A;  2RHU A;  2QXF A;  4CC3 A;  3QHS A;  1OYX A;  2ZAE A;  4RMO A;  5FW9 A;  1Y71 A;  5IHI A;  1MV0 B;  2NLU A;  2GFU A;  1K9M U;  2RHX A;  2YLC A;  3QBY A;  1VYV A;  4J7I A;  1WZO A;  2X4W A;  2FB7 A;  4N4H A;  2YLB A;  4M77 B;  2KAF A;  4A4E A;  4MDX A;  3C4S A;  4IUR A;  2RQW A;  1J3T A;  2DL8 A;  3MP8 A;  1TUG B;  4KUL A;  3HFO A;  4J9D A;  3JCM g;  3JCM e;  4M77 D;  3QYG B;  1YHQ T;  1UDL A;  2OJ2 A;  1YN8 A;  3V7C A;  3ZFJ A;  3JB9 D;  4FL6 A;  5AYF A;  3ZBD A;  4C92 F;  1E6H A;  4UC4 A;  2VGN A;  4M7A F;  2A7Y A;  2FPE A;  2YUO A;  4QVZ A;  1I07 A;  1OZ3 A;  3VUZ A;  1ZX6 A;  3UT1 A;  1NJI U;  3X28 B;  1VIE A;  3I56 T;  3HP9 A;  1VOM A;  2JVV A;  3EG1 A;  2FPD A;  2YT6 A;  4XTY A;  2RO0 A;  1BIA A;  4LD9 K;  1HXD A;  4PJO E;  2D8H A;  3INZ A;  1AEY A;  2V8K A;  2RMO A;  5GAO n;  1B34 A;  1WIE A;  3L2W A;  1EFN A;  3WXM B;  4OGE A;  1VQL T;  2PVD B;  1PC0 A;  1O75 A;  1QCN A;  1KQS P;  3FRN A;  1Q86 R;  5KYU A;  2DYB A;  2XHC A;  4DBF A;  2E6N A;  4J9G A;  3PMT A;  2KRS A;  1BCM A;  3L2Z A;  5LJ3 j;  3EHQ A;  2KBT A;  4EMK A;  3M56 A;  4BY6 B;  3OYI A;  1WPY A;  1VIF A;  3G6E T;  1BKB A;  4LUD A;  5FU7 B;  4J9B A;  4XTW A;  1BCO A;  3JB9 H;  4LDX A;  2X4X A;  3FB9 A;  2EVR A;  1OUL A;  2RHI A;  4Z02 A;  3OS0 A;  1O9S A;  1NEB A;  1UUE A;  4J9F A;  5L23 A;  1Q82 C;  4L5G A;  3C94 A;  1Y96 A;  4RUG A;  2ECZ A;  1F1B B;  4DOV A;  1IB8 A;  4DQ2 A;  4Y91 A;  3EGD B;  1UFF A;  2KXC A;  2H8H A;  3RKW A;  3JCM d;  4A4H A;  2MCN A;  4FIB A;  5GAM h;  4HT8 A;  2F5T X;  3M0R A;  2ZPE B;  1TUC A;  1JEG A;  2JT4 A;  4A63 B;  1ZUY A;  1SRL A;  2CH4 W;  3I55 A;  3OBY A;  2VYT A;  1JJ2 A;  3CMA T;  4CI0 C;  1Q95 G;  3L2U A;  1YBY A;  1U1S A;  2YUQ A;  2E12 A;  2JMA A;  5GMK l;  1QVG A;  1TU0 B;  2K5F A;  3LGF A;  4C8Q A;  1VQ7 T;  1K76 A;  1UGP B;  2DEU A;  2ZGW A;  5FRO A;  1Y07 A;  4HT9 A;  2O88 A;  2E5K A;  1QVF S;  4AFQ C;  1B7T A;  2OTJ Q;  1AWO A;  4J9H A;  3X20 B;  4OMO A;  2DA9 A;  1FMV A;  4JLG A;  3E19 A;  1D0X A;  1M1F A;  3S3N A;  3FIF A;  3VU3 C;  3MCA B;  3C12 A;  5GAN e;  1SG5 A;  1WA7 A;  3QJY A;  2KE9 A;  2DL4 A;  3OSS C;  4E7I A;  1M1K R;  3SWN A;  2DE0 X;  2COY A;  4BE0 A;  3M58 A;  3OW2 S;  1JU5 C;  1YHQ A;  1RI0 A;  1FX7 A;  1Q7Y U;  3VV0 A;  2CT3 A;  2IVW A;  1YWO A;  4Z88 A;  3QDF A;  1Q81 C;  3NTH A;  4PLI A;  3T9N A;  4E6R A;  2QQA A;  2VUB A;  1ACM B;  2P0K A;  1JXO A;  2E4H A;  3I56 A;  4PJJ A;  1M30 A;  5GAM f;  2XU8 A;  1UGR B;  2HL5 C;  1NBE B;  1AZE A;  5J26 A;  3UPU A;  1W2B P;  3CME Q;  2CSI A;  4PJO F;  3QII A;  1QQJ A;  1ARK A;  2KRN A;  2K2M A;  3MKD A;  4E7K A;  5GAM j;  4ESR A;  4PFO A;  5D6W A;  2EQM A;  4DOW A;  2FZC B;  1X27 A;  4JLI A;  1VQL A;  3A8O B;  4M77 E;  2JN0 A;  1LCK A;  1YJN T;  4KRT A;  2EBP A;  1MHN A;  4M7D A;  1KFZ A;  2KNB B;  1I5O B;  3G71 Q;  1WQ7 A;  3BY7 A;  3EFO A;  1I8F A;  4MZP A;  2EQJ A;  2QQB A;  4FYX B;  4EMG A;  1B07 A;  2DKG A;  1AWW A;  5ECA A;  2DXU A;  4MDW A;  4J5Y A;  3RUX A;  4EIK A;  2FL7 A;  4MML A;  2E65 A;  4ZN3 A;  1K4U S;  3O5Z A;  3CCJ T;  3I5S A;  2LNH B;  3EG0 A;  3EG2 A;  1NJI R;  4QW2 A;  4HCZ A;  4RTY A;  1M8M A;  2VV5 A;  1IGU A;  1YI2 A;  3RIR A;  3A8L B;  3RER A;  4HCB A;  3ASK A;  1WXT A;  1SHG A;  2RK2 A;  4M77 A;  1X6B A;  2DIG A;  4JJN K;  3CC2 T;  3OW2 P;  4OMP A;  1OI1 A;  2F5K A;  4M4Z A;  3EFR A;  3CCS T;  2CZ6 B;  4OB3 B;  3REB B;  1AZG B;  1TH7 A;  2DIQ A;  1VQ4 Q;  2EYZ A;  2EIF A;  4RTX A;  5GAM g;  4NL2 A;  5FRM A;  1XOV A;  1JQQ A;  1GL5 A;  1K0X A;  1ZHI A;  2X9H A;  3CMA A;  3QXE B;  5GAN 5;  4HCK A;  4II1 A;  2HZY A;  4PKC C;  4XTV A;  3CD6 T;  1N6A A;  1PD1 A;  3KBG A;  1VQ7 A;  2JNG A;  4AFS C;  1UEC A;  3V8J A;  4KH0 B;  1G3Y A;  2CP0 A;  1QVG S;  3QZ5 B;  1VYU A;  5GMK m;  4A53 A;  1V29 B;  2QGF B;  1OU8 A;  5CK9 A;  5FU6 B;  3I35 A;  3UDC A;  5IHN A;  1G3W A;  3PVL A;  2JJ9 A;  3U23 A;  1GXI E;  1M3B A;  3L2R A;  1PNJ A;  1BK2 A;  4X34 A;  4BAC A;  3VS1 A;  3C0C A;  5A0G A;  1TXQ A;  2DTH A;  5A2Q E;  1A0N B;  6AT1 B;  2YSQ A;  1UTI A;  4M75 B;  2JOY A;  3MET A;  2DBK A;  3H0I A;  3KXT A;  2E6Z A;  3HL8 A;  4J7F A;  4M7D F;  4M75 D;  2ZPF B;  2G3R A;  4J9C A;  1EZZ B;  2MWP A;  3CCU A;  4ZTJ A;  1KQ1 A;  2MK5 A;  2ZZD A;  1MMD A;  3JCM W;  1BYM A;  1HD3 A;  2DVE A;  1TWB A;  1VQM A;  2CH4 A;  1ZQ1 A;  2RJF A;  2MF2 A;  3NPF A;  3CCL T;  4N4I A;  2COZ A;  4R56 A;  1VA7 A;  1UEB A;  3VUB A;  2R5M A;  2LQK A;  1JO8 A;  1AVZ C;  2SEM A;  2FG0 A;  3R6N A;  1MMA A;  3OBW A;  2QA4 A;  2KQW A;  5GAM d;  1K73 C;  2KSS A;  4M77 F;  3SEM A;  4PJN A;  3JB9 F;  3CCQ A;  2JM8 A;  2J6K A;  3CCV Q;  2EYX A;  1LJO A;  1ZA1 B;  1SSH A;  2QK0 A;  2HDA A;  2COW A;  4N0A C;  1WHM A;  3Q1J A;  3D7S B;  1K73 R;  4PFZ A;  2AZS A;  2EFI A;  1KSW A;  1MND A;  1AWJ A;  2M9U A;  3CCJ A;  2WSF E;  2P84 A;  2DXC A;  5I2S A;  2K4Y A;  2LNV A;  1M2O A;  2A08 A;  2KMT A;  1WXB A;  2MIO A;  2D0N A;  2EJ9 A;  2HEQ A;  3OYA A;  2L8D A;  1X2Q A;  3ULR B;  4KT0 E;  3BDU A;  4M78 C;  4LN2 A;  3CC2 A;  3TEE A;  2D9T A;  3CCS A;  2D1X A;  3CXC S;  5I2M A;  1Z9Q A;  4E7S A;  2LCS A;  5IXF A;  3I5R A;  1QMC A;  1WYX A;  4BI8 B;  4E7J A;  4NOY A;  3AT1 B;  3LW5 E;  4P5N A;  1VQP A;  2JZ2 A;  3ZL7 C;  1OX9 A;  4DBQ A;  4J8O A;  4FU6 A;  3OYM A;  4LDW A;  2HQE A;  3OS1 A;  1YFN A;  1PKS A;  5CVI A;  1G8X A;  1IGQ A;  2EWN A;  4JRI A;  4A4K A;  1KC8 U;  3CD6 A;  4C5E A;  1Q82 U;  1YIJ Q;  1UGQ B;  1RAF B;  1WHG A;  1RLP C;  1YHQ Q;  2KY9 A;  3JRZ A;  5KCO A;  5IXB A;  2PZ1 A;  1VQK A;  1MMN A;  3CPW A;  3SFM A;  1D09 B;  5HK0 A;  4IUV A;  4XTX A;  3VYH B;  4V2S A;  2XDB A;  3S6W A;  5IAY A;  5HKC A;  3CBM A;  4FW1 A;  2LMJ A;  4BUG A;  3OY9 A;  3EH2 A;  4M78 B;  3FJ5 A;  1UJ0 A;  4FCY A;  3I56 Q;  1VQ9 A;  2DYI A;  1KD1 R;  4FYY B;  4X9D A;  4M78 D;  2MOX A;  3THK A;  2QAZ A;  3HRS A;  3CCM Q;  2Y4X A;  1IHW A;  2Y90 A;  1YJ9 Q;  4RTU A;  2F69 A;  3L1A A;  1VQL Q;  2L3Q A;  2O01 E;  4BDZ A;  5J3B A;  4ELY C;  2CT4 A;  2NUP A;  1CKB A;  4OGC A;  3MEU A;  3BE3 A;  4WTO B;  1M3C A;  2E5Q A;  3J80 E;  1H92 A;  5GAN h;  3OMC A;  3HPW A;  1RLQ C;  5CKB A;  3CXC P;  4BE2 A;  2X51 A;  2FRY A;  5CKF A;  2J7I A;  2DTI A;  3A5Z B;  1D1C A;  2EYQ A;  1OOT A;  2ROT A;  2Y4Y A;  4MMK A;  2IPO B;  1VQO T;  2KK4 A;  1I5L A;  2JM9 A;  2GQV A;  1S72 T;  5GAO l;  5FRN A;  3RES A;  2QAS A;  1EIF A;  1YI2 Q;  1VQ8 Q;  3A8H B;  4IIM A;  3N5B B;  4M75 E;  5C6S A;  3A1P A;  4OB1 B;  1X6G A;  3GF5 A;  2K57 A;  4F04 B;  4XQ3 A;  3VS3 A;  1PWT A;  1QCO A;  2ENM A;  1N5Z A;  1WI7 A;  2JS2 A;  1HJD A;  1WXU A;  1BI1 A;  2RK1 A;  3CCR T;  4GLM A;  1X6O A;  3LWH A;  1Q86 C;  1YIT A;  5A0D A;  4RKU E;  1VQ5 Q;  1TTH B;  1ABO A;  2P0P A;  3VS0 A;  4E7L A;  3SB2 A;  1G5V A;  2PVO B;  3CMA Q;  1ZSZ C;  5CAI A;  2F2W A;  2YWW A;  1NPP A;  2GGR A;  4LNP A;  1KIK A;  2YDL A;  5KYY B;  4AT1 B;  2DXB A;  2C0O A;  2OTL Q;  1SEM A;  1W4S A;  2QTV A;  3QWX X;  2PUO B;  3SHW A;  2K3X A;  1S1N A;  1UE9 A;  2XID A;  4M75 A;  4C5G A;  4EMH A;  1N27 A;  1PKT A;  4B6M A;  1YCS B;  4F7U G;  4C0Z A;  5GAN 7;  5GAN f;  3X25 B;  2P4R A;  3RBB B;  4M78 G;  3H41 A;  2FHD A;  1RAH B;  2PQW A;  5AT1 B;  3L42 A;  3RKX A;  5GAN j;  4PJO A;  1PRL C;  4FT4 A;  3QO3 A;  2GBQ A;  1DJ7 B;  3DB4 A;  2H3J A;  2RI5 A;  2V8I A;  2YUP A;  4Z89 A;  2P0Q A;  5EG2 A;  4CC2 A;  1B3Q A;  3LX7 A;  1ZSZ B;  3CPW S;  3CCU Q;  2VB6 A;  3V7S A;  1H3H A;  4QQG A;  2CP3 A;  4F16 A;  4JZ3 A;  1GCQ A;  3VRZ A;  2RI2 A;  4XTZ A;  3OYE A;  2L3S A;  1TSF A;  1VQM Q;  3BDL A;  3RDV A;  2QI2 A;  1X43 A;  2A28 A;  2L0A A;  4MZT A;  4PK4 A;  2A37 A;  4C92 C;  4RCB A;  1QKW A;  2DVJ A;  4M7A C;  1M90 C;  2QA4 Q;  1KC8 R;  2O4X A;  2EW3 A;  3PMI A;  1MUZ A;  1T3S A;  2HD0 A;  1VUB A;  1M1K C;  1K1Z A;  1YCY A;  1W1F A;  2DX1 A;  2QQ9 A;  4ZN1 A;  1Z9Z A;  2XKO C;  3R6O A;  1ZBX A;  5KYW B;  2EGE A;  1K8A U;  3UF4 A;  4JUV A;  3CCQ Q;  2ZCF B;  3RMQ A;  5GJV B;  2RJD A;  4MZM A;  1WQW A;  4D8K A;  4E7H A;  4ZGD B;  1GFC A;  2HSP A;  5GAN g;  2LDM A;  4ELZ C;  1M90 R;  1N8R U;  3TCJ A;  4N4G A;  4F7U E;  3M53 A;  4O6J A;  4LD6 A;  4ORZ A;  3MHX A;  2EKO A;  1S72 A;  4M78 E;  2DEQ A;  1K9M C;  3UA7 A;  4F17 A;  4M75 F;  5GAO m;  2LJ3 A;  2EYY A;  2NUT B;  2LT1 A;  3CCS Q;  4VUB A;  3OSV A;  3CCR A;  5EC7 A;  3OYJ A;  2JW4 A;  4XK8 E;  5KCH A;  4QT7 A;  1V76 A;  3G4S Q;  1QWE A;  2FEI A;  3H0H A;  4J6Y A;  3TSZ A;  2A36 A;  1QP3 A;  3O8V A;  5LJ5 h;  4DBR A;  2ZPI B;  1K9M R;  1VQP Q;  3A8M B;  3E9G A;  3MEA A;  1SF9 A;  2V1Q A;  3OS5 A;  1D3B A;  4RTW A;  4EPC A;  2RQT A;  1BBZ A;  2VWF A;  1JB0 E;  4KUI A;  4Y92 A;  2LT4 A;  2YHT A;  3PVQ A;  4R55 A;  5KE3 A;  2LC4 A;  1AD5 A;  1NJI C;  1TG0 A;  5FWC A;  2ZPB B;  3JSC A;  5DY9 A;  1VQK Q;  1U3O A;  2BE9 B;  2KVQ G;  2VVK A;  4BI4 A;  2IIM A;  1VQ6 Q;  3G6E A;  3VS5 A;  3FJP A;  1UG1 A;  3GNG A;  1QVF P;  1MNE A;  1NEG A;  2YXY A;  2D8J A;  2LJ0 A;  2HMA A;  2BIV A;  2DD4 A;  1NM7 A;  2M16 A;  2OTJ T;  3FEO A;  2QEX T;  1YNZ A;  2KR3 A;  2R58 A;  1VQ9 Q;  1AT1 B;  1CKA A;  4PJM A;  4BI3 A;  2X35 A;  3SDZ A;  5GMK e;  5GAN d;  3UAT A;  2XK0 A;  4BDY A;  4E2F B;  3GP8 A;  8AT1 B;  3LH0 A;  1AHJ B;  1YWP A;  3URG A;  1MV3 A;  2YRD A;  3CEY A;  3OYF A;  4FYV B;  5CQX A;  3OYY A;  2C0I A;  3CC7 T;  5CCA A;  4A54 A;  3V8L A;  2A3L A;  4CC4 B;  1QKX A;  1PCX A;  1QW1 A;  4FM4 B;  3KUF A;  5GMK i;  5HK3 A;  3CCE T;  2CP2 A;  1PSF A;  3M9Q A;  3QZ9 B;  5D7U A;  2LX9 A;  1IXD A;  4RTV A;  2D6F A;  1JJ2 S;  1KQ2 A;  3DKM A;  4RCC A;  4EMK C;  2JTE A;  2KYB A;  2NYS A;  5GAN 3;  4OMM A;  1FMW A;  1RUW A;  2ED1 A;  3EGX B;  3CME T;  2LTO A;  1QP2 A;  1UHC A;  2ATC B;  4NS5 A;  4D8D A;  2WSC E;  3OYC A;  2LRQ A;  4L59 A;  1OPK A;  3NFC A;  1QCF A;  2QG9 B;  3VS4 A;  1HSQ A;  1X2K A;  4E47 A;  4J83 A;  3TRE A;  1SSF A;  4C92 G;  1IRX A;  3CC4 T;  2V26 A;  2DRM A;  1WDX A;  4M7A G;  1H64 1;  4CC7 A;  1RL2 A;  2KYM A;  1YIT Q;  3G71 T;  2MWO A;  2KI7 A;  2XI9 A;  3TVT A;  1KHI A;  4M78 F;  3M0S A;  2OI3 A;  2BKD N;  2DL3 A;  4OF1 A;  1BIB A;  2YRC A;  2GFA A;  4QQD A;  2PU9 B;  4RG2 A;  3JCM Q;  4Z8A A;  1KQS A;  5GAO q;  1AWX A;  2L3P A;  1SHF A;  4C8Q C;  1Q7Y C;  1WLP B;  5CKE A;  2VKN A;  3EGD A;  5LJ5 e;  3OB9 A;  4OP0 A;  2WAC A;  3QYH B;  2EQU A;  1VQ4 T;  1Y7X A;  2FO0 A;  4XTU A;  2JMC A;  2AT1 B;  3V7R A;  4JDS A;  1YJN A;  3LGL A;  3MJX A;  2HKQ B;  2RQU A;  2CS7 A;  1Q7Y R;  1JJ2 P;  1NLO C;  4A4G A;  3SWN C;  4ATO A;  2R57 A;  3GLX A;  4C5H A;  2QYZ A;  2GNC A;  1QVG P;  2GF7 A;  4JJC A;  1Q86 U;  1WHH A;  4EDU A;  2I2L A;  2CP5 A;  1P92 A;  3WVE B;  1R77 A;  4KGZ B;  2QDL A;  3OYN A;  4ANJ A;  3JCM V;  2CUB A;  2QEX A;  2D0Q B;  3QSU A;  5HCK A;  3DLL A;  3OA6 A;  5KYW A;  4C92 E;  1R0C B;  3I55 Q;  2KDS A;  2ZPG B;  1RAA B;  3AHU A;  3OYH A;  3RNJ A;  2RJC A;  3M57 A;  4A4F A;  3TSW A;  5IT9 E;  4QKU A;  2EJG A;  2DNU A;  3HHT B;  2ED0 A;  4PL6 A;  3CC7 A;  5KYX B;  1K9A A;  4C8Q D;  2J6F A;  2RD1 A;  4ZGJ B;  2J06 A;  1X01 A;  4TVR A;  3OYG A;  3GIB A;  2O2O A;  2JXB A;  2SRC A;  2DJQ A;  1OU9 A;  2KT1 A;  3JV3 A;  3CCE A;  1NYG A;  3MP1 A;  4Y28 E;  4LDY A;  3MPU B;  3CBO A;  1WHL A;  1M2V B;  1N9R A;  2LQW A;  4M7D C;  1UGS B;  2NUT A;  3QG1 A;  1XNI A;  3NTI A;  4X9C A;  1IRE B;  4BE1 A;  2HSE B;  3JB9 I;  3QJ6 A;  5LJ5 d;  1E7O A;  2DMO A;  1KD1 C;  3NHN A;  5C0M A;  2PUK B;  2DD5 A;  2HKN A;  2DBM A;  1GCP A;  1RAC B;  4F7U B;  1G3T A;  3JCM X;  4L6V 5;  1H3Z A;  3E2U A;  4O5V A;  2BUD A;  3CC4 A;  2DJZ A;  3HRU A;  4X1V A;  2WSE E;  1ABQ A;  3JCM c;  3CCV T;  4FT2 A;  1ZBJ A;  2R5A A;  4M77 C;  2X4Y A;  4FYW B;  1X75 C;  1NE8 A;  1W2B A;  2FZG B;  3TQ7 P;  1OX8 A;  3X26 B;  5KE2 A;  3SD4 A;  1TOV A;  1KHC A;  1VQN T;  5GAN 6;  2RF0 A;  1M4Z A;  2DAQ A;  1LVK A;  1BI0 A;  2RQV A;  2E3H A;  2AIR B;  2CRE A;  2M51 A;  1D0Y A;  3L2Q A;  5LJ3 h;  3TU4 K;  1YJW T;  2GTO A;  4JS5 A;  3CCL A;  1EX4 A;  4Q5W A;  2P4T A;  3G6E Q;  4KGX B;  2HNI A;  2BTT A;  4B9W A;  2DRK A;  3UWN A;  2L2P A;  4RTT A;  2YUN A;  5CR2 A;  2L3R A;  3FDR A;  1VQ4 A;  3HFN A;  4R0K A;  1KK7 A;  3GPL A;  4QVD A;  1RI9 A;  4IIO A;  3GOX A;  1AOJ A;  1UGV A;  2LQ8 A;  2B86 A;  1Q81 U;  2F2X A;  2E70 A;  4IUU A;  1X69 A;  4C8Q G;  3EAE A;  1QLY A;  1ZUU A;  2RI3 A;  3OW2 A;  5D6Y A;  1YIJ T;  2DL7 A;  4AG1 C;  2DPP B;  3G7Z A;  3V8K A;  4BY6 C;  2EYW A;  3EG9 B;  3LLR A;  5FU7 C;  4ZGE B;  3EGX A;  1UJY A;  1T0H A;  3CBP A;  3QDR B;  2ZPH B;  2VGM A;  1VQ7 Q;  3OYD A;  1CSK A;  2XDP A;  2EGC A;  1R8O B;  2LZ6 B;  1G2B A;  1R0B G;  2HQX A;  3NGP A;  4JRK A;  3EG3 A;  1M1G A;  3CCM T;  1YJ9 T;  5LJ3 f;  1I4K 1;  1W70 A;  3OQ5 A;  2DFU A;  4XU1 A;  2HQH A;  5M9O A;  2IG0 A;  3H0F A;  1RAI B;  4XU0 A;  5DLO A;  5GMK h;  4BB7 A;  1M27 C;  1OEB A;  3IQL A;  2AK5 A;  4JJB A;  5I22 A;  2F2V A;  2E3I A;  4KBM B;  4DEX A;  4J9E A;  1ZA2 B;  3M0Q A;  1KJW A;  1LNX A;  4XU2 A;  4WCI A;  2M0O A;  4M7D G;  1KC8 C;  4GLK A;  3NMZ C;  4C8Q E;  3ER0 A;  5D6X A;  3VJP A;  1YI2 T;  1FMK A;  1VQ8 T;  3CCV A;  2AKL A;  4IKF A;  2LVM A;  1WJS A;  2W10 A;  2RM4 A;  1C0M A;  1IHV A;  3GNF B;  4OB2 B;  1N9S A;  2Z0W A;  1JRI A;  5CQY A;  8ATC B;  3M0P A;  1W2B S;  2I0N A;  3PFS A;  1VQN A;  3JAM E;  3M4G A;  3VYG A;  1Q82 R;  4FW2 A;  2DER A;  2MMP A;  2MYS A;  3BFM A;  3VS6 A;  1VQ5 T;  1YJN Q;  4HVV A;  1T3L A;  5CKH A;  4IUQ A;  1ZUK A;  1YJW A;  4M77 G;  2DM1 A;  2QDY B;  4OMQ A;  5LJ3 g;  5LJ3 e;  2XMF A;  3JB9 J;  4FSS A;  4HVW A;  2FRW A;  2O9V A;  3JB9 G;  2DIL A;  3L2V A;  2OTL T;  2MPX C;  5FLX E;  4DA4 A;  2E64 A;  5I21 A;  3EHR A;  1NYF A;  5KYX A;  3CCJ Q;  1VQO A;  2QEX Q;  1M9S A;  3LWI A;  4DEY A;  2RHY A;  4WF2 A;  2KXD A;  1UB4 A;  3M54 A;  2DL5 A;  2JUF A;  1PD0 A;  1G3S A;  4BD3 A;  1M2V A;  3LYI A;  1YIJ A;  1NLP C;  1HK9 A;  2YRV A;  3CC2 Q;  5GMK j;  1FXX A;  4N0A A;  4C92 B;  2K5I A;  3CC7 Q;  2KGT A;  2DO3 A;  2HL3 A;  3FLG A;  2C0T A;  1FYN A;  3MEV A;  4M7A B;  3PNW C;  2JTF A;  3EH1 A;  2OAW A;  2E1H A;  1WFW A;  1RAD B;  3QPH A;  1TUD A;  4M7D E;  1WGS A;  2G6F X;  3BW1 A;  3CPW P;  4C92 D;  3CCE Q;  4LDV A;  4M7A D;  3J7A F;  2DK3 A;  2EKH A;  3CCU T;  2CZ7 B;  1K73 U;  2MI6 A;  4F7U A;  2DXT A;  1G83 A;  4AFZ C;  5KYN A;  2VXF A;  1WNL A;  3CD6 Q;  1FWZ A;  2DF6 A;  2DTO A;  2K79 A;  1VQM T;  2CSQ A;  4M78 A;  2RHZ A;  2ESW A;  3PIP A;  4PJL A;  2LQN A;  1IZ6 A;  1Q81 R;  2PVG B;  3J81 E;  4C0G A;  4PFP A;  3CCM A;  1YJ9 A;  4HCC A;  2QA4 T;  3PTA A;  2GQI A;  4HVU A;  4YTL A;  1YP5 A;  2JTM A;  2VXE A;  2CKK A;  3CC4 Q;  1OPL A;  4C5I A;  3QKJ A;  4ZNX A;  3OYK A;  3CCQ T;  1PM3 A;  1OQK A;  5LJ3 d;  4CRI A;  5IH2 A;  2KT8 A;  1PSE A;  3S3O A;  2GTJ A;  3HKS A;  3X24 B;  5GAO p;  1XTD A;  2EQK A;  3VKI A;  5GAN 8;  1OV3 A;  1V1C A;  1U06 A;  1LOJ A;  2X4J A;  2QQR A;  2K7A A;  3HRT A;  3M4Y A;  9ATC B;  5CO7 A;  5FU6 C;  1NG2 A;  2NUP B;  4C8Q F;  1QWF A;  3M0T A; 
#chains in the Genus database with same CATH homology
 2AZV A;  2J7I A;  2QDL A;  1BB9 A;  5FWB A;  3REA B;  2CUB A;  1OOT A;  2ROT A;  1GBQ A;  2YUQ A;  2JMA A;  3M0U A;  5HCK A;  1BU1 A;  1K76 A;  2X3X D;  2JM9 A;  1Y0M A;  2O88 A;  2E5K A;  4AFQ C;  3VS7 A;  3RNJ A;  4RTZ A;  1AWO A;  4IIM A;  3TSW A;  4J9H A;  3A98 A;  1X6G A;  2FPF A;  4OMO A;  2LX7 A;  2DA9 A;  3VS3 A;  1PWT A;  2DNU A;  2ENM A;  1N5Z A;  1WI7 A;  2ED0 A;  1VYT A;  2JS2 A;  1HJD A;  4OML A;  1K9A A;  1WXU A;  4GLM A;  2J6F A;  1WA7 A;  1SRM A;  2J06 A;  2KE9 A;  2DL4 A;  2EPD A;  2O2O A;  2JXB A;  2SRC A;  2DE0 X;  2DJQ A;  3KFV A;  2KT1 A;  3JV3 A;  1NYG A;  3QWY A;  1ABO A;  3VS0 A;  1JU5 C;  3GBQ A;  2LQW A;  1ZSG A;  2F2W A;  2GGR A;  4LNP A;  1KIK A;  2CT3 A;  2YDL A;  1Y57 A;  1YWO A;  2KRO A;  4JJD A;  4Z88 A;  2V1R A;  2C0O A;  1SEM A;  5GJW B;  4E6R A;  1K0S A;  3QWX X;  1E7O A;  3SHW A;  2DMO A;  1S1N A;  1UE9 A;  3NHN A;  1GCQ C;  3VRY A;  2DBM A;  3VS2 A;  1JXO A;  1PKT A;  2ABL A;  1GCP A;  1YCS B;  1M30 A;  2AKK A;  1E6G A;  1AZE A;  2CSI A;  2M0Y A;  2P4R A;  2CUD A;  3RBB B;  3H41 A;  2KRN A;  4X1V A;  2K2M A;  1ARK A;  1ABQ A;  4ESR A;  1ZBJ A;  2BZY A;  1SPK A;  1X27 A;  2JS0 A;  1PRL C;  1LCK A;  1ZLM A;  2GBQ A;  4KRT A;  2EBP A;  2J6O A;  1KFZ A;  2KNB B;  1GFD A;  2YUP A;  5IHK A;  4Z89 A;  2PTK A;  1M3A A;  3CQT A;  1PRM C;  4CC2 A;  1GRI A;  1T0J A;  2RF0 A;  1B3Q A;  1B07 A;  1JXM A;  5ECA A;  1AWW A;  2BZX A;  1H3H A;  2RQV A;  2K6D A;  2BZ8 A;  2CRE A;  2O9S A;  2M51 A;  1UHF A;  4F16 A;  4JZ3 A;  1GCQ A;  4EIK A;  3VRZ A;  4OMN A;  2W0Z A;  2GTO A;  1K4U S;  2L3S A;  3O5Z A;  3I5S A;  2LNH B;  3EG0 A;  3EG2 A;  1W6X A;  2EQI A;  1X43 A;  4AG2 C;  4RTY A;  2RNA A;  1M8M A;  2BTT A;  2A28 A;  2L0A A;  2DRK A;  2L2P A;  4RTT A;  3UA6 A;  4F14 A;  2YUN A;  2KEA A;  2A37 A;  4R0K A;  2RN8 A;  1QKW A;  1WXT A;  2DVJ A;  1RI9 A;  4IIO A;  1SHG A;  1H8K A;  2EW3 A;  1MUZ A;  1T3S A;  2K3B A;  1X6B A;  1AOJ A;  1K1Z A;  4OMP A;  4M4Z A;  1W1F A;  1UGV A;  2DX1 A;  2B86 A;  1Z9Z A;  2F2X A;  3REB B;  1AZG B;  2HCK A;  2EGE A;  1X69 A;  2EYZ A;  3UF4 A;  4K11 A;  4RTX A;  5GJV B;  2NWM A;  2X3W D;  1QLY A;  1ZUU A;  1XOV A;  4D8K A;  1JQQ A;  2DL7 A;  1GL5 A;  1GFC A;  2HSP A;  4AG1 C;  1K0X A;  4J9I A;  1PHT A;  2RQR A;  1WX6 A;  2EYW A;  4HCK A;  4HXJ A;  2LP5 A;  2O31 A;  4LE9 A;  1I0C A;  4ORZ A;  4AFS C;  1UEC A;  1UJY A;  1T0H A;  4LUE A;  1VYU A;  3EGU A;  2CDT A;  2KRM A;  3UA7 A;  4F17 A;  3I35 A;  2LJ3 A;  5IHN A;  3PVL A;  2EYY A;  3U23 A;  4AFU C;  1M3B A;  1PNJ A;  1CSK A;  1BK2 A;  5EC7 A;  2JW4 A;  2EGC A;  2LZ6 B;  3VS1 A;  3C0C A;  5I11 A;  4QT7 A;  1G2B A;  2ROL A;  2LJ1 A;  1QWE A;  3NGP A;  2FEI A;  1A0N B;  3H0H A;  3EG3 A;  3TSZ A;  2A36 A;  2YSQ A;  1UTI A;  2DBK A;  1GBR A;  3H0I A;  1I1J A;  3I9Q A;  4JPB W;  1W70 A;  2HBW A;  2V1Q A;  4RTW A;  2RQT A;  1BBZ A;  2VWF A;  3H0F A;  2RPN A;  4J9C A;  1M27 C;  1OEB A;  2NUZ A;  3LH5 A;  4Y92 A;  3PVQ A;  3IQL A;  2AK5 A;  4JJB A;  5I22 A;  2F2V A;  1AD5 A;  1TG0 A;  5FWC A;  4DEX A;  4J9E A;  1HD3 A;  3M0Q A;  1KJW A;  2PNI A;  1U3O A;  2CH4 A;  2K9G A;  2VVK A;  2IIM A;  4WCI A;  3NPF A;  3VS5 A;  1UG1 A;  3NMZ C;  1NEG A;  1VA7 A;  2D8J A;  2LJ0 A;  2DLP A;  1JO8 A;  1AVZ C;  2SEM A;  2FG0 A;  1FMK A;  1NM7 A;  2AKL A;  3R6N A;  1U5S A;  4GBQ A;  2J05 A;  1IO6 A;  2W10 A;  1YNZ A;  2KR3 A;  2EGA A;  1CKA A;  3PE0 A;  3SEM A;  4JZ4 A;  4CC3 A;  3UAT A;  3M0P A;  2I0N A;  2JM8 A;  2J6K A;  5FW9 A;  5IHI A;  2EYX A;  1MV0 B;  1YWP A;  1SSH A;  2HDA A;  1MV3 A;  3VS6 A;  1VYV A;  2C0I A;  4CC4 B;  4HVV A;  1T3L A;  1QKX A;  1ZUK A;  2AZS A;  1KSW A;  1AWJ A;  2DM1 A;  2RQW A;  4OMQ A;  1J3T A;  2DL8 A;  2XMF A;  4FSS A;  4HVW A;  2FRW A;  2O9V A;  4J9D A;  2A08 A;  1WXB A;  2DIL A;  2MIO A;  2D0N A;  2HEQ A;  1UDL A;  4RTV A;  3EHR A;  2OJ2 A;  1YN8 A;  1X2Q A;  3ULR B;  1NYF A;  1E6H A;  2JTE A;  4LN2 A;  4DEY A;  2FPE A;  2YUO A;  2D1X A;  2KYB A;  4OMM A;  1Z9Q A;  2KXD A;  1RUW A;  1I07 A;  2ED1 A;  2DL5 A;  1UHC A;  2LCS A;  1ZX6 A;  4D8D A;  5IXF A;  3I5R A;  1OPK A;  1WYX A;  1QCF A;  3VS4 A;  1HSQ A;  1NLP C;  1X2K A;  3ZL7 C;  3EG1 A;  2FPD A;  2KGT A;  2YT6 A;  2C0T A;  1FYN A;  2DRM A;  1WDX A;  2OAW A;  1WFW A;  1PKS A;  2D8H A;  1TUD A;  4CC7 A;  1AEY A;  2KYM A;  2G6F X;  2RMO A;  1WIE A;  1EFN A;  2EKH A;  3TVT A;  1RLP C;  3M0S A;  2OI3 A;  2DYB A;  2DL3 A;  4J9G A;  1G83 A;  2KRS A;  4AFZ C;  5IXB A;  2PZ1 A;  2DF6 A;  3EHQ A;  2KBT A;  2K79 A;  2CSQ A;  2ESW A;  4Z8A A;  4LUD A;  4J9B A;  2LMJ A;  2LQN A;  1AWX A;  2L3P A;  3FJ5 A;  2EVR A;  1UJ0 A;  1SHF A;  1NEB A;  1UUE A;  1WLP B;  2VKN A;  4J9F A;  2GQI A;  4HVU A;  5L23 A;  1YP5 A;  4RUG A;  2ECZ A;  2MOX A;  3THK A;  1OPL A;  4ZNX A;  2FO0 A;  2JMC A;  4RTU A;  5IH2 A;  1UFF A;  2KT8 A;  2KXC A;  2H8H A;  2GTJ A;  2MCN A;  2L3Q A;  2RQU A;  2CT4 A;  1OV3 A;  1CKB A;  1NLO C;  1V1C A;  1U06 A;  3M0R A;  1M3C A;  1TUC A;  2K7A A;  1JEG A;  1H92 A;  2JT4 A;  4A63 B;  1ZUY A;  2GNC A;  1SRL A;  1RLQ C;  4JJC A;  1NG2 A;  2CH4 W;  1QWF A;  2FRY A;  3M0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...