3SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3semA00
1NG2A 2BZXA 2FPFA 2AKLA 1RLPC 5ECAA 2ESWA 3UA6A 4J9GA 1QLYA 2DYBA 1NYGA 4IIMA 2KGTA 2EYWA 2LNHB 3O5ZA 4Z89A 2C0TA 2BZYA 1ZUKA 2OAWA 1VA7A 2C0IA 2DVJA 2FRYA 4GLMA 4RTTA 4D8KA 2ECZA 2LMJA 1PKSA 2XMFA 1X2QA 3NGPA 2CT4A 1AWWA 2K9GA 3TSWA 2YSQA 1M3CA 3JV3A 3ZL7C 5IHIA 1UTIA 2EYXA 2K7AA 2OI3A 2FPDA 1ABQA 1S1NA 4JZ4A 2KNBB 1NEBA 1WXBA 2ED1A 2KXDA 1SHFA 2JTEA 2RF0A 4F16A 1PRLC 4LUEA 3LH5A 2EW3A 4A63B 2FO0A 1YNZA 2EYZA 4AG2C 2EKHA 2L3SA 2MIOA 3EHQA 3THKA 1K0SA 1JQQA 1U3OA 3M0TA 2DL5A 2RMOA 1MUZA 2CUDA 2LCSA 1I0CA 3H0FA 1T3LA 1MV3A 1J3TA 1UFFA 1CSKA 4J9DA 1IO6A 1ZUUA 1JU5C 1WA7A 1PNJA 5HCKA 2AZSA 3RBBB 1AZGB 1U5SA 1G2BA 2YUQA 1WXUA 1QWFA 1OV3A 1JEGA 2A28A 2DL7A 4HVVA 3VS5A 2KEAA 1A0NB 2D0NA 1XOVA 1N5ZA 2SEMA 4RTYA 4EIKA 2DL8A 1SHGA 4QT7A 1X69A 4LNPA 2X3XD 1UHFA 1NYFA 1W6XA 3EG3A 4AFZC 2A08A 2HDAA 2J6KA 1T0JA 4JJCA 1WLPB 1JO8A 5GJVB 2O88A 4E6RA 3EGUA 3NMZC 5GJWB 1H92A 2GGRA 1VYVA 1AVZC 2RQRA 3VRYA 4J9FA 2CSQA 4AFSC 4AFUC 1K0XA 2EBPA 4J9CA 1GCQA 2KT8A 3M0RA 2AZVA 4D8DA 1WYXA 2F2VA 2EGAA 4OMQA 4X1VA 2HCKA 2X3WD 4FSSA 2A36A 1M3BA 3VS2A 2JT4A 2G6FX 2RPNA 2I0NA 1UJYA 1GBQA 1W70A 1V1CA 1AWXA 3UA7A 4ESRA 2YUNA 2JM8A 2DNUA 4AFQC 5IH2A 2GQIA 1K1ZA 2ABLA 2K79A 1H3HA 1U06A 2L3QA 2JS2A 2W0ZA 3QWYA 3H0IA 1YCSB 3VS3A 4OMLA 2KRSA 3EG1A 4JJDA 3I5RA 2OJ2A 2CSIA 1X2KA 4OMOA 2DM1A 3VRZA 2D1XA 1QCFA 2EQIA 3EHRA 3REBB 1JXOA 2KRMA 2PNIA 3H41A 2PZ1A 1ZLMA 2DMOA 2K2MA 4JJBA 4RTUA 1OPLA 1WX6A 3EG0A 1VYUA 4JPBW 3VS7A 2MCNA 3IQLA 1WI7A 1UHCA 2L2PA 2ED0A 1RI9A 4WCIA 2KYMA 2J06A 2GBQA 3REAB 1SPKA 5I11A 1YN8A 1AOJA 1B3QA 3UATA 2E5KA 2O2OA 1LCKA 2KR3A 4CC2A 3QWXX 1GCPA 4AG1C 1YWPA 2JW4A 2VVKA 1UUEA 1K9AA 2BZ8A 1MV0B 1AWJA 1TUCA 1NLOC 1OPKA 1RUWA 1WDXA 2RQWA 4F17A 2CH4A 3U23A 5I22A 2SRCA 1E6HA 3EG2A 1M3AA 2DILA 2DE0X 2LZ6B 4OMNA 1SEMA 5IHKA 2JM9A 2DRMA 1T3SA 3KFVA 3M0UA 1GFCA 2CDTA 4OMMA 3VS0A 1NM7A 4CC3A 1X43A 2DF6A 2J6OA 1Z9QA 2C0OA 2FG0A 2DL3A 5FWCA 1ZSGA 2GTJA 2NUZA 1BU1A 2RQVA 2KBTA 2HSPA 1HJDA 4DEYA 2O9VA 5L23A 1QKWA 1NEGA 1OOTA 4M4ZA 1RLQC 1NLPC 2DA9A 1UE9A 2RQUA 2DBKA 4KRTA 2JXBA 2MOXA 4DEXA 1YP5A 4GBQA 1HSQA 1KSWA 2KROA 1TUDA 1X27A 2YUOA 5IHNA 2VWFA 2D8JA 2JMAA 2K3BA 2BTTA 1ARKA 2J05A 3I35A 1SSHA 1AWOA 1PWTA 1FMKA 2LQWA 1UG1A 2YUPA 4RTWA 4ZNXA 2L0AA 2J7IA 1ZBJA 1ABOA 2W10A 4HVWA 1AZEA 2B86A 1BB9A 2KT1A 2L3PA 1G83A 1VYTA 1E6GA 1ZUYA 3H0HA 1I07A 2FEIA 2KXCA 3VS4A 2LJ0A 4RTXA 5IXFA 1QWEA 2DRKA 1KIKA 2M51A 2O31A 3C0CA 2EGCA 1UGVA 3PVQA 1GFDA 2J6FA 2CUBA 2K6DA 3CQTA 1H8KA 1SRMA 3NHNA 4Z88A 4RTZA 1OEBA 1Y0MA 2CT3A 3RNJA 2EYYA 1GRIA 4RUGA 4J9HA 1PKTA 1CKBA 1PRMC 2LJ3A 2AK5A 2ENMA 2HEQA 5EC7A 1TG0A 1UECA 1UJ0A 1WIEA 1GBRA 3VS6A 4Z8AA 3TSZA 3TVTA 5IXBA 1PHTA 1GL5A 3NPFA 1ZX6A 5FWBA 4ORZA 4CC4B 4HCKA 1GCQC 4J9BA 2LJ1A 3I5SA 4LE9A 2YT6A 1M27C 3FJ5A 2ROLA 1K76A 1M30A 2HBWA 2DJQA 3GBQA 2DL4A 2H8HA 2KE9A 4HXJA 1AEYA 5FW9A 2JMCA 2VKNA 4IIOA 3I9QA 2NWMA 1KFZA 1E7OA 2FPEA 2A37A 2JS0A 3SHWA 3PVLA 1SRLA 2AKKA 1X6GA 2ROTA 4J9IA 4OMPA 1I1JA 3VS1A 2CREA 2D8HA 2DX1A 2GNCA 3A98A 1BBZA 3R6NA 2DLPA 1UDLA 1W1FA 2F2WA 2YDLA 2V1QA 1K4US 2LQNA 3M0QA 2F2XA 1WFWA 1B07A 1M8MA 1Z9ZA 2CH4W 1KJWA 4JZ3A 4RTVA 2GTOA 2RQTA 4K11A 2FRWA 2EGEA 4Y92A 4R0KA 1QKXA 2QDLA 1Y57A 1HD3A 1FYNA 1BK2A 1CKAA 3M0PA 1EFNA 4LN2A 1YWOA 2RN8A 2M0YA 2PTKA 2DBMA 2LX7A 1AD5A 3PE0A 1WXTA 2RNAA 4CC7A 2KRNA 4HVUA 1JXMA 1T0HA 4F14A 2LP5A 2EVRA 3M0SA 2KYBA 2O9SA 4LUDA 1X6BA 2EPDA 2IIMA 2V1RA 3UF4A 4J9EA 3SEMA 3ULRB 2P4RA
chains in the Genus database with same CATH superfamily
2JOYA 3CXCP 3CPWA 1K8AU 1YFNA 1RLPC 3OW2S 5ECAA 4DBHA 1YJWT 3UA6A 2DYBA 2HL3A 5DY9A 4Y28E 1YHQT 2KGTA 3O5ZA 1M2VB 4PLLA 2DZ9A 2KSSA 3VKIA 3TCJA 3P8BB 3CMAT 2NUPA 1TSFA 2WSEE 2C0IA 3QSUA 3VV0A 3CXCS 3DB4A 2CP6A 2IG0A 1I5OB 1LOJA 1K73C 2YSQA 4PJLA 4M78D 2RJEA 5IHIA 1JJ2A 4ATOA 1VQ5A 4DBRA 2OX7A 3D7SB 1ZA1B 2XDPA 2KNBB 1QP2A 2EFIA 4XU2A 1WNLA 3TREA 2QG9B 2RF0A 1PRLC 3CCST 1KQSS 3JAME 3L2RA 1YNZA 2COYA 4HCBA 2RJDA 2EKHA 2DVEA 2CKKA 1M8VA 1K0SA 3C95A 1JQQA 3M0TA 1U1SA 2ZPIB 3H0FA 2YLBA 1MV3A 2A7YA 2LQ8A 2VV5A 2DXCA 3LX7A 4C92A 4IUQA 1PNJA 1VQOQ 2GQVA 3RBBB 1AZGB 5FRMA 1G2BA 1QWFA 3CXCA 1RAAB 2HL5C 4FYVB 4DBFA 2AT1B 1B34B 4B9WA 1ZBXA 2D0NA 3PMIA 1SHGA 4JRQA 3RIRA 3CCEQ 3EH2A 1NE8A 1U8RA 1Y71A 2RD1A 3QJ6A 1UHFA 3CD6A 1NYFA 1OX9A 3CEYA 2KY9A 2O88A 1VQ9A 3EGUA 3NMZC 1MNEA 3V8JA 2QA4Q 5LJ5e 1VYVA 1AVZC 2RQRA 4D6WA 3PT9A 1VUBA 3VRYA 3OS5A 4C92C 2CSQA 2RK2A 3CCJA 1HK9A 1VQ5Q 5GAN3 3L2VA 2AZVA 5HK0A 2BIVA 2EGAA 1D09B 4E7JA 4OMQA 2R5MA 5LJ5f 2D6FA 5GAOr 4FSSA 1M3BA 1R0CB 2JT4A 1Q81C 3JB9I 1GBQA 4XK8E 1LVKA 2YUNA 4M7AA 2DNUA 3R6OA 4AFQC 4HCCA 5IH2A 2K79A 2W0ZA 3QWYA 5LJ3f 4JLIA 2DEUA 3OYYA 4OMLA 4FSXA 4RCBA 1Q7YU 2LQKA 3MHXA 4OVAA 3CC2Q 1VQPQ 2DM1A 3VRZA 2D1XA 3EHRA 3RKWA 1N9RA 2QDYB 3GPLA 3ZEHA 1JXOA 2FZCB 4M7DG 2PNIA 1NBEB 3H41A 2LDMA 2ZAEA 3HRSA 2RHYA 4ELYC 3S3OA 1WHJA 1OPLA 3A8LB 3G6ET 4XU3A 3FRNA 4JPBW 4L6V5 3VS7A 4KT0E 5CO7A 4M7DD 1RI9A 1YITT 1VQNT 2D0QB 2LNVA 1WQWA 4MMLA 3QKJA 1YN8A 1EX4A 4XAXB 1SKUB 4BACA 1LCKA 3OYMA 1GCPA 4AG1C 1YWPA 2VB6A 2X4JA 3LGLA 1QQJA 1EIFA 4M7AB 2QQBA 1AWJA 4C5HA 1TUCA 1RUWA 3X24B 2LRQA 1MMGA 2GFUA 4XU1A 1KQSA 1KC8U 4MMKA 1C0MA 2DKGA 2SRCA 2X9HA 4HT8A 4M77A 4OMNA 2PUKB 3PMTA 2JM9A 1QVFA 1PSEA 1BKBA 1T3SA 4E7IA 4PJOC 5CKHA 4NS5A 1VQ8T 3DLMA 3CCUQ 3A8HB 1GFCA 4QKUA 3TEEA 1NM7A 1X43A 4QQGA 4UC4A 2GCXA 3ER0A 4ME7A 1DJ7B 2DZCA 5DM7R 3BW1A 1TU0B 4RG2A 1VQLQ 4XTWA 2X4XA 1ZSGA 1BU1A 2DPPB 1UGRB 2FZKB 2ATCB 1HJDA 3PIPA 1JBMA 2EQMA 2ZPGB 3QYGB 4HCZA 2EWNA 1NLPC 2LTOA 2DIGA 5KYYB 2RQUA 2AHJB 1YP5A 1KSWA 2CS7A 2E1HA 4FM4B 5IHNA 5GAOp 2ZGWA 2JMAA 2K3BA 2QK0A 4EMKB 2J05A 4C92F 3HL8A 2QEXA 1K8AC 2LQWA 1W4SA 3MCAB 2F69A 3CPWS 1ZSZA 4ZNXA 2L0AA 2QTXA 1PSFA 5GAMg 3MEUA 1ABOA 2Y4YA 3CCVA 4DBQA 2EJ9A 4M77C 3GF5A 2L3PA 1Y96A 2MWPA 1E6GA 3H0HA 1I07A 2A0FB 3SD4A 2CZ6B 1S72A 1XQHA 3RESA 4ZGJB 2M51A 1P92A 1GFDA 2J6FA 2EKOA 3CCET 1AHJB 1XJWB 4KULA 4JLGA 5L8RE 2DIQA 1Q82R 2CT3A 1Y0MA 2EYYA 1OZ3A 4LD6A 1QVGS 1PRMC 2ENMA 4JUVA 1QVFP 2ZCFB 3VS6A 4Z8AA 4M75F 2CP2A 4Y91A 4V2SA 5FWBA 4ORZA 4CC4B 3I55A 4KBMB 5KCHA 3FJ5A 5CKFA 3BY7A 4RG8A 1M30A 2XHCA 3GBQA 3M56A 2DL4A 3QXEB 4HXJA 3QZ9B 4PJOD 3MEVA 5GMKi 3G4ST 5A2QE 1QVFS 4A4FA 3OSVA 5CR2A 2Y90A 2K5LA 2JS0A 1MMNA 4OGEA 2RI3A 2R57A 2ROTA 3VYGA 2ZZDA 4BDZA 1Y96B 2D8HA 3VUBA 3VS1A 3G4SA 1VQ8Q 3OYLA 1YIJQ 3SFMA 1VQLA 2V1QA 2LX9A 5GANf 5GAOm 2LQNA 2YHTA 2F2XA 2K2VA 1UGQB 2FL7A 1Z9ZA 1M8MA 1R77A 1RADB 1VQ9T 7AT1B 2RQTA 3OYIA 1OYXA 1QKXA 3ZFJA 2QYZA 3E19A 4EMHA 4C8QD 1CKAA 3M0PA 5KYXB 5CIUA 4LN2A 3E9GA 2CZ7B 4ZN1A 5IT9E 2PTKA 3CMEA 1YHQQ 5HK3A 3PE0A 3HHTB 4KH1B 4HVUA 1T0HA 1TTHB 2DO3A 2E4HA 2EVRA 1I81A 2IPOB 3M0SA 2O9SA 3OYNA 4JS4A 3SEMA 4N0AA 2E5QA 4DA4A 2FPFA 2AKLA 3CBMA 1VQKT 4E47A 2ESWA 4L59A 4B9XA 1W2BA 4J9GA 1QLYA 3QDRB 3CCSQ 1D3BA 1EZZB 2COZA 2EYWA 4F7UG 2LNHB 4Z89A 5KE2A 2C0TA 2BZYA 2FYKA 2E3IA 1QCNA 5A0GA 1BI1A 3CBPA 2FRYA 4D8KA 2ECZA 2LMJA 3L1AA 4E7KA 3RMQA 3H6ZA 3MPUB 3TSWA 1M3CA 1HYOA 3ZL7C 1UTIA 1WHGA 2EYXA 2K7AA 1VQOA 1Q7YC 4KUDK 1R8OB 2JN0A 5DLOA 1VQPA 1S1NA 4JZ4A 1NEBA 3UT1A 4FCYA 4BE2A 3HSBA 4BI3A 2JTEA 2M16A 2DEQA 3CCEA 4LUEA 4C92D 3LH5A 3JCMV 2EW3A 4J7IA 4PJOF 4A63B 4EPCA 2FO0A 4AG2C 4J8OA 2MIOA 1VQ4A 1NJIU 3MP6A 2LCCA 2DTOA 2RMOA 1IRXA 1IO6A 1ACMB 1D3BB 2KMTA 4F7UE 2YUQA 3BDLA 4M77D 4M75E 2DL7A 3JCMc 4F7UB 2VYTA 1N5ZA 4J6YA 4EIKA 1Q86U 2DL8A 4WF2A 4QT7A 2FVUA 4M78C 1RAHB 3A1PA 4LDUA 3A8GB 2HDAA 5GAOn 5GJVB 3EGXA 1KD1R 4QVZA 2E3HA 1H92A 3CC4Q 4M75A 2HBPA 2VUBA 4AFSC 1M2OA 4MDWA 4M7DF 1K0XA 2X4WA 2EBPA 3QO3A 3S3NA 2KT8A 4D8DA 5I2SA 4E2FB 3G6EA 5IN1A 3HPWA 2A36A 1OZ2A 3MEWA 2ZPEB 1R0BG 3RKYA 2RPNA 2E12A 4JRIA 3OQ5A 1G3SA 1W70A 1AWXA 4ESRA 5D6YA 2JM8A 2VXEA 5DLQE 2GQIA 1K1ZA 2ABLA 2DERA 2RJFA 3JCMb 3JCMQ 1LPLA 5CK9A 2KRSA 1I8FA 1X2KA 1NZ9A 2DXTA 1RL2A 2DETA 1QCFA 3HKSA 1D1CA 3CBOA 5AYFA 3O8VA 2HAXA 2O01E 4C8QB 5GAOq 2D9TA 4NL2A 2Z0WA 2EQUA 4FW2A 2K2MA 3JCMJ 1WX6A 4JJNK 3E2UA 2E41A 1H641 5GAMh 4X9CA 5GAN7 5KE3A 3OMGA 2R58A 2Y4XA 4WCIA 1VQ5T 1Q86C 3BDUA 2GBQA 3EFOA 1MHNA 1M4ZA 2RH2A 1BIAA 5I11A 3ME9A 1QCOA 5D6XA 1WHMA 5EG2A 2DYIA 4LD9K 3UATA 2E5KA 2P0PA 2O2OA 4CC2A 4BDYA 1JB0E 1UUEA 3CCJQ 3CPFA 1K9AA 5J26A 3MKDA 3SWNB 4PNOA 1W2BS 5GMKh 3LYIA 3UWNA 1WDXA 2K5FA 2MAMA 4F17A 3RDVA 4N4GA 1NJIC 3J7AF 2G3RA 1E6HA 2OTLT 3EG2A 1TOVA 1I5LA 2CZ0B 2QQ9A 1MMDA 2XDBA 1BIBA 1KHIA 2EQKA 3KFVA 1YCYA 4C8QA 2ZPBB 1D0YA 3H8ZA 3PFSA 3NTHA 3EGDB 4FYWB 1Z9QA 3FC3A 1YJ9Q 1VQLT 4J83A 3OYKA 3OBWA 3J81E 3DB3A 1TUGB 4OF1A 3I56A 3AHUA 2XI9A 2KBTA 4FL6A 2QQAA 3V8KA 4QW2A 4X9DA 3WVEB 2EAYA 2JJ9A 4M4ZA 2V8JA 3CD6Q 4PJOA 1LJOA 1RLQC 1X01A 1JJ2P 2CYZB 2CP5A 2MOXA 1D0XA 2OAUA 2L3RA 3EFRA 2CZ1B 3N5BB 4M75C 4LDYA 3CMAQ 1PWTA 4C0DB 2K3YA 1RACB 1WGSA 4LDVA 1RAGB 1ZBJA 1YJNA 4NL3A 2OTJT 2B86A 1BB9A 3M57A 1OQKA 2QGFB 1WHHA 2FEIA 3EGDA 2KXCA 2M9UA 4RTXA 5IXFA 3C0CA 2P0KA 2JTFA 2CUBA 5GAN6 2K6DA 3VJPA 2VXFA 1H8KA 1SRMA 3C12A 3OS1A 4BI8B 4RKUE 4M7AD 2DJZA 4J9HA 1FMVA 1IZ6A 1PKTA 2GFAA 2QGGA 2H3JA 2LJ3A 4PJOB 5D6WA 3GLXA 5EC7A 3M4GA 4E7HA 3OS0A 2RHIA 4M77E 2F5TX 1GCQC 4J9BA 2LJ1A 4N4HA 2MWOA 4F04B 1K76A 4C92G 1VOMA 2H8HA 3OYJA 5AT1B 2KQWA 2JMCA 5I21A 2QA4A 5HY6A 1JRIA 1FMWA 3OYEA 2NWMA 1KFZA 2FPEA 2A37A 3OMCA 3A8MB 4IURA 3PVLA 5A0DA 2XK0A 1X6GA 2PVGB 1I1JA 2CREA 2GNCA 3WVDB 3OA6A 4PJNA 2DLPA 3FLGA 2AIRB 1PD1A 1G3TA 1W1FA 2F2WA 1OU9A 5IAYA 1WJRA 1YJWQ 3X20B 3I55Q 4ZTFA 3CC7T 1B07A 2RB6A 4DOVA 4JZ3A 3LLRA 4K11A 2FRWA 2EGEA 4Y92A 1YI2A 4R0KA 1Y57A 4C8QE 1QP3A 5GAMj 1YWOA 4A4EA 2PQWA 1BCMA 5CQXA 3J80E 2DBMA 4M7DC 1WXTA 4F14A 1NJIR 2LP5A 2L89A 4LUDA 2RHXA 1X6BA 2DFUA 4C92E 1VQPT 2V1RA 1TH7A 5C6SA 1OULA 3UF4A 1M9SA 5FU7C 1MNDA 2LT1A 4EDUA 3A5ZB 4WTOB 2FHDA 3CCRA 1NG2A 2BZXA 5GMKe 3OB9A 4LXCA 4VUBA 5KH6A 4FT2A 4M78A 4XTVA 3HP9A 4CRIA 4PFOA 5KYWB 2RHUA 5FU7B 3L2QA 1ZUKA 2DVJA 4GLMA 4M7DA 1PKSA 4JRKA 2XMFA 1X2QA 3NGPA 4FU6A 2H3EB 2K5IA 2CT4A 2NUTB 1AWWA 4M78E 5CAIA 2E70A 3CD6T 1RAEB 1M5Q1 1D1BA 2FPDA 1WXBA 1VIFA 1WHLA 2ED1A 2VASA 2RA2A 1MMAA 1IXDA 1SHFA 4F16A 1KC8C 4ZGDB 4A4HA 2X35A 2EYZA 2KAFA 3BFMA 2L3SA 1Y07A 1U3OA 2DL5A 2LCSA 2CUDA 1I0CA 1W2BP 1T3LA 3OBYA 4M78B 1JU5C 1WA7A 5HCKA 1KK7A 3EFSA 1M2VA 4FYXB 1PC0A 5GANg 3UDCA 3JCMP 1OV3A 4M77F 5GAMd 1K8AR 1A0NB 2JTMA 2RM4A 4RTYA 2P84A 2NUTA 4IKFA 1PG5B 3AT1B 2WACA 2NLUA 1KD1U 1KQ1A 3JB9G 2X3XD 1Q82U 3EG3A 4E7LA 4AFZC 2A08A 1IB8A 2J6KA 4A4KA 5GANj 1VQ9Q 1T0JA 4JJCA 4M7AC 4O5VA 5GANh 1NPPA 4QVDA 5GJWB 5GANd 2KK4A 1S72T 5LJ3g 1YIJT 1IHWA 5GMKm 3I55T 4AFUC 4JRPA 3CC7A 4X34A 1GCQA 2VGMA 1WYXA 2F2VA 4OP0A 1VQ6T 1H3ZA 1WZOA 2PU9B 4X1VA 2HCKA 4C0FA 3G71Q 2LCLA 2X3WD 1KQSP 4MZTA 3G71A 4M7AG 1TXQA 1IGUA 4KH0B 2G6FX 2I0NA 2V26A 1IGQA 1V1CA 5GAN8 5GAN5 1Q95G 2YLCA 4C92B 5J3BA 4PKCC 2X51A 4HT9A 3Q1JA 1WJSA 2L3QA 3OSSC 2RI5A 4M75D 4C0DC 2HQXA 2JS2A 1D1AA 2DAQA 1YCSB 1GXIE 1B34A 2QAZA 2LC4A 2DD5A 2DTHA 3EG1A 3GIBA 2QASA 2CSIA 3CCQQ 2OTLQ 4L5GA 4II1A 2KRMA 2PZ1A 4JJBA 4BY6B 2DK3A 1YJNQ 2CGHA 1VYUA 3QYHB 3ASKA 4M7DE 3CCJT 1VQ7Q 2MCNA 3IQLA 3UPUA 4C0GA 1UHCA 1V76A 2L2PA 2ED0A 2L5QA 3LWHA 4PL6A 2J06A 3REAB 1SPKA 2XG8D 1B3QA 4AT1B 2OTJQ 1O9SA 1XNIA 4M78F 4PLIA 2YWWA 3GNGA 4C0ZA 3E9FA 5LJ5h 3PGGA 2BZ8A 3SDZA 4C5IA 1OU8A 5KYYA 1NLOC 1OPKA 4FYYB 1KQ2A 2JVVA 3X26B 1SSFA 2CH4A 3JCMX 5I22A 5FLXE 2E6ZA 4EMKA 1M3AA 4M7AE 1VQNQ 2DE0X 2LZ6B 3OYDA 1YITQ 2F1LA 1SEMA 5IHKA 4JDSA 2DRMA 3CCRT 3FIFA 2K4YA 3HFOA 3URGA 2MI6A 3CCUA 1XTDA 3M0UA 1YJNT 2HNIA 2KDSA 1MGQA 3VS0A 3JCMf 5KCOA 1I4K1 4CC3A 4OGCA 3RR6A 2F5KA 3ZBDA 1QMCA 3G4SQ 4AMCA 2C0OA 2FG0A 2DL3A 4Q5WA 1KHCA 1FWZA 1SG5A 2GTJA 2NUZA 3FB9A 4E7SA 4DEYA 2O9VA 4RCCA 1PD0A 1QKWA 1Q7YR 1OOTA 1RI0A 5HKCA 1WHKA 4C8QC 5CQYA 4TVRA 2DBKA 4KRTA 3CC4T 1KD1C 2ZPHB 2RHZA 4GBQA 1HSQA 2V8IA 5GMKl 3M54A 1TUDA 5CVIA 2YUOA 2VWFA 3OY9A 5GAN4 3OYCA 4M77B 3CC2A 2YXYA 3I35A 1SSHA 1K73R 3JSCA 1AWOA 1FMKA 4GLKA 1VQ6Q 1UG1A 1FXXA 2QTVA 2CP0A 2EQJA 1VQ8A 2HKQB 4KGXB 2W10A 5GAMe 4IUVA 2HSEB 4HVWA 3OYAA 4EMKC 1G83A 3PIOA 4IUTA 2LJ0A 1KIKA 1QWEA 2DRKA 5LL6S 2O31A 2EGCA 1UGVA 4MZPA 1IREB 9ATCB 2HMAA 3CCVT 3KBGA 2RJCA 3CQTA 4XTXA 3NHNA 4Z88A 1KG1A 4RTZA 5GANe 3P8DA 4IUUA 1K9MC 4A4GA 1PCXA 1GRIA 2JUFA 4RUGA 1VQMQ 1Q81R 1CKBA 2AK5A 1VQOT 2HEQA 3LH0A 3I56T 1TG0A 1UECA 1GBRA 3TSZA 3TVTA 5IXBA 1GL5A 1ZX6A 3L2WA 4HCKA 1M27C 5D7UA 4ZTJA 2HBWA 1VQNA 4LDWA 3EAEA 1TS9A 1VQMT 1YHQA 1AEYA 4RMOA 3EG9A 1U1TA 3VYHB 4IIOA 1ZSZB 3I9QA 4XQ3A 4MDXA 3SHWA 3S3MA 2DD4A 3OS2A 4J9IA 2DX1A 4N4IA 1BBZA 3R6NA 1TWBA 1X6OA 5CKEA 3M53A 4R56A 1YIJA 1Q81U 3M0QA 1LNXA 2XU8A 4BE1A 2CH4W 4BI4A 2HZYA 3MP1A 4RTVA 2GTOA 2QDLA 4J6XA 1HD3A 3I56Q 1FYNA 1PM3A 1BK2A 1EFNA 1FX7A 2PUOB 2RN8A 1RAFB 3L42A 2M0OA 3JB9H 5FROA 1OX8A 2RNAA 4CC7A 3S6WA 3NTIA 1JXMA 3QHSA 4DQ2A 3JB9J 1YJWA 2XKOC 1BI0A 2YRVA 4J9EA 3JCMe 5LJ3h 3EG9B 4OB0B 5LJ3j 2P4RA 1G5VA 2JNGA 4J7FA 4KUIA 4DOWA 1ZQ1A 4NOYA 1NYGA 4IIMA 2X4YA 1WQ7A 3X25B 2E64A 5GMKj 2EJFA 2OAWA 3V7SA 1VA7A 1B7TA 2DTIA 4RTTA 2M1HA 4F7UA 2KVQG 1QW1A 4QQDA 3HRTA 3CC7Q 1K9MR 5KYNA 2K9GA 4PJOE 1Y7XA 3JV3A 5KYXA 4GY5A 5C0MA 3LWIA 3FEOA 2QEXQ 4BE0A 2OI3A 3EGXB 1HXDA 3CCQA 1ABQA 4M75B 1VQ4T 4ZN3A 4R55A 2KXDA 3M58A 4QVCA 3A8OB 4BD3A 4FIBA 1K9MU 2QQSA 3EHQA 1AT1B 3THKA 5KYUB 2VC8A 3P8HA 3TQ7P 3JRZA 1MUZA 1QVGA 3RMSA 4BY6C 3CCUT 1J3TA 1UFFA 1CSKA 2O4XB 4J9DA 1D0ZA 1ZUUA 2P4TA 3V7CA 1VQ7T 2AZSA 1U5SA 4PFZA 3CMAA 3QUIA 1WXUA 2MK5A 4ELZC 4LDXA 1JEGA 2A28A 5I2MA 1YI2Q 4HVVA 3VS5A 2GF7A 4HA8A 2KEAA 1XOVA 4OB3B 2SEMA 3OYFA 3QIIA 1C6VX 3INZA 1X69A 3M5AA 1N9SA 8ATCB 2QXFA 4M75G 4LNPA 1W6XA 4F7UF 4P5NA 1RABB 1WLPB 1JO8A 3CCLA 4E6RA 5FU6C 3TU4K 2GGRA 3CC4A 3M9QA 4J9FA 5M9OA 3X28B 3RERA 4J9CA 3M0RA 1NPRA 4E7ZA 3GP8A 3EFOB 5KYUA 3G6EQ 4JS5A 3VS2A 2HD0A 4HKEA 1UJYA 1BYMA 2O4XA 3L2UA 2FB7A 3UA7A 2WSFE 2ZPFB 3SWNA 3NTKA 3MO8A 4ANJA 1H3HA 1U06A 2MF2A 4OB2B 3META 3HTRA 1BCOA 2RK1A 3H0IA 1G3WA 3VS3A 2OTJA 3HFNA 1Q82C 4JJDA 3CCLQ 3I5RA 1UEBA 2OJ2A 4OMOA 2BE7D 3M55A 2EQIA 1UGPB 3REBB 5LJ3e 3DKMA 1SF9A 1ZLMA 3QDFA 1BI3A 5J39A 2DMOA 4RTUA 4A54A 3EG0A 3MJXA 1M1KU 1WI7A 3OYHA 2C06A 2KYMA 3M59A 2E10A 2EYQA 4OB1B 3CCMA 2QI2A 4ZGEB 5CCAA 2HKNA 3FJPA 1AOJA 2XIDA 2QA4T 2NYSA 4EMGA 4KGZB 2K57A 2KR3A 2XICA 2BKDN 3QWXX 2M02A 5FU6B 2JW4A 1JJ2S 2VVKA 4PK4A 1MV0B 2OTLA 3GOXA 3JCMd 1VIEA 2A3LA 1X75C 1QVPA 3JCMh 3VUZA 5GAN2 2RQWA 3QJYA 3U23A 1N8RC 2R5AA 2LVMA 1WJQA 2DILA 1KC8R 3DLLA 1VQ7A 2V8KA 2DXUA 2RO0A 3G1JA 5GAMf 3RUXA 1VQKA 4PJMA 2HQEA 2XDDA 2BE9B 2CDTA 3JCMW 3QBYA 1M90U 4OMMA 3L2ZA 5LJ5g 2L8DA 2DF6A 2J6OA 4J6WA 1YBYA 3G7ZA 3EH1A 1YJ9T 4C8QG 1Q86R 5FWCA 2VGNA 4BUGA 1F1BB 4MZMA 3CCLT 2RQVA 2HSPA 3G71T 2CP3A 1QVGP 3QZ5B 1C1AA 3CCVQ 5L23A 4XTZA 1OI1A 1NEGA 1ZA2B 2COWA 3RKXA 3LW5E 3WXMB 4B6MA 3M4YA 1ZHIA 1UGSB 2DA9A 1UE9A 1S72Q 1M90C 1M1KC 2JXBA 4DEXA 2EJGA 3MEAA 1K73U 2KROA 4O6JA 1X27A 1VQ6A 2P0QA 4M78G 4OMFB 2D8JA 3SB2A 2MYSA 3T9NA 2BTTA 1ARKA 2PVDB 3KUFA 3OW2P 3JCMg 2EIFA 4XTUA 2YUPA 4RTWA 2E6NA 5A0LA 1YJ9A 4IUPA 2J7IA 4BB7A 4C5GA 2MMPA 1AZEA 4FT4A 1O75A 2I2LA 1N27A 2KT1A 3F70A 1VYTA 1ZUYA 4KGVB 3VS4A 3VU3C 3HRUA 3PVQA 1M1GA 5LJ5j 3CPWP 3CCSA 3CMET 1G3YA 5LJ5d 1OEBA 3RNJA 3QG1A 1G8XA 3KXTA 2KI7A 4M77G 4QQ6A 4PFPA 3V7RA 1RAIB 4YTLA 2XD0A 2PVOB 2DXBA 3CCMT 2B8AA 1UJ0A 1WIEA 4C5EA 2WSCE 1VQMA 3CC2T 1IHVA 1PHTA 3NPFA 3SWNC 3JB9F 1M90R 2HQHA 3JB9D 3I5SA 2E65A 4LE9A 1N8RR 2YT6A 3OYGA 1YITA 2ROLA 3CCRQ 2DJQA 4M7AF 1V29B 4Z02A 2KE9A 5FRNA 1N8RU 5FW9A 2VKNA 1UB4A 3OYBA 3FDRA 2RI2A 4XTYA 1VQ4Q 3CMEQ 2YRDA 1E7OA 1SRLA 2AKKA 2IVWA 2K3XA 4C8QF 8AT1B 4OMPA 2QEXT 4PJJA 3BE3A 3GNFB 3A98A 3PNWC 5KYWA 3C4SA 1UDLA 1ZSZC 5LJ3d 5CKBA 4XU0A 2NUPB 2YDLA 1K4US 1WPYA 4M7DB 4N0AC 1WFWA 3H9NA 5GAOl 2FZGB 1KJWA 1M1FA 3LGFA 1N6AA 2JZ2A 3MP8A 4J5YA 3CCMQ 1BI2A 2BUDA 3OW2A 2M0YA 2LT4A 1M1KR 2YRCA 5CKDA 4A53A 2LX7A 1YI2T 1AD5A 3QPHA 6AT1B 2KRNA 1VQKQ 4CI0C 4FW1A 3E1SA 2CP7A 3V8LA 2KYBA 2MPXC 3PTAA 2EPDA 3NFCA 2IIMA 3CCQT 4PJOG 3C94A 2QQRA 3ULRB
chains in the Genus database with same CATH topology
1NG2A 2BZXA 2FPFA 2AKLA 1RLPC 5ECAA 2ESWA 3UA6A 4J9GA 1QLYA 2DYBA 1NYGA 4IIMA 2KGTA 2EYWA 2LNHB 3O5ZA 4Z89A 2C0TA 2BZYA 1ZUKA 2OAWA 1VA7A 2C0IA 2DVJA 2FRYA 4GLMA 4RTTA 4D8KA 2ECZA 2LMJA 1PKSA 2XMFA 1X2QA 3NGPA 2CT4A 1AWWA 2K9GA 3TSWA 2YSQA 1M3CA 3JV3A 3ZL7C 5IHIA 1UTIA 2EYXA 2K7AA 2OI3A 2FPDA 1ABQA 1S1NA 4JZ4A 2KNBB 1NEBA 1WXBA 2ED1A 2KXDA 1SHFA 2JTEA 2RF0A 4F16A 1PRLC 4LUEA 3LH5A 2EW3A 4A63B 2FO0A 1YNZA 2EYZA 4AG2C 2EKHA 2L3SA 2MIOA 3EHQA 3THKA 1K0SA 1JQQA 1U3OA 3M0TA 2DL5A 2RMOA 1MUZA 2CUDA 2LCSA 1I0CA 3H0FA 1T3LA 1MV3A 1J3TA 1UFFA 1CSKA 4J9DA 1IO6A 1ZUUA 1JU5C 1WA7A 1PNJA 5HCKA 2AZSA 3RBBB 1AZGB 1U5SA 1G2BA 2YUQA 1WXUA 1QWFA 1OV3A 1JEGA 2A28A 2DL7A 4HVVA 3VS5A 2KEAA 1A0NB 2D0NA 1XOVA 1N5ZA 2SEMA 4RTYA 4EIKA 2DL8A 1SHGA 4QT7A 1X69A 4LNPA 2X3XD 1UHFA 1NYFA 1W6XA 3EG3A 4AFZC 2A08A 2HDAA 2J6KA 1T0JA 4JJCA 1WLPB 1JO8A 5GJVB 2O88A 4E6RA 3EGUA 3NMZC 5GJWB 1H92A 2GGRA 1VYVA 1AVZC 2RQRA 3VRYA 4J9FA 2CSQA 4AFSC 4AFUC 1K0XA 2EBPA 4J9CA 1GCQA 2KT8A 3M0RA 2AZVA 4D8DA 1WYXA 2F2VA 2EGAA 4OMQA 4X1VA 2HCKA 2X3WD 4FSSA 2A36A 1M3BA 3VS2A 2JT4A 2G6FX 2RPNA 2I0NA 1UJYA 1GBQA 1W70A 1V1CA 1AWXA 3UA7A 4ESRA 2YUNA 2JM8A 2DNUA 4AFQC 5IH2A 2GQIA 1K1ZA 2ABLA 2K79A 1H3HA 1U06A 2L3QA 2JS2A 2W0ZA 3QWYA 3H0IA 1YCSB 3VS3A 4OMLA 2KRSA 3EG1A 4JJDA 3I5RA 2OJ2A 2CSIA 1X2KA 4OMOA 2DM1A 3VRZA 2D1XA 1QCFA 2EQIA 3EHRA 3REBB 1JXOA 2KRMA 2PNIA 3H41A 2PZ1A 1ZLMA 2DMOA 2K2MA 4JJBA 4RTUA 1OPLA 1WX6A 3EG0A 1VYUA 4JPBW 3VS7A 2MCNA 3IQLA 1WI7A 1UHCA 2L2PA 2ED0A 1RI9A 4WCIA 2KYMA 2J06A 2GBQA 3REAB 1SPKA 5I11A 1YN8A 1AOJA 1B3QA 3UATA 2E5KA 2O2OA 1LCKA 2KR3A 4CC2A 3QWXX 1GCPA 4AG1C 1YWPA 2JW4A 2VVKA 1UUEA 1K9AA 2BZ8A 1MV0B 1AWJA 1TUCA 1NLOC 1OPKA 1RUWA 1WDXA 2RQWA 4F17A 2CH4A 3U23A 5I22A 2SRCA 1E6HA 3EG2A 1M3AA 2DILA 2DE0X 2LZ6B 4OMNA 1SEMA 5IHKA 2JM9A 2DRMA 1T3SA 3KFVA 3M0UA 1GFCA 2CDTA 4OMMA 3VS0A 1NM7A 4CC3A 1X43A 2DF6A 2J6OA 1Z9QA 2C0OA 2FG0A 2DL3A 5FWCA 1ZSGA 2GTJA 2NUZA 1BU1A 2RQVA 2KBTA 2HSPA 1HJDA 4DEYA 2O9VA 5L23A 1QKWA 1NEGA 1OOTA 4M4ZA 1RLQC 1NLPC 2DA9A 1UE9A 2RQUA 2DBKA 4KRTA 2JXBA 2MOXA 4DEXA 1YP5A 4GBQA 1HSQA 1KSWA 2KROA 1TUDA 1X27A 2YUOA 5IHNA 2VWFA 2D8JA 2JMAA 2K3BA 2BTTA 1ARKA 2J05A 3I35A 1SSHA 1AWOA 1PWTA 1FMKA 2LQWA 1UG1A 2YUPA 4RTWA 4ZNXA 2L0AA 2J7IA 1ZBJA 1ABOA 2W10A 4HVWA 1AZEA 2B86A 1BB9A 2KT1A 2L3PA 1G83A 1VYTA 1E6GA 1ZUYA 3H0HA 1I07A 2FEIA 2KXCA 3VS4A 2LJ0A 4RTXA 5IXFA 1QWEA 2DRKA 1KIKA 2M51A 2O31A 3C0CA 2EGCA 1UGVA 3PVQA 1GFDA 2J6FA 2CUBA 2K6DA 3CQTA 1H8KA 1SRMA 3NHNA 4Z88A 4RTZA 1OEBA 1Y0MA 2CT3A 3RNJA 2EYYA 1GRIA 4RUGA 4J9HA 1PKTA 1CKBA 1PRMC 2LJ3A 2AK5A 2ENMA 2HEQA 5EC7A 1TG0A 1UECA 1UJ0A 1WIEA 1GBRA 3VS6A 4Z8AA 3TSZA 3TVTA 5IXBA 1PHTA 1GL5A 3NPFA 1ZX6A 5FWBA 4ORZA 4CC4B 4HCKA 1GCQC 4J9BA 2LJ1A 3I5SA 4LE9A 2YT6A 1M27C 3FJ5A 2ROLA 1K76A 1M30A 2HBWA 2DJQA 3GBQA 2DL4A 2H8HA 2KE9A 4HXJA 1AEYA 5FW9A 2JMCA 2VKNA 4IIOA 3I9QA 2NWMA 1KFZA 1E7OA 2FPEA 2A37A 2JS0A 3SHWA 3PVLA 1SRLA 2AKKA 1X6GA 2ROTA 4J9IA 4OMPA 1I1JA 3VS1A 2CREA 2D8HA 2DX1A 2GNCA 3A98A 1BBZA 3R6NA 2DLPA 1UDLA 1W1FA 2F2WA 2YDLA 2V1QA 1K4US 2LQNA 3M0QA 2F2XA 1WFWA 1B07A 1M8MA 1Z9ZA 2CH4W 1KJWA 4JZ3A 4RTVA 2GTOA 2RQTA 4K11A 2FRWA 2EGEA 4Y92A 4R0KA 1QKXA 2QDLA 1Y57A 1HD3A 1FYNA 1BK2A 1CKAA 3M0PA 1EFNA 4LN2A 1YWOA 2RN8A 2M0YA 2PTKA 2DBMA 2LX7A 1AD5A 3PE0A 1WXTA 2RNAA 4CC7A 2KRNA 4HVUA 1JXMA 1T0HA 4F14A 2LP5A 2EVRA 3M0SA 2KYBA 2O9SA 4LUDA 1X6BA 2EPDA 2IIMA 2V1RA 3UF4A 4J9EA 3SEMA 3ULRB 2P4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG2 A;  2BZX A;  2FPF A;  2AKL A;  1RLP C;  5ECA A;  2ESW A;  3UA6 A;  4J9G A;  1QLY A;  2DYB A;  1NYG A;  4IIM A;  2KGT A;  2EYW A;  2LNH B;  3O5Z A;  4Z89 A;  2C0T A;  2BZY A;  1ZUK A;  2OAW A;  1VA7 A;  2C0I A;  2DVJ A;  2FRY A;  4GLM A;  4RTT A;  4D8K A;  2ECZ A;  2LMJ A;  1PKS A;  2XMF A;  1X2Q A;  3NGP A;  2CT4 A;  1AWW A;  2K9G A;  3TSW A;  2YSQ A;  1M3C A;  3JV3 A;  3ZL7 C;  5IHI A;  1UTI A;  2EYX A;  2K7A A;  2OI3 A;  2FPD A;  1ABQ A;  1S1N A;  4JZ4 A;  2KNB B;  1NEB A;  1WXB A;  2ED1 A;  2KXD A;  1SHF A;  2JTE A;  2RF0 A;  4F16 A;  1PRL C;  4LUE A;  3LH5 A;  2EW3 A;  4A63 B;  2FO0 A;  1YNZ A;  2EYZ A;  4AG2 C;  2EKH A;  2L3S A;  2MIO A;  3EHQ A;  3THK A;  1K0S A;  1JQQ A;  1U3O A;  3M0T A;  2DL5 A;  2RMO A;  1MUZ A;  2CUD A;  2LCS A;  1I0C A;  3H0F A;  1T3L A;  1MV3 A;  1J3T A;  1UFF A;  1CSK A;  4J9D A;  1IO6 A;  1ZUU A;  1JU5 C;  1WA7 A;  1PNJ A;  5HCK A;  2AZS A;  3RBB B;  1AZG B;  1U5S A;  1G2B A;  2YUQ A;  1WXU A;  1QWF A;  1OV3 A;  1JEG A;  2A28 A;  2DL7 A;  4HVV A;  3VS5 A;  2KEA A;  1A0N B;  2D0N A;  1XOV A;  1N5Z A;  2SEM A;  4RTY A;  4EIK A;  2DL8 A;  1SHG A;  4QT7 A;  1X69 A;  4LNP A;  2X3X D;  1UHF A;  1NYF A;  1W6X A;  3EG3 A;  4AFZ C;  2A08 A;  2HDA A;  2J6K A;  1T0J A;  4JJC A;  1WLP B;  1JO8 A;  5GJV B;  2O88 A;  4E6R A;  3EGU A;  3NMZ C;  5GJW B;  1H92 A;  2GGR A;  1VYV A;  1AVZ C;  2RQR A;  3VRY A;  4J9F A;  2CSQ A;  4AFS C;  4AFU C;  1K0X A;  2EBP A;  4J9C A;  1GCQ A;  2KT8 A;  3M0R A;  2AZV A;  4D8D A;  1WYX A;  2F2V A;  2EGA A;  4OMQ A;  4X1V A;  2HCK A;  2X3W D;  4FSS A;  2A36 A;  1M3B A;  3VS2 A;  2JT4 A;  2G6F X;  2RPN A;  2I0N A;  1UJY A;  1GBQ A;  1W70 A;  1V1C A;  1AWX A;  3UA7 A;  4ESR A;  2YUN A;  2JM8 A;  2DNU A;  4AFQ C;  5IH2 A;  2GQI A;  1K1Z A;  2ABL A;  2K79 A;  1H3H A;  1U06 A;  2L3Q A;  2JS2 A;  2W0Z A;  3QWY A;  3H0I A;  1YCS B;  3VS3 A;  4OML A;  2KRS A;  3EG1 A;  4JJD A;  3I5R A;  2OJ2 A;  2CSI A;  1X2K A;  4OMO A;  2DM1 A;  3VRZ A;  2D1X A;  1QCF A;  2EQI A;  3EHR A;  3REB B;  1JXO A;  2KRM A;  2PNI A;  3H41 A;  2PZ1 A;  1ZLM A;  2DMO A;  2K2M A;  4JJB A;  4RTU A;  1OPL A;  1WX6 A;  3EG0 A;  1VYU A;  4JPB W;  3VS7 A;  2MCN A;  3IQL A;  1WI7 A;  1UHC A;  2L2P A;  2ED0 A;  1RI9 A;  4WCI A;  2KYM A;  2J06 A;  2GBQ A;  3REA B;  1SPK A;  5I11 A;  1YN8 A;  1AOJ A;  1B3Q A;  3UAT A;  2E5K A;  2O2O A;  1LCK A;  2KR3 A;  4CC2 A;  3QWX X;  1GCP A;  4AG1 C;  1YWP A;  2JW4 A;  2VVK A;  1UUE A;  1K9A A;  2BZ8 A;  1MV0 B;  1AWJ A;  1TUC A;  1NLO C;  1OPK A;  1RUW A;  1WDX A;  2RQW A;  4F17 A;  2CH4 A;  3U23 A;  5I22 A;  2SRC A;  1E6H A;  3EG2 A;  1M3A A;  2DIL A;  2DE0 X;  2LZ6 B;  4OMN A;  1SEM A;  5IHK A;  2JM9 A;  2DRM A;  1T3S A;  3KFV A;  3M0U A;  1GFC A;  2CDT A;  4OMM A;  3VS0 A;  1NM7 A;  4CC3 A;  1X43 A;  2DF6 A;  2J6O A;  1Z9Q A;  2C0O A;  2FG0 A;  2DL3 A;  5FWC A;  1ZSG A;  2GTJ A;  2NUZ A;  1BU1 A;  2RQV A;  2KBT A;  2HSP A;  1HJD A;  4DEY A;  2O9V A;  5L23 A;  1QKW A;  1NEG A;  1OOT A;  4M4Z A;  1RLQ C;  1NLP C;  2DA9 A;  1UE9 A;  2RQU A;  2DBK A;  4KRT A;  2JXB A;  2MOX A;  4DEX A;  1YP5 A;  4GBQ A;  1HSQ A;  1KSW A;  2KRO A;  1TUD A;  1X27 A;  2YUO A;  5IHN A;  2VWF A;  2D8J A;  2JMA A;  2K3B A;  2BTT A;  1ARK A;  2J05 A;  3I35 A;  1SSH A;  1AWO A;  1PWT A;  1FMK A;  2LQW A;  1UG1 A;  2YUP A;  4RTW A;  4ZNX A;  2L0A A;  2J7I A;  1ZBJ A;  1ABO A;  2W10 A;  4HVW A;  1AZE A;  2B86 A;  1BB9 A;  2KT1 A;  2L3P A;  1G83 A;  1VYT A;  1E6G A;  1ZUY A;  3H0H A;  1I07 A;  2FEI A;  2KXC A;  3VS4 A;  2LJ0 A;  4RTX A;  5IXF A;  1QWE A;  2DRK A;  1KIK A;  2M51 A;  2O31 A;  3C0C A;  2EGC A;  1UGV A;  3PVQ A;  1GFD A;  2J6F A;  2CUB A;  2K6D A;  3CQT A;  1H8K A;  1SRM A;  3NHN A;  4Z88 A;  4RTZ A;  1OEB A;  1Y0M A;  2CT3 A;  3RNJ A;  2EYY A;  1GRI A;  4RUG A;  4J9H A;  1PKT A;  1CKB A;  1PRM C;  2LJ3 A;  2AK5 A;  2ENM A;  2HEQ A;  5EC7 A;  1TG0 A;  1UEC A;  1UJ0 A;  1WIE A;  1GBR A;  3VS6 A;  4Z8A A;  3TSZ A;  3TVT A;  5IXB A;  1PHT A;  1GL5 A;  3NPF A;  1ZX6 A;  5FWB A;  4ORZ A;  4CC4 B;  4HCK A;  1GCQ C;  4J9B A;  2LJ1 A;  3I5S A;  4LE9 A;  2YT6 A;  1M27 C;  3FJ5 A;  2ROL A;  1K76 A;  1M30 A;  2HBW A;  2DJQ A;  3GBQ A;  2DL4 A;  2H8H A;  2KE9 A;  4HXJ A;  1AEY A;  5FW9 A;  2JMC A;  2VKN A;  4IIO A;  3I9Q A;  2NWM A;  1KFZ A;  1E7O A;  2FPE A;  2A37 A;  2JS0 A;  3SHW A;  3PVL A;  1SRL A;  2AKK A;  1X6G A;  2ROT A;  4J9I A;  4OMP A;  1I1J A;  3VS1 A;  2CRE A;  2D8H A;  2DX1 A;  2GNC A;  3A98 A;  1BBZ A;  3R6N A;  2DLP A;  1UDL A;  1W1F A;  2F2W A;  2YDL A;  2V1Q A;  1K4U S;  2LQN A;  3M0Q A;  2F2X A;  1WFW A;  1B07 A;  1M8M A;  1Z9Z A;  2CH4 W;  1KJW A;  4JZ3 A;  4RTV A;  2GTO A;  2RQT A;  4K11 A;  2FRW A;  2EGE A;  4Y92 A;  4R0K A;  1QKX A;  2QDL A;  1Y57 A;  1HD3 A;  1FYN A;  1BK2 A;  1CKA A;  3M0P A;  1EFN A;  4LN2 A;  1YWO A;  2RN8 A;  2M0Y A;  2PTK A;  2DBM A;  2LX7 A;  1AD5 A;  3PE0 A;  1WXT A;  2RNA A;  4CC7 A;  2KRN A;  4HVU A;  1JXM A;  1T0H A;  4F14 A;  2LP5 A;  2EVR A;  3M0S A;  2KYB A;  2O9S A;  4LUD A;  1X6B A;  2EPD A;  2IIM A;  2V1R A;  3UF4 A;  4J9E A;  3SEM A;  3ULR B;  2P4R A; 
#chains in the Genus database with same CATH topology
 2JOY A;  3CXC P;  3CPW A;  1K8A U;  1YFN A;  1RLP C;  3OW2 S;  5ECA A;  4DBH A;  1YJW T;  3UA6 A;  2DYB A;  2HL3 A;  5DY9 A;  4Y28 E;  1YHQ T;  2KGT A;  3O5Z A;  1M2V B;  4PLL A;  2DZ9 A;  2KSS A;  3VKI A;  3TCJ A;  3P8B B;  3CMA T;  2NUP A;  1TSF A;  2WSE E;  2C0I A;  3QSU A;  3VV0 A;  3CXC S;  3DB4 A;  2CP6 A;  2IG0 A;  1I5O B;  1LOJ A;  1K73 C;  2YSQ A;  4PJL A;  4M78 D;  2RJE A;  5IHI A;  1JJ2 A;  4ATO A;  1VQ5 A;  4DBR A;  2OX7 A;  3D7S B;  1ZA1 B;  2XDP A;  2KNB B;  1QP2 A;  2EFI A;  4XU2 A;  1WNL A;  3TRE A;  2QG9 B;  2RF0 A;  1PRL C;  3CCS T;  1KQS S;  3JAM E;  3L2R A;  1YNZ A;  2COY A;  4HCB A;  2RJD A;  2EKH A;  2DVE A;  2CKK A;  1M8V A;  1K0S A;  3C95 A;  1JQQ A;  3M0T A;  1U1S A;  2ZPI B;  3H0F A;  2YLB A;  1MV3 A;  2A7Y A;  2LQ8 A;  2VV5 A;  2DXC A;  3LX7 A;  4C92 A;  4IUQ A;  1PNJ A;  1VQO Q;  2GQV A;  3RBB B;  1AZG B;  5FRM A;  1G2B A;  1QWF A;  3CXC A;  1RAA B;  2HL5 C;  4FYV B;  4DBF A;  2AT1 B;  1B34 B;  4B9W A;  1ZBX A;  2D0N A;  3PMI A;  1SHG A;  4JRQ A;  3RIR A;  3CCE Q;  3EH2 A;  1NE8 A;  1U8R A;  1Y71 A;  2RD1 A;  3QJ6 A;  1UHF A;  3CD6 A;  1NYF A;  1OX9 A;  3CEY A;  2KY9 A;  2O88 A;  1VQ9 A;  3EGU A;  3NMZ C;  1MNE A;  3V8J A;  2QA4 Q;  5LJ5 e;  1VYV A;  1AVZ C;  2RQR A;  4D6W A;  3PT9 A;  1VUB A;  3VRY A;  3OS5 A;  4C92 C;  2CSQ A;  2RK2 A;  3CCJ A;  1HK9 A;  1VQ5 Q;  5GAN 3;  3L2V A;  2AZV A;  5HK0 A;  2BIV A;  2EGA A;  1D09 B;  4E7J A;  4OMQ A;  2R5M A;  5LJ5 f;  2D6F A;  5GAO r;  4FSS A;  1M3B A;  1R0C B;  2JT4 A;  1Q81 C;  3JB9 I;  1GBQ A;  4XK8 E;  1LVK A;  2YUN A;  4M7A A;  2DNU A;  3R6O A;  4AFQ C;  4HCC A;  5IH2 A;  2K79 A;  2W0Z A;  3QWY A;  5LJ3 f;  4JLI A;  2DEU A;  3OYY A;  4OML A;  4FSX A;  4RCB A;  1Q7Y U;  2LQK A;  3MHX A;  4OVA A;  3CC2 Q;  1VQP Q;  2DM1 A;  3VRZ A;  2D1X A;  3EHR A;  3RKW A;  1N9R A;  2QDY B;  3GPL A;  3ZEH A;  1JXO A;  2FZC B;  4M7D G;  2PNI A;  1NBE B;  3H41 A;  2LDM A;  2ZAE A;  3HRS A;  2RHY A;  4ELY C;  3S3O A;  1WHJ A;  1OPL A;  3A8L B;  3G6E T;  4XU3 A;  3FRN A;  4JPB W;  4L6V 5;  3VS7 A;  4KT0 E;  5CO7 A;  4M7D D;  1RI9 A;  1YIT T;  1VQN T;  2D0Q B;  2LNV A;  1WQW A;  4MML A;  3QKJ A;  1YN8 A;  1EX4 A;  4XAX B;  1SKU B;  4BAC A;  1LCK A;  3OYM A;  1GCP A;  4AG1 C;  1YWP A;  2VB6 A;  2X4J A;  3LGL A;  1QQJ A;  1EIF A;  4M7A B;  2QQB A;  1AWJ A;  4C5H A;  1TUC A;  1RUW A;  3X24 B;  2LRQ A;  1MMG A;  2GFU A;  4XU1 A;  1KQS A;  1KC8 U;  4MMK A;  1C0M A;  2DKG A;  2SRC A;  2X9H A;  4HT8 A;  4M77 A;  4OMN A;  2PUK B;  3PMT A;  2JM9 A;  1QVF A;  1PSE A;  1BKB A;  1T3S A;  4E7I A;  4PJO C;  5CKH A;  4NS5 A;  1VQ8 T;  3DLM A;  3CCU Q;  3A8H B;  1GFC A;  4QKU A;  3TEE A;  1NM7 A;  1X43 A;  4QQG A;  4UC4 A;  2GCX A;  3ER0 A;  4ME7 A;  1DJ7 B;  2DZC A;  5DM7 R;  3BW1 A;  1TU0 B;  4RG2 A;  1VQL Q;  4XTW A;  2X4X A;  1ZSG A;  1BU1 A;  2DPP B;  1UGR B;  2FZK B;  2ATC B;  1HJD A;  3PIP A;  1JBM A;  2EQM A;  2ZPG B;  3QYG B;  4HCZ A;  2EWN A;  1NLP C;  2LTO A;  2DIG A;  5KYY B;  2RQU A;  2AHJ B;  1YP5 A;  1KSW A;  2CS7 A;  2E1H A;  4FM4 B;  5IHN A;  5GAO p;  2ZGW A;  2JMA A;  2K3B A;  2QK0 A;  4EMK B;  2J05 A;  4C92 F;  3HL8 A;  2QEX A;  1K8A C;  2LQW A;  1W4S A;  3MCA B;  2F69 A;  3CPW S;  1ZSZ A;  4ZNX A;  2L0A A;  2QTX A;  1PSF A;  5GAM g;  3MEU A;  1ABO A;  2Y4Y A;  3CCV A;  4DBQ A;  2EJ9 A;  4M77 C;  3GF5 A;  2L3P A;  1Y96 A;  2MWP A;  1E6G A;  3H0H A;  1I07 A;  2A0F B;  3SD4 A;  2CZ6 B;  1S72 A;  1XQH A;  3RES A;  4ZGJ B;  2M51 A;  1P92 A;  1GFD A;  2J6F A;  2EKO A;  3CCE T;  1AHJ B;  1XJW B;  4KUL A;  4JLG A;  5L8R E;  2DIQ A;  1Q82 R;  2CT3 A;  1Y0M A;  2EYY A;  1OZ3 A;  4LD6 A;  1QVG S;  1PRM C;  2ENM A;  4JUV A;  1QVF P;  2ZCF B;  3VS6 A;  4Z8A A;  4M75 F;  2CP2 A;  4Y91 A;  4V2S A;  5FWB A;  4ORZ A;  4CC4 B;  3I55 A;  4KBM B;  5KCH A;  3FJ5 A;  5CKF A;  3BY7 A;  4RG8 A;  1M30 A;  2XHC A;  3GBQ A;  3M56 A;  2DL4 A;  3QXE B;  4HXJ A;  3QZ9 B;  4PJO D;  3MEV A;  5GMK i;  3G4S T;  5A2Q E;  1QVF S;  4A4F A;  3OSV A;  5CR2 A;  2Y90 A;  2K5L A;  2JS0 A;  1MMN A;  4OGE A;  2RI3 A;  2R57 A;  2ROT A;  3VYG A;  2ZZD A;  4BDZ A;  1Y96 B;  2D8H A;  3VUB A;  3VS1 A;  3G4S A;  1VQ8 Q;  3OYL A;  1YIJ Q;  3SFM A;  1VQL A;  2V1Q A;  2LX9 A;  5GAN f;  5GAO m;  2LQN A;  2YHT A;  2F2X A;  2K2V A;  1UGQ B;  2FL7 A;  1Z9Z A;  1M8M A;  1R77 A;  1RAD B;  1VQ9 T;  7AT1 B;  2RQT A;  3OYI A;  1OYX A;  1QKX A;  3ZFJ A;  2QYZ A;  3E19 A;  4EMH A;  4C8Q D;  1CKA A;  3M0P A;  5KYX B;  5CIU A;  4LN2 A;  3E9G A;  2CZ7 B;  4ZN1 A;  5IT9 E;  2PTK A;  3CME A;  1YHQ Q;  5HK3 A;  3PE0 A;  3HHT B;  4KH1 B;  4HVU A;  1T0H A;  1TTH B;  2DO3 A;  2E4H A;  2EVR A;  1I81 A;  2IPO B;  3M0S A;  2O9S A;  3OYN A;  4JS4 A;  3SEM A;  4N0A A;  2E5Q A;  4DA4 A;  2FPF A;  2AKL A;  3CBM A;  1VQK T;  4E47 A;  2ESW A;  4L59 A;  4B9X A;  1W2B A;  4J9G A;  1QLY A;  3QDR B;  3CCS Q;  1D3B A;  1EZZ B;  2COZ A;  2EYW A;  4F7U G;  2LNH B;  4Z89 A;  5KE2 A;  2C0T A;  2BZY A;  2FYK A;  2E3I A;  1QCN A;  5A0G A;  1BI1 A;  3CBP A;  2FRY A;  4D8K A;  2ECZ A;  2LMJ A;  3L1A A;  4E7K A;  3RMQ A;  3H6Z A;  3MPU B;  3TSW A;  1M3C A;  1HYO A;  3ZL7 C;  1UTI A;  1WHG A;  2EYX A;  2K7A A;  1VQO A;  1Q7Y C;  4KUD K;  1R8O B;  2JN0 A;  5DLO A;  1VQP A;  1S1N A;  4JZ4 A;  1NEB A;  3UT1 A;  4FCY A;  4BE2 A;  3HSB A;  4BI3 A;  2JTE A;  2M16 A;  2DEQ A;  3CCE A;  4LUE A;  4C92 D;  3LH5 A;  3JCM V;  2EW3 A;  4J7I A;  4PJO F;  4A63 B;  4EPC A;  2FO0 A;  4AG2 C;  4J8O A;  2MIO A;  1VQ4 A;  1NJI U;  3MP6 A;  2LCC A;  2DTO A;  2RMO A;  1IRX A;  1IO6 A;  1ACM B;  1D3B B;  2KMT A;  4F7U E;  2YUQ A;  3BDL A;  4M77 D;  4M75 E;  2DL7 A;  3JCM c;  4F7U B;  2VYT A;  1N5Z A;  4J6Y A;  4EIK A;  1Q86 U;  2DL8 A;  4WF2 A;  4QT7 A;  2FVU A;  4M78 C;  1RAH B;  3A1P A;  4LDU A;  3A8G B;  2HDA A;  5GAO n;  5GJV B;  3EGX A;  1KD1 R;  4QVZ A;  2E3H A;  1H92 A;  3CC4 Q;  4M75 A;  2HBP A;  2VUB A;  4AFS C;  1M2O A;  4MDW A;  4M7D F;  1K0X A;  2X4W A;  2EBP A;  3QO3 A;  3S3N A;  2KT8 A;  4D8D A;  5I2S A;  4E2F B;  3G6E A;  5IN1 A;  3HPW A;  2A36 A;  1OZ2 A;  3MEW A;  2ZPE B;  1R0B G;  3RKY A;  2RPN A;  2E12 A;  4JRI A;  3OQ5 A;  1G3S A;  1W70 A;  1AWX A;  4ESR A;  5D6Y A;  2JM8 A;  2VXE A;  5DLQ E;  2GQI A;  1K1Z A;  2ABL A;  2DER A;  2RJF A;  3JCM b;  3JCM Q;  1LPL A;  5CK9 A;  2KRS A;  1I8F A;  1X2K A;  1NZ9 A;  2DXT A;  1RL2 A;  2DET A;  1QCF A;  3HKS A;  1D1C A;  3CBO A;  5AYF A;  3O8V A;  2HAX A;  2O01 E;  4C8Q B;  5GAO q;  2D9T A;  4NL2 A;  2Z0W A;  2EQU A;  4FW2 A;  2K2M A;  3JCM J;  1WX6 A;  4JJN K;  3E2U A;  2E41 A;  1H64 1;  5GAM h;  4X9C A;  5GAN 7;  5KE3 A;  3OMG A;  2R58 A;  2Y4X A;  4WCI A;  1VQ5 T;  1Q86 C;  3BDU A;  2GBQ A;  3EFO A;  1MHN A;  1M4Z A;  2RH2 A;  1BIA A;  5I11 A;  3ME9 A;  1QCO A;  5D6X A;  1WHM A;  5EG2 A;  2DYI A;  4LD9 K;  3UAT A;  2E5K A;  2P0P A;  2O2O A;  4CC2 A;  4BDY A;  1JB0 E;  1UUE A;  3CCJ Q;  3CPF A;  1K9A A;  5J26 A;  3MKD A;  3SWN B;  4PNO A;  1W2B S;  5GMK h;  3LYI A;  3UWN A;  1WDX A;  2K5F A;  2MAM A;  4F17 A;  3RDV A;  4N4G A;  1NJI C;  3J7A F;  2G3R A;  1E6H A;  2OTL T;  3EG2 A;  1TOV A;  1I5L A;  2CZ0 B;  2QQ9 A;  1MMD A;  2XDB A;  1BIB A;  1KHI A;  2EQK A;  3KFV A;  1YCY A;  4C8Q A;  2ZPB B;  1D0Y A;  3H8Z A;  3PFS A;  3NTH A;  3EGD B;  4FYW B;  1Z9Q A;  3FC3 A;  1YJ9 Q;  1VQL T;  4J83 A;  3OYK A;  3OBW A;  3J81 E;  3DB3 A;  1TUG B;  4OF1 A;  3I56 A;  3AHU A;  2XI9 A;  2KBT A;  4FL6 A;  2QQA A;  3V8K A;  4QW2 A;  4X9D A;  3WVE B;  2EAY A;  2JJ9 A;  4M4Z A;  2V8J A;  3CD6 Q;  4PJO A;  1LJO A;  1RLQ C;  1X01 A;  1JJ2 P;  2CYZ B;  2CP5 A;  2MOX A;  1D0X A;  2OAU A;  2L3R A;  3EFR A;  2CZ1 B;  3N5B B;  4M75 C;  4LDY A;  3CMA Q;  1PWT A;  4C0D B;  2K3Y A;  1RAC B;  1WGS A;  4LDV A;  1RAG B;  1ZBJ A;  1YJN A;  4NL3 A;  2OTJ T;  2B86 A;  1BB9 A;  3M57 A;  1OQK A;  2QGF B;  1WHH A;  2FEI A;  3EGD A;  2KXC A;  2M9U A;  4RTX A;  5IXF A;  3C0C A;  2P0K A;  2JTF A;  2CUB A;  5GAN 6;  2K6D A;  3VJP A;  2VXF A;  1H8K A;  1SRM A;  3C12 A;  3OS1 A;  4BI8 B;  4RKU E;  4M7A D;  2DJZ A;  4J9H A;  1FMV A;  1IZ6 A;  1PKT A;  2GFA A;  2QGG A;  2H3J A;  2LJ3 A;  4PJO B;  5D6W A;  3GLX A;  5EC7 A;  3M4G A;  4E7H A;  3OS0 A;  2RHI A;  4M77 E;  2F5T X;  1GCQ C;  4J9B A;  2LJ1 A;  4N4H A;  2MWO A;  4F04 B;  1K76 A;  4C92 G;  1VOM A;  2H8H A;  3OYJ A;  5AT1 B;  2KQW A;  2JMC A;  5I21 A;  2QA4 A;  5HY6 A;  1JRI A;  1FMW A;  3OYE A;  2NWM A;  1KFZ A;  2FPE A;  2A37 A;  3OMC A;  3A8M B;  4IUR A;  3PVL A;  5A0D A;  2XK0 A;  1X6G A;  2PVG B;  1I1J A;  2CRE A;  2GNC A;  3WVD B;  3OA6 A;  4PJN A;  2DLP A;  3FLG A;  2AIR B;  1PD1 A;  1G3T A;  1W1F A;  2F2W A;  1OU9 A;  5IAY A;  1WJR A;  1YJW Q;  3X20 B;  3I55 Q;  4ZTF A;  3CC7 T;  1B07 A;  2RB6 A;  4DOV A;  4JZ3 A;  3LLR A;  4K11 A;  2FRW A;  2EGE A;  4Y92 A;  1YI2 A;  4R0K A;  1Y57 A;  4C8Q E;  1QP3 A;  5GAM j;  1YWO A;  4A4E A;  2PQW A;  1BCM A;  5CQX A;  3J80 E;  2DBM A;  4M7D C;  1WXT A;  4F14 A;  1NJI R;  2LP5 A;  2L89 A;  4LUD A;  2RHX A;  1X6B A;  2DFU A;  4C92 E;  1VQP T;  2V1R A;  1TH7 A;  5C6S A;  1OUL A;  3UF4 A;  1M9S A;  5FU7 C;  1MND A;  2LT1 A;  4EDU A;  3A5Z B;  4WTO B;  2FHD A;  3CCR A;  1NG2 A;  2BZX A;  5GMK e;  3OB9 A;  4LXC A;  4VUB A;  5KH6 A;  4FT2 A;  4M78 A;  4XTV A;  3HP9 A;  4CRI A;  4PFO A;  5KYW B;  2RHU A;  5FU7 B;  3L2Q A;  1ZUK A;  2DVJ A;  4GLM A;  4M7D A;  1PKS A;  4JRK A;  2XMF A;  1X2Q A;  3NGP A;  4FU6 A;  2H3E B;  2K5I A;  2CT4 A;  2NUT B;  1AWW A;  4M78 E;  5CAI A;  2E70 A;  3CD6 T;  1RAE B;  1M5Q 1;  1D1B A;  2FPD A;  1WXB A;  1VIF A;  1WHL A;  2ED1 A;  2VAS A;  2RA2 A;  1MMA A;  1IXD A;  1SHF A;  4F16 A;  1KC8 C;  4ZGD B;  4A4H A;  2X35 A;  2EYZ A;  2KAF A;  3BFM A;  2L3S A;  1Y07 A;  1U3O A;  2DL5 A;  2LCS A;  2CUD A;  1I0C A;  1W2B P;  1T3L A;  3OBY A;  4M78 B;  1JU5 C;  1WA7 A;  5HCK A;  1KK7 A;  3EFS A;  1M2V A;  4FYX B;  1PC0 A;  5GAN g;  3UDC A;  3JCM P;  1OV3 A;  4M77 F;  5GAM d;  1K8A R;  1A0N B;  2JTM A;  2RM4 A;  4RTY A;  2P84 A;  2NUT A;  4IKF A;  1PG5 B;  3AT1 B;  2WAC A;  2NLU A;  1KD1 U;  1KQ1 A;  3JB9 G;  2X3X D;  1Q82 U;  3EG3 A;  4E7L A;  4AFZ C;  2A08 A;  1IB8 A;  2J6K A;  4A4K A;  5GAN j;  1VQ9 Q;  1T0J A;  4JJC A;  4M7A C;  4O5V A;  5GAN h;  1NPP A;  4QVD A;  5GJW B;  5GAN d;  2KK4 A;  1S72 T;  5LJ3 g;  1YIJ T;  1IHW A;  5GMK m;  3I55 T;  4AFU C;  4JRP A;  3CC7 A;  4X34 A;  1GCQ A;  2VGM A;  1WYX A;  2F2V A;  4OP0 A;  1VQ6 T;  1H3Z A;  1WZO A;  2PU9 B;  4X1V A;  2HCK A;  4C0F A;  3G71 Q;  2LCL A;  2X3W D;  1KQS P;  4MZT A;  3G71 A;  4M7A G;  1TXQ A;  1IGU A;  4KH0 B;  2G6F X;  2I0N A;  2V26 A;  1IGQ A;  1V1C A;  5GAN 8;  5GAN 5;  1Q95 G;  2YLC A;  4C92 B;  5J3B A;  4PKC C;  2X51 A;  4HT9 A;  3Q1J A;  1WJS A;  2L3Q A;  3OSS C;  2RI5 A;  4M75 D;  4C0D C;  2HQX A;  2JS2 A;  1D1A A;  2DAQ A;  1YCS B;  1GXI E;  1B34 A;  2QAZ A;  2LC4 A;  2DD5 A;  2DTH A;  3EG1 A;  3GIB A;  2QAS A;  2CSI A;  3CCQ Q;  2OTL Q;  4L5G A;  4II1 A;  2KRM A;  2PZ1 A;  4JJB A;  4BY6 B;  2DK3 A;  1YJN Q;  2CGH A;  1VYU A;  3QYH B;  3ASK A;  4M7D E;  3CCJ T;  1VQ7 Q;  2MCN A;  3IQL A;  3UPU A;  4C0G A;  1UHC A;  1V76 A;  2L2P A;  2ED0 A;  2L5Q A;  3LWH A;  4PL6 A;  2J06 A;  3REA B;  1SPK A;  2XG8 D;  1B3Q A;  4AT1 B;  2OTJ Q;  1O9S A;  1XNI A;  4M78 F;  4PLI A;  2YWW A;  3GNG A;  4C0Z A;  3E9F A;  5LJ5 h;  3PGG A;  2BZ8 A;  3SDZ A;  4C5I A;  1OU8 A;  5KYY A;  1NLO C;  1OPK A;  4FYY B;  1KQ2 A;  2JVV A;  3X26 B;  1SSF A;  2CH4 A;  3JCM X;  5I22 A;  5FLX E;  2E6Z A;  4EMK A;  1M3A A;  4M7A E;  1VQN Q;  2DE0 X;  2LZ6 B;  3OYD A;  1YIT Q;  2F1L A;  1SEM A;  5IHK A;  4JDS A;  2DRM A;  3CCR T;  3FIF A;  2K4Y A;  3HFO A;  3URG A;  2MI6 A;  3CCU A;  1XTD A;  3M0U A;  1YJN T;  2HNI A;  2KDS A;  1MGQ A;  3VS0 A;  3JCM f;  5KCO A;  1I4K 1;  4CC3 A;  4OGC A;  3RR6 A;  2F5K A;  3ZBD A;  1QMC A;  3G4S Q;  4AMC A;  2C0O A;  2FG0 A;  2DL3 A;  4Q5W A;  1KHC A;  1FWZ A;  1SG5 A;  2GTJ A;  2NUZ A;  3FB9 A;  4E7S A;  4DEY A;  2O9V A;  4RCC A;  1PD0 A;  1QKW A;  1Q7Y R;  1OOT A;  1RI0 A;  5HKC A;  1WHK A;  4C8Q C;  5CQY A;  4TVR A;  2DBK A;  4KRT A;  3CC4 T;  1KD1 C;  2ZPH B;  2RHZ A;  4GBQ A;  1HSQ A;  2V8I A;  5GMK l;  3M54 A;  1TUD A;  5CVI A;  2YUO A;  2VWF A;  3OY9 A;  5GAN 4;  3OYC A;  4M77 B;  3CC2 A;  2YXY A;  3I35 A;  1SSH A;  1K73 R;  3JSC A;  1AWO A;  1FMK A;  4GLK A;  1VQ6 Q;  1UG1 A;  1FXX A;  2QTV A;  2CP0 A;  2EQJ A;  1VQ8 A;  2HKQ B;  4KGX B;  2W10 A;  5GAM e;  4IUV A;  2HSE B;  4HVW A;  3OYA A;  4EMK C;  1G83 A;  3PIO A;  4IUT A;  2LJ0 A;  1KIK A;  1QWE A;  2DRK A;  5LL6 S;  2O31 A;  2EGC A;  1UGV A;  4MZP A;  1IRE B;  9ATC B;  2HMA A;  3CCV T;  3KBG A;  2RJC A;  3CQT A;  4XTX A;  3NHN A;  4Z88 A;  1KG1 A;  4RTZ A;  5GAN e;  3P8D A;  4IUU A;  1K9M C;  4A4G A;  1PCX A;  1GRI A;  2JUF A;  4RUG A;  1VQM Q;  1Q81 R;  1CKB A;  2AK5 A;  1VQO T;  2HEQ A;  3LH0 A;  3I56 T;  1TG0 A;  1UEC A;  1GBR A;  3TSZ A;  3TVT A;  5IXB A;  1GL5 A;  1ZX6 A;  3L2W A;  4HCK A;  1M27 C;  5D7U A;  4ZTJ A;  2HBW A;  1VQN A;  4LDW A;  3EAE A;  1TS9 A;  1VQM T;  1YHQ A;  1AEY A;  4RMO A;  3EG9 A;  1U1T A;  3VYH B;  4IIO A;  1ZSZ B;  3I9Q A;  4XQ3 A;  4MDX A;  3SHW A;  3S3M A;  2DD4 A;  3OS2 A;  4J9I A;  2DX1 A;  4N4I A;  1BBZ A;  3R6N A;  1TWB A;  1X6O A;  5CKE A;  3M53 A;  4R56 A;  1YIJ A;  1Q81 U;  3M0Q A;  1LNX A;  2XU8 A;  4BE1 A;  2CH4 W;  4BI4 A;  2HZY A;  3MP1 A;  4RTV A;  2GTO A;  2QDL A;  4J6X A;  1HD3 A;  3I56 Q;  1FYN A;  1PM3 A;  1BK2 A;  1EFN A;  1FX7 A;  2PUO B;  2RN8 A;  1RAF B;  3L42 A;  2M0O A;  3JB9 H;  5FRO A;  1OX8 A;  2RNA A;  4CC7 A;  3S6W A;  3NTI A;  1JXM A;  3QHS A;  4DQ2 A;  3JB9 J;  1YJW A;  2XKO C;  1BI0 A;  2YRV A;  4J9E A;  3JCM e;  5LJ3 h;  3EG9 B;  4OB0 B;  5LJ3 j;  2P4R A;  1G5V A;  2JNG A;  4J7F A;  4KUI A;  4DOW A;  1ZQ1 A;  4NOY A;  1NYG A;  4IIM A;  2X4Y A;  1WQ7 A;  3X25 B;  2E64 A;  5GMK j;  2EJF A;  2OAW A;  3V7S A;  1VA7 A;  1B7T A;  2DTI A;  4RTT A;  2M1H A;  4F7U A;  2KVQ G;  1QW1 A;  4QQD A;  3HRT A;  3CC7 Q;  1K9M R;  5KYN A;  2K9G A;  4PJO E;  1Y7X A;  3JV3 A;  5KYX A;  4GY5 A;  5C0M A;  3LWI A;  3FEO A;  2QEX Q;  4BE0 A;  2OI3 A;  3EGX B;  1HXD A;  3CCQ A;  1ABQ A;  4M75 B;  1VQ4 T;  4ZN3 A;  4R55 A;  2KXD A;  3M58 A;  4QVC A;  3A8O B;  4BD3 A;  4FIB A;  1K9M U;  2QQS A;  3EHQ A;  1AT1 B;  3THK A;  5KYU B;  2VC8 A;  3P8H A;  3TQ7 P;  3JRZ A;  1MUZ A;  1QVG A;  3RMS A;  4BY6 C;  3CCU T;  1J3T A;  1UFF A;  1CSK A;  2O4X B;  4J9D A;  1D0Z A;  1ZUU A;  2P4T A;  3V7C A;  1VQ7 T;  2AZS A;  1U5S A;  4PFZ A;  3CMA A;  3QUI A;  1WXU A;  2MK5 A;  4ELZ C;  4LDX A;  1JEG A;  2A28 A;  5I2M A;  1YI2 Q;  4HVV A;  3VS5 A;  2GF7 A;  4HA8 A;  2KEA A;  1XOV A;  4OB3 B;  2SEM A;  3OYF A;  3QII A;  1C6V X;  3INZ A;  1X69 A;  3M5A A;  1N9S A;  8ATC B;  2QXF A;  4M75 G;  4LNP A;  1W6X A;  4F7U F;  4P5N A;  1RAB B;  1WLP B;  1JO8 A;  3CCL A;  4E6R A;  5FU6 C;  3TU4 K;  2GGR A;  3CC4 A;  3M9Q A;  4J9F A;  5M9O A;  3X28 B;  3RER A;  4J9C A;  3M0R A;  1NPR A;  4E7Z A;  3GP8 A;  3EFO B;  5KYU A;  3G6E Q;  4JS5 A;  3VS2 A;  2HD0 A;  4HKE A;  1UJY A;  1BYM A;  2O4X A;  3L2U A;  2FB7 A;  3UA7 A;  2WSF E;  2ZPF B;  3SWN A;  3NTK A;  3MO8 A;  4ANJ A;  1H3H A;  1U06 A;  2MF2 A;  4OB2 B;  3MET A;  3HTR A;  1BCO A;  2RK1 A;  3H0I A;  1G3W A;  3VS3 A;  2OTJ A;  3HFN A;  1Q82 C;  4JJD A;  3CCL Q;  3I5R A;  1UEB A;  2OJ2 A;  4OMO A;  2BE7 D;  3M55 A;  2EQI A;  1UGP B;  3REB B;  5LJ3 e;  3DKM A;  1SF9 A;  1ZLM A;  3QDF A;  1BI3 A;  5J39 A;  2DMO A;  4RTU A;  4A54 A;  3EG0 A;  3MJX A;  1M1K U;  1WI7 A;  3OYH A;  2C06 A;  2KYM A;  3M59 A;  2E10 A;  2EYQ A;  4OB1 B;  3CCM A;  2QI2 A;  4ZGE B;  5CCA A;  2HKN A;  3FJP A;  1AOJ A;  2XID A;  2QA4 T;  2NYS A;  4EMG A;  4KGZ B;  2K57 A;  2KR3 A;  2XIC A;  2BKD N;  3QWX X;  2M02 A;  5FU6 B;  2JW4 A;  1JJ2 S;  2VVK A;  4PK4 A;  1MV0 B;  2OTL A;  3GOX A;  3JCM d;  1VIE A;  2A3L A;  1X75 C;  1QVP A;  3JCM h;  3VUZ A;  5GAN 2;  2RQW A;  3QJY A;  3U23 A;  1N8R C;  2R5A A;  2LVM A;  1WJQ A;  2DIL A;  1KC8 R;  3DLL A;  1VQ7 A;  2V8K A;  2DXU A;  2RO0 A;  3G1J A;  5GAM f;  3RUX A;  1VQK A;  4PJM A;  2HQE A;  2XDD A;  2BE9 B;  2CDT A;  3JCM W;  3QBY A;  1M90 U;  4OMM A;  3L2Z A;  5LJ5 g;  2L8D A;  2DF6 A;  2J6O A;  4J6W A;  1YBY A;  3G7Z A;  3EH1 A;  1YJ9 T;  4C8Q G;  1Q86 R;  5FWC A;  2VGN A;  4BUG A;  1F1B B;  4MZM A;  3CCL T;  2RQV A;  2HSP A;  3G71 T;  2CP3 A;  1QVG P;  3QZ5 B;  1C1A A;  3CCV Q;  5L23 A;  4XTZ A;  1OI1 A;  1NEG A;  1ZA2 B;  2COW A;  3RKX A;  3LW5 E;  3WXM B;  4B6M A;  3M4Y A;  1ZHI A;  1UGS B;  2DA9 A;  1UE9 A;  1S72 Q;  1M90 C;  1M1K C;  2JXB A;  4DEX A;  2EJG A;  3MEA A;  1K73 U;  2KRO A;  4O6J A;  1X27 A;  1VQ6 A;  2P0Q A;  4M78 G;  4OMF B;  2D8J A;  3SB2 A;  2MYS A;  3T9N A;  2BTT A;  1ARK A;  2PVD B;  3KUF A;  3OW2 P;  3JCM g;  2EIF A;  4XTU A;  2YUP A;  4RTW A;  2E6N A;  5A0L A;  1YJ9 A;  4IUP A;  2J7I A;  4BB7 A;  4C5G A;  2MMP A;  1AZE A;  4FT4 A;  1O75 A;  2I2L A;  1N27 A;  2KT1 A;  3F70 A;  1VYT A;  1ZUY A;  4KGV B;  3VS4 A;  3VU3 C;  3HRU A;  3PVQ A;  1M1G A;  5LJ5 j;  3CPW P;  3CCS A;  3CME T;  1G3Y A;  5LJ5 d;  1OEB A;  3RNJ A;  3QG1 A;  1G8X A;  3KXT A;  2KI7 A;  4M77 G;  4QQ6 A;  4PFP A;  3V7R A;  1RAI B;  4YTL A;  2XD0 A;  2PVO B;  2DXB A;  3CCM T;  2B8A A;  1UJ0 A;  1WIE A;  4C5E A;  2WSC E;  1VQM A;  3CC2 T;  1IHV A;  1PHT A;  3NPF A;  3SWN C;  3JB9 F;  1M90 R;  2HQH A;  3JB9 D;  3I5S A;  2E65 A;  4LE9 A;  1N8R R;  2YT6 A;  3OYG A;  1YIT A;  2ROL A;  3CCR Q;  2DJQ A;  4M7A F;  1V29 B;  4Z02 A;  2KE9 A;  5FRN A;  1N8R U;  5FW9 A;  2VKN A;  1UB4 A;  3OYB A;  3FDR A;  2RI2 A;  4XTY A;  1VQ4 Q;  3CME Q;  2YRD A;  1E7O A;  1SRL A;  2AKK A;  2IVW A;  2K3X A;  4C8Q F;  8AT1 B;  4OMP A;  2QEX T;  4PJJ A;  3BE3 A;  3GNF B;  3A98 A;  3PNW C;  5KYW A;  3C4S A;  1UDL A;  1ZSZ C;  5LJ3 d;  5CKB A;  4XU0 A;  2NUP B;  2YDL A;  1K4U S;  1WPY A;  4M7D B;  4N0A C;  1WFW A;  3H9N A;  5GAO l;  2FZG B;  1KJW A;  1M1F A;  3LGF A;  1N6A A;  2JZ2 A;  3MP8 A;  4J5Y A;  3CCM Q;  1BI2 A;  2BUD A;  3OW2 A;  2M0Y A;  2LT4 A;  1M1K R;  2YRC A;  5CKD A;  4A53 A;  2LX7 A;  1YI2 T;  1AD5 A;  3QPH A;  6AT1 B;  2KRN A;  1VQK Q;  4CI0 C;  4FW1 A;  3E1S A;  2CP7 A;  3V8L A;  2KYB A;  2MPX C;  3PTA A;  2EPD A;  3NFC A;  2IIM A;  3CCQ T;  4PJO G;  3C94 A;  2QQR A;  3ULR B; 
#chains in the Genus database with same CATH homology
 1NG2 A;  2BZX A;  2FPF A;  2AKL A;  1RLP C;  5ECA A;  2ESW A;  3UA6 A;  4J9G A;  1QLY A;  2DYB A;  1NYG A;  4IIM A;  2KGT A;  2EYW A;  2LNH B;  3O5Z A;  4Z89 A;  2C0T A;  2BZY A;  1ZUK A;  2OAW A;  1VA7 A;  2C0I A;  2DVJ A;  2FRY A;  4GLM A;  4RTT A;  4D8K A;  2ECZ A;  2LMJ A;  1PKS A;  2XMF A;  1X2Q A;  3NGP A;  2CT4 A;  1AWW A;  2K9G A;  3TSW A;  2YSQ A;  1M3C A;  3JV3 A;  3ZL7 C;  5IHI A;  1UTI A;  2EYX A;  2K7A A;  2OI3 A;  2FPD A;  1ABQ A;  1S1N A;  4JZ4 A;  2KNB B;  1NEB A;  1WXB A;  2ED1 A;  2KXD A;  1SHF A;  2JTE A;  2RF0 A;  4F16 A;  1PRL C;  4LUE A;  3LH5 A;  2EW3 A;  4A63 B;  2FO0 A;  1YNZ A;  2EYZ A;  4AG2 C;  2EKH A;  2L3S A;  2MIO A;  3EHQ A;  3THK A;  1K0S A;  1JQQ A;  1U3O A;  3M0T A;  2DL5 A;  2RMO A;  1MUZ A;  2CUD A;  2LCS A;  1I0C A;  3H0F A;  1T3L A;  1MV3 A;  1J3T A;  1UFF A;  1CSK A;  4J9D A;  1IO6 A;  1ZUU A;  1JU5 C;  1WA7 A;  1PNJ A;  5HCK A;  2AZS A;  3RBB B;  1AZG B;  1U5S A;  1G2B A;  2YUQ A;  1WXU A;  1QWF A;  1OV3 A;  1JEG A;  2A28 A;  2DL7 A;  4HVV A;  3VS5 A;  2KEA A;  1A0N B;  2D0N A;  1XOV A;  1N5Z A;  2SEM A;  4RTY A;  4EIK A;  2DL8 A;  1SHG A;  4QT7 A;  1X69 A;  4LNP A;  2X3X D;  1UHF A;  1NYF A;  1W6X A;  3EG3 A;  4AFZ C;  2A08 A;  2HDA A;  2J6K A;  1T0J A;  4JJC A;  1WLP B;  1JO8 A;  5GJV B;  2O88 A;  4E6R A;  3EGU A;  3NMZ C;  5GJW B;  1H92 A;  2GGR A;  1VYV A;  1AVZ C;  2RQR A;  3VRY A;  4J9F A;  2CSQ A;  4AFS C;  4AFU C;  1K0X A;  2EBP A;  4J9C A;  1GCQ A;  2KT8 A;  3M0R A;  2AZV A;  4D8D A;  1WYX A;  2F2V A;  2EGA A;  4OMQ A;  4X1V A;  2HCK A;  2X3W D;  4FSS A;  2A36 A;  1M3B A;  3VS2 A;  2JT4 A;  2G6F X;  2RPN A;  2I0N A;  1UJY A;  1GBQ A;  1W70 A;  1V1C A;  1AWX A;  3UA7 A;  4ESR A;  2YUN A;  2JM8 A;  2DNU A;  4AFQ C;  5IH2 A;  2GQI A;  1K1Z A;  2ABL A;  2K79 A;  1H3H A;  1U06 A;  2L3Q A;  2JS2 A;  2W0Z A;  3QWY A;  3H0I A;  1YCS B;  3VS3 A;  4OML A;  2KRS A;  3EG1 A;  4JJD A;  3I5R A;  2OJ2 A;  2CSI A;  1X2K A;  4OMO A;  2DM1 A;  3VRZ A;  2D1X A;  1QCF A;  2EQI A;  3EHR A;  3REB B;  1JXO A;  2KRM A;  2PNI A;  3H41 A;  2PZ1 A;  1ZLM A;  2DMO A;  2K2M A;  4JJB A;  4RTU A;  1OPL A;  1WX6 A;  3EG0 A;  1VYU A;  4JPB W;  3VS7 A;  2MCN A;  3IQL A;  1WI7 A;  1UHC A;  2L2P A;  2ED0 A;  1RI9 A;  4WCI A;  2KYM A;  2J06 A;  2GBQ A;  3REA B;  1SPK A;  5I11 A;  1YN8 A;  1AOJ A;  1B3Q A;  3UAT A;  2E5K A;  2O2O A;  1LCK A;  2KR3 A;  4CC2 A;  3QWX X;  1GCP A;  4AG1 C;  1YWP A;  2JW4 A;  2VVK A;  1UUE A;  1K9A A;  2BZ8 A;  1MV0 B;  1AWJ A;  1TUC A;  1NLO C;  1OPK A;  1RUW A;  1WDX A;  2RQW A;  4F17 A;  2CH4 A;  3U23 A;  5I22 A;  2SRC A;  1E6H A;  3EG2 A;  1M3A A;  2DIL A;  2DE0 X;  2LZ6 B;  4OMN A;  1SEM A;  5IHK A;  2JM9 A;  2DRM A;  1T3S A;  3KFV A;  3M0U A;  1GFC A;  2CDT A;  4OMM A;  3VS0 A;  1NM7 A;  4CC3 A;  1X43 A;  2DF6 A;  2J6O A;  1Z9Q A;  2C0O A;  2FG0 A;  2DL3 A;  5FWC A;  1ZSG A;  2GTJ A;  2NUZ A;  1BU1 A;  2RQV A;  2KBT A;  2HSP A;  1HJD A;  4DEY A;  2O9V A;  5L23 A;  1QKW A;  1NEG A;  1OOT A;  4M4Z A;  1RLQ C;  1NLP C;  2DA9 A;  1UE9 A;  2RQU A;  2DBK A;  4KRT A;  2JXB A;  2MOX A;  4DEX A;  1YP5 A;  4GBQ A;  1HSQ A;  1KSW A;  2KRO A;  1TUD A;  1X27 A;  2YUO A;  5IHN A;  2VWF A;  2D8J A;  2JMA A;  2K3B A;  2BTT A;  1ARK A;  2J05 A;  3I35 A;  1SSH A;  1AWO A;  1PWT A;  1FMK A;  2LQW A;  1UG1 A;  2YUP A;  4RTW A;  4ZNX A;  2L0A A;  2J7I A;  1ZBJ A;  1ABO A;  2W10 A;  4HVW A;  1AZE A;  2B86 A;  1BB9 A;  2KT1 A;  2L3P A;  1G83 A;  1VYT A;  1E6G A;  1ZUY A;  3H0H A;  1I07 A;  2FEI A;  2KXC A;  3VS4 A;  2LJ0 A;  4RTX A;  5IXF A;  1QWE A;  2DRK A;  1KIK A;  2M51 A;  2O31 A;  3C0C A;  2EGC A;  1UGV A;  3PVQ A;  1GFD A;  2J6F A;  2CUB A;  2K6D A;  3CQT A;  1H8K A;  1SRM A;  3NHN A;  4Z88 A;  4RTZ A;  1OEB A;  1Y0M A;  2CT3 A;  3RNJ A;  2EYY A;  1GRI A;  4RUG A;  4J9H A;  1PKT A;  1CKB A;  1PRM C;  2LJ3 A;  2AK5 A;  2ENM A;  2HEQ A;  5EC7 A;  1TG0 A;  1UEC A;  1UJ0 A;  1WIE A;  1GBR A;  3VS6 A;  4Z8A A;  3TSZ A;  3TVT A;  5IXB A;  1PHT A;  1GL5 A;  3NPF A;  1ZX6 A;  5FWB A;  4ORZ A;  4CC4 B;  4HCK A;  1GCQ C;  4J9B A;  2LJ1 A;  3I5S A;  4LE9 A;  2YT6 A;  1M27 C;  3FJ5 A;  2ROL A;  1K76 A;  1M30 A;  2HBW A;  2DJQ A;  3GBQ A;  2DL4 A;  2H8H A;  2KE9 A;  4HXJ A;  1AEY A;  5FW9 A;  2JMC A;  2VKN A;  4IIO A;  3I9Q A;  2NWM A;  1KFZ A;  1E7O A;  2FPE A;  2A37 A;  2JS0 A;  3SHW A;  3PVL A;  1SRL A;  2AKK A;  1X6G A;  2ROT A;  4J9I A;  4OMP A;  1I1J A;  3VS1 A;  2CRE A;  2D8H A;  2DX1 A;  2GNC A;  3A98 A;  1BBZ A;  3R6N A;  2DLP A;  1UDL A;  1W1F A;  2F2W A;  2YDL A;  2V1Q A;  1K4U S;  2LQN A;  3M0Q A;  2F2X A;  1WFW A;  1B07 A;  1M8M A;  1Z9Z A;  2CH4 W;  1KJW A;  4JZ3 A;  4RTV A;  2GTO A;  2RQT A;  4K11 A;  2FRW A;  2EGE A;  4Y92 A;  4R0K A;  1QKX A;  2QDL A;  1Y57 A;  1HD3 A;  1FYN A;  1BK2 A;  1CKA A;  3M0P A;  1EFN A;  4LN2 A;  1YWO A;  2RN8 A;  2M0Y A;  2PTK A;  2DBM A;  2LX7 A;  1AD5 A;  3PE0 A;  1WXT A;  2RNA A;  4CC7 A;  2KRN A;  4HVU A;  1JXM A;  1T0H A;  4F14 A;  2LP5 A;  2EVR A;  3M0S A;  2KYB A;  2O9S A;  4LUD A;  1X6B A;  2EPD A;  2IIM A;  2V1R A;  3UF4 A;  4J9E A;  3SEM A;  3ULR B;  2P4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...