3SEMA

Sem5 sh3 domain complexed with peptoid inhibitor
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
ETKFVQALFDFNPQESGELAFKRGDVITLINKDDPNWWEGQLNNRRGIFPSNYVCPYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Exploiting the basis of proline recognition by SH3 and WW domains: design of N-substituted inhibitors.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Signaling protein/inhibitor
molecule keywords SEX MUSCLE ABNORMAL PROTEIN 5
total genus 10
structure length 58
sequence length 58
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3semA00
1PNJA 4M4ZA 4JJDA 2LQWA 3EG2A 1UTIA 1WXBA 1E7OA 2M51A 4JPBW 1WI7A 1VA7A 4DEXA 2DA9A 2ENMA 1UHCA 1PRLC 2LP5A 1H3HA 2DX1A 2JW4A 2KXDA 4J9CA 5HCKA 2EW3A 1WDXA 1MV3A 4GLMA 1I07A 2V1QA 4IIOA 1GFCA 2FRWA 1MUZA 2CDTA 4K11A 4J9GA 2RN8A 5GJWB 1AD5A 2BZ8A 2KT8A 4RUGA 4RTXA 3A98A 2EGEA 3M0UA 4DEYA 1LCKA 1UE9A 1ZX6A 4OMQA 1BK2A 1GBQA 2DNUA 2A36A 1WX6A 1CSKA 2BZXA 1SSHA 2EYYA 3UATA 3VS6A 1A0NB 1G2BA 3EG1A 2O2OA 2DBKA 2DF6A 1ZBJA 1WXUA 1Z9ZA 4LN2A 2V1RA 2DRMA 2J05A 4RTWA 1GL5A 2HDAA 3I5RA 2J6OA 3SEMA 2J6FA 2FPDA 4Z89A 5GJVB 1TG0A 2BTTA 3I5SA 4E6RA 2I0NA 2DLPA 2JS2A 2RF0A 3VS5A 1YN8A 2DM1A 2F2XA 2KR3A 1WYXA 1GBRA 3R6NA 3REBB 2MIOA 1K0XA 1WIEA 4Y92A 2CT3A 5L23A 4OMLA 1X43A 5I11A 2DL7A 1M30A 3EHRA 1W70A 2GQIA 1YNZA 4AFQC 2L3PA 3THKA 1GFDA 2EBPA 2YUOA 2MCNA 1MV0B 2KRSA 1YP5A 2EYWA 2CH4W 2M0YA 2DYBA 4GBQA 3C0CA 2YT6A 4FSSA 4HVUA 2W0ZA 4Z88A 2EYXA 2DL3A 3SHWA 2D0NA 2CSQA 1NLOC 2JXBA 1M8MA 2X3XD 1X6GA 3VS1A 4J9IA 2XMFA 1GCQA 1K1ZA 1T0JA 1YCSB 2KRNA 2JM9A 1SRMA 1NEBA 1ZUYA 3NMZC 2DVJA 2GTJA 1QWEA 5IHKA 2OAWA 2KGTA 2LCSA 3VS3A 1X27A 1JXOA 2ESWA 1W6XA 2C0TA 4J9DA 2LQNA 2YUNA 2RQUA 2RNAA 2IIMA 1QWFA 2KE9A 1RI9A 2JMAA 2O9SA 4ORZA 4F16A 4RTVA 1EFNA 1YWPA 1ABOA 3CQTA 1SRLA 2EPDA 1M27C 2KNBB 4ZNXA 1T3SA 2JTEA 1WFWA 1BBZA 3VS2A 1ZLMA 1NYFA 1SPKA 1ZUUA 2VVKA 4AFZC 1XOVA 1SEMA 5IXBA 3KFVA 2J06A 1QKXA 2NUZA 2D8JA 1BU1A 1WLPB 3VS4A 2K79A 1PHTA 3U23A 3TSZA 5I22A 4CC7A 3NGPA 4LUDA 4Z8AA 3RNJA 1VYVA 1RLQC 4F14A 1NM7A 3RBBB 2EYZA 1NYGA 4WCIA 2HBWA 3ULRB 1PWTA 1TUCA 3VRYA 1X2QA 2K9GA 1U3OA 1JEGA 2DILA 4F17A 4D8KA 1BB9A 2CUDA 2K3BA 1K9AA 1QCFA 4J9EA 2L2PA 2AKKA 3I35A 1KSWA 3QWXX 5EC7A 4R0KA 2FPFA 2O9VA 1OEBA 2CUBA 1K4US 3PVQA 1Y0MA 4HXJA 2L3QA 4JJCA 1HD3A 3GBQA 4AFUC 4OMOA 4A63B 1RLPC 2AK5A 3PE0A 1SHFA 2O31A 1M3CA 1T3LA 4OMMA 3EG3A 2EKHA 1OPKA 1UDLA 2LJ3A 1N5ZA 2RQTA 1I0CA 2BZYA 4CC2A 4J9FA 2EQIA 1JXMA 2LZ6B 4JJBA 1E6HA 1PKSA 5FWCA 2X3WD 1UG1A 1K76A 2DL4A 2KYMA 1KFZA 1JQQA 3H0IA 2G6FX 1HSQA 3M0RA 1G83A 3EHQA 4HVWA 3NPFA 4J9HA 3ZL7C 1VYTA 3EG0A 1ARKA 2K6DA 1H92A 4CC4B 2YSQA 3H0FA 4HCKA 2LNHB 1Y57A 2OJ2A 1AWOA 2J7IA 1OOTA 1H8KA 2KBTA 1UJYA 2FG0A 3NHNA 1Z9QA 1GRIA 2DE0X 2ED1A 1VYUA 1J3TA 2KROA 1PKTA 1QLYA 1RUWA 3M0TA 2ED0A 2EGAA 1FMKA 1X69A 3EGUA 2JT4A 1NLPC 5ECAA 2ABLA 2DBMA 1B3QA 2HCKA 4OMNA 2D1XA 2AZVA 5IH2A 2GTOA 2L3SA 4RTZA 1KIKA 2J6KA 5IXFA 1AWWA 4AG1C 3PVLA 1AWJA 2VWFA 3H41A 2CSIA 2L0AA 3TVTA 4RTTA 1UFFA 2VKNA 1U5SA 1JU5C 1U06A 2GBQA 2AZSA 1E6GA 2KRMA 1TUDA 2FPEA 2DMOA 1T0HA 4D8DA 4JZ4A 4KRTA 4J9BA 1X2KA 1AZGB 2ROLA 2K7AA 4QT7A 1CKAA 3FJ5A 5FW9A 2SEMA 2C0IA 3VRZA 4CC3A 2GGRA 3TSWA 2CREA 4AG2C 1ABQA 5IHNA 1ZSGA 2JS0A 2GNCA 2EVRA 1UGVA 2HEQA 4EIKA 2CH4A 2B86A 2AKLA 2LX7A 1SHGA 3IQLA 2P4RA 1FYNA 2KYBA 1AVZC 1I1JA 3UF4A 3M0QA 2KT1A 3VS0A 3H0HA 3M0SA 1OV3A 2FRYA 2EGCA 2A28A 2ROTA 1B07A 1OPLA 1V1CA 1WA7A 3QWYA 2JMCA 2F2VA 1CKBA 2MOXA 4HVVA 2RPNA 2H8HA 3JV3A 1PRMC 1NG2A 4X1VA 1AEYA 3UA7A 2YUPA 1AOJA 2CT4A 2W10A 2DL5A 1AZEA 2A37A 4ESRA 2RQRA 1UHFA 2HSPA 2RQVA 2PTKA 2DL8A 2F2WA 2LMJA 2E5KA 5FWBA 1UJ0A 1UECA 2FO0A 2LJ0A 3LH5A 5IHIA 1K0SA 1W1FA 4OMPA 2O88A 1M3BA 2YUQA 4LE9A 1QKWA 2D8HA 2YDLA 2DRKA 2LJ1A 1GCPA 4LUEA 1ZUKA 4LNPA 1IO6A 4JZ3A 4IIMA 1X6BA 2ECZA 2RMOA 3I9QA 3UA6A 2SRCA 3M0PA 2K2MA 3REAB 2DJQA 1YWOA 2C0OA 2KXCA 2A08A 2JM8A 2NWMA 1GCQC 4AFSC 2FEIA 1HJDA 1KJWA 1M3AA 2PZ1A 2OI3A 1JO8A 4RTYA 1NEGA 2RQWA 2KEAA 1WXTA 1UUEA 2PNIA 1S1NA 3O5ZA 4RTUA 1AWXA 3VS7A 2QDLA
chains in the Genus database with same CATH superfamily
2F69A 3RKYA 3CC4Q 3JCMX 4M4ZA 1LNXA 3EG2A 4M7DC 1TTHB 2DPPB 1WXBA 1ZBXA 1E7OA 2DTHA 2JJ9A 1WI7A 1VA7A 3CMAA 4M7AC 1UHCA 2KAFA 3QUIA 4MDXA 2HQXA 2EW3A 4FYVB 2D0QB 3OYYA 2EFIA 4IIOA 2FRWA 1LVKA 4CRIA 4M7AG 2F5TX 3RKXA 3CCRT 1IHVA 1SSFA 2BZ8A 2ZGWA 3LW5E 3BDUA 3FB9A 4PJOD 3QYHB 1UGSB 3OYGA 1YITA 2EGEA 3M0UA 2V26A 3EGXB 2NUTB 2A36A 3OYJA 4LDWA 2CS7A 4O5VA 4BUGA 1RAGB 1FXXA 3J81E 3VUBA 1HK9A 4M7AB 1TU0B 2DF6A 2BE9B 3LGLA 3JB9J 1VQ4Q 2OTLQ 2OTJT 4LN2A 1RADB 3JB9I 2J6OA 1G3WA 3P8DA 2OAUA 3HSBA 2RHXA 3CMEQ 4Z89A 1OX9A 3JCMd 4E6RA 1OX8A 3CCQA 1VQPA 2DM1A 5GAMh 5L8RE 1GBRA 4IUQA 5GAMe 1K0XA 4C5HA 2IVWA 4C0ZA 2M02A 1M30A 1KC8R 5A0DA 3EHRA 1W70A 2GQIA 5KCHA 4O6JA 1GFDA 1N8RR 2YLBA 5IAYA 2MCNA 1RABB 3CBOA 3G71T 2AT1B 1MHNA 1NPRA 1B7TA 4HA8A 2X4WA 3TREA 3CMEA 2DKGA 1NLOC 4FCYA 2X3XD 1W2BP 4MMLA 1IZ6A 3GNGA 5FU6B 2EQUA 2XMFA 1VUBA 2KRNA 4BY6B 1BYMA 2L8DA 2DVJA 2GTJA 2MYSA 2MF2A 2JVVA 5GAN3 3P8BB 1W6XA 2IIMA 1XTDA 2JMAA 1WJQA 3BDLA 5LJ3g 3JCMb 1YWPA 4E7LA 4LDXA 2ZPHB 1QVPA 3CQTA 1KQSS 4QKUA 2DIGA 3EFRA 4ZNXA 1TOVA 1BBZA 1G3YA 2K3YA 1M9SA 1NZ9A 1SPKA 2VVKA 2YLCA 5CQXA 2J06A 1VQ6T 3EH1A 1VQMA 2P0QA 2NUZA 2DTIA 3QJYA 3U23A 3G6ET 1VQ8T 1VQPT 5DLQE 1QVFS 1X6OA 2LCLA 4LUDA 3G4SA 4R56A 4XU3A 2YRDA 1VYVA 3RBBB 1C6VX 1I81A 2L5QA 5GAMg 1Q86R 2HBWA 1PWTA 2BE7D 3VRYA 4F17A 3CC2T 3GPLA 3UDCA 3QSUA 1H641 4J9EA 3JB9D 2L2PA 1WNLA 1M8VA 3R6OA 3E9GA 3QWXX 3PVQA 2JN0A 3NTKA 3N5BB 1HD3A 4A63B 2LQ8A 2AK5A 3PE0A 1QP2A 1RAIB 5GMKl 3I55T 1SHFA 2O31A 3TCJA 3OS1A 4FYXB 3EG3A 1I8FA 4EDUA 2PUKB 1N5ZA 2RQTA 2BZYA 3OS2A 4J8OA 5FRNA 2K5LA 2LZ6B 2M1HA 3CCSQ 2EQMA 1R0CB 1K76A 1EZZB 5GMKe 3CXCA 1KFZA 1JQQA 2G6FX 1HSQA 4A4EA 4C92B 1G83A 2QK0A 1W2BS 2QEXQ 3RIRA 3UT1A 3S6WA 1Q82C 2L3RA 4PJOE 3OBWA 1WJRA 3A8HB 3CXCP 2EIFA 3EGDA 2VUBA 5KYYA 2K5IA 1H8KA 3NHNA 3QG1A 1YI2T 3EAEA 2CZ1B 1VYUA 2CP2A 4RMOA 1X69A 3CCLA 3CMET 4B9WA 4MDWA 4PJOB 5HK0A 2L3SA 3G1JA 4RTZA 1K73R 4M75F 2E4HA 1AWWA 3JCMg 2QEXA 2VWFA 3CCLQ 3H41A 2L0AA 3OYHA 3CCJA 1PD1A 1YI2A 1R77A 3GLXA 1S72T 1TS9A 2GFUA 1BI3A 1U5SA 3G6EA 1VQ8A 1OYXA 3X26B 3CCUT 4IUVA 3PIPA 3PNWC 4KRTA 1X2KA 1IRXA 2QA4A 2K7AA 4QT7A 1CKAA 3FJ5A 5FW9A 4OF1A 3VRZA 3TSWA 1QMCA 2G3RA 2B8AA 2VXFA 5IHNA 1ZSGA 2GNCA 2K4YA 4BE2A 4ZTJA 2HEQA 2B86A 1X75C 3OSSC 4PJOF 4M78A 2AKLA 2PVGB 4XU0A 2P4RA 4BI4A 1FYNA 3JCMW 4C92C 3OYEA 2CYZB 5IT9E 2ROTA 5FROA 4M78F 1B07A 4OGEA 2ZAEA 1V1CA 1WJSA 5D7UA 1WA7A 2RHUA 5FLXE 2JMCA 2HKNA 4F7UA 2LQKA 2MOXA 4UC4A 2V8JA 3VYHB 2DYIA 2OTLA 2YUPA 2CT4A 1VQ7T 2PTKA 2X4JA 2DL8A 2KSSA 3S3MA 3QO3A 1KHIA 5FU7C 5FWBA 1RAEB 1UECA 2FO0A 5IHIA 1M1KR 1W1FA 3GNFB 3DLMA 4JRKA 2CP7A 3T9NA 2YUQA 2E41A 2Y4XA 3I56A 2D8HA 1PM3A 2LJ1A 3S3NA 5GMKh 2V8IA 1K8AC 1NJIR 1RAHB 3OBYA 1PC0A 3RMSA 4GY5A 3X24B 3UA6A 3I9QA 1QVGP 1RI0A 3MEAA 1YJNA 2RHYA 2PVOB 3ASKA 3SWNB 3GP8A 3CPWP 3CCMT 2KXCA 3E2UA 2JM8A 4R55A 4ZGDB 2QA4T 1M90R 1M3AA 1OI1A 5J3BA 2OI3A 2OTJA 3EGDB 2WSEE 2ZCFB 2KEAA 1WXTA 2RI5A 3L2UA 3SDZA 1UUEA 4ZN1A 1S1NA 1D1CA 5CKFA 3VS7A 4WF2A 2OX7A 1VQOQ 3URGA 1S72Q 4LDVA 4J7FA 2LQWA 1YJNT 3SWNC 1Q95G 1UTIA 4JPBW 1JJ2A 2LP5A 2ATCB 3WVDB 5HCKA 1WDXA 3JAME 5GAOr 2C06A 4JJNK 3CCJQ 4M7AE 1I07A 2V1QA 3CCET 1MUZA 4K11A 3ZBDA 1PG5B 4QVDA 2KT8A 3HRTA 3L2ZA 2Y4YA 3QZ9B 1YI2Q 4M75D 4NS5A 4JLGA 1ZX6A 2LRQA 1BK2A 3QDFA 3CCUA 4M77F 1G3TA 1SKUB 4C92A 3UATA 1YFNA 4JUVA 1G2BA 3I56T 5LJ5e 1Q82U 2CKKA 2V1RA 3QHSA 2DRMA 4RCBA 4PJOG 4M77C 1D3BB 1FMVA 2E64A 4JDSA 3RDVA 2XG8D 2FPDA 1Y96A 1Y07A 2I0NA 2DXCA 4X9CA 2DLPA 4J83A 5FRMA 2RF0A 3VKIA 3VS5A 4IUUA 1HYOA 5KYUA 4BI8B 4XU1A 2MIOA 3H6ZA 4Q5WA 4Y92A 3OYLA 1LPLA 4OMLA 5HKCA 5I11A 3FC3A 4KH1B 4V2SA 1EX4A 1UB4A 2ZPGB 2KRSA 1D1BA 4M7DD 9ATCB 4OB3B 4PKCC 2M0YA 2DVEA 3SD4A 4X34A 2QQRA 2HAXA 4E47A 1AT1B 2JTFA 5LJ5f 1BIBA 4FYWB 3FRNA 3META 1M8MA 4C8QG 5IN1A 1M90U 3MP8A 3WVEB 2ZPBB 4J9IA 4D6WA 1QP3A 2R57A 4BDZA 2E70A 1K1ZA 1NEBA 1WPYA 4BY6C 2HD0A 4M7AF 2COWA 5GAN5 1QWEA 3JCMc 5GAN4 1JXOA 2ESWA 4J9DA 2LQNA 2YUNA 4XTYA 1LOJA 2RNAA 4PJMA 1QWFA 1RI9A 2O9SA 1VQKQ 4L5GA 5LJ3f 5GAMj 1ABOA 2EPDA 1OULA 3TEEA 4MMKA 3OYDA 4J5YA 2JTEA 3OS0A 1WFWA 2XI9A 3M4GA 2HZYA 1ZUUA 1XOVA 1SEMA 1VQKA 2NUPA 3OYBA 4CI0C 1TXQA 4OB1B 1BU1A 1WLPB 3VS4A 1PHTA 7AT1B 1NJIU 2VC8A 3TSZA 3NGPA 3CC4A 5CK9A 2CP3A 2DEUA 3LX7A 1VQ5T 3RNJA 1KD1U 4B9XA 1TSFA 1XJWB 3OYMA 4DOWA 2WSCE 2X35A 4WCIA 3CCST 4E7HA 4QQGA 1U3OA 4D8KA 5GMKj 2K3BA 1K9AA 1M2OA 4FU6A 2AKKA 3OA6A 1KSWA 2O9VA 1OEBA 1VQ6A 1Y0MA 4M77A 1WHGA 1N8RC 3QIIA 2VXEA 1FMWA 4HT8A 1OZ2A 4OMOA 1M90C 2QQSA 1N9RA 1VOMA 5KYWB 1M3CA 1T3LA 4OMMA 1M1KC 1I5OB 2H3EB 2EKHA 3A8GB 2LJ3A 3A1PA 1I0CA 2EQIA 1JXMA 1M2VA 1U8RA 4KUDK 4JJBA 3JB9G 2FZCB 1Q86U 1TH7A 2HL3A 3LLRA 1UG1A 3EFSA 2DL4A 2HL5C 5FU7B 4FT2A 3ZEHA 2XU8A 3CCMQ 4QQ6A 4PLIA 3AT1B 1KHCA 4HVWA 1GXIE 1F1BB 4CC4B 1YIJT 2AIRB 2RM4A 2YSQA 2HNIA 2O01E 4HCKA 1Y57A 3LYIA 5GANj 4EMKC 1XQHA 5GANf 4NOYA 3C4SA 4M7AD 3MEUA 3CCQT 2Z0WA 3GIBA 3OSVA 2VYTA 1RUWA 1VQ9Q 2MK5A 4IURA 3RKWA 5KH6A 1PCXA 2KK4A 4Y28E 1NLPC 2E1HA 5GAOp 3EG9B 3RESA 2HQEA 5I21A 2LVMA 1IXDA 2AZVA 3OMGA 5IH2A 1WHKA 2GTOA 2LNVA 4TVRA 1MMDA 5IXFA 4HCCA 1VQ9A 3HKSA 2WACA 1AWJA 2E6NA 2YRCA 2CSIA 1ACMB 3C94A 3A8LB 3SWNA 2VKNA 5HK3A 1JU5C 1U06A 1E6GA 1VQNT 2KRMA 2DMOA 1T0HA 2JNGA 4IUPA 2ROLA 1MNDA 2SEMA 2CREA 4M77D 1EIFA 3J80E 2EVRA 3OW2P 3EFOA 4EIKA 1UGQB 1VQLQ 3KUFA 1VQ9T 4KBMB 1WQ7A 1I1JA 2M9UA 1UGPB 4DBFA 2DO3A 3DKMA 3M0SA 2FRYA 4BE1A 2RK2A 1VQNA 3G7ZA 1OPLA 2P0KA 1Y7XA 3WXMB 4HT9A 3OW2A 2E3HA 3CBPA 4M7DF 2RPNA 5LJ5d 1VQ4T 1PRMC 3UA7A 1AOJA 3E19A 3CCRA 3RUXA 1WHJA 4M7DA 3DB4A 2LMJA 2XDPA 4C8QD 4FYYB 5I2SA 3MEVA 2E5KA 3G71A 4KUIA 3LH5A 4M77B 2PVDB 4J6WA 3CD6A 2O88A 3CCRQ 4LE9A 3TU4K 1QKWA 2F5KA 4BB7A 4LUEA 1ZUKA 4HCZA 1YHQA 5CKHA 1Q81R 2HKQB 4KGVB 4JZ3A 5A0GA 1KK7A 2ECZA 3QPHA 4M78E 1MMAA 5FU6C 3M0PA 1K8AU 4M77G 2EQJA 1VQMQ 1RACB 1NJIC 3J7AF 1YWOA 2EJ9A 1K9MR 2A08A 2CP5A 3VJPA 2NWMA 3MEWA 4FW1A 1UEBA 2FEIA 2I2LA 2CGHA 3A8OB 4F7UE 1KJWA 1HJDA 6AT1B 2K2VA 2K57A 1WGSA 2PNIA 4BDYA 1VQ5Q 3O5ZA 3MCAB 4RTUA 1YJ9A 3VUZA 3GOXA 5GANe 4OB2B 5KYNA 3V8JA 3VV0A 4EMGA 3QZ5B 1RAFB 2LTOA 2RJCA 3JRZA 1BIAA 5GANd 3CCQQ 2DA9A 1WQWA 3OYCA 1JJ2P 5CQYA 2ZPEB 5DM7R 2DX1A 1H3HA 2KXDA 4J9CA 2DZ9A 1MV3A 2LX9A 4XTZA 3HTRA 4M75E 1Q7YR 4MZMA 5GAN2 2CDTA 4J9GA 3CCVT 2RN8A 2CZ6B 4PJLA 1AD5A 3FIFA 2EAYA 4RUGA 4ANJA 5LJ3d 1BI0A 3OYIA 4DEYA 5KYXB 1LCKA 1UE9A 4OMQA 4C5IA 1GBQA 3G6EQ 2DNUA 1VQ8Q 1I4K1 2WSFE 3VS6A 3CC7A 1VQ6Q 1A0NB 2XKOC 2DEQA 2CZ0B 1IB8A 2RHIA 4A53A 3EG1A 2QAZA 2O2OA 4II1A 3HP9A 1RL2A 4RTWA 1GL5A 2HDAA 2FYKA 3PMTA 5C0MA 3CCUQ 4KULA 2J6FA 4FL6A 4FW2A 1QQJA 1Q7YU 5GJVB 4BI3A 5C6SA 3OYNA 1KQSP 4M78B 3EH2A 3CCLT 1YN8A 2F2XA 3MHXA 2GFAA 1WYXA 2QTVA 3R6NA 2HQHA 1WIEA 4JS5A 2CT3A 1NBEB 5L23A 1KQ2A 2X4YA 4M7AA 3M55A 2DL7A 4F7UB 5LL6S 2L3PA 3THKA 1WHLA 3EGXA 3CMAQ 1AHJB 5DY9A 2CH4W 4GBQA 2YT6A 4HVUA 3G71Q 3C95A 2W0ZA 3SHWA 5LJ5g 2CSQA 3PMIA 4F7UG 1JB0E 3VS1A 4EMKA 4C5GA 1T0JA 1YCSB 2QTXA 3QBYA 4IUTA 3FLGA 5GMKm 3PT9A 5IHKA 3JB9H 2OAWA 1UGRB 2LCSA 2RJDA 4NL3A 5KYWA 2RA2A 4F16A 1EFNA 3OW2S 2KNBB 3S3OA 4C8QE 2F1LA 4A4KA 2E5QA 2CZ7B 2OTJQ 4PNOA 4AFZC 1LJOA 1TUGB 3KFVA 4M7DB 4L6V5 1YJNQ 3FEOA 1Q81U 2K79A 2KVQG 3OYAA 3DLLA 5I22A 4CC7A 3M4YA 4AMCA 1YCYA 2XDBA 1OU9A 4BD3A 1V29B 3RERA 4WTOB 1M1GA 1RLQC 4F14A 5EG2A 1C0MA 1NM7A 2EYZA 4KT0E 2FZKB 1TUCA 3E9FA 3ULRB 1X2QA 2K9GA 1JEGA 4ME7A 1BB9A 2P0PA 3CCVA 4XTVA 3I35A 1VQPQ 4R0KA 4JRQA 1JBMA 2CUBA 2QXFA 4JJCA 1KD1R 4AFUC 4KGZB 1RLPC 5LJ3h 3HFNA 3CCVQ 2XK0A 1C1AA 5CR2A 2BKDN 2EQKA 2L89A 3H8ZA 3QXEB 2RHZA 2RI2A 2XHCA 2QG9B 2DD5A 4C8QB 4ZGEB 2R5AA 1PSEA 2EYQA 4NL2A 4J9FA 4YTLA 1D1AA 2XIDA 3MKDA 2X3WD 5D6XA 8AT1B 2KYMA 2GQVA 4ATOA 3H9NA 3H0IA 5CCAA 2RI3A 4LXCA 4LD6A 2MWPA 1S72A 4PFZA 4XQ3A 3M0RA 1Q81C 3CBMA 3MP6A 2YWWA 3NPFA 3CMAT 3EG0A 4BACA 1ARKA 1U1SA 1P92A 2K6DA 1H92A 1VQ4A 1M1KU 3CCEQ 2KY9A 3ER0A 4E7JA 4P5NA 4M78C 3CCJT 3CPFA 1AWOA 1OOTA 4MZPA 2EKOA 1UJYA 5GANg 2ZPFB 1Y96B 2FG0A 1Z9QA 1GRIA 1VQMT 2DE0X 3EFOB 4M77E 1J3TA 2KROA 1PKTA 1QLYA 5A0LA 4M78G 2ED0A 4RG2A 2EGAA 2KQWA 1FMKA 1MGQA 4C0DB 3EGUA 2E12A 5ECAA 2VGMA 4C8QF 1M5Q1 1ZHIA 4N4GA 1B3QA 2D1XA 2PUOB 5KE3A 1KC8C 1K9MU 3LH0A 5CAIA 3GF5A 1QVGA 2QQ9A 5DLOA 1W2BA 4AG1C 2H3JA 3TVTA 1ZA2B 4RTTA 2NLUA 1UFFA 2D9TA 3G4SQ 4LDYA 2GBQA 1VQOA 2AZSA 1TWBA 2ZZDA 2FPEA 3FJPA 3PGGA 4A4FA 1O75A 4JZ4A 3QYGB 2JZ2A 4J9BA 1IGQA 3X20B 1AZGB 4QVCA 5KYYB 4CC3A 3CXCS 2RD1A 5CIUA 3V8KA 5GAMd 2M0OA 2CH4A 3ZFJA 2LX7A 3IQLA 3JCMV 4L59A 4E7SA 1AVZC 2MWOA 3KBGA 3VS0A 1K73U 2PQWA 4OGCA 5GAOl 1OV3A 2A28A 3L42A 4XTXA 3QWYA 1K8AR 4C5EA 4HCBA 3MPUB 4HVVA 2E10A 3D7SB 3X25B 2H8HA 2DERA 3JV3A 2QEXT 1YJWQ 2VV5A 4X1VA 4KGXB 4C8QC 3M54A 1WHMA 3A8MB 2QGGA 3BE3A 2W10A 4A4GA 2HBPA 2DL5A 2E6ZA 1AZEA 2A37A 4ESRA 2RQRA 1UHFA 2HSPA 1VQNQ 2RQVA 4C0GA 1BI1A 1N9SA 3NFCA 2FVUA 3Q1JA 2QI2A 5CVIA 2RO0A 2A3LA 2LJ0A 1G3SA 1N27A 1KD1C 4OMPA 5KCOA 1YJWT 1SG5A 2XDDA 1M3BA 2YDLA 2DRKA 4RG8A 1GCPA 5GAOq 1PD0A 2DAQA 4QVZA 2FHDA 1YJ9T 3V7CA 1IO6A 3L2RA 2MAMA 4IIMA 2D6FA 1N8RU 3REAB 4E7IA 1B34A 5KE2A 2DXBA 4OMFB 2LCCA 2C0OA 4F7UF 2BIVA 1GCQC 1NE8A 2QASA 4AFSC 5GAN8 1H3ZA 2GF7A 3M53A 1V76A 2PZ1A 3LGFA 4N0AC 4XK8E 4N4IA 1YIJQ 3HPWA 3O8VA 4RTYA 1NEGA 1MNEA 2YXYA 1MMGA 1AWXA 4M7DE 3MJXA 2YRVA 2QDLA 2CP0A 4FM4B 1PNJA 1RAAB 4ELZC 3LWHA 3QKJA 1KQSA 2P84A 4JJDA 3FDRA 1O9SA 2M51A 4DEXA 1Y71A 2ENMA 1BI2A 1VQ5A 1PRLC 2JW4A 4DOVA 2K5FA 1YJ9Q 2IPOB 3OY9A 3I55A 4GLMA 2EWNA 2KMTA 3PTAA 2QDYB 2DXUA 1M4ZA 4LDUA 4C92F 2NYSA 1YHQQ 4DBHA 3NTHA 4E2FB 4J7IA 1GFCA 3C12A 4JRPA 2GCXA 5GAN6 5A2QE 5GJWB 2DXTA 1ZSZC 3M5AA 4E7KA 2KDSA 4RTXA 3A98A 4JLIA 3VU3C 4DBRA 1BCOA 1G8XA 2COYA 1WX6A 2BUDA 1CSKA 3NTIA 4PJOC 2BZXA 1SSHA 2EYYA 3JCMQ 2EJFA 4DQ2A 2Y90A 3CD6T 2XICA 2DBKA 1ZSZB 3HL8A 1ZBJA 1WXUA 1Z9ZA 3OYKA 2J05A 4RCCA 3L2WA 3I5RA 3SEMA 3V7RA 3I55Q 1IHWA 2RH2A 4FT4A 1TG0A 2BTTA 3I5SA 5AT1B 1YITT 2JS2A 2O4XA 4AT1B 5HY6A 4X9DA 5LJ5j 1QCOA 4FIBA 2KR3A 1YJWA 3REBB 1X01A 4M78D 3UWNA 3BY7A 4M75A 3CC2Q 1X43A 4J6XA 4EMHA 2JTMA 5GAN7 3CC7Q 4MZTA 4AFQC 1YNZA 4XTWA 4N4HA 2EBPA 2LC4A 1Q86C 2YUOA 1MV0B 1JJ2S 2E3IA 1YP5A 1WZOA 2EYWA 1QVFA 3AHUA 2DYBA 1MMNA 3C0CA 5LJ3e 4FSSA 2NUTA 5LJ5h 3CPWA 5LJ3j 3G4ST 2DIQA 2V8KA 4XAXB 1QCNA 4Z88A 2EYXA 4KH0B 2DL3A 3PFSA 2D0NA 5CO7A 3LWIA 2JXBA 1X6GA 1GCQA 4C0FA 2JM9A 1SRMA 1ZUYA 1IREB 4N0AA 1R0BG 4DBQA 3NMZC 3RMQA 4Z02A 4E7ZA 1YBYA 2KGTA 5CKBA 1X27A 2YHTA 3VS3A 4C0DC 3PIOA 4XU2A 2C0TA 4PFPA 2RQUA 5D6YA 2KE9A 2A7YA 3EG9A 4ORZA 4RTVA 5I2MA 3MP1A 1SRLA 1M27C 5CKDA 2FB7A 1T3SA 2DJZA 3OS5A 3X28B 2XD0A 3VS2A 1ZLMA 3QDRB 3MO8A 3JSCA 1NYFA 1W4SA 3JCMP 2KI7A 5IXBA 3M9QA 1I5LA 1N6AA 1QKXA 2M16A 1B34B 2D8JA 1D0ZA 1QVGS 3INZA 4Z8AA 3OMCA 3CCMA 3L2QA 4QQDA 3KXTA 2EJGA 1Q82R 1NYGA 5GAMf 1JRIA 4PJOA 3I56Q 2VASA 4M75G 2CP6A 2DILA 1YHQT 2CUDA 1OQKA 1M1FA 1QCFA 2NUPB 5EC7A 1FX7A 2FPFA 1VQKT 1K4US 4LD9K 1VIEA 4HXJA 2L3QA 4OB0B 3GBQA 2VB6A 3M59A 2X51A 4B6MA 2JOYA 3V7SA 4A4HA 1D09B 2RJFA 4C8QA 1R8OB 1ZQ1A 1OPKA 1UDLA 3P8HA 2OTLT 4CC2A 3M58A 1VIFA 4M75B 5D6WA 5J26A 4A54A 1E6HA 2QQAA 2R5MA 1PKSA 5FWCA 2RB6A 1WHHA 3OB9A 1VQOT 1G5VA 2QYZA 2MI6A 1VQLA 3EHQA 4J9HA 3ZL7C 1VYTA 3ME9A 1K9MC 2DK3A 2RK1A 2QA4Q 3OQ5A 3H0FA 3JCMJ 2LNHB 3HHTB 3CC2A 1VQ7A 1M2VB 3F70A 1Q7YC 2OJ2A 1U1TA 2J7IA 4EPCA 2KBTA 1D0XA 4HKEA 2JUFA 2ED1A 3V8LA 4VUBA 4PLLA 1PSFA 3M0TA 4ELYC 3CC4T 3CPWS 3UPUA 2X4XA 2JT4A 3CC7T 2ABLA 2DBMA 2HCKA 4OMNA 4IKFA 4ZTFA 2AHJB 2DTOA 2FZGB 2P4TA 1KIKA 1YIJA 2J6KA 3JCMf 3PVLA 2K3XA 5GMKi 2IG0A 1YITQ 4OP0A 2HMAA 2QQBA 2LDMA 1OZ3A 1VQ7Q 1TUDA 4OVAA 1FWZA 4ZN3A 4D8DA 3HFOA 4C92G 3CCSA 5KYUB 4EMKB 1K73C 4PJJA 3CD6Q 2C0IA 2GGRA 4PK4A 1KC8U 2DD4A 1OU8A 4AG2C 2JS0A 1UGVA 4PL6A 3JCMh 2A0FB 3L2VA 5GAOm 5CKEA 4GLKA 2O4XB 1D3BA 1KG1A 1SHGA 1BKBA 2KYBA 2QGFB 3UF4A 3M0QA 2KT1A 3SFMA 2LT1A 3H0HA 2EGCA 1D0YA 2RJEA 4C92D 3JB9F 1SF9A 2F2VA 1CKBA 2MMPA 2FL7A 4XTUA 3SB2A 3TQ7P 1NG2A 1AEYA 2R58A 4BE0A 2E65A 3E1SA 2HSEB 3VYGA 2F2WA 4PFOA 1UJ0A 3JCMe 1K0SA 4RKUE 4M75C 4J6YA 1BCMA 2PU9B 4JRIA 5M9OA 1ZSZA 3M57A 2COZA 4LNPA 2X9HA 3A5ZB 2DETA 1IGUA 4Y91A 5GANh 1KQ1A 3RR6A 3OYFA 2DFUA 5GAOn 4DA4A 4ZGJB 5KYXA 1X6BA 2RMOA 2SRCA 1XNIA 2K2MA 3HRSA 1NPPA 3HRUA 2DJQA 1VQLT 8ATCB 3BFMA 5AYFA 3QJ6A 1DJ7B 4C92E 3CEYA 4JS4A 1HXDA 4PJNA 3BW1A 2LT4A 2MPXC 3DB3A 1ZA1B 3M56A 1JO8A 3CCEA 4FSXA 2RQWA 4M7DG 3L1AA 2ZPIB 4F04B 1QVFP 4QW2A 1QW1A 5J39A 2DZCA 2VGNA 1ABQA
chains in the Genus database with same CATH topology
1PNJA 4M4ZA 4JJDA 2LQWA 3EG2A 1UTIA 1WXBA 1E7OA 2M51A 4JPBW 1WI7A 1VA7A 4DEXA 2DA9A 2ENMA 1UHCA 1PRLC 2LP5A 1H3HA 2DX1A 2JW4A 2KXDA 4J9CA 5HCKA 2EW3A 1WDXA 1MV3A 4GLMA 1I07A 2V1QA 4IIOA 1GFCA 2FRWA 1MUZA 2CDTA 4K11A 4J9GA 2RN8A 5GJWB 1AD5A 2BZ8A 2KT8A 4RUGA 4RTXA 3A98A 2EGEA 3M0UA 4DEYA 1LCKA 1UE9A 1ZX6A 4OMQA 1BK2A 1GBQA 2DNUA 2A36A 1WX6A 1CSKA 2BZXA 1SSHA 2EYYA 3UATA 3VS6A 1A0NB 1G2BA 3EG1A 2O2OA 2DBKA 2DF6A 1ZBJA 1WXUA 1Z9ZA 4LN2A 2V1RA 2DRMA 2J05A 4RTWA 1GL5A 2HDAA 3I5RA 2J6OA 3SEMA 2J6FA 2FPDA 4Z89A 5GJVB 1TG0A 2BTTA 3I5SA 4E6RA 2I0NA 2DLPA 2JS2A 2RF0A 3VS5A 1YN8A 2DM1A 2F2XA 2KR3A 1WYXA 1GBRA 3R6NA 3REBB 2MIOA 1K0XA 1WIEA 4Y92A 2CT3A 5L23A 4OMLA 1X43A 5I11A 2DL7A 1M30A 3EHRA 1W70A 2GQIA 1YNZA 4AFQC 2L3PA 3THKA 1GFDA 2EBPA 2YUOA 2MCNA 1MV0B 2KRSA 1YP5A 2EYWA 2CH4W 2M0YA 2DYBA 4GBQA 3C0CA 2YT6A 4FSSA 4HVUA 2W0ZA 4Z88A 2EYXA 2DL3A 3SHWA 2D0NA 2CSQA 1NLOC 2JXBA 1M8MA 2X3XD 1X6GA 3VS1A 4J9IA 2XMFA 1GCQA 1K1ZA 1T0JA 1YCSB 2KRNA 2JM9A 1SRMA 1NEBA 1ZUYA 3NMZC 2DVJA 2GTJA 1QWEA 5IHKA 2OAWA 2KGTA 2LCSA 3VS3A 1X27A 1JXOA 2ESWA 1W6XA 2C0TA 4J9DA 2LQNA 2YUNA 2RQUA 2RNAA 2IIMA 1QWFA 2KE9A 1RI9A 2JMAA 2O9SA 4ORZA 4F16A 4RTVA 1EFNA 1YWPA 1ABOA 3CQTA 1SRLA 2EPDA 1M27C 2KNBB 4ZNXA 1T3SA 2JTEA 1WFWA 1BBZA 3VS2A 1ZLMA 1NYFA 1SPKA 1ZUUA 2VVKA 4AFZC 1XOVA 1SEMA 5IXBA 3KFVA 2J06A 1QKXA 2NUZA 2D8JA 1BU1A 1WLPB 3VS4A 2K79A 1PHTA 3U23A 3TSZA 5I22A 4CC7A 3NGPA 4LUDA 4Z8AA 3RNJA 1VYVA 1RLQC 4F14A 1NM7A 3RBBB 2EYZA 1NYGA 4WCIA 2HBWA 3ULRB 1PWTA 1TUCA 3VRYA 1X2QA 2K9GA 1U3OA 1JEGA 2DILA 4F17A 4D8KA 1BB9A 2CUDA 2K3BA 1K9AA 1QCFA 4J9EA 2L2PA 2AKKA 3I35A 1KSWA 3QWXX 5EC7A 4R0KA 2FPFA 2O9VA 1OEBA 2CUBA 1K4US 3PVQA 1Y0MA 4HXJA 2L3QA 4JJCA 1HD3A 3GBQA 4AFUC 4OMOA 4A63B 1RLPC 2AK5A 3PE0A 1SHFA 2O31A 1M3CA 1T3LA 4OMMA 3EG3A 2EKHA 1OPKA 1UDLA 2LJ3A 1N5ZA 2RQTA 1I0CA 2BZYA 4CC2A 4J9FA 2EQIA 1JXMA 2LZ6B 4JJBA 1E6HA 1PKSA 5FWCA 2X3WD 1UG1A 1K76A 2DL4A 2KYMA 1KFZA 1JQQA 3H0IA 2G6FX 1HSQA 3M0RA 1G83A 3EHQA 4HVWA 3NPFA 4J9HA 3ZL7C 1VYTA 3EG0A 1ARKA 2K6DA 1H92A 4CC4B 2YSQA 3H0FA 4HCKA 2LNHB 1Y57A 2OJ2A 1AWOA 2J7IA 1OOTA 1H8KA 2KBTA 1UJYA 2FG0A 3NHNA 1Z9QA 1GRIA 2DE0X 2ED1A 1VYUA 1J3TA 2KROA 1PKTA 1QLYA 1RUWA 3M0TA 2ED0A 2EGAA 1FMKA 1X69A 3EGUA 2JT4A 1NLPC 5ECAA 2ABLA 2DBMA 1B3QA 2HCKA 4OMNA 2D1XA 2AZVA 5IH2A 2GTOA 2L3SA 4RTZA 1KIKA 2J6KA 5IXFA 1AWWA 4AG1C 3PVLA 1AWJA 2VWFA 3H41A 2CSIA 2L0AA 3TVTA 4RTTA 1UFFA 2VKNA 1U5SA 1JU5C 1U06A 2GBQA 2AZSA 1E6GA 2KRMA 1TUDA 2FPEA 2DMOA 1T0HA 4D8DA 4JZ4A 4KRTA 4J9BA 1X2KA 1AZGB 2ROLA 2K7AA 4QT7A 1CKAA 3FJ5A 5FW9A 2SEMA 2C0IA 3VRZA 4CC3A 2GGRA 3TSWA 2CREA 4AG2C 1ABQA 5IHNA 1ZSGA 2JS0A 2GNCA 2EVRA 1UGVA 2HEQA 4EIKA 2CH4A 2B86A 2AKLA 2LX7A 1SHGA 3IQLA 2P4RA 1FYNA 2KYBA 1AVZC 1I1JA 3UF4A 3M0QA 2KT1A 3VS0A 3H0HA 3M0SA 1OV3A 2FRYA 2EGCA 2A28A 2ROTA 1B07A 1OPLA 1V1CA 1WA7A 3QWYA 2JMCA 2F2VA 1CKBA 2MOXA 4HVVA 2RPNA 2H8HA 3JV3A 1PRMC 1NG2A 4X1VA 1AEYA 3UA7A 2YUPA 1AOJA 2CT4A 2W10A 2DL5A 1AZEA 2A37A 4ESRA 2RQRA 1UHFA 2HSPA 2RQVA 2PTKA 2DL8A 2F2WA 2LMJA 2E5KA 5FWBA 1UJ0A 1UECA 2FO0A 2LJ0A 3LH5A 5IHIA 1K0SA 1W1FA 4OMPA 2O88A 1M3BA 2YUQA 4LE9A 1QKWA 2D8HA 2YDLA 2DRKA 2LJ1A 1GCPA 4LUEA 1ZUKA 4LNPA 1IO6A 4JZ3A 4IIMA 1X6BA 2ECZA 2RMOA 3I9QA 3UA6A 2SRCA 3M0PA 2K2MA 3REAB 2DJQA 1YWOA 2C0OA 2KXCA 2A08A 2JM8A 2NWMA 1GCQC 4AFSC 2FEIA 1HJDA 1KJWA 1M3AA 2PZ1A 2OI3A 1JO8A 4RTYA 1NEGA 2RQWA 2KEAA 1WXTA 1UUEA 2PNIA 1S1NA 3O5ZA 4RTUA 1AWXA 3VS7A 2QDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  4M4Z A;  4JJD A;  2LQW A;  3EG2 A;  1UTI A;  1WXB A;  1E7O A;  2M51 A;  4JPB W;  1WI7 A;  1VA7 A;  4DEX A;  2DA9 A;  2ENM A;  1UHC A;  1PRL C;  2LP5 A;  1H3H A;  2DX1 A;  2JW4 A;  2KXD A;  4J9C A;  5HCK A;  2EW3 A;  1WDX A;  1MV3 A;  4GLM A;  1I07 A;  2V1Q A;  4IIO A;  1GFC A;  2FRW A;  1MUZ A;  2CDT A;  4K11 A;  4J9G A;  2RN8 A;  5GJW B;  1AD5 A;  2BZ8 A;  2KT8 A;  4RUG A;  4RTX A;  3A98 A;  2EGE A;  3M0U A;  4DEY A;  1LCK A;  1UE9 A;  1ZX6 A;  4OMQ A;  1BK2 A;  1GBQ A;  2DNU A;  2A36 A;  1WX6 A;  1CSK A;  2BZX A;  1SSH A;  2EYY A;  3UAT A;  3VS6 A;  1A0N B;  1G2B A;  3EG1 A;  2O2O A;  2DBK A;  2DF6 A;  1ZBJ A;  1WXU A;  1Z9Z A;  4LN2 A;  2V1R A;  2DRM A;  2J05 A;  4RTW A;  1GL5 A;  2HDA A;  3I5R A;  2J6O A;  3SEM A;  2J6F A;  2FPD A;  4Z89 A;  5GJV B;  1TG0 A;  2BTT A;  3I5S A;  4E6R A;  2I0N A;  2DLP A;  2JS2 A;  2RF0 A;  3VS5 A;  1YN8 A;  2DM1 A;  2F2X A;  2KR3 A;  1WYX A;  1GBR A;  3R6N A;  3REB B;  2MIO A;  1K0X A;  1WIE A;  4Y92 A;  2CT3 A;  5L23 A;  4OML A;  1X43 A;  5I11 A;  2DL7 A;  1M30 A;  3EHR A;  1W70 A;  2GQI A;  1YNZ A;  4AFQ C;  2L3P A;  3THK A;  1GFD A;  2EBP A;  2YUO A;  2MCN A;  1MV0 B;  2KRS A;  1YP5 A;  2EYW A;  2CH4 W;  2M0Y A;  2DYB A;  4GBQ A;  3C0C A;  2YT6 A;  4FSS A;  4HVU A;  2W0Z A;  4Z88 A;  2EYX A;  2DL3 A;  3SHW A;  2D0N A;  2CSQ A;  1NLO C;  2JXB A;  1M8M A;  2X3X D;  1X6G A;  3VS1 A;  4J9I A;  2XMF A;  1GCQ A;  1K1Z A;  1T0J A;  1YCS B;  2KRN A;  2JM9 A;  1SRM A;  1NEB A;  1ZUY A;  3NMZ C;  2DVJ A;  2GTJ A;  1QWE A;  5IHK A;  2OAW A;  2KGT A;  2LCS A;  3VS3 A;  1X27 A;  1JXO A;  2ESW A;  1W6X A;  2C0T A;  4J9D A;  2LQN A;  2YUN A;  2RQU A;  2RNA A;  2IIM A;  1QWF A;  2KE9 A;  1RI9 A;  2JMA A;  2O9S A;  4ORZ A;  4F16 A;  4RTV A;  1EFN A;  1YWP A;  1ABO A;  3CQT A;  1SRL A;  2EPD A;  1M27 C;  2KNB B;  4ZNX A;  1T3S A;  2JTE A;  1WFW A;  1BBZ A;  3VS2 A;  1ZLM A;  1NYF A;  1SPK A;  1ZUU A;  2VVK A;  4AFZ C;  1XOV A;  1SEM A;  5IXB A;  3KFV A;  2J06 A;  1QKX A;  2NUZ A;  2D8J A;  1BU1 A;  1WLP B;  3VS4 A;  2K79 A;  1PHT A;  3U23 A;  3TSZ A;  5I22 A;  4CC7 A;  3NGP A;  4LUD A;  4Z8A A;  3RNJ A;  1VYV A;  1RLQ C;  4F14 A;  1NM7 A;  3RBB B;  2EYZ A;  1NYG A;  4WCI A;  2HBW A;  3ULR B;  1PWT A;  1TUC A;  3VRY A;  1X2Q A;  2K9G A;  1U3O A;  1JEG A;  2DIL A;  4F17 A;  4D8K A;  1BB9 A;  2CUD A;  2K3B A;  1K9A A;  1QCF A;  4J9E A;  2L2P A;  2AKK A;  3I35 A;  1KSW A;  3QWX X;  5EC7 A;  4R0K A;  2FPF A;  2O9V A;  1OEB A;  2CUB A;  1K4U S;  3PVQ A;  1Y0M A;  4HXJ A;  2L3Q A;  4JJC A;  1HD3 A;  3GBQ A;  4AFU C;  4OMO A;  4A63 B;  1RLP C;  2AK5 A;  3PE0 A;  1SHF A;  2O31 A;  1M3C A;  1T3L A;  4OMM A;  3EG3 A;  2EKH A;  1OPK A;  1UDL A;  2LJ3 A;  1N5Z A;  2RQT A;  1I0C A;  2BZY A;  4CC2 A;  4J9F A;  2EQI A;  1JXM A;  2LZ6 B;  4JJB A;  1E6H A;  1PKS A;  5FWC A;  2X3W D;  1UG1 A;  1K76 A;  2DL4 A;  2KYM A;  1KFZ A;  1JQQ A;  3H0I A;  2G6F X;  1HSQ A;  3M0R A;  1G83 A;  3EHQ A;  4HVW A;  3NPF A;  4J9H A;  3ZL7 C;  1VYT A;  3EG0 A;  1ARK A;  2K6D A;  1H92 A;  4CC4 B;  2YSQ A;  3H0F A;  4HCK A;  2LNH B;  1Y57 A;  2OJ2 A;  1AWO A;  2J7I A;  1OOT A;  1H8K A;  2KBT A;  1UJY A;  2FG0 A;  3NHN A;  1Z9Q A;  1GRI A;  2DE0 X;  2ED1 A;  1VYU A;  1J3T A;  2KRO A;  1PKT A;  1QLY A;  1RUW A;  3M0T A;  2ED0 A;  2EGA A;  1FMK A;  1X69 A;  3EGU A;  2JT4 A;  1NLP C;  5ECA A;  2ABL A;  2DBM A;  1B3Q A;  2HCK A;  4OMN A;  2D1X A;  2AZV A;  5IH2 A;  2GTO A;  2L3S A;  4RTZ A;  1KIK A;  2J6K A;  5IXF A;  1AWW A;  4AG1 C;  3PVL A;  1AWJ A;  2VWF A;  3H41 A;  2CSI A;  2L0A A;  3TVT A;  4RTT A;  1UFF A;  2VKN A;  1U5S A;  1JU5 C;  1U06 A;  2GBQ A;  2AZS A;  1E6G A;  2KRM A;  1TUD A;  2FPE A;  2DMO A;  1T0H A;  4D8D A;  4JZ4 A;  4KRT A;  4J9B A;  1X2K A;  1AZG B;  2ROL A;  2K7A A;  4QT7 A;  1CKA A;  3FJ5 A;  5FW9 A;  2SEM A;  2C0I A;  3VRZ A;  4CC3 A;  2GGR A;  3TSW A;  2CRE A;  4AG2 C;  1ABQ A;  5IHN A;  1ZSG A;  2JS0 A;  2GNC A;  2EVR A;  1UGV A;  2HEQ A;  4EIK A;  2CH4 A;  2B86 A;  2AKL A;  2LX7 A;  1SHG A;  3IQL A;  2P4R A;  1FYN A;  2KYB A;  1AVZ C;  1I1J A;  3UF4 A;  3M0Q A;  2KT1 A;  3VS0 A;  3H0H A;  3M0S A;  1OV3 A;  2FRY A;  2EGC A;  2A28 A;  2ROT A;  1B07 A;  1OPL A;  1V1C A;  1WA7 A;  3QWY A;  2JMC A;  2F2V A;  1CKB A;  2MOX A;  4HVV A;  2RPN A;  2H8H A;  3JV3 A;  1PRM C;  1NG2 A;  4X1V A;  1AEY A;  3UA7 A;  2YUP A;  1AOJ A;  2CT4 A;  2W10 A;  2DL5 A;  1AZE A;  2A37 A;  4ESR A;  2RQR A;  1UHF A;  2HSP A;  2RQV A;  2PTK A;  2DL8 A;  2F2W A;  2LMJ A;  2E5K A;  5FWB A;  1UJ0 A;  1UEC A;  2FO0 A;  2LJ0 A;  3LH5 A;  5IHI A;  1K0S A;  1W1F A;  4OMP A;  2O88 A;  1M3B A;  2YUQ A;  4LE9 A;  1QKW A;  2D8H A;  2YDL A;  2DRK A;  2LJ1 A;  1GCP A;  4LUE A;  1ZUK A;  4LNP A;  1IO6 A;  4JZ3 A;  4IIM A;  1X6B A;  2ECZ A;  2RMO A;  3I9Q A;  3UA6 A;  2SRC A;  3M0P A;  2K2M A;  3REA B;  2DJQ A;  1YWO A;  2C0O A;  2KXC A;  2A08 A;  2JM8 A;  2NWM A;  1GCQ C;  4AFS C;  2FEI A;  1HJD A;  1KJW A;  1M3A A;  2PZ1 A;  2OI3 A;  1JO8 A;  4RTY A;  1NEG A;  2RQW A;  2KEA A;  1WXT A;  1UUE A;  2PNI A;  1S1N A;  3O5Z A;  4RTU A;  1AWX A;  3VS7 A;  2QDL A; 
#chains in the Genus database with same CATH topology
 2F69 A;  3RKY A;  3CC4 Q;  3JCM X;  4M4Z A;  1LNX A;  3EG2 A;  4M7D C;  1TTH B;  2DPP B;  1WXB A;  1ZBX A;  1E7O A;  2DTH A;  2JJ9 A;  1WI7 A;  1VA7 A;  3CMA A;  4M7A C;  1UHC A;  2KAF A;  3QUI A;  4MDX A;  2HQX A;  2EW3 A;  4FYV B;  2D0Q B;  3OYY A;  2EFI A;  4IIO A;  2FRW A;  1LVK A;  4CRI A;  4M7A G;  2F5T X;  3RKX A;  3CCR T;  1IHV A;  1SSF A;  2BZ8 A;  2ZGW A;  3LW5 E;  3BDU A;  3FB9 A;  4PJO D;  3QYH B;  1UGS B;  3OYG A;  1YIT A;  2EGE A;  3M0U A;  2V26 A;  3EGX B;  2NUT B;  2A36 A;  3OYJ A;  4LDW A;  2CS7 A;  4O5V A;  4BUG A;  1RAG B;  1FXX A;  3J81 E;  3VUB A;  1HK9 A;  4M7A B;  1TU0 B;  2DF6 A;  2BE9 B;  3LGL A;  3JB9 J;  1VQ4 Q;  2OTL Q;  2OTJ T;  4LN2 A;  1RAD B;  3JB9 I;  2J6O A;  1G3W A;  3P8D A;  2OAU A;  3HSB A;  2RHX A;  3CME Q;  4Z89 A;  1OX9 A;  3JCM d;  4E6R A;  1OX8 A;  3CCQ A;  1VQP A;  2DM1 A;  5GAM h;  5L8R E;  1GBR A;  4IUQ A;  5GAM e;  1K0X A;  4C5H A;  2IVW A;  4C0Z A;  2M02 A;  1M30 A;  1KC8 R;  5A0D A;  3EHR A;  1W70 A;  2GQI A;  5KCH A;  4O6J A;  1GFD A;  1N8R R;  2YLB A;  5IAY A;  2MCN A;  1RAB B;  3CBO A;  3G71 T;  2AT1 B;  1MHN A;  1NPR A;  1B7T A;  4HA8 A;  2X4W A;  3TRE A;  3CME A;  2DKG A;  1NLO C;  4FCY A;  2X3X D;  1W2B P;  4MML A;  1IZ6 A;  3GNG A;  5FU6 B;  2EQU A;  2XMF A;  1VUB A;  2KRN A;  4BY6 B;  1BYM A;  2L8D A;  2DVJ A;  2GTJ A;  2MYS A;  2MF2 A;  2JVV A;  5GAN 3;  3P8B B;  1W6X A;  2IIM A;  1XTD A;  2JMA A;  1WJQ A;  3BDL A;  5LJ3 g;  3JCM b;  1YWP A;  4E7L A;  4LDX A;  2ZPH B;  1QVP A;  3CQT A;  1KQS S;  4QKU A;  2DIG A;  3EFR A;  4ZNX A;  1TOV A;  1BBZ A;  1G3Y A;  2K3Y A;  1M9S A;  1NZ9 A;  1SPK A;  2VVK A;  2YLC A;  5CQX A;  2J06 A;  1VQ6 T;  3EH1 A;  1VQM A;  2P0Q A;  2NUZ A;  2DTI A;  3QJY A;  3U23 A;  3G6E T;  1VQ8 T;  1VQP T;  5DLQ E;  1QVF S;  1X6O A;  2LCL A;  4LUD A;  3G4S A;  4R56 A;  4XU3 A;  2YRD A;  1VYV A;  3RBB B;  1C6V X;  1I81 A;  2L5Q A;  5GAM g;  1Q86 R;  2HBW A;  1PWT A;  2BE7 D;  3VRY A;  4F17 A;  3CC2 T;  3GPL A;  3UDC A;  3QSU A;  1H64 1;  4J9E A;  3JB9 D;  2L2P A;  1WNL A;  1M8V A;  3R6O A;  3E9G A;  3QWX X;  3PVQ A;  2JN0 A;  3NTK A;  3N5B B;  1HD3 A;  4A63 B;  2LQ8 A;  2AK5 A;  3PE0 A;  1QP2 A;  1RAI B;  5GMK l;  3I55 T;  1SHF A;  2O31 A;  3TCJ A;  3OS1 A;  4FYX B;  3EG3 A;  1I8F A;  4EDU A;  2PUK B;  1N5Z A;  2RQT A;  2BZY A;  3OS2 A;  4J8O A;  5FRN A;  2K5L A;  2LZ6 B;  2M1H A;  3CCS Q;  2EQM A;  1R0C B;  1K76 A;  1EZZ B;  5GMK e;  3CXC A;  1KFZ A;  1JQQ A;  2G6F X;  1HSQ A;  4A4E A;  4C92 B;  1G83 A;  2QK0 A;  1W2B S;  2QEX Q;  3RIR A;  3UT1 A;  3S6W A;  1Q82 C;  2L3R A;  4PJO E;  3OBW A;  1WJR A;  3A8H B;  3CXC P;  2EIF A;  3EGD A;  2VUB A;  5KYY A;  2K5I A;  1H8K A;  3NHN A;  3QG1 A;  1YI2 T;  3EAE A;  2CZ1 B;  1VYU A;  2CP2 A;  4RMO A;  1X69 A;  3CCL A;  3CME T;  4B9W A;  4MDW A;  4PJO B;  5HK0 A;  2L3S A;  3G1J A;  4RTZ A;  1K73 R;  4M75 F;  2E4H A;  1AWW A;  3JCM g;  2QEX A;  2VWF A;  3CCL Q;  3H41 A;  2L0A A;  3OYH A;  3CCJ A;  1PD1 A;  1YI2 A;  1R77 A;  3GLX A;  1S72 T;  1TS9 A;  2GFU A;  1BI3 A;  1U5S A;  3G6E A;  1VQ8 A;  1OYX A;  3X26 B;  3CCU T;  4IUV A;  3PIP A;  3PNW C;  4KRT A;  1X2K A;  1IRX A;  2QA4 A;  2K7A A;  4QT7 A;  1CKA A;  3FJ5 A;  5FW9 A;  4OF1 A;  3VRZ A;  3TSW A;  1QMC A;  2G3R A;  2B8A A;  2VXF A;  5IHN A;  1ZSG A;  2GNC A;  2K4Y A;  4BE2 A;  4ZTJ A;  2HEQ A;  2B86 A;  1X75 C;  3OSS C;  4PJO F;  4M78 A;  2AKL A;  2PVG B;  4XU0 A;  2P4R A;  4BI4 A;  1FYN A;  3JCM W;  4C92 C;  3OYE A;  2CYZ B;  5IT9 E;  2ROT A;  5FRO A;  4M78 F;  1B07 A;  4OGE A;  2ZAE A;  1V1C A;  1WJS A;  5D7U A;  1WA7 A;  2RHU A;  5FLX E;  2JMC A;  2HKN A;  4F7U A;  2LQK A;  2MOX A;  4UC4 A;  2V8J A;  3VYH B;  2DYI A;  2OTL A;  2YUP A;  2CT4 A;  1VQ7 T;  2PTK A;  2X4J A;  2DL8 A;  2KSS A;  3S3M A;  3QO3 A;  1KHI A;  5FU7 C;  5FWB A;  1RAE B;  1UEC A;  2FO0 A;  5IHI A;  1M1K R;  1W1F A;  3GNF B;  3DLM A;  4JRK A;  2CP7 A;  3T9N A;  2YUQ A;  2E41 A;  2Y4X A;  3I56 A;  2D8H A;  1PM3 A;  2LJ1 A;  3S3N A;  5GMK h;  2V8I A;  1K8A C;  1NJI R;  1RAH B;  3OBY A;  1PC0 A;  3RMS A;  4GY5 A;  3X24 B;  3UA6 A;  3I9Q A;  1QVG P;  1RI0 A;  3MEA A;  1YJN A;  2RHY A;  2PVO B;  3ASK A;  3SWN B;  3GP8 A;  3CPW P;  3CCM T;  2KXC A;  3E2U A;  2JM8 A;  4R55 A;  4ZGD B;  2QA4 T;  1M90 R;  1M3A A;  1OI1 A;  5J3B A;  2OI3 A;  2OTJ A;  3EGD B;  2WSE E;  2ZCF B;  2KEA A;  1WXT A;  2RI5 A;  3L2U A;  3SDZ A;  1UUE A;  4ZN1 A;  1S1N A;  1D1C A;  5CKF A;  3VS7 A;  4WF2 A;  2OX7 A;  1VQO Q;  3URG A;  1S72 Q;  4LDV A;  4J7F A;  2LQW A;  1YJN T;  3SWN C;  1Q95 G;  1UTI A;  4JPB W;  1JJ2 A;  2LP5 A;  2ATC B;  3WVD B;  5HCK A;  1WDX A;  3JAM E;  5GAO r;  2C06 A;  4JJN K;  3CCJ Q;  4M7A E;  1I07 A;  2V1Q A;  3CCE T;  1MUZ A;  4K11 A;  3ZBD A;  1PG5 B;  4QVD A;  2KT8 A;  3HRT A;  3L2Z A;  2Y4Y A;  3QZ9 B;  1YI2 Q;  4M75 D;  4NS5 A;  4JLG A;  1ZX6 A;  2LRQ A;  1BK2 A;  3QDF A;  3CCU A;  4M77 F;  1G3T A;  1SKU B;  4C92 A;  3UAT A;  1YFN A;  4JUV A;  1G2B A;  3I56 T;  5LJ5 e;  1Q82 U;  2CKK A;  2V1R A;  3QHS A;  2DRM A;  4RCB A;  4PJO G;  4M77 C;  1D3B B;  1FMV A;  2E64 A;  4JDS A;  3RDV A;  2XG8 D;  2FPD A;  1Y96 A;  1Y07 A;  2I0N A;  2DXC A;  4X9C A;  2DLP A;  4J83 A;  5FRM A;  2RF0 A;  3VKI A;  3VS5 A;  4IUU A;  1HYO A;  5KYU A;  4BI8 B;  4XU1 A;  2MIO A;  3H6Z A;  4Q5W A;  4Y92 A;  3OYL A;  1LPL A;  4OML A;  5HKC A;  5I11 A;  3FC3 A;  4KH1 B;  4V2S A;  1EX4 A;  1UB4 A;  2ZPG B;  2KRS A;  1D1B A;  4M7D D;  9ATC B;  4OB3 B;  4PKC C;  2M0Y A;  2DVE A;  3SD4 A;  4X34 A;  2QQR A;  2HAX A;  4E47 A;  1AT1 B;  2JTF A;  5LJ5 f;  1BIB A;  4FYW B;  3FRN A;  3MET A;  1M8M A;  4C8Q G;  5IN1 A;  1M90 U;  3MP8 A;  3WVE B;  2ZPB B;  4J9I A;  4D6W A;  1QP3 A;  2R57 A;  4BDZ A;  2E70 A;  1K1Z A;  1NEB A;  1WPY A;  4BY6 C;  2HD0 A;  4M7A F;  2COW A;  5GAN 5;  1QWE A;  3JCM c;  5GAN 4;  1JXO A;  2ESW A;  4J9D A;  2LQN A;  2YUN A;  4XTY A;  1LOJ A;  2RNA A;  4PJM A;  1QWF A;  1RI9 A;  2O9S A;  1VQK Q;  4L5G A;  5LJ3 f;  5GAM j;  1ABO A;  2EPD A;  1OUL A;  3TEE A;  4MMK A;  3OYD A;  4J5Y A;  2JTE A;  3OS0 A;  1WFW A;  2XI9 A;  3M4G A;  2HZY A;  1ZUU A;  1XOV A;  1SEM A;  1VQK A;  2NUP A;  3OYB A;  4CI0 C;  1TXQ A;  4OB1 B;  1BU1 A;  1WLP B;  3VS4 A;  1PHT A;  7AT1 B;  1NJI U;  2VC8 A;  3TSZ A;  3NGP A;  3CC4 A;  5CK9 A;  2CP3 A;  2DEU A;  3LX7 A;  1VQ5 T;  3RNJ A;  1KD1 U;  4B9X A;  1TSF A;  1XJW B;  3OYM A;  4DOW A;  2WSC E;  2X35 A;  4WCI A;  3CCS T;  4E7H A;  4QQG A;  1U3O A;  4D8K A;  5GMK j;  2K3B A;  1K9A A;  1M2O A;  4FU6 A;  2AKK A;  3OA6 A;  1KSW A;  2O9V A;  1OEB A;  1VQ6 A;  1Y0M A;  4M77 A;  1WHG A;  1N8R C;  3QII A;  2VXE A;  1FMW A;  4HT8 A;  1OZ2 A;  4OMO A;  1M90 C;  2QQS A;  1N9R A;  1VOM A;  5KYW B;  1M3C A;  1T3L A;  4OMM A;  1M1K C;  1I5O B;  2H3E B;  2EKH A;  3A8G B;  2LJ3 A;  3A1P A;  1I0C A;  2EQI A;  1JXM A;  1M2V A;  1U8R A;  4KUD K;  4JJB A;  3JB9 G;  2FZC B;  1Q86 U;  1TH7 A;  2HL3 A;  3LLR A;  1UG1 A;  3EFS A;  2DL4 A;  2HL5 C;  5FU7 B;  4FT2 A;  3ZEH A;  2XU8 A;  3CCM Q;  4QQ6 A;  4PLI A;  3AT1 B;  1KHC A;  4HVW A;  1GXI E;  1F1B B;  4CC4 B;  1YIJ T;  2AIR B;  2RM4 A;  2YSQ A;  2HNI A;  2O01 E;  4HCK A;  1Y57 A;  3LYI A;  5GAN j;  4EMK C;  1XQH A;  5GAN f;  4NOY A;  3C4S A;  4M7A D;  3MEU A;  3CCQ T;  2Z0W A;  3GIB A;  3OSV A;  2VYT A;  1RUW A;  1VQ9 Q;  2MK5 A;  4IUR A;  3RKW A;  5KH6 A;  1PCX A;  2KK4 A;  4Y28 E;  1NLP C;  2E1H A;  5GAO p;  3EG9 B;  3RES A;  2HQE A;  5I21 A;  2LVM A;  1IXD A;  2AZV A;  3OMG A;  5IH2 A;  1WHK A;  2GTO A;  2LNV A;  4TVR A;  1MMD A;  5IXF A;  4HCC A;  1VQ9 A;  3HKS A;  2WAC A;  1AWJ A;  2E6N A;  2YRC A;  2CSI A;  1ACM B;  3C94 A;  3A8L B;  3SWN A;  2VKN A;  5HK3 A;  1JU5 C;  1U06 A;  1E6G A;  1VQN T;  2KRM A;  2DMO A;  1T0H A;  2JNG A;  4IUP A;  2ROL A;  1MND A;  2SEM A;  2CRE A;  4M77 D;  1EIF A;  3J80 E;  2EVR A;  3OW2 P;  3EFO A;  4EIK A;  1UGQ B;  1VQL Q;  3KUF A;  1VQ9 T;  4KBM B;  1WQ7 A;  1I1J A;  2M9U A;  1UGP B;  4DBF A;  2DO3 A;  3DKM A;  3M0S A;  2FRY A;  4BE1 A;  2RK2 A;  1VQN A;  3G7Z A;  1OPL A;  2P0K A;  1Y7X A;  3WXM B;  4HT9 A;  3OW2 A;  2E3H A;  3CBP A;  4M7D F;  2RPN A;  5LJ5 d;  1VQ4 T;  1PRM C;  3UA7 A;  1AOJ A;  3E19 A;  3CCR A;  3RUX A;  1WHJ A;  4M7D A;  3DB4 A;  2LMJ A;  2XDP A;  4C8Q D;  4FYY B;  5I2S A;  3MEV A;  2E5K A;  3G71 A;  4KUI A;  3LH5 A;  4M77 B;  2PVD B;  4J6W A;  3CD6 A;  2O88 A;  3CCR Q;  4LE9 A;  3TU4 K;  1QKW A;  2F5K A;  4BB7 A;  4LUE A;  1ZUK A;  4HCZ A;  1YHQ A;  5CKH A;  1Q81 R;  2HKQ B;  4KGV B;  4JZ3 A;  5A0G A;  1KK7 A;  2ECZ A;  3QPH A;  4M78 E;  1MMA A;  5FU6 C;  3M0P A;  1K8A U;  4M77 G;  2EQJ A;  1VQM Q;  1RAC B;  1NJI C;  3J7A F;  1YWO A;  2EJ9 A;  1K9M R;  2A08 A;  2CP5 A;  3VJP A;  2NWM A;  3MEW A;  4FW1 A;  1UEB A;  2FEI A;  2I2L A;  2CGH A;  3A8O B;  4F7U E;  1KJW A;  1HJD A;  6AT1 B;  2K2V A;  2K57 A;  1WGS A;  2PNI A;  4BDY A;  1VQ5 Q;  3O5Z A;  3MCA B;  4RTU A;  1YJ9 A;  3VUZ A;  3GOX A;  5GAN e;  4OB2 B;  5KYN A;  3V8J A;  3VV0 A;  4EMG A;  3QZ5 B;  1RAF B;  2LTO A;  2RJC A;  3JRZ A;  1BIA A;  5GAN d;  3CCQ Q;  2DA9 A;  1WQW A;  3OYC A;  1JJ2 P;  5CQY A;  2ZPE B;  5DM7 R;  2DX1 A;  1H3H A;  2KXD A;  4J9C A;  2DZ9 A;  1MV3 A;  2LX9 A;  4XTZ A;  3HTR A;  4M75 E;  1Q7Y R;  4MZM A;  5GAN 2;  2CDT A;  4J9G A;  3CCV T;  2RN8 A;  2CZ6 B;  4PJL A;  1AD5 A;  3FIF A;  2EAY A;  4RUG A;  4ANJ A;  5LJ3 d;  1BI0 A;  3OYI A;  4DEY A;  5KYX B;  1LCK A;  1UE9 A;  4OMQ A;  4C5I A;  1GBQ A;  3G6E Q;  2DNU A;  1VQ8 Q;  1I4K 1;  2WSF E;  3VS6 A;  3CC7 A;  1VQ6 Q;  1A0N B;  2XKO C;  2DEQ A;  2CZ0 B;  1IB8 A;  2RHI A;  4A53 A;  3EG1 A;  2QAZ A;  2O2O A;  4II1 A;  3HP9 A;  1RL2 A;  4RTW A;  1GL5 A;  2HDA A;  2FYK A;  3PMT A;  5C0M A;  3CCU Q;  4KUL A;  2J6F A;  4FL6 A;  4FW2 A;  1QQJ A;  1Q7Y U;  5GJV B;  4BI3 A;  5C6S A;  3OYN A;  1KQS P;  4M78 B;  3EH2 A;  3CCL T;  1YN8 A;  2F2X A;  3MHX A;  2GFA A;  1WYX A;  2QTV A;  3R6N A;  2HQH A;  1WIE A;  4JS5 A;  2CT3 A;  1NBE B;  5L23 A;  1KQ2 A;  2X4Y A;  4M7A A;  3M55 A;  2DL7 A;  4F7U B;  5LL6 S;  2L3P A;  3THK A;  1WHL A;  3EGX A;  3CMA Q;  1AHJ B;  5DY9 A;  2CH4 W;  4GBQ A;  2YT6 A;  4HVU A;  3G71 Q;  3C95 A;  2W0Z A;  3SHW A;  5LJ5 g;  2CSQ A;  3PMI A;  4F7U G;  1JB0 E;  3VS1 A;  4EMK A;  4C5G A;  1T0J A;  1YCS B;  2QTX A;  3QBY A;  4IUT A;  3FLG A;  5GMK m;  3PT9 A;  5IHK A;  3JB9 H;  2OAW A;  1UGR B;  2LCS A;  2RJD A;  4NL3 A;  5KYW A;  2RA2 A;  4F16 A;  1EFN A;  3OW2 S;  2KNB B;  3S3O A;  4C8Q E;  2F1L A;  4A4K A;  2E5Q A;  2CZ7 B;  2OTJ Q;  4PNO A;  4AFZ C;  1LJO A;  1TUG B;  3KFV A;  4M7D B;  4L6V 5;  1YJN Q;  3FEO A;  1Q81 U;  2K79 A;  2KVQ G;  3OYA A;  3DLL A;  5I22 A;  4CC7 A;  3M4Y A;  4AMC A;  1YCY A;  2XDB A;  1OU9 A;  4BD3 A;  1V29 B;  3RER A;  4WTO B;  1M1G A;  1RLQ C;  4F14 A;  5EG2 A;  1C0M A;  1NM7 A;  2EYZ A;  4KT0 E;  2FZK B;  1TUC A;  3E9F A;  3ULR B;  1X2Q A;  2K9G A;  1JEG A;  4ME7 A;  1BB9 A;  2P0P A;  3CCV A;  4XTV A;  3I35 A;  1VQP Q;  4R0K A;  4JRQ A;  1JBM A;  2CUB A;  2QXF A;  4JJC A;  1KD1 R;  4AFU C;  4KGZ B;  1RLP C;  5LJ3 h;  3HFN A;  3CCV Q;  2XK0 A;  1C1A A;  5CR2 A;  2BKD N;  2EQK A;  2L89 A;  3H8Z A;  3QXE B;  2RHZ A;  2RI2 A;  2XHC A;  2QG9 B;  2DD5 A;  4C8Q B;  4ZGE B;  2R5A A;  1PSE A;  2EYQ A;  4NL2 A;  4J9F A;  4YTL A;  1D1A A;  2XID A;  3MKD A;  2X3W D;  5D6X A;  8AT1 B;  2KYM A;  2GQV A;  4ATO A;  3H9N A;  3H0I A;  5CCA A;  2RI3 A;  4LXC A;  4LD6 A;  2MWP A;  1S72 A;  4PFZ A;  4XQ3 A;  3M0R A;  1Q81 C;  3CBM A;  3MP6 A;  2YWW A;  3NPF A;  3CMA T;  3EG0 A;  4BAC A;  1ARK A;  1U1S A;  1P92 A;  2K6D A;  1H92 A;  1VQ4 A;  1M1K U;  3CCE Q;  2KY9 A;  3ER0 A;  4E7J A;  4P5N A;  4M78 C;  3CCJ T;  3CPF A;  1AWO A;  1OOT A;  4MZP A;  2EKO A;  1UJY A;  5GAN g;  2ZPF B;  1Y96 B;  2FG0 A;  1Z9Q A;  1GRI A;  1VQM T;  2DE0 X;  3EFO B;  4M77 E;  1J3T A;  2KRO A;  1PKT A;  1QLY A;  5A0L A;  4M78 G;  2ED0 A;  4RG2 A;  2EGA A;  2KQW A;  1FMK A;  1MGQ A;  4C0D B;  3EGU A;  2E12 A;  5ECA A;  2VGM A;  4C8Q F;  1M5Q 1;  1ZHI A;  4N4G A;  1B3Q A;  2D1X A;  2PUO B;  5KE3 A;  1KC8 C;  1K9M U;  3LH0 A;  5CAI A;  3GF5 A;  1QVG A;  2QQ9 A;  5DLO A;  1W2B A;  4AG1 C;  2H3J A;  3TVT A;  1ZA2 B;  4RTT A;  2NLU A;  1UFF A;  2D9T A;  3G4S Q;  4LDY A;  2GBQ A;  1VQO A;  2AZS A;  1TWB A;  2ZZD A;  2FPE A;  3FJP A;  3PGG A;  4A4F A;  1O75 A;  4JZ4 A;  3QYG B;  2JZ2 A;  4J9B A;  1IGQ A;  3X20 B;  1AZG B;  4QVC A;  5KYY B;  4CC3 A;  3CXC S;  2RD1 A;  5CIU A;  3V8K A;  5GAM d;  2M0O A;  2CH4 A;  3ZFJ A;  2LX7 A;  3IQL A;  3JCM V;  4L59 A;  4E7S A;  1AVZ C;  2MWO A;  3KBG A;  3VS0 A;  1K73 U;  2PQW A;  4OGC A;  5GAO l;  1OV3 A;  2A28 A;  3L42 A;  4XTX A;  3QWY A;  1K8A R;  4C5E A;  4HCB A;  3MPU B;  4HVV A;  2E10 A;  3D7S B;  3X25 B;  2H8H A;  2DER A;  3JV3 A;  2QEX T;  1YJW Q;  2VV5 A;  4X1V A;  4KGX B;  4C8Q C;  3M54 A;  1WHM A;  3A8M B;  2QGG A;  3BE3 A;  2W10 A;  4A4G A;  2HBP A;  2DL5 A;  2E6Z A;  1AZE A;  2A37 A;  4ESR A;  2RQR A;  1UHF A;  2HSP A;  1VQN Q;  2RQV A;  4C0G A;  1BI1 A;  1N9S A;  3NFC A;  2FVU A;  3Q1J A;  2QI2 A;  5CVI A;  2RO0 A;  2A3L A;  2LJ0 A;  1G3S A;  1N27 A;  1KD1 C;  4OMP A;  5KCO A;  1YJW T;  1SG5 A;  2XDD A;  1M3B A;  2YDL A;  2DRK A;  4RG8 A;  1GCP A;  5GAO q;  1PD0 A;  2DAQ A;  4QVZ A;  2FHD A;  1YJ9 T;  3V7C A;  1IO6 A;  3L2R A;  2MAM A;  4IIM A;  2D6F A;  1N8R U;  3REA B;  4E7I A;  1B34 A;  5KE2 A;  2DXB A;  4OMF B;  2LCC A;  2C0O A;  4F7U F;  2BIV A;  1GCQ C;  1NE8 A;  2QAS A;  4AFS C;  5GAN 8;  1H3Z A;  2GF7 A;  3M53 A;  1V76 A;  2PZ1 A;  3LGF A;  4N0A C;  4XK8 E;  4N4I A;  1YIJ Q;  3HPW A;  3O8V A;  4RTY A;  1NEG A;  1MNE A;  2YXY A;  1MMG A;  1AWX A;  4M7D E;  3MJX A;  2YRV A;  2QDL A;  2CP0 A;  4FM4 B;  1PNJ A;  1RAA B;  4ELZ C;  3LWH A;  3QKJ A;  1KQS A;  2P84 A;  4JJD A;  3FDR A;  1O9S A;  2M51 A;  4DEX A;  1Y71 A;  2ENM A;  1BI2 A;  1VQ5 A;  1PRL C;  2JW4 A;  4DOV A;  2K5F A;  1YJ9 Q;  2IPO B;  3OY9 A;  3I55 A;  4GLM A;  2EWN A;  2KMT A;  3PTA A;  2QDY B;  2DXU A;  1M4Z A;  4LDU A;  4C92 F;  2NYS A;  1YHQ Q;  4DBH A;  3NTH A;  4E2F B;  4J7I A;  1GFC A;  3C12 A;  4JRP A;  2GCX A;  5GAN 6;  5A2Q E;  5GJW B;  2DXT A;  1ZSZ C;  3M5A A;  4E7K A;  2KDS A;  4RTX A;  3A98 A;  4JLI A;  3VU3 C;  4DBR A;  1BCO A;  1G8X A;  2COY A;  1WX6 A;  2BUD A;  1CSK A;  3NTI A;  4PJO C;  2BZX A;  1SSH A;  2EYY A;  3JCM Q;  2EJF A;  4DQ2 A;  2Y90 A;  3CD6 T;  2XIC A;  2DBK A;  1ZSZ B;  3HL8 A;  1ZBJ A;  1WXU A;  1Z9Z A;  3OYK A;  2J05 A;  4RCC A;  3L2W A;  3I5R A;  3SEM A;  3V7R A;  3I55 Q;  1IHW A;  2RH2 A;  4FT4 A;  1TG0 A;  2BTT A;  3I5S A;  5AT1 B;  1YIT T;  2JS2 A;  2O4X A;  4AT1 B;  5HY6 A;  4X9D A;  5LJ5 j;  1QCO A;  4FIB A;  2KR3 A;  1YJW A;  3REB B;  1X01 A;  4M78 D;  3UWN A;  3BY7 A;  4M75 A;  3CC2 Q;  1X43 A;  4J6X A;  4EMH A;  2JTM A;  5GAN 7;  3CC7 Q;  4MZT A;  4AFQ C;  1YNZ A;  4XTW A;  4N4H A;  2EBP A;  2LC4 A;  1Q86 C;  2YUO A;  1MV0 B;  1JJ2 S;  2E3I A;  1YP5 A;  1WZO A;  2EYW A;  1QVF A;  3AHU A;  2DYB A;  1MMN A;  3C0C A;  5LJ3 e;  4FSS A;  2NUT A;  5LJ5 h;  3CPW A;  5LJ3 j;  3G4S T;  2DIQ A;  2V8K A;  4XAX B;  1QCN A;  4Z88 A;  2EYX A;  4KH0 B;  2DL3 A;  3PFS A;  2D0N A;  5CO7 A;  3LWI A;  2JXB A;  1X6G A;  1GCQ A;  4C0F A;  2JM9 A;  1SRM A;  1ZUY A;  1IRE B;  4N0A A;  1R0B G;  4DBQ A;  3NMZ C;  3RMQ A;  4Z02 A;  4E7Z A;  1YBY A;  2KGT A;  5CKB A;  1X27 A;  2YHT A;  3VS3 A;  4C0D C;  3PIO A;  4XU2 A;  2C0T A;  4PFP A;  2RQU A;  5D6Y A;  2KE9 A;  2A7Y A;  3EG9 A;  4ORZ A;  4RTV A;  5I2M A;  3MP1 A;  1SRL A;  1M27 C;  5CKD A;  2FB7 A;  1T3S A;  2DJZ A;  3OS5 A;  3X28 B;  2XD0 A;  3VS2 A;  1ZLM A;  3QDR B;  3MO8 A;  3JSC A;  1NYF A;  1W4S A;  3JCM P;  2KI7 A;  5IXB A;  3M9Q A;  1I5L A;  1N6A A;  1QKX A;  2M16 A;  1B34 B;  2D8J A;  1D0Z A;  1QVG S;  3INZ A;  4Z8A A;  3OMC A;  3CCM A;  3L2Q A;  4QQD A;  3KXT A;  2EJG A;  1Q82 R;  1NYG A;  5GAM f;  1JRI A;  4PJO A;  3I56 Q;  2VAS A;  4M75 G;  2CP6 A;  2DIL A;  1YHQ T;  2CUD A;  1OQK A;  1M1F A;  1QCF A;  2NUP B;  5EC7 A;  1FX7 A;  2FPF A;  1VQK T;  1K4U S;  4LD9 K;  1VIE A;  4HXJ A;  2L3Q A;  4OB0 B;  3GBQ A;  2VB6 A;  3M59 A;  2X51 A;  4B6M A;  2JOY A;  3V7S A;  4A4H A;  1D09 B;  2RJF A;  4C8Q A;  1R8O B;  1ZQ1 A;  1OPK A;  1UDL A;  3P8H A;  2OTL T;  4CC2 A;  3M58 A;  1VIF A;  4M75 B;  5D6W A;  5J26 A;  4A54 A;  1E6H A;  2QQA A;  2R5M A;  1PKS A;  5FWC A;  2RB6 A;  1WHH A;  3OB9 A;  1VQO T;  1G5V A;  2QYZ A;  2MI6 A;  1VQL A;  3EHQ A;  4J9H A;  3ZL7 C;  1VYT A;  3ME9 A;  1K9M C;  2DK3 A;  2RK1 A;  2QA4 Q;  3OQ5 A;  3H0F A;  3JCM J;  2LNH B;  3HHT B;  3CC2 A;  1VQ7 A;  1M2V B;  3F70 A;  1Q7Y C;  2OJ2 A;  1U1T A;  2J7I A;  4EPC A;  2KBT A;  1D0X A;  4HKE A;  2JUF A;  2ED1 A;  3V8L A;  4VUB A;  4PLL A;  1PSF A;  3M0T A;  4ELY C;  3CC4 T;  3CPW S;  3UPU A;  2X4X A;  2JT4 A;  3CC7 T;  2ABL A;  2DBM A;  2HCK A;  4OMN A;  4IKF A;  4ZTF A;  2AHJ B;  2DTO A;  2FZG B;  2P4T A;  1KIK A;  1YIJ A;  2J6K A;  3JCM f;  3PVL A;  2K3X A;  5GMK i;  2IG0 A;  1YIT Q;  4OP0 A;  2HMA A;  2QQB A;  2LDM A;  1OZ3 A;  1VQ7 Q;  1TUD A;  4OVA A;  1FWZ A;  4ZN3 A;  4D8D A;  3HFO A;  4C92 G;  3CCS A;  5KYU B;  4EMK B;  1K73 C;  4PJJ A;  3CD6 Q;  2C0I A;  2GGR A;  4PK4 A;  1KC8 U;  2DD4 A;  1OU8 A;  4AG2 C;  2JS0 A;  1UGV A;  4PL6 A;  3JCM h;  2A0F B;  3L2V A;  5GAO m;  5CKE A;  4GLK A;  2O4X B;  1D3B A;  1KG1 A;  1SHG A;  1BKB A;  2KYB A;  2QGF B;  3UF4 A;  3M0Q A;  2KT1 A;  3SFM A;  2LT1 A;  3H0H A;  2EGC A;  1D0Y A;  2RJE A;  4C92 D;  3JB9 F;  1SF9 A;  2F2V A;  1CKB A;  2MMP A;  2FL7 A;  4XTU A;  3SB2 A;  3TQ7 P;  1NG2 A;  1AEY A;  2R58 A;  4BE0 A;  2E65 A;  3E1S A;  2HSE B;  3VYG A;  2F2W A;  4PFO A;  1UJ0 A;  3JCM e;  1K0S A;  4RKU E;  4M75 C;  4J6Y A;  1BCM A;  2PU9 B;  4JRI A;  5M9O A;  1ZSZ A;  3M57 A;  2COZ A;  4LNP A;  2X9H A;  3A5Z B;  2DET A;  1IGU A;  4Y91 A;  5GAN h;  1KQ1 A;  3RR6 A;  3OYF A;  2DFU A;  5GAO n;  4DA4 A;  4ZGJ B;  5KYX A;  1X6B A;  2RMO A;  2SRC A;  1XNI A;  2K2M A;  3HRS A;  1NPP A;  3HRU A;  2DJQ A;  1VQL T;  8ATC B;  3BFM A;  5AYF A;  3QJ6 A;  1DJ7 B;  4C92 E;  3CEY A;  4JS4 A;  1HXD A;  4PJN A;  3BW1 A;  2LT4 A;  2MPX C;  3DB3 A;  1ZA1 B;  3M56 A;  1JO8 A;  3CCE A;  4FSX A;  2RQW A;  4M7D G;  3L1A A;  2ZPI B;  4F04 B;  1QVF P;  4QW2 A;  1QW1 A;  5J39 A;  2DZC A;  2VGN A;  1ABQ A; 
#chains in the Genus database with same CATH homology
 1PNJ A;  4M4Z A;  4JJD A;  2LQW A;  3EG2 A;  1UTI A;  1WXB A;  1E7O A;  2M51 A;  4JPB W;  1WI7 A;  1VA7 A;  4DEX A;  2DA9 A;  2ENM A;  1UHC A;  1PRL C;  2LP5 A;  1H3H A;  2DX1 A;  2JW4 A;  2KXD A;  4J9C A;  5HCK A;  2EW3 A;  1WDX A;  1MV3 A;  4GLM A;  1I07 A;  2V1Q A;  4IIO A;  1GFC A;  2FRW A;  1MUZ A;  2CDT A;  4K11 A;  4J9G A;  2RN8 A;  5GJW B;  1AD5 A;  2BZ8 A;  2KT8 A;  4RUG A;  4RTX A;  3A98 A;  2EGE A;  3M0U A;  4DEY A;  1LCK A;  1UE9 A;  1ZX6 A;  4OMQ A;  1BK2 A;  1GBQ A;  2DNU A;  2A36 A;  1WX6 A;  1CSK A;  2BZX A;  1SSH A;  2EYY A;  3UAT A;  3VS6 A;  1A0N B;  1G2B A;  3EG1 A;  2O2O A;  2DBK A;  2DF6 A;  1ZBJ A;  1WXU A;  1Z9Z A;  4LN2 A;  2V1R A;  2DRM A;  2J05 A;  4RTW A;  1GL5 A;  2HDA A;  3I5R A;  2J6O A;  3SEM A;  2J6F A;  2FPD A;  4Z89 A;  5GJV B;  1TG0 A;  2BTT A;  3I5S A;  4E6R A;  2I0N A;  2DLP A;  2JS2 A;  2RF0 A;  3VS5 A;  1YN8 A;  2DM1 A;  2F2X A;  2KR3 A;  1WYX A;  1GBR A;  3R6N A;  3REB B;  2MIO A;  1K0X A;  1WIE A;  4Y92 A;  2CT3 A;  5L23 A;  4OML A;  1X43 A;  5I11 A;  2DL7 A;  1M30 A;  3EHR A;  1W70 A;  2GQI A;  1YNZ A;  4AFQ C;  2L3P A;  3THK A;  1GFD A;  2EBP A;  2YUO A;  2MCN A;  1MV0 B;  2KRS A;  1YP5 A;  2EYW A;  2CH4 W;  2M0Y A;  2DYB A;  4GBQ A;  3C0C A;  2YT6 A;  4FSS A;  4HVU A;  2W0Z A;  4Z88 A;  2EYX A;  2DL3 A;  3SHW A;  2D0N A;  2CSQ A;  1NLO C;  2JXB A;  1M8M A;  2X3X D;  1X6G A;  3VS1 A;  4J9I A;  2XMF A;  1GCQ A;  1K1Z A;  1T0J A;  1YCS B;  2KRN A;  2JM9 A;  1SRM A;  1NEB A;  1ZUY A;  3NMZ C;  2DVJ A;  2GTJ A;  1QWE A;  5IHK A;  2OAW A;  2KGT A;  2LCS A;  3VS3 A;  1X27 A;  1JXO A;  2ESW A;  1W6X A;  2C0T A;  4J9D A;  2LQN A;  2YUN A;  2RQU A;  2RNA A;  2IIM A;  1QWF A;  2KE9 A;  1RI9 A;  2JMA A;  2O9S A;  4ORZ A;  4F16 A;  4RTV A;  1EFN A;  1YWP A;  1ABO A;  3CQT A;  1SRL A;  2EPD A;  1M27 C;  2KNB B;  4ZNX A;  1T3S A;  2JTE A;  1WFW A;  1BBZ A;  3VS2 A;  1ZLM A;  1NYF A;  1SPK A;  1ZUU A;  2VVK A;  4AFZ C;  1XOV A;  1SEM A;  5IXB A;  3KFV A;  2J06 A;  1QKX A;  2NUZ A;  2D8J A;  1BU1 A;  1WLP B;  3VS4 A;  2K79 A;  1PHT A;  3U23 A;  3TSZ A;  5I22 A;  4CC7 A;  3NGP A;  4LUD A;  4Z8A A;  3RNJ A;  1VYV A;  1RLQ C;  4F14 A;  1NM7 A;  3RBB B;  2EYZ A;  1NYG A;  4WCI A;  2HBW A;  3ULR B;  1PWT A;  1TUC A;  3VRY A;  1X2Q A;  2K9G A;  1U3O A;  1JEG A;  2DIL A;  4F17 A;  4D8K A;  1BB9 A;  2CUD A;  2K3B A;  1K9A A;  1QCF A;  4J9E A;  2L2P A;  2AKK A;  3I35 A;  1KSW A;  3QWX X;  5EC7 A;  4R0K A;  2FPF A;  2O9V A;  1OEB A;  2CUB A;  1K4U S;  3PVQ A;  1Y0M A;  4HXJ A;  2L3Q A;  4JJC A;  1HD3 A;  3GBQ A;  4AFU C;  4OMO A;  4A63 B;  1RLP C;  2AK5 A;  3PE0 A;  1SHF A;  2O31 A;  1M3C A;  1T3L A;  4OMM A;  3EG3 A;  2EKH A;  1OPK A;  1UDL A;  2LJ3 A;  1N5Z A;  2RQT A;  1I0C A;  2BZY A;  4CC2 A;  4J9F A;  2EQI A;  1JXM A;  2LZ6 B;  4JJB A;  1E6H A;  1PKS A;  5FWC A;  2X3W D;  1UG1 A;  1K76 A;  2DL4 A;  2KYM A;  1KFZ A;  1JQQ A;  3H0I A;  2G6F X;  1HSQ A;  3M0R A;  1G83 A;  3EHQ A;  4HVW A;  3NPF A;  4J9H A;  3ZL7 C;  1VYT A;  3EG0 A;  1ARK A;  2K6D A;  1H92 A;  4CC4 B;  2YSQ A;  3H0F A;  4HCK A;  2LNH B;  1Y57 A;  2OJ2 A;  1AWO A;  2J7I A;  1OOT A;  1H8K A;  2KBT A;  1UJY A;  2FG0 A;  3NHN A;  1Z9Q A;  1GRI A;  2DE0 X;  2ED1 A;  1VYU A;  1J3T A;  2KRO A;  1PKT A;  1QLY A;  1RUW A;  3M0T A;  2ED0 A;  2EGA A;  1FMK A;  1X69 A;  3EGU A;  2JT4 A;  1NLP C;  5ECA A;  2ABL A;  2DBM A;  1B3Q A;  2HCK A;  4OMN A;  2D1X A;  2AZV A;  5IH2 A;  2GTO A;  2L3S A;  4RTZ A;  1KIK A;  2J6K A;  5IXF A;  1AWW A;  4AG1 C;  3PVL A;  1AWJ A;  2VWF A;  3H41 A;  2CSI A;  2L0A A;  3TVT A;  4RTT A;  1UFF A;  2VKN A;  1U5S A;  1JU5 C;  1U06 A;  2GBQ A;  2AZS A;  1E6G A;  2KRM A;  1TUD A;  2FPE A;  2DMO A;  1T0H A;  4D8D A;  4JZ4 A;  4KRT A;  4J9B A;  1X2K A;  1AZG B;  2ROL A;  2K7A A;  4QT7 A;  1CKA A;  3FJ5 A;  5FW9 A;  2SEM A;  2C0I A;  3VRZ A;  4CC3 A;  2GGR A;  3TSW A;  2CRE A;  4AG2 C;  1ABQ A;  5IHN A;  1ZSG A;  2JS0 A;  2GNC A;  2EVR A;  1UGV A;  2HEQ A;  4EIK A;  2CH4 A;  2B86 A;  2AKL A;  2LX7 A;  1SHG A;  3IQL A;  2P4R A;  1FYN A;  2KYB A;  1AVZ C;  1I1J A;  3UF4 A;  3M0Q A;  2KT1 A;  3VS0 A;  3H0H A;  3M0S A;  1OV3 A;  2FRY A;  2EGC A;  2A28 A;  2ROT A;  1B07 A;  1OPL A;  1V1C A;  1WA7 A;  3QWY A;  2JMC A;  2F2V A;  1CKB A;  2MOX A;  4HVV A;  2RPN A;  2H8H A;  3JV3 A;  1PRM C;  1NG2 A;  4X1V A;  1AEY A;  3UA7 A;  2YUP A;  1AOJ A;  2CT4 A;  2W10 A;  2DL5 A;  1AZE A;  2A37 A;  4ESR A;  2RQR A;  1UHF A;  2HSP A;  2RQV A;  2PTK A;  2DL8 A;  2F2W A;  2LMJ A;  2E5K A;  5FWB A;  1UJ0 A;  1UEC A;  2FO0 A;  2LJ0 A;  3LH5 A;  5IHI A;  1K0S A;  1W1F A;  4OMP A;  2O88 A;  1M3B A;  2YUQ A;  4LE9 A;  1QKW A;  2D8H A;  2YDL A;  2DRK A;  2LJ1 A;  1GCP A;  4LUE A;  1ZUK A;  4LNP A;  1IO6 A;  4JZ3 A;  4IIM A;  1X6B A;  2ECZ A;  2RMO A;  3I9Q A;  3UA6 A;  2SRC A;  3M0P A;  2K2M A;  3REA B;  2DJQ A;  1YWO A;  2C0O A;  2KXC A;  2A08 A;  2JM8 A;  2NWM A;  1GCQ C;  4AFS C;  2FEI A;  1HJD A;  1KJW A;  1M3A A;  2PZ1 A;  2OI3 A;  1JO8 A;  4RTY A;  1NEG A;  2RQW A;  2KEA A;  1WXT A;  1UUE A;  2PNI A;  1S1N A;  3O5Z A;  4RTU A;  1AWX A;  3VS7 A;  2QDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...