2HL5C

Crystal structure of the c-terminal domain of human eb1 in complex with the a49m mutant cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 15
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl5C00
1TXQA 2CP0A 3E2UA 1WHLA 1LPLA 2CP6A 1WHKA 2COZA 1WHJA 3RDVA 4B6MA 1WHHA 2M02A 2CP2A 2COWA 2E3HA 2MPXC 1TOVA 2E4HA 2HQHA 2QK0A 2CP7A 2CP3A 2COYA 3TQ7P 2Z0WA 1WHMA 2HL3A 1IXDA 2HL5C 1WHGA 2E3IA 2HKNA 2CP5A 2HKQB
chains in the Genus database with same CATH superfamily
4C92B 2FO0A 3P8HA 1JO8A 1EIFA 1VQKT 1WYXA 4XTXA 1KJWA 3CCRQ 1H3ZA 4OMMA 5LJ5j 5J26A 2DL7A 4A4FA 1IGUA 1OX8A 5LJ5e 2XDPA 4C8QE 4N0AA 1BI0A 4BE0A 1K1ZA 1Y07A 5CKBA 3MP8A 2A37A 2EQKA 2V1QA 4LUDA 1W4SA 1K4US 1M27C 2F69A 2COWA 3CD6T 1ACMB 1PC0A 2BE7D 5AYFA 2JTEA 2M0OA 1D1BA 1TUCA 4M78C 1ZBXA 2HEQA 2LCLA 2PZ1A 2RQVA 3CC2T 1G5VA 4EDUA 3M0SA 3HRUA 4ZNXA 3M0RA 3I5RA 3CCLQ 3VS4A 1VQLA 2PUOB 1ZQ1A 2KRMA 1TU0B 4X9CA 4HVVA 3H8ZA 1Y0MA 5GAOl 5FWCA 1ZA1B 5LJ5f 1XTDA 1RAHB 3VYHB 3JRZA 1NYGA 1VQMQ 1K9AA 2RQWA 2KAFA 4FT2A 3EG3A 3UPUA 3RKXA 1ZUUA 2RD1A 4XQ3A 4M7AF 3VS7A 5GANg 2CKKA 4C92D 3CCMQ 2NUZA 5LJ5d 2DL4A 2ZZDA 1I4K1 3BY7A 4C0ZA 2PVGB 1VQ6A 1R77A 5IHKA 3I9QA 1CSKA 3CCUQ 2KDSA 2A7YA 2BIVA 3AT1B 3L42A 3VS2A 5LL6S 3NTKA 3REAB 2X9HA 2L89A 1N6AA 4RMOA 2QYZA 4M77B 1OX9A 2HL5C 2RK1A 3GLXA 4C8QF 1RAEB 2CT3A 2D0NA 2FVUA 3TSZA 1K73U 2ZAEA 3A8GB 3DKMA 1NEGA 1AZGB 4XTYA 5KYYA 4PLLA 4M77E 2I0NA 3VS5A 1M8MA 1KQSP 4DBRA 1RAGB 4RTVA 1N8RU 2CP7A 2F2VA 1AT1B 3NTIA 2KRSA 1OOTA 2HAXA 3OS0A 2EFIA 2EYXA 2CT4A 1H92A 5IN1A 2HBPA 5KYWA 4M7DC 3GIBA 1SRLA 3CCVT 3MEVA 4LE9A 1NZ9A 4OP0A 2CP2A 2DLPA 7AT1B 3PGGA 3CPWP 2FB7A 2KT1A 1IHWA 4EMKB 2RK2A 1KC8U 2KR3A 3X24B 3RNJA 1VQLQ 1XQHA 1UGPB 1Q81R 2IIMA 1HSQA 3FC3A 4JJCA 2K7AA 4JDSA 5GAMh 3UA6A 4D8DA 5HCKA 2QDLA 2DYBA 1P92A 3GPLA 3QDFA 2LJ0A 3RKWA 2C06A 2A08A 2A28A 1IO6A 3FJPA 2R57A 1VQ8Q 3E1SA 4RG2A 4M7AA 3M9QA 1GXIE 4JPBW 2JS0A 1S72A 2DKGA 2KYBA 1UHCA 3X25B 3CCLT 1SRMA 1JEGA 1AHJB 5GMKi 2LNHB 4M78E 2E1HA 2OAWA 8AT1B 1D0YA 4ZGDB 1VQMT 1MUZA 3MKDA 3M53A 2QA4Q 1G83A 1WQWA 1AWXA 1U06A 1M90R 1RABB 1QWFA 3QHSA 2YT6A 3HFNA 4ANJA 1RADB 4FCYA 2IPOB 2JUFA 2V8JA 1M1KR 4GBQA 3CCMT 1VQPA 4E7KA 2VGNA 4M77F 2K3YA 2DA9A 4C92G 3GF5A 4C8QG 1IRXA 1HK9A 4BUGA 4C8QA 1QVFP 4EMHA 3QG1A 1NLOC 1T3LA 2GNCA 3JCMg 1PSEA 1YJWA 2RI5A 2X4YA 3CCSA 4L59A 3J81E 2DTIA 5LJ3g 1NG2A 3HRTA 2FPDA 2AKLA 3CCUT 4OMPA 3OYEA 3P8BB 1QMCA 3OBYA 3ZBDA 1ZSZB 1R8OB 3PMIA 2DTOA 3EFRA 5CKHA 3OYAA 3MEAA 2QEXA 2DXUA 3QJYA 3G6EA 1PKTA 1I5LA 1RLQC 1VQNA 2YRVA 1VOMA 3RKYA 2DL5A 2FPEA 5KCHA 3SEMA 2GGRA 2KRNA 3RMSA 5L23A 3EG9A 2YDLA 2YLCA 5GANf 1M8VA 2D0QB 2GQVA 1IHVA 1G3SA 5FW9A 1PD1A 3RUXA 3UATA 1KQSA 4FSXA 2RH2A 1RLPC 2L3PA 3LH0A 1PSFA 2VVKA 3OYBA 1UJYA 2A3LA 4IIOA 1W2BS 2K3XA 2RJFA 1QCNA 1SEMA 4O6JA 2A36A 5GANd 4CC4B 3QZ9B 5CCAA 4GY5A 4J9IA 4DOVA 3GP8A 2QQBA 3CC4A 3PIOA 2JXBA 2JNGA 1D09B 1TOVA 1VQ5A 1UE9A 4M78F 3OYCA 3QWXX 2DK3A 3CPWA 1S72Q 2K5FA 3JV3A 5KYXB 4BY6C 2MYSA 1VQLT 4V2SA 4M7DE 3ME9A 5GMKe 3E2UA 2L3QA 2DL8A 5KCOA 2AT1B 2CP6A 2J6FA 1IGQA 2QQSA 4B6MA 2AZVA 3P8DA 2LJ3A 1I8FA 3M54A 4AFQC 1TUGB 1SSHA 1B7TA 2H3JA 2JW4A 2CH4A 4DOWA 6AT1B 1ZLMA 3C94A 2DILA 2DD4A 5KE3A 1OZ3A 1TS9A 2GFAA 4M77G 2GTOA 2O01E 4M77A 2PUKB 1RI0A 4XU1A 1WA7A 4XK8E 4PJLA 4D8KA 4XU0A 2JOYA 2FHDA 4CC7A 4RTZA 1VQ6T 3URGA 1WPYA 4KUIA 1YJWQ 1YNZA 5HY6A 2C0TA 1XJWB 2M51A 3OYGA 1KHIA 3J7AF 3RERA 4M75E 1ZUYA 3CCEA 1NJIR 2DIQA 1M3CA 4Z02A 4O5VA 3R6OA 3G6EQ 1KG1A 1Y57A 4A53A 3VUZA 3BFMA 2HKQB 3QO3A 2ZPHB 2X3XD 3QYHB 4RG8A 1VQNQ 4B9WA 1UGRB 2OTJA 2LT4A 4KULA 3I55A 1JJ2P 3L1AA 1UGVA 1TH7A 1QVFA 1K9MU 4PJNA 4LXCA 5LJ5g 2CZ0B 4EMKA 3DB4A 3PTAA 2HKNA 3JB9F 3C95A 2C0IA 4OMOA 1LNXA 2F5KA 4GLKA 4C0DB 3THKA 4NOYA 2DBMA 2DERA 1QCFA 2YLBA 3LW5E 1JXOA 1U1SA 4WCIA 4AG2C 5A0GA 2XI9A 2EJ9A 2I2LA 1X6OA 1Q82R 1H641 3UWNA 2A0FB 2F2XA 4XTVA 4IKFA 1AD5A 5DM7R 4IUUA 5KYYB 1Q81C 4Z8AA 2KE9A 4M7DF 5KYUB 1IB8A 4M78A 1R0BG 4C0FA 1VQ5Q 1BBZA 2VXEA 2P0QA 3A8HB 1OULA 5GAN2 3JCMf 1KD1U 4HVWA 2VB6A 4FL6A 1FX7A 5LJ3f 5CQXA 2RO0A 2LQNA 1BIBA 2RQRA 1MNDA 3CMAA 5KYWB 2MOXA 2FZKB 3HFOA 2MAMA 4ATOA 2HCKA 2BKDN 4J9HA 3O5ZA 2DBKA 2E5QA 5D7UA 1BK2A 3GOXA 2FYKA 1X69A 4J9DA 2R58A 3G1JA 3VV0A 1X2QA 1YJNA 1S72T 1NBEB 3VS3A 1UGSB 4M75F 1WIEA 2KMTA 4GLMA 3JCMh 3OSSC 4ZGJB 4OB1B 5LJ3h 1YP5A 3C4SA 1Y96B 1M90C 1VA7A 3OW2A 1BKBA 1Q86U 1RAIB 1WXBA 1M1KC 1FMVA 3RDVA 1V1CA 2BZYA 2FEIA 1D3BA 3DB3A 4PFOA 2DXCA 2YHTA 3CXCS 3BDLA 4PJOB 2MWPA 4M7AB 1X6BA 1YCSB 2K2MA 2VASA 1VQPT 2OTJQ 4J9BA 1K76A 4DBFA 1GBQA 1SG5A 2JT4A 2ATCB 2CZ7B 1YJWT 4PJOE 3CCST 2DX1A 3LYIA 4RCCA 2DAQA 4LDYA 4AMCA 4C5IA 2J6OA 3LX7A 3LWHA 3JB9G 2EJGA 1Q7YR 5J39A 2KI7A 2J6KA 2QEXT 1KQ1A 2HQEA 3G6ET 3KFVA 4PK4A 5GAOn 3OS5A 1VQNT 5CAIA 4C8QB 1TWBA 2AHJB 1QP3A 1K0XA 1H8KA 2LTOA 2CREA 4IUPA 5HK3A 1VYTA 3VRZA 1JJ2A 1QVGP 2BE9B 2COYA 4M7DA 4E6RA 1WJQA 2FZCB 1D0ZA 1PD0A 2D9TA 4MDXA 2E3IA 5D6WA 1VQ7Q 2EYYA 3M0TA 5FWBA 3C0CA 5KYXA 4LDXA 1YHQA 3LH5A 3QJ6A 3CMAQ 2PVOB 2E3HA 3HRSA 3SFMA 3M56A 1KSWA 3UF4A 5D6XA 4JRPA 3OYLA 2VGMA 3EG9B 2HDAA 3AHUA 4FT4A 1SPKA 2G6FX 4J8OA 5IHNA 5KH6A 4M7AD 1PM3A 3CC4T 2ZGWA 2V8IA 1ZUKA 2LMJA 2VWFA 4HXJA 1C1AA 3L2RA 1YJNQ 4HT8A 1X43A 2Y4YA 2O4XA 2JS2A 2EYZA 4M75G 2CDTA 4M75A 5M9OA 4OMLA 2K9GA 2E4HA 2E64A 3OYYA 1B34A 3SWNC 2RJDA 2CP3A 3PT9A 1MMDA 1VUBA 3RESA 2LZ6B 5CK9A 4JJDA 1YIJA 1PHTA 2L3RA 2YXYA 2GF7A 2RQTA 4FYXB 4HVUA 1SSFA 4ZTJA 1BIAA 1VQ8A 2KSSA 4PJOF 3M57A 2CS7A 4C8QD 4DBQA 2WSCE 1ZSGA 4M4ZA 4A63B 3QYGB 1NJIC 3EG1A 1BCOA 4RKUE 1AVZC 2DL3A 2ZCFB 5LJ5h 1PCXA 3FIFA 5CVIA 3WVEB 3CCET 1VQ9A 2QA4A 3Q1JA 5GAMj 2KBTA 2JMAA 4DA4A 1ZSZC 2Z0WA 1YWPA 3EGUA 5GAMe 4FYYB 3A8OB 2OTJT 1G3WA 2LCCA 3R6NA 3I55T 3QUIA 1UGQB 2DJQA 1S1NA 1JBMA 5GJVB 4HT9A 2E6NA 4QQGA 1Q82C 5KYUA 5IXFA 4KH1B 2ECZA 5HKCA 1VQ4Q 3EH2A 4F17A 4HCCA 2IG0A 2PU9B 1YHQQ 3LLRA 2HNIA 3G4SA 4K11A 1MV0B 2OI3A 2P84A 3CCRT 4QKUA 1PRMC 3JCMP 5CO7A 5CKDA 5GAN3 2LQ8A 4E7IA 2DZCA 1K9MR 2P0PA 2HL3A 4BD3A 1QVGA 4LUEA 4EIKA 3QSUA 2E5KA 1QP2A 1U1TA 4N4IA 2MIOA 3CMAT 3CMEA 4KRTA 1BI1A 1Y96A 2EQUA 1HD3A 2RJEA 3S3MA 3QKJA 1YIJQ 1T0JA 2O31A 2CUDA 2SRCA 2XHCA 2LP5A 4FYVB 2H8HA 5GAN5 4M78B 4PJOG 4M77D 4M7AG 4PJOA 1JB0E 3PE0A 4BE1A 1QWEA 1YJNT 3MHXA 2KGTA 3HPWA 1ABOA 1B3QA 2ZPBB 3X28B 2DTHA 2EYWA 2DM1A 2RF0A 1E6GA 1KD1R 2L8DA 2Y90A 4RTXA 1QKXA 4C0GA 4JJNK 3CQTA 2V8KA 3A8LB 1VQ9Q 2CZ1B 1VQOQ 4J83A 1WX6A 1MNEA 5IAYA 4OMFB 2F1LA 2LVMA 1GL5A 2KY9A 5CKFA 2K5IA 2DVEA 3S3NA 2QK0A 3JCMc 2K5LA 2EVRA 1YBYA 1Q7YC 4IUTA 4FU6A 4OMQA 4C5HA 2X4WA 4RTWA 4F16A 2FG0A 2RMOA 1D1AA 1CKBA 1PG5B 2RJCA 1D3BB 4J9GA 4OB3B 1X6GA 1K8AR 2B86A 2HD0A 3M5AA 2CYZB 3H0HA 3BDUA 4IUVA 2X51A 3G4SQ 5CQYA 5KE2A 4AFZC 2JMCA 1NEBA 3TCJA 2KVQG 3CCQQ 1G3YA 1LOJA 3QDRB 4M78D 5FU6C 2RHUA 1OU9A 5GAN4 1QW1A 5FU7C 3D7SB 4J6XA 3M4GA 3H0IA 5ECAA 4MDWA 2GBQA 3VS0A 3G71Q 1MV3A 3PFSA 3SDZA 3VJPA 3WXMB 4R55A 3QPHA 1YJ9Q 2CH4W 4E7ZA 4JJBA 1UUEA 3QXEB 2RNAA 1WXTA 3CMEQ 4QVCA 4XTWA 2C0OA 3ULRB 3WVDB 2M9UA 4M7DB 2BZXA 1G2BA 1RAFB 2PVDB 2CSQA 4OVAA 4CRIA 5GANh 1I1JA 2KYMA 3NFCA 1J3TA 3CD6A 1MMGA 5CKEA 4JS4A 3OW2P 4LN2A 3MEWA 1Y7XA 2XDBA 3M55A 2RHYA 2EAYA 2R5AA 2GTJA 2OJ2A 1JQQA 1JRIA 2M02A 1YIJT 4HCBA 1XNIA 4FW1A 4HCZA 2YUPA 2OTLA 2RM4A 1ARKA 3MP1A 4F14A 1GFCA 1KK7A 1WHMA 4JRKA 4C5GA 1NLPC 1KQSS 1VQ8T 4J7IA 2NUTA 3L2VA 2O4XB 4M75B 3CEYA 3H0FA 3VYGA 3NGPA 4X34A 3EG0A 1B34B 2DNUA 1WHKA 4MZTA 2EQMA 4JRIA 3JB9D 4X9DA 2DRMA 5AT1B 1DJ7B 1A0NB 5HK0A 5A2QE 4F7UE 3TREA 3CPWS 2QA4T 1YITA 4PKCC 1MMNA 1U3OA 4Y28E 4XU2A 1AZEA 3H6ZA 1GBRA 4AFUC 3OS1A 3OYDA 1FMWA 3ZL7C 4XAXB 4M7DD 5EC7A 1IREB 1IXDA 4C92C 3UT1A 4C8QC 2NWMA 3TEEA 4FW2A 4MMKA 4VUBA 3TVTA 3QWYA 2KEAA 2RHXA 4Z89A 2LT1A 2AZSA 5A0DA 2DMOA 4IUQA 1VQKQ 3LWIA 1LVKA 3QBYA 5IH2A 5GMKh 5GAOr 2EBPA 4DBHA 1O9SA 4EMGA 2HZYA 4OB0B 4B9XA 3G4ST 4JUVA 4N4GA 2CP5A 2XK0A 2QDYB 1AOJA 1Q81U 4IURA 4PJMA 1K73R 1MHNA 2D8JA 4CI0C 3JCMQ 4PFZA 4E47A 2VC8A 4M78G 3JSCA 4M75D 1VQ7A 1UFFA 3LGLA 2J7IA 1N8RR 3CD6Q 1WDXA 1M2OA 3CCVA 1D0XA 3INZA 1TG0A 3RIRA 1NPPA 2PNIA 3EAEA 2QTVA 1WFWA 4C5EA 3CMET 5DY9A 1QVFS 2NYSA 2X3WD 5I2MA 2DZ9A 2K6DA 4YTLA 2L5QA 4N4HA 2OTLQ 2JJ9A 3M0UA 3V8JA 2X35A 5GJWB 2L2PA 4F04B 4Q5WA 1WQ7A 1KC8R 3OYIA 1KIKA 1UECA 4QW2A 3I56A 4KUDK 1D1CA 4LD9K 4F7UF 3HTRA 3VUBA 2HSPA 1Q95G 3CBPA 3OYHA 1M90U 4BY6B 2RHIA 4JZ3A 4BB7A 1M1KU 5C6SA 1W1FA 1YITQ 1AEYA 2NLUA 2EKOA 4LDUA 2EYQA 2YRDA 5GAMg 1U5SA 4PNOA 3A8MB 1AWOA 1I0CA 4CC2A 2LDMA 1OV3A 4ORZA 3NHNA 1V76A 3JAME 4M77C 4NL3A 2ZPFB 2ENMA 1K8AC 3JCMb 3KBGA 4KH0B 2HQXA 3HKSA 2RQUA 1OPKA 1M1FA 1MGQA 1KHCA 2RB6A 2KQWA 3UDCA 4J9CA 2QGFB 1CKAA 2WSEE 2DD5A 2OX7A 3JB9H 3CC7A 4ME7A 2JN0A 3PVLA 1Y71A 2J05A 2ROLA 3VU3C 2DXTA 4FM4B 1M9SA 3L2ZA 2HSEB 4J7FA 1TTHB 2MPXC 4MZPA 5DLOA 4R56A 4AFSC 1B07A 2EIFA 3GNFB 2GCXA 1M3BA 1GRIA 1SKUB 4M7DG 3REBB 4E7HA 1UTIA 4KBMB 3SHWA 3TSWA 2BTTA 4A4KA 1VQ4A 1VYVA 4EMKC 3CCVQ 2MI6A 2CGHA 2GQIA 2X4JA 3L2UA 4DEXA 2JM9A 1G8XA 3JCMX 1NM7A 3EH1A 4BACA 4KGVB 4C92E 2FPFA 4PJOD 1I81A 3EG2A 2YRCA 1VQ5T 4LNPA 3S3OA 1WGSA 2F2WA 3I56Q 4OGCA 2BUDA 2V1RA 4LDWA 4F7UG 2XMFA 4F7UA 3EHRA 2DETA 3LGFA 2MWOA 4ZGEB 3DLLA 2M16A 3FLGA 4DQ2A 5DLQE 1JJ2S 3V8KA 4R0KA 5KYNA 2XU8A 2VKNA 3BE3A 2MF2A 1I5OB 2OTLT 1LJOA 3U23A 1FMKA 2DYIA 4XTUA 2K2VA 9ATCB 4ELZC 4NS5A 3EFOA 3FRNA 1NJIU 2LRQA 3M0QA 2ED1A 2AIRB 1O75A 1ABQA 3QIIA 2DEQA 3VRYA 3NPFA 2LX9A 2OAUA 1VQOA 2AKKA 2QQAA 1YITT 1W2BP 2VXFA 5GAOp 3CC7Q 5FRNA 2NUTB 1GCPA 1NPRA 3ASKA 5GAN7 3MJXA 5D6YA 3BW1A 2ZPEB 3QZ5B 4HA8A 1YFNA 1W6XA 4OMNA 1M2VA 2LCSA 3X26B 2NUPA 3NTHA 3EGXA 2DF6A 4J6WA 1Q82U 1JXMA 2MMPA 1M30A 1GCQC 5J3BA 4C92F 3F70A 1ZX6A 1YI2A 1E7OA 2XICA 1K73C 2LQWA 3CPFA 1SHGA 3FJ5A 4QT7A 2LC4A 3CCJA 3CCQA 1N8RC 4JS5A 3GBQA 4MMLA 3OA6A 5I22A 1BB9A 5GAMf 2J06A 3EGDA 1BI2A 2KT8A 4UC4A 5IXBA 1BI3A 3OYJA 1VQ7T 3G71A 3V7CA 1HXDA 2O88A 3JB9J 4XU3A 3HP9A 3MEUA 1YJ9A 4N0AC 2HBWA 4BI4A 4A4EA 3OB9A 3OBWA 2O9VA 4E7JA 1PNJA 3H41A 2YWWA 1Z9ZA 3OYFA 5GAMd 1KC8C 3RR6A 1TUDA 2D1XA 1ZBJA 5GAOq 2ED0A 4PL6A 3L2QA 4BE2A 2K79A 2KNBB 3V7SA 1WNLA 2JVVA 2EKHA 3I56T 3C12A 2QI2A 4II1A 1WI7A 4M75C 2DE0X 4PFPA 1WHGA 2PTKA 3FEOA 5FROA 2KROA 2QASA 5IHIA 1BCMA 3SWNB 2MK5A 4X1VA 1QVGS 3G7ZA 2P4RA 1OQKA 4PJJA 3FDRA 1VYUA 2XD0A 1BYMA 4L5GA 1SF9A 1VQ6Q 5I11A 1WHHA 2GFUA 3FB9A 4PLIA 1UG1A 2RA2A 4HCKA 1Q7YU 1EZZB 2G3RA 4QQDA 3M58A 5GANj 1N9RA 1R0CB 1HJDA 3O8VA 4AT1B 1TSFA 3HL8A 4BDYA 2CP0A 2RN8A 2JM8A 5IT9E 1Q86R 4BI8B 4E7LA 1PKSA 1EX4A 5GANe 1ZA2B 1WLPB 2COZA 2K4YA 2QXFA 4C92A 1K0SA 1WXUA 3CC7T 2VV5A 1YI2Q 2HMAA 3A98A 1W2BA 2R5MA 3JCMW 5EG2A 2H3EB 4C0DC 1LCKA 1NE8A 2YUQA 4XTZA 3CCJQ 2E65A 3EHQA 2MCNA 4BDZA 1RAAB 5GMKm 2IVWA 1FYNA 1HYOA 4ZN3A 4ZN1A 2E10A 2DRKA 1X01A 1OI1A 3PVQA 2HQHA 1E6HA 4FSSA 1YCYA 2E41A 1VQ4T 2YUNA 1VQKA 1QCOA 4ELYC 2E70A 1YHQT 4E2FB 4A4GA 2LQKA 1UDLA 1XOVA 3GNGA 2M0YA 2DPPB 4J6YA 1AWWA 4ESRA 4DEYA 2JTMA 3CXCP 5FRMA 1H3HA 4KGXB 2EQIA 2EGAA 4RTYA 2K3BA 4IIMA 1OYXA 4RTUA 4OGEA 2XDDA 2KXDA 1OEBA 1PRLC 1WJRA 3M59A 4Y91A 2QQRA 2B8AA 2E6ZA 2QTXA 3A1PA 2L3SA 4RCBA 4KT0E 1I07A 3V8LA 3CC2A 2RPNA 4J9EA 3MP6A 5GAN8 1KQ2A 2YUOA 2FRYA 5GMKj 4J9FA 4AG1C 4ZTFA 3RBBB 3ZFJA 3KUFA 3I35A 2EGCA 2CZ6B 1UB4A 5FLXE 3T9NA 4Y92A 4F7UB 4PJOC 4M7AC 2AK5A 2XIDA 1OPLA 2ABLA 4JLGA 5CIUA 1WJSA 1G3TA 3OYMA 4D6WA 2XG8D 4JRQA 2W10A 3HHTB 2FZGB 3VS6A 3KXTA 3SD4A 3OMGA 1VQ9T 2PQWA 1VQPQ 2D6FA 1VQOT 1X2KA 5GMKl 4TVRA 2SEMA 4J5YA 3CCSQ 1VIFA 3OS2A 3EFOB 2EGEA 3CBMA 1N27A 4KGZB 3ZEHA 2P0KA 5C0MA 2V26A 3UA7A 2FRWA 1QLYA 2DJZA 2W0ZA 1BU1A 2EJFA 2QEXQ 1JU5C 1SHFA 3IQLA 1C0MA 1MMAA 2L0AA 1RACB 2CSIA 1X27A 3MO8A 3PIPA 3E9FA 3E9GA 4Z88A 1N9SA 1QKWA 2CUBA 5LJ3j 3HSBA 1NYFA 2DFUA 3MCAB 3PNWC 4QVDA 4MZMA 3JCMe 5CR2A 2DO3A 1YI2T 4WF2A 2FL7A 2P4TA 2BZ8A 5LJ3e 4P5NA 3M0PA 1K9MC 1FXXA 2ROTA 4NL2A 3OMCA 2RI3A 1M2VB 3CCJT 2RHZA 1YN8A 2LNVA 3CCQT 2NUPB 1WZOA 3EGXB 3TU4K 1T0HA 4JLIA 4HKEA 1F1BB 4BI3A 4RTTA 2VUBA 2EPDA 2X4XA 1W70A 3OQ5A 3G71T 1GFDA 5I2SA 5FU6B 3A5ZB 4WTOB 1EFNA 2XKOC 1C6VX 2KXCA 3CCRA 1UHFA 1YJ9T 1OU8A 5FU7B 2DEUA 5GAN6 4OF1A 1Z9QA 2ZPIB 1M1GA 3OY9A 4L6V5 2O9SA 3CC4Q 3CC2Q 1IZ6A 1U8RA 4A54A 3SWNA 4FYWB 2QAZA 1QVPA 2DIGA 3CXCA 3JB9I 1KD1C 3V7RA 3EGDB 2JTFA 1UJ0A 2WSFE 2YSQA 4LDVA 2KK4A 2EWNA 2QG9B 3N5BB 1PWTA 2LJ1A 4FIBA 1RUWA 2M1HA 2JZ2A 1TXQA 1AWJA 5I21A 3JCMd 2DXBA 1X75C 3CBOA 2RI2A 3E19A 4JZ4A 1RL2A 4LD6A 5LJ3d 3OYNA 4CC3A 3M4YA 3SB2A 1OZ2A 3CCLA 2ZPGB 2D8HA 3PMTA 1M5Q1 8ATCB 2WACA 4RUGA 3VS1A 3VKIA 3JCMJ 1ZHIA 2K57A 3S6WA 2Y4XA 3NMZC 1KFZA 3ER0A 1QQJA 1VQMA 1Q86C 3JCMV 3CCEQ 1ZSZA 3H9NA 4A4HA 2O2OA 1K8AU 4QVZA 3META 1VIEA 1N5ZA 3TQ7P 1T3SA 2ESWA 2QQ9A 2EQJA 5GAOm 3CCMA 2VYTA 3EFSA 4OB2B 3I55Q 1M3AA 3J80E 4QQ6A 3I5SA 1WHLA 4EPCA 1LPLA 4M7AE 1M4ZA 5L8RE 3OYKA 1FWZA 3CCUA 1WHJA 1GCQA 1RI9A 1UEBA 3RMQA 3OW2S 1V29B 2DVJA 3L2WA 3DLMA 3MPUB 2LX7A 2E12A 2EW3A 2F5TX 1YWOA 3OSVA 4E7SA 2QGGA 5A0LA 3X20B
chains in the Genus database with same CATH topology
1TXQA 2CP0A 3E2UA 1WHLA 1LPLA 2CP6A 1WHKA 2COZA 1WHJA 3RDVA 4B6MA 1WHHA 2M02A 2CP2A 2COWA 2E3HA 2MPXC 1TOVA 2E4HA 2HQHA 2QK0A 2CP7A 2CP3A 2COYA 3TQ7P 2Z0WA 1WHMA 2HL3A 1IXDA 2HL5C 1WHGA 2E3IA 2HKNA 2CP5A 2HKQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TXQ A;  2CP0 A;  3E2U A;  1WHL A;  1LPL A;  2CP6 A;  1WHK A;  2COZ A;  1WHJ A;  3RDV A;  4B6M A;  1WHH A;  2M02 A;  2CP2 A;  2COW A;  2E3H A;  2MPX C;  1TOV A;  2E4H A;  2HQH A;  2QK0 A;  2CP7 A;  2CP3 A;  2COY A;  3TQ7 P;  2Z0W A;  1WHM A;  2HL3 A;  1IXD A;  2HL5 C;  1WHG A;  2E3I A;  2HKN A;  2CP5 A;  2HKQ B; 
#chains in the Genus database with same CATH topology
 4C92 B;  2FO0 A;  3P8H A;  1JO8 A;  1EIF A;  1VQK T;  1WYX A;  4XTX A;  1KJW A;  3CCR Q;  1H3Z A;  4OMM A;  5LJ5 j;  5J26 A;  2DL7 A;  4A4F A;  1IGU A;  1OX8 A;  5LJ5 e;  2XDP A;  4C8Q E;  4N0A A;  1BI0 A;  4BE0 A;  1K1Z A;  1Y07 A;  5CKB A;  3MP8 A;  2A37 A;  2EQK A;  2V1Q A;  4LUD A;  1W4S A;  1K4U S;  1M27 C;  2F69 A;  2COW A;  3CD6 T;  1ACM B;  1PC0 A;  2BE7 D;  5AYF A;  2JTE A;  2M0O A;  1D1B A;  1TUC A;  4M78 C;  1ZBX A;  2HEQ A;  2LCL A;  2PZ1 A;  2RQV A;  3CC2 T;  1G5V A;  4EDU A;  3M0S A;  3HRU A;  4ZNX A;  3M0R A;  3I5R A;  3CCL Q;  3VS4 A;  1VQL A;  2PUO B;  1ZQ1 A;  2KRM A;  1TU0 B;  4X9C A;  4HVV A;  3H8Z A;  1Y0M A;  5GAO l;  5FWC A;  1ZA1 B;  5LJ5 f;  1XTD A;  1RAH B;  3VYH B;  3JRZ A;  1NYG A;  1VQM Q;  1K9A A;  2RQW A;  2KAF A;  4FT2 A;  3EG3 A;  3UPU A;  3RKX A;  1ZUU A;  2RD1 A;  4XQ3 A;  4M7A F;  3VS7 A;  5GAN g;  2CKK A;  4C92 D;  3CCM Q;  2NUZ A;  5LJ5 d;  2DL4 A;  2ZZD A;  1I4K 1;  3BY7 A;  4C0Z A;  2PVG B;  1VQ6 A;  1R77 A;  5IHK A;  3I9Q A;  1CSK A;  3CCU Q;  2KDS A;  2A7Y A;  2BIV A;  3AT1 B;  3L42 A;  3VS2 A;  5LL6 S;  3NTK A;  3REA B;  2X9H A;  2L89 A;  1N6A A;  4RMO A;  2QYZ A;  4M77 B;  1OX9 A;  2HL5 C;  2RK1 A;  3GLX A;  4C8Q F;  1RAE B;  2CT3 A;  2D0N A;  2FVU A;  3TSZ A;  1K73 U;  2ZAE A;  3A8G B;  3DKM A;  1NEG A;  1AZG B;  4XTY A;  5KYY A;  4PLL A;  4M77 E;  2I0N A;  3VS5 A;  1M8M A;  1KQS P;  4DBR A;  1RAG B;  4RTV A;  1N8R U;  2CP7 A;  2F2V A;  1AT1 B;  3NTI A;  2KRS A;  1OOT A;  2HAX A;  3OS0 A;  2EFI A;  2EYX A;  2CT4 A;  1H92 A;  5IN1 A;  2HBP A;  5KYW A;  4M7D C;  3GIB A;  1SRL A;  3CCV T;  3MEV A;  4LE9 A;  1NZ9 A;  4OP0 A;  2CP2 A;  2DLP A;  7AT1 B;  3PGG A;  3CPW P;  2FB7 A;  2KT1 A;  1IHW A;  4EMK B;  2RK2 A;  1KC8 U;  2KR3 A;  3X24 B;  3RNJ A;  1VQL Q;  1XQH A;  1UGP B;  1Q81 R;  2IIM A;  1HSQ A;  3FC3 A;  4JJC A;  2K7A A;  4JDS A;  5GAM h;  3UA6 A;  4D8D A;  5HCK A;  2QDL A;  2DYB A;  1P92 A;  3GPL A;  3QDF A;  2LJ0 A;  3RKW A;  2C06 A;  2A08 A;  2A28 A;  1IO6 A;  3FJP A;  2R57 A;  1VQ8 Q;  3E1S A;  4RG2 A;  4M7A A;  3M9Q A;  1GXI E;  4JPB W;  2JS0 A;  1S72 A;  2DKG A;  2KYB A;  1UHC A;  3X25 B;  3CCL T;  1SRM A;  1JEG A;  1AHJ B;  5GMK i;  2LNH B;  4M78 E;  2E1H A;  2OAW A;  8AT1 B;  1D0Y A;  4ZGD B;  1VQM T;  1MUZ A;  3MKD A;  3M53 A;  2QA4 Q;  1G83 A;  1WQW A;  1AWX A;  1U06 A;  1M90 R;  1RAB B;  1QWF A;  3QHS A;  2YT6 A;  3HFN A;  4ANJ A;  1RAD B;  4FCY A;  2IPO B;  2JUF A;  2V8J A;  1M1K R;  4GBQ A;  3CCM T;  1VQP A;  4E7K A;  2VGN A;  4M77 F;  2K3Y A;  2DA9 A;  4C92 G;  3GF5 A;  4C8Q G;  1IRX A;  1HK9 A;  4BUG A;  4C8Q A;  1QVF P;  4EMH A;  3QG1 A;  1NLO C;  1T3L A;  2GNC A;  3JCM g;  1PSE A;  1YJW A;  2RI5 A;  2X4Y A;  3CCS A;  4L59 A;  3J81 E;  2DTI A;  5LJ3 g;  1NG2 A;  3HRT A;  2FPD A;  2AKL A;  3CCU T;  4OMP A;  3OYE A;  3P8B B;  1QMC A;  3OBY A;  3ZBD A;  1ZSZ B;  1R8O B;  3PMI A;  2DTO A;  3EFR A;  5CKH A;  3OYA A;  3MEA A;  2QEX A;  2DXU A;  3QJY A;  3G6E A;  1PKT A;  1I5L A;  1RLQ C;  1VQN A;  2YRV A;  1VOM A;  3RKY A;  2DL5 A;  2FPE A;  5KCH A;  3SEM A;  2GGR A;  2KRN A;  3RMS A;  5L23 A;  3EG9 A;  2YDL A;  2YLC A;  5GAN f;  1M8V A;  2D0Q B;  2GQV A;  1IHV A;  1G3S A;  5FW9 A;  1PD1 A;  3RUX A;  3UAT A;  1KQS A;  4FSX A;  2RH2 A;  1RLP C;  2L3P A;  3LH0 A;  1PSF A;  2VVK A;  3OYB A;  1UJY A;  2A3L A;  4IIO A;  1W2B S;  2K3X A;  2RJF A;  1QCN A;  1SEM A;  4O6J A;  2A36 A;  5GAN d;  4CC4 B;  3QZ9 B;  5CCA A;  4GY5 A;  4J9I A;  4DOV A;  3GP8 A;  2QQB A;  3CC4 A;  3PIO A;  2JXB A;  2JNG A;  1D09 B;  1TOV A;  1VQ5 A;  1UE9 A;  4M78 F;  3OYC A;  3QWX X;  2DK3 A;  3CPW A;  1S72 Q;  2K5F A;  3JV3 A;  5KYX B;  4BY6 C;  2MYS A;  1VQL T;  4V2S A;  4M7D E;  3ME9 A;  5GMK e;  3E2U A;  2L3Q A;  2DL8 A;  5KCO A;  2AT1 B;  2CP6 A;  2J6F A;  1IGQ A;  2QQS A;  4B6M A;  2AZV A;  3P8D A;  2LJ3 A;  1I8F A;  3M54 A;  4AFQ C;  1TUG B;  1SSH A;  1B7T A;  2H3J A;  2JW4 A;  2CH4 A;  4DOW A;  6AT1 B;  1ZLM A;  3C94 A;  2DIL A;  2DD4 A;  5KE3 A;  1OZ3 A;  1TS9 A;  2GFA A;  4M77 G;  2GTO A;  2O01 E;  4M77 A;  2PUK B;  1RI0 A;  4XU1 A;  1WA7 A;  4XK8 E;  4PJL A;  4D8K A;  4XU0 A;  2JOY A;  2FHD A;  4CC7 A;  4RTZ A;  1VQ6 T;  3URG A;  1WPY A;  4KUI A;  1YJW Q;  1YNZ A;  5HY6 A;  2C0T A;  1XJW B;  2M51 A;  3OYG A;  1KHI A;  3J7A F;  3RER A;  4M75 E;  1ZUY A;  3CCE A;  1NJI R;  2DIQ A;  1M3C A;  4Z02 A;  4O5V A;  3R6O A;  3G6E Q;  1KG1 A;  1Y57 A;  4A53 A;  3VUZ A;  3BFM A;  2HKQ B;  3QO3 A;  2ZPH B;  2X3X D;  3QYH B;  4RG8 A;  1VQN Q;  4B9W A;  1UGR B;  2OTJ A;  2LT4 A;  4KUL A;  3I55 A;  1JJ2 P;  3L1A A;  1UGV A;  1TH7 A;  1QVF A;  1K9M U;  4PJN A;  4LXC A;  5LJ5 g;  2CZ0 B;  4EMK A;  3DB4 A;  3PTA A;  2HKN A;  3JB9 F;  3C95 A;  2C0I A;  4OMO A;  1LNX A;  2F5K A;  4GLK A;  4C0D B;  3THK A;  4NOY A;  2DBM A;  2DER A;  1QCF A;  2YLB A;  3LW5 E;  1JXO A;  1U1S A;  4WCI A;  4AG2 C;  5A0G A;  2XI9 A;  2EJ9 A;  2I2L A;  1X6O A;  1Q82 R;  1H64 1;  3UWN A;  2A0F B;  2F2X A;  4XTV A;  4IKF A;  1AD5 A;  5DM7 R;  4IUU A;  5KYY B;  1Q81 C;  4Z8A A;  2KE9 A;  4M7D F;  5KYU B;  1IB8 A;  4M78 A;  1R0B G;  4C0F A;  1VQ5 Q;  1BBZ A;  2VXE A;  2P0Q A;  3A8H B;  1OUL A;  5GAN 2;  3JCM f;  1KD1 U;  4HVW A;  2VB6 A;  4FL6 A;  1FX7 A;  5LJ3 f;  5CQX A;  2RO0 A;  2LQN A;  1BIB A;  2RQR A;  1MND A;  3CMA A;  5KYW B;  2MOX A;  2FZK B;  3HFO A;  2MAM A;  4ATO A;  2HCK A;  2BKD N;  4J9H A;  3O5Z A;  2DBK A;  2E5Q A;  5D7U A;  1BK2 A;  3GOX A;  2FYK A;  1X69 A;  4J9D A;  2R58 A;  3G1J A;  3VV0 A;  1X2Q A;  1YJN A;  1S72 T;  1NBE B;  3VS3 A;  1UGS B;  4M75 F;  1WIE A;  2KMT A;  4GLM A;  3JCM h;  3OSS C;  4ZGJ B;  4OB1 B;  5LJ3 h;  1YP5 A;  3C4S A;  1Y96 B;  1M90 C;  1VA7 A;  3OW2 A;  1BKB A;  1Q86 U;  1RAI B;  1WXB A;  1M1K C;  1FMV A;  3RDV A;  1V1C A;  2BZY A;  2FEI A;  1D3B A;  3DB3 A;  4PFO A;  2DXC A;  2YHT A;  3CXC S;  3BDL A;  4PJO B;  2MWP A;  4M7A B;  1X6B A;  1YCS B;  2K2M A;  2VAS A;  1VQP T;  2OTJ Q;  4J9B A;  1K76 A;  4DBF A;  1GBQ A;  1SG5 A;  2JT4 A;  2ATC B;  2CZ7 B;  1YJW T;  4PJO E;  3CCS T;  2DX1 A;  3LYI A;  4RCC A;  2DAQ A;  4LDY A;  4AMC A;  4C5I A;  2J6O A;  3LX7 A;  3LWH A;  3JB9 G;  2EJG A;  1Q7Y R;  5J39 A;  2KI7 A;  2J6K A;  2QEX T;  1KQ1 A;  2HQE A;  3G6E T;  3KFV A;  4PK4 A;  5GAO n;  3OS5 A;  1VQN T;  5CAI A;  4C8Q B;  1TWB A;  2AHJ B;  1QP3 A;  1K0X A;  1H8K A;  2LTO A;  2CRE A;  4IUP A;  5HK3 A;  1VYT A;  3VRZ A;  1JJ2 A;  1QVG P;  2BE9 B;  2COY A;  4M7D A;  4E6R A;  1WJQ A;  2FZC B;  1D0Z A;  1PD0 A;  2D9T A;  4MDX A;  2E3I A;  5D6W A;  1VQ7 Q;  2EYY A;  3M0T A;  5FWB A;  3C0C A;  5KYX A;  4LDX A;  1YHQ A;  3LH5 A;  3QJ6 A;  3CMA Q;  2PVO B;  2E3H A;  3HRS A;  3SFM A;  3M56 A;  1KSW A;  3UF4 A;  5D6X A;  4JRP A;  3OYL A;  2VGM A;  3EG9 B;  2HDA A;  3AHU A;  4FT4 A;  1SPK A;  2G6F X;  4J8O A;  5IHN A;  5KH6 A;  4M7A D;  1PM3 A;  3CC4 T;  2ZGW A;  2V8I A;  1ZUK A;  2LMJ A;  2VWF A;  4HXJ A;  1C1A A;  3L2R A;  1YJN Q;  4HT8 A;  1X43 A;  2Y4Y A;  2O4X A;  2JS2 A;  2EYZ A;  4M75 G;  2CDT A;  4M75 A;  5M9O A;  4OML A;  2K9G A;  2E4H A;  2E64 A;  3OYY A;  1B34 A;  3SWN C;  2RJD A;  2CP3 A;  3PT9 A;  1MMD A;  1VUB A;  3RES A;  2LZ6 B;  5CK9 A;  4JJD A;  1YIJ A;  1PHT A;  2L3R A;  2YXY A;  2GF7 A;  2RQT A;  4FYX B;  4HVU A;  1SSF A;  4ZTJ A;  1BIA A;  1VQ8 A;  2KSS A;  4PJO F;  3M57 A;  2CS7 A;  4C8Q D;  4DBQ A;  2WSC E;  1ZSG A;  4M4Z A;  4A63 B;  3QYG B;  1NJI C;  3EG1 A;  1BCO A;  4RKU E;  1AVZ C;  2DL3 A;  2ZCF B;  5LJ5 h;  1PCX A;  3FIF A;  5CVI A;  3WVE B;  3CCE T;  1VQ9 A;  2QA4 A;  3Q1J A;  5GAM j;  2KBT A;  2JMA A;  4DA4 A;  1ZSZ C;  2Z0W A;  1YWP A;  3EGU A;  5GAM e;  4FYY B;  3A8O B;  2OTJ T;  1G3W A;  2LCC A;  3R6N A;  3I55 T;  3QUI A;  1UGQ B;  2DJQ A;  1S1N A;  1JBM A;  5GJV B;  4HT9 A;  2E6N A;  4QQG A;  1Q82 C;  5KYU A;  5IXF A;  4KH1 B;  2ECZ A;  5HKC A;  1VQ4 Q;  3EH2 A;  4F17 A;  4HCC A;  2IG0 A;  2PU9 B;  1YHQ Q;  3LLR A;  2HNI A;  3G4S A;  4K11 A;  1MV0 B;  2OI3 A;  2P84 A;  3CCR T;  4QKU A;  1PRM C;  3JCM P;  5CO7 A;  5CKD A;  5GAN 3;  2LQ8 A;  4E7I A;  2DZC A;  1K9M R;  2P0P A;  2HL3 A;  4BD3 A;  1QVG A;  4LUE A;  4EIK A;  3QSU A;  2E5K A;  1QP2 A;  1U1T A;  4N4I A;  2MIO A;  3CMA T;  3CME A;  4KRT A;  1BI1 A;  1Y96 A;  2EQU A;  1HD3 A;  2RJE A;  3S3M A;  3QKJ A;  1YIJ Q;  1T0J A;  2O31 A;  2CUD A;  2SRC A;  2XHC A;  2LP5 A;  4FYV B;  2H8H A;  5GAN 5;  4M78 B;  4PJO G;  4M77 D;  4M7A G;  4PJO A;  1JB0 E;  3PE0 A;  4BE1 A;  1QWE A;  1YJN T;  3MHX A;  2KGT A;  3HPW A;  1ABO A;  1B3Q A;  2ZPB B;  3X28 B;  2DTH A;  2EYW A;  2DM1 A;  2RF0 A;  1E6G A;  1KD1 R;  2L8D A;  2Y90 A;  4RTX A;  1QKX A;  4C0G A;  4JJN K;  3CQT A;  2V8K A;  3A8L B;  1VQ9 Q;  2CZ1 B;  1VQO Q;  4J83 A;  1WX6 A;  1MNE A;  5IAY A;  4OMF B;  2F1L A;  2LVM A;  1GL5 A;  2KY9 A;  5CKF A;  2K5I A;  2DVE A;  3S3N A;  2QK0 A;  3JCM c;  2K5L A;  2EVR A;  1YBY A;  1Q7Y C;  4IUT A;  4FU6 A;  4OMQ A;  4C5H A;  2X4W A;  4RTW A;  4F16 A;  2FG0 A;  2RMO A;  1D1A A;  1CKB A;  1PG5 B;  2RJC A;  1D3B B;  4J9G A;  4OB3 B;  1X6G A;  1K8A R;  2B86 A;  2HD0 A;  3M5A A;  2CYZ B;  3H0H A;  3BDU A;  4IUV A;  2X51 A;  3G4S Q;  5CQY A;  5KE2 A;  4AFZ C;  2JMC A;  1NEB A;  3TCJ A;  2KVQ G;  3CCQ Q;  1G3Y A;  1LOJ A;  3QDR B;  4M78 D;  5FU6 C;  2RHU A;  1OU9 A;  5GAN 4;  1QW1 A;  5FU7 C;  3D7S B;  4J6X A;  3M4G A;  3H0I A;  5ECA A;  4MDW A;  2GBQ A;  3VS0 A;  3G71 Q;  1MV3 A;  3PFS A;  3SDZ A;  3VJP A;  3WXM B;  4R55 A;  3QPH A;  1YJ9 Q;  2CH4 W;  4E7Z A;  4JJB A;  1UUE A;  3QXE B;  2RNA A;  1WXT A;  3CME Q;  4QVC A;  4XTW A;  2C0O A;  3ULR B;  3WVD B;  2M9U A;  4M7D B;  2BZX A;  1G2B A;  1RAF B;  2PVD B;  2CSQ A;  4OVA A;  4CRI A;  5GAN h;  1I1J A;  2KYM A;  3NFC A;  1J3T A;  3CD6 A;  1MMG A;  5CKE A;  4JS4 A;  3OW2 P;  4LN2 A;  3MEW A;  1Y7X A;  2XDB A;  3M55 A;  2RHY A;  2EAY A;  2R5A A;  2GTJ A;  2OJ2 A;  1JQQ A;  1JRI A;  2M02 A;  1YIJ T;  4HCB A;  1XNI A;  4FW1 A;  4HCZ A;  2YUP A;  2OTL A;  2RM4 A;  1ARK A;  3MP1 A;  4F14 A;  1GFC A;  1KK7 A;  1WHM A;  4JRK A;  4C5G A;  1NLP C;  1KQS S;  1VQ8 T;  4J7I A;  2NUT A;  3L2V A;  2O4X B;  4M75 B;  3CEY A;  3H0F A;  3VYG A;  3NGP A;  4X34 A;  3EG0 A;  1B34 B;  2DNU A;  1WHK A;  4MZT A;  2EQM A;  4JRI A;  3JB9 D;  4X9D A;  2DRM A;  5AT1 B;  1DJ7 B;  1A0N B;  5HK0 A;  5A2Q E;  4F7U E;  3TRE A;  3CPW S;  2QA4 T;  1YIT A;  4PKC C;  1MMN A;  1U3O A;  4Y28 E;  4XU2 A;  1AZE A;  3H6Z A;  1GBR A;  4AFU C;  3OS1 A;  3OYD A;  1FMW A;  3ZL7 C;  4XAX B;  4M7D D;  5EC7 A;  1IRE B;  1IXD A;  4C92 C;  3UT1 A;  4C8Q C;  2NWM A;  3TEE A;  4FW2 A;  4MMK A;  4VUB A;  3TVT A;  3QWY A;  2KEA A;  2RHX A;  4Z89 A;  2LT1 A;  2AZS A;  5A0D A;  2DMO A;  4IUQ A;  1VQK Q;  3LWI A;  1LVK A;  3QBY A;  5IH2 A;  5GMK h;  5GAO r;  2EBP A;  4DBH A;  1O9S A;  4EMG A;  2HZY A;  4OB0 B;  4B9X A;  3G4S T;  4JUV A;  4N4G A;  2CP5 A;  2XK0 A;  2QDY B;  1AOJ A;  1Q81 U;  4IUR A;  4PJM A;  1K73 R;  1MHN A;  2D8J A;  4CI0 C;  3JCM Q;  4PFZ A;  4E47 A;  2VC8 A;  4M78 G;  3JSC A;  4M75 D;  1VQ7 A;  1UFF A;  3LGL A;  2J7I A;  1N8R R;  3CD6 Q;  1WDX A;  1M2O A;  3CCV A;  1D0X A;  3INZ A;  1TG0 A;  3RIR A;  1NPP A;  2PNI A;  3EAE A;  2QTV A;  1WFW A;  4C5E A;  3CME T;  5DY9 A;  1QVF S;  2NYS A;  2X3W D;  5I2M A;  2DZ9 A;  2K6D A;  4YTL A;  2L5Q A;  4N4H A;  2OTL Q;  2JJ9 A;  3M0U A;  3V8J A;  2X35 A;  5GJW B;  2L2P A;  4F04 B;  4Q5W A;  1WQ7 A;  1KC8 R;  3OYI A;  1KIK A;  1UEC A;  4QW2 A;  3I56 A;  4KUD K;  1D1C A;  4LD9 K;  4F7U F;  3HTR A;  3VUB A;  2HSP A;  1Q95 G;  3CBP A;  3OYH A;  1M90 U;  4BY6 B;  2RHI A;  4JZ3 A;  4BB7 A;  1M1K U;  5C6S A;  1W1F A;  1YIT Q;  1AEY A;  2NLU A;  2EKO A;  4LDU A;  2EYQ A;  2YRD A;  5GAM g;  1U5S A;  4PNO A;  3A8M B;  1AWO A;  1I0C A;  4CC2 A;  2LDM A;  1OV3 A;  4ORZ A;  3NHN A;  1V76 A;  3JAM E;  4M77 C;  4NL3 A;  2ZPF B;  2ENM A;  1K8A C;  3JCM b;  3KBG A;  4KH0 B;  2HQX A;  3HKS A;  2RQU A;  1OPK A;  1M1F A;  1MGQ A;  1KHC A;  2RB6 A;  2KQW A;  3UDC A;  4J9C A;  2QGF B;  1CKA A;  2WSE E;  2DD5 A;  2OX7 A;  3JB9 H;  3CC7 A;  4ME7 A;  2JN0 A;  3PVL A;  1Y71 A;  2J05 A;  2ROL A;  3VU3 C;  2DXT A;  4FM4 B;  1M9S A;  3L2Z A;  2HSE B;  4J7F A;  1TTH B;  2MPX C;  4MZP A;  5DLO A;  4R56 A;  4AFS C;  1B07 A;  2EIF A;  3GNF B;  2GCX A;  1M3B A;  1GRI A;  1SKU B;  4M7D G;  3REB B;  4E7H A;  1UTI A;  4KBM B;  3SHW A;  3TSW A;  2BTT A;  4A4K A;  1VQ4 A;  1VYV A;  4EMK C;  3CCV Q;  2MI6 A;  2CGH A;  2GQI A;  2X4J A;  3L2U A;  4DEX A;  2JM9 A;  1G8X A;  3JCM X;  1NM7 A;  3EH1 A;  4BAC A;  4KGV B;  4C92 E;  2FPF A;  4PJO D;  1I81 A;  3EG2 A;  2YRC A;  1VQ5 T;  4LNP A;  3S3O A;  1WGS A;  2F2W A;  3I56 Q;  4OGC A;  2BUD A;  2V1R A;  4LDW A;  4F7U G;  2XMF A;  4F7U A;  3EHR A;  2DET A;  3LGF A;  2MWO A;  4ZGE B;  3DLL A;  2M16 A;  3FLG A;  4DQ2 A;  5DLQ E;  1JJ2 S;  3V8K A;  4R0K A;  5KYN A;  2XU8 A;  2VKN A;  3BE3 A;  2MF2 A;  1I5O B;  2OTL T;  1LJO A;  3U23 A;  1FMK A;  2DYI A;  4XTU A;  2K2V A;  9ATC B;  4ELZ C;  4NS5 A;  3EFO A;  3FRN A;  1NJI U;  2LRQ A;  3M0Q A;  2ED1 A;  2AIR B;  1O75 A;  1ABQ A;  3QII A;  2DEQ A;  3VRY A;  3NPF A;  2LX9 A;  2OAU A;  1VQO A;  2AKK A;  2QQA A;  1YIT T;  1W2B P;  2VXF A;  5GAO p;  3CC7 Q;  5FRN A;  2NUT B;  1GCP A;  1NPR A;  3ASK A;  5GAN 7;  3MJX A;  5D6Y A;  3BW1 A;  2ZPE B;  3QZ5 B;  4HA8 A;  1YFN A;  1W6X A;  4OMN A;  1M2V A;  2LCS A;  3X26 B;  2NUP A;  3NTH A;  3EGX A;  2DF6 A;  4J6W A;  1Q82 U;  1JXM A;  2MMP A;  1M30 A;  1GCQ C;  5J3B A;  4C92 F;  3F70 A;  1ZX6 A;  1YI2 A;  1E7O A;  2XIC A;  1K73 C;  2LQW A;  3CPF A;  1SHG A;  3FJ5 A;  4QT7 A;  2LC4 A;  3CCJ A;  3CCQ A;  1N8R C;  4JS5 A;  3GBQ A;  4MML A;  3OA6 A;  5I22 A;  1BB9 A;  5GAM f;  2J06 A;  3EGD A;  1BI2 A;  2KT8 A;  4UC4 A;  5IXB A;  1BI3 A;  3OYJ A;  1VQ7 T;  3G71 A;  3V7C A;  1HXD A;  2O88 A;  3JB9 J;  4XU3 A;  3HP9 A;  3MEU A;  1YJ9 A;  4N0A C;  2HBW A;  4BI4 A;  4A4E A;  3OB9 A;  3OBW A;  2O9V A;  4E7J A;  1PNJ A;  3H41 A;  2YWW A;  1Z9Z A;  3OYF A;  5GAM d;  1KC8 C;  3RR6 A;  1TUD A;  2D1X A;  1ZBJ A;  5GAO q;  2ED0 A;  4PL6 A;  3L2Q A;  4BE2 A;  2K79 A;  2KNB B;  3V7S A;  1WNL A;  2JVV A;  2EKH A;  3I56 T;  3C12 A;  2QI2 A;  4II1 A;  1WI7 A;  4M75 C;  2DE0 X;  4PFP A;  1WHG A;  2PTK A;  3FEO A;  5FRO A;  2KRO A;  2QAS A;  5IHI A;  1BCM A;  3SWN B;  2MK5 A;  4X1V A;  1QVG S;  3G7Z A;  2P4R A;  1OQK A;  4PJJ A;  3FDR A;  1VYU A;  2XD0 A;  1BYM A;  4L5G A;  1SF9 A;  1VQ6 Q;  5I11 A;  1WHH A;  2GFU A;  3FB9 A;  4PLI A;  1UG1 A;  2RA2 A;  4HCK A;  1Q7Y U;  1EZZ B;  2G3R A;  4QQD A;  3M58 A;  5GAN j;  1N9R A;  1R0C B;  1HJD A;  3O8V A;  4AT1 B;  1TSF A;  3HL8 A;  4BDY A;  2CP0 A;  2RN8 A;  2JM8 A;  5IT9 E;  1Q86 R;  4BI8 B;  4E7L A;  1PKS A;  1EX4 A;  5GAN e;  1ZA2 B;  1WLP B;  2COZ A;  2K4Y A;  2QXF A;  4C92 A;  1K0S A;  1WXU A;  3CC7 T;  2VV5 A;  1YI2 Q;  2HMA A;  3A98 A;  1W2B A;  2R5M A;  3JCM W;  5EG2 A;  2H3E B;  4C0D C;  1LCK A;  1NE8 A;  2YUQ A;  4XTZ A;  3CCJ Q;  2E65 A;  3EHQ A;  2MCN A;  4BDZ A;  1RAA B;  5GMK m;  2IVW A;  1FYN A;  1HYO A;  4ZN3 A;  4ZN1 A;  2E10 A;  2DRK A;  1X01 A;  1OI1 A;  3PVQ A;  2HQH A;  1E6H A;  4FSS A;  1YCY A;  2E41 A;  1VQ4 T;  2YUN A;  1VQK A;  1QCO A;  4ELY C;  2E70 A;  1YHQ T;  4E2F B;  4A4G A;  2LQK A;  1UDL A;  1XOV A;  3GNG A;  2M0Y A;  2DPP B;  4J6Y A;  1AWW A;  4ESR A;  4DEY A;  2JTM A;  3CXC P;  5FRM A;  1H3H A;  4KGX B;  2EQI A;  2EGA A;  4RTY A;  2K3B A;  4IIM A;  1OYX A;  4RTU A;  4OGE A;  2XDD A;  2KXD A;  1OEB A;  1PRL C;  1WJR A;  3M59 A;  4Y91 A;  2QQR A;  2B8A A;  2E6Z A;  2QTX A;  3A1P A;  2L3S A;  4RCB A;  4KT0 E;  1I07 A;  3V8L A;  3CC2 A;  2RPN A;  4J9E A;  3MP6 A;  5GAN 8;  1KQ2 A;  2YUO A;  2FRY A;  5GMK j;  4J9F A;  4AG1 C;  4ZTF A;  3RBB B;  3ZFJ A;  3KUF A;  3I35 A;  2EGC A;  2CZ6 B;  1UB4 A;  5FLX E;  3T9N A;  4Y92 A;  4F7U B;  4PJO C;  4M7A C;  2AK5 A;  2XID A;  1OPL A;  2ABL A;  4JLG A;  5CIU A;  1WJS A;  1G3T A;  3OYM A;  4D6W A;  2XG8 D;  4JRQ A;  2W10 A;  3HHT B;  2FZG B;  3VS6 A;  3KXT A;  3SD4 A;  3OMG A;  1VQ9 T;  2PQW A;  1VQP Q;  2D6F A;  1VQO T;  1X2K A;  5GMK l;  4TVR A;  2SEM A;  4J5Y A;  3CCS Q;  1VIF A;  3OS2 A;  3EFO B;  2EGE A;  3CBM A;  1N27 A;  4KGZ B;  3ZEH A;  2P0K A;  5C0M A;  2V26 A;  3UA7 A;  2FRW A;  1QLY A;  2DJZ A;  2W0Z A;  1BU1 A;  2EJF A;  2QEX Q;  1JU5 C;  1SHF A;  3IQL A;  1C0M A;  1MMA A;  2L0A A;  1RAC B;  2CSI A;  1X27 A;  3MO8 A;  3PIP A;  3E9F A;  3E9G A;  4Z88 A;  1N9S A;  1QKW A;  2CUB A;  5LJ3 j;  3HSB A;  1NYF A;  2DFU A;  3MCA B;  3PNW C;  4QVD A;  4MZM A;  3JCM e;  5CR2 A;  2DO3 A;  1YI2 T;  4WF2 A;  2FL7 A;  2P4T A;  2BZ8 A;  5LJ3 e;  4P5N A;  3M0P A;  1K9M C;  1FXX A;  2ROT A;  4NL2 A;  3OMC A;  2RI3 A;  1M2V B;  3CCJ T;  2RHZ A;  1YN8 A;  2LNV A;  3CCQ T;  2NUP B;  1WZO A;  3EGX B;  3TU4 K;  1T0H A;  4JLI A;  4HKE A;  1F1B B;  4BI3 A;  4RTT A;  2VUB A;  2EPD A;  2X4X A;  1W70 A;  3OQ5 A;  3G71 T;  1GFD A;  5I2S A;  5FU6 B;  3A5Z B;  4WTO B;  1EFN A;  2XKO C;  1C6V X;  2KXC A;  3CCR A;  1UHF A;  1YJ9 T;  1OU8 A;  5FU7 B;  2DEU A;  5GAN 6;  4OF1 A;  1Z9Q A;  2ZPI B;  1M1G A;  3OY9 A;  4L6V 5;  2O9S A;  3CC4 Q;  3CC2 Q;  1IZ6 A;  1U8R A;  4A54 A;  3SWN A;  4FYW B;  2QAZ A;  1QVP A;  2DIG A;  3CXC A;  3JB9 I;  1KD1 C;  3V7R A;  3EGD B;  2JTF A;  1UJ0 A;  2WSF E;  2YSQ A;  4LDV A;  2KK4 A;  2EWN A;  2QG9 B;  3N5B B;  1PWT A;  2LJ1 A;  4FIB A;  1RUW A;  2M1H A;  2JZ2 A;  1TXQ A;  1AWJ A;  5I21 A;  3JCM d;  2DXB A;  1X75 C;  3CBO A;  2RI2 A;  3E19 A;  4JZ4 A;  1RL2 A;  4LD6 A;  5LJ3 d;  3OYN A;  4CC3 A;  3M4Y A;  3SB2 A;  1OZ2 A;  3CCL A;  2ZPG B;  2D8H A;  3PMT A;  1M5Q 1;  8ATC B;  2WAC A;  4RUG A;  3VS1 A;  3VKI A;  3JCM J;  1ZHI A;  2K57 A;  3S6W A;  2Y4X A;  3NMZ C;  1KFZ A;  3ER0 A;  1QQJ A;  1VQM A;  1Q86 C;  3JCM V;  3CCE Q;  1ZSZ A;  3H9N A;  4A4H A;  2O2O A;  1K8A U;  4QVZ A;  3MET A;  1VIE A;  1N5Z A;  3TQ7 P;  1T3S A;  2ESW A;  2QQ9 A;  2EQJ A;  5GAO m;  3CCM A;  2VYT A;  3EFS A;  4OB2 B;  3I55 Q;  1M3A A;  3J80 E;  4QQ6 A;  3I5S A;  1WHL A;  4EPC A;  1LPL A;  4M7A E;  1M4Z A;  5L8R E;  3OYK A;  1FWZ A;  3CCU A;  1WHJ A;  1GCQ A;  1RI9 A;  1UEB A;  3RMQ A;  3OW2 S;  1V29 B;  2DVJ A;  3L2W A;  3DLM A;  3MPU B;  2LX7 A;  2E12 A;  2EW3 A;  2F5T X;  1YWO A;  3OSV A;  4E7S A;  2QGG A;  5A0L A;  3X20 B; 
#chains in the Genus database with same CATH homology
 1TXQ A;  2CP0 A;  3E2U A;  1WHL A;  1LPL A;  2CP6 A;  1WHK A;  2COZ A;  1WHJ A;  3RDV A;  4B6M A;  1WHH A;  2M02 A;  2CP2 A;  2COW A;  2E3H A;  2MPX C;  1TOV A;  2E4H A;  2HQH A;  2QK0 A;  2CP7 A;  2CP3 A;  2COY A;  3TQ7 P;  2Z0W A;  1WHM A;  2HL3 A;  1IXD A;  2HL5 C;  1WHG A;  2E3I A;  2HKN A;  2CP5 A;  2HKQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...