2HL5C

Crystal structure of the c-terminal domain of human eb1 in complex with the a49m mutant cap-gly domain of human dynactin-1 (p150-glued)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
76
structure length
76
Chain Sequence
PLRVGSRVEVIGKGHRGTVAYVGMTLFATGKWVGVILDEAKGKNDGTVQGRKYFTCDEGHGIFVRQSQIQVFEDGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microtubule-associated protein RP/EB family member 1
publication title Key interaction modes of dynamic +TIP networks.
pubmed doi rcsb
source organism Homo sapiens
total genus 15
structure length 76
sequence length 76
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2hl5C00
1WHHA 2HL5C 3E2UA 1LPLA 2CP3A 3TQ7P 2E3IA 1TXQA 2COWA 2CP0A 2HQHA 2QK0A 1WHMA 2E4HA 2CP7A 1IXDA 4B6MA 2CP5A 3RDVA 2E3HA 1WHKA 2COZA 1WHGA 2HKQB 2COYA 2HKNA 2HL3A 2CP6A 2MPXC 1TOVA 2M02A 1WHLA 1WHJA 2Z0WA 2CP2A
chains in the Genus database with same CATH superfamily
4XAXB 4MMLA 1KIKA 1FMVA 2EKHA 3M0TA 8AT1B 4JS5A 3EFSA 3SB2A 1BI3A 3RDVA 2BZYA 2EGAA 3VU3C 3UA7A 1VQ4A 3A5ZB 3QZ9B 5GAN6 1NEBA 2LCCA 5GAMh 4F7UA 1YWOA 3OYKA 1YITQ 1ZHIA 5CAIA 1M1KU 1WHHA 4AFZC 2EYWA 4E7SA 3WXMB 1WA7A 3PE0A 2KYMA 5IT9E 2BUDA 5LJ3e 1D3BB 2CZ7B 2IVWA 2C0TA 5CO7A 2C0IA 4OMLA 3G6ET 3ZBDA 1PKTA 3CCJT 3G4SQ 2RQTA 2YRCA 2QTXA 2O01E 3JB9J 4C92C 3NMZC 3QG1A 3QPHA 5HK0A 2KXCA 1ZUUA 1T0HA 2K2VA 3QO3A 5KYNA 1VQPA 1SPKA 4IURA 3CCLQ 4OF1A 4B6MA 1AVZC 1BBZA 3FC3A 4FM4B 1SRLA 1E6HA 1WI7A 1QW1A 2RK2A 4HVVA 4LUEA 1Q86R 1SHFA 3PGGA 1XTDA 2FRWA 2KRMA 2GFAA 1AWOA 3I55T 5I11A 1BI1A 1X6GA 2ED1A 1YJWQ 1UGSB 1UGVA 1NE8A 2F5KA 2EJ9A 4QW2A 2RJFA 2OTJT 4IUVA 3KUFA 5GAN5 2ZPGB 5LJ3g 2LJ3A 3LGLA 3F70A 3L1AA 3SFMA 2K9GA 4BE1A 4DA4A 2PVDB 4A63B 2CYZB 2RO0A 3GIBA 1JBMA 4EMHA 5KE3A 3CCQT 1A0NB 2L5QA 2HKQB 4BE0A 4GY5A 2GQVA 1K0SA 4C92F 3DLMA 1U3OA 2HCKA 4FCYA 2A3LA 2FPDA 1CKAA 3H9NA 2RI3A 1JO8A 1VQ8Q 3CCUT 5FRMA 3CCVQ 5IH2A 4OP0A 2KNBB 1UHCA 5HCKA 2VC8A 5KYYB 2DERA 2CP6A 3TREA 2MF2A 2X3XD 4M77G 4C0DC 3CBPA 1NYGA 1WQ7A 3EGXA 2DL7A 3EHRA 4NOYA 2PTKA 3GBQA 3ZL7C 2LTOA 1WFWA 3G1JA 2LZ6B 3M54A 2V1QA 1G2BA 1KQSP 1X27A 2OAUA 3EFOB 3SHWA 3LH5A 5GAMe 2DF6A 3FB9A 1GRIA 4YTLA 3G6EA 4C92G 5LJ5j 1CKBA 3CCJA 2DLPA 4XTZA 1SKUB 3M4YA 3X25B 4C5HA 3HP9A 4OMMA 1IZ6A 1M1GA 3OYCA 2EQJA 2W0ZA 3ASKA 4M75B 4V2SA 4EPCA 3LGFA 2K3BA 2O9VA 1ZX6A 1WHKA 5A2QE 1YITT 1TUDA 4J9GA 3PFSA 5GAOr 1VYUA 1KSWA 2LRQA 2GNCA 3EG0A 2BIVA 2NUZA 4RTZA 3I55A 2SRCA 2B8AA 2XDDA 3QZ5B 1M1KC 2CDTA 1N9RA 3CXCS 2HZYA 2GF7A 1SG5A 2EYZA 4WTOB 4J9IA 3OSVA 2OTJA 2ECZA 2DD4A 2KSSA 2D8HA 2DTHA 2RD1A 3SWNC 4XK8E 4JRIA 4E7LA 3EAEA 5GAMg 4MZMA 3DB4A 3E9FA 1KK7A 2DL8A 2JXBA 4M77A 2OAWA 3CMAQ 3PVQA 4ESRA 1RUWA 2HDAA 1LOJA 4MZPA 2E6NA 1QVFP 3CCQA 2K4YA 2HAXA 2DXCA 4RTUA 3H8ZA 1QVPA 2H8HA 2VGMA 5IAYA 4AFQC 4L6V5 2BZXA 4J6YA 4Y92A 1IGUA 3CPWA 1M8MA 3GNFB 4M75D 1VQ4Q 3E2UA 3I56T 1WDXA 3CCUA 4KGZB 1SHGA 2DBMA 3QXEB 3RBBB 4A4EA 1K9AA 1B34A 3NGPA 4HT8A 2KI7A 1VUBA 3OB9A 7AT1B 4PJOG 3PTAA 2RQVA 2R58A 2KBTA 4E47A 1T0JA 1M2OA 1NBEB 4XU3A 3OBWA 2VUBA 4FL6A 3CC7Q 1K76A 3JCMW 4OB3B 4M78E 1QLYA 4M78C 2J7IA 2DXUA 4BI8B 2WSFE 2YUPA 5GJWB 2RA2A 1D3BA 1HSQA 1VYTA 2DL3A 2HEQA 5KCHA 2CP5A 5GMKm 2VGNA 3H41A 1IHVA 4IUPA 3MCAB 1VQPQ 2BE7D 1QVGA 3S6WA 1RAEB 2FG0A 1VQ8T 3CCVT 1OX8A 2YUQA 2Z0WA 2LJ0A 2GBQA 4N0AC 4OMFB 1K8AR 1LPLA 1KFZA 4JPBW 2RI2A 1H3ZA 5LJ3j 1BCOA 4PJLA 2F1LA 1VQ6T 1YITA 2MAMA 1XNIA 1IB8A 2CKKA 2RH2A 1MMAA 1GFDA 2MPXC 1WLPB 4M7AC 4LE9A 1PC0A 1N8RR 2CH4A 2ZPHB 2EQIA 5GAOm 1YN8A 3QIIA 2MOXA 4L59A 5GANd 2R57A 3ME9A 2PVOB 4AT1B 4XU1A 3DLLA 1K8AU 4C5EA 3BFMA 5IXFA 4PJOA 4HA8A 4M78F 4D8DA 1JXMA 4FYXB 3ER0A 2RHIA 3M9QA 3HSBA 1N5ZA 1VIFA 1FXXA 4DBHA 2X51A 1WNLA 1BCMA 3REAB 3C95A 1BU1A 5KYUB 1N8RU 3H0HA 1W2BA 3J81E 2X4YA 2RJEA 4O6JA 1VQ5Q 2CP2A 2E6ZA 1JJ2A 3NTIA 4A53A 8ATCB 2AZSA 1Q95G 2XG8D 2D9TA 3I56A 2LDMA 2ATCB 2FPFA 4A4KA 3NPFA 4X34A 4N4GA 2ZAEA 2L0AA 1U8RA 2JVVA 3QJ6A 2AIRB 4M7AF 2O4XA 1KQSS 1N27A 1PM3A 1TSFA 4RCBA 2DRMA 2RPNA 4C0GA 3TCJA 3JCMP 1JQQA 3EG2A 4JJCA 4PJJA 2EGCA 1K9MR 3HFNA 4XU0A 2W10A 3TSZA 3JB9D 2RHXA 1D0ZA 3JCMf 3M0UA 4AFUC 2NLUA 2DYBA 3VYGA 1AZGB 3RKYA 2HKNA 4IUTA 2K3XA 1VQ4T 4F7UF 1VQ8A 3O8VA 3CCVA 2XHCA 2HQXA 3QHSA 2WACA 3VRYA 2VXFA 2K2MA 1NJIR 3D7SB 3VS7A 2QQAA 4QVZA 3UT1A 4BUGA 2DEUA 6AT1B 3JV3A 1VQ6A 3I55Q 4M7AG 1K9MU 4C8QD 3CC7T 2ED0A 1M90R 2K5IA 2K79A 1WGSA 3QYGB 1X6BA 4LDXA 2GTJA 1RAGB 4PJMA 2OTJQ 1WXBA 1JRIA 2FZKB 2AZVA 2NUPB 1WIEA 1VQKQ 2X4XA 2CZ6B 2K6DA 4Y91A 4C5GA 3OQ5A 4DOVA 2DPPB 2AKLA 5GAN2 2MI6A 5GJVB 1Y96B 4A54A 1I1JA 5LJ5f 1QVFS 1TOVA 4F7UG 4A4FA 1VQ7Q 2EKOA 1Y7XA 3QJYA 2HBPA 2NYSA 3M53A 3CCQQ 1QVGP 1Q81U 5A0DA 4WF2A 1QKXA 1M90U 1RAHB 1WJRA 2DYIA 1PWTA 4QQGA 5I2SA 1BK2A 2RHUA 1M4ZA 4C0FA 1I81A 3CCUQ 2DJQA 1K1ZA 3S3MA 1M30A 2DFUA 2M0YA 2XD0A 2ZCFB 3VJPA 5KYWB 1ZLMA 2LP5A 4HT9A 5GMKl 2XI9A 3META 1VQ9T 3EHQA 2PUOB 3CCRQ 1WXUA 3URGA 2QGGA 3CBOA 2QQSA 1LJOA 1MNEA 2V1RA 2IG0A 2KQWA 4KBMB 2CUDA 1K8AC 3BDLA 3EG9B 4D8KA 2K5LA 2EAYA 1YJNQ 2CT4A 3MP1A 3HHTB 1G3TA 2XDBA 2ZPBB 1QP2A 3NTHA 4LD6A 2F2XA 3OYJA 4EMGA 1RAAB 1OYXA 1PSEA 2F2WA 2AK5A 3VS0A 1VQ5T 4C8QG 1N8RC 1N6AA 1PCXA 5CKEA 2DILA 4J6WA 1SSHA 4FSXA 2F69A 1VA7A 2HQEA 1ZSZA 3A8LB 1U1TA 4M77E 2X4JA 4DBRA 2DX1A 3CC4Q 4M77C 1LCKA 4JLGA 5IN1A 1GCPA 3E1SA 1IRXA 5DLQE 1M2VA 1KD1R 2DO3A 2XU8A 3INZA 2QYZA 1H92A 4C0ZA 3CC7A 1X01A 5GAN8 3EGDB 5FLXE 2DETA 3JCMV 4C92E 3FIFA 2A7YA 3OW2A 2D6FA 4HCKA 1HXDA 3X28B 2LMJA 5CKDA 4J9HA 5FU6C 2LT1A 2QEXT 2QQ9A 2GFUA 3PMTA 2KMTA 1RLPC 1MNDA 1WZOA 2V26A 2RQUA 1J3TA 4KT0E 4ZGJB 1KD1U 3CQTA 3LX7A 4DEYA 3I5SA 1UJYA 2GQIA 2X3WD 5KE2A 5LJ3f 4QQDA 1E6GA 5KYUA 2QK0A 5D7UA 3FJ5A 3PT9A 4M7DB 4Q5WA 1Q7YR 1QKWA 4II1A 4J9EA 3I56Q 1PSFA 4ELZC 3KFVA 2COYA 2K57A 4C8QA 1K9MC 4FT4A 1VQKT 4M77F 5J3BA 1WPYA 1O75A 1SF9A 3RNJA 2QQBA 3GP8A 1VQ9A 1I5OB 4C5IA 3P8BB 2VYTA 1X75C 3N5BB 3VV0A 1YI2Q 1Y0MA 1I0CA 4X9DA 3MEWA 1Q86U 4LDWA 2LJ1A 1WYXA 1VQ7T 1HJDA 4X1VA 1OX9A 3C12A 2DTOA 2KROA 1Q7YU 1QWEA 3CPFA 2CP3A 1YNZA 3H0IA 1Q81C 4QVDA 2E3IA 2COWA 1FMKA 3MEVA 4EMKA 4PNOA 1M90C 1B3QA 2J6FA 3MP6A 3RKXA 4J9BA 1VQ5A 4ZTJA 5D6XA 4OMQA 2K7AA 1YHQT 2DM1A 4RMOA 1T3SA 3FJPA 3CCRT 3OS5A 3GNGA 1NPPA 1VQ6Q 3KXTA 4BDZA 4PJOE 4PJOC 4M7DD 4F17A 4ZNXA 2E64A 4A4HA 1IREB 2HQHA 2Y4YA 5EG2A 5FWBA 5CK9A 1CSKA 4XQ3A 5GAOp 1YJNT 3QWYA 1QCNA 2A0FB 1XQHA 1GCQA 4KUIA 3A8GB 1NPRA 5GAN4 4FT2A 4LDVA 3LYIA 9ATCB 2DVEA 2KK4A 2FZCB 2VV5A 1X69A 1M8VA 2VWFA 3QUIA 2E12A 1D0XA 3OYAA 3MEUA 4AG1C 1QVGS 2KY9A 2QEXA 4BB7A 2JW4A 3M0SA 2E5QA 1KQ1A 1Z9QA 3SWNB 2QTVA 3CCMT 1NG2A 5CCAA 2A08A 2BTTA 3CC4T 3L42A 2O88A 1X43A 2DNUA 2FHDA 2DRKA 2I0NA 2O31A 3E19A 5GAMf 2DXBA 3PIOA 5GANj 2P84A 1ARKA 4AFSC 2L3QA 4NL2A 4PJOF 2KVQG 1M27C 1VQKA 1JB0E 2SEMA 2LQKA 4PFOA 3FLGA 3Q1JA 2HL5C 4PLLA 4R56A 1NLOC 1YJ9T 2RB6A 4FSSA 5IXBA 5CQXA 3X20B 3JCMJ 2L89A 3NFCA 3OMGA 1VQ7A 3M57A 1U06A 2ZZDA 2MYSA 2RQRA 2XK0A 4WCIA 5GMKh 1B7TA 5AYFA 2CSQA 2K5FA 4E7KA 3VS3A 1OEBA 3MJXA 2HNIA 3LH0A 4M78B 2V8KA 4M7DG 2P0QA 1KD1C 5I22A 1W4SA 3JCMd 4RTWA 1S1NA 1UG1A 4LN2A 1QP3A 1BB9A 2Y4XA 4KH0B 4J5YA 1YHQA 4OMOA 1H8KA 3L2VA 3GPLA 4F16A 2JMCA 3CCRA 3OYEA 1YI2T 2YT6A 2DZCA 2FB7A 2M1HA 5KYXB 2E70A 3UDCA 2CP0A 3JCMb 4KGVB 1OZ3A 1QCFA 3JRZA 5AT1B 2IIMA 1H641 2YLBA 1YJNA 5L8RE 1Q86C 4RUGA 3RERA 4ZGEB 3EGDA 2DA9A 3QDRB 3HRTA 3DKMA 5CVIA 2YLCA 4HVUA 4IKFA 1Q7YC 2PUKB 3EG3A 3M59A 3RIRA 3HRSA 4RTXA 2CGHA 1OPKA 1IXDA 3CCMA 2KRSA 4OB2B 3LW5E 5FU7B 3A1PA 3V8LA 4XTUA 3CC4A 4M7AE 2GCXA 1VYVA 3E9GA 1EX4A 5GANh 3M0PA 2AT1B 2ZPIB 3JCMX 4M7DA 1VQOT 2KGTA 1UFFA 2FPEA 3S3NA 4NS5A 3G7ZA 3X26B 1VQ9Q 2RHYA 4B9XA 4OVAA 3CXCA 1PNJA 3BW1A 1GBQA 1WQWA 4F7UE 5GAOn 4M75G 1YJ9A 2EBPA 1JXOA 1OULA 1ZSZC 2JMAA 2EPDA 2KAFA 2XMFA 1XJWB 1P92A 1I8FA 4VUBA 1WHGA 2HBWA 1MMDA 1Y71A 4BI3A 1EZZB 1U5SA 2B86A 3UWNA 2EYXA 2JTFA 1PHTA 1VQNQ 3GF5A 3CC2Q 3OS2A 2FVUA 3VS1A 1UB4A 1GBRA 2MWPA 3M55A 4ORZA 1G5VA 5GMKe 2DK3A 2CH4W 4L5GA 3ZEHA 5KYYA 5EC7A 5A0GA 3EH1A 3A8MB 4BI4A 1IHWA 1YI2A 5HK3A 4ZTFA 2E10A 2WSCE 2L3SA 4LDUA 2YSQA 3TQ7P 2IPOB 3EFOA 2DIGA 3OYIA 2FEIA 3OYFA 3MKDA 2JN0A 2D0NA 3THKA 2MIOA 4E2FB 2QEXQ 1OZ2A 3LLRA 1JEGA 2QI2A 4C8QE 2LVMA 5FROA 4C8QC 5FW9A 4BY6C 2JZ2A 2JJ9A 3V7RA 5I2MA 2CZ0B 3OYGA 4XTVA 1WXTA 4M75A 3CPWP 2RNAA 3OYHA 4MZTA 1MMGA 1BYMA 1QWFA 1Q82R 1KJWA 4PLIA 4QVCA 4XTWA 3M58A 5DM7R 2XDPA 4GLKA 5HKCA 1BKBA 1OV3A 4FU6A 1VQOA 4RG8A 1UDLA 1S72Q 2DMOA 1R8OB 4KH1B 2EQMA 2OTLT 1W70A 1AWXA 4EMKC 2MCNA 5GANe 3HFOA 1AD5A 3RMSA 4ZN3A 2KXDA 3WVDB 5IHKA 3AT1B 2MK5A 1NJIU 4E7JA 1PKSA 1TG0A 1EIFA 2V8IA 1R0BG 3JSCA 2C06A 1R0CB 1Q82U 1WJSA 3PMIA 5DLOA 1TXQA 1U1SA 3OA6A 1TU0B 4J83A 2LQ8A 1HK9A 4C8QF 3JAME 1T3LA 3PVLA 1ZQ1A 4JDSA 1GCQC 3BDUA 3OBYA 5I21A 1M1FA 4IIOA 4CC7A 1YHQQ 2CS7A 2ROTA 2ABLA 2QXFA 1GFCA 2VKNA 3MO8A 3JB9G 4AMCA 1K4US 2QA4Q 2YDLA 1EFNA 2BE9B 4FYWB 4MMKA 3OYMA 4RG2A 3LWIA 3UATA 3ZFJA 2NUTB 1QCOA 2EWNA 1RAFB 3M0RA 4PFPA 4ZN1A 5GANg 1PRLC 2DBKA 3CEYA 4M77B 1KQSA 1AHJB 3FRNA 3A8OB 3OS0A 1XOVA 2PQWA 1I07A 1M1KR 4DQ2A 1ACMB 1Y07A 1VQNT 3SEMA 2LQNA 3CC2T 5GAOl 1M9SA 3DB3A 3TU4K 2HMAA 2M51A 2OJ2A 4F04B 1W2BP 3CCMQ 3ULRB 3FDRA 4C92B 1V29B 3OYNA 1M3CA 2KE9A 1JJ2P 4HVWA 5FU6B 3M56A 1PG5B 3CBMA 4MDXA 2P0KA 2P4TA 5FRNA 4O5VA 4J7IA 1B34B 2ZPEB 3EG1A 4XTXA 4LDYA 5ECAA 4R55A 2OI3A 2V8JA 5C6SA 5CR2A 2X35A 2QAZA 1IO6A 1FYNA 2DEQA 2EYQA 3VUZA 2YRDA 2EQKA 4QQ6A 3A8HB 5GAMd 4CRIA 2OX7A 4CI0C 5CIUA 3CD6Q 2PVGB 2PU9B 1RL2A 3OS1A 2E4HA 2OTLA 3L2UA 3CCST 2CP7A 3V7CA 1N9SA 3OYYA 2RMOA 2QASA 2JM8A 1AWWA 1YJ9Q 5DY9A 2AKKA 3S3OA 2LX9A 2DKGA 4M77D 2M16A 1SEMA 2RM4A 3FEOA 3VS4A 4FW1A 1D0YA 2GGRA 4D6WA 4HCZA 1QVFA 1HYOA 4RTVA 4DBQA 3R6NA 4JZ3A 2O9SA 4EDUA 4HCCA 3G71Q 4M4ZA 1TS9A 4J9DA 4J7FA 2RF0A 3RKWA 4C92D 4OMNA 2M02A 3GOXA 2JS0A 1RADB 1S72T 1G83A 4ME7A 1UECA 2RN8A 4ANJA 5J26A 1RAIB 2JOYA 1UUEA 3R6OA 1F1BB 1X6OA 3X24B 4OGEA 2VASA 1BI0A 1YIJQ 3L2RA 2LCLA 2YWWA 4C0DB 2I2LA 2ENMA 1UEBA 2DTIA 2P0PA 1K73R 1G8XA 2P4RA 4JZ4A 2C0OA 2G3RA 4PJOB 1NJIC 4N4HA 2MMPA 2DL4A 1Q82C 1ZBJA 4P5NA 1OOTA 2RK1A 5GMKj 3M5AA 3TSWA 4M7DE 4CC3A 4M7DC 2E3HA 3CPWS 3JB9I 4QT7A 2M9UA 4J8OA 4CC4B 5HY6A 1VQNA 1MMNA 3CC2A 2LNVA 1O9SA 3O5ZA 2YRVA 3MP8A 2QA4T 2KEAA 3P8HA 4OB1B 2FZGB 5CKBA 3OYDA 1UGQB 3VUBA 4Z8AA 1RABB 3BE3A 2DL5A 3RMQA 3M4GA 1K73U 1Z9ZA 2DE0X 1ABQA 2DAQA 1NEGA 1VQOQ 4N4IA 3CMEQ 3L2WA 2O4XB 1NYFA 1AZEA 2LX7A 4OMPA 1RLQC 3M0QA 4JRQA 2NUPA 3QBYA 2G6FX 1FMWA 2ZPFB 1X2QA 4B9WA 1WX6A 2F5TX 2X9HA 3CCSA 1VQLQ 1Y96A 3I9QA 2FRYA 4PKCC 2QQRA 1ZUYA 3EFRA 2L3RA 3VRZA 4PJOD 2YUOA 4GLMA 4AG2C 4JLIA 2E1HA 3CCEQ 5IHNA 4RTYA 2FYKA 4E7ZA 1H3HA 1MV0B 3IQLA 4M7DF 2QGFB 3RR6A 4E7HA 1UTIA 2J06A 2RI5A 4PL6A 4BDYA 2A36A 1OU9A 4RTTA 3V8JA 5GAOq 4IUUA 2EYYA 4ZGDB 3CD6T 4BE2A 4GBQA 3P8DA 2JUFA 5KYWA 4PFZA 3VKIA 1S72A 4XTYA 3SD4A 2LCSA 2BKDN 1JU5C 1D1CA 1VQMQ 3C4SA 1PD0A 2HSPA 1OQKA 3PIPA 2D8JA 2PNIA 4IIMA 2YUNA 3OW2P 4M75E 1B07A 4M75C 1K0XA 2L3PA 4KRTA 2NUTA 3OSSC 3G4ST 4DOWA 3EG9A 2FL7A 2K3YA 3RESA 1IGQA 2EJGA 2ZGWA 5IHIA 3JCMh 3CCLT 5A0LA 3RUXA 4JRPA 1C6VX 2DIQA 3G71T 5KH6A 1W2BS 1BIBA 2E41A 3QDFA 2EFIA 4HXJA 3TVTA 4TVRA 1X2KA 3QSUA 1JJ2S 1C0MA 2EGEA 1HD3A 1W6XA 2DXTA 1OU8A 5KCOA 1QQJA 3HTRA 2XKOC 4C92A 3OMCA 4CC2A 2JT4A 2QA4A 1YJWT 1KC8R 4FW2A 3WVEB 5J39A 2Y90A 4BACA 4KULA 1YIJT 2DVJA 2FO0A 1I4K1 3T9NA 4A4GA 1NM7A 1ZUKA 2E5KA 5D6WA 4KUDK 4ATOA 4ELYC 3UA6A 2RJDA 2OTLQ 3OYLA 1WHJA 4M7AB 3V7SA 1MV3A 3MPUB 3H6ZA 5D6YA 2KDSA 1OI1A 4LNPA 2EJFA 2EVRA 4BD3A 4LUDA 2CREA 5C0MA 4M75F 1FX7A 2KR3A 3V8KA 5LJ5h 5CQYA 1DJ7B 5LL6S 3LWHA 1TUCA 2F2VA 1KC8U 3PNWC 1OPLA 5LJ5d 1PRMC 3VS5A 3MEAA 1G3WA 4M78D 2WSEE 1WJQA 3JB9H 2R5MA 4F7UB 3VS6A 1ZSZB 2H3EB 3CMET 1VOMA 1WHMA 1M3BA 3EH2A 1K73C 1ZA2B 1RI0A 1YCSB 3VYHB 1ABOA 3OYBA 1M2VB 4PJNA 1AEYA 4Z88A 4IUQA 3UF4A 3CD6A 4UC4A 2VXEA 2RHZA 5GMKi 3OY9A 1YWPA 1KHIA 4FYYB 1VQLT 2KRNA 4LXCA 1AOJA 2DD5A 4FIBA 2CUBA 2AHJB 2HD0A 2J6KA 2QDLA 3A98A 3VS2A 3CCET 4M7AD 1W1FA 3G4SA 1YBYA 1ZBXA 2CZ1B 4JJDA 4E6RA 4FYVB 5FU7C 4Z02A 4J9FA 2KT8A 2D1XA 3CCLA 5GAN3 1AWJA 1LNXA 1QMCA 3G71A 2VB6A 1KG1A 2YHTA 4JS4A 3HPWA 4HKEA 1Y57A 1NZ9A 1G3SA 2MWOA 2E65A 3JCMe 2JNGA 3REBB 2CSIA 1WHLA 2DJZA 1VQMT 2XICA 3I35A 3JCMc 1TTHB 4C8QB 4BY6B 1YJWA 2VVKA 1TUGB 1GXIE 3NHNA 4R0KA 3TEEA 1YIJA 1YFNA 1G3YA 2X4WA 1ZSGA 3U23A 1UHFA 4DEXA 2KYBA 3CMAT 1LVKA 3QKJA 2ROLA 4JJBA 3CCSQ 4M78G 1M3AA 1UJ0A 2JS2A 4J6XA 4EIKA 3I5RA 2ESWA 4NL3A 1BI2A 3NTKA 4HCBA 3G6EQ 3SDZA 4RCCA 3C94A 3CCJQ 2L2PA 4OB0B 1C1AA 1RI9A 2L8DA 3SWNA 2M0OA 2EIFA 4EMKB 4KGXB 1I5LA 2GTOA 5L23A 4JUVA 2NWMA 4OGCA 1SRMA 2COZA 3QWXX 4X9CA 2RQWA 4MDWA 2KT1A 5LJ3h 5LJ5e 1V1CA 3JCMg 4LD9K 4DBFA 1D1BA 1E7OA 2EQUA 5CKHA 5LJ3d 2J05A 3CMEA 2A28A 3EGXB 4XU2A 1ZA1B 3JB9F 2J6OA 5GAMj 1SSFA 3UPUA 3J80E 1Q81R 1YP5A 2PZ1A 1PD1A 4E7IA 3OW2S 2QG9B 1KQ2A 2H3JA 3EGUA 1VQLA 2DZ9A 4Z89A 3JCMQ 3C0CA 2BZ8A 1D1AA 3KBGA 1FWZA 3BY7A 1VQPT 4RKUE 1UGPB 3CCEA 4PK4A 1TH7A 1KC8C 3HRUA 2HL3A 2LC4A 2A37A 1VIEA 3H0FA 4Y28E 2D0QB 5CKFA 2R5AA 2LNHB 4J9CA 1MHNA 4M78A 3AHUA 2JM9A 2CT3A 2HSEB 4JJNK 2EW3A 4JRKA 3HL8A 1KHCA 4K11A 1MUZA 4F14A 5LJ5g 1M5Q1 1YCYA 3HKSA 2RJCA 5GANf 3J7AF 5GAN7 2JTMA 2O2OA 3L2QA 4N0AA 1VQMA 1D09B 1UGRB 1GL5A 5KYXA 3CXCP 1R77A 1RACB 2JTEA 2XIDA 3L2ZA 2QDYB 2LQWA 1TWBA 3QYHB 1BIAA 5FWCA 1V76A 2YXYA 3GLXA 1AT1B 3CMAA 2LT4A 4M7AA 1MGQA 5M9OA 4QKUA 1NLPC 1UE9A 3MHXA
chains in the Genus database with same CATH topology
1WHHA 2HL5C 3E2UA 1LPLA 2CP3A 3TQ7P 2E3IA 1TXQA 2COWA 2CP0A 2HQHA 2QK0A 1WHMA 2E4HA 2CP7A 1IXDA 4B6MA 2CP5A 3RDVA 2E3HA 1WHKA 2COZA 1WHGA 2HKQB 2COYA 2HKNA 2HL3A 2CP6A 2MPXC 1TOVA 2M02A 1WHLA 1WHJA 2Z0WA 2CP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WHH A;  2HL5 C;  3E2U A;  1LPL A;  2CP3 A;  3TQ7 P;  2E3I A;  1TXQ A;  2COW A;  2CP0 A;  2HQH A;  2QK0 A;  1WHM A;  2E4H A;  2CP7 A;  1IXD A;  4B6M A;  2CP5 A;  3RDV A;  2E3H A;  1WHK A;  2COZ A;  1WHG A;  2HKQ B;  2COY A;  2HKN A;  2HL3 A;  2CP6 A;  2MPX C;  1TOV A;  2M02 A;  1WHL A;  1WHJ A;  2Z0W A;  2CP2 A; 
#chains in the Genus database with same CATH topology
 4XAX B;  4MML A;  1KIK A;  1FMV A;  2EKH A;  3M0T A;  8AT1 B;  4JS5 A;  3EFS A;  3SB2 A;  1BI3 A;  3RDV A;  2BZY A;  2EGA A;  3VU3 C;  3UA7 A;  1VQ4 A;  3A5Z B;  3QZ9 B;  5GAN 6;  1NEB A;  2LCC A;  5GAM h;  4F7U A;  1YWO A;  3OYK A;  1YIT Q;  1ZHI A;  5CAI A;  1M1K U;  1WHH A;  4AFZ C;  2EYW A;  4E7S A;  3WXM B;  1WA7 A;  3PE0 A;  2KYM A;  5IT9 E;  2BUD A;  5LJ3 e;  1D3B B;  2CZ7 B;  2IVW A;  2C0T A;  5CO7 A;  2C0I A;  4OML A;  3G6E T;  3ZBD A;  1PKT A;  3CCJ T;  3G4S Q;  2RQT A;  2YRC A;  2QTX A;  2O01 E;  3JB9 J;  4C92 C;  3NMZ C;  3QG1 A;  3QPH A;  5HK0 A;  2KXC A;  1ZUU A;  1T0H A;  2K2V A;  3QO3 A;  5KYN A;  1VQP A;  1SPK A;  4IUR A;  3CCL Q;  4OF1 A;  4B6M A;  1AVZ C;  1BBZ A;  3FC3 A;  4FM4 B;  1SRL A;  1E6H A;  1WI7 A;  1QW1 A;  2RK2 A;  4HVV A;  4LUE A;  1Q86 R;  1SHF A;  3PGG A;  1XTD A;  2FRW A;  2KRM A;  2GFA A;  1AWO A;  3I55 T;  5I11 A;  1BI1 A;  1X6G A;  2ED1 A;  1YJW Q;  1UGS B;  1UGV A;  1NE8 A;  2F5K A;  2EJ9 A;  4QW2 A;  2RJF A;  2OTJ T;  4IUV A;  3KUF A;  5GAN 5;  2ZPG B;  5LJ3 g;  2LJ3 A;  3LGL A;  3F70 A;  3L1A A;  3SFM A;  2K9G A;  4BE1 A;  4DA4 A;  2PVD B;  4A63 B;  2CYZ B;  2RO0 A;  3GIB A;  1JBM A;  4EMH A;  5KE3 A;  3CCQ T;  1A0N B;  2L5Q A;  2HKQ B;  4BE0 A;  4GY5 A;  2GQV A;  1K0S A;  4C92 F;  3DLM A;  1U3O A;  2HCK A;  4FCY A;  2A3L A;  2FPD A;  1CKA A;  3H9N A;  2RI3 A;  1JO8 A;  1VQ8 Q;  3CCU T;  5FRM A;  3CCV Q;  5IH2 A;  4OP0 A;  2KNB B;  1UHC A;  5HCK A;  2VC8 A;  5KYY B;  2DER A;  2CP6 A;  3TRE A;  2MF2 A;  2X3X D;  4M77 G;  4C0D C;  3CBP A;  1NYG A;  1WQ7 A;  3EGX A;  2DL7 A;  3EHR A;  4NOY A;  2PTK A;  3GBQ A;  3ZL7 C;  2LTO A;  1WFW A;  3G1J A;  2LZ6 B;  3M54 A;  2V1Q A;  1G2B A;  1KQS P;  1X27 A;  2OAU A;  3EFO B;  3SHW A;  3LH5 A;  5GAM e;  2DF6 A;  3FB9 A;  1GRI A;  4YTL A;  3G6E A;  4C92 G;  5LJ5 j;  1CKB A;  3CCJ A;  2DLP A;  4XTZ A;  1SKU B;  3M4Y A;  3X25 B;  4C5H A;  3HP9 A;  4OMM A;  1IZ6 A;  1M1G A;  3OYC A;  2EQJ A;  2W0Z A;  3ASK A;  4M75 B;  4V2S A;  4EPC A;  3LGF A;  2K3B A;  2O9V A;  1ZX6 A;  1WHK A;  5A2Q E;  1YIT T;  1TUD A;  4J9G A;  3PFS A;  5GAO r;  1VYU A;  1KSW A;  2LRQ A;  2GNC A;  3EG0 A;  2BIV A;  2NUZ A;  4RTZ A;  3I55 A;  2SRC A;  2B8A A;  2XDD A;  3QZ5 B;  1M1K C;  2CDT A;  1N9R A;  3CXC S;  2HZY A;  2GF7 A;  1SG5 A;  2EYZ A;  4WTO B;  4J9I A;  3OSV A;  2OTJ A;  2ECZ A;  2DD4 A;  2KSS A;  2D8H A;  2DTH A;  2RD1 A;  3SWN C;  4XK8 E;  4JRI A;  4E7L A;  3EAE A;  5GAM g;  4MZM A;  3DB4 A;  3E9F A;  1KK7 A;  2DL8 A;  2JXB A;  4M77 A;  2OAW A;  3CMA Q;  3PVQ A;  4ESR A;  1RUW A;  2HDA A;  1LOJ A;  4MZP A;  2E6N A;  1QVF P;  3CCQ A;  2K4Y A;  2HAX A;  2DXC A;  4RTU A;  3H8Z A;  1QVP A;  2H8H A;  2VGM A;  5IAY A;  4AFQ C;  4L6V 5;  2BZX A;  4J6Y A;  4Y92 A;  1IGU A;  3CPW A;  1M8M A;  3GNF B;  4M75 D;  1VQ4 Q;  3E2U A;  3I56 T;  1WDX A;  3CCU A;  4KGZ B;  1SHG A;  2DBM A;  3QXE B;  3RBB B;  4A4E A;  1K9A A;  1B34 A;  3NGP A;  4HT8 A;  2KI7 A;  1VUB A;  3OB9 A;  7AT1 B;  4PJO G;  3PTA A;  2RQV A;  2R58 A;  2KBT A;  4E47 A;  1T0J A;  1M2O A;  1NBE B;  4XU3 A;  3OBW A;  2VUB A;  4FL6 A;  3CC7 Q;  1K76 A;  3JCM W;  4OB3 B;  4M78 E;  1QLY A;  4M78 C;  2J7I A;  2DXU A;  4BI8 B;  2WSF E;  2YUP A;  5GJW B;  2RA2 A;  1D3B A;  1HSQ A;  1VYT A;  2DL3 A;  2HEQ A;  5KCH A;  2CP5 A;  5GMK m;  2VGN A;  3H41 A;  1IHV A;  4IUP A;  3MCA B;  1VQP Q;  2BE7 D;  1QVG A;  3S6W A;  1RAE B;  2FG0 A;  1VQ8 T;  3CCV T;  1OX8 A;  2YUQ A;  2Z0W A;  2LJ0 A;  2GBQ A;  4N0A C;  4OMF B;  1K8A R;  1LPL A;  1KFZ A;  4JPB W;  2RI2 A;  1H3Z A;  5LJ3 j;  1BCO A;  4PJL A;  2F1L A;  1VQ6 T;  1YIT A;  2MAM A;  1XNI A;  1IB8 A;  2CKK A;  2RH2 A;  1MMA A;  1GFD A;  2MPX C;  1WLP B;  4M7A C;  4LE9 A;  1PC0 A;  1N8R R;  2CH4 A;  2ZPH B;  2EQI A;  5GAO m;  1YN8 A;  3QII A;  2MOX A;  4L59 A;  5GAN d;  2R57 A;  3ME9 A;  2PVO B;  4AT1 B;  4XU1 A;  3DLL A;  1K8A U;  4C5E A;  3BFM A;  5IXF A;  4PJO A;  4HA8 A;  4M78 F;  4D8D A;  1JXM A;  4FYX B;  3ER0 A;  2RHI A;  3M9Q A;  3HSB A;  1N5Z A;  1VIF A;  1FXX A;  4DBH A;  2X51 A;  1WNL A;  1BCM A;  3REA B;  3C95 A;  1BU1 A;  5KYU B;  1N8R U;  3H0H A;  1W2B A;  3J81 E;  2X4Y A;  2RJE A;  4O6J A;  1VQ5 Q;  2CP2 A;  2E6Z A;  1JJ2 A;  3NTI A;  4A53 A;  8ATC B;  2AZS A;  1Q95 G;  2XG8 D;  2D9T A;  3I56 A;  2LDM A;  2ATC B;  2FPF A;  4A4K A;  3NPF A;  4X34 A;  4N4G A;  2ZAE A;  2L0A A;  1U8R A;  2JVV A;  3QJ6 A;  2AIR B;  4M7A F;  2O4X A;  1KQS S;  1N27 A;  1PM3 A;  1TSF A;  4RCB A;  2DRM A;  2RPN A;  4C0G A;  3TCJ A;  3JCM P;  1JQQ A;  3EG2 A;  4JJC A;  4PJJ A;  2EGC A;  1K9M R;  3HFN A;  4XU0 A;  2W10 A;  3TSZ A;  3JB9 D;  2RHX A;  1D0Z A;  3JCM f;  3M0U A;  4AFU C;  2NLU A;  2DYB A;  3VYG A;  1AZG B;  3RKY A;  2HKN A;  4IUT A;  2K3X A;  1VQ4 T;  4F7U F;  1VQ8 A;  3O8V A;  3CCV A;  2XHC A;  2HQX A;  3QHS A;  2WAC A;  3VRY A;  2VXF A;  2K2M A;  1NJI R;  3D7S B;  3VS7 A;  2QQA A;  4QVZ A;  3UT1 A;  4BUG A;  2DEU A;  6AT1 B;  3JV3 A;  1VQ6 A;  3I55 Q;  4M7A G;  1K9M U;  4C8Q D;  3CC7 T;  2ED0 A;  1M90 R;  2K5I A;  2K79 A;  1WGS A;  3QYG B;  1X6B A;  4LDX A;  2GTJ A;  1RAG B;  4PJM A;  2OTJ Q;  1WXB A;  1JRI A;  2FZK B;  2AZV A;  2NUP B;  1WIE A;  1VQK Q;  2X4X A;  2CZ6 B;  2K6D A;  4Y91 A;  4C5G A;  3OQ5 A;  4DOV A;  2DPP B;  2AKL A;  5GAN 2;  2MI6 A;  5GJV B;  1Y96 B;  4A54 A;  1I1J A;  5LJ5 f;  1QVF S;  1TOV A;  4F7U G;  4A4F A;  1VQ7 Q;  2EKO A;  1Y7X A;  3QJY A;  2HBP A;  2NYS A;  3M53 A;  3CCQ Q;  1QVG P;  1Q81 U;  5A0D A;  4WF2 A;  1QKX A;  1M90 U;  1RAH B;  1WJR A;  2DYI A;  1PWT A;  4QQG A;  5I2S A;  1BK2 A;  2RHU A;  1M4Z A;  4C0F A;  1I81 A;  3CCU Q;  2DJQ A;  1K1Z A;  3S3M A;  1M30 A;  2DFU A;  2M0Y A;  2XD0 A;  2ZCF B;  3VJP A;  5KYW B;  1ZLM A;  2LP5 A;  4HT9 A;  5GMK l;  2XI9 A;  3MET A;  1VQ9 T;  3EHQ A;  2PUO B;  3CCR Q;  1WXU A;  3URG A;  2QGG A;  3CBO A;  2QQS A;  1LJO A;  1MNE A;  2V1R A;  2IG0 A;  2KQW A;  4KBM B;  2CUD A;  1K8A C;  3BDL A;  3EG9 B;  4D8K A;  2K5L A;  2EAY A;  1YJN Q;  2CT4 A;  3MP1 A;  3HHT B;  1G3T A;  2XDB A;  2ZPB B;  1QP2 A;  3NTH A;  4LD6 A;  2F2X A;  3OYJ A;  4EMG A;  1RAA B;  1OYX A;  1PSE A;  2F2W A;  2AK5 A;  3VS0 A;  1VQ5 T;  4C8Q G;  1N8R C;  1N6A A;  1PCX A;  5CKE A;  2DIL A;  4J6W A;  1SSH A;  4FSX A;  2F69 A;  1VA7 A;  2HQE A;  1ZSZ A;  3A8L B;  1U1T A;  4M77 E;  2X4J A;  4DBR A;  2DX1 A;  3CC4 Q;  4M77 C;  1LCK A;  4JLG A;  5IN1 A;  1GCP A;  3E1S A;  1IRX A;  5DLQ E;  1M2V A;  1KD1 R;  2DO3 A;  2XU8 A;  3INZ A;  2QYZ A;  1H92 A;  4C0Z A;  3CC7 A;  1X01 A;  5GAN 8;  3EGD B;  5FLX E;  2DET A;  3JCM V;  4C92 E;  3FIF A;  2A7Y A;  3OW2 A;  2D6F A;  4HCK A;  1HXD A;  3X28 B;  2LMJ A;  5CKD A;  4J9H A;  5FU6 C;  2LT1 A;  2QEX T;  2QQ9 A;  2GFU A;  3PMT A;  2KMT A;  1RLP C;  1MND A;  1WZO A;  2V26 A;  2RQU A;  1J3T A;  4KT0 E;  4ZGJ B;  1KD1 U;  3CQT A;  3LX7 A;  4DEY A;  3I5S A;  1UJY A;  2GQI A;  2X3W D;  5KE2 A;  5LJ3 f;  4QQD A;  1E6G A;  5KYU A;  2QK0 A;  5D7U A;  3FJ5 A;  3PT9 A;  4M7D B;  4Q5W A;  1Q7Y R;  1QKW A;  4II1 A;  4J9E A;  3I56 Q;  1PSF A;  4ELZ C;  3KFV A;  2COY A;  2K57 A;  4C8Q A;  1K9M C;  4FT4 A;  1VQK T;  4M77 F;  5J3B A;  1WPY A;  1O75 A;  1SF9 A;  3RNJ A;  2QQB A;  3GP8 A;  1VQ9 A;  1I5O B;  4C5I A;  3P8B B;  2VYT A;  1X75 C;  3N5B B;  3VV0 A;  1YI2 Q;  1Y0M A;  1I0C A;  4X9D A;  3MEW A;  1Q86 U;  4LDW A;  2LJ1 A;  1WYX A;  1VQ7 T;  1HJD A;  4X1V A;  1OX9 A;  3C12 A;  2DTO A;  2KRO A;  1Q7Y U;  1QWE A;  3CPF A;  2CP3 A;  1YNZ A;  3H0I A;  1Q81 C;  4QVD A;  2E3I A;  2COW A;  1FMK A;  3MEV A;  4EMK A;  4PNO A;  1M90 C;  1B3Q A;  2J6F A;  3MP6 A;  3RKX A;  4J9B A;  1VQ5 A;  4ZTJ A;  5D6X A;  4OMQ A;  2K7A A;  1YHQ T;  2DM1 A;  4RMO A;  1T3S A;  3FJP A;  3CCR T;  3OS5 A;  3GNG A;  1NPP A;  1VQ6 Q;  3KXT A;  4BDZ A;  4PJO E;  4PJO C;  4M7D D;  4F17 A;  4ZNX A;  2E64 A;  4A4H A;  1IRE B;  2HQH A;  2Y4Y A;  5EG2 A;  5FWB A;  5CK9 A;  1CSK A;  4XQ3 A;  5GAO p;  1YJN T;  3QWY A;  1QCN A;  2A0F B;  1XQH A;  1GCQ A;  4KUI A;  3A8G B;  1NPR A;  5GAN 4;  4FT2 A;  4LDV A;  3LYI A;  9ATC B;  2DVE A;  2KK4 A;  2FZC B;  2VV5 A;  1X69 A;  1M8V A;  2VWF A;  3QUI A;  2E12 A;  1D0X A;  3OYA A;  3MEU A;  4AG1 C;  1QVG S;  2KY9 A;  2QEX A;  4BB7 A;  2JW4 A;  3M0S A;  2E5Q A;  1KQ1 A;  1Z9Q A;  3SWN B;  2QTV A;  3CCM T;  1NG2 A;  5CCA A;  2A08 A;  2BTT A;  3CC4 T;  3L42 A;  2O88 A;  1X43 A;  2DNU A;  2FHD A;  2DRK A;  2I0N A;  2O31 A;  3E19 A;  5GAM f;  2DXB A;  3PIO A;  5GAN j;  2P84 A;  1ARK A;  4AFS C;  2L3Q A;  4NL2 A;  4PJO F;  2KVQ G;  1M27 C;  1VQK A;  1JB0 E;  2SEM A;  2LQK A;  4PFO A;  3FLG A;  3Q1J A;  2HL5 C;  4PLL A;  4R56 A;  1NLO C;  1YJ9 T;  2RB6 A;  4FSS A;  5IXB A;  5CQX A;  3X20 B;  3JCM J;  2L89 A;  3NFC A;  3OMG A;  1VQ7 A;  3M57 A;  1U06 A;  2ZZD A;  2MYS A;  2RQR A;  2XK0 A;  4WCI A;  5GMK h;  1B7T A;  5AYF A;  2CSQ A;  2K5F A;  4E7K A;  3VS3 A;  1OEB A;  3MJX A;  2HNI A;  3LH0 A;  4M78 B;  2V8K A;  4M7D G;  2P0Q A;  1KD1 C;  5I22 A;  1W4S A;  3JCM d;  4RTW A;  1S1N A;  1UG1 A;  4LN2 A;  1QP3 A;  1BB9 A;  2Y4X A;  4KH0 B;  4J5Y A;  1YHQ A;  4OMO A;  1H8K A;  3L2V A;  3GPL A;  4F16 A;  2JMC A;  3CCR A;  3OYE A;  1YI2 T;  2YT6 A;  2DZC A;  2FB7 A;  2M1H A;  5KYX B;  2E70 A;  3UDC A;  2CP0 A;  3JCM b;  4KGV B;  1OZ3 A;  1QCF A;  3JRZ A;  5AT1 B;  2IIM A;  1H64 1;  2YLB A;  1YJN A;  5L8R E;  1Q86 C;  4RUG A;  3RER A;  4ZGE B;  3EGD A;  2DA9 A;  3QDR B;  3HRT A;  3DKM A;  5CVI A;  2YLC A;  4HVU A;  4IKF A;  1Q7Y C;  2PUK B;  3EG3 A;  3M59 A;  3RIR A;  3HRS A;  4RTX A;  2CGH A;  1OPK A;  1IXD A;  3CCM A;  2KRS A;  4OB2 B;  3LW5 E;  5FU7 B;  3A1P A;  3V8L A;  4XTU A;  3CC4 A;  4M7A E;  2GCX A;  1VYV A;  3E9G A;  1EX4 A;  5GAN h;  3M0P A;  2AT1 B;  2ZPI B;  3JCM X;  4M7D A;  1VQO T;  2KGT A;  1UFF A;  2FPE A;  3S3N A;  4NS5 A;  3G7Z A;  3X26 B;  1VQ9 Q;  2RHY A;  4B9X A;  4OVA A;  3CXC A;  1PNJ A;  3BW1 A;  1GBQ A;  1WQW A;  4F7U E;  5GAO n;  4M75 G;  1YJ9 A;  2EBP A;  1JXO A;  1OUL A;  1ZSZ C;  2JMA A;  2EPD A;  2KAF A;  2XMF A;  1XJW B;  1P92 A;  1I8F A;  4VUB A;  1WHG A;  2HBW A;  1MMD A;  1Y71 A;  4BI3 A;  1EZZ B;  1U5S A;  2B86 A;  3UWN A;  2EYX A;  2JTF A;  1PHT A;  1VQN Q;  3GF5 A;  3CC2 Q;  3OS2 A;  2FVU A;  3VS1 A;  1UB4 A;  1GBR A;  2MWP A;  3M55 A;  4ORZ A;  1G5V A;  5GMK e;  2DK3 A;  2CH4 W;  4L5G A;  3ZEH A;  5KYY A;  5EC7 A;  5A0G A;  3EH1 A;  3A8M B;  4BI4 A;  1IHW A;  1YI2 A;  5HK3 A;  4ZTF A;  2E10 A;  2WSC E;  2L3S A;  4LDU A;  2YSQ A;  3TQ7 P;  2IPO B;  3EFO A;  2DIG A;  3OYI A;  2FEI A;  3OYF A;  3MKD A;  2JN0 A;  2D0N A;  3THK A;  2MIO A;  4E2F B;  2QEX Q;  1OZ2 A;  3LLR A;  1JEG A;  2QI2 A;  4C8Q E;  2LVM A;  5FRO A;  4C8Q C;  5FW9 A;  4BY6 C;  2JZ2 A;  2JJ9 A;  3V7R A;  5I2M A;  2CZ0 B;  3OYG A;  4XTV A;  1WXT A;  4M75 A;  3CPW P;  2RNA A;  3OYH A;  4MZT A;  1MMG A;  1BYM A;  1QWF A;  1Q82 R;  1KJW A;  4PLI A;  4QVC A;  4XTW A;  3M58 A;  5DM7 R;  2XDP A;  4GLK A;  5HKC A;  1BKB A;  1OV3 A;  4FU6 A;  1VQO A;  4RG8 A;  1UDL A;  1S72 Q;  2DMO A;  1R8O B;  4KH1 B;  2EQM A;  2OTL T;  1W70 A;  1AWX A;  4EMK C;  2MCN A;  5GAN e;  3HFO A;  1AD5 A;  3RMS A;  4ZN3 A;  2KXD A;  3WVD B;  5IHK A;  3AT1 B;  2MK5 A;  1NJI U;  4E7J A;  1PKS A;  1TG0 A;  1EIF A;  2V8I A;  1R0B G;  3JSC A;  2C06 A;  1R0C B;  1Q82 U;  1WJS A;  3PMI A;  5DLO A;  1TXQ A;  1U1S A;  3OA6 A;  1TU0 B;  4J83 A;  2LQ8 A;  1HK9 A;  4C8Q F;  3JAM E;  1T3L A;  3PVL A;  1ZQ1 A;  4JDS A;  1GCQ C;  3BDU A;  3OBY A;  5I21 A;  1M1F A;  4IIO A;  4CC7 A;  1YHQ Q;  2CS7 A;  2ROT A;  2ABL A;  2QXF A;  1GFC A;  2VKN A;  3MO8 A;  3JB9 G;  4AMC A;  1K4U S;  2QA4 Q;  2YDL A;  1EFN A;  2BE9 B;  4FYW B;  4MMK A;  3OYM A;  4RG2 A;  3LWI A;  3UAT A;  3ZFJ A;  2NUT B;  1QCO A;  2EWN A;  1RAF B;  3M0R A;  4PFP A;  4ZN1 A;  5GAN g;  1PRL C;  2DBK A;  3CEY A;  4M77 B;  1KQS A;  1AHJ B;  3FRN A;  3A8O B;  3OS0 A;  1XOV A;  2PQW A;  1I07 A;  1M1K R;  4DQ2 A;  1ACM B;  1Y07 A;  1VQN T;  3SEM A;  2LQN A;  3CC2 T;  5GAO l;  1M9S A;  3DB3 A;  3TU4 K;  2HMA A;  2M51 A;  2OJ2 A;  4F04 B;  1W2B P;  3CCM Q;  3ULR B;  3FDR A;  4C92 B;  1V29 B;  3OYN A;  1M3C A;  2KE9 A;  1JJ2 P;  4HVW A;  5FU6 B;  3M56 A;  1PG5 B;  3CBM A;  4MDX A;  2P0K A;  2P4T A;  5FRN A;  4O5V A;  4J7I A;  1B34 B;  2ZPE B;  3EG1 A;  4XTX A;  4LDY A;  5ECA A;  4R55 A;  2OI3 A;  2V8J A;  5C6S A;  5CR2 A;  2X35 A;  2QAZ A;  1IO6 A;  1FYN A;  2DEQ A;  2EYQ A;  3VUZ A;  2YRD A;  2EQK A;  4QQ6 A;  3A8H B;  5GAM d;  4CRI A;  2OX7 A;  4CI0 C;  5CIU A;  3CD6 Q;  2PVG B;  2PU9 B;  1RL2 A;  3OS1 A;  2E4H A;  2OTL A;  3L2U A;  3CCS T;  2CP7 A;  3V7C A;  1N9S A;  3OYY A;  2RMO A;  2QAS A;  2JM8 A;  1AWW A;  1YJ9 Q;  5DY9 A;  2AKK A;  3S3O A;  2LX9 A;  2DKG A;  4M77 D;  2M16 A;  1SEM A;  2RM4 A;  3FEO A;  3VS4 A;  4FW1 A;  1D0Y A;  2GGR A;  4D6W A;  4HCZ A;  1QVF A;  1HYO A;  4RTV A;  4DBQ A;  3R6N A;  4JZ3 A;  2O9S A;  4EDU A;  4HCC A;  3G71 Q;  4M4Z A;  1TS9 A;  4J9D A;  4J7F A;  2RF0 A;  3RKW A;  4C92 D;  4OMN A;  2M02 A;  3GOX A;  2JS0 A;  1RAD B;  1S72 T;  1G83 A;  4ME7 A;  1UEC A;  2RN8 A;  4ANJ A;  5J26 A;  1RAI B;  2JOY A;  1UUE A;  3R6O A;  1F1B B;  1X6O A;  3X24 B;  4OGE A;  2VAS A;  1BI0 A;  1YIJ Q;  3L2R A;  2LCL A;  2YWW A;  4C0D B;  2I2L A;  2ENM A;  1UEB A;  2DTI A;  2P0P A;  1K73 R;  1G8X A;  2P4R A;  4JZ4 A;  2C0O A;  2G3R A;  4PJO B;  1NJI C;  4N4H A;  2MMP A;  2DL4 A;  1Q82 C;  1ZBJ A;  4P5N A;  1OOT A;  2RK1 A;  5GMK j;  3M5A A;  3TSW A;  4M7D E;  4CC3 A;  4M7D C;  2E3H A;  3CPW S;  3JB9 I;  4QT7 A;  2M9U A;  4J8O A;  4CC4 B;  5HY6 A;  1VQN A;  1MMN A;  3CC2 A;  2LNV A;  1O9S A;  3O5Z A;  2YRV A;  3MP8 A;  2QA4 T;  2KEA A;  3P8H A;  4OB1 B;  2FZG B;  5CKB A;  3OYD A;  1UGQ B;  3VUB A;  4Z8A A;  1RAB B;  3BE3 A;  2DL5 A;  3RMQ A;  3M4G A;  1K73 U;  1Z9Z A;  2DE0 X;  1ABQ A;  2DAQ A;  1NEG A;  1VQO Q;  4N4I A;  3CME Q;  3L2W A;  2O4X B;  1NYF A;  1AZE A;  2LX7 A;  4OMP A;  1RLQ C;  3M0Q A;  4JRQ A;  2NUP A;  3QBY A;  2G6F X;  1FMW A;  2ZPF B;  1X2Q A;  4B9W A;  1WX6 A;  2F5T X;  2X9H A;  3CCS A;  1VQL Q;  1Y96 A;  3I9Q A;  2FRY A;  4PKC C;  2QQR A;  1ZUY A;  3EFR A;  2L3R A;  3VRZ A;  4PJO D;  2YUO A;  4GLM A;  4AG2 C;  4JLI A;  2E1H A;  3CCE Q;  5IHN A;  4RTY A;  2FYK A;  4E7Z A;  1H3H A;  1MV0 B;  3IQL A;  4M7D F;  2QGF B;  3RR6 A;  4E7H A;  1UTI A;  2J06 A;  2RI5 A;  4PL6 A;  4BDY A;  2A36 A;  1OU9 A;  4RTT A;  3V8J A;  5GAO q;  4IUU A;  2EYY A;  4ZGD B;  3CD6 T;  4BE2 A;  4GBQ A;  3P8D A;  2JUF A;  5KYW A;  4PFZ A;  3VKI A;  1S72 A;  4XTY A;  3SD4 A;  2LCS A;  2BKD N;  1JU5 C;  1D1C A;  1VQM Q;  3C4S A;  1PD0 A;  2HSP A;  1OQK A;  3PIP A;  2D8J A;  2PNI A;  4IIM A;  2YUN A;  3OW2 P;  4M75 E;  1B07 A;  4M75 C;  1K0X A;  2L3P A;  4KRT A;  2NUT A;  3OSS C;  3G4S T;  4DOW A;  3EG9 A;  2FL7 A;  2K3Y A;  3RES A;  1IGQ A;  2EJG A;  2ZGW A;  5IHI A;  3JCM h;  3CCL T;  5A0L A;  3RUX A;  4JRP A;  1C6V X;  2DIQ A;  3G71 T;  5KH6 A;  1W2B S;  1BIB A;  2E41 A;  3QDF A;  2EFI A;  4HXJ A;  3TVT A;  4TVR A;  1X2K A;  3QSU A;  1JJ2 S;  1C0M A;  2EGE A;  1HD3 A;  1W6X A;  2DXT A;  1OU8 A;  5KCO A;  1QQJ A;  3HTR A;  2XKO C;  4C92 A;  3OMC A;  4CC2 A;  2JT4 A;  2QA4 A;  1YJW T;  1KC8 R;  4FW2 A;  3WVE B;  5J39 A;  2Y90 A;  4BAC A;  4KUL A;  1YIJ T;  2DVJ A;  2FO0 A;  1I4K 1;  3T9N A;  4A4G A;  1NM7 A;  1ZUK A;  2E5K A;  5D6W A;  4KUD K;  4ATO A;  4ELY C;  3UA6 A;  2RJD A;  2OTL Q;  3OYL A;  1WHJ A;  4M7A B;  3V7S A;  1MV3 A;  3MPU B;  3H6Z A;  5D6Y A;  2KDS A;  1OI1 A;  4LNP A;  2EJF A;  2EVR A;  4BD3 A;  4LUD A;  2CRE A;  5C0M A;  4M75 F;  1FX7 A;  2KR3 A;  3V8K A;  5LJ5 h;  5CQY A;  1DJ7 B;  5LL6 S;  3LWH A;  1TUC A;  2F2V A;  1KC8 U;  3PNW C;  1OPL A;  5LJ5 d;  1PRM C;  3VS5 A;  3MEA A;  1G3W A;  4M78 D;  2WSE E;  1WJQ A;  3JB9 H;  2R5M A;  4F7U B;  3VS6 A;  1ZSZ B;  2H3E B;  3CME T;  1VOM A;  1WHM A;  1M3B A;  3EH2 A;  1K73 C;  1ZA2 B;  1RI0 A;  1YCS B;  3VYH B;  1ABO A;  3OYB A;  1M2V B;  4PJN A;  1AEY A;  4Z88 A;  4IUQ A;  3UF4 A;  3CD6 A;  4UC4 A;  2VXE A;  2RHZ A;  5GMK i;  3OY9 A;  1YWP A;  1KHI A;  4FYY B;  1VQL T;  2KRN A;  4LXC A;  1AOJ A;  2DD5 A;  4FIB A;  2CUB A;  2AHJ B;  2HD0 A;  2J6K A;  2QDL A;  3A98 A;  3VS2 A;  3CCE T;  4M7A D;  1W1F A;  3G4S A;  1YBY A;  1ZBX A;  2CZ1 B;  4JJD A;  4E6R A;  4FYV B;  5FU7 C;  4Z02 A;  4J9F A;  2KT8 A;  2D1X A;  3CCL A;  5GAN 3;  1AWJ A;  1LNX A;  1QMC A;  3G71 A;  2VB6 A;  1KG1 A;  2YHT A;  4JS4 A;  3HPW A;  4HKE A;  1Y57 A;  1NZ9 A;  1G3S A;  2MWO A;  2E65 A;  3JCM e;  2JNG A;  3REB B;  2CSI A;  1WHL A;  2DJZ A;  1VQM T;  2XIC A;  3I35 A;  3JCM c;  1TTH B;  4C8Q B;  4BY6 B;  1YJW A;  2VVK A;  1TUG B;  1GXI E;  3NHN A;  4R0K A;  3TEE A;  1YIJ A;  1YFN A;  1G3Y A;  2X4W A;  1ZSG A;  3U23 A;  1UHF A;  4DEX A;  2KYB A;  3CMA T;  1LVK A;  3QKJ A;  2ROL A;  4JJB A;  3CCS Q;  4M78 G;  1M3A A;  1UJ0 A;  2JS2 A;  4J6X A;  4EIK A;  3I5R A;  2ESW A;  4NL3 A;  1BI2 A;  3NTK A;  4HCB A;  3G6E Q;  3SDZ A;  4RCC A;  3C94 A;  3CCJ Q;  2L2P A;  4OB0 B;  1C1A A;  1RI9 A;  2L8D A;  3SWN A;  2M0O A;  2EIF A;  4EMK B;  4KGX B;  1I5L A;  2GTO A;  5L23 A;  4JUV A;  2NWM A;  4OGC A;  1SRM A;  2COZ A;  3QWX X;  4X9C A;  2RQW A;  4MDW A;  2KT1 A;  5LJ3 h;  5LJ5 e;  1V1C A;  3JCM g;  4LD9 K;  4DBF A;  1D1B A;  1E7O A;  2EQU A;  5CKH A;  5LJ3 d;  2J05 A;  3CME A;  2A28 A;  3EGX B;  4XU2 A;  1ZA1 B;  3JB9 F;  2J6O A;  5GAM j;  1SSF A;  3UPU A;  3J80 E;  1Q81 R;  1YP5 A;  2PZ1 A;  1PD1 A;  4E7I A;  3OW2 S;  2QG9 B;  1KQ2 A;  2H3J A;  3EGU A;  1VQL A;  2DZ9 A;  4Z89 A;  3JCM Q;  3C0C A;  2BZ8 A;  1D1A A;  3KBG A;  1FWZ A;  3BY7 A;  1VQP T;  4RKU E;  1UGP B;  3CCE A;  4PK4 A;  1TH7 A;  1KC8 C;  3HRU A;  2HL3 A;  2LC4 A;  2A37 A;  1VIE A;  3H0F A;  4Y28 E;  2D0Q B;  5CKF A;  2R5A A;  2LNH B;  4J9C A;  1MHN A;  4M78 A;  3AHU A;  2JM9 A;  2CT3 A;  2HSE B;  4JJN K;  2EW3 A;  4JRK A;  3HL8 A;  1KHC A;  4K11 A;  1MUZ A;  4F14 A;  5LJ5 g;  1M5Q 1;  1YCY A;  3HKS A;  2RJC A;  5GAN f;  3J7A F;  5GAN 7;  2JTM A;  2O2O A;  3L2Q A;  4N0A A;  1VQM A;  1D09 B;  1UGR B;  1GL5 A;  5KYX A;  3CXC P;  1R77 A;  1RAC B;  2JTE A;  2XID A;  3L2Z A;  2QDY B;  2LQW A;  1TWB A;  3QYH B;  1BIA A;  5FWC A;  1V76 A;  2YXY A;  3GLX A;  1AT1 B;  3CMA A;  2LT4 A;  4M7A A;  1MGQ A;  5M9O A;  4QKU A;  1NLP C;  1UE9 A;  3MHX A; 
#chains in the Genus database with same CATH homology
 1WHH A;  2HL5 C;  3E2U A;  1LPL A;  2CP3 A;  3TQ7 P;  2E3I A;  1TXQ A;  2COW A;  2CP0 A;  2HQH A;  2QK0 A;  1WHM A;  2E4H A;  2CP7 A;  1IXD A;  4B6M A;  2CP5 A;  3RDV A;  2E3H A;  1WHK A;  2COZ A;  1WHG A;  2HKQ B;  2COY A;  2HKN A;  2HL3 A;  2CP6 A;  2MPX C;  1TOV A;  2M02 A;  1WHL A;  1WHJ A;  2Z0W A;  2CP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...