4A4HA

Solution structure of spf30 tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
b'ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4hA00
2X4XA 2EQMA 3UT1A 3OYFA 3Q1JA 3FC3A 3MO8A 3LH0A 4Q5WA 5KE3A 2WACA 4LD6A 3MP8A 2MWOA 2EQKA 3DB3A 4E7LA 5CIUA 3QBYA 3P8HA 3PFSA 2RJDA 3NTIA 2QQSA 2R57A 4QQDA 3OYGA 3OYJA 2L89A 3L2QA 4C5IA 2DIGA 1RI0A 1N27A 2EFIA 4QQGA 4E7JA 3QJ6A 3UWNA 3OA6A 2B8AA 4C5GA 3LLRA 3OYCA 4ZTJA 4C5EA 3L42A 4E7KA 2RI3A 2L3RA 2D9TA 2VYTA 2P0KA 4IUUA 3OYMA 1OYXA 2HQXA 4PLIA 4N4GA 4B9XA 2K3XA 3PMIA 1KHCA 2MWPA 4A4FA 3OS2A 3QIIA 2HQEA 2E6NA 1MHNA 1WJRA 4X34A 3DB4A 1OZ3A 4BE2A 3OYAA 4IKFA 3OYBA 2DIQA 3CEYA 3ME9A 3O8VA 4N4HA 4OVAA 2M0OA 3OYHA 4BE1A 2RI5A 3H6ZA 2X4WA 5M9OA 4L59A 1H3ZA 3FLGA 2M1HA 3NTKA 3OQ5A 3QKJA 3S3MA 3M9QA 4IURA 1XNIA 3EAEA 2EKOA 2LDMA 3E9FA 4PLLA 4BD3A 3L2RA 4BE0A 2YRVA 2BIVA 2DAQA 2X35A 4IUQA 4QQ6A 3PNWC 4A4GA 3OMGA 1OI1A 2JTFA 4FL6A 3OYKA 3BDLA 3S3OA 5KCHA 3OB9A 4B9WA 3L2VA 4UC4A 2RO0A 5J39A 3S3NA 2R58A 2G3RA 2FHDA 4EDUA 5KH6A 2RI2A 3LGLA 2LCCA 2RHXA 2X4YA 1G5VA 1WJSA 3MP6A 2BKDN 2JZ2A 2RJEA 3MEWA 2RHIA 2QQRA 5FRMA 3FDRA 5KCOA 4BACA 2R5MA 2NLUA 3F70A 3MEAA 2RHYA 2LTOA 3P8DA 2LRQA 4IUVA 4CRIA 4N4IA 1WJQA 5D6XA 5D6WA 4NS5A 3OYLA 3MP1A 3S6WA 4GY5A 3META 2BUDA 2F5KA 3DLMA 4QW2A 3LYIA 4A4EA 3L2UA 2EQUA 4E7HA 2L8DA 3KUFA 4HCZA 2GF7A 5FRNA 2CKKA 5KE2A 3LX7A 3OYIA 4FU6A 1WGSA 3ZEHA 3NTHA 5J26A 3FEOA 3OYEA 2IG0A 2RJCA 2K3YA 3C4SA 3OYDA 3L2WA 4BDZA 3OYNA 2XDPA 3OMCA 4IUPA 4PL6A 2EQJA 4C5HA 3OS1A 5IAYA 2GFUA 2O4XA 5D6YA 3PMTA 1OZ2A 1SSFA 2RHZA 2XK0A 3ASKA 4Z02A 3SD4A 4E7IA 4RG2A 2PQWA 3E9GA 4BDYA 2E5QA 4A4HA 2R5AA 2GFAA 4II1A 5C6SA 3H8ZA 3OY9A 3MEUA 5C0MA 2M16A 4ZTFA 4IUTA 5FROA 2RHUA 3OS0A 5IN1A 3LGFA 4QVZA 3GOXA 2RJFA 3MEVA 2O4XB 2LVMA
chains in the Genus database with same CATH superfamily
2JJ9A 4J83A 3UT1A 2O9VA 1RLQC 5KE3A 1ZQ1A 2H8HA 2P0QA 3QHSA 5LJ5d 2XU8A 2MOXA 2V8IA 4QQDA 3CCVT 2DERA 3CBOA 4CI0C 4ZGJB 4C5IA 2EFIA 2ED0A 3C0CA 1RLPC 3CBMA 2A37A 2JW4A 4IIOA 4ORZA 3EG2A 4BB7A 3A8MB 1UGSB 4QKUA 2PVGB 4CC4B 3EFOB 3M58A 3CCEA 4J7FA 1VQNT 2KSSA 3H9NA 2AZVA 1YJ9Q 1IGUA 1WPYA 5FW9A 1QCFA 1VYVA 3FRNA 1M2VA 2IVWA 1AZEA 3DLLA 2EYQA 3PNWC 4DA4A 1SHFA 1N8RC 1YWPA 1JJ2S 2RHXA 1UTIA 4F7UE 4C0GA 2CP7A 4C0FA 3CCJA 1I8FA 1NG2A 3JB9I 5D7UA 3H0FA 5D6XA 2XG8D 3PT9A 4PJMA 3QJYA 1BCOA 1VYTA 1TXQA 3UPUA 4RTUA 2EQUA 2QGGA 2ED1A 1VQ7Q 1WNLA 5GANg 2DFUA 2DJQA 5A0GA 3JSCA 1MGQA 1PWTA 1HYOA 5D6YA 4E7IA 2OAUA 2COWA 4A4HA 5FWBA 3HPWA 2KAFA 4M7DB 2M16A 3I55Q 3U23A 4JS4A 1PD1A 5FU6B 3GOXA 4A4KA 3MEVA 3VYHB 4CC3A 2EQMA 4Y92A 1M3BA 4M7AB 2KGTA 2MF2A 3FC3A 2K2VA 3LH0A 2YLCA 2P4TA 3PFSA 1M5Q1 3L2QA 4LNPA 3CC4Q 2CS7A 4M7DC 2DK3A 3EH2A 3SFMA 3QO3A 3SWNA 2DXTA 2HL5C 2X51A 3CQTA 3CCQT 1C0MA 4IUUA 3OYMA 4M7AC 4A53A 4FYXB 5GAOq 6AT1B 2EYZA 3GPLA 4FSSA 2RMOA 2JM9A 4J9FA 5GAN5 4M7DD 1PM3A 1ZUKA 3O8VA 5CQYA 1N9RA 2JVVA 3JCMX 1IB8A 2E64A 3EAEA 3E9FA 3L2RA 1D1BA 1CSKA 1X6OA 2EPDA 2R58A 1KQSP 2E12A 1Q95G 2EJGA 4JLIA 3NFCA 1G3SA 1SSHA 3EGDA 3FDRA 5KCOA 4C92B 3MEAA 3G6ET 2LCLA 1M1GA 1VQ4T 2PU9B 1O75A 2RNAA 2XI9A 3MP1A 1H92A 3OW2S 1K8AR 2J6FA 1GRIA 2DZ9A 1ZLMA 1YJ9A 2L8DA 4N0AC 2EVRA 4PJOA 4WF2A 5KE2A 4XTXA 1E6HA 1GFDA 1ZBJA 1I0CA 4ANJA 4DEXA 4C92C 2KQWA 3ZBDA 1A0NB 2FVUA 2XK0A 1M3AA 1LCKA 3RKXA 5IT9E 1OOTA 2R5AA 4BI3A 4C8QF 3TVTA 2HBWA 4B6MA 1F1BB 5GAOr 4PFPA 3I5RA 1VQ9T 1KQ2A 1UE9A 4M75F 3IQLA 1LPLA 2RN8A 5KYWA 3L2ZA 2WSEE 2LX7A 3RERA 1QP3A 1VQ7A 2PZ1A 3CBPA 4RG8A 2XKOC 4J9GA 2NUTB 4ZTJA 4E7KA 4DQ2A 2FZCB 1IRXA 2CZ0B 5HK0A 1QW1A 5I22A 1WHGA 2DL4A 4C92E 4JJDA 1WI7A 5I2MA 3I55A 2QASA 3CPFA 4DEYA 3MKDA 1VQ8T 3CCMQ 4JZ3A 2M0OA 4PFZA 1Y0MA 2K2MA 2VXFA 5KYXB 2EGCA 4L59A 2PVDB 3NTKA 4C8QB 4RCCA 1D3BB 1VA7A 1TSFA 4IUQA 2X35A 4QQ6A 3S3OA 2ROLA 4F04B 2HL3A 2KXCA 3E2UA 5KCHA 1VQOQ 1VOMA 4Z8AA 1G3TA 4M75B 2VASA 3L1AA 1K8AC 5GAMj 5FRMA 5GMKl 4BACA 2KXDA 2NLUA 5LJ3h 4C8QC 1QP2A 2KYMA 1QMCA 3QSUA 3KXTA 2RD1A 5GJVB 2MIOA 2V26A 1GCQC 4R56A 1KQSA 2XIDA 4F17A 4M75C 2EGAA 3LX7A 4PKCC 5DY9A 1Q86U 3M0SA 4PL6A 5I21A 4M78B 1BKBA 2JUFA 4KULA 1YNZA 2V1RA 4ZN1A 1UG1A 1K9MR 1NPRA 2JXBA 3HRUA 1K1ZA 3I56Q 4D8DA 2AIRB 4RG2A 5A0LA 2ROTA 2FYKA 2L3PA 2DL5A 2FZKB 1R8OB 1NZ9A 1WXUA 4M77G 3WVEB 3A8OB 3GNFB 3REAB 3JCMc 4ZGEB 2J05A 4M78C 1MUZA 2QA4T 5GMKi 2OTLQ 4PFOA 1CKAA 1N6AA 1OPLA 4C8QE 2LQKA 1CKBA 3NGPA 3CC4T 1QVFS 1XQHA 2L89A 1UUEA 3G4SQ 1VQ5T 3EFOA 1OU8A 2B8AA 5GAN8 3OYCA 4M75E 2DF6A 4KUDK 4M78D 5AYFA 3O5ZA 1H8KA 1UGRB 2QQBA 5EC7A 1NM7A 3CD6T 2PUOB 4RTYA 5LJ5f 2RM4A 3V8JA 3NPFA 2IIMA 5GAN3 2FPDA 3QPHA 2CH4W 1YHQA 4E6RA 5CVIA 3UDCA 3CCVQ 1H3ZA 2M1HA 1C6VX 3TCJA 3CMAT 4OB0B 4E7ZA 1HXDA 1BYMA 3FJPA 2F2WA 2L3SA 2X4YA 3CC2T 1Y96B 1KK7A 2OAWA 5LJ3j 2LRQA 3HKSA 1Q7YR 4OMNA 4HKEA 1LJOA 4PJOF 1QWEA 4ZNXA 1K9MC 3CCMA 1SPKA 1G3WA 1UGVA 1W2BS 3VU3C 4M7DA 3C4SA 1TUCA 1BIAA 3GNGA 2CUDA 2OTJT 2QG9B 1WYXA 2XD0A 2EQJA 2EYWA 1VQOA 5IAYA 4JRQA 2RQWA 4M7AA 4BDYA 2FB7A 4F7UG 1TG0A 1K0XA 4NOYA 3OY9A 1IREB 3ZFJA 4L5GA 3N5BB 2X9HA 3URGA 2XDBA 3VS6A 1X6BA 1EFNA 1VQPA 2HSPA 5FU7B 2COYA 4MMKA 2X3XD 3NTIA 1WFWA 1M1FA 3JCMe 3ZL7C 1QVGP 3G71T 3L42A 2CT3A 2C0IA 3I56A 1X43A 1UB4A 5FU7C 1EZZB 4BE2A 3SHWA 3M54A 4FW2A 3I9QA 1AWJA 4FT4A 4N0AA 4F16A 2DX1A 2F2VA 3V7CA 2VV5A 1YP5A 2KVQG 2OTLA 2GBQA 2YRVA 4C92A 8ATCB 3BDLA 3QDFA 3CCQQ 3A5ZB 3G4SA 1Q7YC 5IHKA 3LGLA 3OYYA 4PJJA 2DXUA 2K57A 1B3QA 2JZ2A 2GNCA 1SRMA 1HD3A 2E70A 2DEUA 3M57A 4IUVA 1D0ZA 1U5SA 2QK0A 3OYLA 2LJ0A 1B34B 4HVVA 2ZCFB 1Z9QA 3T9NA 1JRIA 4OB3B 2D8HA 1X27A 3CCLT 1JJ2P 2EQIA 5HK3A 3JCMd 3CCVA 5GANh 1N9SA 1WA7A 1ARKA 3FJ5A 4M77D 1W6XA 2VXEA 3V7RA 4PJOE 1PCXA 3QUIA 4C5HA 1Q82U 1MV0B 4XK8E 3TSWA 4XTZA 2AKKA 1FXXA 2DXBA 3G6EQ 1SF9A 3X25B 1VQ4Q 1WHLA 3I5SA 4CC2A 3C95A 2NWMA 2HAXA 1VQNA 3TEEA 2RJFA 4GLMA 2XHCA 2A7YA 2NUTA 3UATA 3A98A 1ABOA 2WACA 3JCMW 2YUNA 3P8HA 1WIEA 3JV3A 2RA2A 3BDUA 1BIBA 2KR3A 3X26B 4J8OA 2ZPHB 4ATOA 3BE3A 2HNIA 4JJCA 3R6OA 2P0KA 3QZ9B 2AT1B 5KYXA 1VQKT 4B9XA 3RIRA 1KHCA 4C8QA 1D3BA 1VQ9Q 3HSBA 3CCUT 1RADB 1OULA 1GCQA 1QKXA 4YTLA 3OYHA 4M75A 3JB9G 1RAEB 1QVGA 1VQ6T 3M0TA 4E7SA 3M59A 3JB9H 2ZPGB 1YIJT 2BIVA 2DAQA 2DTHA 5LJ5h 2KMTA 3NMZC 3OMGA 4Y28E 1RI9A 1MNEA 1U3OA 5IXFA 2RPNA 2LX9A 3GP8A 2CZ7B 3HHTB 4J9EA 2OI3A 3F70A 1XTDA 2L3QA 1VQ8Q 2O2OA 4M78A 1ZA1B 2QEXT 2DEQA 2RK1A 3DLMA 4M7DF 1JEGA 5GANj 3OSVA 1K73U 2DYBA 5I11A 5J26A 5CAIA 2RJCA 2HKQB 4KT0E 4LDUA 4M7AF 3V8LA 2JTMA 3JCMV 3M0RA 2GFUA 3CCQA 3OW2P 4JUVA 2PQWA 4EMGA 1YFNA 5C6SA 3DKMA 5AT1B 2K6DA 1NJIU 1IXDA 5IN1A 5HCKA 2Y90A 2LVMA 2KRSA 1AHJB 2W10A 3CXCS 1SRLA 3MO8A 3QZ5B 2FPFA 2SRCA 2DRMA 3C94A 4E7LA 2YUPA 4J6WA 1NBEB 5CIUA 2DNUA 3OYJA 3OYGA 2ENMA 2AK5A 4C5EA 2O88A 3G7ZA 2OJ2A 3PIOA 2CSIA 4HVWA 3X28B 1WDXA 2HQXA 2DL3A 3G6EA 2HMAA 4QVCA 2EYXA 3QIIA 1VQ4A 2E6NA 1WJRA 4ELYC 3DB4A 2FRYA 4J9IA 2EW3A 1WZOA 2QA4Q 1VQMT 3M55A 5GAMe 2E41A 1FMKA 1VIFA 3VS1A 1JB0E 2E3HA 2XDDA 4C92F 2YUOA 3OQ5A 1Y96A 3RMSA 2ESWA 4AFQC 1IHWA 1VQ5Q 4RMOA 5FU6C 1OI1A 1KSWA 2E5KA 3OB9A 1AD5A 1MMNA 4UC4A 5J39A 4JRKA 2FRWA 2K4YA 2MK5A 3JAME 3CD6Q 2Y4XA 3VKIA 3VYGA 1R77A 2L5QA 2SEMA 1VQ9A 4GLKA 2CDTA 2F5KA 2CP0A 1VQLT 4A4EA 2A08A 3CMAQ 5LJ5g 2D6FA 1BCMA 1GCPA 3OYIA 2QQAA 1YJNT 5CKDA 5GAOm 3OYNA 2GTJA 1JBMA 3CC2Q 1BU1A 4ZGDB 1M2OA 9ATCB 5GAN4 4M7DE 1Q81U 2DPPB 1G3YA 4JDSA 3R6NA 3RBBB 2J7IA 4CC7A 1AVZC 5GAMd 4M7AE 1RUWA 1PC0A 2CP6A 1VQ8A 3AHUA 2M51A 2HD0A 1GBRA 2CT4A 2DD5A 2ABLA 2DETA 5GMKh 1K9AA 4Y91A 2LQ8A 4JJNK 2K5LA 4LD6A 3OW2A 2OTJQ 3HTRA 4R55A 1TU0B 4WTOB 1S72T 1YITT 2CZ1B 3EH1A 3JB9D 4ME7A 4D8KA 3INZA 3J81E 3RMQA 3RKWA 4HT9A 4IKFA 1WHJA 4LDYA 5L8RE 2DVJA 1EIFA 3HRSA 4OMMA 2L0AA 2C0OA 3FLGA 3VS5A 1SKUB 2KK4A 1Y07A 3CMET 2EKOA 3PVLA 4OMQA 4BE0A 1KC8U 5CKFA 4OP0A 4FL6A 3G71Q 4DOWA 2FL7A 3S3NA 3X24B 1MV3A 1B34A 1Q86R 1YN8A 3WVDB 4RUGA 2KI7A 1PKTA 4LDWA 4M78F 2RHYA 1M90U 1X75C 2H3EB 3VS4A 2QA4A 2ZPFB 4E7HA 1NEBA 2V8KA 2J6OA 3CC4A 1ZSZB 1UEBA 1ZA2B 3ZEHA 5CQXA 3EG3A 1FMVA 1YJWT 2A36A 2VKNA 1VQ5A 1KC8C 2CP3A 2P84A 3CD6A 8AT1B 4II1A 2E3IA 2EYYA 2DD4A 3MEUA 3X20B 1K76A 1W2BP 3JCMf 3BFMA 3CC7T 1ZSZC 2KBTA 5LJ3d 3CCLQ 5GMKj 5A2QE 2CYZB 3G1JA 3M56A 1D09B 3JB9J 1TH7A 3CMAA 1C1AA 2VGMA 4RTVA 3QBYA 2EKHA 4FYYB 4V2SA 1RABB 3RDVA 1JO8A 1X69A 3E1SA 1RI0A 1N27A 1LOJA 4PJOG 3CC2A 4L6V5 3MHXA 2DXCA 1YI2T 2HBPA 3GBQA 2H3JA 4ESRA 2OX7A 5GAN7 3OBYA 2K3XA 2QXFA 2LJ1A 1UGPB 3UA6A 1PKSA 2VB6A 3GIBA 4HA8A 2YSQA 1GL5A 1RACB 3BW1A 3CPWS 4OF1A 2HEQA 2GTOA 2K5IA 2ZPEB 3CCRT 1Q86C 2LDMA 2KEAA 1PHTA 2QAZA 4XU0A 2OTJA 4KBMB 3UF4A 1BI1A 3L2VA 3SB2A 2FHDA 4EDUA 2RQRA 1VQKQ 4J9DA 2JS2A 4FIBA 2VUBA 3A1PA 2K3BA 3CCUQ 4E2FB 3EHQA 3P8DA 3EGXB 3A8GB 1W70A 4KGZB 3S6WA 1VQ6Q 4LUEA 1QCNA 1G8XA 1YIJQ 1I5OB 2V1QA 4M78E 2JMAA 1WGSA 3OYEA 4AG2C 3ER0A 3JRZA 3OMCA 3G71A 5IHIA 2LZ6B 4DBRA 2MCNA 4DBFA 1RAGB 1BK2A 3M0UA 4R0KA 2GFAA 2EJFA 2ZZDA 3CCST 3VUBA 4HVUA 4XTYA 2QEXQ 1R0BG 2BE9B 2CH4A 3P8BB 2BTTA 1IGQA 1KD1U 3JCMJ 3J80E 2RJDA 3QYHB 1TS9A 2DIGA 3QJ6A 1WXTA 1B07A 4C5GA 2QQ9A 3TU4K 4J5YA 2VYTA 2MWPA 4C0DB 1MHNA 1NPPA 3GLXA 3JCMQ 2BZ8A 4JLGA 3OYAA 1UECA 2DIQA 2E4HA 3CEYA 1M1KU 3CCLA 2X4WA 1T0HA 2YHTA 3HFNA 2DZCA 4BD3A 1D0XA 5KYYB 1JXMA 3QWXX 1YHQT 2YXYA 3JCMP 2JTEA 3PTAA 3QWYA 3VS3A 5GANe 2QYZA 2EJ9A 2LCCA 3RNJA 3HP9A 1I5LA 1PRMC 2IPOB 3LWIA 4J6YA 1UJYA 2ZGWA 3EFSA 1G2BA 4MDWA 1VQMQ 1Q82R 1J3TA 2C06A 4M77B 4N4IA 2PNIA 1D1CA 3D7SB 2LT4A 1I07A 4FW1A 2BUDA 3VUZA 4P5NA 1MMAA 1B7TA 1BB9A 4O6JA 5CKBA 1NEGA 3TREA 4IUPA 4AFZC 1GBQA 4M77C 4X1VA 1QVPA 2RHZA 4OGEA 1VQKA 4RTXA 3RESA 3H8ZA 2HZYA 3EG9B 3CCUA 4WCIA 3MCAB 3OS0A 4MZTA 4QVZA 3RKYA 1VQLQ 5I2SA 3NHNA 4LD9K 2O4XB 4KGXB 1T3LA 2AHJB 1PD0A 2A0FB 2XMFA 4Q5WA 1YJNQ 1RL2A 4AMCA 1BBZA 2EQKA 2M9UA 3QDRB 5GANd 3EGUA 1ACMB 3OBWA 4E7JA 4QQGA 4VUBA 5GAMf 3HFOA 3LLRA 1U06A 1M3CA 2DM1A 1G83A 2D9TA 4M7DG 3CXCP 1OV3A 2I2LA 3QG1A 3LWHA 2CSQA 4GBQA 4M77E 2V8JA 2QEXA 4M7AG 5KYUB 3ME9A 4N4HA 1YCSB 5M9OA 1S72Q 1YITQ 2LC4A 4PLLA 4A63B 1Q82C 2RO0A 3FB9A 4MZMA 1BI0A 2G3RA 2RI2A 2RB6A 1K73R 2I0NA 2ZAEA 4XTVA 2RJEA 4FYVB 4JJBA 1ZSZA 4F7UB 2LTOA 3UA7A 3WXMB 3FIFA 4CRIA 1WJQA 4NS5A 4OMPA 1AWWA 4GY5A 1P92A 1FMWA 3CMEQ 2P0PA 3LW5E 1IHVA 4F14A 1NJIR 1MNDA 2LMJA 1LVKA 2YT6A 1H641 3OYDA 2W0ZA 1ZUUA 2LT1A 2MAMA 2FPEA 1UHFA 2LCSA 4LDVA 2PVOB 4DBHA 1N8RU 4LDXA 2DLPA 1YWOA 1SSFA 2P4RA 5GJWB 4KRTA 4C92G 1UFFA 2J06A 1X2QA 2KE9A 5FROA 1KG1A 1VQMA 2EGEA 2CP5A 2DE0X 4RTWA 1OQKA 1SHGA 3OYFA 1R0CB 3Q1JA 2NUPB 4BI4A 3THKA 2E10A 4XTWA 3VS0A 1YJWQ 3MP8A 2MWOA 1K4US 2VWFA 4J9CA 4PJNA 1FYNA 2R57A 2X3WD 1XOVA 2CGHA 2MPXC 1UHCA 1ZSGA 3OA6A 1XJWB 1JJ2A 3M0QA 1NYFA 5LJ3f 5LL6S 4N4GA 5HKCA 2Y4YA 2QTXA 3CC7Q 2YRDA 4PNOA 2HQEA 4X34A 1X2KA 4FYWB 3E19A 1VQLA 1ZX6A 4ZN3A 4EMKB 1PSFA 2RI5A 5GMKm 3JCMg 1K73C 3TQ7P 5CR2A 4FM4B 2JN0A 1YJNA 3BY7A 5IH2A 1XNIA 3CXCA 4RTZA 4A4GA 1V29B 1WXBA 3EGXA 4FT2A 4X9DA 2YWWA 2O31A 1YI2Q 5ECAA 4NL2A 4JRIA 3V8KA 1SEMA 4OGCA 4Z89A 4D6WA 1G5VA 3MP6A 3VS2A 3MEWA 4LN2A 4EMKC 3JB9F 1T0JA 1NJIC 5DLQE 5D6WA 2DTOA 1Q81R 4C0ZA 2D8JA 1BI3A 2LNHB 3QXEB 4JPBW 3CCET 1PNJA 5HY6A 3L2UA 5LJ5j 4C8QG 3CCRQ 3KUFA 1M8VA 2GF7A 1D0YA 2RQUA 1W1FA 1UJ0A 2K3YA 1SG5A 5J3BA 5GMKe 1YITA 1S72A 4HT8A 2QI2A 1AEYA 4M75G 4ELZC 1YBYA 1IO6A 4E47A 3PGGA 4XU1A 3PMTA 4Z02A 1X6GA 5FWCA 1RAAB 2DJZA 3CCJT 3LH5A 2FO0A 2KNBB 3PE0A 3H0HA 4BY6B 1AWXA 2NYSA 2MI6A 4EMHA 2CZ6B 2PTKA 4XQ3A 3CMEA 2JS0A 4M78G 1QCOA 5EG2A 2ZPIB 4M7AD 3UWNA 3VRZA 2LNVA 3I35A 1PRLC 2L3RA 4JZ4A 4KH1B 1KC8R 4BY6C 3CCSQ 2DBKA 1TTHB 2DYIA 3JCMb 2B86A 5CKEA 4A4FA 1V76A 1JXOA 2DKGA 5KYYA 3SDZA 2ZPBB 1DJ7B 5GAMh 4KUIA 2QTVA 1M4ZA 3OYBA 1I1JA 2Z0WA 3VJPA 4AFUC 3RUXA 3QKJA 1I81A 1WQ7A 1YJWA 1MMGA 2FZGB 4MDXA 1M90R 4O5VA 4XAXB 4M77A 2RQVA 5KH6A 1Q81C 3M0PA 1V1CA 3CPWP 5DLOA 1QVFP 3HRTA 2GQVA 3MJXA 2PUKB 3CC7A 1QLYA 5LJ3e 1UDLA 2D1XA 4JRPA 3META 1RAHB 3LYIA 3OSSC 1Y71A 2AKLA 4HCZA 3EG1A 4PJLA 1YHQQ 4C92D 4FCYA 3EG9A 1FX7A 2GQIA 3H0IA 2E1HA 4BUGA 4J9BA 3REBB 4J7IA 2K5FA 2O4XA 1YI2A 3ASKA 1TOVA 2DL7A 1K8AU 2KT1A 1WHKA 1JU5C 2JMCA 2J6KA 2O01E 2ATCB 2JT4A 2WSCE 2X4XA 2KRNA 2A3LA 2HQHA 4J6XA 1UGQB 1YJ9T 3CCRA 3DB3A 3A8HB 5CK9A 2KROA 2QQSA 4PK4A 2RQTA 1S1NA 3M53A 5KYUA 2QGFB 1FWZA 2QDYB 3M4YA 3QYGB 4XTUA 3OS2A 3KFVA 4OB2B 1KFZA 1M90C 2LJ3A 1KQSS 5GANf 1RAFB 1NLPC 4OVAA 2JNGA 4BE1A 1IZ6A 1JQQA 1AT1B 1RAIB 1VQPQ 1KJWA 2VVKA 3M9QA 2BZXA 1QWFA 2CUBA 4F7UA 1VQ7T 2JM8A 3V7SA 2K7AA 2KY9A 1HSQA 1AZGB 2K9GA 1AOJA 4AG1C 2CP2A 4C8QD 4HCKA 1M2VB 1ZUYA 1E7OA 2RHIA 2QQRA 3CCSA 1M9SA 5GAMg 2RK2A 1Z9ZA 2R5MA 2E65A 5GAN2 1U8RA 4M75D 3I55T 1AWOA 4TVRA 4MMLA 3GF5A 3C12A 1T3SA 5FRNA 1Y57A 4KGVB 3CPWA 1EX4A 4BDZA 1QVFA 1HK9A 4M4ZA 2XDPA 3VS7A 3ULRB 2HKNA 1NE8A 1KD1R 5CCAA 2F5TX 1TWBA 1OZ2A 3A8LB 1WHHA 2NUPA 3E9GA 2HDAA 2DVEA 2DILA 4ZTFA 1GXIE 1H3HA 1KHIA 3PVQA 5GAOl 1D1AA 2DO3A 2NUZA 3EHRA 4QVDA 1K9MU 1PSEA 2ECZA 1K0SA 2GCXA 3PIPA 2M0YA 1M1KR 2DMOA 2EAYA 1KIKA 1NLOC 2F2XA 4EIKA 2RI3A 4MZPA 4EMKA 2G6FX 1OYXA 1M8MA 2YRCA 3TSZA 2A28A 5IHNA 2RF0A 4RTTA 1OZ3A 2YUQA 4HCCA 3SWNB 3M4GA 1OX9A 2X4JA 4KH0B 5DM7R 1VQNQ 4QT7A 3J7AF 2E6ZA 3H6ZA 1O9SA 1HJDA 2MMPA 2D0QB 2DTIA 1W2BA 4M77F 2LP5A 1M27C 2JTFA 3OYKA 2MYSA 4BI8B 4RKUE 1VUBA 2QDLA 3SWNC 1WJSA 1VIEA 3RR6A 5L23A 3KBGA 2YDLA 5GAOp 3VRYA 5LJ3g 1X01A 1WLPB 2DRKA 2L2PA 5A0DA 4A54A 2D0NA 2JOYA 1YCYA 4QW2A 1KD1C 4FSXA 4Z88A 4XU2A 7AT1B 3EGDB 1W4SA 5GAOn 4FU6A 4C0DC 4HCBA 2IG0A 2KT8A 3L2WA 1ZBXA 2CREA 4JS5A 5GAN6 4X9CA 2HCKA 2HSEB 1WX6A 3EG0A 3SD4A 1Q7YU 2EBPA 4PJOB 3MPUB 1KQ1A 3H41A 1ZHIA 1QQJA 2F1LA 4LXCA 2XICA 1LNXA 3CCEQ 3AT1B 5CO7A 2LQNA 2FEIA 2K79A 4J9HA 1M1KC 1U1TA 1U1SA 2WSFE 1OU9A 1PG5B 4OMOA 1ABQA 1TUDA 3CCMT 2DL8A 2EWNA 4OMFB 2M02A 4PJOC 2KYBA 3M5AA 2YLBA 3HL8A 1WQWA 1VQOT 3CCJQ 4OB1B 5KYWB 4HXJA 4PLIA 2KRMA 4RCBA 3PMIA 2DBMA 3OS5A 4PJOD 1VQ6A 3EFRA 1YIJA 3SEMA 2C0TA 4LE9A 5IXBA 1VQPT 3JCMh 4DBQA 4NL3A 4AT1B 4F7UF 3S3MA 2GGRA 1WHMA 4IURA 5LJ5e 4B9WA 1QKWA 4IIMA 1VYUA 2VC8A 1MMDA 1OX8A 2BKDN 3I56T 2BE7D 1E6GA 4EPCA 1N8RR 2COZA 1OEBA 1GFCA 4DOVA 4LUDA 2DA9A 1TUGB 2CKKA 2F69A 2O9SA 4XU3A 2VGNA 3NTHA 3FEOA 2OTLT 1I4K1 1BI2A 2LQWA 4AFSC 5KYNA 2BZYA 4OMLA 3OS1A 5CKHA 3G4ST 2AZSA 2EIFA 1NYGA 2FG0A 3VV0A 2E5QA 5C0MA 4IUTA 1Y7XA 2RHUA 2KDSA 5FLXE 1OPKA 3LGFA 1QVGS 2RH2A 1M30A 1N5ZA 4K11A
chains in the Genus database with same CATH topology
4J83A 5GMKj 3UT1A 1VQPA 5A2QE 2CYZB 2MI6A 3M56A 5KE3A 1ZQ1A 3JB9J 2P0QA 1TH7A 5FU7B 4EMHA 2CZ6B 4XQ3A 3CMAA 3CMEA 2VGMA 3QHSA 5LJ5d 2XU8A 4MMKA 3QBYA 3CCVT 2V8IA 3NTIA 4M78G 4QQDA 4V2SA 5EG2A 3CBOA 1M1FA 4CI0C 4ZGJB 3JCMe 4C5IA 3E1SA 1RI0A 1N27A 2EFIA 2ZPIB 4M7AD 3UWNA 1LOJA 3G71T 4PJOG 2LNVA 3CC2A 3L42A 3CBMA 4L6V5 3MHXA 2L3RA 2DXCA 1YI2T 2HBPA 2H3JA 4BY6C 3I56A 5GAN7 3OBYA 2K3XA 2QXFA 3JCMb 5CKEA 1UGPB 1UB4A 4A4FA 4BB7A 2DKGA 3A8MB 1UGSB 5FU7C 3GIBA 3SDZA 2PVGB 4HA8A 2ZPBB 4BE2A 3M58A 3CCEA 1DJ7B 4J7FA 3M54A 5GAMh 1VQNT 4KUIA 4FT4A 1M4ZA 2KSSA 3BW1A 4N0AA 3OYBA 1WPYA 3CPWS 1W2BS 3V7CA 3VJPA 2VV5A 4OF1A 2KVQG 3FRNA 3RUXA 3QKJA 2OTLA 1I81A 1WQ7A 2K5IA 2IVWA 2ZPEB 3CCRT 2LDMA 1YJWA 1Q86C 4MDXA 2YRVA 4XU0A 3DLLA 2OTJA 4C92A 2EYQA 3PNWC 4DA4A 4KBMB 3BDLA 4O5VA 1N8RC 4XAXB 4M77A 3ZEHA 1BI1A 3L2VA 3A5ZB 3G4SA 3SB2A 5KH6A 1Q7YC 2FHDA 4EDUA 1Q81C 3LGLA 3OYYA 1JJ2S 2RHXA 2DXUA 4F7UE 2K57A 4FIBA 4C0GA 4C0FA 2VUBA 2JZ2A 5DLOA 3CCJA 3HRTA 2GQVA 1I8FA 2E70A 3JB9I 3M57A 3P8DA 2PUKB 3CC7A 4IUVA 5D6XA 5LJ3e 3A8GB 2XG8D 3PT9A 3OYLA 3S6WA 4JRPA 3QJYA 3META 1B34B 3UPUA 2ZCFB 3LYIA 1Y71A 1JRIA 2EQUA 3OSSC 4OB3B 3T9NA 3CCLT 4HCZA 4M78E 4C92D 5HK3A 3JCMd 3CCVA 1WGSA 1WNLA 1N9SA 5GANg 5GANh 3OYEA 4M77D 2VXEA 3ER0A 3JRZA 3OMCA 3V7RA 3CCSA 1FX7A 5A0GA 4PJOE 3JSCA 2E1HA 4BUGA 3QUIA 3G71A 4C5HA 1Q82U 1MGQA 4J7IA 2K5FA 2O4XA 4XK8E 1YI2A 5D6YA 4XTZA 3ASKA 4E7IA 1K8AU 1FXXA 2DXBA 2OAUA 4A4HA 2GFAA 2KAFA 3HPWA 3X25B 4M7DB 2EJFA 2ZZDA 3CCST 3VUBA 2M16A 2O01E 4XTYA 4JS4A 3C95A 3P8BB 5FU6B 2HAXA 1VQNA 3TEEA 4A4KA 3GOXA 2RJFA 3MEVA 3VYHB 2XHCA 2WSCE 2A7YA 2X4XA 2EQMA 4M7AB 2A3LA 2MF2A 3FC3A 2K2VA 4J6XA 3LH0A 2YLCA 2WACA 1KD1U 3JCMW 1UGQB 1YJ9T 2P4TA 3JCMJ 3CCRA 3DB3A 3A8HB 5CK9A 3J80E 3P8HA 1M5Q1 2RJDA 3PFSA 3QYHB 2QQSA 3L2QA 2RA2A 2CS7A 3BDUA 1BIBA 3X26B 4M7DC 2DIGA 2DK3A 2ZPHB 4J8OA 4ATOA 3SFMA 3QJ6A 2HNIA 3QO3A 3SWNA 4C5GA 3M53A 2QQ9A 3TU4K 2DXTA 3R6OA 4J5YA 1FWZA 3CCQT 2QDYB 2VYTA 2P0KA 3QZ9B 4IUUA 3M4YA 3OYMA 1VQKT 4B9XA 3QYGB 4M7AC 4XTUA 4A53A 5GAOq 3RIRA 1KHCA 4C8QA 2MWPA 4C0DB 3OS2A 1D3BA 4OB2B 1MHNA 1NPPA 3GPLA 1M90C 3GLXA 3JCMQ 3HSBA 3CCUT 4JLGA 3OYAA 5GAN5 1KQSS 4M7DD 5GANf 2DIQA 3CEYA 3O8VA 4OVAA 4YTLA 2JNGA 5CQYA 3OYHA 4BE1A 4M75A 1M1KU 3CCLA 3JB9G 1N9RA 1QVGA 2JVVA 1VQ6T 2X4WA 1IZ6A 2YHTA 3M59A 3JCMX 2E64A 3JB9H 3M9QA 3HFNA 2DZCA 3EAEA 3E9FA 4BD3A 2ZPGB 3L2RA 1YIJT 2BIVA 2DAQA 2DTHA 5LJ5h 1X6OA 2KMTA 4F7UA 3OMGA 3PTAA 4Y28E 3JCMP 1YHQT 1VQ7T 3V7SA 2KY9A 5GANe 2R58A 2EJ9A 2LCCA 3HP9A 1I5LA 2E12A 2EJGA 2LX9A 4JLIA 4C8QD 3NFCA 3GP8A 2CZ7B 3HHTB 3LWIA 1G3SA 2RHIA 2QQRA 4J6YA 3FDRA 1M9SA 5GAMg 2ZGWA 2RK2A 3EFSA 5KCOA 2R5MA 2E65A 3F70A 4C92B 3MEAA 1XTDA 2LCLA 4MDWA 3G6ET 5GAN2 1M1GA 2C06A 1VQ4T 1U8RA 4M77B 4N4IA 2PU9B 1O75A 2XI9A 3MP1A 4M75D 4M78A 3I55T 3OW2S 2QEXT 2DEQA 2LT4A 2RK1A 2BUDA 3DLMA 4TVRA 3VUZA 4P5NA 2DZ9A 1YJ9A 4M7DF 2L8DA 4MMLA 4N0AC 4PJOA 3GF5A 3C12A 5FRNA 4WF2A 5KE2A 5GANj 3OSVA 1K73U 3CPWA 4XTXA 5J26A 4O6JA 2RJCA 5CKBA 4KT0E 1HK9A 5CAIA 4BDZA 1QVFA 4LDUA 2XDPA 3TREA 4IUPA 4M7AF 3V8LA 4C92C 2JTMA 1NE8A 3JCMV 5CCAA 2KQWA 2GFUA 3ZBDA 3CCQA 2F5TX 2FVUA 4M77C 1OZ2A 1QVPA 2RHZA 2XK0A 3A8LB 4JUVA 4OGEA 2PQWA 3E9GA 1VQKA 3RKXA 5IT9E 3RESA 2R5AA 4BI3A 4EMGA 4M7DA 2DVEA 5C6SA 3H8ZA 3DKMA 4C8QF 4ZTFA 1GXIE 3CCUA 5GAOr 1KHIA 3MCAB 1NJIU 3OS0A 5IN1A 4MZTA 4QVZA 3RKYA 5GAOl 2DO3A 2Y90A 5I2SA 4LD9K 2O4XB 2LVMA 1VQ9T 1KQ2A 1AHJB 2AHJB 3CXCS 3MO8A 4M75F 3QZ5B 4Q5WA 4QVDA 1RL2A 3L2ZA 2WSEE 1K9MU 1PSEA 3C94A 2EQKA 2M9UA 4E7LA 4J6WA 5CIUA 3RERA 1QP3A 3OYJA 2GCXA 3CBPA 3QDRB 3OYGA 3PIPA 5GANd 4RG8A 1VQ7A 2XKOC 2EAYA 3OBWA 4E7JA 4QQGA 4VUBA 5GAMf 3HFOA 3LLRA 4ZTJA 4C5EA 4E7KA 2RI3A 4MZPA 2D9TA 3G7ZA 4DQ2A 3PIOA 4EMKA 2CZ0B 3X28B 5HK0A 4M7DG 1OYXA 1QW1A 2HQXA 2I2LA 3G6EA 4QVCA 3QG1A 3QIIA 4C92E 1VQ4A 2E6NA 3LWHA 1WJRA 4ELYC 3DB4A 1OZ3A 4M77E 5I2MA 3I55A 3CPFA 4HCCA 2V8JA 3SWNB 2QEXA 3M4GA 1VQMT 2X4JA 3M55A 4M7AG 5GAMe 1VQ8T 2E41A 3ME9A 4N4HA 5DM7R 2M0OA 3J7AF 2E6ZA 1VIFA 2VXFA 1JB0E 3H6ZA 1O9SA 5M9OA 2XDDA 4L59A 2PVDB 4C92F 2MMPA 3NTKA 3OQ5A 4C8QB 2D0QB 4RCCA 1Y96A 2DTIA 3RMSA 1D3BB 2LC4A 4M77F 1W2BA 4PLLA 4IUQA 2X35A 4QQ6A 4RMOA 3S3OA 5FU6C 1OI1A 2JTFA 3OYKA 5KCHA 1Q82C 3OB9A 4BI8B 4UC4A 2RO0A 3FB9A 4MZMA 5J39A 1BI0A 2G3RA 1G3TA 4M75B 2RI2A 4RKUE 1VUBA 2RB6A 3L1AA 4JRKA 1K8AC 4XTVA 3SWNC 1WJSA 1VIEA 2K4YA 3JAME 2RJEA 5GAMj 5FRMA 5GMKl 3KBGA 2Y4XA 4BACA 2NLUA 4F7UB 5GAOp 3VKIA 2LTOA 3WXMB 3FIFA 5LJ3h 3VYGA 4C8QC 1WJQA 4CRIA 5LJ3g 1X01A 4NS5A 1QP2A 5A0DA 4A54A 2L5QA 2JOYA 4GY5A 1VQ9A 1P92A 3QSUA 1YCYA 4GLKA 3KXTA 2F5KA 2RD1A 4QW2A 1VQLT 4A4EA 4FSXA 1KD1C 2P0PA 5LJ5g 4R56A 2XIDA 1KQSA 2D6FA 3LW5E 4XU2A 1W4SA 4M75C 5GAOn 3LX7A 2QQAA 3OYIA 4FU6A 4C0DC 4HCBA 1H641 4PKCC 2IG0A 5DY9A 5CKDA 5GAOm 3OYDA 3L2WA 1ZBXA 1YJNT 1Q86U 3OYNA 4JS5A 2LT1A 4PL6A 2MAMA 1BKBA 2JUFA 4M78B 5GAN6 1JBMA 5I21A 4KULA 4LDVA 2PVOB 4X9CA 4ZN1A 4ZGDB 1N8RU 4LDXA 1NPRA 3HRUA 5GAN4 3SD4A 1Q81U 1SSFA 2DPPB 1Q7YU 1G3YA 4M7DE 4PJOB 5A0LA 4RG2A 1KQ1A 4JDSA 2XDBA 4C92G 1ZHIA 2FYKA 1R8OB 1NZ9A 4M77G 2XICA 3WVEB 5FROA 1LNXA 5GAMd 5CO7A 4M7AE 1KG1A 3A8OB 3GNFB 1VQMA 3JCMc 1VQ8A 4ZGEB 1M1KC 3AHUA 1U1TA 1U1SA 2WSFE 2HD0A 2DD5A 3OYFA 4M78C 3Q1JA 2QA4T 5GMKh 4BI4A 5GMKi 4Y91A 2E10A 2LQ8A 3CCMT 4XTWA 4JJNK 2K5LA 4LD6A 3OW2A 3MP8A 2MWOA 2EWNA 1N6AA 4OMFB 4C8QE 2LQKA 3CC4T 4PJOC 2R57A 4R55A 1QVFS 1XQHA 2L89A 1XOVA 2CGHA 1YITT 1S72T 3M5AA 2CZ1B 2YLBA 3HL8A 1VQ5T 3OA6A 2B8AA 1WQWA 5GAN8 3OYCA 1JJ2A 1VQOT 4M75E 4OB1B 4KUDK 3JB9D 4M78D 5LJ3f 5LL6S 4ME7A 5AYFA 3INZA 4PLIA 4N4GA 4RCBA 1UGRB 3PMIA 5HKCA 2OTLT 2Y4YA 2QQBA 2QTXA 3OS5A 4PNOA 3CD6T 2PUOB 3J81E 4PJOD 2HQEA 1VQ6A 3RMQA 5LJ5f 2RM4A 4X34A 3RKWA 3V8JA 3E19A 4HT9A 4IKFA 3EFRA 5GAN3 1VQLA 3QPHA 1YIJA 4LDYA 5L8RE 4ZN3A 4EMKB 1YHQA 1EIFA 1PSFA 2RI5A 3HRSA 5GMKm 1VQPT 5CVIA 3UDCA 3JCMh 3JCMg 4NL3A 1K73C 5CR2A 1H3ZA 3FLGA 2M1HA 4F7UF 2KK4A 3S3MA 4FM4B 3TCJA 2JN0A 1Y07A 3BY7A 4IURA 1XNIA 3CMET 2EKOA 3CXCA 1YJNA 4BE0A 1KC8U 3CMAT 4OB0B 4A4GA 1HXDA 5CKFA 1V29B 4FL6A 4OP0A 5LJ5e 4FT2A 4DOWA 4X9DA 3FJPA 4B9WA 1BYMA 2FL7A 4NL2A 4JRIA 3V8KA 3S3NA 3X24B 4OGCA 3CC2T 2X4YA 4D6WA 1B34A 2VC8A 1G5VA 3MP6A 2BKDN 1Y96B 3MEWA 3WVDB 3I56T 4LDWA 4EMKC 3JB9F 4M78F 1NJIC 4EPCA 2RHYA 5LJ3j 2LRQA 5DLQE 3HKSA 2DTOA 5D6WA 4C0ZA 4DOVA 1BI3A 4HKEA 1M90U 1LJOA 3QXEB 3CCET 4PJOF 1X75C 2QA4A 2ZPFB 1S72A 5HY6A 3L2UA 4E7HA 1K9MC 3CCMA 5LJ5j 4C8QG 1G3WA 3KUFA 1M8VA 2V8KA 2GF7A 2CKKA 2F69A 3CC4A 1UEBA 2VGNA 3NTHA 3FEOA 4XU3A 5CQXA 3C4SA 3VU3C 2K3YA 5J3BA 5GMKe 3GNGA 1BIAA 1I4K1 1BI2A 1YITA 1YJWT 2QI2A 4HT8A 2OTJT 1VQ5A 2XD0A 1KC8C 4M75G 4ELZC 2EQJA 1YBYA 3OS1A 1VQOA 5IAYA 5CKHA 3G4ST 4E47A 3PGGA 4XU1A 4JRQA 2EIFA 3PMTA 4M7AA 4Z02A 3VV0A 4BDYA 2E5QA 2DJZA 2FB7A 3CCJT 4F7UG 3CD6A 4II1A 4NOYA 2DD4A 3MEUA 5C0MA 3X20B 3OY9A 4IUTA 1IREB 1Y7XA 2RHUA 3N5BB 4L5GA 3JCMf 3BFMA 3URGA 2KDSA 3ZFJA 5FLXE 3LGFA 1QVGS 3CC7T 2RH2A 5LJ3d 4BY6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X4X A;  2EQM A;  3UT1 A;  3OYF A;  3Q1J A;  3FC3 A;  3MO8 A;  3LH0 A;  4Q5W A;  5KE3 A;  2WAC A;  4LD6 A;  3MP8 A;  2MWO A;  2EQK A;  3DB3 A;  4E7L A;  5CIU A;  3QBY A;  3P8H A;  3PFS A;  2RJD A;  3NTI A;  2QQS A;  2R57 A;  4QQD A;  3OYG A;  3OYJ A;  2L89 A;  3L2Q A;  4C5I A;  2DIG A;  1RI0 A;  1N27 A;  2EFI A;  4QQG A;  4E7J A;  3QJ6 A;  3UWN A;  3OA6 A;  2B8A A;  4C5G A;  3LLR A;  3OYC A;  4ZTJ A;  4C5E A;  3L42 A;  4E7K A;  2RI3 A;  2L3R A;  2D9T A;  2VYT A;  2P0K A;  4IUU A;  3OYM A;  1OYX A;  2HQX A;  4PLI A;  4N4G A;  4B9X A;  2K3X A;  3PMI A;  1KHC A;  2MWP A;  4A4F A;  3OS2 A;  3QII A;  2HQE A;  2E6N A;  1MHN A;  1WJR A;  4X34 A;  3DB4 A;  1OZ3 A;  4BE2 A;  3OYA A;  4IKF A;  3OYB A;  2DIQ A;  3CEY A;  3ME9 A;  3O8V A;  4N4H A;  4OVA A;  2M0O A;  3OYH A;  4BE1 A;  2RI5 A;  3H6Z A;  2X4W A;  5M9O A;  4L59 A;  1H3Z A;  3FLG A;  2M1H A;  3NTK A;  3OQ5 A;  3QKJ A;  3S3M A;  3M9Q A;  4IUR A;  1XNI A;  3EAE A;  2EKO A;  2LDM A;  3E9F A;  4PLL A;  4BD3 A;  3L2R A;  4BE0 A;  2YRV A;  2BIV A;  2DAQ A;  2X35 A;  4IUQ A;  4QQ6 A;  3PNW C;  4A4G A;  3OMG A;  1OI1 A;  2JTF A;  4FL6 A;  3OYK A;  3BDL A;  3S3O A;  5KCH A;  3OB9 A;  4B9W A;  3L2V A;  4UC4 A;  2RO0 A;  5J39 A;  3S3N A;  2R58 A;  2G3R A;  2FHD A;  4EDU A;  5KH6 A;  2RI2 A;  3LGL A;  2LCC A;  2RHX A;  2X4Y A;  1G5V A;  1WJS A;  3MP6 A;  2BKD N;  2JZ2 A;  2RJE A;  3MEW A;  2RHI A;  2QQR A;  5FRM A;  3FDR A;  5KCO A;  4BAC A;  2R5M A;  2NLU A;  3F70 A;  3MEA A;  2RHY A;  2LTO A;  3P8D A;  2LRQ A;  4IUV A;  4CRI A;  4N4I A;  1WJQ A;  5D6X A;  5D6W A;  4NS5 A;  3OYL A;  3MP1 A;  3S6W A;  4GY5 A;  3MET A;  2BUD A;  2F5K A;  3DLM A;  4QW2 A;  3LYI A;  4A4E A;  3L2U A;  2EQU A;  4E7H A;  2L8D A;  3KUF A;  4HCZ A;  2GF7 A;  5FRN A;  2CKK A;  5KE2 A;  3LX7 A;  3OYI A;  4FU6 A;  1WGS A;  3ZEH A;  3NTH A;  5J26 A;  3FEO A;  3OYE A;  2IG0 A;  2RJC A;  2K3Y A;  3C4S A;  3OYD A;  3L2W A;  4BDZ A;  3OYN A;  2XDP A;  3OMC A;  4IUP A;  4PL6 A;  2EQJ A;  4C5H A;  3OS1 A;  5IAY A;  2GFU A;  2O4X A;  5D6Y A;  3PMT A;  1OZ2 A;  1SSF A;  2RHZ A;  2XK0 A;  3ASK A;  4Z02 A;  3SD4 A;  4E7I A;  4RG2 A;  2PQW A;  3E9G A;  4BDY A;  2E5Q A;  4A4H A;  2R5A A;  2GFA A;  4II1 A;  5C6S A;  3H8Z A;  3OY9 A;  3MEU A;  5C0M A;  2M16 A;  4ZTF A;  4IUT A;  5FRO A;  2RHU A;  3OS0 A;  5IN1 A;  3LGF A;  4QVZ A;  3GOX A;  2RJF A;  3MEV A;  2O4X B;  2LVM A; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  4J83 A;  3UT1 A;  2O9V A;  1RLQ C;  5KE3 A;  1ZQ1 A;  2H8H A;  2P0Q A;  3QHS A;  5LJ5 d;  2XU8 A;  2MOX A;  2V8I A;  4QQD A;  3CCV T;  2DER A;  3CBO A;  4CI0 C;  4ZGJ B;  4C5I A;  2EFI A;  2ED0 A;  3C0C A;  1RLP C;  3CBM A;  2A37 A;  2JW4 A;  4IIO A;  4ORZ A;  3EG2 A;  4BB7 A;  3A8M B;  1UGS B;  4QKU A;  2PVG B;  4CC4 B;  3EFO B;  3M58 A;  3CCE A;  4J7F A;  1VQN T;  2KSS A;  3H9N A;  2AZV A;  1YJ9 Q;  1IGU A;  1WPY A;  5FW9 A;  1QCF A;  1VYV A;  3FRN A;  1M2V A;  2IVW A;  1AZE A;  3DLL A;  2EYQ A;  3PNW C;  4DA4 A;  1SHF A;  1N8R C;  1YWP A;  1JJ2 S;  2RHX A;  1UTI A;  4F7U E;  4C0G A;  2CP7 A;  4C0F A;  3CCJ A;  1I8F A;  1NG2 A;  3JB9 I;  5D7U A;  3H0F A;  5D6X A;  2XG8 D;  3PT9 A;  4PJM A;  3QJY A;  1BCO A;  1VYT A;  1TXQ A;  3UPU A;  4RTU A;  2EQU A;  2QGG A;  2ED1 A;  1VQ7 Q;  1WNL A;  5GAN g;  2DFU A;  2DJQ A;  5A0G A;  3JSC A;  1MGQ A;  1PWT A;  1HYO A;  5D6Y A;  4E7I A;  2OAU A;  2COW A;  4A4H A;  5FWB A;  3HPW A;  2KAF A;  4M7D B;  2M16 A;  3I55 Q;  3U23 A;  4JS4 A;  1PD1 A;  5FU6 B;  3GOX A;  4A4K A;  3MEV A;  3VYH B;  4CC3 A;  2EQM A;  4Y92 A;  1M3B A;  4M7A B;  2KGT A;  2MF2 A;  3FC3 A;  2K2V A;  3LH0 A;  2YLC A;  2P4T A;  3PFS A;  1M5Q 1;  3L2Q A;  4LNP A;  3CC4 Q;  2CS7 A;  4M7D C;  2DK3 A;  3EH2 A;  3SFM A;  3QO3 A;  3SWN A;  2DXT A;  2HL5 C;  2X51 A;  3CQT A;  3CCQ T;  1C0M A;  4IUU A;  3OYM A;  4M7A C;  4A53 A;  4FYX B;  5GAO q;  6AT1 B;  2EYZ A;  3GPL A;  4FSS A;  2RMO A;  2JM9 A;  4J9F A;  5GAN 5;  4M7D D;  1PM3 A;  1ZUK A;  3O8V A;  5CQY A;  1N9R A;  2JVV A;  3JCM X;  1IB8 A;  2E64 A;  3EAE A;  3E9F A;  3L2R A;  1D1B A;  1CSK A;  1X6O A;  2EPD A;  2R58 A;  1KQS P;  2E12 A;  1Q95 G;  2EJG A;  4JLI A;  3NFC A;  1G3S A;  1SSH A;  3EGD A;  3FDR A;  5KCO A;  4C92 B;  3MEA A;  3G6E T;  2LCL A;  1M1G A;  1VQ4 T;  2PU9 B;  1O75 A;  2RNA A;  2XI9 A;  3MP1 A;  1H92 A;  3OW2 S;  1K8A R;  2J6F A;  1GRI A;  2DZ9 A;  1ZLM A;  1YJ9 A;  2L8D A;  4N0A C;  2EVR A;  4PJO A;  4WF2 A;  5KE2 A;  4XTX A;  1E6H A;  1GFD A;  1ZBJ A;  1I0C A;  4ANJ A;  4DEX A;  4C92 C;  2KQW A;  3ZBD A;  1A0N B;  2FVU A;  2XK0 A;  1M3A A;  1LCK A;  3RKX A;  5IT9 E;  1OOT A;  2R5A A;  4BI3 A;  4C8Q F;  3TVT A;  2HBW A;  4B6M A;  1F1B B;  5GAO r;  4PFP A;  3I5R A;  1VQ9 T;  1KQ2 A;  1UE9 A;  4M75 F;  3IQL A;  1LPL A;  2RN8 A;  5KYW A;  3L2Z A;  2WSE E;  2LX7 A;  3RER A;  1QP3 A;  1VQ7 A;  2PZ1 A;  3CBP A;  4RG8 A;  2XKO C;  4J9G A;  2NUT B;  4ZTJ A;  4E7K A;  4DQ2 A;  2FZC B;  1IRX A;  2CZ0 B;  5HK0 A;  1QW1 A;  5I22 A;  1WHG A;  2DL4 A;  4C92 E;  4JJD A;  1WI7 A;  5I2M A;  3I55 A;  2QAS A;  3CPF A;  4DEY A;  3MKD A;  1VQ8 T;  3CCM Q;  4JZ3 A;  2M0O A;  4PFZ A;  1Y0M A;  2K2M A;  2VXF A;  5KYX B;  2EGC A;  4L59 A;  2PVD B;  3NTK A;  4C8Q B;  4RCC A;  1D3B B;  1VA7 A;  1TSF A;  4IUQ A;  2X35 A;  4QQ6 A;  3S3O A;  2ROL A;  4F04 B;  2HL3 A;  2KXC A;  3E2U A;  5KCH A;  1VQO Q;  1VOM A;  4Z8A A;  1G3T A;  4M75 B;  2VAS A;  3L1A A;  1K8A C;  5GAM j;  5FRM A;  5GMK l;  4BAC A;  2KXD A;  2NLU A;  5LJ3 h;  4C8Q C;  1QP2 A;  2KYM A;  1QMC A;  3QSU A;  3KXT A;  2RD1 A;  5GJV B;  2MIO A;  2V26 A;  1GCQ C;  4R56 A;  1KQS A;  2XID A;  4F17 A;  4M75 C;  2EGA A;  3LX7 A;  4PKC C;  5DY9 A;  1Q86 U;  3M0S A;  4PL6 A;  5I21 A;  4M78 B;  1BKB A;  2JUF A;  4KUL A;  1YNZ A;  2V1R A;  4ZN1 A;  1UG1 A;  1K9M R;  1NPR A;  2JXB A;  3HRU A;  1K1Z A;  3I56 Q;  4D8D A;  2AIR B;  4RG2 A;  5A0L A;  2ROT A;  2FYK A;  2L3P A;  2DL5 A;  2FZK B;  1R8O B;  1NZ9 A;  1WXU A;  4M77 G;  3WVE B;  3A8O B;  3GNF B;  3REA B;  3JCM c;  4ZGE B;  2J05 A;  4M78 C;  1MUZ A;  2QA4 T;  5GMK i;  2OTL Q;  4PFO A;  1CKA A;  1N6A A;  1OPL A;  4C8Q E;  2LQK A;  1CKB A;  3NGP A;  3CC4 T;  1QVF S;  1XQH A;  2L89 A;  1UUE A;  3G4S Q;  1VQ5 T;  3EFO A;  1OU8 A;  2B8A A;  5GAN 8;  3OYC A;  4M75 E;  2DF6 A;  4KUD K;  4M78 D;  5AYF A;  3O5Z A;  1H8K A;  1UGR B;  2QQB A;  5EC7 A;  1NM7 A;  3CD6 T;  2PUO B;  4RTY A;  5LJ5 f;  2RM4 A;  3V8J A;  3NPF A;  2IIM A;  5GAN 3;  2FPD A;  3QPH A;  2CH4 W;  1YHQ A;  4E6R A;  5CVI A;  3UDC A;  3CCV Q;  1H3Z A;  2M1H A;  1C6V X;  3TCJ A;  3CMA T;  4OB0 B;  4E7Z A;  1HXD A;  1BYM A;  3FJP A;  2F2W A;  2L3S A;  2X4Y A;  3CC2 T;  1Y96 B;  1KK7 A;  2OAW A;  5LJ3 j;  2LRQ A;  3HKS A;  1Q7Y R;  4OMN A;  4HKE A;  1LJO A;  4PJO F;  1QWE A;  4ZNX A;  1K9M C;  3CCM A;  1SPK A;  1G3W A;  1UGV A;  1W2B S;  3VU3 C;  4M7D A;  3C4S A;  1TUC A;  1BIA A;  3GNG A;  2CUD A;  2OTJ T;  2QG9 B;  1WYX A;  2XD0 A;  2EQJ A;  2EYW A;  1VQO A;  5IAY A;  4JRQ A;  2RQW A;  4M7A A;  4BDY A;  2FB7 A;  4F7U G;  1TG0 A;  1K0X A;  4NOY A;  3OY9 A;  1IRE B;  3ZFJ A;  4L5G A;  3N5B B;  2X9H A;  3URG A;  2XDB A;  3VS6 A;  1X6B A;  1EFN A;  1VQP A;  2HSP A;  5FU7 B;  2COY A;  4MMK A;  2X3X D;  3NTI A;  1WFW A;  1M1F A;  3JCM e;  3ZL7 C;  1QVG P;  3G71 T;  3L42 A;  2CT3 A;  2C0I A;  3I56 A;  1X43 A;  1UB4 A;  5FU7 C;  1EZZ B;  4BE2 A;  3SHW A;  3M54 A;  4FW2 A;  3I9Q A;  1AWJ A;  4FT4 A;  4N0A A;  4F16 A;  2DX1 A;  2F2V A;  3V7C A;  2VV5 A;  1YP5 A;  2KVQ G;  2OTL A;  2GBQ A;  2YRV A;  4C92 A;  8ATC B;  3BDL A;  3QDF A;  3CCQ Q;  3A5Z B;  3G4S A;  1Q7Y C;  5IHK A;  3LGL A;  3OYY A;  4PJJ A;  2DXU A;  2K57 A;  1B3Q A;  2JZ2 A;  2GNC A;  1SRM A;  1HD3 A;  2E70 A;  2DEU A;  3M57 A;  4IUV A;  1D0Z A;  1U5S A;  2QK0 A;  3OYL A;  2LJ0 A;  1B34 B;  4HVV A;  2ZCF B;  1Z9Q A;  3T9N A;  1JRI A;  4OB3 B;  2D8H A;  1X27 A;  3CCL T;  1JJ2 P;  2EQI A;  5HK3 A;  3JCM d;  3CCV A;  5GAN h;  1N9S A;  1WA7 A;  1ARK A;  3FJ5 A;  4M77 D;  1W6X A;  2VXE A;  3V7R A;  4PJO E;  1PCX A;  3QUI A;  4C5H A;  1Q82 U;  1MV0 B;  4XK8 E;  3TSW A;  4XTZ A;  2AKK A;  1FXX A;  2DXB A;  3G6E Q;  1SF9 A;  3X25 B;  1VQ4 Q;  1WHL A;  3I5S A;  4CC2 A;  3C95 A;  2NWM A;  2HAX A;  1VQN A;  3TEE A;  2RJF A;  4GLM A;  2XHC A;  2A7Y A;  2NUT A;  3UAT A;  3A98 A;  1ABO A;  2WAC A;  3JCM W;  2YUN A;  3P8H A;  1WIE A;  3JV3 A;  2RA2 A;  3BDU A;  1BIB A;  2KR3 A;  3X26 B;  4J8O A;  2ZPH B;  4ATO A;  3BE3 A;  2HNI A;  4JJC A;  3R6O A;  2P0K A;  3QZ9 B;  2AT1 B;  5KYX A;  1VQK T;  4B9X A;  3RIR A;  1KHC A;  4C8Q A;  1D3B A;  1VQ9 Q;  3HSB A;  3CCU T;  1RAD B;  1OUL A;  1GCQ A;  1QKX A;  4YTL A;  3OYH A;  4M75 A;  3JB9 G;  1RAE B;  1QVG A;  1VQ6 T;  3M0T A;  4E7S A;  3M59 A;  3JB9 H;  2ZPG B;  1YIJ T;  2BIV A;  2DAQ A;  2DTH A;  5LJ5 h;  2KMT A;  3NMZ C;  3OMG A;  4Y28 E;  1RI9 A;  1MNE A;  1U3O A;  5IXF A;  2RPN A;  2LX9 A;  3GP8 A;  2CZ7 B;  3HHT B;  4J9E A;  2OI3 A;  3F70 A;  1XTD A;  2L3Q A;  1VQ8 Q;  2O2O A;  4M78 A;  1ZA1 B;  2QEX T;  2DEQ A;  2RK1 A;  3DLM A;  4M7D F;  1JEG A;  5GAN j;  3OSV A;  1K73 U;  2DYB A;  5I11 A;  5J26 A;  5CAI A;  2RJC A;  2HKQ B;  4KT0 E;  4LDU A;  4M7A F;  3V8L A;  2JTM A;  3JCM V;  3M0R A;  2GFU A;  3CCQ A;  3OW2 P;  4JUV A;  2PQW A;  4EMG A;  1YFN A;  5C6S A;  3DKM A;  5AT1 B;  2K6D A;  1NJI U;  1IXD A;  5IN1 A;  5HCK A;  2Y90 A;  2LVM A;  2KRS A;  1AHJ B;  2W10 A;  3CXC S;  1SRL A;  3MO8 A;  3QZ5 B;  2FPF A;  2SRC A;  2DRM A;  3C94 A;  4E7L A;  2YUP A;  4J6W A;  1NBE B;  5CIU A;  2DNU A;  3OYJ A;  3OYG A;  2ENM A;  2AK5 A;  4C5E A;  2O88 A;  3G7Z A;  2OJ2 A;  3PIO A;  2CSI A;  4HVW A;  3X28 B;  1WDX A;  2HQX A;  2DL3 A;  3G6E A;  2HMA A;  4QVC A;  2EYX A;  3QII A;  1VQ4 A;  2E6N A;  1WJR A;  4ELY C;  3DB4 A;  2FRY A;  4J9I A;  2EW3 A;  1WZO A;  2QA4 Q;  1VQM T;  3M55 A;  5GAM e;  2E41 A;  1FMK A;  1VIF A;  3VS1 A;  1JB0 E;  2E3H A;  2XDD A;  4C92 F;  2YUO A;  3OQ5 A;  1Y96 A;  3RMS A;  2ESW A;  4AFQ C;  1IHW A;  1VQ5 Q;  4RMO A;  5FU6 C;  1OI1 A;  1KSW A;  2E5K A;  3OB9 A;  1AD5 A;  1MMN A;  4UC4 A;  5J39 A;  4JRK A;  2FRW A;  2K4Y A;  2MK5 A;  3JAM E;  3CD6 Q;  2Y4X A;  3VKI A;  3VYG A;  1R77 A;  2L5Q A;  2SEM A;  1VQ9 A;  4GLK A;  2CDT A;  2F5K A;  2CP0 A;  1VQL T;  4A4E A;  2A08 A;  3CMA Q;  5LJ5 g;  2D6F A;  1BCM A;  1GCP A;  3OYI A;  2QQA A;  1YJN T;  5CKD A;  5GAO m;  3OYN A;  2GTJ A;  1JBM A;  3CC2 Q;  1BU1 A;  4ZGD B;  1M2O A;  9ATC B;  5GAN 4;  4M7D E;  1Q81 U;  2DPP B;  1G3Y A;  4JDS A;  3R6N A;  3RBB B;  2J7I A;  4CC7 A;  1AVZ C;  5GAM d;  4M7A E;  1RUW A;  1PC0 A;  2CP6 A;  1VQ8 A;  3AHU A;  2M51 A;  2HD0 A;  1GBR A;  2CT4 A;  2DD5 A;  2ABL A;  2DET A;  5GMK h;  1K9A A;  4Y91 A;  2LQ8 A;  4JJN K;  2K5L A;  4LD6 A;  3OW2 A;  2OTJ Q;  3HTR A;  4R55 A;  1TU0 B;  4WTO B;  1S72 T;  1YIT T;  2CZ1 B;  3EH1 A;  3JB9 D;  4ME7 A;  4D8K A;  3INZ A;  3J81 E;  3RMQ A;  3RKW A;  4HT9 A;  4IKF A;  1WHJ A;  4LDY A;  5L8R E;  2DVJ A;  1EIF A;  3HRS A;  4OMM A;  2L0A A;  2C0O A;  3FLG A;  3VS5 A;  1SKU B;  2KK4 A;  1Y07 A;  3CME T;  2EKO A;  3PVL A;  4OMQ A;  4BE0 A;  1KC8 U;  5CKF A;  4OP0 A;  4FL6 A;  3G71 Q;  4DOW A;  2FL7 A;  3S3N A;  3X24 B;  1MV3 A;  1B34 A;  1Q86 R;  1YN8 A;  3WVD B;  4RUG A;  2KI7 A;  1PKT A;  4LDW A;  4M78 F;  2RHY A;  1M90 U;  1X75 C;  2H3E B;  3VS4 A;  2QA4 A;  2ZPF B;  4E7H A;  1NEB A;  2V8K A;  2J6O A;  3CC4 A;  1ZSZ B;  1UEB A;  1ZA2 B;  3ZEH A;  5CQX A;  3EG3 A;  1FMV A;  1YJW T;  2A36 A;  2VKN A;  1VQ5 A;  1KC8 C;  2CP3 A;  2P84 A;  3CD6 A;  8AT1 B;  4II1 A;  2E3I A;  2EYY A;  2DD4 A;  3MEU A;  3X20 B;  1K76 A;  1W2B P;  3JCM f;  3BFM A;  3CC7 T;  1ZSZ C;  2KBT A;  5LJ3 d;  3CCL Q;  5GMK j;  5A2Q E;  2CYZ B;  3G1J A;  3M56 A;  1D09 B;  3JB9 J;  1TH7 A;  3CMA A;  1C1A A;  2VGM A;  4RTV A;  3QBY A;  2EKH A;  4FYY B;  4V2S A;  1RAB B;  3RDV A;  1JO8 A;  1X69 A;  3E1S A;  1RI0 A;  1N27 A;  1LOJ A;  4PJO G;  3CC2 A;  4L6V 5;  3MHX A;  2DXC A;  1YI2 T;  2HBP A;  3GBQ A;  2H3J A;  4ESR A;  2OX7 A;  5GAN 7;  3OBY A;  2K3X A;  2QXF A;  2LJ1 A;  1UGP B;  3UA6 A;  1PKS A;  2VB6 A;  3GIB A;  4HA8 A;  2YSQ A;  1GL5 A;  1RAC B;  3BW1 A;  3CPW S;  4OF1 A;  2HEQ A;  2GTO A;  2K5I A;  2ZPE B;  3CCR T;  1Q86 C;  2LDM A;  2KEA A;  1PHT A;  2QAZ A;  4XU0 A;  2OTJ A;  4KBM B;  3UF4 A;  1BI1 A;  3L2V A;  3SB2 A;  2FHD A;  4EDU A;  2RQR A;  1VQK Q;  4J9D A;  2JS2 A;  4FIB A;  2VUB A;  3A1P A;  2K3B A;  3CCU Q;  4E2F B;  3EHQ A;  3P8D A;  3EGX B;  3A8G B;  1W70 A;  4KGZ B;  3S6W A;  1VQ6 Q;  4LUE A;  1QCN A;  1G8X A;  1YIJ Q;  1I5O B;  2V1Q A;  4M78 E;  2JMA A;  1WGS A;  3OYE A;  4AG2 C;  3ER0 A;  3JRZ A;  3OMC A;  3G71 A;  5IHI A;  2LZ6 B;  4DBR A;  2MCN A;  4DBF A;  1RAG B;  1BK2 A;  3M0U A;  4R0K A;  2GFA A;  2EJF A;  2ZZD A;  3CCS T;  3VUB A;  4HVU A;  4XTY A;  2QEX Q;  1R0B G;  2BE9 B;  2CH4 A;  3P8B B;  2BTT A;  1IGQ A;  1KD1 U;  3JCM J;  3J80 E;  2RJD A;  3QYH B;  1TS9 A;  2DIG A;  3QJ6 A;  1WXT A;  1B07 A;  4C5G A;  2QQ9 A;  3TU4 K;  4J5Y A;  2VYT A;  2MWP A;  4C0D B;  1MHN A;  1NPP A;  3GLX A;  3JCM Q;  2BZ8 A;  4JLG A;  3OYA A;  1UEC A;  2DIQ A;  2E4H A;  3CEY A;  1M1K U;  3CCL A;  2X4W A;  1T0H A;  2YHT A;  3HFN A;  2DZC A;  4BD3 A;  1D0X A;  5KYY B;  1JXM A;  3QWX X;  1YHQ T;  2YXY A;  3JCM P;  2JTE A;  3PTA A;  3QWY A;  3VS3 A;  5GAN e;  2QYZ A;  2EJ9 A;  2LCC A;  3RNJ A;  3HP9 A;  1I5L A;  1PRM C;  2IPO B;  3LWI A;  4J6Y A;  1UJY A;  2ZGW A;  3EFS A;  1G2B A;  4MDW A;  1VQM Q;  1Q82 R;  1J3T A;  2C06 A;  4M77 B;  4N4I A;  2PNI A;  1D1C A;  3D7S B;  2LT4 A;  1I07 A;  4FW1 A;  2BUD A;  3VUZ A;  4P5N A;  1MMA A;  1B7T A;  1BB9 A;  4O6J A;  5CKB A;  1NEG A;  3TRE A;  4IUP A;  4AFZ C;  1GBQ A;  4M77 C;  4X1V A;  1QVP A;  2RHZ A;  4OGE A;  1VQK A;  4RTX A;  3RES A;  3H8Z A;  2HZY A;  3EG9 B;  3CCU A;  4WCI A;  3MCA B;  3OS0 A;  4MZT A;  4QVZ A;  3RKY A;  1VQL Q;  5I2S A;  3NHN A;  4LD9 K;  2O4X B;  4KGX B;  1T3L A;  2AHJ B;  1PD0 A;  2A0F B;  2XMF A;  4Q5W A;  1YJN Q;  1RL2 A;  4AMC A;  1BBZ A;  2EQK A;  2M9U A;  3QDR B;  5GAN d;  3EGU A;  1ACM B;  3OBW A;  4E7J A;  4QQG A;  4VUB A;  5GAM f;  3HFO A;  3LLR A;  1U06 A;  1M3C A;  2DM1 A;  1G83 A;  2D9T A;  4M7D G;  3CXC P;  1OV3 A;  2I2L A;  3QG1 A;  3LWH A;  2CSQ A;  4GBQ A;  4M77 E;  2V8J A;  2QEX A;  4M7A G;  5KYU B;  3ME9 A;  4N4H A;  1YCS B;  5M9O A;  1S72 Q;  1YIT Q;  2LC4 A;  4PLL A;  4A63 B;  1Q82 C;  2RO0 A;  3FB9 A;  4MZM A;  1BI0 A;  2G3R A;  2RI2 A;  2RB6 A;  1K73 R;  2I0N A;  2ZAE A;  4XTV A;  2RJE A;  4FYV B;  4JJB A;  1ZSZ A;  4F7U B;  2LTO A;  3UA7 A;  3WXM B;  3FIF A;  4CRI A;  1WJQ A;  4NS5 A;  4OMP A;  1AWW A;  4GY5 A;  1P92 A;  1FMW A;  3CME Q;  2P0P A;  3LW5 E;  1IHV A;  4F14 A;  1NJI R;  1MND A;  2LMJ A;  1LVK A;  2YT6 A;  1H64 1;  3OYD A;  2W0Z A;  1ZUU A;  2LT1 A;  2MAM A;  2FPE A;  1UHF A;  2LCS A;  4LDV A;  2PVO B;  4DBH A;  1N8R U;  4LDX A;  2DLP A;  1YWO A;  1SSF A;  2P4R A;  5GJW B;  4KRT A;  4C92 G;  1UFF A;  2J06 A;  1X2Q A;  2KE9 A;  5FRO A;  1KG1 A;  1VQM A;  2EGE A;  2CP5 A;  2DE0 X;  4RTW A;  1OQK A;  1SHG A;  3OYF A;  1R0C B;  3Q1J A;  2NUP B;  4BI4 A;  3THK A;  2E10 A;  4XTW A;  3VS0 A;  1YJW Q;  3MP8 A;  2MWO A;  1K4U S;  2VWF A;  4J9C A;  4PJN A;  1FYN A;  2R57 A;  2X3W D;  1XOV A;  2CGH A;  2MPX C;  1UHC A;  1ZSG A;  3OA6 A;  1XJW B;  1JJ2 A;  3M0Q A;  1NYF A;  5LJ3 f;  5LL6 S;  4N4G A;  5HKC A;  2Y4Y A;  2QTX A;  3CC7 Q;  2YRD A;  4PNO A;  2HQE A;  4X34 A;  1X2K A;  4FYW B;  3E19 A;  1VQL A;  1ZX6 A;  4ZN3 A;  4EMK B;  1PSF A;  2RI5 A;  5GMK m;  3JCM g;  1K73 C;  3TQ7 P;  5CR2 A;  4FM4 B;  2JN0 A;  1YJN A;  3BY7 A;  5IH2 A;  1XNI A;  3CXC A;  4RTZ A;  4A4G A;  1V29 B;  1WXB A;  3EGX A;  4FT2 A;  4X9D A;  2YWW A;  2O31 A;  1YI2 Q;  5ECA A;  4NL2 A;  4JRI A;  3V8K A;  1SEM A;  4OGC A;  4Z89 A;  4D6W A;  1G5V A;  3MP6 A;  3VS2 A;  3MEW A;  4LN2 A;  4EMK C;  3JB9 F;  1T0J A;  1NJI C;  5DLQ E;  5D6W A;  2DTO A;  1Q81 R;  4C0Z A;  2D8J A;  1BI3 A;  2LNH B;  3QXE B;  4JPB W;  3CCE T;  1PNJ A;  5HY6 A;  3L2U A;  5LJ5 j;  4C8Q G;  3CCR Q;  3KUF A;  1M8V A;  2GF7 A;  1D0Y A;  2RQU A;  1W1F A;  1UJ0 A;  2K3Y A;  1SG5 A;  5J3B A;  5GMK e;  1YIT A;  1S72 A;  4HT8 A;  2QI2 A;  1AEY A;  4M75 G;  4ELZ C;  1YBY A;  1IO6 A;  4E47 A;  3PGG A;  4XU1 A;  3PMT A;  4Z02 A;  1X6G A;  5FWC A;  1RAA B;  2DJZ A;  3CCJ T;  3LH5 A;  2FO0 A;  2KNB B;  3PE0 A;  3H0H A;  4BY6 B;  1AWX A;  2NYS A;  2MI6 A;  4EMH A;  2CZ6 B;  2PTK A;  4XQ3 A;  3CME A;  2JS0 A;  4M78 G;  1QCO A;  5EG2 A;  2ZPI B;  4M7A D;  3UWN A;  3VRZ A;  2LNV A;  3I35 A;  1PRL C;  2L3R A;  4JZ4 A;  4KH1 B;  1KC8 R;  4BY6 C;  3CCS Q;  2DBK A;  1TTH B;  2DYI A;  3JCM b;  2B86 A;  5CKE A;  4A4F A;  1V76 A;  1JXO A;  2DKG A;  5KYY A;  3SDZ A;  2ZPB B;  1DJ7 B;  5GAM h;  4KUI A;  2QTV A;  1M4Z A;  3OYB A;  1I1J A;  2Z0W A;  3VJP A;  4AFU C;  3RUX A;  3QKJ A;  1I81 A;  1WQ7 A;  1YJW A;  1MMG A;  2FZG B;  4MDX A;  1M90 R;  4O5V A;  4XAX B;  4M77 A;  2RQV A;  5KH6 A;  1Q81 C;  3M0P A;  1V1C A;  3CPW P;  5DLO A;  1QVF P;  3HRT A;  2GQV A;  3MJX A;  2PUK B;  3CC7 A;  1QLY A;  5LJ3 e;  1UDL A;  2D1X A;  4JRP A;  3MET A;  1RAH B;  3LYI A;  3OSS C;  1Y71 A;  2AKL A;  4HCZ A;  3EG1 A;  4PJL A;  1YHQ Q;  4C92 D;  4FCY A;  3EG9 A;  1FX7 A;  2GQI A;  3H0I A;  2E1H A;  4BUG A;  4J9B A;  3REB B;  4J7I A;  2K5F A;  2O4X A;  1YI2 A;  3ASK A;  1TOV A;  2DL7 A;  1K8A U;  2KT1 A;  1WHK A;  1JU5 C;  2JMC A;  2J6K A;  2O01 E;  2ATC B;  2JT4 A;  2WSC E;  2X4X A;  2KRN A;  2A3L A;  2HQH A;  4J6X A;  1UGQ B;  1YJ9 T;  3CCR A;  3DB3 A;  3A8H B;  5CK9 A;  2KRO A;  2QQS A;  4PK4 A;  2RQT A;  1S1N A;  3M53 A;  5KYU A;  2QGF B;  1FWZ A;  2QDY B;  3M4Y A;  3QYG B;  4XTU A;  3OS2 A;  3KFV A;  4OB2 B;  1KFZ A;  1M90 C;  2LJ3 A;  1KQS S;  5GAN f;  1RAF B;  1NLP C;  4OVA A;  2JNG A;  4BE1 A;  1IZ6 A;  1JQQ A;  1AT1 B;  1RAI B;  1VQP Q;  1KJW A;  2VVK A;  3M9Q A;  2BZX A;  1QWF A;  2CUB A;  4F7U A;  1VQ7 T;  2JM8 A;  3V7S A;  2K7A A;  2KY9 A;  1HSQ A;  1AZG B;  2K9G A;  1AOJ A;  4AG1 C;  2CP2 A;  4C8Q D;  4HCK A;  1M2V B;  1ZUY A;  1E7O A;  2RHI A;  2QQR A;  3CCS A;  1M9S A;  5GAM g;  2RK2 A;  1Z9Z A;  2R5M A;  2E65 A;  5GAN 2;  1U8R A;  4M75 D;  3I55 T;  1AWO A;  4TVR A;  4MML A;  3GF5 A;  3C12 A;  1T3S A;  5FRN A;  1Y57 A;  4KGV B;  3CPW A;  1EX4 A;  4BDZ A;  1QVF A;  1HK9 A;  4M4Z A;  2XDP A;  3VS7 A;  3ULR B;  2HKN A;  1NE8 A;  1KD1 R;  5CCA A;  2F5T X;  1TWB A;  1OZ2 A;  3A8L B;  1WHH A;  2NUP A;  3E9G A;  2HDA A;  2DVE A;  2DIL A;  4ZTF A;  1GXI E;  1H3H A;  1KHI A;  3PVQ A;  5GAO l;  1D1A A;  2DO3 A;  2NUZ A;  3EHR A;  4QVD A;  1K9M U;  1PSE A;  2ECZ A;  1K0S A;  2GCX A;  3PIP A;  2M0Y A;  1M1K R;  2DMO A;  2EAY A;  1KIK A;  1NLO C;  2F2X A;  4EIK A;  2RI3 A;  4MZP A;  4EMK A;  2G6F X;  1OYX A;  1M8M A;  2YRC A;  3TSZ A;  2A28 A;  5IHN A;  2RF0 A;  4RTT A;  1OZ3 A;  2YUQ A;  4HCC A;  3SWN B;  3M4G A;  1OX9 A;  2X4J A;  4KH0 B;  5DM7 R;  1VQN Q;  4QT7 A;  3J7A F;  2E6Z A;  3H6Z A;  1O9S A;  1HJD A;  2MMP A;  2D0Q B;  2DTI A;  1W2B A;  4M77 F;  2LP5 A;  1M27 C;  2JTF A;  3OYK A;  2MYS A;  4BI8 B;  4RKU E;  1VUB A;  2QDL A;  3SWN C;  1WJS A;  1VIE A;  3RR6 A;  5L23 A;  3KBG A;  2YDL A;  5GAO p;  3VRY A;  5LJ3 g;  1X01 A;  1WLP B;  2DRK A;  2L2P A;  5A0D A;  4A54 A;  2D0N A;  2JOY A;  1YCY A;  4QW2 A;  1KD1 C;  4FSX A;  4Z88 A;  4XU2 A;  7AT1 B;  3EGD B;  1W4S A;  5GAO n;  4FU6 A;  4C0D C;  4HCB A;  2IG0 A;  2KT8 A;  3L2W A;  1ZBX A;  2CRE A;  4JS5 A;  5GAN 6;  4X9C A;  2HCK A;  2HSE B;  1WX6 A;  3EG0 A;  3SD4 A;  1Q7Y U;  2EBP A;  4PJO B;  3MPU B;  1KQ1 A;  3H41 A;  1ZHI A;  1QQJ A;  2F1L A;  4LXC A;  2XIC A;  1LNX A;  3CCE Q;  3AT1 B;  5CO7 A;  2LQN A;  2FEI A;  2K79 A;  4J9H A;  1M1K C;  1U1T A;  1U1S A;  2WSF E;  1OU9 A;  1PG5 B;  4OMO A;  1ABQ A;  1TUD A;  3CCM T;  2DL8 A;  2EWN A;  4OMF B;  2M02 A;  4PJO C;  2KYB A;  3M5A A;  2YLB A;  3HL8 A;  1WQW A;  1VQO T;  3CCJ Q;  4OB1 B;  5KYW B;  4HXJ A;  4PLI A;  2KRM A;  4RCB A;  3PMI A;  2DBM A;  3OS5 A;  4PJO D;  1VQ6 A;  3EFR A;  1YIJ A;  3SEM A;  2C0T A;  4LE9 A;  5IXB A;  1VQP T;  3JCM h;  4DBQ A;  4NL3 A;  4AT1 B;  4F7U F;  3S3M A;  2GGR A;  1WHM A;  4IUR A;  5LJ5 e;  4B9W A;  1QKW A;  4IIM A;  1VYU A;  2VC8 A;  1MMD A;  1OX8 A;  2BKD N;  3I56 T;  2BE7 D;  1E6G A;  4EPC A;  1N8R R;  2COZ A;  1OEB A;  1GFC A;  4DOV A;  4LUD A;  2DA9 A;  1TUG B;  2CKK A;  2F69 A;  2O9S A;  4XU3 A;  2VGN A;  3NTH A;  3FEO A;  2OTL T;  1I4K 1;  1BI2 A;  2LQW A;  4AFS C;  5KYN A;  2BZY A;  4OML A;  3OS1 A;  5CKH A;  3G4S T;  2AZS A;  2EIF A;  1NYG A;  2FG0 A;  3VV0 A;  2E5Q A;  5C0M A;  4IUT A;  1Y7X A;  2RHU A;  2KDS A;  5FLX E;  1OPK A;  3LGF A;  1QVG S;  2RH2 A;  1M30 A;  1N5Z A;  4K11 A; 
#chains in the Genus database with same CATH homology
 4J83 A;  5GMK j;  3UT1 A;  1VQP A;  5A2Q E;  2CYZ B;  2MI6 A;  3M56 A;  5KE3 A;  1ZQ1 A;  3JB9 J;  2P0Q A;  1TH7 A;  5FU7 B;  4EMH A;  2CZ6 B;  4XQ3 A;  3CMA A;  3CME A;  2VGM A;  3QHS A;  5LJ5 d;  2XU8 A;  4MMK A;  3QBY A;  3CCV T;  2V8I A;  3NTI A;  4M78 G;  4QQD A;  4V2S A;  5EG2 A;  3CBO A;  1M1F A;  4CI0 C;  4ZGJ B;  3JCM e;  4C5I A;  3E1S A;  1RI0 A;  1N27 A;  2EFI A;  2ZPI B;  4M7A D;  3UWN A;  1LOJ A;  3G71 T;  4PJO G;  2LNV A;  3CC2 A;  3L42 A;  3CBM A;  4L6V 5;  3MHX A;  2L3R A;  2DXC A;  1YI2 T;  2HBP A;  2H3J A;  4BY6 C;  3I56 A;  5GAN 7;  3OBY A;  2K3X A;  2QXF A;  3JCM b;  5CKE A;  1UGP B;  1UB4 A;  4A4F A;  4BB7 A;  2DKG A;  3A8M B;  1UGS B;  5FU7 C;  3GIB A;  3SDZ A;  2PVG B;  4HA8 A;  2ZPB B;  4BE2 A;  3M58 A;  3CCE A;  1DJ7 B;  4J7F A;  3M54 A;  5GAM h;  1VQN T;  4KUI A;  4FT4 A;  1M4Z A;  2KSS A;  3BW1 A;  4N0A A;  3OYB A;  1WPY A;  3CPW S;  1W2B S;  3V7C A;  3VJP A;  2VV5 A;  4OF1 A;  2KVQ G;  3FRN A;  3RUX A;  3QKJ A;  2OTL A;  1I81 A;  1WQ7 A;  2K5I A;  2IVW A;  2ZPE B;  3CCR T;  2LDM A;  1YJW A;  1Q86 C;  4MDX A;  2YRV A;  4XU0 A;  3DLL A;  2OTJ A;  4C92 A;  2EYQ A;  3PNW C;  4DA4 A;  4KBM B;  3BDL A;  4O5V A;  1N8R C;  4XAX B;  4M77 A;  3ZEH A;  1BI1 A;  3L2V A;  3A5Z B;  3G4S A;  3SB2 A;  5KH6 A;  1Q7Y C;  2FHD A;  4EDU A;  1Q81 C;  3LGL A;  3OYY A;  1JJ2 S;  2RHX A;  2DXU A;  4F7U E;  2K57 A;  4FIB A;  4C0G A;  4C0F A;  2VUB A;  2JZ2 A;  5DLO A;  3CCJ A;  3HRT A;  2GQV A;  1I8F A;  2E70 A;  3JB9 I;  3M57 A;  3P8D A;  2PUK B;  3CC7 A;  4IUV A;  5D6X A;  5LJ3 e;  3A8G B;  2XG8 D;  3PT9 A;  3OYL A;  3S6W A;  4JRP A;  3QJY A;  3MET A;  1B34 B;  3UPU A;  2ZCF B;  3LYI A;  1Y71 A;  1JRI A;  2EQU A;  3OSS C;  4OB3 B;  3T9N A;  3CCL T;  4HCZ A;  4M78 E;  4C92 D;  5HK3 A;  3JCM d;  3CCV A;  1WGS A;  1WNL A;  1N9S A;  5GAN g;  5GAN h;  3OYE A;  4M77 D;  2VXE A;  3ER0 A;  3JRZ A;  3OMC A;  3V7R A;  3CCS A;  1FX7 A;  5A0G A;  4PJO E;  3JSC A;  2E1H A;  4BUG A;  3QUI A;  3G71 A;  4C5H A;  1Q82 U;  1MGQ A;  4J7I A;  2K5F A;  2O4X A;  4XK8 E;  1YI2 A;  5D6Y A;  4XTZ A;  3ASK A;  4E7I A;  1K8A U;  1FXX A;  2DXB A;  2OAU A;  4A4H A;  2GFA A;  2KAF A;  3HPW A;  3X25 B;  4M7D B;  2EJF A;  2ZZD A;  3CCS T;  3VUB A;  2M16 A;  2O01 E;  4XTY A;  4JS4 A;  3C95 A;  3P8B B;  5FU6 B;  2HAX A;  1VQN A;  3TEE A;  4A4K A;  3GOX A;  2RJF A;  3MEV A;  3VYH B;  2XHC A;  2WSC E;  2A7Y A;  2X4X A;  2EQM A;  4M7A B;  2A3L A;  2MF2 A;  3FC3 A;  2K2V A;  4J6X A;  3LH0 A;  2YLC A;  2WAC A;  1KD1 U;  3JCM W;  1UGQ B;  1YJ9 T;  2P4T A;  3JCM J;  3CCR A;  3DB3 A;  3A8H B;  5CK9 A;  3J80 E;  3P8H A;  1M5Q 1;  2RJD A;  3PFS A;  3QYH B;  2QQS A;  3L2Q A;  2RA2 A;  2CS7 A;  3BDU A;  1BIB A;  3X26 B;  4M7D C;  2DIG A;  2DK3 A;  2ZPH B;  4J8O A;  4ATO A;  3SFM A;  3QJ6 A;  2HNI A;  3QO3 A;  3SWN A;  4C5G A;  3M53 A;  2QQ9 A;  3TU4 K;  2DXT A;  3R6O A;  4J5Y A;  1FWZ A;  3CCQ T;  2QDY B;  2VYT A;  2P0K A;  3QZ9 B;  4IUU A;  3M4Y A;  3OYM A;  1VQK T;  4B9X A;  3QYG B;  4M7A C;  4XTU A;  4A53 A;  5GAO q;  3RIR A;  1KHC A;  4C8Q A;  2MWP A;  4C0D B;  3OS2 A;  1D3B A;  4OB2 B;  1MHN A;  1NPP A;  3GPL A;  1M90 C;  3GLX A;  3JCM Q;  3HSB A;  3CCU T;  4JLG A;  3OYA A;  5GAN 5;  1KQS S;  4M7D D;  5GAN f;  2DIQ A;  3CEY A;  3O8V A;  4OVA A;  4YTL A;  2JNG A;  5CQY A;  3OYH A;  4BE1 A;  4M75 A;  1M1K U;  3CCL A;  3JB9 G;  1N9R A;  1QVG A;  2JVV A;  1VQ6 T;  2X4W A;  1IZ6 A;  2YHT A;  3M59 A;  3JCM X;  2E64 A;  3JB9 H;  3M9Q A;  3HFN A;  2DZC A;  3EAE A;  3E9F A;  4BD3 A;  2ZPG B;  3L2R A;  1YIJ T;  2BIV A;  2DAQ A;  2DTH A;  5LJ5 h;  1X6O A;  2KMT A;  4F7U A;  3OMG A;  3PTA A;  4Y28 E;  3JCM P;  1YHQ T;  1VQ7 T;  3V7S A;  2KY9 A;  5GAN e;  2R58 A;  2EJ9 A;  2LCC A;  3HP9 A;  1I5L A;  2E12 A;  2EJG A;  2LX9 A;  4JLI A;  4C8Q D;  3NFC A;  3GP8 A;  2CZ7 B;  3HHT B;  3LWI A;  1G3S A;  2RHI A;  2QQR A;  4J6Y A;  3FDR A;  1M9S A;  5GAM g;  2ZGW A;  2RK2 A;  3EFS A;  5KCO A;  2R5M A;  2E65 A;  3F70 A;  4C92 B;  3MEA A;  1XTD A;  2LCL A;  4MDW A;  3G6E T;  5GAN 2;  1M1G A;  2C06 A;  1VQ4 T;  1U8R A;  4M77 B;  4N4I A;  2PU9 B;  1O75 A;  2XI9 A;  3MP1 A;  4M75 D;  4M78 A;  3I55 T;  3OW2 S;  2QEX T;  2DEQ A;  2LT4 A;  2RK1 A;  2BUD A;  3DLM A;  4TVR A;  3VUZ A;  4P5N A;  2DZ9 A;  1YJ9 A;  4M7D F;  2L8D A;  4MML A;  4N0A C;  4PJO A;  3GF5 A;  3C12 A;  5FRN A;  4WF2 A;  5KE2 A;  5GAN j;  3OSV A;  1K73 U;  3CPW A;  4XTX A;  5J26 A;  4O6J A;  2RJC A;  5CKB A;  4KT0 E;  1HK9 A;  5CAI A;  4BDZ A;  1QVF A;  4LDU A;  2XDP A;  3TRE A;  4IUP A;  4M7A F;  3V8L A;  4C92 C;  2JTM A;  1NE8 A;  3JCM V;  5CCA A;  2KQW A;  2GFU A;  3ZBD A;  3CCQ A;  2F5T X;  2FVU A;  4M77 C;  1OZ2 A;  1QVP A;  2RHZ A;  2XK0 A;  3A8L B;  4JUV A;  4OGE A;  2PQW A;  3E9G A;  1VQK A;  3RKX A;  5IT9 E;  3RES A;  2R5A A;  4BI3 A;  4EMG A;  4M7D A;  2DVE A;  5C6S A;  3H8Z A;  3DKM A;  4C8Q F;  4ZTF A;  1GXI E;  3CCU A;  5GAO r;  1KHI A;  3MCA B;  1NJI U;  3OS0 A;  5IN1 A;  4MZT A;  4QVZ A;  3RKY A;  5GAO l;  2DO3 A;  2Y90 A;  5I2S A;  4LD9 K;  2O4X B;  2LVM A;  1VQ9 T;  1KQ2 A;  1AHJ B;  2AHJ B;  3CXC S;  3MO8 A;  4M75 F;  3QZ5 B;  4Q5W A;  4QVD A;  1RL2 A;  3L2Z A;  2WSE E;  1K9M U;  1PSE A;  3C94 A;  2EQK A;  2M9U A;  4E7L A;  4J6W A;  5CIU A;  3RER A;  1QP3 A;  3OYJ A;  2GCX A;  3CBP A;  3QDR B;  3OYG A;  3PIP A;  5GAN d;  4RG8 A;  1VQ7 A;  2XKO C;  2EAY A;  3OBW A;  4E7J A;  4QQG A;  4VUB A;  5GAM f;  3HFO A;  3LLR A;  4ZTJ A;  4C5E A;  4E7K A;  2RI3 A;  4MZP A;  2D9T A;  3G7Z A;  4DQ2 A;  3PIO A;  4EMK A;  2CZ0 B;  3X28 B;  5HK0 A;  4M7D G;  1OYX A;  1QW1 A;  2HQX A;  2I2L A;  3G6E A;  4QVC A;  3QG1 A;  3QII A;  4C92 E;  1VQ4 A;  2E6N A;  3LWH A;  1WJR A;  4ELY C;  3DB4 A;  1OZ3 A;  4M77 E;  5I2M A;  3I55 A;  3CPF A;  4HCC A;  2V8J A;  3SWN B;  2QEX A;  3M4G A;  1VQM T;  2X4J A;  3M55 A;  4M7A G;  5GAM e;  1VQ8 T;  2E41 A;  3ME9 A;  4N4H A;  5DM7 R;  2M0O A;  3J7A F;  2E6Z A;  1VIF A;  2VXF A;  1JB0 E;  3H6Z A;  1O9S A;  5M9O A;  2XDD A;  4L59 A;  2PVD B;  4C92 F;  2MMP A;  3NTK A;  3OQ5 A;  4C8Q B;  2D0Q B;  4RCC A;  1Y96 A;  2DTI A;  3RMS A;  1D3B B;  2LC4 A;  4M77 F;  1W2B A;  4PLL A;  4IUQ A;  2X35 A;  4QQ6 A;  4RMO A;  3S3O A;  5FU6 C;  1OI1 A;  2JTF A;  3OYK A;  5KCH A;  1Q82 C;  3OB9 A;  4BI8 B;  4UC4 A;  2RO0 A;  3FB9 A;  4MZM A;  5J39 A;  1BI0 A;  2G3R A;  1G3T A;  4M75 B;  2RI2 A;  4RKU E;  1VUB A;  2RB6 A;  3L1A A;  4JRK A;  1K8A C;  4XTV A;  3SWN C;  1WJS A;  1VIE A;  2K4Y A;  3JAM E;  2RJE A;  5GAM j;  5FRM A;  5GMK l;  3KBG A;  2Y4X A;  4BAC A;  2NLU A;  4F7U B;  5GAO p;  3VKI A;  2LTO A;  3WXM B;  3FIF A;  5LJ3 h;  3VYG A;  4C8Q C;  1WJQ A;  4CRI A;  5LJ3 g;  1X01 A;  4NS5 A;  1QP2 A;  5A0D A;  4A54 A;  2L5Q A;  2JOY A;  4GY5 A;  1VQ9 A;  1P92 A;  3QSU A;  1YCY A;  4GLK A;  3KXT A;  2F5K A;  2RD1 A;  4QW2 A;  1VQL T;  4A4E A;  4FSX A;  1KD1 C;  2P0P A;  5LJ5 g;  4R56 A;  2XID A;  1KQS A;  2D6F A;  3LW5 E;  4XU2 A;  1W4S A;  4M75 C;  5GAO n;  3LX7 A;  2QQA A;  3OYI A;  4FU6 A;  4C0D C;  4HCB A;  1H64 1;  4PKC C;  2IG0 A;  5DY9 A;  5CKD A;  5GAO m;  3OYD A;  3L2W A;  1ZBX A;  1YJN T;  1Q86 U;  3OYN A;  4JS5 A;  2LT1 A;  4PL6 A;  2MAM A;  1BKB A;  2JUF A;  4M78 B;  5GAN 6;  1JBM A;  5I21 A;  4KUL A;  4LDV A;  2PVO B;  4X9C A;  4ZN1 A;  4ZGD B;  1N8R U;  4LDX A;  1NPR A;  3HRU A;  5GAN 4;  3SD4 A;  1Q81 U;  1SSF A;  2DPP B;  1Q7Y U;  1G3Y A;  4M7D E;  4PJO B;  5A0L A;  4RG2 A;  1KQ1 A;  4JDS A;  2XDB A;  4C92 G;  1ZHI A;  2FYK A;  1R8O B;  1NZ9 A;  4M77 G;  2XIC A;  3WVE B;  5FRO A;  1LNX A;  5GAM d;  5CO7 A;  4M7A E;  1KG1 A;  3A8O B;  3GNF B;  1VQM A;  3JCM c;  1VQ8 A;  4ZGE B;  1M1K C;  3AHU A;  1U1T A;  1U1S A;  2WSF E;  2HD0 A;  2DD5 A;  3OYF A;  4M78 C;  3Q1J A;  2QA4 T;  5GMK h;  4BI4 A;  5GMK i;  4Y91 A;  2E10 A;  2LQ8 A;  3CCM T;  4XTW A;  4JJN K;  2K5L A;  4LD6 A;  3OW2 A;  3MP8 A;  2MWO A;  2EWN A;  1N6A A;  4OMF B;  4C8Q E;  2LQK A;  3CC4 T;  4PJO C;  2R57 A;  4R55 A;  1QVF S;  1XQH A;  2L89 A;  1XOV A;  2CGH A;  1YIT T;  1S72 T;  3M5A A;  2CZ1 B;  2YLB A;  3HL8 A;  1VQ5 T;  3OA6 A;  2B8A A;  1WQW A;  5GAN 8;  3OYC A;  1JJ2 A;  1VQO T;  4M75 E;  4OB1 B;  4KUD K;  3JB9 D;  4M78 D;  5LJ3 f;  5LL6 S;  4ME7 A;  5AYF A;  3INZ A;  4PLI A;  4N4G A;  4RCB A;  1UGR B;  3PMI A;  5HKC A;  2OTL T;  2Y4Y A;  2QQB A;  2QTX A;  3OS5 A;  4PNO A;  3CD6 T;  2PUO B;  3J81 E;  4PJO D;  2HQE A;  1VQ6 A;  3RMQ A;  5LJ5 f;  2RM4 A;  4X34 A;  3RKW A;  3V8J A;  3E19 A;  4HT9 A;  4IKF A;  3EFR A;  5GAN 3;  1VQL A;  3QPH A;  1YIJ A;  4LDY A;  5L8R E;  4ZN3 A;  4EMK B;  1YHQ A;  1EIF A;  1PSF A;  2RI5 A;  3HRS A;  5GMK m;  1VQP T;  5CVI A;  3UDC A;  3JCM h;  3JCM g;  4NL3 A;  1K73 C;  5CR2 A;  1H3Z A;  3FLG A;  2M1H A;  4F7U F;  2KK4 A;  3S3M A;  4FM4 B;  3TCJ A;  2JN0 A;  1Y07 A;  3BY7 A;  4IUR A;  1XNI A;  3CME T;  2EKO A;  3CXC A;  1YJN A;  4BE0 A;  1KC8 U;  3CMA T;  4OB0 B;  4A4G A;  1HXD A;  5CKF A;  1V29 B;  4FL6 A;  4OP0 A;  5LJ5 e;  4FT2 A;  4DOW A;  4X9D A;  3FJP A;  4B9W A;  1BYM A;  2FL7 A;  4NL2 A;  4JRI A;  3V8K A;  3S3N A;  3X24 B;  4OGC A;  3CC2 T;  2X4Y A;  4D6W A;  1B34 A;  2VC8 A;  1G5V A;  3MP6 A;  2BKD N;  1Y96 B;  3MEW A;  3WVD B;  3I56 T;  4LDW A;  4EMK C;  3JB9 F;  4M78 F;  1NJI C;  4EPC A;  2RHY A;  5LJ3 j;  2LRQ A;  5DLQ E;  3HKS A;  2DTO A;  5D6W A;  4C0Z A;  4DOV A;  1BI3 A;  4HKE A;  1M90 U;  1LJO A;  3QXE B;  3CCE T;  4PJO F;  1X75 C;  2QA4 A;  2ZPF B;  1S72 A;  5HY6 A;  3L2U A;  4E7H A;  1K9M C;  3CCM A;  5LJ5 j;  4C8Q G;  1G3W A;  3KUF A;  1M8V A;  2V8K A;  2GF7 A;  2CKK A;  2F69 A;  3CC4 A;  1UEB A;  2VGN A;  3NTH A;  3FEO A;  4XU3 A;  5CQX A;  3C4S A;  3VU3 C;  2K3Y A;  5J3B A;  5GMK e;  3GNG A;  1BIA A;  1I4K 1;  1BI2 A;  1YIT A;  1YJW T;  2QI2 A;  4HT8 A;  2OTJ T;  1VQ5 A;  2XD0 A;  1KC8 C;  4M75 G;  4ELZ C;  2EQJ A;  1YBY A;  3OS1 A;  1VQO A;  5IAY A;  5CKH A;  3G4S T;  4E47 A;  3PGG A;  4XU1 A;  4JRQ A;  2EIF A;  3PMT A;  4M7A A;  4Z02 A;  3VV0 A;  4BDY A;  2E5Q A;  2DJZ A;  2FB7 A;  3CCJ T;  4F7U G;  3CD6 A;  4II1 A;  4NOY A;  2DD4 A;  3MEU A;  5C0M A;  3X20 B;  3OY9 A;  4IUT A;  1IRE B;  1Y7X A;  2RHU A;  3N5B B;  4L5G A;  3JCM f;  3BFM A;  3URG A;  2KDS A;  3ZFJ A;  5FLX E;  3LGF A;  1QVG S;  3CC7 T;  2RH2 A;  5LJ3 d;  4BY6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...