4A4HA

Solution structure of spf30 tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30
publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4hA00
1OZ3A 3MP8A 4HCZA 5CIUA 3PMIA 3OYJA 3L2QA 2DIQA 3LYIA 4B9WA 4BE1A 3BDLA 3OA6A 3LLRA 2EQJA 2RI2A 2L89A 3MEUA 2K3XA 4C5HA 4BACA 2WACA 3S6WA 3L2WA 2MWOA 2RJEA 4E7HA 3M9QA 4A4EA 2DAQA 3MO8A 2E6NA 3QKJA 3PFSA 4II1A 4N4GA 2RI3A 4C5GA 2LRQA 3OYNA 2EQKA 3NTHA 5D6WA 4NS5A 1WJRA 2G3RA 3DB3A 4BE0A 3L42A 5KCOA 3OYLA 3QBYA 1OI1A 3ASKA 3MP6A 4IUVA 4PL6A 4RG2A 2DIGA 3OS0A 3L2UA 3OYHA 4N4HA 2HQEA 3OQ5A 2VYTA 2LTOA 2JZ2A 4E7KA 3ME9A 2RHIA 4E7LA 2X4WA 2B8AA 5D6YA 3H6ZA 2RJDA 4Z02A 5FRNA 2NLUA 2YRVA 2MWPA 4B9XA 4N4IA 2EQUA 3QJ6A 2BKDN 4ZTJA 1N27A 3LGLA 3P8DA 2BUDA 2CKKA 2RHUA 3FLGA 3OYIA 3FDRA 3ZEHA 3FC3A 5C0MA 5KE3A 3EAEA 1XNIA 3LH0A 2EQMA 2E5QA 2M16A 3O8VA 4FL6A 4IUPA 3OS2A 3OY9A 3MP1A 2R5AA 2M1HA 2F5KA 3L2VA 1WJSA 3QIIA 4BD3A 3CEYA 1MHNA 2QQSA 3NTIA 4ZTFA 1WGSA 3GOXA 4QW2A 2P0KA 4L59A 3LGFA 3OMCA 2O4XB 2XK0A 3H8ZA 5J26A 3L2RA 1H3ZA 1G5VA 2RJFA 4QVZA 5D6XA 3E9FA 3SD4A 4Q5WA 3OYGA 3LX7A 2LCCA 3OYEA 3OMGA 3META 2R57A 2RHYA 4IUUA 3OS1A 4BDZA 2FHDA 2RHXA 2X35A 2RI5A 4QQ6A 4OVAA 3UWNA 3OYBA 3OYMA 3P8HA 3PMTA 1OZ2A 2EFIA 2M0OA 3DLMA 4EDUA 2LVMA 4IKFA 4BDYA 4IUQA 4C5EA 5C6SA 4X34A 3E9GA 3FEOA 4UC4A 4A4GA 2GF7A 4IUTA 2LDMA 2O4XA 1OYXA 2R5MA 3F70A 4IURA 3OYCA 5J39A 2HQXA 3OYDA 2X4XA 3MEWA 4QQGA 5FROA 5M9OA 1KHCA 2JTFA 2GFUA 2PQWA 2BIVA 3Q1JA 4LD6A 4GY5A 4E7JA 3DB4A 2EKOA 3C4SA 3OYFA 2GFAA 3UT1A 2RHZA 3S3OA 2D9TA 1WJQA 4E7IA 4A4FA 3OB9A 4A4HA 3KUFA 4FU6A 4C5IA 3PNWC 2L3RA 2RO0A 2QQRA 2R58A 5IAYA 5IN1A 3OYAA 2RJCA 2XDPA 4PLIA 4BE2A 3MEAA 3S3NA 3MEVA 4QQDA 1SSFA 5KCHA 3NTKA 4CRIA 5KH6A 2X4YA 5KE2A 3S3MA 4PLLA 2K3YA 2IG0A 5FRMA 3OYKA 1RI0A 2L8DA
chains in the Genus database with same CATH superfamily
5CIUA 1YJ9A 4HT8A 3LYIA 3OW2S 4C5HA 4HVWA 2D0QB 1B34A 4M77B 4L6V5 3QZ9B 1Y96B 2EYWA 4NS5A 3CCVQ 1EX4A 2CDTA 4KULA 3REAB 5A0LA 2CH4A 3QWXX 3I5RA 1ZSZA 2NUZA 4OMLA 3HPWA 1Q86C 5GAMh 1NJIR 1W2BS 4AFQC 2LQ8A 4RTTA 2P0PA 4N4IA 2BKDN 3JCMJ 3CC2T 1Q86U 2AT1B 2QI2A 2ROTA 3QXEB 4DBHA 3OYIA 4E6RA 1W1FA 4M75D 2D0NA 3O8VA 3ZL7C 2JN0A 1AD5A 2AK5A 2CUDA 3NFCA 4J6WA 5GAMg 2H3JA 2F2WA 3NTIA 3G4ST 1JU5C 2DVJA 3CCJQ 1W70A 4F7UA 3QUIA 3JCMc 1AT1B 1NYGA 1UJYA 2YXYA 1NPPA 3MJXA 3GPLA 2Y90A 1Y07A 1I0CA 3CC7T 3R6NA 2A7YA 4FIBA 4C8QD 3JCMh 3X20B 2QASA 2JMCA 2PQWA 2RK2A 2ZCFB 3OW2P 1JB0E 3JCMQ 1VQMT 5GMKi 1VYTA 4BY6C 4KBMB 1X6BA 3QG1A 4R55A 1AZEA 2XU8A 2GTOA 4FSXA 3JAME 3E1SA 5KYUA 1WHHA 5LJ3f 4ELYC 3NMZC 1IGUA 2K57A 4HVUA 4RMOA 2IG0A 3JCMg 1W2BP 5FRMA 4PJOG 1SHGA 1WA7A 2DIQA 1YBYA 4Z88A 3INZA 3GNFB 3A8LB 3QYGB 4BACA 2DAQA 2AKLA 1D0YA 3EFOA 1YHQQ 3CMAT 1TH7A 1UE9A 5I11A 1QVGS 2HQEA 3VS5A 2KT8A 2NLUA 3THKA 4LXCA 2EYXA 2LJ3A 1OPKA 3VJPA 1S72T 3CBPA 4M77G 1V29B 3ER0A 2FO0A 2HDAA 4IUPA 2F5KA 3SWNC 1GFDA 1QKXA 4M7DB 3JB9H 1Y57A 2O4XB 2DZCA 2GGRA 2FRWA 2J6FA 1G3YA 3RNJA 2K79A 3CCMT 4XK8E 4OVAA 1OU8A 2PNIA 1M2VB 4PJOF 5HY6A 2EGAA 2HKNA 3CCRT 3UF4A 3VS0A 1ABQA 4LDWA 4RTVA 3FEOA 3IQLA 4A4GA 4C92A 5CK9A 5FU7B 1LJOA 2LX9A 3OBWA 4JJBA 4QQGA 4HT9A 5M9OA 2JTFA 1UEBA 1MNDA 3CC2A 1HD3A 1XJWB 3DLLA 1K73R 5GAMd 4LDUA 4MDXA 2DYIA 2X3WD 4EPCA 1IXDA 1QVGP 4XQ3A 2JXBA 3G4SA 2PZ1A 2GCXA 2D8JA 2CZ0B 2KYBA 4OB1B 2QTVA 4BE1A 4J7IA 5GAOm 4M75B 1Q95G 2QQ9A 1WHKA 4IIOA 1K9MU 4YTLA 4HXJA 5GANh 3P8BB 4LNPA 1C1AA 3CC7A 3PT9A 1V1CA 2ROLA 4JRKA 3OS0A 2DIGA 4MZPA 2VYTA 2LTOA 4XU0A 2LJ1A 1OEBA 3M55A 4FYXB 2J7IA 1D3BA 4PJJA 5FWBA 1VQMA 1M90R 3EGDB 1UTIA 2E6ZA 5CAIA 4CC7A 2A3LA 1JEGA 5GANg 3LH0A 2E5QA 4C8QB 3M59A 2M1HA 1GRIA 1VQNQ 2RM4A 1NM7A 1PWTA 3GOXA 4KGZB 4QW2A 1QMCA 4EMGA 2YDLA 2LJ0A 2NUTA 1G5VA 4QVZA 5KYYA 2V26A 3O5ZA 2C0IA 1Q81C 1YITT 3TVTA 2DILA 1X2KA 3DKMA 2YHTA 1CSKA 2KAFA 4M7DG 3CMAA 1QP2A 1UGVA 3RUXA 2EJ9A 3FJ5A 2KRMA 1KC8U 1Q81U 2GF7A 3BW1A 2L3PA 2Z0WA 1WLPB 3T9NA 4M7AC 2CS7A 4M78E 1DJ7B 3PE0A 1S72A 4ANJA 1UGQB 4A4FA 1I1JA 2HCKA 1H8KA 3AT1B 3PNWC 3OYAA 2QG9B 3CD6T 3G1JA 4PNOA 1JBMA 2M02A 4QQDA 5KCHA 4ORZA 1ZHIA 1WHMA 5KH6A 2EPDA 1RI0A 2Y4XA 1F1BB 4V2SA 3A98A 2GQVA 2RF0A 3S6WA 3CMEQ 2BZXA 1VQPT 4XAXB 3CCMA 4JRPA 1SHFA 5I21A 1OOTA 1RADB 3CCRA 3OYLA 3MP6A 1PRLC 3L2UA 2YRDA 4DA4A 1NE8A 3CCUQ 1VQ5T 2OTLA 3JV3A 4M75G 2P0QA 4XTXA 4DEXA 4ZTJA 2ESWA 5A0DA 4M7DF 2E65A 1VQLT 3EGUA 4JJDA 5IXBA 2K5IA 1QVFS 1QCNA 4OB0B 3LH5A 1D09B 3CCLQ 1YI2Q 2GBQA 2LX7A 2E1HA 1OULA 2VUBA 2O9VA 2FVUA 2DL8A 4ZTFA 1O9SA 3RBBB 1KQSS 2COYA 1FX7A 1M1FA 5I22A 5IH2A 3OYYA 3KBGA 5FU6C 2O9SA 2ZPBB 1KQ1A 2DO3A 3N5BB 4IUUA 3EG0A 4MZTA 1UDLA 2JMAA 1G8XA 2RI5A 4C8QG 4JJCA 4QKUA 3UWNA 2J06A 3DLMA 1AZGB 4WTOB 4J9GA 3V8JA 1WYXA 1ZBJA 5LJ5f 5GANd 3C4SA 4C92D 2AZVA 2KR3A 5GANe 2EGEA 2MK5A 2HZYA 2QA4Q 1B34B 4MMKA 3TSZA 1VQ7Q 3OSVA 4M75F 1M1KU 3MEVA 3JCMf 3QPHA 2FRYA 1AVZC 1WQ7A 1ZSZB 2X51A 3VS6A 3QYHB 3OYKA 3L2QA 5GAN7 5LL6S 4A4KA 3EH2A 4C0GA 2WACA 2EYQA 2RJEA 4E7HA 3M9QA 1YITA 1TUCA 4E2FB 4N4GA 1QVFP 2KXDA 3LW5E 3OYNA 3PVQA 5CKHA 4O5VA 1ZQ1A 2ED1A 1VOMA 2XIDA 3A8HB 2K2MA 2LQNA 3PVLA 1UHFA 3OQ5A 1NYFA 3H6ZA 1KQSP 1N9SA 4F7UB 4F17A 3CCQT 4Y28E 1BU1A 2RMOA 3P8DA 2HL5C 3GNGA 5GAN4 1TU0B 1U3OA 2C06A 1PRMC 3CD6A 4FL6A 4J9BA 2K5LA 3M0UA 4IIMA 1GBRA 1UGRB 5HCKA 4QT7A 2V8JA 2XICA 3EG3A 1M9SA 1VQPA 2RHYA 4FW1A 4DEYA 1B7TA 2F69A 4D8KA 3PGGA 5AYFA 5GAOl 1Y7XA 2XMFA 2RQTA 2CYZB 2OX7A 4E7ZA 5A2QE 3QDRB 4M78A 2JM9A 5C6SA 2MI6A 5KYUB 2QTXA 1VQ5A 2HQXA 2LT1A 4PJOC 2DEQA 4E7JA 4GY5A 3U23A 1D0ZA 1ZUYA 4MMLA 2ABLA 1VQLA 2JS2A 1C0MA 3C94A 2AHJB 5LJ3d 1JRIA 2LT4A 1PHTA 3I5SA 5LJ3e 2WSCE 3VYGA 1TG0A 2E12A 2CSIA 1VYVA 3S3MA 2LMJA 1GCPA 2Y4YA 2JTMA 4JRQA 2YT6A 4J6XA 3SHWA 3CMET 1V76A 2CH4W 2K6DA 3M4YA 1GCQC 4M77C 2E6NA 2FB7A 2RI3A 1E6HA 4XU1A 1BCMA 3PTAA 2DX1A 2OTJQ 3HRTA 3SDZA 3CCUT 2A0FB 4E7KA 3H9NA 4Z02A 5EC7A 2DXCA 1NJIC 2K3BA 2LZ6B 1VQ4Q 3CC4A 2VWFA 1GL5A 1TSFA 2QQAA 1RLQC 1QWFA 1KQ2A 1PD0A 3JB9J 3KFVA 5C0MA 2YLCA 3OS5A 1M30A 4GBQA 1VQ8T 1WJSA 1LNXA 2HBWA 3HP9A 3L2ZA 2YLBA 4R0KA 1QVGA 3OMCA 4C92B 5IXFA 2QYZA 4F7UG 1KD1C 5D6XA 3A5ZB 3E9FA 4Q5WA 1PC0A 4PJNA 4JZ4A 1ZA2B 4A54A 1M3AA 4C0DB 4KUDK 2GTJA 1WHJA 1KD1U 1T3SA 1Y0MA 4DBRA 2EVRA 4QVDA 4C5EA 1QWEA 2KK4A 1UGSB 2MMPA 3I56Q 2CT4A 2LDMA 4IURA 3FRNA 2IPOB 1WXUA 2BIVA 2W10A 3DB4A 4AMCA 2WSEE 5GANj 3CCQA 2G6FX 2D9TA 5IHNA 2QA4T 2COWA 4X1VA 1N6AA 2L3RA 2MAMA 4XTYA 1OU9A 4LD9K 4PLIA 2QEXT 3G71Q 1Q86R 1NZ9A 2X4JA 4PK4A 1ACMB 3BFMA 1OZ3A 2DVEA 3UATA 3JCMP 4ATOA 1D3BB 2HSPA 2K2VA 2MWOA 3VYHB 1RACB 1BK2A 4K11A 1WNLA 3TQ7P 1IO6A 4F7UF 3I55T 3GBQA 2KRSA 2DF6A 3ASKA 2LC4A 4EIKA 1WIEA 2VV5A 2J6OA 2CP5A 3CCST 4BB7A 2B8AA 4FYWB 1KIKA 1GFCA 3I35A 3BDUA 1N27A 3FB9A 3EFSA 4A63B 5KYYB 5KYXA 1MGQA 2CT3A 2HAXA 2SEMA 2LNHB 1YCYA 1XTDA 2EQMA 2M16A 1C6VX 4FW2A 4LUEA 4M7DC 2KEAA 1RABB 2NYSA 4PKCC 1VQ9Q 4Z89A 3RR6A 2HKQB 2ZPGB 2A36A 2P0KA 3CCEA 2DL4A 3A1PA 4WF2A 5J26A 4X9CA 2V1QA 1BCOA 3CMEA 4BDZA 1MNEA 2LQKA 1GBQA 1BKBA 2DEUA 1TOVA 2O01E 1WZOA 2M9UA 3EH1A 3JCMV 3JRZA 1YJWT 1E7OA 2E10A 2JOYA 4C0ZA 1VYUA 4C92G 2FYKA 4UC4A 5FU7C 4AFUC 2R5MA 2QK0A 2XKOC 3ULRB 3OYDA 3SEMA 1XQHA 4M78D 4RTWA 3S3OA 1N8RC 2RNAA 3VUZA 3V7SA 5FWCA 2O2OA 5DM7R 4E7IA 1UUEA 5FLXE 1LCKA 2EYYA 1AWXA 1YIJT 1Q7YC 2M0YA 5LJ3j 1K73C 5IN1A 2HMAA 3S3NA 1N8RU 1VQ8A 3E19A 1A0NB 2L0AA 1Q7YU 5CKFA 3PMIA 1WQWA 4OF1A 2E3HA 4M75C 3CPFA 2RQUA 1PG5B 3MEUA 2P4TA 1VQKQ 4L5GA 4HCCA 1YCSB 4KGXB 1Y96A 1WI7A 4JPBW 1SSHA 3X28B 4RTXA 1JXMA 4AG1C 1NEGA 2G3RA 4BE0A 2OTJT 2GQIA 2KROA 1OI1A 3QBYA 4OB2B 2YWWA 1I5OB 3J7AF 5GAN3 2O31A 1VQ4T 5D6YA 4M77F 4JDSA 4BUGA 2SRCA 4M4ZA 1YJ9Q 6AT1B 1TWBA 2VGMA 1R0BG 2AZSA 4C92F 5KE3A 3EAEA 4C8QC 1M4ZA 3CCVT 1QCFA 3OY9A 2QEXA 5IHIA 2CZ7B 1NEBA 2K4YA 3RKYA 2I0NA 2WSFE 4E7SA 4J9HA 3RIRA 3VU3C 1EIFA 2DD4A 2JS0A 3HL8A 2OAUA 2DL3A 2A28A 2LCCA 2RN8A 2AKKA 4BI8B 2X35A 2FEIA 1QVFA 1RL2A 1UFFA 2HSEB 1BBZA 1U06A 3I55A 3NGPA 1O75A 1K9MR 3I56T 1TXQA 2KBTA 3CCSA 3M5AA 1G2BA 1MV0B 2E5KA 3CCJT 2X4XA 3VS7A 4N0AC 4XTVA 1KQSA 1M2OA 2XDBA 2EQIA 1K1ZA 2DA9A 1ZX6A 1T0JA 1K8AR 3FJPA 4J8OA 5AT1B 2E64A 1YJNQ 1I4K1 2YUOA 3G71T 1M8VA 2MIOA 1IHVA 4CRIA 4BI4A 1RLPC 1PD1A 5IT9E 5DY9A 2K9GA 2X4WA 3HFNA 2HQHA 1UECA 3BDLA 3M0RA 2EWNA 3L2WA 4AT1B 4A4EA 3EHRA 4A53A 2YSQA 4M7AE 5GAOq 3PIPA 3NHNA 1YJWA 3HSBA 2EJGA 1GXIE 4JJNK 1E6GA 2EJFA 2L5QA 2CP6A 1MMDA 4OB3B 1YWPA 5CKBA 1KC8R 1Q81R 1I07A 3X26B 4CC2A 4EMKB 3ZEHA 1BYMA 1YIJA 1RAIB 1YHQT 1EZZB 2CREA 3CPWS 4FCYA 3V8LA 2FPEA 1FMWA 1VQ9T 3RERA 2I2LA 4FT4A 4BD3A 5KYWB 1EFNA 3BE3A 4M78B 3REBB 5LJ3h 2IVWA 1U5SA 3X25B 2DRMA 3J81E 2DBKA 2MCNA 5A0GA 1MMGA 1K0SA 3SD4A 3V7RA 1AWOA 5GJVB 3X24B 2VXEA 2ZPEB 1RI9A 3VRZA 1U8RA 3P8HA 1TTHB 3URGA 5L8RE 4DOVA 5GAMf 2ZZDA 2OTJA 2LVMA 3SWNA 1U1SA 1ARKA 2ZGWA 1OX8A 5LJ3g 1VQ4A 1PSEA 2A37A 2GFUA 4O6JA 1RUWA 2CP3A 4J9EA 2GFAA 2RHZA 3EGXA 2X3XD 3SB2A 3MPUB 2FPFA 3CCVA 5IAYA 2QGGA 2F1LA 2RJCA 1VQOQ 1K9AA 3EFRA 2HD0A 1ZSZC 2J6KA 3NTKA 1R0CB 4PLLA 3PIOA 5GAN6 1Q82C 1VIFA 1IRXA 4B9XA 2MOXA 4B9WA 2JVVA 1IB8A 1NLPC 3UDCA 1VQKT 1Y71A 2DLPA 2K3XA 2DXTA 1Q82U 2KMTA 1T0HA 4C5GA 2NUPA 1QLYA 1YFNA 2COZA 3L1AA 1WJRA 3CPWP 3DB3A 1G83A 3JCMW 3H0IA 2ZAEA 2VXFA 2JW4A 3G4SQ 5GAOr 3CCJA 2K7AA 1JXOA 3QHSA 1B07A 3EGDA 1KHIA 1SRLA 5CO7A 1H641 3V8KA 4J9FA 3QWYA 3VS2A 3LGLA 3G6EQ 3HHTB 3FDRA 2CGHA 4AG2C 1I5LA 2J05A 3G71A 5CR2A 5D7UA 3L2VA 4C0FA 3TEEA 2QXFA 1MHNA 5CQYA 2X9HA 3LGFA 4JRIA 1QW1A 2YRCA 1M1KR 1UHCA 2L3SA 4ZGDB 1VQ6Q 4C8QF 1X75C 4OGEA 3I9QA 3GLXA 4JLGA 1ABOA 1VQNT 4M78G 1WPYA 4PFZA 4DOWA 4Y92A 4D6WA 4IUTA 3F70A 2CP7A 1UB4A 5FROA 1YWOA 4LD6A 5HK3A 4FYYB 4ZGJB 4QVCA 4XTZA 4KH1B 1YJNT 3OB9A 5IHKA 4Z8AA 1YHQA 2M51A 1HK9A 2XD0A 2XDPA 2P4RA 3J80E 3CMAQ 2CSQA 1SSFA 3HRSA 4GLKA 4KT0E 2X4YA 1HSQA 4OMPA 2RK1A 2K3YA 2KRNA 1TUDA 2JJ9A 2KY9A 1S1NA 4M7AA 3EG9A 2EQJA 5CKEA 1S72Q 4J5YA 4PJOE 3QZ5B 1VA7A 4JUVA 1LVKA 3C12A 4OGCA 3RMQA 3EFOB 2DETA 2BE7D 2GNCA 2DBMA 1PNJA 4OP0A 1K0XA 4CI0C 1CKBA 4M78F 4DBFA 3TSWA 3CCMQ 2PU9B 3CBOA 2JUFA 7AT1B 4XTWA 1ZSGA 1X69A 4RG8A 3FIFA 1P92A 4JLIA 4M77E 3QIIA 2HBPA 4C92C 3A8GB 2OTLQ 2PUOB 2EYZA 3QSUA 2P84A 3LX7A 1D0XA 3OMGA 2VVKA 4AFSC 5GANf 4C0DC 2FHDA 1ZLMA 3CCLT 4J83A 1NJIU 1YI2T 1VIEA 1MUZA 1RAEB 1BIAA 2EFIA 4ZNXA 9ATCB 4BDYA 2YUNA 1SG5A 3E9GA 8ATCB 1FWZA 3MEWA 2E4HA 3Q1JA 5L23A 4XTUA 4A4HA 4FU6A 4C5IA 1VQOT 2DE0X 2DM1A 2LNVA 2MYSA 4BE2A 1Z9ZA 2PTKA 2V8IA 4RKUE 4D8DA 2RQWA 4WCIA 3OA6A 4J9CA 4FM4B 2OJ2A 2RD1A 3TCJA 3QDFA 3PFSA 2ATCB 3V7CA 2KI7A 1VQ7T 5KCOA 4PL6A 3M0SA 4RG2A 1VQNA 1N5ZA 1PSFA 1KD1R 4P5NA 2LP5A 1MMNA 3CXCS 3VV0A 5LJ5h 3G6ET 3EG1A 2RPNA 3SFMA 2BUDA 1H3HA 1YJNA 1LPLA 5GMKh 1YITQ 3OBYA 2L2PA 2KQWA 3OS2A 3JB9D 3MP1A 2QDLA 2KDSA 2DL5A 2RB6A 1NG2A 1RAAB 3M0TA 2E3IA 1VQ6T 1M8MA 2DFUA 3H0HA 3M57A 1YP5A 2K5FA 5LJ5g 3OYGA 4R56A 2NUTB 3OS1A 2DJZA 4B6MA 3LWIA 2V1RA 2DTIA 2BZ8A 2DXUA 4QQ6A 2O88A 1JJ2S 1TUGB 1QKWA 3CBMA 3CD6Q 1JO8A 2FL7A 1FMVA 3G7ZA 1RAHB 1KFZA 4M7DE 4J6YA 2KXCA 4JS4A 2JTEA 3JB9I 4KUIA 4LDVA 3JCMb 2L3QA 3RDVA 1H92A 3GP8A 1D1BA 4XU3A 4RTZA 1VQPQ 4BY6B 1D1CA 3RESA 1BB9A 8AT1B 4HA8A 4VUBA 1I8FA 3VRYA 1TS9A 2OI3A 3CCUA 1R77A 2KSSA 2HL3A 1VQ5Q 4PJOA 2DTHA 3M56A 2KVQG 4DBQA 3JCMX 4RTYA 5GJWB 3JSCA 3OYJA 3CXCP 1UGPB 2XI9A 3VS3A 1IREB 4RCCA 1WXTA 3MKDA 1VQLQ 3MO8A 1M5Q1 5EG2A 2IIMA 4AFZC 1KSWA 3CCLA 2CZ6B 2JT4A 2MF2A 1YI2A 4M7AD 3C95A 3L42A 1MV3A 4IUVA 3MHXA 4HCBA 1AOJA 5CKDA 4LUDA 1FMKA 2CZ1B 4E7LA 4ESRA 1K76A 1K73U 4OMNA 2E70A 2D1XA 1X6GA 2XG8D 1GCQA 4M77A 4M75E 1SEMA 1VQOA 5FW9A 1JJ2P 5I2SA 2DKGA 2DPPB 4LDXA 1M27C 3SWNB 3CEYA 1WX6A 2FZCB 1NBEB 1I81A 4L59A 2EAYA 2OTLT 1N8RR 1H3ZA 3CC4Q 1AHJB 4RTUA 1BI3A 1OQKA 2RJFA 1VUBA 4JZ3A 1SKUB 1IZ6A 1Q7YR 2R57A 1J3TA 1M90C 2DL7A 3EGXB 2QA4A 1M1GA 1VQ7A 5GAMe 3VS1A 2NWMA 3CPWA 1BI0A 2ZPFB 1M90U 1Z9QA 4KH0B 4C8QE 4F14A 2KE9A 1K9MC 1OYXA 2F2XA 3QJYA 4XU2A 1M3CA 2V8KA 3M53A 2CP2A 3G6EA 2DXBA 1FYNA 2CUBA 1IGQA 2DTOA 1K8AC 1RAGB 1X43A 1SF9A 3HRUA 2RO0A 5GMKm 1ZBXA 2NUPB 3CQTA 5LJ5d 2ED0A 3QO3A 1R8OB 4BI3A 1K8AU 1X01A 2OAWA 2VB6A 5LJ5e 1VQ6A 3MP8A 4HCZA 2MPXC 3E2UA 1PCXA 3LLRA 2RI2A 4KRTA 2L89A 5GMKe 2EW3A 4PFPA 5HK0A 3CCQQ 2B86A 3QKJA 3JCMd 3R6OA 4ZN1A 2EQKA 5D6WA 1SRMA 2YUPA 1U1TA 3ZFJA 3H41A 3JCMe 4E47A 2DZ9A 2DK3A 3OYHA 3GF5A 4N4HA 2RH2A 2FZGB 2JZ2A 3RKXA 2CP0A 5FRNA 3AHUA 2YRVA 1AWJA 2MWPA 2F5TX 3EG2A 1FXXA 3M54A 1QP3A 2EBPA 4EMKC 1KC8C 1KJWA 2RHUA 2RA2A 4LN2A 4NOYA 1ZUUA 2R5AA 1NLOC 2XDDA 4RUGA 4J9IA 5J3BA 4M78C 1WGSA 1HJDA 1X27A 2XK0A 3H8ZA 1WFWA 2EKHA 2C0TA 1PKTA 2C0OA 3OYEA 1CKAA 3META 1BI2A 1G3SA 3VUBA 3OSSC 1AEYA 1YN8A 1XOVA 5GAOp 3OYBA 3OYMA 4PJMA 4FYVB 3PMTA 4HCKA 2ENMA 4M7DA 2F2VA 4OMMA 4IUQA 2FZKB 2PUKB 4EMHA 2O4XA 3OYCA 1WHLA 3LWHA 5ECAA 3CCEQ 2DD5A 1KHCA 1OPLA 1PM3A 2DYBA 2JM8A 4F04B 4M7AB 3EG9B 1UJ0A 3WVEB 2FPDA 1W4SA 2EIFA 1M3BA 2HNIA 3GIBA 1M2VA 4GLMA 2LCSA 1K4US 4Y91A 2AIRB 4KGVB 5HKCA 3A8MB 3UA7A 1OV3A 2DMOA 4F16A 1W6XA 2RQVA 4PJOD 2LRQA 3UPUA 1MMAA 1QCOA 2YUQA 4ME7A 1ZA1B 1VQ8Q 4RCBA 1NPRA 3ME9A 2ZPIB 2RHIA 2RJDA 1JQQA 4PFOA 5GAOn 1WXBA 4M75A 1BIBA 4MDWA 3JB9G 2DRKA 2CKKA 3FLGA 3CC2Q 2D6FA 1QQJA 3KXTA 1WDXA 2KT1A 1KK7A 2D8HA 2H8HA 2BZYA 4FSSA 4PJLA 4X9DA 4M77D 3UA6A 3I56A 2QQSA 4OMQA 2DJQA 3CC4T 1IHWA 3TU4K 1YJ9T 1HXDA 2HEQA 3M0QA 1M1KC 5FU6B 4HKEA 2BTTA 4OMFB 2EGCA 4TVRA 4F7UE 5GAMj 4C8QA 1G3WA 1YNZA 4ELZC 1OZ2A 1HYOA 2LQWA 2QEXQ 1Q82R 3CC7Q 4X34A 3M0PA 2ECZA 3D7SB 3BY7A 4DQ2A 3VS4A 3RKWA 3OYFA 5KYNA 4HVVA 3UT1A 1VQMQ 1SPKA 4J9DA 1WJQA 1T3LA 2PVDB 2PVGB 2QQRA 3I55Q 3MEAA 3JB9F 3NPFA 3M58A 5KE2A 5LJ5j 1N9RA 3CCSQ 5GAN2 2RQRA 4FT2A 4N0AA 4CC3A 4M7AG 5GMKj 3OW2A 2A08A 2KNBB 2VGNA 2QQBA 2BE9B 2XHCA 3HTRA 4II1A 4NL3A 2QAZA 3NTHA 5CQXA 2VKNA 1AWWA 4MZMA 1VQ9A 3ZBDA 3H0FA 1W2BA 3TREA 2PVOB 3HFOA 4LDYA 2EQUA 3QJ6A 3RMSA 2H3EB 4EMKA 4J7FA 2QGFB 1RAFB 5KYXB 3FC3A 3EHQA 2DNUA 5GAN5 1LOJA 5CVIA 1XNIA 3WXMB 4ZN3A 1YJWQ 1OX9A 5KYWA 2DERA 5GAN8 5GMKl 3WVDB 2E41A 2QDYB 3L2RA 3CXCA 3C0CA 2W0ZA 1ZUKA 5I2MA 5DLOA 5DLQE 1D1AA 2RHXA 1UG1A 1YIJQ 1PKSA 2M0OA 4EDUA 1BI1A 4M7AF 1QVPA 4NL2A 4IKFA 3CCRQ 2FG0A 2KYMA 3CCET 2ZPHB 4JS5A 5J39A 1KG1A 3HKSA 2JNGA 4M7DD 2VC8A 4OMOA 4CC4B 5CCAA 4PJOB 3MCAB 2EKOA 1X2QA 3VKIA 4C92E 4LE9A 1VQKA 3KUFA 1X6OA 4ZGEB 2R58A 3A8OB 3M4GA 1WHGA 1JJ2A 2KGTA 2LCLA 2VASA 1B3QA 1G3TA 2L8DA
chains in the Genus database with same CATH topology
5CIUA 1YJ9A 2DTHA 3M56A 2KVQG 3HFNA 3JCMX 3OYJA 3L2QA 3JSCA 3LYIA 5GAN7 3OW2S 4HT8A 3BDLA 1UGPB 5LL6S 2XI9A 4A4KA 1IREB 2EWNA 4RCCA 4C0GA 4C5HA 2WACA 3L2WA 2EYQA 2RJEA 4E7HA 2D0QB 3M9QA 4A4EA 3MO8A 1YITA 1M5Q1 5EG2A 4A53A 1B34A 4N4GA 4M77B 4L6V5 3LW5E 3QZ9B 5GAOq 1Y96B 3PIPA 3OYNA 3CCLA 2CZ6B 2MF2A 4NS5A 1YI2A 4M7AD 3C95A 5CKHA 1YJWA 4O5VA 1ZQ1A 4KULA 5A0LA 3L42A 3HSBA 2EJGA 2XIDA 1GXIE 3A8HB 4IUVA 3MHXA 3HPWA 1Q86C 4JJNK 3OQ5A 5GAMh 4HCBA 5CKDA 1W2BS 2CZ1B 4E7LA 2LQ8A 2X4WA 2P0PA 2EJFA 2L5QA 3H6ZA 1N9SA 1K73U 4OB3B 4N4IA 2BKDN 5CKBA 2E70A 4F7UB 3JCMJ 3X26B 4Y28E 3CCQT 3CC2T 1Q86U 3P8DA 3GNGA 2QI2A 2XG8D 3QXEB 4EMKB 4M77A 3ZEHA 5GAN4 3OYIA 1BYMA 4M75E 1YIJA 1YHQT 4M75D 1VQOA 2C06A 5I2SA 3O8VA 4FL6A 3CPWS 2DKGA 3CD6A 3V8LA 1VQ9T 2DPPB 3RERA 4LDXA 2JN0A 2I2LA 2K5LA 4FT4A 4BD3A 3SWNB 3CEYA 3NFCA 4J6WA 5GAMg 2H3JA 3NTIA 4M78B 3G4ST 4L59A 1I81A 5LJ3h 2IVWA 2EAYA 3X25B 2OTLT 3J81E 1UGRB 1H3ZA 1AHJB 3QUIA 4F7UA 3JCMc 1BI3A 2RJFA 2V8JA 5A0GA 1VUBA 2XICA 3SD4A 3V7RA 1NPPA 3OYKA 1M9SA 1IZ6A 1VQPA 2R57A 2RHYA 3X24B 2VXEA 1M90C 2ZPEB 2F69A 3GPLA 1U8RA 2QA4A 3PGGA 1M1GA 5AYFA 5GAOl 1Y7XA 1VQ7A 3P8HA 3URGA 2Y90A 5GAMe 1Y07A 5L8RE 4DOVA 5GAMf 2CYZB 2ZZDA 2LVMA 3CPWA 3SWNA 3CC7T 2OTJA 5A2QE 1BI0A 1U1SA 3QDRB 2ZPFB 4M78A 2ZGWA 2MI6A 5C6SA 1M90U 4C8QE 2A7YA 4FIBA 1K9MC 5LJ3g 1OYXA 4C8QD 2QTXA 1VQ4A 1VQ5A 2HQXA 3JCMh 2LT1A 3X20B 1PSEA 4PJOC 3QJYA 2DEQA 2GFUA 4XU2A 4O6JA 2PQWA 4E7JA 2RK2A 2V8KA 2ZCFB 1JB0E 3M53A 4GY5A 3JCMQ 1VQMT 5GMKi 2GFAA 2DXBA 2RHZA 3G6EA 4BY6C 4KBMB 4MMLA 1VQLA 3QG1A 3SB2A 4R55A 2DTOA 3C94A 1K8AC 2AHJB 2XU8A 5LJ3d 4FSXA 3HRUA 3CCVA 2RO0A 1JRIA 2LT4A 5IAYA 5GMKm 1ZBXA 4PJOA 3JAME 2RJCA 3EFRA 5LJ3e 2WSCE 3VYGA 2HD0A 3E1SA 5LJ3f 4ELYC 5LJ5d 2E12A 3NTKA 3S3MA 2K57A 3QO3A 1R8OB 4PLLA 4BI3A 4RMOA 2IG0A 3PIOA 1X01A 3JCMg 5GAN6 1VIFA 1Q82C 5FRMA 5LJ5e 4PJOG 4B9XA 1VQ6A 3MP8A 4HCZA 2Y4YA 2DIQA 2JTMA 4JRQA 4B9WA 1YBYA 2JVVA 3LLRA 4J6XA 3INZA 2RI2A 3GNFB 3UDCA 2L89A 1Y71A 5GMKe 3CMET 1VQKT 2K3XA 3A8LB 3QYGB 5HK0A 4BACA 2DXTA 3M4YA 1Q82U 2DAQA 2KMTA 4M77C 2E6NA 3QKJA 2FB7A 2RI3A 3JCMd 4C5GA 3R6OA 4ZN1A 2EQKA 5D6WA 4XU1A 3L1AA 1WJRA 3DB3A 3JCMW 1U1TA 3ZFJA 3PTAA 1TH7A 3JCMe 4E47A 3CMAT 2DZ9A 3HRTA 1QVGS 2DK3A 3OYHA 2VXFA 3SDZA 3GF5A 4N4HA 2HQEA 2RH2A 3CCUT 3RKXA 2JZ2A 4E7KA 5GAOr 3CCJA 4Z02A 1K8AU 5FRNA 2DXCA 1NJIC 3AHUA 2NLUA 2YRVA 3CC4A 2MWPA 3QHSA 1KHIA 2F5TX 5CO7A 1FXXA 3VJPA 1H641 2QQAA 3V8KA 1S72T 3M54A 1QP3A 3LGLA 4EMKC 1KC8C 3CBPA 3HHTB 2RHUA 4M77G 1KQ2A 2RA2A 3FDRA 1V29B 3JB9J 3ER0A 5C0MA 2CGHA 2YLCA 1I5LA 3OS5A 3G71A 5CR2A 4IUPA 4NOYA 2R5AA 2F5KA 3SWNC 2XDDA 1VQ8T 3L2VA 4C0FA 1WJSA 4M7DB 3TEEA 5J3BA 4M78C 2QXFA 3JB9H 1MHNA 1LNXA 1WGSA 3HP9A 3L2ZA 2YLBA 1QVGA 5CQYA 3LGFA 3OMCA 4JRIA 1QW1A 2O4XB 2XK0A 4C92B 3H8ZA 4F7UG 1KD1C 2DZCA 4ZGDB 4C8QF 5D6XA 3A5ZB 3E9FA 4Q5WA 3OYEA 1G3YA 3META 1BI2A 1G3SA 4A54A 3CCMT 3VUBA 4C0DB 3OSSC 4KUDK 1X75C 1XOVA 4OGEA 5GAOp 4XK8E 4OVAA 1KD1U 3OYBA 4PJOF 5HY6A 3OYMA 3GLXA 3PMTA 4JLGA 4M7DA 3CCRT 4QVDA 1VQNT 4IUQA 4M78G 4C5EA 1WPYA 4DOWA 2PUKB 4LDWA 4D6WA 2KK4A 1UGSB 2MMPA 3FEOA 4A4GA 4IUTA 2LDMA 2O4XA 3F70A 4IURA 3FRNA 4C92A 5CK9A 5FU7B 3OYCA 1LJOA 2LX9A 3OBWA 1UB4A 3LWHA 5FROA 4QQGA 4HT9A 2DD5A 1KHCA 1UEBA 2JTFA 5M9OA 2BIVA 4LD6A 3DB4A 5HK3A 2WSEE 4M7AB 5GANj 3CCQA 2D9TA 3WVEB 4ZGJB 4QVCA 4XTZA 3CC2A 1W4SA 2EIFA 4M7AE 3DLLA 1YJNT 2HNIA 3OB9A 2QA4T 5GAMd 3GIBA 1YHQA 1N6AA 2L3RA 2MAMA 4XTYA 1HK9A 4LDUA 2XD0A 4Y91A 2XDPA 4LD9K 4PLIA 2QEXT 4MDXA 3J80E 1NZ9A 4EPCA 5HKCA 1SSFA 3A8MB 3HRSA 4GLKA 2X4JA 4KT0E 2X4YA 4XQ3A 2RK1A 3G4SA 2K3YA 2GCXA 3BFMA 2CZ0B 1OZ3A 2DVEA 3JCMP 4OB1B 2KY9A 4BE1A 4J7IA 4M7AA 2EQJA 5GAOm 4ATOA 1D3BB 4M75B 5CKEA 2K2VA 2QQ9A 4J5YA 2MWOA 4PJOE 3VYHB 3QZ5B 4JUVA 1K9MU 4PJOD 3C12A 4OGCA 4YTLA 2LRQA 3RMQA 3UPUA 1WNLA 5GANh 3P8BB 4F7UF 4ME7A 3I55T 3CC7A 3PT9A 3ASKA 4JRKA 2LC4A 2DIGA 3OS0A 2VV5A 4MZPA 2VYTA 2LTOA 4RCBA 4XU0A 3CCST 1NPRA 3ME9A 2ZPIB 2RHIA 4BB7A 2B8AA 2RJDA 3M55A 3BDUA 5GAOn 1D3BA 4M75A 1BIBA 4OP0A 1VQMA 4MDWA 3JB9G 1N27A 3FB9A 3EFSA 2E6ZA 4CI0C 4M78F 2CKKA 1MGQA 3FLGA 5CAIA 2HAXA 2A3LA 2D6FA 3KXTA 2PU9B 1YCYA 5GANg 1XTDA 2JUFA 3CBOA 3LH0A 2EQMA 2E5QA 2M16A 4XTWA 4C8QB 3M59A 4M7DC 2M1HA 3FIFA 1P92A 4JLIA 4PKCC 4M77E 4RG8A 4X9DA 3QIIA 2RM4A 4M77D 2HBPA 3I56A 2QQSA 2ZPGB 4C92C 4QW2A 4EMGA 2P0KA 3A8GB 3GOXA 3CCEA 3CC4T 3TU4K 1YJ9T 4WF2A 5J26A 1HXDA 4X9CA 1G5VA 2PUOB 4QVZA 3QSUA 1M1KC 3LX7A 5FU6B 3CMEA 3OMGA 4HKEA 4OMFB 5GANf 4C0DC 4BDZA 1Q81C 2FHDA 2LQKA 1YITT 1BKBA 4TVRA 4F7UE 2O01E 5GAMj 2M9UA 3CCLT 3DKMA 4J83A 3JCMV 4C8QA 2YHTA 1YI2T 1NJIU 2KAFA 3JRZA 1G3WA 4ELZC 1YJWT 1OZ2A 1VIEA 2EFIA 4M7DG 1BIAA 3CMAA 1QP2A 2E10A 2JOYA 3RUXA 2EJ9A 4BDYA 4C0ZA 1KC8U 1Q81U 4X34A 4C92G 2FYKA 3E9GA 4UC4A 5FU7C 2GF7A 2R5MA 3BW1A 2XKOC 3OYDA 1FWZA 3MEWA 3BY7A 1XQHA 4DQ2A 3Q1JA 3T9NA 3RKWA 4M7AC 2CS7A 4M78E 3OYFA 1DJ7B 4M78D 3UT1A 3S3OA 1N8RC 1S72A 3VUZA 1UGQB 3V7SA 1WJQA 4XTUA 5DM7R 4E7IA 4A4FA 4A4HA 5FLXE 2PVDB 2PVGB 3PNWC 4FU6A 4C5IA 1YIJT 1Q7YC 1VQOT 2QQRA 5LJ3j 1K73C 5IN1A 3OYAA 2LNVA 3CD6T 4BE2A 3MEAA 3S3NA 4PNOA 1N8RU 1JBMA 4QQDA 5KCHA 1VQ8A 1ZHIA 3E19A 3JB9F 5KH6A 3M58A 5KE2A 5LJ5j 2V8IA 4EMHA 1N9RA 1Q7YU 5GAN2 4RKUE 1RI0A 2Y4XA 5CKFA 4FT2A 3PMIA 1WQWA 4N0AA 4OF1A 4M7AG 5GMKj 4M75C 3OW2A 3CPFA 3OA6A 4V2SA 3MEUA 2P4TA 4FM4B 2GQVA 4L5GA 3S6WA 1VQPT 2RD1A 2VGNA 4HCCA 3TCJA 1Y96A 2QQBA 4XAXB 3CCMA 4JRPA 3PFSA 2XHCA 4II1A 3V7CA 4NL3A 3NTHA 3X28B 5CQXA 5I21A 1VQ7T 4MZMA 2G3RA 4BE0A 5KCOA 2OTJT 3CCRA 3OYLA 1VQ9A 3QBYA 1OI1A 3MP6A 4PL6A 4RG2A 1VQNA 4OB2B 3L2UA 1PSFA 4DA4A 3J7AF 4P5NA 3ZBDA 1NE8A 5GAN3 1W2BA 3TREA 2PVOB 4M77F 5D6YA 1VQ4T 4JDSA 1VQ5T 4BUGA 3HFOA 2OTLA 4M75G 4LDYA 2P0QA 4XTXA 3VV0A 3CXCS 2EQUA 3QJ6A 4ZTJA 3RMSA 5LJ5h 5A0DA 4M7DF 2VGMA 3G6ET 4EMKA 4J7FA 3SFMA 2E65A 2BUDA 1VQLT 1YJNA 3FC3A 4C92F 5GMKh 3OBYA 5GAN5 2K5IA 1QVFS 1LOJA 4OB0B 5KE3A 3EAEA 4C8QC 1M4ZA 1XNIA 5CVIA 3WXMB 4ZN3A 3CCVT 2KQWA 3OS2A 3OY9A 2E1HA 2QEXA 3MP1A 3JB9D 2CZ7B 2KDSA 2VUBA 2K4YA 3RKYA 5GAN8 2FVUA 2RB6A 4ZTFA 2WSFE 1O9SA 5GMKl 3RIRA 3VU3C 3WVDB 1EIFA 2DD4A 2E41A 1FX7A 1KQSS 1M1FA 1VQ6T 2QDYB 3HL8A 3M57A 3OYYA 3L2RA 2OAUA 2K5FA 3KBGA 5FU6C 5LJ5g 3CXCA 2ZPBB 3OYGA 4R56A 2LCCA 1KQ1A 5I2MA 2DO3A 3N5BB 5DLOA 3OS1A 2DJZA 4IUUA 4BI8B 5DLQE 2DTIA 3LWIA 2RHXA 2X35A 4MZTA 4C8QG 2RI5A 2DXUA 4QQ6A 3UWNA 1JJ2S 1RL2A 1QVFA 3CBMA 3I55A 2M0OA 3DLMA 1BI1A 4EDUA 4M7AF 3V8JA 1QVPA 4NL2A 4IKFA 1O75A 2FL7A 3I56T 3G7ZA 3CCSA 3M5AA 3CCET 2ZPHB 4JS5A 5J39A 3CCJT 5LJ5f 1KG1A 2X4XA 4M7DE 3HKSA 4N0AC 2JNGA 4J6YA 4XTVA 1KQSA 2VC8A 4M7DD 2XDBA 5CCAA 4PJOB 5GANd 3MCAB 4JS4A 2EKOA 3C4SA 3JB9I 3VKIA 4KUIA 4LDVA 4C92E 3JCMb 1VQKA 3GP8A 4C92D 4XU3A 5GANe 4BY6B 3FJPA 4J8OA 3KUFA 2E64A 1I4K1 1X6OA 4ZGEB 1B34B 4MMKA 2R58A 3G71T 1M8VA 3A8OB 3M4GA 3OSVA 1JJ2A 3RESA 4M75F 1M1KU 3MEVA 2LCLA 1I8FA 4HA8A 4VUBA 3JCMf 3QPHA 4CRIA 4BI4A 1WQ7A 1G3TA 3CCUA 5IT9E 5DY9A 3QYHB 2KSSA 2L8DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZ3 A;  3MP8 A;  4HCZ A;  5CIU A;  3PMI A;  3OYJ A;  3L2Q A;  2DIQ A;  3LYI A;  4B9W A;  4BE1 A;  3BDL A;  3OA6 A;  3LLR A;  2EQJ A;  2RI2 A;  2L89 A;  3MEU A;  2K3X A;  4C5H A;  4BAC A;  2WAC A;  3S6W A;  3L2W A;  2MWO A;  2RJE A;  4E7H A;  3M9Q A;  4A4E A;  2DAQ A;  3MO8 A;  2E6N A;  3QKJ A;  3PFS A;  4II1 A;  4N4G A;  2RI3 A;  4C5G A;  2LRQ A;  3OYN A;  2EQK A;  3NTH A;  5D6W A;  4NS5 A;  1WJR A;  2G3R A;  3DB3 A;  4BE0 A;  3L42 A;  5KCO A;  3OYL A;  3QBY A;  1OI1 A;  3ASK A;  3MP6 A;  4IUV A;  4PL6 A;  4RG2 A;  2DIG A;  3OS0 A;  3L2U A;  3OYH A;  4N4H A;  2HQE A;  3OQ5 A;  2VYT A;  2LTO A;  2JZ2 A;  4E7K A;  3ME9 A;  2RHI A;  4E7L A;  2X4W A;  2B8A A;  5D6Y A;  3H6Z A;  2RJD A;  4Z02 A;  5FRN A;  2NLU A;  2YRV A;  2MWP A;  4B9X A;  4N4I A;  2EQU A;  3QJ6 A;  2BKD N;  4ZTJ A;  1N27 A;  3LGL A;  3P8D A;  2BUD A;  2CKK A;  2RHU A;  3FLG A;  3OYI A;  3FDR A;  3ZEH A;  3FC3 A;  5C0M A;  5KE3 A;  3EAE A;  1XNI A;  3LH0 A;  2EQM A;  2E5Q A;  2M16 A;  3O8V A;  4FL6 A;  4IUP A;  3OS2 A;  3OY9 A;  3MP1 A;  2R5A A;  2M1H A;  2F5K A;  3L2V A;  1WJS A;  3QII A;  4BD3 A;  3CEY A;  1MHN A;  2QQS A;  3NTI A;  4ZTF A;  1WGS A;  3GOX A;  4QW2 A;  2P0K A;  4L59 A;  3LGF A;  3OMC A;  2O4X B;  2XK0 A;  3H8Z A;  5J26 A;  3L2R A;  1H3Z A;  1G5V A;  2RJF A;  4QVZ A;  5D6X A;  3E9F A;  3SD4 A;  4Q5W A;  3OYG A;  3LX7 A;  2LCC A;  3OYE A;  3OMG A;  3MET A;  2R57 A;  2RHY A;  4IUU A;  3OS1 A;  4BDZ A;  2FHD A;  2RHX A;  2X35 A;  2RI5 A;  4QQ6 A;  4OVA A;  3UWN A;  3OYB A;  3OYM A;  3P8H A;  3PMT A;  1OZ2 A;  2EFI A;  2M0O A;  3DLM A;  4EDU A;  2LVM A;  4IKF A;  4BDY A;  4IUQ A;  4C5E A;  5C6S A;  4X34 A;  3E9G A;  3FEO A;  4UC4 A;  4A4G A;  2GF7 A;  4IUT A;  2LDM A;  2O4X A;  1OYX A;  2R5M A;  3F70 A;  4IUR A;  3OYC A;  5J39 A;  2HQX A;  3OYD A;  2X4X A;  3MEW A;  4QQG A;  5FRO A;  5M9O A;  1KHC A;  2JTF A;  2GFU A;  2PQW A;  2BIV A;  3Q1J A;  4LD6 A;  4GY5 A;  4E7J A;  3DB4 A;  2EKO A;  3C4S A;  3OYF A;  2GFA A;  3UT1 A;  2RHZ A;  3S3O A;  2D9T A;  1WJQ A;  4E7I A;  4A4F A;  3OB9 A;  4A4H A;  3KUF A;  4FU6 A;  4C5I A;  3PNW C;  2L3R A;  2RO0 A;  2QQR A;  2R58 A;  5IAY A;  5IN1 A;  3OYA A;  2RJC A;  2XDP A;  4PLI A;  4BE2 A;  3MEA A;  3S3N A;  3MEV A;  4QQD A;  1SSF A;  5KCH A;  3NTK A;  4CRI A;  5KH6 A;  2X4Y A;  5KE2 A;  3S3M A;  4PLL A;  2K3Y A;  2IG0 A;  5FRM A;  3OYK A;  1RI0 A;  2L8D A; 
#chains in the Genus database with same CATH topology
 5CIU A;  1YJ9 A;  4HT8 A;  3LYI A;  3OW2 S;  4C5H A;  4HVW A;  2D0Q B;  1B34 A;  4M77 B;  4L6V 5;  3QZ9 B;  1Y96 B;  2EYW A;  4NS5 A;  3CCV Q;  1EX4 A;  2CDT A;  4KUL A;  3REA B;  5A0L A;  2CH4 A;  3QWX X;  3I5R A;  1ZSZ A;  2NUZ A;  4OML A;  3HPW A;  1Q86 C;  5GAM h;  1NJI R;  1W2B S;  4AFQ C;  2LQ8 A;  4RTT A;  2P0P A;  4N4I A;  2BKD N;  3JCM J;  3CC2 T;  1Q86 U;  2AT1 B;  2QI2 A;  2ROT A;  3QXE B;  4DBH A;  3OYI A;  4E6R A;  1W1F A;  4M75 D;  2D0N A;  3O8V A;  3ZL7 C;  2JN0 A;  1AD5 A;  2AK5 A;  2CUD A;  3NFC A;  4J6W A;  5GAM g;  2H3J A;  2F2W A;  3NTI A;  3G4S T;  1JU5 C;  2DVJ A;  3CCJ Q;  1W70 A;  4F7U A;  3QUI A;  3JCM c;  1AT1 B;  1NYG A;  1UJY A;  2YXY A;  1NPP A;  3MJX A;  3GPL A;  2Y90 A;  1Y07 A;  1I0C A;  3CC7 T;  3R6N A;  2A7Y A;  4FIB A;  4C8Q D;  3JCM h;  3X20 B;  2QAS A;  2JMC A;  2PQW A;  2RK2 A;  2ZCF B;  3OW2 P;  1JB0 E;  3JCM Q;  1VQM T;  5GMK i;  1VYT A;  4BY6 C;  4KBM B;  1X6B A;  3QG1 A;  4R55 A;  1AZE A;  2XU8 A;  2GTO A;  4FSX A;  3JAM E;  3E1S A;  5KYU A;  1WHH A;  5LJ3 f;  4ELY C;  3NMZ C;  1IGU A;  2K57 A;  4HVU A;  4RMO A;  2IG0 A;  3JCM g;  1W2B P;  5FRM A;  4PJO G;  1SHG A;  1WA7 A;  2DIQ A;  1YBY A;  4Z88 A;  3INZ A;  3GNF B;  3A8L B;  3QYG B;  4BAC A;  2DAQ A;  2AKL A;  1D0Y A;  3EFO A;  1YHQ Q;  3CMA T;  1TH7 A;  1UE9 A;  5I11 A;  1QVG S;  2HQE A;  3VS5 A;  2KT8 A;  2NLU A;  3THK A;  4LXC A;  2EYX A;  2LJ3 A;  1OPK A;  3VJP A;  1S72 T;  3CBP A;  4M77 G;  1V29 B;  3ER0 A;  2FO0 A;  2HDA A;  4IUP A;  2F5K A;  3SWN C;  1GFD A;  1QKX A;  4M7D B;  3JB9 H;  1Y57 A;  2O4X B;  2DZC A;  2GGR A;  2FRW A;  2J6F A;  1G3Y A;  3RNJ A;  2K79 A;  3CCM T;  4XK8 E;  4OVA A;  1OU8 A;  2PNI A;  1M2V B;  4PJO F;  5HY6 A;  2EGA A;  2HKN A;  3CCR T;  3UF4 A;  3VS0 A;  1ABQ A;  4LDW A;  4RTV A;  3FEO A;  3IQL A;  4A4G A;  4C92 A;  5CK9 A;  5FU7 B;  1LJO A;  2LX9 A;  3OBW A;  4JJB A;  4QQG A;  4HT9 A;  5M9O A;  2JTF A;  1UEB A;  1MND A;  3CC2 A;  1HD3 A;  1XJW B;  3DLL A;  1K73 R;  5GAM d;  4LDU A;  4MDX A;  2DYI A;  2X3W D;  4EPC A;  1IXD A;  1QVG P;  4XQ3 A;  2JXB A;  3G4S A;  2PZ1 A;  2GCX A;  2D8J A;  2CZ0 B;  2KYB A;  4OB1 B;  2QTV A;  4BE1 A;  4J7I A;  5GAO m;  4M75 B;  1Q95 G;  2QQ9 A;  1WHK A;  4IIO A;  1K9M U;  4YTL A;  4HXJ A;  5GAN h;  3P8B B;  4LNP A;  1C1A A;  3CC7 A;  3PT9 A;  1V1C A;  2ROL A;  4JRK A;  3OS0 A;  2DIG A;  4MZP A;  2VYT A;  2LTO A;  4XU0 A;  2LJ1 A;  1OEB A;  3M55 A;  4FYX B;  2J7I A;  1D3B A;  4PJJ A;  5FWB A;  1VQM A;  1M90 R;  3EGD B;  1UTI A;  2E6Z A;  5CAI A;  4CC7 A;  2A3L A;  1JEG A;  5GAN g;  3LH0 A;  2E5Q A;  4C8Q B;  3M59 A;  2M1H A;  1GRI A;  1VQN Q;  2RM4 A;  1NM7 A;  1PWT A;  3GOX A;  4KGZ B;  4QW2 A;  1QMC A;  4EMG A;  2YDL A;  2LJ0 A;  2NUT A;  1G5V A;  4QVZ A;  5KYY A;  2V26 A;  3O5Z A;  2C0I A;  1Q81 C;  1YIT T;  3TVT A;  2DIL A;  1X2K A;  3DKM A;  2YHT A;  1CSK A;  2KAF A;  4M7D G;  3CMA A;  1QP2 A;  1UGV A;  3RUX A;  2EJ9 A;  3FJ5 A;  2KRM A;  1KC8 U;  1Q81 U;  2GF7 A;  3BW1 A;  2L3P A;  2Z0W A;  1WLP B;  3T9N A;  4M7A C;  2CS7 A;  4M78 E;  1DJ7 B;  3PE0 A;  1S72 A;  4ANJ A;  1UGQ B;  4A4F A;  1I1J A;  2HCK A;  1H8K A;  3AT1 B;  3PNW C;  3OYA A;  2QG9 B;  3CD6 T;  3G1J A;  4PNO A;  1JBM A;  2M02 A;  4QQD A;  5KCH A;  4ORZ A;  1ZHI A;  1WHM A;  5KH6 A;  2EPD A;  1RI0 A;  2Y4X A;  1F1B B;  4V2S A;  3A98 A;  2GQV A;  2RF0 A;  3S6W A;  3CME Q;  2BZX A;  1VQP T;  4XAX B;  3CCM A;  4JRP A;  1SHF A;  5I21 A;  1OOT A;  1RAD B;  3CCR A;  3OYL A;  3MP6 A;  1PRL C;  3L2U A;  2YRD A;  4DA4 A;  1NE8 A;  3CCU Q;  1VQ5 T;  2OTL A;  3JV3 A;  4M75 G;  2P0Q A;  4XTX A;  4DEX A;  4ZTJ A;  2ESW A;  5A0D A;  4M7D F;  2E65 A;  1VQL T;  3EGU A;  4JJD A;  5IXB A;  2K5I A;  1QVF S;  1QCN A;  4OB0 B;  3LH5 A;  1D09 B;  3CCL Q;  1YI2 Q;  2GBQ A;  2LX7 A;  2E1H A;  1OUL A;  2VUB A;  2O9V A;  2FVU A;  2DL8 A;  4ZTF A;  1O9S A;  3RBB B;  1KQS S;  2COY A;  1FX7 A;  1M1F A;  5I22 A;  5IH2 A;  3OYY A;  3KBG A;  5FU6 C;  2O9S A;  2ZPB B;  1KQ1 A;  2DO3 A;  3N5B B;  4IUU A;  3EG0 A;  4MZT A;  1UDL A;  2JMA A;  1G8X A;  2RI5 A;  4C8Q G;  4JJC A;  4QKU A;  3UWN A;  2J06 A;  3DLM A;  1AZG B;  4WTO B;  4J9G A;  3V8J A;  1WYX A;  1ZBJ A;  5LJ5 f;  5GAN d;  3C4S A;  4C92 D;  2AZV A;  2KR3 A;  5GAN e;  2EGE A;  2MK5 A;  2HZY A;  2QA4 Q;  1B34 B;  4MMK A;  3TSZ A;  1VQ7 Q;  3OSV A;  4M75 F;  1M1K U;  3MEV A;  3JCM f;  3QPH A;  2FRY A;  1AVZ C;  1WQ7 A;  1ZSZ B;  2X51 A;  3VS6 A;  3QYH B;  3OYK A;  3L2Q A;  5GAN 7;  5LL6 S;  4A4K A;  3EH2 A;  4C0G A;  2WAC A;  2EYQ A;  2RJE A;  4E7H A;  3M9Q A;  1YIT A;  1TUC A;  4E2F B;  4N4G A;  1QVF P;  2KXD A;  3LW5 E;  3OYN A;  3PVQ A;  5CKH A;  4O5V A;  1ZQ1 A;  2ED1 A;  1VOM A;  2XID A;  3A8H B;  2K2M A;  2LQN A;  3PVL A;  1UHF A;  3OQ5 A;  1NYF A;  3H6Z A;  1KQS P;  1N9S A;  4F7U B;  4F17 A;  3CCQ T;  4Y28 E;  1BU1 A;  2RMO A;  3P8D A;  2HL5 C;  3GNG A;  5GAN 4;  1TU0 B;  1U3O A;  2C06 A;  1PRM C;  3CD6 A;  4FL6 A;  4J9B A;  2K5L A;  3M0U A;  4IIM A;  1GBR A;  1UGR B;  5HCK A;  4QT7 A;  2V8J A;  2XIC A;  3EG3 A;  1M9S A;  1VQP A;  2RHY A;  4FW1 A;  4DEY A;  1B7T A;  2F69 A;  4D8K A;  3PGG A;  5AYF A;  5GAO l;  1Y7X A;  2XMF A;  2RQT A;  2CYZ B;  2OX7 A;  4E7Z A;  5A2Q E;  3QDR B;  4M78 A;  2JM9 A;  5C6S A;  2MI6 A;  5KYU B;  2QTX A;  1VQ5 A;  2HQX A;  2LT1 A;  4PJO C;  2DEQ A;  4E7J A;  4GY5 A;  3U23 A;  1D0Z A;  1ZUY A;  4MML A;  2ABL A;  1VQL A;  2JS2 A;  1C0M A;  3C94 A;  2AHJ B;  5LJ3 d;  1JRI A;  2LT4 A;  1PHT A;  3I5S A;  5LJ3 e;  2WSC E;  3VYG A;  1TG0 A;  2E12 A;  2CSI A;  1VYV A;  3S3M A;  2LMJ A;  1GCP A;  2Y4Y A;  2JTM A;  4JRQ A;  2YT6 A;  4J6X A;  3SHW A;  3CME T;  1V76 A;  2CH4 W;  2K6D A;  3M4Y A;  1GCQ C;  4M77 C;  2E6N A;  2FB7 A;  2RI3 A;  1E6H A;  4XU1 A;  1BCM A;  3PTA A;  2DX1 A;  2OTJ Q;  3HRT A;  3SDZ A;  3CCU T;  2A0F B;  4E7K A;  3H9N A;  4Z02 A;  5EC7 A;  2DXC A;  1NJI C;  2K3B A;  2LZ6 B;  1VQ4 Q;  3CC4 A;  2VWF A;  1GL5 A;  1TSF A;  2QQA A;  1RLQ C;  1QWF A;  1KQ2 A;  1PD0 A;  3JB9 J;  3KFV A;  5C0M A;  2YLC A;  3OS5 A;  1M30 A;  4GBQ A;  1VQ8 T;  1WJS A;  1LNX A;  2HBW A;  3HP9 A;  3L2Z A;  2YLB A;  4R0K A;  1QVG A;  3OMC A;  4C92 B;  5IXF A;  2QYZ A;  4F7U G;  1KD1 C;  5D6X A;  3A5Z B;  3E9F A;  4Q5W A;  1PC0 A;  4PJN A;  4JZ4 A;  1ZA2 B;  4A54 A;  1M3A A;  4C0D B;  4KUD K;  2GTJ A;  1WHJ A;  1KD1 U;  1T3S A;  1Y0M A;  4DBR A;  2EVR A;  4QVD A;  4C5E A;  1QWE A;  2KK4 A;  1UGS B;  2MMP A;  3I56 Q;  2CT4 A;  2LDM A;  4IUR A;  3FRN A;  2IPO B;  1WXU A;  2BIV A;  2W10 A;  3DB4 A;  4AMC A;  2WSE E;  5GAN j;  3CCQ A;  2G6F X;  2D9T A;  5IHN A;  2QA4 T;  2COW A;  4X1V A;  1N6A A;  2L3R A;  2MAM A;  4XTY A;  1OU9 A;  4LD9 K;  4PLI A;  2QEX T;  3G71 Q;  1Q86 R;  1NZ9 A;  2X4J A;  4PK4 A;  1ACM B;  3BFM A;  1OZ3 A;  2DVE A;  3UAT A;  3JCM P;  4ATO A;  1D3B B;  2HSP A;  2K2V A;  2MWO A;  3VYH B;  1RAC B;  1BK2 A;  4K11 A;  1WNL A;  3TQ7 P;  1IO6 A;  4F7U F;  3I55 T;  3GBQ A;  2KRS A;  2DF6 A;  3ASK A;  2LC4 A;  4EIK A;  1WIE A;  2VV5 A;  2J6O A;  2CP5 A;  3CCS T;  4BB7 A;  2B8A A;  4FYW B;  1KIK A;  1GFC A;  3I35 A;  3BDU A;  1N27 A;  3FB9 A;  3EFS A;  4A63 B;  5KYY B;  5KYX A;  1MGQ A;  2CT3 A;  2HAX A;  2SEM A;  2LNH B;  1YCY A;  1XTD A;  2EQM A;  2M16 A;  1C6V X;  4FW2 A;  4LUE A;  4M7D C;  2KEA A;  1RAB B;  2NYS A;  4PKC C;  1VQ9 Q;  4Z89 A;  3RR6 A;  2HKQ B;  2ZPG B;  2A36 A;  2P0K A;  3CCE A;  2DL4 A;  3A1P A;  4WF2 A;  5J26 A;  4X9C A;  2V1Q A;  1BCO A;  3CME A;  4BDZ A;  1MNE A;  2LQK A;  1GBQ A;  1BKB A;  2DEU A;  1TOV A;  2O01 E;  1WZO A;  2M9U A;  3EH1 A;  3JCM V;  3JRZ A;  1YJW T;  1E7O A;  2E10 A;  2JOY A;  4C0Z A;  1VYU A;  4C92 G;  2FYK A;  4UC4 A;  5FU7 C;  4AFU C;  2R5M A;  2QK0 A;  2XKO C;  3ULR B;  3OYD A;  3SEM A;  1XQH A;  4M78 D;  4RTW A;  3S3O A;  1N8R C;  2RNA A;  3VUZ A;  3V7S A;  5FWC A;  2O2O A;  5DM7 R;  4E7I A;  1UUE A;  5FLX E;  1LCK A;  2EYY A;  1AWX A;  1YIJ T;  1Q7Y C;  2M0Y A;  5LJ3 j;  1K73 C;  5IN1 A;  2HMA A;  3S3N A;  1N8R U;  1VQ8 A;  3E19 A;  1A0N B;  2L0A A;  1Q7Y U;  5CKF A;  3PMI A;  1WQW A;  4OF1 A;  2E3H A;  4M75 C;  3CPF A;  2RQU A;  1PG5 B;  3MEU A;  2P4T A;  1VQK Q;  4L5G A;  4HCC A;  1YCS B;  4KGX B;  1Y96 A;  1WI7 A;  4JPB W;  1SSH A;  3X28 B;  4RTX A;  1JXM A;  4AG1 C;  1NEG A;  2G3R A;  4BE0 A;  2OTJ T;  2GQI A;  2KRO A;  1OI1 A;  3QBY A;  4OB2 B;  2YWW A;  1I5O B;  3J7A F;  5GAN 3;  2O31 A;  1VQ4 T;  5D6Y A;  4M77 F;  4JDS A;  4BUG A;  2SRC A;  4M4Z A;  1YJ9 Q;  6AT1 B;  1TWB A;  2VGM A;  1R0B G;  2AZS A;  4C92 F;  5KE3 A;  3EAE A;  4C8Q C;  1M4Z A;  3CCV T;  1QCF A;  3OY9 A;  2QEX A;  5IHI A;  2CZ7 B;  1NEB A;  2K4Y A;  3RKY A;  2I0N A;  2WSF E;  4E7S A;  4J9H A;  3RIR A;  3VU3 C;  1EIF A;  2DD4 A;  2JS0 A;  3HL8 A;  2OAU A;  2DL3 A;  2A28 A;  2LCC A;  2RN8 A;  2AKK A;  4BI8 B;  2X35 A;  2FEI A;  1QVF A;  1RL2 A;  1UFF A;  2HSE B;  1BBZ A;  1U06 A;  3I55 A;  3NGP A;  1O75 A;  1K9M R;  3I56 T;  1TXQ A;  2KBT A;  3CCS A;  3M5A A;  1G2B A;  1MV0 B;  2E5K A;  3CCJ T;  2X4X A;  3VS7 A;  4N0A C;  4XTV A;  1KQS A;  1M2O A;  2XDB A;  2EQI A;  1K1Z A;  2DA9 A;  1ZX6 A;  1T0J A;  1K8A R;  3FJP A;  4J8O A;  5AT1 B;  2E64 A;  1YJN Q;  1I4K 1;  2YUO A;  3G71 T;  1M8V A;  2MIO A;  1IHV A;  4CRI A;  4BI4 A;  1RLP C;  1PD1 A;  5IT9 E;  5DY9 A;  2K9G A;  2X4W A;  3HFN A;  2HQH A;  1UEC A;  3BDL A;  3M0R A;  2EWN A;  3L2W A;  4AT1 B;  4A4E A;  3EHR A;  4A53 A;  2YSQ A;  4M7A E;  5GAO q;  3PIP A;  3NHN A;  1YJW A;  3HSB A;  2EJG A;  1GXI E;  4JJN K;  1E6G A;  2EJF A;  2L5Q A;  2CP6 A;  1MMD A;  4OB3 B;  1YWP A;  5CKB A;  1KC8 R;  1Q81 R;  1I07 A;  3X26 B;  4CC2 A;  4EMK B;  3ZEH A;  1BYM A;  1YIJ A;  1RAI B;  1YHQ T;  1EZZ B;  2CRE A;  3CPW S;  4FCY A;  3V8L A;  2FPE A;  1FMW A;  1VQ9 T;  3RER A;  2I2L A;  4FT4 A;  4BD3 A;  5KYW B;  1EFN A;  3BE3 A;  4M78 B;  3REB B;  5LJ3 h;  2IVW A;  1U5S A;  3X25 B;  2DRM A;  3J81 E;  2DBK A;  2MCN A;  5A0G A;  1MMG A;  1K0S A;  3SD4 A;  3V7R A;  1AWO A;  5GJV B;  3X24 B;  2VXE A;  2ZPE B;  1RI9 A;  3VRZ A;  1U8R A;  3P8H A;  1TTH B;  3URG A;  5L8R E;  4DOV A;  5GAM f;  2ZZD A;  2OTJ A;  2LVM A;  3SWN A;  1U1S A;  1ARK A;  2ZGW A;  1OX8 A;  5LJ3 g;  1VQ4 A;  1PSE A;  2A37 A;  2GFU A;  4O6J A;  1RUW A;  2CP3 A;  4J9E A;  2GFA A;  2RHZ A;  3EGX A;  2X3X D;  3SB2 A;  3MPU B;  2FPF A;  3CCV A;  5IAY A;  2QGG A;  2F1L A;  2RJC A;  1VQO Q;  1K9A A;  3EFR A;  2HD0 A;  1ZSZ C;  2J6K A;  3NTK A;  1R0C B;  4PLL A;  3PIO A;  5GAN 6;  1Q82 C;  1VIF A;  1IRX A;  4B9X A;  2MOX A;  4B9W A;  2JVV A;  1IB8 A;  1NLP C;  3UDC A;  1VQK T;  1Y71 A;  2DLP A;  2K3X A;  2DXT A;  1Q82 U;  2KMT A;  1T0H A;  4C5G A;  2NUP A;  1QLY A;  1YFN A;  2COZ A;  3L1A A;  1WJR A;  3CPW P;  3DB3 A;  1G83 A;  3JCM W;  3H0I A;  2ZAE A;  2VXF A;  2JW4 A;  3G4S Q;  5GAO r;  3CCJ A;  2K7A A;  1JXO A;  3QHS A;  1B07 A;  3EGD A;  1KHI A;  1SRL A;  5CO7 A;  1H64 1;  3V8K A;  4J9F A;  3QWY A;  3VS2 A;  3LGL A;  3G6E Q;  3HHT B;  3FDR A;  2CGH A;  4AG2 C;  1I5L A;  2J05 A;  3G71 A;  5CR2 A;  5D7U A;  3L2V A;  4C0F A;  3TEE A;  2QXF A;  1MHN A;  5CQY A;  2X9H A;  3LGF A;  4JRI A;  1QW1 A;  2YRC A;  1M1K R;  1UHC A;  2L3S A;  4ZGD B;  1VQ6 Q;  4C8Q F;  1X75 C;  4OGE A;  3I9Q A;  3GLX A;  4JLG A;  1ABO A;  1VQN T;  4M78 G;  1WPY A;  4PFZ A;  4DOW A;  4Y92 A;  4D6W A;  4IUT A;  3F70 A;  2CP7 A;  1UB4 A;  5FRO A;  1YWO A;  4LD6 A;  5HK3 A;  4FYY B;  4ZGJ B;  4QVC A;  4XTZ A;  4KH1 B;  1YJN T;  3OB9 A;  5IHK A;  4Z8A A;  1YHQ A;  2M51 A;  1HK9 A;  2XD0 A;  2XDP A;  2P4R A;  3J80 E;  3CMA Q;  2CSQ A;  1SSF A;  3HRS A;  4GLK A;  4KT0 E;  2X4Y A;  1HSQ A;  4OMP A;  2RK1 A;  2K3Y A;  2KRN A;  1TUD A;  2JJ9 A;  2KY9 A;  1S1N A;  4M7A A;  3EG9 A;  2EQJ A;  5CKE A;  1S72 Q;  4J5Y A;  4PJO E;  3QZ5 B;  1VA7 A;  4JUV A;  1LVK A;  3C12 A;  4OGC A;  3RMQ A;  3EFO B;  2DET A;  2BE7 D;  2GNC A;  2DBM A;  1PNJ A;  4OP0 A;  1K0X A;  4CI0 C;  1CKB A;  4M78 F;  4DBF A;  3TSW A;  3CCM Q;  2PU9 B;  3CBO A;  2JUF A;  7AT1 B;  4XTW A;  1ZSG A;  1X69 A;  4RG8 A;  3FIF A;  1P92 A;  4JLI A;  4M77 E;  3QII A;  2HBP A;  4C92 C;  3A8G B;  2OTL Q;  2PUO B;  2EYZ A;  3QSU A;  2P84 A;  3LX7 A;  1D0X A;  3OMG A;  2VVK A;  4AFS C;  5GAN f;  4C0D C;  2FHD A;  1ZLM A;  3CCL T;  4J83 A;  1NJI U;  1YI2 T;  1VIE A;  1MUZ A;  1RAE B;  1BIA A;  2EFI A;  4ZNX A;  9ATC B;  4BDY A;  2YUN A;  1SG5 A;  3E9G A;  8ATC B;  1FWZ A;  3MEW A;  2E4H A;  3Q1J A;  5L23 A;  4XTU A;  4A4H A;  4FU6 A;  4C5I A;  1VQO T;  2DE0 X;  2DM1 A;  2LNV A;  2MYS A;  4BE2 A;  1Z9Z A;  2PTK A;  2V8I A;  4RKU E;  4D8D A;  2RQW A;  4WCI A;  3OA6 A;  4J9C A;  4FM4 B;  2OJ2 A;  2RD1 A;  3TCJ A;  3QDF A;  3PFS A;  2ATC B;  3V7C A;  2KI7 A;  1VQ7 T;  5KCO A;  4PL6 A;  3M0S A;  4RG2 A;  1VQN A;  1N5Z A;  1PSF A;  1KD1 R;  4P5N A;  2LP5 A;  1MMN A;  3CXC S;  3VV0 A;  5LJ5 h;  3G6E T;  3EG1 A;  2RPN A;  3SFM A;  2BUD A;  1H3H A;  1YJN A;  1LPL A;  5GMK h;  1YIT Q;  3OBY A;  2L2P A;  2KQW A;  3OS2 A;  3JB9 D;  3MP1 A;  2QDL A;  2KDS A;  2DL5 A;  2RB6 A;  1NG2 A;  1RAA B;  3M0T A;  2E3I A;  1VQ6 T;  1M8M A;  2DFU A;  3H0H A;  3M57 A;  1YP5 A;  2K5F A;  5LJ5 g;  3OYG A;  4R56 A;  2NUT B;  3OS1 A;  2DJZ A;  4B6M A;  3LWI A;  2V1R A;  2DTI A;  2BZ8 A;  2DXU A;  4QQ6 A;  2O88 A;  1JJ2 S;  1TUG B;  1QKW A;  3CBM A;  3CD6 Q;  1JO8 A;  2FL7 A;  1FMV A;  3G7Z A;  1RAH B;  1KFZ A;  4M7D E;  4J6Y A;  2KXC A;  4JS4 A;  2JTE A;  3JB9 I;  4KUI A;  4LDV A;  3JCM b;  2L3Q A;  3RDV A;  1H92 A;  3GP8 A;  1D1B A;  4XU3 A;  4RTZ A;  1VQP Q;  4BY6 B;  1D1C A;  3RES A;  1BB9 A;  8AT1 B;  4HA8 A;  4VUB A;  1I8F A;  3VRY A;  1TS9 A;  2OI3 A;  3CCU A;  1R77 A;  2KSS A;  2HL3 A;  1VQ5 Q;  4PJO A;  2DTH A;  3M56 A;  2KVQ G;  4DBQ A;  3JCM X;  4RTY A;  5GJW B;  3JSC A;  3OYJ A;  3CXC P;  1UGP B;  2XI9 A;  3VS3 A;  1IRE B;  4RCC A;  1WXT A;  3MKD A;  1VQL Q;  3MO8 A;  1M5Q 1;  5EG2 A;  2IIM A;  4AFZ C;  1KSW A;  3CCL A;  2CZ6 B;  2JT4 A;  2MF2 A;  1YI2 A;  4M7A D;  3C95 A;  3L42 A;  1MV3 A;  4IUV A;  3MHX A;  4HCB A;  1AOJ A;  5CKD A;  4LUD A;  1FMK A;  2CZ1 B;  4E7L A;  4ESR A;  1K76 A;  1K73 U;  4OMN A;  2E70 A;  2D1X A;  1X6G A;  2XG8 D;  1GCQ A;  4M77 A;  4M75 E;  1SEM A;  1VQO A;  5FW9 A;  1JJ2 P;  5I2S A;  2DKG A;  2DPP B;  4LDX A;  1M27 C;  3SWN B;  3CEY A;  1WX6 A;  2FZC B;  1NBE B;  1I81 A;  4L59 A;  2EAY A;  2OTL T;  1N8R R;  1H3Z A;  3CC4 Q;  1AHJ B;  4RTU A;  1BI3 A;  1OQK A;  2RJF A;  1VUB A;  4JZ3 A;  1SKU B;  1IZ6 A;  1Q7Y R;  2R57 A;  1J3T A;  1M90 C;  2DL7 A;  3EGX B;  2QA4 A;  1M1G A;  1VQ7 A;  5GAM e;  3VS1 A;  2NWM A;  3CPW A;  1BI0 A;  2ZPF B;  1M90 U;  1Z9Q A;  4KH0 B;  4C8Q E;  4F14 A;  2KE9 A;  1K9M C;  1OYX A;  2F2X A;  3QJY A;  4XU2 A;  1M3C A;  2V8K A;  3M53 A;  2CP2 A;  3G6E A;  2DXB A;  1FYN A;  2CUB A;  1IGQ A;  2DTO A;  1K8A C;  1RAG B;  1X43 A;  1SF9 A;  3HRU A;  2RO0 A;  5GMK m;  1ZBX A;  2NUP B;  3CQT A;  5LJ5 d;  2ED0 A;  3QO3 A;  1R8O B;  4BI3 A;  1K8A U;  1X01 A;  2OAW A;  2VB6 A;  5LJ5 e;  1VQ6 A;  3MP8 A;  4HCZ A;  2MPX C;  3E2U A;  1PCX A;  3LLR A;  2RI2 A;  4KRT A;  2L89 A;  5GMK e;  2EW3 A;  4PFP A;  5HK0 A;  3CCQ Q;  2B86 A;  3QKJ A;  3JCM d;  3R6O A;  4ZN1 A;  2EQK A;  5D6W A;  1SRM A;  2YUP A;  1U1T A;  3ZFJ A;  3H41 A;  3JCM e;  4E47 A;  2DZ9 A;  2DK3 A;  3OYH A;  3GF5 A;  4N4H A;  2RH2 A;  2FZG B;  2JZ2 A;  3RKX A;  2CP0 A;  5FRN A;  3AHU A;  2YRV A;  1AWJ A;  2MWP A;  2F5T X;  3EG2 A;  1FXX A;  3M54 A;  1QP3 A;  2EBP A;  4EMK C;  1KC8 C;  1KJW A;  2RHU A;  2RA2 A;  4LN2 A;  4NOY A;  1ZUU A;  2R5A A;  1NLO C;  2XDD A;  4RUG A;  4J9I A;  5J3B A;  4M78 C;  1WGS A;  1HJD A;  1X27 A;  2XK0 A;  3H8Z A;  1WFW A;  2EKH A;  2C0T A;  1PKT A;  2C0O A;  3OYE A;  1CKA A;  3MET A;  1BI2 A;  1G3S A;  3VUB A;  3OSS C;  1AEY A;  1YN8 A;  1XOV A;  5GAO p;  3OYB A;  3OYM A;  4PJM A;  4FYV B;  3PMT A;  4HCK A;  2ENM A;  4M7D A;  2F2V A;  4OMM A;  4IUQ A;  2FZK B;  2PUK B;  4EMH A;  2O4X A;  3OYC A;  1WHL A;  3LWH A;  5ECA A;  3CCE Q;  2DD5 A;  1KHC A;  1OPL A;  1PM3 A;  2DYB A;  2JM8 A;  4F04 B;  4M7A B;  3EG9 B;  1UJ0 A;  3WVE B;  2FPD A;  1W4S A;  2EIF A;  1M3B A;  2HNI A;  3GIB A;  1M2V A;  4GLM A;  2LCS A;  1K4U S;  4Y91 A;  2AIR B;  4KGV B;  5HKC A;  3A8M B;  3UA7 A;  1OV3 A;  2DMO A;  4F16 A;  1W6X A;  2RQV A;  4PJO D;  2LRQ A;  3UPU A;  1MMA A;  1QCO A;  2YUQ A;  4ME7 A;  1ZA1 B;  1VQ8 Q;  4RCB A;  1NPR A;  3ME9 A;  2ZPI B;  2RHI A;  2RJD A;  1JQQ A;  4PFO A;  5GAO n;  1WXB A;  4M75 A;  1BIB A;  4MDW A;  3JB9 G;  2DRK A;  2CKK A;  3FLG A;  3CC2 Q;  2D6F A;  1QQJ A;  3KXT A;  1WDX A;  2KT1 A;  1KK7 A;  2D8H A;  2H8H A;  2BZY A;  4FSS A;  4PJL A;  4X9D A;  4M77 D;  3UA6 A;  3I56 A;  2QQS A;  4OMQ A;  2DJQ A;  3CC4 T;  1IHW A;  3TU4 K;  1YJ9 T;  1HXD A;  2HEQ A;  3M0Q A;  1M1K C;  5FU6 B;  4HKE A;  2BTT A;  4OMF B;  2EGC A;  4TVR A;  4F7U E;  5GAM j;  4C8Q A;  1G3W A;  1YNZ A;  4ELZ C;  1OZ2 A;  1HYO A;  2LQW A;  2QEX Q;  1Q82 R;  3CC7 Q;  4X34 A;  3M0P A;  2ECZ A;  3D7S B;  3BY7 A;  4DQ2 A;  3VS4 A;  3RKW A;  3OYF A;  5KYN A;  4HVV A;  3UT1 A;  1VQM Q;  1SPK A;  4J9D A;  1WJQ A;  1T3L A;  2PVD B;  2PVG B;  2QQR A;  3I55 Q;  3MEA A;  3JB9 F;  3NPF A;  3M58 A;  5KE2 A;  5LJ5 j;  1N9R A;  3CCS Q;  5GAN 2;  2RQR A;  4FT2 A;  4N0A A;  4CC3 A;  4M7A G;  5GMK j;  3OW2 A;  2A08 A;  2KNB B;  2VGN A;  2QQB A;  2BE9 B;  2XHC A;  3HTR A;  4II1 A;  4NL3 A;  2QAZ A;  3NTH A;  5CQX A;  2VKN A;  1AWW A;  4MZM A;  1VQ9 A;  3ZBD A;  3H0F A;  1W2B A;  3TRE A;  2PVO B;  3HFO A;  4LDY A;  2EQU A;  3QJ6 A;  3RMS A;  2H3E B;  4EMK A;  4J7F A;  2QGF B;  1RAF B;  5KYX B;  3FC3 A;  3EHQ A;  2DNU A;  5GAN 5;  1LOJ A;  5CVI A;  1XNI A;  3WXM B;  4ZN3 A;  1YJW Q;  1OX9 A;  5KYW A;  2DER A;  5GAN 8;  5GMK l;  3WVD B;  2E41 A;  2QDY B;  3L2R A;  3CXC A;  3C0C A;  2W0Z A;  1ZUK A;  5I2M A;  5DLO A;  5DLQ E;  1D1A A;  2RHX A;  1UG1 A;  1YIJ Q;  1PKS A;  2M0O A;  4EDU A;  1BI1 A;  4M7A F;  1QVP A;  4NL2 A;  4IKF A;  3CCR Q;  2FG0 A;  2KYM A;  3CCE T;  2ZPH B;  4JS5 A;  5J39 A;  1KG1 A;  3HKS A;  2JNG A;  4M7D D;  2VC8 A;  4OMO A;  4CC4 B;  5CCA A;  4PJO B;  3MCA B;  2EKO A;  1X2Q A;  3VKI A;  4C92 E;  4LE9 A;  1VQK A;  3KUF A;  1X6O A;  4ZGE B;  2R58 A;  3A8O B;  3M4G A;  1WHG A;  1JJ2 A;  2KGT A;  2LCL A;  2VAS A;  1B3Q A;  1G3T A;  2L8D A; 
#chains in the Genus database with same CATH homology
 5CIU A;  1YJ9 A;  2DTH A;  3M56 A;  2KVQ G;  3HFN A;  3JCM X;  3OYJ A;  3L2Q A;  3JSC A;  3LYI A;  5GAN 7;  3OW2 S;  4HT8 A;  3BDL A;  1UGP B;  5LL6 S;  2XI9 A;  4A4K A;  1IRE B;  2EWN A;  4RCC A;  4C0G A;  4C5H A;  2WAC A;  3L2W A;  2EYQ A;  2RJE A;  4E7H A;  2D0Q B;  3M9Q A;  4A4E A;  3MO8 A;  1YIT A;  1M5Q 1;  5EG2 A;  4A53 A;  1B34 A;  4N4G A;  4M77 B;  4L6V 5;  3LW5 E;  3QZ9 B;  5GAO q;  1Y96 B;  3PIP A;  3OYN A;  3CCL A;  2CZ6 B;  2MF2 A;  4NS5 A;  1YI2 A;  4M7A D;  3C95 A;  5CKH A;  1YJW A;  4O5V A;  1ZQ1 A;  4KUL A;  5A0L A;  3L42 A;  3HSB A;  2EJG A;  2XID A;  1GXI E;  3A8H B;  4IUV A;  3MHX A;  3HPW A;  1Q86 C;  4JJN K;  3OQ5 A;  5GAM h;  4HCB A;  5CKD A;  1W2B S;  2CZ1 B;  4E7L A;  2LQ8 A;  2X4W A;  2P0P A;  2EJF A;  2L5Q A;  3H6Z A;  1N9S A;  1K73 U;  4OB3 B;  4N4I A;  2BKD N;  5CKB A;  2E70 A;  4F7U B;  3JCM J;  3X26 B;  4Y28 E;  3CCQ T;  3CC2 T;  1Q86 U;  3P8D A;  3GNG A;  2QI2 A;  2XG8 D;  3QXE B;  4EMK B;  4M77 A;  3ZEH A;  5GAN 4;  3OYI A;  1BYM A;  4M75 E;  1YIJ A;  1YHQ T;  4M75 D;  1VQO A;  2C06 A;  5I2S A;  3O8V A;  4FL6 A;  3CPW S;  2DKG A;  3CD6 A;  3V8L A;  1VQ9 T;  2DPP B;  3RER A;  4LDX A;  2JN0 A;  2I2L A;  2K5L A;  4FT4 A;  4BD3 A;  3SWN B;  3CEY A;  3NFC A;  4J6W A;  5GAM g;  2H3J A;  3NTI A;  4M78 B;  3G4S T;  4L59 A;  1I81 A;  5LJ3 h;  2IVW A;  2EAY A;  3X25 B;  2OTL T;  3J81 E;  1UGR B;  1H3Z A;  1AHJ B;  3QUI A;  4F7U A;  3JCM c;  1BI3 A;  2RJF A;  2V8J A;  5A0G A;  1VUB A;  2XIC A;  3SD4 A;  3V7R A;  1NPP A;  3OYK A;  1M9S A;  1IZ6 A;  1VQP A;  2R57 A;  2RHY A;  3X24 B;  2VXE A;  1M90 C;  2ZPE B;  2F69 A;  3GPL A;  1U8R A;  2QA4 A;  3PGG A;  1M1G A;  5AYF A;  5GAO l;  1Y7X A;  1VQ7 A;  3P8H A;  3URG A;  2Y90 A;  5GAM e;  1Y07 A;  5L8R E;  4DOV A;  5GAM f;  2CYZ B;  2ZZD A;  2LVM A;  3CPW A;  3SWN A;  3CC7 T;  2OTJ A;  5A2Q E;  1BI0 A;  1U1S A;  3QDR B;  2ZPF B;  4M78 A;  2ZGW A;  2MI6 A;  5C6S A;  1M90 U;  4C8Q E;  2A7Y A;  4FIB A;  1K9M C;  5LJ3 g;  1OYX A;  4C8Q D;  2QTX A;  1VQ4 A;  1VQ5 A;  2HQX A;  3JCM h;  2LT1 A;  3X20 B;  1PSE A;  4PJO C;  3QJY A;  2DEQ A;  2GFU A;  4XU2 A;  4O6J A;  2PQW A;  4E7J A;  2RK2 A;  2V8K A;  2ZCF B;  1JB0 E;  3M53 A;  4GY5 A;  3JCM Q;  1VQM T;  5GMK i;  2GFA A;  2DXB A;  2RHZ A;  3G6E A;  4BY6 C;  4KBM B;  4MML A;  1VQL A;  3QG1 A;  3SB2 A;  4R55 A;  2DTO A;  3C94 A;  1K8A C;  2AHJ B;  2XU8 A;  5LJ3 d;  4FSX A;  3HRU A;  3CCV A;  2RO0 A;  1JRI A;  2LT4 A;  5IAY A;  5GMK m;  1ZBX A;  4PJO A;  3JAM E;  2RJC A;  3EFR A;  5LJ3 e;  2WSC E;  3VYG A;  2HD0 A;  3E1S A;  5LJ3 f;  4ELY C;  5LJ5 d;  2E12 A;  3NTK A;  3S3M A;  2K57 A;  3QO3 A;  1R8O B;  4PLL A;  4BI3 A;  4RMO A;  2IG0 A;  3PIO A;  1X01 A;  3JCM g;  5GAN 6;  1VIF A;  1Q82 C;  5FRM A;  5LJ5 e;  4PJO G;  4B9X A;  1VQ6 A;  3MP8 A;  4HCZ A;  2Y4Y A;  2DIQ A;  2JTM A;  4JRQ A;  4B9W A;  1YBY A;  2JVV A;  3LLR A;  4J6X A;  3INZ A;  2RI2 A;  3GNF B;  3UDC A;  2L89 A;  1Y71 A;  5GMK e;  3CME T;  1VQK T;  2K3X A;  3A8L B;  3QYG B;  5HK0 A;  4BAC A;  2DXT A;  3M4Y A;  1Q82 U;  2DAQ A;  2KMT A;  4M77 C;  2E6N A;  3QKJ A;  2FB7 A;  2RI3 A;  3JCM d;  4C5G A;  3R6O A;  4ZN1 A;  2EQK A;  5D6W A;  4XU1 A;  3L1A A;  1WJR A;  3DB3 A;  3JCM W;  1U1T A;  3ZFJ A;  3PTA A;  1TH7 A;  3JCM e;  4E47 A;  3CMA T;  2DZ9 A;  3HRT A;  1QVG S;  2DK3 A;  3OYH A;  2VXF A;  3SDZ A;  3GF5 A;  4N4H A;  2HQE A;  2RH2 A;  3CCU T;  3RKX A;  2JZ2 A;  4E7K A;  5GAO r;  3CCJ A;  4Z02 A;  1K8A U;  5FRN A;  2DXC A;  1NJI C;  3AHU A;  2NLU A;  2YRV A;  3CC4 A;  2MWP A;  3QHS A;  1KHI A;  2F5T X;  5CO7 A;  1FXX A;  3VJP A;  1H64 1;  2QQA A;  3V8K A;  1S72 T;  3M54 A;  1QP3 A;  3LGL A;  4EMK C;  1KC8 C;  3CBP A;  3HHT B;  2RHU A;  4M77 G;  1KQ2 A;  2RA2 A;  3FDR A;  1V29 B;  3JB9 J;  3ER0 A;  5C0M A;  2CGH A;  2YLC A;  1I5L A;  3OS5 A;  3G71 A;  5CR2 A;  4IUP A;  4NOY A;  2R5A A;  2F5K A;  3SWN C;  2XDD A;  1VQ8 T;  3L2V A;  4C0F A;  1WJS A;  4M7D B;  3TEE A;  5J3B A;  4M78 C;  2QXF A;  3JB9 H;  1MHN A;  1LNX A;  1WGS A;  3HP9 A;  3L2Z A;  2YLB A;  1QVG A;  5CQY A;  3LGF A;  3OMC A;  4JRI A;  1QW1 A;  2O4X B;  2XK0 A;  4C92 B;  3H8Z A;  4F7U G;  1KD1 C;  2DZC A;  4ZGD B;  4C8Q F;  5D6X A;  3A5Z B;  3E9F A;  4Q5W A;  3OYE A;  1G3Y A;  3MET A;  1BI2 A;  1G3S A;  4A54 A;  3CCM T;  3VUB A;  4C0D B;  3OSS C;  4KUD K;  1X75 C;  1XOV A;  4OGE A;  5GAO p;  4XK8 E;  4OVA A;  1KD1 U;  3OYB A;  4PJO F;  5HY6 A;  3OYM A;  3GLX A;  3PMT A;  4JLG A;  4M7D A;  3CCR T;  4QVD A;  1VQN T;  4IUQ A;  4M78 G;  4C5E A;  1WPY A;  4DOW A;  2PUK B;  4LDW A;  4D6W A;  2KK4 A;  1UGS B;  2MMP A;  3FEO A;  4A4G A;  4IUT A;  2LDM A;  2O4X A;  3F70 A;  4IUR A;  3FRN A;  4C92 A;  5CK9 A;  5FU7 B;  3OYC A;  1LJO A;  2LX9 A;  3OBW A;  1UB4 A;  3LWH A;  5FRO A;  4QQG A;  4HT9 A;  2DD5 A;  1KHC A;  1UEB A;  2JTF A;  5M9O A;  2BIV A;  4LD6 A;  3DB4 A;  5HK3 A;  2WSE E;  4M7A B;  5GAN j;  3CCQ A;  2D9T A;  3WVE B;  4ZGJ B;  4QVC A;  4XTZ A;  3CC2 A;  1W4S A;  2EIF A;  4M7A E;  3DLL A;  1YJN T;  2HNI A;  3OB9 A;  2QA4 T;  5GAM d;  3GIB A;  1YHQ A;  1N6A A;  2L3R A;  2MAM A;  4XTY A;  1HK9 A;  4LDU A;  2XD0 A;  4Y91 A;  2XDP A;  4LD9 K;  4PLI A;  2QEX T;  4MDX A;  3J80 E;  1NZ9 A;  4EPC A;  5HKC A;  1SSF A;  3A8M B;  3HRS A;  4GLK A;  2X4J A;  4KT0 E;  2X4Y A;  4XQ3 A;  2RK1 A;  3G4S A;  2K3Y A;  2GCX A;  3BFM A;  2CZ0 B;  1OZ3 A;  2DVE A;  3JCM P;  4OB1 B;  2KY9 A;  4BE1 A;  4J7I A;  4M7A A;  2EQJ A;  5GAO m;  4ATO A;  1D3B B;  4M75 B;  5CKE A;  2K2V A;  2QQ9 A;  4J5Y A;  2MWO A;  4PJO E;  3VYH B;  3QZ5 B;  4JUV A;  1K9M U;  4PJO D;  3C12 A;  4OGC A;  4YTL A;  2LRQ A;  3RMQ A;  3UPU A;  1WNL A;  5GAN h;  3P8B B;  4F7U F;  4ME7 A;  3I55 T;  3CC7 A;  3PT9 A;  3ASK A;  4JRK A;  2LC4 A;  2DIG A;  3OS0 A;  2VV5 A;  4MZP A;  2VYT A;  2LTO A;  4RCB A;  4XU0 A;  3CCS T;  1NPR A;  3ME9 A;  2ZPI B;  2RHI A;  4BB7 A;  2B8A A;  2RJD A;  3M55 A;  3BDU A;  5GAO n;  1D3B A;  4M75 A;  1BIB A;  4OP0 A;  1VQM A;  4MDW A;  3JB9 G;  1N27 A;  3FB9 A;  3EFS A;  2E6Z A;  4CI0 C;  4M78 F;  2CKK A;  1MGQ A;  3FLG A;  5CAI A;  2HAX A;  2A3L A;  2D6F A;  3KXT A;  2PU9 B;  1YCY A;  5GAN g;  1XTD A;  2JUF A;  3CBO A;  3LH0 A;  2EQM A;  2E5Q A;  2M16 A;  4XTW A;  4C8Q B;  3M59 A;  4M7D C;  2M1H A;  3FIF A;  1P92 A;  4JLI A;  4PKC C;  4M77 E;  4RG8 A;  4X9D A;  3QII A;  2RM4 A;  4M77 D;  2HBP A;  3I56 A;  2QQS A;  2ZPG B;  4C92 C;  4QW2 A;  4EMG A;  2P0K A;  3A8G B;  3GOX A;  3CCE A;  3CC4 T;  3TU4 K;  1YJ9 T;  4WF2 A;  5J26 A;  1HXD A;  4X9C A;  1G5V A;  2PUO B;  4QVZ A;  3QSU A;  1M1K C;  3LX7 A;  5FU6 B;  3CME A;  3OMG A;  4HKE A;  4OMF B;  5GAN f;  4C0D C;  4BDZ A;  1Q81 C;  2FHD A;  2LQK A;  1YIT T;  1BKB A;  4TVR A;  4F7U E;  2O01 E;  5GAM j;  2M9U A;  3CCL T;  3DKM A;  4J83 A;  3JCM V;  4C8Q A;  2YHT A;  1YI2 T;  1NJI U;  2KAF A;  3JRZ A;  1G3W A;  4ELZ C;  1YJW T;  1OZ2 A;  1VIE A;  2EFI A;  4M7D G;  1BIA A;  3CMA A;  1QP2 A;  2E10 A;  2JOY A;  3RUX A;  2EJ9 A;  4BDY A;  4C0Z A;  1KC8 U;  1Q81 U;  4X34 A;  4C92 G;  2FYK A;  3E9G A;  4UC4 A;  5FU7 C;  2GF7 A;  2R5M A;  3BW1 A;  2XKO C;  3OYD A;  1FWZ A;  3MEW A;  3BY7 A;  1XQH A;  4DQ2 A;  3Q1J A;  3T9N A;  3RKW A;  4M7A C;  2CS7 A;  4M78 E;  3OYF A;  1DJ7 B;  4M78 D;  3UT1 A;  3S3O A;  1N8R C;  1S72 A;  3VUZ A;  1UGQ B;  3V7S A;  1WJQ A;  4XTU A;  5DM7 R;  4E7I A;  4A4F A;  4A4H A;  5FLX E;  2PVD B;  2PVG B;  3PNW C;  4FU6 A;  4C5I A;  1YIJ T;  1Q7Y C;  1VQO T;  2QQR A;  5LJ3 j;  1K73 C;  5IN1 A;  3OYA A;  2LNV A;  3CD6 T;  4BE2 A;  3MEA A;  3S3N A;  4PNO A;  1N8R U;  1JBM A;  4QQD A;  5KCH A;  1VQ8 A;  1ZHI A;  3E19 A;  3JB9 F;  5KH6 A;  3M58 A;  5KE2 A;  5LJ5 j;  2V8I A;  4EMH A;  1N9R A;  1Q7Y U;  5GAN 2;  4RKU E;  1RI0 A;  2Y4X A;  5CKF A;  4FT2 A;  3PMI A;  1WQW A;  4N0A A;  4OF1 A;  4M7A G;  5GMK j;  4M75 C;  3OW2 A;  3CPF A;  3OA6 A;  4V2S A;  3MEU A;  2P4T A;  4FM4 B;  2GQV A;  4L5G A;  3S6W A;  1VQP T;  2RD1 A;  2VGN A;  4HCC A;  3TCJ A;  1Y96 A;  2QQB A;  4XAX B;  3CCM A;  4JRP A;  3PFS A;  2XHC A;  4II1 A;  3V7C A;  4NL3 A;  3NTH A;  3X28 B;  5CQX A;  5I21 A;  1VQ7 T;  4MZM A;  2G3R A;  4BE0 A;  5KCO A;  2OTJ T;  3CCR A;  3OYL A;  1VQ9 A;  3QBY A;  1OI1 A;  3MP6 A;  4PL6 A;  4RG2 A;  1VQN A;  4OB2 B;  3L2U A;  1PSF A;  4DA4 A;  3J7A F;  4P5N A;  3ZBD A;  1NE8 A;  5GAN 3;  1W2B A;  3TRE A;  2PVO B;  4M77 F;  5D6Y A;  1VQ4 T;  4JDS A;  1VQ5 T;  4BUG A;  3HFO A;  2OTL A;  4M75 G;  4LDY A;  2P0Q A;  4XTX A;  3VV0 A;  3CXC S;  2EQU A;  3QJ6 A;  4ZTJ A;  3RMS A;  5LJ5 h;  5A0D A;  4M7D F;  2VGM A;  3G6E T;  4EMK A;  4J7F A;  3SFM A;  2E65 A;  2BUD A;  1VQL T;  1YJN A;  3FC3 A;  4C92 F;  5GMK h;  3OBY A;  5GAN 5;  2K5I A;  1QVF S;  1LOJ A;  4OB0 B;  5KE3 A;  3EAE A;  4C8Q C;  1M4Z A;  1XNI A;  5CVI A;  3WXM B;  4ZN3 A;  3CCV T;  2KQW A;  3OS2 A;  3OY9 A;  2E1H A;  2QEX A;  3MP1 A;  3JB9 D;  2CZ7 B;  2KDS A;  2VUB A;  2K4Y A;  3RKY A;  5GAN 8;  2FVU A;  2RB6 A;  4ZTF A;  2WSF E;  1O9S A;  5GMK l;  3RIR A;  3VU3 C;  3WVD B;  1EIF A;  2DD4 A;  2E41 A;  1FX7 A;  1KQS S;  1M1F A;  1VQ6 T;  2QDY B;  3HL8 A;  3M57 A;  3OYY A;  3L2R A;  2OAU A;  2K5F A;  3KBG A;  5FU6 C;  5LJ5 g;  3CXC A;  2ZPB B;  3OYG A;  4R56 A;  2LCC A;  1KQ1 A;  5I2M A;  2DO3 A;  3N5B B;  5DLO A;  3OS1 A;  2DJZ A;  4IUU A;  4BI8 B;  5DLQ E;  2DTI A;  3LWI A;  2RHX A;  2X35 A;  4MZT A;  4C8Q G;  2RI5 A;  2DXU A;  4QQ6 A;  3UWN A;  1JJ2 S;  1RL2 A;  1QVF A;  3CBM A;  3I55 A;  2M0O A;  3DLM A;  1BI1 A;  4EDU A;  4M7A F;  3V8J A;  1QVP A;  4NL2 A;  4IKF A;  1O75 A;  2FL7 A;  3I56 T;  3G7Z A;  3CCS A;  3M5A A;  3CCE T;  2ZPH B;  4JS5 A;  5J39 A;  3CCJ T;  5LJ5 f;  1KG1 A;  2X4X A;  4M7D E;  3HKS A;  4N0A C;  2JNG A;  4J6Y A;  4XTV A;  1KQS A;  2VC8 A;  4M7D D;  2XDB A;  5CCA A;  4PJO B;  5GAN d;  3MCA B;  4JS4 A;  2EKO A;  3C4S A;  3JB9 I;  3VKI A;  4KUI A;  4LDV A;  4C92 E;  3JCM b;  1VQK A;  3GP8 A;  4C92 D;  4XU3 A;  5GAN e;  4BY6 B;  3FJP A;  4J8O A;  3KUF A;  2E64 A;  1I4K 1;  1X6O A;  4ZGE B;  1B34 B;  4MMK A;  2R58 A;  3G71 T;  1M8V A;  3A8O B;  3M4G A;  3OSV A;  1JJ2 A;  3RES A;  4M75 F;  1M1K U;  3MEV A;  2LCL A;  1I8F A;  4HA8 A;  4VUB A;  3JCM f;  3QPH A;  4CRI A;  4BI4 A;  1WQ7 A;  1G3T A;  3CCU A;  5IT9 E;  5DY9 A;  3QYH B;  2KSS A;  2L8D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...