4A4HA

Solution structure of spf30 tudor domain in complex with asymmetrically dimethylated arginine
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
64
Chain Sequence
ASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Dimethyl-Arginine Recognition by the Tudor Domains of Human Smn and Spf30 Proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords SURVIVAL OF MOTOR NEURON-RELATED-SPLICING FACTOR 30
total genus 9
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2011-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4a4hA00
5KCOA 1WJSA 4QQGA 3OYNA 3DB3A 4L59A 3OYHA 3DLMA 4ZTFA 2RJDA 1OZ2A 5J39A 1SSFA 4BD3A 2IG0A 5KE3A 4Q5WA 3L2RA 4N4HA 2X4YA 4GY5A 1WJQA 2X4XA 3CEYA 3MEAA 2K3XA 1H3ZA 4BE0A 4C5GA 3PNWC 5D6WA 5KH6A 3LLRA 2RJFA 4BDYA 2JTFA 2MWPA 2EQKA 5FRMA 2O4XA 5M9OA 3C4SA 5FROA 2G3RA 4RG2A 3S6WA 2B8AA 2R57A 4E7IA 2R58A 4ZTJA 4IUQA 1OI1A 2EQJA 2P0KA 1OYXA 3ZEHA 3UWNA 2LVMA 3GOXA 2LRQA 3LGLA 4QW2A 1WJRA 2EQUA 3QBYA 4C5IA 2RI5A 3SD4A 5C0MA 2RHIA 3OYMA 2GF7A 1G5VA 2GFUA 3L2QA 4E7LA 2GFAA 2K3YA 3P8HA 5KE2A 2F5KA 2M0OA 1KHCA 3QJ6A 1OZ3A 3OYBA 2JZ2A 3MP6A 1RI0A 3NTIA 4E7HA 2RHXA 5C6SA 2R5AA 3L42A 5D6YA 3PMIA 2LDMA 5IAYA 2RHYA 4QVZA 4A4EA 2L3RA 4A4GA 3H6ZA 3E9GA 4IURA 4E7KA 2X35A 2XK0A 3OS0A 3S3MA 2CKKA 3OYDA 2E5QA 3FDRA 3H8ZA 3E9FA 4IUPA 3FC3A 1N27A 4PLLA 3PFSA 2RO0A 4X34A 4QQ6A 4C5HA 4NS5A 2EKOA 3P8DA 2XDPA 4A4HA 3QKJA 3OMGA 3QIIA 2BIVA 3NTHA 2L8DA 2RJCA 3LX7A 3S3OA 4BE1A 3MEUA 3Q1JA 2M1HA 2YRVA 3EAEA 3ME9A 3NTKA 2MWOA 3ASKA 3PMTA 4A4FA 3OY9A 3L2WA 3OYIA 2PQWA 2FHDA 3OYGA 2NLUA 1MHNA 3DB4A 2LTOA 3META 1WGSA 2DIGA 4B9XA 3UT1A 2VYTA 4C5EA 4BE2A 4BDZA 3L2UA 4IUUA 3OYJA 4Z02A 2BUDA 4IUVA 2LCCA 2HQEA 2R5MA 2D9TA 5D6XA 2DIQA 4IKFA 3OYFA 4HCZA 2RHUA 4OVAA 3F70A 3OS1A 2EQMA 3OA6A 5CIUA 4PLIA 2BKDN 3LYIA 3FEOA 4II1A 3O8VA 3MEVA 2L89A 4FL6A 3OMCA 4N4GA 3OS2A 5KCHA 4QQDA 2WACA 2O4XB 3MP8A 3MP1A 4EDUA 3OYLA 4B9WA 4BACA 2HQXA 2QQSA 5FRNA 2X4WA 2DAQA 3OQ5A 3OYCA 3L2VA 2RJEA 5IN1A 4PL6A 4N4IA 3M9QA 2QQRA 4UC4A 4CRIA 3FLGA 4FU6A 3OYAA 3BDLA 2RI3A 3S3NA 2E6NA 5J26A 3MEWA 1XNIA 2RI2A 4IUTA 4LD6A 3OB9A 3KUFA 3LGFA 3MO8A 3OYKA 2M16A 4E7JA 2RHZA 2EFIA 3OYEA 3LH0A
chains in the Genus database with same CATH superfamily
1EIFA 2AHJB 3I5RA 5HY6A 1JXMA 1PNJA 3JSCA 3J80E 1BKBA 1M1GA 1FMWA 2KRSA 5LJ5h 1Q82U 4CC2A 2JTMA 2X4YA 2QGFB 3SB2A 5GAOn 3I55Q 3CCQQ 1NJIR 4JRKA 4F16A 4C5GA 1QKXA 1C6VX 2MWPA 5M9OA 1M2VA 2G3RA 1RL2A 2V1RA 2GTJA 4HCKA 1PCXA 4QW2A 2EW3A 2EQUA 3M58A 1ZBJA 1GFCA 1KQ1A 3I55A 2K3BA 3HP9A 3VKIA 2C0TA 3DKMA 5EG2A 2FZGB 4KRTA 4E7HA 2RHXA 3QPHA 4VUBA 2XDBA 4FSSA 4IURA 4M4ZA 4YTLA 3CMET 1YI2A 2QTVA 4M75C 4XTVA 3LWHA 1YITT 1AZEA 2EKOA 1R77A 1S72T 1KG1A 2K9GA 4PJOC 2L8DA 3JB9I 3LX7A 3V7CA 4DBFA 1D0ZA 3RKWA 1TG0A 3ULRB 1U8RA 3META 3EH2A 2VYTA 2FVUA 4HA8A 3CCVA 2LT4A 2DIQA 1KQ2A 1KQSS 4L6V5 5ECAA 1Q82C 3OS1A 4HKEA 2HQHA 2CYZB 4QQDA 5KYUB 2EGEA 4EMGA 3NFCA 2D6FA 1PRMC 4B9WA 2HMAA 2KYBA 2COWA 4LUDA 4LDUA 1WHJA 3A8OB 1FMVA 4DQ2A 2NWMA 2PVGB 4IUTA 1BI1A 2DRKA 1D3BB 3REAB 4CC3A 1M2OA 1OZ2A 4M7AF 4BB7A 3CC4T 2IG0A 1I81A 2YUPA 3JCMX 3VRYA 2DEQA 1KC8C 4DEXA 2L3PA 1LJOA 2IIMA 3PNWC 4FYXB 5L23A 5KH6A 2QEXT 2LQWA 4XU2A 1NLPC 3QZ5B 2VXEA 2R57A 4L5GA 3CCRQ 2Z0WA 3VJPA 2LP5A 1BI3A 2HL3A 2RN8A 4P5NA 1M8MA 4FYVB 1AHJB 1WHKA 5KE2A 3CCRA 1R0CB 2M0OA 2XDDA 3NTIA 3MP6A 2DVEA 2QQBA 4ELZC 3JCMh 1WXBA 3OBWA 4A53A 2E4HA 1WQ7A 2L3RA 1JU5C 1AVZC 4OMLA 2E5QA 3FDRA 1VIEA 1NM7A 5I11A 2DJZA 2RK1A 2QGGA 2JMCA 2E70A 3OSSC 3M4YA 1G3WA 1ZBXA 4DA4A 4J7FA 1JQQA 2P84A 2H8HA 5GMKh 1JJ2S 2DBKA 5IXBA 1Y07A 4JS5A 3ASKA 1B07A 1VQ9A 2SEMA 3THKA 5DM7R 2VUBA 1K8AC 4C0GA 1YJWT 2LX7A 2M9UA 1CKBA 2AIRB 4C8QE 2BKDN 4DBHA 1IGUA 4EDUA 3HHTB 4KBMB 2YUOA 2J6FA 6AT1B 4ZGJB 1YWOA 1J3TA 3M57A 3MKDA 2DXCA 1W2BP 2RJDA 2KYMA 2QDLA 5GMKi 2LJ1A 4IIOA 2C0IA 1E7OA 4M75B 1G3TA 2I0NA 3EFSA 4Z88A 2YLCA 1YITA 2GNCA 2EQKA 2O88A 1SF9A 5GANg 5I2MA 1KC8R 4M7DA 3RBBB 5GAN3 1U3OA 2E65A 5GAN4 4C8QD 4LD9K 1M90R 4K11A 4JLIA 1HYOA 2WSEE 3L2QA 3I56A 3CMAT 2YUQA 2EJGA 3EG9A 2YRCA 3I5SA 4KUIA 1YJNA 3LW5E 1HSQA 3JAME 3I56T 1YBYA 3CC7Q 1NEGA 4OGEA 2J6OA 4EIKA 2JN0A 4ZNXA 2DNUA 3CCLA 4C92F 1E6HA 4FIBA 3JCMP 2JJ9A 3OMGA 1VQ7Q 2P0PA 1H641 2ZPBB 2OAWA 4MZMA 1MV3A 1RAFB 2F2WA 4JLGA 2KXCA 4M77C 1VQOA 3O5ZA 4IUUA 3OYJA 1K73R 4KGXB 3NPFA 1Q82R 3QXEB 1U5SA 2BZYA 4J9IA 2OTLA 1AWOA 2HSPA 5DLQE 5CIUA 1YIJA 4FYWB 1KQSP 2K7AA 1VQNT 4HT8A 5GAOl 4JJCA 4N4IA 3VS7A 2DYBA 1GCQA 2A36A 4EMKC 3PGGA 3OB9A 1YWPA 5KYWB 2QI2A 3OYEA 4JPBW 5EC7A 4F04B 1X27A 5LJ3f 4C8QG 5GMKj 3I55T 3MHXA 1KSWA 3N5BB 2A7YA 1I4K1 3G1JA 3CC7A 2QYZA 1M1FA 1X2QA 4JRIA 4BDYA 4OP0A 2ESWA 1UECA 3JV3A 3HRUA 2CT3A 4RG2A 4D6WA 1GCPA 3E19A 8AT1B 1JBMA 2RHIA 1MMDA 4C8QA 5FWBA 1C0MA 4RTZA 2I2LA 3CMEQ 1ZSZB 1ABQA 4ZN3A 3QUIA 2ZPGB 4AMCA 1W2BS 1Q86C 2RHYA 4ANJA 1YP5A 1YITQ 5CO7A 4JRPA 2CUDA 3CCEQ 1G83A 1N9SA 1FYNA 2RQUA 2XDPA 4MMKA 4J9HA 2COYA 3QIIA 2B86A 2BIVA 5HKCA 1Q95G 1UGVA 4PJOA 2YRVA 1ABOA 4OMFB 3CCLT 3TSWA 4ORZA 1OV3A 1BIAA 1UB4A 4MZPA 1M1KC 3RESA 4M78F 1YHQT 3HRTA 2DZ9A 2DEUA 1VQPT 1Q7YR 4IKFA 3OYFA 4HCCA 3JB9G 2MYSA 4PLIA 2KBTA 5CR2A 1WPYA 3P8BB 5GMKl 1VQKT 1TUDA 3V7RA 1QVFP 1QVGS 3OYLA 1RLQC 1Z9QA 4FSXA 1ZLMA 3MJXA 3BDLA 1VQ5Q 1RADB 4LD6A 7AT1B 4F7UF 3CCSA 4EMHA 3OYNA 2L5QA 1P92A 2BTTA 2QEXQ 1T3SA 2YUNA 5DLOA 4ESRA 1VQMA 3RNJA 4F7UA 2X4XA 3UF4A 2K3XA 5FU7B 5GAOm 1H3ZA 2RF0A 1TTHB 1SRLA 1U1SA 1K8AU 3VYGA 2A37A 3JCMc 3CMAA 2NYSA 4C0FA 2P0KA 2FPDA 4XTZA 1IZ6A 1X6BA 2GF7A 1G8XA 3BW1A 4C92E 2M0YA 4MZTA 1M4ZA 2JZ2A 4M7AE 1QQJA 2HKNA 3NGPA 4A4GA 1Y96A 2JOYA 2MOXA 4RKUE 1UJ0A 2EYQA 3V7SA 5GMKm 3OYYA 1D3BA 4GLMA 4A54A 1KHIA 2CP3A 2V8KA 3CPWP 4JUVA 2M51A 4R0KA 3JCMb 2CSQA 1WHLA 4J9FA 5LJ5j 1Y7XA 2CH4W 4PFOA 3IQLA 2X4JA 2KQWA 3PVLA 1NYGA 1EX4A 1JO8A 1VQ5A 3H0IA 1A0NB 3E1SA 1G3SA 2IPOB 4B9XA 1K73C 1QVFS 4C5EA 2DO3A 4OMMA 3OW2A 3G71T 2DPPB 2PUKB 1WHGA 3RUXA 1QCOA 3OA6A 1D09B 1GCQC 2J6KA 2V26A 1TS9A 2F2XA 1VQ6A 2E10A 3VYHB 2LC4A 2DETA 3UDCA 3FLGA 2DKGA 4JZ3A 1MUZA 5DY9A 1XNIA 2RI2A 2PVOB 3OYKA 1VQ6T 4F7UG 5GAN7 3A98A 4DBQA 2BE7D 1YFNA 3OYHA 3GF5A 1QCFA 3L2RA 1G2BA 1D0XA 3A8HB 2AZVA 2JW4A 2QASA 1QVFA 2QA4A 3CC2A 4LE9A 2KI7A 2O4XA 4BY6C 1GL5A 4NL3A 4E7ZA 1FWZA 4XAXB 2EQJA 2DFUA 2GBQA 1FX7A 2XI9A 2F5KA 4EMKB 2LQKA 2EAYA 1RI0A 1PKTA 1K1ZA 1PG5B 1QP2A 3R6OA 1PSFA 2OX7A 2LDMA 2DD4A 4A4EA 4M78D 1QKWA 3CCQA 2XK0A 4OB2B 2NUZA 2KT1A 2FRYA 4OB3B 2YWWA 1NPRA 2LCSA 1RI9A 1NZ9A 1ZUUA 4QQ6A 5GAN8 1SPKA 4A4KA 3VV0A 5CCAA 2J06A 2K5IA 2JT4A 5J3BA 1ZUYA 3EAEA 1K4US 3OY9A 4DBRA 3OYIA 2E5KA 2LTOA 3LH5A 3GNFB 3CCEA 2RQVA 2X9HA 1W70A 3NHNA 2K2VA 1SKUB 1V1CA 1ZHIA 2R5MA 3I35A 1VQNQ 2EQMA 3RKYA 1RAIB 2RQWA 4M77B 1YJ9A 3CBPA 1AT1B 2QQSA 4CC4B 1OX9A 4PJOE 5CQXA 2RJEA 4UC4A 2QQRA 3QJYA 1Q86R 5LL6S 5LJ5f 5A0LA 2QDYB 4RG8A 5GANh 2RPNA 4LUEA 3X28B 4V2SA 4MDWA 2X3WD 4ZTFA 2EIFA 5GAN2 1SG5A 3C0CA 3HL8A 2W10A 2RB6A 4HT9A 2M02A 1XJWB 3VUBA 3MEAA 1N9RA 5GANd 1PWTA 5LJ3h 2P0QA 4MDXA 1UJYA 1K9AA 1BB9A 2KT8A 3VS2A 4LXCA 4X9CA 2OTJA 1OYXA 1UG1A 5CVIA 1VQLT 2FRWA 2EJ9A 1N6AA 2RK2A 3JCMg 5IHKA 2VB6A 3OYBA 2DM1A 4D8KA 4XQ3A 4Y92A 4J6WA 2E1HA 2DXBA 2HD0A 1YJ9Q 1KFZA 4BUGA 1SRMA 4QVZA 4ZGEB 2MIOA 2ZPHB 2X35A 4J83A 5IHIA 5CAIA 4IUPA 3FC3A 2JS0A 1AZGB 2RO0A 4XTXA 2DL4A 1UE9A 1K0SA 1UHFA 2QQ9A 1I8FA 4M77A 1VQ7A 4NL2A 3AHUA 3X20B 3S3OA 2OJ2A 3TEEA 1RAGB 2ZZDA 5GAN5 1TSFA 1GXIE 3M0TA 3L2WA 3ER0A 3CCUT 4M77F 1UHCA 4XTYA 1I0CA 4RMOA 3M53A 1X69A 1YJWA 1UGPB 1VQ8Q 2HEQA 4IUVA 2VKNA 8ATCB 2QA4T 1WNLA 3CC2T 4HCZA 2RHUA 4RTYA 1WIEA 2OI3A 1LNXA 1U06A 2KMTA 3RKXA 4E2FB 4NOYA 1V76A 2D1XA 1HK9A 1X6GA 4PFPA 1ZA2B 1V29B 1R0BG 4N0AA 3S3NA 1QLYA 2M16A 4B6MA 3G6EA 3LH0A 3CCQT 2LT1A 5J39A 1SSFA 4M75D 1X6OA 1N8RR 5HK3A 2PTKA 2MI6A 4N4HA 1HD3A 4HCBA 3WVEB 2HSEB 3QDRB 1UFFA 1WFWA 5D6WA 3OBYA 4PJMA 3CXCA 1JJ2A 1MMGA 4E7SA 3HFNA 2K2MA 2HAXA 1VYVA 2Y4YA 2K57A 2DYIA 2B8AA 4DOWA 4E7IA 2DJQA 1GBRA 4M7AC 3CPFA 3UWNA 1Y71A 2CZ6B 4OF1A 1XOVA 1K0XA 5GAOr 1G5VA 2GFUA 1W2BA 3VS4A 4J8OA 4C92B 3DLLA 5GAMh 1AWWA 1NBEB 3PMIA 3H9NA 1M27C 4RCCA 1ZX6A 3BY7A 2D8HA 2ATCB 1OU8A 5I2SA 5HK0A 1JXOA 2MAMA 2QEXA 4FYYB 3VS0A 4J7IA 4BI3A 1RAEB 3UATA 5CKEA 4BI4A 3GNGA 2DE0X 2PQWA 2RMOA 1WX6A 3DB4A 1CSKA 2PUOB 2DIGA 4AFSC 1QMCA 3LWIA 2FG0A 4Z02A 5A0GA 2CT4A 4ELYC 2DTOA 3JCMf 1M8VA 3O8VA 4M75F 4FL6A 2DL3A 1T3LA 2AT1B 2DVJA 1GBQA 2GCXA 1KC8U 3JCMQ 1H3HA 2E41A 1VQ6Q 1QWFA 3QZ9B 3VS5A 3WVDB 2FO0A 3EG2A 1QVGP 3CC4Q 1Y0MA 4M78A 3QSUA 4ATOA 3JCMd 5KCOA 2FYKA 2CP7A 4M7AG 5HCKA 2DX1A 3REBB 1M3CA 4J9EA 2QAZA 1D1CA 2COZA 4PJOF 1NPPA 3G4SA 3V8JA 2XG8D 3SWNC 3JCMe 4AFQC 5FRMA 2KROA 2ZPEB 3V8KA 1D1BA 4ZTJA 2VVKA 1LOJA 3GLXA 3G7ZA 5LJ5e 4C5IA 1OEBA 1KD1R 1M9SA 3OYMA 2IVWA 4OB1B 3TSZA 2KXDA 1ZQ1A 1I1JA 2CUBA 1K8AR 2EGCA 1MV0B 3A8MB 3RIRA 3H6ZA 5FLXE 4ZN1A 5IXFA 2ROTA 3JB9H 3PIOA 2EPDA 1ZSZC 1N27A 3QG1A 3TVTA 3BFMA 2O2OA 1WXTA 1T0JA 2NUTB 2GGRA 3KBGA 1MNDA 1OPLA 4RUGA 5GANj 1R8OB 5KYWA 5FW9A 3NTKA 3G6ET 2Y90A 1K9MR 1Z9ZA 1WHMA 3KFVA 1C1AA 2RA2A 4XTWA 2DLPA 3M0QA 2MCNA 4BDZA 1YHQA 2EBPA 2LCCA 1PC0A 4M75A 3F70A 1YIJQ 1Q81C 1RAHB 1ZA1B 4C92A 4F7UB 4RTUA 3HFOA 1S1NA 4M7AB 2C06A 1VIFA 3L2VA 1WLPB 3EFOA 2EKHA 4PJOB 3VUZA 1JB0E 2FZKB 4LDXA 1LVKA 2ZGWA 1VQLA 2MMPA 3SWNB 3GPLA 3CCJQ 2RNAA 3DLMA 1N5ZA 4BD3A 1PHTA 4AG1C 1AWXA 1WJQA 2FPEA 1OOTA 1WXUA 2ABLA 1WI7A 1AWJA 5GAN6 3EGUA 3CMAQ 3QYHB 3ZEHA 1YJNQ 3C94A 2PVDB 2RD1A 1WJRA 5C0MA 2LJ0A 3G71A 1U1TA 3P8HA 3I56Q 3CD6T 4RTWA 2DBMA 1KD1C 3M0UA 1PM3A 2R5AA 4JS4A 4JJDA 1CKAA 4WCIA 1UGSB 2NUTA 2DA9A 5CKDA 3OS0A 3PIPA 5LJ5d 1OPKA 2DF6A 2QTXA 1G3YA 2OTLQ 2EYXA 2K5FA 1SHFA 4C92G 5KYNA 1RLPC 2HKQB 1YCYA 1M90U 3RDVA 2LX9A 3E2UA 3Q1JA 1PD0A 4PKCC 2CZ1B 2JM8A 4R56A 2V8JA 1B34A 2D8JA 3QO3A 2XHCA 4M7DE 3RMQA 3PTAA 2AK5A 3L2UA 3SHWA 2EQIA 1N8RC 2OTJT 2VASA 3I9QA 5I22A 5D6XA 2KRMA 1X2KA 3LYIA 3FEOA 3OS2A 3MPUB 1BBZA 3VS1A 3CXCS 5KYYB 1WQWA 1TUGB 4PJLA 1UGQB 1KQSA 3MO8A 5FU6B 2QG9B 4C8QF 4FT2A 3DB3A 1Q7YU 1IHWA 1BCMA 1ACMB 1M3BA 1IREB 1Q86U 2AKKA 1IB8A 3URGA 3PE0A 1W1FA 2JTFA 3SDZA 2A08A 5KYUA 3HSBA 2CDTA 3J81E 2ECZA 2G6FX 2W0ZA 3FJPA 4KUDK 2LNHB 2EYWA 4FCYA 1BI2A 3SD4A 1KJWA 1M1KR 3EG9B 2DL5A 2K3YA 1K73U 1OZ3A 2J7IA 3JCMJ 1AOJA 3ZFJA 4AFZC 4PK4A 2KRNA 3HRSA 4E7KA 2CKKA 3CCUA 4MMLA 3M55A 3H8ZA 1QW1A 4OMPA 1MMNA 2XICA 2KVQG 3P8DA 1OU9A 4QKUA 2JTEA 1VQ9Q 2QXFA 4WTOB 3NTHA 2KR3A 3ME9A 4LN2A 2MWOA 3PMTA 1VQ4A 4ZGDB 3GP8A 1QVGA 2AZSA 4EMKA 2CH4A 4J6XA 1EFNA 2DRMA 3A8GB 2CSIA 1NJIU 4M78G 1VQKQ 2L0AA 1I5OB 4C92D 3VS6A 4E6RA 4A63B 5GAMg 1QWEA 4LDWA 1VQOT 2YDLA 1ZSGA 1WHHA 3OMCA 2F2VA 1SHGA 3CCVQ 2XD0A 2FB7A 2RH2A 2DAQA 2DXTA 4M7DG 1RAAB 3WXMB 2F5TX 3EGDA 5IT9E 3CPWA 2WSCE 2YSQA 4FU6A 1UGRB 1UEBA 1MNEA 3C12A 1VA7A 4C92C 4O5VA 3LGFA 1UUEA 2RHZA 3VU3C 4KGVB 2AKLA 4FT4A 5GAOq 2ED1A 2VGMA 1YNZA 3QHSA 4M75E 5AT1B 3G4ST 4BE0A 3A1PA 4QVDA 3LLRA 4EPCA 2YXYA 2HL5C 2MF2A 5FROA 3QWYA 3TU4K 2KK4A 4IUQA 4F17A 1K9MC 3JCMV 2ZPFB 1X43A 5FWCA 4DEYA 1ZSZA 4Z8AA 3M0SA 3V8LA 4X9DA 1Y57A 2K6DA 1PRLC 2V1QA 2YLBA 3CPWS 1O9SA 2FPFA 3S3MA 4GBQA 3EFRA 1VQKA 2LMJA 2V8IA 4PLLA 2JXBA 2VWFA 3PFSA 4X34A 3EGDB 2DL7A 3CC7T 3PT9A 1UTIA 4J6YA 3G6EQ 1S72A 2D0QB 1GFDA 2E3IA 3X26B 2XMFA 1VYTA 1WA7A 4BE1A 4R55A 3CCST 4A4FA 2YRDA 1TOVA 3OYGA 2NLUA 5LJ3j 3G71Q 3JB9D 9ATCB 1I5LA 2O9SA 4C0ZA 3H41A 2ZCFB 2KAFA 2HDAA 3INZA 4J5YA 3QDFA 1VYUA 4JJBA 1XTDA 3M5AA 3GIBA 4M78C 3AT1B 4N4GA 2O4XB 1IO6A 3RERA 1HJDA 2FL7A 2K5LA 3OYCA 3OQ5A 4M7DF 2VC8A 3CMEA 1YI2T 5IN1A 4LNPA 4M78E 3M9QA 1K9MU 3OYAA 3CCJT 1B7TA 2E6NA 1JRIA 3TCJA 2E64A 2JVVA 2O01E 5CK9A 2BZ8A 4L59A 3SFMA 4JZ4A 2CZ0B 4Q5WA 3C95A 4Z89A 4GY5A 5GAMd 3X24B 2HBPA 3J7AF 1XQHA 3L1AA 2HBWA 3CCMA 2LZ6B 1YJNT 2RJFA 3EGXB 2O31A 4KGZB 4IIMA 3CD6Q 1VQ4T 1BK2A 2EGAA 2LCLA 3CBMA 4XU3A 3L2ZA 4O6JA 3QBYA 1JEGA 2RI5A 4WF2A 4Y91A 3EHQA 2GFAA 1VQMQ 3BE3A 1M30A 2VXFA 2YT6A 5C6SA 5D6YA 1TU0B 4X1VA 1X01A 2OTLT 2K4YA 4LDYA 3CXCP 1NE8A 2LQ8A 1Y96B 4OMOA 2PZ1A 4TVRA 2DD5A 3VRZA 2EYYA 1VOMA 4RTVA 1H92A 1WZOA 1PSEA 3CCET 2DZCA 2RJCA 4OMNA 2JMAA 2EJFA 4C0DC 1W4SA 2CGHA 2HCKA 2FZCB 1BU1A 2OTJQ 5CKFA 2VGNA 2KY9A 4E47A 3T9NA 4PJJA 4M7DB 2L3QA 3CCLQ 2HNIA 2D9TA 2RQRA 1VQNA 5LJ3d 4HVVA 3KXTA 2JM9A 1B34B 3JB9F 3JRZA 3CQTA 3HTRA 1YHQQ 4BY6B 3MEVA 5KCHA 2RQTA 1VQPQ 2EYZA 3U23A 1GRIA 3EG1A 4CRIA 5LJ3e 4AFUC 5IH2A 5J26A 3EFOB 2GQIA 5CQYA 2VV5A 5A2QE 4LDVA 3CCMQ 5KYYA 3M56A 1VQ5T 1M2VB 1KD1U 5KE3A 4AG2C 4CC7A 2C0OA 1Q7YC 2HZYA 2CP2A 3FB9A 2YHTA 5GJVB 2KNBB 5FU6C 4HVUA 3FIFA 3FRNA 1VQLQ 2KSSA 1QCNA 2P4RA 1OI1A 1B3QA 2E12A 2LRQA 3LGLA 5FU7C 2DILA 5GAMj 3UA7A 4PNOA 3QJ6A 4DOVA 3NMZC 1TXQA 4M77E 3OW2P 1BCOA 3L42A 4M7DD 3M59A 3RMSA 1EZZB 3OSVA 2ED0A 3OYDA 3BDUA 4QVCA 4M78B 1I07A 1VQ9T 4OGCA 2KE9A 4NS5A 2OAUA 1Q81R 4A4HA 2KGTA 5GANe 3CD6A 3CCUQ 2XIDA 2DMOA 3CC4A 4M7DC 4KH0B 1BIBA 1IHVA 3MEUA 1X75C 1NLOC 1T0HA 2DTIA 2LJ3A 1S72Q 3SEMA 1VQ8T 1W6XA 2A3LA 2EVRA 4M77G 5CKHA 2FHDA 1MHNA 1NEBA 1WGSA 3UT1A 1VQOQ 4PJNA 2MK5A 2O9VA 1OQKA 2BUDA 5CKBA 2XKOC 3CCVT 4PJOD 4QT7A 1UDLA 2F1LA 1ARKA 4II1A 2JS2A 5I21A 4E7JA 3HPWA 2L89A 4M7AD 4C8QB 2WACA 4ME7A 3MCAB 1RACB 4BACA 2WSFE 2X4WA 2E6ZA 3PVQA 1FMKA 2P4TA 1IRXA 2GTOA 2A0FB 1WDXA 3KUFA 2PNIA 4JRQA 2EFIA 1WJSA 2ZAEA 5KYXB 3M0RA 3G4SQ 3OS5A 2PU9B 1KIKA 2RM4A 1M1KU 2ENMA 3TQ7P 3CEYA 4AT1B 3ZL7C 3EG3A 2D0NA 4KH1B 5L8RE 4XU0A 3TREA 2ZPIB 3C4SA 2KDSA 3GBQA 2R58A 1YCSB 2L3SA 4C0DB 2K79A 2GQVA 5GMKe 5GANf 2QK0A 4GLKA 5A0DA 1JJ2P 4J9CA 4E7LA 3CCRT 1KHCA 1K76A 3ZBDA 4FM4B 4XK8E 3JCMW 1DJ7B 3EG0A 3M0PA 5IAYA 1TUCA 3E9GA 3UPUA 2DK3A 4D8DA 2SRCA 1FXXA 4C5HA 5GAMe 3CCSQ 2DTHA 1LCKA 2FEIA 4KULA 1TH7A 3EHRA 2XU8A 2M1HA 4F14A 2CP5A 2H3EB 2CREA 3SWNA 2EWNA 1KK7A 3X25B 1VUBA 4BE2A 5GAMf 2J05A 2JUFA 5D7UA 1VQPA 1IXDA 3FJ5A 2NUPB 2CZ7B 4J9DA 2H3JA 2DXUA 1YI2Q 1YJWQ 4M75G 1O75A 1ZUKA 3VS3A 1SSHA 1Q81U 2E3HA 1D1AA 2CS7A 1LPLA 1OULA 5FRNA 2QQAA 1NYFA 2LQNA 4RTTA 1F1BB 4PFZA 3CCJA 3QWXX 3M4GA 3MEWA 1AEYA 3R6NA 2X3XD 4RCBA 3M54A 4QQGA 2L2PA 2ROLA 1NJIC 4Y28E 4RTXA 1RUWA 3A5ZB 1AD5A 2DL8A 1E6GA 4HXJA 3UA6A 5LJ3g 4PJOG 1BI0A 1QVPA 1VQ4Q 3H0FA 3QYGB 1TWBA 4XU1A 2CP0A 3A8LB 4BI8B 4J9BA 1HXDA 2CP6A 3S6WA 4CI0C 1VQMT 1WYXA 2LVMA 3GOXA 3JB9J 5AYFA 4J9GA 1OX8A 2F69A 4HVWA 4N0AC 4FW2A 1SEMA 4OB0B 4XTUA 1NG2A 2NUPA 2BZXA 1IGQA 1M3AA 5GAOp 4KT0E 3EH1A 1M5Q1 3H0HA 1VQ8A 1PKSA 1YJ9T 4C8QC 2X51A 3E9FA 4M77D 1QP3A 5KYXA 1RABB 2A28A 3RR6A 4OMQA 4M7AA 3QKJA 3EGXA 3CBOA 1M90C 5GJWB 1YN8A 4JDSA 2DERA 1VQ7T 2JNGA 1YIJT 2BE9B 1H8KA 2KEAA 2HQEA 2LNVA 4OVAA 3HKSA 2Y4XA 1N8RU 3D7SB 4F7UE 1D0YA 2QA4Q 4FW1A 3CC2Q 3MP8A 3MP1A 2HQXA 2MPXC 5LJ5g 4JJNK 1BYMA 1PD1A 3OW2S 4PL6A 3CCMT 1MMAA 2RI3A 1MGQA 5IHNA
chains in the Genus database with same CATH topology
5KCOA 1EIFA 3OYNA 2FYKA 4L59A 2L5QA 3SFMA 2AHJB 1P92A 5HY6A 4M7AG 3JSCA 3J80E 1BKBA 1M1GA 2CZ0B 4Q5WA 5DLOA 5LJ5h 1Q82U 2JTMA 2X4YA 3C95A 3SB2A 4GY5A 5GAMd 4PJOF 3X24B 2HBPA 4F7UA 5GAOn 1VQMA 3J7AF 2X4XA 1NPPA 3G4SA 1XQHA 2K3XA 3L1AA 5FU7B 2XG8D 4JRKA 3V8JA 4C5GA 5GAOm 3CCMA 1H3ZA 1YJNT 3SWNC 3JCMe 2RJFA 5FRMA 2MWPA 2ZPEB 1U1SA 5M9OA 1K8AU 3V8KA 3VYGA 3CMAA 2G3RA 3JCMc 1RL2A 4C0FA 4ZTJA 2P0KA 1LOJA 3GLXA 3G7ZA 5LJ5e 1VQ4T 2LCLA 3CBMA 3L2ZA 4QW2A 4O6JA 2EQUA 3QBYA 4XTZA 4XU3A 2RI5A 1IZ6A 1M9SA 3M58A 3OYMA 2IVWA 2GF7A 4OB1B 4WF2A 4Y91A 1KQ1A 3I55A 2GFAA 3BW1A 3HP9A 4C92E 4MZTA 1ZQ1A 3VKIA 2VXFA 3DKMA 1M4ZA 2JZ2A 5EG2A 4E7HA 4M7AE 2RHXA 5C6SA 5D6YA 3QPHA 4VUBA 2XDBA 1X01A 2OTLT 2K4YA 3A8MB 3RIRA 4LDYA 4A4GA 3H6ZA 1Y96A 4IURA 2JOYA 4RKUE 4YTLA 3CMET 1YI2A 2EYQA 5FLXE 3V7SA 4ZN1A 5GMKm 1NE8A 2LQ8A 3OYYA 1D3BA 3JB9H 1Y96B 4M75C 4A54A 3PIOA 1KHIA 4XTVA 1N27A 2V8KA 3LWHA 3QG1A 3BFMA 4C5IA 1YITT 4JUVA 4TVRA 2DD5A 2EKOA 3JCMb 1S72T 1KG1A 5LJ5j 1Y7XA 4PJOC 1PSEA 3CCET 3KBGA 2DZCA 2L8DA 2RJCA 2X4JA 3LX7A 3JB9I 3V7CA 5GANj 1R8OB 2KQWA 2EJFA 4C0DC 1W4SA 2CGHA 3NTKA 3G6ET 5CKFA 2Y90A 2VGNA 3RKWA 1VQ5A 1U8RA 2KY9A 3E1SA 1G3SA 3META 4E47A 2RA2A 4B9XA 1K73C 1QVFS 4C5EA 2VYTA 4XTWA 2FVUA 3T9NA 4BDZA 1YHQA 4M7DB 2DO3A 2HNIA 3OW2A 2LCCA 2D9TA 4HA8A 3CCVA 2LT4A 2DIQA 1KQ2A 1KQSS 1VQNA 4L6V5 4M75A 3F70A 5LJ3d 3G71T 3OS1A 1Q82C 2DPPB 2PUKB 4HKEA 3KXTA 3RUXA 1Q81C 1B34B 3OA6A 3JRZA 3JB9F 4C92A 4F7UB 4BY6B 3MEVA 3HFOA 2CYZB 5KCHA 4QQDA 4EMGA 3NFCA 2D6FA 4M7AB 4B9WA 1VQ6A 2E10A 2C06A 1VIFA 3L2VA 4LDUA 3VYHB 2LC4A 4PJOB 3UDCA 4CRIA 5LJ3e 3FLGA 2DKGA 3VUZA 3A8OB 5J26A 1JB0E 4DQ2A 4LDXA 5DY9A 1XNIA 2RI2A 2PVGB 2ZGWA 4IUTA 2PVOB 3OYKA 1BI1A 1QVGA 1VQLA 1VQ6T 2MMPA 4F7UG 5CQYA 5GAN7 2VV5A 5A2QE 4LDVA 3SWNB 3GPLA 1D3BB 3OYHA 3DLMA 3M56A 1OZ2A 1VQ5T 4M7AF 4BB7A 4BD3A 2IG0A 5KE3A 3CC4T 1KD1U 1I81A 3GF5A 3L2RA 3JCMX 2DEQA 3A8HB 3FB9A 1Q7YC 1WJQA 2YHTA 1KC8C 1LJOA 5FU6C 1QVFA 3PNWC 5KH6A 2QA4A 3CC2A 3FIFA 2QEXT 3FRNA 4XU2A 2O4XA 5GAN6 2KSSA 3QZ5B 4BY6C 2VXEA 4NL3A 2R57A 3QYHB 4L5GA 1FWZA 1OI1A 2EQJA 4XAXB 3VJPA 3ZEHA 2E12A 2LRQA 2PVDB 1WJRA 2RD1A 3C94A 3LGLA 5FU7C 1BI3A 5C0MA 1FX7A 4P5NA 2XI9A 5GAMj 1AHJB 4PNOA 3G71A 1U1TA 3P8HA 5KE2A 2F5KA 3CCRA 2M0OA 3QJ6A 4EMKB 2XDDA 4DOVA 2LQKA 3CD6T 2EAYA 3MP6A 1RI0A 2DVEA 2QQBA 3NTIA 1KD1C 4M77E 1QP2A 2R5AA 3L42A 4ELZC 4JS4A 3R6OA 4M7DD 1PSFA 3M59A 3RMSA 3JCMh 2LDMA 3OBWA 4A53A 2DD4A 1WQ7A 1UGSB 4A4EA 2L3RA 4M78D 3OSVA 3CCQA 2XK0A 4OB2B 5CKDA 3OS0A 3PIPA 3BDUA 3OYDA 2E5QA 3FDRA 1VIEA 4QVCA 4M78B 4OB3B 5LJ5d 1NPRA 2QTXA 4OGCA 1VQ9T 1G3YA 2DJZA 2RK1A 1NZ9A 2K5FA 4QQ6A 2E70A 3OSSC 4C92G 4NS5A 5GAN8 2OAUA 4A4HA 5GANe 1YCYA 3M4YA 1M90U 3CD6A 4A4KA 1G3WA 3VV0A 2XIDA 2LX9A 5CCAA 3CC4A 1ZBXA 4DA4A 2K5IA 4J7FA 4M7DC 1BIBA 5J3BA 5GMKh 1JJ2S 3MEUA 1X75C 1Y07A 3Q1JA 4JS5A 2DTIA 3EAEA 4PKCC 2CZ1B 3ASKA 1VQ8T 3OY9A 2A3LA 4M77G 4R56A 3OYIA 5CKHA 2V8JA 2FHDA 1B34A 1MHNA 2LTOA 3GNFB 1VQ9A 1WGSA 3CCEA 3QO3A 3UT1A 2XHCA 4M7DE 2K2VA 3RMQA 3PTAA 5DM7R 2VUBA 1K8AC 4C0GA 3L2UA 1N8RC 2OTJT 1YJWT 2BUDA 1ZHIA 2R5MA 5CKBA 2M9UA 2XKOC 5D6XA 3CCVT 4PJOD 2EQMA 3RKYA 4C8QE 2BKDN 3LYIA 3FEOA 4II1A 5I21A 3HPWA 2L89A 3OS2A 4M77B 4C8QB 4E7JA 4M7AD 2WACA 4ME7A 3MCAB 4EDUA 3CXCS 1YJ9A 3CBPA 4BACA 3HHTB 2WSFE 2QQSA 4KBMB 2X4WA 4PJOE 1WQWA 5CQXA 2RJEA 2E6ZA 4UC4A 2QQRA 3QJYA 1UGQB 4ZGJB 5LL6S 2P4TA 5LJ5f 1KQSA 3M57A 2QDYB 5A0LA 3KUFA 3MO8A 5FU6B 4RG8A 5GANh 2EFIA 4JRQA 2DXCA 1WJSA 4FT2A 4C8QF 3DB3A 3X28B 4V2SA 3OS5A 4MDWA 4ZTFA 2RJDA 2EIFA 1Q7YU 2PU9B 5GAN2 5GMKi 2RM4A 3HL8A 1M1KU 2RB6A 4HT9A 4M75B 3VUBA 1G3TA 3EFSA 1IREB 2YLCA 3CEYA 3MEAA 1YITA 1Q86U 1N9RA 3URGA 5GANd 5LJ3h 5L8RE 4XU0A 2JTFA 3SDZA 2EQKA 2P0QA 3TREA 3HSBA 4MDXA 5GANg 2ZPIB 5I2MA 3J81E 3C4SA 2KDSA 4M7DA 2R58A 5GAN3 4X9CA 2OTJA 3FJPA 1OYXA 2E65A 5CVIA 4C0DB 5GAN4 4KUDK 2GQVA 4C8QD 4LD9K 5GMKe 4JLIA 5GANf 1VQLT 1BI2A 3SD4A 4GLKA 5A0DA 2EJ9A 1N6AA 2WSEE 3L2QA 3I56A 2RK2A 4E7LA 2K3YA 3CCRT 1K73U 3CMAT 3JCMg 1KHCA 2EJGA 1OZ3A 4XQ3A 3OYBA 3ZBDA 4FM4B 4J6WA 4XK8E 4KUIA 3JCMJ 2E1HA 3ZFJA 1YJNA 2DXBA 2HD0A 3LW5E 3JCMW 4BUGA 1DJ7B 5IAYA 4QVZA 4ZGEB 3JAME 3I56T 1YBYA 3E9GA 2ZPHB 3HRSA 2X35A 3UPUA 4E7KA 2CKKA 3CCUA 4MMLA 4OGEA 2DK3A 4J83A 3M55A 3H8ZA 1QW1A 5CAIA 4IUPA 1FXXA 3FC3A 4XTXA 2RO0A 2JN0A 3CCLA 4C5HA 2XICA 4C92F 2KVQG 5GAMe 3P8DA 2QQ9A 4FIBA 1I8FA 2DTHA 4M77A 3JCMP 2QXFA 3OMGA 4KULA 1VQ7A 1TH7A 3NTHA 4NL2A 3AHUA 3X20B 3S3OA 3TEEA 2XU8A 2ZZDA 5GAN5 2M1HA 2P0PA 1GXIE 3ME9A 1H641 3SWNA 2ZPBB 2EWNA 2MWOA 3PMTA 1VQ4A 4ZGDB 3L2WA 3GP8A 3ER0A 3X25B 4M77F 4MZMA 4EMKA 3CCUT 4XTYA 1VUBA 4J6XA 4JLGA 3A8GB 4BE2A 4M77C 5GAMf 1VQOA 4RMOA 1NJIU 3M53A 1YJWA 4IUUA 4M78G 1UGPB 3OYJA 2JUFA 4IUVA 2QA4T 3QXEB 1WNLA 4C92D 3CC2T 2OTLA 1VQPA 4HCZA 2RHUA 5GAMg 2CZ7B 2H3JA 4LDWA 1VQOT 5DLQE 1LNXA 5CIUA 2DXUA 2KMTA 3RKXA 1YIJA 4M75G 1O75A 3OMCA 4NOYA 1Q81U 2XD0A 2FB7A 1VQNT 4HT8A 5GAOl 1HK9A 2CS7A 2RH2A 5FRNA 2DAQA 2DXTA 4M7DG 2QQAA 1V29B 3WXMB 2F5TX 5IT9E 4N4IA 3CPWA 2WSCE 4FU6A 1UGRB 1UEBA 4N0AA 3CCJA 3S3NA 3C12A 3M4GA 3MEWA 4EMKC 3PGGA 4C92C 3OB9A 4O5VA 3LGFA 2M16A 2RHZA 2QI2A 3OYEA 3G6EA 3LH0A 4RCBA 3M54A 5LJ3f 4QQGA 3VU3C 4C8QG 5GMKj 3MHXA 3I55T 3CCQT 3N5BB 1NJIC 4Y28E 2LT1A 5J39A 1SSFA 2A7YA 4M75D 3A5ZB 1X6OA 4FT4A 5HK3A 1I4K1 2MI6A 4N4HA 5GAOq 4HCBA 3WVEB 5LJ3g 2VGMA 4PJOG 3QDRB 1BI0A 3CC7A 3QHSA 4M75E 3G4ST 4BE0A 1M1FA 1QVPA 5D6WA 3OBYA 4QVDA 3LLRA 3QYGB 4JRIA 4BDYA 4EPCA 3CXCA 4XU1A 4OP0A 1JJ2A 3A8LB 4BI8B 3HFNA 1HXDA 2HAXA 2Y4YA 2MF2A 2K57A 5FROA 3HRUA 4RG2A 3S6WA 2B8AA 4D6WA 4DOWA 4E7IA 3TU4K 2KK4A 4IUQA 4CI0C 1VQMT 1K9MC 3JCMV 4M7AC 3E19A 3CPFA 3UWNA 1Y71A 2LVMA 2CZ6B 3GOXA 3JB9J 5AYFA 4OF1A 1JBMA 2ZPFB 1XOVA 2F69A 2RHIA 5GAOr 1G5VA 2GFUA 4N0AC 1W2BA 4OB0B 4C8QA 3V8LA 2I2LA 4X9DA 4XTUA 4J8OA 4C92B 3DLLA 5GAMh 4ZN3A 3QUIA 2ZPGB 1W2BS 1Q86C 3PMIA 2YLBA 3CPWS 2RHYA 1O9SA 5GAOp 4KT0E 4RCCA 1M5Q1 3S3MA 3EFRA 1VQ8A 1VQKA 5CO7A 4JRPA 2V8IA 3BY7A 1YJ9T 4C8QC 3E9FA 4M77D 1QP3A 4PLLA 1N9SA 3PFSA 4X34A 5I2SA 3CC7T 5HK0A 3PT9A 4J6YA 2MAMA 2XDPA 4MMKA 1S72A 4M7AA 2D0QB 2QEXA 3QKJA 3X26B 3QIIA 2BIVA 5HKCA 4J7IA 4BI3A 4BE1A 4PJOA 3CBOA 1M90C 2YRVA 4R55A 4OMFB 3CCST 5CKEA 3CCLT 4A4FA 4BI4A 4JDSA 3GNGA 2PQWA 3OYGA 2NLUA 3DB4A 1BIAA 1UB4A 2PUOB 2DIGA 4MZPA 2JNGA 5LJ3j 1VQ7T 1YIJT 1M1KC 3JB9D 3RESA 1I5LA 3LWIA 4M78F 1YHQT 3HRTA 4Z02A 4C0ZA 2DZ9A 2ZCFB 5A0GA 2HQEA 2LNVA 2KAFA 3INZA 4J5YA 3JCMd 1VQPT 4ELYC 4IKFA 3OYFA 4OVAA 3HKSA 2Y4XA 1N8RU 2DTOA 3JCMf 4F7UE 1XTDA 3M5AA 4HCCA 3JB9G 3GIBA 4M78C 4PLIA 5CR2A 1M8VA 1WPYA 3O8VA 3P8BB 4M75F 4FL6A 3V7RA 4N4GA 5GMKl 1QVGS 1VQKT 3MP8A 2O4XB 3OYLA 3MP1A 2GCXA 1KC8U 3JCMQ 2FL7A 2HQXA 3RERA 5LJ5g 4JJNK 1BYMA 2E41A 2K5LA 3OYCA 3OQ5A 4M7DF 2VC8A 3CMEA 4FSXA 1YI2T 3QZ9B 5IN1A 3OW2S 4PL6A 4M78E 3M9QA 3WVDB 3CCMT 1K9MU 3OYAA 3CCJT 3BDLA 2RI3A 2E6NA 1JRIA 3TCJA 2E64A 1MGQA 2JVVA 4M78A 4LD6A 2O01E 3QSUA 4F7UF 5CK9A 3CCSA 4ATOA 4EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KCO A;  1WJS A;  4QQG A;  3OYN A;  3DB3 A;  4L59 A;  3OYH A;  3DLM A;  4ZTF A;  2RJD A;  1OZ2 A;  5J39 A;  1SSF A;  4BD3 A;  2IG0 A;  5KE3 A;  4Q5W A;  3L2R A;  4N4H A;  2X4Y A;  4GY5 A;  1WJQ A;  2X4X A;  3CEY A;  3MEA A;  2K3X A;  1H3Z A;  4BE0 A;  4C5G A;  3PNW C;  5D6W A;  5KH6 A;  3LLR A;  2RJF A;  4BDY A;  2JTF A;  2MWP A;  2EQK A;  5FRM A;  2O4X A;  5M9O A;  3C4S A;  5FRO A;  2G3R A;  4RG2 A;  3S6W A;  2B8A A;  2R57 A;  4E7I A;  2R58 A;  4ZTJ A;  4IUQ A;  1OI1 A;  2EQJ A;  2P0K A;  1OYX A;  3ZEH A;  3UWN A;  2LVM A;  3GOX A;  2LRQ A;  3LGL A;  4QW2 A;  1WJR A;  2EQU A;  3QBY A;  4C5I A;  2RI5 A;  3SD4 A;  5C0M A;  2RHI A;  3OYM A;  2GF7 A;  1G5V A;  2GFU A;  3L2Q A;  4E7L A;  2GFA A;  2K3Y A;  3P8H A;  5KE2 A;  2F5K A;  2M0O A;  1KHC A;  3QJ6 A;  1OZ3 A;  3OYB A;  2JZ2 A;  3MP6 A;  1RI0 A;  3NTI A;  4E7H A;  2RHX A;  5C6S A;  2R5A A;  3L42 A;  5D6Y A;  3PMI A;  2LDM A;  5IAY A;  2RHY A;  4QVZ A;  4A4E A;  2L3R A;  4A4G A;  3H6Z A;  3E9G A;  4IUR A;  4E7K A;  2X35 A;  2XK0 A;  3OS0 A;  3S3M A;  2CKK A;  3OYD A;  2E5Q A;  3FDR A;  3H8Z A;  3E9F A;  4IUP A;  3FC3 A;  1N27 A;  4PLL A;  3PFS A;  2RO0 A;  4X34 A;  4QQ6 A;  4C5H A;  4NS5 A;  2EKO A;  3P8D A;  2XDP A;  4A4H A;  3QKJ A;  3OMG A;  3QII A;  2BIV A;  3NTH A;  2L8D A;  2RJC A;  3LX7 A;  3S3O A;  4BE1 A;  3MEU A;  3Q1J A;  2M1H A;  2YRV A;  3EAE A;  3ME9 A;  3NTK A;  2MWO A;  3ASK A;  3PMT A;  4A4F A;  3OY9 A;  3L2W A;  3OYI A;  2PQW A;  2FHD A;  3OYG A;  2NLU A;  1MHN A;  3DB4 A;  2LTO A;  3MET A;  1WGS A;  2DIG A;  4B9X A;  3UT1 A;  2VYT A;  4C5E A;  4BE2 A;  4BDZ A;  3L2U A;  4IUU A;  3OYJ A;  4Z02 A;  2BUD A;  4IUV A;  2LCC A;  2HQE A;  2R5M A;  2D9T A;  5D6X A;  2DIQ A;  4IKF A;  3OYF A;  4HCZ A;  2RHU A;  4OVA A;  3F70 A;  3OS1 A;  2EQM A;  3OA6 A;  5CIU A;  4PLI A;  2BKD N;  3LYI A;  3FEO A;  4II1 A;  3O8V A;  3MEV A;  2L89 A;  4FL6 A;  3OMC A;  4N4G A;  3OS2 A;  5KCH A;  4QQD A;  2WAC A;  2O4X B;  3MP8 A;  3MP1 A;  4EDU A;  3OYL A;  4B9W A;  4BAC A;  2HQX A;  2QQS A;  5FRN A;  2X4W A;  2DAQ A;  3OQ5 A;  3OYC A;  3L2V A;  2RJE A;  5IN1 A;  4PL6 A;  4N4I A;  3M9Q A;  2QQR A;  4UC4 A;  4CRI A;  3FLG A;  4FU6 A;  3OYA A;  3BDL A;  2RI3 A;  3S3N A;  2E6N A;  5J26 A;  3MEW A;  1XNI A;  2RI2 A;  4IUT A;  4LD6 A;  3OB9 A;  3KUF A;  3LGF A;  3MO8 A;  3OYK A;  2M16 A;  4E7J A;  2RHZ A;  2EFI A;  3OYE A;  3LH0 A; 
#chains in the Genus database with same CATH topology
 1EIF A;  2AHJ B;  3I5R A;  5HY6 A;  1JXM A;  1PNJ A;  3JSC A;  3J80 E;  1BKB A;  1M1G A;  1FMW A;  2KRS A;  5LJ5 h;  1Q82 U;  4CC2 A;  2JTM A;  2X4Y A;  2QGF B;  3SB2 A;  5GAO n;  3I55 Q;  3CCQ Q;  1NJI R;  4JRK A;  4F16 A;  4C5G A;  1QKX A;  1C6V X;  2MWP A;  5M9O A;  1M2V A;  2G3R A;  1RL2 A;  2V1R A;  2GTJ A;  4HCK A;  1PCX A;  4QW2 A;  2EW3 A;  2EQU A;  3M58 A;  1ZBJ A;  1GFC A;  1KQ1 A;  3I55 A;  2K3B A;  3HP9 A;  3VKI A;  2C0T A;  3DKM A;  5EG2 A;  2FZG B;  4KRT A;  4E7H A;  2RHX A;  3QPH A;  4VUB A;  2XDB A;  4FSS A;  4IUR A;  4M4Z A;  4YTL A;  3CME T;  1YI2 A;  2QTV A;  4M75 C;  4XTV A;  3LWH A;  1YIT T;  1AZE A;  2EKO A;  1R77 A;  1S72 T;  1KG1 A;  2K9G A;  4PJO C;  2L8D A;  3JB9 I;  3LX7 A;  3V7C A;  4DBF A;  1D0Z A;  3RKW A;  1TG0 A;  3ULR B;  1U8R A;  3MET A;  3EH2 A;  2VYT A;  2FVU A;  4HA8 A;  3CCV A;  2LT4 A;  2DIQ A;  1KQ2 A;  1KQS S;  4L6V 5;  5ECA A;  1Q82 C;  3OS1 A;  4HKE A;  2HQH A;  2CYZ B;  4QQD A;  5KYU B;  2EGE A;  4EMG A;  3NFC A;  2D6F A;  1PRM C;  4B9W A;  2HMA A;  2KYB A;  2COW A;  4LUD A;  4LDU A;  1WHJ A;  3A8O B;  1FMV A;  4DQ2 A;  2NWM A;  2PVG B;  4IUT A;  1BI1 A;  2DRK A;  1D3B B;  3REA B;  4CC3 A;  1M2O A;  1OZ2 A;  4M7A F;  4BB7 A;  3CC4 T;  2IG0 A;  1I81 A;  2YUP A;  3JCM X;  3VRY A;  2DEQ A;  1KC8 C;  4DEX A;  2L3P A;  1LJO A;  2IIM A;  3PNW C;  4FYX B;  5L23 A;  5KH6 A;  2QEX T;  2LQW A;  4XU2 A;  1NLP C;  3QZ5 B;  2VXE A;  2R57 A;  4L5G A;  3CCR Q;  2Z0W A;  3VJP A;  2LP5 A;  1BI3 A;  2HL3 A;  2RN8 A;  4P5N A;  1M8M A;  4FYV B;  1AHJ B;  1WHK A;  5KE2 A;  3CCR A;  1R0C B;  2M0O A;  2XDD A;  3NTI A;  3MP6 A;  2DVE A;  2QQB A;  4ELZ C;  3JCM h;  1WXB A;  3OBW A;  4A53 A;  2E4H A;  1WQ7 A;  2L3R A;  1JU5 C;  1AVZ C;  4OML A;  2E5Q A;  3FDR A;  1VIE A;  1NM7 A;  5I11 A;  2DJZ A;  2RK1 A;  2QGG A;  2JMC A;  2E70 A;  3OSS C;  3M4Y A;  1G3W A;  1ZBX A;  4DA4 A;  4J7F A;  1JQQ A;  2P84 A;  2H8H A;  5GMK h;  1JJ2 S;  2DBK A;  5IXB A;  1Y07 A;  4JS5 A;  3ASK A;  1B07 A;  1VQ9 A;  2SEM A;  3THK A;  5DM7 R;  2VUB A;  1K8A C;  4C0G A;  1YJW T;  2LX7 A;  2M9U A;  1CKB A;  2AIR B;  4C8Q E;  2BKD N;  4DBH A;  1IGU A;  4EDU A;  3HHT B;  4KBM B;  2YUO A;  2J6F A;  6AT1 B;  4ZGJ B;  1YWO A;  1J3T A;  3M57 A;  3MKD A;  2DXC A;  1W2B P;  2RJD A;  2KYM A;  2QDL A;  5GMK i;  2LJ1 A;  4IIO A;  2C0I A;  1E7O A;  4M75 B;  1G3T A;  2I0N A;  3EFS A;  4Z88 A;  2YLC A;  1YIT A;  2GNC A;  2EQK A;  2O88 A;  1SF9 A;  5GAN g;  5I2M A;  1KC8 R;  4M7D A;  3RBB B;  5GAN 3;  1U3O A;  2E65 A;  5GAN 4;  4C8Q D;  4LD9 K;  1M90 R;  4K11 A;  4JLI A;  1HYO A;  2WSE E;  3L2Q A;  3I56 A;  3CMA T;  2YUQ A;  2EJG A;  3EG9 A;  2YRC A;  3I5S A;  4KUI A;  1YJN A;  3LW5 E;  1HSQ A;  3JAM E;  3I56 T;  1YBY A;  3CC7 Q;  1NEG A;  4OGE A;  2J6O A;  4EIK A;  2JN0 A;  4ZNX A;  2DNU A;  3CCL A;  4C92 F;  1E6H A;  4FIB A;  3JCM P;  2JJ9 A;  3OMG A;  1VQ7 Q;  2P0P A;  1H64 1;  2ZPB B;  2OAW A;  4MZM A;  1MV3 A;  1RAF B;  2F2W A;  4JLG A;  2KXC A;  4M77 C;  1VQO A;  3O5Z A;  4IUU A;  3OYJ A;  1K73 R;  4KGX B;  3NPF A;  1Q82 R;  3QXE B;  1U5S A;  2BZY A;  4J9I A;  2OTL A;  1AWO A;  2HSP A;  5DLQ E;  5CIU A;  1YIJ A;  4FYW B;  1KQS P;  2K7A A;  1VQN T;  4HT8 A;  5GAO l;  4JJC A;  4N4I A;  3VS7 A;  2DYB A;  1GCQ A;  2A36 A;  4EMK C;  3PGG A;  3OB9 A;  1YWP A;  5KYW B;  2QI2 A;  3OYE A;  4JPB W;  5EC7 A;  4F04 B;  1X27 A;  5LJ3 f;  4C8Q G;  5GMK j;  3I55 T;  3MHX A;  1KSW A;  3N5B B;  2A7Y A;  1I4K 1;  3G1J A;  3CC7 A;  2QYZ A;  1M1F A;  1X2Q A;  4JRI A;  4BDY A;  4OP0 A;  2ESW A;  1UEC A;  3JV3 A;  3HRU A;  2CT3 A;  4RG2 A;  4D6W A;  1GCP A;  3E19 A;  8AT1 B;  1JBM A;  2RHI A;  1MMD A;  4C8Q A;  5FWB A;  1C0M A;  4RTZ A;  2I2L A;  3CME Q;  1ZSZ B;  1ABQ A;  4ZN3 A;  3QUI A;  2ZPG B;  4AMC A;  1W2B S;  1Q86 C;  2RHY A;  4ANJ A;  1YP5 A;  1YIT Q;  5CO7 A;  4JRP A;  2CUD A;  3CCE Q;  1G83 A;  1N9S A;  1FYN A;  2RQU A;  2XDP A;  4MMK A;  4J9H A;  2COY A;  3QII A;  2B86 A;  2BIV A;  5HKC A;  1Q95 G;  1UGV A;  4PJO A;  2YRV A;  1ABO A;  4OMF B;  3CCL T;  3TSW A;  4ORZ A;  1OV3 A;  1BIA A;  1UB4 A;  4MZP A;  1M1K C;  3RES A;  4M78 F;  1YHQ T;  3HRT A;  2DZ9 A;  2DEU A;  1VQP T;  1Q7Y R;  4IKF A;  3OYF A;  4HCC A;  3JB9 G;  2MYS A;  4PLI A;  2KBT A;  5CR2 A;  1WPY A;  3P8B B;  5GMK l;  1VQK T;  1TUD A;  3V7R A;  1QVF P;  1QVG S;  3OYL A;  1RLQ C;  1Z9Q A;  4FSX A;  1ZLM A;  3MJX A;  3BDL A;  1VQ5 Q;  1RAD B;  4LD6 A;  7AT1 B;  4F7U F;  3CCS A;  4EMH A;  3OYN A;  2L5Q A;  1P92 A;  2BTT A;  2QEX Q;  1T3S A;  2YUN A;  5DLO A;  4ESR A;  1VQM A;  3RNJ A;  4F7U A;  2X4X A;  3UF4 A;  2K3X A;  5FU7 B;  5GAO m;  1H3Z A;  2RF0 A;  1TTH B;  1SRL A;  1U1S A;  1K8A U;  3VYG A;  2A37 A;  3JCM c;  3CMA A;  2NYS A;  4C0F A;  2P0K A;  2FPD A;  4XTZ A;  1IZ6 A;  1X6B A;  2GF7 A;  1G8X A;  3BW1 A;  4C92 E;  2M0Y A;  4MZT A;  1M4Z A;  2JZ2 A;  4M7A E;  1QQJ A;  2HKN A;  3NGP A;  4A4G A;  1Y96 A;  2JOY A;  2MOX A;  4RKU E;  1UJ0 A;  2EYQ A;  3V7S A;  5GMK m;  3OYY A;  1D3B A;  4GLM A;  4A54 A;  1KHI A;  2CP3 A;  2V8K A;  3CPW P;  4JUV A;  2M51 A;  4R0K A;  3JCM b;  2CSQ A;  1WHL A;  4J9F A;  5LJ5 j;  1Y7X A;  2CH4 W;  4PFO A;  3IQL A;  2X4J A;  2KQW A;  3PVL A;  1NYG A;  1EX4 A;  1JO8 A;  1VQ5 A;  3H0I A;  1A0N B;  3E1S A;  1G3S A;  2IPO B;  4B9X A;  1K73 C;  1QVF S;  4C5E A;  2DO3 A;  4OMM A;  3OW2 A;  3G71 T;  2DPP B;  2PUK B;  1WHG A;  3RUX A;  1QCO A;  3OA6 A;  1D09 B;  1GCQ C;  2J6K A;  2V26 A;  1TS9 A;  2F2X A;  1VQ6 A;  2E10 A;  3VYH B;  2LC4 A;  2DET A;  3UDC A;  3FLG A;  2DKG A;  4JZ3 A;  1MUZ A;  5DY9 A;  1XNI A;  2RI2 A;  2PVO B;  3OYK A;  1VQ6 T;  4F7U G;  5GAN 7;  3A98 A;  4DBQ A;  2BE7 D;  1YFN A;  3OYH A;  3GF5 A;  1QCF A;  3L2R A;  1G2B A;  1D0X A;  3A8H B;  2AZV A;  2JW4 A;  2QAS A;  1QVF A;  2QA4 A;  3CC2 A;  4LE9 A;  2KI7 A;  2O4X A;  4BY6 C;  1GL5 A;  4NL3 A;  4E7Z A;  1FWZ A;  4XAX B;  2EQJ A;  2DFU A;  2GBQ A;  1FX7 A;  2XI9 A;  2F5K A;  4EMK B;  2LQK A;  2EAY A;  1RI0 A;  1PKT A;  1K1Z A;  1PG5 B;  1QP2 A;  3R6O A;  1PSF A;  2OX7 A;  2LDM A;  2DD4 A;  4A4E A;  4M78 D;  1QKW A;  3CCQ A;  2XK0 A;  4OB2 B;  2NUZ A;  2KT1 A;  2FRY A;  4OB3 B;  2YWW A;  1NPR A;  2LCS A;  1RI9 A;  1NZ9 A;  1ZUU A;  4QQ6 A;  5GAN 8;  1SPK A;  4A4K A;  3VV0 A;  5CCA A;  2J06 A;  2K5I A;  2JT4 A;  5J3B A;  1ZUY A;  3EAE A;  1K4U S;  3OY9 A;  4DBR A;  3OYI A;  2E5K A;  2LTO A;  3LH5 A;  3GNF B;  3CCE A;  2RQV A;  2X9H A;  1W70 A;  3NHN A;  2K2V A;  1SKU B;  1V1C A;  1ZHI A;  2R5M A;  3I35 A;  1VQN Q;  2EQM A;  3RKY A;  1RAI B;  2RQW A;  4M77 B;  1YJ9 A;  3CBP A;  1AT1 B;  2QQS A;  4CC4 B;  1OX9 A;  4PJO E;  5CQX A;  2RJE A;  4UC4 A;  2QQR A;  3QJY A;  1Q86 R;  5LL6 S;  5LJ5 f;  5A0L A;  2QDY B;  4RG8 A;  5GAN h;  2RPN A;  4LUE A;  3X28 B;  4V2S A;  4MDW A;  2X3W D;  4ZTF A;  2EIF A;  5GAN 2;  1SG5 A;  3C0C A;  3HL8 A;  2W10 A;  2RB6 A;  4HT9 A;  2M02 A;  1XJW B;  3VUB A;  3MEA A;  1N9R A;  5GAN d;  1PWT A;  5LJ3 h;  2P0Q A;  4MDX A;  1UJY A;  1K9A A;  1BB9 A;  2KT8 A;  3VS2 A;  4LXC A;  4X9C A;  2OTJ A;  1OYX A;  1UG1 A;  5CVI A;  1VQL T;  2FRW A;  2EJ9 A;  1N6A A;  2RK2 A;  3JCM g;  5IHK A;  2VB6 A;  3OYB A;  2DM1 A;  4D8K A;  4XQ3 A;  4Y92 A;  4J6W A;  2E1H A;  2DXB A;  2HD0 A;  1YJ9 Q;  1KFZ A;  4BUG A;  1SRM A;  4QVZ A;  4ZGE B;  2MIO A;  2ZPH B;  2X35 A;  4J83 A;  5IHI A;  5CAI A;  4IUP A;  3FC3 A;  2JS0 A;  1AZG B;  2RO0 A;  4XTX A;  2DL4 A;  1UE9 A;  1K0S A;  1UHF A;  2QQ9 A;  1I8F A;  4M77 A;  1VQ7 A;  4NL2 A;  3AHU A;  3X20 B;  3S3O A;  2OJ2 A;  3TEE A;  1RAG B;  2ZZD A;  5GAN 5;  1TSF A;  1GXI E;  3M0T A;  3L2W A;  3ER0 A;  3CCU T;  4M77 F;  1UHC A;  4XTY A;  1I0C A;  4RMO A;  3M53 A;  1X69 A;  1YJW A;  1UGP B;  1VQ8 Q;  2HEQ A;  4IUV A;  2VKN A;  8ATC B;  2QA4 T;  1WNL A;  3CC2 T;  4HCZ A;  2RHU A;  4RTY A;  1WIE A;  2OI3 A;  1LNX A;  1U06 A;  2KMT A;  3RKX A;  4E2F B;  4NOY A;  1V76 A;  2D1X A;  1HK9 A;  1X6G A;  4PFP A;  1ZA2 B;  1V29 B;  1R0B G;  4N0A A;  3S3N A;  1QLY A;  2M16 A;  4B6M A;  3G6E A;  3LH0 A;  3CCQ T;  2LT1 A;  5J39 A;  1SSF A;  4M75 D;  1X6O A;  1N8R R;  5HK3 A;  2PTK A;  2MI6 A;  4N4H A;  1HD3 A;  4HCB A;  3WVE B;  2HSE B;  3QDR B;  1UFF A;  1WFW A;  5D6W A;  3OBY A;  4PJM A;  3CXC A;  1JJ2 A;  1MMG A;  4E7S A;  3HFN A;  2K2M A;  2HAX A;  1VYV A;  2Y4Y A;  2K57 A;  2DYI A;  2B8A A;  4DOW A;  4E7I A;  2DJQ A;  1GBR A;  4M7A C;  3CPF A;  3UWN A;  1Y71 A;  2CZ6 B;  4OF1 A;  1XOV A;  1K0X A;  5GAO r;  1G5V A;  2GFU A;  1W2B A;  3VS4 A;  4J8O A;  4C92 B;  3DLL A;  5GAM h;  1AWW A;  1NBE B;  3PMI A;  3H9N A;  1M27 C;  4RCC A;  1ZX6 A;  3BY7 A;  2D8H A;  2ATC B;  1OU8 A;  5I2S A;  5HK0 A;  1JXO A;  2MAM A;  2QEX A;  4FYY B;  3VS0 A;  4J7I A;  4BI3 A;  1RAE B;  3UAT A;  5CKE A;  4BI4 A;  3GNG A;  2DE0 X;  2PQW A;  2RMO A;  1WX6 A;  3DB4 A;  1CSK A;  2PUO B;  2DIG A;  4AFS C;  1QMC A;  3LWI A;  2FG0 A;  4Z02 A;  5A0G A;  2CT4 A;  4ELY C;  2DTO A;  3JCM f;  1M8V A;  3O8V A;  4M75 F;  4FL6 A;  2DL3 A;  1T3L A;  2AT1 B;  2DVJ A;  1GBQ A;  2GCX A;  1KC8 U;  3JCM Q;  1H3H A;  2E41 A;  1VQ6 Q;  1QWF A;  3QZ9 B;  3VS5 A;  3WVD B;  2FO0 A;  3EG2 A;  1QVG P;  3CC4 Q;  1Y0M A;  4M78 A;  3QSU A;  4ATO A;  3JCM d;  5KCO A;  2FYK A;  2CP7 A;  4M7A G;  5HCK A;  2DX1 A;  3REB B;  1M3C A;  4J9E A;  2QAZ A;  1D1C A;  2COZ A;  4PJO F;  1NPP A;  3G4S A;  3V8J A;  2XG8 D;  3SWN C;  3JCM e;  4AFQ C;  5FRM A;  2KRO A;  2ZPE B;  3V8K A;  1D1B A;  4ZTJ A;  2VVK A;  1LOJ A;  3GLX A;  3G7Z A;  5LJ5 e;  4C5I A;  1OEB A;  1KD1 R;  1M9S A;  3OYM A;  2IVW A;  4OB1 B;  3TSZ A;  2KXD A;  1ZQ1 A;  1I1J A;  2CUB A;  1K8A R;  2EGC A;  1MV0 B;  3A8M B;  3RIR A;  3H6Z A;  5FLX E;  4ZN1 A;  5IXF A;  2ROT A;  3JB9 H;  3PIO A;  2EPD A;  1ZSZ C;  1N27 A;  3QG1 A;  3TVT A;  3BFM A;  2O2O A;  1WXT A;  1T0J A;  2NUT B;  2GGR A;  3KBG A;  1MND A;  1OPL A;  4RUG A;  5GAN j;  1R8O B;  5KYW A;  5FW9 A;  3NTK A;  3G6E T;  2Y90 A;  1K9M R;  1Z9Z A;  1WHM A;  3KFV A;  1C1A A;  2RA2 A;  4XTW A;  2DLP A;  3M0Q A;  2MCN A;  4BDZ A;  1YHQ A;  2EBP A;  2LCC A;  1PC0 A;  4M75 A;  3F70 A;  1YIJ Q;  1Q81 C;  1RAH B;  1ZA1 B;  4C92 A;  4F7U B;  4RTU A;  3HFO A;  1S1N A;  4M7A B;  2C06 A;  1VIF A;  3L2V A;  1WLP B;  3EFO A;  2EKH A;  4PJO B;  3VUZ A;  1JB0 E;  2FZK B;  4LDX A;  1LVK A;  2ZGW A;  1VQL A;  2MMP A;  3SWN B;  3GPL A;  3CCJ Q;  2RNA A;  3DLM A;  1N5Z A;  4BD3 A;  1PHT A;  4AG1 C;  1AWX A;  1WJQ A;  2FPE A;  1OOT A;  1WXU A;  2ABL A;  1WI7 A;  1AWJ A;  5GAN 6;  3EGU A;  3CMA Q;  3QYH B;  3ZEH A;  1YJN Q;  3C94 A;  2PVD B;  2RD1 A;  1WJR A;  5C0M A;  2LJ0 A;  3G71 A;  1U1T A;  3P8H A;  3I56 Q;  3CD6 T;  4RTW A;  2DBM A;  1KD1 C;  3M0U A;  1PM3 A;  2R5A A;  4JS4 A;  4JJD A;  1CKA A;  4WCI A;  1UGS B;  2NUT A;  2DA9 A;  5CKD A;  3OS0 A;  3PIP A;  5LJ5 d;  1OPK A;  2DF6 A;  2QTX A;  1G3Y A;  2OTL Q;  2EYX A;  2K5F A;  1SHF A;  4C92 G;  5KYN A;  1RLP C;  2HKQ B;  1YCY A;  1M90 U;  3RDV A;  2LX9 A;  3E2U A;  3Q1J A;  1PD0 A;  4PKC C;  2CZ1 B;  2JM8 A;  4R56 A;  2V8J A;  1B34 A;  2D8J A;  3QO3 A;  2XHC A;  4M7D E;  3RMQ A;  3PTA A;  2AK5 A;  3L2U A;  3SHW A;  2EQI A;  1N8R C;  2OTJ T;  2VAS A;  3I9Q A;  5I22 A;  5D6X A;  2KRM A;  1X2K A;  3LYI A;  3FEO A;  3OS2 A;  3MPU B;  1BBZ A;  3VS1 A;  3CXC S;  5KYY B;  1WQW A;  1TUG B;  4PJL A;  1UGQ B;  1KQS A;  3MO8 A;  5FU6 B;  2QG9 B;  4C8Q F;  4FT2 A;  3DB3 A;  1Q7Y U;  1IHW A;  1BCM A;  1ACM B;  1M3B A;  1IRE B;  1Q86 U;  2AKK A;  1IB8 A;  3URG A;  3PE0 A;  1W1F A;  2JTF A;  3SDZ A;  2A08 A;  5KYU A;  3HSB A;  2CDT A;  3J81 E;  2ECZ A;  2G6F X;  2W0Z A;  3FJP A;  4KUD K;  2LNH B;  2EYW A;  4FCY A;  1BI2 A;  3SD4 A;  1KJW A;  1M1K R;  3EG9 B;  2DL5 A;  2K3Y A;  1K73 U;  1OZ3 A;  2J7I A;  3JCM J;  1AOJ A;  3ZFJ A;  4AFZ C;  4PK4 A;  2KRN A;  3HRS A;  4E7K A;  2CKK A;  3CCU A;  4MML A;  3M55 A;  3H8Z A;  1QW1 A;  4OMP A;  1MMN A;  2XIC A;  2KVQ G;  3P8D A;  1OU9 A;  4QKU A;  2JTE A;  1VQ9 Q;  2QXF A;  4WTO B;  3NTH A;  2KR3 A;  3ME9 A;  4LN2 A;  2MWO A;  3PMT A;  1VQ4 A;  4ZGD B;  3GP8 A;  1QVG A;  2AZS A;  4EMK A;  2CH4 A;  4J6X A;  1EFN A;  2DRM A;  3A8G B;  2CSI A;  1NJI U;  4M78 G;  1VQK Q;  2L0A A;  1I5O B;  4C92 D;  3VS6 A;  4E6R A;  4A63 B;  5GAM g;  1QWE A;  4LDW A;  1VQO T;  2YDL A;  1ZSG A;  1WHH A;  3OMC A;  2F2V A;  1SHG A;  3CCV Q;  2XD0 A;  2FB7 A;  2RH2 A;  2DAQ A;  2DXT A;  4M7D G;  1RAA B;  3WXM B;  2F5T X;  3EGD A;  5IT9 E;  3CPW A;  2WSC E;  2YSQ A;  4FU6 A;  1UGR B;  1UEB A;  1MNE A;  3C12 A;  1VA7 A;  4C92 C;  4O5V A;  3LGF A;  1UUE A;  2RHZ A;  3VU3 C;  4KGV B;  2AKL A;  4FT4 A;  5GAO q;  2ED1 A;  2VGM A;  1YNZ A;  3QHS A;  4M75 E;  5AT1 B;  3G4S T;  4BE0 A;  3A1P A;  4QVD A;  3LLR A;  4EPC A;  2YXY A;  2HL5 C;  2MF2 A;  5FRO A;  3QWY A;  3TU4 K;  2KK4 A;  4IUQ A;  4F17 A;  1K9M C;  3JCM V;  2ZPF B;  1X43 A;  5FWC A;  4DEY A;  1ZSZ A;  4Z8A A;  3M0S A;  3V8L A;  4X9D A;  1Y57 A;  2K6D A;  1PRL C;  2V1Q A;  2YLB A;  3CPW S;  1O9S A;  2FPF A;  3S3M A;  4GBQ A;  3EFR A;  1VQK A;  2LMJ A;  2V8I A;  4PLL A;  2JXB A;  2VWF A;  3PFS A;  4X34 A;  3EGD B;  2DL7 A;  3CC7 T;  3PT9 A;  1UTI A;  4J6Y A;  3G6E Q;  1S72 A;  2D0Q B;  1GFD A;  2E3I A;  3X26 B;  2XMF A;  1VYT A;  1WA7 A;  4BE1 A;  4R55 A;  3CCS T;  4A4F A;  2YRD A;  1TOV A;  3OYG A;  2NLU A;  5LJ3 j;  3G71 Q;  3JB9 D;  9ATC B;  1I5L A;  2O9S A;  4C0Z A;  3H41 A;  2ZCF B;  2KAF A;  2HDA A;  3INZ A;  4J5Y A;  3QDF A;  1VYU A;  4JJB A;  1XTD A;  3M5A A;  3GIB A;  4M78 C;  3AT1 B;  4N4G A;  2O4X B;  1IO6 A;  3RER A;  1HJD A;  2FL7 A;  2K5L A;  3OYC A;  3OQ5 A;  4M7D F;  2VC8 A;  3CME A;  1YI2 T;  5IN1 A;  4LNP A;  4M78 E;  3M9Q A;  1K9M U;  3OYA A;  3CCJ T;  1B7T A;  2E6N A;  1JRI A;  3TCJ A;  2E64 A;  2JVV A;  2O01 E;  5CK9 A;  2BZ8 A;  4L59 A;  3SFM A;  4JZ4 A;  2CZ0 B;  4Q5W A;  3C95 A;  4Z89 A;  4GY5 A;  5GAM d;  3X24 B;  2HBP A;  3J7A F;  1XQH A;  3L1A A;  2HBW A;  3CCM A;  2LZ6 B;  1YJN T;  2RJF A;  3EGX B;  2O31 A;  4KGZ B;  4IIM A;  3CD6 Q;  1VQ4 T;  1BK2 A;  2EGA A;  2LCL A;  3CBM A;  4XU3 A;  3L2Z A;  4O6J A;  3QBY A;  1JEG A;  2RI5 A;  4WF2 A;  4Y91 A;  3EHQ A;  2GFA A;  1VQM Q;  3BE3 A;  1M30 A;  2VXF A;  2YT6 A;  5C6S A;  5D6Y A;  1TU0 B;  4X1V A;  1X01 A;  2OTL T;  2K4Y A;  4LDY A;  3CXC P;  1NE8 A;  2LQ8 A;  1Y96 B;  4OMO A;  2PZ1 A;  4TVR A;  2DD5 A;  3VRZ A;  2EYY A;  1VOM A;  4RTV A;  1H92 A;  1WZO A;  1PSE A;  3CCE T;  2DZC A;  2RJC A;  4OMN A;  2JMA A;  2EJF A;  4C0D C;  1W4S A;  2CGH A;  2HCK A;  2FZC B;  1BU1 A;  2OTJ Q;  5CKF A;  2VGN A;  2KY9 A;  4E47 A;  3T9N A;  4PJJ A;  4M7D B;  2L3Q A;  3CCL Q;  2HNI A;  2D9T A;  2RQR A;  1VQN A;  5LJ3 d;  4HVV A;  3KXT A;  2JM9 A;  1B34 B;  3JB9 F;  3JRZ A;  3CQT A;  3HTR A;  1YHQ Q;  4BY6 B;  3MEV A;  5KCH A;  2RQT A;  1VQP Q;  2EYZ A;  3U23 A;  1GRI A;  3EG1 A;  4CRI A;  5LJ3 e;  4AFU C;  5IH2 A;  5J26 A;  3EFO B;  2GQI A;  5CQY A;  2VV5 A;  5A2Q E;  4LDV A;  3CCM Q;  5KYY A;  3M56 A;  1VQ5 T;  1M2V B;  1KD1 U;  5KE3 A;  4AG2 C;  4CC7 A;  2C0O A;  1Q7Y C;  2HZY A;  2CP2 A;  3FB9 A;  2YHT A;  5GJV B;  2KNB B;  5FU6 C;  4HVU A;  3FIF A;  3FRN A;  1VQL Q;  2KSS A;  1QCN A;  2P4R A;  1OI1 A;  1B3Q A;  2E12 A;  2LRQ A;  3LGL A;  5FU7 C;  2DIL A;  5GAM j;  3UA7 A;  4PNO A;  3QJ6 A;  4DOV A;  3NMZ C;  1TXQ A;  4M77 E;  3OW2 P;  1BCO A;  3L42 A;  4M7D D;  3M59 A;  3RMS A;  1EZZ B;  3OSV A;  2ED0 A;  3OYD A;  3BDU A;  4QVC A;  4M78 B;  1I07 A;  1VQ9 T;  4OGC A;  2KE9 A;  4NS5 A;  2OAU A;  1Q81 R;  4A4H A;  2KGT A;  5GAN e;  3CD6 A;  3CCU Q;  2XID A;  2DMO A;  3CC4 A;  4M7D C;  4KH0 B;  1BIB A;  1IHV A;  3MEU A;  1X75 C;  1NLO C;  1T0H A;  2DTI A;  2LJ3 A;  1S72 Q;  3SEM A;  1VQ8 T;  1W6X A;  2A3L A;  2EVR A;  4M77 G;  5CKH A;  2FHD A;  1MHN A;  1NEB A;  1WGS A;  3UT1 A;  1VQO Q;  4PJN A;  2MK5 A;  2O9V A;  1OQK A;  2BUD A;  5CKB A;  2XKO C;  3CCV T;  4PJO D;  4QT7 A;  1UDL A;  2F1L A;  1ARK A;  4II1 A;  2JS2 A;  5I21 A;  4E7J A;  3HPW A;  2L89 A;  4M7A D;  4C8Q B;  2WAC A;  4ME7 A;  3MCA B;  1RAC B;  4BAC A;  2WSF E;  2X4W A;  2E6Z A;  3PVQ A;  1FMK A;  2P4T A;  1IRX A;  2GTO A;  2A0F B;  1WDX A;  3KUF A;  2PNI A;  4JRQ A;  2EFI A;  1WJS A;  2ZAE A;  5KYX B;  3M0R A;  3G4S Q;  3OS5 A;  2PU9 B;  1KIK A;  2RM4 A;  1M1K U;  2ENM A;  3TQ7 P;  3CEY A;  4AT1 B;  3ZL7 C;  3EG3 A;  2D0N A;  4KH1 B;  5L8R E;  4XU0 A;  3TRE A;  2ZPI B;  3C4S A;  2KDS A;  3GBQ A;  2R58 A;  1YCS B;  2L3S A;  4C0D B;  2K79 A;  2GQV A;  5GMK e;  5GAN f;  2QK0 A;  4GLK A;  5A0D A;  1JJ2 P;  4J9C A;  4E7L A;  3CCR T;  1KHC A;  1K76 A;  3ZBD A;  4FM4 B;  4XK8 E;  3JCM W;  1DJ7 B;  3EG0 A;  3M0P A;  5IAY A;  1TUC A;  3E9G A;  3UPU A;  2DK3 A;  4D8D A;  2SRC A;  1FXX A;  4C5H A;  5GAM e;  3CCS Q;  2DTH A;  1LCK A;  2FEI A;  4KUL A;  1TH7 A;  3EHR A;  2XU8 A;  2M1H A;  4F14 A;  2CP5 A;  2H3E B;  2CRE A;  3SWN A;  2EWN A;  1KK7 A;  3X25 B;  1VUB A;  4BE2 A;  5GAM f;  2J05 A;  2JUF A;  5D7U A;  1VQP A;  1IXD A;  3FJ5 A;  2NUP B;  2CZ7 B;  4J9D A;  2H3J A;  2DXU A;  1YI2 Q;  1YJW Q;  4M75 G;  1O75 A;  1ZUK A;  3VS3 A;  1SSH A;  1Q81 U;  2E3H A;  1D1A A;  2CS7 A;  1LPL A;  1OUL A;  5FRN A;  2QQA A;  1NYF A;  2LQN A;  4RTT A;  1F1B B;  4PFZ A;  3CCJ A;  3QWX X;  3M4G A;  3MEW A;  1AEY A;  3R6N A;  2X3X D;  4RCB A;  3M54 A;  4QQG A;  2L2P A;  2ROL A;  1NJI C;  4Y28 E;  4RTX A;  1RUW A;  3A5Z B;  1AD5 A;  2DL8 A;  1E6G A;  4HXJ A;  3UA6 A;  5LJ3 g;  4PJO G;  1BI0 A;  1QVP A;  1VQ4 Q;  3H0F A;  3QYG B;  1TWB A;  4XU1 A;  2CP0 A;  3A8L B;  4BI8 B;  4J9B A;  1HXD A;  2CP6 A;  3S6W A;  4CI0 C;  1VQM T;  1WYX A;  2LVM A;  3GOX A;  3JB9 J;  5AYF A;  4J9G A;  1OX8 A;  2F69 A;  4HVW A;  4N0A C;  4FW2 A;  1SEM A;  4OB0 B;  4XTU A;  1NG2 A;  2NUP A;  2BZX A;  1IGQ A;  1M3A A;  5GAO p;  4KT0 E;  3EH1 A;  1M5Q 1;  3H0H A;  1VQ8 A;  1PKS A;  1YJ9 T;  4C8Q C;  2X51 A;  3E9F A;  4M77 D;  1QP3 A;  5KYX A;  1RAB B;  2A28 A;  3RR6 A;  4OMQ A;  4M7A A;  3QKJ A;  3EGX A;  3CBO A;  1M90 C;  5GJW B;  1YN8 A;  4JDS A;  2DER A;  1VQ7 T;  2JNG A;  1YIJ T;  2BE9 B;  1H8K A;  2KEA A;  2HQE A;  2LNV A;  4OVA A;  3HKS A;  2Y4X A;  1N8R U;  3D7S B;  4F7U E;  1D0Y A;  2QA4 Q;  4FW1 A;  3CC2 Q;  3MP8 A;  3MP1 A;  2HQX A;  2MPX C;  5LJ5 g;  4JJN K;  1BYM A;  1PD1 A;  3OW2 S;  4PL6 A;  3CCM T;  1MMA A;  2RI3 A;  1MGQ A;  5IHN A; 
#chains in the Genus database with same CATH homology
 5KCO A;  1EIF A;  3OYN A;  2FYK A;  4L59 A;  2L5Q A;  3SFM A;  2AHJ B;  1P92 A;  5HY6 A;  4M7A G;  3JSC A;  3J80 E;  1BKB A;  1M1G A;  2CZ0 B;  4Q5W A;  5DLO A;  5LJ5 h;  1Q82 U;  2JTM A;  2X4Y A;  3C95 A;  3SB2 A;  4GY5 A;  5GAM d;  4PJO F;  3X24 B;  2HBP A;  4F7U A;  5GAO n;  1VQM A;  3J7A F;  2X4X A;  1NPP A;  3G4S A;  1XQH A;  2K3X A;  3L1A A;  5FU7 B;  2XG8 D;  4JRK A;  3V8J A;  4C5G A;  5GAO m;  3CCM A;  1H3Z A;  1YJN T;  3SWN C;  3JCM e;  2RJF A;  5FRM A;  2MWP A;  2ZPE B;  1U1S A;  5M9O A;  1K8A U;  3V8K A;  3VYG A;  3CMA A;  2G3R A;  3JCM c;  1RL2 A;  4C0F A;  4ZTJ A;  2P0K A;  1LOJ A;  3GLX A;  3G7Z A;  5LJ5 e;  1VQ4 T;  2LCL A;  3CBM A;  3L2Z A;  4QW2 A;  4O6J A;  2EQU A;  3QBY A;  4XTZ A;  4XU3 A;  2RI5 A;  1IZ6 A;  1M9S A;  3M58 A;  3OYM A;  2IVW A;  2GF7 A;  4OB1 B;  4WF2 A;  4Y91 A;  1KQ1 A;  3I55 A;  2GFA A;  3BW1 A;  3HP9 A;  4C92 E;  4MZT A;  1ZQ1 A;  3VKI A;  2VXF A;  3DKM A;  1M4Z A;  2JZ2 A;  5EG2 A;  4E7H A;  4M7A E;  2RHX A;  5C6S A;  5D6Y A;  3QPH A;  4VUB A;  2XDB A;  1X01 A;  2OTL T;  2K4Y A;  3A8M B;  3RIR A;  4LDY A;  4A4G A;  3H6Z A;  1Y96 A;  4IUR A;  2JOY A;  4RKU E;  4YTL A;  3CME T;  1YI2 A;  2EYQ A;  5FLX E;  3V7S A;  4ZN1 A;  5GMK m;  1NE8 A;  2LQ8 A;  3OYY A;  1D3B A;  3JB9 H;  1Y96 B;  4M75 C;  4A54 A;  3PIO A;  1KHI A;  4XTV A;  1N27 A;  2V8K A;  3LWH A;  3QG1 A;  3BFM A;  4C5I A;  1YIT T;  4JUV A;  4TVR A;  2DD5 A;  2EKO A;  3JCM b;  1S72 T;  1KG1 A;  5LJ5 j;  1Y7X A;  4PJO C;  1PSE A;  3CCE T;  3KBG A;  2DZC A;  2L8D A;  2RJC A;  2X4J A;  3LX7 A;  3JB9 I;  3V7C A;  5GAN j;  1R8O B;  2KQW A;  2EJF A;  4C0D C;  1W4S A;  2CGH A;  3NTK A;  3G6E T;  5CKF A;  2Y90 A;  2VGN A;  3RKW A;  1VQ5 A;  1U8R A;  2KY9 A;  3E1S A;  1G3S A;  3MET A;  4E47 A;  2RA2 A;  4B9X A;  1K73 C;  1QVF S;  4C5E A;  2VYT A;  4XTW A;  2FVU A;  3T9N A;  4BDZ A;  1YHQ A;  4M7D B;  2DO3 A;  2HNI A;  3OW2 A;  2LCC A;  2D9T A;  4HA8 A;  3CCV A;  2LT4 A;  2DIQ A;  1KQ2 A;  1KQS S;  1VQN A;  4L6V 5;  4M75 A;  3F70 A;  5LJ3 d;  3G71 T;  3OS1 A;  1Q82 C;  2DPP B;  2PUK B;  4HKE A;  3KXT A;  3RUX A;  1Q81 C;  1B34 B;  3OA6 A;  3JRZ A;  3JB9 F;  4C92 A;  4F7U B;  4BY6 B;  3MEV A;  3HFO A;  2CYZ B;  5KCH A;  4QQD A;  4EMG A;  3NFC A;  2D6F A;  4M7A B;  4B9W A;  1VQ6 A;  2E10 A;  2C06 A;  1VIF A;  3L2V A;  4LDU A;  3VYH B;  2LC4 A;  4PJO B;  3UDC A;  4CRI A;  5LJ3 e;  3FLG A;  2DKG A;  3VUZ A;  3A8O B;  5J26 A;  1JB0 E;  4DQ2 A;  4LDX A;  5DY9 A;  1XNI A;  2RI2 A;  2PVG B;  2ZGW A;  4IUT A;  2PVO B;  3OYK A;  1BI1 A;  1QVG A;  1VQL A;  1VQ6 T;  2MMP A;  4F7U G;  5CQY A;  5GAN 7;  2VV5 A;  5A2Q E;  4LDV A;  3SWN B;  3GPL A;  1D3B B;  3OYH A;  3DLM A;  3M56 A;  1OZ2 A;  1VQ5 T;  4M7A F;  4BB7 A;  4BD3 A;  2IG0 A;  5KE3 A;  3CC4 T;  1KD1 U;  1I81 A;  3GF5 A;  3L2R A;  3JCM X;  2DEQ A;  3A8H B;  3FB9 A;  1Q7Y C;  1WJQ A;  2YHT A;  1KC8 C;  1LJO A;  5FU6 C;  1QVF A;  3PNW C;  5KH6 A;  2QA4 A;  3CC2 A;  3FIF A;  2QEX T;  3FRN A;  4XU2 A;  2O4X A;  5GAN 6;  2KSS A;  3QZ5 B;  4BY6 C;  2VXE A;  4NL3 A;  2R57 A;  3QYH B;  4L5G A;  1FWZ A;  1OI1 A;  2EQJ A;  4XAX B;  3VJP A;  3ZEH A;  2E12 A;  2LRQ A;  2PVD B;  1WJR A;  2RD1 A;  3C94 A;  3LGL A;  5FU7 C;  1BI3 A;  5C0M A;  1FX7 A;  4P5N A;  2XI9 A;  5GAM j;  1AHJ B;  4PNO A;  3G71 A;  1U1T A;  3P8H A;  5KE2 A;  2F5K A;  3CCR A;  2M0O A;  3QJ6 A;  4EMK B;  2XDD A;  4DOV A;  2LQK A;  3CD6 T;  2EAY A;  3MP6 A;  1RI0 A;  2DVE A;  2QQB A;  3NTI A;  1KD1 C;  4M77 E;  1QP2 A;  2R5A A;  3L42 A;  4ELZ C;  4JS4 A;  3R6O A;  4M7D D;  1PSF A;  3M59 A;  3RMS A;  3JCM h;  2LDM A;  3OBW A;  4A53 A;  2DD4 A;  1WQ7 A;  1UGS B;  4A4E A;  2L3R A;  4M78 D;  3OSV A;  3CCQ A;  2XK0 A;  4OB2 B;  5CKD A;  3OS0 A;  3PIP A;  3BDU A;  3OYD A;  2E5Q A;  3FDR A;  1VIE A;  4QVC A;  4M78 B;  4OB3 B;  5LJ5 d;  1NPR A;  2QTX A;  4OGC A;  1VQ9 T;  1G3Y A;  2DJZ A;  2RK1 A;  1NZ9 A;  2K5F A;  4QQ6 A;  2E70 A;  3OSS C;  4C92 G;  4NS5 A;  5GAN 8;  2OAU A;  4A4H A;  5GAN e;  1YCY A;  3M4Y A;  1M90 U;  3CD6 A;  4A4K A;  1G3W A;  3VV0 A;  2XID A;  2LX9 A;  5CCA A;  3CC4 A;  1ZBX A;  4DA4 A;  2K5I A;  4J7F A;  4M7D C;  1BIB A;  5J3B A;  5GMK h;  1JJ2 S;  3MEU A;  1X75 C;  1Y07 A;  3Q1J A;  4JS5 A;  2DTI A;  3EAE A;  4PKC C;  2CZ1 B;  3ASK A;  1VQ8 T;  3OY9 A;  2A3L A;  4M77 G;  4R56 A;  3OYI A;  5CKH A;  2V8J A;  2FHD A;  1B34 A;  1MHN A;  2LTO A;  3GNF B;  1VQ9 A;  1WGS A;  3CCE A;  3QO3 A;  3UT1 A;  2XHC A;  4M7D E;  2K2V A;  3RMQ A;  3PTA A;  5DM7 R;  2VUB A;  1K8A C;  4C0G A;  3L2U A;  1N8R C;  2OTJ T;  1YJW T;  2BUD A;  1ZHI A;  2R5M A;  5CKB A;  2M9U A;  2XKO C;  5D6X A;  3CCV T;  4PJO D;  2EQM A;  3RKY A;  4C8Q E;  2BKD N;  3LYI A;  3FEO A;  4II1 A;  5I21 A;  3HPW A;  2L89 A;  3OS2 A;  4M77 B;  4C8Q B;  4E7J A;  4M7A D;  2WAC A;  4ME7 A;  3MCA B;  4EDU A;  3CXC S;  1YJ9 A;  3CBP A;  4BAC A;  3HHT B;  2WSF E;  2QQS A;  4KBM B;  2X4W A;  4PJO E;  1WQW A;  5CQX A;  2RJE A;  2E6Z A;  4UC4 A;  2QQR A;  3QJY A;  1UGQ B;  4ZGJ B;  5LL6 S;  2P4T A;  5LJ5 f;  1KQS A;  3M57 A;  2QDY B;  5A0L A;  3KUF A;  3MO8 A;  5FU6 B;  4RG8 A;  5GAN h;  2EFI A;  4JRQ A;  2DXC A;  1WJS A;  4FT2 A;  4C8Q F;  3DB3 A;  3X28 B;  4V2S A;  3OS5 A;  4MDW A;  4ZTF A;  2RJD A;  2EIF A;  1Q7Y U;  2PU9 B;  5GAN 2;  5GMK i;  2RM4 A;  3HL8 A;  1M1K U;  2RB6 A;  4HT9 A;  4M75 B;  3VUB A;  1G3T A;  3EFS A;  1IRE B;  2YLC A;  3CEY A;  3MEA A;  1YIT A;  1Q86 U;  1N9R A;  3URG A;  5GAN d;  5LJ3 h;  5L8R E;  4XU0 A;  2JTF A;  3SDZ A;  2EQK A;  2P0Q A;  3TRE A;  3HSB A;  4MDX A;  5GAN g;  2ZPI B;  5I2M A;  3J81 E;  3C4S A;  2KDS A;  4M7D A;  2R58 A;  5GAN 3;  4X9C A;  2OTJ A;  3FJP A;  1OYX A;  2E65 A;  5CVI A;  4C0D B;  5GAN 4;  4KUD K;  2GQV A;  4C8Q D;  4LD9 K;  5GMK e;  4JLI A;  5GAN f;  1VQL T;  1BI2 A;  3SD4 A;  4GLK A;  5A0D A;  2EJ9 A;  1N6A A;  2WSE E;  3L2Q A;  3I56 A;  2RK2 A;  4E7L A;  2K3Y A;  3CCR T;  1K73 U;  3CMA T;  3JCM g;  1KHC A;  2EJG A;  1OZ3 A;  4XQ3 A;  3OYB A;  3ZBD A;  4FM4 B;  4J6W A;  4XK8 E;  4KUI A;  3JCM J;  2E1H A;  3ZFJ A;  1YJN A;  2DXB A;  2HD0 A;  3LW5 E;  3JCM W;  4BUG A;  1DJ7 B;  5IAY A;  4QVZ A;  4ZGE B;  3JAM E;  3I56 T;  1YBY A;  3E9G A;  2ZPH B;  3HRS A;  2X35 A;  3UPU A;  4E7K A;  2CKK A;  3CCU A;  4MML A;  4OGE A;  2DK3 A;  4J83 A;  3M55 A;  3H8Z A;  1QW1 A;  5CAI A;  4IUP A;  1FXX A;  3FC3 A;  4XTX A;  2RO0 A;  2JN0 A;  3CCL A;  4C5H A;  2XIC A;  4C92 F;  2KVQ G;  5GAM e;  3P8D A;  2QQ9 A;  4FIB A;  1I8F A;  2DTH A;  4M77 A;  3JCM P;  2QXF A;  3OMG A;  4KUL A;  1VQ7 A;  1TH7 A;  3NTH A;  4NL2 A;  3AHU A;  3X20 B;  3S3O A;  3TEE A;  2XU8 A;  2ZZD A;  5GAN 5;  2M1H A;  2P0P A;  1GXI E;  3ME9 A;  1H64 1;  3SWN A;  2ZPB B;  2EWN A;  2MWO A;  3PMT A;  1VQ4 A;  4ZGD B;  3L2W A;  3GP8 A;  3ER0 A;  3X25 B;  4M77 F;  4MZM A;  4EMK A;  3CCU T;  4XTY A;  1VUB A;  4J6X A;  4JLG A;  3A8G B;  4BE2 A;  4M77 C;  5GAM f;  1VQO A;  4RMO A;  1NJI U;  3M53 A;  1YJW A;  4IUU A;  4M78 G;  1UGP B;  3OYJ A;  2JUF A;  4IUV A;  2QA4 T;  3QXE B;  1WNL A;  4C92 D;  3CC2 T;  2OTL A;  1VQP A;  4HCZ A;  2RHU A;  5GAM g;  2CZ7 B;  2H3J A;  4LDW A;  1VQO T;  5DLQ E;  1LNX A;  5CIU A;  2DXU A;  2KMT A;  3RKX A;  1YIJ A;  4M75 G;  1O75 A;  3OMC A;  4NOY A;  1Q81 U;  2XD0 A;  2FB7 A;  1VQN T;  4HT8 A;  5GAO l;  1HK9 A;  2CS7 A;  2RH2 A;  5FRN A;  2DAQ A;  2DXT A;  4M7D G;  2QQA A;  1V29 B;  3WXM B;  2F5T X;  5IT9 E;  4N4I A;  3CPW A;  2WSC E;  4FU6 A;  1UGR B;  1UEB A;  4N0A A;  3CCJ A;  3S3N A;  3C12 A;  3M4G A;  3MEW A;  4EMK C;  3PGG A;  4C92 C;  3OB9 A;  4O5V A;  3LGF A;  2M16 A;  2RHZ A;  2QI2 A;  3OYE A;  3G6E A;  3LH0 A;  4RCB A;  3M54 A;  5LJ3 f;  4QQG A;  3VU3 C;  4C8Q G;  5GMK j;  3MHX A;  3I55 T;  3CCQ T;  3N5B B;  1NJI C;  4Y28 E;  2LT1 A;  5J39 A;  1SSF A;  2A7Y A;  4M75 D;  3A5Z B;  1X6O A;  4FT4 A;  5HK3 A;  1I4K 1;  2MI6 A;  4N4H A;  5GAO q;  4HCB A;  3WVE B;  5LJ3 g;  2VGM A;  4PJO G;  3QDR B;  1BI0 A;  3CC7 A;  3QHS A;  4M75 E;  3G4S T;  4BE0 A;  1M1F A;  1QVP A;  5D6W A;  3OBY A;  4QVD A;  3LLR A;  3QYG B;  4JRI A;  4BDY A;  4EPC A;  3CXC A;  4XU1 A;  4OP0 A;  1JJ2 A;  3A8L B;  4BI8 B;  3HFN A;  1HXD A;  2HAX A;  2Y4Y A;  2MF2 A;  2K57 A;  5FRO A;  3HRU A;  4RG2 A;  3S6W A;  2B8A A;  4D6W A;  4DOW A;  4E7I A;  3TU4 K;  2KK4 A;  4IUQ A;  4CI0 C;  1VQM T;  1K9M C;  3JCM V;  4M7A C;  3E19 A;  3CPF A;  3UWN A;  1Y71 A;  2LVM A;  2CZ6 B;  3GOX A;  3JB9 J;  5AYF A;  4OF1 A;  1JBM A;  2ZPF B;  1XOV A;  2F69 A;  2RHI A;  5GAO r;  1G5V A;  2GFU A;  4N0A C;  1W2B A;  4OB0 B;  4C8Q A;  3V8L A;  2I2L A;  4X9D A;  4XTU A;  4J8O A;  4C92 B;  3DLL A;  5GAM h;  4ZN3 A;  3QUI A;  2ZPG B;  1W2B S;  1Q86 C;  3PMI A;  2YLB A;  3CPW S;  2RHY A;  1O9S A;  5GAO p;  4KT0 E;  4RCC A;  1M5Q 1;  3S3M A;  3EFR A;  1VQ8 A;  1VQK A;  5CO7 A;  4JRP A;  2V8I A;  3BY7 A;  1YJ9 T;  4C8Q C;  3E9F A;  4M77 D;  1QP3 A;  4PLL A;  1N9S A;  3PFS A;  4X34 A;  5I2S A;  3CC7 T;  5HK0 A;  3PT9 A;  4J6Y A;  2MAM A;  2XDP A;  4MMK A;  1S72 A;  4M7A A;  2D0Q B;  2QEX A;  3QKJ A;  3X26 B;  3QII A;  2BIV A;  5HKC A;  4J7I A;  4BI3 A;  4BE1 A;  4PJO A;  3CBO A;  1M90 C;  2YRV A;  4R55 A;  4OMF B;  3CCS T;  5CKE A;  3CCL T;  4A4F A;  4BI4 A;  4JDS A;  3GNG A;  2PQW A;  3OYG A;  2NLU A;  3DB4 A;  1BIA A;  1UB4 A;  2PUO B;  2DIG A;  4MZP A;  2JNG A;  5LJ3 j;  1VQ7 T;  1YIJ T;  1M1K C;  3JB9 D;  3RES A;  1I5L A;  3LWI A;  4M78 F;  1YHQ T;  3HRT A;  4Z02 A;  4C0Z A;  2DZ9 A;  2ZCF B;  5A0G A;  2HQE A;  2LNV A;  2KAF A;  3INZ A;  4J5Y A;  3JCM d;  1VQP T;  4ELY C;  4IKF A;  3OYF A;  4OVA A;  3HKS A;  2Y4X A;  1N8R U;  2DTO A;  3JCM f;  4F7U E;  1XTD A;  3M5A A;  4HCC A;  3JB9 G;  3GIB A;  4M78 C;  4PLI A;  5CR2 A;  1M8V A;  1WPY A;  3O8V A;  3P8B B;  4M75 F;  4FL6 A;  3V7R A;  4N4G A;  5GMK l;  1QVG S;  1VQK T;  3MP8 A;  2O4X B;  3OYL A;  3MP1 A;  2GCX A;  1KC8 U;  3JCM Q;  2FL7 A;  2HQX A;  3RER A;  5LJ5 g;  4JJN K;  1BYM A;  2E41 A;  2K5L A;  3OYC A;  3OQ5 A;  4M7D F;  2VC8 A;  3CME A;  4FSX A;  1YI2 T;  3QZ9 B;  5IN1 A;  3OW2 S;  4PL6 A;  4M78 E;  3M9Q A;  3WVD B;  3CCM T;  1K9M U;  3OYA A;  3CCJ T;  3BDL A;  2RI3 A;  2E6N A;  1JRI A;  3TCJ A;  2E64 A;  1MGQ A;  2JVV A;  4M78 A;  4LD6 A;  2O01 E;  3QSU A;  4F7U F;  5CK9 A;  3CCS A;  4ATO A;  4EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...