1G5VA

Solution structure of the tudor domain of the human smn protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SURVIVAL MOTOR NEURON PROTEIN 1
publication title SMN tudor domain structure and its interaction with the Sm proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g5vA00
3PMIA 3H8ZA 4IURA 2R57A 2LDMA 3UWNA 1OYXA 3L2QA 3PMTA 4N4IA 3L2WA 3OYNA 4PLLA 2GFUA 3NTIA 4E7KA 3MP8A 4IUQA 2EKOA 1N27A 2K3XA 4N4HA 3EAEA 3LGFA 3OYFA 2X4YA 2RHZA 4E7HA 2XK0A 2R5MA 4BACA 2O4XB 4QVZA 4LD6A 3OMCA 1OI1A 4IUPA 3NTKA 4IUUA 3OYLA 5FROA 3S6WA 2L8DA 3LLRA 2GFAA 2RJEA 4E7LA 4BE2A 3ASKA 2P0KA 4PLIA 1WJSA 3OYKA 2RHXA 2RJCA 3META 4QQ6A 3S3NA 5J39A 4RG2A 4BE0A 5D6WA 3S3OA 2E6NA 2F5KA 3QBYA 5FRMA 2EQUA 3OS0A 4IKFA 3BDLA 2RJDA 2RI5A 3DLMA 1WJRA 3MEAA 3OA6A 5KE2A 3OB9A 3PNWC 3SD4A 4A4FA 2WACA 4GY5A 4A4EA 4B9WA 3LH0A 3PFSA 4BE1A 5FRNA 3OYDA 4ZTFA 2NLUA 2X35A 2R58A 4FL6A 1KHCA 3DB4A 3E9FA 5KE3A 3OYHA 2FHDA 2MWPA 4HCZA 4E7IA 3P8DA 4PL6A 3OYJA 3OMGA 4B9XA 1XNIA 2RI3A 2X4WA 4L59A 2X4XA 3MEVA 4C5EA 2K3YA 3MP6A 3LX7A 4X34A 3FEOA 4IUVA 5M9OA 3CEYA 2RI2A 2CKKA 3MO8A 1WJQA 2LCCA 3NTHA 2QQRA 2EQKA 5IN1A 4A4GA 2M0OA 3GOXA 2IG0A 5C6SA 2M1HA 1SSFA 3OS2A 4BDZA 3UT1A 3P8HA 4Q5WA 3OYMA 4CRIA 3E9GA 4BDYA 3L2UA 2MWOA 2EQJA 3LYIA 5D6YA 5J26A 4C5GA 5KH6A 2HQEA 4EDUA 3L2RA 3L42A 2BKDN 3O8VA 2LTOA 1WGSA 5KCHA 3OYIA 3L2VA 3OYEA 2JZ2A 4E7JA 2DIQA 3F70A 3FLGA 2BUDA 2VYTA 1OZ2A 2B8AA 2QQSA 2RHIA 3MP1A 3OS1A 3QIIA 3OYGA 1OZ3A 3Q1JA 4QQDA 5CIUA 4C5IA 5D6XA 3ME9A 3M9QA 2GF7A 3OYBA 2PQWA 3FDRA 3OY9A 2E5QA 2EFIA 2XDPA 3KUFA 2D9TA 4QW2A 2G3RA 3C4SA 2DAQA 3OYAA 2RHUA 4NS5A 1MHNA 2JTFA 2YRVA 4QQGA 4UC4A 2R5AA 2L89A 2LVMA 3ZEHA 3MEWA 1H3ZA 2HQXA 2LRQA 5KCOA 3FC3A 4FU6A 3MEUA 1G5VA 3OQ5A 3DB3A 4IUTA 5IAYA 3QJ6A 4N4GA 4OVAA 2RJFA 3H6ZA 4C5HA 5C0MA 2BIVA 2M16A 2L3RA 2O4XA 2RO0A 3LGLA 3QKJA 2RHYA 4II1A 4Z02A 1RI0A 2DIGA 3OYCA 4BD3A 2EQMA 3S3MA 4A4HA 4ZTJA
chains in the Genus database with same CATH superfamily
1E6GA 2KE9A 3E1SA 3CCST 1IREB 2CZ7B 1B7TA 4ZGDB 5GAOp 4M77C 4XU3A 1VQOT 2QA4Q 2J6KA 4KH1B 5DLOA 7AT1B 1QVGP 2EWNA 2JMAA 3M57A 5GANh 5FU7C 4QVZA 2CGHA 2QI2A 2YSQA 1WA7A 1VQPT 1M4ZA 2MMPA 4DOVA 2RJEA 4GBQA 2E41A 5FU6B 1D0YA 4JJDA 4MMLA 1YJNT 3JAME 1K8AC 1QW1A 1JXOA 2CP5A 1K9MC 1V76A 2M0YA 4KGZB 2OTJA 3PT9A 4ZTFA 2MOXA 3HP9A 1Y7XA 2RI3A 1M3AA 3HFOA 3MP6A 2HNIA 4LDXA 2DVJA 3VS3A 4C92D 2RMOA 3MO8A 4M7DE 1JRIA 1PRMC 2V8IA 2HCKA 5LJ3j 1QCFA 1VQ4A 2FZKB 2MWOA 1D0ZA 3EG9B 1Q95G 4P5NA 4AFSC 1WGSA 3OYIA 2AK5A 2XDDA 2F69A 2IIMA 3Q1JA 2ROTA 1JJ2S 1U8RA 2JJ9A 3TU4K 2PQWA 1QCNA 4ZNXA 4E47A 3OSSC 1SRMA 4M7DG 4ANJA 4PJLA 4J9FA 3G1JA 3QWXX 1I4K1 5LJ5h 1NYGA 3A8HB 5IHNA 3QKJA 1NEBA 4HKEA 3V7CA 4JLIA 5I11A 1WDXA 3S3MA 3M0UA 4XU2A 1RAEB 3QUIA 2XKOC 1FYNA 2KGTA 1WQWA 4LXCA 1A0NB 5CKDA 1X01A 2ZGWA 1YFNA 1QKWA 2O01E 3EG2A 3CCRT 3TEEA 5EG2A 3CBPA 3S6WA 2DTOA 3LLRA 3RMQA 2KK4A 2P0KA 1PG5B 2RHXA 2RJCA 2VUBA 3IQLA 3QBYA 2P4TA 3CPFA 2LNVA 5GAMf 2DRMA 2ESWA 2L3QA 3CCQA 3CCMA 2BZXA 2EGAA 4XTXA 5D7UA 1KIKA 2VWFA 4E7SA 1LCKA 3QPHA 2EYWA 1JQQA 4L59A 3MEVA 4J6YA 1I0CA 2NUPA 1WI7A 2WSCE 4EMKC 4RG8A 1Y57A 1KQSP 4AMCA 2M1HA 4RTUA 2CDTA 3OYMA 4M77F 4MZPA 3TCJA 2LX7A 1VQ6A 2DM1A 3OYEA 2JS0A 3FLGA 1PWTA 4WF2A 1YBYA 1VYVA 4C92E 2K5LA 2KXCA 5CKBA 1BK2A 3G71T 3CCLQ 5CIUA 3CCVQ 3M9QA 3NMZC 4A4KA 4BI3A 3OYBA 4PJJA 4PJOD 2AHJB 1BU1A 1UE9A 2K4YA 3ZFJA 2JT4A 3SEMA 4JZ3A 3MEWA 2PTKA 4F16A 2KRSA 5HK0A 1Z9ZA 4YTLA 2ZCFB 5A0GA 3CXCP 4OB2B 1LOJA 2O4XA 4KUDK 4LD9K 2E65A 3OYNA 3REAB 4C92G 1HK9A 2E4HA 4JPBW 2QA4T 1Q7YR 1Q7YU 2PUOB 3E19A 1K0SA 2XG8D 2R5MA 1AZGB 2O4XB 4BACA 1IB8A 1OI1A 2CP2A 3CC4A 1N9SA 4PFZA 1AWOA 1WHMA 2C0IA 1YIJQ 4E7LA 1KHIA 6AT1B 1YI2Q 3JB9F 4JRQA 3S3NA 3I55A 5FRMA 4EMHA 2KROA 2RJDA 2DL3A 3N5BB 4OMPA 3CPWP 2GTOA 2RQUA 3JB9I 3MCAB 2EW3A 4M75C 1AWJA 4M78D 3P8DA 4M7AA 2KQWA 3T9NA 2HD0A 4FT2A 3ULRB 1JEGA 4JJCA 3V7SA 1SKUB 1RAHB 2M0OA 2K5FA 1JB0E 1VQNA 3EGUA 1ZUYA 1Q7YC 1VQKA 2PUKB 5GAOm 3M0SA 1BI3A 1NYFA 2JZ2A 2DFUA 2VYTA 5GANj 2NUZA 1VQ8A 4F7UF 2FZCB 1VQ5A 1WX6A 3G7ZA 3CCUA 2EFIA 2XDPA 1FMKA 2K5IA 2V1RA 1D09B 2Y90A 2RHUA 3SB2A 2M51A 4QQGA 2A37A 1ZSGA 3FJPA 1VIEA 1X69A 2QQ9A 4JRPA 2QEXT 1UGSB 4X1VA 3BE3A 5GAOl 2RHYA 4II1A 4FYWB 3VYHB 3QYGB 3LWHA 2CYZB 4B6MA 1YITQ 2GFUA 1AEYA 1PD0A 5CR2A 3CC2A 1N27A 2PNIA 4J6WA 3EFOB 4C0GA 4LNPA 4QT7A 2GTJA 2KNBB 2WSEE 3I56Q 4EPCA 3EHQA 3G6ET 2W0ZA 4RKUE 1IXDA 1KG1A 2P0QA 1WJSA 2XD0A 5CKEA 3CCSQ 3BDLA 4QVCA 2RQWA 2RNAA 2RH2A 1IO6A 1O75A 1ZUUA 4GY5A 5FRNA 4M4ZA 3PFSA 3H0FA 1H92A 8ATCB 3E9FA 3CCEQ 5KE3A 4C8QD 1VQPQ 1Q82R 4KBMB 4JJNK 3OW2P 1Q82U 1IRXA 3CC7Q 1XNIA 5GAOr 1R0BG 1RABB 2QDLA 1CKAA 2X4XA 3D7SB 3HHTB 4Z8AA 3BY7A 3X24B 1WJQA 2OAUA 1YCSB 4M77A 2H3JA 3OS2A 1W1FA 2EKHA 2JTMA 1RI9A 3EFRA 4M78E 3L2UA 3PGGA 5KH6A 5GAOq 2KRNA 3NHNA 4D8KA 1WFWA 3RKXA 2QK0A 1HYOA 1I1JA 1PKSA 2K2VA 5LJ3f 3MP1A 3JV3A 3I35A 1RL2A 3QIIA 5GAMg 3U23A 3CCLT 5CAIA 3CCVT 4C5IA 2NYSA 2XIDA 4BI4A 3M58A 2E12A 3GPLA 1XJWB 2V8KA 4AT1B 4PFOA 3CMAQ 1NM7A 1Q81U 1BI1A 5FU7B 3M0PA 2EQIA 4PJOB 2CSQA 3H9NA 5IAYA 4MZMA 3JCMW 4JJBA 2EIFA 1GL5A 2DIGA 1U1SA 4HVUA 2H8HA 3E2UA 4ZTJA 3HKSA 1VQ9Q 4IURA 3JSCA 4N4IA 1U06A 4IUQA 1UGQB 1YWOA 1FMWA 1W4SA 4OGEA 4HCBA 4ELZC 2BE7D 3OMCA 3VS0A 4HT9A 2JUFA 4C92C 3J80E 1O9SA 4F7UE 1YIJT 1KQ1A 2JW4A 3H0IA 4DEYA 5GAMd 2JMCA 4BUGA 2HBPA 2RI5A 5KE2A 3PNWC 4KRTA 4QVDA 4A4EA 1AZEA 3NPFA 3C95A 2NLUA 2X35A 1ACMB 1KHCA 2LCSA 1M3BA 2A0FB 3CCRQ 4JS4A 3OMGA 2RQRA 2KEAA 3RR6A 3SHWA 2EPDA 4C5EA 4BY6C 4GLMA 1IHWA 4ZN3A 2DVEA 1Y71A 3RESA 3JCMV 4F7UG 1GCQA 2YUNA 5I22A 2VXEA 1PRLC 2EQKA 5CKFA 1U1TA 1VQLA 1D1AA 5CO7A 3JRZA 4M7DD 5AT1B 1S72Q 3PIPA 1VQ7T 2DIQA 1IZ6A 2HZYA 2LQWA 5FWCA 1UECA 3V8KA 3EFSA 2BZ8A 3VYGA 1EIFA 1X6BA 1KQSS 1N6AA 1SHGA 4XQ3A 4JZ4A 1X27A 5GMKm 4RTVA 2D0NA 1M8MA 2FRYA 3VJPA 4F04B 1ZA2B 4J7FA 2O9VA 1PM3A 3A8MB 4OMNA 2PVGB 1I5OB 2FPDA 2FYKA 4EMKA 1IGQA 3WVEB 1YITT 5GMKj 1M2VA 2AKLA 2HQHA 1VYUA 5HCKA 3TSWA 3CXCS 4E7HA 3MHXA 1BIBA 2HDAA 5I2SA 3I56T 2JN0A 4IUUA 3EGXB 5DLQE 2AT1B 1ZQ1A 2M02A 2NWMA 2FG0A 1QVFP 3CCJA 3OYKA 1WZOA 2AZVA 4CC2A 2RQTA 2P4RA 4XTUA 1Y0MA 2DEQA 4FYXB 4PJNA 4J9EA 4BE1A 4HCKA 4MDXA 3CCET 2K79A 1UGVA 3CC7T 2VXFA 4PL6A 4PJOC 5IXBA 4B9XA 2X4WA 2CSIA 2ENMA 3OSVA 4D8DA 1VOMA 3CCQT 3CCMT 3NTHA 1C6VX 4BDZA 3CPWS 3M56A 2BKDN 1K73R 1K73U 3RKWA 2BUDA 3EG9A 3P8BB 2C0TA 2A36A 4XTZA 1SRLA 1NJIU 2RM4A 1T0HA 2QQAA 4M7AF 5EC7A 1SSHA 3BW1A 3VS4A 2D9TA 3CMAT 4NS5A 2J7IA 1RADB 1H3ZA 2LRQA 3ZBDA 1YJWA 2LZ6B 1IGUA 4OVAA 4M75A 2M16A 5GAN6 1NG2A 1VQ9T 2RN8A 2MI6A 4PK4A 1MV3A 2VV5A 3PMTA 2E5KA 1UTIA 1WXUA 2HAXA 5LJ3g 5GMKi 4M78C 2DO3A 2QQBA 4M75B 2XK0A 1MMAA 1AD5A 2FEIA 3CD6Q 1UG1A 1K73C 5FROA 2QEXQ 3VRZA 3WXMB 2L8DA 2OAWA 4ZN1A 5IH2A 1UJYA 1MNEA 1WHGA 3FRNA 3CMEA 2CH4A 2K57A 1D1BA 2ZAEA 1GCQC 3CC4T 1QQJA 2Z0WA 4LDUA 2LQNA 4A4FA 4XU1A 2KDSA 5GAMh 2DXUA 3FIFA 2D8HA 1QMCA 1JJ2A 1NPRA 3DB4A 2HMAA 1RAIB 4NL2A 4OMLA 3G6EQ 1X2QA 1Y07A 1M1GA 4J83A 1BKBA 3L1AA 2KYBA 2IG0A 2EGCA 2MYSA 4CRIA 2H3EB 2PU9B 4HT8A 3J81E 5LJ3d 4OMOA 3OW2S 1PD1A 4E7JA 1S72T 2I2LA 2ZPBB 1VQOA 1VQNT 3RERA 1BI0A 2DL5A 5LJ3e 3JCMP 1QVPA 2X9HA 3FDRA 2E5QA 1YHQQ 1LJOA 1BYMA 3OYAA 1Z9QA 1VQ8T 2HQXA 1YJNA 4E7ZA 2MIOA 4PNOA 3CCUT 3QYHB 1NE8A 5GAN3 2RO0A 2DETA 3JCMQ 2MAMA 5FLXE 1PNJA 2OX7A 1HJDA 4PJOF 3G4SQ 2QGGA 4PLLA 4DQ2A 3NTIA 4C8QC 1E6HA 1W2BS 2RQVA 2X4YA 3A98A 2FPFA 2DERA 4TVRA 1M8VA 4N0AC 2E6ZA 3MKDA 4LD6A 2DX1A 4M7AE 1MMGA 4AFZC 2OTLQ 2JXBA 2AKKA 1TOVA 3META 1LNXA 1XQHA 4BE0A 5D6WA 4WCIA 4ATOA 1OPLA 3OYYA 2EYYA 4L6V5 4RTXA 1B07A 2E64A 1T3LA 2CP3A 1BCMA 2F2VA 4OMFB 2JM9A 1I07A 3OYDA 1I5LA 2RB6A 1DJ7B 3OYHA 3I5SA 2MK5A 3BFMA 2CUBA 3M4GA 3PTAA 4D6WA 3QO3A 2YWWA 2NUTA 4CC4B 1ABOA 1AT1B 1TSFA 1W2BA 3JCMe 1JBMA 1OX8A 2MF2A 1NLOC 2CKKA 3EG3A 4LDWA 4M7AG 2QQRA 5IN1A 2KT1A 2DYBA 2LJ3A 2DE0X 2OI3A 1ZLMA 1N8RR 4BDYA 1N8RU 5D6YA 4ESRA 3L42A 1QWFA 2PZ1A 1XTDA 1YJ9A 2NUTB 4PJMA 2DXBA 1ZHIA 2VB6A 1K0XA 2A7YA 4C92A 3UF4A 1GBRA 1G3WA 4FYYB 1PCXA 5GAN2 2OTJQ 2K3BA 2L89A 3ZEHA 4ME7A 1VQMT 1RLQC 4C92B 2JNGA 4N4GA 3H6ZA 3PVQA 1VQ7Q 3H41A 2BTTA 1UUEA 4WTOB 1VQ4Q 3OYCA 1Y96A 2CZ0B 4IIOA 4A4HA 5L23A 5GAN4 2R57A 1WQ7A 2DL8A 2GQIA 1C1AA 2QTXA 3OBWA 3A8LB 3FJ5A 2EKOA 1Q86R 1Q86U 1FXXA 2BE9B 3QG1A 3OYFA 1R8OB 4BI8B 1JU5C 1N8RC 2KY9A 3VV0A 4C0DC 1FMVA 3CD6T 2BZYA 3EFOA 3NTKA 1Y96B 5IHIA 4BY6B 3UA6A 4LN2A 1AHJB 5CCAA 2PVOB 1QLYA 1PHTA 4M7DC 4JLGA 4M77E 3G71A 1RACB 3RIRA 2YLBA 1OV3A 2WACA 4B9WA 2EYZA 4R55A 4FL6A 3REBB 1QVFS 2LNHB 2QYZA 2MWPA 4OB3B 4J9DA 3URGA 2RA2A 1C0MA 2RD1A 4KULA 3GF5A 1OU9A 4AFUC 1GRIA 1TS9A 2ED0A 5CK9A 2YLCA 4J8OA 2GGRA 1QVGS 1KFZA 4XTVA 1HSQA 1Q86C 5J26A 4RTYA 3NGPA 4M77G 3L2VA 2QA4A 1IHVA 3X25B 4LDYA 2GNCA 2V1QA 2ZPEB 5LJ3h 2LMJA 2E1HA 2DEUA 4PFPA 4QQDA 5LJ5j 3CCQQ 1UJ0A 3CCMQ 3GP8A 1YHQT 1M1KU 3DLLA 1AWWA 2K6DA 4FIBA 5GANe 1EFNA 1YCYA 1RLPC 2K7AA 2L3SA 4F17A 3VUZA 2SEMA 4R0KA 5L8RE 3MPUB 4C5HA 2FVUA 5GAMj 3HSBA 4PJOA 3HRSA 1TU0B 3G4ST 1VQ6Q 4E7KA 3I9QA 4NOYA 1Q81R 2B86A 2RHZA 2KXDA 2DXTA 5J3BA 1M9SA 2CUDA 5GJVB 1M90U 2GFAA 1UGPB 2OTLT 4BE2A 4M75F 1Q82C 1B34A 1EX4A 5KYUA 3JB9G 4A63B 1AOJA 2RK2A 4OB1B 1MMNA 3SD4A 4RMOA 3CCJT 2C06A 2KMTA 2LQKA 1W70A 3H0HA 2AZSA 2R58A 3HTRA 1B34B 4RCBA 1CKBA 1K4US 5KYUB 2XICA 3M5AA 3LX7A 3M54A 2L3PA 2CS7A 4HVWA 2QEXA 3JCMX 2COYA 1SSFA 1D0XA 2FB7A 3CC4Q 2E70A 4M78A 4E6RA 2D6FA 1Q81C 2HQEA 2V26A 2X3WD 4DOWA 5I21A 3F70A 2FO0A 3I55Q 1OZ2A 3VRYA 1G2BA 4QKUA 3JCMf 3OYGA 4HVVA 1OZ3A 3GNGA 1PSEA 3VU3C 2OTJT 4M78B 1M27C 4V2SA 1BB9A 2DKGA 4DEXA 2VGMA 3C4SA 3EHRA 3R6NA 2QGFB 1UB4A 2R5AA 3LWIA 1KD1U 3ZL7C 1MV0B 5KYNA 4E2FB 3RMSA 1ZX6A 1KC8R 1KC8U 1VQNQ 1RI0A 2DNUA 1VQ4T 3GIBA 3RNJA 2AIRB 1VQKQ 3PMIA 3MJXA 2F2XA 4JRKA 3L2QA 3L2WA 2C0OA 1YJWT 4LUEA 1OPKA 1WXBA 3QDRB 1MNDA 2HL3A 1OX9A 1VQ8Q 2OJ2A 2EAYA 1GXIE 1VQ5Q 3CCUQ 1PC0A 5ECAA 1X2KA 2DLPA 2DD5A 3EGXA 2LT1A 1SPKA 3NFCA 2KSSA 2FZGB 1TWBA 4RTTA 2DA9A 1VA7A 2G6FX 4JS5A 3OA6A 3CCLA 3CCVA 5GMKl 4F7UB 4XTWA 1KQSA 3CMET 2LJ0A 2FHDA 2EJFA 2ZPGB 3CC2Q 4X34A 1G8XA 5M9OA 2LP5A 5KYWA 1T3SA 2DPPB 1WLPB 1WIEA 5GAOn 3P8HA 4C8QA 2YUQA 2CH4W 1V29B 3O8VA 2M9UA 4N0AA 2LTOA 4M75E 3RBBB 1KSWA 2VASA 5KYWB 3V8JA 3OS1A 1T0JA 4LE9A 3CXCA 3QHSA 4X9CA 2ED1A 1W6XA 2DJZA 4C8QB 1WYXA 1GBQA 1QCOA 2YDLA 1YIJA 3M0TA 2JVVA 2XHCA 1YI2A 2CP7A 2LVMA 2HSPA 3VS7A 5KYXB 3MEUA 3VS1A 4IUTA 1M1FA 4XK8E 1AWXA 2I0NA 2LQ8A 2L0AA 2RK1A 4DBRA 4K11A 5CQXA 8AT1B 4BD3A 4EIKA 1OULA 4C92F 1NJIR 4M75G 1BI2A 4O6JA 5GJWB 1PSFA 3UWNA 1VQ6T 3QSUA 2L2PA 4C0FA 2J06A 2E3HA 2PVDB 5GANf 3EH1A 4N4HA 3EAEA 3LGFA 4FW1A 2IVWA 1BBZA 4EMGA 3QDFA 1NLPC 4J6XA 1VQMQ 4OP0A 4IUPA 5KYYA 3VS5A 2F2WA 5CVIA 1QKXA 5GMKe 3CPWA 4OB0B 1YWPA 2LJ1A 1YN8A 1LVKA 4MDWA 1D3BA 3PIOA 4QQ6A 5DY9A 2EYQA 2DK3A 1VQ7A 3VS2A 2EVRA 4M7AD 3V7RA 1WJRA 2ROLA 3EGDA 5IT9E 3OB9A 1VIFA 5KYYB 4RUGA 4L5GA 2HKQB 5FWBA 3C12A 2QTVA 2LX9A 3DKMA 3RDVA 1MGQA 3JCMb 2KYMA 1WPYA 1D3BB 2YXYA 2VVKA 2XI9A 3FEOA 4GLKA 3CEYA 1UHCA 1NJIC 3EGDB 1QWEA 2LCCA 3GOXA 1G83A 4Z88A 2DZ9A 1YNZA 4C5GA 2DTIA 2X3XD 1G3SA 1YITA 3I55T 2JS2A 2RPNA 4CC7A 3UPUA 2P84A 2EGEA 1RUWA 2FL7A 4RCCA 4F14A 3TQ7P 3I56A 2DILA 2K9GA 1YJ9T 1QP2A 1ZBXA 4M7DA 2YRCA 2CZ1B 1WHHA 2Y4YA 3TSZA 3CBMA 3SWNC 4C0DB 4MZTA 1R77A 3FC3A 3L2ZA 5LJ5f 3CCSA 2DMOA 3QJ6A 1X43A 2EBPA 3EH2A 3RUXA 2X4JA 2V8JA 3ER0A 1BCOA 4DBHA 1VQKT 4M7DB 1VQLQ 4HA8A 3CCEA 4RTZA 1M30A 1VQPA 4ZGEB 3CC7A 1ZBJA 1GFCA 2K3XA 5A0DA 2WSFE 3JCMg 2ECZA 1TUCA 3JCMc 3M4YA 2DBKA 1VQ5T 2K2MA 1YP5A 2J6OA 2YUOA 4ORZA 4XTYA 3C94A 4J9BA 2YHTA 4RG2A 1D1CA 2KR3A 3OW2A 4IKFA 1RAAB 1X6GA 3DLMA 4AFQC 3THKA 2HL5C 1NZ9A 4M77D 2YRDA 1G3YA 3M0RA 2NUPB 3CMAA 4HCZA 3HPWA 4Y91A 3CC2T 1WHKA 4KUIA 1NEGA 2KVQG 1M5Q1 4KT0E 4LDVA 5FU6C 1UGRB 1VYTA 4J9HA 2MCNA 4KGXB 2EQJA 4FSXA 2QAZA 1VQ9A 3CCJQ 1ZUKA 5DM7R 1OU8A 1VUBA 1B3QA 5KCHA 3JCMd 1KK7A 4HCCA 3X20B 2DD4A 2RHIA 5AYFA 3QXEB 1MUZA 4PKCC 2DL4A 3OY9A 3KUFA 4OMQA 2LT4A 2DAQA 4XU0A 2YUPA 2JTFA 4DBFA 1SF9A 2JOYA 4FU6A 4M78F 3OQ5A 3DB3A 1G5VA 3KBGA 2LCLA 3UATA 4JDSA 1MMDA 2VC8A 3HL8A 3H8ZA 4OMMA 4JRIA 3TVTA 3CCRA 1RAGB 2QDYB 3JB9D 2COWA 3A8OB 1TXQA 5LL6S 3M59A 4CI0C 4Y92A 2YT6A 1J3TA 1ARKA 3GLXA 3AT1B 4J7IA 1H8KA 3OYLA 4FM4B 1TUGB 1HXDA 5GMKh 2QG9B 3ASKA 3BDUA 1WHJA 1S72A 2E6NA 2EQUA 1YJWQ 2XMFA 2JM8A 4J9GA 2W10A 4M7AB 2ZPIB 3OBYA 1ZA1B 2MPXC 4E7IA 2CZ6B 2CT4A 2D8JA 2DJQA 5GANg 1SG5A 3GNFB 2ZPHB 3M55A 3O5ZA 1U5SA 2HBWA 2RI2A 1X6OA 3R6OA 2FRWA 1FWZA 1JJ2P 1EZZB 4R56A 5HK3A 2QASA 4J9CA 4OF1A 1M2OA 3VUBA 4C0ZA 1SHFA 1ZSZA 3WVDB 3UA7A 2GBQA 3CMEQ 1QP3A 4J9IA 1WNLA 2B8AA 2QQSA 4PJOE 1JO8A 3M53A 2QXFA 2DXCA 3ME9A 4FT4A 3EG1A 4QW2A 1ZSZB 2YRVA 1OQKA 2O88A 3GBQA 3UDCA 2CT3A 3VKIA 4C8QF 3J7AF 5C0MA 2BIVA 5A0LA 4A53A 1NPPA 1VQLT 1ABQA 2D1XA 5GANd 4A54A 3HRTA 3HFNA 1OYXA 4PJOG 4KH0B 1HD3A 1M1KR 2FPEA 2J05A 1QVFA 3MP8A 5CKHA 1VQOQ 2COZA 3AHUA 2DBMA 1H641 2SRCA 1OEBA 2VKNA 1TG0A 3PVLA 5GAN8 4JUVA 1F1BB 3C0CA 5A2QE 1S1NA 4DA4A 2ATCB 4AG2C 3JB9J 1QVGA 2RF0A 2A08A 4FCYA 2P0PA 2LC4A 5LJ5g 1XOVA 1YJNQ 2EYXA 3QWYA 1OOTA 1K1ZA 2JTEA 2DL7A 3MEAA 3PE0A 3LH0A 4AG1C 2CP6A 1WXTA 2DRKA 2KI7A 1U3OA 2Y4XA 2ZPFB 5HY6A 1I81A 4Z89A 4NL3A 1UDLA 1M90R 2GCXA 1VQMA 4M77B 1TH7A 2K3YA 2DTHA 5FW9A 2GQVA 1G3TA 2F1LA 2F5TX 5C6SA 2E3IA 4Q5WA 1M1KC 3E9GA 3LYIA 1N9RA 3OS5A 2HEQA 3CQTA 1W2BP 4M78G 3CBOA 2EJGA 3A5ZB 3QZ5B 5IXFA 5D6XA 4M75D 3CD6A 3JCMh 1WHLA 1I8FA 3FB9A 5LJ5d 2G3RA 3JCMJ 1KQ2A 1MHNA 5CQYA 4VUBA 3EG0A 3TREA 1H3HA 1K9AA 3INZA 4O5VA 2IPOB 3A8GB 3QJYA 5LJ5e 2KRMA 4Z02A 4M7AC 1PKTA 5HKCA 1YI2T 1M90C 2E10A 3LW5E 2A3LA 2X51A 2KT8A 2HSEB 2VGNA 2KAFA 2LDMA 1UEBA 5GAN5 1YJ9Q 2O2OA 2ZZDA 3G6EA 2CREA 4M7DF 4X9DA 1AVZC 2DYIA 5GAMe 1KD1R 4ZGJB 1N5ZA 3X26B 1X75C 1E7OA 3M0QA 4PLIA 4Y28E 4DBQA 1FX7A 1RAFB 4FSSA 3S3OA 1P92A 5J39A 2XDBA 2F5KA 3OS0A 3A1PA 1K76A 4C8QE 3SWNA 1TTHB 4XAXB 3X28B 3HRUA 3I5RA 5IHKA 1SEMA 2EJ9A 1ZSZC 3JB9H 4HXJA 1YHQA 4F7UA 1KJWA 3OYJA 2CP0A 1BIAA 1UHFA 4ELYC 3LH5A 3V8LA 4FW2A 3KXTA 4IUVA 5I2MA 4FYVB 3SWNB 3SDZA 1GFDA 4A4GA 3QZ9B 3UT1A 2J6FA 3L2RA 3RKYA 4EDUA 1JXMA 1GCPA 3G4SA 4J5YA 1KD1C 4C8QG 4LUDA 2O31A 1R0CB 3VS6A 1KC8C 4RTWA 3G71Q 1LPLA 4KGVB 1K8AR 1K8AU 2GF7A 5GAN7 1M3CA 1NBEB 2DZCA 2D0QB 2DF6A 4MMKA 4IIMA 1K9MR 1K9MU 2A28A 2OTLA 4UC4A 1CSKA 2XU8A 1V1CA 2O9SA 5KCOA 1UFFA 2ABLA 2L5QA 3KFVA 2KBTA 2RJFA 9ATCB 3SFMA 2L3RA 3LGLA 4CC3A 5KYXA 4EMKB 1TUDA 4OGCA 2HKNA 4BB7A 1M2VB 2EQMA
chains in the Genus database with same CATH topology
5GAN4 3HKSA 4HA8A 3CCEA 4IURA 3E1SA 3CCST 1IREB 1WQ7A 2R57A 3JSCA 4N4IA 2CZ7B 4ZGDB 5GAOp 1VQPA 4M77C 4XU3A 4ZGEB 2QTXA 3OBWA 3CC7A 1VQOT 3A8LB 4IUQA 1UGQB 2EKOA 5DLOA 2K3XA 1Q86U 5A0DA 1FXXA 1W4SA 3QG1A 4OGEA 3OYFA 1R8OB 2EWNA 2WSFE 3M57A 3JCMg 4BI8B 5GANh 1N8RC 4HCBA 2KY9A 3VV0A 4C0DC 5FU7C 3CD6T 4QVZA 4ELZC 3JCMc 2CGHA 2QI2A 3M4YA 3OMCA 1VQPT 3NTKA 1VQ5T 1M4ZA 4HT9A 1Y96B 2JUFA 4BY6B 2MMPA 4C92C 3J80E 1O9SA 4F7UE 4DOVA 1YIJT 4XTYA 2RJEA 3C94A 1KQ1A 1AHJB 2E41A 5FU6B 2YHTA 2PVOB 5CCAA 4MMLA 1YJNT 5GAMd 3JAME 4RG2A 1K8AC 4JLGA 4M7DC 3OW2A 4M77E 4BUGA 4IKFA 2HBPA 1QW1A 3G71A 2RI5A 3DLMA 1K9MC 3RIRA 2YLBA 5KE2A 3PNWC 4QVDA 2WACA 1NZ9A 4A4EA 4B9WA 2OTJA 3PT9A 3C95A 4M77D 4R55A 2NLUA 4ZTFA 2X35A 4FL6A 4M7AG 1KHCA 1G3YA 1QVFS 4OB3B 3CMAA 2MWPA 4HCZA 3HPWA 3HP9A 1Y7XA 4Y91A 3URGA 3OMGA 2RA2A 4JS4A 2RD1A 4KULA 3CC2T 2RI3A 3HFOA 3GF5A 4KUIA 4BY6C 2KVQG 1M5Q1 3MP6A 2HNIA 4C5EA 4LDXA 4ZN3A 2DVEA 4KT0E 4C92D 1Y71A 4LDVA 3RESA 3JCMV 4F7UG 3MO8A 4M7DE 2VXEA 1JRIA 5FU6C 2V8IA 1UGRB 5CK9A 2EQKA 2YLCA 5CKFA 4J8OA 5LJ3j 1QVGS 1U1TA 1VQ4A 1VQLA 4XTVA 2MWOA 2EQJA 4FSXA 5CO7A 5J26A 1Q86C 1VQ9A 3JRZA 4M77G 4M7DD 4P5NA 5DM7R 1VUBA 1WGSA 5KCHA 3OYIA 3L2VA 3JCMd 3PIPA 1VQ7T 2DIQA 2QA4A 1IZ6A 3X25B 4HCCA 3X20B 2DD4A 2RHIA 4LDYA 5AYFA 3V8KA 3EFSA 3VYGA 3QXEB 2ZPEB 5LJ3h 1EIFA 2XDDA 2F69A 2E1HA 1KQSS 1N6AA 3Q1JA 4PKCC 4QQDA 4XQ3A 5LJ5j 1JJ2S 1U8RA 3TU4K 5GMKm 2PQWA 3OY9A 3GP8A 1YHQT 3KUFA 1M1KU 3DLLA 2LT4A 2DAQA 4XU0A 4E47A 4FIBA 3VJPA 2JTFA 5GANe 3OSSC 4J7FA 1YCYA 4M7DG 3A8MB 2JOYA 4FU6A 4M78F 3OQ5A 3DB3A 3VUZA 1G5VA 3KBGA 5L8RE 1I4K1 5LJ5h 4C5HA 2LCLA 2FVUA 2PVGB 3A8HB 4JDSA 3QKJA 5GAMj 3HSBA 4PJOA 2VC8A 4HKEA 4JLIA 3HRSA 3V7CA 2FYKA 3S3MA 3HL8A 4EMKA 3H8ZA 4XU2A 4JRIA 3G4ST 3QUIA 2XKOC 2QDYB 3WVEB 3CCRA 3JB9D 1YITT 5GMKj 3A8OB 4E7KA 5LL6S 1WQWA 3M59A 4NOYA 4CI0C 5CKDA 1X01A 2ZGWA 3CXCS 2RHZA 4E7HA 3MHXA 1BIBA 3I56T 5I2SA 3GLXA 2O01E 4J7IA 2DXTA 2JN0A 3CCRT 5J3BA 4IUUA 3TEEA 5EG2A 3CBPA 1M9SA 5DLQE 3S6WA 1ZQ1A 3OYLA 4FM4B 1M90U 2DTOA 3LLRA 3RMQA 1HXDA 2GFAA 1UGPB 2KK4A 5GMKh 2OTLT 4BE2A 3ASKA 2P0KA 4M75F 3CCJA 3OYKA 1Q82C 1B34A 3BDUA 2RHXA 2RJCA 1S72A 2VUBA 3JB9G 4XTUA 2E6NA 3QBYA 2EQUA 2P4TA 2DEQA 2RK2A 3CPFA 4OB1B 2LNVA 5GAMf 3SD4A 4RMOA 3CCJT 2C06A 2KMTA 2LQKA 4BE1A 3CCQA 3CCMA 4M7AB 4MDXA 2ZPIB 3OBYA 2R58A 4XTXA 3CCET 4E7IA 1B34B 2CZ6B 3CC7T 2VXFA 4PL6A 4PJOC 4RCBA 3QPHA 4B9XA 5GANg 2X4WA 4L59A 3GNFB 3MEVA 2ZPHB 4J6YA 2XICA 3M5AA 3LX7A 3OSVA 3M55A 3M54A 2CS7A 2WSCE 4EMKC 3CCQT 3CCMT 4RG8A 2RI2A 3JCMX 1X6OA 2QEXA 3NTHA 3R6OA 1FWZA 2M1HA 1SSFA 4BDZA 3CPWS 4R56A 2FB7A 5HK3A 2E70A 4M78A 4M77F 3OYMA 4MZPA 4OF1A 2D6FA 1Q81C 3M56A 2HQEA 3TCJA 3VUBA 4C0ZA 2BKDN 3WVDB 1K73U 3RKWA 1VQ6A 3OYEA 4DOWA 1QP3A 3F70A 3FLGA 5I21A 2BUDA 4WF2A 3P8BB 1YBYA 1OZ2A 1WNLA 4C92E 2B8AA 2K5LA 2QQSA 4PJOE 5CKBA 3G71T 4XTZA 3JCMf 3OYGA 1OZ3A 3GNGA 1PSEA 2RM4A 3M53A 5CIUA 3VU3C 1NJIU 2QXFA 2DXCA 2QQAA 3M9QA 3ME9A 4FT4A 4A4KA 4BI3A 4M7AF 2OTJT 3OYBA 3BW1A 4M78B 2AHJB 4PJOD 4V2SA 2K4YA 2DKGA 3ZFJA 2D9TA 4QW2A 2VGMA 3C4SA 3CMAT 4NS5A 2YRVA 1UB4A 2R5AA 3MEWA 3LWIA 1KD1U 1H3ZA 3UDCA 2LRQA 5HK0A 3VKIA 4C8QF 3RMSA 3ZBDA 4YTLA 1YJWA 3J7AF 2ZCFB 5A0GA 4OVAA 4M75A 4OB2B 1KC8U 1LOJA 5C0MA 2BIVA 2M16A 2O4XA 5A0LA 4KUDK 4A53A 4LD9K 1RI0A 1NPPA 1VQ4T 3GIBA 2E65A 5GAN6 1VQLT 3OYNA 3PMIA 5GANd 4A54A 1VQ9T 2MI6A 4JRKA 3HRTA 4C92G 1HK9A 3L2QA 3HFNA 1OYXA 4PJOG 3PMTA 2VV5A 3L2WA 1YJWT 3QDRB 2QA4T 1QVFA 3MP8A 5CKHA 2HAXA 1Q7YU 5LJ3g 3AHUA 5GMKi 4M78C 1H641 2PUOB 3E19A 2DO3A 2QQBA 4M75B 2XG8D 2XK0A 5GAN8 2R5MA 4JUVA 2O4XB 4BACA 2EAYA 1OI1A 1K73C 5A2QE 1GXIE 5FROA 4DA4A 3CC4A 1N9SA 3WXMB 2L8DA 3JB9J 4ZN1A 1QVGA 4E7LA 2DD5A 1KHIA 3FRNA 2LT1A 3JB9F 3CMEA 2P0PA 3NFCA 2K57A 2KSSA 1XOVA 2LC4A 5LJ5g 4JRQA 3S3NA 3I55A 5FRMA 4EMHA 2RJDA 3CC4T 4JS5A 4LDUA 3MEAA 3OA6A 3N5BB 3CCLA 3CCVA 4A4FA 4XU1A 5GMKl 2KDSA 3LH0A 5GAMh 4F7UB 4XTWA 1KQSA 2DXUA 3FIFA 3CMET 3JB9I 1JJ2A 1NPRA 3DB4A 3MCAB 4M75C 2FHDA 4M78D 2EJFA 2Y4XA 2ZPFB 2ZPGB 1I81A 3P8DA 4NL2A 5HY6A 4NL3A 4M7AA 2GCXA 1VQMA 2KQWA 4M77B 3T9NA 1TH7A 2K3YA 4X34A 1Y07A 2DTHA 1M1GA 2HD0A 4FT2A 5M9OA 4J83A 3V7SA 1BKBA 2GQVA 1G3TA 2F5TX 3L1AA 2M0OA 2K5FA 1JB0E 2IG0A 2DPPB 5C6SA 1VQNA 5GAOn 3P8HA 4Q5WA 4C8QA 1M1KC 4CRIA 1Q7YC 3E9GA 2PUKB 1VQKA 2PU9B 3LYIA 1N9RA 3OS5A 3J81E 5LJ3d 4HT8A 5GAOm 1V29B 3O8VA 2M9UA 4N0AA 1BI3A 2LTOA 3OW2S 4E7JA 1S72T 2JZ2A 2I2LA 2ZPBB 3CBOA 4M75E 4M78G 1VQOA 2VYTA 5GANj 1VQNT 3RERA 2EJGA 1BI0A 5LJ3e 3V8JA 3OS1A 3JCMP 3A5ZB 3QZ5B 1QVPA 1VQ8A 4F7UF 5D6XA 4M75D 3CD6A 3CXCA 3JCMh 3QHSA 4X9CA 1VQ5A 2DJZA 4C8QB 3FDRA 3G7ZA 3CCUA 2E5QA 2EFIA 2XDPA 1LJOA 1I8FA 3FB9A 5LJ5d 2G3RA 1YIJA 1BYMA 2K5IA 2Y90A 3OYAA 3JCMJ 2JVVA 2RHUA 2XHCA 1MHNA 3SB2A 4QQGA 5CQYA 1YI2A 1KQ2A 2LVMA 4VUBA 3FJPA 1VQ8T 1VIEA 2HQXA 3TREA 1YJNA 2QQ9A 4JRPA 3INZA 3MEUA 4O5VA 4IUTA 3A8GB 4PNOA 3QJYA 5LJ5e 2QEXT 1M1FA 3QYHB 3CCUT 1UGSB 1NE8A 5GAN3 2RO0A 5GAOl 2RHYA 4II1A 4Z02A 2LQ8A 4M7AC 2RK1A 2MAMA 5CQXA 5FLXE 5HKCA 3JCMQ 1YI2T 4BD3A 1M90C 4C92F 2E10A 3LW5E 4M75G 2A3LA 4PJOF 3VYHB 3QYGB 3LWHA 2VGNA 1BI2A 4O6JA 2KAFA 1PSFA 2CYZB 2LDMA 3UWNA 1UEBA 5GAN5 1VQ6T 3QSUA 4PLLA 4C0FA 2GFUA 4DQ2A 3NTIA 2ZZDA 3G6EA 5CR2A 3CC2A 2PVDB 1N27A 4C8QC 5GANf 4N4HA 3EAEA 3LGFA 4J6WA 4M7DF 4X9DA 1W2BS 4C0GA 5GAMe 2IVWA 2X4YA 4EMGA 1M8VA 2WSEE 4J6XA 4N0AC 4TVRA 4ZGJB 2E6ZA 4LD6A 4OP0A 4IUPA 3X26B 4EPCA 5CVIA 3G6ET 1X75C 4M7AE 5GMKe 4RKUE 1KG1A 3CPWA 4OB0B 2P0QA 4PLIA 1WJSA 4Y28E 1FX7A 4MDWA 2XD0A 1D3BA 3PIOA 5CKEA 3META 4QQ6A 1LNXA 2EYQA 1XQHA 1P92A 2DK3A 5DY9A 5D6WA 5J39A 4BE0A 3S3OA 1VQ7A 2XDBA 4M7AD 2F5KA 4M7DB 3V7RA 3OS0A 3BDLA 4QVCA 4ATOA 2RH2A 4C8QE 3SWNA 1WJRA 1O75A 3OYYA 4L6V5 5IT9E 2E64A 3OB9A 1VIFA 4XAXB 4GY5A 3HRUA 3X28B 5FRNA 3PFSA 4L5GA 3OYDA 1I5LA 4OMFB 2EJ9A 3C12A 2RB6A 3JB9H 1DJ7B 3OYHA 1YHQA 3E9FA 5KE3A 2LX9A 3BFMA 4C8QD 3DKMA 3M4GA 1MGQA 3JCMb 3PTAA 4KBMB 1WPYA 3QO3A 1D3BB 4D6WA 4F7UA 3OYJA 4JJNK 1Q82U 1BIAA 1XNIA 5GAOr 4ELYC 2X4XA 3HHTB 1W2BA 3V8LA 3KXTA 3JCMe 2XI9A 1JBMA 3FEOA 4IUVA 4GLKA 3CEYA 5I2MA 2MF2A 3BY7A 1NJIC 2CKKA 4LDWA 3SWNB 3X24B 1WJQA 2OAUA 3SDZA 2LCCA 3GOXA 2QQRA 4M77A 5IN1A 4A4GA 3QZ9B 2H3JA 3OS2A 3UT1A 2DZ9A 3EFRA 2JTMA 4BDYA 4M78E 3L2UA 3PGGA 4C5GA 5D6YA 5KH6A 5GAOq 3L2RA 3RKYA 1N8RU 2DTIA 4EDUA 3L42A 3RKXA 3G4SA 1G3SA 1XTDA 1YJ9A 4J5YA 1YITA 1KD1C 2DXBA 4C8QG 1ZHIA 2A7YA 3I55T 4C92A 2K2VA 5LJ3f 3UPUA 3MP1A 1KC8C 2FL7A 1G3WA 1RL2A 3QIIA 4RCCA 5GAMg 3CCLT 3CCVT 5CAIA 4C5IA 3I56A 2XIDA 5GAN2 1K8AU 2GF7A 3M58A 4BI4A 1QP2A 2E12A 1ZBXA 5GAN7 1YJ9T 4M7DA 3GPLA 2DZCA 2D0QB 2V8KA 2CZ1B 2Y4YA 4MMKA 3CBMA 1K9MU 1Q81U 3SWNC 4C0DB 1BI1A 5FU7B 4UC4A 2OTLA 4MZTA 2L89A 3ZEHA 2XU8A 4ME7A 1VQMT 3FC3A 3L2ZA 4C92B 5KCOA 5LJ5f 4PJOB 2JNGA 3CCSA 2L5QA 5IAYA 3QJ6A 4MZMA 4N4GA 3JCMW 2RJFA 3H6ZA 2EIFA 3RUXA 2X4JA 3SFMA 2L3RA 2V8JA 3LGLA 4EMKB 2DIGA 1U1SA 3ER0A 3OYCA 1Y96A 2CZ0B 4OGCA 1VQKT 4BB7A 4XK8E 2EQMA 4A4HA 4ZTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMI A;  3H8Z A;  4IUR A;  2R57 A;  2LDM A;  3UWN A;  1OYX A;  3L2Q A;  3PMT A;  4N4I A;  3L2W A;  3OYN A;  4PLL A;  2GFU A;  3NTI A;  4E7K A;  3MP8 A;  4IUQ A;  2EKO A;  1N27 A;  2K3X A;  4N4H A;  3EAE A;  3LGF A;  3OYF A;  2X4Y A;  2RHZ A;  4E7H A;  2XK0 A;  2R5M A;  4BAC A;  2O4X B;  4QVZ A;  4LD6 A;  3OMC A;  1OI1 A;  4IUP A;  3NTK A;  4IUU A;  3OYL A;  5FRO A;  3S6W A;  2L8D A;  3LLR A;  2GFA A;  2RJE A;  4E7L A;  4BE2 A;  3ASK A;  2P0K A;  4PLI A;  1WJS A;  3OYK A;  2RHX A;  2RJC A;  3MET A;  4QQ6 A;  3S3N A;  5J39 A;  4RG2 A;  4BE0 A;  5D6W A;  3S3O A;  2E6N A;  2F5K A;  3QBY A;  5FRM A;  2EQU A;  3OS0 A;  4IKF A;  3BDL A;  2RJD A;  2RI5 A;  3DLM A;  1WJR A;  3MEA A;  3OA6 A;  5KE2 A;  3OB9 A;  3PNW C;  3SD4 A;  4A4F A;  2WAC A;  4GY5 A;  4A4E A;  4B9W A;  3LH0 A;  3PFS A;  4BE1 A;  5FRN A;  3OYD A;  4ZTF A;  2NLU A;  2X35 A;  2R58 A;  4FL6 A;  1KHC A;  3DB4 A;  3E9F A;  5KE3 A;  3OYH A;  2FHD A;  2MWP A;  4HCZ A;  4E7I A;  3P8D A;  4PL6 A;  3OYJ A;  3OMG A;  4B9X A;  1XNI A;  2RI3 A;  2X4W A;  4L59 A;  2X4X A;  3MEV A;  4C5E A;  2K3Y A;  3MP6 A;  3LX7 A;  4X34 A;  3FEO A;  4IUV A;  5M9O A;  3CEY A;  2RI2 A;  2CKK A;  3MO8 A;  1WJQ A;  2LCC A;  3NTH A;  2QQR A;  2EQK A;  5IN1 A;  4A4G A;  2M0O A;  3GOX A;  2IG0 A;  5C6S A;  2M1H A;  1SSF A;  3OS2 A;  4BDZ A;  3UT1 A;  3P8H A;  4Q5W A;  3OYM A;  4CRI A;  3E9G A;  4BDY A;  3L2U A;  2MWO A;  2EQJ A;  3LYI A;  5D6Y A;  5J26 A;  4C5G A;  5KH6 A;  2HQE A;  4EDU A;  3L2R A;  3L42 A;  2BKD N;  3O8V A;  2LTO A;  1WGS A;  5KCH A;  3OYI A;  3L2V A;  3OYE A;  2JZ2 A;  4E7J A;  2DIQ A;  3F70 A;  3FLG A;  2BUD A;  2VYT A;  1OZ2 A;  2B8A A;  2QQS A;  2RHI A;  3MP1 A;  3OS1 A;  3QII A;  3OYG A;  1OZ3 A;  3Q1J A;  4QQD A;  5CIU A;  4C5I A;  5D6X A;  3ME9 A;  3M9Q A;  2GF7 A;  3OYB A;  2PQW A;  3FDR A;  3OY9 A;  2E5Q A;  2EFI A;  2XDP A;  3KUF A;  2D9T A;  4QW2 A;  2G3R A;  3C4S A;  2DAQ A;  3OYA A;  2RHU A;  4NS5 A;  1MHN A;  2JTF A;  2YRV A;  4QQG A;  4UC4 A;  2R5A A;  2L89 A;  2LVM A;  3ZEH A;  3MEW A;  1H3Z A;  2HQX A;  2LRQ A;  5KCO A;  3FC3 A;  4FU6 A;  3MEU A;  1G5V A;  3OQ5 A;  3DB3 A;  4IUT A;  5IAY A;  3QJ6 A;  4N4G A;  4OVA A;  2RJF A;  3H6Z A;  4C5H A;  5C0M A;  2BIV A;  2M16 A;  2L3R A;  2O4X A;  2RO0 A;  3LGL A;  3QKJ A;  2RHY A;  4II1 A;  4Z02 A;  1RI0 A;  2DIG A;  3OYC A;  4BD3 A;  2EQM A;  3S3M A;  4A4H A;  4ZTJ A; 
#chains in the Genus database with same CATH topology
 1E6G A;  2KE9 A;  3E1S A;  3CCS T;  1IRE B;  2CZ7 B;  1B7T A;  4ZGD B;  5GAO p;  4M77 C;  4XU3 A;  1VQO T;  2QA4 Q;  2J6K A;  4KH1 B;  5DLO A;  7AT1 B;  1QVG P;  2EWN A;  2JMA A;  3M57 A;  5GAN h;  5FU7 C;  4QVZ A;  2CGH A;  2QI2 A;  2YSQ A;  1WA7 A;  1VQP T;  1M4Z A;  2MMP A;  4DOV A;  2RJE A;  4GBQ A;  2E41 A;  5FU6 B;  1D0Y A;  4JJD A;  4MML A;  1YJN T;  3JAM E;  1K8A C;  1QW1 A;  1JXO A;  2CP5 A;  1K9M C;  1V76 A;  2M0Y A;  4KGZ B;  2OTJ A;  3PT9 A;  4ZTF A;  2MOX A;  3HP9 A;  1Y7X A;  2RI3 A;  1M3A A;  3HFO A;  3MP6 A;  2HNI A;  4LDX A;  2DVJ A;  3VS3 A;  4C92 D;  2RMO A;  3MO8 A;  4M7D E;  1JRI A;  1PRM C;  2V8I A;  2HCK A;  5LJ3 j;  1QCF A;  1VQ4 A;  2FZK B;  2MWO A;  1D0Z A;  3EG9 B;  1Q95 G;  4P5N A;  4AFS C;  1WGS A;  3OYI A;  2AK5 A;  2XDD A;  2F69 A;  2IIM A;  3Q1J A;  2ROT A;  1JJ2 S;  1U8R A;  2JJ9 A;  3TU4 K;  2PQW A;  1QCN A;  4ZNX A;  4E47 A;  3OSS C;  1SRM A;  4M7D G;  4ANJ A;  4PJL A;  4J9F A;  3G1J A;  3QWX X;  1I4K 1;  5LJ5 h;  1NYG A;  3A8H B;  5IHN A;  3QKJ A;  1NEB A;  4HKE A;  3V7C A;  4JLI A;  5I11 A;  1WDX A;  3S3M A;  3M0U A;  4XU2 A;  1RAE B;  3QUI A;  2XKO C;  1FYN A;  2KGT A;  1WQW A;  4LXC A;  1A0N B;  5CKD A;  1X01 A;  2ZGW A;  1YFN A;  1QKW A;  2O01 E;  3EG2 A;  3CCR T;  3TEE A;  5EG2 A;  3CBP A;  3S6W A;  2DTO A;  3LLR A;  3RMQ A;  2KK4 A;  2P0K A;  1PG5 B;  2RHX A;  2RJC A;  2VUB A;  3IQL A;  3QBY A;  2P4T A;  3CPF A;  2LNV A;  5GAM f;  2DRM A;  2ESW A;  2L3Q A;  3CCQ A;  3CCM A;  2BZX A;  2EGA A;  4XTX A;  5D7U A;  1KIK A;  2VWF A;  4E7S A;  1LCK A;  3QPH A;  2EYW A;  1JQQ A;  4L59 A;  3MEV A;  4J6Y A;  1I0C A;  2NUP A;  1WI7 A;  2WSC E;  4EMK C;  4RG8 A;  1Y57 A;  1KQS P;  4AMC A;  2M1H A;  4RTU A;  2CDT A;  3OYM A;  4M77 F;  4MZP A;  3TCJ A;  2LX7 A;  1VQ6 A;  2DM1 A;  3OYE A;  2JS0 A;  3FLG A;  1PWT A;  4WF2 A;  1YBY A;  1VYV A;  4C92 E;  2K5L A;  2KXC A;  5CKB A;  1BK2 A;  3G71 T;  3CCL Q;  5CIU A;  3CCV Q;  3M9Q A;  3NMZ C;  4A4K A;  4BI3 A;  3OYB A;  4PJJ A;  4PJO D;  2AHJ B;  1BU1 A;  1UE9 A;  2K4Y A;  3ZFJ A;  2JT4 A;  3SEM A;  4JZ3 A;  3MEW A;  2PTK A;  4F16 A;  2KRS A;  5HK0 A;  1Z9Z A;  4YTL A;  2ZCF B;  5A0G A;  3CXC P;  4OB2 B;  1LOJ A;  2O4X A;  4KUD K;  4LD9 K;  2E65 A;  3OYN A;  3REA B;  4C92 G;  1HK9 A;  2E4H A;  4JPB W;  2QA4 T;  1Q7Y R;  1Q7Y U;  2PUO B;  3E19 A;  1K0S A;  2XG8 D;  2R5M A;  1AZG B;  2O4X B;  4BAC A;  1IB8 A;  1OI1 A;  2CP2 A;  3CC4 A;  1N9S A;  4PFZ A;  1AWO A;  1WHM A;  2C0I A;  1YIJ Q;  4E7L A;  1KHI A;  6AT1 B;  1YI2 Q;  3JB9 F;  4JRQ A;  3S3N A;  3I55 A;  5FRM A;  4EMH A;  2KRO A;  2RJD A;  2DL3 A;  3N5B B;  4OMP A;  3CPW P;  2GTO A;  2RQU A;  3JB9 I;  3MCA B;  2EW3 A;  4M75 C;  1AWJ A;  4M78 D;  3P8D A;  4M7A A;  2KQW A;  3T9N A;  2HD0 A;  4FT2 A;  3ULR B;  1JEG A;  4JJC A;  3V7S A;  1SKU B;  1RAH B;  2M0O A;  2K5F A;  1JB0 E;  1VQN A;  3EGU A;  1ZUY A;  1Q7Y C;  1VQK A;  2PUK B;  5GAO m;  3M0S A;  1BI3 A;  1NYF A;  2JZ2 A;  2DFU A;  2VYT A;  5GAN j;  2NUZ A;  1VQ8 A;  4F7U F;  2FZC B;  1VQ5 A;  1WX6 A;  3G7Z A;  3CCU A;  2EFI A;  2XDP A;  1FMK A;  2K5I A;  2V1R A;  1D09 B;  2Y90 A;  2RHU A;  3SB2 A;  2M51 A;  4QQG A;  2A37 A;  1ZSG A;  3FJP A;  1VIE A;  1X69 A;  2QQ9 A;  4JRP A;  2QEX T;  1UGS B;  4X1V A;  3BE3 A;  5GAO l;  2RHY A;  4II1 A;  4FYW B;  3VYH B;  3QYG B;  3LWH A;  2CYZ B;  4B6M A;  1YIT Q;  2GFU A;  1AEY A;  1PD0 A;  5CR2 A;  3CC2 A;  1N27 A;  2PNI A;  4J6W A;  3EFO B;  4C0G A;  4LNP A;  4QT7 A;  2GTJ A;  2KNB B;  2WSE E;  3I56 Q;  4EPC A;  3EHQ A;  3G6E T;  2W0Z A;  4RKU E;  1IXD A;  1KG1 A;  2P0Q A;  1WJS A;  2XD0 A;  5CKE A;  3CCS Q;  3BDL A;  4QVC A;  2RQW A;  2RNA A;  2RH2 A;  1IO6 A;  1O75 A;  1ZUU A;  4GY5 A;  5FRN A;  4M4Z A;  3PFS A;  3H0F A;  1H92 A;  8ATC B;  3E9F A;  3CCE Q;  5KE3 A;  4C8Q D;  1VQP Q;  1Q82 R;  4KBM B;  4JJN K;  3OW2 P;  1Q82 U;  1IRX A;  3CC7 Q;  1XNI A;  5GAO r;  1R0B G;  1RAB B;  2QDL A;  1CKA A;  2X4X A;  3D7S B;  3HHT B;  4Z8A A;  3BY7 A;  3X24 B;  1WJQ A;  2OAU A;  1YCS B;  4M77 A;  2H3J A;  3OS2 A;  1W1F A;  2EKH A;  2JTM A;  1RI9 A;  3EFR A;  4M78 E;  3L2U A;  3PGG A;  5KH6 A;  5GAO q;  2KRN A;  3NHN A;  4D8K A;  1WFW A;  3RKX A;  2QK0 A;  1HYO A;  1I1J A;  1PKS A;  2K2V A;  5LJ3 f;  3MP1 A;  3JV3 A;  3I35 A;  1RL2 A;  3QII A;  5GAM g;  3U23 A;  3CCL T;  5CAI A;  3CCV T;  4C5I A;  2NYS A;  2XID A;  4BI4 A;  3M58 A;  2E12 A;  3GPL A;  1XJW B;  2V8K A;  4AT1 B;  4PFO A;  3CMA Q;  1NM7 A;  1Q81 U;  1BI1 A;  5FU7 B;  3M0P A;  2EQI A;  4PJO B;  2CSQ A;  3H9N A;  5IAY A;  4MZM A;  3JCM W;  4JJB A;  2EIF A;  1GL5 A;  2DIG A;  1U1S A;  4HVU A;  2H8H A;  3E2U A;  4ZTJ A;  3HKS A;  1VQ9 Q;  4IUR A;  3JSC A;  4N4I A;  1U06 A;  4IUQ A;  1UGQ B;  1YWO A;  1FMW A;  1W4S A;  4OGE A;  4HCB A;  4ELZ C;  2BE7 D;  3OMC A;  3VS0 A;  4HT9 A;  2JUF A;  4C92 C;  3J80 E;  1O9S A;  4F7U E;  1YIJ T;  1KQ1 A;  2JW4 A;  3H0I A;  4DEY A;  5GAM d;  2JMC A;  4BUG A;  2HBP A;  2RI5 A;  5KE2 A;  3PNW C;  4KRT A;  4QVD A;  4A4E A;  1AZE A;  3NPF A;  3C95 A;  2NLU A;  2X35 A;  1ACM B;  1KHC A;  2LCS A;  1M3B A;  2A0F B;  3CCR Q;  4JS4 A;  3OMG A;  2RQR A;  2KEA A;  3RR6 A;  3SHW A;  2EPD A;  4C5E A;  4BY6 C;  4GLM A;  1IHW A;  4ZN3 A;  2DVE A;  1Y71 A;  3RES A;  3JCM V;  4F7U G;  1GCQ A;  2YUN A;  5I22 A;  2VXE A;  1PRL C;  2EQK A;  5CKF A;  1U1T A;  1VQL A;  1D1A A;  5CO7 A;  3JRZ A;  4M7D D;  5AT1 B;  1S72 Q;  3PIP A;  1VQ7 T;  2DIQ A;  1IZ6 A;  2HZY A;  2LQW A;  5FWC A;  1UEC A;  3V8K A;  3EFS A;  2BZ8 A;  3VYG A;  1EIF A;  1X6B A;  1KQS S;  1N6A A;  1SHG A;  4XQ3 A;  4JZ4 A;  1X27 A;  5GMK m;  4RTV A;  2D0N A;  1M8M A;  2FRY A;  3VJP A;  4F04 B;  1ZA2 B;  4J7F A;  2O9V A;  1PM3 A;  3A8M B;  4OMN A;  2PVG B;  1I5O B;  2FPD A;  2FYK A;  4EMK A;  1IGQ A;  3WVE B;  1YIT T;  5GMK j;  1M2V A;  2AKL A;  2HQH A;  1VYU A;  5HCK A;  3TSW A;  3CXC S;  4E7H A;  3MHX A;  1BIB A;  2HDA A;  5I2S A;  3I56 T;  2JN0 A;  4IUU A;  3EGX B;  5DLQ E;  2AT1 B;  1ZQ1 A;  2M02 A;  2NWM A;  2FG0 A;  1QVF P;  3CCJ A;  3OYK A;  1WZO A;  2AZV A;  4CC2 A;  2RQT A;  2P4R A;  4XTU A;  1Y0M A;  2DEQ A;  4FYX B;  4PJN A;  4J9E A;  4BE1 A;  4HCK A;  4MDX A;  3CCE T;  2K79 A;  1UGV A;  3CC7 T;  2VXF A;  4PL6 A;  4PJO C;  5IXB A;  4B9X A;  2X4W A;  2CSI A;  2ENM A;  3OSV A;  4D8D A;  1VOM A;  3CCQ T;  3CCM T;  3NTH A;  1C6V X;  4BDZ A;  3CPW S;  3M56 A;  2BKD N;  1K73 R;  1K73 U;  3RKW A;  2BUD A;  3EG9 A;  3P8B B;  2C0T A;  2A36 A;  4XTZ A;  1SRL A;  1NJI U;  2RM4 A;  1T0H A;  2QQA A;  4M7A F;  5EC7 A;  1SSH A;  3BW1 A;  3VS4 A;  2D9T A;  3CMA T;  4NS5 A;  2J7I A;  1RAD B;  1H3Z A;  2LRQ A;  3ZBD A;  1YJW A;  2LZ6 B;  1IGU A;  4OVA A;  4M75 A;  2M16 A;  5GAN 6;  1NG2 A;  1VQ9 T;  2RN8 A;  2MI6 A;  4PK4 A;  1MV3 A;  2VV5 A;  3PMT A;  2E5K A;  1UTI A;  1WXU A;  2HAX A;  5LJ3 g;  5GMK i;  4M78 C;  2DO3 A;  2QQB A;  4M75 B;  2XK0 A;  1MMA A;  1AD5 A;  2FEI A;  3CD6 Q;  1UG1 A;  1K73 C;  5FRO A;  2QEX Q;  3VRZ A;  3WXM B;  2L8D A;  2OAW A;  4ZN1 A;  5IH2 A;  1UJY A;  1MNE A;  1WHG A;  3FRN A;  3CME A;  2CH4 A;  2K57 A;  1D1B A;  2ZAE A;  1GCQ C;  3CC4 T;  1QQJ A;  2Z0W A;  4LDU A;  2LQN A;  4A4F A;  4XU1 A;  2KDS A;  5GAM h;  2DXU A;  3FIF A;  2D8H A;  1QMC A;  1JJ2 A;  1NPR A;  3DB4 A;  2HMA A;  1RAI B;  4NL2 A;  4OML A;  3G6E Q;  1X2Q A;  1Y07 A;  1M1G A;  4J83 A;  1BKB A;  3L1A A;  2KYB A;  2IG0 A;  2EGC A;  2MYS A;  4CRI A;  2H3E B;  2PU9 B;  4HT8 A;  3J81 E;  5LJ3 d;  4OMO A;  3OW2 S;  1PD1 A;  4E7J A;  1S72 T;  2I2L A;  2ZPB B;  1VQO A;  1VQN T;  3RER A;  1BI0 A;  2DL5 A;  5LJ3 e;  3JCM P;  1QVP A;  2X9H A;  3FDR A;  2E5Q A;  1YHQ Q;  1LJO A;  1BYM A;  3OYA A;  1Z9Q A;  1VQ8 T;  2HQX A;  1YJN A;  4E7Z A;  2MIO A;  4PNO A;  3CCU T;  3QYH B;  1NE8 A;  5GAN 3;  2RO0 A;  2DET A;  3JCM Q;  2MAM A;  5FLX E;  1PNJ A;  2OX7 A;  1HJD A;  4PJO F;  3G4S Q;  2QGG A;  4PLL A;  4DQ2 A;  3NTI A;  4C8Q C;  1E6H A;  1W2B S;  2RQV A;  2X4Y A;  3A98 A;  2FPF A;  2DER A;  4TVR A;  1M8V A;  4N0A C;  2E6Z A;  3MKD A;  4LD6 A;  2DX1 A;  4M7A E;  1MMG A;  4AFZ C;  2OTL Q;  2JXB A;  2AKK A;  1TOV A;  3MET A;  1LNX A;  1XQH A;  4BE0 A;  5D6W A;  4WCI A;  4ATO A;  1OPL A;  3OYY A;  2EYY A;  4L6V 5;  4RTX A;  1B07 A;  2E64 A;  1T3L A;  2CP3 A;  1BCM A;  2F2V A;  4OMF B;  2JM9 A;  1I07 A;  3OYD A;  1I5L A;  2RB6 A;  1DJ7 B;  3OYH A;  3I5S A;  2MK5 A;  3BFM A;  2CUB A;  3M4G A;  3PTA A;  4D6W A;  3QO3 A;  2YWW A;  2NUT A;  4CC4 B;  1ABO A;  1AT1 B;  1TSF A;  1W2B A;  3JCM e;  1JBM A;  1OX8 A;  2MF2 A;  1NLO C;  2CKK A;  3EG3 A;  4LDW A;  4M7A G;  2QQR A;  5IN1 A;  2KT1 A;  2DYB A;  2LJ3 A;  2DE0 X;  2OI3 A;  1ZLM A;  1N8R R;  4BDY A;  1N8R U;  5D6Y A;  4ESR A;  3L42 A;  1QWF A;  2PZ1 A;  1XTD A;  1YJ9 A;  2NUT B;  4PJM A;  2DXB A;  1ZHI A;  2VB6 A;  1K0X A;  2A7Y A;  4C92 A;  3UF4 A;  1GBR A;  1G3W A;  4FYY B;  1PCX A;  5GAN 2;  2OTJ Q;  2K3B A;  2L89 A;  3ZEH A;  4ME7 A;  1VQM T;  1RLQ C;  4C92 B;  2JNG A;  4N4G A;  3H6Z A;  3PVQ A;  1VQ7 Q;  3H41 A;  2BTT A;  1UUE A;  4WTO B;  1VQ4 Q;  3OYC A;  1Y96 A;  2CZ0 B;  4IIO A;  4A4H A;  5L23 A;  5GAN 4;  2R57 A;  1WQ7 A;  2DL8 A;  2GQI A;  1C1A A;  2QTX A;  3OBW A;  3A8L B;  3FJ5 A;  2EKO A;  1Q86 R;  1Q86 U;  1FXX A;  2BE9 B;  3QG1 A;  3OYF A;  1R8O B;  4BI8 B;  1JU5 C;  1N8R C;  2KY9 A;  3VV0 A;  4C0D C;  1FMV A;  3CD6 T;  2BZY A;  3EFO A;  3NTK A;  1Y96 B;  5IHI A;  4BY6 B;  3UA6 A;  4LN2 A;  1AHJ B;  5CCA A;  2PVO B;  1QLY A;  1PHT A;  4M7D C;  4JLG A;  4M77 E;  3G71 A;  1RAC B;  3RIR A;  2YLB A;  1OV3 A;  2WAC A;  4B9W A;  2EYZ A;  4R55 A;  4FL6 A;  3REB B;  1QVF S;  2LNH B;  2QYZ A;  2MWP A;  4OB3 B;  4J9D A;  3URG A;  2RA2 A;  1C0M A;  2RD1 A;  4KUL A;  3GF5 A;  1OU9 A;  4AFU C;  1GRI A;  1TS9 A;  2ED0 A;  5CK9 A;  2YLC A;  4J8O A;  2GGR A;  1QVG S;  1KFZ A;  4XTV A;  1HSQ A;  1Q86 C;  5J26 A;  4RTY A;  3NGP A;  4M77 G;  3L2V A;  2QA4 A;  1IHV A;  3X25 B;  4LDY A;  2GNC A;  2V1Q A;  2ZPE B;  5LJ3 h;  2LMJ A;  2E1H A;  2DEU A;  4PFP A;  4QQD A;  5LJ5 j;  3CCQ Q;  1UJ0 A;  3CCM Q;  3GP8 A;  1YHQ T;  1M1K U;  3DLL A;  1AWW A;  2K6D A;  4FIB A;  5GAN e;  1EFN A;  1YCY A;  1RLP C;  2K7A A;  2L3S A;  4F17 A;  3VUZ A;  2SEM A;  4R0K A;  5L8R E;  3MPU B;  4C5H A;  2FVU A;  5GAM j;  3HSB A;  4PJO A;  3HRS A;  1TU0 B;  3G4S T;  1VQ6 Q;  4E7K A;  3I9Q A;  4NOY A;  1Q81 R;  2B86 A;  2RHZ A;  2KXD A;  2DXT A;  5J3B A;  1M9S A;  2CUD A;  5GJV B;  1M90 U;  2GFA A;  1UGP B;  2OTL T;  4BE2 A;  4M75 F;  1Q82 C;  1B34 A;  1EX4 A;  5KYU A;  3JB9 G;  4A63 B;  1AOJ A;  2RK2 A;  4OB1 B;  1MMN A;  3SD4 A;  4RMO A;  3CCJ T;  2C06 A;  2KMT A;  2LQK A;  1W70 A;  3H0H A;  2AZS A;  2R58 A;  3HTR A;  1B34 B;  4RCB A;  1CKB A;  1K4U S;  5KYU B;  2XIC A;  3M5A A;  3LX7 A;  3M54 A;  2L3P A;  2CS7 A;  4HVW A;  2QEX A;  3JCM X;  2COY A;  1SSF A;  1D0X A;  2FB7 A;  3CC4 Q;  2E70 A;  4M78 A;  4E6R A;  2D6F A;  1Q81 C;  2HQE A;  2V26 A;  2X3W D;  4DOW A;  5I21 A;  3F70 A;  2FO0 A;  3I55 Q;  1OZ2 A;  3VRY A;  1G2B A;  4QKU A;  3JCM f;  3OYG A;  4HVV A;  1OZ3 A;  3GNG A;  1PSE A;  3VU3 C;  2OTJ T;  4M78 B;  1M27 C;  4V2S A;  1BB9 A;  2DKG A;  4DEX A;  2VGM A;  3C4S A;  3EHR A;  3R6N A;  2QGF B;  1UB4 A;  2R5A A;  3LWI A;  1KD1 U;  3ZL7 C;  1MV0 B;  5KYN A;  4E2F B;  3RMS A;  1ZX6 A;  1KC8 R;  1KC8 U;  1VQN Q;  1RI0 A;  2DNU A;  1VQ4 T;  3GIB A;  3RNJ A;  2AIR B;  1VQK Q;  3PMI A;  3MJX A;  2F2X A;  4JRK A;  3L2Q A;  3L2W A;  2C0O A;  1YJW T;  4LUE A;  1OPK A;  1WXB A;  3QDR B;  1MND A;  2HL3 A;  1OX9 A;  1VQ8 Q;  2OJ2 A;  2EAY A;  1GXI E;  1VQ5 Q;  3CCU Q;  1PC0 A;  5ECA A;  1X2K A;  2DLP A;  2DD5 A;  3EGX A;  2LT1 A;  1SPK A;  3NFC A;  2KSS A;  2FZG B;  1TWB A;  4RTT A;  2DA9 A;  1VA7 A;  2G6F X;  4JS5 A;  3OA6 A;  3CCL A;  3CCV A;  5GMK l;  4F7U B;  4XTW A;  1KQS A;  3CME T;  2LJ0 A;  2FHD A;  2EJF A;  2ZPG B;  3CC2 Q;  4X34 A;  1G8X A;  5M9O A;  2LP5 A;  5KYW A;  1T3S A;  2DPP B;  1WLP B;  1WIE A;  5GAO n;  3P8H A;  4C8Q A;  2YUQ A;  2CH4 W;  1V29 B;  3O8V A;  2M9U A;  4N0A A;  2LTO A;  4M75 E;  3RBB B;  1KSW A;  2VAS A;  5KYW B;  3V8J A;  3OS1 A;  1T0J A;  4LE9 A;  3CXC A;  3QHS A;  4X9C A;  2ED1 A;  1W6X A;  2DJZ A;  4C8Q B;  1WYX A;  1GBQ A;  1QCO A;  2YDL A;  1YIJ A;  3M0T A;  2JVV A;  2XHC A;  1YI2 A;  2CP7 A;  2LVM A;  2HSP A;  3VS7 A;  5KYX B;  3MEU A;  3VS1 A;  4IUT A;  1M1F A;  4XK8 E;  1AWX A;  2I0N A;  2LQ8 A;  2L0A A;  2RK1 A;  4DBR A;  4K11 A;  5CQX A;  8AT1 B;  4BD3 A;  4EIK A;  1OUL A;  4C92 F;  1NJI R;  4M75 G;  1BI2 A;  4O6J A;  5GJW B;  1PSF A;  3UWN A;  1VQ6 T;  3QSU A;  2L2P A;  4C0F A;  2J06 A;  2E3H A;  2PVD B;  5GAN f;  3EH1 A;  4N4H A;  3EAE A;  3LGF A;  4FW1 A;  2IVW A;  1BBZ A;  4EMG A;  3QDF A;  1NLP C;  4J6X A;  1VQM Q;  4OP0 A;  4IUP A;  5KYY A;  3VS5 A;  2F2W A;  5CVI A;  1QKX A;  5GMK e;  3CPW A;  4OB0 B;  1YWP A;  2LJ1 A;  1YN8 A;  1LVK A;  4MDW A;  1D3B A;  3PIO A;  4QQ6 A;  5DY9 A;  2EYQ A;  2DK3 A;  1VQ7 A;  3VS2 A;  2EVR A;  4M7A D;  3V7R A;  1WJR A;  2ROL A;  3EGD A;  5IT9 E;  3OB9 A;  1VIF A;  5KYY B;  4RUG A;  4L5G A;  2HKQ B;  5FWB A;  3C12 A;  2QTV A;  2LX9 A;  3DKM A;  3RDV A;  1MGQ A;  3JCM b;  2KYM A;  1WPY A;  1D3B B;  2YXY A;  2VVK A;  2XI9 A;  3FEO A;  4GLK A;  3CEY A;  1UHC A;  1NJI C;  3EGD B;  1QWE A;  2LCC A;  3GOX A;  1G83 A;  4Z88 A;  2DZ9 A;  1YNZ A;  4C5G A;  2DTI A;  2X3X D;  1G3S A;  1YIT A;  3I55 T;  2JS2 A;  2RPN A;  4CC7 A;  3UPU A;  2P84 A;  2EGE A;  1RUW A;  2FL7 A;  4RCC A;  4F14 A;  3TQ7 P;  3I56 A;  2DIL A;  2K9G A;  1YJ9 T;  1QP2 A;  1ZBX A;  4M7D A;  2YRC A;  2CZ1 B;  1WHH A;  2Y4Y A;  3TSZ A;  3CBM A;  3SWN C;  4C0D B;  4MZT A;  1R77 A;  3FC3 A;  3L2Z A;  5LJ5 f;  3CCS A;  2DMO A;  3QJ6 A;  1X43 A;  2EBP A;  3EH2 A;  3RUX A;  2X4J A;  2V8J A;  3ER0 A;  1BCO A;  4DBH A;  1VQK T;  4M7D B;  1VQL Q;  4HA8 A;  3CCE A;  4RTZ A;  1M30 A;  1VQP A;  4ZGE B;  3CC7 A;  1ZBJ A;  1GFC A;  2K3X A;  5A0D A;  2WSF E;  3JCM g;  2ECZ A;  1TUC A;  3JCM c;  3M4Y A;  2DBK A;  1VQ5 T;  2K2M A;  1YP5 A;  2J6O A;  2YUO A;  4ORZ A;  4XTY A;  3C94 A;  4J9B A;  2YHT A;  4RG2 A;  1D1C A;  2KR3 A;  3OW2 A;  4IKF A;  1RAA B;  1X6G A;  3DLM A;  4AFQ C;  3THK A;  2HL5 C;  1NZ9 A;  4M77 D;  2YRD A;  1G3Y A;  3M0R A;  2NUP B;  3CMA A;  4HCZ A;  3HPW A;  4Y91 A;  3CC2 T;  1WHK A;  4KUI A;  1NEG A;  2KVQ G;  1M5Q 1;  4KT0 E;  4LDV A;  5FU6 C;  1UGR B;  1VYT A;  4J9H A;  2MCN A;  4KGX B;  2EQJ A;  4FSX A;  2QAZ A;  1VQ9 A;  3CCJ Q;  1ZUK A;  5DM7 R;  1OU8 A;  1VUB A;  1B3Q A;  5KCH A;  3JCM d;  1KK7 A;  4HCC A;  3X20 B;  2DD4 A;  2RHI A;  5AYF A;  3QXE B;  1MUZ A;  4PKC C;  2DL4 A;  3OY9 A;  3KUF A;  4OMQ A;  2LT4 A;  2DAQ A;  4XU0 A;  2YUP A;  2JTF A;  4DBF A;  1SF9 A;  2JOY A;  4FU6 A;  4M78 F;  3OQ5 A;  3DB3 A;  1G5V A;  3KBG A;  2LCL A;  3UAT A;  4JDS A;  1MMD A;  2VC8 A;  3HL8 A;  3H8Z A;  4OMM A;  4JRI A;  3TVT A;  3CCR A;  1RAG B;  2QDY B;  3JB9 D;  2COW A;  3A8O B;  1TXQ A;  5LL6 S;  3M59 A;  4CI0 C;  4Y92 A;  2YT6 A;  1J3T A;  1ARK A;  3GLX A;  3AT1 B;  4J7I A;  1H8K A;  3OYL A;  4FM4 B;  1TUG B;  1HXD A;  5GMK h;  2QG9 B;  3ASK A;  3BDU A;  1WHJ A;  1S72 A;  2E6N A;  2EQU A;  1YJW Q;  2XMF A;  2JM8 A;  4J9G A;  2W10 A;  4M7A B;  2ZPI B;  3OBY A;  1ZA1 B;  2MPX C;  4E7I A;  2CZ6 B;  2CT4 A;  2D8J A;  2DJQ A;  5GAN g;  1SG5 A;  3GNF B;  2ZPH B;  3M55 A;  3O5Z A;  1U5S A;  2HBW A;  2RI2 A;  1X6O A;  3R6O A;  2FRW A;  1FWZ A;  1JJ2 P;  1EZZ B;  4R56 A;  5HK3 A;  2QAS A;  4J9C A;  4OF1 A;  1M2O A;  3VUB A;  4C0Z A;  1SHF A;  1ZSZ A;  3WVD B;  3UA7 A;  2GBQ A;  3CME Q;  1QP3 A;  4J9I A;  1WNL A;  2B8A A;  2QQS A;  4PJO E;  1JO8 A;  3M53 A;  2QXF A;  2DXC A;  3ME9 A;  4FT4 A;  3EG1 A;  4QW2 A;  1ZSZ B;  2YRV A;  1OQK A;  2O88 A;  3GBQ A;  3UDC A;  2CT3 A;  3VKI A;  4C8Q F;  3J7A F;  5C0M A;  2BIV A;  5A0L A;  4A53 A;  1NPP A;  1VQL T;  1ABQ A;  2D1X A;  5GAN d;  4A54 A;  3HRT A;  3HFN A;  1OYX A;  4PJO G;  4KH0 B;  1HD3 A;  1M1K R;  2FPE A;  2J05 A;  1QVF A;  3MP8 A;  5CKH A;  1VQO Q;  2COZ A;  3AHU A;  2DBM A;  1H64 1;  2SRC A;  1OEB A;  2VKN A;  1TG0 A;  3PVL A;  5GAN 8;  4JUV A;  1F1B B;  3C0C A;  5A2Q E;  1S1N A;  4DA4 A;  2ATC B;  4AG2 C;  3JB9 J;  1QVG A;  2RF0 A;  2A08 A;  4FCY A;  2P0P A;  2LC4 A;  5LJ5 g;  1XOV A;  1YJN Q;  2EYX A;  3QWY A;  1OOT A;  1K1Z A;  2JTE A;  2DL7 A;  3MEA A;  3PE0 A;  3LH0 A;  4AG1 C;  2CP6 A;  1WXT A;  2DRK A;  2KI7 A;  1U3O A;  2Y4X A;  2ZPF B;  5HY6 A;  1I81 A;  4Z89 A;  4NL3 A;  1UDL A;  1M90 R;  2GCX A;  1VQM A;  4M77 B;  1TH7 A;  2K3Y A;  2DTH A;  5FW9 A;  2GQV A;  1G3T A;  2F1L A;  2F5T X;  5C6S A;  2E3I A;  4Q5W A;  1M1K C;  3E9G A;  3LYI A;  1N9R A;  3OS5 A;  2HEQ A;  3CQT A;  1W2B P;  4M78 G;  3CBO A;  2EJG A;  3A5Z B;  3QZ5 B;  5IXF A;  5D6X A;  4M75 D;  3CD6 A;  3JCM h;  1WHL A;  1I8F A;  3FB9 A;  5LJ5 d;  2G3R A;  3JCM J;  1KQ2 A;  1MHN A;  5CQY A;  4VUB A;  3EG0 A;  3TRE A;  1H3H A;  1K9A A;  3INZ A;  4O5V A;  2IPO B;  3A8G B;  3QJY A;  5LJ5 e;  2KRM A;  4Z02 A;  4M7A C;  1PKT A;  5HKC A;  1YI2 T;  1M90 C;  2E10 A;  3LW5 E;  2A3L A;  2X51 A;  2KT8 A;  2HSE B;  2VGN A;  2KAF A;  2LDM A;  1UEB A;  5GAN 5;  1YJ9 Q;  2O2O A;  2ZZD A;  3G6E A;  2CRE A;  4M7D F;  4X9D A;  1AVZ C;  2DYI A;  5GAM e;  1KD1 R;  4ZGJ B;  1N5Z A;  3X26 B;  1X75 C;  1E7O A;  3M0Q A;  4PLI A;  4Y28 E;  4DBQ A;  1FX7 A;  1RAF B;  4FSS A;  3S3O A;  1P92 A;  5J39 A;  2XDB A;  2F5K A;  3OS0 A;  3A1P A;  1K76 A;  4C8Q E;  3SWN A;  1TTH B;  4XAX B;  3X28 B;  3HRU A;  3I5R A;  5IHK A;  1SEM A;  2EJ9 A;  1ZSZ C;  3JB9 H;  4HXJ A;  1YHQ A;  4F7U A;  1KJW A;  3OYJ A;  2CP0 A;  1BIA A;  1UHF A;  4ELY C;  3LH5 A;  3V8L A;  4FW2 A;  3KXT A;  4IUV A;  5I2M A;  4FYV B;  3SWN B;  3SDZ A;  1GFD A;  4A4G A;  3QZ9 B;  3UT1 A;  2J6F A;  3L2R A;  3RKY A;  4EDU A;  1JXM A;  1GCP A;  3G4S A;  4J5Y A;  1KD1 C;  4C8Q G;  4LUD A;  2O31 A;  1R0C B;  3VS6 A;  1KC8 C;  4RTW A;  3G71 Q;  1LPL A;  4KGV B;  1K8A R;  1K8A U;  2GF7 A;  5GAN 7;  1M3C A;  1NBE B;  2DZC A;  2D0Q B;  2DF6 A;  4MMK A;  4IIM A;  1K9M R;  1K9M U;  2A28 A;  2OTL A;  4UC4 A;  1CSK A;  2XU8 A;  1V1C A;  2O9S A;  5KCO A;  1UFF A;  2ABL A;  2L5Q A;  3KFV A;  2KBT A;  2RJF A;  9ATC B;  3SFM A;  2L3R A;  3LGL A;  4CC3 A;  5KYX A;  4EMK B;  1TUD A;  4OGC A;  2HKN A;  4BB7 A;  1M2V B;  2EQM A; 
#chains in the Genus database with same CATH homology
 5GAN 4;  3HKS A;  4HA8 A;  3CCE A;  4IUR A;  3E1S A;  3CCS T;  1IRE B;  1WQ7 A;  2R57 A;  3JSC A;  4N4I A;  2CZ7 B;  4ZGD B;  5GAO p;  1VQP A;  4M77 C;  4XU3 A;  4ZGE B;  2QTX A;  3OBW A;  3CC7 A;  1VQO T;  3A8L B;  4IUQ A;  1UGQ B;  2EKO A;  5DLO A;  2K3X A;  1Q86 U;  5A0D A;  1FXX A;  1W4S A;  3QG1 A;  4OGE A;  3OYF A;  1R8O B;  2EWN A;  2WSF E;  3M57 A;  3JCM g;  4BI8 B;  5GAN h;  1N8R C;  4HCB A;  2KY9 A;  3VV0 A;  4C0D C;  5FU7 C;  3CD6 T;  4QVZ A;  4ELZ C;  3JCM c;  2CGH A;  2QI2 A;  3M4Y A;  3OMC A;  1VQP T;  3NTK A;  1VQ5 T;  1M4Z A;  4HT9 A;  1Y96 B;  2JUF A;  4BY6 B;  2MMP A;  4C92 C;  3J80 E;  1O9S A;  4F7U E;  4DOV A;  1YIJ T;  4XTY A;  2RJE A;  3C94 A;  1KQ1 A;  1AHJ B;  2E41 A;  5FU6 B;  2YHT A;  2PVO B;  5CCA A;  4MML A;  1YJN T;  5GAM d;  3JAM E;  4RG2 A;  1K8A C;  4JLG A;  4M7D C;  3OW2 A;  4M77 E;  4BUG A;  4IKF A;  2HBP A;  1QW1 A;  3G71 A;  2RI5 A;  3DLM A;  1K9M C;  3RIR A;  2YLB A;  5KE2 A;  3PNW C;  4QVD A;  2WAC A;  1NZ9 A;  4A4E A;  4B9W A;  2OTJ A;  3PT9 A;  3C95 A;  4M77 D;  4R55 A;  2NLU A;  4ZTF A;  2X35 A;  4FL6 A;  4M7A G;  1KHC A;  1G3Y A;  1QVF S;  4OB3 B;  3CMA A;  2MWP A;  4HCZ A;  3HPW A;  3HP9 A;  1Y7X A;  4Y91 A;  3URG A;  3OMG A;  2RA2 A;  4JS4 A;  2RD1 A;  4KUL A;  3CC2 T;  2RI3 A;  3HFO A;  3GF5 A;  4KUI A;  4BY6 C;  2KVQ G;  1M5Q 1;  3MP6 A;  2HNI A;  4C5E A;  4LDX A;  4ZN3 A;  2DVE A;  4KT0 E;  4C92 D;  1Y71 A;  4LDV A;  3RES A;  3JCM V;  4F7U G;  3MO8 A;  4M7D E;  2VXE A;  1JRI A;  5FU6 C;  2V8I A;  1UGR B;  5CK9 A;  2EQK A;  2YLC A;  5CKF A;  4J8O A;  5LJ3 j;  1QVG S;  1U1T A;  1VQ4 A;  1VQL A;  4XTV A;  2MWO A;  2EQJ A;  4FSX A;  5CO7 A;  5J26 A;  1Q86 C;  1VQ9 A;  3JRZ A;  4M77 G;  4M7D D;  4P5N A;  5DM7 R;  1VUB A;  1WGS A;  5KCH A;  3OYI A;  3L2V A;  3JCM d;  3PIP A;  1VQ7 T;  2DIQ A;  2QA4 A;  1IZ6 A;  3X25 B;  4HCC A;  3X20 B;  2DD4 A;  2RHI A;  4LDY A;  5AYF A;  3V8K A;  3EFS A;  3VYG A;  3QXE B;  2ZPE B;  5LJ3 h;  1EIF A;  2XDD A;  2F69 A;  2E1H A;  1KQS S;  1N6A A;  3Q1J A;  4PKC C;  4QQD A;  4XQ3 A;  5LJ5 j;  1JJ2 S;  1U8R A;  3TU4 K;  5GMK m;  2PQW A;  3OY9 A;  3GP8 A;  1YHQ T;  3KUF A;  1M1K U;  3DLL A;  2LT4 A;  2DAQ A;  4XU0 A;  4E47 A;  4FIB A;  3VJP A;  2JTF A;  5GAN e;  3OSS C;  4J7F A;  1YCY A;  4M7D G;  3A8M B;  2JOY A;  4FU6 A;  4M78 F;  3OQ5 A;  3DB3 A;  3VUZ A;  1G5V A;  3KBG A;  5L8R E;  1I4K 1;  5LJ5 h;  4C5H A;  2LCL A;  2FVU A;  2PVG B;  3A8H B;  4JDS A;  3QKJ A;  5GAM j;  3HSB A;  4PJO A;  2VC8 A;  4HKE A;  4JLI A;  3HRS A;  3V7C A;  2FYK A;  3S3M A;  3HL8 A;  4EMK A;  3H8Z A;  4XU2 A;  4JRI A;  3G4S T;  3QUI A;  2XKO C;  2QDY B;  3WVE B;  3CCR A;  3JB9 D;  1YIT T;  5GMK j;  3A8O B;  4E7K A;  5LL6 S;  1WQW A;  3M59 A;  4NOY A;  4CI0 C;  5CKD A;  1X01 A;  2ZGW A;  3CXC S;  2RHZ A;  4E7H A;  3MHX A;  1BIB A;  3I56 T;  5I2S A;  3GLX A;  2O01 E;  4J7I A;  2DXT A;  2JN0 A;  3CCR T;  5J3B A;  4IUU A;  3TEE A;  5EG2 A;  3CBP A;  1M9S A;  5DLQ E;  3S6W A;  1ZQ1 A;  3OYL A;  4FM4 B;  1M90 U;  2DTO A;  3LLR A;  3RMQ A;  1HXD A;  2GFA A;  1UGP B;  2KK4 A;  5GMK h;  2OTL T;  4BE2 A;  3ASK A;  2P0K A;  4M75 F;  3CCJ A;  3OYK A;  1Q82 C;  1B34 A;  3BDU A;  2RHX A;  2RJC A;  1S72 A;  2VUB A;  3JB9 G;  4XTU A;  2E6N A;  3QBY A;  2EQU A;  2P4T A;  2DEQ A;  2RK2 A;  3CPF A;  4OB1 B;  2LNV A;  5GAM f;  3SD4 A;  4RMO A;  3CCJ T;  2C06 A;  2KMT A;  2LQK A;  4BE1 A;  3CCQ A;  3CCM A;  4M7A B;  4MDX A;  2ZPI B;  3OBY A;  2R58 A;  4XTX A;  3CCE T;  4E7I A;  1B34 B;  2CZ6 B;  3CC7 T;  2VXF A;  4PL6 A;  4PJO C;  4RCB A;  3QPH A;  4B9X A;  5GAN g;  2X4W A;  4L59 A;  3GNF B;  3MEV A;  2ZPH B;  4J6Y A;  2XIC A;  3M5A A;  3LX7 A;  3OSV A;  3M55 A;  3M54 A;  2CS7 A;  2WSC E;  4EMK C;  3CCQ T;  3CCM T;  4RG8 A;  2RI2 A;  3JCM X;  1X6O A;  2QEX A;  3NTH A;  3R6O A;  1FWZ A;  2M1H A;  1SSF A;  4BDZ A;  3CPW S;  4R56 A;  2FB7 A;  5HK3 A;  2E70 A;  4M78 A;  4M77 F;  3OYM A;  4MZP A;  4OF1 A;  2D6F A;  1Q81 C;  3M56 A;  2HQE A;  3TCJ A;  3VUB A;  4C0Z A;  2BKD N;  3WVD B;  1K73 U;  3RKW A;  1VQ6 A;  3OYE A;  4DOW A;  1QP3 A;  3F70 A;  3FLG A;  5I21 A;  2BUD A;  4WF2 A;  3P8B B;  1YBY A;  1OZ2 A;  1WNL A;  4C92 E;  2B8A A;  2K5L A;  2QQS A;  4PJO E;  5CKB A;  3G71 T;  4XTZ A;  3JCM f;  3OYG A;  1OZ3 A;  3GNG A;  1PSE A;  2RM4 A;  3M53 A;  5CIU A;  3VU3 C;  1NJI U;  2QXF A;  2DXC A;  2QQA A;  3M9Q A;  3ME9 A;  4FT4 A;  4A4K A;  4BI3 A;  4M7A F;  2OTJ T;  3OYB A;  3BW1 A;  4M78 B;  2AHJ B;  4PJO D;  4V2S A;  2K4Y A;  2DKG A;  3ZFJ A;  2D9T A;  4QW2 A;  2VGM A;  3C4S A;  3CMA T;  4NS5 A;  2YRV A;  1UB4 A;  2R5A A;  3MEW A;  3LWI A;  1KD1 U;  1H3Z A;  3UDC A;  2LRQ A;  5HK0 A;  3VKI A;  4C8Q F;  3RMS A;  3ZBD A;  4YTL A;  1YJW A;  3J7A F;  2ZCF B;  5A0G A;  4OVA A;  4M75 A;  4OB2 B;  1KC8 U;  1LOJ A;  5C0M A;  2BIV A;  2M16 A;  2O4X A;  5A0L A;  4KUD K;  4A53 A;  4LD9 K;  1RI0 A;  1NPP A;  1VQ4 T;  3GIB A;  2E65 A;  5GAN 6;  1VQL T;  3OYN A;  3PMI A;  5GAN d;  4A54 A;  1VQ9 T;  2MI6 A;  4JRK A;  3HRT A;  4C92 G;  1HK9 A;  3L2Q A;  3HFN A;  1OYX A;  4PJO G;  3PMT A;  2VV5 A;  3L2W A;  1YJW T;  3QDR B;  2QA4 T;  1QVF A;  3MP8 A;  5CKH A;  2HAX A;  1Q7Y U;  5LJ3 g;  3AHU A;  5GMK i;  4M78 C;  1H64 1;  2PUO B;  3E19 A;  2DO3 A;  2QQB A;  4M75 B;  2XG8 D;  2XK0 A;  5GAN 8;  2R5M A;  4JUV A;  2O4X B;  4BAC A;  2EAY A;  1OI1 A;  1K73 C;  5A2Q E;  1GXI E;  5FRO A;  4DA4 A;  3CC4 A;  1N9S A;  3WXM B;  2L8D A;  3JB9 J;  4ZN1 A;  1QVG A;  4E7L A;  2DD5 A;  1KHI A;  3FRN A;  2LT1 A;  3JB9 F;  3CME A;  2P0P A;  3NFC A;  2K57 A;  2KSS A;  1XOV A;  2LC4 A;  5LJ5 g;  4JRQ A;  3S3N A;  3I55 A;  5FRM A;  4EMH A;  2RJD A;  3CC4 T;  4JS5 A;  4LDU A;  3MEA A;  3OA6 A;  3N5B B;  3CCL A;  3CCV A;  4A4F A;  4XU1 A;  5GMK l;  2KDS A;  3LH0 A;  5GAM h;  4F7U B;  4XTW A;  1KQS A;  2DXU A;  3FIF A;  3CME T;  3JB9 I;  1JJ2 A;  1NPR A;  3DB4 A;  3MCA B;  4M75 C;  2FHD A;  4M78 D;  2EJF A;  2Y4X A;  2ZPF B;  2ZPG B;  1I81 A;  3P8D A;  4NL2 A;  5HY6 A;  4NL3 A;  4M7A A;  2GCX A;  1VQM A;  2KQW A;  4M77 B;  3T9N A;  1TH7 A;  2K3Y A;  4X34 A;  1Y07 A;  2DTH A;  1M1G A;  2HD0 A;  4FT2 A;  5M9O A;  4J83 A;  3V7S A;  1BKB A;  2GQV A;  1G3T A;  2F5T X;  3L1A A;  2M0O A;  2K5F A;  1JB0 E;  2IG0 A;  2DPP B;  5C6S A;  1VQN A;  5GAO n;  3P8H A;  4Q5W A;  4C8Q A;  1M1K C;  4CRI A;  1Q7Y C;  3E9G A;  2PUK B;  1VQK A;  2PU9 B;  3LYI A;  1N9R A;  3OS5 A;  3J81 E;  5LJ3 d;  4HT8 A;  5GAO m;  1V29 B;  3O8V A;  2M9U A;  4N0A A;  1BI3 A;  2LTO A;  3OW2 S;  4E7J A;  1S72 T;  2JZ2 A;  2I2L A;  2ZPB B;  3CBO A;  4M75 E;  4M78 G;  1VQO A;  2VYT A;  5GAN j;  1VQN T;  3RER A;  2EJG A;  1BI0 A;  5LJ3 e;  3V8J A;  3OS1 A;  3JCM P;  3A5Z B;  3QZ5 B;  1QVP A;  1VQ8 A;  4F7U F;  5D6X A;  4M75 D;  3CD6 A;  3CXC A;  3JCM h;  3QHS A;  4X9C A;  1VQ5 A;  2DJZ A;  4C8Q B;  3FDR A;  3G7Z A;  3CCU A;  2E5Q A;  2EFI A;  2XDP A;  1LJO A;  1I8F A;  3FB9 A;  5LJ5 d;  2G3R A;  1YIJ A;  1BYM A;  2K5I A;  2Y90 A;  3OYA A;  3JCM J;  2JVV A;  2RHU A;  2XHC A;  1MHN A;  3SB2 A;  4QQG A;  5CQY A;  1YI2 A;  1KQ2 A;  2LVM A;  4VUB A;  3FJP A;  1VQ8 T;  1VIE A;  2HQX A;  3TRE A;  1YJN A;  2QQ9 A;  4JRP A;  3INZ A;  3MEU A;  4O5V A;  4IUT A;  3A8G B;  4PNO A;  3QJY A;  5LJ5 e;  2QEX T;  1M1F A;  3QYH B;  3CCU T;  1UGS B;  1NE8 A;  5GAN 3;  2RO0 A;  5GAO l;  2RHY A;  4II1 A;  4Z02 A;  2LQ8 A;  4M7A C;  2RK1 A;  2MAM A;  5CQX A;  5FLX E;  5HKC A;  3JCM Q;  1YI2 T;  4BD3 A;  1M90 C;  4C92 F;  2E10 A;  3LW5 E;  4M75 G;  2A3L A;  4PJO F;  3VYH B;  3QYG B;  3LWH A;  2VGN A;  1BI2 A;  4O6J A;  2KAF A;  1PSF A;  2CYZ B;  2LDM A;  3UWN A;  1UEB A;  5GAN 5;  1VQ6 T;  3QSU A;  4PLL A;  4C0F A;  2GFU A;  4DQ2 A;  3NTI A;  2ZZD A;  3G6E A;  5CR2 A;  3CC2 A;  2PVD B;  1N27 A;  4C8Q C;  5GAN f;  4N4H A;  3EAE A;  3LGF A;  4J6W A;  4M7D F;  4X9D A;  1W2B S;  4C0G A;  5GAM e;  2IVW A;  2X4Y A;  4EMG A;  1M8V A;  2WSE E;  4J6X A;  4N0A C;  4TVR A;  4ZGJ B;  2E6Z A;  4LD6 A;  4OP0 A;  4IUP A;  3X26 B;  4EPC A;  5CVI A;  3G6E T;  1X75 C;  4M7A E;  5GMK e;  4RKU E;  1KG1 A;  3CPW A;  4OB0 B;  2P0Q A;  4PLI A;  1WJS A;  4Y28 E;  1FX7 A;  4MDW A;  2XD0 A;  1D3B A;  3PIO A;  5CKE A;  3MET A;  4QQ6 A;  1LNX A;  2EYQ A;  1XQH A;  1P92 A;  2DK3 A;  5DY9 A;  5D6W A;  5J39 A;  4BE0 A;  3S3O A;  1VQ7 A;  2XDB A;  4M7A D;  2F5K A;  4M7D B;  3V7R A;  3OS0 A;  3BDL A;  4QVC A;  4ATO A;  2RH2 A;  4C8Q E;  3SWN A;  1WJR A;  1O75 A;  3OYY A;  4L6V 5;  5IT9 E;  2E64 A;  3OB9 A;  1VIF A;  4XAX B;  4GY5 A;  3HRU A;  3X28 B;  5FRN A;  3PFS A;  4L5G A;  3OYD A;  1I5L A;  4OMF B;  2EJ9 A;  3C12 A;  2RB6 A;  3JB9 H;  1DJ7 B;  3OYH A;  1YHQ A;  3E9F A;  5KE3 A;  2LX9 A;  3BFM A;  4C8Q D;  3DKM A;  3M4G A;  1MGQ A;  3JCM b;  3PTA A;  4KBM B;  1WPY A;  3QO3 A;  1D3B B;  4D6W A;  4F7U A;  3OYJ A;  4JJN K;  1Q82 U;  1BIA A;  1XNI A;  5GAO r;  4ELY C;  2X4X A;  3HHT B;  1W2B A;  3V8L A;  3KXT A;  3JCM e;  2XI9 A;  1JBM A;  3FEO A;  4IUV A;  4GLK A;  3CEY A;  5I2M A;  2MF2 A;  3BY7 A;  1NJI C;  2CKK A;  4LDW A;  3SWN B;  3X24 B;  1WJQ A;  2OAU A;  3SDZ A;  2LCC A;  3GOX A;  2QQR A;  4M77 A;  5IN1 A;  4A4G A;  3QZ9 B;  2H3J A;  3OS2 A;  3UT1 A;  2DZ9 A;  3EFR A;  2JTM A;  4BDY A;  4M78 E;  3L2U A;  3PGG A;  4C5G A;  5D6Y A;  5KH6 A;  5GAO q;  3L2R A;  3RKY A;  1N8R U;  2DTI A;  4EDU A;  3L42 A;  3RKX A;  3G4S A;  1G3S A;  1XTD A;  1YJ9 A;  4J5Y A;  1YIT A;  1KD1 C;  2DXB A;  4C8Q G;  1ZHI A;  2A7Y A;  3I55 T;  4C92 A;  2K2V A;  5LJ3 f;  3UPU A;  3MP1 A;  1KC8 C;  2FL7 A;  1G3W A;  1RL2 A;  3QII A;  4RCC A;  5GAM g;  3CCL T;  3CCV T;  5CAI A;  4C5I A;  3I56 A;  2XID A;  5GAN 2;  1K8A U;  2GF7 A;  3M58 A;  4BI4 A;  1QP2 A;  2E12 A;  1ZBX A;  5GAN 7;  1YJ9 T;  4M7D A;  3GPL A;  2DZC A;  2D0Q B;  2V8K A;  2CZ1 B;  2Y4Y A;  4MMK A;  3CBM A;  1K9M U;  1Q81 U;  3SWN C;  4C0D B;  1BI1 A;  5FU7 B;  4UC4 A;  2OTL A;  4MZT A;  2L89 A;  3ZEH A;  2XU8 A;  4ME7 A;  1VQM T;  3FC3 A;  3L2Z A;  4C92 B;  5KCO A;  5LJ5 f;  4PJO B;  2JNG A;  3CCS A;  2L5Q A;  5IAY A;  3QJ6 A;  4MZM A;  4N4G A;  3JCM W;  2RJF A;  3H6Z A;  2EIF A;  3RUX A;  2X4J A;  3SFM A;  2L3R A;  2V8J A;  3LGL A;  4EMK B;  2DIG A;  1U1S A;  3ER0 A;  3OYC A;  1Y96 A;  2CZ0 B;  4OGC A;  1VQK T;  4BB7 A;  4XK8 E;  2EQM A;  4A4H A;  4ZTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...