1G5VA

Solution structure of the tudor domain of the human smn protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SMN tudor domain structure and its interaction with the Sm proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords SURVIVAL MOTOR NEURON PROTEIN 1
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g5vA00
1G5VA 2LTOA 4IKFA 2EFIA 2D9TA 3S3MA 3E9FA 2R5AA 1WJSA 3OYIA 4E7IA 3OYFA 3OYHA 3NTKA 2GFAA 3MEVA 2LVMA 3FDRA 4BDZA 4II1A 3OYAA 3MEAA 2F5KA 3PNWC 3O8VA 3UWNA 5J26A 2RI5A 5CIUA 3OA6A 4FL6A 4PLIA 3NTIA 2O4XA 4QVZA 4A4FA 1XNIA 4Q5WA 5FROA 3L2VA 1RI0A 4E7HA 4QW2A 3OYGA 2YRVA 4UC4A 2L89A 4C5HA 3LLRA 3FC3A 2P0KA 2RHYA 2RJCA 3MEUA 2HQXA 5FRMA 3OYBA 3PMTA 2XK0A 2IG0A 3MO8A 3EAEA 2RHZA 1OZ2A 2BIVA 2EQMA 2GF7A 2X35A 3S3NA 3P8HA 2RI2A 2R57A 4C5GA 3OQ5A 4BACA 2EQJA 3LGLA 2BUDA 3META 3L2RA 4ZTJA 4QQDA 2MWPA 2NLUA 3BDLA 1N27A 3OB9A 3DLMA 3OMGA 3QIIA 3QKJA 2LRQA 4BE2A 3MP6A 2B8AA 3MP8A 2RO0A 2LCCA 3LYIA 4FU6A 4LD6A 4N4HA 5D6WA 4A4GA 4EDUA 5M9OA 3OS1A 3QBYA 3LGFA 3M9QA 3KUFA 2X4XA 4C5IA 5KCHA 4B9XA 3FEOA 3DB3A 5D6YA 3GOXA 4E7KA 1OZ3A 2JTFA 3ASKA 4A4EA 4BE0A 2E5QA 4B9WA 4N4GA 3FLGA 1OI1A 2RJFA 2WACA 3OS2A 2X4WA 2EKOA 3OMCA 3OYCA 5J39A 2E6NA 4E7LA 3L2QA 2RJEA 2RHXA 4GY5A 5D6XA 3H6ZA 4NS5A 4X34A 3SD4A 2DIQA 2G3RA 1SSFA 3CEYA 3E9GA 2CKKA 4IUQA 4N4IA 3LH0A 4RG2A 1WJQA 3OYNA 3L2WA 2BKDN 2QQSA 3DB4A 3ME9A 2EQKA 3S3OA 4Z02A 3NTHA 3UT1A 2HQEA 4HCZA 5IAYA 4IURA 4L59A 3OYMA 2K3XA 3LX7A 2FHDA 4CRIA 2GFUA 2M16A 2LDMA 1WJRA 2RJDA 4BD3A 3H8ZA 2R5MA 4QQGA 2R58A 3OYKA 5KE3A 3C4SA 1OYXA 2L3RA 2EQUA 2RI3A 3L2UA 4BE1A 3QJ6A 4E7JA 3PFSA 3OYJA 2VYTA 3P8DA 4PL6A 4BDYA 2K3YA 2JZ2A 2L8DA 4IUPA 3F70A 4ZTFA 1H3ZA 3OS0A 2M1HA 3OYEA 3OY9A 2DAQA 5C0MA 2M0OA 4C5EA 4A4HA 3MP1A 5C6SA 4IUUA 2RHUA 1MHNA 2XDPA 3PMIA 2MWOA 3MEWA 4OVAA 5KCOA 5FRNA 1WGSA 1KHCA 4IUTA 4IUVA 5KE2A 3S6WA 3OYDA 4QQ6A 2O4XB 3Q1JA 5IN1A 2RHIA 3L42A 2DIGA 2X4YA 3OYLA 3ZEHA 2QQRA 2PQWA 4PLLA 5KH6A
chains in the Genus database with same CATH superfamily
2VC8A 1GCQA 2EFIA 2KEAA 1TUGB 4WTOB 5LJ5d 3E9FA 3SWNA 1WXBA 4M7AD 4FCYA 3CCUA 4PJLA 4Z88A 1V1CA 3A1PA 4LD9K 2O4XA 2VGMA 2GTJA 5FROA 1LNXA 1RI0A 2FZCB 3OYGA 3QWXX 4UC4A 2CUDA 2FRWA 4Z8AA 2P0KA 3MEUA 3NGPA 2M02A 2WSFE 2DLPA 1WHMA 3CCLT 4GLKA 1WFWA 2A3LA 1AD5A 1M1KC 4M78A 3EG0A 2QEXA 2J6OA 2FPEA 3CC4A 1OV3A 2ABLA 3I9QA 1U1TA 1Z9ZA 2LMJA 8ATCB 3JCMQ 5I22A 3MP6A 1Q7YC 2V8KA 3VUZA 4AG1C 3G71A 1YIJT 1LOJA 3DKMA 2PTKA 4L5GA 5KCHA 3CC4T 1ZBJA 4V2SA 3FEOA 2AKLA 3ASKA 2YUPA 2BE9B 3OS2A 2LT4A 2VV5A 1Q81U 1YJ9T 1MV0B 2QQSA 2DBKA 2X4JA 1GBQA 2CP5A 3HP9A 2HKQB 2JTEA 1D1AA 1NPRA 4BUGA 2KAFA 2M16A 3A98A 3CCMQ 2RJDA 2XD0A 3AHUA 3M0TA 1H8KA 1Y96B 3F70A 4O6JA 5LJ3g 2A37A 4A4HA 3CCET 1N5ZA 2KXCA 4C92F 2LJ3A 2RN8A 3MEWA 1QVFP 1BI2A 2RF0A 3M55A 1FXXA 2MIOA 2QK0A 3ER0A 1RAHB 2O4XB 3D7SB 4AFQC 5AYFA 1WJSA 1T0HA 3NTKA 3SWNB 4KULA 2CP0A 3OBYA 4CI0C 4QVDA 3MEAA 3PNWC 2J6FA 3UWNA 4LN2A 2RA2A 2Z0WA 3CCVT 4Q5WA 5FU7B 2YUOA 2YRVA 5IHNA 4C5HA 2HQXA 4ZNXA 1YHQQ 2ZCFB 2VWFA 4M7AB 2E4HA 4OB0B 1C0MA 4C0GA 4RTVA 3GF5A 1UE9A 1VYTA 2DVEA 2XU8A 2FL7A 1SPKA 1ABOA 4ZTJA 4JRQA 2HBPA 4PJOF 2CSIA 2QQ9A 4M75D 1X43A 3A8LB 3SB2A 1UB4A 2EJGA 1VQKQ 2KMTA 1K73U 2M0YA 3CPFA 2CP7A 4PK4A 2KGTA 1I81A 5CAIA 4C8QF 5A0LA 4E7LA 4NS5A 1BYMA 4JPBW 1UUEA 1GBRA 4LE9A 3DB4A 4Z02A 1K8AR 1W70A 5I11A 1KQSA 4JJCA 3PVQA 3H8ZA 1PRLC 1G3SA 2FO0A 3G71T 4J5YA 4XTYA 2H8HA 2VXEA 4RG8A 1HK9A 1H3ZA 1JJ2S 1I5OB 1QP3A 4E6RA 4HXJA 4DBHA 5GMKi 1FMKA 3G7ZA 4DEYA 2DD5A 3RKYA 3FJPA 2VB6A 1MNDA 1KK7A 1BBZA 1LCKA 2QQBA 3Q1JA 1GCQC 2AZSA 2B86A 4KUIA 5LJ3d 4JRIA 1RADB 1BKBA 4II1A 3V7CA 1HD3A 1M3AA 5A2QE 2EYZA 2QQAA 4QW2A 4M7DA 3G4SA 2HL5C 1HJDA 2RHYA 2C0OA 3A8MB 3CMAQ 1VIFA 4XK8E 1M2OA 2L2PA 2NUPA 1K73C 3GP8A 4KH1B 4FYXB 3U23A 3M4GA 2RQVA 3GBQA 2A28A 2YHTA 1TOVA 2PVGB 1N27A 4C8QB 3CCMT 1ZX6A 3JB9J 4BE2A 2JM9A 4QVCA 3CCMA 2YDLA 2PUOB 4M7AC 2DO3A 5GAMd 4OB1B 1PD0A 5CKEA 1X6OA 2MI6A 5I2SA 2ED0A 1MMNA 5KYYA 2DXTA 2QDYB 5J39A 2DJQA 4ELZC 3H0IA 4EMKC 4PJOA 2H3JA 1U8RA 3CBMA 1YI2Q 2XMFA 3ME9A 3NTHA 1Y57A 1RAIB 1FX7A 1OX8A 3A8OB 4C92C 3VYGA 2EYXA 3UATA 5GAMf 2KQWA 1K1ZA 3BY7A 1Y07A 4M75A 2CZ0B 1YITT 3OYEA 1YJNQ 4EMGA 2DAQA 3JB9G 2YRDA 2JUFA 3PMIA 3C94A 4BY6B 2HMAA 1OEBA 3OYLA 1ZSZA 2CZ6B 2OJ2A 1PSEA 2LX7A 1G5VA 2Y4YA 3H0FA 3M53A 4F7UA 2G6FX 2DD4A 5EG2A 4J6XA 3X28B 2LQ8A 5J3BA 2GFAA 1RAGB 2LVMA 1M1FA 2JT4A 3O8VA 1UGPB 5J26A 4PLIA 1LVKA 4FW2A 5KYUA 5LL6S 1PNJA 1K8AU 3URGA 5KYWB 2K2VA 1VQ6A 2DXBA 1BI1A 1YJNT 1VQPQ 2XG8D 2EGEA 3CMAT 5FWBA 4JUVA 4LNPA 1X2KA 3META 1D09B 2KNBB 2HEQA 1IO6A 4LDYA 3OYYA 1BB9A 5GAOn 1YI2T 4JLIA 2X4XA 3HRTA 2MOXA 5KYXB 1G3WA 1M2VB 4AFUC 1NEBA 3OMCA 1MUZA 2DJZA 3QPHA 5GAOq 4F7UB 1RAFB 1FMWA 1JJ2A 1KG1A 2E65A 3LX7A 1AWOA 2ED1A 5GAMh 2R5MA 3CCRT 3E1SA 3JCMg 2VYTA 1MMAA 2IPOB 3REAB 2WSEE 1ABQA 3UA6A 2DRMA 3V8JA 1S72Q 3MP1A 1RABB 2RQTA 1OPLA 5CQXA 2DRKA 4E7ZA 3CCSQ 4JJNK 4WF2A 1R77A 1W2BA 2F1LA 4M78G 2IVWA 3RR6A 1Q81R 4AMCA 1NJIC 1T3LA 2K79A 3ZEHA 3CCQT 5KH6A 2H3EB 1WZOA 2HAXA 3M0RA 1PD1A 2CT4A 4M78E 4J9HA 1GRIA 4BDZA 3JSCA 1H92A 5HY6A 3INZA 2A36A 1B34B 1CKBA 2RI5A 3JCMf 1GXIE 1EX4A 2L89A 3CMEA 2JXBA 1U5SA 4LDXA 3J7AF 5KYYB 1QVGP 1AWXA 4QKUA 2K5FA 2QDLA 3EGXA 5LJ5j 4M7DG 1OZ2A 3QDFA 4AG2C 1KD1C 5GAN4 1D0XA 3S3NA 1YHQT 2RI2A 2XHCA 4C0DC 3OQ5A 4BACA 5GAOm 4EPCA 3G71Q 2K57A 4OF1A 4F04B 1H641 1AZEA 1M5Q1 5GMKj 1QVPA 1BU1A 2EGCA 2KYBA 2QAZA 3CC2A 3OS1A 2HL3A 3I55A 3CC7A 4ZGEB 1K9MU 1T0JA 4N0AC 5LJ5e 4BE0A 2CP2A 2E5QA 4N4GA 3EG3A 4PJOC 4N0AA 3M0UA 3I56A 1I07A 2DXUA 2RJEA 5D6XA 3QDRB 4N4IA 1AZGB 4RG2A 2LQKA 4PJMA 1VQKT 1S72T 4HA8A 2VVKA 3OYMA 4D8DA 4CRIA 3CCJA 3SDZA 3I35A 2GNCA 4QQGA 3OYKA 1QLYA 2L3RA 2DL5A 2EQUA 2RI3A 4BE1A 1ZHIA 1VQKA 1M3CA 3E2UA 2DTOA 1Y7XA 3VUBA 2MYSA 4E2FB 2M0OA 3GLXA 4J7IA 1VQ9A 2DNUA 1ZSZC 1YJ9Q 2K4YA 1WGSA 2K6DA 3CCVQ 1I4K1 1KD1U 3CMEQ 3FB9A 1WJQA 5IHKA 1KQ1A 2JTMA 3OYAA 1YIJQ 1U1SA 2OAUA 1QVFA 2J06A 5GAN3 3X26B 1QQJA 4OMOA 5DM7R 4M77F 2JS2A 1Q7YU 2RJCA 2IG0A 4OMPA 2CP3A 3MO8A 1ZSGA 3JCMb 1HSQA 2RM4A 4OP0A 4M77B 1VQ8Q 3DLLA 1XTDA 2E10A 1NM7A 2R57A 1GFCA 1EIFA 4MDXA 4JDSA 2KR3A 5M9OA 4M4ZA 1P92A 1PSFA 3I5RA 4B9XA 2DEUA 1D1CA 1F1BB 2EYWA 4E7KA 1PWTA 2GTOA 1SHFA 2CH4A 3CPWA 3RDVA 3CBOA 4LDVA 4X9DA 4IUQA 1SSFA 3E9GA 3TVTA 3RMSA 2EYQA 3CD6Q 1WNLA 4L59A 2FHDA 2FB7A 2DPPB 3G6EA 1WJRA 3ULRB 1TUCA 5AT1B 4OGCA 1PC0A 4HT9A 4NL2A 5IHIA 4ESRA 2F69A 4M75C 2OTJA 1G2BA 4ZTFA 4NOYA 1E6HA 8AT1B 1ZUKA 2E41A 3CCLQ 1ACMB 1M8VA 3EH2A 2Y90A 1SRLA 2MWOA 5KCOA 3CD6A 4RTUA 1MMGA 3VS4A 3O5ZA 4M78D 2YUNA 1D3BB 1UGRB 4XTWA 2DETA 2XICA 1S1NA 4BI4A 2LTOA 3J80E 2XDBA 4J6WA 2AK5A 1TU0B 3EG2A 5IT9E 4KH0B 3CC2T 3HFNA 2YWWA 4EIKA 3MPUB 3SFMA 1NJIR 2E6ZA 2W10A 2RQWA 3N5BB 3OYBA 1MV3A 3V7SA 1V29B 1KQSS 1G8XA 2C0IA 2E12A 2BIVA 2W0ZA 2X35A 1YJNA 3VS7A 3TREA 3CBPA 5HK0A 1YJWA 4C8QC 3BDLA 4M78B 4RTTA 3DLMA 4XU0A 2NUPB 1VQNQ 1VQ7T 4PKCC 1OX9A 2B8AA 4ZN1A 2L3QA 4N4HA 3CC7T 3MHXA 1WQWA 1OU9A 2YRCA 3OW2P 4MZTA 2PVDB 3OW2S 5ECAA 2MCNA 2KRMA 3QZ9B 3UF4A 4A4EA 1X2QA 1OI1A 2BTTA 3OBWA 1BCMA 1OOTA 4LUDA 2E70A 1TXQA 2CZ1B 2L3SA 1VQPA 2KVQG 1WHLA 4M7DD 2DL3A 2EQIA 1QKWA 4EMKB 3BFMA 3JCMJ 1OPKA 1VOMA 5GANh 2K3XA 5FU6B 1VQOA 2SRCA 2R58A 2D8HA 4JZ3A 1KQ2A 3QJ6A 5D7UA 3FRNA 2O88A 1V76A 5GAOl 4M7DE 1K0SA 3OS0A 3M56A 1UHCA 1UJYA 5L23A 4ZGJB 2QEXQ 2FPDA 3HRSA 1FWZA 2KSSA 5FRNA 1M90C 2CS7A 2I0NA 2CUBA 1SEMA 1NG2A 4FSSA 4BB7A 1XOVA 2ZPBB 4EMHA 3M57A 4JRKA 5CVIA 3FIFA 5CKBA 2QQRA 4C92B 3JCMc 2X3WD 3G4SQ 2QA4Q 3JB9H 3S3MA 2FPFA 2C0TA 1VA7A 2DZCA 4OMFB 3SWNC 2DBMA 3OA6A 3CCUQ 3H41A 4B6MA 3EFOA 2HDAA 3VS0A 2DTHA 4A4KA 5GANe 4J83A 3EAEA 2VUBA 3OSSC 4GBQA 2LJ1A 2HQHA 1TH7A 5GJVB 2AHJB 1WX6A 2JN0A 2GBQA 1VIEA 1W2BP 3EG9B 1QWEA 4ZN3A 3LYIA 2LCCA 2LJ0A 2QI2A 1ARKA 5A0DA 3CXCA 5CKDA 5GANg 2OTLA 4M75B 1VQ8A 2YLBA 3JAME 1ZUUA 2YXYA 4AT1B 1WI7A 2VGNA 3BE3A 4C0FA 5LJ3e 4NL3A 2WACA 4A63B 2OI3A 5CO7A 2MAMA 3VJPA 4OMNA 4F14A 3C12A 4DBRA 1M9SA 1HXDA 3CXCP 4M7AF 2HQEA 2ZPFB 4C92A 3M0PA 4CC7A 4BY6C 2LNHB 1IREB 5KE3A 1OYXA 1OQKA 3I55Q 2M51A 1YCSB 2FG0A 5GAN6 2LX9A 4J7FA 4PL6A 2MK5A 4BDYA 2L8DA 4O5VA 3H9NA 2NUTA 2SEMA 1SKUB 2D8JA 3QYHB 3RESA 1M90U 1QVGS 3HRUA 4OVAA 1VQLQ 3OS5A 4MMKA 4J9GA 2I2LA 4M77C 2NUZA 4M75E 3J81E 1QVGA 2BE7D 3HHTB 1GL5A 1MGQA 3EGXB 4C8QE 3MEVA 3VS5A 4ZGDB 1JXMA 4QVZA 2DFUA 1JXOA 3MCAB 5GMKh 2DL7A 1VQMT 1NJIU 3G1JA 2RB6A 4PNOA 2KDSA 1VQ7A 5GMKe 2YUQA 2ECZA 2O9SA 1YJWT 3T9NA 4F7UG 3G4ST 1YBYA 4C92G 3KBGA 4JRPA 4PJJA 4GLMA 4R0KA 3OMGA 2QASA 1YFNA 1VUBA 2JMAA 2RMOA 5GAMe 2BZYA 4LD6A 2DKGA 1XJWB 2HBWA 1KC8R 2OTJQ 5FWCA 1TWBA 2ESWA 2QEXT 2JMCA 1K8AC 4QT7A 5IXBA 1M27C 2FZKB 2KRSA 4AFZC 4PJOB 2XDDA 4PFZA 2LQNA 5FU7C 1WXTA 3SEMA 2RHXA 3L1AA 2LP5A 4IIMA 4JLGA 2G3RA 2ZPGB 1PCXA 1WA7A 4DEXA 1OULA 1YN8A 3CQTA 4E7SA 5IAYA 3PIOA 2QYZA 4BI3A 2FYKA 2ZZDA 4FT4A 2AKKA 1IB8A 5DY9A 3NFCA 2ZPIB 3PFSA 3ZBDA 4C0DB 2O01E 3I56T 5GANj 4IUPA 1R8OB 2A0FB 1JQQA 1JO8A 2CP6A 5CCAA 3GIBA 2KRNA 2ROLA 1X69A 4OB2B 2QG9B 4C92E 4OGEA 3G6ET 4PJOD 1KHCA 4J9DA 2DEQA 3PGGA 1VQ7Q 2JOYA 4KGZB 1M90R 1YCYA 2COZA 3NMZC 3S6WA 3CCST 2DX1A 5IN1A 3L42A 4Y92A 1AEYA 2FZGB 1D1BA 3OYFA 4HCKA 1D0YA 4KRTA 1VQ6Q 4RKUE 4JJDA 3WVEB 1IZ6A 1M30A 5FLXE 2COWA 1NPPA 1RI9A 3LW5E 3NTIA 1XNIA 2E1HA 3A8GB 1UGQB 4XAXB 4OMLA 2RPNA 2X51A 3PMTA 5LJ3f 2DTIA 2FRYA 1VQ6T 3VV0A 2LT1A 2GF7A 3EFRA 2L3PA 1WIEA 3HFOA 2EPDA 5GMKl 4PFOA 2OTLT 3LGLA 4X9CA 3JB9F 1ZSZB 4J9FA 1U06A 3JCMP 2NYSA 2VKNA 1WPYA 3QIIA 1NE8A 3OY9A 5D6WA 3RERA 1QCNA 3QBYA 3LGFA 3QWYA 1TUDA 2CYZB 1WHGA 4FM4B 1JB0E 4RCCA 3GOXA 2F2XA 3PIPA 4C0ZA 3QYGB 1Q95G 2RJFA 3BDUA 2C06A 1Q86U 3THKA 2NWMA 2YT6A 2FEIA 3L2WA 1B7TA 1VQPT 4VUBA 2K3BA 4YTLA 2DERA 1KFZA 2RK1A 2COYA 4HCZA 2P0QA 3TQ7P 4XTZA 2GFUA 2LDMA 2EIFA 1VQ5T 1NZ9A 3EG9A 2JNGA 4FYWB 6AT1B 9ATCB 3OYJA 4JZ4A 2CH4W 2VXFA 4FT2A 3VS6A 1HYOA 1G3TA 1IHVA 2KROA 4LDWA 5C0MA 1O9SA 3X20B 2RQUA 1M4ZA 4IUUA 4F16A 2RHUA 1DJ7B 2XDPA 1VQOT 2BZ8A 3QUIA 1UTIA 4C8QD 1QWFA 3CCJQ 5CQYA 1TS9A 4A53A 4JS4A 5LJ5h 3OYHA 1UG1A 2F5KA 3CPWP 2L5QA 1YI2A 1X75C 3L2VA 3R6NA 3V8KA 4DBQA 1IXDA 1VQ4Q 1W1FA 2XKOC 3VS3A 5FRMA 2DL4A 4MMLA 1SG5A 1AHJB 1VYUA 3RUXA 2V26A 1ZUYA 4RTWA 3M5AA 1Q81C 2MMPA 3MKDA 2BUDA 1N9RA 3EHQA 4M78C 1NLPC 1YHQA 2MWPA 4LUEA 1ZLMA 3C95A 1K4US 3CPWS 1Q82R 2DXCA 3LH5A 4M77E 1PHTA 1AOJA 2LC4A 3WXMB 1KC8C 4AFSC 1PRMC 1LPLA 1R0CB 1YWPA 4HVVA 1E7OA 1TTHB 2EKOA 4HCCA 3SD4A 3H6ZA 1UJ0A 3E19A 2YLCA 4DA4A 5FU6C 1RLQC 2P84A 1AWWA 4IURA 1NLOC 4J9BA 2CSQA 1O75A 3X25B 5HCKA 2D1XA 4XQ3A 2E64A 1UHFA 3VU3C 2QXFA 2J05A 4MZPA 2P4RA 4F7UE 5GAN8 4XTVA 1QVFS 1X27A 2V1RA 5C6SA 1OU8A 4ELYC 4XU1A 3CCVA 1JEGA 4RTXA 3QZ5B 5KE2A 1M1KR 2M9UA 2LCLA 2JJ9A 3VKIA 3JRZA 3TU4K 4E7IA 3WVDB 2DMOA 3OSVA 2J6KA 5GAMg 3JCMV 1VQ9T 3EFOB 3EGDB 2JVVA 5DLQE 1VQLT 1TSFA 1RUWA 3C0CA 2HCKA 1C1AA 3VS2A 1B07A 3CCLA 1K0XA 4KBMB 3P8HA 2QA4T 1XQHA 2ZGWA 4DOVA 4HVUA 3L2RA 2ZPHB 3CMAA 4RTYA 1VQ4T 1FMVA 5GAN5 3ZL7C 1M1KU 3M0QA 1N8RR 3QKJA 1B3QA 3MP8A 1FYNA 4C5IA 1KJWA 3DB3A 4MZMA 2ENMA 5EC7A 1VQ5A 2X3XD 4FYVB 2F5TX 3JCMh 2CREA 4ORZA 5I21A 3EGDA 2K9GA 1GCPA 1UGSB 1YIJA 1X6BA 4GY5A 1VQOQ 1KD1R 4Y28E 2PVOB 2D6FA 2EQKA 3EG1A 1X01A 2DYIA 3PT9A 1UFFA 1WHHA 1AT1B 1YWOA 3C4SA 4IIOA 2AZVA 3TSWA 2EBPA 3M59A 3CCRA 5IXFA 2K3YA 3QXEB 2DZ9A 1D0ZA 3ZFJA 1UEBA 3HPWA 3VS1A 2P0PA 1VQNA 2HD0A 2KYMA 2KXDA 4M7AE 1VQNT 2K5IA 3OYDA 1W2BS 2JM8A 4FSXA 2D0NA 1SRMA 1W4SA 3VYHB 4D6WA 4M7DF 2D9TA 1K9MR 2K2MA 5I2MA 2RQRA 5GJWB 2DYBA 5CIUA 3HL8A 1KC8U 4HCBA 4M75G 4XU3A 2LZ6B 4K11A 3M54A 4KGXB 4M7DC 5GAMj 2EYYA 5LJ3h 3CC2Q 2V1QA 3H0HA 1JRIA 2EQMA 5LJ5g 1VQLA 1WQ7A 1WXUA 4C8QA 5KYNA 3UPUA 3JCMW 1M1GA 1UDLA 4Z89A 4QQDA 1EFNA 2D0QB 5HK3A 3SHWA 2LQWA 4FIBA 3CC4Q 2RO0A 4A4GA 2K7AA 3AT1B 3REBB 2PZ1A 1M8MA 3UDCA 1I0CA 4Y91A 1SSHA 2QGFB 2OAWA 4CC2A 1VQ4A 3R6OA 2HSPA 3FLGA 5GANd 2QA4A 2J7IA 3OYCA 1I8FA 4WCIA 3L2QA 3QJYA 2L0AA 3G6EQ 2HZYA 1C6VX 4XU2A 1WDXA 3HTRA 4L6V5 2BKDN 2LCSA 3CC7Q 1NEGA 5LJ5f 2MPXC 2DVJA 3FJ5A 1G83A 3CD6T 4BD3A 1M3BA 1WHKA 1WYXA 2OTLQ 1Q82C 3HKSA 3GNGA 1NYGA 4PJNA 3P8DA 1E6GA 3QO3A 3V7RA 4HKEA 1SF9A 5A0GA 3QG1A 4HVWA 3RMQA 1MHNA 3RKWA 5GAN2 2BZXA 1GFDA 1UGVA 1YNZA 2KK4A 3PVLA 3KXTA 1U3OA 1ZBXA 3JV3A 4ATOA 4KT0E 4IKFA 2QGGA 1MNEA 4XTXA 1TG0A 3NHNA 1CSKA 4C92D 3LWHA 3CCEA 1BIBA 3UA7A 1KQSP 4FL6A 1M2VA 3JB9D 5CKFA 3MJXA 2F2VA 3LLRA 2WSCE 1QCOA 3JB9I 1VQMA 1YJWQ 2QTXA 3VRYA 4R56A 1PKTA 3JCMX 3NPFA 2CDTA 1S72A 2JW4A 2AT1B 3M0SA 3RKXA 2EJFA 4DQ2A 2VASA 2O9VA 5IH2A 1I5LA 2P4TA 1VQ9Q 4DOWA 4R55A 3M9QA 1N8RU 1Q86R 5D6YA 4M7AA 1OZ3A 2JTFA 4M78F 2EWNA 1Z9QA 1YP5A 2E6NA 2PNIA 4JS5A 4M75F 5KYXA 4M77D 1K73R 3QHSA 1WHJA 3EFSA 2CKKA 3LH0A 3S3OA 4EMKA 2OTJT 3UT1A 4MDWA 3JCMd 1J3TA 4F17A 4DBFA 2RNAA 2ROTA 3LWIA 2DM1A 1QCFA 1IHWA 2DK3A 2EKHA 2CT3A 1RAEB 3GNFB 1Q86C 3M4YA 4F7UF 1VQ8T 7AT1B 1RLPC 2E3IA 3GPLA 5LJ3j 4C5EA 4D8KA 1Q7YR 1Y96A 2GCXA 2XI9A 4J9IA 1A0NB 1VQMQ 2IIMA 3EH1A 1NYFA 2V8IA 3CCSA 2KI7A 1PM3A 4QQ6A 2DIGA 2PQWA 2GQIA 1EZZB 2HKNA 1H3HA 3CXCS 2R5AA 3P8BB 2JS0A 2PU9B 3EGUA 3RIRA 1UECA 3I5SA 5FW9A 1W6XA 2KT8A 4J8OA 1QP2A 3CMET 1Q82U 4RCBA 1BI3A 4HT8A 2V8JA 2A08A 1N9SA 1BK2A 1KHIA 5GMKm 1LJOA 4A54A 2EGAA 3I55T 4CC3A 3CCQQ 1CKAA 2FVUA 5CK9A 2LRQA 2E3HA 3CCUT 4FU6A 4M7AG 1SHGA 1ZQ1A 3KFVA 3KUFA 1T3SA 4PJOE 3CCEQ 2ZPEB 3IQLA 2E5KA 5HKCA 5GAOr 1WLPB 1PKSA 4B9WA 2HSEB 3CCJT 2X4WA 2DA9A 4J9CA 2DL8A 4KUDK 4X34A 2DIQA 3CEYA 2YSQA 2MF2A 5DLOA 1AWJA 2OX7A 1Y0MA 1NBEB 4XTUA 2KT1A 2LNVA 2AIRB 2HNIA 3BW1A 1Y71A 4FW1A 3L2UA 4KGVB 1D3BA 3A8HB 3TEEA 1VQ5Q 2A7YA 2JZ2A 2M1HA 4OMMA 2NUTB 3A5ZB 1N6AA 3L2ZA 4OMQA 1K9AA 2PUKB 3VRZA 4RTZA 4OB3B 4LXCA 1BCOA 4PJOG 3TSZA 2DF6A 4IUTA 3PTAA 4M7DB 2EAYA 2Y4XA 2EVRA 3HSBA 2RHIA 1B34A 1RAAB 1X6GA 3OW2A 4M77A 3OYIA 3EHRA 5KYWA 4RMOA 5GANf 3FDRA 4JJBA 1JJ2P 4BI8B 4ME7A 3RNJA 3PE0A 4A4FA 5KYUB 1JU5C 2GQVA 1YITA 4E7HA 1RL2A 2F2WA 3V8LA 3FC3A 1QKXA 5CR2A 1MMDA 2XK0A 2DE0X 1K9MC 3CCQA 2RHZA 4J9EA 4RUGA 1ZA2B 2DILA 4ANJA 4C5GA 1IRXA 2EQJA 3CCRQ 2O31A 2NLUA 2CZ7B 2RK2A 3OB9A 5CKHA 5GAN7 1YJ9A 1KSWA 4EDUA 2O2OA 2QTVA 2ZAEA 2EW3A 1K76A 4FYYB 2K5LA 1YITQ 2KE9A 4E47A 1G3YA 2RD1A 1PG5B 2KBTA 1BIAA 3QSUA 2CGHA 2XIDA 1I1JA 4TVRA 3OYNA 1VYVA 2ATCB 1AVZC 1ZA1B 2GGRA 3TCJA 3I56Q 1BI0A 1JBMA 1IGQA 4X1VA 1QMCA 4E7JA 4PFPA 1R0BG 4CC4B 1KIKA 3X24B 4J6YA 1IGUA 2KY9A 3M58A 5L8RE 1N8RC 2EJ9A 4LDUA 1QW1A 1RACB 4M77G 5GAOp 4C8QG 4IUVA 3RBBB 2X9HA 4P5NA 3JCMe 2X4YA 2RH2A 4PLLA
chains in the Genus database with same CATH topology
1W4SA 3VYHB 2VC8A 4D6WA 3J81E 1QVGA 2HAXA 2EFIA 5LJ5d 2D9TA 3HHTB 4M7DF 1MGQA 3E9FA 3SWNA 4M78E 4C8QE 5I2MA 4M7AD 3MEVA 3CCUA 4BDZA 3JSCA 5HY6A 4ZGDB 3INZA 1B34B 2RI5A 5CIUA 3HL8A 3JCMf 1KC8U 4LD9K 1GXIE 4QVZA 2O4XA 2VGMA 5FROA 1LNXA 1RI0A 4HCBA 4M75G 3OYGA 4UC4A 3MCAB 2L89A 5GMKh 4XU3A 3CMEA 1VQMT 4LDXA 3J7AF 2P0KA 3MEUA 1NJIU 3M54A 2WSFE 4M7DC 2RB6A 2K5FA 5GAMj 4PNOA 2KDSA 3CCLT 4GLKA 1VQ7A 5LJ3h 2A3LA 5GMKe 5LJ5j 4M7DG 1OZ2A 1JRIA 2EQMA 5LJ5g 1KD1C 1VQLA 1WQ7A 5GAN4 3S3NA 4M78A 4C8QA 2RI2A 1YHQT 2QEXA 3T9NA 1YJWT 2XHCA 4C0DC 3OQ5A 4F7UG 4BACA 3G4ST 1YBYA 4C92G 3KBGA 4EPCA 1M1GA 5GAOm 4JRPA 3UPUA 2K57A 3JCMW 3CC4A 4OF1A 4QQDA 1H641 1M5Q1 1U1TA 3OMGA 2D0QB 1VUBA 5HK3A 5GMKj 1QVPA 3JCMQ 4FIBA 5GAMe 3MP6A 1Q7YC 3CC2A 2V8KA 2RO0A 2DKGA 4LD6A 3VUZA 4A4GA 3OS1A 3G71A 1YIJT 2QEXT 1LOJA 3DKMA 3I55A 3UDCA 4L5GA 5KCHA 3CC4T 4V2SA 1K8AC 3CC7A 3FEOA 4Y91A 4ZGEB 1VQ4A 1K9MU 4N0AC 3R6OA 3ASKA 5LJ5e 4BE0A 4PJOB 2E5QA 4N4GA 2XDDA 3FLGA 5GANd 2QA4A 4PJOC 3OS2A 4N0AA 2LT4A 3OYCA 5FU7C 3I56A 1I8FA 2DXUA 2VV5A 3QJYA 2RJEA 2RHXA 3L1AA 5D6XA 3L2QA 1Q81U 3QDRB 4JLGA 2G3RA 4N4IA 1QVFA 2ZPGB 4RG2A 1YJ9T 2LQKA 4XU2A 4L6V5 2BKDN 2QQSA 1VQKT 2X4JA 3HP9A 5LJ5f 4HA8A 1S72T 5IAYA 3PIOA 4BI3A 3OYMA 1NPRA 4BUGA 4CRIA 2M16A 2FYKA 2KAFA 3SDZA 2RJDA 4BD3A 3CCJA 3CD6T 4QQGA 2ZZDA 3OYKA 4FT4A 2L3RA 2RI3A 2EQUA 1Q82C 4BE1A 2XD0A 5DY9A 1ZHIA 2ZPIB 3HKSA 3NFCA 3PFSA 3ZBDA 4C0DB 3GNGA 1VQKA 2O01E 3AHUA 3P8DA 3I56T 1Y96B 5GANj 4IUPA 3F70A 1R8OB 2DTOA 1Y7XA 4O6JA 3VUBA 3QO3A 5LJ3g 2M0OA 3V7RA 5CCAA 4HKEA 3GIBA 4A4HA 5A0GA 3GLXA 3QG1A 4J7IA 3CCET 1VQ9A 3RMQA 1MHNA 3RKWA 4C92F 3MEWA 5GAN2 2K4YA 4OB2B 4C92E 1WGSA 4OGEA 1BI2A 3G6ET 4PJOD 3M55A 1FXXA 1I4K1 1KHCA 2DEQA 3PGGA 1KD1U 2JOYA 1YCYA 3ER0A 2KK4A 3FB9A 3S6WA 2O4XB 3KXTA 5IN1A 3CCST 3L42A 1ZBXA 1WJQA 4ATOA 4KT0E 4IKFA 4XTXA 5AYFA 1WJSA 3OYFA 1KQ1A 3NTKA 2JTMA 4KULA 3SWNB 3OBYA 4RKUE 4CI0C 4QVDA 3OYAA 3MEAA 3PNWC 4C92D 3LWHA 1U1SA 1IZ6A 2OAUA 3UWNA 3WVEB 3X26B 1BIBA 5FLXE 5GAN3 2RA2A 3CCEA 4FL6A 1NPPA 3LW5E 3NTIA 3CCVT 1XNIA 2E1HA 4Q5WA 3JB9D 5FU7B 3A8GB 2YRVA 1UGQB 5CKFA 4XAXB 5DM7R 4M77F 4C5HA 3LLRA 2WSCE 1Q7YU 2RJCA 2HQXA 3PMTA 3JB9I 5LJ3f 2DTIA 2IG0A 1VQMA 2ZCFB 3MO8A 4M7AB 2QTXA 3JCMb 2RM4A 4OP0A 4M77B 1VQ6T 4R56A 3VV0A 2LT1A 2GF7A 3EFRA 4OB0B 4C0GA 3DLLA 1XTDA 3GF5A 2E10A 3JCMX 2R57A 3HFOA 2DVEA 5GMKl 1S72A 2XU8A 2FL7A 2OTLT 3LGLA 4X9CA 4ZTJA 3JB9F 4JRQA 1EIFA 2HBPA 4PJOF 3RKXA 4DQ2A 2EJFA 2QQ9A 4JDSA 3JCMP 4MDXA 4M75D 1WPYA 3A8LB 3QIIA 1I5LA 1NE8A 2P4TA 5M9OA 3SB2A 3OY9A 5D6WA 1UB4A 2EJGA 3RERA 4DOWA 1P92A 1PSFA 3QBYA 2KMTA 3LGFA 4R55A 1K73U 3M9QA 2CYZB 4FM4B 4B9XA 1N8RU 3CPFA 1JB0E 4RCCA 5D6YA 3GOXA 4M7AA 3PIPA 1OZ3A 2JTFA 4C0ZA 1I81A 4E7KA 5CAIA 4M78F 4C8QF 3CPWA 2EWNA 3QYGB 2RJFA 3BDUA 5A0LA 2C06A 1Q86U 2E6NA 4E7LA 3CBOA 4JS5A 4M75F 4LDVA 4NS5A 4M77D 4X9DA 3QHSA 3EFSA 1SSFA 3E9GA 4IUQA 2CKKA 3L2WA 1VQPT 3LH0A 4VUBA 1BYMA 4YTLA 3RMSA 2EYQA 3DB4A 3S3OA 4EMKA 2OTJT 4Z02A 3UT1A 2RK1A 1WNLA 4HCZA 4MDWA 2P0QA 4L59A 3JCMd 1KQSA 2FHDA 2FB7A 2GFUA 4XTZA 2DPPB 2LDMA 1WJRA 3G6EA 2EIFA 3H8ZA 4OGCA 1G3SA 1VQ5T 1NZ9A 2JNGA 3LWIA 3G71T 4J5YA 4HT9A 4XTYA 2DK3A 4NL2A 3OYJA 2F69A 4M75C 2VXEA 2VXFA 3GNFB 4FT2A 2OTJA 1Q86C 3M4YA 4F7UF 1VQ8T 4RG8A 1HK9A 1H3ZA 1G3TA 4ZTFA 1JJ2S 4NOYA 1QP3A 2E41A 4LDWA 3GPLA 1M8VA 5LJ3j 2Y90A 5C0MA 4C5EA 1Y96A 2GCXA 1O9SA 2XI9A 5GMKi 3X20B 3G7ZA 1M4ZA 4IUUA 2RHUA 1DJ7B 2DD5A 2XDPA 2MWOA 3RKYA 5KCOA 1M1KC 1VQOT 2V8IA 3CCSA 3CD6A 3FJPA 3QUIA 4M78D 4C8QD 1D3BB 2QQBA 4QQ6A 3Q1JA 2DIGA 5CQYA 2PQWA 1UGRB 4XTWA 2XICA 4BI4A 4KUIA 2LTOA 3J80E 4A53A 2XDBA 3CXCS 4J6WA 2R5AA 3P8BB 4JS4A 2PU9B 5LJ5h 5LJ3d 4JRIA 3RIRA 3OYHA 1BKBA 5IT9E 3CC2T 3HFNA 4II1A 2F5KA 2L5QA 1YI2A 3V7CA 1X75C 1QP2A 4J8OA 3CMET 3L2VA 5A2QE 2QQAA 3SFMA 3V8KA 4QW2A 1Q82U 4RCBA 1BI3A 2E6ZA 4HT8A 4M7DA 3G4SA 2XKOC 2V8JA 2RHYA 3N5BB 5FRMA 3OYBA 1N9SA 3A8MB 1KHIA 5GMKm 3V7SA 1V29B 4MMLA 1KQSS 1AHJB 1VIFA 1LJOA 4XK8E 2E12A 2BIVA 3RUXA 1K73C 2X35A 4A54A 3GP8A 1YJNA 1Q81C 3I55T 3M5AA 3M4GA 3TREA 3CBPA 2MMPA 5HK0A 2BUDA 1N9RA 4M78C 4C8QC 2YHTA 1YJWA 1YHQA 2MWPA 2PVGB 2FVUA 3BDLA 1N27A 3C95A 3DLMA 4M78B 4XU0A 4C8QB 3CCMT 3JB9J 3CPWS 5CK9A 1VQ7T 4PKCC 2DXCA 2LRQA 4BE2A 2B8AA 4M77E 4ZN1A 4QVCA 4FU6A 3CCUT 3CCMA 4M7AG 4N4HA 3CC7T 3MHXA 1WQWA 2PUOB 1ZQ1A 2LC4A 3KUFA 4MZTA 2PVDB 3WXMB 3OW2S 1KC8C 4M7AC 4PJOE 2ZPEB 3QZ9B 2DO3A 5GAMd 4OB1B 5HKCA 4A4EA 5GAOr 5CKEA 1X6OA 2MI6A 4B9WA 5I2SA 1OI1A 3OBWA 2DXTA 2QDYB 2X4WA 2E70A 2EKOA 3CCJT 5J39A 2CZ1B 1VQPA 4ELZC 4KUDK 4HCCA 3SD4A 2KVQG 3H6ZA 4X34A 4PJOA 4EMKC 2DIQA 4M7DD 2H3JA 3CEYA 3E19A 1U8RA 2YLCA 3CBMA 5KH6A 3ME9A 4DA4A 2MF2A 4EMKB 3NTHA 5DLOA 5FU6C 3BFMA 3JCMJ 4IURA 1FX7A 5GANh 2K3XA 4XTUA 5FU6B 1VQOA 2LNVA 3A8OB 2HNIA 1O75A 3BW1A 3VYGA 3X25B 1Y71A 4C92C 2R58A 5GAMf 4XQ3A 3L2UA 2E64A 2KQWA 3BY7A 3QJ6A 1KQ2A 3VU3C 2QXFA 1D3BA 3FRNA 3A8HB 3TEEA 5GAOl 4MZPA 4M7DE 1Y07A 4F7UE 2A7YA 2JZ2A 5GAN8 4M75A 3OS0A 2CZ0B 3M56A 2M1HA 4XTVA 3OYEA 1YITT 1QVFS 4EMGA 3A5ZB 2DAQA 1N6AA 3L2ZA 3JB9G 4ZGJB 2JUFA 5C6SA 2PUKB 4ELYC 3HRSA 3PMIA 4XU1A 3C94A 3CCVA 1FWZA 2KSSA 5FRNA 4OB3B 4BY6B 1M90C 2CS7A 4PJOG 3OYLA 4IUTA 2CZ6B 3QZ5B 3PTAA 4M7DB 2EAYA 2Y4XA 4BB7A 1XOVA 2ZPBB 5KE2A 3HSBA 4EMHA 3M57A 4JRKA 5CVIA 1PSEA 3FIFA 2RHIA 5CKBA 2QQRA 2M9UA 4C92B 1B34A 3JCMc 2LCLA 3OW2A 3JB9H 2Y4YA 3VKIA 4M77A 1G5VA 3JRZA 3M53A 4F7UA 3S3MA 3TU4K 5EG2A 2DD4A 3OYIA 4J6XA 3X28B 4E7IA 2LQ8A 5J3BA 2DZCA 3WVDB 2GFAA 4RMOA 2LVMA 3FDRA 3OSVA 4OMFB 5GANf 1M1FA 3SWNC 3O8VA 5GAMg 1UGPB 5J26A 3OA6A 3JCMV 4ME7A 4BI8B 1VQ9T 4PLIA 2JVVA 5DLQE 4A4FA 1VQLT 2GQVA 1YITA 4E7HA 1RL2A 5LL6S 3V8LA 3FC3A 2DTHA 1K8AU 3URGA 5CR2A 2K2VA 4A4KA 5GANe 2XK0A 1VQ6A 1K9MC 2DXBA 1BI1A 4J83A 3CCQA 3EAEA 2RHZA 1YJNT 2VUBA 2XG8D 3OSSC 3CCLA 4KBMB 3CMAT 3P8HA 1TH7A 4C5GA 2QA4T 1XQHA 2EQJA 2AHJB 4JUVA 2ZGWA 4DOVA 3META 3L2RA 2ZPHB 2JN0A 3CMAA 1VQ4T 2NLUA 2CZ7B 1VIEA 2RK2A 3OB9A 4LDYA 5CKHA 5GAN7 5GAN5 1YJ9A 3OYYA 1M1KU 5GAOn 4ZN3A 3QKJA 3MP8A 3LYIA 2LCCA 4EDUA 2QI2A 5A0DA 3CXCA 1YI2T 4JLIA 5CKDA 5GANg 2X4XA 4C5IA 2OTLA 4M75B 1VQ8A 2YLBA 3JAME 3HRTA 3DB3A 2K5LA 4MZMA 1VQ5A 2F5TX 1G3WA 2VGNA 3JCMh 4E47A 5I21A 4C0FA 5LJ3e 4NL3A 2WACA 3OMCA 5CO7A 2MAMA 1G3YA 1UGSB 3VJPA 1YIJA 2RD1A 4GY5A 3QSUA 1BIAA 2CGHA 2DJZA 3C12A 3QPHA 5GAOq 1M9SA 2XIDA 4Y28E 4TVRA 3OYNA 1HXDA 4F7UB 2PVOB 2D6FA 2EQKA 1X01A 4M7AF 2HQEA 2ZPFB 4C92A 1JJ2A 1KG1A 3PT9A 2E65A 3LX7A 5GAMh 4BY6C 1IREB 2R5MA 3TCJA 5KE3A 1BI0A 1JBMA 1OYXA 3C4SA 3E1SA 3CCRT 3JCMg 4E7JA 2VYTA 5GAN6 3M59A 3CCRA 2LX9A 4J7FA 4PL6A 4BDYA 2K3YA 2L8DA 2WSEE 3QXEB 4O5VA 3X24B 4J6YA 2DZ9A 2KY9A 3ZFJA 3M58A 1UEBA 3V8JA 5L8RE 3QYHB 3HPWA 3MP1A 1N8RC 2EJ9A 3RESA 4LDUA 2P0PA 1M90U 1QVGS 5CQXA 1VQNA 3HRUA 4OVAA 4JJNK 2HD0A 4WF2A 1QW1A 4M7AE 4M77G 1W2BA 1VQNT 5GAOp 3OS5A 2IVWA 4IUVA 4M78G 4MMKA 4C8QG 2K5IA 3OYDA 2I2LA 1NJIC 4M77C 4P5NA 3JCMe 1W2BS 4FSXA 2X4YA 2RH2A 3ZEHA 3CCQT 4PLLA 4M75E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G5V A;  2LTO A;  4IKF A;  2EFI A;  2D9T A;  3S3M A;  3E9F A;  2R5A A;  1WJS A;  3OYI A;  4E7I A;  3OYF A;  3OYH A;  3NTK A;  2GFA A;  3MEV A;  2LVM A;  3FDR A;  4BDZ A;  4II1 A;  3OYA A;  3MEA A;  2F5K A;  3PNW C;  3O8V A;  3UWN A;  5J26 A;  2RI5 A;  5CIU A;  3OA6 A;  4FL6 A;  4PLI A;  3NTI A;  2O4X A;  4QVZ A;  4A4F A;  1XNI A;  4Q5W A;  5FRO A;  3L2V A;  1RI0 A;  4E7H A;  4QW2 A;  3OYG A;  2YRV A;  4UC4 A;  2L89 A;  4C5H A;  3LLR A;  3FC3 A;  2P0K A;  2RHY A;  2RJC A;  3MEU A;  2HQX A;  5FRM A;  3OYB A;  3PMT A;  2XK0 A;  2IG0 A;  3MO8 A;  3EAE A;  2RHZ A;  1OZ2 A;  2BIV A;  2EQM A;  2GF7 A;  2X35 A;  3S3N A;  3P8H A;  2RI2 A;  2R57 A;  4C5G A;  3OQ5 A;  4BAC A;  2EQJ A;  3LGL A;  2BUD A;  3MET A;  3L2R A;  4ZTJ A;  4QQD A;  2MWP A;  2NLU A;  3BDL A;  1N27 A;  3OB9 A;  3DLM A;  3OMG A;  3QII A;  3QKJ A;  2LRQ A;  4BE2 A;  3MP6 A;  2B8A A;  3MP8 A;  2RO0 A;  2LCC A;  3LYI A;  4FU6 A;  4LD6 A;  4N4H A;  5D6W A;  4A4G A;  4EDU A;  5M9O A;  3OS1 A;  3QBY A;  3LGF A;  3M9Q A;  3KUF A;  2X4X A;  4C5I A;  5KCH A;  4B9X A;  3FEO A;  3DB3 A;  5D6Y A;  3GOX A;  4E7K A;  1OZ3 A;  2JTF A;  3ASK A;  4A4E A;  4BE0 A;  2E5Q A;  4B9W A;  4N4G A;  3FLG A;  1OI1 A;  2RJF A;  2WAC A;  3OS2 A;  2X4W A;  2EKO A;  3OMC A;  3OYC A;  5J39 A;  2E6N A;  4E7L A;  3L2Q A;  2RJE A;  2RHX A;  4GY5 A;  5D6X A;  3H6Z A;  4NS5 A;  4X34 A;  3SD4 A;  2DIQ A;  2G3R A;  1SSF A;  3CEY A;  3E9G A;  2CKK A;  4IUQ A;  4N4I A;  3LH0 A;  4RG2 A;  1WJQ A;  3OYN A;  3L2W A;  2BKD N;  2QQS A;  3DB4 A;  3ME9 A;  2EQK A;  3S3O A;  4Z02 A;  3NTH A;  3UT1 A;  2HQE A;  4HCZ A;  5IAY A;  4IUR A;  4L59 A;  3OYM A;  2K3X A;  3LX7 A;  2FHD A;  4CRI A;  2GFU A;  2M16 A;  2LDM A;  1WJR A;  2RJD A;  4BD3 A;  3H8Z A;  2R5M A;  4QQG A;  2R58 A;  3OYK A;  5KE3 A;  3C4S A;  1OYX A;  2L3R A;  2EQU A;  2RI3 A;  3L2U A;  4BE1 A;  3QJ6 A;  4E7J A;  3PFS A;  3OYJ A;  2VYT A;  3P8D A;  4PL6 A;  4BDY A;  2K3Y A;  2JZ2 A;  2L8D A;  4IUP A;  3F70 A;  4ZTF A;  1H3Z A;  3OS0 A;  2M1H A;  3OYE A;  3OY9 A;  2DAQ A;  5C0M A;  2M0O A;  4C5E A;  4A4H A;  3MP1 A;  5C6S A;  4IUU A;  2RHU A;  1MHN A;  2XDP A;  3PMI A;  2MWO A;  3MEW A;  4OVA A;  5KCO A;  5FRN A;  1WGS A;  1KHC A;  4IUT A;  4IUV A;  5KE2 A;  3S6W A;  3OYD A;  4QQ6 A;  2O4X B;  3Q1J A;  5IN1 A;  2RHI A;  3L42 A;  2DIG A;  2X4Y A;  3OYL A;  3ZEH A;  2QQR A;  2PQW A;  4PLL A;  5KH6 A; 
#chains in the Genus database with same CATH topology
 2VC8 A;  1GCQ A;  2EFI A;  2KEA A;  1TUG B;  4WTO B;  5LJ5 d;  3E9F A;  3SWN A;  1WXB A;  4M7A D;  4FCY A;  3CCU A;  4PJL A;  4Z88 A;  1V1C A;  3A1P A;  4LD9 K;  2O4X A;  2VGM A;  2GTJ A;  5FRO A;  1LNX A;  1RI0 A;  2FZC B;  3OYG A;  3QWX X;  4UC4 A;  2CUD A;  2FRW A;  4Z8A A;  2P0K A;  3MEU A;  3NGP A;  2M02 A;  2WSF E;  2DLP A;  1WHM A;  3CCL T;  4GLK A;  1WFW A;  2A3L A;  1AD5 A;  1M1K C;  4M78 A;  3EG0 A;  2QEX A;  2J6O A;  2FPE A;  3CC4 A;  1OV3 A;  2ABL A;  3I9Q A;  1U1T A;  1Z9Z A;  2LMJ A;  8ATC B;  3JCM Q;  5I22 A;  3MP6 A;  1Q7Y C;  2V8K A;  3VUZ A;  4AG1 C;  3G71 A;  1YIJ T;  1LOJ A;  3DKM A;  2PTK A;  4L5G A;  5KCH A;  3CC4 T;  1ZBJ A;  4V2S A;  3FEO A;  2AKL A;  3ASK A;  2YUP A;  2BE9 B;  3OS2 A;  2LT4 A;  2VV5 A;  1Q81 U;  1YJ9 T;  1MV0 B;  2QQS A;  2DBK A;  2X4J A;  1GBQ A;  2CP5 A;  3HP9 A;  2HKQ B;  2JTE A;  1D1A A;  1NPR A;  4BUG A;  2KAF A;  2M16 A;  3A98 A;  3CCM Q;  2RJD A;  2XD0 A;  3AHU A;  3M0T A;  1H8K A;  1Y96 B;  3F70 A;  4O6J A;  5LJ3 g;  2A37 A;  4A4H A;  3CCE T;  1N5Z A;  2KXC A;  4C92 F;  2LJ3 A;  2RN8 A;  3MEW A;  1QVF P;  1BI2 A;  2RF0 A;  3M55 A;  1FXX A;  2MIO A;  2QK0 A;  3ER0 A;  1RAH B;  2O4X B;  3D7S B;  4AFQ C;  5AYF A;  1WJS A;  1T0H A;  3NTK A;  3SWN B;  4KUL A;  2CP0 A;  3OBY A;  4CI0 C;  4QVD A;  3MEA A;  3PNW C;  2J6F A;  3UWN A;  4LN2 A;  2RA2 A;  2Z0W A;  3CCV T;  4Q5W A;  5FU7 B;  2YUO A;  2YRV A;  5IHN A;  4C5H A;  2HQX A;  4ZNX A;  1YHQ Q;  2ZCF B;  2VWF A;  4M7A B;  2E4H A;  4OB0 B;  1C0M A;  4C0G A;  4RTV A;  3GF5 A;  1UE9 A;  1VYT A;  2DVE A;  2XU8 A;  2FL7 A;  1SPK A;  1ABO A;  4ZTJ A;  4JRQ A;  2HBP A;  4PJO F;  2CSI A;  2QQ9 A;  4M75 D;  1X43 A;  3A8L B;  3SB2 A;  1UB4 A;  2EJG A;  1VQK Q;  2KMT A;  1K73 U;  2M0Y A;  3CPF A;  2CP7 A;  4PK4 A;  2KGT A;  1I81 A;  5CAI A;  4C8Q F;  5A0L A;  4E7L A;  4NS5 A;  1BYM A;  4JPB W;  1UUE A;  1GBR A;  4LE9 A;  3DB4 A;  4Z02 A;  1K8A R;  1W70 A;  5I11 A;  1KQS A;  4JJC A;  3PVQ A;  3H8Z A;  1PRL C;  1G3S A;  2FO0 A;  3G71 T;  4J5Y A;  4XTY A;  2H8H A;  2VXE A;  4RG8 A;  1HK9 A;  1H3Z A;  1JJ2 S;  1I5O B;  1QP3 A;  4E6R A;  4HXJ A;  4DBH A;  5GMK i;  1FMK A;  3G7Z A;  4DEY A;  2DD5 A;  3RKY A;  3FJP A;  2VB6 A;  1MND A;  1KK7 A;  1BBZ A;  1LCK A;  2QQB A;  3Q1J A;  1GCQ C;  2AZS A;  2B86 A;  4KUI A;  5LJ3 d;  4JRI A;  1RAD B;  1BKB A;  4II1 A;  3V7C A;  1HD3 A;  1M3A A;  5A2Q E;  2EYZ A;  2QQA A;  4QW2 A;  4M7D A;  3G4S A;  2HL5 C;  1HJD A;  2RHY A;  2C0O A;  3A8M B;  3CMA Q;  1VIF A;  4XK8 E;  1M2O A;  2L2P A;  2NUP A;  1K73 C;  3GP8 A;  4KH1 B;  4FYX B;  3U23 A;  3M4G A;  2RQV A;  3GBQ A;  2A28 A;  2YHT A;  1TOV A;  2PVG B;  1N27 A;  4C8Q B;  3CCM T;  1ZX6 A;  3JB9 J;  4BE2 A;  2JM9 A;  4QVC A;  3CCM A;  2YDL A;  2PUO B;  4M7A C;  2DO3 A;  5GAM d;  4OB1 B;  1PD0 A;  5CKE A;  1X6O A;  2MI6 A;  5I2S A;  2ED0 A;  1MMN A;  5KYY A;  2DXT A;  2QDY B;  5J39 A;  2DJQ A;  4ELZ C;  3H0I A;  4EMK C;  4PJO A;  2H3J A;  1U8R A;  3CBM A;  1YI2 Q;  2XMF A;  3ME9 A;  3NTH A;  1Y57 A;  1RAI B;  1FX7 A;  1OX8 A;  3A8O B;  4C92 C;  3VYG A;  2EYX A;  3UAT A;  5GAM f;  2KQW A;  1K1Z A;  3BY7 A;  1Y07 A;  4M75 A;  2CZ0 B;  1YIT T;  3OYE A;  1YJN Q;  4EMG A;  2DAQ A;  3JB9 G;  2YRD A;  2JUF A;  3PMI A;  3C94 A;  4BY6 B;  2HMA A;  1OEB A;  3OYL A;  1ZSZ A;  2CZ6 B;  2OJ2 A;  1PSE A;  2LX7 A;  1G5V A;  2Y4Y A;  3H0F A;  3M53 A;  4F7U A;  2G6F X;  2DD4 A;  5EG2 A;  4J6X A;  3X28 B;  2LQ8 A;  5J3B A;  2GFA A;  1RAG B;  2LVM A;  1M1F A;  2JT4 A;  3O8V A;  1UGP B;  5J26 A;  4PLI A;  1LVK A;  4FW2 A;  5KYU A;  5LL6 S;  1PNJ A;  1K8A U;  3URG A;  5KYW B;  2K2V A;  1VQ6 A;  2DXB A;  1BI1 A;  1YJN T;  1VQP Q;  2XG8 D;  2EGE A;  3CMA T;  5FWB A;  4JUV A;  4LNP A;  1X2K A;  3MET A;  1D09 B;  2KNB B;  2HEQ A;  1IO6 A;  4LDY A;  3OYY A;  1BB9 A;  5GAO n;  1YI2 T;  4JLI A;  2X4X A;  3HRT A;  2MOX A;  5KYX B;  1G3W A;  1M2V B;  4AFU C;  1NEB A;  3OMC A;  1MUZ A;  2DJZ A;  3QPH A;  5GAO q;  4F7U B;  1RAF B;  1FMW A;  1JJ2 A;  1KG1 A;  2E65 A;  3LX7 A;  1AWO A;  2ED1 A;  5GAM h;  2R5M A;  3CCR T;  3E1S A;  3JCM g;  2VYT A;  1MMA A;  2IPO B;  3REA B;  2WSE E;  1ABQ A;  3UA6 A;  2DRM A;  3V8J A;  1S72 Q;  3MP1 A;  1RAB B;  2RQT A;  1OPL A;  5CQX A;  2DRK A;  4E7Z A;  3CCS Q;  4JJN K;  4WF2 A;  1R77 A;  1W2B A;  2F1L A;  4M78 G;  2IVW A;  3RR6 A;  1Q81 R;  4AMC A;  1NJI C;  1T3L A;  2K79 A;  3ZEH A;  3CCQ T;  5KH6 A;  2H3E B;  1WZO A;  2HAX A;  3M0R A;  1PD1 A;  2CT4 A;  4M78 E;  4J9H A;  1GRI A;  4BDZ A;  3JSC A;  1H92 A;  5HY6 A;  3INZ A;  2A36 A;  1B34 B;  1CKB A;  2RI5 A;  3JCM f;  1GXI E;  1EX4 A;  2L89 A;  3CME A;  2JXB A;  1U5S A;  4LDX A;  3J7A F;  5KYY B;  1QVG P;  1AWX A;  4QKU A;  2K5F A;  2QDL A;  3EGX A;  5LJ5 j;  4M7D G;  1OZ2 A;  3QDF A;  4AG2 C;  1KD1 C;  5GAN 4;  1D0X A;  3S3N A;  1YHQ T;  2RI2 A;  2XHC A;  4C0D C;  3OQ5 A;  4BAC A;  5GAO m;  4EPC A;  3G71 Q;  2K57 A;  4OF1 A;  4F04 B;  1H64 1;  1AZE A;  1M5Q 1;  5GMK j;  1QVP A;  1BU1 A;  2EGC A;  2KYB A;  2QAZ A;  3CC2 A;  3OS1 A;  2HL3 A;  3I55 A;  3CC7 A;  4ZGE B;  1K9M U;  1T0J A;  4N0A C;  5LJ5 e;  4BE0 A;  2CP2 A;  2E5Q A;  4N4G A;  3EG3 A;  4PJO C;  4N0A A;  3M0U A;  3I56 A;  1I07 A;  2DXU A;  2RJE A;  5D6X A;  3QDR B;  4N4I A;  1AZG B;  4RG2 A;  2LQK A;  4PJM A;  1VQK T;  1S72 T;  4HA8 A;  2VVK A;  3OYM A;  4D8D A;  4CRI A;  3CCJ A;  3SDZ A;  3I35 A;  2GNC A;  4QQG A;  3OYK A;  1QLY A;  2L3R A;  2DL5 A;  2EQU A;  2RI3 A;  4BE1 A;  1ZHI A;  1VQK A;  1M3C A;  3E2U A;  2DTO A;  1Y7X A;  3VUB A;  2MYS A;  4E2F B;  2M0O A;  3GLX A;  4J7I A;  1VQ9 A;  2DNU A;  1ZSZ C;  1YJ9 Q;  2K4Y A;  1WGS A;  2K6D A;  3CCV Q;  1I4K 1;  1KD1 U;  3CME Q;  3FB9 A;  1WJQ A;  5IHK A;  1KQ1 A;  2JTM A;  3OYA A;  1YIJ Q;  1U1S A;  2OAU A;  1QVF A;  2J06 A;  5GAN 3;  3X26 B;  1QQJ A;  4OMO A;  5DM7 R;  4M77 F;  2JS2 A;  1Q7Y U;  2RJC A;  2IG0 A;  4OMP A;  2CP3 A;  3MO8 A;  1ZSG A;  3JCM b;  1HSQ A;  2RM4 A;  4OP0 A;  4M77 B;  1VQ8 Q;  3DLL A;  1XTD A;  2E10 A;  1NM7 A;  2R57 A;  1GFC A;  1EIF A;  4MDX A;  4JDS A;  2KR3 A;  5M9O A;  4M4Z A;  1P92 A;  1PSF A;  3I5R A;  4B9X A;  2DEU A;  1D1C A;  1F1B B;  2EYW A;  4E7K A;  1PWT A;  2GTO A;  1SHF A;  2CH4 A;  3CPW A;  3RDV A;  3CBO A;  4LDV A;  4X9D A;  4IUQ A;  1SSF A;  3E9G A;  3TVT A;  3RMS A;  2EYQ A;  3CD6 Q;  1WNL A;  4L59 A;  2FHD A;  2FB7 A;  2DPP B;  3G6E A;  1WJR A;  3ULR B;  1TUC A;  5AT1 B;  4OGC A;  1PC0 A;  4HT9 A;  4NL2 A;  5IHI A;  4ESR A;  2F69 A;  4M75 C;  2OTJ A;  1G2B A;  4ZTF A;  4NOY A;  1E6H A;  8AT1 B;  1ZUK A;  2E41 A;  3CCL Q;  1ACM B;  1M8V A;  3EH2 A;  2Y90 A;  1SRL A;  2MWO A;  5KCO A;  3CD6 A;  4RTU A;  1MMG A;  3VS4 A;  3O5Z A;  4M78 D;  2YUN A;  1D3B B;  1UGR B;  4XTW A;  2DET A;  2XIC A;  1S1N A;  4BI4 A;  2LTO A;  3J80 E;  2XDB A;  4J6W A;  2AK5 A;  1TU0 B;  3EG2 A;  5IT9 E;  4KH0 B;  3CC2 T;  3HFN A;  2YWW A;  4EIK A;  3MPU B;  3SFM A;  1NJI R;  2E6Z A;  2W10 A;  2RQW A;  3N5B B;  3OYB A;  1MV3 A;  3V7S A;  1V29 B;  1KQS S;  1G8X A;  2C0I A;  2E12 A;  2BIV A;  2W0Z A;  2X35 A;  1YJN A;  3VS7 A;  3TRE A;  3CBP A;  5HK0 A;  1YJW A;  4C8Q C;  3BDL A;  4M78 B;  4RTT A;  3DLM A;  4XU0 A;  2NUP B;  1VQN Q;  1VQ7 T;  4PKC C;  1OX9 A;  2B8A A;  4ZN1 A;  2L3Q A;  4N4H A;  3CC7 T;  3MHX A;  1WQW A;  1OU9 A;  2YRC A;  3OW2 P;  4MZT A;  2PVD B;  3OW2 S;  5ECA A;  2MCN A;  2KRM A;  3QZ9 B;  3UF4 A;  4A4E A;  1X2Q A;  1OI1 A;  2BTT A;  3OBW A;  1BCM A;  1OOT A;  4LUD A;  2E70 A;  1TXQ A;  2CZ1 B;  2L3S A;  1VQP A;  2KVQ G;  1WHL A;  4M7D D;  2DL3 A;  2EQI A;  1QKW A;  4EMK B;  3BFM A;  3JCM J;  1OPK A;  1VOM A;  5GAN h;  2K3X A;  5FU6 B;  1VQO A;  2SRC A;  2R58 A;  2D8H A;  4JZ3 A;  1KQ2 A;  3QJ6 A;  5D7U A;  3FRN A;  2O88 A;  1V76 A;  5GAO l;  4M7D E;  1K0S A;  3OS0 A;  3M56 A;  1UHC A;  1UJY A;  5L23 A;  4ZGJ B;  2QEX Q;  2FPD A;  3HRS A;  1FWZ A;  2KSS A;  5FRN A;  1M90 C;  2CS7 A;  2I0N A;  2CUB A;  1SEM A;  1NG2 A;  4FSS A;  4BB7 A;  1XOV A;  2ZPB B;  4EMH A;  3M57 A;  4JRK A;  5CVI A;  3FIF A;  5CKB A;  2QQR A;  4C92 B;  3JCM c;  2X3W D;  3G4S Q;  2QA4 Q;  3JB9 H;  3S3M A;  2FPF A;  2C0T A;  1VA7 A;  2DZC A;  4OMF B;  3SWN C;  2DBM A;  3OA6 A;  3CCU Q;  3H41 A;  4B6M A;  3EFO A;  2HDA A;  3VS0 A;  2DTH A;  4A4K A;  5GAN e;  4J83 A;  3EAE A;  2VUB A;  3OSS C;  4GBQ A;  2LJ1 A;  2HQH A;  1TH7 A;  5GJV B;  2AHJ B;  1WX6 A;  2JN0 A;  2GBQ A;  1VIE A;  1W2B P;  3EG9 B;  1QWE A;  4ZN3 A;  3LYI A;  2LCC A;  2LJ0 A;  2QI2 A;  1ARK A;  5A0D A;  3CXC A;  5CKD A;  5GAN g;  2OTL A;  4M75 B;  1VQ8 A;  2YLB A;  3JAM E;  1ZUU A;  2YXY A;  4AT1 B;  1WI7 A;  2VGN A;  3BE3 A;  4C0F A;  5LJ3 e;  4NL3 A;  2WAC A;  4A63 B;  2OI3 A;  5CO7 A;  2MAM A;  3VJP A;  4OMN A;  4F14 A;  3C12 A;  4DBR A;  1M9S A;  1HXD A;  3CXC P;  4M7A F;  2HQE A;  2ZPF B;  4C92 A;  3M0P A;  4CC7 A;  4BY6 C;  2LNH B;  1IRE B;  5KE3 A;  1OYX A;  1OQK A;  3I55 Q;  2M51 A;  1YCS B;  2FG0 A;  5GAN 6;  2LX9 A;  4J7F A;  4PL6 A;  2MK5 A;  4BDY A;  2L8D A;  4O5V A;  3H9N A;  2NUT A;  2SEM A;  1SKU B;  2D8J A;  3QYH B;  3RES A;  1M90 U;  1QVG S;  3HRU A;  4OVA A;  1VQL Q;  3OS5 A;  4MMK A;  4J9G A;  2I2L A;  4M77 C;  2NUZ A;  4M75 E;  3J81 E;  1QVG A;  2BE7 D;  3HHT B;  1GL5 A;  1MGQ A;  3EGX B;  4C8Q E;  3MEV A;  3VS5 A;  4ZGD B;  1JXM A;  4QVZ A;  2DFU A;  1JXO A;  3MCA B;  5GMK h;  2DL7 A;  1VQM T;  1NJI U;  3G1J A;  2RB6 A;  4PNO A;  2KDS A;  1VQ7 A;  5GMK e;  2YUQ A;  2ECZ A;  2O9S A;  1YJW T;  3T9N A;  4F7U G;  3G4S T;  1YBY A;  4C92 G;  3KBG A;  4JRP A;  4PJJ A;  4GLM A;  4R0K A;  3OMG A;  2QAS A;  1YFN A;  1VUB A;  2JMA A;  2RMO A;  5GAM e;  2BZY A;  4LD6 A;  2DKG A;  1XJW B;  2HBW A;  1KC8 R;  2OTJ Q;  5FWC A;  1TWB A;  2ESW A;  2QEX T;  2JMC A;  1K8A C;  4QT7 A;  5IXB A;  1M27 C;  2FZK B;  2KRS A;  4AFZ C;  4PJO B;  2XDD A;  4PFZ A;  2LQN A;  5FU7 C;  1WXT A;  3SEM A;  2RHX A;  3L1A A;  2LP5 A;  4IIM A;  4JLG A;  2G3R A;  2ZPG B;  1PCX A;  1WA7 A;  4DEX A;  1OUL A;  1YN8 A;  3CQT A;  4E7S A;  5IAY A;  3PIO A;  2QYZ A;  4BI3 A;  2FYK A;  2ZZD A;  4FT4 A;  2AKK A;  1IB8 A;  5DY9 A;  3NFC A;  2ZPI B;  3PFS A;  3ZBD A;  4C0D B;  2O01 E;  3I56 T;  5GAN j;  4IUP A;  1R8O B;  2A0F B;  1JQQ A;  1JO8 A;  2CP6 A;  5CCA A;  3GIB A;  2KRN A;  2ROL A;  1X69 A;  4OB2 B;  2QG9 B;  4C92 E;  4OGE A;  3G6E T;  4PJO D;  1KHC A;  4J9D A;  2DEQ A;  3PGG A;  1VQ7 Q;  2JOY A;  4KGZ B;  1M90 R;  1YCY A;  2COZ A;  3NMZ C;  3S6W A;  3CCS T;  2DX1 A;  5IN1 A;  3L42 A;  4Y92 A;  1AEY A;  2FZG B;  1D1B A;  3OYF A;  4HCK A;  1D0Y A;  4KRT A;  1VQ6 Q;  4RKU E;  4JJD A;  3WVE B;  1IZ6 A;  1M30 A;  5FLX E;  2COW A;  1NPP A;  1RI9 A;  3LW5 E;  3NTI A;  1XNI A;  2E1H A;  3A8G B;  1UGQ B;  4XAX B;  4OML A;  2RPN A;  2X51 A;  3PMT A;  5LJ3 f;  2DTI A;  2FRY A;  1VQ6 T;  3VV0 A;  2LT1 A;  2GF7 A;  3EFR A;  2L3P A;  1WIE A;  3HFO A;  2EPD A;  5GMK l;  4PFO A;  2OTL T;  3LGL A;  4X9C A;  3JB9 F;  1ZSZ B;  4J9F A;  1U06 A;  3JCM P;  2NYS A;  2VKN A;  1WPY A;  3QII A;  1NE8 A;  3OY9 A;  5D6W A;  3RER A;  1QCN A;  3QBY A;  3LGF A;  3QWY A;  1TUD A;  2CYZ B;  1WHG A;  4FM4 B;  1JB0 E;  4RCC A;  3GOX A;  2F2X A;  3PIP A;  4C0Z A;  3QYG B;  1Q95 G;  2RJF A;  3BDU A;  2C06 A;  1Q86 U;  3THK A;  2NWM A;  2YT6 A;  2FEI A;  3L2W A;  1B7T A;  1VQP T;  4VUB A;  2K3B A;  4YTL A;  2DER A;  1KFZ A;  2RK1 A;  2COY A;  4HCZ A;  2P0Q A;  3TQ7 P;  4XTZ A;  2GFU A;  2LDM A;  2EIF A;  1VQ5 T;  1NZ9 A;  3EG9 A;  2JNG A;  4FYW B;  6AT1 B;  9ATC B;  3OYJ A;  4JZ4 A;  2CH4 W;  2VXF A;  4FT2 A;  3VS6 A;  1HYO A;  1G3T A;  1IHV A;  2KRO A;  4LDW A;  5C0M A;  1O9S A;  3X20 B;  2RQU A;  1M4Z A;  4IUU A;  4F16 A;  2RHU A;  1DJ7 B;  2XDP A;  1VQO T;  2BZ8 A;  3QUI A;  1UTI A;  4C8Q D;  1QWF A;  3CCJ Q;  5CQY A;  1TS9 A;  4A53 A;  4JS4 A;  5LJ5 h;  3OYH A;  1UG1 A;  2F5K A;  3CPW P;  2L5Q A;  1YI2 A;  1X75 C;  3L2V A;  3R6N A;  3V8K A;  4DBQ A;  1IXD A;  1VQ4 Q;  1W1F A;  2XKO C;  3VS3 A;  5FRM A;  2DL4 A;  4MML A;  1SG5 A;  1AHJ B;  1VYU A;  3RUX A;  2V26 A;  1ZUY A;  4RTW A;  3M5A A;  1Q81 C;  2MMP A;  3MKD A;  2BUD A;  1N9R A;  3EHQ A;  4M78 C;  1NLP C;  1YHQ A;  2MWP A;  4LUE A;  1ZLM A;  3C95 A;  1K4U S;  3CPW S;  1Q82 R;  2DXC A;  3LH5 A;  4M77 E;  1PHT A;  1AOJ A;  2LC4 A;  3WXM B;  1KC8 C;  4AFS C;  1PRM C;  1LPL A;  1R0C B;  1YWP A;  4HVV A;  1E7O A;  1TTH B;  2EKO A;  4HCC A;  3SD4 A;  3H6Z A;  1UJ0 A;  3E19 A;  2YLC A;  4DA4 A;  5FU6 C;  1RLQ C;  2P84 A;  1AWW A;  4IUR A;  1NLO C;  4J9B A;  2CSQ A;  1O75 A;  3X25 B;  5HCK A;  2D1X A;  4XQ3 A;  2E64 A;  1UHF A;  3VU3 C;  2QXF A;  2J05 A;  4MZP A;  2P4R A;  4F7U E;  5GAN 8;  4XTV A;  1QVF S;  1X27 A;  2V1R A;  5C6S A;  1OU8 A;  4ELY C;  4XU1 A;  3CCV A;  1JEG A;  4RTX A;  3QZ5 B;  5KE2 A;  1M1K R;  2M9U A;  2LCL A;  2JJ9 A;  3VKI A;  3JRZ A;  3TU4 K;  4E7I A;  3WVD B;  2DMO A;  3OSV A;  2J6K A;  5GAM g;  3JCM V;  1VQ9 T;  3EFO B;  3EGD B;  2JVV A;  5DLQ E;  1VQL T;  1TSF A;  1RUW A;  3C0C A;  2HCK A;  1C1A A;  3VS2 A;  1B07 A;  3CCL A;  1K0X A;  4KBM B;  3P8H A;  2QA4 T;  1XQH A;  2ZGW A;  4DOV A;  4HVU A;  3L2R A;  2ZPH B;  3CMA A;  4RTY A;  1VQ4 T;  1FMV A;  5GAN 5;  3ZL7 C;  1M1K U;  3M0Q A;  1N8R R;  3QKJ A;  1B3Q A;  3MP8 A;  1FYN A;  4C5I A;  1KJW A;  3DB3 A;  4MZM A;  2ENM A;  5EC7 A;  1VQ5 A;  2X3X D;  4FYV B;  2F5T X;  3JCM h;  2CRE A;  4ORZ A;  5I21 A;  3EGD A;  2K9G A;  1GCP A;  1UGS B;  1YIJ A;  1X6B A;  4GY5 A;  1VQO Q;  1KD1 R;  4Y28 E;  2PVO B;  2D6F A;  2EQK A;  3EG1 A;  1X01 A;  2DYI A;  3PT9 A;  1UFF A;  1WHH A;  1AT1 B;  1YWO A;  3C4S A;  4IIO A;  2AZV A;  3TSW A;  2EBP A;  3M59 A;  3CCR A;  5IXF A;  2K3Y A;  3QXE B;  2DZ9 A;  1D0Z A;  3ZFJ A;  1UEB A;  3HPW A;  3VS1 A;  2P0P A;  1VQN A;  2HD0 A;  2KYM A;  2KXD A;  4M7A E;  1VQN T;  2K5I A;  3OYD A;  1W2B S;  2JM8 A;  4FSX A;  2D0N A;  1SRM A;  1W4S A;  3VYH B;  4D6W A;  4M7D F;  2D9T A;  1K9M R;  2K2M A;  5I2M A;  2RQR A;  5GJW B;  2DYB A;  5CIU A;  3HL8 A;  1KC8 U;  4HCB A;  4M75 G;  4XU3 A;  2LZ6 B;  4K11 A;  3M54 A;  4KGX B;  4M7D C;  5GAM j;  2EYY A;  5LJ3 h;  3CC2 Q;  2V1Q A;  3H0H A;  1JRI A;  2EQM A;  5LJ5 g;  1VQL A;  1WQ7 A;  1WXU A;  4C8Q A;  5KYN A;  3UPU A;  3JCM W;  1M1G A;  1UDL A;  4Z89 A;  4QQD A;  1EFN A;  2D0Q B;  5HK3 A;  3SHW A;  2LQW A;  4FIB A;  3CC4 Q;  2RO0 A;  4A4G A;  2K7A A;  3AT1 B;  3REB B;  2PZ1 A;  1M8M A;  3UDC A;  1I0C A;  4Y91 A;  1SSH A;  2QGF B;  2OAW A;  4CC2 A;  1VQ4 A;  3R6O A;  2HSP A;  3FLG A;  5GAN d;  2QA4 A;  2J7I A;  3OYC A;  1I8F A;  4WCI A;  3L2Q A;  3QJY A;  2L0A A;  3G6E Q;  2HZY A;  1C6V X;  4XU2 A;  1WDX A;  3HTR A;  4L6V 5;  2BKD N;  2LCS A;  3CC7 Q;  1NEG A;  5LJ5 f;  2MPX C;  2DVJ A;  3FJ5 A;  1G83 A;  3CD6 T;  4BD3 A;  1M3B A;  1WHK A;  1WYX A;  2OTL Q;  1Q82 C;  3HKS A;  3GNG A;  1NYG A;  4PJN A;  3P8D A;  1E6G A;  3QO3 A;  3V7R A;  4HKE A;  1SF9 A;  5A0G A;  3QG1 A;  4HVW A;  3RMQ A;  1MHN A;  3RKW A;  5GAN 2;  2BZX A;  1GFD A;  1UGV A;  1YNZ A;  2KK4 A;  3PVL A;  3KXT A;  1U3O A;  1ZBX A;  3JV3 A;  4ATO A;  4KT0 E;  4IKF A;  2QGG A;  1MNE A;  4XTX A;  1TG0 A;  3NHN A;  1CSK A;  4C92 D;  3LWH A;  3CCE A;  1BIB A;  3UA7 A;  1KQS P;  4FL6 A;  1M2V A;  3JB9 D;  5CKF A;  3MJX A;  2F2V A;  3LLR A;  2WSC E;  1QCO A;  3JB9 I;  1VQM A;  1YJW Q;  2QTX A;  3VRY A;  4R56 A;  1PKT A;  3JCM X;  3NPF A;  2CDT A;  1S72 A;  2JW4 A;  2AT1 B;  3M0S A;  3RKX A;  2EJF A;  4DQ2 A;  2VAS A;  2O9V A;  5IH2 A;  1I5L A;  2P4T A;  1VQ9 Q;  4DOW A;  4R55 A;  3M9Q A;  1N8R U;  1Q86 R;  5D6Y A;  4M7A A;  1OZ3 A;  2JTF A;  4M78 F;  2EWN A;  1Z9Q A;  1YP5 A;  2E6N A;  2PNI A;  4JS5 A;  4M75 F;  5KYX A;  4M77 D;  1K73 R;  3QHS A;  1WHJ A;  3EFS A;  2CKK A;  3LH0 A;  3S3O A;  4EMK A;  2OTJ T;  3UT1 A;  4MDW A;  3JCM d;  1J3T A;  4F17 A;  4DBF A;  2RNA A;  2ROT A;  3LWI A;  2DM1 A;  1QCF A;  1IHW A;  2DK3 A;  2EKH A;  2CT3 A;  1RAE B;  3GNF B;  1Q86 C;  3M4Y A;  4F7U F;  1VQ8 T;  7AT1 B;  1RLP C;  2E3I A;  3GPL A;  5LJ3 j;  4C5E A;  4D8K A;  1Q7Y R;  1Y96 A;  2GCX A;  2XI9 A;  4J9I A;  1A0N B;  1VQM Q;  2IIM A;  3EH1 A;  1NYF A;  2V8I A;  3CCS A;  2KI7 A;  1PM3 A;  4QQ6 A;  2DIG A;  2PQW A;  2GQI A;  1EZZ B;  2HKN A;  1H3H A;  3CXC S;  2R5A A;  3P8B B;  2JS0 A;  2PU9 B;  3EGU A;  3RIR A;  1UEC A;  3I5S A;  5FW9 A;  1W6X A;  2KT8 A;  4J8O A;  1QP2 A;  3CME T;  1Q82 U;  4RCB A;  1BI3 A;  4HT8 A;  2V8J A;  2A08 A;  1N9S A;  1BK2 A;  1KHI A;  5GMK m;  1LJO A;  4A54 A;  2EGA A;  3I55 T;  4CC3 A;  3CCQ Q;  1CKA A;  2FVU A;  5CK9 A;  2LRQ A;  2E3H A;  3CCU T;  4FU6 A;  4M7A G;  1SHG A;  1ZQ1 A;  3KFV A;  3KUF A;  1T3S A;  4PJO E;  3CCE Q;  2ZPE B;  3IQL A;  2E5K A;  5HKC A;  5GAO r;  1WLP B;  1PKS A;  4B9W A;  2HSE B;  3CCJ T;  2X4W A;  2DA9 A;  4J9C A;  2DL8 A;  4KUD K;  4X34 A;  2DIQ A;  3CEY A;  2YSQ A;  2MF2 A;  5DLO A;  1AWJ A;  2OX7 A;  1Y0M A;  1NBE B;  4XTU A;  2KT1 A;  2LNV A;  2AIR B;  2HNI A;  3BW1 A;  1Y71 A;  4FW1 A;  3L2U A;  4KGV B;  1D3B A;  3A8H B;  3TEE A;  1VQ5 Q;  2A7Y A;  2JZ2 A;  2M1H A;  4OMM A;  2NUT B;  3A5Z B;  1N6A A;  3L2Z A;  4OMQ A;  1K9A A;  2PUK B;  3VRZ A;  4RTZ A;  4OB3 B;  4LXC A;  1BCO A;  4PJO G;  3TSZ A;  2DF6 A;  4IUT A;  3PTA A;  4M7D B;  2EAY A;  2Y4X A;  2EVR A;  3HSB A;  2RHI A;  1B34 A;  1RAA B;  1X6G A;  3OW2 A;  4M77 A;  3OYI A;  3EHR A;  5KYW A;  4RMO A;  5GAN f;  3FDR A;  4JJB A;  1JJ2 P;  4BI8 B;  4ME7 A;  3RNJ A;  3PE0 A;  4A4F A;  5KYU B;  1JU5 C;  2GQV A;  1YIT A;  4E7H A;  1RL2 A;  2F2W A;  3V8L A;  3FC3 A;  1QKX A;  5CR2 A;  1MMD A;  2XK0 A;  2DE0 X;  1K9M C;  3CCQ A;  2RHZ A;  4J9E A;  4RUG A;  1ZA2 B;  2DIL A;  4ANJ A;  4C5G A;  1IRX A;  2EQJ A;  3CCR Q;  2O31 A;  2NLU A;  2CZ7 B;  2RK2 A;  3OB9 A;  5CKH A;  5GAN 7;  1YJ9 A;  1KSW A;  4EDU A;  2O2O A;  2QTV A;  2ZAE A;  2EW3 A;  1K76 A;  4FYY B;  2K5L A;  1YIT Q;  2KE9 A;  4E47 A;  1G3Y A;  2RD1 A;  1PG5 B;  2KBT A;  1BIA A;  3QSU A;  2CGH A;  2XID A;  1I1J A;  4TVR A;  3OYN A;  1VYV A;  2ATC B;  1AVZ C;  1ZA1 B;  2GGR A;  3TCJ A;  3I56 Q;  1BI0 A;  1JBM A;  1IGQ A;  4X1V A;  1QMC A;  4E7J A;  4PFP A;  1R0B G;  4CC4 B;  1KIK A;  3X24 B;  4J6Y A;  1IGU A;  2KY9 A;  3M58 A;  5L8R E;  1N8R C;  2EJ9 A;  4LDU A;  1QW1 A;  1RAC B;  4M77 G;  5GAO p;  4C8Q G;  4IUV A;  3RBB B;  2X9H A;  4P5N A;  3JCM e;  2X4Y A;  2RH2 A;  4PLL A; 
#chains in the Genus database with same CATH homology
 1W4S A;  3VYH B;  2VC8 A;  4D6W A;  3J81 E;  1QVG A;  2HAX A;  2EFI A;  5LJ5 d;  2D9T A;  3HHT B;  4M7D F;  1MGQ A;  3E9F A;  3SWN A;  4M78 E;  4C8Q E;  5I2M A;  4M7A D;  3MEV A;  3CCU A;  4BDZ A;  3JSC A;  5HY6 A;  4ZGD B;  3INZ A;  1B34 B;  2RI5 A;  5CIU A;  3HL8 A;  3JCM f;  1KC8 U;  4LD9 K;  1GXI E;  4QVZ A;  2O4X A;  2VGM A;  5FRO A;  1LNX A;  1RI0 A;  4HCB A;  4M75 G;  3OYG A;  4UC4 A;  3MCA B;  2L89 A;  5GMK h;  4XU3 A;  3CME A;  1VQM T;  4LDX A;  3J7A F;  2P0K A;  3MEU A;  1NJI U;  3M54 A;  2WSF E;  4M7D C;  2RB6 A;  2K5F A;  5GAM j;  4PNO A;  2KDS A;  3CCL T;  4GLK A;  1VQ7 A;  5LJ3 h;  2A3L A;  5GMK e;  5LJ5 j;  4M7D G;  1OZ2 A;  1JRI A;  2EQM A;  5LJ5 g;  1KD1 C;  1VQL A;  1WQ7 A;  5GAN 4;  3S3N A;  4M78 A;  4C8Q A;  2RI2 A;  1YHQ T;  2QEX A;  3T9N A;  1YJW T;  2XHC A;  4C0D C;  3OQ5 A;  4F7U G;  4BAC A;  3G4S T;  1YBY A;  4C92 G;  3KBG A;  4EPC A;  1M1G A;  5GAO m;  4JRP A;  3UPU A;  2K57 A;  3JCM W;  3CC4 A;  4OF1 A;  4QQD A;  1H64 1;  1M5Q 1;  1U1T A;  3OMG A;  2D0Q B;  1VUB A;  5HK3 A;  5GMK j;  1QVP A;  3JCM Q;  4FIB A;  5GAM e;  3MP6 A;  1Q7Y C;  3CC2 A;  2V8K A;  2RO0 A;  2DKG A;  4LD6 A;  3VUZ A;  4A4G A;  3OS1 A;  3G71 A;  1YIJ T;  2QEX T;  1LOJ A;  3DKM A;  3I55 A;  3UDC A;  4L5G A;  5KCH A;  3CC4 T;  4V2S A;  1K8A C;  3CC7 A;  3FEO A;  4Y91 A;  4ZGE B;  1VQ4 A;  1K9M U;  4N0A C;  3R6O A;  3ASK A;  5LJ5 e;  4BE0 A;  4PJO B;  2E5Q A;  4N4G A;  2XDD A;  3FLG A;  5GAN d;  2QA4 A;  4PJO C;  3OS2 A;  4N0A A;  2LT4 A;  3OYC A;  5FU7 C;  3I56 A;  1I8F A;  2DXU A;  2VV5 A;  3QJY A;  2RJE A;  2RHX A;  3L1A A;  5D6X A;  3L2Q A;  1Q81 U;  3QDR B;  4JLG A;  2G3R A;  4N4I A;  1QVF A;  2ZPG B;  4RG2 A;  1YJ9 T;  2LQK A;  4XU2 A;  4L6V 5;  2BKD N;  2QQS A;  1VQK T;  2X4J A;  3HP9 A;  5LJ5 f;  4HA8 A;  1S72 T;  5IAY A;  3PIO A;  4BI3 A;  3OYM A;  1NPR A;  4BUG A;  4CRI A;  2M16 A;  2FYK A;  2KAF A;  3SDZ A;  2RJD A;  4BD3 A;  3CCJ A;  3CD6 T;  4QQG A;  2ZZD A;  3OYK A;  4FT4 A;  2L3R A;  2RI3 A;  2EQU A;  1Q82 C;  4BE1 A;  2XD0 A;  5DY9 A;  1ZHI A;  2ZPI B;  3HKS A;  3NFC A;  3PFS A;  3ZBD A;  4C0D B;  3GNG A;  1VQK A;  2O01 E;  3AHU A;  3P8D A;  3I56 T;  1Y96 B;  5GAN j;  4IUP A;  3F70 A;  1R8O B;  2DTO A;  1Y7X A;  4O6J A;  3VUB A;  3QO3 A;  5LJ3 g;  2M0O A;  3V7R A;  5CCA A;  4HKE A;  3GIB A;  4A4H A;  5A0G A;  3GLX A;  3QG1 A;  4J7I A;  3CCE T;  1VQ9 A;  3RMQ A;  1MHN A;  3RKW A;  4C92 F;  3MEW A;  5GAN 2;  2K4Y A;  4OB2 B;  4C92 E;  1WGS A;  4OGE A;  1BI2 A;  3G6E T;  4PJO D;  3M55 A;  1FXX A;  1I4K 1;  1KHC A;  2DEQ A;  3PGG A;  1KD1 U;  2JOY A;  1YCY A;  3ER0 A;  2KK4 A;  3FB9 A;  3S6W A;  2O4X B;  3KXT A;  5IN1 A;  3CCS T;  3L42 A;  1ZBX A;  1WJQ A;  4ATO A;  4KT0 E;  4IKF A;  4XTX A;  5AYF A;  1WJS A;  3OYF A;  1KQ1 A;  3NTK A;  2JTM A;  4KUL A;  3SWN B;  3OBY A;  4RKU E;  4CI0 C;  4QVD A;  3OYA A;  3MEA A;  3PNW C;  4C92 D;  3LWH A;  1U1S A;  1IZ6 A;  2OAU A;  3UWN A;  3WVE B;  3X26 B;  1BIB A;  5FLX E;  5GAN 3;  2RA2 A;  3CCE A;  4FL6 A;  1NPP A;  3LW5 E;  3NTI A;  3CCV T;  1XNI A;  2E1H A;  4Q5W A;  3JB9 D;  5FU7 B;  3A8G B;  2YRV A;  1UGQ B;  5CKF A;  4XAX B;  5DM7 R;  4M77 F;  4C5H A;  3LLR A;  2WSC E;  1Q7Y U;  2RJC A;  2HQX A;  3PMT A;  3JB9 I;  5LJ3 f;  2DTI A;  2IG0 A;  1VQM A;  2ZCF B;  3MO8 A;  4M7A B;  2QTX A;  3JCM b;  2RM4 A;  4OP0 A;  4M77 B;  1VQ6 T;  4R56 A;  3VV0 A;  2LT1 A;  2GF7 A;  3EFR A;  4OB0 B;  4C0G A;  3DLL A;  1XTD A;  3GF5 A;  2E10 A;  3JCM X;  2R57 A;  3HFO A;  2DVE A;  5GMK l;  1S72 A;  2XU8 A;  2FL7 A;  2OTL T;  3LGL A;  4X9C A;  4ZTJ A;  3JB9 F;  4JRQ A;  1EIF A;  2HBP A;  4PJO F;  3RKX A;  4DQ2 A;  2EJF A;  2QQ9 A;  4JDS A;  3JCM P;  4MDX A;  4M75 D;  1WPY A;  3A8L B;  3QII A;  1I5L A;  1NE8 A;  2P4T A;  5M9O A;  3SB2 A;  3OY9 A;  5D6W A;  1UB4 A;  2EJG A;  3RER A;  4DOW A;  1P92 A;  1PSF A;  3QBY A;  2KMT A;  3LGF A;  4R55 A;  1K73 U;  3M9Q A;  2CYZ B;  4FM4 B;  4B9X A;  1N8R U;  3CPF A;  1JB0 E;  4RCC A;  5D6Y A;  3GOX A;  4M7A A;  3PIP A;  1OZ3 A;  2JTF A;  4C0Z A;  1I81 A;  4E7K A;  5CAI A;  4M78 F;  4C8Q F;  3CPW A;  2EWN A;  3QYG B;  2RJF A;  3BDU A;  5A0L A;  2C06 A;  1Q86 U;  2E6N A;  4E7L A;  3CBO A;  4JS5 A;  4M75 F;  4LDV A;  4NS5 A;  4M77 D;  4X9D A;  3QHS A;  3EFS A;  1SSF A;  3E9G A;  4IUQ A;  2CKK A;  3L2W A;  1VQP T;  3LH0 A;  4VUB A;  1BYM A;  4YTL A;  3RMS A;  2EYQ A;  3DB4 A;  3S3O A;  4EMK A;  2OTJ T;  4Z02 A;  3UT1 A;  2RK1 A;  1WNL A;  4HCZ A;  4MDW A;  2P0Q A;  4L59 A;  3JCM d;  1KQS A;  2FHD A;  2FB7 A;  2GFU A;  4XTZ A;  2DPP B;  2LDM A;  1WJR A;  3G6E A;  2EIF A;  3H8Z A;  4OGC A;  1G3S A;  1VQ5 T;  1NZ9 A;  2JNG A;  3LWI A;  3G71 T;  4J5Y A;  4HT9 A;  4XTY A;  2DK3 A;  4NL2 A;  3OYJ A;  2F69 A;  4M75 C;  2VXE A;  2VXF A;  3GNF B;  4FT2 A;  2OTJ A;  1Q86 C;  3M4Y A;  4F7U F;  1VQ8 T;  4RG8 A;  1HK9 A;  1H3Z A;  1G3T A;  4ZTF A;  1JJ2 S;  4NOY A;  1QP3 A;  2E41 A;  4LDW A;  3GPL A;  1M8V A;  5LJ3 j;  2Y90 A;  5C0M A;  4C5E A;  1Y96 A;  2GCX A;  1O9S A;  2XI9 A;  5GMK i;  3X20 B;  3G7Z A;  1M4Z A;  4IUU A;  2RHU A;  1DJ7 B;  2DD5 A;  2XDP A;  2MWO A;  3RKY A;  5KCO A;  1M1K C;  1VQO T;  2V8I A;  3CCS A;  3CD6 A;  3FJP A;  3QUI A;  4M78 D;  4C8Q D;  1D3B B;  2QQB A;  4QQ6 A;  3Q1J A;  2DIG A;  5CQY A;  2PQW A;  1UGR B;  4XTW A;  2XIC A;  4BI4 A;  4KUI A;  2LTO A;  3J80 E;  4A53 A;  2XDB A;  3CXC S;  4J6W A;  2R5A A;  3P8B B;  4JS4 A;  2PU9 B;  5LJ5 h;  5LJ3 d;  4JRI A;  3RIR A;  3OYH A;  1BKB A;  5IT9 E;  3CC2 T;  3HFN A;  4II1 A;  2F5K A;  2L5Q A;  1YI2 A;  3V7C A;  1X75 C;  1QP2 A;  4J8O A;  3CME T;  3L2V A;  5A2Q E;  2QQA A;  3SFM A;  3V8K A;  4QW2 A;  1Q82 U;  4RCB A;  1BI3 A;  2E6Z A;  4HT8 A;  4M7D A;  3G4S A;  2XKO C;  2V8J A;  2RHY A;  3N5B B;  5FRM A;  3OYB A;  1N9S A;  3A8M B;  1KHI A;  5GMK m;  3V7S A;  1V29 B;  4MML A;  1KQS S;  1AHJ B;  1VIF A;  1LJO A;  4XK8 E;  2E12 A;  2BIV A;  3RUX A;  1K73 C;  2X35 A;  4A54 A;  3GP8 A;  1YJN A;  1Q81 C;  3I55 T;  3M5A A;  3M4G A;  3TRE A;  3CBP A;  2MMP A;  5HK0 A;  2BUD A;  1N9R A;  4M78 C;  4C8Q C;  2YHT A;  1YJW A;  1YHQ A;  2MWP A;  2PVG B;  2FVU A;  3BDL A;  1N27 A;  3C95 A;  3DLM A;  4M78 B;  4XU0 A;  4C8Q B;  3CCM T;  3JB9 J;  3CPW S;  5CK9 A;  1VQ7 T;  4PKC C;  2DXC A;  2LRQ A;  4BE2 A;  2B8A A;  4M77 E;  4ZN1 A;  4QVC A;  4FU6 A;  3CCU T;  3CCM A;  4M7A G;  4N4H A;  3CC7 T;  3MHX A;  1WQW A;  2PUO B;  1ZQ1 A;  2LC4 A;  3KUF A;  4MZT A;  2PVD B;  3WXM B;  3OW2 S;  1KC8 C;  4M7A C;  4PJO E;  2ZPE B;  3QZ9 B;  2DO3 A;  5GAM d;  4OB1 B;  5HKC A;  4A4E A;  5GAO r;  5CKE A;  1X6O A;  2MI6 A;  4B9W A;  5I2S A;  1OI1 A;  3OBW A;  2DXT A;  2QDY B;  2X4W A;  2E70 A;  2EKO A;  3CCJ T;  5J39 A;  2CZ1 B;  1VQP A;  4ELZ C;  4KUD K;  4HCC A;  3SD4 A;  2KVQ G;  3H6Z A;  4X34 A;  4PJO A;  4EMK C;  2DIQ A;  4M7D D;  2H3J A;  3CEY A;  3E19 A;  1U8R A;  2YLC A;  3CBM A;  5KH6 A;  3ME9 A;  4DA4 A;  2MF2 A;  4EMK B;  3NTH A;  5DLO A;  5FU6 C;  3BFM A;  3JCM J;  4IUR A;  1FX7 A;  5GAN h;  2K3X A;  4XTU A;  5FU6 B;  1VQO A;  2LNV A;  3A8O B;  2HNI A;  1O75 A;  3BW1 A;  3VYG A;  3X25 B;  1Y71 A;  4C92 C;  2R58 A;  5GAM f;  4XQ3 A;  3L2U A;  2E64 A;  2KQW A;  3BY7 A;  3QJ6 A;  1KQ2 A;  3VU3 C;  2QXF A;  1D3B A;  3FRN A;  3A8H B;  3TEE A;  5GAO l;  4MZP A;  4M7D E;  1Y07 A;  4F7U E;  2A7Y A;  2JZ2 A;  5GAN 8;  4M75 A;  3OS0 A;  2CZ0 B;  3M56 A;  2M1H A;  4XTV A;  3OYE A;  1YIT T;  1QVF S;  4EMG A;  3A5Z B;  2DAQ A;  1N6A A;  3L2Z A;  3JB9 G;  4ZGJ B;  2JUF A;  5C6S A;  2PUK B;  4ELY C;  3HRS A;  3PMI A;  4XU1 A;  3C94 A;  3CCV A;  1FWZ A;  2KSS A;  5FRN A;  4OB3 B;  4BY6 B;  1M90 C;  2CS7 A;  4PJO G;  3OYL A;  4IUT A;  2CZ6 B;  3QZ5 B;  3PTA A;  4M7D B;  2EAY A;  2Y4X A;  4BB7 A;  1XOV A;  2ZPB B;  5KE2 A;  3HSB A;  4EMH A;  3M57 A;  4JRK A;  5CVI A;  1PSE A;  3FIF A;  2RHI A;  5CKB A;  2QQR A;  2M9U A;  4C92 B;  1B34 A;  3JCM c;  2LCL A;  3OW2 A;  3JB9 H;  2Y4Y A;  3VKI A;  4M77 A;  1G5V A;  3JRZ A;  3M53 A;  4F7U A;  3S3M A;  3TU4 K;  5EG2 A;  2DD4 A;  3OYI A;  4J6X A;  3X28 B;  4E7I A;  2LQ8 A;  5J3B A;  2DZC A;  3WVD B;  2GFA A;  4RMO A;  2LVM A;  3FDR A;  3OSV A;  4OMF B;  5GAN f;  1M1F A;  3SWN C;  3O8V A;  5GAM g;  1UGP B;  5J26 A;  3OA6 A;  3JCM V;  4ME7 A;  4BI8 B;  1VQ9 T;  4PLI A;  2JVV A;  5DLQ E;  4A4F A;  1VQL T;  2GQV A;  1YIT A;  4E7H A;  1RL2 A;  5LL6 S;  3V8L A;  3FC3 A;  2DTH A;  1K8A U;  3URG A;  5CR2 A;  2K2V A;  4A4K A;  5GAN e;  2XK0 A;  1VQ6 A;  1K9M C;  2DXB A;  1BI1 A;  4J83 A;  3CCQ A;  3EAE A;  2RHZ A;  1YJN T;  2VUB A;  2XG8 D;  3OSS C;  3CCL A;  4KBM B;  3CMA T;  3P8H A;  1TH7 A;  4C5G A;  2QA4 T;  1XQH A;  2EQJ A;  2AHJ B;  4JUV A;  2ZGW A;  4DOV A;  3MET A;  3L2R A;  2ZPH B;  2JN0 A;  3CMA A;  1VQ4 T;  2NLU A;  2CZ7 B;  1VIE A;  2RK2 A;  3OB9 A;  4LDY A;  5CKH A;  5GAN 7;  5GAN 5;  1YJ9 A;  3OYY A;  1M1K U;  5GAO n;  4ZN3 A;  3QKJ A;  3MP8 A;  3LYI A;  2LCC A;  4EDU A;  2QI2 A;  5A0D A;  3CXC A;  1YI2 T;  4JLI A;  5CKD A;  5GAN g;  2X4X A;  4C5I A;  2OTL A;  4M75 B;  1VQ8 A;  2YLB A;  3JAM E;  3HRT A;  3DB3 A;  2K5L A;  4MZM A;  1VQ5 A;  2F5T X;  1G3W A;  2VGN A;  3JCM h;  4E47 A;  5I21 A;  4C0F A;  5LJ3 e;  4NL3 A;  2WAC A;  3OMC A;  5CO7 A;  2MAM A;  1G3Y A;  1UGS B;  3VJP A;  1YIJ A;  2RD1 A;  4GY5 A;  3QSU A;  1BIA A;  2CGH A;  2DJZ A;  3C12 A;  3QPH A;  5GAO q;  1M9S A;  2XID A;  4Y28 E;  4TVR A;  3OYN A;  1HXD A;  4F7U B;  2PVO B;  2D6F A;  2EQK A;  1X01 A;  4M7A F;  2HQE A;  2ZPF B;  4C92 A;  1JJ2 A;  1KG1 A;  3PT9 A;  2E65 A;  3LX7 A;  5GAM h;  4BY6 C;  1IRE B;  2R5M A;  3TCJ A;  5KE3 A;  1BI0 A;  1JBM A;  1OYX A;  3C4S A;  3E1S A;  3CCR T;  3JCM g;  4E7J A;  2VYT A;  5GAN 6;  3M59 A;  3CCR A;  2LX9 A;  4J7F A;  4PL6 A;  4BDY A;  2K3Y A;  2L8D A;  2WSE E;  3QXE B;  4O5V A;  3X24 B;  4J6Y A;  2DZ9 A;  2KY9 A;  3ZFJ A;  3M58 A;  1UEB A;  3V8J A;  5L8R E;  3QYH B;  3HPW A;  3MP1 A;  1N8R C;  2EJ9 A;  3RES A;  4LDU A;  2P0P A;  1M90 U;  1QVG S;  5CQX A;  1VQN A;  3HRU A;  4OVA A;  4JJN K;  2HD0 A;  4WF2 A;  1QW1 A;  4M7A E;  4M77 G;  1W2B A;  1VQN T;  5GAO p;  3OS5 A;  2IVW A;  4IUV A;  4M78 G;  4MMK A;  4C8Q G;  2K5I A;  3OYD A;  2I2L A;  1NJI C;  4M77 C;  4P5N A;  3JCM e;  1W2B S;  4FSX A;  2X4Y A;  2RH2 A;  3ZEH A;  3CCQ T;  4PLL A;  4M75 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...