1G5VA

Solution structure of the tudor domain of the human smn protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
56
structure length
56
Chain Sequence
QQWKVGDKCSAIWSEDGCIYPATIASIDFKRETCVVVYTGYGNREEQNLSDLLSPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Translation
molecule keywords SURVIVAL MOTOR NEURON PROTEIN 1
publication title SMN tudor domain structure and its interaction with the Sm proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2000-11-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1g5vA00
4CRIA 3PFSA 2RI5A 3UT1A 3DB3A 3DLMA 4N4HA 3EAEA 4OVAA 3L2QA 4E7KA 1MHNA 3ME9A 3PMIA 2GF7A 5IAYA 3L2UA 4QW2A 3ZEHA 4BDZA 3FDRA 3Q1JA 3OYIA 3NTHA 2X35A 4UC4A 3MP1A 4C5IA 4GY5A 4IUVA 5D6WA 2O4XA 3OYNA 1XNIA 3MEUA 2HQXA 2JZ2A 3MO8A 2K3XA 3QIIA 3OYAA 2RJCA 3OYCA 4ZTFA 4E7IA 4LD6A 3O8VA 4IUPA 2LRQA 5CIUA 4II1A 5KCOA 2QQRA 2RHZA 2E5QA 2MWOA 3QJ6A 4A4FA 2MWPA 1H3ZA 2R58A 3PMTA 4C5GA 3OYJA 3OYMA 4QVZA 2EQJA 2BUDA 3OS2A 1RI0A 3OMCA 3LLRA 4RG2A 5C0MA 2LCCA 1G5VA 3OYLA 3F70A 4NS5A 2LTOA 5D6XA 2RI3A 2YRVA 2EQKA 3NTKA 3S3NA 5KCHA 4A4EA 2NLUA 4PLLA 2M1HA 3OQ5A 2R5MA 5FRNA 2D9TA 5J26A 4HCZA 4QQGA 4X34A 3OYGA 3H6ZA 4IUTA 3OYFA 1WJRA 4IUQA 3S3OA 2R57A 5KE3A 4BE2A 5FRMA 3LGFA 3MEWA 3P8HA 1OI1A 1WJSA 3L2RA 3LH0A 2F5KA 1WJQA 2LVMA 3FLGA 2RJEA 2B8AA 5M9OA 3NTIA 5KE2A 5J39A 3LX7A 2GFAA 3OYEA 3MEAA 4C5EA 4E7LA 2L8DA 2EQMA 2XK0A 2X4WA 3L2WA 4BACA 2L3RA 2QQSA 2DIQA 2O4XB 3ASKA 2K3YA 5KH6A 3FC3A 4N4IA 2FHDA 3OS0A 2R5AA 4PL6A 2RHYA 4QQDA 1OZ2A 1OZ3A 1SSFA 2G3RA 2RHIA 2RHUA 2RJFA 4IKFA 4E7HA 2CKKA 3OYBA 2RI2A 2E6NA 2EKOA 3H8ZA 5FROA 2LDMA 3QBYA 2RJDA 4N4GA 3DB4A 3M9QA 3OY9A 3OYDA 3OYHA 4A4HA 4IUUA 4BD3A 1KHCA 3C4SA 2RHXA 1N27A 4Q5WA 2DAQA 3KUFA 3LYIA 3PNWC 2M0OA 4PLIA 3SD4A 3OS1A 3OB9A 4ZTJA 1OYXA 3BDLA 3OYKA 2IG0A 3OMGA 4IURA 3L42A 3S6WA 4BDYA 4E7JA 5C6SA 3OA6A 2BIVA 2VYTA 3P8DA 4BE1A 3MP8A 2XDPA 2RO0A 5IN1A 3E9FA 3FEOA 5D6YA 3QKJA 1WGSA 3L2VA 3MEVA 2DIGA 2EFIA 4BE0A 2BKDN 4L59A 4QQ6A 4B9WA 2WACA 2GFUA 3META 3LGLA 3GOXA 2JTFA 4FU6A 4Z02A 4A4GA 2M16A 4C5HA 4B9XA 3E9GA 4EDUA 3S3MA 2L89A 3UWNA 3CEYA 4FL6A 2EQUA 2X4XA 3MP6A 2X4YA 2P0KA 2HQEA 2PQWA
chains in the Genus database with same CATH superfamily
4CC3A 1SSHA 3X26B 8AT1B 2CUBA 1WHGA 1G3SA 4DOWA 2XKOC 1ABQA 1Y96B 4ZN3A 3VS7A 3ZEHA 1BK2A 4JZ3A 1PD1A 1UGQB 3OYNA 3CMAT 1IGQA 3E1SA 2DK3A 5J3BA 2P84A 4FYWB 3CXCS 5LJ5e 1WXUA 4PJOB 1X6BA 1BU1A 3R6OA 4M77G 4MZPA 5AYFA 4M78B 1K4US 2KK4A 1JB0E 4ELYC 2C0TA 1QKWA 3CCVT 1WHLA 4XU0A 4X34A 3OYGA 1S72Q 1KK7A 1G3YA 4LXCA 2VB6A 1BB9A 5KE3A 1EX4A 4HXJA 1WA7A 3L2RA 2LVMA 1VQNQ 3UDCA 4M7AA 4C92E 2YSQA 1VUBA 2IPOB 2DIQA 2VC8A 2O31A 4E6RA 1X75C 3CC2T 1ZUYA 3VUBA 3M0TA 1JJ2S 2OX7A 3G1JA 5GAOn 1BI2A 9ATCB 1SSFA 4QKUA 4E7ZA 2XHCA 4HA8A 5FW9A 4M78G 3G4ST 1VQLT 1WXBA 2H3EB 2AKKA 1YI2A 2M0OA 2P0PA 4BB7A 2ZAEA 4M77C 5CO7A 1K73R 3E9FA 3QWXX 2RK2A 5GAMe 2BKDN 3TSWA 1VQ6T 4M7DB 3JCMh 1OEBA 4OB0B 1Z9ZA 2GFUA 3META 1U06A 1JQQA 1XTDA 3WVEB 3FJ5A 1PHTA 4X9CA 1JEGA 3A8HB 4LNPA 1VQOA 3M54A 5J39A 2RI5A 4E47A 3L2QA 4KH1B 3CD6Q 1PRLC 4KBMB 4PJOC 3VS0A 3CBOA 2J6KA 1PSEA 1VQMA 3OW2A 4M78C 4X1VA 4EMKB 2QQAA 3JCMW 4OGCA 5GAN5 5KCOA 1YJNQ 2MWPA 1H3ZA 2FRYA 2IVWA 2CSQA 2E3HA 4M7DG 3OS2A 2A36A 1QCNA 2GQIA 4DBRA 1VQ4T 8ATCB 5D6XA 4F7UA 4A4EA 2NLUA 3OQ5A 3JCMJ 2X51A 3CXCA 3CMEQ 1Q86U 4KGXB 2J05A 3JAME 3EGDB 1Q7YC 3NTIA 2AIRB 3INZA 1M30A 2CP3A 2HZYA 2L3RA 5HKCA 1B34A 2RQTA 2FL7A 3PVLA 3JB9F 2KR3A 2OTLT 2K5LA 4V2SA 2EGCA 1X6OA 2DTIA 1OZ3A 2HNIA 4Z8AA 1TUGB 5FRNA 3OYDA 4N4GA 2NUTA 5IHKA 3MHXA 1J3TA 1SHFA 3I56A 3E19A 4M7DC 5GANf 1H8KA 3I55A 2HBPA 3QDRB 3RBBB 1JJ2A 5IXFA 2NUPA 2ZPIB 1MNDA 2CREA 3CCSQ 4AFZC 4QQ6A 2WACA 2KE9A 3DLLA 2QGFB 3CEYA 1ZX6A 3OSSC 1HXDA 1SPKA 2EQMA 1SRLA 2HL3A 4HVUA 2L3SA 2RH2A 2DBKA 4C0DB 2V8IA 4EMKC 2Y4YA 3OSVA 3TQ7P 5KYNA 3FDRA 2JW4A 2DTOA 2PVGB 3V7SA 5D6WA 2YRDA 4NOYA 4KRTA 4N0AC 3EHRA 2AZVA 3VRZA 2X9HA 3AT1B 2H3JA 4C92B 2DA9A 2MWOA 4A4FA 3OYMA 2CZ6B 3M57A 3N5BB 3GBQA 4C0GA 3CCEQ 2F2XA 3JCMd 3CCRQ 3OYLA 3A8LB 2LTOA 3UATA 1VIEA 5GMKm 1KQ1A 4LUEA 5GMKi 1GFDA 4IUQA 1KG1A 3G6EA 1UECA 4AMCA 1GCQC 4XTYA 3GPLA 2CS7A 2LNVA 2DRKA 2GFAA 5GAOm 1WYXA 1N8RR 1H3HA 2K6DA 5DLQE 2B86A 4LN2A 4C92G 3FC3A 4XU1A 4N4IA 2FHDA 2YT6A 1PG5B 2RPNA 2WSCE 1S1NA 1UHFA 1KD1R 1KQSP 4E7HA 4HCBA 1AWXA 1QP2A 4XTZA 3EGXA 4F04B 2ZCFB 2GTJA 3CQTA 1VQPQ 3V7CA 4PLIA 5GANj 5CKDA 1Y71A 4C0ZA 5HCKA 2K57A 2K3BA 4E7JA 1JBMA 5I22A 3OA6A 2BIVA 2LMJA 2BZ8A 4WF2A 2JMCA 2P0QA 2GNCA 4D8DA 5D6YA 3GP8A 4RTZA 3PE0A 3V8KA 3CCQQ 4C0DC 2J06A 4M77D 3M0QA 1VQ9Q 2GBQA 3T9NA 1GBQA 4J7IA 2OAUA 4D6WA 1IGUA 3HFOA 2W0ZA 4HCKA 4CRIA 4ORZA 5IHIA 2WSEE 4C8QD 1D0XA 3PMIA 3JB9J 3L2UA 3SWNB 1S72A 1SKUB 4C92C 1Q82R 4XTWA 4IUVA 4M75E 3MEUA 3JV3A 1VQNA 2E3IA 4DEYA 4JUVA 3JB9I 4R55A 2J6FA 1P92A 4M77F 2D0QB 4RTVA 4PJOD 2LT4A 1VQKQ 1YI2T 4PJMA 1WI7A 4RG2A 4M78D 1M4ZA 5LJ5g 5I2MA 2QG9B 3EG0A 3VS3A 5FU7B 3JCMg 2XIDA 3RIRA 4HCZA 1JU5C 1UG1A 5IXBA 1WJRA 5KYUA 2KQWA 3LX7A 1OU9A 1ZSGA 2DVEA 4LDYA 1VQOT 1PSFA 1TUCA 3RMQA 1ZUKA 3UA7A 4MZMA 4DBQA 1YWOA 4F17A 1I81A 1VYTA 1Q82U 5GAN4 4RMOA 4PL6A 1VQ7T 2LCSA 4EMHA 1YHQQ 1O9SA 3M9QA 1RACB 2JS0A 5EC7A 1N27A 3CD6A 3KUFA 1OX8A 1K9MR 3VJPA 1HK9A 2Y90A 1Y57A 3RKXA 2DJQA 5GANe 2BTTA 2CSIA 1WGSA 2EYZA 1VQ5T 1I5LA 1LCKA 1D3BB 1YJNA 4L59A 1AWOA 1VQ8Q 1PWTA 4Z02A 4OMNA 2KDSA 3SWNC 1FWZA 2DXBA 1ZA1B 2A08A 2HMAA 5GAMg 1M1KU 2P0KA 3RNJA 4N4HA 4AG1C 3PIOA 2CZ7B 4PJLA 4BDZA 2X35A 4JJBA 4XQ3A 4OMFB 2OTJQ 2EYQA 4C5IA 1ACMB 3VS1A 1QCOA 1IREB 3L1AA 2JTMA 3O8VA 1KIKA 1G3TA 3A1PA 2ROTA 3QUIA 4M7DF 1WHJA 4KGZB 5FU7C 1K9MU 1I8FA 2M0YA 3NMZC 1NJIR 2DX1A 3I56Q 2YRVA 2MI6A 3M0RA 4FT2A 2GQVA 1ZA2B 5D7UA 1Q95G 4BE2A 5GANh 1YITQ 1UB4A 1WX6A 2EPDA 2HKQB 1ZSZA 3UPUA 4Y92A 1MMDA 3CCSA 3HRUA 1HYOA 1JXMA 2L0AA 3C95A 1G2BA 4IKFA 3HRTA 3QPHA 4J6XA 3NHNA 1YWPA 4OMOA 2CZ1B 2AHJB 2RF0A 5CQYA 3QHSA 5GAN6 2PU9B 5CK9A 5I11A 5A2QE 4BE1A 4PFZA 5IN1A 2V1QA 3RKWA 4M75B 2ECZA 3MEVA 3X28B 1RLQC 4FSXA 1OULA 4J6WA 1IO6A 4J7FA 1WNLA 3CCEA 3A5ZB 3G6ET 4PFPA 2X4YA 2F69A 3CCRA 4XAXB 3HSBA 1K0XA 3FRNA 3DB3A 2E6ZA 3I9QA 1R8OB 1OQKA 4JLIA 1NM7A 4PKCC 5IAYA 1NPPA 4KUIA 2H8HA 1H92A 4ZNXA 1NEBA 1AHJB 2CDTA 3MPUB 3OYAA 1YN8A 2VGNA 5GMKj 4JRPA 1IZ6A 2JXBA 3CCMQ 3EFSA 1C1AA 4M75G 2QQRA 4Y91A 4C92D 1KC8C 1QQJA 2R58A 2DETA 4M7AE 3CPWP 2LT1A 1UJ0A 3OMCA 1EFNA 2IIMA 3IQLA 4CC2A 1OV3A 4C8QB 4M4ZA 1WHHA 5I2SA 4JS4A 1YBYA 2HCKA 1MGQA 2BE7D 2R5MA 3OBYA 5KYWB 2DLPA 1WZOA 1VQPA 1WDXA 3NGPA 3JCMV 3P8HA 1XQHA 3CBMA 1WJQA 1WLPB 4ANJA 1X6GA 1PD0A 1NYFA 2ZPEB 3JCMe 3OS5A 1X01A 2ED0A 3L2WA 3EG3A 3CCQA 2K2MA 1M3BA 2O4XB 1M2VB 2K3YA 1VQ9A 3HPWA 1S72T 1YNZA 3M0SA 1QP3A 2HDAA 2MPXC 4C8QG 3URGA 2FB7A 2GTOA 1VQNT 2DYIA 4M75C 2FYKA 2EJGA 2C06A 3G71Q 1Q7YR 1PKTA 1OPKA 3FIFA 2VYTA 1TS9A 2XU8A 3CPWS 2D1XA 3DKMA 5EG2A 4PJOG 2KT8A 2EJ9A 2XD0A 5GANd 2XDDA 2OAWA 2LCLA 1VQKA 3VS4A 4XU2A 1M8VA 1AWWA 1YIJT 2ENMA 1FMKA 1HSQA 1ZUUA 2JJ9A 2KBTA 2GF7A 2JOYA 3LH5A 4QW2A 1M90C 3OYIA 1X27A 2EWNA 4F7UE 1G83A 1QWFA 3VYHB 2HQXA 1UHCA 2K3XA 2RJCA 3OYCA 4C8QC 5ECAA 4RUGA 1AVZC 2KRMA 2V1RA 1T3SA 4II1A 1U1TA 1Q86R 1R77A 5GMKe 1Q7YU 1I0CA 5IT9E 1K0SA 1RAGB 3CD6T 3HHTB 1QVGP 1ZHIA 2CT4A 1YHQA 4J6YA 3GIBA 3M4GA 2JM9A 2LX9A 1D1BA 3RESA 2LQNA 1VQ6Q 1D1AA 1YJNT 4J83A 1BI1A 3OYYA 2F5KA 3FLGA 1K1ZA 2VKNA 5KE2A 4AG2C 3HTRA 4R0KA 4WCIA 3SFMA 3SHWA 2X4WA 5GJVB 2A3LA 3EFOA 1YJWT 1NYGA 1UDLA 1VQ8A 5FWBA 5KH6A 2XICA 1H641 3CMET 3V8JA 1VIFA 3MJXA 2RHIA 2RI2A 4E2FB 4EIKA 2L3PA 4FM4B 3EG1A 1OPLA 2PUKB 2ESWA 3FB9A 2Y4XA 3L42A 2OTJA 1MUZA 2FPEA 4ATOA 2DO3A 3P8DA 1BI0A 2XDPA 2RO0A 2VASA 3EHQA 1QVGS 3CCJT 1VQ4Q 2EVRA 5GMKh 2DFUA 2MF2A 5IH2A 4A4GA 5CKFA 4GLMA 4B9XA 1RLPC 5GANg 4M7AB 1UUEA 1ZQ1A 3RDVA 3KXTA 3UA6A 3RUXA 2PTKA 4A4HA 3M0UA 3TVTA 2FZKB 4OVAA 3CPWA 3CCUQ 2YUQA 2F5TX 4HCCA 3CCST 2NUZA 3MP1A 1W4SA 1UGVA 4GY5A 4MZTA 1YITA 1BCOA 1SG5A 2QGGA 2CP5A 5CIUA 2QEXQ 4JJNK 4JRIA 4PNOA 1K73C 4ELZC 1G5VA 3V8LA 2I2LA 1CKBA 1N9SA 2KEAA 2DILA 1WXTA 3H6ZA 4QVCA 2XMFA 3S3OA 1M3CA 2RB6A 1OI1A 4JZ4A 3HFNA 1W1FA 3CCET 2B8AA 3CCRT 2JVVA 1RAEB 4LUDA 4RKUE 1NE8A 4NL3A 4P5NA 5FU6B 3WVDB 5KYXA 1K8AC 1LVKA 3VU3C 4Y28E 1RAAB 3QBYA 3DB4A 1CSKA 3A8MB 5LJ3d 1HD3A 3M56A 4MMKA 2OJ2A 5LL6S 3C94A 1LOJA 3OB9A 1PC0A 1M8MA 4J9CA 2E10A 3OMGA 4BDYA 2O9VA 4F7UB 1WQ7A 4M7AC 2OI3A 4JPBW 1R0BG 4ME7A 1U8RA 4M75D 3WXMB 3L2VA 2LJ0A 2HSEB 1R0CB 2M9UA 3CCMA 3A8OB 3QO3A 1M3AA 3I5SA 3V7RA 1TU0B 4ZN1A 4EDUA 2FO0A 3UWNA 2QDYB 3MKDA 3CC4Q 2PQWA 3BE3A 1B34B 1MV0B 1TWBA 3HKSA 4JS5A 5I21A 1RI9A 2QASA 3ME9A 1N6AA 1QVGA 4ESRA 3Q1JA 3CCQT 3QYGB 2RQWA 2CP0A 2SEMA 1PNJA 4FT4A 4DBHA 5GAN8 4PFOA 1VQ9T 1XNIA 2NUTB 4F7UG 3CBPA 3AHUA 2MMPA 2O88A 3VS2A 3ULRB 4FIBA 5AT1B 3RKYA 1D09B 3PMTA 2G6FX 2PNIA 1B07A 3E2UA 4KT0E 2NUPB 3J7AF 3JCMc 1HJDA 3ER0A 1VYVA 2EQIA 1E6HA 3G71A 5KYYA 2DVJA 4MMLA 1KQSS 1VQKT 5FU6C 3X20B 2YXYA 4J9FA 4E7LA 4GBQA 2FRWA 3TU4K 2QQSA 3ASKA 3HRSA 3MCAB 1GFCA 4C8QF 3ZFJA 2KAFA 4HT8A 1U1SA 3M0PA 4F16A 4Q5WA 2KY9A 4OB3B 2DF6A 2X4JA 2PVDB 4ZTJA 2KYMA 1OYXA 3D7SB 1M1KR 2XI9A 1M2OA 3QXEB 4PJOF 3MP8A 4CC7A 2XG8D 5LJ3f 4KULA 4O5VA 3X25B 4M78F 2QA4Q 5LJ5f 4HKEA 2E5KA 4XU3A 4OF1A 1NEGA 3S3MA 2VWFA 1VQMT 1SEMA 2EQUA 2KVQG 4OB2B 1RAFB 1LJOA 2QQBA 2HL5C 3LWHA 1B7TA 1W6XA 4ZGJB 1WFWA 2EKHA 1VQ6A 2A0FB 1NLOC 1KD1C 1VQ8T 3EGXB 3QIIA 2NYSA 4CC4B 3TEEA 1NBEB 1RL2A 2DXUA 2LZ6B 3VKIA 2L5QA 2V26A 1U5SA 3NFCA 5GAN7 3H9NA 1X43A 1RI0A 3LLRA 2YWWA 3F70A 4NS5A 4BUGA 1ZBJA 2CP2A 3QJYA 1WIEA 2YDLA 4WTOB 1VQ5Q 1QWEA 1M5Q1 2W10A 1QVPA 2RQRA 3A98A 4VUBA 1UEBA 3OYFA 5IHNA 2COWA 2LC4A 1MMGA 4M77A 1KC8R 2RJEA 2SRCA 3M53A 1WHMA 3VUZA 3MEAA 1VQ4A 2ZPBB 4AFQC 1WQWA 4BACA 2MK5A 5GAMf 3I56T 3I55T 1T3LA 2D0NA 2R5AA 1Y96A 2LJ1A 1OZ2A 2RHUA 2E6NA 1TUDA 1KQSA 1YITT 2CP7A 4JRKA 2J7IA 2RHXA 4Z88A 1BCMA 3CCUA 1X2QA 3SD4A 3CC7Q 1YCYA 2IG0A 1RADB 4PJOA 2L3QA 4PK4A 1UGRB 2P4RA 4E7SA 5LJ3j 4TVRA 2VXEA 4M78A 2LJ3A 4Z89A 2DIGA 5LJ5j 2CZ0B 2QEXA 2E65A 3TCJA 5KYUB 1RABB 5CR2A 1YFNA 4M7DE 4M7AD 1KC8U 4IIOA 1GXIE 1D0ZA 3PFSA 2DJZA 4RTXA 1YJ9Q 2DD4A 4NL2A 4EMGA 1IRXA 3REAB 3QWYA 2KT1A 3P8BB 1JRIA 3OW2P 2DL4A 2ED1A 2JM8A 4GLKA 2JZ2A 2A7YA 4ZTFA 1FMWA 1XJWB 2DE0X 4LD6A 2KI7A 4JJDA 2L2PA 3EGUA 4J9GA 3CCLQ 5L8RE 1FXXA 3PVQA 3M58A 4AFUC 1Q81C 2V8JA 4PJJA 2D6FA 1C6VX 1ARKA 2LCCA 3THKA 1TG0A 3NTKA 2DZCA 5DY9A 1I5OB 4XTXA 3CCMT 5CCAA 4M7DA 4FW1A 3MEWA 3LH0A 4CI0C 2DD5A 2K2VA 2QTVA 1I1JA 2DXTA 5GAMj 1BYMA 4X9DA 1NLPC 5CQXA 2D8JA 3REBB 4BY6B 1UGPB 2KSSA 1Y0MA 2CH4W 4BI4A 1PCXA 1NPRA 2G3RA 1D0YA 4D8KA 3CC4A 2K5IA 3OYHA 4LD9K 2F2VA 2YHTA 4EMKA 1NJIC 1K76A 1M1FA 3OYKA 2RA2A 2JS2A 1D1CA 1JJ2P 4PJNA 4LDXA 3O5ZA 5L23A 4C92F 5CKEA 2P4TA 1M90U 3QSUA 4A54A 1CKAA 2JMAA 2ROLA 4N0AA 2QQ9A 2K5FA 2EFIA 1TXQA 2JN0A 4J9HA 4MDXA 2EIFA 4LE9A 1I4K1 5LJ3e 3GOXA 3CMAQ 3SEMA 2M16A 4L5GA 4OMMA 3G71T 1ZSZB 2X4XA 3R6NA 1WPYA 2AZSA 3EGDA 1UGSB 2YLCA 2DM1A 3EH1A 4F7UF 2EW3A 2QK0A 1GCQA 2AKLA 1SF9A 5HY6A 5HK3A 3CCVQ 4E7IA 4KH0B 2LRQA 4F14A 1WHKA 1Z9QA 1EIFA 1VOMA 3OYJA 3M59A 2MCNA 1AT1B 3GNGA 4OP0A 5C0MA 2F2WA 4L6V5 1KQ2A 4FYVB 5KCHA 3C0CA 3CC2Q 2F1LA 1N5ZA 1UTIA 1KFZA 1X69A 1F1BB 3QZ5B 2LQKA 3EG9A 3G4SQ 3LGFA 1VQLQ 4BY6C 1JXOA 2LQ8A 1YIJQ 2L8DA 2XK0A 5GJWB 3H0HA 4DQ2A 2QA4A 2K4YA 5LJ3h 2X3XD 2JNGA 2XDBA 5LJ5h 4QQDA 2RJFA 2Z0WA 5GMKl 3A8GB 2KNBB 1YP5A 2CKKA 3H8ZA 2EKOA 4BI8B 1X2KA 1KHCA 3LYIA 3BDLA 1SHGA 4C92A 5GAOl 1FYNA 1ZSZC 1VQ7A 2KROA 2VXFA 1FMVA 1K8AR 2DXCA 4EPCA 3LGLA 2MYSA 2VVKA 4AT1B 1IHVA 4HVVA 2E70A 3MP6A 1M9SA 1AEYA 2YUNA 3EH2A 3RR6A 3JB9D 3EAEA 1K73U 1VQ5A 5DLOA 2LX7A 1YJWQ 3LWIA 3NTHA 4UC4A 1VA7A 4A4KA 4J5YA 4DOVA 4JRQA 1V76A 1YCSB 4IUPA 3VRYA 3VS5A 2COZA 1ZLMA 4O6JA 1KHIA 3TREA 4C5GA 2BZXA 5GAMh 1UJYA 2CP6A 3VV0A 3CCUT 1JO8A 2DERA 1ZBXA 1AZEA 2BZYA 2EGAA 1U3OA 3BW1A 2LNHB 2QI2A 2PUOB 4XK8E 3H0FA 1K8AU 2M1HA 3CCJQ 2DNUA 2OTLQ 3JSCA 1BBZA 1B3QA 2QEXT 3CC7A 3EG2A 1WJSA 5M9OA 5GAOr 3OYEA 2ABLA 4C5EA 1FX7A 3HL8A 2HAXA 2HSPA 2EYXA 2VUBA 2RD1A 2HKNA 2I0NA 4M7AG 2EYWA 2KXCA 2AK5A 2V8KA 1Y7XA 5FWCA 3EG9B 3SWNA 4RTTA 3LW5E 5FROA 4LDWA 1YJ9A 1Q86C 4BD3A 2ZPHB 3CPFA 2ATCB 4DEXA 1BIAA 1MNEA 4IURA 2E4HA 3JB9H 2FG0A 2LQWA 5C6SA 3TSZA 2RQUA 1BI3A 1GBRA 2E41A 3QZ9B 4ZGDB 2DL8A 3CCLA 2YRCA 4DA4A 2X3WD 4FU6A 1OX9A 3JCMb 4RTUA 2QAZA 1K9AA 4MDWA 2LP5A 3J80E 3QDFA 1QVFP 4J9EA 2RK1A 3EFOB 5LJ5d 2HQEA 3OBWA 3UT1A 3DLMA 3PT9A 1AD5A 2A28A 5CKBA 3VS6A 3C12A 1A0NB 1PKSA 4K11A 5GAN2 1T0HA 4KGVB 2KXDA 5GAOq 2E64A 1VQPT 3CC4T 3QG1A 5GAN3 4J9DA 2BUDA 1QMCA 2QYZA 2FZCB 2HEQA 3KFVA 1NZ9A 1GCPA 7AT1B 1G3WA 2DBMA 2D9TA 1M1GA 2KGTA 1QLYA 2CYZB 4IUTA 1I07A 4M75F 1W2BP 1D3BA 1G8XA 5FRMA 2COYA 2DRMA 5CKHA 1GRIA 2PVOB 3RMSA 2DEUA 5A0LA 3PTAA 1IHWA 1QVFS 4DBFA 3ZL7C 4HT9A 3RERA 1E7OA 2RM4A 4OMLA 3CMAA 2FPDA 2RHYA 2KRSA 4FYXB 1AOJA 1EZZB 2JT4A 4KUDK 5GAMd 2YUOA 3ZBDA 4FW2A 4J8OA 1QCFA 1V1CA 3NPFA 3X24B 2FPFA 2RNAA 2CGHA 4FCYA 1N8RU 2JUFA 3S6WA 4OMQA 1OOTA 3FEOA 3CCVA 1BKBA 2CUDA 1KD1U 3QYHB 1OU8A 4BE0A 1XOVA 3FJPA 2DL7A 4RTYA 2AT1B 2JTFA 4C5HA 2MOXA 2RMOA 1N9RA 3M5AA 1RAHB 4FL6A 1W2BS 2C0IA 1ABOA 1PRMC 5LJ3g 1T0JA 4YTLA 1YI2Q 3CC2A 5KYXB 2HD0A 2QXFA 2QA4T 2J6OA 1IB8A 6AT1B 1AWJA 3G4SA 1VQLA 1YHQT 3H41A 1O75A 3M55A 1QKXA 1E6GA 1SRMA 3JCMf 1YIJA 4M77E 5FLXE 2RHZA 3JCMQ 2E5QA 1LNXA 3QJ6A 2GGRA 4QVZA 4J9IA 2DMOA 1RAIB 1N8RC 2ZGWA 2DKGA 1VQOQ 1RUWA 4RCBA 4C8QE 2RI3A 4J9BA 2EQKA 2O2OA 3S3NA 2E12A 4PLLA 5J26A 2KRNA 1PM3A 4M75A 1MMNA 1VQ7Q 2FEIA 2O01E 2R57A 4OB1B 2DYBA 3I35A 2EAYA 1VQMQ 1Q81R 4PJOE 1DJ7B 5DM7R 2K9GA 2OTJT 2KMTA 4A63B 2K79A 2A37A 4M78E 3VYGA 3OS0A 4M7DD 4JDSA 3JB9G 2DZ9A 4RG8A 3OYBA 2PZ1A 2RJDA 4HVWA 5CVIA 3PGGA 4JJCA 2DPPB 2DAQA 3PNWC 1QVFA 3OS1A 2RN8A 1YJWA 2WSFE 1TTHB 2DEQA 4OMPA 1TH7A 3UF4A 3CMEA 4C8QA 5KYYB 1Q82C 3GLXA 2EJFA 2KYBA 1M27C 4FYYB 4B9WA 4BI3A 4LDVA 1AZGB 2DL3A 4A53A 5KYWA 3E9GA 2MIOA 3CC7T 1Q81U 3U23A 1VYUA 4XTUA 1MMAA 4R56A 4E7KA 1MHNA 3CCJA 1KSWA 2E1HA 2EYYA 2OTLA 3M4YA 2MAMA 2C0OA 3I55Q 3BDUA 3H0IA 3JCMP 2EBPA 2O4XA 1M2VA 3JRZA 5GAOp 1UFFA 3MO8A 4QVDA 4C0FA 3SDZA 5HK0A 4JLGA 1W2BA 2M02A 5A0GA 3JCMX 1YJ9T 2EQJA 1M1KC 3G7ZA 2ZPGB 1TOVA 3GNFB 3KBGA 2HQHA 2VV5A 1Y07A 2CT3A 1UE9A 2JTEA 2M51A 3EFRA 3PIPA 1V29B 2DTHA 1KJWA 1BIBA 2NWMA 4QQGA 1GL5A 4B6MA 2DL5A 2ZZDA 4IIMA 3CCLT 1MV3A 3HP9A 1NJIU 4FSSA 2FVUA 1K9MC 2EGEA 2YLBA 5A0DA 4M7AF 2K7AA 4RCCA 2YUPA 4QT7A 2HBWA 5CAIA 1M90R 2CH4A 3GF5A 4XTVA 4OGEA 2O9SA 3CXCP 1W70A 2QDLA 2LDMA 3OY9A 4IUUA 3C4SA 1TSFA 1IXDA 2D8HA 3G6EQ 3BY7A 4RTWA 1LPLA 1QW1A 1C0MA 3QKJA 3SB2A 2ZPFB 2BE9B 3L2ZA 4M77B 4ZGEB 2VGMA 3J81E 3OW2S 2RQVA 1NG2A 2FZGB 2GCXA 3BFMA 2L89A 3I5RA 4AFSC 4LDUA 2QTXA
chains in the Genus database with same CATH topology
3JB9D 3X26B 4N4HA 1B34B 3EAEA 1G3SA 3HKSA 2XKOC 4DOWA 5I21A 4JS5A 1K73U 3PIOA 3ME9A 2CZ7B 1VQ5A 1N6AA 1Y96B 5DLOA 4ZN3A 1QVGA 3ZEHA 4BDZA 3Q1JA 3LWIA 3QYGB 3NTHA 2X35A 4UC4A 4FT4A 4XQ3A 4A4KA 4OMFB 5GAN8 2EYQA 4C5IA 4J5YA 4DOVA 4JRQA 1VQ9T 1UGQB 1XNIA 3OYNA 3CMAT 3E1SA 1IREB 3L1AA 4F7UG 2DK3A 3CBPA 2JTMA 3O8VA 4IUPA 5J3BA 3AHUA 1G3TA 2MMPA 3CXCS 5LJ5e 3QUIA 4O6JA 4M7DF 1KHIA 4PJOB 4FIBA 3RKYA 5FU7C 3TREA 3R6OA 1K9MU 1I8FA 3PMTA 4C5GA 5GAMh 3VV0A 4M77G 3CCUT 1ZBXA 4KT0E 4MZPA 5AYFA 4M78B 3J7AF 2KK4A 1JB0E 3JCMc 3BW1A 2QI2A 4ELYC 2PUOB 2YRVA 2MI6A 4XK8E 3ER0A 4FT2A 3CCVT 2GQVA 1K8AU 2M1HA 4XU0A 3JSCA 4X34A 3OYGA 3G71A 2QEXT 1G3YA 3CC7A 4MMLA 5KE3A 4BE2A 1KQSS 1VQKT 1WJSA 5FU6C 5GANh 3L2RA 2LVMA 1UB4A 3UDCA 5M9OA 4M7AA 3X20B 3OYEA 5GAOr 4C5EA 1FX7A 3HL8A 4C92E 3UPUA 4E7LA 2HAXA 3TU4K 1VUBA 2QQSA 2VUBA 2RD1A 2DIQA 3CCSA 2VC8A 3HRUA 4M7AG 3ASKA 3CC2T 1X75C 3VUBA 3HRSA 1JJ2S 2V8KA 1Y7XA 3MCAB 3C95A 1BI2A 4C8QF 5GAOn 3SWNA 3ZFJA 1SSFA 4IKFA 2XHCA 3HRTA 4HA8A 2KAFA 4M78G 3QPHA 4J6XA 3LW5E 3G4ST 5FROA 1VQLT 4LDWA 4HT8A 1U1SA 1YJ9A 1Q86C 4BD3A 2CZ1B 2AHJB 2ZPHB 4Q5WA 2KY9A 1YI2A 4OB3B 3CPFA 2X4JA 2PVDB 4ZTJA 2M0OA 1BIAA 2P0PA 4BB7A 5CQYA 1OYXA 4M77C 4IURA 3QHSA 3JB9H 5GAN6 5C6SA 2PU9B 5CK9A 2XI9A 3QXEB 5CO7A 4PJOF 3MP8A 5A2QE 4BE1A 1BI3A 5IN1A 3E9FA 3RKWA 4M75B 2E41A 2XG8D 3QZ9B 2RK2A 5LJ3f 3MEVA 4ZGDB 3X28B 4KULA 5GAMe 4O5VA 3X25B 4M78F 2BKDN 5LJ5f 1VQ6T 4HKEA 4M7DB 3JCMh 3CCLA 4OB0B 4FSXA 2GFUA 4J6WA 4XU3A 3META 4DA4A 1XTDA 4OF1A 4FU6A 3WVEB 3JCMb 4J7FA 1WNLA 3S3MA 3CCEA 3J80E 3A5ZB 4MDWA 1VQMT 4X9CA 3G6ET 2EQUA 2KVQG 3A8HB 4OB2B 1VQOA 2RK1A 2F69A 2X4YA 3M54A 2HQEA 4XAXB 5J39A 5LJ5d 3CCRA 3HSBA 2RI5A 3FRNA 3DB3A 3DLMA 3OBWA 3UT1A 2E6ZA 1LJOA 3PT9A 4E47A 1R8OB 2QQBA 3L2QA 3LWHA 4JLIA 5CKBA 4PKCC 5IAYA 1NPPA 4ZGJB 4KUIA 1M1KU 4KBMB 1VQ6A 4PJOC 3C12A 1KD1C 1VQ8T 5GAN2 1AHJB 3CBOA 3OYAA 3QIIA 2VGNA 1PSEA 5GMKj 3TEEA 4JRPA 3OW2A 4M78C 1IZ6A 4EMKB 2QQAA 3JCMW 1VQMA 1RL2A 4OGCA 5GAOq 2DXUA 2E64A 3EFSA 4M75G 5KCOA 5GAN5 2QQRA 3QG1A 3CC4T 4Y91A 3VKIA 4C92D 1KC8C 2MWPA 1H3ZA 2R58A 2L5QA 5GAN3 2IVWA 4M7AE 3NFCA 5GAN7 2BUDA 4M7DG 2LT1A 3OS2A 1RI0A 3OMCA 3LLRA 1M9SA 4C8QB 1VQ4T 1NZ9A 3F70A 4NS5A 5I2SA 4BUGA 5D6XA 1YBYA 4JS4A 3QJYA 4F7UA 4A4EA 1MGQA 2NLUA 1G3WA 3OQ5A 2R5MA 2D9TA 1M1GA 3OBYA 3JCMJ 1M5Q1 1VQPA 1VQPT 2CYZB 1QVPA 4IUTA 4VUBA 3OYFA 1UEBA 4M75F 3CXCA 1Q86U 1D3BA 2LC4A 5FRMA 3JCMV 3JAME 3P8HA 4M77A 1XQHA 5CKHA 2PVOB 3RMSA 3CBMA 1WJQA 5A0LA 2RJEA 3PTAA 3NTIA 3M53A 3VUZA 2ZPEB 1Q7YC 3JCMe 3MEAA 1QVFS 3OS5A 1VQ4A 2ZPBB 1X01A 1WQWA 3INZA 3L2WA 4BACA 5GAMf 3I56T 2L3RA 3CCQA 5HKCA 3I55T 3RERA 4HT9A 2O4XB 2RM4A 1B34A 2FL7A 2K3YA 1VQ9A 3JB9F 3HPWA 3CMAA 2K5LA 2OTLT 1S72T 2R5AA 4V2SA 1Y96A 2RHYA 1X6OA 2DTIA 1QP3A 1OZ2A 1OZ3A 2RHUA 2HNIA 4KUDK 5GAMd 4C8QG 2E6NA 3URGA 5FRNA 3ZBDA 3OYDA 2FB7A 4N4GA 1YITT 1KQSA 1VQNT 4J8OA 4JRKA 4M75C 2FYKA 2RHXA 3MHXA 2EJGA 2C06A 3X24B 3CCUA 3SD4A 2CGHA 3I56A 3E19A 4M7DC 1N8RU 5GANf 1YCYA 2IG0A 3I55A 2JUFA 2HBPA 3S6WA 4PJOA 3QDRB 3FIFA 2VYTA 1UGRB 2XU8A 3CPWS 3FEOA 3DKMA 5LJ3j 3CCVA 1JJ2A 1BKBA 5EG2A 4TVRA 2VXEA 4M78A 4PJOG 2ZPIB 3QYHB 2EJ9A 2DIGA 1KD1U 5LJ5j 2CZ0B 4BE0A 5GANd 2XD0A 2XDDA 2QEXA 2E65A 3TCJA 1XOVA 3FJPA 4QQ6A 2LCLA 2WACA 5CR2A 1VQKA 2JTFA 4C5HA 4M7DE 3DLLA 4XU2A 4M7AD 1M8VA 1N9RA 3M5AA 1KC8U 3CEYA 4FL6A 3OSSC 1W2BS 1YIJT 1HXDA 2EQMA 1GXIE 3PFSA 2DJZA 2RH2A 2DD4A 4NL2A 4C0DB 2V8IA 4EMGA 4EMKC 5LJ3g 4YTLA 2Y4YA 3CC2A 3OSVA 2GF7A 2HD0A 2JOYA 4QW2A 1M90C 3FDRA 2QXFA 2QA4T 3OYIA 2DTOA 3P8BB 2EWNA 4F7UE 2PVGB 1JRIA 3V7SA 5D6WA 4GLKA 3G4SA 1VQLA 3VYHB 1YHQT 2HQXA 2JZ2A 4NOYA 2K3XA 1O75A 2A7YA 2RJCA 3M55A 4N0AC 3OYCA 4ZTFA 4C8QC 4LD6A 3JCMf 1YIJA 4II1A 4M77E 1U1TA 2H3JA 5FLXE 2RHZA 4C92B 3JCMQ 2E5QA 5L8RE 2MWOA 1LNXA 1FXXA 3QJ6A 4A4FA 3M58A 5GMKe 1Q7YU 3OYMA 4QVZA 1Q81C 5IT9E 2V8JA 2CZ6B 3M57A 3CD6T 3HHTB 3N5BB 2D6FA 4C0GA 1N8RC 2ZGWA 3JCMd 2DKGA 1ZHIA 2LCCA 4RCBA 3OYLA 3A8LB 2LTOA 4C8QE 2RI3A 1VIEA 4J6YA 2EQKA 3NTKA 2DZCA 3M4GA 5DY9A 1YHQA 3S3NA 3GIBA 4XTXA 2E12A 2LX9A 4PLLA 3RESA 5J26A 5GMKm 1KQ1A 4M75A 5GMKi 3CCMT 5CCAA 2O01E 1YJNT 4IUQA 1KG1A 2R57A 3G6EA 4J83A 4M7DA 4OB1B 4XTYA 3MEWA 3GPLA 2CS7A 1BI1A 2LNVA 3LH0A 3OYYA 2F5KA 2EAYA 3FLGA 5KE2A 2GFAA 2DD5A 4CI0C 2K2VA 3SFMA 2DXTA 5GAOm 5GAMj 4PJOE 2X4WA 1BYMA 4X9DA 1DJ7B 5CQXA 2A3LA 1YJWT 5DM7R 5DLQE 4C92G 2KMTA 2OTJT 1VQ8A 5KH6A 3FC3A 4BY6B 4XU1A 4M78E 3VYGA 2XICA 1UGPB 2KSSA 2FHDA 4N4IA 2WSCE 3OS0A 4BI4A 4M7DD 4JDSA 1H641 1NPRA 3CMET 2G3RA 3V8JA 1VIFA 3JB9G 2RHIA 2DZ9A 4RG8A 4E7HA 4HCBA 3OYBA 2RI2A 3CC4A 2K5IA 2RJDA 5CVIA 3OYHA 1QP2A 4LD9K 3PGGA 4XTZA 4FM4B 2DPPB 2ZCFB 2YHTA 4EMKA 2DAQA 3PNWC 3V7CA 2PUKB 4PLIA 5GANj 5CKDA 1Y71A 4C0ZA 3OS1A 1YJWA 1M1FA 3FB9A 1QVFA 2K57A 2RA2A 2WSFE 2Y4XA 3OYKA 3L42A 2DEQA 2OTJA 4E7JA 4LDXA 1JBMA 1TH7A 4ATOA 2DO3A 2BIVA 5CKEA 2P4TA 3P8DA 4WF2A 4C92F 3OA6A 2P0QA 1BI0A 2XDPA 2RO0A 4A54A 1M90U 5D6YA 3CMEA 4N0AA 1QVGS 3GP8A 3CCJT 2QQ9A 2K5FA 4C8QA 1Q82C 2EFIA 2JN0A 3GLXA 4MDXA 2EJFA 3V8KA 5GMKh 4C0DC 2EIFA 2MF2A 1I4K1 4M77D 4B9WA 5LJ3e 4BI3A 4LDVA 3GOXA 4A4GA 2M16A 4L5GA 5CKFA 4A53A 4B9XA 5GANg 3E9GA 3G71T 4M7AB 3T9NA 3CC7T 4J7IA 1ZQ1A 2OAUA 4D6WA 3HFOA 2X4XA 3KXTA 1Q81U 3RUXA 4A4HA 4XTUA 1WPYA 4CRIA 1NJIC 4OVAA 2WSEE 4R56A 4C8QD 3CPWA 4E7KA 1MHNA 3CCJA 3PMIA 1UGSB 2E1HA 3JB9J 2YLCA 2OTLA 3L2UA 3M4YA 3SWNB 1S72A 2F5TX 4C92C 4HCCA 2MAMA 3CCST 3MP1A 1W4SA 3BDUA 4GY5A 4XTWA 3JCMP 4IUVA 4F7UF 2O4XA 4MZTA 4M75E 3MEUA 3JRZA 5HY6A 3MO8A 5HK3A 5GAOp 1YITA 1VQNA 4QVDA 4C0FA 3SDZA 4E7IA 2LRQA 5CIUA 4JUVA 3JB9I 5HK0A 4R55A 3CCQT 4JLGA 4JJNK 1W2BA 1P92A 4JRIA 2D0QB 4M77F 5A0GA 1EIFA 3JCMX 1YJ9T 4PNOA 4PJOD 2LT4A 3OYJA 2EQJA 3M59A 1YI2T 1M1KC 3GNGA 3G7ZA 4OP0A 3MP6A 4RG2A 2ZPGB 4M78D 5C0MA 1K73C 1M4ZA 3GNFB 3KBGA 4ELZC 1G5VA 3V8LA 2VV5A 5LJ5g 5I2MA 2I2LA 1Y07A 3QSUA 4L6V5 1N9SA 3EFRA 1KQ2A 5FU7B 3JCMg 5KCHA 1V29B 3PIPA 2DTHA 2XIDA 3RIRA 4HCZA 1BIBA 4QQGA 3H6ZA 4QVCA 2ZZDA 1WJRA 3QZ5B 3CCLT 3S3OA 2RB6A 2LQKA 3LGFA 3HP9A 4BY6C 1OI1A 1NJIU 2KQWA 3HFNA 2FVUA 2B8AA 3CCET 2LQ8A 3LX7A 1K9MC 2YLBA 5A0DA 2DVEA 1VQOT 4LDYA 3CCRT 2L8DA 2XK0A 1PSFA 4M7AF 2JVVA 4RCCA 3RMQA 4DQ2A 2K4YA 5LJ3h 2QA4A 4MZMA 4RKUE 1NE8A 5CAIA 2JNGA 2XDBA 1I81A 4NL3A 5LJ5h 1Q82U 4P5NA 5FU6B 5GAN4 3WVDB 3GF5A 4XTVA 4RMOA 4PL6A 1VQ7T 4OGEA 4QQDA 1K8AC 2RJFA 5GMKl 3A8GB 3VU3C 2CKKA 3H8ZA 2EKOA 1O9SA 4Y28E 4BI8B 2LDMA 3QBYA 4EMHA 3OY9A 3DB4A 3M9QA 3A8MB 5LJ3d 4IUUA 1KHCA 3C4SA 1N27A 3M56A 4MMKA 3CD6A 3KUFA 3LYIA 5LL6S 3C94A 1LOJA 3OB9A 3VJPA 1HK9A 3BDLA 3BY7A 2E10A 3OMGA 4C92A 4BDYA 2Y90A 1QW1A 5GAOl 4F7UB 1WQ7A 3RKXA 4M7AC 5GANe 1VQ7A 2VXFA 4ME7A 3QKJA 4M75D 3SB2A 1WGSA 2ZPFB 3WXMB 3L2VA 1U8RA 1VQ5T 2M9UA 3L2ZA 1I5LA 3CCMA 3A8OB 1D3BB 2DXCA 4L59A 1YJNA 3QO3A 4M77B 4ZGEB 4EPCA 2VGMA 3LGLA 3V7RA 4Z02A 3J81E 3OW2S 2KDSA 4ZN1A 3SWNC 4EDUA 2GCXA 3BFMA 1FWZA 2DXBA 2L89A 3UWNA 2QDYB 2E70A 4LDUA 5GAMg 2QTXA 2P0KA 2PQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CRI A;  3PFS A;  2RI5 A;  3UT1 A;  3DB3 A;  3DLM A;  4N4H A;  3EAE A;  4OVA A;  3L2Q A;  4E7K A;  1MHN A;  3ME9 A;  3PMI A;  2GF7 A;  5IAY A;  3L2U A;  4QW2 A;  3ZEH A;  4BDZ A;  3FDR A;  3Q1J A;  3OYI A;  3NTH A;  2X35 A;  4UC4 A;  3MP1 A;  4C5I A;  4GY5 A;  4IUV A;  5D6W A;  2O4X A;  3OYN A;  1XNI A;  3MEU A;  2HQX A;  2JZ2 A;  3MO8 A;  2K3X A;  3QII A;  3OYA A;  2RJC A;  3OYC A;  4ZTF A;  4E7I A;  4LD6 A;  3O8V A;  4IUP A;  2LRQ A;  5CIU A;  4II1 A;  5KCO A;  2QQR A;  2RHZ A;  2E5Q A;  2MWO A;  3QJ6 A;  4A4F A;  2MWP A;  1H3Z A;  2R58 A;  3PMT A;  4C5G A;  3OYJ A;  3OYM A;  4QVZ A;  2EQJ A;  2BUD A;  3OS2 A;  1RI0 A;  3OMC A;  3LLR A;  4RG2 A;  5C0M A;  2LCC A;  1G5V A;  3OYL A;  3F70 A;  4NS5 A;  2LTO A;  5D6X A;  2RI3 A;  2YRV A;  2EQK A;  3NTK A;  3S3N A;  5KCH A;  4A4E A;  2NLU A;  4PLL A;  2M1H A;  3OQ5 A;  2R5M A;  5FRN A;  2D9T A;  5J26 A;  4HCZ A;  4QQG A;  4X34 A;  3OYG A;  3H6Z A;  4IUT A;  3OYF A;  1WJR A;  4IUQ A;  3S3O A;  2R57 A;  5KE3 A;  4BE2 A;  5FRM A;  3LGF A;  3MEW A;  3P8H A;  1OI1 A;  1WJS A;  3L2R A;  3LH0 A;  2F5K A;  1WJQ A;  2LVM A;  3FLG A;  2RJE A;  2B8A A;  5M9O A;  3NTI A;  5KE2 A;  5J39 A;  3LX7 A;  2GFA A;  3OYE A;  3MEA A;  4C5E A;  4E7L A;  2L8D A;  2EQM A;  2XK0 A;  2X4W A;  3L2W A;  4BAC A;  2L3R A;  2QQS A;  2DIQ A;  2O4X B;  3ASK A;  2K3Y A;  5KH6 A;  3FC3 A;  4N4I A;  2FHD A;  3OS0 A;  2R5A A;  4PL6 A;  2RHY A;  4QQD A;  1OZ2 A;  1OZ3 A;  1SSF A;  2G3R A;  2RHI A;  2RHU A;  2RJF A;  4IKF A;  4E7H A;  2CKK A;  3OYB A;  2RI2 A;  2E6N A;  2EKO A;  3H8Z A;  5FRO A;  2LDM A;  3QBY A;  2RJD A;  4N4G A;  3DB4 A;  3M9Q A;  3OY9 A;  3OYD A;  3OYH A;  4A4H A;  4IUU A;  4BD3 A;  1KHC A;  3C4S A;  2RHX A;  1N27 A;  4Q5W A;  2DAQ A;  3KUF A;  3LYI A;  3PNW C;  2M0O A;  4PLI A;  3SD4 A;  3OS1 A;  3OB9 A;  4ZTJ A;  1OYX A;  3BDL A;  3OYK A;  2IG0 A;  3OMG A;  4IUR A;  3L42 A;  3S6W A;  4BDY A;  4E7J A;  5C6S A;  3OA6 A;  2BIV A;  2VYT A;  3P8D A;  4BE1 A;  3MP8 A;  2XDP A;  2RO0 A;  5IN1 A;  3E9F A;  3FEO A;  5D6Y A;  3QKJ A;  1WGS A;  3L2V A;  3MEV A;  2DIG A;  2EFI A;  4BE0 A;  2BKD N;  4L59 A;  4QQ6 A;  4B9W A;  2WAC A;  2GFU A;  3MET A;  3LGL A;  3GOX A;  2JTF A;  4FU6 A;  4Z02 A;  4A4G A;  2M16 A;  4C5H A;  4B9X A;  3E9G A;  4EDU A;  3S3M A;  2L89 A;  3UWN A;  3CEY A;  4FL6 A;  2EQU A;  2X4X A;  3MP6 A;  2X4Y A;  2P0K A;  2HQE A;  2PQW A; 
#chains in the Genus database with same CATH topology
 4CC3 A;  1SSH A;  3X26 B;  8AT1 B;  2CUB A;  1WHG A;  1G3S A;  4DOW A;  2XKO C;  1ABQ A;  1Y96 B;  4ZN3 A;  3VS7 A;  3ZEH A;  1BK2 A;  4JZ3 A;  1PD1 A;  1UGQ B;  3OYN A;  3CMA T;  1IGQ A;  3E1S A;  2DK3 A;  5J3B A;  2P84 A;  4FYW B;  3CXC S;  5LJ5 e;  1WXU A;  4PJO B;  1X6B A;  1BU1 A;  3R6O A;  4M77 G;  4MZP A;  5AYF A;  4M78 B;  1K4U S;  2KK4 A;  1JB0 E;  4ELY C;  2C0T A;  1QKW A;  3CCV T;  1WHL A;  4XU0 A;  4X34 A;  3OYG A;  1S72 Q;  1KK7 A;  1G3Y A;  4LXC A;  2VB6 A;  1BB9 A;  5KE3 A;  1EX4 A;  4HXJ A;  1WA7 A;  3L2R A;  2LVM A;  1VQN Q;  3UDC A;  4M7A A;  4C92 E;  2YSQ A;  1VUB A;  2IPO B;  2DIQ A;  2VC8 A;  2O31 A;  4E6R A;  1X75 C;  3CC2 T;  1ZUY A;  3VUB A;  3M0T A;  1JJ2 S;  2OX7 A;  3G1J A;  5GAO n;  1BI2 A;  9ATC B;  1SSF A;  4QKU A;  4E7Z A;  2XHC A;  4HA8 A;  5FW9 A;  4M78 G;  3G4S T;  1VQL T;  1WXB A;  2H3E B;  2AKK A;  1YI2 A;  2M0O A;  2P0P A;  4BB7 A;  2ZAE A;  4M77 C;  5CO7 A;  1K73 R;  3E9F A;  3QWX X;  2RK2 A;  5GAM e;  2BKD N;  3TSW A;  1VQ6 T;  4M7D B;  3JCM h;  1OEB A;  4OB0 B;  1Z9Z A;  2GFU A;  3MET A;  1U06 A;  1JQQ A;  1XTD A;  3WVE B;  3FJ5 A;  1PHT A;  4X9C A;  1JEG A;  3A8H B;  4LNP A;  1VQO A;  3M54 A;  5J39 A;  2RI5 A;  4E47 A;  3L2Q A;  4KH1 B;  3CD6 Q;  1PRL C;  4KBM B;  4PJO C;  3VS0 A;  3CBO A;  2J6K A;  1PSE A;  1VQM A;  3OW2 A;  4M78 C;  4X1V A;  4EMK B;  2QQA A;  3JCM W;  4OGC A;  5GAN 5;  5KCO A;  1YJN Q;  2MWP A;  1H3Z A;  2FRY A;  2IVW A;  2CSQ A;  2E3H A;  4M7D G;  3OS2 A;  2A36 A;  1QCN A;  2GQI A;  4DBR A;  1VQ4 T;  8ATC B;  5D6X A;  4F7U A;  4A4E A;  2NLU A;  3OQ5 A;  3JCM J;  2X51 A;  3CXC A;  3CME Q;  1Q86 U;  4KGX B;  2J05 A;  3JAM E;  3EGD B;  1Q7Y C;  3NTI A;  2AIR B;  3INZ A;  1M30 A;  2CP3 A;  2HZY A;  2L3R A;  5HKC A;  1B34 A;  2RQT A;  2FL7 A;  3PVL A;  3JB9 F;  2KR3 A;  2OTL T;  2K5L A;  4V2S A;  2EGC A;  1X6O A;  2DTI A;  1OZ3 A;  2HNI A;  4Z8A A;  1TUG B;  5FRN A;  3OYD A;  4N4G A;  2NUT A;  5IHK A;  3MHX A;  1J3T A;  1SHF A;  3I56 A;  3E19 A;  4M7D C;  5GAN f;  1H8K A;  3I55 A;  2HBP A;  3QDR B;  3RBB B;  1JJ2 A;  5IXF A;  2NUP A;  2ZPI B;  1MND A;  2CRE A;  3CCS Q;  4AFZ C;  4QQ6 A;  2WAC A;  2KE9 A;  3DLL A;  2QGF B;  3CEY A;  1ZX6 A;  3OSS C;  1HXD A;  1SPK A;  2EQM A;  1SRL A;  2HL3 A;  4HVU A;  2L3S A;  2RH2 A;  2DBK A;  4C0D B;  2V8I A;  4EMK C;  2Y4Y A;  3OSV A;  3TQ7 P;  5KYN A;  3FDR A;  2JW4 A;  2DTO A;  2PVG B;  3V7S A;  5D6W A;  2YRD A;  4NOY A;  4KRT A;  4N0A C;  3EHR A;  2AZV A;  3VRZ A;  2X9H A;  3AT1 B;  2H3J A;  4C92 B;  2DA9 A;  2MWO A;  4A4F A;  3OYM A;  2CZ6 B;  3M57 A;  3N5B B;  3GBQ A;  4C0G A;  3CCE Q;  2F2X A;  3JCM d;  3CCR Q;  3OYL A;  3A8L B;  2LTO A;  3UAT A;  1VIE A;  5GMK m;  1KQ1 A;  4LUE A;  5GMK i;  1GFD A;  4IUQ A;  1KG1 A;  3G6E A;  1UEC A;  4AMC A;  1GCQ C;  4XTY A;  3GPL A;  2CS7 A;  2LNV A;  2DRK A;  2GFA A;  5GAO m;  1WYX A;  1N8R R;  1H3H A;  2K6D A;  5DLQ E;  2B86 A;  4LN2 A;  4C92 G;  3FC3 A;  4XU1 A;  4N4I A;  2FHD A;  2YT6 A;  1PG5 B;  2RPN A;  2WSC E;  1S1N A;  1UHF A;  1KD1 R;  1KQS P;  4E7H A;  4HCB A;  1AWX A;  1QP2 A;  4XTZ A;  3EGX A;  4F04 B;  2ZCF B;  2GTJ A;  3CQT A;  1VQP Q;  3V7C A;  4PLI A;  5GAN j;  5CKD A;  1Y71 A;  4C0Z A;  5HCK A;  2K57 A;  2K3B A;  4E7J A;  1JBM A;  5I22 A;  3OA6 A;  2BIV A;  2LMJ A;  2BZ8 A;  4WF2 A;  2JMC A;  2P0Q A;  2GNC A;  4D8D A;  5D6Y A;  3GP8 A;  4RTZ A;  3PE0 A;  3V8K A;  3CCQ Q;  4C0D C;  2J06 A;  4M77 D;  3M0Q A;  1VQ9 Q;  2GBQ A;  3T9N A;  1GBQ A;  4J7I A;  2OAU A;  4D6W A;  1IGU A;  3HFO A;  2W0Z A;  4HCK A;  4CRI A;  4ORZ A;  5IHI A;  2WSE E;  4C8Q D;  1D0X A;  3PMI A;  3JB9 J;  3L2U A;  3SWN B;  1S72 A;  1SKU B;  4C92 C;  1Q82 R;  4XTW A;  4IUV A;  4M75 E;  3MEU A;  3JV3 A;  1VQN A;  2E3I A;  4DEY A;  4JUV A;  3JB9 I;  4R55 A;  2J6F A;  1P92 A;  4M77 F;  2D0Q B;  4RTV A;  4PJO D;  2LT4 A;  1VQK Q;  1YI2 T;  4PJM A;  1WI7 A;  4RG2 A;  4M78 D;  1M4Z A;  5LJ5 g;  5I2M A;  2QG9 B;  3EG0 A;  3VS3 A;  5FU7 B;  3JCM g;  2XID A;  3RIR A;  4HCZ A;  1JU5 C;  1UG1 A;  5IXB A;  1WJR A;  5KYU A;  2KQW A;  3LX7 A;  1OU9 A;  1ZSG A;  2DVE A;  4LDY A;  1VQO T;  1PSF A;  1TUC A;  3RMQ A;  1ZUK A;  3UA7 A;  4MZM A;  4DBQ A;  1YWO A;  4F17 A;  1I81 A;  1VYT A;  1Q82 U;  5GAN 4;  4RMO A;  4PL6 A;  1VQ7 T;  2LCS A;  4EMH A;  1YHQ Q;  1O9S A;  3M9Q A;  1RAC B;  2JS0 A;  5EC7 A;  1N27 A;  3CD6 A;  3KUF A;  1OX8 A;  1K9M R;  3VJP A;  1HK9 A;  2Y90 A;  1Y57 A;  3RKX A;  2DJQ A;  5GAN e;  2BTT A;  2CSI A;  1WGS A;  2EYZ A;  1VQ5 T;  1I5L A;  1LCK A;  1D3B B;  1YJN A;  4L59 A;  1AWO A;  1VQ8 Q;  1PWT A;  4Z02 A;  4OMN A;  2KDS A;  3SWN C;  1FWZ A;  2DXB A;  1ZA1 B;  2A08 A;  2HMA A;  5GAM g;  1M1K U;  2P0K A;  3RNJ A;  4N4H A;  4AG1 C;  3PIO A;  2CZ7 B;  4PJL A;  4BDZ A;  2X35 A;  4JJB A;  4XQ3 A;  4OMF B;  2OTJ Q;  2EYQ A;  4C5I A;  1ACM B;  3VS1 A;  1QCO A;  1IRE B;  3L1A A;  2JTM A;  3O8V A;  1KIK A;  1G3T A;  3A1P A;  2ROT A;  3QUI A;  4M7D F;  1WHJ A;  4KGZ B;  5FU7 C;  1K9M U;  1I8F A;  2M0Y A;  3NMZ C;  1NJI R;  2DX1 A;  3I56 Q;  2YRV A;  2MI6 A;  3M0R A;  4FT2 A;  2GQV A;  1ZA2 B;  5D7U A;  1Q95 G;  4BE2 A;  5GAN h;  1YIT Q;  1UB4 A;  1WX6 A;  2EPD A;  2HKQ B;  1ZSZ A;  3UPU A;  4Y92 A;  1MMD A;  3CCS A;  3HRU A;  1HYO A;  1JXM A;  2L0A A;  3C95 A;  1G2B A;  4IKF A;  3HRT A;  3QPH A;  4J6X A;  3NHN A;  1YWP A;  4OMO A;  2CZ1 B;  2AHJ B;  2RF0 A;  5CQY A;  3QHS A;  5GAN 6;  2PU9 B;  5CK9 A;  5I11 A;  5A2Q E;  4BE1 A;  4PFZ A;  5IN1 A;  2V1Q A;  3RKW A;  4M75 B;  2ECZ A;  3MEV A;  3X28 B;  1RLQ C;  4FSX A;  1OUL A;  4J6W A;  1IO6 A;  4J7F A;  1WNL A;  3CCE A;  3A5Z B;  3G6E T;  4PFP A;  2X4Y A;  2F69 A;  3CCR A;  4XAX B;  3HSB A;  1K0X A;  3FRN A;  3DB3 A;  2E6Z A;  3I9Q A;  1R8O B;  1OQK A;  4JLI A;  1NM7 A;  4PKC C;  5IAY A;  1NPP A;  4KUI A;  2H8H A;  1H92 A;  4ZNX A;  1NEB A;  1AHJ B;  2CDT A;  3MPU B;  3OYA A;  1YN8 A;  2VGN A;  5GMK j;  4JRP A;  1IZ6 A;  2JXB A;  3CCM Q;  3EFS A;  1C1A A;  4M75 G;  2QQR A;  4Y91 A;  4C92 D;  1KC8 C;  1QQJ A;  2R58 A;  2DET A;  4M7A E;  3CPW P;  2LT1 A;  1UJ0 A;  3OMC A;  1EFN A;  2IIM A;  3IQL A;  4CC2 A;  1OV3 A;  4C8Q B;  4M4Z A;  1WHH A;  5I2S A;  4JS4 A;  1YBY A;  2HCK A;  1MGQ A;  2BE7 D;  2R5M A;  3OBY A;  5KYW B;  2DLP A;  1WZO A;  1VQP A;  1WDX A;  3NGP A;  3JCM V;  3P8H A;  1XQH A;  3CBM A;  1WJQ A;  1WLP B;  4ANJ A;  1X6G A;  1PD0 A;  1NYF A;  2ZPE B;  3JCM e;  3OS5 A;  1X01 A;  2ED0 A;  3L2W A;  3EG3 A;  3CCQ A;  2K2M A;  1M3B A;  2O4X B;  1M2V B;  2K3Y A;  1VQ9 A;  3HPW A;  1S72 T;  1YNZ A;  3M0S A;  1QP3 A;  2HDA A;  2MPX C;  4C8Q G;  3URG A;  2FB7 A;  2GTO A;  1VQN T;  2DYI A;  4M75 C;  2FYK A;  2EJG A;  2C06 A;  3G71 Q;  1Q7Y R;  1PKT A;  1OPK A;  3FIF A;  2VYT A;  1TS9 A;  2XU8 A;  3CPW S;  2D1X A;  3DKM A;  5EG2 A;  4PJO G;  2KT8 A;  2EJ9 A;  2XD0 A;  5GAN d;  2XDD A;  2OAW A;  2LCL A;  1VQK A;  3VS4 A;  4XU2 A;  1M8V A;  1AWW A;  1YIJ T;  2ENM A;  1FMK A;  1HSQ A;  1ZUU A;  2JJ9 A;  2KBT A;  2GF7 A;  2JOY A;  3LH5 A;  4QW2 A;  1M90 C;  3OYI A;  1X27 A;  2EWN A;  4F7U E;  1G83 A;  1QWF A;  3VYH B;  2HQX A;  1UHC A;  2K3X A;  2RJC A;  3OYC A;  4C8Q C;  5ECA A;  4RUG A;  1AVZ C;  2KRM A;  2V1R A;  1T3S A;  4II1 A;  1U1T A;  1Q86 R;  1R77 A;  5GMK e;  1Q7Y U;  1I0C A;  5IT9 E;  1K0S A;  1RAG B;  3CD6 T;  3HHT B;  1QVG P;  1ZHI A;  2CT4 A;  1YHQ A;  4J6Y A;  3GIB A;  3M4G A;  2JM9 A;  2LX9 A;  1D1B A;  3RES A;  2LQN A;  1VQ6 Q;  1D1A A;  1YJN T;  4J83 A;  1BI1 A;  3OYY A;  2F5K A;  3FLG A;  1K1Z A;  2VKN A;  5KE2 A;  4AG2 C;  3HTR A;  4R0K A;  4WCI A;  3SFM A;  3SHW A;  2X4W A;  5GJV B;  2A3L A;  3EFO A;  1YJW T;  1NYG A;  1UDL A;  1VQ8 A;  5FWB A;  5KH6 A;  2XIC A;  1H64 1;  3CME T;  3V8J A;  1VIF A;  3MJX A;  2RHI A;  2RI2 A;  4E2F B;  4EIK A;  2L3P A;  4FM4 B;  3EG1 A;  1OPL A;  2PUK B;  2ESW A;  3FB9 A;  2Y4X A;  3L42 A;  2OTJ A;  1MUZ A;  2FPE A;  4ATO A;  2DO3 A;  3P8D A;  1BI0 A;  2XDP A;  2RO0 A;  2VAS A;  3EHQ A;  1QVG S;  3CCJ T;  1VQ4 Q;  2EVR A;  5GMK h;  2DFU A;  2MF2 A;  5IH2 A;  4A4G A;  5CKF A;  4GLM A;  4B9X A;  1RLP C;  5GAN g;  4M7A B;  1UUE A;  1ZQ1 A;  3RDV A;  3KXT A;  3UA6 A;  3RUX A;  2PTK A;  4A4H A;  3M0U A;  3TVT A;  2FZK B;  4OVA A;  3CPW A;  3CCU Q;  2YUQ A;  2F5T X;  4HCC A;  3CCS T;  2NUZ A;  3MP1 A;  1W4S A;  1UGV A;  4GY5 A;  4MZT A;  1YIT A;  1BCO A;  1SG5 A;  2QGG A;  2CP5 A;  5CIU A;  2QEX Q;  4JJN K;  4JRI A;  4PNO A;  1K73 C;  4ELZ C;  1G5V A;  3V8L A;  2I2L A;  1CKB A;  1N9S A;  2KEA A;  2DIL A;  1WXT A;  3H6Z A;  4QVC A;  2XMF A;  3S3O A;  1M3C A;  2RB6 A;  1OI1 A;  4JZ4 A;  3HFN A;  1W1F A;  3CCE T;  2B8A A;  3CCR T;  2JVV A;  1RAE B;  4LUD A;  4RKU E;  1NE8 A;  4NL3 A;  4P5N A;  5FU6 B;  3WVD B;  5KYX A;  1K8A C;  1LVK A;  3VU3 C;  4Y28 E;  1RAA B;  3QBY A;  3DB4 A;  1CSK A;  3A8M B;  5LJ3 d;  1HD3 A;  3M56 A;  4MMK A;  2OJ2 A;  5LL6 S;  3C94 A;  1LOJ A;  3OB9 A;  1PC0 A;  1M8M A;  4J9C A;  2E10 A;  3OMG A;  4BDY A;  2O9V A;  4F7U B;  1WQ7 A;  4M7A C;  2OI3 A;  4JPB W;  1R0B G;  4ME7 A;  1U8R A;  4M75 D;  3WXM B;  3L2V A;  2LJ0 A;  2HSE B;  1R0C B;  2M9U A;  3CCM A;  3A8O B;  3QO3 A;  1M3A A;  3I5S A;  3V7R A;  1TU0 B;  4ZN1 A;  4EDU A;  2FO0 A;  3UWN A;  2QDY B;  3MKD A;  3CC4 Q;  2PQW A;  3BE3 A;  1B34 B;  1MV0 B;  1TWB A;  3HKS A;  4JS5 A;  5I21 A;  1RI9 A;  2QAS A;  3ME9 A;  1N6A A;  1QVG A;  4ESR A;  3Q1J A;  3CCQ T;  3QYG B;  2RQW A;  2CP0 A;  2SEM A;  1PNJ A;  4FT4 A;  4DBH A;  5GAN 8;  4PFO A;  1VQ9 T;  1XNI A;  2NUT B;  4F7U G;  3CBP A;  3AHU A;  2MMP A;  2O88 A;  3VS2 A;  3ULR B;  4FIB A;  5AT1 B;  3RKY A;  1D09 B;  3PMT A;  2G6F X;  2PNI A;  1B07 A;  3E2U A;  4KT0 E;  2NUP B;  3J7A F;  3JCM c;  1HJD A;  3ER0 A;  1VYV A;  2EQI A;  1E6H A;  3G71 A;  5KYY A;  2DVJ A;  4MML A;  1KQS S;  1VQK T;  5FU6 C;  3X20 B;  2YXY A;  4J9F A;  4E7L A;  4GBQ A;  2FRW A;  3TU4 K;  2QQS A;  3ASK A;  3HRS A;  3MCA B;  1GFC A;  4C8Q F;  3ZFJ A;  2KAF A;  4HT8 A;  1U1S A;  3M0P A;  4F16 A;  4Q5W A;  2KY9 A;  4OB3 B;  2DF6 A;  2X4J A;  2PVD B;  4ZTJ A;  2KYM A;  1OYX A;  3D7S B;  1M1K R;  2XI9 A;  1M2O A;  3QXE B;  4PJO F;  3MP8 A;  4CC7 A;  2XG8 D;  5LJ3 f;  4KUL A;  4O5V A;  3X25 B;  4M78 F;  2QA4 Q;  5LJ5 f;  4HKE A;  2E5K A;  4XU3 A;  4OF1 A;  1NEG A;  3S3M A;  2VWF A;  1VQM T;  1SEM A;  2EQU A;  2KVQ G;  4OB2 B;  1RAF B;  1LJO A;  2QQB A;  2HL5 C;  3LWH A;  1B7T A;  1W6X A;  4ZGJ B;  1WFW A;  2EKH A;  1VQ6 A;  2A0F B;  1NLO C;  1KD1 C;  1VQ8 T;  3EGX B;  3QII A;  2NYS A;  4CC4 B;  3TEE A;  1NBE B;  1RL2 A;  2DXU A;  2LZ6 B;  3VKI A;  2L5Q A;  2V26 A;  1U5S A;  3NFC A;  5GAN 7;  3H9N A;  1X43 A;  1RI0 A;  3LLR A;  2YWW A;  3F70 A;  4NS5 A;  4BUG A;  1ZBJ A;  2CP2 A;  3QJY A;  1WIE A;  2YDL A;  4WTO B;  1VQ5 Q;  1QWE A;  1M5Q 1;  2W10 A;  1QVP A;  2RQR A;  3A98 A;  4VUB A;  1UEB A;  3OYF A;  5IHN A;  2COW A;  2LC4 A;  1MMG A;  4M77 A;  1KC8 R;  2RJE A;  2SRC A;  3M53 A;  1WHM A;  3VUZ A;  3MEA A;  1VQ4 A;  2ZPB B;  4AFQ C;  1WQW A;  4BAC A;  2MK5 A;  5GAM f;  3I56 T;  3I55 T;  1T3L A;  2D0N A;  2R5A A;  1Y96 A;  2LJ1 A;  1OZ2 A;  2RHU A;  2E6N A;  1TUD A;  1KQS A;  1YIT T;  2CP7 A;  4JRK A;  2J7I A;  2RHX A;  4Z88 A;  1BCM A;  3CCU A;  1X2Q A;  3SD4 A;  3CC7 Q;  1YCY A;  2IG0 A;  1RAD B;  4PJO A;  2L3Q A;  4PK4 A;  1UGR B;  2P4R A;  4E7S A;  5LJ3 j;  4TVR A;  2VXE A;  4M78 A;  2LJ3 A;  4Z89 A;  2DIG A;  5LJ5 j;  2CZ0 B;  2QEX A;  2E65 A;  3TCJ A;  5KYU B;  1RAB B;  5CR2 A;  1YFN A;  4M7D E;  4M7A D;  1KC8 U;  4IIO A;  1GXI E;  1D0Z A;  3PFS A;  2DJZ A;  4RTX A;  1YJ9 Q;  2DD4 A;  4NL2 A;  4EMG A;  1IRX A;  3REA B;  3QWY A;  2KT1 A;  3P8B B;  1JRI A;  3OW2 P;  2DL4 A;  2ED1 A;  2JM8 A;  4GLK A;  2JZ2 A;  2A7Y A;  4ZTF A;  1FMW A;  1XJW B;  2DE0 X;  4LD6 A;  2KI7 A;  4JJD A;  2L2P A;  3EGU A;  4J9G A;  3CCL Q;  5L8R E;  1FXX A;  3PVQ A;  3M58 A;  4AFU C;  1Q81 C;  2V8J A;  4PJJ A;  2D6F A;  1C6V X;  1ARK A;  2LCC A;  3THK A;  1TG0 A;  3NTK A;  2DZC A;  5DY9 A;  1I5O B;  4XTX A;  3CCM T;  5CCA A;  4M7D A;  4FW1 A;  3MEW A;  3LH0 A;  4CI0 C;  2DD5 A;  2K2V A;  2QTV A;  1I1J A;  2DXT A;  5GAM j;  1BYM A;  4X9D A;  1NLP C;  5CQX A;  2D8J A;  3REB B;  4BY6 B;  1UGP B;  2KSS A;  1Y0M A;  2CH4 W;  4BI4 A;  1PCX A;  1NPR A;  2G3R A;  1D0Y A;  4D8K A;  3CC4 A;  2K5I A;  3OYH A;  4LD9 K;  2F2V A;  2YHT A;  4EMK A;  1NJI C;  1K76 A;  1M1F A;  3OYK A;  2RA2 A;  2JS2 A;  1D1C A;  1JJ2 P;  4PJN A;  4LDX A;  3O5Z A;  5L23 A;  4C92 F;  5CKE A;  2P4T A;  1M90 U;  3QSU A;  4A54 A;  1CKA A;  2JMA A;  2ROL A;  4N0A A;  2QQ9 A;  2K5F A;  2EFI A;  1TXQ A;  2JN0 A;  4J9H A;  4MDX A;  2EIF A;  4LE9 A;  1I4K 1;  5LJ3 e;  3GOX A;  3CMA Q;  3SEM A;  2M16 A;  4L5G A;  4OMM A;  3G71 T;  1ZSZ B;  2X4X A;  3R6N A;  1WPY A;  2AZS A;  3EGD A;  1UGS B;  2YLC A;  2DM1 A;  3EH1 A;  4F7U F;  2EW3 A;  2QK0 A;  1GCQ A;  2AKL A;  1SF9 A;  5HY6 A;  5HK3 A;  3CCV Q;  4E7I A;  4KH0 B;  2LRQ A;  4F14 A;  1WHK A;  1Z9Q A;  1EIF A;  1VOM A;  3OYJ A;  3M59 A;  2MCN A;  1AT1 B;  3GNG A;  4OP0 A;  5C0M A;  2F2W A;  4L6V 5;  1KQ2 A;  4FYV B;  5KCH A;  3C0C A;  3CC2 Q;  2F1L A;  1N5Z A;  1UTI A;  1KFZ A;  1X69 A;  1F1B B;  3QZ5 B;  2LQK A;  3EG9 A;  3G4S Q;  3LGF A;  1VQL Q;  4BY6 C;  1JXO A;  2LQ8 A;  1YIJ Q;  2L8D A;  2XK0 A;  5GJW B;  3H0H A;  4DQ2 A;  2QA4 A;  2K4Y A;  5LJ3 h;  2X3X D;  2JNG A;  2XDB A;  5LJ5 h;  4QQD A;  2RJF A;  2Z0W A;  5GMK l;  3A8G B;  2KNB B;  1YP5 A;  2CKK A;  3H8Z A;  2EKO A;  4BI8 B;  1X2K A;  1KHC A;  3LYI A;  3BDL A;  1SHG A;  4C92 A;  5GAO l;  1FYN A;  1ZSZ C;  1VQ7 A;  2KRO A;  2VXF A;  1FMV A;  1K8A R;  2DXC A;  4EPC A;  3LGL A;  2MYS A;  2VVK A;  4AT1 B;  1IHV A;  4HVV A;  2E70 A;  3MP6 A;  1M9S A;  1AEY A;  2YUN A;  3EH2 A;  3RR6 A;  3JB9 D;  3EAE A;  1K73 U;  1VQ5 A;  5DLO A;  2LX7 A;  1YJW Q;  3LWI A;  3NTH A;  4UC4 A;  1VA7 A;  4A4K A;  4J5Y A;  4DOV A;  4JRQ A;  1V76 A;  1YCS B;  4IUP A;  3VRY A;  3VS5 A;  2COZ A;  1ZLM A;  4O6J A;  1KHI A;  3TRE A;  4C5G A;  2BZX A;  5GAM h;  1UJY A;  2CP6 A;  3VV0 A;  3CCU T;  1JO8 A;  2DER A;  1ZBX A;  1AZE A;  2BZY A;  2EGA A;  1U3O A;  3BW1 A;  2LNH B;  2QI2 A;  2PUO B;  4XK8 E;  3H0F A;  1K8A U;  2M1H A;  3CCJ Q;  2DNU A;  2OTL Q;  3JSC A;  1BBZ A;  1B3Q A;  2QEX T;  3CC7 A;  3EG2 A;  1WJS A;  5M9O A;  5GAO r;  3OYE A;  2ABL A;  4C5E A;  1FX7 A;  3HL8 A;  2HAX A;  2HSP A;  2EYX A;  2VUB A;  2RD1 A;  2HKN A;  2I0N A;  4M7A G;  2EYW A;  2KXC A;  2AK5 A;  2V8K A;  1Y7X A;  5FWC A;  3EG9 B;  3SWN A;  4RTT A;  3LW5 E;  5FRO A;  4LDW A;  1YJ9 A;  1Q86 C;  4BD3 A;  2ZPH B;  3CPF A;  2ATC B;  4DEX A;  1BIA A;  1MNE A;  4IUR A;  2E4H A;  3JB9 H;  2FG0 A;  2LQW A;  5C6S A;  3TSZ A;  2RQU A;  1BI3 A;  1GBR A;  2E41 A;  3QZ9 B;  4ZGD B;  2DL8 A;  3CCL A;  2YRC A;  4DA4 A;  2X3W D;  4FU6 A;  1OX9 A;  3JCM b;  4RTU A;  2QAZ A;  1K9A A;  4MDW A;  2LP5 A;  3J80 E;  3QDF A;  1QVF P;  4J9E A;  2RK1 A;  3EFO B;  5LJ5 d;  2HQE A;  3OBW A;  3UT1 A;  3DLM A;  3PT9 A;  1AD5 A;  2A28 A;  5CKB A;  3VS6 A;  3C12 A;  1A0N B;  1PKS A;  4K11 A;  5GAN 2;  1T0H A;  4KGV B;  2KXD A;  5GAO q;  2E64 A;  1VQP T;  3CC4 T;  3QG1 A;  5GAN 3;  4J9D A;  2BUD A;  1QMC A;  2QYZ A;  2FZC B;  2HEQ A;  3KFV A;  1NZ9 A;  1GCP A;  7AT1 B;  1G3W A;  2DBM A;  2D9T A;  1M1G A;  2KGT A;  1QLY A;  2CYZ B;  4IUT A;  1I07 A;  4M75 F;  1W2B P;  1D3B A;  1G8X A;  5FRM A;  2COY A;  2DRM A;  5CKH A;  1GRI A;  2PVO B;  3RMS A;  2DEU A;  5A0L A;  3PTA A;  1IHW A;  1QVF S;  4DBF A;  3ZL7 C;  4HT9 A;  3RER A;  1E7O A;  2RM4 A;  4OML A;  3CMA A;  2FPD A;  2RHY A;  2KRS A;  4FYX B;  1AOJ A;  1EZZ B;  2JT4 A;  4KUD K;  5GAM d;  2YUO A;  3ZBD A;  4FW2 A;  4J8O A;  1QCF A;  1V1C A;  3NPF A;  3X24 B;  2FPF A;  2RNA A;  2CGH A;  4FCY A;  1N8R U;  2JUF A;  3S6W A;  4OMQ A;  1OOT A;  3FEO A;  3CCV A;  1BKB A;  2CUD A;  1KD1 U;  3QYH B;  1OU8 A;  4BE0 A;  1XOV A;  3FJP A;  2DL7 A;  4RTY A;  2AT1 B;  2JTF A;  4C5H A;  2MOX A;  2RMO A;  1N9R A;  3M5A A;  1RAH B;  4FL6 A;  1W2B S;  2C0I A;  1ABO A;  1PRM C;  5LJ3 g;  1T0J A;  4YTL A;  1YI2 Q;  3CC2 A;  5KYX B;  2HD0 A;  2QXF A;  2QA4 T;  2J6O A;  1IB8 A;  6AT1 B;  1AWJ A;  3G4S A;  1VQL A;  1YHQ T;  3H41 A;  1O75 A;  3M55 A;  1QKX A;  1E6G A;  1SRM A;  3JCM f;  1YIJ A;  4M77 E;  5FLX E;  2RHZ A;  3JCM Q;  2E5Q A;  1LNX A;  3QJ6 A;  2GGR A;  4QVZ A;  4J9I A;  2DMO A;  1RAI B;  1N8R C;  2ZGW A;  2DKG A;  1VQO Q;  1RUW A;  4RCB A;  4C8Q E;  2RI3 A;  4J9B A;  2EQK A;  2O2O A;  3S3N A;  2E12 A;  4PLL A;  5J26 A;  2KRN A;  1PM3 A;  4M75 A;  1MMN A;  1VQ7 Q;  2FEI A;  2O01 E;  2R57 A;  4OB1 B;  2DYB A;  3I35 A;  2EAY A;  1VQM Q;  1Q81 R;  4PJO E;  1DJ7 B;  5DM7 R;  2K9G A;  2OTJ T;  2KMT A;  4A63 B;  2K79 A;  2A37 A;  4M78 E;  3VYG A;  3OS0 A;  4M7D D;  4JDS A;  3JB9 G;  2DZ9 A;  4RG8 A;  3OYB A;  2PZ1 A;  2RJD A;  4HVW A;  5CVI A;  3PGG A;  4JJC A;  2DPP B;  2DAQ A;  3PNW C;  1QVF A;  3OS1 A;  2RN8 A;  1YJW A;  2WSF E;  1TTH B;  2DEQ A;  4OMP A;  1TH7 A;  3UF4 A;  3CME A;  4C8Q A;  5KYY B;  1Q82 C;  3GLX A;  2EJF A;  2KYB A;  1M27 C;  4FYY B;  4B9W A;  4BI3 A;  4LDV A;  1AZG B;  2DL3 A;  4A53 A;  5KYW A;  3E9G A;  2MIO A;  3CC7 T;  1Q81 U;  3U23 A;  1VYU A;  4XTU A;  1MMA A;  4R56 A;  4E7K A;  1MHN A;  3CCJ A;  1KSW A;  2E1H A;  2EYY A;  2OTL A;  3M4Y A;  2MAM A;  2C0O A;  3I55 Q;  3BDU A;  3H0I A;  3JCM P;  2EBP A;  2O4X A;  1M2V A;  3JRZ A;  5GAO p;  1UFF A;  3MO8 A;  4QVD A;  4C0F A;  3SDZ A;  5HK0 A;  4JLG A;  1W2B A;  2M02 A;  5A0G A;  3JCM X;  1YJ9 T;  2EQJ A;  1M1K C;  3G7Z A;  2ZPG B;  1TOV A;  3GNF B;  3KBG A;  2HQH A;  2VV5 A;  1Y07 A;  2CT3 A;  1UE9 A;  2JTE A;  2M51 A;  3EFR A;  3PIP A;  1V29 B;  2DTH A;  1KJW A;  1BIB A;  2NWM A;  4QQG A;  1GL5 A;  4B6M A;  2DL5 A;  2ZZD A;  4IIM A;  3CCL T;  1MV3 A;  3HP9 A;  1NJI U;  4FSS A;  2FVU A;  1K9M C;  2EGE A;  2YLB A;  5A0D A;  4M7A F;  2K7A A;  4RCC A;  2YUP A;  4QT7 A;  2HBW A;  5CAI A;  1M90 R;  2CH4 A;  3GF5 A;  4XTV A;  4OGE A;  2O9S A;  3CXC P;  1W70 A;  2QDL A;  2LDM A;  3OY9 A;  4IUU A;  3C4S A;  1TSF A;  1IXD A;  2D8H A;  3G6E Q;  3BY7 A;  4RTW A;  1LPL A;  1QW1 A;  1C0M A;  3QKJ A;  3SB2 A;  2ZPF B;  2BE9 B;  3L2Z A;  4M77 B;  4ZGE B;  2VGM A;  3J81 E;  3OW2 S;  2RQV A;  1NG2 A;  2FZG B;  2GCX A;  3BFM A;  2L89 A;  3I5R A;  4AFS C;  4LDU A;  2QTX A; 
#chains in the Genus database with same CATH homology
 3JB9 D;  3X26 B;  4N4H A;  1B34 B;  3EAE A;  1G3S A;  3HKS A;  2XKO C;  4DOW A;  5I21 A;  4JS5 A;  1K73 U;  3PIO A;  3ME9 A;  2CZ7 B;  1VQ5 A;  1N6A A;  1Y96 B;  5DLO A;  4ZN3 A;  1QVG A;  3ZEH A;  4BDZ A;  3Q1J A;  3LWI A;  3QYG B;  3NTH A;  2X35 A;  4UC4 A;  4FT4 A;  4XQ3 A;  4A4K A;  4OMF B;  5GAN 8;  2EYQ A;  4C5I A;  4J5Y A;  4DOV A;  4JRQ A;  1VQ9 T;  1UGQ B;  1XNI A;  3OYN A;  3CMA T;  3E1S A;  1IRE B;  3L1A A;  4F7U G;  2DK3 A;  3CBP A;  2JTM A;  3O8V A;  4IUP A;  5J3B A;  3AHU A;  1G3T A;  2MMP A;  3CXC S;  5LJ5 e;  3QUI A;  4O6J A;  4M7D F;  1KHI A;  4PJO B;  4FIB A;  3RKY A;  5FU7 C;  3TRE A;  3R6O A;  1K9M U;  1I8F A;  3PMT A;  4C5G A;  5GAM h;  3VV0 A;  4M77 G;  3CCU T;  1ZBX A;  4KT0 E;  4MZP A;  5AYF A;  4M78 B;  3J7A F;  2KK4 A;  1JB0 E;  3JCM c;  3BW1 A;  2QI2 A;  4ELY C;  2PUO B;  2YRV A;  2MI6 A;  4XK8 E;  3ER0 A;  4FT2 A;  3CCV T;  2GQV A;  1K8A U;  2M1H A;  4XU0 A;  3JSC A;  4X34 A;  3OYG A;  3G71 A;  2QEX T;  1G3Y A;  3CC7 A;  4MML A;  5KE3 A;  4BE2 A;  1KQS S;  1VQK T;  1WJS A;  5FU6 C;  5GAN h;  3L2R A;  2LVM A;  1UB4 A;  3UDC A;  5M9O A;  4M7A A;  3X20 B;  3OYE A;  5GAO r;  4C5E A;  1FX7 A;  3HL8 A;  4C92 E;  3UPU A;  4E7L A;  2HAX A;  3TU4 K;  1VUB A;  2QQS A;  2VUB A;  2RD1 A;  2DIQ A;  3CCS A;  2VC8 A;  3HRU A;  4M7A G;  3ASK A;  3CC2 T;  1X75 C;  3VUB A;  3HRS A;  1JJ2 S;  2V8K A;  1Y7X A;  3MCA B;  3C95 A;  1BI2 A;  4C8Q F;  5GAO n;  3SWN A;  3ZFJ A;  1SSF A;  4IKF A;  2XHC A;  3HRT A;  4HA8 A;  2KAF A;  4M78 G;  3QPH A;  4J6X A;  3LW5 E;  3G4S T;  5FRO A;  1VQL T;  4LDW A;  4HT8 A;  1U1S A;  1YJ9 A;  1Q86 C;  4BD3 A;  2CZ1 B;  2AHJ B;  2ZPH B;  4Q5W A;  2KY9 A;  1YI2 A;  4OB3 B;  3CPF A;  2X4J A;  2PVD B;  4ZTJ A;  2M0O A;  1BIA A;  2P0P A;  4BB7 A;  5CQY A;  1OYX A;  4M77 C;  4IUR A;  3QHS A;  3JB9 H;  5GAN 6;  5C6S A;  2PU9 B;  5CK9 A;  2XI9 A;  3QXE B;  5CO7 A;  4PJO F;  3MP8 A;  5A2Q E;  4BE1 A;  1BI3 A;  5IN1 A;  3E9F A;  3RKW A;  4M75 B;  2E41 A;  2XG8 D;  3QZ9 B;  2RK2 A;  5LJ3 f;  3MEV A;  4ZGD B;  3X28 B;  4KUL A;  5GAM e;  4O5V A;  3X25 B;  4M78 F;  2BKD N;  5LJ5 f;  1VQ6 T;  4HKE A;  4M7D B;  3JCM h;  3CCL A;  4OB0 B;  4FSX A;  2GFU A;  4J6W A;  4XU3 A;  3MET A;  4DA4 A;  1XTD A;  4OF1 A;  4FU6 A;  3WVE B;  3JCM b;  4J7F A;  1WNL A;  3S3M A;  3CCE A;  3J80 E;  3A5Z B;  4MDW A;  1VQM T;  4X9C A;  3G6E T;  2EQU A;  2KVQ G;  3A8H B;  4OB2 B;  1VQO A;  2RK1 A;  2F69 A;  2X4Y A;  3M54 A;  2HQE A;  4XAX B;  5J39 A;  5LJ5 d;  3CCR A;  3HSB A;  2RI5 A;  3FRN A;  3DB3 A;  3DLM A;  3OBW A;  3UT1 A;  2E6Z A;  1LJO A;  3PT9 A;  4E47 A;  1R8O B;  2QQB A;  3L2Q A;  3LWH A;  4JLI A;  5CKB A;  4PKC C;  5IAY A;  1NPP A;  4ZGJ B;  4KUI A;  1M1K U;  4KBM B;  1VQ6 A;  4PJO C;  3C12 A;  1KD1 C;  1VQ8 T;  5GAN 2;  1AHJ B;  3CBO A;  3OYA A;  3QII A;  2VGN A;  1PSE A;  5GMK j;  3TEE A;  4JRP A;  3OW2 A;  4M78 C;  1IZ6 A;  4EMK B;  2QQA A;  3JCM W;  1VQM A;  1RL2 A;  4OGC A;  5GAO q;  2DXU A;  2E64 A;  3EFS A;  4M75 G;  5KCO A;  5GAN 5;  2QQR A;  3QG1 A;  3CC4 T;  4Y91 A;  3VKI A;  4C92 D;  1KC8 C;  2MWP A;  1H3Z A;  2R58 A;  2L5Q A;  5GAN 3;  2IVW A;  4M7A E;  3NFC A;  5GAN 7;  2BUD A;  4M7D G;  2LT1 A;  3OS2 A;  1RI0 A;  3OMC A;  3LLR A;  1M9S A;  4C8Q B;  1VQ4 T;  1NZ9 A;  3F70 A;  4NS5 A;  5I2S A;  4BUG A;  5D6X A;  1YBY A;  4JS4 A;  3QJY A;  4F7U A;  4A4E A;  1MGQ A;  2NLU A;  1G3W A;  3OQ5 A;  2R5M A;  2D9T A;  1M1G A;  3OBY A;  3JCM J;  1M5Q 1;  1VQP A;  1VQP T;  2CYZ B;  1QVP A;  4IUT A;  4VUB A;  3OYF A;  1UEB A;  4M75 F;  3CXC A;  1Q86 U;  1D3B A;  2LC4 A;  5FRM A;  3JCM V;  3JAM E;  3P8H A;  4M77 A;  1XQH A;  5CKH A;  2PVO B;  3RMS A;  3CBM A;  1WJQ A;  5A0L A;  2RJE A;  3PTA A;  3NTI A;  3M53 A;  3VUZ A;  2ZPE B;  1Q7Y C;  3JCM e;  3MEA A;  1QVF S;  3OS5 A;  1VQ4 A;  2ZPB B;  1X01 A;  1WQW A;  3INZ A;  3L2W A;  4BAC A;  5GAM f;  3I56 T;  2L3R A;  3CCQ A;  5HKC A;  3I55 T;  3RER A;  4HT9 A;  2O4X B;  2RM4 A;  1B34 A;  2FL7 A;  2K3Y A;  1VQ9 A;  3JB9 F;  3HPW A;  3CMA A;  2K5L A;  2OTL T;  1S72 T;  2R5A A;  4V2S A;  1Y96 A;  2RHY A;  1X6O A;  2DTI A;  1QP3 A;  1OZ2 A;  1OZ3 A;  2RHU A;  2HNI A;  4KUD K;  5GAM d;  4C8Q G;  2E6N A;  3URG A;  5FRN A;  3ZBD A;  3OYD A;  2FB7 A;  4N4G A;  1YIT T;  1KQS A;  1VQN T;  4J8O A;  4JRK A;  4M75 C;  2FYK A;  2RHX A;  3MHX A;  2EJG A;  2C06 A;  3X24 B;  3CCU A;  3SD4 A;  2CGH A;  3I56 A;  3E19 A;  4M7D C;  1N8R U;  5GAN f;  1YCY A;  2IG0 A;  3I55 A;  2JUF A;  2HBP A;  3S6W A;  4PJO A;  3QDR B;  3FIF A;  2VYT A;  1UGR B;  2XU8 A;  3CPW S;  3FEO A;  3DKM A;  5LJ3 j;  3CCV A;  1JJ2 A;  1BKB A;  5EG2 A;  4TVR A;  2VXE A;  4M78 A;  4PJO G;  2ZPI B;  3QYH B;  2EJ9 A;  2DIG A;  1KD1 U;  5LJ5 j;  2CZ0 B;  4BE0 A;  5GAN d;  2XD0 A;  2XDD A;  2QEX A;  2E65 A;  3TCJ A;  1XOV A;  3FJP A;  4QQ6 A;  2LCL A;  2WAC A;  5CR2 A;  1VQK A;  2JTF A;  4C5H A;  4M7D E;  3DLL A;  4XU2 A;  4M7A D;  1M8V A;  1N9R A;  3M5A A;  1KC8 U;  3CEY A;  4FL6 A;  3OSS C;  1W2B S;  1YIJ T;  1HXD A;  2EQM A;  1GXI E;  3PFS A;  2DJZ A;  2RH2 A;  2DD4 A;  4NL2 A;  4C0D B;  2V8I A;  4EMG A;  4EMK C;  5LJ3 g;  4YTL A;  2Y4Y A;  3CC2 A;  3OSV A;  2GF7 A;  2HD0 A;  2JOY A;  4QW2 A;  1M90 C;  3FDR A;  2QXF A;  2QA4 T;  3OYI A;  2DTO A;  3P8B B;  2EWN A;  4F7U E;  2PVG B;  1JRI A;  3V7S A;  5D6W A;  4GLK A;  3G4S A;  1VQL A;  3VYH B;  1YHQ T;  2HQX A;  2JZ2 A;  4NOY A;  2K3X A;  1O75 A;  2A7Y A;  2RJC A;  3M55 A;  4N0A C;  3OYC A;  4ZTF A;  4C8Q C;  4LD6 A;  3JCM f;  1YIJ A;  4II1 A;  4M77 E;  1U1T A;  2H3J A;  5FLX E;  2RHZ A;  4C92 B;  3JCM Q;  2E5Q A;  5L8R E;  2MWO A;  1LNX A;  1FXX A;  3QJ6 A;  4A4F A;  3M58 A;  5GMK e;  1Q7Y U;  3OYM A;  4QVZ A;  1Q81 C;  5IT9 E;  2V8J A;  2CZ6 B;  3M57 A;  3CD6 T;  3HHT B;  3N5B B;  2D6F A;  4C0G A;  1N8R C;  2ZGW A;  3JCM d;  2DKG A;  1ZHI A;  2LCC A;  4RCB A;  3OYL A;  3A8L B;  2LTO A;  4C8Q E;  2RI3 A;  1VIE A;  4J6Y A;  2EQK A;  3NTK A;  2DZC A;  3M4G A;  5DY9 A;  1YHQ A;  3S3N A;  3GIB A;  4XTX A;  2E12 A;  2LX9 A;  4PLL A;  3RES A;  5J26 A;  5GMK m;  1KQ1 A;  4M75 A;  5GMK i;  3CCM T;  5CCA A;  2O01 E;  1YJN T;  4IUQ A;  1KG1 A;  2R57 A;  3G6E A;  4J83 A;  4M7D A;  4OB1 B;  4XTY A;  3MEW A;  3GPL A;  2CS7 A;  1BI1 A;  2LNV A;  3LH0 A;  3OYY A;  2F5K A;  2EAY A;  3FLG A;  5KE2 A;  2GFA A;  2DD5 A;  4CI0 C;  2K2V A;  3SFM A;  2DXT A;  5GAO m;  5GAM j;  4PJO E;  2X4W A;  1BYM A;  4X9D A;  1DJ7 B;  5CQX A;  2A3L A;  1YJW T;  5DM7 R;  5DLQ E;  4C92 G;  2KMT A;  2OTJ T;  1VQ8 A;  5KH6 A;  3FC3 A;  4BY6 B;  4XU1 A;  4M78 E;  3VYG A;  2XIC A;  1UGP B;  2KSS A;  2FHD A;  4N4I A;  2WSC E;  3OS0 A;  4BI4 A;  4M7D D;  4JDS A;  1H64 1;  1NPR A;  3CME T;  2G3R A;  3V8J A;  1VIF A;  3JB9 G;  2RHI A;  2DZ9 A;  4RG8 A;  4E7H A;  4HCB A;  3OYB A;  2RI2 A;  3CC4 A;  2K5I A;  2RJD A;  5CVI A;  3OYH A;  1QP2 A;  4LD9 K;  3PGG A;  4XTZ A;  4FM4 B;  2DPP B;  2ZCF B;  2YHT A;  4EMK A;  2DAQ A;  3PNW C;  3V7C A;  2PUK B;  4PLI A;  5GAN j;  5CKD A;  1Y71 A;  4C0Z A;  3OS1 A;  1YJW A;  1M1F A;  3FB9 A;  1QVF A;  2K57 A;  2RA2 A;  2WSF E;  2Y4X A;  3OYK A;  3L42 A;  2DEQ A;  2OTJ A;  4E7J A;  4LDX A;  1JBM A;  1TH7 A;  4ATO A;  2DO3 A;  2BIV A;  5CKE A;  2P4T A;  3P8D A;  4WF2 A;  4C92 F;  3OA6 A;  2P0Q A;  1BI0 A;  2XDP A;  2RO0 A;  4A54 A;  1M90 U;  5D6Y A;  3CME A;  4N0A A;  1QVG S;  3GP8 A;  3CCJ T;  2QQ9 A;  2K5F A;  4C8Q A;  1Q82 C;  2EFI A;  2JN0 A;  3GLX A;  4MDX A;  2EJF A;  3V8K A;  5GMK h;  4C0D C;  2EIF A;  2MF2 A;  1I4K 1;  4M77 D;  4B9W A;  5LJ3 e;  4BI3 A;  4LDV A;  3GOX A;  4A4G A;  2M16 A;  4L5G A;  5CKF A;  4A53 A;  4B9X A;  5GAN g;  3E9G A;  3G71 T;  4M7A B;  3T9N A;  3CC7 T;  4J7I A;  1ZQ1 A;  2OAU A;  4D6W A;  3HFO A;  2X4X A;  3KXT A;  1Q81 U;  3RUX A;  4A4H A;  4XTU A;  1WPY A;  4CRI A;  1NJI C;  4OVA A;  2WSE E;  4R56 A;  4C8Q D;  3CPW A;  4E7K A;  1MHN A;  3CCJ A;  3PMI A;  1UGS B;  2E1H A;  3JB9 J;  2YLC A;  2OTL A;  3L2U A;  3M4Y A;  3SWN B;  1S72 A;  2F5T X;  4C92 C;  4HCC A;  2MAM A;  3CCS T;  3MP1 A;  1W4S A;  3BDU A;  4GY5 A;  4XTW A;  3JCM P;  4IUV A;  4F7U F;  2O4X A;  4MZT A;  4M75 E;  3MEU A;  3JRZ A;  5HY6 A;  3MO8 A;  5HK3 A;  5GAO p;  1YIT A;  1VQN A;  4QVD A;  4C0F A;  3SDZ A;  4E7I A;  2LRQ A;  5CIU A;  4JUV A;  3JB9 I;  5HK0 A;  4R55 A;  3CCQ T;  4JLG A;  4JJN K;  1W2B A;  1P92 A;  4JRI A;  2D0Q B;  4M77 F;  5A0G A;  1EIF A;  3JCM X;  1YJ9 T;  4PNO A;  4PJO D;  2LT4 A;  3OYJ A;  2EQJ A;  3M59 A;  1YI2 T;  1M1K C;  3GNG A;  3G7Z A;  4OP0 A;  3MP6 A;  4RG2 A;  2ZPG B;  4M78 D;  5C0M A;  1K73 C;  1M4Z A;  3GNF B;  3KBG A;  4ELZ C;  1G5V A;  3V8L A;  2VV5 A;  5LJ5 g;  5I2M A;  2I2L A;  1Y07 A;  3QSU A;  4L6V 5;  1N9S A;  3EFR A;  1KQ2 A;  5FU7 B;  3JCM g;  5KCH A;  1V29 B;  3PIP A;  2DTH A;  2XID A;  3RIR A;  4HCZ A;  1BIB A;  4QQG A;  3H6Z A;  4QVC A;  2ZZD A;  1WJR A;  3QZ5 B;  3CCL T;  3S3O A;  2RB6 A;  2LQK A;  3LGF A;  3HP9 A;  4BY6 C;  1OI1 A;  1NJI U;  2KQW A;  3HFN A;  2FVU A;  2B8A A;  3CCE T;  2LQ8 A;  3LX7 A;  1K9M C;  2YLB A;  5A0D A;  2DVE A;  1VQO T;  4LDY A;  3CCR T;  2L8D A;  2XK0 A;  1PSF A;  4M7A F;  2JVV A;  4RCC A;  3RMQ A;  4DQ2 A;  2K4Y A;  5LJ3 h;  2QA4 A;  4MZM A;  4RKU E;  1NE8 A;  5CAI A;  2JNG A;  2XDB A;  1I81 A;  4NL3 A;  5LJ5 h;  1Q82 U;  4P5N A;  5FU6 B;  5GAN 4;  3WVD B;  3GF5 A;  4XTV A;  4RMO A;  4PL6 A;  1VQ7 T;  4OGE A;  4QQD A;  1K8A C;  2RJF A;  5GMK l;  3A8G B;  3VU3 C;  2CKK A;  3H8Z A;  2EKO A;  1O9S A;  4Y28 E;  4BI8 B;  2LDM A;  3QBY A;  4EMH A;  3OY9 A;  3DB4 A;  3M9Q A;  3A8M B;  5LJ3 d;  4IUU A;  1KHC A;  3C4S A;  1N27 A;  3M56 A;  4MMK A;  3CD6 A;  3KUF A;  3LYI A;  5LL6 S;  3C94 A;  1LOJ A;  3OB9 A;  3VJP A;  1HK9 A;  3BDL A;  3BY7 A;  2E10 A;  3OMG A;  4C92 A;  4BDY A;  2Y90 A;  1QW1 A;  5GAO l;  4F7U B;  1WQ7 A;  3RKX A;  4M7A C;  5GAN e;  1VQ7 A;  2VXF A;  4ME7 A;  3QKJ A;  4M75 D;  3SB2 A;  1WGS A;  2ZPF B;  3WXM B;  3L2V A;  1U8R A;  1VQ5 T;  2M9U A;  3L2Z A;  1I5L A;  3CCM A;  3A8O B;  1D3B B;  2DXC A;  4L59 A;  1YJN A;  3QO3 A;  4M77 B;  4ZGE B;  4EPC A;  2VGM A;  3LGL A;  3V7R A;  4Z02 A;  3J81 E;  3OW2 S;  2KDS A;  4ZN1 A;  3SWN C;  4EDU A;  2GCX A;  3BFM A;  1FWZ A;  2DXB A;  2L89 A;  3UWN A;  2QDY B;  2E70 A;  4LDU A;  5GAM g;  2QTX A;  2P0K A;  2PQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...