1U5SA

Nmr structure of the complex between nck-2 sh3 domain and pinch-1 lim4 domain
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
71
structure length
71
Chain Sequence
QGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNARGQVGLVPKNYVVVLSDGPALH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytoplasmic protein NCK2
publication title Structure of an ultraweak protein-protein complex and its crucial role in regulation of cell morphology and motility.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 5
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2004-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1u5sA00
1GBQA 4EIKA 2HEQA 4AFSC 1TUDA 1Y57A 3IQLA 3M0SA 2G6FX 1SRLA 1NYGA 2EYXA 1AZEA 2KRSA 2YUPA 4J9FA 5IHIA 3TSZA 3ULRB 1JQQA 1UTIA 1W1FA 2GNCA 2FG0A 2JS0A 2JM9A 3QWXX 2DMOA 2KRNA 2O88A 3UATA 5GJWB 5FW9A 4K11A 2K79A 3VS3A 4JJDA 4CC2A 2LJ1A 1MUZA 2K7AA 2EPDA 4J9HA 1TG0A 2J05A 2GGRA 1PNJA 1NM7A 2K9GA 1GBRA 2YT6A 3PVQA 3H0IA 5IXFA 5I11A 2JXBA 1OOTA 2K3BA 1UGVA 1B07A 5ECAA 1SHGA 1JXOA 3NHNA 1SHFA 1M27C 1B3QA 2IIMA 1KIKA 2EGEA 2V1QA 4J9IA 3PVLA 4JZ3A 2L3SA 2LQWA 2DX1A 2A37A 4F16A 3FJ5A 1I1JA 1T3SA 3H0FA 2CSIA 2O9VA 1KFZA 1Z9ZA 1X6BA 4LUEA 2GTJA 2RQUA 1VYVA 1X2QA 2RQRA 1I0CA 1AOJA 3EG3A 4ORZA 2LJ0A 3I9QA 1K9AA 2KXCA 2MIOA 2JMAA 2A36A 1MV3A 2D8HA 2NWMA 4GLMA 1JO8A 2RQWA 1M3BA 1WDXA 2GQIA 1ZSGA 2EGCA 2SRCA 1IO6A 4RTTA 1EFNA 1X69A 3PE0A 2RQTA 2X3XD 2DBMA 1WLPB 1GL5A 2J6FA 2HDAA 1W6XA 2ED0A 2KROA 4F14A 1WA7A 1V1CA 2W10A 1QWEA 1AWXA 1RUWA 2BZXA 2JW4A 1OEBA 1K0SA 2MCNA 2ROTA 2DILA 1WXTA 4FSSA 4ESRA 1AEYA 2ROLA 1H92A 2L3QA 4OMPA 1PRMC 2PZ1A 1T0HA 2VKNA 2FRWA 3R6NA 2DRMA 4RUGA 1NEGA 1BB9A 2DLPA 2AZVA 2DM1A 4AFQC 2X3WD 1TUCA 2P4RA 5GJVB 2OI3A 1ABQA 4IIOA 1CSKA 4Z88A 2CT3A 3C0CA 3VS2A 3TSWA 1CKAA 3VS5A 3UA7A 4J9EA 1LCKA 4JJCA 2CUDA 3EG1A 1SEMA 4ZNXA 4E6RA 1QKXA 2EYYA 4QT7A 3REBB 1GFDA 2FPDA 1CKBA 3VS0A 1GCQC 1AWJA 1ZUYA 2RN8A 4JZ4A 2EBPA 1NG2A 2O2OA 2KBTA 2D1XA 2LJ3A 2J6OA 1FYNA 1K76A 4WCIA 1WYXA 2KRMA 3EG0A 1GCQA 2KYMA 2CDTA 2EQIA 4HVUA 1GFCA 1SPKA 1VYTA 4LN2A 5IH2A 2DYBA 2K2MA 3VS4A 2EKHA 2H8HA 2D8JA 1NLOC 4HXJA 2ESWA 5FWCA 1ZLMA 2LX7A 3I5RA 5L23A 5I22A 4Y92A 3M0UA 2DL8A 2M51A 4Z8AA 1ARKA 2K6DA 1KJWA 1AWWA 2F2XA 4J9GA 1RLQC 3ZL7C 1K4US 1JXMA 2O31A 2YUNA 4HVWA 1W70A 4RTZA 2OJ2A 3EGUA 4CC3A 3SEMA 4DEXA 5IHNA 1PKTA 2A08A 2JS2A 2V1RA 1JU5C 1YCSB 1VYUA 3M0TA 2ENMA 1M30A 3NPFA 2DVJA 2ECZA 1UDLA 1G2BA 1Z9QA 2EYWA 2PTKA 1UHCA 3GBQA 1GRIA 4HCKA 4LE9A 1BBZA 2C0OA 2J06A 3THKA 2DF6A 1PKSA 3M0PA 4OMMA 2A28A 2DE0X 1T0JA 1E6GA 1QWFA 2LP5A 3NMZC 4D8DA 1HSQA 1QLYA 2L2PA 2DNUA 2KNBB 2LNHB 2DA9A 3VS1A 4AG2C 1YWPA 2F2VA 1OV3A 2GBQA 1ZBJA 2J6KA 2KYBA 4OMLA 5EC7A 2VVKA 4GBQA 3SHWA 2QDLA 2KEAA 1J3TA 4RTUA 3I5SA 4RTWA 2JTEA 2KXDA 2CUBA 1AVZC 3REAB 3U23A 4J9BA 3VRYA 1NYFA 2YUOA 2CSQA 1YN8A 3UF4A 1UUEA 2C0TA 2DL3A 2JM8A 2YUQA 3VRZA 2ED1A 4F17A 1YWOA 1RLPC 4RTXA 1E7OA 2MOXA 2EGAA 2YSQA 1UE9A 4M4ZA 2ABLA 1MV0B 1X27A 3VS7A 2D0NA 1WI7A 3KFVA 1A0NB 2AKKA 1UJYA 2LZ6B 1M8MA 2DBKA 3RBBB 1X43A 1X2KA 2RPNA 3JV3A 1WXBA 3TVTA 1AWOA 2FPEA 1VA7A 1JEGA 2EW3A 1M3AA 1S1NA 4JJBA 1E6HA 1M3CA 1T3LA 1BU1A 2C0IA 2DRKA 2SEMA 4JPBW 2L0AA 1ZUKA 2AZSA 4OMQA 3EHRA 3M0QA 2DL4A 4RTYA 1X6GA 1UG1A 2OAWA 1UJ0A 1U3OA 1QKWA 2KE9A 3NGPA 3QWYA 1FMKA 4LUDA 4AFUC 1QCFA 1PRLC 2KGTA 4Z89A 1WIEA 2HCKA 2KT1A 5HCKA 1N5ZA 2RNAA 2FRYA 3O5ZA 3EG2A 3VS6A 1RI9A 2CREA 2W0ZA 1PWTA 2FO0A 2PNIA 1ZX6A 4J9CA 5IXBA 3H41A 3EHQA 4DEYA 2LCSA 2F2WA 3A98A 2VWFA 1ZUUA 4AG1C 2AKLA 1XOVA 4CC7A 1U5SA 4D8KA 2KT8A 4HVVA 4X1VA 1WFWA 1OPLA 1ABOA 1NEBA 2DL7A 2FPFA 2LMJA 1HJDA 1WX6A 1BK2A 1K1ZA 1AZGB 2M0YA 2XMFA 4KRTA 1Y0MA 2YDLA 3RNJA 3UA6A 4R0KA 2RQVA 1OPKA 1AD5A 1UECA 2AK5A 4OMOA 2CH4A 1SRMA 2HSPA 1YNZA 3H0HA 1KSWA 1U06A 1NLPC 4AFZC 2J7IA 2RMOA 1I07A 2CH4W 4OMNA 1UHFA 2E5KA 2DJQA 2LQNA 2I0NA 2L3PA 2JMCA 4J9DA 1SSHA 3CQTA 2KR3A 2NUZA 3I35A 1YP5A 4CC4B 2EVRA 2B86A 4LNPA 2BZYA 4A63B 1WXUA 2DL5A 2JT4A 2BZ8A 2GTOA 2HBWA 2EYZA 3M0RA 1PHTA 2FEIA 2O9SA 1H3HA 2RF0A 5IHKA 2BTTA 1K0XA 4IIMA 2CT4A 4RTVA 1GCPA 3LH5A 1UFFA 1G83A 5FWBA 1HD3A 1H8KA
chains in the Genus database with same CATH superfamily
1GBQA 3VV0A 2YRCA 2NUTB 5D7UA 2MPXC 4EMKC 3M0SA 2K3XA 2R58A 1SRLA 1BI3A 3QZ5B 1AZEA 1KK7A 2E5QA 3EFSA 3JCMJ 5IHIA 3SD4A 4NS5A 3NTHA 2KDSA 4MMKA 1JQQA 1YITQ 5DY9A 1KQSS 3CCQA 2VB6A 3QWXX 4PLLA 2O88A 4IUVA 3OYHA 4K11A 3VS3A 2LJ1A 1MUZA 2K7AA 3G4SA 2FB7A 4J9HA 3C94A 3Q1JA 2GGRA 2RB6A 2K9GA 1GBRA 3PVQA 3H0IA 5GANg 1YI2Q 5I11A 3VJPA 4RCCA 2NUTA 2VASA 4PJMA 3OYLA 4M75F 5ECAA 1SHGA 2LVMA 1SHFA 3MEVA 2DAQA 2IIMA 3OW2A 4E7LA 3CCVQ 1VUBA 4J9IA 4A4GA 5CKHA 3UT1A 1KHCA 3PT9A 3QIIA 5GANe 3H0FA 1MNDA 1X6BA 4LUEA 2GTJA 3CPWS 4QVCA 2Y4YA 3G6EQ 1AOJA 5GAN3 1K9AA 4XTZA 1YHQA 1S72A 1W2BS 2MYSA 3M4GA 3CCMQ 2HNIA 1JO8A 2AIRB 1IRXA 3PNWC 1I4K1 1WDXA 2PQWA 1EFNA 4PJOA 3PE0A 2DBMA 4KGVB 2J6FA 3QYGB 2ED0A 4NL2A 2K5LA 2LCLA 1VQ9T 4KULA 4R56A 3E2UA 1AWXA 2BZXA 4C5EA 3V8KA 4ESRA 1H92A 1WJRA 1BI2A 3R6NA 2DRMA 2OTLT 1BB9A 2ZPIB 2QXFA 4M78B 4MZPA 2P4RA 2PVDB 2OI3A 1M4ZA 4Z88A 2Z0WA 4M75C 4HT8A 3QG1A 2HSEB 2LTOA 4C92C 3EG1A 1QCOA 3X24B 1QKXA 1GFDA 2FPDA 4EPCA 3MP6A 1CKBA 4ELYC 5I2SA 1VQ8A 2F5KA 4C5IA 2D1XA 2EYQA 1WYXA 3EG0A 5GAN6 3QDRB 3OS5A 1GCQA 2CDTA 3MJXA 2EQJA 4QW2A 1VYTA 5IH2A 1K9MC 2EKHA 2D8JA 3R6OA 3EFOB 3KXTA 3JCMg 1YJWT 1YJ9T 1QQJA 2E3HA 2DL8A 1OU9A 4Z8AA 1ARKA 3VKIA 4M78E 2K6DA 2F2XA 4KH0B 4MDXA 1C6VX 2FYKA 2KMTA 5CQYA 1RLQC 3CC7A 5HKCA 1SG5A 1Q7YC 4BY6B 3CD6A 3JCMe 4RTZA 3EGUA 4XTYA 3SEMA 4DEXA 3OW2S 3OYKA 3M0TA 2ENMA 3NPFA 2DVJA 4XAXB 1WHMA 2M9UA 2ECZA 1UDLA 1G2BA 3X20B 3T9NA 4HCKA 3AT1B 2QQ9A 1BBZA 5LJ5h 3V7RA 3OYBA 2DE0X 3NMZC 4D8DA 1KC8C 3BDUA 2ZPBB 3RMQA 3CXCA 3L2VA 1XNIA 2E1HA 2F2VA 1M90C 2WACA 1ACMB 3C12A 2HQEA 3SHWA 3SFMA 5A0LA 1OX8A 3V7SA 1VIEA 1OQKA 4XU0A 3CCUA 1BIAA 1XTDA 1AT1B 1YN8A 3UF4A 2C0TA 3CCEQ 2XHCA 3SWNC 1Q7YR 1RABB 1WHGA 2EGAA 2YSQA 1PM3A 1MV0B 1X27A 1A0NB 2LZ6B 4JRQA 3RBBB 2CZ6B 1NJIR 2IVWA 3FRNA 1Y96B 4KBMB 3CC2T 2XK0A 3TVTA 1BCOA 1VA7A 3X26B 2EW3A 1M3AA 3JCMh 1VQNT 4EMGA 2QTVA 4C92D 1VQNA 4OMQA 3EHRA 2DL4A 3BE3A 1UJ0A 1N9SA 2RO0A 3QWYA 1VQ4Q 4M77A 2EFIA 2RHYA 3QYHB 4ZGEB 3CCJQ 1YBYA 2HQXA 4MZMA 3GNGA 1D0YA 2KT1A 3EG9B 1N5ZA 2RNAA 3QHSA 5CK9A 2FRYA 2QAZA 2W0ZA 1PWTA 2PNIA 3F70A 4PL6A 2Y4XA 5J39A 4OGEA 4DEYA 2LCSA 1PD0A 1N8RU 1Y96A 3H8ZA 4CC7A 5A0GA 3KUFA 1U5SA 3H6ZA 4D8KA 2QQBA 4J83A 1BI1A 4X1VA 1MMDA 2FPFA 1NPRA 3PMIA 2DK3A 4JS4A 1K1ZA 1AZGB 3LX7A 4R55A 2EJFA 1K8AC 3RNJA 5KYNA 1G8XA 2LDMA 4R0KA 2RQVA 3L1AA 1AD5A 1UECA 2VC8A 1K73R 4OMOA 4F04B 4FT2A 4M7AD 4PJJA 3M4YA 1U06A 2RMOA 3WXMB 1I07A 3HP9A 4BI3A 2PVGB 1UHFA 3V7CA 4PNOA 2RI3A 1PSFA 1Q81U 2L3PA 3CXCS 5KYXB 4FYVB 4J9DA 3L2ZA 2JZ2A 3I35A 2KR3A 1YP5A 2PUOB 2B86A 1H641 4M78G 5AYFA 3CMAT 1WHHA 3CMAA 2F69A 3P8DA 3MHXA 5IHKA 4RG2A 3JCMc 3JCMW 2WSFE 1M1KU 5GAN4 1G83A 3META 2OTJT 3QO3A 2RHZA 1IGQA 2HEQA 4AFSC 2OTJA 4BE2A 2OAUA 3IQLA 4FU6A 4PJOF 3JSCA 3S3OA 5FU7B 3M58A 5CKFA 4J9FA 1VQMA 4O6JA 3ULRB 2ZPEB 1VQ6Q 2BIVA 2E6ZA 1W1FA 2JS0A 3V8LA 4V2SA 1VQOT 2GFUA 3E19A 2CGHA 4QQGA 2DMOA 5LJ3d 5GAOl 5GJWB 1TSFA 4E7JA 1D3BB 4M7DA 5IN1A 4C8QD 2DZ9A 4FW2A 3GIBA 3CC4T 3MEAA 2WSEE 1QMCA 3GPLA 4M7DE 3DB4A 1VQ5T 2VXFA 1VQ5A 5IXFA 2YLCA 1OZ3A 5LJ3f 4BI8B 4LD9K 1D09B 1WJQA 2CYZB 4QVZA 1OOTA 5KYWB 5A2QE 1UGVA 5DLQE 4WF2A 3CPWP 4HA8A 1B07A 2O4XA 2PU9B 1JXOA 3E9GA 1Q95G 1KIKA 3I56T 1VQKA 1N6AA 2DXTA 1YFNA 2LQKA 2QA4T 2HKQB 2K5IA 4PFZA 2HKNA 3LH0A 1I1JA 3E1SA 3CCRQ 1Z9ZA 4A4KA 1BI0A 4UC4A 1VYVA 3ER0A 3EG3A 3I9QA 1JRIA 1D3BA 3SB2A 2KXCA 2JMAA 2NWMA 5GMKi 1KD1U 1RACB 2KY9A 5GAMh 4E2FB 2RI2A 1ZSGA 1VQPQ 4F7UB 3CPFA 1X69A 2RQTA 2X3XD 1YIJT 2HDAA 3CCST 1YIJA 8AT1B 1QP3A 3CCSA 3MP1A 2JOYA 4RCBA 4F14A 2QGFB 3INZA 1FWZA 1QWEA 2X51A 4L6V5 5LJ3j 3PIPA 1AEYA 3JAME 2PZ1A 2P84A 1YI2A 1T0HA 2D0QB 1JJ2P 2RHXA 3QDFA 2DLPA 1NZ9A 3HRUA 4AFQC 2QEXQ 1VOMA 4IIOA 3CCLQ 1TS9A 2QI2A 3VU3C 3CCVA 3TSWA 8ATCB 1LCKA 1TXQA 1I5OB 5GAMd 5HY6A 2EYYA 3REBB 4F7UA 2QK0A 1GCQC 2MWPA 4Y28E 3G6EA 1MMGA 1Q86C 1KG1A 3CCQT 2EBPA 2JVVA 2ATCB 4F7UE 4MMLA 4BE1A 2NLUA 1FYNA 2COZA 3HL8A 1VQLQ 2KRMA 2DZCA 3G4ST 2VYTA 2XKOC 4M78C 5GAMf 3CMET 2RHUA 4HVUA 1ZA2B 3CMEA 4LN2A 3L42A 5GMKh 3EFRA 1RAHB 4HXJA 4BB7A 2RK1A 5L23A 1EIFA 4Y92A 4PJOB 3A8OB 3OW2P 4TVRA 2CP7A 3URGA 3MO8A 1AWWA 2F5TX 1TWBA 4J9GA 3JCMQ 1VQ7Q 5DM7R 1Q82C 1VIFA 1YJNT 1K4US 2XICA 4J7IA 2CZ1B 1YJNA 4ZGJB 4ANJA 1TOVA 2O31A 1GXIE 3CBPA 3FC3A 4X9DA 2OJ2A 4CC3A 1RADB 2FVUA 1MMNA 4EDUA 4KT0E 2JS2A 4BUGA 5M9OA 1JU5C 1YCSB 3A8MB 4IUQA 4IUTA 1YHQT 4DA4A 1S72T 4HCCA 2EYWA 2DVEA 2PTKA 4ELZC 3GBQA 2YHTA 4LE9A 4J6WA 2C0OA 1Q86R 4M77F 1PKSA 3M0PA 4OMMA 1E6GA 1M9SA 1QLYA 4IUPA 2CP2A 3JB9D 2KNBB 3VS1A 4BY6C 3WVEB 4PJOE 2GBQA 2LQ8A 1ZBJA 3KBGA 2J6KA 4OMLA 2QDYB 3A8HB 4GBQA 2JNGA 4KH1B 2MAMA 1UGQB 3OB9A 1LPLA 1G3TA 2JTEA 2KXDA 3M55A 2CUBA 1AVZC 1U1TA 1U1SA 3PIOA 1C0MA 4J9BA 2CSQA 2C06A 3M9QA 2DERA 1Q82R 1UUEA 3VRZA 1WHKA 4RKUE 4JLIA 4RTXA 5L8RE 3EAEA 3G71T 1ZHIA 1UE9A 2M02A 3OBWA 2D0NA 3G71A 1VQ8T 4O5VA 1M8MA 1NPPA 1IZ6A 1X43A 3L2RA 2CP6A 3FEOA 4PFPA 4FM4B 4FW1A 4XTXA 4DOVA 1AWOA 1FMVA 4JJBA 1IHVA 1M3CA 5GANh 2VV5A 4Q5WA 4J8OA 1BU1A 2C0IA 4JPBW 1QP2A 4N4GA 1ZUKA 2AZSA 4EMKA 2D9TA 3M0QA 1AHJB 2OAWA 1UG1A 1Q7YU 2KE9A 3MP8A 3NGPA 1WZOA 3C95A 9ATCB 3OA6A 2DPPB 5I2MA 2EJ9A 1M1FA 1BKBA 4LUDA 1PRLC 2X4YA 3CC7T 4LDVA 2X35A 1VQ9Q 3M56A 3UDCA 3L2WA 4M78D 1NJIU 3RR6A 4E7HA 3CD6T 3EG2A 3VS6A 2CREA 2FO0A 4J9CA 3EHQA 4B6MA 2OTLQ 2BE7D 3CCEA 1ZUUA 1XOVA 2ZPFB 2V8IA 4XK8E 2LMJA 1WX6A 2DD4A 3A1PA 3J81E 2COWA 5D6YA 3GF5A 2YDLA 4D6WA 4IURA 5A0DA 4B9XA 1OI1A 2E41A 4M7DF 4F7UG 2CH4A 3FDRA 1SRMA 1IXDA 2YWWA 2HSPA 1X75C 1YNZA 4XTUA 2HAXA 4DOWA 1U8RA 1NLPC 3M57A 2L3RA 4AFZC 2J7IA 2ZAEA 3PFSA 2BE9B 1K9MR 3EH1A 2R5MA 1RAEB 5GAOr 3HRTA 3D7SB 3CCUT 5FLXE 2NUZA 4BDYA 4HCZA 4CC4B 4NOYA 1VQ4A 5EG2A 3UPUA 2KVQG 1IHWA 2BZ8A 3CCJA 1YJWQ 2GTOA 2JTFA 1YJ9Q 2EYZA 3LGLA 1K73U 2K57A 1PHTA 2FEIA 4M77B 3MPUB 1QW1A 2BTTA 2LT1A 2V26A 2RJDA 1K0XA 4A4HA 4II1A 2RI5A 5LJ5d 4DBQA 3LH5A 1KHIA 1HD3A 2FL7A 2HQHA 1H8KA 2R57A 1PSEA 2FZCB 4GY5A 3MKDA 1TUDA 1XJWB 1DJ7B 4JDSA 3DKMA 2G6FX 1KQ2A 3RMSA 4M75D 2EWNA 2EYXA 5LJ5f 4LDYA 5KYYB 2R5AA 1RAGB 1IGUA 1XQHA 3RUXA 4C92A 1EZZB 5KCOA 4AMCA 2FG0A 1KC8R 2RA2A 1UB4A 2MI6A 2DTIA 4FCYA 2JM9A 3J80E 2XIDA 3E9FA 4PJOG 2KRNA 4C92E 1BIBA 1M90R 4JJDA 4M7AB 4CC2A 1ZQ1A 2EPDA 4CRIA 4M77E 1NM7A 1LOJA 2H3JA 3O8VA 4PJLA 5CCAA 5FU7C 2XD0A 1QVGA 1G3YA 3A8GB 4C0ZA 2DIGA 1RAAB 3EH2A 2E10A 2CP3A 4F7UF 2A0FB 2QG9B 3NHNA 3JCMd 1M27C 1D1BA 2EGEA 3I55T 4BE0A 1RAFB 1N9RA 4C5HA 3I55A 2CS7A 3BY7A 2L3SA 2RM4A 5KYYA 2LQWA 3CBOA 2DX1A 2ZGWA 4F16A 1T3SA 3RERA 4BACA 3L2QA 5LJ5j 1X2QA 3LYIA 3JCMf 5KCHA 2RQRA 5FU6B 2LJ0A 3JCMV 2O01E 4A54A 4M7AA 2MIOA 3CC2Q 2D8HA 4GLMA 4L59A 4M7AE 3X28B 1VQNQ 1M3BA 1N8RC 2GQIA 2SRCA 4RTTA 2XDDA 2E70A 3FLGA 1WLPB 1GL5A 1BYMA 4LDWA 1W6XA 3TU4K 4B9WA 3S3MA 2KROA 1WA7A 4OB0B 1OEBA 4BI4A 1K0SA 4N0AC 4M7DB 3QKJA 2L3QA 4OMPA 4QQ6A 4E7IA 2FRWA 3ASKA 4C8QB 1IREB 4RUGA 2LX9A 2AZVA 2X3WD 2LCCA 1TUCA 5GJVB 1ABQA 5HK3A 2DEUA 3OS2A 4JLGA 1KQSP 3C0CA 3OYMA 1CKAA 3VS5A 5GAOn 3UA7A 1Q81C 3G1JA 2O4XB 1OYXA 1K8AR 1O9SA 2L5QA 4ZNXA 1FXXA 2K5FA 4QT7A 4N4HA 1VQMT 1I5LA 3CCRA 2CZ0B 3EGXA 3VS0A 1NE8A 1AWJA 1M2VB 3LGFA 2YXYA 2RN8A 3HHTB 1D0XA 3VYGA 2O2OA 5CKDA 2KBTA 2LJ3A 2J6OA 1K76A 4WCIA 2KYMA 1JB0E 1M1KC 1GFCA 2RHIA 1SPKA 1WPYA 3GLXA 3MEWA 3OSSC 3GOXA 4HCBA 2GCXA 2K2MA 3VS4A 4C8QA 2FHDA 1NLOC 4JRKA 2XDBA 2QQAA 2ESWA 2EQUA 4WTOB 3QJYA 4C8QE 3M0UA 4J7FA 4J6YA 3HKSA 1KJWA 3CMAQ 3ZEHA 1VQKT 5IT9E 1I8FA 3ZL7C 1D1CA 4EMHA 1W2BP 3OQ5A 1JXMA 2EJGA 1QVGS 3JRZA 2XI9A 2YUNA 2COYA 4HVWA 1M2VA 1QVFA 2AT1B 4VUBA 1OULA 1M2OA 3CCLT 2FZGB 5I21A 3CCLA 5IHNA 4C0FA 2EQKA 2OTJQ 1QVPA 1M30A 4FIBA 1UGSB 3TEEA 4PJOC 1GRIA 3TREA 3RKWA 1YITT 2M0OA 4DBHA 3AHUA 1YITA 2DF6A 2DXCA 3OYNA 1T0JA 2I2LA 1QWFA 2LP5A 2D6FA 1WNLA 2MWOA 2DNUA 3JCMP 4X34A 4OB1B 2BUDA 2DA9A 2P4TA 4AG2C 5GMKm 1VQOQ 2CP0A 5FROA 4BDZA 2VXEA 1M1KR 4C0DB 2KYBA 5GAOp 2A7YA 2DO3A 2HD0A 2VVKA 4RG8A 5EC7A 4M77G 2H3EB 3GNFB 3UWNA 2HZYA 1J3TA 1YI2T 3MCAB 4RTUA 3I5SA 4ZN3A 2VUBA 3CC4Q 2JN0A 3OYFA 1TTHB 1OU8A 3EGDA 2DXBA 1VQ5Q 1NYFA 2FZKB 2YUOA 2E6NA 1VQ7A 3CCVT 2YUQA 1KD1C 2DL3A 2JM8A 1QCNA 2ED1A 1YWOA 2EQMA 1RLPC 4ZTJA 1E7OA 4LD6A 2X9HA 2EIFA 3I56Q 2ABLA 3VS7A 3OYYA 2MK5A 3G7ZA 1WQWA 2QA4Q 1UJYA 3G6ET 5CIUA 1JJ2A 4XTVA 2DEQA 1X2KA 4KUIA 2DYIA 3BDLA 1ZBXA 2RPNA 4FL6A 3JV3A 3CCMT 3C4SA 3NTKA 1JEGA 3QBYA 4X9CA 1S1NA 1E6HA 3CCMA 1T3LA 4M7AG 4FSXA 2L0AA 4BD3A 5C0MA 4XTWA 1Q82U 3QPHA 4JS5A 3V8JA 2V8JA 5CQXA 2NUPB 4RTYA 1QKWA 2PUKB 4JUVA 1FMKA 2HBPA 3OS0A 1YIJQ 4AFUC 1QCFA 3CCSQ 3VUBA 2KGTA 4Z89A 1WIEA 3OY9A 4LXCA 1PC0A 5CR2A 2RJCA 4XQ3A 2HCKA 3OBYA 5HCKA 2HL3A 5J3BA 3O5ZA 1KQ1A 1UGRB 2RJEA 4KGZB 1ZSZB 2L89A 5IXBA 3H41A 2DD5A 1KD1R 2GQVA 2VWFA 3RDVA 4AG1C 2AKLA 4ZGDB 3LW5E 4HVVA 4C92F 5KE2A 2JTMA 3S6WA 1OPLA 2DTOA 1NEBA 2DL7A 1QVFS 2M0YA 2XMFA 2XU8A 1F1BB 2NUPA 5FRMA 1OPKA 5GAN5 2AK5A 5GAMj 4OGCA 4OMFB 3RKYA 3H0HA 1KSWA 3CCQQ 5DLOA 5J26A 3JCMb 2LC4A 2CH4W 2E5KA 2VGNA 4PJOD 2DFUA 1MNEA 3G4SQ 4M7DG 2LQNA 5GAN7 3CMEQ 4AT1B 1ZSZA 2JMCA 4ATOA 5HK0A 4C8QG 4EMKB 1MMAA 3CQTA 2G3RA 2EVRA 3WVDB 2LNVA 4LNPA 2BZYA 2KI7A 2X4XA 2DTHA 1WXUA 2JT4A 5LJ5g 1VQ9A 2O9SA 3HFOA 2CZ7B 4ME7A 2RF0A 2CT4A 1G5VA 3JB9J 4RTVA 2DJZA 1YJNQ 1UFFA 3HPWA 4M7AF 3JCMX 2OTLA 4N4IA 3OMCA 1K9MU 4EIKA 1RL2A 3PGGA 2KAFA 1C1AA 5LJ5e 1Y57A 5GAN2 3OYAA 1YHQQ 1SF9A 1NYGA 3RIRA 1S72Q 2KRSA 1JJ2S 2YUPA 3TSZA 2BKDN 4M77C 2V8KA 1UTIA 2GNCA 5GMKj 4JRIA 3GP8A 4ZTFA 2HMAA 3UATA 4P5NA 5FW9A 2K79A 1TUGB 2M16A 3J7AF 1FMWA 2RD1A 4KGXB 1TG0A 2B8AA 2J05A 5D6WA 1PNJA 4JRPA 4XU1A 2YT6A 4NL3A 2K4YA 4M78A 2P0QA 2DIQA 2QTXA 2GF7A 3CCET 2JXBA 2K3BA 3ZBDA 1YJWA 1YJ9A 5GAOq 2CKKA 5GANd 1B3QA 1KC8U 3P8HA 2V1QA 3PVLA 2IG0A 4JZ3A 1M90U 2A37A 4A4FA 1R77A 3FJ5A 4M7AC 3G71Q 2CSIA 2O9VA 1KFZA 3CXCP 3ZFJA 2RQUA 5GANf 2RK2A 1VQ8Q 1I0CA 1Y07A 5CKEA 4ORZA 5CAIA 4C8QF 1B34B 1NJIC 2QYZA 2ZPHB 4QKUA 2A36A 1MV3A 1RAIB 1I81A 2K2VA 2RQWA 2XDPA 3H9NA 3EFOA 2EGCA 4M75B 1IO6A 3OYEA 1HXDA 4C92B 4OB3B 1VQ4T 1WQ7A 3BFMA 6AT1B 1LVKA 3CCJT 1V1CA 2L8DA 2K3YA 2W10A 1RUWA 2JW4A 2NYSA 1NBEB 1R8OB 3HRSA 2ROTA 2MCNA 2DILA 1WXTA 4FSSA 3PTAA 5FU6C 4E47A 2ROLA 2CP5A 2A3LA 3CC7Q 4L5GA 5FRNA 1PRMC 4PKCC 2VKNA 3NTIA 5CO7A 1NEGA 5LL6S 1WGSA 2DM1A 3CD6Q 4PJNA 5KE3A 2MMPA 1MHNA 1B34A 4OF1A 1CSKA 3OYIA 1JBMA 1O75A 2CT3A 4FYXB 3VS2A 1HYOA 4J9EA 4JJCA 2CUDA 1SEMA 5GANj 4E6RA 1PCXA 3OS1A 4M75A 5LJ3g 3ME9A 1W4SA 1ZUYA 3LWHA 4M7DC 1LJOA 3OYCA 2EKOA 4JZ4A 4DBRA 1NG2A 4M75E 3OYGA 1K73C 3QUIA 2LRQA 5D6XA 4C8QC 1M8VA 3CC2A 1TH7A 2KSSA 2AHJB 2EQIA 4DBFA 4FT4A 1EX4A 3BW1A 3JB9G 2QGGA 3JB9I 2DYBA 3VUZA 2WSCE 2DETA 5LJ3e 1UEBA 2H8HA 4OB2B 1QVGP 4PLIA 2KQWA 3LLRA 5FWCA 1ZLMA 2LX7A 3I5RA 5I22A 4M77D 1BCMA 3FB9A 1K8AU 1R0CB 3QSUA 1Y71A 2RH2A 2M51A 3MEUA 3CCUQ 3LWIA 1PG5B 4PK4A 1WJSA 1D0ZA 3N5BB 3PMTA 2EAYA 4LDXA 1WHJA 3X25B 2E4HA 3RKXA 1W70A 3SDZA 3M53A 1LNXA 5KYUB 1PKTA 2A08A 2V1RA 1VYUA 2X4WA 3A8LB 3A5ZB 2IPOB 3TQ7P 2QQRA 1Z9QA 3QXEB 3JB9H 1UHCA 3M54A 3HTRA 1VQ6T 1IB8A 2J06A 3THKA 1VQ6A 1X6OA 3SWNB 2A28A 4GLKA 4IUUA 4PFOA 3EGXB 2M1HA 1HSQA 2L2PA 1V29B 1UGPB 2ZPGB 2LNHB 3QZ9B 1YWPA 1OV3A 4Z02A 1X01A 2E3IA 1M5Q1 3OYJA 2JJ9A 3EG9A 5CKBA 2QDLA 4A4EA 2KEAA 2ZCFB 4RTWA 2E65A 3L2UA 3S3NA 2QASA 4C0GA 3REAB 4RMOA 4MDWA 5KYUA 3U23A 3VRYA 3CEYA 5LJ3h 2F1LA 1G3SA 4C5GA 5GAMg 4HT9A 3DLMA 1G3WA 3QJ6A 1SKUB 4E7SA 2YRDA 4IKFA 4F17A 4YTLA 2MOXA 3OYDA 4M4ZA 3CCRT 3I55Q 3DLLA 1WI7A 4C0DC 3KFVA 3SWNA 2AKKA 3JB9F 2DBKA 2KK4A 5GAMe 1WXBA 2FPEA 4FYWB 1KQSA 3FIFA 1MGQA 2DRKA 2SEMA 1VQPT 1N8RR 1B7TA 1VQPA 4QVDA 1RI0A 5KYXA 1ZA1B 5GMKl 1OZ2A 1X6GA 4J6XA 4QQDA 1U3OA 3P8BB 1FX7A 3HSBA 1VQOA 4M7DD 5AT1B 1N27A 3M5AA 4ZN1A 2X4JA 5C6SA 1QVFP 3CC4A 4DQ2A 4Y91A 4A53A 1RI9A 1YCYA 2QQSA 2RJFA 3CBMA 2E64A 2QEXT 1ZX6A 1WHLA 2VGMA 1OX9A 5GAN8 2YLBA 2F2WA 3EGDB 2QEXA 4J5YA 4XU3A 3A98A 1Q81R 1D1AA 2KT8A 2GFAA 3VYHB 2E12A 1P92A 1WFWA 1ABOA 1HJDA 2JUFA 3CPWA 1BK2A 3I56A 2LT4A 4OVAA 1V76A 4KRTA 1Y0MA 5IAYA 3UA6A 1R0BG 2QA4A 1W2BA 1H3ZA 4M75G 1VQMQ 1VQLT 5KH6A 2XG8D 4C92G 7AT1B 1VQLA 5GMKe 2HL5C 4LDUA 1ZSZC 4M78F 4E7KA 4OMNA 2PVOB 5CVIA 5GAOm 2DJQA 1PD1A 2I0NA 2P0PA 2DKGA 4CI0C 3TCJA 1HK9A 4JJNK 3M59A 1SSFA 1SSHA 3OMGA 5KYWA 3FJPA 2P0KA 1Y7XA 4HKEA 4E7ZA 1VQ7T 4XU2A 4A63B 4KUDK 2DXUA 2DL5A 2HBWA 1Q86U 3M0RA 2OX7A 1H3HA 3OSVA 4FYYB 2Y90A 1M1GA 4IIMA 3DB3A 2MF2A 2YRVA 1VQKQ 4MZTA 4OP0A 3RESA 2ZZDA 3NFCA 1GCPA 1TU0B 4N0AA 5FWBA 3HFNA
chains in the Genus database with same CATH topology
1GBQA 4EIKA 2HEQA 4AFSC 1TUDA 1Y57A 3IQLA 3M0SA 2G6FX 1SRLA 1NYGA 2EYXA 1AZEA 2KRSA 2YUPA 4J9FA 5IHIA 3TSZA 3ULRB 1JQQA 1UTIA 1W1FA 2GNCA 2FG0A 2JS0A 2JM9A 3QWXX 2DMOA 2KRNA 2O88A 3UATA 5GJWB 5FW9A 4K11A 2K79A 3VS3A 4JJDA 4CC2A 2LJ1A 1MUZA 2K7AA 2EPDA 4J9HA 1TG0A 2J05A 2GGRA 1PNJA 1NM7A 2K9GA 1GBRA 2YT6A 3PVQA 3H0IA 5IXFA 5I11A 2JXBA 1OOTA 2K3BA 1UGVA 1B07A 5ECAA 1SHGA 1JXOA 3NHNA 1SHFA 1M27C 1B3QA 2IIMA 1KIKA 2EGEA 2V1QA 4J9IA 3PVLA 4JZ3A 2L3SA 2LQWA 2DX1A 2A37A 4F16A 3FJ5A 1I1JA 1T3SA 3H0FA 2CSIA 2O9VA 1KFZA 1Z9ZA 1X6BA 4LUEA 2GTJA 2RQUA 1VYVA 1X2QA 2RQRA 1I0CA 1AOJA 3EG3A 4ORZA 2LJ0A 3I9QA 1K9AA 2KXCA 2MIOA 2JMAA 2A36A 1MV3A 2D8HA 2NWMA 4GLMA 1JO8A 2RQWA 1M3BA 1WDXA 2GQIA 1ZSGA 2EGCA 2SRCA 1IO6A 4RTTA 1EFNA 1X69A 3PE0A 2RQTA 2X3XD 2DBMA 1WLPB 1GL5A 2J6FA 2HDAA 1W6XA 2ED0A 2KROA 4F14A 1WA7A 1V1CA 2W10A 1QWEA 1AWXA 1RUWA 2BZXA 2JW4A 1OEBA 1K0SA 2MCNA 2ROTA 2DILA 1WXTA 4FSSA 4ESRA 1AEYA 2ROLA 1H92A 2L3QA 4OMPA 1PRMC 2PZ1A 1T0HA 2VKNA 2FRWA 3R6NA 2DRMA 4RUGA 1NEGA 1BB9A 2DLPA 2AZVA 2DM1A 4AFQC 2X3WD 1TUCA 2P4RA 5GJVB 2OI3A 1ABQA 4IIOA 1CSKA 4Z88A 2CT3A 3C0CA 3VS2A 3TSWA 1CKAA 3VS5A 3UA7A 4J9EA 1LCKA 4JJCA 2CUDA 3EG1A 1SEMA 4ZNXA 4E6RA 1QKXA 2EYYA 4QT7A 3REBB 1GFDA 2FPDA 1CKBA 3VS0A 1GCQC 1AWJA 1ZUYA 2RN8A 4JZ4A 2EBPA 1NG2A 2O2OA 2KBTA 2D1XA 2LJ3A 2J6OA 1FYNA 1K76A 4WCIA 1WYXA 2KRMA 3EG0A 1GCQA 2KYMA 2CDTA 2EQIA 4HVUA 1GFCA 1SPKA 1VYTA 4LN2A 5IH2A 2DYBA 2K2MA 3VS4A 2EKHA 2H8HA 2D8JA 1NLOC 4HXJA 2ESWA 5FWCA 1ZLMA 2LX7A 3I5RA 5L23A 5I22A 4Y92A 3M0UA 2DL8A 2M51A 4Z8AA 1ARKA 2K6DA 1KJWA 1AWWA 2F2XA 4J9GA 1RLQC 3ZL7C 1K4US 1JXMA 2O31A 2YUNA 4HVWA 1W70A 4RTZA 2OJ2A 3EGUA 4CC3A 3SEMA 4DEXA 5IHNA 1PKTA 2A08A 2JS2A 2V1RA 1JU5C 1YCSB 1VYUA 3M0TA 2ENMA 1M30A 3NPFA 2DVJA 2ECZA 1UDLA 1G2BA 1Z9QA 2EYWA 2PTKA 1UHCA 3GBQA 1GRIA 4HCKA 4LE9A 1BBZA 2C0OA 2J06A 3THKA 2DF6A 1PKSA 3M0PA 4OMMA 2A28A 2DE0X 1T0JA 1E6GA 1QWFA 2LP5A 3NMZC 4D8DA 1HSQA 1QLYA 2L2PA 2DNUA 2KNBB 2LNHB 2DA9A 3VS1A 4AG2C 1YWPA 2F2VA 1OV3A 2GBQA 1ZBJA 2J6KA 2KYBA 4OMLA 5EC7A 2VVKA 4GBQA 3SHWA 2QDLA 2KEAA 1J3TA 4RTUA 3I5SA 4RTWA 2JTEA 2KXDA 2CUBA 1AVZC 3REAB 3U23A 4J9BA 3VRYA 1NYFA 2YUOA 2CSQA 1YN8A 3UF4A 1UUEA 2C0TA 2DL3A 2JM8A 2YUQA 3VRZA 2ED1A 4F17A 1YWOA 1RLPC 4RTXA 1E7OA 2MOXA 2EGAA 2YSQA 1UE9A 4M4ZA 2ABLA 1MV0B 1X27A 3VS7A 2D0NA 1WI7A 3KFVA 1A0NB 2AKKA 1UJYA 2LZ6B 1M8MA 2DBKA 3RBBB 1X43A 1X2KA 2RPNA 3JV3A 1WXBA 3TVTA 1AWOA 2FPEA 1VA7A 1JEGA 2EW3A 1M3AA 1S1NA 4JJBA 1E6HA 1M3CA 1T3LA 1BU1A 2C0IA 2DRKA 2SEMA 4JPBW 2L0AA 1ZUKA 2AZSA 4OMQA 3EHRA 3M0QA 2DL4A 4RTYA 1X6GA 1UG1A 2OAWA 1UJ0A 1U3OA 1QKWA 2KE9A 3NGPA 3QWYA 1FMKA 4LUDA 4AFUC 1QCFA 1PRLC 2KGTA 4Z89A 1WIEA 2HCKA 2KT1A 5HCKA 1N5ZA 2RNAA 2FRYA 3O5ZA 3EG2A 3VS6A 1RI9A 2CREA 2W0ZA 1PWTA 2FO0A 2PNIA 1ZX6A 4J9CA 5IXBA 3H41A 3EHQA 4DEYA 2LCSA 2F2WA 3A98A 2VWFA 1ZUUA 4AG1C 2AKLA 1XOVA 4CC7A 1U5SA 4D8KA 2KT8A 4HVVA 4X1VA 1WFWA 1OPLA 1ABOA 1NEBA 2DL7A 2FPFA 2LMJA 1HJDA 1WX6A 1BK2A 1K1ZA 1AZGB 2M0YA 2XMFA 4KRTA 1Y0MA 2YDLA 3RNJA 3UA6A 4R0KA 2RQVA 1OPKA 1AD5A 1UECA 2AK5A 4OMOA 2CH4A 1SRMA 2HSPA 1YNZA 3H0HA 1KSWA 1U06A 1NLPC 4AFZC 2J7IA 2RMOA 1I07A 2CH4W 4OMNA 1UHFA 2E5KA 2DJQA 2LQNA 2I0NA 2L3PA 2JMCA 4J9DA 1SSHA 3CQTA 2KR3A 2NUZA 3I35A 1YP5A 4CC4B 2EVRA 2B86A 4LNPA 2BZYA 4A63B 1WXUA 2DL5A 2JT4A 2BZ8A 2GTOA 2HBWA 2EYZA 3M0RA 1PHTA 2FEIA 2O9SA 1H3HA 2RF0A 5IHKA 2BTTA 1K0XA 4IIMA 2CT4A 4RTVA 1GCPA 3LH5A 1UFFA 1G83A 5FWBA 1HD3A 1H8KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GBQ A;  4EIK A;  2HEQ A;  4AFS C;  1TUD A;  1Y57 A;  3IQL A;  3M0S A;  2G6F X;  1SRL A;  1NYG A;  2EYX A;  1AZE A;  2KRS A;  2YUP A;  4J9F A;  5IHI A;  3TSZ A;  3ULR B;  1JQQ A;  1UTI A;  1W1F A;  2GNC A;  2FG0 A;  2JS0 A;  2JM9 A;  3QWX X;  2DMO A;  2KRN A;  2O88 A;  3UAT A;  5GJW B;  5FW9 A;  4K11 A;  2K79 A;  3VS3 A;  4JJD A;  4CC2 A;  2LJ1 A;  1MUZ A;  2K7A A;  2EPD A;  4J9H A;  1TG0 A;  2J05 A;  2GGR A;  1PNJ A;  1NM7 A;  2K9G A;  1GBR A;  2YT6 A;  3PVQ A;  3H0I A;  5IXF A;  5I11 A;  2JXB A;  1OOT A;  2K3B A;  1UGV A;  1B07 A;  5ECA A;  1SHG A;  1JXO A;  3NHN A;  1SHF A;  1M27 C;  1B3Q A;  2IIM A;  1KIK A;  2EGE A;  2V1Q A;  4J9I A;  3PVL A;  4JZ3 A;  2L3S A;  2LQW A;  2DX1 A;  2A37 A;  4F16 A;  3FJ5 A;  1I1J A;  1T3S A;  3H0F A;  2CSI A;  2O9V A;  1KFZ A;  1Z9Z A;  1X6B A;  4LUE A;  2GTJ A;  2RQU A;  1VYV A;  1X2Q A;  2RQR A;  1I0C A;  1AOJ A;  3EG3 A;  4ORZ A;  2LJ0 A;  3I9Q A;  1K9A A;  2KXC A;  2MIO A;  2JMA A;  2A36 A;  1MV3 A;  2D8H A;  2NWM A;  4GLM A;  1JO8 A;  2RQW A;  1M3B A;  1WDX A;  2GQI A;  1ZSG A;  2EGC A;  2SRC A;  1IO6 A;  4RTT A;  1EFN A;  1X69 A;  3PE0 A;  2RQT A;  2X3X D;  2DBM A;  1WLP B;  1GL5 A;  2J6F A;  2HDA A;  1W6X A;  2ED0 A;  2KRO A;  4F14 A;  1WA7 A;  1V1C A;  2W10 A;  1QWE A;  1AWX A;  1RUW A;  2BZX A;  2JW4 A;  1OEB A;  1K0S A;  2MCN A;  2ROT A;  2DIL A;  1WXT A;  4FSS A;  4ESR A;  1AEY A;  2ROL A;  1H92 A;  2L3Q A;  4OMP A;  1PRM C;  2PZ1 A;  1T0H A;  2VKN A;  2FRW A;  3R6N A;  2DRM A;  4RUG A;  1NEG A;  1BB9 A;  2DLP A;  2AZV A;  2DM1 A;  4AFQ C;  2X3W D;  1TUC A;  2P4R A;  5GJV B;  2OI3 A;  1ABQ A;  4IIO A;  1CSK A;  4Z88 A;  2CT3 A;  3C0C A;  3VS2 A;  3TSW A;  1CKA A;  3VS5 A;  3UA7 A;  4J9E A;  1LCK A;  4JJC A;  2CUD A;  3EG1 A;  1SEM A;  4ZNX A;  4E6R A;  1QKX A;  2EYY A;  4QT7 A;  3REB B;  1GFD A;  2FPD A;  1CKB A;  3VS0 A;  1GCQ C;  1AWJ A;  1ZUY A;  2RN8 A;  4JZ4 A;  2EBP A;  1NG2 A;  2O2O A;  2KBT A;  2D1X A;  2LJ3 A;  2J6O A;  1FYN A;  1K76 A;  4WCI A;  1WYX A;  2KRM A;  3EG0 A;  1GCQ A;  2KYM A;  2CDT A;  2EQI A;  4HVU A;  1GFC A;  1SPK A;  1VYT A;  4LN2 A;  5IH2 A;  2DYB A;  2K2M A;  3VS4 A;  2EKH A;  2H8H A;  2D8J A;  1NLO C;  4HXJ A;  2ESW A;  5FWC A;  1ZLM A;  2LX7 A;  3I5R A;  5L23 A;  5I22 A;  4Y92 A;  3M0U A;  2DL8 A;  2M51 A;  4Z8A A;  1ARK A;  2K6D A;  1KJW A;  1AWW A;  2F2X A;  4J9G A;  1RLQ C;  3ZL7 C;  1K4U S;  1JXM A;  2O31 A;  2YUN A;  4HVW A;  1W70 A;  4RTZ A;  2OJ2 A;  3EGU A;  4CC3 A;  3SEM A;  4DEX A;  5IHN A;  1PKT A;  2A08 A;  2JS2 A;  2V1R A;  1JU5 C;  1YCS B;  1VYU A;  3M0T A;  2ENM A;  1M30 A;  3NPF A;  2DVJ A;  2ECZ A;  1UDL A;  1G2B A;  1Z9Q A;  2EYW A;  2PTK A;  1UHC A;  3GBQ A;  1GRI A;  4HCK A;  4LE9 A;  1BBZ A;  2C0O A;  2J06 A;  3THK A;  2DF6 A;  1PKS A;  3M0P A;  4OMM A;  2A28 A;  2DE0 X;  1T0J A;  1E6G A;  1QWF A;  2LP5 A;  3NMZ C;  4D8D A;  1HSQ A;  1QLY A;  2L2P A;  2DNU A;  2KNB B;  2LNH B;  2DA9 A;  3VS1 A;  4AG2 C;  1YWP A;  2F2V A;  1OV3 A;  2GBQ A;  1ZBJ A;  2J6K A;  2KYB A;  4OML A;  5EC7 A;  2VVK A;  4GBQ A;  3SHW A;  2QDL A;  2KEA A;  1J3T A;  4RTU A;  3I5S A;  4RTW A;  2JTE A;  2KXD A;  2CUB A;  1AVZ C;  3REA B;  3U23 A;  4J9B A;  3VRY A;  1NYF A;  2YUO A;  2CSQ A;  1YN8 A;  3UF4 A;  1UUE A;  2C0T A;  2DL3 A;  2JM8 A;  2YUQ A;  3VRZ A;  2ED1 A;  4F17 A;  1YWO A;  1RLP C;  4RTX A;  1E7O A;  2MOX A;  2EGA A;  2YSQ A;  1UE9 A;  4M4Z A;  2ABL A;  1MV0 B;  1X27 A;  3VS7 A;  2D0N A;  1WI7 A;  3KFV A;  1A0N B;  2AKK A;  1UJY A;  2LZ6 B;  1M8M A;  2DBK A;  3RBB B;  1X43 A;  1X2K A;  2RPN A;  3JV3 A;  1WXB A;  3TVT A;  1AWO A;  2FPE A;  1VA7 A;  1JEG A;  2EW3 A;  1M3A A;  1S1N A;  4JJB A;  1E6H A;  1M3C A;  1T3L A;  1BU1 A;  2C0I A;  2DRK A;  2SEM A;  4JPB W;  2L0A A;  1ZUK A;  2AZS A;  4OMQ A;  3EHR A;  3M0Q A;  2DL4 A;  4RTY A;  1X6G A;  1UG1 A;  2OAW A;  1UJ0 A;  1U3O A;  1QKW A;  2KE9 A;  3NGP A;  3QWY A;  1FMK A;  4LUD A;  4AFU C;  1QCF A;  1PRL C;  2KGT A;  4Z89 A;  1WIE A;  2HCK A;  2KT1 A;  5HCK A;  1N5Z A;  2RNA A;  2FRY A;  3O5Z A;  3EG2 A;  3VS6 A;  1RI9 A;  2CRE A;  2W0Z A;  1PWT A;  2FO0 A;  2PNI A;  1ZX6 A;  4J9C A;  5IXB A;  3H41 A;  3EHQ A;  4DEY A;  2LCS A;  2F2W A;  3A98 A;  2VWF A;  1ZUU A;  4AG1 C;  2AKL A;  1XOV A;  4CC7 A;  1U5S A;  4D8K A;  2KT8 A;  4HVV A;  4X1V A;  1WFW A;  1OPL A;  1ABO A;  1NEB A;  2DL7 A;  2FPF A;  2LMJ A;  1HJD A;  1WX6 A;  1BK2 A;  1K1Z A;  1AZG B;  2M0Y A;  2XMF A;  4KRT A;  1Y0M A;  2YDL A;  3RNJ A;  3UA6 A;  4R0K A;  2RQV A;  1OPK A;  1AD5 A;  1UEC A;  2AK5 A;  4OMO A;  2CH4 A;  1SRM A;  2HSP A;  1YNZ A;  3H0H A;  1KSW A;  1U06 A;  1NLP C;  4AFZ C;  2J7I A;  2RMO A;  1I07 A;  2CH4 W;  4OMN A;  1UHF A;  2E5K A;  2DJQ A;  2LQN A;  2I0N A;  2L3P A;  2JMC A;  4J9D A;  1SSH A;  3CQT A;  2KR3 A;  2NUZ A;  3I35 A;  1YP5 A;  4CC4 B;  2EVR A;  2B86 A;  4LNP A;  2BZY A;  4A63 B;  1WXU A;  2DL5 A;  2JT4 A;  2BZ8 A;  2GTO A;  2HBW A;  2EYZ A;  3M0R A;  1PHT A;  2FEI A;  2O9S A;  1H3H A;  2RF0 A;  5IHK A;  2BTT A;  1K0X A;  4IIM A;  2CT4 A;  4RTV A;  1GCP A;  3LH5 A;  1UFF A;  1G83 A;  5FWB A;  1HD3 A;  1H8K A; 
#chains in the Genus database with same CATH topology
 1GBQ A;  3VV0 A;  2YRC A;  2NUT B;  5D7U A;  2MPX C;  4EMK C;  3M0S A;  2K3X A;  2R58 A;  1SRL A;  1BI3 A;  3QZ5 B;  1AZE A;  1KK7 A;  2E5Q A;  3EFS A;  3JCM J;  5IHI A;  3SD4 A;  4NS5 A;  3NTH A;  2KDS A;  4MMK A;  1JQQ A;  1YIT Q;  5DY9 A;  1KQS S;  3CCQ A;  2VB6 A;  3QWX X;  4PLL A;  2O88 A;  4IUV A;  3OYH A;  4K11 A;  3VS3 A;  2LJ1 A;  1MUZ A;  2K7A A;  3G4S A;  2FB7 A;  4J9H A;  3C94 A;  3Q1J A;  2GGR A;  2RB6 A;  2K9G A;  1GBR A;  3PVQ A;  3H0I A;  5GAN g;  1YI2 Q;  5I11 A;  3VJP A;  4RCC A;  2NUT A;  2VAS A;  4PJM A;  3OYL A;  4M75 F;  5ECA A;  1SHG A;  2LVM A;  1SHF A;  3MEV A;  2DAQ A;  2IIM A;  3OW2 A;  4E7L A;  3CCV Q;  1VUB A;  4J9I A;  4A4G A;  5CKH A;  3UT1 A;  1KHC A;  3PT9 A;  3QII A;  5GAN e;  3H0F A;  1MND A;  1X6B A;  4LUE A;  2GTJ A;  3CPW S;  4QVC A;  2Y4Y A;  3G6E Q;  1AOJ A;  5GAN 3;  1K9A A;  4XTZ A;  1YHQ A;  1S72 A;  1W2B S;  2MYS A;  3M4G A;  3CCM Q;  2HNI A;  1JO8 A;  2AIR B;  1IRX A;  3PNW C;  1I4K 1;  1WDX A;  2PQW A;  1EFN A;  4PJO A;  3PE0 A;  2DBM A;  4KGV B;  2J6F A;  3QYG B;  2ED0 A;  4NL2 A;  2K5L A;  2LCL A;  1VQ9 T;  4KUL A;  4R56 A;  3E2U A;  1AWX A;  2BZX A;  4C5E A;  3V8K A;  4ESR A;  1H92 A;  1WJR A;  1BI2 A;  3R6N A;  2DRM A;  2OTL T;  1BB9 A;  2ZPI B;  2QXF A;  4M78 B;  4MZP A;  2P4R A;  2PVD B;  2OI3 A;  1M4Z A;  4Z88 A;  2Z0W A;  4M75 C;  4HT8 A;  3QG1 A;  2HSE B;  2LTO A;  4C92 C;  3EG1 A;  1QCO A;  3X24 B;  1QKX A;  1GFD A;  2FPD A;  4EPC A;  3MP6 A;  1CKB A;  4ELY C;  5I2S A;  1VQ8 A;  2F5K A;  4C5I A;  2D1X A;  2EYQ A;  1WYX A;  3EG0 A;  5GAN 6;  3QDR B;  3OS5 A;  1GCQ A;  2CDT A;  3MJX A;  2EQJ A;  4QW2 A;  1VYT A;  5IH2 A;  1K9M C;  2EKH A;  2D8J A;  3R6O A;  3EFO B;  3KXT A;  3JCM g;  1YJW T;  1YJ9 T;  1QQJ A;  2E3H A;  2DL8 A;  1OU9 A;  4Z8A A;  1ARK A;  3VKI A;  4M78 E;  2K6D A;  2F2X A;  4KH0 B;  4MDX A;  1C6V X;  2FYK A;  2KMT A;  5CQY A;  1RLQ C;  3CC7 A;  5HKC A;  1SG5 A;  1Q7Y C;  4BY6 B;  3CD6 A;  3JCM e;  4RTZ A;  3EGU A;  4XTY A;  3SEM A;  4DEX A;  3OW2 S;  3OYK A;  3M0T A;  2ENM A;  3NPF A;  2DVJ A;  4XAX B;  1WHM A;  2M9U A;  2ECZ A;  1UDL A;  1G2B A;  3X20 B;  3T9N A;  4HCK A;  3AT1 B;  2QQ9 A;  1BBZ A;  5LJ5 h;  3V7R A;  3OYB A;  2DE0 X;  3NMZ C;  4D8D A;  1KC8 C;  3BDU A;  2ZPB B;  3RMQ A;  3CXC A;  3L2V A;  1XNI A;  2E1H A;  2F2V A;  1M90 C;  2WAC A;  1ACM B;  3C12 A;  2HQE A;  3SHW A;  3SFM A;  5A0L A;  1OX8 A;  3V7S A;  1VIE A;  1OQK A;  4XU0 A;  3CCU A;  1BIA A;  1XTD A;  1AT1 B;  1YN8 A;  3UF4 A;  2C0T A;  3CCE Q;  2XHC A;  3SWN C;  1Q7Y R;  1RAB B;  1WHG A;  2EGA A;  2YSQ A;  1PM3 A;  1MV0 B;  1X27 A;  1A0N B;  2LZ6 B;  4JRQ A;  3RBB B;  2CZ6 B;  1NJI R;  2IVW A;  3FRN A;  1Y96 B;  4KBM B;  3CC2 T;  2XK0 A;  3TVT A;  1BCO A;  1VA7 A;  3X26 B;  2EW3 A;  1M3A A;  3JCM h;  1VQN T;  4EMG A;  2QTV A;  4C92 D;  1VQN A;  4OMQ A;  3EHR A;  2DL4 A;  3BE3 A;  1UJ0 A;  1N9S A;  2RO0 A;  3QWY A;  1VQ4 Q;  4M77 A;  2EFI A;  2RHY A;  3QYH B;  4ZGE B;  3CCJ Q;  1YBY A;  2HQX A;  4MZM A;  3GNG A;  1D0Y A;  2KT1 A;  3EG9 B;  1N5Z A;  2RNA A;  3QHS A;  5CK9 A;  2FRY A;  2QAZ A;  2W0Z A;  1PWT A;  2PNI A;  3F70 A;  4PL6 A;  2Y4X A;  5J39 A;  4OGE A;  4DEY A;  2LCS A;  1PD0 A;  1N8R U;  1Y96 A;  3H8Z A;  4CC7 A;  5A0G A;  3KUF A;  1U5S A;  3H6Z A;  4D8K A;  2QQB A;  4J83 A;  1BI1 A;  4X1V A;  1MMD A;  2FPF A;  1NPR A;  3PMI A;  2DK3 A;  4JS4 A;  1K1Z A;  1AZG B;  3LX7 A;  4R55 A;  2EJF A;  1K8A C;  3RNJ A;  5KYN A;  1G8X A;  2LDM A;  4R0K A;  2RQV A;  3L1A A;  1AD5 A;  1UEC A;  2VC8 A;  1K73 R;  4OMO A;  4F04 B;  4FT2 A;  4M7A D;  4PJJ A;  3M4Y A;  1U06 A;  2RMO A;  3WXM B;  1I07 A;  3HP9 A;  4BI3 A;  2PVG B;  1UHF A;  3V7C A;  4PNO A;  2RI3 A;  1PSF A;  1Q81 U;  2L3P A;  3CXC S;  5KYX B;  4FYV B;  4J9D A;  3L2Z A;  2JZ2 A;  3I35 A;  2KR3 A;  1YP5 A;  2PUO B;  2B86 A;  1H64 1;  4M78 G;  5AYF A;  3CMA T;  1WHH A;  3CMA A;  2F69 A;  3P8D A;  3MHX A;  5IHK A;  4RG2 A;  3JCM c;  3JCM W;  2WSF E;  1M1K U;  5GAN 4;  1G83 A;  3MET A;  2OTJ T;  3QO3 A;  2RHZ A;  1IGQ A;  2HEQ A;  4AFS C;  2OTJ A;  4BE2 A;  2OAU A;  3IQL A;  4FU6 A;  4PJO F;  3JSC A;  3S3O A;  5FU7 B;  3M58 A;  5CKF A;  4J9F A;  1VQM A;  4O6J A;  3ULR B;  2ZPE B;  1VQ6 Q;  2BIV A;  2E6Z A;  1W1F A;  2JS0 A;  3V8L A;  4V2S A;  1VQO T;  2GFU A;  3E19 A;  2CGH A;  4QQG A;  2DMO A;  5LJ3 d;  5GAO l;  5GJW B;  1TSF A;  4E7J A;  1D3B B;  4M7D A;  5IN1 A;  4C8Q D;  2DZ9 A;  4FW2 A;  3GIB A;  3CC4 T;  3MEA A;  2WSE E;  1QMC A;  3GPL A;  4M7D E;  3DB4 A;  1VQ5 T;  2VXF A;  1VQ5 A;  5IXF A;  2YLC A;  1OZ3 A;  5LJ3 f;  4BI8 B;  4LD9 K;  1D09 B;  1WJQ A;  2CYZ B;  4QVZ A;  1OOT A;  5KYW B;  5A2Q E;  1UGV A;  5DLQ E;  4WF2 A;  3CPW P;  4HA8 A;  1B07 A;  2O4X A;  2PU9 B;  1JXO A;  3E9G A;  1Q95 G;  1KIK A;  3I56 T;  1VQK A;  1N6A A;  2DXT A;  1YFN A;  2LQK A;  2QA4 T;  2HKQ B;  2K5I A;  4PFZ A;  2HKN A;  3LH0 A;  1I1J A;  3E1S A;  3CCR Q;  1Z9Z A;  4A4K A;  1BI0 A;  4UC4 A;  1VYV A;  3ER0 A;  3EG3 A;  3I9Q A;  1JRI A;  1D3B A;  3SB2 A;  2KXC A;  2JMA A;  2NWM A;  5GMK i;  1KD1 U;  1RAC B;  2KY9 A;  5GAM h;  4E2F B;  2RI2 A;  1ZSG A;  1VQP Q;  4F7U B;  3CPF A;  1X69 A;  2RQT A;  2X3X D;  1YIJ T;  2HDA A;  3CCS T;  1YIJ A;  8AT1 B;  1QP3 A;  3CCS A;  3MP1 A;  2JOY A;  4RCB A;  4F14 A;  2QGF B;  3INZ A;  1FWZ A;  1QWE A;  2X51 A;  4L6V 5;  5LJ3 j;  3PIP A;  1AEY A;  3JAM E;  2PZ1 A;  2P84 A;  1YI2 A;  1T0H A;  2D0Q B;  1JJ2 P;  2RHX A;  3QDF A;  2DLP A;  1NZ9 A;  3HRU A;  4AFQ C;  2QEX Q;  1VOM A;  4IIO A;  3CCL Q;  1TS9 A;  2QI2 A;  3VU3 C;  3CCV A;  3TSW A;  8ATC B;  1LCK A;  1TXQ A;  1I5O B;  5GAM d;  5HY6 A;  2EYY A;  3REB B;  4F7U A;  2QK0 A;  1GCQ C;  2MWP A;  4Y28 E;  3G6E A;  1MMG A;  1Q86 C;  1KG1 A;  3CCQ T;  2EBP A;  2JVV A;  2ATC B;  4F7U E;  4MML A;  4BE1 A;  2NLU A;  1FYN A;  2COZ A;  3HL8 A;  1VQL Q;  2KRM A;  2DZC A;  3G4S T;  2VYT A;  2XKO C;  4M78 C;  5GAM f;  3CME T;  2RHU A;  4HVU A;  1ZA2 B;  3CME A;  4LN2 A;  3L42 A;  5GMK h;  3EFR A;  1RAH B;  4HXJ A;  4BB7 A;  2RK1 A;  5L23 A;  1EIF A;  4Y92 A;  4PJO B;  3A8O B;  3OW2 P;  4TVR A;  2CP7 A;  3URG A;  3MO8 A;  1AWW A;  2F5T X;  1TWB A;  4J9G A;  3JCM Q;  1VQ7 Q;  5DM7 R;  1Q82 C;  1VIF A;  1YJN T;  1K4U S;  2XIC A;  4J7I A;  2CZ1 B;  1YJN A;  4ZGJ B;  4ANJ A;  1TOV A;  2O31 A;  1GXI E;  3CBP A;  3FC3 A;  4X9D A;  2OJ2 A;  4CC3 A;  1RAD B;  2FVU A;  1MMN A;  4EDU A;  4KT0 E;  2JS2 A;  4BUG A;  5M9O A;  1JU5 C;  1YCS B;  3A8M B;  4IUQ A;  4IUT A;  1YHQ T;  4DA4 A;  1S72 T;  4HCC A;  2EYW A;  2DVE A;  2PTK A;  4ELZ C;  3GBQ A;  2YHT A;  4LE9 A;  4J6W A;  2C0O A;  1Q86 R;  4M77 F;  1PKS A;  3M0P A;  4OMM A;  1E6G A;  1M9S A;  1QLY A;  4IUP A;  2CP2 A;  3JB9 D;  2KNB B;  3VS1 A;  4BY6 C;  3WVE B;  4PJO E;  2GBQ A;  2LQ8 A;  1ZBJ A;  3KBG A;  2J6K A;  4OML A;  2QDY B;  3A8H B;  4GBQ A;  2JNG A;  4KH1 B;  2MAM A;  1UGQ B;  3OB9 A;  1LPL A;  1G3T A;  2JTE A;  2KXD A;  3M55 A;  2CUB A;  1AVZ C;  1U1T A;  1U1S A;  3PIO A;  1C0M A;  4J9B A;  2CSQ A;  2C06 A;  3M9Q A;  2DER A;  1Q82 R;  1UUE A;  3VRZ A;  1WHK A;  4RKU E;  4JLI A;  4RTX A;  5L8R E;  3EAE A;  3G71 T;  1ZHI A;  1UE9 A;  2M02 A;  3OBW A;  2D0N A;  3G71 A;  1VQ8 T;  4O5V A;  1M8M A;  1NPP A;  1IZ6 A;  1X43 A;  3L2R A;  2CP6 A;  3FEO A;  4PFP A;  4FM4 B;  4FW1 A;  4XTX A;  4DOV A;  1AWO A;  1FMV A;  4JJB A;  1IHV A;  1M3C A;  5GAN h;  2VV5 A;  4Q5W A;  4J8O A;  1BU1 A;  2C0I A;  4JPB W;  1QP2 A;  4N4G A;  1ZUK A;  2AZS A;  4EMK A;  2D9T A;  3M0Q A;  1AHJ B;  2OAW A;  1UG1 A;  1Q7Y U;  2KE9 A;  3MP8 A;  3NGP A;  1WZO A;  3C95 A;  9ATC B;  3OA6 A;  2DPP B;  5I2M A;  2EJ9 A;  1M1F A;  1BKB A;  4LUD A;  1PRL C;  2X4Y A;  3CC7 T;  4LDV A;  2X35 A;  1VQ9 Q;  3M56 A;  3UDC A;  3L2W A;  4M78 D;  1NJI U;  3RR6 A;  4E7H A;  3CD6 T;  3EG2 A;  3VS6 A;  2CRE A;  2FO0 A;  4J9C A;  3EHQ A;  4B6M A;  2OTL Q;  2BE7 D;  3CCE A;  1ZUU A;  1XOV A;  2ZPF B;  2V8I A;  4XK8 E;  2LMJ A;  1WX6 A;  2DD4 A;  3A1P A;  3J81 E;  2COW A;  5D6Y A;  3GF5 A;  2YDL A;  4D6W A;  4IUR A;  5A0D A;  4B9X A;  1OI1 A;  2E41 A;  4M7D F;  4F7U G;  2CH4 A;  3FDR A;  1SRM A;  1IXD A;  2YWW A;  2HSP A;  1X75 C;  1YNZ A;  4XTU A;  2HAX A;  4DOW A;  1U8R A;  1NLP C;  3M57 A;  2L3R A;  4AFZ C;  2J7I A;  2ZAE A;  3PFS A;  2BE9 B;  1K9M R;  3EH1 A;  2R5M A;  1RAE B;  5GAO r;  3HRT A;  3D7S B;  3CCU T;  5FLX E;  2NUZ A;  4BDY A;  4HCZ A;  4CC4 B;  4NOY A;  1VQ4 A;  5EG2 A;  3UPU A;  2KVQ G;  1IHW A;  2BZ8 A;  3CCJ A;  1YJW Q;  2GTO A;  2JTF A;  1YJ9 Q;  2EYZ A;  3LGL A;  1K73 U;  2K57 A;  1PHT A;  2FEI A;  4M77 B;  3MPU B;  1QW1 A;  2BTT A;  2LT1 A;  2V26 A;  2RJD A;  1K0X A;  4A4H A;  4II1 A;  2RI5 A;  5LJ5 d;  4DBQ A;  3LH5 A;  1KHI A;  1HD3 A;  2FL7 A;  2HQH A;  1H8K A;  2R57 A;  1PSE A;  2FZC B;  4GY5 A;  3MKD A;  1TUD A;  1XJW B;  1DJ7 B;  4JDS A;  3DKM A;  2G6F X;  1KQ2 A;  3RMS A;  4M75 D;  2EWN A;  2EYX A;  5LJ5 f;  4LDY A;  5KYY B;  2R5A A;  1RAG B;  1IGU A;  1XQH A;  3RUX A;  4C92 A;  1EZZ B;  5KCO A;  4AMC A;  2FG0 A;  1KC8 R;  2RA2 A;  1UB4 A;  2MI6 A;  2DTI A;  4FCY A;  2JM9 A;  3J80 E;  2XID A;  3E9F A;  4PJO G;  2KRN A;  4C92 E;  1BIB A;  1M90 R;  4JJD A;  4M7A B;  4CC2 A;  1ZQ1 A;  2EPD A;  4CRI A;  4M77 E;  1NM7 A;  1LOJ A;  2H3J A;  3O8V A;  4PJL A;  5CCA A;  5FU7 C;  2XD0 A;  1QVG A;  1G3Y A;  3A8G B;  4C0Z A;  2DIG A;  1RAA B;  3EH2 A;  2E10 A;  2CP3 A;  4F7U F;  2A0F B;  2QG9 B;  3NHN A;  3JCM d;  1M27 C;  1D1B A;  2EGE A;  3I55 T;  4BE0 A;  1RAF B;  1N9R A;  4C5H A;  3I55 A;  2CS7 A;  3BY7 A;  2L3S A;  2RM4 A;  5KYY A;  2LQW A;  3CBO A;  2DX1 A;  2ZGW A;  4F16 A;  1T3S A;  3RER A;  4BAC A;  3L2Q A;  5LJ5 j;  1X2Q A;  3LYI A;  3JCM f;  5KCH A;  2RQR A;  5FU6 B;  2LJ0 A;  3JCM V;  2O01 E;  4A54 A;  4M7A A;  2MIO A;  3CC2 Q;  2D8H A;  4GLM A;  4L59 A;  4M7A E;  3X28 B;  1VQN Q;  1M3B A;  1N8R C;  2GQI A;  2SRC A;  4RTT A;  2XDD A;  2E70 A;  3FLG A;  1WLP B;  1GL5 A;  1BYM A;  4LDW A;  1W6X A;  3TU4 K;  4B9W A;  3S3M A;  2KRO A;  1WA7 A;  4OB0 B;  1OEB A;  4BI4 A;  1K0S A;  4N0A C;  4M7D B;  3QKJ A;  2L3Q A;  4OMP A;  4QQ6 A;  4E7I A;  2FRW A;  3ASK A;  4C8Q B;  1IRE B;  4RUG A;  2LX9 A;  2AZV A;  2X3W D;  2LCC A;  1TUC A;  5GJV B;  1ABQ A;  5HK3 A;  2DEU A;  3OS2 A;  4JLG A;  1KQS P;  3C0C A;  3OYM A;  1CKA A;  3VS5 A;  5GAO n;  3UA7 A;  1Q81 C;  3G1J A;  2O4X B;  1OYX A;  1K8A R;  1O9S A;  2L5Q A;  4ZNX A;  1FXX A;  2K5F A;  4QT7 A;  4N4H A;  1VQM T;  1I5L A;  3CCR A;  2CZ0 B;  3EGX A;  3VS0 A;  1NE8 A;  1AWJ A;  1M2V B;  3LGF A;  2YXY A;  2RN8 A;  3HHT B;  1D0X A;  3VYG A;  2O2O A;  5CKD A;  2KBT A;  2LJ3 A;  2J6O A;  1K76 A;  4WCI A;  2KYM A;  1JB0 E;  1M1K C;  1GFC A;  2RHI A;  1SPK A;  1WPY A;  3GLX A;  3MEW A;  3OSS C;  3GOX A;  4HCB A;  2GCX A;  2K2M A;  3VS4 A;  4C8Q A;  2FHD A;  1NLO C;  4JRK A;  2XDB A;  2QQA A;  2ESW A;  2EQU A;  4WTO B;  3QJY A;  4C8Q E;  3M0U A;  4J7F A;  4J6Y A;  3HKS A;  1KJW A;  3CMA Q;  3ZEH A;  1VQK T;  5IT9 E;  1I8F A;  3ZL7 C;  1D1C A;  4EMH A;  1W2B P;  3OQ5 A;  1JXM A;  2EJG A;  1QVG S;  3JRZ A;  2XI9 A;  2YUN A;  2COY A;  4HVW A;  1M2V A;  1QVF A;  2AT1 B;  4VUB A;  1OUL A;  1M2O A;  3CCL T;  2FZG B;  5I21 A;  3CCL A;  5IHN A;  4C0F A;  2EQK A;  2OTJ Q;  1QVP A;  1M30 A;  4FIB A;  1UGS B;  3TEE A;  4PJO C;  1GRI A;  3TRE A;  3RKW A;  1YIT T;  2M0O A;  4DBH A;  3AHU A;  1YIT A;  2DF6 A;  2DXC A;  3OYN A;  1T0J A;  2I2L A;  1QWF A;  2LP5 A;  2D6F A;  1WNL A;  2MWO A;  2DNU A;  3JCM P;  4X34 A;  4OB1 B;  2BUD A;  2DA9 A;  2P4T A;  4AG2 C;  5GMK m;  1VQO Q;  2CP0 A;  5FRO A;  4BDZ A;  2VXE A;  1M1K R;  4C0D B;  2KYB A;  5GAO p;  2A7Y A;  2DO3 A;  2HD0 A;  2VVK A;  4RG8 A;  5EC7 A;  4M77 G;  2H3E B;  3GNF B;  3UWN A;  2HZY A;  1J3T A;  1YI2 T;  3MCA B;  4RTU A;  3I5S A;  4ZN3 A;  2VUB A;  3CC4 Q;  2JN0 A;  3OYF A;  1TTH B;  1OU8 A;  3EGD A;  2DXB A;  1VQ5 Q;  1NYF A;  2FZK B;  2YUO A;  2E6N A;  1VQ7 A;  3CCV T;  2YUQ A;  1KD1 C;  2DL3 A;  2JM8 A;  1QCN A;  2ED1 A;  1YWO A;  2EQM A;  1RLP C;  4ZTJ A;  1E7O A;  4LD6 A;  2X9H A;  2EIF A;  3I56 Q;  2ABL A;  3VS7 A;  3OYY A;  2MK5 A;  3G7Z A;  1WQW A;  2QA4 Q;  1UJY A;  3G6E T;  5CIU A;  1JJ2 A;  4XTV A;  2DEQ A;  1X2K A;  4KUI A;  2DYI A;  3BDL A;  1ZBX A;  2RPN A;  4FL6 A;  3JV3 A;  3CCM T;  3C4S A;  3NTK A;  1JEG A;  3QBY A;  4X9C A;  1S1N A;  1E6H A;  3CCM A;  1T3L A;  4M7A G;  4FSX A;  2L0A A;  4BD3 A;  5C0M A;  4XTW A;  1Q82 U;  3QPH A;  4JS5 A;  3V8J A;  2V8J A;  5CQX A;  2NUP B;  4RTY A;  1QKW A;  2PUK B;  4JUV A;  1FMK A;  2HBP A;  3OS0 A;  1YIJ Q;  4AFU C;  1QCF A;  3CCS Q;  3VUB A;  2KGT A;  4Z89 A;  1WIE A;  3OY9 A;  4LXC A;  1PC0 A;  5CR2 A;  2RJC A;  4XQ3 A;  2HCK A;  3OBY A;  5HCK A;  2HL3 A;  5J3B A;  3O5Z A;  1KQ1 A;  1UGR B;  2RJE A;  4KGZ B;  1ZSZ B;  2L89 A;  5IXB A;  3H41 A;  2DD5 A;  1KD1 R;  2GQV A;  2VWF A;  3RDV A;  4AG1 C;  2AKL A;  4ZGD B;  3LW5 E;  4HVV A;  4C92 F;  5KE2 A;  2JTM A;  3S6W A;  1OPL A;  2DTO A;  1NEB A;  2DL7 A;  1QVF S;  2M0Y A;  2XMF A;  2XU8 A;  1F1B B;  2NUP A;  5FRM A;  1OPK A;  5GAN 5;  2AK5 A;  5GAM j;  4OGC A;  4OMF B;  3RKY A;  3H0H A;  1KSW A;  3CCQ Q;  5DLO A;  5J26 A;  3JCM b;  2LC4 A;  2CH4 W;  2E5K A;  2VGN A;  4PJO D;  2DFU A;  1MNE A;  3G4S Q;  4M7D G;  2LQN A;  5GAN 7;  3CME Q;  4AT1 B;  1ZSZ A;  2JMC A;  4ATO A;  5HK0 A;  4C8Q G;  4EMK B;  1MMA A;  3CQT A;  2G3R A;  2EVR A;  3WVD B;  2LNV A;  4LNP A;  2BZY A;  2KI7 A;  2X4X A;  2DTH A;  1WXU A;  2JT4 A;  5LJ5 g;  1VQ9 A;  2O9S A;  3HFO A;  2CZ7 B;  4ME7 A;  2RF0 A;  2CT4 A;  1G5V A;  3JB9 J;  4RTV A;  2DJZ A;  1YJN Q;  1UFF A;  3HPW A;  4M7A F;  3JCM X;  2OTL A;  4N4I A;  3OMC A;  1K9M U;  4EIK A;  1RL2 A;  3PGG A;  2KAF A;  1C1A A;  5LJ5 e;  1Y57 A;  5GAN 2;  3OYA A;  1YHQ Q;  1SF9 A;  1NYG A;  3RIR A;  1S72 Q;  2KRS A;  1JJ2 S;  2YUP A;  3TSZ A;  2BKD N;  4M77 C;  2V8K A;  1UTI A;  2GNC A;  5GMK j;  4JRI A;  3GP8 A;  4ZTF A;  2HMA A;  3UAT A;  4P5N A;  5FW9 A;  2K79 A;  1TUG B;  2M16 A;  3J7A F;  1FMW A;  2RD1 A;  4KGX B;  1TG0 A;  2B8A A;  2J05 A;  5D6W A;  1PNJ A;  4JRP A;  4XU1 A;  2YT6 A;  4NL3 A;  2K4Y A;  4M78 A;  2P0Q A;  2DIQ A;  2QTX A;  2GF7 A;  3CCE T;  2JXB A;  2K3B A;  3ZBD A;  1YJW A;  1YJ9 A;  5GAO q;  2CKK A;  5GAN d;  1B3Q A;  1KC8 U;  3P8H A;  2V1Q A;  3PVL A;  2IG0 A;  4JZ3 A;  1M90 U;  2A37 A;  4A4F A;  1R77 A;  3FJ5 A;  4M7A C;  3G71 Q;  2CSI A;  2O9V A;  1KFZ A;  3CXC P;  3ZFJ A;  2RQU A;  5GAN f;  2RK2 A;  1VQ8 Q;  1I0C A;  1Y07 A;  5CKE A;  4ORZ A;  5CAI A;  4C8Q F;  1B34 B;  1NJI C;  2QYZ A;  2ZPH B;  4QKU A;  2A36 A;  1MV3 A;  1RAI B;  1I81 A;  2K2V A;  2RQW A;  2XDP A;  3H9N A;  3EFO A;  2EGC A;  4M75 B;  1IO6 A;  3OYE A;  1HXD A;  4C92 B;  4OB3 B;  1VQ4 T;  1WQ7 A;  3BFM A;  6AT1 B;  1LVK A;  3CCJ T;  1V1C A;  2L8D A;  2K3Y A;  2W10 A;  1RUW A;  2JW4 A;  2NYS A;  1NBE B;  1R8O B;  3HRS A;  2ROT A;  2MCN A;  2DIL A;  1WXT A;  4FSS A;  3PTA A;  5FU6 C;  4E47 A;  2ROL A;  2CP5 A;  2A3L A;  3CC7 Q;  4L5G A;  5FRN A;  1PRM C;  4PKC C;  2VKN A;  3NTI A;  5CO7 A;  1NEG A;  5LL6 S;  1WGS A;  2DM1 A;  3CD6 Q;  4PJN A;  5KE3 A;  2MMP A;  1MHN A;  1B34 A;  4OF1 A;  1CSK A;  3OYI A;  1JBM A;  1O75 A;  2CT3 A;  4FYX B;  3VS2 A;  1HYO A;  4J9E A;  4JJC A;  2CUD A;  1SEM A;  5GAN j;  4E6R A;  1PCX A;  3OS1 A;  4M75 A;  5LJ3 g;  3ME9 A;  1W4S A;  1ZUY A;  3LWH A;  4M7D C;  1LJO A;  3OYC A;  2EKO A;  4JZ4 A;  4DBR A;  1NG2 A;  4M75 E;  3OYG A;  1K73 C;  3QUI A;  2LRQ A;  5D6X A;  4C8Q C;  1M8V A;  3CC2 A;  1TH7 A;  2KSS A;  2AHJ B;  2EQI A;  4DBF A;  4FT4 A;  1EX4 A;  3BW1 A;  3JB9 G;  2QGG A;  3JB9 I;  2DYB A;  3VUZ A;  2WSC E;  2DET A;  5LJ3 e;  1UEB A;  2H8H A;  4OB2 B;  1QVG P;  4PLI A;  2KQW A;  3LLR A;  5FWC A;  1ZLM A;  2LX7 A;  3I5R A;  5I22 A;  4M77 D;  1BCM A;  3FB9 A;  1K8A U;  1R0C B;  3QSU A;  1Y71 A;  2RH2 A;  2M51 A;  3MEU A;  3CCU Q;  3LWI A;  1PG5 B;  4PK4 A;  1WJS A;  1D0Z A;  3N5B B;  3PMT A;  2EAY A;  4LDX A;  1WHJ A;  3X25 B;  2E4H A;  3RKX A;  1W70 A;  3SDZ A;  3M53 A;  1LNX A;  5KYU B;  1PKT A;  2A08 A;  2V1R A;  1VYU A;  2X4W A;  3A8L B;  3A5Z B;  2IPO B;  3TQ7 P;  2QQR A;  1Z9Q A;  3QXE B;  3JB9 H;  1UHC A;  3M54 A;  3HTR A;  1VQ6 T;  1IB8 A;  2J06 A;  3THK A;  1VQ6 A;  1X6O A;  3SWN B;  2A28 A;  4GLK A;  4IUU A;  4PFO A;  3EGX B;  2M1H A;  1HSQ A;  2L2P A;  1V29 B;  1UGP B;  2ZPG B;  2LNH B;  3QZ9 B;  1YWP A;  1OV3 A;  4Z02 A;  1X01 A;  2E3I A;  1M5Q 1;  3OYJ A;  2JJ9 A;  3EG9 A;  5CKB A;  2QDL A;  4A4E A;  2KEA A;  2ZCF B;  4RTW A;  2E65 A;  3L2U A;  3S3N A;  2QAS A;  4C0G A;  3REA B;  4RMO A;  4MDW A;  5KYU A;  3U23 A;  3VRY A;  3CEY A;  5LJ3 h;  2F1L A;  1G3S A;  4C5G A;  5GAM g;  4HT9 A;  3DLM A;  1G3W A;  3QJ6 A;  1SKU B;  4E7S A;  2YRD A;  4IKF A;  4F17 A;  4YTL A;  2MOX A;  3OYD A;  4M4Z A;  3CCR T;  3I55 Q;  3DLL A;  1WI7 A;  4C0D C;  3KFV A;  3SWN A;  2AKK A;  3JB9 F;  2DBK A;  2KK4 A;  5GAM e;  1WXB A;  2FPE A;  4FYW B;  1KQS A;  3FIF A;  1MGQ A;  2DRK A;  2SEM A;  1VQP T;  1N8R R;  1B7T A;  1VQP A;  4QVD A;  1RI0 A;  5KYX A;  1ZA1 B;  5GMK l;  1OZ2 A;  1X6G A;  4J6X A;  4QQD A;  1U3O A;  3P8B B;  1FX7 A;  3HSB A;  1VQO A;  4M7D D;  5AT1 B;  1N27 A;  3M5A A;  4ZN1 A;  2X4J A;  5C6S A;  1QVF P;  3CC4 A;  4DQ2 A;  4Y91 A;  4A53 A;  1RI9 A;  1YCY A;  2QQS A;  2RJF A;  3CBM A;  2E64 A;  2QEX T;  1ZX6 A;  1WHL A;  2VGM A;  1OX9 A;  5GAN 8;  2YLB A;  2F2W A;  3EGD B;  2QEX A;  4J5Y A;  4XU3 A;  3A98 A;  1Q81 R;  1D1A A;  2KT8 A;  2GFA A;  3VYH B;  2E12 A;  1P92 A;  1WFW A;  1ABO A;  1HJD A;  2JUF A;  3CPW A;  1BK2 A;  3I56 A;  2LT4 A;  4OVA A;  1V76 A;  4KRT A;  1Y0M A;  5IAY A;  3UA6 A;  1R0B G;  2QA4 A;  1W2B A;  1H3Z A;  4M75 G;  1VQM Q;  1VQL T;  5KH6 A;  2XG8 D;  4C92 G;  7AT1 B;  1VQL A;  5GMK e;  2HL5 C;  4LDU A;  1ZSZ C;  4M78 F;  4E7K A;  4OMN A;  2PVO B;  5CVI A;  5GAO m;  2DJQ A;  1PD1 A;  2I0N A;  2P0P A;  2DKG A;  4CI0 C;  3TCJ A;  1HK9 A;  4JJN K;  3M59 A;  1SSF A;  1SSH A;  3OMG A;  5KYW A;  3FJP A;  2P0K A;  1Y7X A;  4HKE A;  4E7Z A;  1VQ7 T;  4XU2 A;  4A63 B;  4KUD K;  2DXU A;  2DL5 A;  2HBW A;  1Q86 U;  3M0R A;  2OX7 A;  1H3H A;  3OSV A;  4FYY B;  2Y90 A;  1M1G A;  4IIM A;  3DB3 A;  2MF2 A;  2YRV A;  1VQK Q;  4MZT A;  4OP0 A;  3RES A;  2ZZD A;  3NFC A;  1GCP A;  1TU0 B;  4N0A A;  5FWB A;  3HFN A; 
#chains in the Genus database with same CATH homology
 1GBQ A;  4EIK A;  2HEQ A;  4AFS C;  1TUD A;  1Y57 A;  3IQL A;  3M0S A;  2G6F X;  1SRL A;  1NYG A;  2EYX A;  1AZE A;  2KRS A;  2YUP A;  4J9F A;  5IHI A;  3TSZ A;  3ULR B;  1JQQ A;  1UTI A;  1W1F A;  2GNC A;  2FG0 A;  2JS0 A;  2JM9 A;  3QWX X;  2DMO A;  2KRN A;  2O88 A;  3UAT A;  5GJW B;  5FW9 A;  4K11 A;  2K79 A;  3VS3 A;  4JJD A;  4CC2 A;  2LJ1 A;  1MUZ A;  2K7A A;  2EPD A;  4J9H A;  1TG0 A;  2J05 A;  2GGR A;  1PNJ A;  1NM7 A;  2K9G A;  1GBR A;  2YT6 A;  3PVQ A;  3H0I A;  5IXF A;  5I11 A;  2JXB A;  1OOT A;  2K3B A;  1UGV A;  1B07 A;  5ECA A;  1SHG A;  1JXO A;  3NHN A;  1SHF A;  1M27 C;  1B3Q A;  2IIM A;  1KIK A;  2EGE A;  2V1Q A;  4J9I A;  3PVL A;  4JZ3 A;  2L3S A;  2LQW A;  2DX1 A;  2A37 A;  4F16 A;  3FJ5 A;  1I1J A;  1T3S A;  3H0F A;  2CSI A;  2O9V A;  1KFZ A;  1Z9Z A;  1X6B A;  4LUE A;  2GTJ A;  2RQU A;  1VYV A;  1X2Q A;  2RQR A;  1I0C A;  1AOJ A;  3EG3 A;  4ORZ A;  2LJ0 A;  3I9Q A;  1K9A A;  2KXC A;  2MIO A;  2JMA A;  2A36 A;  1MV3 A;  2D8H A;  2NWM A;  4GLM A;  1JO8 A;  2RQW A;  1M3B A;  1WDX A;  2GQI A;  1ZSG A;  2EGC A;  2SRC A;  1IO6 A;  4RTT A;  1EFN A;  1X69 A;  3PE0 A;  2RQT A;  2X3X D;  2DBM A;  1WLP B;  1GL5 A;  2J6F A;  2HDA A;  1W6X A;  2ED0 A;  2KRO A;  4F14 A;  1WA7 A;  1V1C A;  2W10 A;  1QWE A;  1AWX A;  1RUW A;  2BZX A;  2JW4 A;  1OEB A;  1K0S A;  2MCN A;  2ROT A;  2DIL A;  1WXT A;  4FSS A;  4ESR A;  1AEY A;  2ROL A;  1H92 A;  2L3Q A;  4OMP A;  1PRM C;  2PZ1 A;  1T0H A;  2VKN A;  2FRW A;  3R6N A;  2DRM A;  4RUG A;  1NEG A;  1BB9 A;  2DLP A;  2AZV A;  2DM1 A;  4AFQ C;  2X3W D;  1TUC A;  2P4R A;  5GJV B;  2OI3 A;  1ABQ A;  4IIO A;  1CSK A;  4Z88 A;  2CT3 A;  3C0C A;  3VS2 A;  3TSW A;  1CKA A;  3VS5 A;  3UA7 A;  4J9E A;  1LCK A;  4JJC A;  2CUD A;  3EG1 A;  1SEM A;  4ZNX A;  4E6R A;  1QKX A;  2EYY A;  4QT7 A;  3REB B;  1GFD A;  2FPD A;  1CKB A;  3VS0 A;  1GCQ C;  1AWJ A;  1ZUY A;  2RN8 A;  4JZ4 A;  2EBP A;  1NG2 A;  2O2O A;  2KBT A;  2D1X A;  2LJ3 A;  2J6O A;  1FYN A;  1K76 A;  4WCI A;  1WYX A;  2KRM A;  3EG0 A;  1GCQ A;  2KYM A;  2CDT A;  2EQI A;  4HVU A;  1GFC A;  1SPK A;  1VYT A;  4LN2 A;  5IH2 A;  2DYB A;  2K2M A;  3VS4 A;  2EKH A;  2H8H A;  2D8J A;  1NLO C;  4HXJ A;  2ESW A;  5FWC A;  1ZLM A;  2LX7 A;  3I5R A;  5L23 A;  5I22 A;  4Y92 A;  3M0U A;  2DL8 A;  2M51 A;  4Z8A A;  1ARK A;  2K6D A;  1KJW A;  1AWW A;  2F2X A;  4J9G A;  1RLQ C;  3ZL7 C;  1K4U S;  1JXM A;  2O31 A;  2YUN A;  4HVW A;  1W70 A;  4RTZ A;  2OJ2 A;  3EGU A;  4CC3 A;  3SEM A;  4DEX A;  5IHN A;  1PKT A;  2A08 A;  2JS2 A;  2V1R A;  1JU5 C;  1YCS B;  1VYU A;  3M0T A;  2ENM A;  1M30 A;  3NPF A;  2DVJ A;  2ECZ A;  1UDL A;  1G2B A;  1Z9Q A;  2EYW A;  2PTK A;  1UHC A;  3GBQ A;  1GRI A;  4HCK A;  4LE9 A;  1BBZ A;  2C0O A;  2J06 A;  3THK A;  2DF6 A;  1PKS A;  3M0P A;  4OMM A;  2A28 A;  2DE0 X;  1T0J A;  1E6G A;  1QWF A;  2LP5 A;  3NMZ C;  4D8D A;  1HSQ A;  1QLY A;  2L2P A;  2DNU A;  2KNB B;  2LNH B;  2DA9 A;  3VS1 A;  4AG2 C;  1YWP A;  2F2V A;  1OV3 A;  2GBQ A;  1ZBJ A;  2J6K A;  2KYB A;  4OML A;  5EC7 A;  2VVK A;  4GBQ A;  3SHW A;  2QDL A;  2KEA A;  1J3T A;  4RTU A;  3I5S A;  4RTW A;  2JTE A;  2KXD A;  2CUB A;  1AVZ C;  3REA B;  3U23 A;  4J9B A;  3VRY A;  1NYF A;  2YUO A;  2CSQ A;  1YN8 A;  3UF4 A;  1UUE A;  2C0T A;  2DL3 A;  2JM8 A;  2YUQ A;  3VRZ A;  2ED1 A;  4F17 A;  1YWO A;  1RLP C;  4RTX A;  1E7O A;  2MOX A;  2EGA A;  2YSQ A;  1UE9 A;  4M4Z A;  2ABL A;  1MV0 B;  1X27 A;  3VS7 A;  2D0N A;  1WI7 A;  3KFV A;  1A0N B;  2AKK A;  1UJY A;  2LZ6 B;  1M8M A;  2DBK A;  3RBB B;  1X43 A;  1X2K A;  2RPN A;  3JV3 A;  1WXB A;  3TVT A;  1AWO A;  2FPE A;  1VA7 A;  1JEG A;  2EW3 A;  1M3A A;  1S1N A;  4JJB A;  1E6H A;  1M3C A;  1T3L A;  1BU1 A;  2C0I A;  2DRK A;  2SEM A;  4JPB W;  2L0A A;  1ZUK A;  2AZS A;  4OMQ A;  3EHR A;  3M0Q A;  2DL4 A;  4RTY A;  1X6G A;  1UG1 A;  2OAW A;  1UJ0 A;  1U3O A;  1QKW A;  2KE9 A;  3NGP A;  3QWY A;  1FMK A;  4LUD A;  4AFU C;  1QCF A;  1PRL C;  2KGT A;  4Z89 A;  1WIE A;  2HCK A;  2KT1 A;  5HCK A;  1N5Z A;  2RNA A;  2FRY A;  3O5Z A;  3EG2 A;  3VS6 A;  1RI9 A;  2CRE A;  2W0Z A;  1PWT A;  2FO0 A;  2PNI A;  1ZX6 A;  4J9C A;  5IXB A;  3H41 A;  3EHQ A;  4DEY A;  2LCS A;  2F2W A;  3A98 A;  2VWF A;  1ZUU A;  4AG1 C;  2AKL A;  1XOV A;  4CC7 A;  1U5S A;  4D8K A;  2KT8 A;  4HVV A;  4X1V A;  1WFW A;  1OPL A;  1ABO A;  1NEB A;  2DL7 A;  2FPF A;  2LMJ A;  1HJD A;  1WX6 A;  1BK2 A;  1K1Z A;  1AZG B;  2M0Y A;  2XMF A;  4KRT A;  1Y0M A;  2YDL A;  3RNJ A;  3UA6 A;  4R0K A;  2RQV A;  1OPK A;  1AD5 A;  1UEC A;  2AK5 A;  4OMO A;  2CH4 A;  1SRM A;  2HSP A;  1YNZ A;  3H0H A;  1KSW A;  1U06 A;  1NLP C;  4AFZ C;  2J7I A;  2RMO A;  1I07 A;  2CH4 W;  4OMN A;  1UHF A;  2E5K A;  2DJQ A;  2LQN A;  2I0N A;  2L3P A;  2JMC A;  4J9D A;  1SSH A;  3CQT A;  2KR3 A;  2NUZ A;  3I35 A;  1YP5 A;  4CC4 B;  2EVR A;  2B86 A;  4LNP A;  2BZY A;  4A63 B;  1WXU A;  2DL5 A;  2JT4 A;  2BZ8 A;  2GTO A;  2HBW A;  2EYZ A;  3M0R A;  1PHT A;  2FEI A;  2O9S A;  1H3H A;  2RF0 A;  5IHK A;  2BTT A;  1K0X A;  4IIM A;  2CT4 A;  4RTV A;  1GCP A;  3LH5 A;  1UFF A;  1G83 A;  5FWB A;  1HD3 A;  1H8K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...