5L23A

Crystal structure of the complex between the n-terminal sh3 domain of crkii and a proline-rich ligand
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter molecule crk
publication title Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand
rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2016-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5l23A00
2VKNA 3SEMA 4JPBW 2NUZA 1NG2A 2KYMA 2K9GA 1OEBA 3A98A 2YSQA 4ZNXA 1GCQC 2O9SA 3O5ZA 1SEMA 4J9FA 3ZL7C 2RN8A 4DEXA 1WYXA 2GNCA 2YUNA 2EYXA 2JS2A 2CUDA 1K1ZA 2A08A 1V1CA 4LNPA 4LUEA 1VYVA 2DJQA 1G2BA 5FW9A 3H0IA 1GCPA 1I0CA 2A28A 1UJYA 1SHGA 2DBKA 2ROTA 1GCQA 2BZXA 2FRWA 3PVQA 2X3XD 2CSIA 2DF6A 1QKXA 1QKWA 2ROLA 2KROA 4ESRA 3PE0A 1UDLA 3KFVA 3UA6A 4ORZA 1ZUUA 2ABLA 2LQWA 5ECAA 1TG0A 1Y57A 1UFFA 5I11A 5EC7A 2CT4A 4CC3A 1U3OA 2CSQA 2KYBA 3VS2A 4JZ4A 2O2OA 4E6RA 2LX7A 2CH4W 2KR3A 1HSQA 2F2WA 4A63B 4JJDA 1K76A 2DVJA 4IIOA 1UGVA 1UHFA 1K0SA 1T0JA 2GQIA 3U23A 2YUPA 2L3QA 5FWBA 2OI3A 1E7OA 1M27C 4Y92A 3NMZC 2KT8A 3EG1A 1BK2A 1JEGA 2O31A 1NLOC 4J9BA 2NWMA 1RLPC 5FWCA 1U5SA 2DYBA 2KRSA 5IHKA 2DL4A 1UECA 1PHTA 2MIOA 1PKSA 2FPEA 2RMOA 1AEYA 1SHFA 1BB9A 1H92A 1TUDA 1UHCA 2KGTA 2AKLA 2B86A 2DA9A 2JMCA 2RPNA 1OOTA 2CT3A 3EHQA 4HVUA 2EYZA 2DLPA 2CUBA 2CH4A 1OV3A 1ZUKA 1OPKA 2GGRA 4J9IA 1NEBA 2V1RA 1Z9QA 3UATA 2EYWA 1NM7A 4J9EA 1FMKA 2YUOA 3H0FA 1PKTA 1ABOA 1UE9A 2DL7A 2DRMA 4IIMA 3H41A 4GLMA 4RUGA 4X1VA 5IH2A 3IQLA 1X43A 1CKAA 2D8JA 1YWOA 4LE9A 3M0PA 1GL5A 2D8HA 3QWXX 3I5RA 3H0HA 2KRNA 2AK5A 2FG0A 4RTXA 1X6BA 2JXBA 4HXJA 3C0CA 4AG2C 2DNUA 4DEYA 2H8HA 4J9HA 1W6XA 2PNIA 1NYFA 4AFSC 2ECZA 2C0IA 1X69A 2F2XA 4K11A 3RNJA 4OMQA 2DL3A 2X3WD 2KNBB 1AVZC 4J9DA 1X6GA 2FO0A 1Z9ZA 5IXFA 3NHNA 4J9GA 3UA7A 1JXOA 1HD3A 1NYGA 1FYNA 2V1QA 1JQQA 1AOJA 1RI9A 1T3SA 2EVRA 4Z88A 1GFCA 1GFDA 1TUCA 1QWEA 3TSWA 1QWFA 4OMPA 2KXDA 2LZ6B 2JM8A 3I9QA 4RTVA 2RQRA 2LNHB 3UF4A 2KE9A 2HBWA 2L0AA 2GBQA 1CSKA 2KEAA 4HVVA 4GBQA 4R0KA 1RLQC 2K79A 1GRIA 2ED0A 2J6OA 3EHRA 5IHIA 2KT1A 2PTKA 2L3SA 1Y0MA 2J06A 3VS3A 1VYTA 1SRMA 1WLPB 2LP5A 2OAWA 1JO8A 1I07A 1MV0B 3VS1A 4LN2A 5I22A 1AWJA 4EIKA 2J6KA 4Z8AA 1AZGB 1M3BA 1UUEA 2A37A 2ENMA 1JXMA 4RTWA 1WXUA 2HCKA 3NGPA 1S1NA 2LQNA 1YWPA 2C0TA 3TVTA 1X27A 2PZ1A 2P4RA 2J05A 2ESWA 2D1XA 3EG2A 1ZLMA 4M4ZA 4CC4B 5HCKA 3SHWA 1K4US 1UG1A 1W70A 4LUDA 4RTUA 5IXBA 4OMOA 1KJWA 2EKHA 3VRYA 1JU5C 4F14A 1U06A 3QWYA 2DL8A 1SPKA 2BZ8A 4OMLA 1A0NB 2DILA 3LH5A 4JJCA 1SSHA 4J9CA 2DMOA 3TSZA 2QDLA 3VS4A 1WIEA 3REBB 1YCSB 1WDXA 5L23A 1X2KA 2GTOA 2EW3A 1WXBA 2CREA 2FPFA 2M51A 2L2PA 2EPDA 2JM9A 1YNZA 1G83A 1M3CA 2K2MA 1YP5A 1GBQA 4KRTA 2O9VA 2M0YA 2DX1A 3VS7A 1HJDA 2GTJA 2EQIA 4FSSA 1ZX6A 1CKBA 2D0NA 4RTTA 2RNAA 4OMNA 2BZYA 2FPDA 4D8KA 1ARKA 1WFWA 1AWOA 2J6FA 3VRZA 4RTYA 5GJWB 2AKKA 2MOXA 2ED1A 1M30A 2YUQA 2C0OA 5GJVB 4AFUC 2XMFA 2DBMA 2EBPA 4F17A 1BBZA 1E6HA 1ABQA 1W1FA 2VWFA 2O88A 1NEGA 1WXTA 4HCKA 4JZ3A 3GBQA 3REAB 2EYYA 3THKA 2SEMA 1ZBJA 3VS0A 3EG0A 1NLPC 3PVLA 3EG3A 2AZVA 1PNJA 2JTEA 2FRYA 4HVWA 1XOVA 1PWTA 1QLYA 1M3AA 4AFZC 1M8MA 2VVKA 1MV3A 1VA7A 1X2QA 2DRKA 2JMAA 2K7AA 2IIMA 4RTZA 3ULRB 2YT6A 2E5KA 2YDLA 4D8DA 1N5ZA 3NPFA 3M0UA 1WI7A 2J7IA 2L3PA 4AFQC 2HEQA 2LJ3A 2RQTA 1E6GA 3I5SA 2DM1A 2HSPA 1H3HA 1ZUYA 2W0ZA 3M0SA 2K6DA 2CDTA 1AWWA 2KXCA 4CC7A 4OMMA 1MUZA 2EGEA 1KFZA 1I1JA 3EGUA 2LCSA 1BU1A 3FJ5A 1T0HA 2OJ2A 1WA7A 1KIKA 2AZSA 1LCKA 2JT4A 2W10A 2JS0A 4JJBA 1VYUA 4WCIA 1WX6A 2K3BA 4AG1C 1B3QA 1RUWA 2EGAA 2MCNA 3R6NA 1KSWA 3VS5A 1QCFA 1H8KA 2LJ1A 2RQVA 2KBTA 2HDAA 1ZSGA 2EGCA 1PRLC 3CQTA 3I35A 1PRMC 1AWXA 2LJ0A 4Z89A 2RF0A 2JW4A 3VS6A 1K9AA 3JV3A 3M0TA 2A36A 2DL5A 2KRMA 1J3TA 1GBRA 2F2VA 2I0NA 1EFNA 4QT7A 1T3LA 2BTTA 5IHNA 1UJ0A 1B07A 4CC2A 2FEIA 2LMJA 3M0RA 1IO6A 4F16A 3RBBB 1SRLA 1AD5A 2SRCA 2G6FX 1K0XA 3M0QA 2DE0X 2RQWA 1YN8A 1OPLA 2RQUA 1UTIA 1AZEA
chains in the Genus database with same CATH superfamily
4M75F 5LJ5j 2KDSA 3SEMA 1NG2A 2KYMA 4DBQA 1QP2A 1VQ9T 2ZPEB 4ZNXA 3FC3A 3O5ZA 1SEMA 1WYXA 4MDWA 3LW5E 4J7FA 2RH2A 2XK0A 3CD6T 3MEAA 1RAIB 5FW9A 3QDRB 1QMCA 1GCPA 1I0CA 1WHKA 1UJYA 1VQPQ 1QVGP 3H9NA 4M7AD 1XJWB 2BZXA 3PVQA 1K8AR 9ATCB 6AT1B 2DF6A 1QKXA 3S6WA 1QKWA 2ROLA 4R55A 4NL2A 4PFOA 3PE0A 4ESRA 1OYXA 4ORZA 4GY5A 3A8OB 4OB1B 3I56A 1PG5B 4KUDK 2HNIA 1WHLA 4D6WA 5I11A 1BIAA 5EC7A 4CC3A 1VQ6Q 1WQ7A 2L3RA 2O2OA 1OULA 1LVKA 4J5YA 1MNDA 2K5FA 2YLBA 1U1TA 4HCBA 1UHFA 1K0SA 1H641 2DTOA 2HL5C 3HSBA 4EMGA 2E10A 1Y71A 3HFNA 1M27C 1B34A 2H3JA 2ZAEA 2CP0A 1JEGA 4A4HA 1N9SA 5CIUA 4J9BA 1RLPC 1U5SA 2DYBA 1M8VA 4PNOA 3G4SA 4ME7A 1UECA 1ZA1B 3GLXA 3OS2A 1PKSA 2R5MA 2RMOA 2XKOC 4BI8B 1H92A 1UHCA 2KGTA 3GP8A 3HPWA 2RPNA 1PCXA 1OOTA 2QA4T 4C92G 2X35A 4KUIA 3RIRA 4XQ3A 2CH4A 2LNVA 4J9IA 1NEBA 2V1RA 2VB6A 1X75C 2PVOB 1FMKA 3H0FA 3UDCA 5LJ5h 2RHZA 1UE9A 2DL7A 2IVWA 1BYMA 3HHTB 3JCMf 3H41A 5IH2A 3EH2A 2E3IA 5GMKl 2P0PA 1GL5A 2OAUA 2D8HA 1YI2T 4ZN1A 2EJ9A 4PJOE 3PIPA 1YJWT 4OGCA 2KMTA 2CGHA 2JXBA 4KT0E 1Q86R 3JAME 2DPPB 2DK3A 1G3TA 2HZYA 2DNUA 4NS5A 1UGRB 5DY9A 1I5OB 4C92D 2C0IA 1VQNQ 1X69A 4PJOF 1JB0E 3RNJA 2LDMA 2YRCA 5DLQE 1YJ9T 2DL3A 2X3WD 3CCMA 1YHQT 3F70A 1X6GA 2FO0A 1Z9ZA 4J9GA 4DOWA 2CP5A 1HD3A 3KUFA 2V1QA 1B34B 4JS5A 1ZSZA 3E1SA 1RI9A 3TU4K 2LRQA 4M77E 3GNGA 4OMPA 3X28B 5KH6A 3S3NA 1K73R 3INZA 2VC8A 4PJNA 2RQRA 2LNHB 4C0FA 2WSFE 2ZZDA 2PVDB 1MHNA 1CSKA 2GFUA 2PUOB 2DJZA 2JOYA 4CI0C 1RAAB 4ZGJB 4M77F 4ELYC 4C0DB 5LJ3d 3OS1A 2L3SA 1I5LA 2J06A 5HK3A 3LLRA 3VS3A 4E7HA 2EAYA 4PJOG 1WLPB 2LP5A 2OAWA 3L2QA 1I07A 1MV0B 4HCCA 1RI0A 4LN2A 4BE0A 1VQ5A 4EIKA 4XU0A 1VQ9Q 3FDRA 4PJJA 1C1AA 2FZKB 2J6KA 2X4JA 1VQMA 4HT9A 1UUEA 2A37A 5GAOp 4FYXB 3C95A 4B9WA 3ZFJA 1YWPA 1OU9A 4OF1A 2PZ1A 3CD6Q 4N4HA 2D1XA 3EGDA 3EG2A 1ZLMA 4M4ZA 3PMIA 3SHWA 1K4US 3VU3C 3J80E 3JCMQ 1W70A 2X51A 4MZTA 1JJ2P 2YRVA 1YJ9A 2OTJA 2EKHA 3CPWP 2RJEA 5C0MA 1YHQA 1OU8A 2Y90A 1M1FA 4NOYA 1VIEA 4OMLA 4IKFA 4M77G 1XQHA 2X4XA 2JN0A 1OX9A 2R5AA 1MGQA 3LH5A 4JJCA 2AHJB 1RAEB 1R77A 3FB9A 3HFOA 3OYLA 1WDXA 4M75A 4QQDA 5L23A 1PSFA 1VOMA 4XTYA 2CREA 2DKGA 4Z02A 3G6EA 3JRZA 1BI0A 2JM9A 4L6V5 3E9GA 4JLIA 1GBQA 1MMNA 1Q86C 3OY9A 1IGUA 1M1KU 2QDYB 2V8JA 2KAFA 5FU6C 3VUBA 1CKBA 4RTTA 2RJDA 5J39A 4E2FB 1GXIE 1WFWA 1AWOA 4RTYA 3CC4A 2ED1A 3JB9I 3P8HA 3EAEA 5LJ3e 4JDSA 2QA4Q 2RJCA 4RCCA 2XMFA 5IT9E 4F17A 1W1FA 4A54A 1ZBXA 3GBQA 3HRTA 1SG5A 3C94A 1VIFA 2LCLA 4QQ6A 1PWTA 1C0MA 2XI9A 3QIIA 1R0CB 3EGDB 4RTZA 1IB8A 1VA7A 2DRKA 2IIMA 2K7AA 2YT6A 2E5KA 4D8DA 3TCJA 1VQ4T 4FW1A 1WJRA 3RMSA 4KGVB 2RI3A 1YJWQ 1KC8C 4JJNK 1KQSA 3QUIA 2EQUA 5GMKe 2E6NA 2M16A 2HEQA 3LGFA 3MHXA 3T9NA 3I55T 2LJ3A 1E6GA 5HKCA 2E65A 1W2BA 2DM1A 1H3HA 4M7DA 3MCAB 2KXCA 2MMPA 4UC4A 4CC7A 1VQLT 4M75B 1MUZA 4OMMA 3HTRA 2EGEA 1KFZA 3EGUA 2LCSA 4J83A 1YJ9Q 2HKNA 2ZPHB 1YHQQ 3LH0A 2LT4A 3D7SB 5CAIA 3OBYA 1N8RU 4WCIA 4JRPA 1NJIC 4J7IA 4C0GA 3FRNA 3E2UA 2QQ9A 2LJ1A 1VQPT 1PRLC 1AWXA 2RI5A 2RF0A 3L2VA 3JV3A 2GCXA 5LJ5g 2EFIA 2HQXA 3A8HB 5LJ3f 3SDZA 4Y28E 4Y91A 4C8QC 5GAMh 3VKIA 2F2VA 3HKSA 4EDUA 1TOVA 1FWZA 1T3LA 5IHNA 5FRMA 1UJ0A 1B07A 2FEIA 3M0RA 3VUZA 5KE2A 4M78C 1SRLA 5GANj 3OYIA 3M0QA 4XTVA 2DE0X 4N0AC 1LPLA 2M1HA 4O5VA 4OMFB 1UTIA 2LCCA 4LDWA 1B7TA 4OGEA 4LDUA 3JCMc 1VQKT 2NUZA 1Y7XA 2K9GA 3JCMP 2YSQA 1GCQC 4A53A 3QYHB 3OB9A 2YUNA 2FZGB 1W2BS 3LX7A 2ZPFB 2XIDA 2X9HA 5CKDA 4MMKA 4C0ZA 4E7KA 1K1ZA 2A08A 4M7DB 2WACA 1BI2A 4JRQA 1V1CA 2VXEA 4LNPA 3CCLT 3WXMB 3CMEA 2MAMA 1BCMA 2RHXA 4ZTFA 3H0IA 2A28A 2DBKA 2ROTA 7AT1B 2OTLT 2FRWA 1M90C 2X3XD 2AT1B 2FZCB 4A4EA 2KROA 1LJOA 1UDLA 1FX7A 3H8ZA 2QXFA 5C6SA 5ECAA 1TG0A 1Y57A 1Q81C 1RAFB 3GIBA 2CSQA 3AHUA 4BY6B 1O75A 2LX7A 3GOXA 3OYAA 3JCMd 1HSQA 5KYUA 4VUBA 1D3BA 2DVJA 1UGVA 2OX7A 5KE3A 3JB9G 4KBMB 3M59A 2HQEA 3G1JA 3NMZC 2KT8A 2O31A 3PIOA 2PVGB 4PJLA 4DBFA 1YCYA 3L2ZA 4PJOB 2KRSA 5IHKA 2DL4A 1PHTA 5GMKi 5CR2A 3I56T 3E9FA 1TUDA 3QG1A 2A3LA 4HA8A 5KYNA 2JMCA 2QQBA 5D7UA 1Q7YC 2L8DA 2DLPA 3WVDB 4AMCA 1OPKA 2GGRA 3X26B 2QTVA 1Z9QA 2KY9A 1NBEB 2JTFA 1R0BG 5I2MA 4BD3A 4GLKA 3META 4M75E 1TWBA 1U1SA 3BY7A 2RK1A 3V7SA 3GF5A 2DFUA 3CCLA 3JB9D 3G71T 2P84A 3DB3A 2DRMA 1VQ4Q 4V2SA 4X1VA 2HQHA 3JCMh 1X43A 1CKAA 4PFPA 1YJNT 2D8JA 3M0PA 4M77B 2DEQA 3G4ST 3QWXX 3RERA 1OX8A 3O8VA 2KRNA 1YBYA 3OYYA 4RTXA 1Q82U 1KD1C 5IN1A 2FVUA 4HXJA 4C8QE 4DEYA 1VQLQ 2MI6A 2RHIA 2ECZA 3P8BB 3SWNA 4EMKC 1M2VB 2IPOB 3QJYA 3HP9A 2MPXC 1D1BA 2NUTB 4M78E 4PK4A 1D3BB 4J9DA 1I4K1 4C8QF 4BI4A 1JXOA 3JCMe 1JQQA 2F5TX 5CKEA 4IUQA 5FLXE 2EVRA 4F7UF 3V8KA 1TUCA 4L59A 4M78F 2KXDA 2LZ6B 2JM8A 2P4TA 4PJMA 3X25B 1OZ3A 3I9QA 4BI3A 3EGXA 2L0AA 2Y4XA 3ASKA 5GAOl 1EX4A 3CCQA 2VXFA 1N9RA 2K79A 4M75G 1ZA2B 3L2WA 2ED0A 3EG9A 4DBHA 2JZ2A 4R56A 3EHRA 2KT1A 3CCMT 3Q1JA 4OP0A 4M7DE 1VQ8T 1VYTA 3G71A 4RG2A 4C5HA 1M5Q1 1O9SA 1VQKQ 1KHIA 5GAN7 1YJNA 5I22A 2RB6A 3OYKA 4X9CA 2BE7D 2QTXA 1IRXA 1KQ1A 4M7DF 2ENMA 4MZMA 1G3SA 1KQSP 3OYCA 3JCMJ 2O01E 2LQNA 2CZ7B 2C0TA 3TVTA 1X27A 1YITA 1IZ6A 4IUUA 3CCLQ 1W2BP 2QK0A 2E12A 5HCKA 1PD0A 1X6OA 2MK5A 2OTLQ 4M75D 3SWNB 3JB9J 2E3HA 2EKOA 4XAXB 4MMLA 4JRIA 1K8AU 4F14A 4XTWA 1SPKA 4ZGDB 2BZ8A 2CZ6B 5FU7C 1A0NB 2QGGA 5CVIA 2G3RA 3VS4A 2DMOA 5A2QE 1VQ5T 3REBB 1VQ7A 3DLLA 3RKXA 1VQMT 4JRKA 2B8AA 2M9UA 1EZZB 4DQ2A 3EGXB 1G83A 1Y07A 1M3CA 2K2VA 4KRTA 2E41A 1SKUB 5D6XA 3FIFA 3M55A 2M0YA 4MDXA 2DX1A 5LJ3j 2GTJA 4M7DG 4FSSA 3CCUA 2D0NA 1M1GA 3VV0A 2OTJT 4OVAA 3EG9B 3ZEHA 4D8KA 1VQ8A 3OYFA 3LWHA 1D0XA 3VRZA 3A8GB 5GJWB 2YWWA 3I56Q 3CBPA 1TS9A 5AYFA 5CKBA 5GAN4 4BDZA 5GJVB 2E5QA 2DD5A 1MMDA 2DBMA 2EBPA 3R6OA 1V76A 3MP1A 2VWFA 3G6ET 4HCKA 4JZ3A 1RACB 3OYDA 2EYYA 1ZBJA 3JCMX 5GMKj 3EG3A 3G71Q 2JTEA 2FRYA 1XOVA 3MJXA 1M3AA 4AFZC 1KC8R 2VVKA 1KHCA 4M7DD 2CS7A 3OYMA 4JLGA 1YJNQ 2JUFA 1YIJA 3G4SQ 4BUGA 1UEBA 2L3PA 2RD1A 3CC4T 5FROA 3DLMA 4E7SA 2QEXA 1ZUYA 4XTZA 2W0ZA 3M0SA 1ZQ1A 2K6DA 1QW1A 2D9TA 2CKKA 1I1JA 1BU1A 1NJIR 2QQAA 2JVVA 1D0ZA 2COZA 1KIKA 2W10A 2GFAA 4BB7A 1F1BB 3CC7A 1RUWA 2MCNA 1KSWA 3VS5A 5GANg 4EPCA 2DIGA 2KBTA 3MO8A 3NTIA 2HDAA 2EGCA 2LQ8A 3CQTA 2CZ1B 3I35A 2AIRB 2LJ0A 4Z89A 3VS6A 2K3YA 3BDUA 2DL5A 4E47A 1K73U 5I2SA 4PJOD 3OMGA 1ZSZB 5LJ3h 3CC2T 3CCVA 1WHJA 5FU6B 4BDYA 1GBRA 5GAOr 2I0NA 1EFNA 4IUPA 5LJ5f 2BTTA 4KH0B 3CCMQ 4LD6A 4CC2A 1AT1B 3QSUA 1QCNA 1VQ8Q 4PL6A 2NLUA 1Y96A 4EMHA 2SRCA 5GAMj 2RQWA 3OS5A 2EQJA 1M4ZA 2RK2A 2VGNA 1HXDA 1NE8A 3TQ7P 4C8QA 4XU1A 2VKNA 2GF7A 2COYA 4JPBW 3A98A 3OYNA 2O9SA 4F7UA 4J9FA 3NTHA 2RN8A 3ZL7C 4M77D 5GMKh 2GNCA 4M78A 4QKUA 2EYXA 2HL3A 2JS2A 4ELZC 4N0AA 3GNFB 2CP6A 1N8RR 3V8JA 1M90R 2FL7A 1YIJQ 4M7AC 5CCAA 5KYWA 1SHGA 1GCQA 2CSIA 1AHJB 4Q5WA 3CMAA 3MP6A 3OYHA 1Q81R 3KFVA 3UA6A 1ZUUA 1TSFA 1VQ5Q 1WHGA 1IREB 1VQMQ 2V8IA 2PUKB 3DKMA 4FSXA 1U3OA 2KYBA 3VS2A 2VUBA 1I8FA 2X4WA 4E6RA 2CH4W 5D6WA 3M9QA 2F2WA 4A4FA 2DO3A 4A63B 1LOJA 4KGXB 4IIOA 3CC2A 5HY6A 3JSCA 2GQIA 2YUPA 3A1PA 3CMET 1OQKA 2CP3A 2OI3A 1E7OA 2OTJQ 4PKCC 8AT1B 3JCMW 1QP3A 1M1KC 3QDFA 2YHTA 2DEUA 1NLOC 4IURA 4QVDA 2NWMA 5FWCA 5CQXA 2QGFB 4LDVA 2V26A 3OSVA 1N6AA 1SHFA 1Q7YR 3OYGA 4C8QB 3CCVQ 1FMVA 1WJSA 3MKDA 3ZBDA 3G6EQ 4QVZA 1K9MU 2CT3A 3V7RA 4HVUA 2EYZA 2RM4A 4F7UB 2CUBA 1OV3A 1ZUKA 4M78B 3CCRT 3UATA 2BUDA 1NM7A 4J9EA 2EJGA 1ABOA 2K5IA 3LYIA 2C06A 2CZ0B 1VQOA 3CCJT 1KD1R 4FT4A 3MEVA 3PFSA 5KYWB 3CC4Q 1ZHIA 3I5RA 2AK5A 2EYQA 4MZPA 1EIFA 1TU0B 2QAZA 4AG2C 3CCST 4C92C 3V8LA 3L42A 2ATCB 3OYBA 4AFSC 4J6WA 1BCOA 4J8OA 2BE9B 2F5KA 4K11A 2LX9A 4BACA 2KNBB 5A0DA 5IXFA 2DXUA 3UA7A 1TTHB 1QVFA 1NYGA 1FYNA 1AOJA 1N8RC 3GPLA 4Z88A 1GFCA 2NUPA 1GFDA 3TSWA 4E7IA 4ZTJA 1QWFA 4EMKA 3G7ZA 1H3ZA 2RHUA 3CC2Q 1WPYA 1DJ7B 3UF4A 3PNWC 2Y4YA 2GBQA 3CCET 4P5NA 4GBQA 1OZ2A 3QZ5B 3RR6A 3CCRA 5IHIA 1Y0MA 5GANd 4J6XA 4FU6A 2O4XA 3NFCA 1BKBA 3CCJA 3RUXA 1M9SA 1AWJA 4M7AF 3ER0A 3OSSC 3M57A 4E7JA 4Z8AA 4KULA 1JXMA 4RTWA 1VQ6A 1WXUA 3MEWA 1U8RA 3CPWA 3AT1B 4FM4B 1I81A 3J81E 4LD9K 3NGPA 2E1HA 1HYOA 3CCSA 2P4RA 2J05A 3CCQT 1UG1A 1RABB 2EJFA 5A0GA 3M58A 1VQOQ 3LWIA 4RTUA 5IXBA 4OMOA 3TEEA 5LJ3g 4JUVA 5GAN6 1JU5C 1XNIA 2DL8A 1YFNA 3QWYA 1QVFS 4WF2A 2DXTA 4PJOC 3CEYA 2K5LA 2EWNA 3CPFA 3TSZA 4KGZB 5DLOA 2FHDA 1YCSB 5M9OA 2NUPB 2EW3A 1WXBA 5GAN2 1G3YA 1JBMA 4EMKB 5CQYA 1JRIA 1FXXA 2E6ZA 2HSEB 1NZ9A 1YITT 3QBYA 2DTHA 3CCEA 2O9VA 4WTOB 3CMEQ 3VS7A 3EH1A 1ZX6A 4N4IA 4F7UE 2KI7A 1SF9A 2XHCA 2RNAA 4OMNA 5KYUB 2BZYA 3M4YA 1ARKA 2ZGWA 1UB4A 2J6FA 3EFOA 2KSSA 2R57A 1HK9A 2AKKA 4M77C 1WNLA 2MOXA 3DB4A 1C6VX 2O4XB 2MYSA 2C0OA 5GANe 2DZCA 1VQ7T 4AFUC 4C92E 1BBZA 4BE1A 1JJ2S 2O88A 1WXTA 3CXCA 3CPWS 5EG2A 5CKFA 2QYZA 3KBGA 3REAB 3CCRQ 2SEMA 1SSFA 1VQNA 3HL8A 2AZVA 1PNJA 3QZ9B 3QJ6A 5GAN3 3CCUT 1M8MA 4C92F 1VUBA 1X2QA 2JMAA 3CCJQ 4C5EA 3WVEB 3SD4A 2YDLA 3CBMA 1P92A 2DXBA 1N5ZA 2J7IA 2LC4A 1RAHB 5AT1B 5LJ5d 4NL3A 1N27A 2RQTA 1XTDA 3CCSQ 2RI2A 4XU2A 2EIFA 4RCBA 4LDXA 1Q82C 4C8QG 2CDTA 2MWOA 1D1CA 1D1AA 1IHWA 5GAOm 3FJ5A 2KK4A 4F7UG 4B9XA 3L2RA 2OJ2A 5KCHA 4M78G 4HT8A 2NYSA 4JJBA 5FU7B 4XTUA 4XK8E 2HKQB 4AG1C 1B3QA 2EGAA 1YIJT 2RQVA 5GAMg 4C5IA 1PRMC 2JW4A 1K9AA 1VQ9A 3C12A 3EFOB 3M0TA 2A36A 1KK7A 1G5VA 1TXQA 5GANf 2QEXT 3CCEQ 2YXYA 3JCMV 1QCOA 3UT1A 4C8QD 3CXCS 4QT7A 2XDDA 3CD6A 2MF2A 4F16A 3SWNC 1WJQA 1AD5A 2DVEA 2G6FX 4M78D 1RL2A 2DZ9A 4PFZA 1YN8A 1OPLA 3CC7T 4DBRA 2QI2A 5KCOA 3OYEA 3TREA 2QG9B 5CKHA 5GMKm 2K3XA 1OEBA 3VYHB 1PSEA 4E7ZA 5DM7R 4DEXA 4LDYA 5HK0A 2F69A 2F1LA 1NPRA 2CUDA 1S72T 5GAN8 3CCVT 3CCQQ 3M5AA 3A8MB 5LJ5e 4LUEA 1VYVA 3X24B 2DJQA 1G2BA 2M02A 1X01A 3S3OA 2DD4A 1W4SA 4O6JA 1ACMB 4FYWB 3HRUA 2ABLA 2LQWA 1K8AC 2V8KA 1QQJA 2JJ9A 4ZN3A 1UFFA 2X4YA 4L5GA 1QVFP 2CT4A 1QVPA 1WHMA 3UPUA 1M2OA 4JZ4A 2QA4A 4M7AA 1Q86U 2QQRA 2K4YA 2KR3A 1YITQ 1NPPA 2CP2A 1OI1A 3M53A 4JJDA 2JTMA 1K76A 4X9DA 2WSEE 1T0JA 1M1KR 2E4HA 3U23A 2L3QA 3M4GA 3BW1A 5FWBA 2RHYA 5KYYA 4Y92A 4RMOA 2MWPA 2DYIA 3EG1A 1BK2A 4FW2A 2KVQG 2L89A 4C0DC 4FYVB 5I21A 3CMAT 3PGGA 1YI2A 1YJWA 2MIOA 2FPEA 5GAOn 2E70A 1VQ7Q 1AEYA 2ZPBB 1BB9A 2JNGA 2AKLA 2B86A 2DA9A 4QW2A 3OW2A 2XG8D 3CBOA 1MMAA 3EHQA 3MP8A 2COWA 3M54A 3JCMg 1BI1A 2PQWA 1S72A 2EQMA 2EYWA 1KG1A 3CCUQ 2YUOA 1PKTA 1KC8U 5IAYA 4IIMA 1UGSB 5CO7A 4GLMA 4RUGA 3IQLA 2FB7A 1YWOA 4OB3B 1UGPB 4LE9A 1LNXA 2E64A 4X34A 3NTKA 3H0HA 2D0QB 2FG0A 1X6BA 2DIQA 3C0CA 1G8XA 3VJPA 1PD1A 2H8HA 3H6ZA 1W6XA 4J9HA 5GAN5 2PNIA 1NYFA 2XDPA 1ZSZC 2M0OA 2RJFA 1PM3A 2PU9B 1QVGA 4M7AB 3KXTA 2F2XA 3P8DA 1TH7A 2ZPIB 4OB2B 4OMQA 1NJIU 1AVZC 2YRDA 3NHNA 2DERA 5KYYB 2CYZB 1VQOT 4C92A 1T3SA 1WQWA 1QWEA 5D6YA 2GQVA 1K9MR 2XD0A 3FEOA 2QEXQ 4RTVA 3N5BB 3OW2S 2KE9A 4ANJA 2A7YA 4CRIA 2HBWA 2KEAA 5LL6S 1K73C 4HVVA 2LQKA 4R0KA 1RLQC 1GRIA 4PLIA 2VYTA 2J6OA 3FLGA 2LTOA 2PTKA 3SFMA 3OS0A 3CXCP 5GAMd 3URGA 1YI2Q 3CC7Q 1SRMA 4HKEA 3QXEB 4FIBA 1JO8A 3VS1A 1V29B 3BDLA 1TUGB 3OA6A 1Y96B 3E19A 1AZGB 1IHVA 1M3BA 3JB9H 2VV5A 4FL6A 1WHHA 2RA2A 2HCKA 1S72Q 2ZPGB 1S1NA 3HRSA 4QVCA 4XTXA 1D0YA 4BE2A 3OQ5A 2ESWA 1QVGS 1FMWA 4CC4B 2HAXA 3BFMA 4M75C 1M90U 4TVRA 2HBPA 3BE3A 4IUVA 4LUDA 3VYGA 1KJWA 1BIBA 3SB2A 3VRYA 1U06A 2D6FA 2HMAA 2XICA 1Q81U 3EFRA 1BI3A 2DILA 1SSHA 3QYGB 4J9CA 2QDLA 1WIEA 4DOVA 2L5QA 4XU3A 4C92B 1IGQA 2KQWA 4FYYB 1X2KA 2GTOA 2YLCA 2FPFA 2M51A 2DETA 3OYJA 1VQ6T 1Q95G 2L2PA 2EPDA 4PLLA 3RMQA 3A5ZB 2XDBA 1YNZA 4LXCA 5KYXA 2RO0A 1YP5A 2K2MA 5FRNA 1UGQB 4PJOA 1HJDA 4RG8A 4J6YA 2EQIA 1MNEA 3MEUA 4C5GA 3V7CA 3MPUB 4IUTA 4QQGA 2FPDA 2P0KA 3CMAQ 1VQ4A 3PT9A 3UWNA 1KQSS 3EFSA 4ATOA 2BIVA 2IG0A 4YTLA 3JB9F 3QKJA 2YUQA 1M30A 1MMGA 3I55A 3L1AA 1WZOA 5GAMe 1Q7YU 2EQKA 1RAGB 1E6HA 2FYKA 1ABQA 4A4GA 1VQLA 2VGMA 1NEGA 3L2UA 4FCYA 4DA4A 1PC0A 4KH1B 3THKA 1K9MC 4E7LA 2DXCA 3VS0A 3EG0A 1NLPC 3PVLA 3J7AF 3RDVA 4M77A 2ZCFB 4HVWA 1QLYA 1G3WA 1R8OB 4M7DC 4RKUE 2Z0WA 4M7AE 1MV3A 3ULRB 4JS4A 3RKYA 3NPFA 3M0UA 1KD1U 1RADB 1WI7A 1VQPA 2P0QA 4A4KA 5J3BA 3C4SA 2BKDN 1Q82R 4AFQC 4F04B 3S3MA 3PTAA 1M2VA 4ZGEB 3I5SA 4OB0B 2QASA 2HSPA 2NUTA 3FJPA 3QPHA 1AWWA 4N4GA 1JJ2A 4BY6C 3JCMb 2XU8A 3ME9A 3A8LB 5L8RE 1VQNT 1T0HA 1WA7A 5KYXB 2DTIA 2AZSA 3RKWA 3LGLA 2I2LA 3RESA 1LCKA 2CP7A 2JT4A 2JS0A 1VYUA 4B6MA 1WX6A 2K3BA 1D09B 3OBWA 2R58A 4HCZA 1IXDA 3R6NA 2DAQA 1QCFA 1H8KA 1ZSGA 1VQKA 2H3EB 2K57A 2LVMA 2A0FB 5CK9A 3OMCA 3QO3A 4FT2A 4II1A 2WSCE 4AT1B 2KRMA 1J3TA 5GAMf 5GANh 2HD0A 1KQ2A 3OW2P 5GAOq 1WGSA 2LMJA 5A0LA 4M7AG 3M56A 1IO6A 5J26A 2QQSA 3RBBB 2OTLA 3X20B 3PMTA 3QHSA 1K0XA 2VASA 3I55Q 8ATCB 2LT1A 2RQUA 1AZEA
chains in the Genus database with same CATH topology
2VKNA 3SEMA 4JPBW 2NUZA 1NG2A 2KYMA 2K9GA 1OEBA 3A98A 2YSQA 4ZNXA 1GCQC 2O9SA 3O5ZA 1SEMA 4J9FA 3ZL7C 2RN8A 4DEXA 1WYXA 2GNCA 2YUNA 2EYXA 2JS2A 2CUDA 1K1ZA 2A08A 1V1CA 4LNPA 4LUEA 1VYVA 2DJQA 1G2BA 5FW9A 3H0IA 1GCPA 1I0CA 2A28A 1UJYA 1SHGA 2DBKA 2ROTA 1GCQA 2BZXA 2FRWA 3PVQA 2X3XD 2CSIA 2DF6A 1QKXA 1QKWA 2ROLA 2KROA 4ESRA 3PE0A 1UDLA 3KFVA 3UA6A 4ORZA 1ZUUA 2ABLA 2LQWA 5ECAA 1TG0A 1Y57A 1UFFA 5I11A 5EC7A 2CT4A 4CC3A 1U3OA 2CSQA 2KYBA 3VS2A 4JZ4A 2O2OA 4E6RA 2LX7A 2CH4W 2KR3A 1HSQA 2F2WA 4A63B 4JJDA 1K76A 2DVJA 4IIOA 1UGVA 1UHFA 1K0SA 1T0JA 2GQIA 3U23A 2YUPA 2L3QA 5FWBA 2OI3A 1E7OA 1M27C 4Y92A 3NMZC 2KT8A 3EG1A 1BK2A 1JEGA 2O31A 1NLOC 4J9BA 2NWMA 1RLPC 5FWCA 1U5SA 2DYBA 2KRSA 5IHKA 2DL4A 1UECA 1PHTA 2MIOA 1PKSA 2FPEA 2RMOA 1AEYA 1SHFA 1BB9A 1H92A 1TUDA 1UHCA 2KGTA 2AKLA 2B86A 2DA9A 2JMCA 2RPNA 1OOTA 2CT3A 3EHQA 4HVUA 2EYZA 2DLPA 2CUBA 2CH4A 1OV3A 1ZUKA 1OPKA 2GGRA 4J9IA 1NEBA 2V1RA 1Z9QA 3UATA 2EYWA 1NM7A 4J9EA 1FMKA 2YUOA 3H0FA 1PKTA 1ABOA 1UE9A 2DL7A 2DRMA 4IIMA 3H41A 4GLMA 4RUGA 4X1VA 5IH2A 3IQLA 1X43A 1CKAA 2D8JA 1YWOA 4LE9A 3M0PA 1GL5A 2D8HA 3QWXX 3I5RA 3H0HA 2KRNA 2AK5A 2FG0A 4RTXA 1X6BA 2JXBA 4HXJA 3C0CA 4AG2C 2DNUA 4DEYA 2H8HA 4J9HA 1W6XA 2PNIA 1NYFA 4AFSC 2ECZA 2C0IA 1X69A 2F2XA 4K11A 3RNJA 4OMQA 2DL3A 2X3WD 2KNBB 1AVZC 4J9DA 1X6GA 2FO0A 1Z9ZA 5IXFA 3NHNA 4J9GA 3UA7A 1JXOA 1HD3A 1NYGA 1FYNA 2V1QA 1JQQA 1AOJA 1RI9A 1T3SA 2EVRA 4Z88A 1GFCA 1GFDA 1TUCA 1QWEA 3TSWA 1QWFA 4OMPA 2KXDA 2LZ6B 2JM8A 3I9QA 4RTVA 2RQRA 2LNHB 3UF4A 2KE9A 2HBWA 2L0AA 2GBQA 1CSKA 2KEAA 4HVVA 4GBQA 4R0KA 1RLQC 2K79A 1GRIA 2ED0A 2J6OA 3EHRA 5IHIA 2KT1A 2PTKA 2L3SA 1Y0MA 2J06A 3VS3A 1VYTA 1SRMA 1WLPB 2LP5A 2OAWA 1JO8A 1I07A 1MV0B 3VS1A 4LN2A 5I22A 1AWJA 4EIKA 2J6KA 4Z8AA 1AZGB 1M3BA 1UUEA 2A37A 2ENMA 1JXMA 4RTWA 1WXUA 2HCKA 3NGPA 1S1NA 2LQNA 1YWPA 2C0TA 3TVTA 1X27A 2PZ1A 2P4RA 2J05A 2ESWA 2D1XA 3EG2A 1ZLMA 4M4ZA 4CC4B 5HCKA 3SHWA 1K4US 1UG1A 1W70A 4LUDA 4RTUA 5IXBA 4OMOA 1KJWA 2EKHA 3VRYA 1JU5C 4F14A 1U06A 3QWYA 2DL8A 1SPKA 2BZ8A 4OMLA 1A0NB 2DILA 3LH5A 4JJCA 1SSHA 4J9CA 2DMOA 3TSZA 2QDLA 3VS4A 1WIEA 3REBB 1YCSB 1WDXA 5L23A 1X2KA 2GTOA 2EW3A 1WXBA 2CREA 2FPFA 2M51A 2L2PA 2EPDA 2JM9A 1YNZA 1G83A 1M3CA 2K2MA 1YP5A 1GBQA 4KRTA 2O9VA 2M0YA 2DX1A 3VS7A 1HJDA 2GTJA 2EQIA 4FSSA 1ZX6A 1CKBA 2D0NA 4RTTA 2RNAA 4OMNA 2BZYA 2FPDA 4D8KA 1ARKA 1WFWA 1AWOA 2J6FA 3VRZA 4RTYA 5GJWB 2AKKA 2MOXA 2ED1A 1M30A 2YUQA 2C0OA 5GJVB 4AFUC 2XMFA 2DBMA 2EBPA 4F17A 1BBZA 1E6HA 1ABQA 1W1FA 2VWFA 2O88A 1NEGA 1WXTA 4HCKA 4JZ3A 3GBQA 3REAB 2EYYA 3THKA 2SEMA 1ZBJA 3VS0A 3EG0A 1NLPC 3PVLA 3EG3A 2AZVA 1PNJA 2JTEA 2FRYA 4HVWA 1XOVA 1PWTA 1QLYA 1M3AA 4AFZC 1M8MA 2VVKA 1MV3A 1VA7A 1X2QA 2DRKA 2JMAA 2K7AA 2IIMA 4RTZA 3ULRB 2YT6A 2E5KA 2YDLA 4D8DA 1N5ZA 3NPFA 3M0UA 1WI7A 2J7IA 2L3PA 4AFQC 2HEQA 2LJ3A 2RQTA 1E6GA 3I5SA 2DM1A 2HSPA 1H3HA 1ZUYA 2W0ZA 3M0SA 2K6DA 2CDTA 1AWWA 2KXCA 4CC7A 4OMMA 1MUZA 2EGEA 1KFZA 1I1JA 3EGUA 2LCSA 1BU1A 3FJ5A 1T0HA 2OJ2A 1WA7A 1KIKA 2AZSA 1LCKA 2JT4A 2W10A 2JS0A 4JJBA 1VYUA 4WCIA 1WX6A 2K3BA 4AG1C 1B3QA 1RUWA 2EGAA 2MCNA 3R6NA 1KSWA 3VS5A 1QCFA 1H8KA 2LJ1A 2RQVA 2KBTA 2HDAA 1ZSGA 2EGCA 1PRLC 3CQTA 3I35A 1PRMC 1AWXA 2LJ0A 4Z89A 2RF0A 2JW4A 3VS6A 1K9AA 3JV3A 3M0TA 2A36A 2DL5A 2KRMA 1J3TA 1GBRA 2F2VA 2I0NA 1EFNA 4QT7A 1T3LA 2BTTA 5IHNA 1UJ0A 1B07A 4CC2A 2FEIA 2LMJA 3M0RA 1IO6A 4F16A 3RBBB 1SRLA 1AD5A 2SRCA 2G6FX 1K0XA 3M0QA 2DE0X 2RQWA 1YN8A 1OPLA 2RQUA 1UTIA 1AZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKN A;  3SEM A;  4JPB W;  2NUZ A;  1NG2 A;  2KYM A;  2K9G A;  1OEB A;  3A98 A;  2YSQ A;  4ZNX A;  1GCQ C;  2O9S A;  3O5Z A;  1SEM A;  4J9F A;  3ZL7 C;  2RN8 A;  4DEX A;  1WYX A;  2GNC A;  2YUN A;  2EYX A;  2JS2 A;  2CUD A;  1K1Z A;  2A08 A;  1V1C A;  4LNP A;  4LUE A;  1VYV A;  2DJQ A;  1G2B A;  5FW9 A;  3H0I A;  1GCP A;  1I0C A;  2A28 A;  1UJY A;  1SHG A;  2DBK A;  2ROT A;  1GCQ A;  2BZX A;  2FRW A;  3PVQ A;  2X3X D;  2CSI A;  2DF6 A;  1QKX A;  1QKW A;  2ROL A;  2KRO A;  4ESR A;  3PE0 A;  1UDL A;  3KFV A;  3UA6 A;  4ORZ A;  1ZUU A;  2ABL A;  2LQW A;  5ECA A;  1TG0 A;  1Y57 A;  1UFF A;  5I11 A;  5EC7 A;  2CT4 A;  4CC3 A;  1U3O A;  2CSQ A;  2KYB A;  3VS2 A;  4JZ4 A;  2O2O A;  4E6R A;  2LX7 A;  2CH4 W;  2KR3 A;  1HSQ A;  2F2W A;  4A63 B;  4JJD A;  1K76 A;  2DVJ A;  4IIO A;  1UGV A;  1UHF A;  1K0S A;  1T0J A;  2GQI A;  3U23 A;  2YUP A;  2L3Q A;  5FWB A;  2OI3 A;  1E7O A;  1M27 C;  4Y92 A;  3NMZ C;  2KT8 A;  3EG1 A;  1BK2 A;  1JEG A;  2O31 A;  1NLO C;  4J9B A;  2NWM A;  1RLP C;  5FWC A;  1U5S A;  2DYB A;  2KRS A;  5IHK A;  2DL4 A;  1UEC A;  1PHT A;  2MIO A;  1PKS A;  2FPE A;  2RMO A;  1AEY A;  1SHF A;  1BB9 A;  1H92 A;  1TUD A;  1UHC A;  2KGT A;  2AKL A;  2B86 A;  2DA9 A;  2JMC A;  2RPN A;  1OOT A;  2CT3 A;  3EHQ A;  4HVU A;  2EYZ A;  2DLP A;  2CUB A;  2CH4 A;  1OV3 A;  1ZUK A;  1OPK A;  2GGR A;  4J9I A;  1NEB A;  2V1R A;  1Z9Q A;  3UAT A;  2EYW A;  1NM7 A;  4J9E A;  1FMK A;  2YUO A;  3H0F A;  1PKT A;  1ABO A;  1UE9 A;  2DL7 A;  2DRM A;  4IIM A;  3H41 A;  4GLM A;  4RUG A;  4X1V A;  5IH2 A;  3IQL A;  1X43 A;  1CKA A;  2D8J A;  1YWO A;  4LE9 A;  3M0P A;  1GL5 A;  2D8H A;  3QWX X;  3I5R A;  3H0H A;  2KRN A;  2AK5 A;  2FG0 A;  4RTX A;  1X6B A;  2JXB A;  4HXJ A;  3C0C A;  4AG2 C;  2DNU A;  4DEY A;  2H8H A;  4J9H A;  1W6X A;  2PNI A;  1NYF A;  4AFS C;  2ECZ A;  2C0I A;  1X69 A;  2F2X A;  4K11 A;  3RNJ A;  4OMQ A;  2DL3 A;  2X3W D;  2KNB B;  1AVZ C;  4J9D A;  1X6G A;  2FO0 A;  1Z9Z A;  5IXF A;  3NHN A;  4J9G A;  3UA7 A;  1JXO A;  1HD3 A;  1NYG A;  1FYN A;  2V1Q A;  1JQQ A;  1AOJ A;  1RI9 A;  1T3S A;  2EVR A;  4Z88 A;  1GFC A;  1GFD A;  1TUC A;  1QWE A;  3TSW A;  1QWF A;  4OMP A;  2KXD A;  2LZ6 B;  2JM8 A;  3I9Q A;  4RTV A;  2RQR A;  2LNH B;  3UF4 A;  2KE9 A;  2HBW A;  2L0A A;  2GBQ A;  1CSK A;  2KEA A;  4HVV A;  4GBQ A;  4R0K A;  1RLQ C;  2K79 A;  1GRI A;  2ED0 A;  2J6O A;  3EHR A;  5IHI A;  2KT1 A;  2PTK A;  2L3S A;  1Y0M A;  2J06 A;  3VS3 A;  1VYT A;  1SRM A;  1WLP B;  2LP5 A;  2OAW A;  1JO8 A;  1I07 A;  1MV0 B;  3VS1 A;  4LN2 A;  5I22 A;  1AWJ A;  4EIK A;  2J6K A;  4Z8A A;  1AZG B;  1M3B A;  1UUE A;  2A37 A;  2ENM A;  1JXM A;  4RTW A;  1WXU A;  2HCK A;  3NGP A;  1S1N A;  2LQN A;  1YWP A;  2C0T A;  3TVT A;  1X27 A;  2PZ1 A;  2P4R A;  2J05 A;  2ESW A;  2D1X A;  3EG2 A;  1ZLM A;  4M4Z A;  4CC4 B;  5HCK A;  3SHW A;  1K4U S;  1UG1 A;  1W70 A;  4LUD A;  4RTU A;  5IXB A;  4OMO A;  1KJW A;  2EKH A;  3VRY A;  1JU5 C;  4F14 A;  1U06 A;  3QWY A;  2DL8 A;  1SPK A;  2BZ8 A;  4OML A;  1A0N B;  2DIL A;  3LH5 A;  4JJC A;  1SSH A;  4J9C A;  2DMO A;  3TSZ A;  2QDL A;  3VS4 A;  1WIE A;  3REB B;  1YCS B;  1WDX A;  5L23 A;  1X2K A;  2GTO A;  2EW3 A;  1WXB A;  2CRE A;  2FPF A;  2M51 A;  2L2P A;  2EPD A;  2JM9 A;  1YNZ A;  1G83 A;  1M3C A;  2K2M A;  1YP5 A;  1GBQ A;  4KRT A;  2O9V A;  2M0Y A;  2DX1 A;  3VS7 A;  1HJD A;  2GTJ A;  2EQI A;  4FSS A;  1ZX6 A;  1CKB A;  2D0N A;  4RTT A;  2RNA A;  4OMN A;  2BZY A;  2FPD A;  4D8K A;  1ARK A;  1WFW A;  1AWO A;  2J6F A;  3VRZ A;  4RTY A;  5GJW B;  2AKK A;  2MOX A;  2ED1 A;  1M30 A;  2YUQ A;  2C0O A;  5GJV B;  4AFU C;  2XMF A;  2DBM A;  2EBP A;  4F17 A;  1BBZ A;  1E6H A;  1ABQ A;  1W1F A;  2VWF A;  2O88 A;  1NEG A;  1WXT A;  4HCK A;  4JZ3 A;  3GBQ A;  3REA B;  2EYY A;  3THK A;  2SEM A;  1ZBJ A;  3VS0 A;  3EG0 A;  1NLP C;  3PVL A;  3EG3 A;  2AZV A;  1PNJ A;  2JTE A;  2FRY A;  4HVW A;  1XOV A;  1PWT A;  1QLY A;  1M3A A;  4AFZ C;  1M8M A;  2VVK A;  1MV3 A;  1VA7 A;  1X2Q A;  2DRK A;  2JMA A;  2K7A A;  2IIM A;  4RTZ A;  3ULR B;  2YT6 A;  2E5K A;  2YDL A;  4D8D A;  1N5Z A;  3NPF A;  3M0U A;  1WI7 A;  2J7I A;  2L3P A;  4AFQ C;  2HEQ A;  2LJ3 A;  2RQT A;  1E6G A;  3I5S A;  2DM1 A;  2HSP A;  1H3H A;  1ZUY A;  2W0Z A;  3M0S A;  2K6D A;  2CDT A;  1AWW A;  2KXC A;  4CC7 A;  4OMM A;  1MUZ A;  2EGE A;  1KFZ A;  1I1J A;  3EGU A;  2LCS A;  1BU1 A;  3FJ5 A;  1T0H A;  2OJ2 A;  1WA7 A;  1KIK A;  2AZS A;  1LCK A;  2JT4 A;  2W10 A;  2JS0 A;  4JJB A;  1VYU A;  4WCI A;  1WX6 A;  2K3B A;  4AG1 C;  1B3Q A;  1RUW A;  2EGA A;  2MCN A;  3R6N A;  1KSW A;  3VS5 A;  1QCF A;  1H8K A;  2LJ1 A;  2RQV A;  2KBT A;  2HDA A;  1ZSG A;  2EGC A;  1PRL C;  3CQT A;  3I35 A;  1PRM C;  1AWX A;  2LJ0 A;  4Z89 A;  2RF0 A;  2JW4 A;  3VS6 A;  1K9A A;  3JV3 A;  3M0T A;  2A36 A;  2DL5 A;  2KRM A;  1J3T A;  1GBR A;  2F2V A;  2I0N A;  1EFN A;  4QT7 A;  1T3L A;  2BTT A;  5IHN A;  1UJ0 A;  1B07 A;  4CC2 A;  2FEI A;  2LMJ A;  3M0R A;  1IO6 A;  4F16 A;  3RBB B;  1SRL A;  1AD5 A;  2SRC A;  2G6F X;  1K0X A;  3M0Q A;  2DE0 X;  2RQW A;  1YN8 A;  1OPL A;  2RQU A;  1UTI A;  1AZE A; 
#chains in the Genus database with same CATH topology
 4M75 F;  5LJ5 j;  2KDS A;  3SEM A;  1NG2 A;  2KYM A;  4DBQ A;  1QP2 A;  1VQ9 T;  2ZPE B;  4ZNX A;  3FC3 A;  3O5Z A;  1SEM A;  1WYX A;  4MDW A;  3LW5 E;  4J7F A;  2RH2 A;  2XK0 A;  3CD6 T;  3MEA A;  1RAI B;  5FW9 A;  3QDR B;  1QMC A;  1GCP A;  1I0C A;  1WHK A;  1UJY A;  1VQP Q;  1QVG P;  3H9N A;  4M7A D;  1XJW B;  2BZX A;  3PVQ A;  1K8A R;  9ATC B;  6AT1 B;  2DF6 A;  1QKX A;  3S6W A;  1QKW A;  2ROL A;  4R55 A;  4NL2 A;  4PFO A;  3PE0 A;  4ESR A;  1OYX A;  4ORZ A;  4GY5 A;  3A8O B;  4OB1 B;  3I56 A;  1PG5 B;  4KUD K;  2HNI A;  1WHL A;  4D6W A;  5I11 A;  1BIA A;  5EC7 A;  4CC3 A;  1VQ6 Q;  1WQ7 A;  2L3R A;  2O2O A;  1OUL A;  1LVK A;  4J5Y A;  1MND A;  2K5F A;  2YLB A;  1U1T A;  4HCB A;  1UHF A;  1K0S A;  1H64 1;  2DTO A;  2HL5 C;  3HSB A;  4EMG A;  2E10 A;  1Y71 A;  3HFN A;  1M27 C;  1B34 A;  2H3J A;  2ZAE A;  2CP0 A;  1JEG A;  4A4H A;  1N9S A;  5CIU A;  4J9B A;  1RLP C;  1U5S A;  2DYB A;  1M8V A;  4PNO A;  3G4S A;  4ME7 A;  1UEC A;  1ZA1 B;  3GLX A;  3OS2 A;  1PKS A;  2R5M A;  2RMO A;  2XKO C;  4BI8 B;  1H92 A;  1UHC A;  2KGT A;  3GP8 A;  3HPW A;  2RPN A;  1PCX A;  1OOT A;  2QA4 T;  4C92 G;  2X35 A;  4KUI A;  3RIR A;  4XQ3 A;  2CH4 A;  2LNV A;  4J9I A;  1NEB A;  2V1R A;  2VB6 A;  1X75 C;  2PVO B;  1FMK A;  3H0F A;  3UDC A;  5LJ5 h;  2RHZ A;  1UE9 A;  2DL7 A;  2IVW A;  1BYM A;  3HHT B;  3JCM f;  3H41 A;  5IH2 A;  3EH2 A;  2E3I A;  5GMK l;  2P0P A;  1GL5 A;  2OAU A;  2D8H A;  1YI2 T;  4ZN1 A;  2EJ9 A;  4PJO E;  3PIP A;  1YJW T;  4OGC A;  2KMT A;  2CGH A;  2JXB A;  4KT0 E;  1Q86 R;  3JAM E;  2DPP B;  2DK3 A;  1G3T A;  2HZY A;  2DNU A;  4NS5 A;  1UGR B;  5DY9 A;  1I5O B;  4C92 D;  2C0I A;  1VQN Q;  1X69 A;  4PJO F;  1JB0 E;  3RNJ A;  2LDM A;  2YRC A;  5DLQ E;  1YJ9 T;  2DL3 A;  2X3W D;  3CCM A;  1YHQ T;  3F70 A;  1X6G A;  2FO0 A;  1Z9Z A;  4J9G A;  4DOW A;  2CP5 A;  1HD3 A;  3KUF A;  2V1Q A;  1B34 B;  4JS5 A;  1ZSZ A;  3E1S A;  1RI9 A;  3TU4 K;  2LRQ A;  4M77 E;  3GNG A;  4OMP A;  3X28 B;  5KH6 A;  3S3N A;  1K73 R;  3INZ A;  2VC8 A;  4PJN A;  2RQR A;  2LNH B;  4C0F A;  2WSF E;  2ZZD A;  2PVD B;  1MHN A;  1CSK A;  2GFU A;  2PUO B;  2DJZ A;  2JOY A;  4CI0 C;  1RAA B;  4ZGJ B;  4M77 F;  4ELY C;  4C0D B;  5LJ3 d;  3OS1 A;  2L3S A;  1I5L A;  2J06 A;  5HK3 A;  3LLR A;  3VS3 A;  4E7H A;  2EAY A;  4PJO G;  1WLP B;  2LP5 A;  2OAW A;  3L2Q A;  1I07 A;  1MV0 B;  4HCC A;  1RI0 A;  4LN2 A;  4BE0 A;  1VQ5 A;  4EIK A;  4XU0 A;  1VQ9 Q;  3FDR A;  4PJJ A;  1C1A A;  2FZK B;  2J6K A;  2X4J A;  1VQM A;  4HT9 A;  1UUE A;  2A37 A;  5GAO p;  4FYX B;  3C95 A;  4B9W A;  3ZFJ A;  1YWP A;  1OU9 A;  4OF1 A;  2PZ1 A;  3CD6 Q;  4N4H A;  2D1X A;  3EGD A;  3EG2 A;  1ZLM A;  4M4Z A;  3PMI A;  3SHW A;  1K4U S;  3VU3 C;  3J80 E;  3JCM Q;  1W70 A;  2X51 A;  4MZT A;  1JJ2 P;  2YRV A;  1YJ9 A;  2OTJ A;  2EKH A;  3CPW P;  2RJE A;  5C0M A;  1YHQ A;  1OU8 A;  2Y90 A;  1M1F A;  4NOY A;  1VIE A;  4OML A;  4IKF A;  4M77 G;  1XQH A;  2X4X A;  2JN0 A;  1OX9 A;  2R5A A;  1MGQ A;  3LH5 A;  4JJC A;  2AHJ B;  1RAE B;  1R77 A;  3FB9 A;  3HFO A;  3OYL A;  1WDX A;  4M75 A;  4QQD A;  5L23 A;  1PSF A;  1VOM A;  4XTY A;  2CRE A;  2DKG A;  4Z02 A;  3G6E A;  3JRZ A;  1BI0 A;  2JM9 A;  4L6V 5;  3E9G A;  4JLI A;  1GBQ A;  1MMN A;  1Q86 C;  3OY9 A;  1IGU A;  1M1K U;  2QDY B;  2V8J A;  2KAF A;  5FU6 C;  3VUB A;  1CKB A;  4RTT A;  2RJD A;  5J39 A;  4E2F B;  1GXI E;  1WFW A;  1AWO A;  4RTY A;  3CC4 A;  2ED1 A;  3JB9 I;  3P8H A;  3EAE A;  5LJ3 e;  4JDS A;  2QA4 Q;  2RJC A;  4RCC A;  2XMF A;  5IT9 E;  4F17 A;  1W1F A;  4A54 A;  1ZBX A;  3GBQ A;  3HRT A;  1SG5 A;  3C94 A;  1VIF A;  2LCL A;  4QQ6 A;  1PWT A;  1C0M A;  2XI9 A;  3QII A;  1R0C B;  3EGD B;  4RTZ A;  1IB8 A;  1VA7 A;  2DRK A;  2IIM A;  2K7A A;  2YT6 A;  2E5K A;  4D8D A;  3TCJ A;  1VQ4 T;  4FW1 A;  1WJR A;  3RMS A;  4KGV B;  2RI3 A;  1YJW Q;  1KC8 C;  4JJN K;  1KQS A;  3QUI A;  2EQU A;  5GMK e;  2E6N A;  2M16 A;  2HEQ A;  3LGF A;  3MHX A;  3T9N A;  3I55 T;  2LJ3 A;  1E6G A;  5HKC A;  2E65 A;  1W2B A;  2DM1 A;  1H3H A;  4M7D A;  3MCA B;  2KXC A;  2MMP A;  4UC4 A;  4CC7 A;  1VQL T;  4M75 B;  1MUZ A;  4OMM A;  3HTR A;  2EGE A;  1KFZ A;  3EGU A;  2LCS A;  4J83 A;  1YJ9 Q;  2HKN A;  2ZPH B;  1YHQ Q;  3LH0 A;  2LT4 A;  3D7S B;  5CAI A;  3OBY A;  1N8R U;  4WCI A;  4JRP A;  1NJI C;  4J7I A;  4C0G A;  3FRN A;  3E2U A;  2QQ9 A;  2LJ1 A;  1VQP T;  1PRL C;  1AWX A;  2RI5 A;  2RF0 A;  3L2V A;  3JV3 A;  2GCX A;  5LJ5 g;  2EFI A;  2HQX A;  3A8H B;  5LJ3 f;  3SDZ A;  4Y28 E;  4Y91 A;  4C8Q C;  5GAM h;  3VKI A;  2F2V A;  3HKS A;  4EDU A;  1TOV A;  1FWZ A;  1T3L A;  5IHN A;  5FRM A;  1UJ0 A;  1B07 A;  2FEI A;  3M0R A;  3VUZ A;  5KE2 A;  4M78 C;  1SRL A;  5GAN j;  3OYI A;  3M0Q A;  4XTV A;  2DE0 X;  4N0A C;  1LPL A;  2M1H A;  4O5V A;  4OMF B;  1UTI A;  2LCC A;  4LDW A;  1B7T A;  4OGE A;  4LDU A;  3JCM c;  1VQK T;  2NUZ A;  1Y7X A;  2K9G A;  3JCM P;  2YSQ A;  1GCQ C;  4A53 A;  3QYH B;  3OB9 A;  2YUN A;  2FZG B;  1W2B S;  3LX7 A;  2ZPF B;  2XID A;  2X9H A;  5CKD A;  4MMK A;  4C0Z A;  4E7K A;  1K1Z A;  2A08 A;  4M7D B;  2WAC A;  1BI2 A;  4JRQ A;  1V1C A;  2VXE A;  4LNP A;  3CCL T;  3WXM B;  3CME A;  2MAM A;  1BCM A;  2RHX A;  4ZTF A;  3H0I A;  2A28 A;  2DBK A;  2ROT A;  7AT1 B;  2OTL T;  2FRW A;  1M90 C;  2X3X D;  2AT1 B;  2FZC B;  4A4E A;  2KRO A;  1LJO A;  1UDL A;  1FX7 A;  3H8Z A;  2QXF A;  5C6S A;  5ECA A;  1TG0 A;  1Y57 A;  1Q81 C;  1RAF B;  3GIB A;  2CSQ A;  3AHU A;  4BY6 B;  1O75 A;  2LX7 A;  3GOX A;  3OYA A;  3JCM d;  1HSQ A;  5KYU A;  4VUB A;  1D3B A;  2DVJ A;  1UGV A;  2OX7 A;  5KE3 A;  3JB9 G;  4KBM B;  3M59 A;  2HQE A;  3G1J A;  3NMZ C;  2KT8 A;  2O31 A;  3PIO A;  2PVG B;  4PJL A;  4DBF A;  1YCY A;  3L2Z A;  4PJO B;  2KRS A;  5IHK A;  2DL4 A;  1PHT A;  5GMK i;  5CR2 A;  3I56 T;  3E9F A;  1TUD A;  3QG1 A;  2A3L A;  4HA8 A;  5KYN A;  2JMC A;  2QQB A;  5D7U A;  1Q7Y C;  2L8D A;  2DLP A;  3WVD B;  4AMC A;  1OPK A;  2GGR A;  3X26 B;  2QTV A;  1Z9Q A;  2KY9 A;  1NBE B;  2JTF A;  1R0B G;  5I2M A;  4BD3 A;  4GLK A;  3MET A;  4M75 E;  1TWB A;  1U1S A;  3BY7 A;  2RK1 A;  3V7S A;  3GF5 A;  2DFU A;  3CCL A;  3JB9 D;  3G71 T;  2P84 A;  3DB3 A;  2DRM A;  1VQ4 Q;  4V2S A;  4X1V A;  2HQH A;  3JCM h;  1X43 A;  1CKA A;  4PFP A;  1YJN T;  2D8J A;  3M0P A;  4M77 B;  2DEQ A;  3G4S T;  3QWX X;  3RER A;  1OX8 A;  3O8V A;  2KRN A;  1YBY A;  3OYY A;  4RTX A;  1Q82 U;  1KD1 C;  5IN1 A;  2FVU A;  4HXJ A;  4C8Q E;  4DEY A;  1VQL Q;  2MI6 A;  2RHI A;  2ECZ A;  3P8B B;  3SWN A;  4EMK C;  1M2V B;  2IPO B;  3QJY A;  3HP9 A;  2MPX C;  1D1B A;  2NUT B;  4M78 E;  4PK4 A;  1D3B B;  4J9D A;  1I4K 1;  4C8Q F;  4BI4 A;  1JXO A;  3JCM e;  1JQQ A;  2F5T X;  5CKE A;  4IUQ A;  5FLX E;  2EVR A;  4F7U F;  3V8K A;  1TUC A;  4L59 A;  4M78 F;  2KXD A;  2LZ6 B;  2JM8 A;  2P4T A;  4PJM A;  3X25 B;  1OZ3 A;  3I9Q A;  4BI3 A;  3EGX A;  2L0A A;  2Y4X A;  3ASK A;  5GAO l;  1EX4 A;  3CCQ A;  2VXF A;  1N9R A;  2K79 A;  4M75 G;  1ZA2 B;  3L2W A;  2ED0 A;  3EG9 A;  4DBH A;  2JZ2 A;  4R56 A;  3EHR A;  2KT1 A;  3CCM T;  3Q1J A;  4OP0 A;  4M7D E;  1VQ8 T;  1VYT A;  3G71 A;  4RG2 A;  4C5H A;  1M5Q 1;  1O9S A;  1VQK Q;  1KHI A;  5GAN 7;  1YJN A;  5I22 A;  2RB6 A;  3OYK A;  4X9C A;  2BE7 D;  2QTX A;  1IRX A;  1KQ1 A;  4M7D F;  2ENM A;  4MZM A;  1G3S A;  1KQS P;  3OYC A;  3JCM J;  2O01 E;  2LQN A;  2CZ7 B;  2C0T A;  3TVT A;  1X27 A;  1YIT A;  1IZ6 A;  4IUU A;  3CCL Q;  1W2B P;  2QK0 A;  2E12 A;  5HCK A;  1PD0 A;  1X6O A;  2MK5 A;  2OTL Q;  4M75 D;  3SWN B;  3JB9 J;  2E3H A;  2EKO A;  4XAX B;  4MML A;  4JRI A;  1K8A U;  4F14 A;  4XTW A;  1SPK A;  4ZGD B;  2BZ8 A;  2CZ6 B;  5FU7 C;  1A0N B;  2QGG A;  5CVI A;  2G3R A;  3VS4 A;  2DMO A;  5A2Q E;  1VQ5 T;  3REB B;  1VQ7 A;  3DLL A;  3RKX A;  1VQM T;  4JRK A;  2B8A A;  2M9U A;  1EZZ B;  4DQ2 A;  3EGX B;  1G83 A;  1Y07 A;  1M3C A;  2K2V A;  4KRT A;  2E41 A;  1SKU B;  5D6X A;  3FIF A;  3M55 A;  2M0Y A;  4MDX A;  2DX1 A;  5LJ3 j;  2GTJ A;  4M7D G;  4FSS A;  3CCU A;  2D0N A;  1M1G A;  3VV0 A;  2OTJ T;  4OVA A;  3EG9 B;  3ZEH A;  4D8K A;  1VQ8 A;  3OYF A;  3LWH A;  1D0X A;  3VRZ A;  3A8G B;  5GJW B;  2YWW A;  3I56 Q;  3CBP A;  1TS9 A;  5AYF A;  5CKB A;  5GAN 4;  4BDZ A;  5GJV B;  2E5Q A;  2DD5 A;  1MMD A;  2DBM A;  2EBP A;  3R6O A;  1V76 A;  3MP1 A;  2VWF A;  3G6E T;  4HCK A;  4JZ3 A;  1RAC B;  3OYD A;  2EYY A;  1ZBJ A;  3JCM X;  5GMK j;  3EG3 A;  3G71 Q;  2JTE A;  2FRY A;  1XOV A;  3MJX A;  1M3A A;  4AFZ C;  1KC8 R;  2VVK A;  1KHC A;  4M7D D;  2CS7 A;  3OYM A;  4JLG A;  1YJN Q;  2JUF A;  1YIJ A;  3G4S Q;  4BUG A;  1UEB A;  2L3P A;  2RD1 A;  3CC4 T;  5FRO A;  3DLM A;  4E7S A;  2QEX A;  1ZUY A;  4XTZ A;  2W0Z A;  3M0S A;  1ZQ1 A;  2K6D A;  1QW1 A;  2D9T A;  2CKK A;  1I1J A;  1BU1 A;  1NJI R;  2QQA A;  2JVV A;  1D0Z A;  2COZ A;  1KIK A;  2W10 A;  2GFA A;  4BB7 A;  1F1B B;  3CC7 A;  1RUW A;  2MCN A;  1KSW A;  3VS5 A;  5GAN g;  4EPC A;  2DIG A;  2KBT A;  3MO8 A;  3NTI A;  2HDA A;  2EGC A;  2LQ8 A;  3CQT A;  2CZ1 B;  3I35 A;  2AIR B;  2LJ0 A;  4Z89 A;  3VS6 A;  2K3Y A;  3BDU A;  2DL5 A;  4E47 A;  1K73 U;  5I2S A;  4PJO D;  3OMG A;  1ZSZ B;  5LJ3 h;  3CC2 T;  3CCV A;  1WHJ A;  5FU6 B;  4BDY A;  1GBR A;  5GAO r;  2I0N A;  1EFN A;  4IUP A;  5LJ5 f;  2BTT A;  4KH0 B;  3CCM Q;  4LD6 A;  4CC2 A;  1AT1 B;  3QSU A;  1QCN A;  1VQ8 Q;  4PL6 A;  2NLU A;  1Y96 A;  4EMH A;  2SRC A;  5GAM j;  2RQW A;  3OS5 A;  2EQJ A;  1M4Z A;  2RK2 A;  2VGN A;  1HXD A;  1NE8 A;  3TQ7 P;  4C8Q A;  4XU1 A;  2VKN A;  2GF7 A;  2COY A;  4JPB W;  3A98 A;  3OYN A;  2O9S A;  4F7U A;  4J9F A;  3NTH A;  2RN8 A;  3ZL7 C;  4M77 D;  5GMK h;  2GNC A;  4M78 A;  4QKU A;  2EYX A;  2HL3 A;  2JS2 A;  4ELZ C;  4N0A A;  3GNF B;  2CP6 A;  1N8R R;  3V8J A;  1M90 R;  2FL7 A;  1YIJ Q;  4M7A C;  5CCA A;  5KYW A;  1SHG A;  1GCQ A;  2CSI A;  1AHJ B;  4Q5W A;  3CMA A;  3MP6 A;  3OYH A;  1Q81 R;  3KFV A;  3UA6 A;  1ZUU A;  1TSF A;  1VQ5 Q;  1WHG A;  1IRE B;  1VQM Q;  2V8I A;  2PUK B;  3DKM A;  4FSX A;  1U3O A;  2KYB A;  3VS2 A;  2VUB A;  1I8F A;  2X4W A;  4E6R A;  2CH4 W;  5D6W A;  3M9Q A;  2F2W A;  4A4F A;  2DO3 A;  4A63 B;  1LOJ A;  4KGX B;  4IIO A;  3CC2 A;  5HY6 A;  3JSC A;  2GQI A;  2YUP A;  3A1P A;  3CME T;  1OQK A;  2CP3 A;  2OI3 A;  1E7O A;  2OTJ Q;  4PKC C;  8AT1 B;  3JCM W;  1QP3 A;  1M1K C;  3QDF A;  2YHT A;  2DEU A;  1NLO C;  4IUR A;  4QVD A;  2NWM A;  5FWC A;  5CQX A;  2QGF B;  4LDV A;  2V26 A;  3OSV A;  1N6A A;  1SHF A;  1Q7Y R;  3OYG A;  4C8Q B;  3CCV Q;  1FMV A;  1WJS A;  3MKD A;  3ZBD A;  3G6E Q;  4QVZ A;  1K9M U;  2CT3 A;  3V7R A;  4HVU A;  2EYZ A;  2RM4 A;  4F7U B;  2CUB A;  1OV3 A;  1ZUK A;  4M78 B;  3CCR T;  3UAT A;  2BUD A;  1NM7 A;  4J9E A;  2EJG A;  1ABO A;  2K5I A;  3LYI A;  2C06 A;  2CZ0 B;  1VQO A;  3CCJ T;  1KD1 R;  4FT4 A;  3MEV A;  3PFS A;  5KYW B;  3CC4 Q;  1ZHI A;  3I5R A;  2AK5 A;  2EYQ A;  4MZP A;  1EIF A;  1TU0 B;  2QAZ A;  4AG2 C;  3CCS T;  4C92 C;  3V8L A;  3L42 A;  2ATC B;  3OYB A;  4AFS C;  4J6W A;  1BCO A;  4J8O A;  2BE9 B;  2F5K A;  4K11 A;  2LX9 A;  4BAC A;  2KNB B;  5A0D A;  5IXF A;  2DXU A;  3UA7 A;  1TTH B;  1QVF A;  1NYG A;  1FYN A;  1AOJ A;  1N8R C;  3GPL A;  4Z88 A;  1GFC A;  2NUP A;  1GFD A;  3TSW A;  4E7I A;  4ZTJ A;  1QWF A;  4EMK A;  3G7Z A;  1H3Z A;  2RHU A;  3CC2 Q;  1WPY A;  1DJ7 B;  3UF4 A;  3PNW C;  2Y4Y A;  2GBQ A;  3CCE T;  4P5N A;  4GBQ A;  1OZ2 A;  3QZ5 B;  3RR6 A;  3CCR A;  5IHI A;  1Y0M A;  5GAN d;  4J6X A;  4FU6 A;  2O4X A;  3NFC A;  1BKB A;  3CCJ A;  3RUX A;  1M9S A;  1AWJ A;  4M7A F;  3ER0 A;  3OSS C;  3M57 A;  4E7J A;  4Z8A A;  4KUL A;  1JXM A;  4RTW A;  1VQ6 A;  1WXU A;  3MEW A;  1U8R A;  3CPW A;  3AT1 B;  4FM4 B;  1I81 A;  3J81 E;  4LD9 K;  3NGP A;  2E1H A;  1HYO A;  3CCS A;  2P4R A;  2J05 A;  3CCQ T;  1UG1 A;  1RAB B;  2EJF A;  5A0G A;  3M58 A;  1VQO Q;  3LWI A;  4RTU A;  5IXB A;  4OMO A;  3TEE A;  5LJ3 g;  4JUV A;  5GAN 6;  1JU5 C;  1XNI A;  2DL8 A;  1YFN A;  3QWY A;  1QVF S;  4WF2 A;  2DXT A;  4PJO C;  3CEY A;  2K5L A;  2EWN A;  3CPF A;  3TSZ A;  4KGZ B;  5DLO A;  2FHD A;  1YCS B;  5M9O A;  2NUP B;  2EW3 A;  1WXB A;  5GAN 2;  1G3Y A;  1JBM A;  4EMK B;  5CQY A;  1JRI A;  1FXX A;  2E6Z A;  2HSE B;  1NZ9 A;  1YIT T;  3QBY A;  2DTH A;  3CCE A;  2O9V A;  4WTO B;  3CME Q;  3VS7 A;  3EH1 A;  1ZX6 A;  4N4I A;  4F7U E;  2KI7 A;  1SF9 A;  2XHC A;  2RNA A;  4OMN A;  5KYU B;  2BZY A;  3M4Y A;  1ARK A;  2ZGW A;  1UB4 A;  2J6F A;  3EFO A;  2KSS A;  2R57 A;  1HK9 A;  2AKK A;  4M77 C;  1WNL A;  2MOX A;  3DB4 A;  1C6V X;  2O4X B;  2MYS A;  2C0O A;  5GAN e;  2DZC A;  1VQ7 T;  4AFU C;  4C92 E;  1BBZ A;  4BE1 A;  1JJ2 S;  2O88 A;  1WXT A;  3CXC A;  3CPW S;  5EG2 A;  5CKF A;  2QYZ A;  3KBG A;  3REA B;  3CCR Q;  2SEM A;  1SSF A;  1VQN A;  3HL8 A;  2AZV A;  1PNJ A;  3QZ9 B;  3QJ6 A;  5GAN 3;  3CCU T;  1M8M A;  4C92 F;  1VUB A;  1X2Q A;  2JMA A;  3CCJ Q;  4C5E A;  3WVE B;  3SD4 A;  2YDL A;  3CBM A;  1P92 A;  2DXB A;  1N5Z A;  2J7I A;  2LC4 A;  1RAH B;  5AT1 B;  5LJ5 d;  4NL3 A;  1N27 A;  2RQT A;  1XTD A;  3CCS Q;  2RI2 A;  4XU2 A;  2EIF A;  4RCB A;  4LDX A;  1Q82 C;  4C8Q G;  2CDT A;  2MWO A;  1D1C A;  1D1A A;  1IHW A;  5GAO m;  3FJ5 A;  2KK4 A;  4F7U G;  4B9X A;  3L2R A;  2OJ2 A;  5KCH A;  4M78 G;  4HT8 A;  2NYS A;  4JJB A;  5FU7 B;  4XTU A;  4XK8 E;  2HKQ B;  4AG1 C;  1B3Q A;  2EGA A;  1YIJ T;  2RQV A;  5GAM g;  4C5I A;  1PRM C;  2JW4 A;  1K9A A;  1VQ9 A;  3C12 A;  3EFO B;  3M0T A;  2A36 A;  1KK7 A;  1G5V A;  1TXQ A;  5GAN f;  2QEX T;  3CCE Q;  2YXY A;  3JCM V;  1QCO A;  3UT1 A;  4C8Q D;  3CXC S;  4QT7 A;  2XDD A;  3CD6 A;  2MF2 A;  4F16 A;  3SWN C;  1WJQ A;  1AD5 A;  2DVE A;  2G6F X;  4M78 D;  1RL2 A;  2DZ9 A;  4PFZ A;  1YN8 A;  1OPL A;  3CC7 T;  4DBR A;  2QI2 A;  5KCO A;  3OYE A;  3TRE A;  2QG9 B;  5CKH A;  5GMK m;  2K3X A;  1OEB A;  3VYH B;  1PSE A;  4E7Z A;  5DM7 R;  4DEX A;  4LDY A;  5HK0 A;  2F69 A;  2F1L A;  1NPR A;  2CUD A;  1S72 T;  5GAN 8;  3CCV T;  3CCQ Q;  3M5A A;  3A8M B;  5LJ5 e;  4LUE A;  1VYV A;  3X24 B;  2DJQ A;  1G2B A;  2M02 A;  1X01 A;  3S3O A;  2DD4 A;  1W4S A;  4O6J A;  1ACM B;  4FYW B;  3HRU A;  2ABL A;  2LQW A;  1K8A C;  2V8K A;  1QQJ A;  2JJ9 A;  4ZN3 A;  1UFF A;  2X4Y A;  4L5G A;  1QVF P;  2CT4 A;  1QVP A;  1WHM A;  3UPU A;  1M2O A;  4JZ4 A;  2QA4 A;  4M7A A;  1Q86 U;  2QQR A;  2K4Y A;  2KR3 A;  1YIT Q;  1NPP A;  2CP2 A;  1OI1 A;  3M53 A;  4JJD A;  2JTM A;  1K76 A;  4X9D A;  2WSE E;  1T0J A;  1M1K R;  2E4H A;  3U23 A;  2L3Q A;  3M4G A;  3BW1 A;  5FWB A;  2RHY A;  5KYY A;  4Y92 A;  4RMO A;  2MWP A;  2DYI A;  3EG1 A;  1BK2 A;  4FW2 A;  2KVQ G;  2L89 A;  4C0D C;  4FYV B;  5I21 A;  3CMA T;  3PGG A;  1YI2 A;  1YJW A;  2MIO A;  2FPE A;  5GAO n;  2E70 A;  1VQ7 Q;  1AEY A;  2ZPB B;  1BB9 A;  2JNG A;  2AKL A;  2B86 A;  2DA9 A;  4QW2 A;  3OW2 A;  2XG8 D;  3CBO A;  1MMA A;  3EHQ A;  3MP8 A;  2COW A;  3M54 A;  3JCM g;  1BI1 A;  2PQW A;  1S72 A;  2EQM A;  2EYW A;  1KG1 A;  3CCU Q;  2YUO A;  1PKT A;  1KC8 U;  5IAY A;  4IIM A;  1UGS B;  5CO7 A;  4GLM A;  4RUG A;  3IQL A;  2FB7 A;  1YWO A;  4OB3 B;  1UGP B;  4LE9 A;  1LNX A;  2E64 A;  4X34 A;  3NTK A;  3H0H A;  2D0Q B;  2FG0 A;  1X6B A;  2DIQ A;  3C0C A;  1G8X A;  3VJP A;  1PD1 A;  2H8H A;  3H6Z A;  1W6X A;  4J9H A;  5GAN 5;  2PNI A;  1NYF A;  2XDP A;  1ZSZ C;  2M0O A;  2RJF A;  1PM3 A;  2PU9 B;  1QVG A;  4M7A B;  3KXT A;  2F2X A;  3P8D A;  1TH7 A;  2ZPI B;  4OB2 B;  4OMQ A;  1NJI U;  1AVZ C;  2YRD A;  3NHN A;  2DER A;  5KYY B;  2CYZ B;  1VQO T;  4C92 A;  1T3S A;  1WQW A;  1QWE A;  5D6Y A;  2GQV A;  1K9M R;  2XD0 A;  3FEO A;  2QEX Q;  4RTV A;  3N5B B;  3OW2 S;  2KE9 A;  4ANJ A;  2A7Y A;  4CRI A;  2HBW A;  2KEA A;  5LL6 S;  1K73 C;  4HVV A;  2LQK A;  4R0K A;  1RLQ C;  1GRI A;  4PLI A;  2VYT A;  2J6O A;  3FLG A;  2LTO A;  2PTK A;  3SFM A;  3OS0 A;  3CXC P;  5GAM d;  3URG A;  1YI2 Q;  3CC7 Q;  1SRM A;  4HKE A;  3QXE B;  4FIB A;  1JO8 A;  3VS1 A;  1V29 B;  3BDL A;  1TUG B;  3OA6 A;  1Y96 B;  3E19 A;  1AZG B;  1IHV A;  1M3B A;  3JB9 H;  2VV5 A;  4FL6 A;  1WHH A;  2RA2 A;  2HCK A;  1S72 Q;  2ZPG B;  1S1N A;  3HRS A;  4QVC A;  4XTX A;  1D0Y A;  4BE2 A;  3OQ5 A;  2ESW A;  1QVG S;  1FMW A;  4CC4 B;  2HAX A;  3BFM A;  4M75 C;  1M90 U;  4TVR A;  2HBP A;  3BE3 A;  4IUV A;  4LUD A;  3VYG A;  1KJW A;  1BIB A;  3SB2 A;  3VRY A;  1U06 A;  2D6F A;  2HMA A;  2XIC A;  1Q81 U;  3EFR A;  1BI3 A;  2DIL A;  1SSH A;  3QYG B;  4J9C A;  2QDL A;  1WIE A;  4DOV A;  2L5Q A;  4XU3 A;  4C92 B;  1IGQ A;  2KQW A;  4FYY B;  1X2K A;  2GTO A;  2YLC A;  2FPF A;  2M51 A;  2DET A;  3OYJ A;  1VQ6 T;  1Q95 G;  2L2P A;  2EPD A;  4PLL A;  3RMQ A;  3A5Z B;  2XDB A;  1YNZ A;  4LXC A;  5KYX A;  2RO0 A;  1YP5 A;  2K2M A;  5FRN A;  1UGQ B;  4PJO A;  1HJD A;  4RG8 A;  4J6Y A;  2EQI A;  1MNE A;  3MEU A;  4C5G A;  3V7C A;  3MPU B;  4IUT A;  4QQG A;  2FPD A;  2P0K A;  3CMA Q;  1VQ4 A;  3PT9 A;  3UWN A;  1KQS S;  3EFS A;  4ATO A;  2BIV A;  2IG0 A;  4YTL A;  3JB9 F;  3QKJ A;  2YUQ A;  1M30 A;  1MMG A;  3I55 A;  3L1A A;  1WZO A;  5GAM e;  1Q7Y U;  2EQK A;  1RAG B;  1E6H A;  2FYK A;  1ABQ A;  4A4G A;  1VQL A;  2VGM A;  1NEG A;  3L2U A;  4FCY A;  4DA4 A;  1PC0 A;  4KH1 B;  3THK A;  1K9M C;  4E7L A;  2DXC A;  3VS0 A;  3EG0 A;  1NLP C;  3PVL A;  3J7A F;  3RDV A;  4M77 A;  2ZCF B;  4HVW A;  1QLY A;  1G3W A;  1R8O B;  4M7D C;  4RKU E;  2Z0W A;  4M7A E;  1MV3 A;  3ULR B;  4JS4 A;  3RKY A;  3NPF A;  3M0U A;  1KD1 U;  1RAD B;  1WI7 A;  1VQP A;  2P0Q A;  4A4K A;  5J3B A;  3C4S A;  2BKD N;  1Q82 R;  4AFQ C;  4F04 B;  3S3M A;  3PTA A;  1M2V A;  4ZGE B;  3I5S A;  4OB0 B;  2QAS A;  2HSP A;  2NUT A;  3FJP A;  3QPH A;  1AWW A;  4N4G A;  1JJ2 A;  4BY6 C;  3JCM b;  2XU8 A;  3ME9 A;  3A8L B;  5L8R E;  1VQN T;  1T0H A;  1WA7 A;  5KYX B;  2DTI A;  2AZS A;  3RKW A;  3LGL A;  2I2L A;  3RES A;  1LCK A;  2CP7 A;  2JT4 A;  2JS0 A;  1VYU A;  4B6M A;  1WX6 A;  2K3B A;  1D09 B;  3OBW A;  2R58 A;  4HCZ A;  1IXD A;  3R6N A;  2DAQ A;  1QCF A;  1H8K A;  1ZSG A;  1VQK A;  2H3E B;  2K57 A;  2LVM A;  2A0F B;  5CK9 A;  3OMC A;  3QO3 A;  4FT2 A;  4II1 A;  2WSC E;  4AT1 B;  2KRM A;  1J3T A;  5GAM f;  5GAN h;  2HD0 A;  1KQ2 A;  3OW2 P;  5GAO q;  1WGS A;  2LMJ A;  5A0L A;  4M7A G;  3M56 A;  1IO6 A;  5J26 A;  2QQS A;  3RBB B;  2OTL A;  3X20 B;  3PMT A;  3QHS A;  1K0X A;  2VAS A;  3I55 Q;  8ATC B;  2LT1 A;  2RQU A;  1AZE A; 
#chains in the Genus database with same CATH homology
 2VKN A;  3SEM A;  4JPB W;  2NUZ A;  1NG2 A;  2KYM A;  2K9G A;  1OEB A;  3A98 A;  2YSQ A;  4ZNX A;  1GCQ C;  2O9S A;  3O5Z A;  1SEM A;  4J9F A;  3ZL7 C;  2RN8 A;  4DEX A;  1WYX A;  2GNC A;  2YUN A;  2EYX A;  2JS2 A;  2CUD A;  1K1Z A;  2A08 A;  1V1C A;  4LNP A;  4LUE A;  1VYV A;  2DJQ A;  1G2B A;  5FW9 A;  3H0I A;  1GCP A;  1I0C A;  2A28 A;  1UJY A;  1SHG A;  2DBK A;  2ROT A;  1GCQ A;  2BZX A;  2FRW A;  3PVQ A;  2X3X D;  2CSI A;  2DF6 A;  1QKX A;  1QKW A;  2ROL A;  2KRO A;  4ESR A;  3PE0 A;  1UDL A;  3KFV A;  3UA6 A;  4ORZ A;  1ZUU A;  2ABL A;  2LQW A;  5ECA A;  1TG0 A;  1Y57 A;  1UFF A;  5I11 A;  5EC7 A;  2CT4 A;  4CC3 A;  1U3O A;  2CSQ A;  2KYB A;  3VS2 A;  4JZ4 A;  2O2O A;  4E6R A;  2LX7 A;  2CH4 W;  2KR3 A;  1HSQ A;  2F2W A;  4A63 B;  4JJD A;  1K76 A;  2DVJ A;  4IIO A;  1UGV A;  1UHF A;  1K0S A;  1T0J A;  2GQI A;  3U23 A;  2YUP A;  2L3Q A;  5FWB A;  2OI3 A;  1E7O A;  1M27 C;  4Y92 A;  3NMZ C;  2KT8 A;  3EG1 A;  1BK2 A;  1JEG A;  2O31 A;  1NLO C;  4J9B A;  2NWM A;  1RLP C;  5FWC A;  1U5S A;  2DYB A;  2KRS A;  5IHK A;  2DL4 A;  1UEC A;  1PHT A;  2MIO A;  1PKS A;  2FPE A;  2RMO A;  1AEY A;  1SHF A;  1BB9 A;  1H92 A;  1TUD A;  1UHC A;  2KGT A;  2AKL A;  2B86 A;  2DA9 A;  2JMC A;  2RPN A;  1OOT A;  2CT3 A;  3EHQ A;  4HVU A;  2EYZ A;  2DLP A;  2CUB A;  2CH4 A;  1OV3 A;  1ZUK A;  1OPK A;  2GGR A;  4J9I A;  1NEB A;  2V1R A;  1Z9Q A;  3UAT A;  2EYW A;  1NM7 A;  4J9E A;  1FMK A;  2YUO A;  3H0F A;  1PKT A;  1ABO A;  1UE9 A;  2DL7 A;  2DRM A;  4IIM A;  3H41 A;  4GLM A;  4RUG A;  4X1V A;  5IH2 A;  3IQL A;  1X43 A;  1CKA A;  2D8J A;  1YWO A;  4LE9 A;  3M0P A;  1GL5 A;  2D8H A;  3QWX X;  3I5R A;  3H0H A;  2KRN A;  2AK5 A;  2FG0 A;  4RTX A;  1X6B A;  2JXB A;  4HXJ A;  3C0C A;  4AG2 C;  2DNU A;  4DEY A;  2H8H A;  4J9H A;  1W6X A;  2PNI A;  1NYF A;  4AFS C;  2ECZ A;  2C0I A;  1X69 A;  2F2X A;  4K11 A;  3RNJ A;  4OMQ A;  2DL3 A;  2X3W D;  2KNB B;  1AVZ C;  4J9D A;  1X6G A;  2FO0 A;  1Z9Z A;  5IXF A;  3NHN A;  4J9G A;  3UA7 A;  1JXO A;  1HD3 A;  1NYG A;  1FYN A;  2V1Q A;  1JQQ A;  1AOJ A;  1RI9 A;  1T3S A;  2EVR A;  4Z88 A;  1GFC A;  1GFD A;  1TUC A;  1QWE A;  3TSW A;  1QWF A;  4OMP A;  2KXD A;  2LZ6 B;  2JM8 A;  3I9Q A;  4RTV A;  2RQR A;  2LNH B;  3UF4 A;  2KE9 A;  2HBW A;  2L0A A;  2GBQ A;  1CSK A;  2KEA A;  4HVV A;  4GBQ A;  4R0K A;  1RLQ C;  2K79 A;  1GRI A;  2ED0 A;  2J6O A;  3EHR A;  5IHI A;  2KT1 A;  2PTK A;  2L3S A;  1Y0M A;  2J06 A;  3VS3 A;  1VYT A;  1SRM A;  1WLP B;  2LP5 A;  2OAW A;  1JO8 A;  1I07 A;  1MV0 B;  3VS1 A;  4LN2 A;  5I22 A;  1AWJ A;  4EIK A;  2J6K A;  4Z8A A;  1AZG B;  1M3B A;  1UUE A;  2A37 A;  2ENM A;  1JXM A;  4RTW A;  1WXU A;  2HCK A;  3NGP A;  1S1N A;  2LQN A;  1YWP A;  2C0T A;  3TVT A;  1X27 A;  2PZ1 A;  2P4R A;  2J05 A;  2ESW A;  2D1X A;  3EG2 A;  1ZLM A;  4M4Z A;  4CC4 B;  5HCK A;  3SHW A;  1K4U S;  1UG1 A;  1W70 A;  4LUD A;  4RTU A;  5IXB A;  4OMO A;  1KJW A;  2EKH A;  3VRY A;  1JU5 C;  4F14 A;  1U06 A;  3QWY A;  2DL8 A;  1SPK A;  2BZ8 A;  4OML A;  1A0N B;  2DIL A;  3LH5 A;  4JJC A;  1SSH A;  4J9C A;  2DMO A;  3TSZ A;  2QDL A;  3VS4 A;  1WIE A;  3REB B;  1YCS B;  1WDX A;  5L23 A;  1X2K A;  2GTO A;  2EW3 A;  1WXB A;  2CRE A;  2FPF A;  2M51 A;  2L2P A;  2EPD A;  2JM9 A;  1YNZ A;  1G83 A;  1M3C A;  2K2M A;  1YP5 A;  1GBQ A;  4KRT A;  2O9V A;  2M0Y A;  2DX1 A;  3VS7 A;  1HJD A;  2GTJ A;  2EQI A;  4FSS A;  1ZX6 A;  1CKB A;  2D0N A;  4RTT A;  2RNA A;  4OMN A;  2BZY A;  2FPD A;  4D8K A;  1ARK A;  1WFW A;  1AWO A;  2J6F A;  3VRZ A;  4RTY A;  5GJW B;  2AKK A;  2MOX A;  2ED1 A;  1M30 A;  2YUQ A;  2C0O A;  5GJV B;  4AFU C;  2XMF A;  2DBM A;  2EBP A;  4F17 A;  1BBZ A;  1E6H A;  1ABQ A;  1W1F A;  2VWF A;  2O88 A;  1NEG A;  1WXT A;  4HCK A;  4JZ3 A;  3GBQ A;  3REA B;  2EYY A;  3THK A;  2SEM A;  1ZBJ A;  3VS0 A;  3EG0 A;  1NLP C;  3PVL A;  3EG3 A;  2AZV A;  1PNJ A;  2JTE A;  2FRY A;  4HVW A;  1XOV A;  1PWT A;  1QLY A;  1M3A A;  4AFZ C;  1M8M A;  2VVK A;  1MV3 A;  1VA7 A;  1X2Q A;  2DRK A;  2JMA A;  2K7A A;  2IIM A;  4RTZ A;  3ULR B;  2YT6 A;  2E5K A;  2YDL A;  4D8D A;  1N5Z A;  3NPF A;  3M0U A;  1WI7 A;  2J7I A;  2L3P A;  4AFQ C;  2HEQ A;  2LJ3 A;  2RQT A;  1E6G A;  3I5S A;  2DM1 A;  2HSP A;  1H3H A;  1ZUY A;  2W0Z A;  3M0S A;  2K6D A;  2CDT A;  1AWW A;  2KXC A;  4CC7 A;  4OMM A;  1MUZ A;  2EGE A;  1KFZ A;  1I1J A;  3EGU A;  2LCS A;  1BU1 A;  3FJ5 A;  1T0H A;  2OJ2 A;  1WA7 A;  1KIK A;  2AZS A;  1LCK A;  2JT4 A;  2W10 A;  2JS0 A;  4JJB A;  1VYU A;  4WCI A;  1WX6 A;  2K3B A;  4AG1 C;  1B3Q A;  1RUW A;  2EGA A;  2MCN A;  3R6N A;  1KSW A;  3VS5 A;  1QCF A;  1H8K A;  2LJ1 A;  2RQV A;  2KBT A;  2HDA A;  1ZSG A;  2EGC A;  1PRL C;  3CQT A;  3I35 A;  1PRM C;  1AWX A;  2LJ0 A;  4Z89 A;  2RF0 A;  2JW4 A;  3VS6 A;  1K9A A;  3JV3 A;  3M0T A;  2A36 A;  2DL5 A;  2KRM A;  1J3T A;  1GBR A;  2F2V A;  2I0N A;  1EFN A;  4QT7 A;  1T3L A;  2BTT A;  5IHN A;  1UJ0 A;  1B07 A;  4CC2 A;  2FEI A;  2LMJ A;  3M0R A;  1IO6 A;  4F16 A;  3RBB B;  1SRL A;  1AD5 A;  2SRC A;  2G6F X;  1K0X A;  3M0Q A;  2DE0 X;  2RQW A;  1YN8 A;  1OPL A;  2RQU A;  1UTI A;  1AZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...