5L23A

Crystal structure of the complex between the n-terminal sh3 domain of crkii and a proline-rich ligand
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
b'AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Adapter molecule crk
molecule tags Protein binding
source organism Mus musculus
publication title Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand
rcsb
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2016-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5l23A00
1PNJA 3GBQA 2C0OA 4RTTA 2L2PA 3FJ5A 2AK5A 2L3SA 3THKA 1X6BA 2LZ6B 1W6XA 2DILA 1MV3A 1QCFA 2J06A 2EGAA 1RLPC 3VRZA 2L3QA 2FPDA 1UTIA 2DYBA 4A63B 2D8JA 1JXOA 2GQIA 2G6FX 2GTOA 1BB9A 1B3QA 1B07A 3H0FA 2HSPA 1SRMA 4OMNA 1AEYA 1G83A 1UHFA 5FWCA 4IIMA 2FPFA 3EG3A 2YSQA 1UJ0A 5IXFA 2DJQA 5IHNA 3NMZC 2LJ0A 2YUNA 1G2BA 4LE9A 1Z9ZA 1PWTA 4HVWA 2CDTA 1JU5C 2LP5A 1UJYA 1JO8A 1T0JA 2VKNA 4DEYA 1TUCA 4HVVA 2RPNA 1YWOA 2DA9A 3EG2A 1OPLA 1WA7A 4CC3A 5ECAA 2JW4A 2NUZA 2KYMA 4GLMA 1PRLC 2JT4A 2LNHB 1K1ZA 2AKLA 2DMOA 1M3CA 2A28A 1BK2A 1T3LA 2L0AA 2RQWA 5GJWB 2KYBA 3I5RA 1AWXA 4OMMA 3QWXX 1OEBA 4JJCA 2X3WD 5HCKA 4DEXA 3H41A 1UE9A 4LUEA 2KRNA 1SRLA 2HBWA 2K6DA 4ESRA 3C0CA 3A98A 2A36A 1WLPB 4Z88A 2O88A 3VS5A 1YNZA 3U23A 2HEQA 1VYVA 2KRSA 4KRTA 2BZ8A 4AG2C 4F16A 1CKBA 3EG1A 1A0NB 3KFVA 1ZX6A 4J9FA 3ZL7C 1AWWA 2GTJA 2EYWA 2LJ1A 1GBRA 3VS4A 4HVUA 3REBB 1QKWA 2FRYA 3H0HA 2DNUA 2ENMA 1AWOA 3VS2A 3NGPA 5I22A 2CSIA 2K9GA 2EGCA 1CKAA 1MUZA 1ARKA 2JXBA 2ROLA 1WDXA 1YP5A 2YUOA 1WXUA 1FMKA 4M4ZA 3TSZA 3EG0A 4RTXA 1YN8A 2KGTA 1BBZA 1RI9A 2BZXA 4CC7A 1T0HA 1NM7A 1H8KA 2EVRA 1OPKA 1WI7A 3REAB 1AVZC 2W0ZA 2V1QA 4RTWA 4J9IA 2C0IA 1QWEA 1SSHA 4R0KA 1M3AA 2I0NA 1GRIA 1PKSA 1AZEA 2CT4A 2JM8A 2MCNA 2D1XA 1UDLA 2AZSA 4AFQC 2BZYA 1NG2A 1NYGA 2KBTA 2D8HA 5EC7A 4ZNXA 2ED1A 1KSWA 1AOJA 1T3SA 3UATA 4J9EA 1KJWA 2M51A 4K11A 1UGVA 4CC2A 3VS6A 4J9CA 2LX7A 1WXBA 2K7AA 4RTZA 5IHKA 2X3XD 2LJ3A 2XMFA 2SEMA 4RTVA 4D8KA 1H3HA 2L3PA 2RQVA 4AFSC 1ZUYA 2VVKA 1GFDA 4J9BA 1QLYA 1GBQA 1QKXA 2CT3A 2YDLA 2ESWA 2RMOA 1WFWA 1E6HA 2EPDA 2K79A 2DE0X 1OOTA 4OMLA 1JQQA 2SRCA 3M0RA 1Y0MA 3JV3A 1TUDA 3I5SA 1K4US 4LN2A 2FG0A 2FEIA 4Z89A 2CH4A 1VA7A 1U06A 2KE9A 1M3BA 4D8DA 3NHNA 4LNPA 2YUQA 3UA7A 1JEGA 1EFNA 2EKHA 2AKKA 2JMAA 4RTYA 1GL5A 2J6OA 2EGEA 1K76A 1ABOA 1K0SA 1U5SA 1H92A 1YCSB 1Z9QA 2DX1A 2O2OA 2KNBB 4AFZC 2OAWA 1NEBA 1W70A 2RQUA 1HSQA 1K9AA 1NLPC 1SEMA 2CUDA 3RNJA 2IIMA 4JZ4A 4FSSA 4HXJA 2DL7A 2JTEA 4HCKA 1OV3A 1JXMA 1X6GA 1MV0B 1I1JA 2AZVA 1M8MA 3EGUA 1GCQA 2EYZA 2KXDA 2O9VA 1ABQA 1CSKA 2DL5A 2HDAA 1UHCA 2J6FA 1N5ZA 4OMQA 5GJVB 3VS3A 1VYTA 2GBQA 1KFZA 3M0UA 3I35A 1UUEA 3PVLA 4AFUC 3RBBB 1FYNA 2VWFA 1ZBJA 3VS7A 1E6GA 4J9GA 3PE0A 5IH2A 2YT6A 2JM9A 4Z8AA 3TVTA 3M0QA 1AZGB 1UG1A 2KXCA 1UECA 3EHRA 4JJBA 2DL3A 4EIKA 3O5ZA 5FWBA 1WIEA 2LMJA 4OMPA 4J9HA 2C0TA 2CUBA 1I0CA 1LCKA 1S1NA 2F2WA 2DLPA 1XOVA 2F2VA 2LQNA 1SHGA 3SEMA 2DVJA 2KR3A 3H0IA 1HJDA 2ROTA 2DL4A 5L23A 5I11A 1E7OA 1GCQC 3EHQA 2JMCA 1BU1A 2H8HA 2DF6A 3IQLA 2J6KA 4LUDA 1W1FA 1ZUKA 2OJ2A 4J9DA 4CC4B 2A37A 2LCSA 2J05A 1PRMC 1GFCA 1J3TA 2O31A 5FW9A 1K0XA 2D0NA 2ABLA 1M27C 1WX6A 4RTUA 1WYXA 2ECZA 2MOXA 2CREA 2PZ1A 1SPKA 2DL8A 1PKTA 2YUPA 3ULRB 2F2XA 2KROA 4AG1C 1X43A 2DBKA 2V1RA 3M0PA 3R6NA 4GBQA 2E5KA 1RLQC 2DRMA 1KIKA 2KEAA 2P4RA 1HD3A 1UFFA 4WCIA 3M0TA 2BTTA 1AWJA 2MIOA 3VRYA 3QWYA 2CSQA 1QWFA 1ZUUA 2EQIA 4ORZA 1PHTA 1RUWA 2CH4W 1Y57A 1U3OA 2FPEA 1WXTA 4JJDA 2EBPA 4JPBW 3CQTA 1M30A 2KT1A 2RQTA 1ZSGA 2B86A 2K2MA 4RUGA 1X2QA 2HCKA 2EYXA 2EW3A 2M0YA 1X27A 3VS1A 2FO0A 2ED0A 2NWMA 2RF0A 4JZ3A 2PTKA 1VYUA 2QDLA 1V1CA 4QT7A 1NEGA 2EYYA 2RQRA 2GGRA 4F17A 4Y92A 2JS2A 3LH5A 5IXBA 3UA6A 3NPFA 4OMOA 3M0SA 4IIOA 4X1VA 1I07A 2DM1A 3PVQA 2LQWA 2DRKA 1SHFA 2JS0A 3VS0A 2W10A 2K3BA 3I9QA 1X69A 3TSWA 4E6RA 2J7IA 2O9SA 2A08A 3SHWA 4F14A 1GCPA 1IO6A 2GNCA 2KRMA 2DBMA 2RNAA 1ZLMA 5IHIA 1X2KA 2KT8A 1YWPA 3UF4A 1NYFA 1TG0A 2RN8A 2PNIA 1AD5A 2FRWA 1NLOC 2OI3A
chains in the Genus database with same CATH superfamily
4M78B 5FU7B 4RTTA 4N4GA 3L42A 3CBMA 2DIQA 3O8VA 3FJ5A 2AK5A 5FRMA 3THKA 3FB9A 3E2UA 1X6BA 2LZ6B 4N4IA 1MV3A 1QCFA 3UPUA 2J06A 5GAN5 3CCLA 2L3QA 2FPDA 3CD6Q 4QVDA 1VQLQ 1BB9A 1PD0A 1B07A 1VOMA 4OMNA 3SWNC 2E6ZA 1G83A 4IIMA 3A8HB 3QO3A 3CC2T 3EG3A 2YSQA 3E9GA 5IXFA 5IHNA 1D0ZA 2LJ0A 1DJ7B 1G2BA 2CZ7B 4LE9A 4M7AG 5KYWB 2CDTA 3MHXA 3HSBA 4ME7A 5GANh 3G71Q 2YRDA 4XTXA 4CC3A 5ECAA 2RI5A 2NUPB 2OTJT 4Y28E 2NUZA 1IB8A 2HL3A 4GLMA 3A8GB 3CCVT 4BI8B 2QQ9A 2AKLA 1M3CA 2A28A 3LX7A 1BK2A 1WHKA 1T3LA 4ZTJA 5I2SA 2O01E 3WXMB 5GAMe 1OEBA 4JJCA 3LWHA 2DXCA 1VQ4A 5HKCA 4RG2A 1NJIR 1VQNA 2HBWA 1R8OB 1NPPA 1XQHA 3A98A 2A36A 1Q81U 4XU0A 3GLXA 2O88A 3VS5A 2Y90A 5L8RE 1KQ2A 2YRVA 5KYUB 1WQ7A 2EJ9A 1VYVA 2X4XA 4MZPA 3OYGA 3EH2A 1RI0A 3CMAT 3CMET 2RI3A 3HRTA 2AHJB 2FZKB 4GY5A 3OS1A 3LGLA 4A4GA 1A0NB 3OYLA 2GTJA 4HVUA 2FRYA 3H0HA 2CP0A 2R5MA 4M7DD 2K9GA 3URGA 2RHZA 5KYNA 1M2OA 4KUDK 1CKAA 4FW1A 4M7AB 1TH7A 2R58A 2DTHA 4M7DC 1WXUA 4M4ZA 1Q81R 3OS0A 4F7UA 2PU9B 3GF5A 1YN8A 2KGTA 4DBQA 1K73R 4N0AC 1T0HA 4J6WA 1QMCA 3L1AA 3TQ7P 4IURA 2MI6A 2R5AA 5LJ5e 3REAB 2W0ZA 4C8QA 3PMIA 2PUOB 1QWEA 1R0BG 3PIOA 2XG8D 1WNLA 1PKSA 5CVIA 4O5VA 2CT4A 4PFPA 4AFQC 4IUPA 4YTLA 3CC7Q 4ZNXA 4EMKC 1AOJA 1T3SA 4A4HA 2ZPGB 1KD1C 4M75F 1WHGA 1QVPA 3G4SQ 4JDSA 1PC0A 1WXBA 2HMAA 2K7AA 3CCRA 4AT1B 1K73C 5CAIA 5LJ5d 1G3SA 4RTVA 4DOVA 2VB6A 2RH2A 5CKHA 5LJ3f 3CCUQ 3V8JA 2VVKA 3QBYA 4J9BA 1Q95G 1QLYA 2CT3A 4LDVA 2RD1A 2RMOA 4A4KA 2K79A 1OOTA 1PD1A 2SRCA 4ZGJB 1KHCA 3CCLT 2JTFA 4LN2A 4M77E 1QVGA 2RI2A 2FG0A 1SF9A 2PQWA 4C5IA 2P84A 2KE9A 1M3BA 5I21A 4D8DA 1IHVA 4J6XA 1QW1A 1W4SA 1WHMA 3S6WA 1K76A 1QQJA 2DK3A 4QW2A 1K73U 1VQPQ 2QEXT 3OYBA 1YJ9A 4EMHA 4J6YA 2M16A 4C92C 2O2OA 2KNBB 2X9HA 3EFSA 1NJIC 2XU8A 3ME9A 4MDWA 2FZCB 3VUZA 2E10A 1SEMA 3JCMX 4ZN1A 4MMKA 3CCEA 2EQUA 3CC4Q 2VYTA 1OV3A 1VQ5T 2HAXA 4JLIA 1YBYA 3QYHB 5KYUA 4ANJA 1UB4A 2KI7A 4QVZA 1GCQA 2KXDA 5CKBA 1ABQA 1VQMT 2HDAA 1QP3A 4N0AA 1N5ZA 2RJFA 1FXXA 5GMKj 2RA2A 1C6VX 3PVLA 4AFUC 3CCMA 3EFRA 4PFOA 1E6GA 2JM9A 1IGQA 1UG1A 2KXCA 4KBMB 2DL3A 3G6ET 4M75D 1M8VA 4EIKA 1NJIU 1D1BA 2LMJA 2WSFE 4ELYC 1M1KU 3FC3A 2C0TA 5DM7R 1I0CA 1RAIB 3QJYA 1ZBXA 2F2VA 2OTLT 1SHGA 2DVJA 1BYMA 2DO3A 4M77G 3EGDA 2WSCE 4JRQA 1QP2A 2JMCA 2H8HA 3IQLA 2WSEE 1VQ5Q 4LUDA 1W1FA 2E1HA 2E12A 1IXDA 1MMGA 5LJ3e 1PRMC 1GFCA 5IAYA 2E6NA 2BE7D 2BE9B 3A8MB 1M1KR 4RTUA 1K9MR 1SPKA 1PKTA 2E3IA 2KY9A 3ULRB 2LVMA 2P4TA 2YLBA 3HFNA 3M0PA 1UGQB 4OB2B 2E5KA 1N8RR 1HD3A 3MJXA 1VQ9Q 4OGEA 1N27A 2DYIA 1AWJA 2QA4Q 2XD0A 2R57A 2PVDB 3M9QA 4FYVB 2K2VA 2ZZDA 1RUWA 1D3BA 2DEUA 3INZA 4J7FA 2DXUA 5KYXA 3GNFB 3G71A 2EBPA 5DLQE 1VQ9A 4BY6B 5AYFA 5LJ5f 2RHXA 3FLGA 3RKYA 4FU6A 4IKFA 2M0YA 1X27A 3L2WA 3VS1A 2NWMA 2PTKA 2QDLA 2ZPEB 3JCMQ 4QT7A 2LTOA 2EYYA 4FT2A 2GGRA 2LT1A 3G1JA 3LH5A 2QA4T 4M75E 4M78C 5FU7C 4PJOD 3G4ST 1RL2A 4X1VA 5CO7A 3OMGA 2M1HA 2JS0A 2K3BA 3CPWA 2CZ1B 2A08A 4LD9K 4A4FA 1IO6A 2GNCA 3V7SA 2DERA 2DBMA 5GAN3 1Y96B 4M7DA 3VYGA 2GCXA 3UF4A 1EZZB 1YJNQ 3SWNB 2FRWA 4CI0C 3MP8A 3LYIA 2CP6A 3CCLQ 2L3SA 3GPLA 3P8BB 1YITQ 2DXTA 1VQPT 1W6XA 1NPRA 2EGAA 2D8JA 4E7LA 1JXOA 1R0CB 4M7DE 3CCSQ 1IZ6A 4FT4A 1YFNA 2HSPA 1SRMA 3H0FA 4M75A 3J7AF 1M1FA 3OYMA 5GANg 3CCET 2FPFA 3L2VA 1NBEB 1UJ0A 1QVFS 2DJQA 4C5GA 5CCAA 3S3OA 4KUIA 3OA6A 1Z9ZA 1BCOA 1BIBA 2MYSA 2NUTB 4HVWA 1K9MC 1JU5C 1UJYA 1OX9A 3JAME 4DEYA 1TUCA 4HVVA 1VIEA 3JCMc 1OPLA 1LVKA 1WA7A 1N8RC 4XTYA 2CP5A 2JW4A 2KYMA 3X20B 1MMDA 1PRLC 3VV0A 5GMKi 2OTLQ 1VQ5A 2DMOA 3EH1A 1M90C 1M90R 5GJWB 2KYBA 1Q7YR 1Q82R 2X4WA 2YWWA 4F7UF 2ZPFB 5IN1A 5LJ3d 4JRKA 4WTOB 1UE9A 4LUEA 2PVGB 3CC7T 2XKOC 3C0CA 3JB9I 2QDYB 1WLPB 4IUUA 1VQ4T 2JTMA 2KRSA 4KRTA 3TREA 3SWNA 3VUBA 4IUTA 2YRCA 3RMQA 3A8OB 1N8RU 3EG1A 1OI1A 3HP9A 2FZGB 2FL7A 3RR6A 3BDLA 3A5ZB 2CZ0B 2ZAEA 1XNIA 2DNUA 1OZ2A 1VQOQ 1WJQA 5CKFA 5AT1B 2DTOA 3VS2A 2K5LA 5I22A 4NL3A 4FCYA 4XU1A 2KDSA 2DPPB 2JXBA 5CR2A 2CZ6B 1D0YA 1VIFA 2LDMA 1BBZA 3VJPA 2HNIA 1SG5A 1UGRB 1W2BP 2HBPA 3QSUA 5J3BA 4DQ2A 4R0KA 3ZEHA 1M3AA 3PT9A 4LDYA 2K3XA 1AZEA 2P0KA 2MCNA 1UDLA 2AZSA 4CRIA 2DD4A 3R6OA 2KBTA 2D8HA 5GAOr 5EC7A 4QKUA 4BD3A 3HFOA 4C8QB 1KSWA 1RAHB 3UATA 1N9SA 4J9EA 1KJWA 4OB3B 4DBFA 4CC2A 1SKUB 3NTHA 1UEBA 2CP7A 4C0GA 2G3RA 2VUBA 3CCQQ 1EIFA 1RAAB 2L3PA 1KD1R 2RQVA 3QZ5B 1M1KC 5GAOp 3OYFA 1GBQA 2L3RA 1QKXA 2YDLA 2K5FA 2DTIA 3M0RA 1JQQA 1WHJA 3I5SA 4JUVA 2WACA 1ZSZB 1B34A 4OMFB 3JCMP 1IREB 3UWNA 1U06A 2YXYA 2C06A 1Q82U 1EX4A 3NHNA 1TTHB 3CCJQ 1JEGA 1EFNA 2EQKA 3FEOA 2JMAA 2JZ2A 2VGMA 1VQ8Q 2J6OA 4E7SA 2BUDA 1ABOA 4EMGA 4C8QD 1K0SA 2X35A 4JS4A 1YCSB 1Z9QA 4II1A 1M2VA 4JRPA 2FHDA 1XJWB 1YJWA 4IUVA 1HSQA 1K9AA 2CUDA 1Q86U 2ATCB 2CP3A 2VC8A 3GOXA 4HXJA 2DL7A 2JTEA 3QKJA 4R56A 4HCKA 4C92F 3C95A 1RABB 3I56Q 4OVAA 2CS7A 1LOJA 1WGSA 2I2LA 2OAUA 2RHIA 1TS9A 5CK9A 2DL5A 5GAOl 3MO8A 1WJRA 5KYXB 3OS5A 1KQSA 3VS3A 4M77B 5HY6A 1VQLA 4M77D 3M0UA 2LX9A 2P0QA 3RBBB 2VWFA 1YHQT 1ZBJA 4M78F 2V26A 1UECA 3CD6T 2E65A 4QQDA 3S3MA 3JSCA 9ATCB 4A54A 5FWBA 1WIEA 3BE3A 4M7AF 3EAEA 1D0XA 4OMPA 1Q86C 1Q86R 1U1SA 1LCKA 1ACMB 2DLPA 2GFUA 1VQ4Q 4M7DF 2QTVA 3MEAA 4DA4A 2HD0A 2DD5A 2NUTA 2D0QB 3JCMh 1E7OA 2O4XB 1YJNT 2DF6A 2K4YA 1D1CA 1OULA 2OJ2A 2QQBA 5FW9A 1NE8A 2ABLA 3C4SA 4BUGA 1M27C 4JJNK 2LC4A 1WYXA 2MOXA 5DLOA 4M77A 3KBGA 4AMCA 2LT4A 2XI9A 2F2XA 2XIDA 2V1RA 5D7UA 3JB9H 1RLQC 1VQKT 2P0PA 5EG2A 3M0TA 4BY6C 3OS2A 2K5IA 2L5QA 3CPWP 4DOWA 3CCST 3QWYA 4MDXA 3HPWA 2X4JA 1JB0E 4FM4B 1Y96A 3CC2A 2KK4A 4FL6A 3N5BB 3OYYA 1VQMA 4E7KA 2FPEA 2PVOB 2JN0A 4Z02A 1Q7YC 2E3HA 5GAMj 4PJNA 3M59A 3CCMT 2RQTA 4O6JA 1X2QA 3HRUA 1YI2T 1JBMA 3CXCS 2FO0A 1VQ9T 4M78E 4JZ3A 2QG9B 4M75C 2E5QA 3CCQT 2JS2A 1KQ1A 3NPFA 8AT1B 4IIOA 5D6WA 1I07A 4RCCA 4X34A 3PVQA 3VS0A 5GAN2 3TSWA 1OU9A 5GAOq 2QXFA 5A0DA 2J7IA 4JLGA 3TEEA 1GCPA 1FWZA 1RAGB 3QJ6A 2KRMA 4C92D 3OBYA 5IHIA 3S3NA 1X2KA 2RM4A 2DIGA 2KT8A 2COWA 2RN8A 4ZN3A 1AD5A 3FDRA 3P8HA 2QGFB 2D9TA 2RJEA 4OP0A 4RKUE 2OI3A 4KT0E 1PNJA 4PL6A 2C0OA 5D6XA 1JJ2A 4JS5A 1G5VA 1PSFA 2DILA 1KHIA 1G3YA 2NLUA 3QXEB 3QHSA 3SB2A 5LJ3j 4KGXB 4PKCC 2JVVA 2DAQA 3MEWA 2G6FX 3H6ZA 3RDVA 3NTIA 1B3QA 1R77A 1AEYA 1UHFA 3A8LB 5FWCA 3V8LA 2KQWA 3QUIA 1KG1A 5HK0A 1RACB 1IGUA 8ATCB 2YUNA 3I56A 1IHWA 1PWTA 3WVEB 1KC8C 3ZFJA 1T0JA 5GANd 1AHJB 1YWOA 3LWIA 2DA9A 4M7DG 3BW1A 1TXQA 4BE2A 1X75C 1G8XA 4M7AC 2LNHB 2JT4A 4HCZA 3NFCA 1K8AR 2QA4A 3QG1A 2L0AA 1QVGP 3I5RA 3CCVA 1VQ8A 4VUBA 1AWXA 4PJOB 3QWXX 4BI3A 2XHCA 4B9WA 5KH6A 5HCKA 1M2VB 4F7UG 4DEXA 3H41A 4ZTFA 1SRLA 2K6DA 3PFSA 1O75A 4Q5WA 5KYYA 4Z88A 1YNZA 5GAOn 2V8KA 3CCEQ 2HEQA 2RK1A 3ZBDA 1YCYA 1YJNA 5M9OA 4AG2C 4F16A 5LJ3g 3L2ZA 1B34B 3KXTA 3KFVA 1K8AC 1YJ9Q 4J9FA 4PJOE 3ZL7C 1VQPA 3CXCP 2EYWA 1D09B 1GBRA 3MKDA 5A0GA 3OY9A 3REBB 1QKWA 4JRIA 1WZOA 1AWOA 1RAEB 3NGPA 1MNDA 3OYJA 4PJJA 4C92E 2EGCA 1KC8R 1BI0A 3QZ9B 1MUZA 1ARKA 4FYYB 2ROLA 1HXDA 1RAFB 4M7AD 1QCOA 2MK5A 4HA8A 3BFMA 2RB6A 3EG0A 4RTXA 1RI9A 4PJLA 4CC7A 1V76A 3RERA 2XK0A 4P5NA 4C0DB 5FROA 4FYXB 1H8KA 4XTVA 4C8QC 3LW5E 1YJ9T 5KE2A 4Y91A 1OPKA 1WI7A 2EVRA 1QVGS 3H8ZA 2IVWA 2V1QA 4ATOA 2QYZA 4J9IA 1K8AU 3OSVA 1SSHA 4E7ZA 4QQ6A 1VUBA 1BKBA 2HQXA 1OZ3A 2IPOB 2I0NA 1GRIA 4D6WA 1YI2Q 2Z0WA 3SFMA 2JM8A 2D1XA 2DEQA 3CCVQ 1NYGA 1KQSS 2DVEA 1PSEA 3JCMe 4BDYA 5GMKm 2XICA 3CC7A 2M51A 4K11A 4ELZC 2QTXA 3JB9G 4HCBA 1N6AA 3VS6A 4J9CA 4RMOA 1I5OB 3LGFA 4XTZA 4ZGDB 1OX8A 3OYCA 3JCMW 4KULA 1FMWA 3X24B 3CC4A 2Y4YA 3X26B 3CCQA 2X3XD 1H3ZA 5GAMf 2MPXC 3OYKA 2SEMA 5LJ5j 4M7DB 1H3HA 3CCRT 2ZPHB 1BI3A 4AFSC 4XK8E 2DZCA 1M1GA 1JJ2P 2EWNA 3CBOA 2ESWA 1WFWA 2JJ9A 4FYWB 1E6HA 2EPDA 2DE0X 1H641 4J83A 1P92A 1TUDA 3EG9A 2OTLA 2HKQB 3T9NA 3OYEA 4KGZB 2CH4A 2D6FA 1ZA1B 4C0ZA 2CP2A 4FW2A 5KE3A 4LNPA 2YUQA 3RKWA 2V8IA 3CEYA 3HTRA 1GL5A 3JB9J 3EFOA 1S72A 4C0FA 4B9XA 2BIVA 3OSSC 3M4GA 5CIUA 1MMAA 4RCBA 1ZA2B 2DX1A 1I8FA 2OAWA 4M78G 2QK0A 2FVUA 3MP1A 1W70A 1OU8A 2RQUA 2QEXA 4KH1B 4L6V5 5GANj 5C0MA 2IIMA 4XU2A 4JZ4A 4FSSA 2E4HA 3CCRQ 3OYDA 3M5AA 2OX7A 2AZVA 3A1PA 1M8MA 4XAXB 1AT1B 1QVFA 2RO0A 3L2QA 2EYZA 2O9VA 3LLRA 1CSKA 2H3EB 1UHCA 2J6FA 2M9UA 3QDFA 4OMQA 5LJ3h 4V2SA 2K57A 4LDWA 1KFZA 4PJOA 3G6EA 3CPWS 3FJPA 4IUQA 1FYNA 2JOYA 3VS7A 3M54A 4J9GA 1IRXA 3C12A 2YT6A 5J39A 3E19A 3LH0A 4F7UE 1VQLT 1AZGB 4JJBA 3TCJA 4LDXA 3GP8A 4X9DA 3O5ZA 1YHQA 1YHQQ 3CC2Q 4PNOA 4J9HA 2CUBA 2F2WA 2EIFA 1X01A 1TUGB 2DJZA 2RJCA 2LQNA 3SEMA 1Q81C 2DL4A 1YIJT 5I11A 3EHQA 3JCMb 2J6KA 4EDUA 1VQ7Q 4PJOF 4J9DA 2A37A 4XTUA 2LCSA 3D7SB 2ZGWA 2J05A 1J3TA 3UDCA 2D0NA 1VQ6Q 3AT1B 2XDPA 2YLCA 2ECZA 4E7HA 2KAFA 2CREA 2PZ1A 2DL8A 2EFIA 2LQ8A 2EJGA 2YUPA 3OYAA 4J5YA 4AG1C 1WHHA 1YJWT 1W2BS 2QEXQ 4PLIA 2DRMA 1KIKA 2KEAA 5GMKl 1UFFA 1KC8U 2EQJA 1D1AA 1I4K1 2A7YA 4LD6A 4NL2A 2CSQA 1ZUUA 1VQKA 3VYHB 2EQIA 1PG5B 4M75B 3V7RA 2V8JA 1PHTA 4ORZA 4BDZA 1VQ7T 2CH4W 5FU6B 3G7ZA 2AT1B 3JCMV 4JJDA 4BACA 1M9SA 4JPBW 3BY7A 1TWBA 2ZPIB 3Q1JA 2KT1A 2B86A 2HZYA 2K2MA 1W2BA 2HCKA 4BI4A 2EW3A 3NTKA 1YJWQ 1UGPB 2FYKA 2ED0A 4M78D 4KGVB 1VYUA 1V1CA 4PLLA 4BB7A 2M02A 3CCUA 1NEGA 5GANf 3J80E 2LNVA 1LJOA 5IXBA 1TU0B 3CCJT 1C1AA 3UA6A 4OMOA 1TSFA 3RMSA 2DM1A 1MNEA 3M55A 1SHFA 1VQNT 3F70A 3I9QA 1X69A 3X25B 4E6RA 1NZ9A 2O9SA 3SHWA 3G4SA 1I5LA 2BKDN 2E70A 3HKSA 3CCMQ 5GAN8 1ZLMA 2EJFA 3PMTA 4L5GA 4HCCA 2VXEA 4M77F 3VKIA 1VQMQ 2JUFA 3GBQA 4E47A 2L8DA 2L2PA 2ZPBB 3MEUA 2FB7A 4C8QE 1S72T 4BE0A 2EYQA 1O9SA 2RJDA 1RLPC 2X4YA 3VRZA 2XDDA 1UTIA 5KYWA 2DYBA 4A63B 4J7IA 3UT1A 2B8AA 2GQIA 3G6EQ 1RADB 2GTOA 5A2QE 3EFOB 4J8OA 2COZA 3NMZC 1XTDA 1G3TA 4OGCA 5CKEA 1FMVA 1VQOA 2LP5A 3EG9B 1JO8A 4PJOC 2VKNA 2RPNA 4WF2A 5C6SA 2KSSA 3EG2A 3CPFA 2HL5C 3PGGA 4MZTA 3DB3A 3BDUA 4X9CA 1VQ7A 4B6MA 1K1ZA 1WQWA 2L89A 4NS5A 2QQAA 2RQWA 3OQ5A 1N9RA 2MAMA 1S72Q 2VASA 4OMMA 3JCMd 2MMPA 3KUFA 2X3WD 4C8QG 2QASA 5FRNA 2KRNA 3E1SA 2EAYA 4ESRA 1PCXA 3X28B 3CMEA 1VQ8T 1G3WA 1V29B 1BI1A 3U23A 4UC4A 5GANe 2BZ8A 4M7AE 3JCMJ 3OYIA 3JB9D 3L2RA 1CKBA 3DB4A 1ZX6A 2AIRB 1AWWA 5KYYB 3DLMA 5HK3A 2LJ1A 2CGHA 4MZMA 3VS4A 2DZ9A 2RK2A 4C0DC 1MHNA 2ENMA 2DETA 5GAMh 3H9NA 5A0LA 2CSIA 2EQMA 4F04B 3GNGA 1OYXA 1Y7XA 3FRNA 1WDXA 1YP5A 2YUOA 3M57A 1VQ6T 1FMKA 1Y07A 3TSZA 2QQRA 2M0OA 3E9FA 4BE1A 1UGSB 2BZXA 2GF7A 1NM7A 1YITA 2QAZA 1AVZC 1ZSZC 4RTWA 4XTWA 2C0IA 3HL8A 5CQXA 1LPLA 4TVRA 2H3JA 3M4YA 3P8DA 4NOYA 1GXIE 3JB9F 4OB0B 2BZYA 1NG2A 2F1LA 3OB9A 2ED1A 1HK9A 1PM3A 1QCNA 3MPUB 2A3LA 2DKGA 4A4EA 1UGVA 3PTAA 4MMLA 3DKMA 1SSFA 1Y71A 2VGNA 1QVFP 4LDUA 3MP6A 2LX7A 3MEVA 2VV5A 1X6OA 4RTZA 5IHKA 1MGQA 1YIJQ 2K3YA 3CCUT 3RIRA 1M4ZA 4C5EA 2HKNA 2LJ3A 4M7AA 3RKXA 2XMFA 1VQKQ 1KQSP 3CMAQ 2NYSA 4D8KA 3CCJA 5CQYA 4LXCA 3OW2S 3AHUA 3I55A 4EMKB 2HSEB 2KMTA 3M56A 3CC4T 4PJMA 1ZUYA 2NUPA 3EGDB 2QGGA 2RHYA 1GFDA 2HQEA 4M77C 4OMLA 3ASKA 1Y0MA 3JV3A 5LJ5g 4R55A 1K4US 2FEIA 4Z89A 2LRQA 5I2MA 1VA7A 3HRSA 5KCOA 3I55Q 3EGXA 4C8QF 1BIAA 3UA7A 3QIIA 2EKHA 2AKKA 1TOVA 1ZQ1A 4RTYA 3FIFA 3HHTB 2DXBA 2EGEA 2LCLA 2DFUA 2PUKB 1U5SA 2LQKA 3OYNA 3META 2MF2A 1H92A 4AFZC 2LCCA 2MWPA 1NEBA 3PIPA 4HT8A 4A53A 2QI2A 5GAN7 3RNJA 1NLPC 2JNGA 2Y4XA 1HYOA 3VU3C 4HKEA 3G71T 2QQSA 3M58A 4F7UB 1Q82C 2HQHA 4HT9A 2OTJQ 1JXMA 1BCMA 1X6GA 3EGXB 1MV0B 1JRIA 1I1JA 1YITT 1WPYA 3EGUA 3GIBA 1VQOT 4FIBA 4C92B 3L2UA 5LL6S 1KD1U 1ZHIA 5GMKe 2X51A 2F5KA 5GJVB 1VYTA 2GBQA 3MCAB 3I35A 3SDZA 4FSXA 3CD6A 1UUEA 5CKDA 3OYHA 4E7JA 3PE0A 5IH2A 1OQKA 3QPHA 4Z8AA 3TVTA 3M0QA 3EHRA 2IG0A 5J26A 1M90U 2EKOA 2VXFA 6AT1B 1JJ2S 1K9MU 3SD4A 1M5Q1 1S1NA 3RUXA 1VQNQ 1XOVA 2F69A 5GAN6 4PK4A 4E7IA 3CBPA 1LNXA 1C0MA 4ZGEB 1HJDA 2KR3A 3H0IA 2ROTA 5L23A 4EPCA 1GCQC 3V8KA 2RHUA 4M78A 1I81A 1BU1A 4XU3A 3V7CA 4C92G 4DBRA 3RESA 1ZUKA 4CC4B 2GFAA 1YIJA 1VQ6A 1BI2A 2O31A 1K0XA 4QQGA 3WVDB 1U8RA 1WX6A 2MWOA 4DBHA 4PJOG 5FLXE 5FU6C 4N4HA 2KROA 2CKKA 3JRZA 3CMEQ 3CXCA 1MMNA 1X43A 2DBKA 3R6NA 4C92A 3TU4K 5GAMg 4GBQA 3CCSA 2P4RA 3QYGB 4WCIA 2BTTA 3DLLA 4KH0B 2A0FB 7AT1B 2MIOA 2COYA 3M53A 2XDBA 3VRYA 1QWFA 2OTJA 4L59A 3PNWC 2O4XA 3OW2A 1Y57A 3C94A 1U3OA 1WXTA 5GAMd 3I56T 1WHLA 4E2FB 3JCMg 3CQTA 1M30A 3OW2P 1ZSGA 4GLKA 4RUGA 4C5HA 2EYXA 2F5TX 1WJSA 2KVQG 2RF0A 4RG8A 3OBWA 5LJ5h 2RQRA 4QVCA 5D6YA 4M75G 4F17A 4Y92A 1B7TA 5GMKh 1YI2A 5IT9E 3ER0A 1ZSZA 3CMAA 3I55T 2YHTA 2GQVA 4OF1A 3M0SA 5GAN4 2E64A 5GAOm 1Q7YU 2LQWA 2DRKA 2W10A 1F1BB 4XQ3A 2ZCFB 1FX7A 4OB1B 4F14A 3OMCA 1D3BB 4EMKA 3QDRB 5KCHA 2CYZB 5DY9A 3J81E 2RNAA 1YWPA 1KK7A 1NYFA 1TG0A 4PFZA 3JCMf 2PNIA 2E41A 1U1TA 1NLOC
chains in the Genus database with same CATH topology
1PNJA 3GBQA 2C0OA 4RTTA 2L2PA 3FJ5A 2AK5A 2L3SA 3THKA 1X6BA 2LZ6B 1W6XA 2DILA 1MV3A 1QCFA 2J06A 2EGAA 1RLPC 3VRZA 2L3QA 2FPDA 1UTIA 2DYBA 4A63B 2D8JA 1JXOA 2GQIA 2G6FX 2GTOA 1BB9A 1B3QA 1B07A 3H0FA 2HSPA 1SRMA 4OMNA 1AEYA 1G83A 1UHFA 5FWCA 4IIMA 2FPFA 3EG3A 2YSQA 1UJ0A 5IXFA 2DJQA 5IHNA 3NMZC 2LJ0A 2YUNA 1G2BA 4LE9A 1Z9ZA 1PWTA 4HVWA 2CDTA 1JU5C 2LP5A 1UJYA 1JO8A 1T0JA 2VKNA 4DEYA 1TUCA 4HVVA 2RPNA 1YWOA 2DA9A 3EG2A 1OPLA 1WA7A 4CC3A 5ECAA 2JW4A 2NUZA 2KYMA 4GLMA 1PRLC 2JT4A 2LNHB 1K1ZA 2AKLA 2DMOA 1M3CA 2A28A 1BK2A 1T3LA 2L0AA 2RQWA 5GJWB 2KYBA 3I5RA 1AWXA 4OMMA 3QWXX 1OEBA 4JJCA 2X3WD 5HCKA 4DEXA 3H41A 1UE9A 4LUEA 2KRNA 1SRLA 2HBWA 2K6DA 4ESRA 3C0CA 3A98A 2A36A 1WLPB 4Z88A 2O88A 3VS5A 1YNZA 3U23A 2HEQA 1VYVA 2KRSA 4KRTA 2BZ8A 4AG2C 4F16A 1CKBA 3EG1A 1A0NB 3KFVA 1ZX6A 4J9FA 3ZL7C 1AWWA 2GTJA 2EYWA 2LJ1A 1GBRA 3VS4A 4HVUA 3REBB 1QKWA 2FRYA 3H0HA 2DNUA 2ENMA 1AWOA 3VS2A 3NGPA 5I22A 2CSIA 2K9GA 2EGCA 1CKAA 1MUZA 1ARKA 2JXBA 2ROLA 1WDXA 1YP5A 2YUOA 1WXUA 1FMKA 4M4ZA 3TSZA 3EG0A 4RTXA 1YN8A 2KGTA 1BBZA 1RI9A 2BZXA 4CC7A 1T0HA 1NM7A 1H8KA 2EVRA 1OPKA 1WI7A 3REAB 1AVZC 2W0ZA 2V1QA 4RTWA 4J9IA 2C0IA 1QWEA 1SSHA 4R0KA 1M3AA 2I0NA 1GRIA 1PKSA 1AZEA 2CT4A 2JM8A 2MCNA 2D1XA 1UDLA 2AZSA 4AFQC 2BZYA 1NG2A 1NYGA 2KBTA 2D8HA 5EC7A 4ZNXA 2ED1A 1KSWA 1AOJA 1T3SA 3UATA 4J9EA 1KJWA 2M51A 4K11A 1UGVA 4CC2A 3VS6A 4J9CA 2LX7A 1WXBA 2K7AA 4RTZA 5IHKA 2X3XD 2LJ3A 2XMFA 2SEMA 4RTVA 4D8KA 1H3HA 2L3PA 2RQVA 4AFSC 1ZUYA 2VVKA 1GFDA 4J9BA 1QLYA 1GBQA 1QKXA 2CT3A 2YDLA 2ESWA 2RMOA 1WFWA 1E6HA 2EPDA 2K79A 2DE0X 1OOTA 4OMLA 1JQQA 2SRCA 3M0RA 1Y0MA 3JV3A 1TUDA 3I5SA 1K4US 4LN2A 2FG0A 2FEIA 4Z89A 2CH4A 1VA7A 1U06A 2KE9A 1M3BA 4D8DA 3NHNA 4LNPA 2YUQA 3UA7A 1JEGA 1EFNA 2EKHA 2AKKA 2JMAA 4RTYA 1GL5A 2J6OA 2EGEA 1K76A 1ABOA 1K0SA 1U5SA 1H92A 1YCSB 1Z9QA 2DX1A 2O2OA 2KNBB 4AFZC 2OAWA 1NEBA 1W70A 2RQUA 1HSQA 1K9AA 1NLPC 1SEMA 2CUDA 3RNJA 2IIMA 4JZ4A 4FSSA 4HXJA 2DL7A 2JTEA 4HCKA 1OV3A 1JXMA 1X6GA 1MV0B 1I1JA 2AZVA 1M8MA 3EGUA 1GCQA 2EYZA 2KXDA 2O9VA 1ABQA 1CSKA 2DL5A 2HDAA 1UHCA 2J6FA 1N5ZA 4OMQA 5GJVB 3VS3A 1VYTA 2GBQA 1KFZA 3M0UA 3I35A 1UUEA 3PVLA 4AFUC 3RBBB 1FYNA 2VWFA 1ZBJA 3VS7A 1E6GA 4J9GA 3PE0A 5IH2A 2YT6A 2JM9A 4Z8AA 3TVTA 3M0QA 1AZGB 1UG1A 2KXCA 1UECA 3EHRA 4JJBA 2DL3A 4EIKA 3O5ZA 5FWBA 1WIEA 2LMJA 4OMPA 4J9HA 2C0TA 2CUBA 1I0CA 1LCKA 1S1NA 2F2WA 2DLPA 1XOVA 2F2VA 2LQNA 1SHGA 3SEMA 2DVJA 2KR3A 3H0IA 1HJDA 2ROTA 2DL4A 5L23A 5I11A 1E7OA 1GCQC 3EHQA 2JMCA 1BU1A 2H8HA 2DF6A 3IQLA 2J6KA 4LUDA 1W1FA 1ZUKA 2OJ2A 4J9DA 4CC4B 2A37A 2LCSA 2J05A 1PRMC 1GFCA 1J3TA 2O31A 5FW9A 1K0XA 2D0NA 2ABLA 1M27C 1WX6A 4RTUA 1WYXA 2ECZA 2MOXA 2CREA 2PZ1A 1SPKA 2DL8A 1PKTA 2YUPA 3ULRB 2F2XA 2KROA 4AG1C 1X43A 2DBKA 2V1RA 3M0PA 3R6NA 4GBQA 2E5KA 1RLQC 2DRMA 1KIKA 2KEAA 2P4RA 1HD3A 1UFFA 4WCIA 3M0TA 2BTTA 1AWJA 2MIOA 3VRYA 3QWYA 2CSQA 1QWFA 1ZUUA 2EQIA 4ORZA 1PHTA 1RUWA 2CH4W 1Y57A 1U3OA 2FPEA 1WXTA 4JJDA 2EBPA 4JPBW 3CQTA 1M30A 2KT1A 2RQTA 1ZSGA 2B86A 2K2MA 4RUGA 1X2QA 2HCKA 2EYXA 2EW3A 2M0YA 1X27A 3VS1A 2FO0A 2ED0A 2NWMA 2RF0A 4JZ3A 2PTKA 1VYUA 2QDLA 1V1CA 4QT7A 1NEGA 2EYYA 2RQRA 2GGRA 4F17A 4Y92A 2JS2A 3LH5A 5IXBA 3UA6A 3NPFA 4OMOA 3M0SA 4IIOA 4X1VA 1I07A 2DM1A 3PVQA 2LQWA 2DRKA 1SHFA 2JS0A 3VS0A 2W10A 2K3BA 3I9QA 1X69A 3TSWA 4E6RA 2J7IA 2O9SA 2A08A 3SHWA 4F14A 1GCPA 1IO6A 2GNCA 2KRMA 2DBMA 2RNAA 1ZLMA 5IHIA 1X2KA 2KT8A 1YWPA 3UF4A 1NYFA 1TG0A 2RN8A 2PNIA 1AD5A 2FRWA 1NLOC 2OI3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PNJ A;  3GBQ A;  2C0O A;  4RTT A;  2L2P A;  3FJ5 A;  2AK5 A;  2L3S A;  3THK A;  1X6B A;  2LZ6 B;  1W6X A;  2DIL A;  1MV3 A;  1QCF A;  2J06 A;  2EGA A;  1RLP C;  3VRZ A;  2L3Q A;  2FPD A;  1UTI A;  2DYB A;  4A63 B;  2D8J A;  1JXO A;  2GQI A;  2G6F X;  2GTO A;  1BB9 A;  1B3Q A;  1B07 A;  3H0F A;  2HSP A;  1SRM A;  4OMN A;  1AEY A;  1G83 A;  1UHF A;  5FWC A;  4IIM A;  2FPF A;  3EG3 A;  2YSQ A;  1UJ0 A;  5IXF A;  2DJQ A;  5IHN A;  3NMZ C;  2LJ0 A;  2YUN A;  1G2B A;  4LE9 A;  1Z9Z A;  1PWT A;  4HVW A;  2CDT A;  1JU5 C;  2LP5 A;  1UJY A;  1JO8 A;  1T0J A;  2VKN A;  4DEY A;  1TUC A;  4HVV A;  2RPN A;  1YWO A;  2DA9 A;  3EG2 A;  1OPL A;  1WA7 A;  4CC3 A;  5ECA A;  2JW4 A;  2NUZ A;  2KYM A;  4GLM A;  1PRL C;  2JT4 A;  2LNH B;  1K1Z A;  2AKL A;  2DMO A;  1M3C A;  2A28 A;  1BK2 A;  1T3L A;  2L0A A;  2RQW A;  5GJW B;  2KYB A;  3I5R A;  1AWX A;  4OMM A;  3QWX X;  1OEB A;  4JJC A;  2X3W D;  5HCK A;  4DEX A;  3H41 A;  1UE9 A;  4LUE A;  2KRN A;  1SRL A;  2HBW A;  2K6D A;  4ESR A;  3C0C A;  3A98 A;  2A36 A;  1WLP B;  4Z88 A;  2O88 A;  3VS5 A;  1YNZ A;  3U23 A;  2HEQ A;  1VYV A;  2KRS A;  4KRT A;  2BZ8 A;  4AG2 C;  4F16 A;  1CKB A;  3EG1 A;  1A0N B;  3KFV A;  1ZX6 A;  4J9F A;  3ZL7 C;  1AWW A;  2GTJ A;  2EYW A;  2LJ1 A;  1GBR A;  3VS4 A;  4HVU A;  3REB B;  1QKW A;  2FRY A;  3H0H A;  2DNU A;  2ENM A;  1AWO A;  3VS2 A;  3NGP A;  5I22 A;  2CSI A;  2K9G A;  2EGC A;  1CKA A;  1MUZ A;  1ARK A;  2JXB A;  2ROL A;  1WDX A;  1YP5 A;  2YUO A;  1WXU A;  1FMK A;  4M4Z A;  3TSZ A;  3EG0 A;  4RTX A;  1YN8 A;  2KGT A;  1BBZ A;  1RI9 A;  2BZX A;  4CC7 A;  1T0H A;  1NM7 A;  1H8K A;  2EVR A;  1OPK A;  1WI7 A;  3REA B;  1AVZ C;  2W0Z A;  2V1Q A;  4RTW A;  4J9I A;  2C0I A;  1QWE A;  1SSH A;  4R0K A;  1M3A A;  2I0N A;  1GRI A;  1PKS A;  1AZE A;  2CT4 A;  2JM8 A;  2MCN A;  2D1X A;  1UDL A;  2AZS A;  4AFQ C;  2BZY A;  1NG2 A;  1NYG A;  2KBT A;  2D8H A;  5EC7 A;  4ZNX A;  2ED1 A;  1KSW A;  1AOJ A;  1T3S A;  3UAT A;  4J9E A;  1KJW A;  2M51 A;  4K11 A;  1UGV A;  4CC2 A;  3VS6 A;  4J9C A;  2LX7 A;  1WXB A;  2K7A A;  4RTZ A;  5IHK A;  2X3X D;  2LJ3 A;  2XMF A;  2SEM A;  4RTV A;  4D8K A;  1H3H A;  2L3P A;  2RQV A;  4AFS C;  1ZUY A;  2VVK A;  1GFD A;  4J9B A;  1QLY A;  1GBQ A;  1QKX A;  2CT3 A;  2YDL A;  2ESW A;  2RMO A;  1WFW A;  1E6H A;  2EPD A;  2K79 A;  2DE0 X;  1OOT A;  4OML A;  1JQQ A;  2SRC A;  3M0R A;  1Y0M A;  3JV3 A;  1TUD A;  3I5S A;  1K4U S;  4LN2 A;  2FG0 A;  2FEI A;  4Z89 A;  2CH4 A;  1VA7 A;  1U06 A;  2KE9 A;  1M3B A;  4D8D A;  3NHN A;  4LNP A;  2YUQ A;  3UA7 A;  1JEG A;  1EFN A;  2EKH A;  2AKK A;  2JMA A;  4RTY A;  1GL5 A;  2J6O A;  2EGE A;  1K76 A;  1ABO A;  1K0S A;  1U5S A;  1H92 A;  1YCS B;  1Z9Q A;  2DX1 A;  2O2O A;  2KNB B;  4AFZ C;  2OAW A;  1NEB A;  1W70 A;  2RQU A;  1HSQ A;  1K9A A;  1NLP C;  1SEM A;  2CUD A;  3RNJ A;  2IIM A;  4JZ4 A;  4FSS A;  4HXJ A;  2DL7 A;  2JTE A;  4HCK A;  1OV3 A;  1JXM A;  1X6G A;  1MV0 B;  1I1J A;  2AZV A;  1M8M A;  3EGU A;  1GCQ A;  2EYZ A;  2KXD A;  2O9V A;  1ABQ A;  1CSK A;  2DL5 A;  2HDA A;  1UHC A;  2J6F A;  1N5Z A;  4OMQ A;  5GJV B;  3VS3 A;  1VYT A;  2GBQ A;  1KFZ A;  3M0U A;  3I35 A;  1UUE A;  3PVL A;  4AFU C;  3RBB B;  1FYN A;  2VWF A;  1ZBJ A;  3VS7 A;  1E6G A;  4J9G A;  3PE0 A;  5IH2 A;  2YT6 A;  2JM9 A;  4Z8A A;  3TVT A;  3M0Q A;  1AZG B;  1UG1 A;  2KXC A;  1UEC A;  3EHR A;  4JJB A;  2DL3 A;  4EIK A;  3O5Z A;  5FWB A;  1WIE A;  2LMJ A;  4OMP A;  4J9H A;  2C0T A;  2CUB A;  1I0C A;  1LCK A;  1S1N A;  2F2W A;  2DLP A;  1XOV A;  2F2V A;  2LQN A;  1SHG A;  3SEM A;  2DVJ A;  2KR3 A;  3H0I A;  1HJD A;  2ROT A;  2DL4 A;  5L23 A;  5I11 A;  1E7O A;  1GCQ C;  3EHQ A;  2JMC A;  1BU1 A;  2H8H A;  2DF6 A;  3IQL A;  2J6K A;  4LUD A;  1W1F A;  1ZUK A;  2OJ2 A;  4J9D A;  4CC4 B;  2A37 A;  2LCS A;  2J05 A;  1PRM C;  1GFC A;  1J3T A;  2O31 A;  5FW9 A;  1K0X A;  2D0N A;  2ABL A;  1M27 C;  1WX6 A;  4RTU A;  1WYX A;  2ECZ A;  2MOX A;  2CRE A;  2PZ1 A;  1SPK A;  2DL8 A;  1PKT A;  2YUP A;  3ULR B;  2F2X A;  2KRO A;  4AG1 C;  1X43 A;  2DBK A;  2V1R A;  3M0P A;  3R6N A;  4GBQ A;  2E5K A;  1RLQ C;  2DRM A;  1KIK A;  2KEA A;  2P4R A;  1HD3 A;  1UFF A;  4WCI A;  3M0T A;  2BTT A;  1AWJ A;  2MIO A;  3VRY A;  3QWY A;  2CSQ A;  1QWF A;  1ZUU A;  2EQI A;  4ORZ A;  1PHT A;  1RUW A;  2CH4 W;  1Y57 A;  1U3O A;  2FPE A;  1WXT A;  4JJD A;  2EBP A;  4JPB W;  3CQT A;  1M30 A;  2KT1 A;  2RQT A;  1ZSG A;  2B86 A;  2K2M A;  4RUG A;  1X2Q A;  2HCK A;  2EYX A;  2EW3 A;  2M0Y A;  1X27 A;  3VS1 A;  2FO0 A;  2ED0 A;  2NWM A;  2RF0 A;  4JZ3 A;  2PTK A;  1VYU A;  2QDL A;  1V1C A;  4QT7 A;  1NEG A;  2EYY A;  2RQR A;  2GGR A;  4F17 A;  4Y92 A;  2JS2 A;  3LH5 A;  5IXB A;  3UA6 A;  3NPF A;  4OMO A;  3M0S A;  4IIO A;  4X1V A;  1I07 A;  2DM1 A;  3PVQ A;  2LQW A;  2DRK A;  1SHF A;  2JS0 A;  3VS0 A;  2W10 A;  2K3B A;  3I9Q A;  1X69 A;  3TSW A;  4E6R A;  2J7I A;  2O9S A;  2A08 A;  3SHW A;  4F14 A;  1GCP A;  1IO6 A;  2GNC A;  2KRM A;  2DBM A;  2RNA A;  1ZLM A;  5IHI A;  1X2K A;  2KT8 A;  1YWP A;  3UF4 A;  1NYF A;  1TG0 A;  2RN8 A;  2PNI A;  1AD5 A;  2FRW A;  1NLO C;  2OI3 A; 
#chains in the Genus database with same CATH topology
 4M78 B;  5FU7 B;  4RTT A;  4N4G A;  3L42 A;  3CBM A;  2DIQ A;  3O8V A;  3FJ5 A;  2AK5 A;  5FRM A;  3THK A;  3FB9 A;  3E2U A;  1X6B A;  2LZ6 B;  4N4I A;  1MV3 A;  1QCF A;  3UPU A;  2J06 A;  5GAN 5;  3CCL A;  2L3Q A;  2FPD A;  3CD6 Q;  4QVD A;  1VQL Q;  1BB9 A;  1PD0 A;  1B07 A;  1VOM A;  4OMN A;  3SWN C;  2E6Z A;  1G83 A;  4IIM A;  3A8H B;  3QO3 A;  3CC2 T;  3EG3 A;  2YSQ A;  3E9G A;  5IXF A;  5IHN A;  1D0Z A;  2LJ0 A;  1DJ7 B;  1G2B A;  2CZ7 B;  4LE9 A;  4M7A G;  5KYW B;  2CDT A;  3MHX A;  3HSB A;  4ME7 A;  5GAN h;  3G71 Q;  2YRD A;  4XTX A;  4CC3 A;  5ECA A;  2RI5 A;  2NUP B;  2OTJ T;  4Y28 E;  2NUZ A;  1IB8 A;  2HL3 A;  4GLM A;  3A8G B;  3CCV T;  4BI8 B;  2QQ9 A;  2AKL A;  1M3C A;  2A28 A;  3LX7 A;  1BK2 A;  1WHK A;  1T3L A;  4ZTJ A;  5I2S A;  2O01 E;  3WXM B;  5GAM e;  1OEB A;  4JJC A;  3LWH A;  2DXC A;  1VQ4 A;  5HKC A;  4RG2 A;  1NJI R;  1VQN A;  2HBW A;  1R8O B;  1NPP A;  1XQH A;  3A98 A;  2A36 A;  1Q81 U;  4XU0 A;  3GLX A;  2O88 A;  3VS5 A;  2Y90 A;  5L8R E;  1KQ2 A;  2YRV A;  5KYU B;  1WQ7 A;  2EJ9 A;  1VYV A;  2X4X A;  4MZP A;  3OYG A;  3EH2 A;  1RI0 A;  3CMA T;  3CME T;  2RI3 A;  3HRT A;  2AHJ B;  2FZK B;  4GY5 A;  3OS1 A;  3LGL A;  4A4G A;  1A0N B;  3OYL A;  2GTJ A;  4HVU A;  2FRY A;  3H0H A;  2CP0 A;  2R5M A;  4M7D D;  2K9G A;  3URG A;  2RHZ A;  5KYN A;  1M2O A;  4KUD K;  1CKA A;  4FW1 A;  4M7A B;  1TH7 A;  2R58 A;  2DTH A;  4M7D C;  1WXU A;  4M4Z A;  1Q81 R;  3OS0 A;  4F7U A;  2PU9 B;  3GF5 A;  1YN8 A;  2KGT A;  4DBQ A;  1K73 R;  4N0A C;  1T0H A;  4J6W A;  1QMC A;  3L1A A;  3TQ7 P;  4IUR A;  2MI6 A;  2R5A A;  5LJ5 e;  3REA B;  2W0Z A;  4C8Q A;  3PMI A;  2PUO B;  1QWE A;  1R0B G;  3PIO A;  2XG8 D;  1WNL A;  1PKS A;  5CVI A;  4O5V A;  2CT4 A;  4PFP A;  4AFQ C;  4IUP A;  4YTL A;  3CC7 Q;  4ZNX A;  4EMK C;  1AOJ A;  1T3S A;  4A4H A;  2ZPG B;  1KD1 C;  4M75 F;  1WHG A;  1QVP A;  3G4S Q;  4JDS A;  1PC0 A;  1WXB A;  2HMA A;  2K7A A;  3CCR A;  4AT1 B;  1K73 C;  5CAI A;  5LJ5 d;  1G3S A;  4RTV A;  4DOV A;  2VB6 A;  2RH2 A;  5CKH A;  5LJ3 f;  3CCU Q;  3V8J A;  2VVK A;  3QBY A;  4J9B A;  1Q95 G;  1QLY A;  2CT3 A;  4LDV A;  2RD1 A;  2RMO A;  4A4K A;  2K79 A;  1OOT A;  1PD1 A;  2SRC A;  4ZGJ B;  1KHC A;  3CCL T;  2JTF A;  4LN2 A;  4M77 E;  1QVG A;  2RI2 A;  2FG0 A;  1SF9 A;  2PQW A;  4C5I A;  2P84 A;  2KE9 A;  1M3B A;  5I21 A;  4D8D A;  1IHV A;  4J6X A;  1QW1 A;  1W4S A;  1WHM A;  3S6W A;  1K76 A;  1QQJ A;  2DK3 A;  4QW2 A;  1K73 U;  1VQP Q;  2QEX T;  3OYB A;  1YJ9 A;  4EMH A;  4J6Y A;  2M16 A;  4C92 C;  2O2O A;  2KNB B;  2X9H A;  3EFS A;  1NJI C;  2XU8 A;  3ME9 A;  4MDW A;  2FZC B;  3VUZ A;  2E10 A;  1SEM A;  3JCM X;  4ZN1 A;  4MMK A;  3CCE A;  2EQU A;  3CC4 Q;  2VYT A;  1OV3 A;  1VQ5 T;  2HAX A;  4JLI A;  1YBY A;  3QYH B;  5KYU A;  4ANJ A;  1UB4 A;  2KI7 A;  4QVZ A;  1GCQ A;  2KXD A;  5CKB A;  1ABQ A;  1VQM T;  2HDA A;  1QP3 A;  4N0A A;  1N5Z A;  2RJF A;  1FXX A;  5GMK j;  2RA2 A;  1C6V X;  3PVL A;  4AFU C;  3CCM A;  3EFR A;  4PFO A;  1E6G A;  2JM9 A;  1IGQ A;  1UG1 A;  2KXC A;  4KBM B;  2DL3 A;  3G6E T;  4M75 D;  1M8V A;  4EIK A;  1NJI U;  1D1B A;  2LMJ A;  2WSF E;  4ELY C;  1M1K U;  3FC3 A;  2C0T A;  5DM7 R;  1I0C A;  1RAI B;  3QJY A;  1ZBX A;  2F2V A;  2OTL T;  1SHG A;  2DVJ A;  1BYM A;  2DO3 A;  4M77 G;  3EGD A;  2WSC E;  4JRQ A;  1QP2 A;  2JMC A;  2H8H A;  3IQL A;  2WSE E;  1VQ5 Q;  4LUD A;  1W1F A;  2E1H A;  2E12 A;  1IXD A;  1MMG A;  5LJ3 e;  1PRM C;  1GFC A;  5IAY A;  2E6N A;  2BE7 D;  2BE9 B;  3A8M B;  1M1K R;  4RTU A;  1K9M R;  1SPK A;  1PKT A;  2E3I A;  2KY9 A;  3ULR B;  2LVM A;  2P4T A;  2YLB A;  3HFN A;  3M0P A;  1UGQ B;  4OB2 B;  2E5K A;  1N8R R;  1HD3 A;  3MJX A;  1VQ9 Q;  4OGE A;  1N27 A;  2DYI A;  1AWJ A;  2QA4 Q;  2XD0 A;  2R57 A;  2PVD B;  3M9Q A;  4FYV B;  2K2V A;  2ZZD A;  1RUW A;  1D3B A;  2DEU A;  3INZ A;  4J7F A;  2DXU A;  5KYX A;  3GNF B;  3G71 A;  2EBP A;  5DLQ E;  1VQ9 A;  4BY6 B;  5AYF A;  5LJ5 f;  2RHX A;  3FLG A;  3RKY A;  4FU6 A;  4IKF A;  2M0Y A;  1X27 A;  3L2W A;  3VS1 A;  2NWM A;  2PTK A;  2QDL A;  2ZPE B;  3JCM Q;  4QT7 A;  2LTO A;  2EYY A;  4FT2 A;  2GGR A;  2LT1 A;  3G1J A;  3LH5 A;  2QA4 T;  4M75 E;  4M78 C;  5FU7 C;  4PJO D;  3G4S T;  1RL2 A;  4X1V A;  5CO7 A;  3OMG A;  2M1H A;  2JS0 A;  2K3B A;  3CPW A;  2CZ1 B;  2A08 A;  4LD9 K;  4A4F A;  1IO6 A;  2GNC A;  3V7S A;  2DER A;  2DBM A;  5GAN 3;  1Y96 B;  4M7D A;  3VYG A;  2GCX A;  3UF4 A;  1EZZ B;  1YJN Q;  3SWN B;  2FRW A;  4CI0 C;  3MP8 A;  3LYI A;  2CP6 A;  3CCL Q;  2L3S A;  3GPL A;  3P8B B;  1YIT Q;  2DXT A;  1VQP T;  1W6X A;  1NPR A;  2EGA A;  2D8J A;  4E7L A;  1JXO A;  1R0C B;  4M7D E;  3CCS Q;  1IZ6 A;  4FT4 A;  1YFN A;  2HSP A;  1SRM A;  3H0F A;  4M75 A;  3J7A F;  1M1F A;  3OYM A;  5GAN g;  3CCE T;  2FPF A;  3L2V A;  1NBE B;  1UJ0 A;  1QVF S;  2DJQ A;  4C5G A;  5CCA A;  3S3O A;  4KUI A;  3OA6 A;  1Z9Z A;  1BCO A;  1BIB A;  2MYS A;  2NUT B;  4HVW A;  1K9M C;  1JU5 C;  1UJY A;  1OX9 A;  3JAM E;  4DEY A;  1TUC A;  4HVV A;  1VIE A;  3JCM c;  1OPL A;  1LVK A;  1WA7 A;  1N8R C;  4XTY A;  2CP5 A;  2JW4 A;  2KYM A;  3X20 B;  1MMD A;  1PRL C;  3VV0 A;  5GMK i;  2OTL Q;  1VQ5 A;  2DMO A;  3EH1 A;  1M90 C;  1M90 R;  5GJW B;  2KYB A;  1Q7Y R;  1Q82 R;  2X4W A;  2YWW A;  4F7U F;  2ZPF B;  5IN1 A;  5LJ3 d;  4JRK A;  4WTO B;  1UE9 A;  4LUE A;  2PVG B;  3CC7 T;  2XKO C;  3C0C A;  3JB9 I;  2QDY B;  1WLP B;  4IUU A;  1VQ4 T;  2JTM A;  2KRS A;  4KRT A;  3TRE A;  3SWN A;  3VUB A;  4IUT A;  2YRC A;  3RMQ A;  3A8O B;  1N8R U;  3EG1 A;  1OI1 A;  3HP9 A;  2FZG B;  2FL7 A;  3RR6 A;  3BDL A;  3A5Z B;  2CZ0 B;  2ZAE A;  1XNI A;  2DNU A;  1OZ2 A;  1VQO Q;  1WJQ A;  5CKF A;  5AT1 B;  2DTO A;  3VS2 A;  2K5L A;  5I22 A;  4NL3 A;  4FCY A;  4XU1 A;  2KDS A;  2DPP B;  2JXB A;  5CR2 A;  2CZ6 B;  1D0Y A;  1VIF A;  2LDM A;  1BBZ A;  3VJP A;  2HNI A;  1SG5 A;  1UGR B;  1W2B P;  2HBP A;  3QSU A;  5J3B A;  4DQ2 A;  4R0K A;  3ZEH A;  1M3A A;  3PT9 A;  4LDY A;  2K3X A;  1AZE A;  2P0K A;  2MCN A;  1UDL A;  2AZS A;  4CRI A;  2DD4 A;  3R6O A;  2KBT A;  2D8H A;  5GAO r;  5EC7 A;  4QKU A;  4BD3 A;  3HFO A;  4C8Q B;  1KSW A;  1RAH B;  3UAT A;  1N9S A;  4J9E A;  1KJW A;  4OB3 B;  4DBF A;  4CC2 A;  1SKU B;  3NTH A;  1UEB A;  2CP7 A;  4C0G A;  2G3R A;  2VUB A;  3CCQ Q;  1EIF A;  1RAA B;  2L3P A;  1KD1 R;  2RQV A;  3QZ5 B;  1M1K C;  5GAO p;  3OYF A;  1GBQ A;  2L3R A;  1QKX A;  2YDL A;  2K5F A;  2DTI A;  3M0R A;  1JQQ A;  1WHJ A;  3I5S A;  4JUV A;  2WAC A;  1ZSZ B;  1B34 A;  4OMF B;  3JCM P;  1IRE B;  3UWN A;  1U06 A;  2YXY A;  2C06 A;  1Q82 U;  1EX4 A;  3NHN A;  1TTH B;  3CCJ Q;  1JEG A;  1EFN A;  2EQK A;  3FEO A;  2JMA A;  2JZ2 A;  2VGM A;  1VQ8 Q;  2J6O A;  4E7S A;  2BUD A;  1ABO A;  4EMG A;  4C8Q D;  1K0S A;  2X35 A;  4JS4 A;  1YCS B;  1Z9Q A;  4II1 A;  1M2V A;  4JRP A;  2FHD A;  1XJW B;  1YJW A;  4IUV A;  1HSQ A;  1K9A A;  2CUD A;  1Q86 U;  2ATC B;  2CP3 A;  2VC8 A;  3GOX A;  4HXJ A;  2DL7 A;  2JTE A;  3QKJ A;  4R56 A;  4HCK A;  4C92 F;  3C95 A;  1RAB B;  3I56 Q;  4OVA A;  2CS7 A;  1LOJ A;  1WGS A;  2I2L A;  2OAU A;  2RHI A;  1TS9 A;  5CK9 A;  2DL5 A;  5GAO l;  3MO8 A;  1WJR A;  5KYX B;  3OS5 A;  1KQS A;  3VS3 A;  4M77 B;  5HY6 A;  1VQL A;  4M77 D;  3M0U A;  2LX9 A;  2P0Q A;  3RBB B;  2VWF A;  1YHQ T;  1ZBJ A;  4M78 F;  2V26 A;  1UEC A;  3CD6 T;  2E65 A;  4QQD A;  3S3M A;  3JSC A;  9ATC B;  4A54 A;  5FWB A;  1WIE A;  3BE3 A;  4M7A F;  3EAE A;  1D0X A;  4OMP A;  1Q86 C;  1Q86 R;  1U1S A;  1LCK A;  1ACM B;  2DLP A;  2GFU A;  1VQ4 Q;  4M7D F;  2QTV A;  3MEA A;  4DA4 A;  2HD0 A;  2DD5 A;  2NUT A;  2D0Q B;  3JCM h;  1E7O A;  2O4X B;  1YJN T;  2DF6 A;  2K4Y A;  1D1C A;  1OUL A;  2OJ2 A;  2QQB A;  5FW9 A;  1NE8 A;  2ABL A;  3C4S A;  4BUG A;  1M27 C;  4JJN K;  2LC4 A;  1WYX A;  2MOX A;  5DLO A;  4M77 A;  3KBG A;  4AMC A;  2LT4 A;  2XI9 A;  2F2X A;  2XID A;  2V1R A;  5D7U A;  3JB9 H;  1RLQ C;  1VQK T;  2P0P A;  5EG2 A;  3M0T A;  4BY6 C;  3OS2 A;  2K5I A;  2L5Q A;  3CPW P;  4DOW A;  3CCS T;  3QWY A;  4MDX A;  3HPW A;  2X4J A;  1JB0 E;  4FM4 B;  1Y96 A;  3CC2 A;  2KK4 A;  4FL6 A;  3N5B B;  3OYY A;  1VQM A;  4E7K A;  2FPE A;  2PVO B;  2JN0 A;  4Z02 A;  1Q7Y C;  2E3H A;  5GAM j;  4PJN A;  3M59 A;  3CCM T;  2RQT A;  4O6J A;  1X2Q A;  3HRU A;  1YI2 T;  1JBM A;  3CXC S;  2FO0 A;  1VQ9 T;  4M78 E;  4JZ3 A;  2QG9 B;  4M75 C;  2E5Q A;  3CCQ T;  2JS2 A;  1KQ1 A;  3NPF A;  8AT1 B;  4IIO A;  5D6W A;  1I07 A;  4RCC A;  4X34 A;  3PVQ A;  3VS0 A;  5GAN 2;  3TSW A;  1OU9 A;  5GAO q;  2QXF A;  5A0D A;  2J7I A;  4JLG A;  3TEE A;  1GCP A;  1FWZ A;  1RAG B;  3QJ6 A;  2KRM A;  4C92 D;  3OBY A;  5IHI A;  3S3N A;  1X2K A;  2RM4 A;  2DIG A;  2KT8 A;  2COW A;  2RN8 A;  4ZN3 A;  1AD5 A;  3FDR A;  3P8H A;  2QGF B;  2D9T A;  2RJE A;  4OP0 A;  4RKU E;  2OI3 A;  4KT0 E;  1PNJ A;  4PL6 A;  2C0O A;  5D6X A;  1JJ2 A;  4JS5 A;  1G5V A;  1PSF A;  2DIL A;  1KHI A;  1G3Y A;  2NLU A;  3QXE B;  3QHS A;  3SB2 A;  5LJ3 j;  4KGX B;  4PKC C;  2JVV A;  2DAQ A;  3MEW A;  2G6F X;  3H6Z A;  3RDV A;  3NTI A;  1B3Q A;  1R77 A;  1AEY A;  1UHF A;  3A8L B;  5FWC A;  3V8L A;  2KQW A;  3QUI A;  1KG1 A;  5HK0 A;  1RAC B;  1IGU A;  8ATC B;  2YUN A;  3I56 A;  1IHW A;  1PWT A;  3WVE B;  1KC8 C;  3ZFJ A;  1T0J A;  5GAN d;  1AHJ B;  1YWO A;  3LWI A;  2DA9 A;  4M7D G;  3BW1 A;  1TXQ A;  4BE2 A;  1X75 C;  1G8X A;  4M7A C;  2LNH B;  2JT4 A;  4HCZ A;  3NFC A;  1K8A R;  2QA4 A;  3QG1 A;  2L0A A;  1QVG P;  3I5R A;  3CCV A;  1VQ8 A;  4VUB A;  1AWX A;  4PJO B;  3QWX X;  4BI3 A;  2XHC A;  4B9W A;  5KH6 A;  5HCK A;  1M2V B;  4F7U G;  4DEX A;  3H41 A;  4ZTF A;  1SRL A;  2K6D A;  3PFS A;  1O75 A;  4Q5W A;  5KYY A;  4Z88 A;  1YNZ A;  5GAO n;  2V8K A;  3CCE Q;  2HEQ A;  2RK1 A;  3ZBD A;  1YCY A;  1YJN A;  5M9O A;  4AG2 C;  4F16 A;  5LJ3 g;  3L2Z A;  1B34 B;  3KXT A;  3KFV A;  1K8A C;  1YJ9 Q;  4J9F A;  4PJO E;  3ZL7 C;  1VQP A;  3CXC P;  2EYW A;  1D09 B;  1GBR A;  3MKD A;  5A0G A;  3OY9 A;  3REB B;  1QKW A;  4JRI A;  1WZO A;  1AWO A;  1RAE B;  3NGP A;  1MND A;  3OYJ A;  4PJJ A;  4C92 E;  2EGC A;  1KC8 R;  1BI0 A;  3QZ9 B;  1MUZ A;  1ARK A;  4FYY B;  2ROL A;  1HXD A;  1RAF B;  4M7A D;  1QCO A;  2MK5 A;  4HA8 A;  3BFM A;  2RB6 A;  3EG0 A;  4RTX A;  1RI9 A;  4PJL A;  4CC7 A;  1V76 A;  3RER A;  2XK0 A;  4P5N A;  4C0D B;  5FRO A;  4FYX B;  1H8K A;  4XTV A;  4C8Q C;  3LW5 E;  1YJ9 T;  5KE2 A;  4Y91 A;  1OPK A;  1WI7 A;  2EVR A;  1QVG S;  3H8Z A;  2IVW A;  2V1Q A;  4ATO A;  2QYZ A;  4J9I A;  1K8A U;  3OSV A;  1SSH A;  4E7Z A;  4QQ6 A;  1VUB A;  1BKB A;  2HQX A;  1OZ3 A;  2IPO B;  2I0N A;  1GRI A;  4D6W A;  1YI2 Q;  2Z0W A;  3SFM A;  2JM8 A;  2D1X A;  2DEQ A;  3CCV Q;  1NYG A;  1KQS S;  2DVE A;  1PSE A;  3JCM e;  4BDY A;  5GMK m;  2XIC A;  3CC7 A;  2M51 A;  4K11 A;  4ELZ C;  2QTX A;  3JB9 G;  4HCB A;  1N6A A;  3VS6 A;  4J9C A;  4RMO A;  1I5O B;  3LGF A;  4XTZ A;  4ZGD B;  1OX8 A;  3OYC A;  3JCM W;  4KUL A;  1FMW A;  3X24 B;  3CC4 A;  2Y4Y A;  3X26 B;  3CCQ A;  2X3X D;  1H3Z A;  5GAM f;  2MPX C;  3OYK A;  2SEM A;  5LJ5 j;  4M7D B;  1H3H A;  3CCR T;  2ZPH B;  1BI3 A;  4AFS C;  4XK8 E;  2DZC A;  1M1G A;  1JJ2 P;  2EWN A;  3CBO A;  2ESW A;  1WFW A;  2JJ9 A;  4FYW B;  1E6H A;  2EPD A;  2DE0 X;  1H64 1;  4J83 A;  1P92 A;  1TUD A;  3EG9 A;  2OTL A;  2HKQ B;  3T9N A;  3OYE A;  4KGZ B;  2CH4 A;  2D6F A;  1ZA1 B;  4C0Z A;  2CP2 A;  4FW2 A;  5KE3 A;  4LNP A;  2YUQ A;  3RKW A;  2V8I A;  3CEY A;  3HTR A;  1GL5 A;  3JB9 J;  3EFO A;  1S72 A;  4C0F A;  4B9X A;  2BIV A;  3OSS C;  3M4G A;  5CIU A;  1MMA A;  4RCB A;  1ZA2 B;  2DX1 A;  1I8F A;  2OAW A;  4M78 G;  2QK0 A;  2FVU A;  3MP1 A;  1W70 A;  1OU8 A;  2RQU A;  2QEX A;  4KH1 B;  4L6V 5;  5GAN j;  5C0M A;  2IIM A;  4XU2 A;  4JZ4 A;  4FSS A;  2E4H A;  3CCR Q;  3OYD A;  3M5A A;  2OX7 A;  2AZV A;  3A1P A;  1M8M A;  4XAX B;  1AT1 B;  1QVF A;  2RO0 A;  3L2Q A;  2EYZ A;  2O9V A;  3LLR A;  1CSK A;  2H3E B;  1UHC A;  2J6F A;  2M9U A;  3QDF A;  4OMQ A;  5LJ3 h;  4V2S A;  2K57 A;  4LDW A;  1KFZ A;  4PJO A;  3G6E A;  3CPW S;  3FJP A;  4IUQ A;  1FYN A;  2JOY A;  3VS7 A;  3M54 A;  4J9G A;  1IRX A;  3C12 A;  2YT6 A;  5J39 A;  3E19 A;  3LH0 A;  4F7U E;  1VQL T;  1AZG B;  4JJB A;  3TCJ A;  4LDX A;  3GP8 A;  4X9D A;  3O5Z A;  1YHQ A;  1YHQ Q;  3CC2 Q;  4PNO A;  4J9H A;  2CUB A;  2F2W A;  2EIF A;  1X01 A;  1TUG B;  2DJZ A;  2RJC A;  2LQN A;  3SEM A;  1Q81 C;  2DL4 A;  1YIJ T;  5I11 A;  3EHQ A;  3JCM b;  2J6K A;  4EDU A;  1VQ7 Q;  4PJO F;  4J9D A;  2A37 A;  4XTU A;  2LCS A;  3D7S B;  2ZGW A;  2J05 A;  1J3T A;  3UDC A;  2D0N A;  1VQ6 Q;  3AT1 B;  2XDP A;  2YLC A;  2ECZ A;  4E7H A;  2KAF A;  2CRE A;  2PZ1 A;  2DL8 A;  2EFI A;  2LQ8 A;  2EJG A;  2YUP A;  3OYA A;  4J5Y A;  4AG1 C;  1WHH A;  1YJW T;  1W2B S;  2QEX Q;  4PLI A;  2DRM A;  1KIK A;  2KEA A;  5GMK l;  1UFF A;  1KC8 U;  2EQJ A;  1D1A A;  1I4K 1;  2A7Y A;  4LD6 A;  4NL2 A;  2CSQ A;  1ZUU A;  1VQK A;  3VYH B;  2EQI A;  1PG5 B;  4M75 B;  3V7R A;  2V8J A;  1PHT A;  4ORZ A;  4BDZ A;  1VQ7 T;  2CH4 W;  5FU6 B;  3G7Z A;  2AT1 B;  3JCM V;  4JJD A;  4BAC A;  1M9S A;  4JPB W;  3BY7 A;  1TWB A;  2ZPI B;  3Q1J A;  2KT1 A;  2B86 A;  2HZY A;  2K2M A;  1W2B A;  2HCK A;  4BI4 A;  2EW3 A;  3NTK A;  1YJW Q;  1UGP B;  2FYK A;  2ED0 A;  4M78 D;  4KGV B;  1VYU A;  1V1C A;  4PLL A;  4BB7 A;  2M02 A;  3CCU A;  1NEG A;  5GAN f;  3J80 E;  2LNV A;  1LJO A;  5IXB A;  1TU0 B;  3CCJ T;  1C1A A;  3UA6 A;  4OMO A;  1TSF A;  3RMS A;  2DM1 A;  1MNE A;  3M55 A;  1SHF A;  1VQN T;  3F70 A;  3I9Q A;  1X69 A;  3X25 B;  4E6R A;  1NZ9 A;  2O9S A;  3SHW A;  3G4S A;  1I5L A;  2BKD N;  2E70 A;  3HKS A;  3CCM Q;  5GAN 8;  1ZLM A;  2EJF A;  3PMT A;  4L5G A;  4HCC A;  2VXE A;  4M77 F;  3VKI A;  1VQM Q;  2JUF A;  3GBQ A;  4E47 A;  2L8D A;  2L2P A;  2ZPB B;  3MEU A;  2FB7 A;  4C8Q E;  1S72 T;  4BE0 A;  2EYQ A;  1O9S A;  2RJD A;  1RLP C;  2X4Y A;  3VRZ A;  2XDD A;  1UTI A;  5KYW A;  2DYB A;  4A63 B;  4J7I A;  3UT1 A;  2B8A A;  2GQI A;  3G6E Q;  1RAD B;  2GTO A;  5A2Q E;  3EFO B;  4J8O A;  2COZ A;  3NMZ C;  1XTD A;  1G3T A;  4OGC A;  5CKE A;  1FMV A;  1VQO A;  2LP5 A;  3EG9 B;  1JO8 A;  4PJO C;  2VKN A;  2RPN A;  4WF2 A;  5C6S A;  2KSS A;  3EG2 A;  3CPF A;  2HL5 C;  3PGG A;  4MZT A;  3DB3 A;  3BDU A;  4X9C A;  1VQ7 A;  4B6M A;  1K1Z A;  1WQW A;  2L89 A;  4NS5 A;  2QQA A;  2RQW A;  3OQ5 A;  1N9R A;  2MAM A;  1S72 Q;  2VAS A;  4OMM A;  3JCM d;  2MMP A;  3KUF A;  2X3W D;  4C8Q G;  2QAS A;  5FRN A;  2KRN A;  3E1S A;  2EAY A;  4ESR A;  1PCX A;  3X28 B;  3CME A;  1VQ8 T;  1G3W A;  1V29 B;  1BI1 A;  3U23 A;  4UC4 A;  5GAN e;  2BZ8 A;  4M7A E;  3JCM J;  3OYI A;  3JB9 D;  3L2R A;  1CKB A;  3DB4 A;  1ZX6 A;  2AIR B;  1AWW A;  5KYY B;  3DLM A;  5HK3 A;  2LJ1 A;  2CGH A;  4MZM A;  3VS4 A;  2DZ9 A;  2RK2 A;  4C0D C;  1MHN A;  2ENM A;  2DET A;  5GAM h;  3H9N A;  5A0L A;  2CSI A;  2EQM A;  4F04 B;  3GNG A;  1OYX A;  1Y7X A;  3FRN A;  1WDX A;  1YP5 A;  2YUO A;  3M57 A;  1VQ6 T;  1FMK A;  1Y07 A;  3TSZ A;  2QQR A;  2M0O A;  3E9F A;  4BE1 A;  1UGS B;  2BZX A;  2GF7 A;  1NM7 A;  1YIT A;  2QAZ A;  1AVZ C;  1ZSZ C;  4RTW A;  4XTW A;  2C0I A;  3HL8 A;  5CQX A;  1LPL A;  4TVR A;  2H3J A;  3M4Y A;  3P8D A;  4NOY A;  1GXI E;  3JB9 F;  4OB0 B;  2BZY A;  1NG2 A;  2F1L A;  3OB9 A;  2ED1 A;  1HK9 A;  1PM3 A;  1QCN A;  3MPU B;  2A3L A;  2DKG A;  4A4E A;  1UGV A;  3PTA A;  4MML A;  3DKM A;  1SSF A;  1Y71 A;  2VGN A;  1QVF P;  4LDU A;  3MP6 A;  2LX7 A;  3MEV A;  2VV5 A;  1X6O A;  4RTZ A;  5IHK A;  1MGQ A;  1YIJ Q;  2K3Y A;  3CCU T;  3RIR A;  1M4Z A;  4C5E A;  2HKN A;  2LJ3 A;  4M7A A;  3RKX A;  2XMF A;  1VQK Q;  1KQS P;  3CMA Q;  2NYS A;  4D8K A;  3CCJ A;  5CQY A;  4LXC A;  3OW2 S;  3AHU A;  3I55 A;  4EMK B;  2HSE B;  2KMT A;  3M56 A;  3CC4 T;  4PJM A;  1ZUY A;  2NUP A;  3EGD B;  2QGG A;  2RHY A;  1GFD A;  2HQE A;  4M77 C;  4OML A;  3ASK A;  1Y0M A;  3JV3 A;  5LJ5 g;  4R55 A;  1K4U S;  2FEI A;  4Z89 A;  2LRQ A;  5I2M A;  1VA7 A;  3HRS A;  5KCO A;  3I55 Q;  3EGX A;  4C8Q F;  1BIA A;  3UA7 A;  3QII A;  2EKH A;  2AKK A;  1TOV A;  1ZQ1 A;  4RTY A;  3FIF A;  3HHT B;  2DXB A;  2EGE A;  2LCL A;  2DFU A;  2PUK B;  1U5S A;  2LQK A;  3OYN A;  3MET A;  2MF2 A;  1H92 A;  4AFZ C;  2LCC A;  2MWP A;  1NEB A;  3PIP A;  4HT8 A;  4A53 A;  2QI2 A;  5GAN 7;  3RNJ A;  1NLP C;  2JNG A;  2Y4X A;  1HYO A;  3VU3 C;  4HKE A;  3G71 T;  2QQS A;  3M58 A;  4F7U B;  1Q82 C;  2HQH A;  4HT9 A;  2OTJ Q;  1JXM A;  1BCM A;  1X6G A;  3EGX B;  1MV0 B;  1JRI A;  1I1J A;  1YIT T;  1WPY A;  3EGU A;  3GIB A;  1VQO T;  4FIB A;  4C92 B;  3L2U A;  5LL6 S;  1KD1 U;  1ZHI A;  5GMK e;  2X51 A;  2F5K A;  5GJV B;  1VYT A;  2GBQ A;  3MCA B;  3I35 A;  3SDZ A;  4FSX A;  3CD6 A;  1UUE A;  5CKD A;  3OYH A;  4E7J A;  3PE0 A;  5IH2 A;  1OQK A;  3QPH A;  4Z8A A;  3TVT A;  3M0Q A;  3EHR A;  2IG0 A;  5J26 A;  1M90 U;  2EKO A;  2VXF A;  6AT1 B;  1JJ2 S;  1K9M U;  3SD4 A;  1M5Q 1;  1S1N A;  3RUX A;  1VQN Q;  1XOV A;  2F69 A;  5GAN 6;  4PK4 A;  4E7I A;  3CBP A;  1LNX A;  1C0M A;  4ZGE B;  1HJD A;  2KR3 A;  3H0I A;  2ROT A;  5L23 A;  4EPC A;  1GCQ C;  3V8K A;  2RHU A;  4M78 A;  1I81 A;  1BU1 A;  4XU3 A;  3V7C A;  4C92 G;  4DBR A;  3RES A;  1ZUK A;  4CC4 B;  2GFA A;  1YIJ A;  1VQ6 A;  1BI2 A;  2O31 A;  1K0X A;  4QQG A;  3WVD B;  1U8R A;  1WX6 A;  2MWO A;  4DBH A;  4PJO G;  5FLX E;  5FU6 C;  4N4H A;  2KRO A;  2CKK A;  3JRZ A;  3CME Q;  3CXC A;  1MMN A;  1X43 A;  2DBK A;  3R6N A;  4C92 A;  3TU4 K;  5GAM g;  4GBQ A;  3CCS A;  2P4R A;  3QYG B;  4WCI A;  2BTT A;  3DLL A;  4KH0 B;  2A0F B;  7AT1 B;  2MIO A;  2COY A;  3M53 A;  2XDB A;  3VRY A;  1QWF A;  2OTJ A;  4L59 A;  3PNW C;  2O4X A;  3OW2 A;  1Y57 A;  3C94 A;  1U3O A;  1WXT A;  5GAM d;  3I56 T;  1WHL A;  4E2F B;  3JCM g;  3CQT A;  1M30 A;  3OW2 P;  1ZSG A;  4GLK A;  4RUG A;  4C5H A;  2EYX A;  2F5T X;  1WJS A;  2KVQ G;  2RF0 A;  4RG8 A;  3OBW A;  5LJ5 h;  2RQR A;  4QVC A;  5D6Y A;  4M75 G;  4F17 A;  4Y92 A;  1B7T A;  5GMK h;  1YI2 A;  5IT9 E;  3ER0 A;  1ZSZ A;  3CMA A;  3I55 T;  2YHT A;  2GQV A;  4OF1 A;  3M0S A;  5GAN 4;  2E64 A;  5GAO m;  1Q7Y U;  2LQW A;  2DRK A;  2W10 A;  1F1B B;  4XQ3 A;  2ZCF B;  1FX7 A;  4OB1 B;  4F14 A;  3OMC A;  1D3B B;  4EMK A;  3QDR B;  5KCH A;  2CYZ B;  5DY9 A;  3J81 E;  2RNA A;  1YWP A;  1KK7 A;  1NYF A;  1TG0 A;  4PFZ A;  3JCM f;  2PNI A;  2E41 A;  1U1T A;  1NLO C; 
#chains in the Genus database with same CATH homology
 1PNJ A;  3GBQ A;  2C0O A;  4RTT A;  2L2P A;  3FJ5 A;  2AK5 A;  2L3S A;  3THK A;  1X6B A;  2LZ6 B;  1W6X A;  2DIL A;  1MV3 A;  1QCF A;  2J06 A;  2EGA A;  1RLP C;  3VRZ A;  2L3Q A;  2FPD A;  1UTI A;  2DYB A;  4A63 B;  2D8J A;  1JXO A;  2GQI A;  2G6F X;  2GTO A;  1BB9 A;  1B3Q A;  1B07 A;  3H0F A;  2HSP A;  1SRM A;  4OMN A;  1AEY A;  1G83 A;  1UHF A;  5FWC A;  4IIM A;  2FPF A;  3EG3 A;  2YSQ A;  1UJ0 A;  5IXF A;  2DJQ A;  5IHN A;  3NMZ C;  2LJ0 A;  2YUN A;  1G2B A;  4LE9 A;  1Z9Z A;  1PWT A;  4HVW A;  2CDT A;  1JU5 C;  2LP5 A;  1UJY A;  1JO8 A;  1T0J A;  2VKN A;  4DEY A;  1TUC A;  4HVV A;  2RPN A;  1YWO A;  2DA9 A;  3EG2 A;  1OPL A;  1WA7 A;  4CC3 A;  5ECA A;  2JW4 A;  2NUZ A;  2KYM A;  4GLM A;  1PRL C;  2JT4 A;  2LNH B;  1K1Z A;  2AKL A;  2DMO A;  1M3C A;  2A28 A;  1BK2 A;  1T3L A;  2L0A A;  2RQW A;  5GJW B;  2KYB A;  3I5R A;  1AWX A;  4OMM A;  3QWX X;  1OEB A;  4JJC A;  2X3W D;  5HCK A;  4DEX A;  3H41 A;  1UE9 A;  4LUE A;  2KRN A;  1SRL A;  2HBW A;  2K6D A;  4ESR A;  3C0C A;  3A98 A;  2A36 A;  1WLP B;  4Z88 A;  2O88 A;  3VS5 A;  1YNZ A;  3U23 A;  2HEQ A;  1VYV A;  2KRS A;  4KRT A;  2BZ8 A;  4AG2 C;  4F16 A;  1CKB A;  3EG1 A;  1A0N B;  3KFV A;  1ZX6 A;  4J9F A;  3ZL7 C;  1AWW A;  2GTJ A;  2EYW A;  2LJ1 A;  1GBR A;  3VS4 A;  4HVU A;  3REB B;  1QKW A;  2FRY A;  3H0H A;  2DNU A;  2ENM A;  1AWO A;  3VS2 A;  3NGP A;  5I22 A;  2CSI A;  2K9G A;  2EGC A;  1CKA A;  1MUZ A;  1ARK A;  2JXB A;  2ROL A;  1WDX A;  1YP5 A;  2YUO A;  1WXU A;  1FMK A;  4M4Z A;  3TSZ A;  3EG0 A;  4RTX A;  1YN8 A;  2KGT A;  1BBZ A;  1RI9 A;  2BZX A;  4CC7 A;  1T0H A;  1NM7 A;  1H8K A;  2EVR A;  1OPK A;  1WI7 A;  3REA B;  1AVZ C;  2W0Z A;  2V1Q A;  4RTW A;  4J9I A;  2C0I A;  1QWE A;  1SSH A;  4R0K A;  1M3A A;  2I0N A;  1GRI A;  1PKS A;  1AZE A;  2CT4 A;  2JM8 A;  2MCN A;  2D1X A;  1UDL A;  2AZS A;  4AFQ C;  2BZY A;  1NG2 A;  1NYG A;  2KBT A;  2D8H A;  5EC7 A;  4ZNX A;  2ED1 A;  1KSW A;  1AOJ A;  1T3S A;  3UAT A;  4J9E A;  1KJW A;  2M51 A;  4K11 A;  1UGV A;  4CC2 A;  3VS6 A;  4J9C A;  2LX7 A;  1WXB A;  2K7A A;  4RTZ A;  5IHK A;  2X3X D;  2LJ3 A;  2XMF A;  2SEM A;  4RTV A;  4D8K A;  1H3H A;  2L3P A;  2RQV A;  4AFS C;  1ZUY A;  2VVK A;  1GFD A;  4J9B A;  1QLY A;  1GBQ A;  1QKX A;  2CT3 A;  2YDL A;  2ESW A;  2RMO A;  1WFW A;  1E6H A;  2EPD A;  2K79 A;  2DE0 X;  1OOT A;  4OML A;  1JQQ A;  2SRC A;  3M0R A;  1Y0M A;  3JV3 A;  1TUD A;  3I5S A;  1K4U S;  4LN2 A;  2FG0 A;  2FEI A;  4Z89 A;  2CH4 A;  1VA7 A;  1U06 A;  2KE9 A;  1M3B A;  4D8D A;  3NHN A;  4LNP A;  2YUQ A;  3UA7 A;  1JEG A;  1EFN A;  2EKH A;  2AKK A;  2JMA A;  4RTY A;  1GL5 A;  2J6O A;  2EGE A;  1K76 A;  1ABO A;  1K0S A;  1U5S A;  1H92 A;  1YCS B;  1Z9Q A;  2DX1 A;  2O2O A;  2KNB B;  4AFZ C;  2OAW A;  1NEB A;  1W70 A;  2RQU A;  1HSQ A;  1K9A A;  1NLP C;  1SEM A;  2CUD A;  3RNJ A;  2IIM A;  4JZ4 A;  4FSS A;  4HXJ A;  2DL7 A;  2JTE A;  4HCK A;  1OV3 A;  1JXM A;  1X6G A;  1MV0 B;  1I1J A;  2AZV A;  1M8M A;  3EGU A;  1GCQ A;  2EYZ A;  2KXD A;  2O9V A;  1ABQ A;  1CSK A;  2DL5 A;  2HDA A;  1UHC A;  2J6F A;  1N5Z A;  4OMQ A;  5GJV B;  3VS3 A;  1VYT A;  2GBQ A;  1KFZ A;  3M0U A;  3I35 A;  1UUE A;  3PVL A;  4AFU C;  3RBB B;  1FYN A;  2VWF A;  1ZBJ A;  3VS7 A;  1E6G A;  4J9G A;  3PE0 A;  5IH2 A;  2YT6 A;  2JM9 A;  4Z8A A;  3TVT A;  3M0Q A;  1AZG B;  1UG1 A;  2KXC A;  1UEC A;  3EHR A;  4JJB A;  2DL3 A;  4EIK A;  3O5Z A;  5FWB A;  1WIE A;  2LMJ A;  4OMP A;  4J9H A;  2C0T A;  2CUB A;  1I0C A;  1LCK A;  1S1N A;  2F2W A;  2DLP A;  1XOV A;  2F2V A;  2LQN A;  1SHG A;  3SEM A;  2DVJ A;  2KR3 A;  3H0I A;  1HJD A;  2ROT A;  2DL4 A;  5L23 A;  5I11 A;  1E7O A;  1GCQ C;  3EHQ A;  2JMC A;  1BU1 A;  2H8H A;  2DF6 A;  3IQL A;  2J6K A;  4LUD A;  1W1F A;  1ZUK A;  2OJ2 A;  4J9D A;  4CC4 B;  2A37 A;  2LCS A;  2J05 A;  1PRM C;  1GFC A;  1J3T A;  2O31 A;  5FW9 A;  1K0X A;  2D0N A;  2ABL A;  1M27 C;  1WX6 A;  4RTU A;  1WYX A;  2ECZ A;  2MOX A;  2CRE A;  2PZ1 A;  1SPK A;  2DL8 A;  1PKT A;  2YUP A;  3ULR B;  2F2X A;  2KRO A;  4AG1 C;  1X43 A;  2DBK A;  2V1R A;  3M0P A;  3R6N A;  4GBQ A;  2E5K A;  1RLQ C;  2DRM A;  1KIK A;  2KEA A;  2P4R A;  1HD3 A;  1UFF A;  4WCI A;  3M0T A;  2BTT A;  1AWJ A;  2MIO A;  3VRY A;  3QWY A;  2CSQ A;  1QWF A;  1ZUU A;  2EQI A;  4ORZ A;  1PHT A;  1RUW A;  2CH4 W;  1Y57 A;  1U3O A;  2FPE A;  1WXT A;  4JJD A;  2EBP A;  4JPB W;  3CQT A;  1M30 A;  2KT1 A;  2RQT A;  1ZSG A;  2B86 A;  2K2M A;  4RUG A;  1X2Q A;  2HCK A;  2EYX A;  2EW3 A;  2M0Y A;  1X27 A;  3VS1 A;  2FO0 A;  2ED0 A;  2NWM A;  2RF0 A;  4JZ3 A;  2PTK A;  1VYU A;  2QDL A;  1V1C A;  4QT7 A;  1NEG A;  2EYY A;  2RQR A;  2GGR A;  4F17 A;  4Y92 A;  2JS2 A;  3LH5 A;  5IXB A;  3UA6 A;  3NPF A;  4OMO A;  3M0S A;  4IIO A;  4X1V A;  1I07 A;  2DM1 A;  3PVQ A;  2LQW A;  2DRK A;  1SHF A;  2JS0 A;  3VS0 A;  2W10 A;  2K3B A;  3I9Q A;  1X69 A;  3TSW A;  4E6R A;  2J7I A;  2O9S A;  2A08 A;  3SHW A;  4F14 A;  1GCP A;  1IO6 A;  2GNC A;  2KRM A;  2DBM A;  2RNA A;  1ZLM A;  5IHI A;  1X2K A;  2KT8 A;  1YWP A;  3UF4 A;  1NYF A;  1TG0 A;  2RN8 A;  2PNI A;  1AD5 A;  2FRW A;  1NLO C;  2OI3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...