5L23A

Crystal structure of the complex between the n-terminal sh3 domain of crkii and a proline-rich ligand
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
58
structure length
58
Chain Sequence
AEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRGMIPVPYVEKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Adapter molecule crk
publication title Crystal structure of the complex between the N-terminal SH3 domain of CrkII and a proline-rich ligand
rcsb
source organism Mus musculus
total genus 10
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2016-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 5l23A00
1NEGA 3EG2A 2OI3A 4OMQA 2KNBB 3FJ5A 1AWWA 3EG0A 2FRYA 1JO8A 2X3XD 2L3PA 2KRNA 1OEBA 2RF0A 1RLQC 1X6BA 2M51A 2VWFA 1GFDA 1QLYA 3I9QA 3TSWA 2K79A 2DMOA 1BBZA 2NWMA 4J9EA 2FEIA 2EGCA 2HBWA 1SPKA 2JW4A 2EGEA 2F2WA 1K0SA 1Z9QA 2QDLA 4RTUA 2J6OA 4OMNA 4DEYA 1QWEA 4JZ3A 1KFZA 2DRMA 2JT4A 5EC7A 3VRZA 1J3TA 2DBMA 1PHTA 1UFFA 3RNJA 3PVLA 1KIKA 2YT6A 2E5KA 3A98A 2CSQA 2J05A 2JMAA 5IH2A 2C0TA 1GCPA 1YN8A 2ESWA 4J9DA 2KXCA 4DEXA 2H8HA 2DLPA 2J06A 3PVQA 1YCSB 1I0CA 1GRIA 3UA6A 2D0NA 1M8MA 4FSSA 4RTXA 4D8KA 1UE9A 2JXBA 2EYWA 1A0NB 1AVZC 1S1NA 1PRLC 1YWOA 2J7IA 4F14A 2D8HA 4CC2A 3EHQA 1T0HA 2DM1A 2YDLA 1VYVA 1W1FA 4A63B 5L23A 2LJ3A 1ZBJA 1LCKA 1GCQC 1K0XA 1JEGA 4RTWA 1NG2A 1YWPA 4OMMA 2ECZA 1PRMC 2BZYA 3RBBB 2GNCA 1AWOA 2JM8A 2RN8A 3UA7A 2A28A 2RQWA 2O2OA 3H0HA 3NGPA 1CKBA 4F16A 3IQLA 1UJ0A 3NPFA 2LQWA 4AG2C 2DL3A 2KR3A 2GGRA 2LNHB 2GQIA 4LN2A 1AD5A 5I11A 1CKAA 3ZL7C 2VVKA 1NLPC 1UTIA 2HEQA 3VS7A 1QWFA 3VS6A 2M0YA 1XOVA 2L0AA 1UJYA 4CC3A 1RUWA 3NMZC 4ORZA 2V1RA 4HVVA 2KYBA 2DX1A 4ESRA 3THKA 4LNPA 1GBRA 2RQUA 4GBQA 4GLMA 1B3QA 1K4US 3O5ZA 3UF4A 3I5SA 1ARKA 1W6XA 2K9GA 2F2XA 2CUDA 2KBTA 1JXMA 1E6HA 1H92A 1HD3A 1NYGA 2GTJA 2V1QA 1IO6A 1RI9A 3R6NA 1T0JA 2DL4A 1M3BA 2EW3A 2FPDA 3VS0A 5IXFA 2K2MA 3M0UA 2NUZA 4QT7A 2A08A 1SSHA 1AWXA 2ED1A 2JMCA 4JJBA 1G83A 2CH4W 1WXUA 4RTVA 1ZUYA 3EGUA 2DJQA 2AKLA 1V1CA 5IHKA 1GFCA 2KT8A 5IHNA 1JXOA 2EVRA 3H0FA 2F2VA 3M0TA 2RQTA 2SEMA 2LCSA 2DBKA 3LH5A 4J9GA 4JJCA 2C0IA 1HSQA 2L3SA 2LX7A 1T3SA 1MV3A 3EG1A 2KRMA 1CSKA 1M3CA 1M3AA 1ABOA 3QWXX 1WI7A 2YUOA 2AZSA 1SRMA 2YUQA 4LUDA 2KEAA 2O9VA 2FG0A 2LP5A 1ZUUA 4AG1C 2KT1A 1QKXA 1GCQA 5FWBA 1X27A 1HJDA 3I5RA 1WX6A 2YSQA 3KFVA 4J9IA 3REAB 3U23A 1FMKA 4AFQC 4RTZA 2K6DA 1WXTA 3VS1A 2RPNA 1SHGA 1X43A 2KE9A 2GTOA 2KROA 4AFZC 2CUBA 3UATA 5ECAA 1E6GA 4D8DA 4EIKA 3SHWA 1E7OA 1I1JA 3VS3A 1NYFA 2L3QA 2LQNA 2JS2A 1MUZA 1WA7A 3NHNA 3M0RA 2KXDA 1X2KA 2XMFA 4M4ZA 1YNZA 2EPDA 1I07A 1JU5C 2LJ0A 2OAWA 2P4RA 2D1XA 2YUPA 3PE0A 3VS2A 1VYTA 1X69A 1KSWA 1ZSGA 2ED0A 1OOTA 1BK2A 1T3LA 1WLPB 4ZNXA 1Y0MA 2KGTA 5HCKA 1AZEA 1AEYA 1PWTA 4HVUA 1VA7A 2A36A 4CC4B 1G2BA 2W10A 4HXJA 4OMLA 3REBB 2L2PA 5IXBA 4J9CA 2ROLA 2HSPA 3M0SA 2DL8A 2FPFA 1K1ZA 3VS5A 1Y57A 2DA9A 4R0KA 2G6FX 4IIOA 4J9FA 5I22A 3TSZA 1U3OA 2C0OA 2CDTA 2AZVA 1WFWA 2MCNA 2VKNA 2DL7A 2CSIA 4F17A 2I0NA 1JQQA 1UGVA 1H8KA 3EHRA 1TUDA 2EKHA 4RTYA 2MOXA 2BZ8A 5FW9A 2CT3A 3EG3A 1UUEA 2J6FA 2HCKA 4KRTA 1NLOC 4K11A 2YUNA 3SEMA 2PZ1A 4AFUC 4Z8AA 3QWYA 2PNIA 4X1VA 1OV3A 2AKKA 3C0CA 2B86A 1AZGB 2BTTA 4Z89A 2KRSA 2W0ZA 1YP5A 2EQIA 1ZX6A 2FO0A 2DVJA 2CT4A 1TG0A 1BU1A 2J6KA 2CH4A 4J9HA 2EYYA 2DF6A 2DL5A 1GL5A 4HVWA 1PNJA 1H3HA 1WYXA 1OPLA 4WCIA 1NM7A 2JM9A 1WDXA 2EYZA 2DYBA 2D8JA 3H0IA 3VRYA 1OPKA 2RQVA 4OMPA 1UHCA 4RUGA 1UDLA 1M27C 5GJWB 2O88A 2IIMA 2A37A 3VS4A 2DE0X 4LUEA 4AFSC 2ABLA 4RTTA 1SHFA 1K9AA 1KJWA 2ROTA 1N5ZA 1UHFA 3ULRB 2AK5A 1AOJA 2RNAA 3I35A 2CREA 1WIEA 2JS0A 2LMJA 4JZ4A 3TVTA 2O9SA 2HDAA 1K76A 1RLPC 1PKTA 2LZ6B 1AWJA 2EBPA 1FYNA 4CC7A 4Z88A 2FRWA 2DNUA 4IIMA 1SRLA 1U06A 1U5SA 2GBQA 1TUCA 1EFNA 2RMOA 1M30A 1ABQA 1MV0B 1B07A 2RQRA 3GBQA 1QKWA 4JJDA 4J9BA 2EYXA 1BB9A 4OMOA 2X3WD 1GBQA 1W70A 3H41A 2PTKA 1UECA 2MIOA 1ZLMA 2KYMA 1WXBA 3CQTA 2DILA 1QCFA 1SEMA 2SRCA 1UG1A 1NEBA 1VYUA 5FWCA 4Y92A 2K7AA 4JPBW 4E6RA 2FPEA 2ENMA 1X6GA 3M0QA 4LE9A 1ZUKA 2O31A 2BZXA 5GJVB 4HCKA 3M0PA 1Z9ZA 2EGAA 2LJ1A 2JTEA 5IHIA 2K3BA 2DRKA 1X2QA 1PKSA 2OJ2A 3JV3A
chains in the Genus database with same CATH superfamily
3EG2A 1Y07A 3MP1A 2DTHA 2CP5A 2FRYA 1TH7A 3NTKA 1YIJQ 2DFUA 3HFOA 3OYKA 2L3PA 1PG5B 2RHIA 1GFDA 2VWFA 4JS5A 5LJ5h 5KE3A 1EX4A 3TSWA 5GAMj 2K79A 2FZCB 3OBYA 1IRXA 4C8QG 3N5BB 3M57A 4J9EA 2KAFA 1RADB 1RI0A 2HBWA 5LJ5e 1NPRA 4A54A 3OYDA 3CPWP 2DETA 2F2WA 3S3OA 4KT0E 3I56Q 4RTUA 1MMGA 1QWEA 3PMTA 2DRMA 3V7RA 1PC0A 1J3TA 1PHTA 4OB2B 3RNJA 1QQJA 1W2BP 3CCLT 4RG8A 5J26A 2YT6A 4HT9A 2E5KA 3R6OA 3PIPA 2JMAA 5CKBA 3CBPA 2NUPB 3CBOA 5IH2A 3MEUA 3CCRA 4M7DB 4J9DA 2KXCA 2EFIA 4DEXA 2XKOC 3JCMP 4Y28E 1MNEA 1YCSB 2VC8A 4F7UG 3UA6A 2D0NA 1M8MA 3UWNA 1Q86U 1UE9A 1XTDA 5A0DA 2J7IA 4F14A 2D8HA 3KBGA 4CC2A 2KI7A 5KYWA 2DM1A 2LJ3A 2JJ9A 4J6XA 1RAEB 1PRMC 3X24B 3CMEA 3OYMA 1EIFA 3OB9A 3DB3A 2OTJQ 2ZAEA 3BDUA 1KQ2A 1VQNT 5GAMg 3UA7A 4DBHA 2JVVA 1TWBA 1VQMT 4C8QB 2RQWA 3H0HA 4PFZA 3NGPA 2EJGA 3M55A 1VOMA 1WNLA 2LQWA 5CVIA 3M58A 1ZHIA 5LJ3h 3L42A 4A4HA 3M9QA 2K5FA 4NS5A 3RMQA 2GQIA 1SF9A 1CKAA 2X51A 1PD1A 5I11A 5LJ3e 3OYFA 1UTIA 2QEXT 3DLLA 2KY9A 5GANf 3VS6A 4C92C 1N8RR 2GFAA 1UJYA 2QG9B 1XQHA 1M90U 4X9CA 1JJ2P 2DTOA 1M1GA 2FYKA 3FEOA 3OS2A 3LW5E 1Q7YU 2F5TX 3L1AA 2G3RA 1BCOA 1N6AA 3X26B 4BE2A 3EH1A 3G6EA 4XK8E 2CUDA 1QVFS 1QVFA 2OTLT 3P8HA 3JCMX 5D6XA 3R6NA 2X4WA 1G3SA 4FIBA 2EW3A 2FPDA 1BYMA 1AWXA 2JMCA 2K4YA 3OYJA 4JJBA 1G83A 2ZPEB 3CCEA 2GCXA 5KCHA 3LX7A 2LRQA 1V76A 3FLGA 1KC8C 3CCVA 3L2WA 2HD0A 2YRDA 5KYWB 4KH1B 2QTVA 2PVOB 3M0TA 2P0QA 2XG8D 4BY6C 2LCSA 2CS7A 2DBKA 4J9GA 4JJCA 3I55Q 1VQLQ 1VQ7A 1MV3A 2K57A 2EQUA 4ZGEB 1M3CA 5HK0A 1YI2A 8ATCB 4BI3A 4C0GA 4OP0A 3TEEA 5M9OA 2LQ8A 3QYHB 3UT1A 3EAEA 2LP5A 2DKGA 4X9DA 4X34A 3X25B 1QKXA 4M75F 5FWBA 1X27A 2HKNA 1WX6A 3REAB 3U23A 2K6DA 3VS1A 4N0AA 1VQ4T 5I2MA 2E65A 3PGGA 1I5LA 1VQ8A 2CUBA 2RK1A 2DK3A 5ECAA 3OW2P 4D8DA 4ZN1A 3SHWA 3VS3A 1KHIA 1NYFA 1VQOT 1ZBXA 2KXDA 1X2KA 1YBYA 2R5MA 2OAWA 2EPDA 1I07A 2P4RA 4E7IA 2D1XA 4GY5A 1KHCA 3CCST 3MPUB 4JRQA 2PVDB 4C0DB 1ZSGA 4BDZA 1BK2A 4DA4A 1NJIU 1LNXA 1Y0MA 1AZEA 1AEYA 4ZTFA 4B9XA 4HVUA 2A36A 2C06A 1VQKA 4HXJA 2E4HA 5GAMf 3REBB 1N9SA 2L2PA 5IXBA 4J9CA 1YCYA 3CCUA 3MEAA 2MPXC 2K5IA 3JSCA 2DL8A 3EGXB 3OYEA 3VS5A 1P92A 1Y57A 1N8RC 2FL7A 2QQ9A 1K73U 3MO8A 4KGVB 1U3OA 2C0OA 1D0XA 4XQ3A 2QYZA 2KMTA 2VXEA 3F70A 1JQQA 5GANd 2E3IA 3EFSA 3NTHA 2A0FB 1YJ9Q 2P0KA 4IUPA 4EMGA 4PLLA 1YHQA 2MI6A 2MOXA 1OX9A 3CMEQ 3CBMA 2CT3A 1UUEA 2LNVA 2QASA 1VQPT 1RABB 3C12A 2YLBA 4NOYA 1OV3A 2AKKA 3CCJT 3V7SA 2B86A 8AT1B 1AZGB 2DXUA 3C95A 2DVJA 2CT4A 1TG0A 3CC2A 2RI3A 2J6KA 4FL6A 1TOVA 2JTMA 2PUOB 1I8FA 5FU7C 1PNJA 1WYXA 4OB0B 4WCIA 2JM9A 1UGRB 2DYBA 1FWZA 1OPKA 2RQVA 1UHCA 2QQAA 1S72T 2WACA 3EGDA 2AIRB 4BUGA 4LUEA 1QVGA 1K9AA 3ULRB 2RH2A 1Y71A 4F04B 1WIEA 4M78E 2O9SA 4A4FA 1RLPC 4M78C 2EBPA 2DAQA 1U1TA 2CKKA 2FRWA 4DQ2A 1WHKA 3WXMB 3CCEQ 3PIOA 5IN1A 1EFNA 2QQBA 1ABQA 4PJOE 4N0AC 3CCVQ 3A8MB 4M75A 4JJDA 4C8QF 4XTWA 4E7JA 4PJOC 1WHHA 3CCQT 5LJ5d 3CXCA 3QJ6A 5A2QE 3V8LA 2XHCA 2FZGB 2DEQA 1M2VB 3CC7T 1BIAA 2MIOA 3CPWS 2CZ6B 1QCFA 4E7ZA 1SEMA 1YJNT 2COZA 1JB0E 3OMGA 5HY6A 1I4K1 4F7UF 3DKMA 3M54A 1W2BS 5KH6A 1X01A 4BE0A 5KYXB 2P84A 2V8JA 4LE9A 2BZXA 3G4SQ 3G71T 1VQ6T 1G3WA 1MMDA 1I5OB 5L8RE 2RI2A 1BI2A 2DRKA 1PKSA 1KK7A 2OJ2A 2OTJA 3JV3A 4M77A 1NEGA 2OI3A 3EGDB 3OA6A 2VGMA 2KRNA 1OEBA 2L89A 2M51A 3I9QA 3CMAT 2CP3A 2K5LA 3V8JA 2NWMA 4C5GA 2FEIA 4N4HA 2JW4A 1K0SA 1Z9QA 5D6YA 1YJWA 1KFZA 2JT4A 5EC7A 3VRZA 1UEBA 2DBMA 1KIKA 1QVPA 4MMLA 2VGNA 3GLXA 3HHTB 5LJ3d 4FYWB 3A98A 5CAIA 3RIRA 2DLPA 2M16A 2J06A 3PVQA 2COWA 1I0CA 2JTFA 3OSSC 1D3BA 1HYOA 4PL6A 1S1NA 1KD1R 1JJ2S 2DTIA 5CCAA 5AT1B 4A4GA 3CD6Q 3EHQA 2YWWA 3X28B 3OYCA 1W1FA 4QQGA 3JCMb 1WHMA 1LCKA 4Q5WA 4JS4A 4QKUA 3JB9I 1GCQC 2E5QA 1K0XA 1BCMA 1RAIB 3BDLA 4J7FA 1JEGA 2MF2A 4OMMA 3GNFB 2BZYA 3E2UA 2NUPA 1RAGB 4M7DA 1QMCA 1AWOA 4LDUA 2A28A 3MKDA 3OYGA 1VQLA 2O2OA 1MNDA 3L2VA 2CGHA 2ZPIB 1X6OA 4F16A 3IQLA 1UJ0A 1M1KR 3FIFA 3JB9J 2QA4A 2KR3A 5D7UA 2GGRA 3RMSA 1GXIE 1AD5A 1D1AA 5CKDA 3CC2Q 2VVKA 1YITA 2HEQA 1QWFA 4Z02A 2M0YA 1XOVA 2L0AA 2ZPBB 3EFOA 4M75C 3THKA 3MHXA 3OY9A 4BI8B 2L8DA 2RQUA 3QHSA 5GAN3 5DLQE 2QGFB 3H6ZA 4C92G 4C8QA 3JCMg 3CC4A 2EQJA 3I5SA 1WHLA 3OYAA 1BKBA 2RHXA 2GTJA 3E1SA 3CCRT 1QCOA 2DL4A 3WVEB 4FCYA 4A53A 4M7AE 3SWNB 1VQ5Q 1NPPA 3OW2S 3OW2A 4M7AC 1D3BB 2CH4W 2VUBA 1WXUA 4F7UA 2DJQA 2AKLA 4ZTJA 2KT8A 4FT4A 4P5NA 1JXOA 2EVRA 3H0FA 3CCMQ 3LLRA 2RJFA 1K8AR 1KQSP 4C92D 4J83A 2RQTA 2SEMA 4OB3B 3J7AF 4XTUA 2LX7A 2XI9A 2KRMA 1ABOA 4M77C 1ZSZC 1M8VA 2RB6A 2ZPFB 1VQ9A 2AZSA 3VUZA 4VUBA 2O9VA 4QQDA 2FG0A 5J3BA 1B34B 3RKYA 1K9MR 4DBFA 1IXDA 5GAMh 1ZUUA 4TVRA 5HK3A 4OF1A 4AG1C 2KT1A 3TCJA 5C6SA 4LDXA 3RERA 5GAMe 1Q81U 3I5RA 1IGUA 2YSQA 2RPNA 2WSEE 1SHGA 3JCMQ 3HRUA 2KE9A 1YJ9A 1Q82U 1TUGB 2P0PA 3RR6A 3UATA 4ELZC 4EIKA 2LVMA 1KD1C 3A8OB 3VYGA 2L3QA 3EFOB 4E2FB 2RI5A 2YRVA 1KG1A 4DBRA 1YNZA 1QW1A 2LJ0A 3SD4A 2RM4A 2OX7A 3VS2A 3KUFA 4KUIA 4HA8A 5AYFA 5GAOr 4HCBA 1X69A 1BI3A 4ATOA 1KSWA 2HBPA 3G6ET 3A8HB 2XU8A 4XU2A 1MHNA 1OOTA 3OYLA 2HQXA 2HQEA 3URGA 2H3JA 1WLPB 4O6JA 4KBMB 3QIIA 4C92E 1VA7A 4UC4A 2PQWA 1YJWQ 1G2BA 1M1KC 2O01E 3PMIA 4M7DC 3GOXA 1M2OA 4F7UB 2HAXA 3CCVT 1B7TA 1NBEB 1Y96B 2MK5A 1OYXA 5GMKi 3M0SA 4HT8A 3L2ZA 1K1ZA 3MCAB 2BUDA 5CKFA 4HCZA 1RAHB 1LVKA 3MP8A 2G6FX 1VQ7T 4LDWA 2Y4YA 1SKUB 4ANJA 2FZKB 3FJPA 1YI2T 2MCNA 3QUIA 3RKXA 2VKNA 1G3TA 2CSIA 1WJSA 4F17A 2I0NA 1UGVA 7AT1B 4JUVA 1TUDA 4N4IA 1WHGA 2QGGA 4RTYA 2BZ8A 5FW9A 2MMPA 1M5Q1 2IVWA 2GQVA 4XU0A 3EGXA 4KRTA 4C8QC 3QPHA 4K11A 4AFUC 2PZ1A 4Z8AA 4PFPA 2PNIA 1VQ8T 5GAN4 4Z89A 2LT1A 2W0ZA 1YP5A 2QA4Q 2EQMA 1ZX6A 3EH2A 2FO0A 1K8AC 3OS5A 4IURA 4LDYA 1BU1A 1YITQ 4J9HA 4RMOA 1JRIA 1F1BB 2Y4XA 2D0QB 2WSCE 1TTHB 2RJEA 1FXXA 1NM7A 5CK9A 1WDXA 3H0IA 2E70A 3VRYA 4RUGA 1UDLA 3G4SA 3EG9A 4EPCA 2IIMA 4MMKA 1K9MC 5FROA 3CC4Q 3BY7A 1UHFA 1VQKT 2XD0A 1M9SA 5FRNA 2CREA 2I2LA 4XTXA 3TVTA 3CCUT 1K76A 5FU6B 4EMKA 1IZ6A 2LZ6B 1AWJA 4DBQA 1FYNA 3JRZA 2B8AA 4A4KA 3O8VA 4KULA 1R0CB 4IIMA 2AHJB 1R8OB 2WSFE 4J6YA 3A8LB 1U5SA 1TUCA 1OZ3A 4M78G 1PM3A 3MP6A 1MV0B 1B07A 3GBQA 1QKWA 4J9BA 1BB9A 4OMOA 5D6WA 1RAFB 1GBQA 4DOWA 3HP9A 4J7IA 2DD4A 3OS1A 5LL6S 1YHQT 1D0ZA 4IUTA 1D09B 2YRCA 4BACA 1ZLMA 3PFSA 3KXTA 4PJOG 1WXBA 1VQ9Q 3A1PA 1VQ4A 2SRCA 1UG1A 1NEBA 3HFNA 1VYUA 3VKIA 1JBMA 2ZZDA 4Y92A 2FHDA 3V8KA 3LWIA 4MZPA 4M78D 3CD6A 3VYHB 2R57A 2ZPGB 1ZUKA 2O31A 1Q86R 4JDSA 5GJVB 3H9NA 3CC2T 4HCKA 5DM7R 2EGAA 1H3ZA 1IB8A 5IHIA 2QDYB 2K3BA 4JLIA 1TXQA 1X2QA 1M2VA 2CP2A 1SSFA 3E9GA 2E6ZA 3HRTA 4PJOD 5GMKj 4E7SA 5C0MA 4C0DC 3EG9B 4OMQA 2KNBB 3FJ5A 2X4JA 2E12A 2COYA 1RLQC 1OULA 2EQKA 3GIBA 1ZQ1A 1QLYA 2K3YA 5KYXA 2DIGA 3CCLQ 1BBZA 5IT9E 1WJQA 4EMKB 1SPKA 4L5GA 2D9TA 3TREA 2FVUA 2EGEA 4II1A 2QDLA 2J6OA 4OMNA 4DEYA 3S3NA 1YIJT 2DXBA 4IUVA 3GNGA 2H3EB 4FT2A 3MJXA 3PVLA 5KCOA 2RJDA 2CSQA 4WTOB 1WGSA 2C0TA 1YN8A 1M90R 4CRIA 2H8HA 1G3YA 1N27A 3I56T 4BDYA 1MMAA 5GAN2 2HQHA 4FSSA 4RTXA 4C92F 1Q7YR 3EFRA 4D8KA 1HK9A 2JXBA 1A0NB 1QVFP 1AVZC 1PRLC 1R77A 2CYZB 3HL8A 2Z0WA 1ZBJA 1VQPA 4XU3A 1VQ5A 1VQMQ 1M4ZA 1YWPA 5DY9A 1KC8U 3RBBB 4L59A 2GNCA 4YTLA 3CCMA 1MGQA 5DLOA 2K3XA 3QDFA 2RN8A 2RA2A 4WF2A 2QEXQ 1AHJB 3NTIA 3RESA 3NPFA 2JN0A 4QW2A 3JCMJ 2OTJT 3CPWA 4OGCA 4E47A 4LN2A 2ZGWA 4AMCA 1KQSS 3ZL7C 1KQSA 2ZCFB 1NLPC 3VS7A 1U1SA 2DO3A 4C0ZA 4FSXA 1RUWA 3NMZC 4ORZA 1W2BA 2OTLQ 4HVVA 3OYIA 5CQXA 1GBRA 3C94A 1PSEA 5A0GA 4GLMA 3D7SB 1K4US 2XICA 3UF4A 5GAOm 5GAMd 1W6XA 2K9GA 4PNOA 2E10A 2KBTA 3BW1A 3OBWA 4RCCA 2V1QA 1Q86C 2LX9A 4BE1A 1T0JA 3VS0A 3T9NA 4Y91A 2K2MA 4QT7A 5IXFA 2A08A 2ED1A 2RO0A 2RD1A 1WJRA 3CCQA 4RTVA 1ZUYA 2MYSA 5IHKA 1GFCA 2QQSA 5IHNA 2F2VA 2CP0A 2DD5A 1NJIR 3V7CA 4M7AG 5J39A 3LH5A 2LDMA 5GANj 1HSQA 2L3SA 4M75D 1Y7XA 1T3SA 3GP8A 3EG1A 1M3AA 1VIEA 2LTOA 1WI7A 1N8RU 3RDVA 2VXFA 1SRMA 2YUQA 3SWNA 2KEAA 1VQ4Q 3AT1B 5CKEA 3I55T 1VQLT 2X35A 2DPPB 4M77G 1JJ2A 2ZPHB 1VQOQ 1WPYA 1M90C 2QTXA 1K73R 2CZ1B 4RTZA 4OGEA 2VYTA 4BD3A 2GTOA 3JAME 3UDCA 4AFZC 3CCSQ 4M7AD 2K2VA 1Q7YC 1PD0A 1E6GA 4PJLA 2QXFA 3J81E 1I1JA 2CZ7B 3ME9A 4LD9K 4ZGJB 3PNWC 3DB4A 4M4ZA 3QZ5B 3JCMc 2YUPA 1B34A 1BI1A 4IKFA 1VYTA 1VUBA 2ED0A 3JCMh 4PJJA 4M77D 2MWPA 2YHTA 5HCKA 2KGTA 4FYXB 3JCMe 2CP7A 2HKQB 4CC4B 4C0FA 4M75E 1G5VA 4OMLA 5GAOp 1H641 2DXTA 2PU9B 2LQKA 3FDRA 3PT9A 4E7LA 2KDSA 2HSPA 4NL3A 1NE8A 1UGSB 1MMNA 2DA9A 4R0KA 4IUUA 1BIBA 3SFMA 1QVGP 5KYYB 3C4SA 3BE3A 4M7DG 1OQKA 5I22A 3JB9H 3FRNA 3TSZA 1U8RA 4BI4A 1UGPB 4PFOA 1XNIA 5LJ5j 3G1JA 2DL7A 1H8KA 1VQPQ 3PTAA 2RK2A 1WQWA 2HL5C 2EKHA 2E6NA 4C5IA 1RACB 3CCJQ 1IHWA 1Y96A 3ZEHA 4QQ6A 3QZ9B 3LGLA 1ACMB 4M78F 1KC8R 3SEMA 1YJ9T 4X1VA 5EG2A 4M77E 4M7DD 3JB9G 3INZA 5CIUA 2IG0A 3CXCP 2BTTA 3CMET 2KRSA 2CZ0B 4MDXA 2DYIA 4RKUE 1NJIC 1IHVA 2Y90A 1S72Q 2MWOA 4PJOF 1C6VX 4MZTA 2JUFA 3OMCA 3QO3A 1GL5A 4DOVA 3A5ZB 4XTYA 1OPLA 4C92B 5CKHA 3BFMA 1X75C 2EYZA 2D8JA 2NLUA 2GF7A 4FU6A 2O88A 2A37A 3VS4A 2DE0X 2ABLA 3QBYA 1KJWA 5LJ5g 2ROTA 1N5ZA 5GAN6 1W4SA 3JB9D 4O5VA 1LOJA 3SB2A 3I35A 3MEWA 3QXEB 2V8IA 1K73C 4C8QD 2QAZA 4ZN3A 3SWNC 4JRIA 3HKSA 5LJ3j 4FW2A 4CC7A 4Z88A 4J5YA 2DNUA 2DZ9A 3CCQQ 5KE2A 1U06A 3CCLA 1QCNA 1IGQA 2RMOA 2X4YA 2M1HA 3CC7Q 2RQRA 2E41A 2EIFA 1O75A 1YJNQ 4M7DE 4FYVB 1W70A 3CCET 3M59A 3LH0A 3H41A 1FMVA 4BY6B 3L2UA 1EZZB 1UECA 2EJ9A 2NUTB 1PCXA 2KYMA 2DILA 2LC4A 3OYHA 3G71Q 3QSUA 3G7ZA 1VQ6Q 5FWCA 5CR2A 2K7AA 4JPBW 5KYUA 2ENMA 2BE9B 4PLIA 1RL2A 3M0QA 1VQNA 3DLMA 4XTZA 2XDBA 1Z9ZA 1VQMA 1I81A 2F69A 5LJ3g 3JCMf 1M1FA 3M53A 4C8QE 3S6WA 3QJYA 3CMAQ 1ZA1B 3M0UA 3G4ST 2AT1B 1OX8A 4D6WA 3J80E 4MZMA 1AWWA 2QEXA 3EG0A 3FC3A 1YFNA 1JO8A 2X3XD 1WHJA 1LPLA 1X6BA 2RF0A 2DEUA 2DMOA 3RKWA 1WZOA 2EGCA 5GMKm 4ELYC 2LCCA 4KGZB 2V8KA 4F7UE 5FLXE 1OZ2A 4JZ3A 5GAN5 1UFFA 2HSEB 3P8DA 2OTLA 3HTRA 3OS0A 2J05A 1TU0B 1GCPA 2QI2A 2ESWA 3GF5A 2RHYA 3HSBA 4M78A 1GRIA 4OB1B 4B9WA 2EWNA 1D1CA 2EYWA 2EKOA 1YWOA 2OAUA 1QP2A 3ZBDA 1T0HA 2YDLA 1VYVA 4A63B 3OQ5A 5L23A 3META 4EMHA 2EAYA 2M0OA 4PJOA 4HKEA 1QP3A 4XTVA 4RTWA 2HZYA 1NG2A 5KYUB 3SDZA 5GAOl 2ECZA 2O4XA 3ZFJA 1FMWA 5LJ5f 2L5QA 3WVDB 3CD6T 1VIFA 1BI0A 1D1BA 2BE7D 2JM8A 3LWHA 2DJZA 3P8BB 4M7AF 1CKBA 1V29B 4AG2C 2DL3A 1RAAB 2LNHB 2BKDN 4PKCC 1OI1A 5GAN7 4J8OA 5IAYA 4HCCA 4CC3A 2A3LA 5CQYA 2V1RA 2KYBA 2DX1A 4ESRA 1VQOA 4LNPA 4M77F 3VUBA 4AT1B 5FU7B 4GBQA 3CCRQ 2MAMA 1PSFA 1TSFA 4PJNA 3QKJA 3RUXA 5I21A 1B3QA 2BIVA 3O5ZA 3CCSA 1KD1U 3CEYA 1Q81R 2A7YA 1ARKA 2F2XA 4MDWA 1JXMA 1E6HA 1H92A 5FU6C 1HD3A 1NYGA 1Q82R 1IO6A 1RI9A 2L3RA 1M3BA 1AT1B 3E19A 3VV0A 2NUZA 4M78B 1SSHA 4FW1A 3TQ7P 4QVDA 2VB6A 2KVQG 3EGUA 1OU8A 1N9RA 1V1CA 2E1HA 5LJ3f 1HXDA 1Q95G 2DERA 3JCMV 1NZ9A 1VQ5T 9ATCB 1M1KU 3JCMd 3L2QA 4PJOB 2C0IA 5HKCA 2E3HA 3UPUA 2O4XB 1CSKA 2X4XA 3A8GB 5GMKh 3QWXX 3M4GA 3CCMT 2YUOA 2EYQA 3OYBA 3OYYA 4LUDA 5GMKe 3FB9A 4JRKA 3OYNA 2IPOB 3OSVA 4M7DF 1GCQA 2XK0A 2QK0A 4R56A 1HJDA 3KFVA 4J9IA 1FMKA 4AFQC 1WXTA 1DJ7B 1VQNQ 2M9UA 1X43A 2KROA 4FM4B 1QVGS 3Q1JA 3CCJA 3G6EQ 1E7OA 1D0YA 2D6FA 4XU1A 2LQNA 2JS2A 1MUZA 2DIQA 1WA7A 3NHNA 3VJPA 4V2SA 3M0RA 2XMFA 3QYGB 3TU4K 1JU5C 4B6MA 3PE0A 4L6V5 1YIJA 4KUDK 2YXYA 2PUKB 2E64A 5KYNA 4EMKC 3VU3C 3JB9F 1T3LA 1K8AU 4LD6A 4ZNXA 2F5KA 1ZA2B 4GLKA 1PWTA 1S72A 3I56A 4R55A 4FYYB 2KSSA 3CPFA 4JLGA 2W10A 1C0MA 2KK4A 3CXCS 2ATCB 1VQ7Q 5FRMA 4RG2A 1SG5A 1FX7A 2ROLA 1YI2Q 1R0BG 1K9MU 2FPFA 2XIDA 2JNGA 6AT1B 2HMAA 1YJWT 4IIOA 4J9FA 4M75G 4ZGDB 2XDPA 2CDTA 4M7AA 2AZVA 1WFWA 2XDDA 5CO7A 2RJCA 4KH0B 3S3MA 2HNIA 2VV5A 1Q81C 3EHRA 3AHUA 3QG1A 1VQ8Q 1G8XA 4CI0C 3ER0A 1Q82C 4NL2A 3CC7A 3EG3A 2J6FA 3H8ZA 2HCKA 1NLOC 1LJOA 1ZSZA 2YUNA 1XJWB 1YJNA 4LXCA 3QWYA 5KYYA 4OMFB 1OU9A 3C0CA 3L2RA 2M02A 1IREB 2EQIA 5GAOn 4KGXB 4BB7A 2GFUA 2FB7A 4IUQA 1C1AA 2CP6A 3G71A 3MEVA 1VQ6A 2CH4A 4QVZA 2EYYA 2DF6A 3M4YA 2DL5A 1VQKQ 2EJFA 2VASA 4HVWA 1H3HA 2QA4T 5I2SA 1UGQB 3CCUQ 4OMPA 2DXCA 2PVGB 1M27C 4M75B 5GJWB 4JJNK 1YITT 4AFSC 3LYIA 3X20B 5GAOq 4RTTA 1SHFA 5GANh 3M5AA 2AK5A 4XAXB 4PJMA 1AOJA 2RNAA 5GANe 2JS0A 2LMJA 4JZ4A 3CMAA 2HDAA 2R5AA 1PKTA 3LGFA 2YLCA 3NFCA 3QDRB 3CC4T 2RHUA 2RHZA 1SRLA 2F1LA 4C92A 4N4GA 1YHQQ 4RCBA 2DVEA 2GBQA 4M7AB 4OVAA 4LDVA 1M30A 4ME7A 2P4TA 5A0LA 5GANg 4C5HA 2HL3A 5GAN8 2NYSA 2EYXA 2KQWA 3JCMW 2X3WD 3I55A 4A4EA 2PTKA 4PK4A 2V26A 1KQ1A 3HPWA 3CQTA 2JZ2A 4EDUA 1WQ7A 1O9SA 3ASKA 4M77B 1ZSZB 3HRSA 5GMKl 2X9HA 4E6RA 2FPEA 4E7HA 2JOYA 1X6GA 2DZCA 1VQ9T 4QVCA 3GPLA 2LT4A 4C5EA 3M0PA 2LJ1A 2JTEA 3M56A 2R58A 1TS9A 2QQRA 2LCLA 3E9FA 2NUTA 1UB4A 4E7KA 4J6WA 4JRPA
chains in the Genus database with same CATH topology
1NEGA 3EG2A 2OI3A 4OMQA 2KNBB 3FJ5A 1AWWA 3EG0A 2FRYA 1JO8A 2X3XD 2L3PA 2KRNA 1OEBA 2RF0A 1RLQC 1X6BA 2M51A 2VWFA 1GFDA 1QLYA 3I9QA 3TSWA 2K79A 2DMOA 1BBZA 2NWMA 4J9EA 2FEIA 2EGCA 2HBWA 1SPKA 2JW4A 2EGEA 2F2WA 1K0SA 1Z9QA 2QDLA 4RTUA 2J6OA 4OMNA 4DEYA 1QWEA 4JZ3A 1KFZA 2DRMA 2JT4A 5EC7A 3VRZA 1J3TA 2DBMA 1PHTA 1UFFA 3RNJA 3PVLA 1KIKA 2YT6A 2E5KA 3A98A 2CSQA 2J05A 2JMAA 5IH2A 2C0TA 1GCPA 1YN8A 2ESWA 4J9DA 2KXCA 4DEXA 2H8HA 2DLPA 2J06A 3PVQA 1YCSB 1I0CA 1GRIA 3UA6A 2D0NA 1M8MA 4FSSA 4RTXA 4D8KA 1UE9A 2JXBA 2EYWA 1A0NB 1AVZC 1S1NA 1PRLC 1YWOA 2J7IA 4F14A 2D8HA 4CC2A 3EHQA 1T0HA 2DM1A 2YDLA 1VYVA 1W1FA 4A63B 5L23A 2LJ3A 1ZBJA 1LCKA 1GCQC 1K0XA 1JEGA 4RTWA 1NG2A 1YWPA 4OMMA 2ECZA 1PRMC 2BZYA 3RBBB 2GNCA 1AWOA 2JM8A 2RN8A 3UA7A 2A28A 2RQWA 2O2OA 3H0HA 3NGPA 1CKBA 4F16A 3IQLA 1UJ0A 3NPFA 2LQWA 4AG2C 2DL3A 2KR3A 2GGRA 2LNHB 2GQIA 4LN2A 1AD5A 5I11A 1CKAA 3ZL7C 2VVKA 1NLPC 1UTIA 2HEQA 3VS7A 1QWFA 3VS6A 2M0YA 1XOVA 2L0AA 1UJYA 4CC3A 1RUWA 3NMZC 4ORZA 2V1RA 4HVVA 2KYBA 2DX1A 4ESRA 3THKA 4LNPA 1GBRA 2RQUA 4GBQA 4GLMA 1B3QA 1K4US 3O5ZA 3UF4A 3I5SA 1ARKA 1W6XA 2K9GA 2F2XA 2CUDA 2KBTA 1JXMA 1E6HA 1H92A 1HD3A 1NYGA 2GTJA 2V1QA 1IO6A 1RI9A 3R6NA 1T0JA 2DL4A 1M3BA 2EW3A 2FPDA 3VS0A 5IXFA 2K2MA 3M0UA 2NUZA 4QT7A 2A08A 1SSHA 1AWXA 2ED1A 2JMCA 4JJBA 1G83A 2CH4W 1WXUA 4RTVA 1ZUYA 3EGUA 2DJQA 2AKLA 1V1CA 5IHKA 1GFCA 2KT8A 5IHNA 1JXOA 2EVRA 3H0FA 2F2VA 3M0TA 2RQTA 2SEMA 2LCSA 2DBKA 3LH5A 4J9GA 4JJCA 2C0IA 1HSQA 2L3SA 2LX7A 1T3SA 1MV3A 3EG1A 2KRMA 1CSKA 1M3CA 1M3AA 1ABOA 3QWXX 1WI7A 2YUOA 2AZSA 1SRMA 2YUQA 4LUDA 2KEAA 2O9VA 2FG0A 2LP5A 1ZUUA 4AG1C 2KT1A 1QKXA 1GCQA 5FWBA 1X27A 1HJDA 3I5RA 1WX6A 2YSQA 3KFVA 4J9IA 3REAB 3U23A 1FMKA 4AFQC 4RTZA 2K6DA 1WXTA 3VS1A 2RPNA 1SHGA 1X43A 2KE9A 2GTOA 2KROA 4AFZC 2CUBA 3UATA 5ECAA 1E6GA 4D8DA 4EIKA 3SHWA 1E7OA 1I1JA 3VS3A 1NYFA 2L3QA 2LQNA 2JS2A 1MUZA 1WA7A 3NHNA 3M0RA 2KXDA 1X2KA 2XMFA 4M4ZA 1YNZA 2EPDA 1I07A 1JU5C 2LJ0A 2OAWA 2P4RA 2D1XA 2YUPA 3PE0A 3VS2A 1VYTA 1X69A 1KSWA 1ZSGA 2ED0A 1OOTA 1BK2A 1T3LA 1WLPB 4ZNXA 1Y0MA 2KGTA 5HCKA 1AZEA 1AEYA 1PWTA 4HVUA 1VA7A 2A36A 4CC4B 1G2BA 2W10A 4HXJA 4OMLA 3REBB 2L2PA 5IXBA 4J9CA 2ROLA 2HSPA 3M0SA 2DL8A 2FPFA 1K1ZA 3VS5A 1Y57A 2DA9A 4R0KA 2G6FX 4IIOA 4J9FA 5I22A 3TSZA 1U3OA 2C0OA 2CDTA 2AZVA 1WFWA 2MCNA 2VKNA 2DL7A 2CSIA 4F17A 2I0NA 1JQQA 1UGVA 1H8KA 3EHRA 1TUDA 2EKHA 4RTYA 2MOXA 2BZ8A 5FW9A 2CT3A 3EG3A 1UUEA 2J6FA 2HCKA 4KRTA 1NLOC 4K11A 2YUNA 3SEMA 2PZ1A 4AFUC 4Z8AA 3QWYA 2PNIA 4X1VA 1OV3A 2AKKA 3C0CA 2B86A 1AZGB 2BTTA 4Z89A 2KRSA 2W0ZA 1YP5A 2EQIA 1ZX6A 2FO0A 2DVJA 2CT4A 1TG0A 1BU1A 2J6KA 2CH4A 4J9HA 2EYYA 2DF6A 2DL5A 1GL5A 4HVWA 1PNJA 1H3HA 1WYXA 1OPLA 4WCIA 1NM7A 2JM9A 1WDXA 2EYZA 2DYBA 2D8JA 3H0IA 3VRYA 1OPKA 2RQVA 4OMPA 1UHCA 4RUGA 1UDLA 1M27C 5GJWB 2O88A 2IIMA 2A37A 3VS4A 2DE0X 4LUEA 4AFSC 2ABLA 4RTTA 1SHFA 1K9AA 1KJWA 2ROTA 1N5ZA 1UHFA 3ULRB 2AK5A 1AOJA 2RNAA 3I35A 2CREA 1WIEA 2JS0A 2LMJA 4JZ4A 3TVTA 2O9SA 2HDAA 1K76A 1RLPC 1PKTA 2LZ6B 1AWJA 2EBPA 1FYNA 4CC7A 4Z88A 2FRWA 2DNUA 4IIMA 1SRLA 1U06A 1U5SA 2GBQA 1TUCA 1EFNA 2RMOA 1M30A 1ABQA 1MV0B 1B07A 2RQRA 3GBQA 1QKWA 4JJDA 4J9BA 2EYXA 1BB9A 4OMOA 2X3WD 1GBQA 1W70A 3H41A 2PTKA 1UECA 2MIOA 1ZLMA 2KYMA 1WXBA 3CQTA 2DILA 1QCFA 1SEMA 2SRCA 1UG1A 1NEBA 1VYUA 5FWCA 4Y92A 2K7AA 4JPBW 4E6RA 2FPEA 2ENMA 1X6GA 3M0QA 4LE9A 1ZUKA 2O31A 2BZXA 5GJVB 4HCKA 3M0PA 1Z9ZA 2EGAA 2LJ1A 2JTEA 5IHIA 2K3BA 2DRKA 1X2QA 1PKSA 2OJ2A 3JV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NEG A;  3EG2 A;  2OI3 A;  4OMQ A;  2KNB B;  3FJ5 A;  1AWW A;  3EG0 A;  2FRY A;  1JO8 A;  2X3X D;  2L3P A;  2KRN A;  1OEB A;  2RF0 A;  1RLQ C;  1X6B A;  2M51 A;  2VWF A;  1GFD A;  1QLY A;  3I9Q A;  3TSW A;  2K79 A;  2DMO A;  1BBZ A;  2NWM A;  4J9E A;  2FEI A;  2EGC A;  2HBW A;  1SPK A;  2JW4 A;  2EGE A;  2F2W A;  1K0S A;  1Z9Q A;  2QDL A;  4RTU A;  2J6O A;  4OMN A;  4DEY A;  1QWE A;  4JZ3 A;  1KFZ A;  2DRM A;  2JT4 A;  5EC7 A;  3VRZ A;  1J3T A;  2DBM A;  1PHT A;  1UFF A;  3RNJ A;  3PVL A;  1KIK A;  2YT6 A;  2E5K A;  3A98 A;  2CSQ A;  2J05 A;  2JMA A;  5IH2 A;  2C0T A;  1GCP A;  1YN8 A;  2ESW A;  4J9D A;  2KXC A;  4DEX A;  2H8H A;  2DLP A;  2J06 A;  3PVQ A;  1YCS B;  1I0C A;  1GRI A;  3UA6 A;  2D0N A;  1M8M A;  4FSS A;  4RTX A;  4D8K A;  1UE9 A;  2JXB A;  2EYW A;  1A0N B;  1AVZ C;  1S1N A;  1PRL C;  1YWO A;  2J7I A;  4F14 A;  2D8H A;  4CC2 A;  3EHQ A;  1T0H A;  2DM1 A;  2YDL A;  1VYV A;  1W1F A;  4A63 B;  5L23 A;  2LJ3 A;  1ZBJ A;  1LCK A;  1GCQ C;  1K0X A;  1JEG A;  4RTW A;  1NG2 A;  1YWP A;  4OMM A;  2ECZ A;  1PRM C;  2BZY A;  3RBB B;  2GNC A;  1AWO A;  2JM8 A;  2RN8 A;  3UA7 A;  2A28 A;  2RQW A;  2O2O A;  3H0H A;  3NGP A;  1CKB A;  4F16 A;  3IQL A;  1UJ0 A;  3NPF A;  2LQW A;  4AG2 C;  2DL3 A;  2KR3 A;  2GGR A;  2LNH B;  2GQI A;  4LN2 A;  1AD5 A;  5I11 A;  1CKA A;  3ZL7 C;  2VVK A;  1NLP C;  1UTI A;  2HEQ A;  3VS7 A;  1QWF A;  3VS6 A;  2M0Y A;  1XOV A;  2L0A A;  1UJY A;  4CC3 A;  1RUW A;  3NMZ C;  4ORZ A;  2V1R A;  4HVV A;  2KYB A;  2DX1 A;  4ESR A;  3THK A;  4LNP A;  1GBR A;  2RQU A;  4GBQ A;  4GLM A;  1B3Q A;  1K4U S;  3O5Z A;  3UF4 A;  3I5S A;  1ARK A;  1W6X A;  2K9G A;  2F2X A;  2CUD A;  2KBT A;  1JXM A;  1E6H A;  1H92 A;  1HD3 A;  1NYG A;  2GTJ A;  2V1Q A;  1IO6 A;  1RI9 A;  3R6N A;  1T0J A;  2DL4 A;  1M3B A;  2EW3 A;  2FPD A;  3VS0 A;  5IXF A;  2K2M A;  3M0U A;  2NUZ A;  4QT7 A;  2A08 A;  1SSH A;  1AWX A;  2ED1 A;  2JMC A;  4JJB A;  1G83 A;  2CH4 W;  1WXU A;  4RTV A;  1ZUY A;  3EGU A;  2DJQ A;  2AKL A;  1V1C A;  5IHK A;  1GFC A;  2KT8 A;  5IHN A;  1JXO A;  2EVR A;  3H0F A;  2F2V A;  3M0T A;  2RQT A;  2SEM A;  2LCS A;  2DBK A;  3LH5 A;  4J9G A;  4JJC A;  2C0I A;  1HSQ A;  2L3S A;  2LX7 A;  1T3S A;  1MV3 A;  3EG1 A;  2KRM A;  1CSK A;  1M3C A;  1M3A A;  1ABO A;  3QWX X;  1WI7 A;  2YUO A;  2AZS A;  1SRM A;  2YUQ A;  4LUD A;  2KEA A;  2O9V A;  2FG0 A;  2LP5 A;  1ZUU A;  4AG1 C;  2KT1 A;  1QKX A;  1GCQ A;  5FWB A;  1X27 A;  1HJD A;  3I5R A;  1WX6 A;  2YSQ A;  3KFV A;  4J9I A;  3REA B;  3U23 A;  1FMK A;  4AFQ C;  4RTZ A;  2K6D A;  1WXT A;  3VS1 A;  2RPN A;  1SHG A;  1X43 A;  2KE9 A;  2GTO A;  2KRO A;  4AFZ C;  2CUB A;  3UAT A;  5ECA A;  1E6G A;  4D8D A;  4EIK A;  3SHW A;  1E7O A;  1I1J A;  3VS3 A;  1NYF A;  2L3Q A;  2LQN A;  2JS2 A;  1MUZ A;  1WA7 A;  3NHN A;  3M0R A;  2KXD A;  1X2K A;  2XMF A;  4M4Z A;  1YNZ A;  2EPD A;  1I07 A;  1JU5 C;  2LJ0 A;  2OAW A;  2P4R A;  2D1X A;  2YUP A;  3PE0 A;  3VS2 A;  1VYT A;  1X69 A;  1KSW A;  1ZSG A;  2ED0 A;  1OOT A;  1BK2 A;  1T3L A;  1WLP B;  4ZNX A;  1Y0M A;  2KGT A;  5HCK A;  1AZE A;  1AEY A;  1PWT A;  4HVU A;  1VA7 A;  2A36 A;  4CC4 B;  1G2B A;  2W10 A;  4HXJ A;  4OML A;  3REB B;  2L2P A;  5IXB A;  4J9C A;  2ROL A;  2HSP A;  3M0S A;  2DL8 A;  2FPF A;  1K1Z A;  3VS5 A;  1Y57 A;  2DA9 A;  4R0K A;  2G6F X;  4IIO A;  4J9F A;  5I22 A;  3TSZ A;  1U3O A;  2C0O A;  2CDT A;  2AZV A;  1WFW A;  2MCN A;  2VKN A;  2DL7 A;  2CSI A;  4F17 A;  2I0N A;  1JQQ A;  1UGV A;  1H8K A;  3EHR A;  1TUD A;  2EKH A;  4RTY A;  2MOX A;  2BZ8 A;  5FW9 A;  2CT3 A;  3EG3 A;  1UUE A;  2J6F A;  2HCK A;  4KRT A;  1NLO C;  4K11 A;  2YUN A;  3SEM A;  2PZ1 A;  4AFU C;  4Z8A A;  3QWY A;  2PNI A;  4X1V A;  1OV3 A;  2AKK A;  3C0C A;  2B86 A;  1AZG B;  2BTT A;  4Z89 A;  2KRS A;  2W0Z A;  1YP5 A;  2EQI A;  1ZX6 A;  2FO0 A;  2DVJ A;  2CT4 A;  1TG0 A;  1BU1 A;  2J6K A;  2CH4 A;  4J9H A;  2EYY A;  2DF6 A;  2DL5 A;  1GL5 A;  4HVW A;  1PNJ A;  1H3H A;  1WYX A;  1OPL A;  4WCI A;  1NM7 A;  2JM9 A;  1WDX A;  2EYZ A;  2DYB A;  2D8J A;  3H0I A;  3VRY A;  1OPK A;  2RQV A;  4OMP A;  1UHC A;  4RUG A;  1UDL A;  1M27 C;  5GJW B;  2O88 A;  2IIM A;  2A37 A;  3VS4 A;  2DE0 X;  4LUE A;  4AFS C;  2ABL A;  4RTT A;  1SHF A;  1K9A A;  1KJW A;  2ROT A;  1N5Z A;  1UHF A;  3ULR B;  2AK5 A;  1AOJ A;  2RNA A;  3I35 A;  2CRE A;  1WIE A;  2JS0 A;  2LMJ A;  4JZ4 A;  3TVT A;  2O9S A;  2HDA A;  1K76 A;  1RLP C;  1PKT A;  2LZ6 B;  1AWJ A;  2EBP A;  1FYN A;  4CC7 A;  4Z88 A;  2FRW A;  2DNU A;  4IIM A;  1SRL A;  1U06 A;  1U5S A;  2GBQ A;  1TUC A;  1EFN A;  2RMO A;  1M30 A;  1ABQ A;  1MV0 B;  1B07 A;  2RQR A;  3GBQ A;  1QKW A;  4JJD A;  4J9B A;  2EYX A;  1BB9 A;  4OMO A;  2X3W D;  1GBQ A;  1W70 A;  3H41 A;  2PTK A;  1UEC A;  2MIO A;  1ZLM A;  2KYM A;  1WXB A;  3CQT A;  2DIL A;  1QCF A;  1SEM A;  2SRC A;  1UG1 A;  1NEB A;  1VYU A;  5FWC A;  4Y92 A;  2K7A A;  4JPB W;  4E6R A;  2FPE A;  2ENM A;  1X6G A;  3M0Q A;  4LE9 A;  1ZUK A;  2O31 A;  2BZX A;  5GJV B;  4HCK A;  3M0P A;  1Z9Z A;  2EGA A;  2LJ1 A;  2JTE A;  5IHI A;  2K3B A;  2DRK A;  1X2Q A;  1PKS A;  2OJ2 A;  3JV3 A; 
#chains in the Genus database with same CATH topology
 3EG2 A;  1Y07 A;  3MP1 A;  2DTH A;  2CP5 A;  2FRY A;  1TH7 A;  3NTK A;  1YIJ Q;  2DFU A;  3HFO A;  3OYK A;  2L3P A;  1PG5 B;  2RHI A;  1GFD A;  2VWF A;  4JS5 A;  5LJ5 h;  5KE3 A;  1EX4 A;  3TSW A;  5GAM j;  2K79 A;  2FZC B;  3OBY A;  1IRX A;  4C8Q G;  3N5B B;  3M57 A;  4J9E A;  2KAF A;  1RAD B;  1RI0 A;  2HBW A;  5LJ5 e;  1NPR A;  4A54 A;  3OYD A;  3CPW P;  2DET A;  2F2W A;  3S3O A;  4KT0 E;  3I56 Q;  4RTU A;  1MMG A;  1QWE A;  3PMT A;  2DRM A;  3V7R A;  1PC0 A;  1J3T A;  1PHT A;  4OB2 B;  3RNJ A;  1QQJ A;  1W2B P;  3CCL T;  4RG8 A;  5J26 A;  2YT6 A;  4HT9 A;  2E5K A;  3R6O A;  3PIP A;  2JMA A;  5CKB A;  3CBP A;  2NUP B;  3CBO A;  5IH2 A;  3MEU A;  3CCR A;  4M7D B;  4J9D A;  2KXC A;  2EFI A;  4DEX A;  2XKO C;  3JCM P;  4Y28 E;  1MNE A;  1YCS B;  2VC8 A;  4F7U G;  3UA6 A;  2D0N A;  1M8M A;  3UWN A;  1Q86 U;  1UE9 A;  1XTD A;  5A0D A;  2J7I A;  4F14 A;  2D8H A;  3KBG A;  4CC2 A;  2KI7 A;  5KYW A;  2DM1 A;  2LJ3 A;  2JJ9 A;  4J6X A;  1RAE B;  1PRM C;  3X24 B;  3CME A;  3OYM A;  1EIF A;  3OB9 A;  3DB3 A;  2OTJ Q;  2ZAE A;  3BDU A;  1KQ2 A;  1VQN T;  5GAM g;  3UA7 A;  4DBH A;  2JVV A;  1TWB A;  1VQM T;  4C8Q B;  2RQW A;  3H0H A;  4PFZ A;  3NGP A;  2EJG A;  3M55 A;  1VOM A;  1WNL A;  2LQW A;  5CVI A;  3M58 A;  1ZHI A;  5LJ3 h;  3L42 A;  4A4H A;  3M9Q A;  2K5F A;  4NS5 A;  3RMQ A;  2GQI A;  1SF9 A;  1CKA A;  2X51 A;  1PD1 A;  5I11 A;  5LJ3 e;  3OYF A;  1UTI A;  2QEX T;  3DLL A;  2KY9 A;  5GAN f;  3VS6 A;  4C92 C;  1N8R R;  2GFA A;  1UJY A;  2QG9 B;  1XQH A;  1M90 U;  4X9C A;  1JJ2 P;  2DTO A;  1M1G A;  2FYK A;  3FEO A;  3OS2 A;  3LW5 E;  1Q7Y U;  2F5T X;  3L1A A;  2G3R A;  1BCO A;  1N6A A;  3X26 B;  4BE2 A;  3EH1 A;  3G6E A;  4XK8 E;  2CUD A;  1QVF S;  1QVF A;  2OTL T;  3P8H A;  3JCM X;  5D6X A;  3R6N A;  2X4W A;  1G3S A;  4FIB A;  2EW3 A;  2FPD A;  1BYM A;  1AWX A;  2JMC A;  2K4Y A;  3OYJ A;  4JJB A;  1G83 A;  2ZPE B;  3CCE A;  2GCX A;  5KCH A;  3LX7 A;  2LRQ A;  1V76 A;  3FLG A;  1KC8 C;  3CCV A;  3L2W A;  2HD0 A;  2YRD A;  5KYW B;  4KH1 B;  2QTV A;  2PVO B;  3M0T A;  2P0Q A;  2XG8 D;  4BY6 C;  2LCS A;  2CS7 A;  2DBK A;  4J9G A;  4JJC A;  3I55 Q;  1VQL Q;  1VQ7 A;  1MV3 A;  2K57 A;  2EQU A;  4ZGE B;  1M3C A;  5HK0 A;  1YI2 A;  8ATC B;  4BI3 A;  4C0G A;  4OP0 A;  3TEE A;  5M9O A;  2LQ8 A;  3QYH B;  3UT1 A;  3EAE A;  2LP5 A;  2DKG A;  4X9D A;  4X34 A;  3X25 B;  1QKX A;  4M75 F;  5FWB A;  1X27 A;  2HKN A;  1WX6 A;  3REA B;  3U23 A;  2K6D A;  3VS1 A;  4N0A A;  1VQ4 T;  5I2M A;  2E65 A;  3PGG A;  1I5L A;  1VQ8 A;  2CUB A;  2RK1 A;  2DK3 A;  5ECA A;  3OW2 P;  4D8D A;  4ZN1 A;  3SHW A;  3VS3 A;  1KHI A;  1NYF A;  1VQO T;  1ZBX A;  2KXD A;  1X2K A;  1YBY A;  2R5M A;  2OAW A;  2EPD A;  1I07 A;  2P4R A;  4E7I A;  2D1X A;  4GY5 A;  1KHC A;  3CCS T;  3MPU B;  4JRQ A;  2PVD B;  4C0D B;  1ZSG A;  4BDZ A;  1BK2 A;  4DA4 A;  1NJI U;  1LNX A;  1Y0M A;  1AZE A;  1AEY A;  4ZTF A;  4B9X A;  4HVU A;  2A36 A;  2C06 A;  1VQK A;  4HXJ A;  2E4H A;  5GAM f;  3REB B;  1N9S A;  2L2P A;  5IXB A;  4J9C A;  1YCY A;  3CCU A;  3MEA A;  2MPX C;  2K5I A;  3JSC A;  2DL8 A;  3EGX B;  3OYE A;  3VS5 A;  1P92 A;  1Y57 A;  1N8R C;  2FL7 A;  2QQ9 A;  1K73 U;  3MO8 A;  4KGV B;  1U3O A;  2C0O A;  1D0X A;  4XQ3 A;  2QYZ A;  2KMT A;  2VXE A;  3F70 A;  1JQQ A;  5GAN d;  2E3I A;  3EFS A;  3NTH A;  2A0F B;  1YJ9 Q;  2P0K A;  4IUP A;  4EMG A;  4PLL A;  1YHQ A;  2MI6 A;  2MOX A;  1OX9 A;  3CME Q;  3CBM A;  2CT3 A;  1UUE A;  2LNV A;  2QAS A;  1VQP T;  1RAB B;  3C12 A;  2YLB A;  4NOY A;  1OV3 A;  2AKK A;  3CCJ T;  3V7S A;  2B86 A;  8AT1 B;  1AZG B;  2DXU A;  3C95 A;  2DVJ A;  2CT4 A;  1TG0 A;  3CC2 A;  2RI3 A;  2J6K A;  4FL6 A;  1TOV A;  2JTM A;  2PUO B;  1I8F A;  5FU7 C;  1PNJ A;  1WYX A;  4OB0 B;  4WCI A;  2JM9 A;  1UGR B;  2DYB A;  1FWZ A;  1OPK A;  2RQV A;  1UHC A;  2QQA A;  1S72 T;  2WAC A;  3EGD A;  2AIR B;  4BUG A;  4LUE A;  1QVG A;  1K9A A;  3ULR B;  2RH2 A;  1Y71 A;  4F04 B;  1WIE A;  4M78 E;  2O9S A;  4A4F A;  1RLP C;  4M78 C;  2EBP A;  2DAQ A;  1U1T A;  2CKK A;  2FRW A;  4DQ2 A;  1WHK A;  3WXM B;  3CCE Q;  3PIO A;  5IN1 A;  1EFN A;  2QQB A;  1ABQ A;  4PJO E;  4N0A C;  3CCV Q;  3A8M B;  4M75 A;  4JJD A;  4C8Q F;  4XTW A;  4E7J A;  4PJO C;  1WHH A;  3CCQ T;  5LJ5 d;  3CXC A;  3QJ6 A;  5A2Q E;  3V8L A;  2XHC A;  2FZG B;  2DEQ A;  1M2V B;  3CC7 T;  1BIA A;  2MIO A;  3CPW S;  2CZ6 B;  1QCF A;  4E7Z A;  1SEM A;  1YJN T;  2COZ A;  1JB0 E;  3OMG A;  5HY6 A;  1I4K 1;  4F7U F;  3DKM A;  3M54 A;  1W2B S;  5KH6 A;  1X01 A;  4BE0 A;  5KYX B;  2P84 A;  2V8J A;  4LE9 A;  2BZX A;  3G4S Q;  3G71 T;  1VQ6 T;  1G3W A;  1MMD A;  1I5O B;  5L8R E;  2RI2 A;  1BI2 A;  2DRK A;  1PKS A;  1KK7 A;  2OJ2 A;  2OTJ A;  3JV3 A;  4M77 A;  1NEG A;  2OI3 A;  3EGD B;  3OA6 A;  2VGM A;  2KRN A;  1OEB A;  2L89 A;  2M51 A;  3I9Q A;  3CMA T;  2CP3 A;  2K5L A;  3V8J A;  2NWM A;  4C5G A;  2FEI A;  4N4H A;  2JW4 A;  1K0S A;  1Z9Q A;  5D6Y A;  1YJW A;  1KFZ A;  2JT4 A;  5EC7 A;  3VRZ A;  1UEB A;  2DBM A;  1KIK A;  1QVP A;  4MML A;  2VGN A;  3GLX A;  3HHT B;  5LJ3 d;  4FYW B;  3A98 A;  5CAI A;  3RIR A;  2DLP A;  2M16 A;  2J06 A;  3PVQ A;  2COW A;  1I0C A;  2JTF A;  3OSS C;  1D3B A;  1HYO A;  4PL6 A;  1S1N A;  1KD1 R;  1JJ2 S;  2DTI A;  5CCA A;  5AT1 B;  4A4G A;  3CD6 Q;  3EHQ A;  2YWW A;  3X28 B;  3OYC A;  1W1F A;  4QQG A;  3JCM b;  1WHM A;  1LCK A;  4Q5W A;  4JS4 A;  4QKU A;  3JB9 I;  1GCQ C;  2E5Q A;  1K0X A;  1BCM A;  1RAI B;  3BDL A;  4J7F A;  1JEG A;  2MF2 A;  4OMM A;  3GNF B;  2BZY A;  3E2U A;  2NUP A;  1RAG B;  4M7D A;  1QMC A;  1AWO A;  4LDU A;  2A28 A;  3MKD A;  3OYG A;  1VQL A;  2O2O A;  1MND A;  3L2V A;  2CGH A;  2ZPI B;  1X6O A;  4F16 A;  3IQL A;  1UJ0 A;  1M1K R;  3FIF A;  3JB9 J;  2QA4 A;  2KR3 A;  5D7U A;  2GGR A;  3RMS A;  1GXI E;  1AD5 A;  1D1A A;  5CKD A;  3CC2 Q;  2VVK A;  1YIT A;  2HEQ A;  1QWF A;  4Z02 A;  2M0Y A;  1XOV A;  2L0A A;  2ZPB B;  3EFO A;  4M75 C;  3THK A;  3MHX A;  3OY9 A;  4BI8 B;  2L8D A;  2RQU A;  3QHS A;  5GAN 3;  5DLQ E;  2QGF B;  3H6Z A;  4C92 G;  4C8Q A;  3JCM g;  3CC4 A;  2EQJ A;  3I5S A;  1WHL A;  3OYA A;  1BKB A;  2RHX A;  2GTJ A;  3E1S A;  3CCR T;  1QCO A;  2DL4 A;  3WVE B;  4FCY A;  4A53 A;  4M7A E;  3SWN B;  1VQ5 Q;  1NPP A;  3OW2 S;  3OW2 A;  4M7A C;  1D3B B;  2CH4 W;  2VUB A;  1WXU A;  4F7U A;  2DJQ A;  2AKL A;  4ZTJ A;  2KT8 A;  4FT4 A;  4P5N A;  1JXO A;  2EVR A;  3H0F A;  3CCM Q;  3LLR A;  2RJF A;  1K8A R;  1KQS P;  4C92 D;  4J83 A;  2RQT A;  2SEM A;  4OB3 B;  3J7A F;  4XTU A;  2LX7 A;  2XI9 A;  2KRM A;  1ABO A;  4M77 C;  1ZSZ C;  1M8V A;  2RB6 A;  2ZPF B;  1VQ9 A;  2AZS A;  3VUZ A;  4VUB A;  2O9V A;  4QQD A;  2FG0 A;  5J3B A;  1B34 B;  3RKY A;  1K9M R;  4DBF A;  1IXD A;  5GAM h;  1ZUU A;  4TVR A;  5HK3 A;  4OF1 A;  4AG1 C;  2KT1 A;  3TCJ A;  5C6S A;  4LDX A;  3RER A;  5GAM e;  1Q81 U;  3I5R A;  1IGU A;  2YSQ A;  2RPN A;  2WSE E;  1SHG A;  3JCM Q;  3HRU A;  2KE9 A;  1YJ9 A;  1Q82 U;  1TUG B;  2P0P A;  3RR6 A;  3UAT A;  4ELZ C;  4EIK A;  2LVM A;  1KD1 C;  3A8O B;  3VYG A;  2L3Q A;  3EFO B;  4E2F B;  2RI5 A;  2YRV A;  1KG1 A;  4DBR A;  1YNZ A;  1QW1 A;  2LJ0 A;  3SD4 A;  2RM4 A;  2OX7 A;  3VS2 A;  3KUF A;  4KUI A;  4HA8 A;  5AYF A;  5GAO r;  4HCB A;  1X69 A;  1BI3 A;  4ATO A;  1KSW A;  2HBP A;  3G6E T;  3A8H B;  2XU8 A;  4XU2 A;  1MHN A;  1OOT A;  3OYL A;  2HQX A;  2HQE A;  3URG A;  2H3J A;  1WLP B;  4O6J A;  4KBM B;  3QII A;  4C92 E;  1VA7 A;  4UC4 A;  2PQW A;  1YJW Q;  1G2B A;  1M1K C;  2O01 E;  3PMI A;  4M7D C;  3GOX A;  1M2O A;  4F7U B;  2HAX A;  3CCV T;  1B7T A;  1NBE B;  1Y96 B;  2MK5 A;  1OYX A;  5GMK i;  3M0S A;  4HT8 A;  3L2Z A;  1K1Z A;  3MCA B;  2BUD A;  5CKF A;  4HCZ A;  1RAH B;  1LVK A;  3MP8 A;  2G6F X;  1VQ7 T;  4LDW A;  2Y4Y A;  1SKU B;  4ANJ A;  2FZK B;  3FJP A;  1YI2 T;  2MCN A;  3QUI A;  3RKX A;  2VKN A;  1G3T A;  2CSI A;  1WJS A;  4F17 A;  2I0N A;  1UGV A;  7AT1 B;  4JUV A;  1TUD A;  4N4I A;  1WHG A;  2QGG A;  4RTY A;  2BZ8 A;  5FW9 A;  2MMP A;  1M5Q 1;  2IVW A;  2GQV A;  4XU0 A;  3EGX A;  4KRT A;  4C8Q C;  3QPH A;  4K11 A;  4AFU C;  2PZ1 A;  4Z8A A;  4PFP A;  2PNI A;  1VQ8 T;  5GAN 4;  4Z89 A;  2LT1 A;  2W0Z A;  1YP5 A;  2QA4 Q;  2EQM A;  1ZX6 A;  3EH2 A;  2FO0 A;  1K8A C;  3OS5 A;  4IUR A;  4LDY A;  1BU1 A;  1YIT Q;  4J9H A;  4RMO A;  1JRI A;  1F1B B;  2Y4X A;  2D0Q B;  2WSC E;  1TTH B;  2RJE A;  1FXX A;  1NM7 A;  5CK9 A;  1WDX A;  3H0I A;  2E70 A;  3VRY A;  4RUG A;  1UDL A;  3G4S A;  3EG9 A;  4EPC A;  2IIM A;  4MMK A;  1K9M C;  5FRO A;  3CC4 Q;  3BY7 A;  1UHF A;  1VQK T;  2XD0 A;  1M9S A;  5FRN A;  2CRE A;  2I2L A;  4XTX A;  3TVT A;  3CCU T;  1K76 A;  5FU6 B;  4EMK A;  1IZ6 A;  2LZ6 B;  1AWJ A;  4DBQ A;  1FYN A;  3JRZ A;  2B8A A;  4A4K A;  3O8V A;  4KUL A;  1R0C B;  4IIM A;  2AHJ B;  1R8O B;  2WSF E;  4J6Y A;  3A8L B;  1U5S A;  1TUC A;  1OZ3 A;  4M78 G;  1PM3 A;  3MP6 A;  1MV0 B;  1B07 A;  3GBQ A;  1QKW A;  4J9B A;  1BB9 A;  4OMO A;  5D6W A;  1RAF B;  1GBQ A;  4DOW A;  3HP9 A;  4J7I A;  2DD4 A;  3OS1 A;  5LL6 S;  1YHQ T;  1D0Z A;  4IUT A;  1D09 B;  2YRC A;  4BAC A;  1ZLM A;  3PFS A;  3KXT A;  4PJO G;  1WXB A;  1VQ9 Q;  3A1P A;  1VQ4 A;  2SRC A;  1UG1 A;  1NEB A;  3HFN A;  1VYU A;  3VKI A;  1JBM A;  2ZZD A;  4Y92 A;  2FHD A;  3V8K A;  3LWI A;  4MZP A;  4M78 D;  3CD6 A;  3VYH B;  2R57 A;  2ZPG B;  1ZUK A;  2O31 A;  1Q86 R;  4JDS A;  5GJV B;  3H9N A;  3CC2 T;  4HCK A;  5DM7 R;  2EGA A;  1H3Z A;  1IB8 A;  5IHI A;  2QDY B;  2K3B A;  4JLI A;  1TXQ A;  1X2Q A;  1M2V A;  2CP2 A;  1SSF A;  3E9G A;  2E6Z A;  3HRT A;  4PJO D;  5GMK j;  4E7S A;  5C0M A;  4C0D C;  3EG9 B;  4OMQ A;  2KNB B;  3FJ5 A;  2X4J A;  2E12 A;  2COY A;  1RLQ C;  1OUL A;  2EQK A;  3GIB A;  1ZQ1 A;  1QLY A;  2K3Y A;  5KYX A;  2DIG A;  3CCL Q;  1BBZ A;  5IT9 E;  1WJQ A;  4EMK B;  1SPK A;  4L5G A;  2D9T A;  3TRE A;  2FVU A;  2EGE A;  4II1 A;  2QDL A;  2J6O A;  4OMN A;  4DEY A;  3S3N A;  1YIJ T;  2DXB A;  4IUV A;  3GNG A;  2H3E B;  4FT2 A;  3MJX A;  3PVL A;  5KCO A;  2RJD A;  2CSQ A;  4WTO B;  1WGS A;  2C0T A;  1YN8 A;  1M90 R;  4CRI A;  2H8H A;  1G3Y A;  1N27 A;  3I56 T;  4BDY A;  1MMA A;  5GAN 2;  2HQH A;  4FSS A;  4RTX A;  4C92 F;  1Q7Y R;  3EFR A;  4D8K A;  1HK9 A;  2JXB A;  1A0N B;  1QVF P;  1AVZ C;  1PRL C;  1R77 A;  2CYZ B;  3HL8 A;  2Z0W A;  1ZBJ A;  1VQP A;  4XU3 A;  1VQ5 A;  1VQM Q;  1M4Z A;  1YWP A;  5DY9 A;  1KC8 U;  3RBB B;  4L59 A;  2GNC A;  4YTL A;  3CCM A;  1MGQ A;  5DLO A;  2K3X A;  3QDF A;  2RN8 A;  2RA2 A;  4WF2 A;  2QEX Q;  1AHJ B;  3NTI A;  3RES A;  3NPF A;  2JN0 A;  4QW2 A;  3JCM J;  2OTJ T;  3CPW A;  4OGC A;  4E47 A;  4LN2 A;  2ZGW A;  4AMC A;  1KQS S;  3ZL7 C;  1KQS A;  2ZCF B;  1NLP C;  3VS7 A;  1U1S A;  2DO3 A;  4C0Z A;  4FSX A;  1RUW A;  3NMZ C;  4ORZ A;  1W2B A;  2OTL Q;  4HVV A;  3OYI A;  5CQX A;  1GBR A;  3C94 A;  1PSE A;  5A0G A;  4GLM A;  3D7S B;  1K4U S;  2XIC A;  3UF4 A;  5GAO m;  5GAM d;  1W6X A;  2K9G A;  4PNO A;  2E10 A;  2KBT A;  3BW1 A;  3OBW A;  4RCC A;  2V1Q A;  1Q86 C;  2LX9 A;  4BE1 A;  1T0J A;  3VS0 A;  3T9N A;  4Y91 A;  2K2M A;  4QT7 A;  5IXF A;  2A08 A;  2ED1 A;  2RO0 A;  2RD1 A;  1WJR A;  3CCQ A;  4RTV A;  1ZUY A;  2MYS A;  5IHK A;  1GFC A;  2QQS A;  5IHN A;  2F2V A;  2CP0 A;  2DD5 A;  1NJI R;  3V7C A;  4M7A G;  5J39 A;  3LH5 A;  2LDM A;  5GAN j;  1HSQ A;  2L3S A;  4M75 D;  1Y7X A;  1T3S A;  3GP8 A;  3EG1 A;  1M3A A;  1VIE A;  2LTO A;  1WI7 A;  1N8R U;  3RDV A;  2VXF A;  1SRM A;  2YUQ A;  3SWN A;  2KEA A;  1VQ4 Q;  3AT1 B;  5CKE A;  3I55 T;  1VQL T;  2X35 A;  2DPP B;  4M77 G;  1JJ2 A;  2ZPH B;  1VQO Q;  1WPY A;  1M90 C;  2QTX A;  1K73 R;  2CZ1 B;  4RTZ A;  4OGE A;  2VYT A;  4BD3 A;  2GTO A;  3JAM E;  3UDC A;  4AFZ C;  3CCS Q;  4M7A D;  2K2V A;  1Q7Y C;  1PD0 A;  1E6G A;  4PJL A;  2QXF A;  3J81 E;  1I1J A;  2CZ7 B;  3ME9 A;  4LD9 K;  4ZGJ B;  3PNW C;  3DB4 A;  4M4Z A;  3QZ5 B;  3JCM c;  2YUP A;  1B34 A;  1BI1 A;  4IKF A;  1VYT A;  1VUB A;  2ED0 A;  3JCM h;  4PJJ A;  4M77 D;  2MWP A;  2YHT A;  5HCK A;  2KGT A;  4FYX B;  3JCM e;  2CP7 A;  2HKQ B;  4CC4 B;  4C0F A;  4M75 E;  1G5V A;  4OML A;  5GAO p;  1H64 1;  2DXT A;  2PU9 B;  2LQK A;  3FDR A;  3PT9 A;  4E7L A;  2KDS A;  2HSP A;  4NL3 A;  1NE8 A;  1UGS B;  1MMN A;  2DA9 A;  4R0K A;  4IUU A;  1BIB A;  3SFM A;  1QVG P;  5KYY B;  3C4S A;  3BE3 A;  4M7D G;  1OQK A;  5I22 A;  3JB9 H;  3FRN A;  3TSZ A;  1U8R A;  4BI4 A;  1UGP B;  4PFO A;  1XNI A;  5LJ5 j;  3G1J A;  2DL7 A;  1H8K A;  1VQP Q;  3PTA A;  2RK2 A;  1WQW A;  2HL5 C;  2EKH A;  2E6N A;  4C5I A;  1RAC B;  3CCJ Q;  1IHW A;  1Y96 A;  3ZEH A;  4QQ6 A;  3QZ9 B;  3LGL A;  1ACM B;  4M78 F;  1KC8 R;  3SEM A;  1YJ9 T;  4X1V A;  5EG2 A;  4M77 E;  4M7D D;  3JB9 G;  3INZ A;  5CIU A;  2IG0 A;  3CXC P;  2BTT A;  3CME T;  2KRS A;  2CZ0 B;  4MDX A;  2DYI A;  4RKU E;  1NJI C;  1IHV A;  2Y90 A;  1S72 Q;  2MWO A;  4PJO F;  1C6V X;  4MZT A;  2JUF A;  3OMC A;  3QO3 A;  1GL5 A;  4DOV A;  3A5Z B;  4XTY A;  1OPL A;  4C92 B;  5CKH A;  3BFM A;  1X75 C;  2EYZ A;  2D8J A;  2NLU A;  2GF7 A;  4FU6 A;  2O88 A;  2A37 A;  3VS4 A;  2DE0 X;  2ABL A;  3QBY A;  1KJW A;  5LJ5 g;  2ROT A;  1N5Z A;  5GAN 6;  1W4S A;  3JB9 D;  4O5V A;  1LOJ A;  3SB2 A;  3I35 A;  3MEW A;  3QXE B;  2V8I A;  1K73 C;  4C8Q D;  2QAZ A;  4ZN3 A;  3SWN C;  4JRI A;  3HKS A;  5LJ3 j;  4FW2 A;  4CC7 A;  4Z88 A;  4J5Y A;  2DNU A;  2DZ9 A;  3CCQ Q;  5KE2 A;  1U06 A;  3CCL A;  1QCN A;  1IGQ A;  2RMO A;  2X4Y A;  2M1H A;  3CC7 Q;  2RQR A;  2E41 A;  2EIF A;  1O75 A;  1YJN Q;  4M7D E;  4FYV B;  1W70 A;  3CCE T;  3M59 A;  3LH0 A;  3H41 A;  1FMV A;  4BY6 B;  3L2U A;  1EZZ B;  1UEC A;  2EJ9 A;  2NUT B;  1PCX A;  2KYM A;  2DIL A;  2LC4 A;  3OYH A;  3G71 Q;  3QSU A;  3G7Z A;  1VQ6 Q;  5FWC A;  5CR2 A;  2K7A A;  4JPB W;  5KYU A;  2ENM A;  2BE9 B;  4PLI A;  1RL2 A;  3M0Q A;  1VQN A;  3DLM A;  4XTZ A;  2XDB A;  1Z9Z A;  1VQM A;  1I81 A;  2F69 A;  5LJ3 g;  3JCM f;  1M1F A;  3M53 A;  4C8Q E;  3S6W A;  3QJY A;  3CMA Q;  1ZA1 B;  3M0U A;  3G4S T;  2AT1 B;  1OX8 A;  4D6W A;  3J80 E;  4MZM A;  1AWW A;  2QEX A;  3EG0 A;  3FC3 A;  1YFN A;  1JO8 A;  2X3X D;  1WHJ A;  1LPL A;  1X6B A;  2RF0 A;  2DEU A;  2DMO A;  3RKW A;  1WZO A;  2EGC A;  5GMK m;  4ELY C;  2LCC A;  4KGZ B;  2V8K A;  4F7U E;  5FLX E;  1OZ2 A;  4JZ3 A;  5GAN 5;  1UFF A;  2HSE B;  3P8D A;  2OTL A;  3HTR A;  3OS0 A;  2J05 A;  1TU0 B;  1GCP A;  2QI2 A;  2ESW A;  3GF5 A;  2RHY A;  3HSB A;  4M78 A;  1GRI A;  4OB1 B;  4B9W A;  2EWN A;  1D1C A;  2EYW A;  2EKO A;  1YWO A;  2OAU A;  1QP2 A;  3ZBD A;  1T0H A;  2YDL A;  1VYV A;  4A63 B;  3OQ5 A;  5L23 A;  3MET A;  4EMH A;  2EAY A;  2M0O A;  4PJO A;  4HKE A;  1QP3 A;  4XTV A;  4RTW A;  2HZY A;  1NG2 A;  5KYU B;  3SDZ A;  5GAO l;  2ECZ A;  2O4X A;  3ZFJ A;  1FMW A;  5LJ5 f;  2L5Q A;  3WVD B;  3CD6 T;  1VIF A;  1BI0 A;  1D1B A;  2BE7 D;  2JM8 A;  3LWH A;  2DJZ A;  3P8B B;  4M7A F;  1CKB A;  1V29 B;  4AG2 C;  2DL3 A;  1RAA B;  2LNH B;  2BKD N;  4PKC C;  1OI1 A;  5GAN 7;  4J8O A;  5IAY A;  4HCC A;  4CC3 A;  2A3L A;  5CQY A;  2V1R A;  2KYB A;  2DX1 A;  4ESR A;  1VQO A;  4LNP A;  4M77 F;  3VUB A;  4AT1 B;  5FU7 B;  4GBQ A;  3CCR Q;  2MAM A;  1PSF A;  1TSF A;  4PJN A;  3QKJ A;  3RUX A;  5I21 A;  1B3Q A;  2BIV A;  3O5Z A;  3CCS A;  1KD1 U;  3CEY A;  1Q81 R;  2A7Y A;  1ARK A;  2F2X A;  4MDW A;  1JXM A;  1E6H A;  1H92 A;  5FU6 C;  1HD3 A;  1NYG A;  1Q82 R;  1IO6 A;  1RI9 A;  2L3R A;  1M3B A;  1AT1 B;  3E19 A;  3VV0 A;  2NUZ A;  4M78 B;  1SSH A;  4FW1 A;  3TQ7 P;  4QVD A;  2VB6 A;  2KVQ G;  3EGU A;  1OU8 A;  1N9R A;  1V1C A;  2E1H A;  5LJ3 f;  1HXD A;  1Q95 G;  2DER A;  3JCM V;  1NZ9 A;  1VQ5 T;  9ATC B;  1M1K U;  3JCM d;  3L2Q A;  4PJO B;  2C0I A;  5HKC A;  2E3H A;  3UPU A;  2O4X B;  1CSK A;  2X4X A;  3A8G B;  5GMK h;  3QWX X;  3M4G A;  3CCM T;  2YUO A;  2EYQ A;  3OYB A;  3OYY A;  4LUD A;  5GMK e;  3FB9 A;  4JRK A;  3OYN A;  2IPO B;  3OSV A;  4M7D F;  1GCQ A;  2XK0 A;  2QK0 A;  4R56 A;  1HJD A;  3KFV A;  4J9I A;  1FMK A;  4AFQ C;  1WXT A;  1DJ7 B;  1VQN Q;  2M9U A;  1X43 A;  2KRO A;  4FM4 B;  1QVG S;  3Q1J A;  3CCJ A;  3G6E Q;  1E7O A;  1D0Y A;  2D6F A;  4XU1 A;  2LQN A;  2JS2 A;  1MUZ A;  2DIQ A;  1WA7 A;  3NHN A;  3VJP A;  4V2S A;  3M0R A;  2XMF A;  3QYG B;  3TU4 K;  1JU5 C;  4B6M A;  3PE0 A;  4L6V 5;  1YIJ A;  4KUD K;  2YXY A;  2PUK B;  2E64 A;  5KYN A;  4EMK C;  3VU3 C;  3JB9 F;  1T3L A;  1K8A U;  4LD6 A;  4ZNX A;  2F5K A;  1ZA2 B;  4GLK A;  1PWT A;  1S72 A;  3I56 A;  4R55 A;  4FYY B;  2KSS A;  3CPF A;  4JLG A;  2W10 A;  1C0M A;  2KK4 A;  3CXC S;  2ATC B;  1VQ7 Q;  5FRM A;  4RG2 A;  1SG5 A;  1FX7 A;  2ROL A;  1YI2 Q;  1R0B G;  1K9M U;  2FPF A;  2XID A;  2JNG A;  6AT1 B;  2HMA A;  1YJW T;  4IIO A;  4J9F A;  4M75 G;  4ZGD B;  2XDP A;  2CDT A;  4M7A A;  2AZV A;  1WFW A;  2XDD A;  5CO7 A;  2RJC A;  4KH0 B;  3S3M A;  2HNI A;  2VV5 A;  1Q81 C;  3EHR A;  3AHU A;  3QG1 A;  1VQ8 Q;  1G8X A;  4CI0 C;  3ER0 A;  1Q82 C;  4NL2 A;  3CC7 A;  3EG3 A;  2J6F A;  3H8Z A;  2HCK A;  1NLO C;  1LJO A;  1ZSZ A;  2YUN A;  1XJW B;  1YJN A;  4LXC A;  3QWY A;  5KYY A;  4OMF B;  1OU9 A;  3C0C A;  3L2R A;  2M02 A;  1IRE B;  2EQI A;  5GAO n;  4KGX B;  4BB7 A;  2GFU A;  2FB7 A;  4IUQ A;  1C1A A;  2CP6 A;  3G71 A;  3MEV A;  1VQ6 A;  2CH4 A;  4QVZ A;  2EYY A;  2DF6 A;  3M4Y A;  2DL5 A;  1VQK Q;  2EJF A;  2VAS A;  4HVW A;  1H3H A;  2QA4 T;  5I2S A;  1UGQ B;  3CCU Q;  4OMP A;  2DXC A;  2PVG B;  1M27 C;  4M75 B;  5GJW B;  4JJN K;  1YIT T;  4AFS C;  3LYI A;  3X20 B;  5GAO q;  4RTT A;  1SHF A;  5GAN h;  3M5A A;  2AK5 A;  4XAX B;  4PJM A;  1AOJ A;  2RNA A;  5GAN e;  2JS0 A;  2LMJ A;  4JZ4 A;  3CMA A;  2HDA A;  2R5A A;  1PKT A;  3LGF A;  2YLC A;  3NFC A;  3QDR B;  3CC4 T;  2RHU A;  2RHZ A;  1SRL A;  2F1L A;  4C92 A;  4N4G A;  1YHQ Q;  4RCB A;  2DVE A;  2GBQ A;  4M7A B;  4OVA A;  4LDV A;  1M30 A;  4ME7 A;  2P4T A;  5A0L A;  5GAN g;  4C5H A;  2HL3 A;  5GAN 8;  2NYS A;  2EYX A;  2KQW A;  3JCM W;  2X3W D;  3I55 A;  4A4E A;  2PTK A;  4PK4 A;  2V26 A;  1KQ1 A;  3HPW A;  3CQT A;  2JZ2 A;  4EDU A;  1WQ7 A;  1O9S A;  3ASK A;  4M77 B;  1ZSZ B;  3HRS A;  5GMK l;  2X9H A;  4E6R A;  2FPE A;  4E7H A;  2JOY A;  1X6G A;  2DZC A;  1VQ9 T;  4QVC A;  3GPL A;  2LT4 A;  4C5E A;  3M0P A;  2LJ1 A;  2JTE A;  3M56 A;  2R58 A;  1TS9 A;  2QQR A;  2LCL A;  3E9F A;  2NUT A;  1UB4 A;  4E7K A;  4J6W A;  4JRP A; 
#chains in the Genus database with same CATH homology
 1NEG A;  3EG2 A;  2OI3 A;  4OMQ A;  2KNB B;  3FJ5 A;  1AWW A;  3EG0 A;  2FRY A;  1JO8 A;  2X3X D;  2L3P A;  2KRN A;  1OEB A;  2RF0 A;  1RLQ C;  1X6B A;  2M51 A;  2VWF A;  1GFD A;  1QLY A;  3I9Q A;  3TSW A;  2K79 A;  2DMO A;  1BBZ A;  2NWM A;  4J9E A;  2FEI A;  2EGC A;  2HBW A;  1SPK A;  2JW4 A;  2EGE A;  2F2W A;  1K0S A;  1Z9Q A;  2QDL A;  4RTU A;  2J6O A;  4OMN A;  4DEY A;  1QWE A;  4JZ3 A;  1KFZ A;  2DRM A;  2JT4 A;  5EC7 A;  3VRZ A;  1J3T A;  2DBM A;  1PHT A;  1UFF A;  3RNJ A;  3PVL A;  1KIK A;  2YT6 A;  2E5K A;  3A98 A;  2CSQ A;  2J05 A;  2JMA A;  5IH2 A;  2C0T A;  1GCP A;  1YN8 A;  2ESW A;  4J9D A;  2KXC A;  4DEX A;  2H8H A;  2DLP A;  2J06 A;  3PVQ A;  1YCS B;  1I0C A;  1GRI A;  3UA6 A;  2D0N A;  1M8M A;  4FSS A;  4RTX A;  4D8K A;  1UE9 A;  2JXB A;  2EYW A;  1A0N B;  1AVZ C;  1S1N A;  1PRL C;  1YWO A;  2J7I A;  4F14 A;  2D8H A;  4CC2 A;  3EHQ A;  1T0H A;  2DM1 A;  2YDL A;  1VYV A;  1W1F A;  4A63 B;  5L23 A;  2LJ3 A;  1ZBJ A;  1LCK A;  1GCQ C;  1K0X A;  1JEG A;  4RTW A;  1NG2 A;  1YWP A;  4OMM A;  2ECZ A;  1PRM C;  2BZY A;  3RBB B;  2GNC A;  1AWO A;  2JM8 A;  2RN8 A;  3UA7 A;  2A28 A;  2RQW A;  2O2O A;  3H0H A;  3NGP A;  1CKB A;  4F16 A;  3IQL A;  1UJ0 A;  3NPF A;  2LQW A;  4AG2 C;  2DL3 A;  2KR3 A;  2GGR A;  2LNH B;  2GQI A;  4LN2 A;  1AD5 A;  5I11 A;  1CKA A;  3ZL7 C;  2VVK A;  1NLP C;  1UTI A;  2HEQ A;  3VS7 A;  1QWF A;  3VS6 A;  2M0Y A;  1XOV A;  2L0A A;  1UJY A;  4CC3 A;  1RUW A;  3NMZ C;  4ORZ A;  2V1R A;  4HVV A;  2KYB A;  2DX1 A;  4ESR A;  3THK A;  4LNP A;  1GBR A;  2RQU A;  4GBQ A;  4GLM A;  1B3Q A;  1K4U S;  3O5Z A;  3UF4 A;  3I5S A;  1ARK A;  1W6X A;  2K9G A;  2F2X A;  2CUD A;  2KBT A;  1JXM A;  1E6H A;  1H92 A;  1HD3 A;  1NYG A;  2GTJ A;  2V1Q A;  1IO6 A;  1RI9 A;  3R6N A;  1T0J A;  2DL4 A;  1M3B A;  2EW3 A;  2FPD A;  3VS0 A;  5IXF A;  2K2M A;  3M0U A;  2NUZ A;  4QT7 A;  2A08 A;  1SSH A;  1AWX A;  2ED1 A;  2JMC A;  4JJB A;  1G83 A;  2CH4 W;  1WXU A;  4RTV A;  1ZUY A;  3EGU A;  2DJQ A;  2AKL A;  1V1C A;  5IHK A;  1GFC A;  2KT8 A;  5IHN A;  1JXO A;  2EVR A;  3H0F A;  2F2V A;  3M0T A;  2RQT A;  2SEM A;  2LCS A;  2DBK A;  3LH5 A;  4J9G A;  4JJC A;  2C0I A;  1HSQ A;  2L3S A;  2LX7 A;  1T3S A;  1MV3 A;  3EG1 A;  2KRM A;  1CSK A;  1M3C A;  1M3A A;  1ABO A;  3QWX X;  1WI7 A;  2YUO A;  2AZS A;  1SRM A;  2YUQ A;  4LUD A;  2KEA A;  2O9V A;  2FG0 A;  2LP5 A;  1ZUU A;  4AG1 C;  2KT1 A;  1QKX A;  1GCQ A;  5FWB A;  1X27 A;  1HJD A;  3I5R A;  1WX6 A;  2YSQ A;  3KFV A;  4J9I A;  3REA B;  3U23 A;  1FMK A;  4AFQ C;  4RTZ A;  2K6D A;  1WXT A;  3VS1 A;  2RPN A;  1SHG A;  1X43 A;  2KE9 A;  2GTO A;  2KRO A;  4AFZ C;  2CUB A;  3UAT A;  5ECA A;  1E6G A;  4D8D A;  4EIK A;  3SHW A;  1E7O A;  1I1J A;  3VS3 A;  1NYF A;  2L3Q A;  2LQN A;  2JS2 A;  1MUZ A;  1WA7 A;  3NHN A;  3M0R A;  2KXD A;  1X2K A;  2XMF A;  4M4Z A;  1YNZ A;  2EPD A;  1I07 A;  1JU5 C;  2LJ0 A;  2OAW A;  2P4R A;  2D1X A;  2YUP A;  3PE0 A;  3VS2 A;  1VYT A;  1X69 A;  1KSW A;  1ZSG A;  2ED0 A;  1OOT A;  1BK2 A;  1T3L A;  1WLP B;  4ZNX A;  1Y0M A;  2KGT A;  5HCK A;  1AZE A;  1AEY A;  1PWT A;  4HVU A;  1VA7 A;  2A36 A;  4CC4 B;  1G2B A;  2W10 A;  4HXJ A;  4OML A;  3REB B;  2L2P A;  5IXB A;  4J9C A;  2ROL A;  2HSP A;  3M0S A;  2DL8 A;  2FPF A;  1K1Z A;  3VS5 A;  1Y57 A;  2DA9 A;  4R0K A;  2G6F X;  4IIO A;  4J9F A;  5I22 A;  3TSZ A;  1U3O A;  2C0O A;  2CDT A;  2AZV A;  1WFW A;  2MCN A;  2VKN A;  2DL7 A;  2CSI A;  4F17 A;  2I0N A;  1JQQ A;  1UGV A;  1H8K A;  3EHR A;  1TUD A;  2EKH A;  4RTY A;  2MOX A;  2BZ8 A;  5FW9 A;  2CT3 A;  3EG3 A;  1UUE A;  2J6F A;  2HCK A;  4KRT A;  1NLO C;  4K11 A;  2YUN A;  3SEM A;  2PZ1 A;  4AFU C;  4Z8A A;  3QWY A;  2PNI A;  4X1V A;  1OV3 A;  2AKK A;  3C0C A;  2B86 A;  1AZG B;  2BTT A;  4Z89 A;  2KRS A;  2W0Z A;  1YP5 A;  2EQI A;  1ZX6 A;  2FO0 A;  2DVJ A;  2CT4 A;  1TG0 A;  1BU1 A;  2J6K A;  2CH4 A;  4J9H A;  2EYY A;  2DF6 A;  2DL5 A;  1GL5 A;  4HVW A;  1PNJ A;  1H3H A;  1WYX A;  1OPL A;  4WCI A;  1NM7 A;  2JM9 A;  1WDX A;  2EYZ A;  2DYB A;  2D8J A;  3H0I A;  3VRY A;  1OPK A;  2RQV A;  4OMP A;  1UHC A;  4RUG A;  1UDL A;  1M27 C;  5GJW B;  2O88 A;  2IIM A;  2A37 A;  3VS4 A;  2DE0 X;  4LUE A;  4AFS C;  2ABL A;  4RTT A;  1SHF A;  1K9A A;  1KJW A;  2ROT A;  1N5Z A;  1UHF A;  3ULR B;  2AK5 A;  1AOJ A;  2RNA A;  3I35 A;  2CRE A;  1WIE A;  2JS0 A;  2LMJ A;  4JZ4 A;  3TVT A;  2O9S A;  2HDA A;  1K76 A;  1RLP C;  1PKT A;  2LZ6 B;  1AWJ A;  2EBP A;  1FYN A;  4CC7 A;  4Z88 A;  2FRW A;  2DNU A;  4IIM A;  1SRL A;  1U06 A;  1U5S A;  2GBQ A;  1TUC A;  1EFN A;  2RMO A;  1M30 A;  1ABQ A;  1MV0 B;  1B07 A;  2RQR A;  3GBQ A;  1QKW A;  4JJD A;  4J9B A;  2EYX A;  1BB9 A;  4OMO A;  2X3W D;  1GBQ A;  1W70 A;  3H41 A;  2PTK A;  1UEC A;  2MIO A;  1ZLM A;  2KYM A;  1WXB A;  3CQT A;  2DIL A;  1QCF A;  1SEM A;  2SRC A;  1UG1 A;  1NEB A;  1VYU A;  5FWC A;  4Y92 A;  2K7A A;  4JPB W;  4E6R A;  2FPE A;  2ENM A;  1X6G A;  3M0Q A;  4LE9 A;  1ZUK A;  2O31 A;  2BZX A;  5GJV B;  4HCK A;  3M0P A;  1Z9Z A;  2EGA A;  2LJ1 A;  2JTE A;  5IHI A;  2K3B A;  2DRK A;  1X2Q A;  1PKS A;  2OJ2 A;  3JV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...