1SRMA

1h and 15n assignments and secondary structure of the src sh3 domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRC TYROSINE KINASE SH3 DOMAIN
publication title 1H and 15N assignments and secondary structure of the Src SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Phosphotransferase
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1srmA00
2A08A 1T0JA 1AWJA 1X69A 2L0AA 1K0XA 4J9IA 1BK2A 4F14A 2DF6A 4KRTA 1K76A 1GCQC 2EGEA 2CUDA 4ESRA 3FJ5A 1A0NB 2DL5A 4J9BA 2A36A 2KXCA 2CH4W 4HVWA 1UHCA 1ZSGA 1NEGA 2J6FA 4QT7A 1X6BA 2PTKA 4OMLA 4JJDA 1IO6A 2LJ3A 4RTUA 1E6HA 2KT8A 1OEBA 2RPNA 2GTOA 3UA6A 4WCIA 3H41A 4J9GA 1UDLA 2L2PA 4R0KA 2FG0A 2EGAA 3EGUA 5IHIA 2DA9A 1CSKA 2CH4A 2HDAA 2J6KA 2KYBA 4Z89A 5FW9A 1QLYA 3H0FA 4Z8AA 2RNAA 2EYWA 2EQIA 1WXTA 3M0SA 2MCNA 1WX6A 2K9GA 1ZLMA 1UJYA 4A63B 2PNIA 1J3TA 1PRMC 2X3XD 4Y92A 4AFZC 4JJBA 2FRWA 2EW3A 1B3QA 1JXOA 1CKBA 2YUNA 4OMNA 4K11A 2V1RA 2JXBA 2AKLA 4GBQA 1FYNA 1W70A 2RQRA 3H0HA 3RNJA 2LQNA 1LCKA 2RQVA 1UFFA 2EPDA 1HD3A 1B07A 2M0YA 1K4US 2JS0A 5IHNA 3M0RA 4FSSA 2OAWA 2DL4A 2K79A 3RBBB 2ED1A 2JW4A 4CC2A 1UHFA 4ZNXA 1VYTA 3GBQA 1VYVA 2JTEA 2ROLA 1G83A 2NUZA 2RF0A 2VWFA 1PWTA 1WLPB 2KBTA 1CKAA 1UGVA 1QWFA 2FPFA 1E7OA 1SSHA 3M0PA 3CQTA 2YUOA 2O88A 2HCKA 2J06A 3O5ZA 2PZ1A 3THKA 2KR3A 1W6XA 3I5RA 4Z88A 2DRMA 2EGCA 2DBMA 3VS7A 4RTZA 2RMOA 1M30A 2F2VA 2K2MA 3PVLA 4RUGA 1NEBA 4D8DA 1NG2A 1UG1A 2AZVA 3EG1A 1UTIA 3QWYA 1KSWA 3UA7A 4LUDA 2GTJA 1UJ0A 2A37A 2DNUA 1ABOA 2SRCA 2F2XA 2HBWA 2YUPA 4RTVA 3VS5A 2RQTA 1RLPC 1PNJA 2DJQA 2AK5A 3PVQA 1GBQA 2VKNA 2DMOA 2CSIA 2JMCA 1SRLA 4EIKA 1BBZA 1GFDA 1WYXA 1NYGA 5HCKA 2KRNA 1OV3A 1K1ZA 1MUZA 1NM7A 4J9EA 2L3SA 4CC3A 1BU1A 1U06A 2EYXA 1U3OA 2EVRA 2HSPA 2RN8A 4HCKA 2B86A 4HVVA 4RTWA 2EKHA 3REBB 2AKKA 2O2OA 2LZ6B 1SHFA 4JZ3A 1G2BA 2H8HA 2KRMA 2DE0X 2LJ1A 2O31A 2J7IA 4RTXA 1M3CA 2CSQA 2DL8A 2JMAA 1MV3A 2KT1A 1I07A 2FPDA 1PKTA 3SHWA 2NWMA 3M0QA 3H0IA 4HXJA 2D0NA 5L23A 3NPFA 4AG2C 2EBPA 2GNCA 1WXUA 3NHNA 4DEXA 2KGTA 1H92A 2JM9A 1KIKA 3IQLA 2BZXA 2GGRA 3C0CA 3ULRB 4LNPA 3M0TA 2QDLA 5FWCA 1V1CA 1X27A 2BZ8A 3QWXX 3JV3A 1X43A 1N5ZA 2DVJA 2ABLA 2O9VA 3EHQA 5I11A 1X6GA 1GCQA 2P4RA 1GRIA 2OJ2A 2RQWA 3U23A 4LN2A 1RI9A 1WDXA 2LMJA 1PHTA 3TSWA 1M8MA 2L3QA 1AWOA 2LQWA 3EG2A 4IIMA 1HJDA 1TG0A 3EG0A 3I9QA 2W10A 1BB9A 4CC4B 1RLQC 1H8KA 3TVTA 2MIOA 4OMQA 1AD5A 3REAB 2X3WD 1UE9A 5FWBA 1JU5C 2KYMA 1WA7A 1YWOA 2ECZA 1QKXA 2AZSA 2O9SA 4F16A 1QKWA 1WI7A 2FRYA 1X2KA 2CT3A 1Z9ZA 1JXMA 4GLMA 1Z9QA 1WFWA 1U5SA 1ZUYA 2ESWA 4JZ4A 1GFCA 4J9HA 4OMPA 2E5KA 2C0TA 2LP5A 2GBQA 2OI3A 3UATA 1RUWA 1S1NA 1NLPC 3I5SA 1VA7A 1Y57A 1E6GA 3TSZA 4AFUC 4E6RA 2L3PA 3VS3A 2CUBA 1T3LA 2C0OA 5I22A 2DM1A 2ED0A 2G6FX 2XMFA 3VS1A 2YUQA 2KE9A 2LJ0A 2KRSA 2DLPA 4OMOA 1K9AA 1ABQA 4OMMA 3VRZA 4LUEA 2RQUA 5GJWB 1PKSA 3VS2A 2LX7A 4DEYA 2CREA 1X2QA 1QWEA 1VYUA 2M51A 1YWPA 1ZX6A 2FO0A 1GCPA 2J6OA 5IXFA 1KFZA 1AWWA 1QCFA 2A28A 3KFVA 2C0IA 1T0HA 3SEMA 2HEQA 3VS6A 2DL3A 1NLOC 2I0NA 4IIOA 2DRKA 1XOVA 1Y0MA 5GJVB 1AZGB 1FMKA 2FEIA 1EFNA 3R6NA 2D8HA 2J05A 2W0ZA 3NMZC 1YN8A 4AFQC 4AFSC 1W1FA 1YP5A 1HSQA 2DYBA 4JPBW 3VS4A 2EYYA 2K7AA 2ROTA 4RTTA 5IHKA 4J9FA 1WIEA 2K3BA 1T3SA 2DL7A 1JEGA 1AOJA 4X1VA 2KNBB 1YCSB 1SEMA 2ENMA 2V1QA 3I35A 1SHGA 5ECAA 1AEYA 1UECA 2DBKA 1MV0B 2GQIA 1WXBA 2BZYA 2YT6A 5EC7A 1JQQA 2FPEA 3LH5A 1AVZC 1I0CA 2YDLA 1ZUKA 1TUDA 2JT4A 3NGPA 2F2WA 2LNHB 2K6DA 1M3AA 1ARKA 1GBRA 5IXBA 1PRLC 1OPLA 4JJCA 4AG1C 1M3BA 1I1JA 3EG3A 2IIMA 2D1XA 2KROA 2DX1A 1KJWA 3VRYA 1K0SA 2YSQA 1SPKA 2MOXA 1M27C 3PE0A 3M0UA 1JO8A 2JM8A 4J9DA 3UF4A 1SRMA 1AWXA 2BTTA 2JS2A 4J9CA 1NYFA 2DILA 1UUEA 4M4ZA 1YNZA 2LCSA 1AZEA 5IH2A 1OPKA 4RTYA 1OOTA 2CDTA 2CT4A 4F17A 4ORZA 4HVUA 2KEAA 3ZL7C 2KXDA 4D8KA 3A98A 1ZBJA 3EHRA 2SEMA 2VVKA 2EYZA 4CC7A 4LE9A 1H3HA 1ZUUA 1GL5A 1TUCA 3VS0A 2D8JA
chains in the Genus database with same CATH superfamily
4JS4A 2IPOB 1K0XA 2L0AA 3VV0A 4C5HA 1W2BA 1K76A 1GCQC 1UGPB 1A0NB 3EH1A 1VQPA 2A36A 2F1LA 3PMTA 2L3RA 1BCMA 2CH4W 4HVWA 4EMKC 5GAN4 2QGGA 1DJ7B 1H641 3CPWS 2MF2A 3CXCP 4OMLA 2YHTA 2K5LA 1VQKT 2LJ3A 3BFMA 1WHJA 2RPNA 4L59A 4C0GA 4BE1A 2KAFA 5GAN7 2QQBA 3CCMT 2EGAA 1D1CA 1TXQA 3OA6A 2HDAA 4Z89A 3H0FA 4F04B 4E7LA 2RNAA 1WXTA 2GQVA 4PK4A 3G7ZA 4XU3A 1UJYA 1PSFA 2PNIA 3FRNA 4QVZA 1IB8A 2QEXA 2WSEE 1PRMC 4Y92A 1OQKA 4OB2B 4YTLA 3DKMA 3MP8A 2EW3A 1JB0E 4R56A 2NUTA 2YWWA 1X75C 1MGQA 3HTRA 4OMNA 5FU7B 5LJ5e 3A8OB 3LWHA 1YFNA 1FYNA 1W70A 3H0HA 5D6XA 3SWNA 3Q1JA 1UFFA 2NYSA 1NZ9A 5GAMe 1JBMA 4OF1A 3L2WA 5GAN6 2NUTB 3M0RA 4PL6A 3OW2A 5CCAA 3UT1A 4EMGA 2O4XA 3L42A 2RB6A 5LJ3g 1RABB 3C95A 4LD9K 1PCXA 3SWNB 5GMKe 1VYTA 2F5TX 5IT9E 2EWNA 2LT1A 3NTKA 1NJIC 4M7DD 4QQDA 1CKAA 3UWNA 1UGVA 3X20B 1K9MR 4XU2A 2E70A 3CCEA 2O4XB 2H3JA 2HCKA 2J06A 3M53A 2X9HA 2KR3A 1W6XA 4X9DA 3VS7A 2JTMA 4N4GA 2RMOA 1X01A 2COYA 1G8XA 2V8JA 4E7ZA 4OVAA 4C0FA 5LJ5d 2K2MA 1KHIA 1UGQB 2K3XA 1VQ7Q 4UC4A 3QWYA 1VQLT 1M1FA 2WSFE 3X26B 2A37A 4X9CA 1MHNA 1C0MA 5GAMd 4E2FB 4J6WA 2HBWA 1RLPC 1G3WA 3JCMW 5KYXA 2MYSA 2K5FA 2JVVA 3DLLA 4EPCA 1GBQA 2VKNA 1VQ5A 1KD1C 4OB3B 1SRLA 4RG2A 2YXYA 4M78E 2FHDA 5D7UA 1GFDA 2KRNA 3HHTB 1PG5B 4II1A 1M1KC 3OW2S 5KCHA 2DEUA 5FRMA 1PC0A 5KYXB 3MEWA 1IGQA 1BU1A 2DTOA 2EYXA 1ZA2B 2EVRA 5CKHA 4RTWA 3RDVA 2CP5A 1BKBA 3LGLA 4HCZA 3CC7A 1R0CB 4JZ3A 2DE0X 2O31A 3QKJA 2DVEA 4RTXA 4M75E 1MV3A 2CS7A 4BI4A 1I07A 2NWMA 3H0IA 4FW2A 3G6ET 3JCMe 1VQOT 3JSCA 3NHNA 4N0AA 4C8QF 4BI3A 1PD1A 2QAZA 1VQKA 4JRQA 3SFMA 1Q81C 2GGRA 1IZ6A 2R57A 4RMOA 2R5MA 1V1CA 1X27A 3CCMA 3M54A 1W4SA 1S72Q 4VUBA 2P4RA 5LJ3h 3U23A 4PFOA 1HYOA 4Z02A 1AWOA 4IIMA 1TG0A 4HCBA 2CZ7B 4XTYA 1Q82R 1R8OB 1BB9A 2EAYA 2FL7A 4E7IA 1QVPA 1RAAB 2LCCA 1HXDA 1AD5A 5LJ3e 4M7AD 2DEQA 2E6ZA 1YWOA 2ECZA 3CC4Q 1QKXA 1RAHB 2AZSA 4B9XA 4F16A 3LYIA 1QKWA 3JCMd 4KGZB 1X2KA 5KYUA 3HRUA 3JCMX 2CT3A 1LPLA 3PNWC 1Y7XA 4J6XA 3I56T 1U5SA 4JZ4A 5CQYA 1QVGP 2E5KA 5KYWA 2LP5A 4M78G 5FU7C 1IHWA 1RUWA 5GANf 3G71T 3DLMA 3OYBA 1Q7YR 4E6RA 4M75A 1T3LA 2C0OA 4O6JA 3VS1A 4KUDK 1KG1A 3CCUQ 2QA4T 3MCAB 3SWNC 5CVIA 3M5AA 1K9AA 4M75G 4BDYA 1VQPQ 3VRZA 4C92F 4M75B 1PKSA 1WJRA 3HSBA 4MMLA 2M51A 4F7UF 4A4FA 1ZX6A 1YCYA 2XG8D 2D6FA 2J6OA 3HPWA 3QJ6A 1BYMA 3OSSC 1T0HA 2HEQA 1Y71A 3SDZA 1NBEB 1NLOC 1Q86U 3MPUB 1D0ZA 1D0XA 2GF7A 2D8HA 3JCMQ 1YN8A 5KYNA 1U1TA 5L8RE 1HSQA 2VC8A 2DYBA 1V29B 3E9FA 5IHKA 4CRIA 3HFNA 1WIEA 1VQ6T 2K3BA 2XU8A 1D3BA 4C5IA 1T3SA 1EX4A 1YHQQ 1JEGA 2COWA 2DKGA 4X1VA 2X51A 2QEXQ 5HKCA 1N9RA 2DBKA 3CCQA 5HK3A 2V8KA 3X28B 1FMWA 2DXTA 2C06A 1QQJA 1XJWB 1D3BB 1AT1B 3I55A 3H9NA 2YDLA 3OS0A 2GFAA 2F2WA 4EMKA 2K6DA 1H3ZA 1GBRA 2E4HA 1I5LA 4JJCA 2H3EB 1VQOA 1D1AA 2JN0A 2IIMA 2D1XA 2RK2A 4M77A 3JCMc 1OX8A 1K0SA 1KJWA 1SPKA 1RADB 1JO8A 2JM8A 3G1JA 1BI1A 4XK8E 2EJGA 1AWXA 2BTTA 1QCOA 2DTHA 2DZCA 4N4HA 3CCEQ 1YIJT 1BI3A 1VQNT 1YNZA 1YITT 1KQSA 2EQJA 1OPKA 2CDTA 2CT4A 1VIEA 4ORZA 2M0OA 4HVUA 4A54A 4A53A 3ZL7C 4EMHA 3CEYA 4D8KA 1YJWT 2SEMA 2EYZA 4XQ3A 4XTVA 4CC7A 3UPUA 4OMFB 1K73R 4QQGA 1NPPA 3WVEB 2CZ6B 1WJQA 1T0JA 1AWJA 2DYIA 4F14A 3P8BB 3I56A 1ZHIA 1VQ5Q 2L8DA 2CUDA 4ESRA 1VQ8T 3QZ5B 1TSFA 1MNDA 3MEAA 2F69A 3TREA 3G71A 3V7CA 2EQMA 4ZGEB 1KC8R 1IO6A 5LJ5f 2KT8A 1U8RA 1OEBA 4BY6B 1G3TA 2RM4A 3UA6A 4WCIA 2CP6A 3H41A 1QP3A 3CC7Q 4R0KA 2FG0A 3FLGA 1YJNT 5GAMf 1CSKA 1RAFB 2CH4A 2KYBA 2BE9B 2ZPEB 1QLYA 1PM3A 2R58A 3M0SA 1WX6A 1KQSS 3S3OA 2XD0A 1VQKQ 4AFZC 4XAXB 4FYVB 3TCJA 4PFPA 1CKBA 3CCMQ 4FYWB 4KH0B 4M75C 1IXDA 4FM4B 4K11A 1V76A 2LT4A 1TWBA 2P0PA 3A8LB 4M7AF 4C8QD 5C0MA 1LCKA 2RQVA 5HK0A 1HD3A 2BE7D 4ZN3A 2M0YA 1VQ6A 1OU8A 2JS0A 3CBOA 4PJOA 5IHNA 4ANJA 2OAWA 1UEBA 2IVWA 2K79A 2RO0A 4KT0E 1M90U 2ED1A 5LL6S 2VB6A 4CC2A 5I21A 1UHFA 4FCYA 2RH2A 4A4EA 1SKUB 3FIFA 4AMCA 1VYVA 2ROLA 1G83A 2NUZA 4PJOB 5A0DA 1WLPB 4BUGA 1QWFA 3CCVT 1E7OA 3EFOB 4BDZA 3L2ZA 2RHXA 3EAEA 3THKA 3VUBA 1KHCA 4Z88A 3QSUA 3CPWP 4RTZA 2HL5C 4ELYC 4C8QG 3PVLA 4RUGA 4PKCC 5GAN2 1NEBA 2CZ0B 4D8DA 2RHIA 2MMPA 4JS5A 2EQKA 1UTIA 1Q86C 2DNUA 1ABOA 2MAMA 3SD4A 2SRCA 2OX7A 4E7SA 3CCUA 3M56A 1YIJA 1VQNA 3PT9A 4MZMA 3QYHB 2M16A 2LTOA 2CSIA 5CO7A 3JCMf 3CC2T 4P5NA 3L2QA 2HAXA 3RIRA 4IUTA 4RKUE 1TS9A 3HKSA 3HRSA 1VQLQ 4M77C 4ZTFA 2L3SA 2AIRB 4XTWA 1M2OA 2VYTA 3OMCA 1M4ZA 4WF2A 1U3OA 4C92D 4ZN1A 2B86A 4JLGA 4M7DE 1W2BP 2CGHA 1SHFA 4L5GA 1G2BA 2LDMA 3OS1A 3MHXA 3QZ9B 1M3CA 2CSQA 1VQ8A 2JMAA 1YHQA 2NLUA 2KT1A 1QVFA 4OB0B 3M0QA 2E3IA 4HXJA 3NPFA 4AG2C 1QCNA 5CKDA 2KY9A 1OYXA 4IUQA 2Y4YA 1H92A 3CMAT 1KIKA 1G3SA 2EQUA 3CCQQ 2BZXA 5KH6A 3OYHA 3ULRB 1BIBA 4LNPA 3M0TA 2QDLA 2BZ8A 2OTJT 3JCMP 3QWXX 4KH1B 3M57A 1N5ZA 2PU9B 2VGMA 3I55Q 3G4ST 3EHQA 1WJSA 1W2BS 5I11A 2FVUA 4KGVB 3R6OA 1K8AR 2OJ2A 2DIGA 4LN2A 2LMJA 3UDCA 4BY6C 1M8MA 2DD4A 3G6EQ 3ME9A 1YBYA 3M9QA 1VQOQ 4F7UG 4J5YA 3X24B 2MI6A 4KGXB 1WNLA 3EG0A 4XTXA 3BDUA 4DBFA 2JTFA 4CC4B 4ATOA 2AHJB 3TVTA 3EFSA 1VQ9A 3REAB 2X3WD 1UE9A 3OBWA 4E7HA 4LDWA 4FYYB 3CBPA 2O9SA 3OSVA 3CCJT 9ATCB 1JXMA 1U1SA 3E9GA 1Z9QA 1ZUYA 1FMVA 1C6VX 3OW2P 3DB4A 2C0TA 4MZPA 1QVFS 3GPLA 3I5SA 4HA8A 2QGFB 4JRKA 6AT1B 3M59A 3M55A 3TSZA 4AFUC 2L3PA 2E64A 3WVDB 3L2VA 2G6FX 3CCVA 1LJOA 4A4KA 4HT8A 4M7DG 2YUQA 2K4YA 2KE9A 2KRSA 2V26A 4B9WA 3CPFA 3I56Q 2DLPA 4M7DB 3MP1A 4OMOA 4O5VA 4OMMA 4JDSA 5GANj 2RQUA 5GJWB 4PJOC 3OYCA 3N5BB 2LX7A 2CREA 4QKUA 3SB2A 4ME7A 1VYUA 3G71Q 1IREB 1I81A 4FYXB 2FO0A 2HQHA 5FLXE 2DK3A 2C0IA 2DRKA 4FT4A 2LQ8A 4ELZC 1FMKA 4M7AE 2VGNA 1BI2A 2W0ZA 1C1AA 4PJMA 4AFSC 1KK7A 1W1FA 4ZGDB 3VS4A 2K7AA 2ROTA 4RTTA 2EJFA 3J7AF 3OYNA 1IHVA 1RAGB 1YI2T 2AT1B 2P0QA 2RJFA 3M58A 3MP6A 1M90C 3JB9I 2E41A 1HK9A 2QQAA 4RCBA 5I2SA 2FZCB 1AEYA 2KQWA 2DAQA 2JNGA 2B8AA 2GQIA 2YT6A 1JQQA 2WACA 3V8LA 1MNEA 3H6ZA 1I0CA 2R5AA 4IUVA 1TUDA 4PLIA 3NGPA 1Q82U 4AT1B 1VQ6Q 1M3AA 3D7SB 5J3BA 1I8FA 3CCST 3O8VA 2EKOA 4AG1C 1M3BA 3OYDA 3LX7A 4A4HA 1WHHA 2KROA 2YRCA 2E5QA 2ZAEA 2RJDA 3VKIA 2E6NA 1UB4A 4M78A 2LVMA 1M27C 3M0UA 3G4SA 1VQ7T 3VU3C 4BI8B 4J9DA 1ZQ1A 3HRTA 3TU4K 1SRMA 3GNFB 2DILA 2FZKB 4J7FA 4RCCA 5DLQE 2OTLT 2LCSA 5GMKm 4RTYA 4M78B 5J39A 1NE8A 3OS2A 1Q7YU 1VQMT 2FZGB 3RR6A 5KE3A 3HFOA 2DTIA 2P4TA 3C4SA 1LOJA 3EHRA 2VVKA 4L6V5 2D9TA 2RJEA 3BY7A 4WTOB 3JB9D 1N8RR 1MMDA 5DLOA 1TUCA 3VS0A 5CAIA 3OYEA 4A4GA 2A08A 4M7AG 1YIJQ 2OAUA 3CCJA 2QASA 3CCLT 1VQNQ 1B7TA 4M7AB 5LJ3d 4KRTA 2YRDA 2DL5A 2DERA 1YJ9T 2XICA 2KXCA 1VQLA 2I2LA 2M1HA 2CP2A 4JRPA 1UHCA 5C6SA 1ZSGA 1YJWQ 1NEGA 4QT7A 3J81E 2EYQA 4MMKA 1X6BA 2GFUA 5GANg 4JJDA 4KULA 5D6YA 2V8IA 3L1AA 2QDYB 1N27A 2L2PA 2LCLA 2RI2A 3EGUA 5AYFA 1KQ2A 2DA9A 1RI0A 1VQ8Q 3ZBDA 5FW9A 2PUKB 1S72T 1GXIE 2K57A 3NTHA 1WHKA 2EQIA 2MCNA 2X35A 2JOYA 5A0LA 5CR2A 2K9GA 5LJ5j 1ZLMA 2RI5A 4A63B 4TVRA 1K9MC 4C0ZA 2RJCA 2X3XD 4D6WA 4JJBA 4M7DC 4MDXA 1XTDA 2FRWA 5GAN3 4HKEA 3ZEHA 1B3QA 1O9SA 2JJ9A 2YUNA 2PVOB 5GAMj 3GOXA 2JXBA 4LDXA 3S6WA 3MO8A 4M77D 1OI1A 3RNJA 3P8HA 4J8OA 2RI3A 2EPDA 3G6EA 3CC4T 1B07A 5GMKj 1RAIB 1YI2A 3H8ZA 3PFSA 4FSSA 2DL4A 2K2VA 2MPXC 1VQ4T 3RBBB 1VQ9Q 3GBQA 1EIFA 2JZ2A 3A5ZB 1XQHA 2RD1A 1B34A 2FYKA 4IKFA 5GMKl 1MMNA 2KBTA 1ZBXA 2CP7A 2KSSA 1SSHA 4N4IA 3CQTA 3JRZA 3GLXA 2PZ1A 4PNOA 2EGCA 1LVKA 2DBMA 2PQWA 3CCSA 5IAYA 1FWZA 1QP2A 2EJ9A 2F2VA 1N9SA 1K73U 1B34B 3PMIA 3FEOA 1P92A 3EG9A 1UG1A 2AZVA 3EG1A 4DA4A 3UA7A 4LUDA 1ZA1B 5GAN8 3QHSA 3CCVQ 3RKWA 2YUPA 1PNJA 3OB9A 1KQSP 2AK5A 2OTLA 2XIDA 3JCMJ 2YLCA 3EG9B 2P0KA 2X4XA 5GANh 3DB3A 4C8QE 1KC8U 4NS5A 1NJIR 1VQMA 2HMAA 5HCKA 2ZCFB 1K1ZA 5KYYB 3VYGA 2E3HA 1NM7A 4J9EA 4DBHA 1EZZB 2E12A 1FXXA 3QPHA 2QG9B 4M78C 2QA4A 4HVVA 2RN8A 5GANe 2EKHA 2HL3A 2AKKA 2O2OA 2HZYA 3CCLA 3FDRA 2YLBA 1Q82C 2LJ1A 4DOVA 5GAOm 3L2UA 3J80E 3CC2Q 2M02A 1YJ9A 2FPDA 1PKTA 3INZA 1OZ2A 1SF9A 2GNCA 3TQ7P 1WXUA 2JM9A 1PD0A 1JJ2A 3IQLA 4Y91A 1KD1R 3BDLA 5GAOn 5I2MA 4PJOD 5GAOp 1Q95G 3QJYA 2DD5A 5LJ5g 2K3YA 3JV3A 5FU6B 2LC4A 3META 4FIBA 3TEEA 2DVJA 1M1KR 1X6GA 1GRIA 2RQWA 4IURA 1WDXA 2HKNA 3EFOA 1Q7YC 2CKKA 5GAMg 2VXEA 2L3QA 3QIIA 2LQWA 4M75F 1I5OB 3CD6T 3CMET 3CMAQ 2L89A 2W10A 4ZTJA 1H8KA 3OMGA 1MMGA 2OTJQ 1TU0B 5FWBA 1JU5C 3MKDA 1WA7A 4C8QA 3FC3A 4LD6A 3G4SQ 1O75A 5CKEA 2RHUA 3JB9F 2MWOA 4C92E 3LH0A 3F70A 3GIBA 1Q81R 4F7UE 3CCRT 4J9HA 4OGEA 5IN1A 1M2VA 4C8QB 5CKBA 2RHYA 1VQ4A 3EFRA 1VA7A 1E6GA 1AHJB 1M9SA 2BIVA 1JJ2S 3CXCA 2DM1A 2ED0A 2DO3A 2CZ1B 2XMFA 1YITA 1M2VB 3A8MB 3CCJQ 3M4GA 3OBYA 1WGSA 5M9OA 1ABQA 3PIPA 3EH2A 3CC7T 4LUEA 1R0BG 2XDPA 4KBMB 3PTAA 4E7KA 1YJWA 3VS2A 4DEYA 1X2QA 4Y28E 1YWPA 2P84A 1GCPA 2A3LA 1MMAA 1WHLA 5IXFA 5FRNA 4J83A 2HD0A 3KFVA 2BKDN 3SEMA 1TTHB 4BE2A 3VS6A 5GAOl 4IIOA 4QQ6A 1Y0MA 5GJVB 1AZGB 4QVCA 4J6YA 1EFNA 2FEIA 2J05A 2LRQA 3ZFJA 4NL2A 1YP5A 3NFCA 3VUZA 4JPBW 4XU0A 2XHCA 4M77F 2XI9A 2HSEB 3OYAA 4PJNA 5GAOq 5LJ3f 2DL7A 3JCMg 4LDVA 5LJ5h 2PVGB 3A1PA 2KNBB 1YCSB 3RESA 3I35A 4C92A 2X4YA 1SHGA 2DZ9A 3T9NA 1WQWA 1K8AU 1YJNA 4F7UA 1MV0B 5GAMh 1TUGB 3ASKA 3QG1A 4E47A 4DBRA 3CXCS 3JCMV 1AVZC 2JUFA 4C92G 2A7YA 1QVFP 3FJPA 4C92B 2LNHB 5GMKh 3X25B 1ARKA 2DETA 1YI2Q 4GY5A 1PRLC 4F7UB 1K73C 1OPLA 1K9MU 1I1JA 3EG3A 4DBQA 3VJPA 2DX1A 5D6WA 4V2SA 5CKFA 3OYYA 1UGSB 2MOXA 1KQ1A 2XDBA 1ACMB 4BB7A 3PE0A 3QO3A 3UF4A 1IRXA 2JS2A 4FT2A 2E1HA 1UUEA 4M4ZA 1KC8C 3AT1B 3QYGB 3CCSQ 1AZEA 5IH2A 7AT1B 4M7DA 1OOTA 3JB9J 3RKXA 5FU6C 3CD6A 4F17A 3CMEA 4XU1A 2QI2A 2KXDA 2NUPA 2G3RA 4ZGJB 3A98A 4JLIA 4LE9A 1H3HA 2F5KA 1ZUUA 4MDWA 5KCOA 1GL5A 2D8JA 1QWEA 1ZSZA 4LXCA 1X69A 3AHUA 2XK0A 4J9IA 1BK2A 2COZA 2OTLQ 3CCRA 2DF6A 2CP3A 4NL3A 2NUPB 2EGEA 3KBGA 3OYLA 3FJ5A 4BACA 4J9BA 3RMSA 1FX7A 1VQMQ 1N6AA 3PGGA 3WXMB 1VIFA 1BCOA 3RERA 4FL6A 4C0DB 3CBMA 1JRIA 1ZSZB 2J6FA 2PTKA 1WHGA 4RTUA 1E6HA 4KUIA 3GF5A 2GTOA 2QA4Q 4FU6A 5HY6A 4B6MA 4C8QC 1UGRB 4J9GA 1UDLA 4PJOF 3CCLQ 3CCQT 3JCMh 1D1BA 3CC2A 5IHIA 2J6KA 1YJ9Q 3PIOA 3I55T 2X4WA 4LDYA 4Z8AA 3MEVA 1VUBA 2EYWA 2K5IA 1D09B 2ZPHB 3ER0A 5A0GA 1J3TA 2O01E 4JJNK 3S3MA 3OY9A 2BUDA 1JXOA 2HQXA 4Q5WA 2V1RA 3OYGA 2AKLA 4GBQA 3FB9A 2RQRA 5CQXA 2LQNA 2QXFA 4M78D 2ZPBB 1K4US 1OX9A 3CMAA 2ZGWA 2QQRA 5CK9A 2DIQA 1QVGA 2DXBA 2OTJA 2LQKA 2JW4A 2VV5A 4ZNXA 5GAN5 4JUVA 3L2RA 2JTEA 2RF0A 2VWFA 1PWTA 1WHMA 2CYZB 2FPFA 3S3NA 4M75D 3M0PA 2Y90A 2YUOA 2O88A 3O5ZA 4E7JA 1RL2A 4DOWA 3I5RA 2DRMA 2KVQG 4M7AA 2DXCA 1N8RU 2DFUA 1M30A 1VQ4Q 4EDUA 5AT1B 2PVDB 1NG2A 2YRVA 1KSWA 4C92C 1R77A 5KE2A 2GTJA 1UJ0A 3QXEB 5KYUB 2HKQB 1YITQ 1OULA 2F2XA 4RTVA 3VS5A 3C12A 2RQTA 2M9UA 4FSXA 2RHZA 2PUOB 1LNXA 3C94A 2DJQA 3PVQA 2HNIA 5KYWB 4M77E 1F1BB 5A2QE 8ATCB 3MJXA 2DMOA 2VXFA 2JMCA 4NOYA 4EIKA 1BBZA 5DM7R 3LGFA 1WYXA 1NYGA 1OV3A 1QW1A 3RKYA 3URGA 3V7RA 2IG0A 1QVGS 1K8AC 1MUZA 4CC3A 4HCCA 1U06A 3OYFA 4R55A 2HSPA 4HCKA 3JB9G 4PFZA 1SSFA 2QYZA 3QDRB 3REBB 1G5VA 2LZ6B 4PJLA 1BIAA 2Y4XA 2H8HA 2KRMA 3GP8A 2J7IA 2RA2A 2X4JA 3OYIA 2EFIA 1X6OA 2DL8A 4C5EA 1Q86R 4HT9A 3SHWA 3M4YA 4XTUA 2D0NA 4DQ2A 5L23A 1TOVA 2EBPA 1RAEB 4DEXA 2KGTA 3RMQA 3HP9A 4OB1B 1YJNQ 3C0CA 5FROA 2QTVA 2KI7A 5FWCA 5GMKi 5CIUA 5GAOr 1X43A 2QQ9A 2ABLA 2O9VA 2D0QB 3RUXA 3VYHB 4C0DC 4BE0A 1ZSZC 2QK0A 1GCQA 1RI9A 4M7DF 1PHTA 4QVDA 3TSWA 2LNVA 3NTIA 2ZPIB 3EG2A 1HJDA 3EGDA 3I9QA 1RLQC 2MIOA 4OMQA 2ZPGB 2KYMA 3OYKA 4EMKB 1WI7A 2FRYA 1TH7A 1Z9ZA 3EGDB 4C5GA 4GLMA 2VUBA 1XNIA 3V8JA 1WFWA 4M77G 2ESWA 3CCUT 1GFCA 4OMPA 3LLRA 4M77B 1VQPT 2GBQA 2OI3A 3UATA 3CD6Q 2DJZA 3CMEQ 1S1NA 2E65A 1NLPC 4OP0A 4GLKA 4IUPA 3JCMb 1VQ7A 1Y57A 5KYYA 2XDDA 2KDSA 1D0YA 3VS3A 2CUBA 5I22A 4N0AC 4PJOE 4IUUA 1NJIU 4QW2A 2L5QA 2LJ0A 2QQSA 3A8GB 3CCRQ 3KXTA 2GCXA 1Y96A 3HL8A 2DXUA 1WQ7A 2KMTA 4J7IA 3LWIA 1SG5A 2MWPA 2FB7A 2HBPA 1WPYA 2ATCB 4CI0C 1YHQT 4PJJA 2EIFA 3E1SA 2QEXT 2LX9A 1KFZA 1AWWA 1QCFA 2A28A 4OGCA 1Y96B 2DL3A 2I0NA 1XOVA 3MEUA 3R6NA 3NMZC 5DY9A 4AFQC 4MZTA 4PLLA 3V7SA 1M1GA 2EYYA 4J9FA 1KD1U 1M5Q1 2Z0WA 2ZPFB 4M7AC 4M78F 2VASA 1AOJA 3QDFA 2KK4A 1SEMA 2ENMA 2V1QA 1M1KU 5ECAA 4XTZA 1UECA 1BI0A 1WXBA 2BZYA 5EC7A 1IGUA 4X34A 2ZZDA 2FPEA 1WZOA 3LH5A 1S72A 1VQ9T 2HQEA 1ZUKA 8AT1B 1M8VA 2JT4A 3CCET 2RK1A 5LJ3j 5GANd 2E10A 1N8RC 5J26A 3E19A 5IXBA 2DPPB 2CP0A 3BW1A 4BD3A 1QMCA 3CPWA 1JJ2P 2A0FB 4JRIA 3V8KA 3VRYA 2YSQA 3GNGA 4RG8A 3KUFA 1VOMA 1Q81U 2QTXA 3LW5E 4PJOG 3CC4A 3QBYA 1NPRA 1RACB 1M90R 3JB9H 3BE3A 4J9CA 1NYFA 1Y07A 3EGXA 3OYMA 2MK5A 1VQ5T 2XKOC 3QUIA 2WSCE 1I4K1 1G3YA 2KEAA 1PSEA 4LDUA 3JAME 1OZ3A 1ZBJA 5EG2A 3OS5A 3EGXB 3A8HB 3E2UA 3P8DA 1OU9A 3OYJA 4FW1A 3OQ5A
chains in the Genus database with same CATH topology
2A08A 1T0JA 1AWJA 1X69A 2L0AA 1K0XA 4J9IA 1BK2A 4F14A 2DF6A 4KRTA 1K76A 1GCQC 2EGEA 2CUDA 4ESRA 3FJ5A 1A0NB 2DL5A 4J9BA 2A36A 2KXCA 2CH4W 4HVWA 1UHCA 1ZSGA 1NEGA 2J6FA 4QT7A 1X6BA 2PTKA 4OMLA 4JJDA 1IO6A 2LJ3A 4RTUA 1E6HA 2KT8A 1OEBA 2RPNA 2GTOA 3UA6A 4WCIA 3H41A 4J9GA 1UDLA 2L2PA 4R0KA 2FG0A 2EGAA 3EGUA 5IHIA 2DA9A 1CSKA 2CH4A 2HDAA 2J6KA 2KYBA 4Z89A 5FW9A 1QLYA 3H0FA 4Z8AA 2RNAA 2EYWA 2EQIA 1WXTA 3M0SA 2MCNA 1WX6A 2K9GA 1ZLMA 1UJYA 4A63B 2PNIA 1J3TA 1PRMC 2X3XD 4Y92A 4AFZC 4JJBA 2FRWA 2EW3A 1B3QA 1JXOA 1CKBA 2YUNA 4OMNA 4K11A 2V1RA 2JXBA 2AKLA 4GBQA 1FYNA 1W70A 2RQRA 3H0HA 3RNJA 2LQNA 1LCKA 2RQVA 1UFFA 2EPDA 1HD3A 1B07A 2M0YA 1K4US 2JS0A 5IHNA 3M0RA 4FSSA 2OAWA 2DL4A 2K79A 3RBBB 2ED1A 2JW4A 4CC2A 1UHFA 4ZNXA 1VYTA 3GBQA 1VYVA 2JTEA 2ROLA 1G83A 2NUZA 2RF0A 2VWFA 1PWTA 1WLPB 2KBTA 1CKAA 1UGVA 1QWFA 2FPFA 1E7OA 1SSHA 3M0PA 3CQTA 2YUOA 2O88A 2HCKA 2J06A 3O5ZA 2PZ1A 3THKA 2KR3A 1W6XA 3I5RA 4Z88A 2DRMA 2EGCA 2DBMA 3VS7A 4RTZA 2RMOA 1M30A 2F2VA 2K2MA 3PVLA 4RUGA 1NEBA 4D8DA 1NG2A 1UG1A 2AZVA 3EG1A 1UTIA 3QWYA 1KSWA 3UA7A 4LUDA 2GTJA 1UJ0A 2A37A 2DNUA 1ABOA 2SRCA 2F2XA 2HBWA 2YUPA 4RTVA 3VS5A 2RQTA 1RLPC 1PNJA 2DJQA 2AK5A 3PVQA 1GBQA 2VKNA 2DMOA 2CSIA 2JMCA 1SRLA 4EIKA 1BBZA 1GFDA 1WYXA 1NYGA 5HCKA 2KRNA 1OV3A 1K1ZA 1MUZA 1NM7A 4J9EA 2L3SA 4CC3A 1BU1A 1U06A 2EYXA 1U3OA 2EVRA 2HSPA 2RN8A 4HCKA 2B86A 4HVVA 4RTWA 2EKHA 3REBB 2AKKA 2O2OA 2LZ6B 1SHFA 4JZ3A 1G2BA 2H8HA 2KRMA 2DE0X 2LJ1A 2O31A 2J7IA 4RTXA 1M3CA 2CSQA 2DL8A 2JMAA 1MV3A 2KT1A 1I07A 2FPDA 1PKTA 3SHWA 2NWMA 3M0QA 3H0IA 4HXJA 2D0NA 5L23A 3NPFA 4AG2C 2EBPA 2GNCA 1WXUA 3NHNA 4DEXA 2KGTA 1H92A 2JM9A 1KIKA 3IQLA 2BZXA 2GGRA 3C0CA 3ULRB 4LNPA 3M0TA 2QDLA 5FWCA 1V1CA 1X27A 2BZ8A 3QWXX 3JV3A 1X43A 1N5ZA 2DVJA 2ABLA 2O9VA 3EHQA 5I11A 1X6GA 1GCQA 2P4RA 1GRIA 2OJ2A 2RQWA 3U23A 4LN2A 1RI9A 1WDXA 2LMJA 1PHTA 3TSWA 1M8MA 2L3QA 1AWOA 2LQWA 3EG2A 4IIMA 1HJDA 1TG0A 3EG0A 3I9QA 2W10A 1BB9A 4CC4B 1RLQC 1H8KA 3TVTA 2MIOA 4OMQA 1AD5A 3REAB 2X3WD 1UE9A 5FWBA 1JU5C 2KYMA 1WA7A 1YWOA 2ECZA 1QKXA 2AZSA 2O9SA 4F16A 1QKWA 1WI7A 2FRYA 1X2KA 2CT3A 1Z9ZA 1JXMA 4GLMA 1Z9QA 1WFWA 1U5SA 1ZUYA 2ESWA 4JZ4A 1GFCA 4J9HA 4OMPA 2E5KA 2C0TA 2LP5A 2GBQA 2OI3A 3UATA 1RUWA 1S1NA 1NLPC 3I5SA 1VA7A 1Y57A 1E6GA 3TSZA 4AFUC 4E6RA 2L3PA 3VS3A 2CUBA 1T3LA 2C0OA 5I22A 2DM1A 2ED0A 2G6FX 2XMFA 3VS1A 2YUQA 2KE9A 2LJ0A 2KRSA 2DLPA 4OMOA 1K9AA 1ABQA 4OMMA 3VRZA 4LUEA 2RQUA 5GJWB 1PKSA 3VS2A 2LX7A 4DEYA 2CREA 1X2QA 1QWEA 1VYUA 2M51A 1YWPA 1ZX6A 2FO0A 1GCPA 2J6OA 5IXFA 1KFZA 1AWWA 1QCFA 2A28A 3KFVA 2C0IA 1T0HA 3SEMA 2HEQA 3VS6A 2DL3A 1NLOC 2I0NA 4IIOA 2DRKA 1XOVA 1Y0MA 5GJVB 1AZGB 1FMKA 2FEIA 1EFNA 3R6NA 2D8HA 2J05A 2W0ZA 3NMZC 1YN8A 4AFQC 4AFSC 1W1FA 1YP5A 1HSQA 2DYBA 4JPBW 3VS4A 2EYYA 2K7AA 2ROTA 4RTTA 5IHKA 4J9FA 1WIEA 2K3BA 1T3SA 2DL7A 1JEGA 1AOJA 4X1VA 2KNBB 1YCSB 1SEMA 2ENMA 2V1QA 3I35A 1SHGA 5ECAA 1AEYA 1UECA 2DBKA 1MV0B 2GQIA 1WXBA 2BZYA 2YT6A 5EC7A 1JQQA 2FPEA 3LH5A 1AVZC 1I0CA 2YDLA 1ZUKA 1TUDA 2JT4A 3NGPA 2F2WA 2LNHB 2K6DA 1M3AA 1ARKA 1GBRA 5IXBA 1PRLC 1OPLA 4JJCA 4AG1C 1M3BA 1I1JA 3EG3A 2IIMA 2D1XA 2KROA 2DX1A 1KJWA 3VRYA 1K0SA 2YSQA 1SPKA 2MOXA 1M27C 3PE0A 3M0UA 1JO8A 2JM8A 4J9DA 3UF4A 1SRMA 1AWXA 2BTTA 2JS2A 4J9CA 1NYFA 2DILA 1UUEA 4M4ZA 1YNZA 2LCSA 1AZEA 5IH2A 1OPKA 4RTYA 1OOTA 2CDTA 2CT4A 4F17A 4ORZA 4HVUA 2KEAA 3ZL7C 2KXDA 4D8KA 3A98A 1ZBJA 3EHRA 2SEMA 2VVKA 2EYZA 4CC7A 4LE9A 1H3HA 1ZUUA 1GL5A 1TUCA 3VS0A 2D8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A08 A;  1T0J A;  1AWJ A;  1X69 A;  2L0A A;  1K0X A;  4J9I A;  1BK2 A;  4F14 A;  2DF6 A;  4KRT A;  1K76 A;  1GCQ C;  2EGE A;  2CUD A;  4ESR A;  3FJ5 A;  1A0N B;  2DL5 A;  4J9B A;  2A36 A;  2KXC A;  2CH4 W;  4HVW A;  1UHC A;  1ZSG A;  1NEG A;  2J6F A;  4QT7 A;  1X6B A;  2PTK A;  4OML A;  4JJD A;  1IO6 A;  2LJ3 A;  4RTU A;  1E6H A;  2KT8 A;  1OEB A;  2RPN A;  2GTO A;  3UA6 A;  4WCI A;  3H41 A;  4J9G A;  1UDL A;  2L2P A;  4R0K A;  2FG0 A;  2EGA A;  3EGU A;  5IHI A;  2DA9 A;  1CSK A;  2CH4 A;  2HDA A;  2J6K A;  2KYB A;  4Z89 A;  5FW9 A;  1QLY A;  3H0F A;  4Z8A A;  2RNA A;  2EYW A;  2EQI A;  1WXT A;  3M0S A;  2MCN A;  1WX6 A;  2K9G A;  1ZLM A;  1UJY A;  4A63 B;  2PNI A;  1J3T A;  1PRM C;  2X3X D;  4Y92 A;  4AFZ C;  4JJB A;  2FRW A;  2EW3 A;  1B3Q A;  1JXO A;  1CKB A;  2YUN A;  4OMN A;  4K11 A;  2V1R A;  2JXB A;  2AKL A;  4GBQ A;  1FYN A;  1W70 A;  2RQR A;  3H0H A;  3RNJ A;  2LQN A;  1LCK A;  2RQV A;  1UFF A;  2EPD A;  1HD3 A;  1B07 A;  2M0Y A;  1K4U S;  2JS0 A;  5IHN A;  3M0R A;  4FSS A;  2OAW A;  2DL4 A;  2K79 A;  3RBB B;  2ED1 A;  2JW4 A;  4CC2 A;  1UHF A;  4ZNX A;  1VYT A;  3GBQ A;  1VYV A;  2JTE A;  2ROL A;  1G83 A;  2NUZ A;  2RF0 A;  2VWF A;  1PWT A;  1WLP B;  2KBT A;  1CKA A;  1UGV A;  1QWF A;  2FPF A;  1E7O A;  1SSH A;  3M0P A;  3CQT A;  2YUO A;  2O88 A;  2HCK A;  2J06 A;  3O5Z A;  2PZ1 A;  3THK A;  2KR3 A;  1W6X A;  3I5R A;  4Z88 A;  2DRM A;  2EGC A;  2DBM A;  3VS7 A;  4RTZ A;  2RMO A;  1M30 A;  2F2V A;  2K2M A;  3PVL A;  4RUG A;  1NEB A;  4D8D A;  1NG2 A;  1UG1 A;  2AZV A;  3EG1 A;  1UTI A;  3QWY A;  1KSW A;  3UA7 A;  4LUD A;  2GTJ A;  1UJ0 A;  2A37 A;  2DNU A;  1ABO A;  2SRC A;  2F2X A;  2HBW A;  2YUP A;  4RTV A;  3VS5 A;  2RQT A;  1RLP C;  1PNJ A;  2DJQ A;  2AK5 A;  3PVQ A;  1GBQ A;  2VKN A;  2DMO A;  2CSI A;  2JMC A;  1SRL A;  4EIK A;  1BBZ A;  1GFD A;  1WYX A;  1NYG A;  5HCK A;  2KRN A;  1OV3 A;  1K1Z A;  1MUZ A;  1NM7 A;  4J9E A;  2L3S A;  4CC3 A;  1BU1 A;  1U06 A;  2EYX A;  1U3O A;  2EVR A;  2HSP A;  2RN8 A;  4HCK A;  2B86 A;  4HVV A;  4RTW A;  2EKH A;  3REB B;  2AKK A;  2O2O A;  2LZ6 B;  1SHF A;  4JZ3 A;  1G2B A;  2H8H A;  2KRM A;  2DE0 X;  2LJ1 A;  2O31 A;  2J7I A;  4RTX A;  1M3C A;  2CSQ A;  2DL8 A;  2JMA A;  1MV3 A;  2KT1 A;  1I07 A;  2FPD A;  1PKT A;  3SHW A;  2NWM A;  3M0Q A;  3H0I A;  4HXJ A;  2D0N A;  5L23 A;  3NPF A;  4AG2 C;  2EBP A;  2GNC A;  1WXU A;  3NHN A;  4DEX A;  2KGT A;  1H92 A;  2JM9 A;  1KIK A;  3IQL A;  2BZX A;  2GGR A;  3C0C A;  3ULR B;  4LNP A;  3M0T A;  2QDL A;  5FWC A;  1V1C A;  1X27 A;  2BZ8 A;  3QWX X;  3JV3 A;  1X43 A;  1N5Z A;  2DVJ A;  2ABL A;  2O9V A;  3EHQ A;  5I11 A;  1X6G A;  1GCQ A;  2P4R A;  1GRI A;  2OJ2 A;  2RQW A;  3U23 A;  4LN2 A;  1RI9 A;  1WDX A;  2LMJ A;  1PHT A;  3TSW A;  1M8M A;  2L3Q A;  1AWO A;  2LQW A;  3EG2 A;  4IIM A;  1HJD A;  1TG0 A;  3EG0 A;  3I9Q A;  2W10 A;  1BB9 A;  4CC4 B;  1RLQ C;  1H8K A;  3TVT A;  2MIO A;  4OMQ A;  1AD5 A;  3REA B;  2X3W D;  1UE9 A;  5FWB A;  1JU5 C;  2KYM A;  1WA7 A;  1YWO A;  2ECZ A;  1QKX A;  2AZS A;  2O9S A;  4F16 A;  1QKW A;  1WI7 A;  2FRY A;  1X2K A;  2CT3 A;  1Z9Z A;  1JXM A;  4GLM A;  1Z9Q A;  1WFW A;  1U5S A;  1ZUY A;  2ESW A;  4JZ4 A;  1GFC A;  4J9H A;  4OMP A;  2E5K A;  2C0T A;  2LP5 A;  2GBQ A;  2OI3 A;  3UAT A;  1RUW A;  1S1N A;  1NLP C;  3I5S A;  1VA7 A;  1Y57 A;  1E6G A;  3TSZ A;  4AFU C;  4E6R A;  2L3P A;  3VS3 A;  2CUB A;  1T3L A;  2C0O A;  5I22 A;  2DM1 A;  2ED0 A;  2G6F X;  2XMF A;  3VS1 A;  2YUQ A;  2KE9 A;  2LJ0 A;  2KRS A;  2DLP A;  4OMO A;  1K9A A;  1ABQ A;  4OMM A;  3VRZ A;  4LUE A;  2RQU A;  5GJW B;  1PKS A;  3VS2 A;  2LX7 A;  4DEY A;  2CRE A;  1X2Q A;  1QWE A;  1VYU A;  2M51 A;  1YWP A;  1ZX6 A;  2FO0 A;  1GCP A;  2J6O A;  5IXF A;  1KFZ A;  1AWW A;  1QCF A;  2A28 A;  3KFV A;  2C0I A;  1T0H A;  3SEM A;  2HEQ A;  3VS6 A;  2DL3 A;  1NLO C;  2I0N A;  4IIO A;  2DRK A;  1XOV A;  1Y0M A;  5GJV B;  1AZG B;  1FMK A;  2FEI A;  1EFN A;  3R6N A;  2D8H A;  2J05 A;  2W0Z A;  3NMZ C;  1YN8 A;  4AFQ C;  4AFS C;  1W1F A;  1YP5 A;  1HSQ A;  2DYB A;  4JPB W;  3VS4 A;  2EYY A;  2K7A A;  2ROT A;  4RTT A;  5IHK A;  4J9F A;  1WIE A;  2K3B A;  1T3S A;  2DL7 A;  1JEG A;  1AOJ A;  4X1V A;  2KNB B;  1YCS B;  1SEM A;  2ENM A;  2V1Q A;  3I35 A;  1SHG A;  5ECA A;  1AEY A;  1UEC A;  2DBK A;  1MV0 B;  2GQI A;  1WXB A;  2BZY A;  2YT6 A;  5EC7 A;  1JQQ A;  2FPE A;  3LH5 A;  1AVZ C;  1I0C A;  2YDL A;  1ZUK A;  1TUD A;  2JT4 A;  3NGP A;  2F2W A;  2LNH B;  2K6D A;  1M3A A;  1ARK A;  1GBR A;  5IXB A;  1PRL C;  1OPL A;  4JJC A;  4AG1 C;  1M3B A;  1I1J A;  3EG3 A;  2IIM A;  2D1X A;  2KRO A;  2DX1 A;  1KJW A;  3VRY A;  1K0S A;  2YSQ A;  1SPK A;  2MOX A;  1M27 C;  3PE0 A;  3M0U A;  1JO8 A;  2JM8 A;  4J9D A;  3UF4 A;  1SRM A;  1AWX A;  2BTT A;  2JS2 A;  4J9C A;  1NYF A;  2DIL A;  1UUE A;  4M4Z A;  1YNZ A;  2LCS A;  1AZE A;  5IH2 A;  1OPK A;  4RTY A;  1OOT A;  2CDT A;  2CT4 A;  4F17 A;  4ORZ A;  4HVU A;  2KEA A;  3ZL7 C;  2KXD A;  4D8K A;  3A98 A;  1ZBJ A;  3EHR A;  2SEM A;  2VVK A;  2EYZ A;  4CC7 A;  4LE9 A;  1H3H A;  1ZUU A;  1GL5 A;  1TUC A;  3VS0 A;  2D8J A; 
#chains in the Genus database with same CATH topology
 4JS4 A;  2IPO B;  1K0X A;  2L0A A;  3VV0 A;  4C5H A;  1W2B A;  1K76 A;  1GCQ C;  1UGP B;  1A0N B;  3EH1 A;  1VQP A;  2A36 A;  2F1L A;  3PMT A;  2L3R A;  1BCM A;  2CH4 W;  4HVW A;  4EMK C;  5GAN 4;  2QGG A;  1DJ7 B;  1H64 1;  3CPW S;  2MF2 A;  3CXC P;  4OML A;  2YHT A;  2K5L A;  1VQK T;  2LJ3 A;  3BFM A;  1WHJ A;  2RPN A;  4L59 A;  4C0G A;  4BE1 A;  2KAF A;  5GAN 7;  2QQB A;  3CCM T;  2EGA A;  1D1C A;  1TXQ A;  3OA6 A;  2HDA A;  4Z89 A;  3H0F A;  4F04 B;  4E7L A;  2RNA A;  1WXT A;  2GQV A;  4PK4 A;  3G7Z A;  4XU3 A;  1UJY A;  1PSF A;  2PNI A;  3FRN A;  4QVZ A;  1IB8 A;  2QEX A;  2WSE E;  1PRM C;  4Y92 A;  1OQK A;  4OB2 B;  4YTL A;  3DKM A;  3MP8 A;  2EW3 A;  1JB0 E;  4R56 A;  2NUT A;  2YWW A;  1X75 C;  1MGQ A;  3HTR A;  4OMN A;  5FU7 B;  5LJ5 e;  3A8O B;  3LWH A;  1YFN A;  1FYN A;  1W70 A;  3H0H A;  5D6X A;  3SWN A;  3Q1J A;  1UFF A;  2NYS A;  1NZ9 A;  5GAM e;  1JBM A;  4OF1 A;  3L2W A;  5GAN 6;  2NUT B;  3M0R A;  4PL6 A;  3OW2 A;  5CCA A;  3UT1 A;  4EMG A;  2O4X A;  3L42 A;  2RB6 A;  5LJ3 g;  1RAB B;  3C95 A;  4LD9 K;  1PCX A;  3SWN B;  5GMK e;  1VYT A;  2F5T X;  5IT9 E;  2EWN A;  2LT1 A;  3NTK A;  1NJI C;  4M7D D;  4QQD A;  1CKA A;  3UWN A;  1UGV A;  3X20 B;  1K9M R;  4XU2 A;  2E70 A;  3CCE A;  2O4X B;  2H3J A;  2HCK A;  2J06 A;  3M53 A;  2X9H A;  2KR3 A;  1W6X A;  4X9D A;  3VS7 A;  2JTM A;  4N4G A;  2RMO A;  1X01 A;  2COY A;  1G8X A;  2V8J A;  4E7Z A;  4OVA A;  4C0F A;  5LJ5 d;  2K2M A;  1KHI A;  1UGQ B;  2K3X A;  1VQ7 Q;  4UC4 A;  3QWY A;  1VQL T;  1M1F A;  2WSF E;  3X26 B;  2A37 A;  4X9C A;  1MHN A;  1C0M A;  5GAM d;  4E2F B;  4J6W A;  2HBW A;  1RLP C;  1G3W A;  3JCM W;  5KYX A;  2MYS A;  2K5F A;  2JVV A;  3DLL A;  4EPC A;  1GBQ A;  2VKN A;  1VQ5 A;  1KD1 C;  4OB3 B;  1SRL A;  4RG2 A;  2YXY A;  4M78 E;  2FHD A;  5D7U A;  1GFD A;  2KRN A;  3HHT B;  1PG5 B;  4II1 A;  1M1K C;  3OW2 S;  5KCH A;  2DEU A;  5FRM A;  1PC0 A;  5KYX B;  3MEW A;  1IGQ A;  1BU1 A;  2DTO A;  2EYX A;  1ZA2 B;  2EVR A;  5CKH A;  4RTW A;  3RDV A;  2CP5 A;  1BKB A;  3LGL A;  4HCZ A;  3CC7 A;  1R0C B;  4JZ3 A;  2DE0 X;  2O31 A;  3QKJ A;  2DVE A;  4RTX A;  4M75 E;  1MV3 A;  2CS7 A;  4BI4 A;  1I07 A;  2NWM A;  3H0I A;  4FW2 A;  3G6E T;  3JCM e;  1VQO T;  3JSC A;  3NHN A;  4N0A A;  4C8Q F;  4BI3 A;  1PD1 A;  2QAZ A;  1VQK A;  4JRQ A;  3SFM A;  1Q81 C;  2GGR A;  1IZ6 A;  2R57 A;  4RMO A;  2R5M A;  1V1C A;  1X27 A;  3CCM A;  3M54 A;  1W4S A;  1S72 Q;  4VUB A;  2P4R A;  5LJ3 h;  3U23 A;  4PFO A;  1HYO A;  4Z02 A;  1AWO A;  4IIM A;  1TG0 A;  4HCB A;  2CZ7 B;  4XTY A;  1Q82 R;  1R8O B;  1BB9 A;  2EAY A;  2FL7 A;  4E7I A;  1QVP A;  1RAA B;  2LCC A;  1HXD A;  1AD5 A;  5LJ3 e;  4M7A D;  2DEQ A;  2E6Z A;  1YWO A;  2ECZ A;  3CC4 Q;  1QKX A;  1RAH B;  2AZS A;  4B9X A;  4F16 A;  3LYI A;  1QKW A;  3JCM d;  4KGZ B;  1X2K A;  5KYU A;  3HRU A;  3JCM X;  2CT3 A;  1LPL A;  3PNW C;  1Y7X A;  4J6X A;  3I56 T;  1U5S A;  4JZ4 A;  5CQY A;  1QVG P;  2E5K A;  5KYW A;  2LP5 A;  4M78 G;  5FU7 C;  1IHW A;  1RUW A;  5GAN f;  3G71 T;  3DLM A;  3OYB A;  1Q7Y R;  4E6R A;  4M75 A;  1T3L A;  2C0O A;  4O6J A;  3VS1 A;  4KUD K;  1KG1 A;  3CCU Q;  2QA4 T;  3MCA B;  3SWN C;  5CVI A;  3M5A A;  1K9A A;  4M75 G;  4BDY A;  1VQP Q;  3VRZ A;  4C92 F;  4M75 B;  1PKS A;  1WJR A;  3HSB A;  4MML A;  2M51 A;  4F7U F;  4A4F A;  1ZX6 A;  1YCY A;  2XG8 D;  2D6F A;  2J6O A;  3HPW A;  3QJ6 A;  1BYM A;  3OSS C;  1T0H A;  2HEQ A;  1Y71 A;  3SDZ A;  1NBE B;  1NLO C;  1Q86 U;  3MPU B;  1D0Z A;  1D0X A;  2GF7 A;  2D8H A;  3JCM Q;  1YN8 A;  5KYN A;  1U1T A;  5L8R E;  1HSQ A;  2VC8 A;  2DYB A;  1V29 B;  3E9F A;  5IHK A;  4CRI A;  3HFN A;  1WIE A;  1VQ6 T;  2K3B A;  2XU8 A;  1D3B A;  4C5I A;  1T3S A;  1EX4 A;  1YHQ Q;  1JEG A;  2COW A;  2DKG A;  4X1V A;  2X51 A;  2QEX Q;  5HKC A;  1N9R A;  2DBK A;  3CCQ A;  5HK3 A;  2V8K A;  3X28 B;  1FMW A;  2DXT A;  2C06 A;  1QQJ A;  1XJW B;  1D3B B;  1AT1 B;  3I55 A;  3H9N A;  2YDL A;  3OS0 A;  2GFA A;  2F2W A;  4EMK A;  2K6D A;  1H3Z A;  1GBR A;  2E4H A;  1I5L A;  4JJC A;  2H3E B;  1VQO A;  1D1A A;  2JN0 A;  2IIM A;  2D1X A;  2RK2 A;  4M77 A;  3JCM c;  1OX8 A;  1K0S A;  1KJW A;  1SPK A;  1RAD B;  1JO8 A;  2JM8 A;  3G1J A;  1BI1 A;  4XK8 E;  2EJG A;  1AWX A;  2BTT A;  1QCO A;  2DTH A;  2DZC A;  4N4H A;  3CCE Q;  1YIJ T;  1BI3 A;  1VQN T;  1YNZ A;  1YIT T;  1KQS A;  2EQJ A;  1OPK A;  2CDT A;  2CT4 A;  1VIE A;  4ORZ A;  2M0O A;  4HVU A;  4A54 A;  4A53 A;  3ZL7 C;  4EMH A;  3CEY A;  4D8K A;  1YJW T;  2SEM A;  2EYZ A;  4XQ3 A;  4XTV A;  4CC7 A;  3UPU A;  4OMF B;  1K73 R;  4QQG A;  1NPP A;  3WVE B;  2CZ6 B;  1WJQ A;  1T0J A;  1AWJ A;  2DYI A;  4F14 A;  3P8B B;  3I56 A;  1ZHI A;  1VQ5 Q;  2L8D A;  2CUD A;  4ESR A;  1VQ8 T;  3QZ5 B;  1TSF A;  1MND A;  3MEA A;  2F69 A;  3TRE A;  3G71 A;  3V7C A;  2EQM A;  4ZGE B;  1KC8 R;  1IO6 A;  5LJ5 f;  2KT8 A;  1U8R A;  1OEB A;  4BY6 B;  1G3T A;  2RM4 A;  3UA6 A;  4WCI A;  2CP6 A;  3H41 A;  1QP3 A;  3CC7 Q;  4R0K A;  2FG0 A;  3FLG A;  1YJN T;  5GAM f;  1CSK A;  1RAF B;  2CH4 A;  2KYB A;  2BE9 B;  2ZPE B;  1QLY A;  1PM3 A;  2R58 A;  3M0S A;  1WX6 A;  1KQS S;  3S3O A;  2XD0 A;  1VQK Q;  4AFZ C;  4XAX B;  4FYV B;  3TCJ A;  4PFP A;  1CKB A;  3CCM Q;  4FYW B;  4KH0 B;  4M75 C;  1IXD A;  4FM4 B;  4K11 A;  1V76 A;  2LT4 A;  1TWB A;  2P0P A;  3A8L B;  4M7A F;  4C8Q D;  5C0M A;  1LCK A;  2RQV A;  5HK0 A;  1HD3 A;  2BE7 D;  4ZN3 A;  2M0Y A;  1VQ6 A;  1OU8 A;  2JS0 A;  3CBO A;  4PJO A;  5IHN A;  4ANJ A;  2OAW A;  1UEB A;  2IVW A;  2K79 A;  2RO0 A;  4KT0 E;  1M90 U;  2ED1 A;  5LL6 S;  2VB6 A;  4CC2 A;  5I21 A;  1UHF A;  4FCY A;  2RH2 A;  4A4E A;  1SKU B;  3FIF A;  4AMC A;  1VYV A;  2ROL A;  1G83 A;  2NUZ A;  4PJO B;  5A0D A;  1WLP B;  4BUG A;  1QWF A;  3CCV T;  1E7O A;  3EFO B;  4BDZ A;  3L2Z A;  2RHX A;  3EAE A;  3THK A;  3VUB A;  1KHC A;  4Z88 A;  3QSU A;  3CPW P;  4RTZ A;  2HL5 C;  4ELY C;  4C8Q G;  3PVL A;  4RUG A;  4PKC C;  5GAN 2;  1NEB A;  2CZ0 B;  4D8D A;  2RHI A;  2MMP A;  4JS5 A;  2EQK A;  1UTI A;  1Q86 C;  2DNU A;  1ABO A;  2MAM A;  3SD4 A;  2SRC A;  2OX7 A;  4E7S A;  3CCU A;  3M56 A;  1YIJ A;  1VQN A;  3PT9 A;  4MZM A;  3QYH B;  2M16 A;  2LTO A;  2CSI A;  5CO7 A;  3JCM f;  3CC2 T;  4P5N A;  3L2Q A;  2HAX A;  3RIR A;  4IUT A;  4RKU E;  1TS9 A;  3HKS A;  3HRS A;  1VQL Q;  4M77 C;  4ZTF A;  2L3S A;  2AIR B;  4XTW A;  1M2O A;  2VYT A;  3OMC A;  1M4Z A;  4WF2 A;  1U3O A;  4C92 D;  4ZN1 A;  2B86 A;  4JLG A;  4M7D E;  1W2B P;  2CGH A;  1SHF A;  4L5G A;  1G2B A;  2LDM A;  3OS1 A;  3MHX A;  3QZ9 B;  1M3C A;  2CSQ A;  1VQ8 A;  2JMA A;  1YHQ A;  2NLU A;  2KT1 A;  1QVF A;  4OB0 B;  3M0Q A;  2E3I A;  4HXJ A;  3NPF A;  4AG2 C;  1QCN A;  5CKD A;  2KY9 A;  1OYX A;  4IUQ A;  2Y4Y A;  1H92 A;  3CMA T;  1KIK A;  1G3S A;  2EQU A;  3CCQ Q;  2BZX A;  5KH6 A;  3OYH A;  3ULR B;  1BIB A;  4LNP A;  3M0T A;  2QDL A;  2BZ8 A;  2OTJ T;  3JCM P;  3QWX X;  4KH1 B;  3M57 A;  1N5Z A;  2PU9 B;  2VGM A;  3I55 Q;  3G4S T;  3EHQ A;  1WJS A;  1W2B S;  5I11 A;  2FVU A;  4KGV B;  3R6O A;  1K8A R;  2OJ2 A;  2DIG A;  4LN2 A;  2LMJ A;  3UDC A;  4BY6 C;  1M8M A;  2DD4 A;  3G6E Q;  3ME9 A;  1YBY A;  3M9Q A;  1VQO Q;  4F7U G;  4J5Y A;  3X24 B;  2MI6 A;  4KGX B;  1WNL A;  3EG0 A;  4XTX A;  3BDU A;  4DBF A;  2JTF A;  4CC4 B;  4ATO A;  2AHJ B;  3TVT A;  3EFS A;  1VQ9 A;  3REA B;  2X3W D;  1UE9 A;  3OBW A;  4E7H A;  4LDW A;  4FYY B;  3CBP A;  2O9S A;  3OSV A;  3CCJ T;  9ATC B;  1JXM A;  1U1S A;  3E9G A;  1Z9Q A;  1ZUY A;  1FMV A;  1C6V X;  3OW2 P;  3DB4 A;  2C0T A;  4MZP A;  1QVF S;  3GPL A;  3I5S A;  4HA8 A;  2QGF B;  4JRK A;  6AT1 B;  3M59 A;  3M55 A;  3TSZ A;  4AFU C;  2L3P A;  2E64 A;  3WVD B;  3L2V A;  2G6F X;  3CCV A;  1LJO A;  4A4K A;  4HT8 A;  4M7D G;  2YUQ A;  2K4Y A;  2KE9 A;  2KRS A;  2V26 A;  4B9W A;  3CPF A;  3I56 Q;  2DLP A;  4M7D B;  3MP1 A;  4OMO A;  4O5V A;  4OMM A;  4JDS A;  5GAN j;  2RQU A;  5GJW B;  4PJO C;  3OYC A;  3N5B B;  2LX7 A;  2CRE A;  4QKU A;  3SB2 A;  4ME7 A;  1VYU A;  3G71 Q;  1IRE B;  1I81 A;  4FYX B;  2FO0 A;  2HQH A;  5FLX E;  2DK3 A;  2C0I A;  2DRK A;  4FT4 A;  2LQ8 A;  4ELZ C;  1FMK A;  4M7A E;  2VGN A;  1BI2 A;  2W0Z A;  1C1A A;  4PJM A;  4AFS C;  1KK7 A;  1W1F A;  4ZGD B;  3VS4 A;  2K7A A;  2ROT A;  4RTT A;  2EJF A;  3J7A F;  3OYN A;  1IHV A;  1RAG B;  1YI2 T;  2AT1 B;  2P0Q A;  2RJF A;  3M58 A;  3MP6 A;  1M90 C;  3JB9 I;  2E41 A;  1HK9 A;  2QQA A;  4RCB A;  5I2S A;  2FZC B;  1AEY A;  2KQW A;  2DAQ A;  2JNG A;  2B8A A;  2GQI A;  2YT6 A;  1JQQ A;  2WAC A;  3V8L A;  1MNE A;  3H6Z A;  1I0C A;  2R5A A;  4IUV A;  1TUD A;  4PLI A;  3NGP A;  1Q82 U;  4AT1 B;  1VQ6 Q;  1M3A A;  3D7S B;  5J3B A;  1I8F A;  3CCS T;  3O8V A;  2EKO A;  4AG1 C;  1M3B A;  3OYD A;  3LX7 A;  4A4H A;  1WHH A;  2KRO A;  2YRC A;  2E5Q A;  2ZAE A;  2RJD A;  3VKI A;  2E6N A;  1UB4 A;  4M78 A;  2LVM A;  1M27 C;  3M0U A;  3G4S A;  1VQ7 T;  3VU3 C;  4BI8 B;  4J9D A;  1ZQ1 A;  3HRT A;  3TU4 K;  1SRM A;  3GNF B;  2DIL A;  2FZK B;  4J7F A;  4RCC A;  5DLQ E;  2OTL T;  2LCS A;  5GMK m;  4RTY A;  4M78 B;  5J39 A;  1NE8 A;  3OS2 A;  1Q7Y U;  1VQM T;  2FZG B;  3RR6 A;  5KE3 A;  3HFO A;  2DTI A;  2P4T A;  3C4S A;  1LOJ A;  3EHR A;  2VVK A;  4L6V 5;  2D9T A;  2RJE A;  3BY7 A;  4WTO B;  3JB9 D;  1N8R R;  1MMD A;  5DLO A;  1TUC A;  3VS0 A;  5CAI A;  3OYE A;  4A4G A;  2A08 A;  4M7A G;  1YIJ Q;  2OAU A;  3CCJ A;  2QAS A;  3CCL T;  1VQN Q;  1B7T A;  4M7A B;  5LJ3 d;  4KRT A;  2YRD A;  2DL5 A;  2DER A;  1YJ9 T;  2XIC A;  2KXC A;  1VQL A;  2I2L A;  2M1H A;  2CP2 A;  4JRP A;  1UHC A;  5C6S A;  1ZSG A;  1YJW Q;  1NEG A;  4QT7 A;  3J81 E;  2EYQ A;  4MMK A;  1X6B A;  2GFU A;  5GAN g;  4JJD A;  4KUL A;  5D6Y A;  2V8I A;  3L1A A;  2QDY B;  1N27 A;  2L2P A;  2LCL A;  2RI2 A;  3EGU A;  5AYF A;  1KQ2 A;  2DA9 A;  1RI0 A;  1VQ8 Q;  3ZBD A;  5FW9 A;  2PUK B;  1S72 T;  1GXI E;  2K57 A;  3NTH A;  1WHK A;  2EQI A;  2MCN A;  2X35 A;  2JOY A;  5A0L A;  5CR2 A;  2K9G A;  5LJ5 j;  1ZLM A;  2RI5 A;  4A63 B;  4TVR A;  1K9M C;  4C0Z A;  2RJC A;  2X3X D;  4D6W A;  4JJB A;  4M7D C;  4MDX A;  1XTD A;  2FRW A;  5GAN 3;  4HKE A;  3ZEH A;  1B3Q A;  1O9S A;  2JJ9 A;  2YUN A;  2PVO B;  5GAM j;  3GOX A;  2JXB A;  4LDX A;  3S6W A;  3MO8 A;  4M77 D;  1OI1 A;  3RNJ A;  3P8H A;  4J8O A;  2RI3 A;  2EPD A;  3G6E A;  3CC4 T;  1B07 A;  5GMK j;  1RAI B;  1YI2 A;  3H8Z A;  3PFS A;  4FSS A;  2DL4 A;  2K2V A;  2MPX C;  1VQ4 T;  3RBB B;  1VQ9 Q;  3GBQ A;  1EIF A;  2JZ2 A;  3A5Z B;  1XQH A;  2RD1 A;  1B34 A;  2FYK A;  4IKF A;  5GMK l;  1MMN A;  2KBT A;  1ZBX A;  2CP7 A;  2KSS A;  1SSH A;  4N4I A;  3CQT A;  3JRZ A;  3GLX A;  2PZ1 A;  4PNO A;  2EGC A;  1LVK A;  2DBM A;  2PQW A;  3CCS A;  5IAY A;  1FWZ A;  1QP2 A;  2EJ9 A;  2F2V A;  1N9S A;  1K73 U;  1B34 B;  3PMI A;  3FEO A;  1P92 A;  3EG9 A;  1UG1 A;  2AZV A;  3EG1 A;  4DA4 A;  3UA7 A;  4LUD A;  1ZA1 B;  5GAN 8;  3QHS A;  3CCV Q;  3RKW A;  2YUP A;  1PNJ A;  3OB9 A;  1KQS P;  2AK5 A;  2OTL A;  2XID A;  3JCM J;  2YLC A;  3EG9 B;  2P0K A;  2X4X A;  5GAN h;  3DB3 A;  4C8Q E;  1KC8 U;  4NS5 A;  1NJI R;  1VQM A;  2HMA A;  5HCK A;  2ZCF B;  1K1Z A;  5KYY B;  3VYG A;  2E3H A;  1NM7 A;  4J9E A;  4DBH A;  1EZZ B;  2E12 A;  1FXX A;  3QPH A;  2QG9 B;  4M78 C;  2QA4 A;  4HVV A;  2RN8 A;  5GAN e;  2EKH A;  2HL3 A;  2AKK A;  2O2O A;  2HZY A;  3CCL A;  3FDR A;  2YLB A;  1Q82 C;  2LJ1 A;  4DOV A;  5GAO m;  3L2U A;  3J80 E;  3CC2 Q;  2M02 A;  1YJ9 A;  2FPD A;  1PKT A;  3INZ A;  1OZ2 A;  1SF9 A;  2GNC A;  3TQ7 P;  1WXU A;  2JM9 A;  1PD0 A;  1JJ2 A;  3IQL A;  4Y91 A;  1KD1 R;  3BDL A;  5GAO n;  5I2M A;  4PJO D;  5GAO p;  1Q95 G;  3QJY A;  2DD5 A;  5LJ5 g;  2K3Y A;  3JV3 A;  5FU6 B;  2LC4 A;  3MET A;  4FIB A;  3TEE A;  2DVJ A;  1M1K R;  1X6G A;  1GRI A;  2RQW A;  4IUR A;  1WDX A;  2HKN A;  3EFO A;  1Q7Y C;  2CKK A;  5GAM g;  2VXE A;  2L3Q A;  3QII A;  2LQW A;  4M75 F;  1I5O B;  3CD6 T;  3CME T;  3CMA Q;  2L89 A;  2W10 A;  4ZTJ A;  1H8K A;  3OMG A;  1MMG A;  2OTJ Q;  1TU0 B;  5FWB A;  1JU5 C;  3MKD A;  1WA7 A;  4C8Q A;  3FC3 A;  4LD6 A;  3G4S Q;  1O75 A;  5CKE A;  2RHU A;  3JB9 F;  2MWO A;  4C92 E;  3LH0 A;  3F70 A;  3GIB A;  1Q81 R;  4F7U E;  3CCR T;  4J9H A;  4OGE A;  5IN1 A;  1M2V A;  4C8Q B;  5CKB A;  2RHY A;  1VQ4 A;  3EFR A;  1VA7 A;  1E6G A;  1AHJ B;  1M9S A;  2BIV A;  1JJ2 S;  3CXC A;  2DM1 A;  2ED0 A;  2DO3 A;  2CZ1 B;  2XMF A;  1YIT A;  1M2V B;  3A8M B;  3CCJ Q;  3M4G A;  3OBY A;  1WGS A;  5M9O A;  1ABQ A;  3PIP A;  3EH2 A;  3CC7 T;  4LUE A;  1R0B G;  2XDP A;  4KBM B;  3PTA A;  4E7K A;  1YJW A;  3VS2 A;  4DEY A;  1X2Q A;  4Y28 E;  1YWP A;  2P84 A;  1GCP A;  2A3L A;  1MMA A;  1WHL A;  5IXF A;  5FRN A;  4J83 A;  2HD0 A;  3KFV A;  2BKD N;  3SEM A;  1TTH B;  4BE2 A;  3VS6 A;  5GAO l;  4IIO A;  4QQ6 A;  1Y0M A;  5GJV B;  1AZG B;  4QVC A;  4J6Y A;  1EFN A;  2FEI A;  2J05 A;  2LRQ A;  3ZFJ A;  4NL2 A;  1YP5 A;  3NFC A;  3VUZ A;  4JPB W;  4XU0 A;  2XHC A;  4M77 F;  2XI9 A;  2HSE B;  3OYA A;  4PJN A;  5GAO q;  5LJ3 f;  2DL7 A;  3JCM g;  4LDV A;  5LJ5 h;  2PVG B;  3A1P A;  2KNB B;  1YCS B;  3RES A;  3I35 A;  4C92 A;  2X4Y A;  1SHG A;  2DZ9 A;  3T9N A;  1WQW A;  1K8A U;  1YJN A;  4F7U A;  1MV0 B;  5GAM h;  1TUG B;  3ASK A;  3QG1 A;  4E47 A;  4DBR A;  3CXC S;  3JCM V;  1AVZ C;  2JUF A;  4C92 G;  2A7Y A;  1QVF P;  3FJP A;  4C92 B;  2LNH B;  5GMK h;  3X25 B;  1ARK A;  2DET A;  1YI2 Q;  4GY5 A;  1PRL C;  4F7U B;  1K73 C;  1OPL A;  1K9M U;  1I1J A;  3EG3 A;  4DBQ A;  3VJP A;  2DX1 A;  5D6W A;  4V2S A;  5CKF A;  3OYY A;  1UGS B;  2MOX A;  1KQ1 A;  2XDB A;  1ACM B;  4BB7 A;  3PE0 A;  3QO3 A;  3UF4 A;  1IRX A;  2JS2 A;  4FT2 A;  2E1H A;  1UUE A;  4M4Z A;  1KC8 C;  3AT1 B;  3QYG B;  3CCS Q;  1AZE A;  5IH2 A;  7AT1 B;  4M7D A;  1OOT A;  3JB9 J;  3RKX A;  5FU6 C;  3CD6 A;  4F17 A;  3CME A;  4XU1 A;  2QI2 A;  2KXD A;  2NUP A;  2G3R A;  4ZGJ B;  3A98 A;  4JLI A;  4LE9 A;  1H3H A;  2F5K A;  1ZUU A;  4MDW A;  5KCO A;  1GL5 A;  2D8J A;  1QWE A;  1ZSZ A;  4LXC A;  1X69 A;  3AHU A;  2XK0 A;  4J9I A;  1BK2 A;  2COZ A;  2OTL Q;  3CCR A;  2DF6 A;  2CP3 A;  4NL3 A;  2NUP B;  2EGE A;  3KBG A;  3OYL A;  3FJ5 A;  4BAC A;  4J9B A;  3RMS A;  1FX7 A;  1VQM Q;  1N6A A;  3PGG A;  3WXM B;  1VIF A;  1BCO A;  3RER A;  4FL6 A;  4C0D B;  3CBM A;  1JRI A;  1ZSZ B;  2J6F A;  2PTK A;  1WHG A;  4RTU A;  1E6H A;  4KUI A;  3GF5 A;  2GTO A;  2QA4 Q;  4FU6 A;  5HY6 A;  4B6M A;  4C8Q C;  1UGR B;  4J9G A;  1UDL A;  4PJO F;  3CCL Q;  3CCQ T;  3JCM h;  1D1B A;  3CC2 A;  5IHI A;  2J6K A;  1YJ9 Q;  3PIO A;  3I55 T;  2X4W A;  4LDY A;  4Z8A A;  3MEV A;  1VUB A;  2EYW A;  2K5I A;  1D09 B;  2ZPH B;  3ER0 A;  5A0G A;  1J3T A;  2O01 E;  4JJN K;  3S3M A;  3OY9 A;  2BUD A;  1JXO A;  2HQX A;  4Q5W A;  2V1R A;  3OYG A;  2AKL A;  4GBQ A;  3FB9 A;  2RQR A;  5CQX A;  2LQN A;  2QXF A;  4M78 D;  2ZPB B;  1K4U S;  1OX9 A;  3CMA A;  2ZGW A;  2QQR A;  5CK9 A;  2DIQ A;  1QVG A;  2DXB A;  2OTJ A;  2LQK A;  2JW4 A;  2VV5 A;  4ZNX A;  5GAN 5;  4JUV A;  3L2R A;  2JTE A;  2RF0 A;  2VWF A;  1PWT A;  1WHM A;  2CYZ B;  2FPF A;  3S3N A;  4M75 D;  3M0P A;  2Y90 A;  2YUO A;  2O88 A;  3O5Z A;  4E7J A;  1RL2 A;  4DOW A;  3I5R A;  2DRM A;  2KVQ G;  4M7A A;  2DXC A;  1N8R U;  2DFU A;  1M30 A;  1VQ4 Q;  4EDU A;  5AT1 B;  2PVD B;  1NG2 A;  2YRV A;  1KSW A;  4C92 C;  1R77 A;  5KE2 A;  2GTJ A;  1UJ0 A;  3QXE B;  5KYU B;  2HKQ B;  1YIT Q;  1OUL A;  2F2X A;  4RTV A;  3VS5 A;  3C12 A;  2RQT A;  2M9U A;  4FSX A;  2RHZ A;  2PUO B;  1LNX A;  3C94 A;  2DJQ A;  3PVQ A;  2HNI A;  5KYW B;  4M77 E;  1F1B B;  5A2Q E;  8ATC B;  3MJX A;  2DMO A;  2VXF A;  2JMC A;  4NOY A;  4EIK A;  1BBZ A;  5DM7 R;  3LGF A;  1WYX A;  1NYG A;  1OV3 A;  1QW1 A;  3RKY A;  3URG A;  3V7R A;  2IG0 A;  1QVG S;  1K8A C;  1MUZ A;  4CC3 A;  4HCC A;  1U06 A;  3OYF A;  4R55 A;  2HSP A;  4HCK A;  3JB9 G;  4PFZ A;  1SSF A;  2QYZ A;  3QDR B;  3REB B;  1G5V A;  2LZ6 B;  4PJL A;  1BIA A;  2Y4X A;  2H8H A;  2KRM A;  3GP8 A;  2J7I A;  2RA2 A;  2X4J A;  3OYI A;  2EFI A;  1X6O A;  2DL8 A;  4C5E A;  1Q86 R;  4HT9 A;  3SHW A;  3M4Y A;  4XTU A;  2D0N A;  4DQ2 A;  5L23 A;  1TOV A;  2EBP A;  1RAE B;  4DEX A;  2KGT A;  3RMQ A;  3HP9 A;  4OB1 B;  1YJN Q;  3C0C A;  5FRO A;  2QTV A;  2KI7 A;  5FWC A;  5GMK i;  5CIU A;  5GAO r;  1X43 A;  2QQ9 A;  2ABL A;  2O9V A;  2D0Q B;  3RUX A;  3VYH B;  4C0D C;  4BE0 A;  1ZSZ C;  2QK0 A;  1GCQ A;  1RI9 A;  4M7D F;  1PHT A;  4QVD A;  3TSW A;  2LNV A;  3NTI A;  2ZPI B;  3EG2 A;  1HJD A;  3EGD A;  3I9Q A;  1RLQ C;  2MIO A;  4OMQ A;  2ZPG B;  2KYM A;  3OYK A;  4EMK B;  1WI7 A;  2FRY A;  1TH7 A;  1Z9Z A;  3EGD B;  4C5G A;  4GLM A;  2VUB A;  1XNI A;  3V8J A;  1WFW A;  4M77 G;  2ESW A;  3CCU T;  1GFC A;  4OMP A;  3LLR A;  4M77 B;  1VQP T;  2GBQ A;  2OI3 A;  3UAT A;  3CD6 Q;  2DJZ A;  3CME Q;  1S1N A;  2E65 A;  1NLP C;  4OP0 A;  4GLK A;  4IUP A;  3JCM b;  1VQ7 A;  1Y57 A;  5KYY A;  2XDD A;  2KDS A;  1D0Y A;  3VS3 A;  2CUB A;  5I22 A;  4N0A C;  4PJO E;  4IUU A;  1NJI U;  4QW2 A;  2L5Q A;  2LJ0 A;  2QQS A;  3A8G B;  3CCR Q;  3KXT A;  2GCX A;  1Y96 A;  3HL8 A;  2DXU A;  1WQ7 A;  2KMT A;  4J7I A;  3LWI A;  1SG5 A;  2MWP A;  2FB7 A;  2HBP A;  1WPY A;  2ATC B;  4CI0 C;  1YHQ T;  4PJJ A;  2EIF A;  3E1S A;  2QEX T;  2LX9 A;  1KFZ A;  1AWW A;  1QCF A;  2A28 A;  4OGC A;  1Y96 B;  2DL3 A;  2I0N A;  1XOV A;  3MEU A;  3R6N A;  3NMZ C;  5DY9 A;  4AFQ C;  4MZT A;  4PLL A;  3V7S A;  1M1G A;  2EYY A;  4J9F A;  1KD1 U;  1M5Q 1;  2Z0W A;  2ZPF B;  4M7A C;  4M78 F;  2VAS A;  1AOJ A;  3QDF A;  2KK4 A;  1SEM A;  2ENM A;  2V1Q A;  1M1K U;  5ECA A;  4XTZ A;  1UEC A;  1BI0 A;  1WXB A;  2BZY A;  5EC7 A;  1IGU A;  4X34 A;  2ZZD A;  2FPE A;  1WZO A;  3LH5 A;  1S72 A;  1VQ9 T;  2HQE A;  1ZUK A;  8AT1 B;  1M8V A;  2JT4 A;  3CCE T;  2RK1 A;  5LJ3 j;  5GAN d;  2E10 A;  1N8R C;  5J26 A;  3E19 A;  5IXB A;  2DPP B;  2CP0 A;  3BW1 A;  4BD3 A;  1QMC A;  3CPW A;  1JJ2 P;  2A0F B;  4JRI A;  3V8K A;  3VRY A;  2YSQ A;  3GNG A;  4RG8 A;  3KUF A;  1VOM A;  1Q81 U;  2QTX A;  3LW5 E;  4PJO G;  3CC4 A;  3QBY A;  1NPR A;  1RAC B;  1M90 R;  3JB9 H;  3BE3 A;  4J9C A;  1NYF A;  1Y07 A;  3EGX A;  3OYM A;  2MK5 A;  1VQ5 T;  2XKO C;  3QUI A;  2WSC E;  1I4K 1;  1G3Y A;  2KEA A;  1PSE A;  4LDU A;  3JAM E;  1OZ3 A;  1ZBJ A;  5EG2 A;  3OS5 A;  3EGX B;  3A8H B;  3E2U A;  3P8D A;  1OU9 A;  3OYJ A;  4FW1 A;  3OQ5 A; 
#chains in the Genus database with same CATH homology
 2A08 A;  1T0J A;  1AWJ A;  1X69 A;  2L0A A;  1K0X A;  4J9I A;  1BK2 A;  4F14 A;  2DF6 A;  4KRT A;  1K76 A;  1GCQ C;  2EGE A;  2CUD A;  4ESR A;  3FJ5 A;  1A0N B;  2DL5 A;  4J9B A;  2A36 A;  2KXC A;  2CH4 W;  4HVW A;  1UHC A;  1ZSG A;  1NEG A;  2J6F A;  4QT7 A;  1X6B A;  2PTK A;  4OML A;  4JJD A;  1IO6 A;  2LJ3 A;  4RTU A;  1E6H A;  2KT8 A;  1OEB A;  2RPN A;  2GTO A;  3UA6 A;  4WCI A;  3H41 A;  4J9G A;  1UDL A;  2L2P A;  4R0K A;  2FG0 A;  2EGA A;  3EGU A;  5IHI A;  2DA9 A;  1CSK A;  2CH4 A;  2HDA A;  2J6K A;  2KYB A;  4Z89 A;  5FW9 A;  1QLY A;  3H0F A;  4Z8A A;  2RNA A;  2EYW A;  2EQI A;  1WXT A;  3M0S A;  2MCN A;  1WX6 A;  2K9G A;  1ZLM A;  1UJY A;  4A63 B;  2PNI A;  1J3T A;  1PRM C;  2X3X D;  4Y92 A;  4AFZ C;  4JJB A;  2FRW A;  2EW3 A;  1B3Q A;  1JXO A;  1CKB A;  2YUN A;  4OMN A;  4K11 A;  2V1R A;  2JXB A;  2AKL A;  4GBQ A;  1FYN A;  1W70 A;  2RQR A;  3H0H A;  3RNJ A;  2LQN A;  1LCK A;  2RQV A;  1UFF A;  2EPD A;  1HD3 A;  1B07 A;  2M0Y A;  1K4U S;  2JS0 A;  5IHN A;  3M0R A;  4FSS A;  2OAW A;  2DL4 A;  2K79 A;  3RBB B;  2ED1 A;  2JW4 A;  4CC2 A;  1UHF A;  4ZNX A;  1VYT A;  3GBQ A;  1VYV A;  2JTE A;  2ROL A;  1G83 A;  2NUZ A;  2RF0 A;  2VWF A;  1PWT A;  1WLP B;  2KBT A;  1CKA A;  1UGV A;  1QWF A;  2FPF A;  1E7O A;  1SSH A;  3M0P A;  3CQT A;  2YUO A;  2O88 A;  2HCK A;  2J06 A;  3O5Z A;  2PZ1 A;  3THK A;  2KR3 A;  1W6X A;  3I5R A;  4Z88 A;  2DRM A;  2EGC A;  2DBM A;  3VS7 A;  4RTZ A;  2RMO A;  1M30 A;  2F2V A;  2K2M A;  3PVL A;  4RUG A;  1NEB A;  4D8D A;  1NG2 A;  1UG1 A;  2AZV A;  3EG1 A;  1UTI A;  3QWY A;  1KSW A;  3UA7 A;  4LUD A;  2GTJ A;  1UJ0 A;  2A37 A;  2DNU A;  1ABO A;  2SRC A;  2F2X A;  2HBW A;  2YUP A;  4RTV A;  3VS5 A;  2RQT A;  1RLP C;  1PNJ A;  2DJQ A;  2AK5 A;  3PVQ A;  1GBQ A;  2VKN A;  2DMO A;  2CSI A;  2JMC A;  1SRL A;  4EIK A;  1BBZ A;  1GFD A;  1WYX A;  1NYG A;  5HCK A;  2KRN A;  1OV3 A;  1K1Z A;  1MUZ A;  1NM7 A;  4J9E A;  2L3S A;  4CC3 A;  1BU1 A;  1U06 A;  2EYX A;  1U3O A;  2EVR A;  2HSP A;  2RN8 A;  4HCK A;  2B86 A;  4HVV A;  4RTW A;  2EKH A;  3REB B;  2AKK A;  2O2O A;  2LZ6 B;  1SHF A;  4JZ3 A;  1G2B A;  2H8H A;  2KRM A;  2DE0 X;  2LJ1 A;  2O31 A;  2J7I A;  4RTX A;  1M3C A;  2CSQ A;  2DL8 A;  2JMA A;  1MV3 A;  2KT1 A;  1I07 A;  2FPD A;  1PKT A;  3SHW A;  2NWM A;  3M0Q A;  3H0I A;  4HXJ A;  2D0N A;  5L23 A;  3NPF A;  4AG2 C;  2EBP A;  2GNC A;  1WXU A;  3NHN A;  4DEX A;  2KGT A;  1H92 A;  2JM9 A;  1KIK A;  3IQL A;  2BZX A;  2GGR A;  3C0C A;  3ULR B;  4LNP A;  3M0T A;  2QDL A;  5FWC A;  1V1C A;  1X27 A;  2BZ8 A;  3QWX X;  3JV3 A;  1X43 A;  1N5Z A;  2DVJ A;  2ABL A;  2O9V A;  3EHQ A;  5I11 A;  1X6G A;  1GCQ A;  2P4R A;  1GRI A;  2OJ2 A;  2RQW A;  3U23 A;  4LN2 A;  1RI9 A;  1WDX A;  2LMJ A;  1PHT A;  3TSW A;  1M8M A;  2L3Q A;  1AWO A;  2LQW A;  3EG2 A;  4IIM A;  1HJD A;  1TG0 A;  3EG0 A;  3I9Q A;  2W10 A;  1BB9 A;  4CC4 B;  1RLQ C;  1H8K A;  3TVT A;  2MIO A;  4OMQ A;  1AD5 A;  3REA B;  2X3W D;  1UE9 A;  5FWB A;  1JU5 C;  2KYM A;  1WA7 A;  1YWO A;  2ECZ A;  1QKX A;  2AZS A;  2O9S A;  4F16 A;  1QKW A;  1WI7 A;  2FRY A;  1X2K A;  2CT3 A;  1Z9Z A;  1JXM A;  4GLM A;  1Z9Q A;  1WFW A;  1U5S A;  1ZUY A;  2ESW A;  4JZ4 A;  1GFC A;  4J9H A;  4OMP A;  2E5K A;  2C0T A;  2LP5 A;  2GBQ A;  2OI3 A;  3UAT A;  1RUW A;  1S1N A;  1NLP C;  3I5S A;  1VA7 A;  1Y57 A;  1E6G A;  3TSZ A;  4AFU C;  4E6R A;  2L3P A;  3VS3 A;  2CUB A;  1T3L A;  2C0O A;  5I22 A;  2DM1 A;  2ED0 A;  2G6F X;  2XMF A;  3VS1 A;  2YUQ A;  2KE9 A;  2LJ0 A;  2KRS A;  2DLP A;  4OMO A;  1K9A A;  1ABQ A;  4OMM A;  3VRZ A;  4LUE A;  2RQU A;  5GJW B;  1PKS A;  3VS2 A;  2LX7 A;  4DEY A;  2CRE A;  1X2Q A;  1QWE A;  1VYU A;  2M51 A;  1YWP A;  1ZX6 A;  2FO0 A;  1GCP A;  2J6O A;  5IXF A;  1KFZ A;  1AWW A;  1QCF A;  2A28 A;  3KFV A;  2C0I A;  1T0H A;  3SEM A;  2HEQ A;  3VS6 A;  2DL3 A;  1NLO C;  2I0N A;  4IIO A;  2DRK A;  1XOV A;  1Y0M A;  5GJV B;  1AZG B;  1FMK A;  2FEI A;  1EFN A;  3R6N A;  2D8H A;  2J05 A;  2W0Z A;  3NMZ C;  1YN8 A;  4AFQ C;  4AFS C;  1W1F A;  1YP5 A;  1HSQ A;  2DYB A;  4JPB W;  3VS4 A;  2EYY A;  2K7A A;  2ROT A;  4RTT A;  5IHK A;  4J9F A;  1WIE A;  2K3B A;  1T3S A;  2DL7 A;  1JEG A;  1AOJ A;  4X1V A;  2KNB B;  1YCS B;  1SEM A;  2ENM A;  2V1Q A;  3I35 A;  1SHG A;  5ECA A;  1AEY A;  1UEC A;  2DBK A;  1MV0 B;  2GQI A;  1WXB A;  2BZY A;  2YT6 A;  5EC7 A;  1JQQ A;  2FPE A;  3LH5 A;  1AVZ C;  1I0C A;  2YDL A;  1ZUK A;  1TUD A;  2JT4 A;  3NGP A;  2F2W A;  2LNH B;  2K6D A;  1M3A A;  1ARK A;  1GBR A;  5IXB A;  1PRL C;  1OPL A;  4JJC A;  4AG1 C;  1M3B A;  1I1J A;  3EG3 A;  2IIM A;  2D1X A;  2KRO A;  2DX1 A;  1KJW A;  3VRY A;  1K0S A;  2YSQ A;  1SPK A;  2MOX A;  1M27 C;  3PE0 A;  3M0U A;  1JO8 A;  2JM8 A;  4J9D A;  3UF4 A;  1SRM A;  1AWX A;  2BTT A;  2JS2 A;  4J9C A;  1NYF A;  2DIL A;  1UUE A;  4M4Z A;  1YNZ A;  2LCS A;  1AZE A;  5IH2 A;  1OPK A;  4RTY A;  1OOT A;  2CDT A;  2CT4 A;  4F17 A;  4ORZ A;  4HVU A;  2KEA A;  3ZL7 C;  2KXD A;  4D8K A;  3A98 A;  1ZBJ A;  3EHR A;  2SEM A;  2VVK A;  2EYZ A;  4CC7 A;  4LE9 A;  1H3H A;  1ZUU A;  1GL5 A;  1TUC A;  3VS0 A;  2D8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...