1SRMA

1h and 15n assignments and secondary structure of the src sh3 domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRC TYROSINE KINASE SH3 DOMAIN
molecule tags Phosphotransferase
source organism Gallus gallus
publication title 1H and 15N assignments and secondary structure of the Src SH3 domain.
pubmed doi rcsb
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1srmA00
3EG3A 1CKBA 2P4RA 3VS0A 1N5ZA 2HBWA 4JZ4A 1I07A 3M0PA 2K6DA 4HVUA 3EHQA 3TVTA 2JM9A 1AWJA 1E6HA 4F16A 1UHFA 2RQWA 1ZSGA 2LJ3A 3SHWA 5IXFA 4HCKA 2KYMA 1ABOA 1PKSA 4JJBA 1TUDA 3KFVA 2DX1A 2EGAA 1OV3A 1W1FA 2ESWA 4X1VA 1JXOA 4RTYA 2J6FA 1EFNA 1M8MA 1GRIA 2KXDA 4AFSC 2O9SA 2M0YA 1ZUKA 2RQUA 3NGPA 1T3SA 2KBTA 3REBB 3CQTA 1ZLMA 4RUGA 1JU5C 1MUZA 1UG1A 5FWCA 2OAWA 3EG2A 3U23A 2EBPA 2RQRA 1JXMA 3M0SA 3EG1A 4LE9A 3VS3A 1AD5A 4GLMA 1X6GA 1A0NB 4OMLA 1PHTA 2DNUA 1OPKA 1WXBA 2FPEA 5I22A 2KRNA 4A63B 2J6OA 4J9GA 4J9CA 1H3HA 3PE0A 2F2WA 2J6KA 2GGRA 1TUCA 1RLQC 2D8JA 2DL4A 2DL8A 2KR3A 2L3QA 2MIOA 4J9EA 2A36A 1Z9ZA 2KYBA 3UATA 2EYZA 2AKKA 1GFCA 2G6FX 2KEAA 4LUDA 2HSPA 4CC3A 1NLOC 1BB9A 2ABLA 3QWYA 1AWWA 1K0SA 4KRTA 4JJCA 2OJ2A 3ZL7C 1K4US 3TSWA 4Z89A 2YT6A 1Z9QA 2BZYA 2DE0X 1CKAA 2HDAA 4HVWA 4JJDA 1SSHA 1NYFA 4ORZA 3UA7A 2ED0A 4F17A 1UFFA 1MV3A 1GCQA 2JXBA 4J9FA 1OPLA 4RTTA 1VA7A 2JM8A 1SRMA 1AZEA 1V1CA 4M4ZA 3GBQA 1PRMC 2HCKA 3H0HA 3M0RA 2C0IA 5L23A 2AZSA 5IHNA 2FEIA 2E5KA 2JW4A 2EGCA 1U3OA 2JMAA 2LMJA 1LCKA 1M3AA 4RTWA 2L0AA 2ROLA 4F14A 2ECZA 3REAB 1UDLA 3I5SA 3M0TA 3M0UA 4JZ3A 1UHCA 2GTOA 1NYGA 2YUOA 4OMNA 2YUQA 2I0NA 1FMKA 1T0JA 1AOJA 2KT8A 2EYYA 1BK2A 5IHIA 5IH2A 1KJWA 1PNJA 2YUPA 1M3CA 4AFQC 1K76A 1UJYA 4CC2A 4ZNXA 3O5ZA 1KSWA 1ZBJA 3VS4A 4RTUA 1H8KA 2EYWA 4Z8AA 3A98A 2DL5A 1Y0MA 3JV3A 3VRZA 5HCKA 1CSKA 4K11A 2LCSA 1PWTA 1ZUUA 2DM1A 3I5RA 4GBQA 4ESRA 1SPKA 2KRMA 2CT3A 1U06A 2LJ0A 2C0TA 2X3WD 2DL3A 1YN8A 1WX6A 2L3PA 2GQIA 2DA9A 1X2KA 2DLPA 1B07A 2RF0A 4OMOA 1E7OA 1GCQC 2C0OA 4D8KA 1QKXA 2O31A 2A37A 2DMOA 1K0XA 1RI9A 1WXUA 4E6RA 2LJ1A 2AK5A 3H41A 1WIEA 4HXJA 2H8HA 2DVJA 1YNZA 1SRLA 2O9VA 1AZGB 1G83A 1HD3A 2KRSA 1YWOA 2LNHB 1Y57A 1HSQA 2DF6A 4DEYA 1QLYA 2RPNA 2V1QA 3I35A 1OOTA 5FWBA 1M27C 2RMOA 2LZ6B 2KROA 2A08A 2FG0A 2DRMA 4RTVA 2EKHA 4LUEA 4LN2A 4EIKA 4IIOA 1WYXA 3RBBB 2RQVA 3PVLA 3NPFA 1UUEA 3EGUA 2FRWA 1UGVA 4OMQA 1NM7A 1AWOA 2KE9A 3H0IA 2XMFA 1NEGA 4OMPA 2SRCA 3C0CA 2A28A 2BZXA 2BTTA 3RNJA 5GJVB 2JMCA 2YSQA 1GFDA 1K1ZA 4AG1C 4AFUC 1WA7A 1PRLC 3UA6A 1YP5A 1XOVA 4WCIA 2W10A 1ARKA 1AEYA 1ZX6A 2EPDA 2GNCA 1K9AA 5IHKA 2M51A 1GBRA 2DJQA 1X6BA 2X3XD 2CUDA 2B86A 2ENMA 2NUZA 1QKWA 2PZ1A 3NHNA 1RUWA 2J06A 2OI3A 3ULRB 2CT4A 1GCPA 1I0CA 1H92A 2LX7A 2LQWA 1WDXA 5GJWB 2DILA 2CUBA 2GTJA 1J3TA 1RLPC 2D0NA 2EYXA 4IIMA 4J9HA 1E6GA 1VYUA 2CSQA 1UECA 3VRYA 1S1NA 4RTZA 3R6NA 1I1JA 2EGEA 2EQIA 5ECAA 1QCFA 2DBKA 2L2PA 1X27A 2F2XA 2AZVA 2K9GA 2KGTA 1WFWA 1T3LA 1SHGA 2L3SA 2DRKA 1G2BA 4CC4B 1GBQA 2DBMA 1VYTA 2EW3A 2RN8A 1T0HA 1B3QA 4Z88A 2VKNA 3LH5A 2K3BA 5IXBA 2K7AA 2VVKA 1QWEA 1WXTA 2DYBA 1PKTA 2K79A 2MOXA 1QWFA 4CC7A 3PVQA 3IQLA 2NWMA 2MCNA 1UJ0A 1YWPA 2FPDA 2IIMA 1AWXA 1SHFA 2SEMA 1TG0A 1WI7A 2J05A 3UF4A 2JT4A 4LNPA 1FYNA 1YCSB 1ZUYA 3QWXX 5EC7A 1BU1A 1X69A 2VWFA 4JPBW 2DL7A 2CREA 1JQQA 1AVZC 3SEMA 2KXCA 1SEMA 1UE9A 4R0KA 2RNAA 2QDLA 3EHRA 1NG2A 1VYVA 4QT7A 2PNIA 3VS7A 1U5SA 2LP5A 2FPFA 2EVRA 1JEGA 1GL5A 3VS5A 4J9IA 1MV0B 1ABQA 2F2VA 2D1XA 1OEBA 3FJ5A 1W70A 1M30A 4RTXA 2FRYA 2HEQA 2YDLA 1KFZA 5FW9A 1NLPC 2PTKA 2JS0A 2JS2A 3M0QA 5I11A 2GBQA 3VS1A 3TSZA 1NEBA 4J9DA 3VS2A 2CH4A 2LQNA 4OMMA 2W0ZA 3EG0A 2ED1A 1M3BA 4J9BA 1JO8A 2V1RA 2BZ8A 2CH4W 2D8HA 2K2MA 4Y92A 1X2QA 1KIKA 4DEXA 2YUNA 2O88A 1UTIA 4HVVA 4D8DA 1X43A 2KNBB 2O2OA 1WLPB 1BBZA 3VS6A 1IO6A 2AKLA 4AG2C 2FO0A 4FSSA 1W6XA 2JTEA 4AFZC 1HJDA 2RQTA 2KT1A 3THKA 2CSIA 3H0FA 3NMZC 2J7IA 2CDTA 3I9QA 2ROTA
chains in the Genus database with same CATH superfamily
2E6NA 1CKBA 4M7DE 3C95A 1VQ6Q 1N5ZA 3CCRA 4JZ4A 4X9DA 2K6DA 4C8QE 1E6HA 2PQWA 3CCUA 1UHFA 1YJNA 2RQWA 1ZSGA 3GOXA 1NJIC 4BY6C 3SHWA 1OYXA 2WSFE 3QDFA 1YHQA 5A0DA 4JJBA 1NBEB 1TUDA 2DIQA 2E12A 2P0KA 1OV3A 2ESWA 5LJ3g 1MGQA 5FROA 4J6YA 4EPCA 2J6FA 4F7UF 1GRIA 2KXDA 2F5TX 4AFSC 1OX9A 1Y96B 4M75E 1QCOA 1KC8C 1WQWA 2GCXA 3NGPA 2MMPA 2KY9A 2EQUA 2LTOA 2QI2A 1XJWB 4RUGA 1NJIU 2CP3A 1V76A 1G5VA 5GANh 5CQYA 4BD3A 2OAWA 2JTMA 4B9XA 3U23A 2EBPA 4J6XA 5A0LA 1AD5A 3HP9A 3LWIA 1WHKA 5GAN3 2FPEA 2J6OA 4J9GA 3S6WA 5FU7C 1Y07A 3EAEA 2HQEA 2QTVA 3OS5A 2D8JA 2DL8A 2MIOA 4R56A 3PGGA 1QVGA 4PKCC 4L5GA 3UATA 2EYZA 2LCCA 4C0ZA 4GY5A 1RADB 2HSPA 5GAMj 4HCBA 3CD6T 3LGFA 2ABLA 1K0SA 1QP3A 4JJCA 5KE3A 2F69A 3CC4A 1K4US 4N4HA 1YJWT 3EGDB 2XDPA 4FYXB 3UA7A 2DVEA 1UFFA 3OS0A 1M5Q1 3CCSQ 1GCQA 4C8QA 1OPLA 1FXXA 3CC4Q 1FMVA 2HZYA 3A8HB 3CPWS 1VQOQ 2HCKA 3M0RA 4J8OA 2C0IA 5L23A 4ZGEB 1VQMT 2QQSA 1R77A 2EGCA 4IUVA 3CCSA 3QKJA 1VQ9T 5LJ3j 3QJYA 2L0AA 4A4EA 1D0YA 3I5SA 3M0TA 2IVWA 3QYGB 2B8AA 4PJMA 4M7AE 1K9MC 2PU9B 1Q86U 1WJQA 2EJFA 1VQ7T 3EFOA 2I0NA 1FMKA 1T0JA 2HBPA 1BK2A 2P84A 3CC7A 1PD1A 2ZPHB 3H8ZA 1Q82C 1K76A 9ATCB 1DJ7B 5CK9A 1RABB 2K3XA 4JDSA 3VS4A 4RTUA 3CMEA 4Z8AA 2DL5A 5GAMd 5D6WA 2PVDB 3CCET 4K11A 1WNLA 1ZUUA 2BKDN 2CYZB 2DM1A 4PLLA 3I5RA 5EG2A 1SPKA 2KRMA 2CT3A 1K73U 1U06A 1ZBXA 2YRCA 3CCVQ 2DL3A 1WX6A 3WVDB 1X2KA 2DLPA 5GAN8 1E7OA 4D8KA 2A37A 4OVAA 1RI9A 1WXUA 4E6RA 1BI3A 2AK5A 1KG1A 3CCVA 1YNZA 5C6SA 1SRLA 1YJNT 5KYNA 2O4XB 1Y57A 1YI2T 1YI2Q 2KROA 3X28B 2Y90A 4IIOA 3RBBB 2YLCA 3NPFA 1UGVA 3G71A 3VV0A 3ASKA 1IHWA 4A4GA 4F04B 4JLGA 1NEGA 2EJ9A 3OS2A 2RJDA 3A8GB 3C0CA 2BZXA 5FU6C 3V8KA 2DD4A 4M77F 3GNGA 2JMCA 2QEXQ 3G6EQ 1GFDA 1WA7A 3CD6Q 3G71Q 5KCHA 3UA6A 1YP5A 4M7DB 5I21A 1AEYA 2GNCA 3OMGA 1K9AA 3QZ5B 5IHKA 2X3XD 4DBRA 4C8QB 3OA6A 1MNEA 3CCUT 1YJWQ 4XTWA 2QA4T 3OS1A 3UDCA 4JLIA 3A5ZB 5KYUB 2KQWA 4M77C 1RUWA 2OI3A 4MMKA 2CT4A 3X20B 3NFCA 1VQ4Q 3J80E 2DILA 2CUBA 2GTJA 5LJ5j 1J3TA 1RLPC 1H641 2HNIA 3PT9A 3AT1B 3JCMW 5CQXA 2JUFA 2CSQA 1M2OA 3R6NA 2DPPB 2LCLA 3QBYA 1I1JA 2EGEA 2GFUA 2DBKA 2F2XA 4M78G 2NUPB 2KGTA 2L3SA 3M5AA 1X01A 2PVOB 3LH0A 1VQ7Q 3HSBA 2XKOC 1PG5B 3OY9A 1NPPA 1YIJA 5GAOn 2PUOB 1UGSB 1LPLA 3G4SQ 4KGVB 3PIOA 5GANf 2MOXA 2DYBA 1VQ8A 1QWFA 1VQMQ 3PVQA 1V29B 1U1TA 1NZ9A 1R8OB 3D7SB 2X4JA 2SEMA 5KE2A 5HK0A 2J05A 2FZKB 1X69A 4JPBW 3OYAA 3LWHA 5I2MA 3OYCA 3JB9J 2KXCA 3CCJT 3TREA 2RNAA 5CKFA 4PFZA 1RL2A 1M90C 4QT7A 2PNIA 1U5SA 2LP5A 3I56T 2LC4A 1MV0B 1ABQA 2K5LA 1OEBA 2LQKA 1M30A 4RTXA 1U1SA 3E2UA 1N6AA 4NS5A 5FW9A 5GANd 3CC2A 1EZZB 5CIUA 2CH4A 2LQNA 4FSXA 3FIFA 2RI5A 3A8MB 3RUXA 2COWA 1SKUB 3QG1A 3VUBA 4PK4A 4J9BA 3CC2T 3CC2Q 5GAOp 3OSVA 2D8HA 5A2QE 5CKEA 5FLXE 1KHIA 1M4ZA 4E7LA 3FDRA 3L42A 2X4YA 4HVVA 1FWZA 4ZTFA 5GAN5 4FIBA 2KNBB 1WLPB 2O2OA 3UT1A 5J3BA 1AHJB 2FO0A 1M90R 1GXIE 1WHLA 2RJFA 2JTEA 4AFZC 1EIFA 5CCAA 2KT1A 3THKA 4DBHA 3OYKA 4HT9A 1M1FA 5GAMe 3CCLT 5GAN2 3QUIA 2RK2A 2P4RA 4HCZA 3VS0A 4XK8E 3QZ9B 1B7TA 3M0PA 4HVUA 3EHQA 3TVTA 4C0DC 3HRTA 4EMKC 1VQLT 2MYSA 1K73R 2YHTA 2Y4XA 3CC7T 3OYHA 2RH2A 5FRMA 1PKSA 5KYXB 4BDYA 5GAOl 6AT1B 3FEOA 4GLKA 1SF9A 4OP0A 2OAUA 1QQJA 2DK3A 2FZCB 1ZA2B 2O9SA 5CKBA 2KBTA 3HKSA 1D1BA 2K57A 2PVGB 1UG1A 3OBWA 3P8HA 5DM7R 1JXMA 1LVKA 3M0SA 3EG1A 4LE9A 3VS3A 4OMLA 1PHTA 3L2RA 1WXBA 3LGLA 4A63B 2L8DA 2XIDA 4LDYA 2X35A 2K3YA 2NUPA 4M7DG 2F2WA 1TUCA 1RLQC 1VQKQ 3META 4HCCA 2A36A 1ZQ1A 2M1HA 2HSEB 2KMTA 4QVZA 3ZEHA 3QXEB 2HAXA 1WHHA 4OGCA 4JS5A 4CC3A 1NLOC 3TEEA 2EAYA 3CCJQ 3GNFB 2OJ2A 2V8JA 2MWPA 5D7UA 3ZL7C 1VQLA 3L1AA 3TSWA 4EMKA 1IHVA 4JJDA 4UC4A 1SSHA 5CAIA 1IRXA 4ORZA 1YJ9Q 1YJ9T 4PFOA 2AT1B 5LJ3h 2LQ8A 3CCJA 2JXBA 4J9FA 3M9QA 4QQGA 1SRMA 2DTHA 3JB9I 4LD6A 4M78B 5GMKh 1PRMC 3FRNA 4EMGA 4M7DA 2JZ2A 2AZSA 2XK0A 3G1JA 5IHNA 2CZ1B 2FEIA 1UB4A 3JB9D 5GAMf 1BI0A 1ZHIA 1I4K1 2RM4A 3SWNA 1VQ5A 3I56Q 1TOVA 1M3AA 4RTWA 2ROLA 4F14A 2ECZA 3REAB 4M7DF 2O01E 3M0UA 1W2BP 4JZ3A 4MMLA 2R57A 2M02A 2E4HA 1D0ZA 2JNGA 2DYIA 2YUOA 2A0FB 3CMET 5IN1A 3MP1A 2CS7A 2DKGA 3JCMg 2YUQA 1VQPQ 2KT8A 3G71T 3I56A 2HKQB 2D9TA 2YUPA 1M3CA 4AFQC 1QVFA 1UJYA 8ATCB 1MMGA 2O4XA 3L2VA 1KSWA 1KC8U 3CCLQ 4D6WA 1ZSZA 4QVDA 1QVGP 2WACA 3VRZA 4Y28E 2LCSA 1AT1B 1PWTA 1BCMA 4GBQA 4MZMA 2LJ0A 2C0TA 4KT0E 1YN8A 3A1PA 1YITA 1KQ2A 2GQIA 2DA9A 1Y7XA 1VQ8T 2WSCE 3CEYA 4OMOA 3P8BB 1QVGS 4A53A 3RKWA 2DMOA 1K0XA 3VU3C 3L2UA 4ANJA 1X75C 2LJ1A 1G3TA 3RKYA 4F7UB 3GPLA 2DVJA 4QVCA 2LT4A 4HKEA 4DOWA 5M9OA 4DQ2A 4DEYA 2RPNA 2V1QA 1KQSS 4LDXA 2DRMA 4PFPA 4A4KA 4EIKA 4LN2A 3M4GA 3PVLA 1WJRA 2VGNA 3CD6A 3EGUA 2FRWA 4LDVA 4OMQA 2RA2A 3CBOA 4OGEA 3JSCA 1VQKT 4RMOA 3RERA 3HRSA 4OMPA 2SRCA 5LJ5f 2ZZDA 2M16A 2A28A 4OB0B 4DOVA 2YSQA 2FB7A 3OSSC 4AG1C 4AFUC 3CCRT 4KH1B 1ZX6A 2FL7A 1VQ4A 1GBRA 3MPUB 3VYGA 4V2SA 4PNOA 2ENMA 4EMHA 4IUUA 2PZ1A 2ZPGB 3N5BB 1YCYA 2RHZA 1GCPA 1WDXA 5GJWB 4M7AG 1YJWA 4M7AF 1M8VA 4J9HA 4XTVA 3X26B 4C5HA 1M1KR 2LVMA 1VYUA 2VB6A 1UECA 1WGSA 2DERA 2EQIA 5HK3A 2YLBA 4M75A 2AZVA 1OZ3A 2K9GA 2RJEA 4M78D 2DTIA 4QQDA 3FLGA 1T3LA 4ZGJB 3PTAA 1IREB 2DRKA 4JRIA 1VQMA 3EGDA 4OB2B 2GQVA 2DBMA 1N27A 4XU2A 2QQAA 4Z88A 1BYMA 3LH5A 2K3BA 2VVKA 1M2VB 2K79A 1K8AR 2ZGWA 3JB9G 1K8AC 1UJ0A 2CP5A 2ZPIB 1R0CB 1U8RA 5AYFA 4NL3A 3C94A 3A8OB 1FYNA 3JCMX 3QWXX 2OTJT 2DXBA 2P0PA 3RESA 2COYA 2P4TA 2VWFA 1VQ8Q 2CREA 1JQQA 1Q7YU 1SEMA 1UE9A 4R0KA 1PCXA 2CZ0B 2QDLA 2MI6A 3CCEA 3VS7A 2FPFA 1JEGA 3FJ5A 4QKUA 1W70A 5IAYA 3I55T 2GFAA 3SDZA 2M9UA 3CMAQ 1Q82U 2A3LA 3DKMA 4M78E 1Y71A 1TSFA 1N8RU 1NEBA 4J9DA 4JRPA 3BDUA 4OMMA 1VQ9A 4OF1A 1M1KU 4XU0A 1JJ2S 2E41A 3EG0A 3S3OA 2OTLQ 4RKUE 1BI1A 1K73C 2CZ6B 2JOYA 3A8LB 4KULA 5D6XA 2K5IA 2K2MA 3OYIA 4Y92A 4DEXA 2RO0A 4Z02A 5AT1B 2RD1A 3RMSA 4D8DA 2X9HA 2BE7D 1X43A 3DB4A 1BBZA 2Z0WA 1IO6A 2AKLA 2E65A 2C06A 1QP2A 2HKNA 1N8RR 4E47A 1HJDA 3EFRA 4MDXA 2CSIA 4N0AC 3OBYA 3NMZC 2XU8A 3FB9A 4J7IA 3I9QA 2ROTA 3EG3A 1TS9A 2LT1A 3VKIA 3JCMe 3CCQT 5DLQE 2NYSA 1VQ6T 2HBWA 3SWNB 1I07A 4PJOA 4BDZA 2M0OA 3EFOB 2JM9A 5D6YA 1AWJA 2H3EB 2BE9B 4F16A 3MO8A 3JCMV 3CXCS 2LJ3A 1D1AA 4MDWA 1MMAA 5IXFA 4F7UG 2JTFA 1ABOA 1VQ6A 4F7UE 2QGFB 4E7HA 3KFVA 1G3SA 3CCMT 2EGAA 1W1FA 4IUQA 1UGPB 1JXOA 2QQ9A 4RTYA 4L6V5 1EFNA 1M8MA 4ELYC 1YJNQ 4KUDK 4JS4A 2M0YA 2RI3A 3M55A 2RQUA 1T3SA 3CQTA 1ZLMA 3NTHA 3BFMA 5LJ5g 3BE3A 4E7SA 3EH2A 4F7UA 3PMTA 3EG2A 4ZN1A 2QG9B 3OW2P 2XICA 1JRIA 4GLMA 1RACB 3UPUA 1A0NB 2DNUA 4MZTA 2QA4Q 3PFSA 1OPKA 2JVVA 5I22A 4M77E 1LOJA 3OB9A 1QVFP 2KRNA 4QW2A 2E6ZA 3OW2S 4J83A 1H3HA 4MZPA 5GMKm 1OI1A 5GANj 1D3BB 2J6KA 2GGRA 4N4IA 3AHUA 4C92F 4II1A 3LLRA 1QVFS 4J9EA 4XU1A 4FYWB 1Z9ZA 2KDSA 1PM3A 3V8JA 1WZOA 2KYBA 3OYYA 4C0FA 3L2WA 1GFCA 1K9MU 2G6FX 2KEAA 4B9WA 3CCQA 3G6ET 2DZ9A 3INZA 2XHCA 3JCMd 5LJ5h 1AWWA 4KRTA 2CP7A 1IGQA 1VQKA 3CMAT 2DE0X 2EYQA 1VQOA 2HDAA 4HVWA 3V8LA 4KH0B 2NUTA 4NOYA 1RAGB 1IGUA 2X51A 1JJ2P 1NYFA 1M1KC 3PMIA 3PIPA 2ED0A 4Q5WA 1B34A 5GMKl 1KD1C 1H3ZA 5LJ3e 4TVRA 5FU6B 1MMNA 4XU3A 4RTTA 1VQLQ 1VA7A 2JM8A 4M7DC 2DFUA 2OTJQ 2L89A 3GBQA 3EG9A 3H0HA 2GF7A 4C8QC 2IG0A 1F1BB 2OTLT 1YJ9A 2VC8A 2E5KA 3V7RA 1U3OA 1OZ2A 1KQSA 1LCKA 2DAQA 3J7AF 3SB2A 3OYBA 5GMKe 4KGZB 4C8QG 4JRQA 3VUZA 2GTOA 2VXFA 2ZPBB 3CBPA 1Q7YC 3HTRA 4BB7A 4OMNA 3ME9A 4PL6A 2L3RA 5IHIA 1FX7A 1WHMA 1KJWA 1PNJA 4J6WA 2RJCA 2VUBA 1KQSP 2H3JA 2MAMA 5FRNA 1ZSZC 3O5ZA 4E7KA 3CPFA 5LJ3d 1H8KA 2R5MA 3A98A 1LJOA 4OB3B 3SFMA 2DXCA 4PJOE 1CSKA 4ESRA 4XAXB 7AT1B 2X3WD 5KYWA 3S3MA 2HD0A 4RG8A 1B07A 2RF0A 4WTOB 3M56A 1TWBA 2CGHA 2C0OA 3MKDA 3CCLA 2CP2A 1Q7YR 2AIRB 4KBMB 1PSFA 3H41A 3RIRA 4HXJA 1I5OB 1WHJA 1UGQB 4XQ3A 1G83A 1C6VX 2DEUA 1HD3A 4HT8A 2KRSA 1YWOA 2LNHB 2F1LA 4C5EA 1BKBA 4LDUA 4M7AD 2DF6A 1Q81R 1QLYA 1IXDA 3X24B 1M27C 2RMOA 2LZ6B 4A4HA 4BY6B 2A08A 2XG8D 4P5NA 4RTVA 2EKHA 3RMQA 4AMCA 1WYXA 2K2VA 2RQVA 3JCMQ 4JRKA 5KYYB 4ZGDB 4FW1A 1KD1R 1AWOA 4M75G 3H0IA 2XMFA 1KC8R 3RR6A 2RI2A 3LW5E 3MEAA 4X9CA 2E3HA 5L8RE 4C92B 3RNJA 1BIAA 3RDVA 3E19A 5GJVB 2QEXT 5CKHA 4C8QD 3MP8A 4N4GA 1PRLC 2EWNA 5GAN6 4ATOA 2YRDA 3E9GA 3OYNA 1UEBA 3RKXA 1W2BS 2ZPFB 2M51A 5GAOr 2DJQA 2CUDA 5LJ5e 4DA4A 1D0XA 4Y91A 2B86A 4LXCA 1Q81U 2NUZA 3G6EA 1QKWA 2MPXC 3P8DA 1YITT 2D0QB 4O5VA 2J06A 2RHYA 3ULRB 3S3NA 4RG2A 2R58A 1I0CA 1H92A 4M75D 2LX7A 4E7ZA 1C1AA 1O75A 2DJZA 4M77A 1IB8A 5KYXA 2P0QA 1I81A 2QK0A 1E6GA 2E3IA 2VGMA 3CBMA 2K5FA 4J5YA 3URGA 1OU8A 3M57A 3WVEB 2VV5A 8AT1B 1S1NA 4RTZA 1QW1A 3I55Q 5ECAA 2DIGA 1XTDA 4JJNK 1WFWA 2HL5C 2VXEA 4C0DB 1G2BA 3MEUA 1X6OA 5GMKj 4C0GA 4KGXB 3JCMh 1G3YA 2LDMA 1VYTA 1FMWA 2EW3A 4DBFA 2X4WA 4VUBA 1T0HA 2MK5A 2VKNA 1BI2A 3G4ST 1YBYA 1PKTA 1KHCA 3GF5A 4CC7A 2R5AA 3IQLA 1VQ7A 2QTXA 4C92D 2FPDA 2G3RA 1ZA1B 1SHFA 1VQNA 3ZFJA 1WI7A 4LNPA 3V7CA 1YCSB 3UWNA 3G4SA 2XDDA 2LNVA 4N0AA 5EC7A 1BU1A 2XI9A 2DL7A 5KH6A 3SEMA 1AVZC 4E7IA 1S72Q 1S72T 4IKFA 5GAN7 1TXQA 5GAN4 3EHRA 1NG2A 1VYVA 3CXCA 3FC3A 3CCMQ 5KYUA 2EVRA 4A54A 3VS5A 1C0MA 2HEQA 2YDLA 3F70A 2KI7A 1OX8A 5I2SA 1N9RA 3JRZA 4BE0A 1NLPC 1HK9A 2YRVA 4DBQA 2JS0A 2V8IA 3M0QA 4L59A 5I11A 4ZN3A 1OU9A 2NUTB 3JAME 3CCEQ 3R6OA 3DB3A 1VQ5T 1PC0A 1NJIR 3M54A 4PJJA 2HMAA 3CMAA 3OW2A 1M3BA 1PSEA 2DETA 2RK1A 5GANg 5LJ3f 2V1RA 1SSFA 1KIKA 2RB6A 1M90U 3EG9B 2YUNA 2KAFA 2O88A 3MHXA 1UTIA 1W2BA 3VS6A 2PUKB 3BW1A 4AG2C 2DXUA 4BI4A 2DXTA 1NE8A 3PNWC 2E5QA 2RQTA 3E9FA 3C4SA 2CKKA 3OYDA 2L5QA 3H0FA 3CCUQ 3QSUA 2CP6A 3QPHA 2J7IA 3OYEA 1LNXA 2MWOA 1MNDA 3HFNA 4PJOB 2CDTA 2DO3A 5LL6S 3OYLA 5DY9A 1TUGB 2EIFA 1RAEB 3L2ZA 1YIJT 1SG5A 2YXYA 1WQ7A 1IZ6A 3HFOA 4OMFB 4EMKB 2E1HA 3JCMc 4LDWA 3VJPA 4HCKA 2KYMA 3QHSA 5C0MA 5GAOm 2DX1A 3H6ZA 4X1VA 2ZCFB 4BE1A 5FU7B 5A0GA 4IUPA 2LRQA 1ZUKA 3HRUA 2RHXA 3REBB 1JJ2A 2QA4A 1YHQQ 1JU5C 1MUZA 4M77B 2RHUA 2K4YA 5FWCA 1M2VA 3QYHB 4PLIA 3QJ6A 3LX7A 3ZBDA 4FCYA 4M75B 4FYVB 2RQRA 3EGXA 3V7SA 2NLUA 1X6GA 2ZAEA 1BCOA 4C92G 2KSSA 1HXDA 3HHTB 3KUFA 4J9CA 3PE0A 2E10A 2VYTA 3C12A 1VIEA 2DL4A 2KR3A 2L3QA 4FM4B 4XTXA 4C92C 1QCNA 4BI8B 3X25B 4FT4A 2AKKA 3JCMP 5KYWB 1MMDA 4LUDA 3EFSA 1BB9A 1VOMA 3QWYA 2XDBA 4FW2A 1VIFA 2V8KA 1Q86R 4AT1B 3OYMA 4Z89A 2I2LA 2YT6A 1NPRA 1Z9QA 2BZYA 3OQ5A 5CVIA 1CKAA 2JN0A 2EQKA 3DLMA 1XQHA 3CCQQ 3J81E 4F17A 2V26A 2FYKA 1Q82R 3JB9F 3GP8A 1MV3A 2MF2A 4A4FA 1VQ5Q 3M58A 5LJ5d 1VUBA 3ER0A 4FU6A 3CCVT 5J26A 1AZEA 1V1CA 4M4ZA 2EQJA 4M75F 3CXCP 2QXFA 1K9MR 1W4SA 2JW4A 3WXMB 1K8AU 2JMAA 2LMJA 1VQPA 2XD0A 4M78F 3CPWP 3M4YA 1BIBA 4JUVA 2OTJA 1UDLA 3OYJA 1QMCA 1R0BG 1UHCA 2QQBA 5CR2A 1NYGA 5HY6A 3CMEQ 4KUIA 3MJXA 4O6JA 4BE2A 1RAAB 1AOJA 2EYYA 3QIIA 1B34B 5J39A 2YWWA 5IH2A 1Q95G 3HL8A 4M7AC 4X34A 4ELZC 4M7AB 1YITQ 4CC2A 4ZNXA 4NL2A 3MEVA 3JCMf 3OYGA 1ZBJA 4C92A 2EYWA 1JB0E 4CRIA 1Y0MA 3JV3A 5HCKA 1HYOA 3CC7Q 2AHJB 4LD9K 1EX4A 2L3PA 2HL3A 5DLOA 2ATCB 1XNIA 4YTLA 1N8RC 1GCQC 4J7FA 2DEQA 1QKXA 2O31A 1TH7A 5CKDA 3M53A 3EH1A 3QDRB 1KQ1A 1VQNT 2HQHA 1G8XA 3O8VA 1I5LA 4ZTJA 1WIEA 3OYFA 2H8HA 2E64A 1ZSZB 5KYYA 2O9VA 4OB1B 1AZGB 3VYHB 2CP0A 1D09B 1HSQA 4C8QF 3GLXA 4FT2A 3I35A 1OOTA 5FWBA 3JCMb 1VQOT 3MP6A 2FG0A 2FVUA 4LUEA 1RAIB 3CC4T 3Q1JA 1Q81C 3NTKA 2BIVA 4C92E 1UUEA 1NM7A 2KE9A 1RI0A 4M78A 2CZ7B 2EQMA 1YI2A 4PJOF 2BUDA 5GANe 4BUGA 3H9NA 2BTTA 1JBMA 4PJOG 1K1ZA 4CI0C 2OX7A 3EGXB 3KXTA 4M7AA 4WCIA 1XOVA 2W10A 1ARKA 2EPDA 1D3BA 4M7DD 4XTUA 1X6BA 4R55A 2X4XA 2LX9A 3TQ7P 4PJOC 2QAZA 2QEXA 3SD4A 3NHNA 1Y96A 4RCCA 1WPYA 2EFIA 3G7ZA 2LQWA 5GAMh 2JJ9A 3GIBA 2D0NA 2EYXA 4FL6A 1WJSA 3FJPA 4IIMA 2FHDA 2HQXA 3TU4K 3JCMJ 4M77G 1OQKA 4QQ6A 2VASA 1TU0B 2FZGB 3VRYA 1UGRB 1QCFA 2L2PA 1X27A 2DD5A 5IT9E 3M59A 2IPOB 3SWNC 2EKOA 4BACA 1SHGA 2Y4YA 2D6FA 4CC4B 3MCAB 3HPWA 4M75C 2COZA 5HKCA 1GBQA 4E2FB 1RAHB 4M77D 1WHGA 3I55A 3JB9H 2RN8A 4XTZA 1B3QA 4M78C 5IXBA 1MHNA 2K7AA 2DZCA 1QWEA 1WXTA 5CO7A 2NWMA 2MCNA 3KBGA 1YWPA 2IIMA 4B6MA 1AWXA 1M9SA 2KVQG 1TG0A 2QYZA 1YIJQ 2DTOA 5KCOA 3UF4A 2JT4A 4RCBA 1Q86C 1VQ4T 1ZUYA 2E70A 1KD1U 2QASA 1O9SA 1D1CA 4WF2A 1PD0A 3TCJA 1RAFB 1KK7A 1VQPT 1OULA 1YFNA 1VQNQ 1TTHB 1GL5A 4BI3A 4J9IA 2F2VA 2D1XA 2QQRA 1YHQT 4PJOD 2FRYA 4EDUA 4HA8A 2QGGA 1KFZA 5GMKi 2WSEE 3T9NA 1M1GA 1G3WA 2PTKA 4E7JA 1S72A 2JS2A 2GBQA 3VS1A 3TSZA 1N9SA 2EJGA 3CCMA 2QDYB 3VS2A 3BY7A 4IUTA 3MEWA 3CCST 2KK4A 2W0ZA 4PJLA 1QVPA 2ED1A 3QO3A 4XTYA 2RHIA 4IURA 1P92A 1JO8A 2BZ8A 2CH4W 4PJNA 1X2QA 2ZPEB 1I8FA 3CPWA 3NTIA 2A7YA 1VQ9Q 1ACMB 2F5KA 3E1SA 5GAOq 2OTLA 3L2QA 5GAMg 3OMCA 3CCRQ 3DLLA 4FSSA 1W6XA 3BDLA 4ME7A 4C5IA 3LYIA 4C5GA 4FYYB
chains in the Genus database with same CATH topology
3EG3A 1CKBA 2P4RA 3VS0A 1N5ZA 2HBWA 4JZ4A 1I07A 3M0PA 2K6DA 4HVUA 3EHQA 3TVTA 2JM9A 1AWJA 1E6HA 4F16A 1UHFA 2RQWA 1ZSGA 2LJ3A 3SHWA 5IXFA 4HCKA 2KYMA 1ABOA 1PKSA 4JJBA 1TUDA 3KFVA 2DX1A 2EGAA 1OV3A 1W1FA 2ESWA 4X1VA 1JXOA 4RTYA 2J6FA 1EFNA 1M8MA 1GRIA 2KXDA 4AFSC 2O9SA 2M0YA 1ZUKA 2RQUA 3NGPA 1T3SA 2KBTA 3REBB 3CQTA 1ZLMA 4RUGA 1JU5C 1MUZA 1UG1A 5FWCA 2OAWA 3EG2A 3U23A 2EBPA 2RQRA 1JXMA 3M0SA 3EG1A 4LE9A 3VS3A 1AD5A 4GLMA 1X6GA 1A0NB 4OMLA 1PHTA 2DNUA 1OPKA 1WXBA 2FPEA 5I22A 2KRNA 4A63B 2J6OA 4J9GA 4J9CA 1H3HA 3PE0A 2F2WA 2J6KA 2GGRA 1TUCA 1RLQC 2D8JA 2DL4A 2DL8A 2KR3A 2L3QA 2MIOA 4J9EA 2A36A 1Z9ZA 2KYBA 3UATA 2EYZA 2AKKA 1GFCA 2G6FX 2KEAA 4LUDA 2HSPA 4CC3A 1NLOC 1BB9A 2ABLA 3QWYA 1AWWA 1K0SA 4KRTA 4JJCA 2OJ2A 3ZL7C 1K4US 3TSWA 4Z89A 2YT6A 1Z9QA 2BZYA 2DE0X 1CKAA 2HDAA 4HVWA 4JJDA 1SSHA 1NYFA 4ORZA 3UA7A 2ED0A 4F17A 1UFFA 1MV3A 1GCQA 2JXBA 4J9FA 1OPLA 4RTTA 1VA7A 2JM8A 1SRMA 1AZEA 1V1CA 4M4ZA 3GBQA 1PRMC 2HCKA 3H0HA 3M0RA 2C0IA 5L23A 2AZSA 5IHNA 2FEIA 2E5KA 2JW4A 2EGCA 1U3OA 2JMAA 2LMJA 1LCKA 1M3AA 4RTWA 2L0AA 2ROLA 4F14A 2ECZA 3REAB 1UDLA 3I5SA 3M0TA 3M0UA 4JZ3A 1UHCA 2GTOA 1NYGA 2YUOA 4OMNA 2YUQA 2I0NA 1FMKA 1T0JA 1AOJA 2KT8A 2EYYA 1BK2A 5IHIA 5IH2A 1KJWA 1PNJA 2YUPA 1M3CA 4AFQC 1K76A 1UJYA 4CC2A 4ZNXA 3O5ZA 1KSWA 1ZBJA 3VS4A 4RTUA 1H8KA 2EYWA 4Z8AA 3A98A 2DL5A 1Y0MA 3JV3A 3VRZA 5HCKA 1CSKA 4K11A 2LCSA 1PWTA 1ZUUA 2DM1A 3I5RA 4GBQA 4ESRA 1SPKA 2KRMA 2CT3A 1U06A 2LJ0A 2C0TA 2X3WD 2DL3A 1YN8A 1WX6A 2L3PA 2GQIA 2DA9A 1X2KA 2DLPA 1B07A 2RF0A 4OMOA 1E7OA 1GCQC 2C0OA 4D8KA 1QKXA 2O31A 2A37A 2DMOA 1K0XA 1RI9A 1WXUA 4E6RA 2LJ1A 2AK5A 3H41A 1WIEA 4HXJA 2H8HA 2DVJA 1YNZA 1SRLA 2O9VA 1AZGB 1G83A 1HD3A 2KRSA 1YWOA 2LNHB 1Y57A 1HSQA 2DF6A 4DEYA 1QLYA 2RPNA 2V1QA 3I35A 1OOTA 5FWBA 1M27C 2RMOA 2LZ6B 2KROA 2A08A 2FG0A 2DRMA 4RTVA 2EKHA 4LUEA 4LN2A 4EIKA 4IIOA 1WYXA 3RBBB 2RQVA 3PVLA 3NPFA 1UUEA 3EGUA 2FRWA 1UGVA 4OMQA 1NM7A 1AWOA 2KE9A 3H0IA 2XMFA 1NEGA 4OMPA 2SRCA 3C0CA 2A28A 2BZXA 2BTTA 3RNJA 5GJVB 2JMCA 2YSQA 1GFDA 1K1ZA 4AG1C 4AFUC 1WA7A 1PRLC 3UA6A 1YP5A 1XOVA 4WCIA 2W10A 1ARKA 1AEYA 1ZX6A 2EPDA 2GNCA 1K9AA 5IHKA 2M51A 1GBRA 2DJQA 1X6BA 2X3XD 2CUDA 2B86A 2ENMA 2NUZA 1QKWA 2PZ1A 3NHNA 1RUWA 2J06A 2OI3A 3ULRB 2CT4A 1GCPA 1I0CA 1H92A 2LX7A 2LQWA 1WDXA 5GJWB 2DILA 2CUBA 2GTJA 1J3TA 1RLPC 2D0NA 2EYXA 4IIMA 4J9HA 1E6GA 1VYUA 2CSQA 1UECA 3VRYA 1S1NA 4RTZA 3R6NA 1I1JA 2EGEA 2EQIA 5ECAA 1QCFA 2DBKA 2L2PA 1X27A 2F2XA 2AZVA 2K9GA 2KGTA 1WFWA 1T3LA 1SHGA 2L3SA 2DRKA 1G2BA 4CC4B 1GBQA 2DBMA 1VYTA 2EW3A 2RN8A 1T0HA 1B3QA 4Z88A 2VKNA 3LH5A 2K3BA 5IXBA 2K7AA 2VVKA 1QWEA 1WXTA 2DYBA 1PKTA 2K79A 2MOXA 1QWFA 4CC7A 3PVQA 3IQLA 2NWMA 2MCNA 1UJ0A 1YWPA 2FPDA 2IIMA 1AWXA 1SHFA 2SEMA 1TG0A 1WI7A 2J05A 3UF4A 2JT4A 4LNPA 1FYNA 1YCSB 1ZUYA 3QWXX 5EC7A 1BU1A 1X69A 2VWFA 4JPBW 2DL7A 2CREA 1JQQA 1AVZC 3SEMA 2KXCA 1SEMA 1UE9A 4R0KA 2RNAA 2QDLA 3EHRA 1NG2A 1VYVA 4QT7A 2PNIA 3VS7A 1U5SA 2LP5A 2FPFA 2EVRA 1JEGA 1GL5A 3VS5A 4J9IA 1MV0B 1ABQA 2F2VA 2D1XA 1OEBA 3FJ5A 1W70A 1M30A 4RTXA 2FRYA 2HEQA 2YDLA 1KFZA 5FW9A 1NLPC 2PTKA 2JS0A 2JS2A 3M0QA 5I11A 2GBQA 3VS1A 3TSZA 1NEBA 4J9DA 3VS2A 2CH4A 2LQNA 4OMMA 2W0ZA 3EG0A 2ED1A 1M3BA 4J9BA 1JO8A 2V1RA 2BZ8A 2CH4W 2D8HA 2K2MA 4Y92A 1X2QA 1KIKA 4DEXA 2YUNA 2O88A 1UTIA 4HVVA 4D8DA 1X43A 2KNBB 2O2OA 1WLPB 1BBZA 3VS6A 1IO6A 2AKLA 4AG2C 2FO0A 4FSSA 1W6XA 2JTEA 4AFZC 1HJDA 2RQTA 2KT1A 3THKA 2CSIA 3H0FA 3NMZC 2J7IA 2CDTA 3I9QA 2ROTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EG3 A;  1CKB A;  2P4R A;  3VS0 A;  1N5Z A;  2HBW A;  4JZ4 A;  1I07 A;  3M0P A;  2K6D A;  4HVU A;  3EHQ A;  3TVT A;  2JM9 A;  1AWJ A;  1E6H A;  4F16 A;  1UHF A;  2RQW A;  1ZSG A;  2LJ3 A;  3SHW A;  5IXF A;  4HCK A;  2KYM A;  1ABO A;  1PKS A;  4JJB A;  1TUD A;  3KFV A;  2DX1 A;  2EGA A;  1OV3 A;  1W1F A;  2ESW A;  4X1V A;  1JXO A;  4RTY A;  2J6F A;  1EFN A;  1M8M A;  1GRI A;  2KXD A;  4AFS C;  2O9S A;  2M0Y A;  1ZUK A;  2RQU A;  3NGP A;  1T3S A;  2KBT A;  3REB B;  3CQT A;  1ZLM A;  4RUG A;  1JU5 C;  1MUZ A;  1UG1 A;  5FWC A;  2OAW A;  3EG2 A;  3U23 A;  2EBP A;  2RQR A;  1JXM A;  3M0S A;  3EG1 A;  4LE9 A;  3VS3 A;  1AD5 A;  4GLM A;  1X6G A;  1A0N B;  4OML A;  1PHT A;  2DNU A;  1OPK A;  1WXB A;  2FPE A;  5I22 A;  2KRN A;  4A63 B;  2J6O A;  4J9G A;  4J9C A;  1H3H A;  3PE0 A;  2F2W A;  2J6K A;  2GGR A;  1TUC A;  1RLQ C;  2D8J A;  2DL4 A;  2DL8 A;  2KR3 A;  2L3Q A;  2MIO A;  4J9E A;  2A36 A;  1Z9Z A;  2KYB A;  3UAT A;  2EYZ A;  2AKK A;  1GFC A;  2G6F X;  2KEA A;  4LUD A;  2HSP A;  4CC3 A;  1NLO C;  1BB9 A;  2ABL A;  3QWY A;  1AWW A;  1K0S A;  4KRT A;  4JJC A;  2OJ2 A;  3ZL7 C;  1K4U S;  3TSW A;  4Z89 A;  2YT6 A;  1Z9Q A;  2BZY A;  2DE0 X;  1CKA A;  2HDA A;  4HVW A;  4JJD A;  1SSH A;  1NYF A;  4ORZ A;  3UA7 A;  2ED0 A;  4F17 A;  1UFF A;  1MV3 A;  1GCQ A;  2JXB A;  4J9F A;  1OPL A;  4RTT A;  1VA7 A;  2JM8 A;  1SRM A;  1AZE A;  1V1C A;  4M4Z A;  3GBQ A;  1PRM C;  2HCK A;  3H0H A;  3M0R A;  2C0I A;  5L23 A;  2AZS A;  5IHN A;  2FEI A;  2E5K A;  2JW4 A;  2EGC A;  1U3O A;  2JMA A;  2LMJ A;  1LCK A;  1M3A A;  4RTW A;  2L0A A;  2ROL A;  4F14 A;  2ECZ A;  3REA B;  1UDL A;  3I5S A;  3M0T A;  3M0U A;  4JZ3 A;  1UHC A;  2GTO A;  1NYG A;  2YUO A;  4OMN A;  2YUQ A;  2I0N A;  1FMK A;  1T0J A;  1AOJ A;  2KT8 A;  2EYY A;  1BK2 A;  5IHI A;  5IH2 A;  1KJW A;  1PNJ A;  2YUP A;  1M3C A;  4AFQ C;  1K76 A;  1UJY A;  4CC2 A;  4ZNX A;  3O5Z A;  1KSW A;  1ZBJ A;  3VS4 A;  4RTU A;  1H8K A;  2EYW A;  4Z8A A;  3A98 A;  2DL5 A;  1Y0M A;  3JV3 A;  3VRZ A;  5HCK A;  1CSK A;  4K11 A;  2LCS A;  1PWT A;  1ZUU A;  2DM1 A;  3I5R A;  4GBQ A;  4ESR A;  1SPK A;  2KRM A;  2CT3 A;  1U06 A;  2LJ0 A;  2C0T A;  2X3W D;  2DL3 A;  1YN8 A;  1WX6 A;  2L3P A;  2GQI A;  2DA9 A;  1X2K A;  2DLP A;  1B07 A;  2RF0 A;  4OMO A;  1E7O A;  1GCQ C;  2C0O A;  4D8K A;  1QKX A;  2O31 A;  2A37 A;  2DMO A;  1K0X A;  1RI9 A;  1WXU A;  4E6R A;  2LJ1 A;  2AK5 A;  3H41 A;  1WIE A;  4HXJ A;  2H8H A;  2DVJ A;  1YNZ A;  1SRL A;  2O9V A;  1AZG B;  1G83 A;  1HD3 A;  2KRS A;  1YWO A;  2LNH B;  1Y57 A;  1HSQ A;  2DF6 A;  4DEY A;  1QLY A;  2RPN A;  2V1Q A;  3I35 A;  1OOT A;  5FWB A;  1M27 C;  2RMO A;  2LZ6 B;  2KRO A;  2A08 A;  2FG0 A;  2DRM A;  4RTV A;  2EKH A;  4LUE A;  4LN2 A;  4EIK A;  4IIO A;  1WYX A;  3RBB B;  2RQV A;  3PVL A;  3NPF A;  1UUE A;  3EGU A;  2FRW A;  1UGV A;  4OMQ A;  1NM7 A;  1AWO A;  2KE9 A;  3H0I A;  2XMF A;  1NEG A;  4OMP A;  2SRC A;  3C0C A;  2A28 A;  2BZX A;  2BTT A;  3RNJ A;  5GJV B;  2JMC A;  2YSQ A;  1GFD A;  1K1Z A;  4AG1 C;  4AFU C;  1WA7 A;  1PRL C;  3UA6 A;  1YP5 A;  1XOV A;  4WCI A;  2W10 A;  1ARK A;  1AEY A;  1ZX6 A;  2EPD A;  2GNC A;  1K9A A;  5IHK A;  2M51 A;  1GBR A;  2DJQ A;  1X6B A;  2X3X D;  2CUD A;  2B86 A;  2ENM A;  2NUZ A;  1QKW A;  2PZ1 A;  3NHN A;  1RUW A;  2J06 A;  2OI3 A;  3ULR B;  2CT4 A;  1GCP A;  1I0C A;  1H92 A;  2LX7 A;  2LQW A;  1WDX A;  5GJW B;  2DIL A;  2CUB A;  2GTJ A;  1J3T A;  1RLP C;  2D0N A;  2EYX A;  4IIM A;  4J9H A;  1E6G A;  1VYU A;  2CSQ A;  1UEC A;  3VRY A;  1S1N A;  4RTZ A;  3R6N A;  1I1J A;  2EGE A;  2EQI A;  5ECA A;  1QCF A;  2DBK A;  2L2P A;  1X27 A;  2F2X A;  2AZV A;  2K9G A;  2KGT A;  1WFW A;  1T3L A;  1SHG A;  2L3S A;  2DRK A;  1G2B A;  4CC4 B;  1GBQ A;  2DBM A;  1VYT A;  2EW3 A;  2RN8 A;  1T0H A;  1B3Q A;  4Z88 A;  2VKN A;  3LH5 A;  2K3B A;  5IXB A;  2K7A A;  2VVK A;  1QWE A;  1WXT A;  2DYB A;  1PKT A;  2K79 A;  2MOX A;  1QWF A;  4CC7 A;  3PVQ A;  3IQL A;  2NWM A;  2MCN A;  1UJ0 A;  1YWP A;  2FPD A;  2IIM A;  1AWX A;  1SHF A;  2SEM A;  1TG0 A;  1WI7 A;  2J05 A;  3UF4 A;  2JT4 A;  4LNP A;  1FYN A;  1YCS B;  1ZUY A;  3QWX X;  5EC7 A;  1BU1 A;  1X69 A;  2VWF A;  4JPB W;  2DL7 A;  2CRE A;  1JQQ A;  1AVZ C;  3SEM A;  2KXC A;  1SEM A;  1UE9 A;  4R0K A;  2RNA A;  2QDL A;  3EHR A;  1NG2 A;  1VYV A;  4QT7 A;  2PNI A;  3VS7 A;  1U5S A;  2LP5 A;  2FPF A;  2EVR A;  1JEG A;  1GL5 A;  3VS5 A;  4J9I A;  1MV0 B;  1ABQ A;  2F2V A;  2D1X A;  1OEB A;  3FJ5 A;  1W70 A;  1M30 A;  4RTX A;  2FRY A;  2HEQ A;  2YDL A;  1KFZ A;  5FW9 A;  1NLP C;  2PTK A;  2JS0 A;  2JS2 A;  3M0Q A;  5I11 A;  2GBQ A;  3VS1 A;  3TSZ A;  1NEB A;  4J9D A;  3VS2 A;  2CH4 A;  2LQN A;  4OMM A;  2W0Z A;  3EG0 A;  2ED1 A;  1M3B A;  4J9B A;  1JO8 A;  2V1R A;  2BZ8 A;  2CH4 W;  2D8H A;  2K2M A;  4Y92 A;  1X2Q A;  1KIK A;  4DEX A;  2YUN A;  2O88 A;  1UTI A;  4HVV A;  4D8D A;  1X43 A;  2KNB B;  2O2O A;  1WLP B;  1BBZ A;  3VS6 A;  1IO6 A;  2AKL A;  4AG2 C;  2FO0 A;  4FSS A;  1W6X A;  2JTE A;  4AFZ C;  1HJD A;  2RQT A;  2KT1 A;  3THK A;  2CSI A;  3H0F A;  3NMZ C;  2J7I A;  2CDT A;  3I9Q A;  2ROT A; 
#chains in the Genus database with same CATH topology
 2E6N A;  1CKB A;  4M7D E;  3C95 A;  1VQ6 Q;  1N5Z A;  3CCR A;  4JZ4 A;  4X9D A;  2K6D A;  4C8Q E;  1E6H A;  2PQW A;  3CCU A;  1UHF A;  1YJN A;  2RQW A;  1ZSG A;  3GOX A;  1NJI C;  4BY6 C;  3SHW A;  1OYX A;  2WSF E;  3QDF A;  1YHQ A;  5A0D A;  4JJB A;  1NBE B;  1TUD A;  2DIQ A;  2E12 A;  2P0K A;  1OV3 A;  2ESW A;  5LJ3 g;  1MGQ A;  5FRO A;  4J6Y A;  4EPC A;  2J6F A;  4F7U F;  1GRI A;  2KXD A;  2F5T X;  4AFS C;  1OX9 A;  1Y96 B;  4M75 E;  1QCO A;  1KC8 C;  1WQW A;  2GCX A;  3NGP A;  2MMP A;  2KY9 A;  2EQU A;  2LTO A;  2QI2 A;  1XJW B;  4RUG A;  1NJI U;  2CP3 A;  1V76 A;  1G5V A;  5GAN h;  5CQY A;  4BD3 A;  2OAW A;  2JTM A;  4B9X A;  3U23 A;  2EBP A;  4J6X A;  5A0L A;  1AD5 A;  3HP9 A;  3LWI A;  1WHK A;  5GAN 3;  2FPE A;  2J6O A;  4J9G A;  3S6W A;  5FU7 C;  1Y07 A;  3EAE A;  2HQE A;  2QTV A;  3OS5 A;  2D8J A;  2DL8 A;  2MIO A;  4R56 A;  3PGG A;  1QVG A;  4PKC C;  4L5G A;  3UAT A;  2EYZ A;  2LCC A;  4C0Z A;  4GY5 A;  1RAD B;  2HSP A;  5GAM j;  4HCB A;  3CD6 T;  3LGF A;  2ABL A;  1K0S A;  1QP3 A;  4JJC A;  5KE3 A;  2F69 A;  3CC4 A;  1K4U S;  4N4H A;  1YJW T;  3EGD B;  2XDP A;  4FYX B;  3UA7 A;  2DVE A;  1UFF A;  3OS0 A;  1M5Q 1;  3CCS Q;  1GCQ A;  4C8Q A;  1OPL A;  1FXX A;  3CC4 Q;  1FMV A;  2HZY A;  3A8H B;  3CPW S;  1VQO Q;  2HCK A;  3M0R A;  4J8O A;  2C0I A;  5L23 A;  4ZGE B;  1VQM T;  2QQS A;  1R77 A;  2EGC A;  4IUV A;  3CCS A;  3QKJ A;  1VQ9 T;  5LJ3 j;  3QJY A;  2L0A A;  4A4E A;  1D0Y A;  3I5S A;  3M0T A;  2IVW A;  3QYG B;  2B8A A;  4PJM A;  4M7A E;  1K9M C;  2PU9 B;  1Q86 U;  1WJQ A;  2EJF A;  1VQ7 T;  3EFO A;  2I0N A;  1FMK A;  1T0J A;  2HBP A;  1BK2 A;  2P84 A;  3CC7 A;  1PD1 A;  2ZPH B;  3H8Z A;  1Q82 C;  1K76 A;  9ATC B;  1DJ7 B;  5CK9 A;  1RAB B;  2K3X A;  4JDS A;  3VS4 A;  4RTU A;  3CME A;  4Z8A A;  2DL5 A;  5GAM d;  5D6W A;  2PVD B;  3CCE T;  4K11 A;  1WNL A;  1ZUU A;  2BKD N;  2CYZ B;  2DM1 A;  4PLL A;  3I5R A;  5EG2 A;  1SPK A;  2KRM A;  2CT3 A;  1K73 U;  1U06 A;  1ZBX A;  2YRC A;  3CCV Q;  2DL3 A;  1WX6 A;  3WVD B;  1X2K A;  2DLP A;  5GAN 8;  1E7O A;  4D8K A;  2A37 A;  4OVA A;  1RI9 A;  1WXU A;  4E6R A;  1BI3 A;  2AK5 A;  1KG1 A;  3CCV A;  1YNZ A;  5C6S A;  1SRL A;  1YJN T;  5KYN A;  2O4X B;  1Y57 A;  1YI2 T;  1YI2 Q;  2KRO A;  3X28 B;  2Y90 A;  4IIO A;  3RBB B;  2YLC A;  3NPF A;  1UGV A;  3G71 A;  3VV0 A;  3ASK A;  1IHW A;  4A4G A;  4F04 B;  4JLG A;  1NEG A;  2EJ9 A;  3OS2 A;  2RJD A;  3A8G B;  3C0C A;  2BZX A;  5FU6 C;  3V8K A;  2DD4 A;  4M77 F;  3GNG A;  2JMC A;  2QEX Q;  3G6E Q;  1GFD A;  1WA7 A;  3CD6 Q;  3G71 Q;  5KCH A;  3UA6 A;  1YP5 A;  4M7D B;  5I21 A;  1AEY A;  2GNC A;  3OMG A;  1K9A A;  3QZ5 B;  5IHK A;  2X3X D;  4DBR A;  4C8Q B;  3OA6 A;  1MNE A;  3CCU T;  1YJW Q;  4XTW A;  2QA4 T;  3OS1 A;  3UDC A;  4JLI A;  3A5Z B;  5KYU B;  2KQW A;  4M77 C;  1RUW A;  2OI3 A;  4MMK A;  2CT4 A;  3X20 B;  3NFC A;  1VQ4 Q;  3J80 E;  2DIL A;  2CUB A;  2GTJ A;  5LJ5 j;  1J3T A;  1RLP C;  1H64 1;  2HNI A;  3PT9 A;  3AT1 B;  3JCM W;  5CQX A;  2JUF A;  2CSQ A;  1M2O A;  3R6N A;  2DPP B;  2LCL A;  3QBY A;  1I1J A;  2EGE A;  2GFU A;  2DBK A;  2F2X A;  4M78 G;  2NUP B;  2KGT A;  2L3S A;  3M5A A;  1X01 A;  2PVO B;  3LH0 A;  1VQ7 Q;  3HSB A;  2XKO C;  1PG5 B;  3OY9 A;  1NPP A;  1YIJ A;  5GAO n;  2PUO B;  1UGS B;  1LPL A;  3G4S Q;  4KGV B;  3PIO A;  5GAN f;  2MOX A;  2DYB A;  1VQ8 A;  1QWF A;  1VQM Q;  3PVQ A;  1V29 B;  1U1T A;  1NZ9 A;  1R8O B;  3D7S B;  2X4J A;  2SEM A;  5KE2 A;  5HK0 A;  2J05 A;  2FZK B;  1X69 A;  4JPB W;  3OYA A;  3LWH A;  5I2M A;  3OYC A;  3JB9 J;  2KXC A;  3CCJ T;  3TRE A;  2RNA A;  5CKF A;  4PFZ A;  1RL2 A;  1M90 C;  4QT7 A;  2PNI A;  1U5S A;  2LP5 A;  3I56 T;  2LC4 A;  1MV0 B;  1ABQ A;  2K5L A;  1OEB A;  2LQK A;  1M30 A;  4RTX A;  1U1S A;  3E2U A;  1N6A A;  4NS5 A;  5FW9 A;  5GAN d;  3CC2 A;  1EZZ B;  5CIU A;  2CH4 A;  2LQN A;  4FSX A;  3FIF A;  2RI5 A;  3A8M B;  3RUX A;  2COW A;  1SKU B;  3QG1 A;  3VUB A;  4PK4 A;  4J9B A;  3CC2 T;  3CC2 Q;  5GAO p;  3OSV A;  2D8H A;  5A2Q E;  5CKE A;  5FLX E;  1KHI A;  1M4Z A;  4E7L A;  3FDR A;  3L42 A;  2X4Y A;  4HVV A;  1FWZ A;  4ZTF A;  5GAN 5;  4FIB A;  2KNB B;  1WLP B;  2O2O A;  3UT1 A;  5J3B A;  1AHJ B;  2FO0 A;  1M90 R;  1GXI E;  1WHL A;  2RJF A;  2JTE A;  4AFZ C;  1EIF A;  5CCA A;  2KT1 A;  3THK A;  4DBH A;  3OYK A;  4HT9 A;  1M1F A;  5GAM e;  3CCL T;  5GAN 2;  3QUI A;  2RK2 A;  2P4R A;  4HCZ A;  3VS0 A;  4XK8 E;  3QZ9 B;  1B7T A;  3M0P A;  4HVU A;  3EHQ A;  3TVT A;  4C0D C;  3HRT A;  4EMK C;  1VQL T;  2MYS A;  1K73 R;  2YHT A;  2Y4X A;  3CC7 T;  3OYH A;  2RH2 A;  5FRM A;  1PKS A;  5KYX B;  4BDY A;  5GAO l;  6AT1 B;  3FEO A;  4GLK A;  1SF9 A;  4OP0 A;  2OAU A;  1QQJ A;  2DK3 A;  2FZC B;  1ZA2 B;  2O9S A;  5CKB A;  2KBT A;  3HKS A;  1D1B A;  2K57 A;  2PVG B;  1UG1 A;  3OBW A;  3P8H A;  5DM7 R;  1JXM A;  1LVK A;  3M0S A;  3EG1 A;  4LE9 A;  3VS3 A;  4OML A;  1PHT A;  3L2R A;  1WXB A;  3LGL A;  4A63 B;  2L8D A;  2XID A;  4LDY A;  2X35 A;  2K3Y A;  2NUP A;  4M7D G;  2F2W A;  1TUC A;  1RLQ C;  1VQK Q;  3MET A;  4HCC A;  2A36 A;  1ZQ1 A;  2M1H A;  2HSE B;  2KMT A;  4QVZ A;  3ZEH A;  3QXE B;  2HAX A;  1WHH A;  4OGC A;  4JS5 A;  4CC3 A;  1NLO C;  3TEE A;  2EAY A;  3CCJ Q;  3GNF B;  2OJ2 A;  2V8J A;  2MWP A;  5D7U A;  3ZL7 C;  1VQL A;  3L1A A;  3TSW A;  4EMK A;  1IHV A;  4JJD A;  4UC4 A;  1SSH A;  5CAI A;  1IRX A;  4ORZ A;  1YJ9 Q;  1YJ9 T;  4PFO A;  2AT1 B;  5LJ3 h;  2LQ8 A;  3CCJ A;  2JXB A;  4J9F A;  3M9Q A;  4QQG A;  1SRM A;  2DTH A;  3JB9 I;  4LD6 A;  4M78 B;  5GMK h;  1PRM C;  3FRN A;  4EMG A;  4M7D A;  2JZ2 A;  2AZS A;  2XK0 A;  3G1J A;  5IHN A;  2CZ1 B;  2FEI A;  1UB4 A;  3JB9 D;  5GAM f;  1BI0 A;  1ZHI A;  1I4K 1;  2RM4 A;  3SWN A;  1VQ5 A;  3I56 Q;  1TOV A;  1M3A A;  4RTW A;  2ROL A;  4F14 A;  2ECZ A;  3REA B;  4M7D F;  2O01 E;  3M0U A;  1W2B P;  4JZ3 A;  4MML A;  2R57 A;  2M02 A;  2E4H A;  1D0Z A;  2JNG A;  2DYI A;  2YUO A;  2A0F B;  3CME T;  5IN1 A;  3MP1 A;  2CS7 A;  2DKG A;  3JCM g;  2YUQ A;  1VQP Q;  2KT8 A;  3G71 T;  3I56 A;  2HKQ B;  2D9T A;  2YUP A;  1M3C A;  4AFQ C;  1QVF A;  1UJY A;  8ATC B;  1MMG A;  2O4X A;  3L2V A;  1KSW A;  1KC8 U;  3CCL Q;  4D6W A;  1ZSZ A;  4QVD A;  1QVG P;  2WAC A;  3VRZ A;  4Y28 E;  2LCS A;  1AT1 B;  1PWT A;  1BCM A;  4GBQ A;  4MZM A;  2LJ0 A;  2C0T A;  4KT0 E;  1YN8 A;  3A1P A;  1YIT A;  1KQ2 A;  2GQI A;  2DA9 A;  1Y7X A;  1VQ8 T;  2WSC E;  3CEY A;  4OMO A;  3P8B B;  1QVG S;  4A53 A;  3RKW A;  2DMO A;  1K0X A;  3VU3 C;  3L2U A;  4ANJ A;  1X75 C;  2LJ1 A;  1G3T A;  3RKY A;  4F7U B;  3GPL A;  2DVJ A;  4QVC A;  2LT4 A;  4HKE A;  4DOW A;  5M9O A;  4DQ2 A;  4DEY A;  2RPN A;  2V1Q A;  1KQS S;  4LDX A;  2DRM A;  4PFP A;  4A4K A;  4EIK A;  4LN2 A;  3M4G A;  3PVL A;  1WJR A;  2VGN A;  3CD6 A;  3EGU A;  2FRW A;  4LDV A;  4OMQ A;  2RA2 A;  3CBO A;  4OGE A;  3JSC A;  1VQK T;  4RMO A;  3RER A;  3HRS A;  4OMP A;  2SRC A;  5LJ5 f;  2ZZD A;  2M16 A;  2A28 A;  4OB0 B;  4DOV A;  2YSQ A;  2FB7 A;  3OSS C;  4AG1 C;  4AFU C;  3CCR T;  4KH1 B;  1ZX6 A;  2FL7 A;  1VQ4 A;  1GBR A;  3MPU B;  3VYG A;  4V2S A;  4PNO A;  2ENM A;  4EMH A;  4IUU A;  2PZ1 A;  2ZPG B;  3N5B B;  1YCY A;  2RHZ A;  1GCP A;  1WDX A;  5GJW B;  4M7A G;  1YJW A;  4M7A F;  1M8V A;  4J9H A;  4XTV A;  3X26 B;  4C5H A;  1M1K R;  2LVM A;  1VYU A;  2VB6 A;  1UEC A;  1WGS A;  2DER A;  2EQI A;  5HK3 A;  2YLB A;  4M75 A;  2AZV A;  1OZ3 A;  2K9G A;  2RJE A;  4M78 D;  2DTI A;  4QQD A;  3FLG A;  1T3L A;  4ZGJ B;  3PTA A;  1IRE B;  2DRK A;  4JRI A;  1VQM A;  3EGD A;  4OB2 B;  2GQV A;  2DBM A;  1N27 A;  4XU2 A;  2QQA A;  4Z88 A;  1BYM A;  3LH5 A;  2K3B A;  2VVK A;  1M2V B;  2K79 A;  1K8A R;  2ZGW A;  3JB9 G;  1K8A C;  1UJ0 A;  2CP5 A;  2ZPI B;  1R0C B;  1U8R A;  5AYF A;  4NL3 A;  3C94 A;  3A8O B;  1FYN A;  3JCM X;  3QWX X;  2OTJ T;  2DXB A;  2P0P A;  3RES A;  2COY A;  2P4T A;  2VWF A;  1VQ8 Q;  2CRE A;  1JQQ A;  1Q7Y U;  1SEM A;  1UE9 A;  4R0K A;  1PCX A;  2CZ0 B;  2QDL A;  2MI6 A;  3CCE A;  3VS7 A;  2FPF A;  1JEG A;  3FJ5 A;  4QKU A;  1W70 A;  5IAY A;  3I55 T;  2GFA A;  3SDZ A;  2M9U A;  3CMA Q;  1Q82 U;  2A3L A;  3DKM A;  4M78 E;  1Y71 A;  1TSF A;  1N8R U;  1NEB A;  4J9D A;  4JRP A;  3BDU A;  4OMM A;  1VQ9 A;  4OF1 A;  1M1K U;  4XU0 A;  1JJ2 S;  2E41 A;  3EG0 A;  3S3O A;  2OTL Q;  4RKU E;  1BI1 A;  1K73 C;  2CZ6 B;  2JOY A;  3A8L B;  4KUL A;  5D6X A;  2K5I A;  2K2M A;  3OYI A;  4Y92 A;  4DEX A;  2RO0 A;  4Z02 A;  5AT1 B;  2RD1 A;  3RMS A;  4D8D A;  2X9H A;  2BE7 D;  1X43 A;  3DB4 A;  1BBZ A;  2Z0W A;  1IO6 A;  2AKL A;  2E65 A;  2C06 A;  1QP2 A;  2HKN A;  1N8R R;  4E47 A;  1HJD A;  3EFR A;  4MDX A;  2CSI A;  4N0A C;  3OBY A;  3NMZ C;  2XU8 A;  3FB9 A;  4J7I A;  3I9Q A;  2ROT A;  3EG3 A;  1TS9 A;  2LT1 A;  3VKI A;  3JCM e;  3CCQ T;  5DLQ E;  2NYS A;  1VQ6 T;  2HBW A;  3SWN B;  1I07 A;  4PJO A;  4BDZ A;  2M0O A;  3EFO B;  2JM9 A;  5D6Y A;  1AWJ A;  2H3E B;  2BE9 B;  4F16 A;  3MO8 A;  3JCM V;  3CXC S;  2LJ3 A;  1D1A A;  4MDW A;  1MMA A;  5IXF A;  4F7U G;  2JTF A;  1ABO A;  1VQ6 A;  4F7U E;  2QGF B;  4E7H A;  3KFV A;  1G3S A;  3CCM T;  2EGA A;  1W1F A;  4IUQ A;  1UGP B;  1JXO A;  2QQ9 A;  4RTY A;  4L6V 5;  1EFN A;  1M8M A;  4ELY C;  1YJN Q;  4KUD K;  4JS4 A;  2M0Y A;  2RI3 A;  3M55 A;  2RQU A;  1T3S A;  3CQT A;  1ZLM A;  3NTH A;  3BFM A;  5LJ5 g;  3BE3 A;  4E7S A;  3EH2 A;  4F7U A;  3PMT A;  3EG2 A;  4ZN1 A;  2QG9 B;  3OW2 P;  2XIC A;  1JRI A;  4GLM A;  1RAC B;  3UPU A;  1A0N B;  2DNU A;  4MZT A;  2QA4 Q;  3PFS A;  1OPK A;  2JVV A;  5I22 A;  4M77 E;  1LOJ A;  3OB9 A;  1QVF P;  2KRN A;  4QW2 A;  2E6Z A;  3OW2 S;  4J83 A;  1H3H A;  4MZP A;  5GMK m;  1OI1 A;  5GAN j;  1D3B B;  2J6K A;  2GGR A;  4N4I A;  3AHU A;  4C92 F;  4II1 A;  3LLR A;  1QVF S;  4J9E A;  4XU1 A;  4FYW B;  1Z9Z A;  2KDS A;  1PM3 A;  3V8J A;  1WZO A;  2KYB A;  3OYY A;  4C0F A;  3L2W A;  1GFC A;  1K9M U;  2G6F X;  2KEA A;  4B9W A;  3CCQ A;  3G6E T;  2DZ9 A;  3INZ A;  2XHC A;  3JCM d;  5LJ5 h;  1AWW A;  4KRT A;  2CP7 A;  1IGQ A;  1VQK A;  3CMA T;  2DE0 X;  2EYQ A;  1VQO A;  2HDA A;  4HVW A;  3V8L A;  4KH0 B;  2NUT A;  4NOY A;  1RAG B;  1IGU A;  2X51 A;  1JJ2 P;  1NYF A;  1M1K C;  3PMI A;  3PIP A;  2ED0 A;  4Q5W A;  1B34 A;  5GMK l;  1KD1 C;  1H3Z A;  5LJ3 e;  4TVR A;  5FU6 B;  1MMN A;  4XU3 A;  4RTT A;  1VQL Q;  1VA7 A;  2JM8 A;  4M7D C;  2DFU A;  2OTJ Q;  2L89 A;  3GBQ A;  3EG9 A;  3H0H A;  2GF7 A;  4C8Q C;  2IG0 A;  1F1B B;  2OTL T;  1YJ9 A;  2VC8 A;  2E5K A;  3V7R A;  1U3O A;  1OZ2 A;  1KQS A;  1LCK A;  2DAQ A;  3J7A F;  3SB2 A;  3OYB A;  5GMK e;  4KGZ B;  4C8Q G;  4JRQ A;  3VUZ A;  2GTO A;  2VXF A;  2ZPB B;  3CBP A;  1Q7Y C;  3HTR A;  4BB7 A;  4OMN A;  3ME9 A;  4PL6 A;  2L3R A;  5IHI A;  1FX7 A;  1WHM A;  1KJW A;  1PNJ A;  4J6W A;  2RJC A;  2VUB A;  1KQS P;  2H3J A;  2MAM A;  5FRN A;  1ZSZ C;  3O5Z A;  4E7K A;  3CPF A;  5LJ3 d;  1H8K A;  2R5M A;  3A98 A;  1LJO A;  4OB3 B;  3SFM A;  2DXC A;  4PJO E;  1CSK A;  4ESR A;  4XAX B;  7AT1 B;  2X3W D;  5KYW A;  3S3M A;  2HD0 A;  4RG8 A;  1B07 A;  2RF0 A;  4WTO B;  3M56 A;  1TWB A;  2CGH A;  2C0O A;  3MKD A;  3CCL A;  2CP2 A;  1Q7Y R;  2AIR B;  4KBM B;  1PSF A;  3H41 A;  3RIR A;  4HXJ A;  1I5O B;  1WHJ A;  1UGQ B;  4XQ3 A;  1G83 A;  1C6V X;  2DEU A;  1HD3 A;  4HT8 A;  2KRS A;  1YWO A;  2LNH B;  2F1L A;  4C5E A;  1BKB A;  4LDU A;  4M7A D;  2DF6 A;  1Q81 R;  1QLY A;  1IXD A;  3X24 B;  1M27 C;  2RMO A;  2LZ6 B;  4A4H A;  4BY6 B;  2A08 A;  2XG8 D;  4P5N A;  4RTV A;  2EKH A;  3RMQ A;  4AMC A;  1WYX A;  2K2V A;  2RQV A;  3JCM Q;  4JRK A;  5KYY B;  4ZGD B;  4FW1 A;  1KD1 R;  1AWO A;  4M75 G;  3H0I A;  2XMF A;  1KC8 R;  3RR6 A;  2RI2 A;  3LW5 E;  3MEA A;  4X9C A;  2E3H A;  5L8R E;  4C92 B;  3RNJ A;  1BIA A;  3RDV A;  3E19 A;  5GJV B;  2QEX T;  5CKH A;  4C8Q D;  3MP8 A;  4N4G A;  1PRL C;  2EWN A;  5GAN 6;  4ATO A;  2YRD A;  3E9G A;  3OYN A;  1UEB A;  3RKX A;  1W2B S;  2ZPF B;  2M51 A;  5GAO r;  2DJQ A;  2CUD A;  5LJ5 e;  4DA4 A;  1D0X A;  4Y91 A;  2B86 A;  4LXC A;  1Q81 U;  2NUZ A;  3G6E A;  1QKW A;  2MPX C;  3P8D A;  1YIT T;  2D0Q B;  4O5V A;  2J06 A;  2RHY A;  3ULR B;  3S3N A;  4RG2 A;  2R58 A;  1I0C A;  1H92 A;  4M75 D;  2LX7 A;  4E7Z A;  1C1A A;  1O75 A;  2DJZ A;  4M77 A;  1IB8 A;  5KYX A;  2P0Q A;  1I81 A;  2QK0 A;  1E6G A;  2E3I A;  2VGM A;  3CBM A;  2K5F A;  4J5Y A;  3URG A;  1OU8 A;  3M57 A;  3WVE B;  2VV5 A;  8AT1 B;  1S1N A;  4RTZ A;  1QW1 A;  3I55 Q;  5ECA A;  2DIG A;  1XTD A;  4JJN K;  1WFW A;  2HL5 C;  2VXE A;  4C0D B;  1G2B A;  3MEU A;  1X6O A;  5GMK j;  4C0G A;  4KGX B;  3JCM h;  1G3Y A;  2LDM A;  1VYT A;  1FMW A;  2EW3 A;  4DBF A;  2X4W A;  4VUB A;  1T0H A;  2MK5 A;  2VKN A;  1BI2 A;  3G4S T;  1YBY A;  1PKT A;  1KHC A;  3GF5 A;  4CC7 A;  2R5A A;  3IQL A;  1VQ7 A;  2QTX A;  4C92 D;  2FPD A;  2G3R A;  1ZA1 B;  1SHF A;  1VQN A;  3ZFJ A;  1WI7 A;  4LNP A;  3V7C A;  1YCS B;  3UWN A;  3G4S A;  2XDD A;  2LNV A;  4N0A A;  5EC7 A;  1BU1 A;  2XI9 A;  2DL7 A;  5KH6 A;  3SEM A;  1AVZ C;  4E7I A;  1S72 Q;  1S72 T;  4IKF A;  5GAN 7;  1TXQ A;  5GAN 4;  3EHR A;  1NG2 A;  1VYV A;  3CXC A;  3FC3 A;  3CCM Q;  5KYU A;  2EVR A;  4A54 A;  3VS5 A;  1C0M A;  2HEQ A;  2YDL A;  3F70 A;  2KI7 A;  1OX8 A;  5I2S A;  1N9R A;  3JRZ A;  4BE0 A;  1NLP C;  1HK9 A;  2YRV A;  4DBQ A;  2JS0 A;  2V8I A;  3M0Q A;  4L59 A;  5I11 A;  4ZN3 A;  1OU9 A;  2NUT B;  3JAM E;  3CCE Q;  3R6O A;  3DB3 A;  1VQ5 T;  1PC0 A;  1NJI R;  3M54 A;  4PJJ A;  2HMA A;  3CMA A;  3OW2 A;  1M3B A;  1PSE A;  2DET A;  2RK1 A;  5GAN g;  5LJ3 f;  2V1R A;  1SSF A;  1KIK A;  2RB6 A;  1M90 U;  3EG9 B;  2YUN A;  2KAF A;  2O88 A;  3MHX A;  1UTI A;  1W2B A;  3VS6 A;  2PUK B;  3BW1 A;  4AG2 C;  2DXU A;  4BI4 A;  2DXT A;  1NE8 A;  3PNW C;  2E5Q A;  2RQT A;  3E9F A;  3C4S A;  2CKK A;  3OYD A;  2L5Q A;  3H0F A;  3CCU Q;  3QSU A;  2CP6 A;  3QPH A;  2J7I A;  3OYE A;  1LNX A;  2MWO A;  1MND A;  3HFN A;  4PJO B;  2CDT A;  2DO3 A;  5LL6 S;  3OYL A;  5DY9 A;  1TUG B;  2EIF A;  1RAE B;  3L2Z A;  1YIJ T;  1SG5 A;  2YXY A;  1WQ7 A;  1IZ6 A;  3HFO A;  4OMF B;  4EMK B;  2E1H A;  3JCM c;  4LDW A;  3VJP A;  4HCK A;  2KYM A;  3QHS A;  5C0M A;  5GAO m;  2DX1 A;  3H6Z A;  4X1V A;  2ZCF B;  4BE1 A;  5FU7 B;  5A0G A;  4IUP A;  2LRQ A;  1ZUK A;  3HRU A;  2RHX A;  3REB B;  1JJ2 A;  2QA4 A;  1YHQ Q;  1JU5 C;  1MUZ A;  4M77 B;  2RHU A;  2K4Y A;  5FWC A;  1M2V A;  3QYH B;  4PLI A;  3QJ6 A;  3LX7 A;  3ZBD A;  4FCY A;  4M75 B;  4FYV B;  2RQR A;  3EGX A;  3V7S A;  2NLU A;  1X6G A;  2ZAE A;  1BCO A;  4C92 G;  2KSS A;  1HXD A;  3HHT B;  3KUF A;  4J9C A;  3PE0 A;  2E10 A;  2VYT A;  3C12 A;  1VIE A;  2DL4 A;  2KR3 A;  2L3Q A;  4FM4 B;  4XTX A;  4C92 C;  1QCN A;  4BI8 B;  3X25 B;  4FT4 A;  2AKK A;  3JCM P;  5KYW B;  1MMD A;  4LUD A;  3EFS A;  1BB9 A;  1VOM A;  3QWY A;  2XDB A;  4FW2 A;  1VIF A;  2V8K A;  1Q86 R;  4AT1 B;  3OYM A;  4Z89 A;  2I2L A;  2YT6 A;  1NPR A;  1Z9Q A;  2BZY A;  3OQ5 A;  5CVI A;  1CKA A;  2JN0 A;  2EQK A;  3DLM A;  1XQH A;  3CCQ Q;  3J81 E;  4F17 A;  2V26 A;  2FYK A;  1Q82 R;  3JB9 F;  3GP8 A;  1MV3 A;  2MF2 A;  4A4F A;  1VQ5 Q;  3M58 A;  5LJ5 d;  1VUB A;  3ER0 A;  4FU6 A;  3CCV T;  5J26 A;  1AZE A;  1V1C A;  4M4Z A;  2EQJ A;  4M75 F;  3CXC P;  2QXF A;  1K9M R;  1W4S A;  2JW4 A;  3WXM B;  1K8A U;  2JMA A;  2LMJ A;  1VQP A;  2XD0 A;  4M78 F;  3CPW P;  3M4Y A;  1BIB A;  4JUV A;  2OTJ A;  1UDL A;  3OYJ A;  1QMC A;  1R0B G;  1UHC A;  2QQB A;  5CR2 A;  1NYG A;  5HY6 A;  3CME Q;  4KUI A;  3MJX A;  4O6J A;  4BE2 A;  1RAA B;  1AOJ A;  2EYY A;  3QII A;  1B34 B;  5J39 A;  2YWW A;  5IH2 A;  1Q95 G;  3HL8 A;  4M7A C;  4X34 A;  4ELZ C;  4M7A B;  1YIT Q;  4CC2 A;  4ZNX A;  4NL2 A;  3MEV A;  3JCM f;  3OYG A;  1ZBJ A;  4C92 A;  2EYW A;  1JB0 E;  4CRI A;  1Y0M A;  3JV3 A;  5HCK A;  1HYO A;  3CC7 Q;  2AHJ B;  4LD9 K;  1EX4 A;  2L3P A;  2HL3 A;  5DLO A;  2ATC B;  1XNI A;  4YTL A;  1N8R C;  1GCQ C;  4J7F A;  2DEQ A;  1QKX A;  2O31 A;  1TH7 A;  5CKD A;  3M53 A;  3EH1 A;  3QDR B;  1KQ1 A;  1VQN T;  2HQH A;  1G8X A;  3O8V A;  1I5L A;  4ZTJ A;  1WIE A;  3OYF A;  2H8H A;  2E64 A;  1ZSZ B;  5KYY A;  2O9V A;  4OB1 B;  1AZG B;  3VYH B;  2CP0 A;  1D09 B;  1HSQ A;  4C8Q F;  3GLX A;  4FT2 A;  3I35 A;  1OOT A;  5FWB A;  3JCM b;  1VQO T;  3MP6 A;  2FG0 A;  2FVU A;  4LUE A;  1RAI B;  3CC4 T;  3Q1J A;  1Q81 C;  3NTK A;  2BIV A;  4C92 E;  1UUE A;  1NM7 A;  2KE9 A;  1RI0 A;  4M78 A;  2CZ7 B;  2EQM A;  1YI2 A;  4PJO F;  2BUD A;  5GAN e;  4BUG A;  3H9N A;  2BTT A;  1JBM A;  4PJO G;  1K1Z A;  4CI0 C;  2OX7 A;  3EGX B;  3KXT A;  4M7A A;  4WCI A;  1XOV A;  2W10 A;  1ARK A;  2EPD A;  1D3B A;  4M7D D;  4XTU A;  1X6B A;  4R55 A;  2X4X A;  2LX9 A;  3TQ7 P;  4PJO C;  2QAZ A;  2QEX A;  3SD4 A;  3NHN A;  1Y96 A;  4RCC A;  1WPY A;  2EFI A;  3G7Z A;  2LQW A;  5GAM h;  2JJ9 A;  3GIB A;  2D0N A;  2EYX A;  4FL6 A;  1WJS A;  3FJP A;  4IIM A;  2FHD A;  2HQX A;  3TU4 K;  3JCM J;  4M77 G;  1OQK A;  4QQ6 A;  2VAS A;  1TU0 B;  2FZG B;  3VRY A;  1UGR B;  1QCF A;  2L2P A;  1X27 A;  2DD5 A;  5IT9 E;  3M59 A;  2IPO B;  3SWN C;  2EKO A;  4BAC A;  1SHG A;  2Y4Y A;  2D6F A;  4CC4 B;  3MCA B;  3HPW A;  4M75 C;  2COZ A;  5HKC A;  1GBQ A;  4E2F B;  1RAH B;  4M77 D;  1WHG A;  3I55 A;  3JB9 H;  2RN8 A;  4XTZ A;  1B3Q A;  4M78 C;  5IXB A;  1MHN A;  2K7A A;  2DZC A;  1QWE A;  1WXT A;  5CO7 A;  2NWM A;  2MCN A;  3KBG A;  1YWP A;  2IIM A;  4B6M A;  1AWX A;  1M9S A;  2KVQ G;  1TG0 A;  2QYZ A;  1YIJ Q;  2DTO A;  5KCO A;  3UF4 A;  2JT4 A;  4RCB A;  1Q86 C;  1VQ4 T;  1ZUY A;  2E70 A;  1KD1 U;  2QAS A;  1O9S A;  1D1C A;  4WF2 A;  1PD0 A;  3TCJ A;  1RAF B;  1KK7 A;  1VQP T;  1OUL A;  1YFN A;  1VQN Q;  1TTH B;  1GL5 A;  4BI3 A;  4J9I A;  2F2V A;  2D1X A;  2QQR A;  1YHQ T;  4PJO D;  2FRY A;  4EDU A;  4HA8 A;  2QGG A;  1KFZ A;  5GMK i;  2WSE E;  3T9N A;  1M1G A;  1G3W A;  2PTK A;  4E7J A;  1S72 A;  2JS2 A;  2GBQ A;  3VS1 A;  3TSZ A;  1N9S A;  2EJG A;  3CCM A;  2QDY B;  3VS2 A;  3BY7 A;  4IUT A;  3MEW A;  3CCS T;  2KK4 A;  2W0Z A;  4PJL A;  1QVP A;  2ED1 A;  3QO3 A;  4XTY A;  2RHI A;  4IUR A;  1P92 A;  1JO8 A;  2BZ8 A;  2CH4 W;  4PJN A;  1X2Q A;  2ZPE B;  1I8F A;  3CPW A;  3NTI A;  2A7Y A;  1VQ9 Q;  1ACM B;  2F5K A;  3E1S A;  5GAO q;  2OTL A;  3L2Q A;  5GAM g;  3OMC A;  3CCR Q;  3DLL A;  4FSS A;  1W6X A;  3BDL A;  4ME7 A;  4C5I A;  3LYI A;  4C5G A;  4FYY B; 
#chains in the Genus database with same CATH homology
 3EG3 A;  1CKB A;  2P4R A;  3VS0 A;  1N5Z A;  2HBW A;  4JZ4 A;  1I07 A;  3M0P A;  2K6D A;  4HVU A;  3EHQ A;  3TVT A;  2JM9 A;  1AWJ A;  1E6H A;  4F16 A;  1UHF A;  2RQW A;  1ZSG A;  2LJ3 A;  3SHW A;  5IXF A;  4HCK A;  2KYM A;  1ABO A;  1PKS A;  4JJB A;  1TUD A;  3KFV A;  2DX1 A;  2EGA A;  1OV3 A;  1W1F A;  2ESW A;  4X1V A;  1JXO A;  4RTY A;  2J6F A;  1EFN A;  1M8M A;  1GRI A;  2KXD A;  4AFS C;  2O9S A;  2M0Y A;  1ZUK A;  2RQU A;  3NGP A;  1T3S A;  2KBT A;  3REB B;  3CQT A;  1ZLM A;  4RUG A;  1JU5 C;  1MUZ A;  1UG1 A;  5FWC A;  2OAW A;  3EG2 A;  3U23 A;  2EBP A;  2RQR A;  1JXM A;  3M0S A;  3EG1 A;  4LE9 A;  3VS3 A;  1AD5 A;  4GLM A;  1X6G A;  1A0N B;  4OML A;  1PHT A;  2DNU A;  1OPK A;  1WXB A;  2FPE A;  5I22 A;  2KRN A;  4A63 B;  2J6O A;  4J9G A;  4J9C A;  1H3H A;  3PE0 A;  2F2W A;  2J6K A;  2GGR A;  1TUC A;  1RLQ C;  2D8J A;  2DL4 A;  2DL8 A;  2KR3 A;  2L3Q A;  2MIO A;  4J9E A;  2A36 A;  1Z9Z A;  2KYB A;  3UAT A;  2EYZ A;  2AKK A;  1GFC A;  2G6F X;  2KEA A;  4LUD A;  2HSP A;  4CC3 A;  1NLO C;  1BB9 A;  2ABL A;  3QWY A;  1AWW A;  1K0S A;  4KRT A;  4JJC A;  2OJ2 A;  3ZL7 C;  1K4U S;  3TSW A;  4Z89 A;  2YT6 A;  1Z9Q A;  2BZY A;  2DE0 X;  1CKA A;  2HDA A;  4HVW A;  4JJD A;  1SSH A;  1NYF A;  4ORZ A;  3UA7 A;  2ED0 A;  4F17 A;  1UFF A;  1MV3 A;  1GCQ A;  2JXB A;  4J9F A;  1OPL A;  4RTT A;  1VA7 A;  2JM8 A;  1SRM A;  1AZE A;  1V1C A;  4M4Z A;  3GBQ A;  1PRM C;  2HCK A;  3H0H A;  3M0R A;  2C0I A;  5L23 A;  2AZS A;  5IHN A;  2FEI A;  2E5K A;  2JW4 A;  2EGC A;  1U3O A;  2JMA A;  2LMJ A;  1LCK A;  1M3A A;  4RTW A;  2L0A A;  2ROL A;  4F14 A;  2ECZ A;  3REA B;  1UDL A;  3I5S A;  3M0T A;  3M0U A;  4JZ3 A;  1UHC A;  2GTO A;  1NYG A;  2YUO A;  4OMN A;  2YUQ A;  2I0N A;  1FMK A;  1T0J A;  1AOJ A;  2KT8 A;  2EYY A;  1BK2 A;  5IHI A;  5IH2 A;  1KJW A;  1PNJ A;  2YUP A;  1M3C A;  4AFQ C;  1K76 A;  1UJY A;  4CC2 A;  4ZNX A;  3O5Z A;  1KSW A;  1ZBJ A;  3VS4 A;  4RTU A;  1H8K A;  2EYW A;  4Z8A A;  3A98 A;  2DL5 A;  1Y0M A;  3JV3 A;  3VRZ A;  5HCK A;  1CSK A;  4K11 A;  2LCS A;  1PWT A;  1ZUU A;  2DM1 A;  3I5R A;  4GBQ A;  4ESR A;  1SPK A;  2KRM A;  2CT3 A;  1U06 A;  2LJ0 A;  2C0T A;  2X3W D;  2DL3 A;  1YN8 A;  1WX6 A;  2L3P A;  2GQI A;  2DA9 A;  1X2K A;  2DLP A;  1B07 A;  2RF0 A;  4OMO A;  1E7O A;  1GCQ C;  2C0O A;  4D8K A;  1QKX A;  2O31 A;  2A37 A;  2DMO A;  1K0X A;  1RI9 A;  1WXU A;  4E6R A;  2LJ1 A;  2AK5 A;  3H41 A;  1WIE A;  4HXJ A;  2H8H A;  2DVJ A;  1YNZ A;  1SRL A;  2O9V A;  1AZG B;  1G83 A;  1HD3 A;  2KRS A;  1YWO A;  2LNH B;  1Y57 A;  1HSQ A;  2DF6 A;  4DEY A;  1QLY A;  2RPN A;  2V1Q A;  3I35 A;  1OOT A;  5FWB A;  1M27 C;  2RMO A;  2LZ6 B;  2KRO A;  2A08 A;  2FG0 A;  2DRM A;  4RTV A;  2EKH A;  4LUE A;  4LN2 A;  4EIK A;  4IIO A;  1WYX A;  3RBB B;  2RQV A;  3PVL A;  3NPF A;  1UUE A;  3EGU A;  2FRW A;  1UGV A;  4OMQ A;  1NM7 A;  1AWO A;  2KE9 A;  3H0I A;  2XMF A;  1NEG A;  4OMP A;  2SRC A;  3C0C A;  2A28 A;  2BZX A;  2BTT A;  3RNJ A;  5GJV B;  2JMC A;  2YSQ A;  1GFD A;  1K1Z A;  4AG1 C;  4AFU C;  1WA7 A;  1PRL C;  3UA6 A;  1YP5 A;  1XOV A;  4WCI A;  2W10 A;  1ARK A;  1AEY A;  1ZX6 A;  2EPD A;  2GNC A;  1K9A A;  5IHK A;  2M51 A;  1GBR A;  2DJQ A;  1X6B A;  2X3X D;  2CUD A;  2B86 A;  2ENM A;  2NUZ A;  1QKW A;  2PZ1 A;  3NHN A;  1RUW A;  2J06 A;  2OI3 A;  3ULR B;  2CT4 A;  1GCP A;  1I0C A;  1H92 A;  2LX7 A;  2LQW A;  1WDX A;  5GJW B;  2DIL A;  2CUB A;  2GTJ A;  1J3T A;  1RLP C;  2D0N A;  2EYX A;  4IIM A;  4J9H A;  1E6G A;  1VYU A;  2CSQ A;  1UEC A;  3VRY A;  1S1N A;  4RTZ A;  3R6N A;  1I1J A;  2EGE A;  2EQI A;  5ECA A;  1QCF A;  2DBK A;  2L2P A;  1X27 A;  2F2X A;  2AZV A;  2K9G A;  2KGT A;  1WFW A;  1T3L A;  1SHG A;  2L3S A;  2DRK A;  1G2B A;  4CC4 B;  1GBQ A;  2DBM A;  1VYT A;  2EW3 A;  2RN8 A;  1T0H A;  1B3Q A;  4Z88 A;  2VKN A;  3LH5 A;  2K3B A;  5IXB A;  2K7A A;  2VVK A;  1QWE A;  1WXT A;  2DYB A;  1PKT A;  2K79 A;  2MOX A;  1QWF A;  4CC7 A;  3PVQ A;  3IQL A;  2NWM A;  2MCN A;  1UJ0 A;  1YWP A;  2FPD A;  2IIM A;  1AWX A;  1SHF A;  2SEM A;  1TG0 A;  1WI7 A;  2J05 A;  3UF4 A;  2JT4 A;  4LNP A;  1FYN A;  1YCS B;  1ZUY A;  3QWX X;  5EC7 A;  1BU1 A;  1X69 A;  2VWF A;  4JPB W;  2DL7 A;  2CRE A;  1JQQ A;  1AVZ C;  3SEM A;  2KXC A;  1SEM A;  1UE9 A;  4R0K A;  2RNA A;  2QDL A;  3EHR A;  1NG2 A;  1VYV A;  4QT7 A;  2PNI A;  3VS7 A;  1U5S A;  2LP5 A;  2FPF A;  2EVR A;  1JEG A;  1GL5 A;  3VS5 A;  4J9I A;  1MV0 B;  1ABQ A;  2F2V A;  2D1X A;  1OEB A;  3FJ5 A;  1W70 A;  1M30 A;  4RTX A;  2FRY A;  2HEQ A;  2YDL A;  1KFZ A;  5FW9 A;  1NLP C;  2PTK A;  2JS0 A;  2JS2 A;  3M0Q A;  5I11 A;  2GBQ A;  3VS1 A;  3TSZ A;  1NEB A;  4J9D A;  3VS2 A;  2CH4 A;  2LQN A;  4OMM A;  2W0Z A;  3EG0 A;  2ED1 A;  1M3B A;  4J9B A;  1JO8 A;  2V1R A;  2BZ8 A;  2CH4 W;  2D8H A;  2K2M A;  4Y92 A;  1X2Q A;  1KIK A;  4DEX A;  2YUN A;  2O88 A;  1UTI A;  4HVV A;  4D8D A;  1X43 A;  2KNB B;  2O2O A;  1WLP B;  1BBZ A;  3VS6 A;  1IO6 A;  2AKL A;  4AG2 C;  2FO0 A;  4FSS A;  1W6X A;  2JTE A;  4AFZ C;  1HJD A;  2RQT A;  2KT1 A;  3THK A;  2CSI A;  3H0F A;  3NMZ C;  2J7I A;  2CDT A;  3I9Q A;  2ROT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...