1SRMA

1h and 15n assignments and secondary structure of the src sh3 domain
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords SRC TYROSINE KINASE SH3 DOMAIN
publication title 1H and 15N assignments and secondary structure of the Src SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
total genus 4
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1srmA00
2H8HA 4J9GA 1OPKA 1K4US 2KR3A 2BZ8A 1K1ZA 2JMAA 1I07A 1UHCA 2RQTA 4IIOA 2L3QA 5ECAA 1WXBA 2D0NA 2GTOA 1K0XA 2LQWA 3VRZA 2O9VA 1Y57A 1SHGA 1KJWA 4IIMA 3PVLA 3SEMA 1BU1A 2CSQA 3QWXX 1YWPA 1NLOC 1G83A 2K7AA 1FMKA 2LMJA 3M0QA 3VS7A 2AKLA 2CSIA 2SEMA 1NEGA 2FEIA 4J9HA 2KYMA 1K0SA 2CDTA 1SHFA 3VS2A 4JPBW 2ABLA 4RTXA 1TUDA 2GNCA 4AFZC 1AWXA 4J9FA 4AG2C 1PRMC 3EGUA 1U3OA 2FPFA 4JJCA 2F2WA 3M0PA 1VA7A 1QKXA 2DM1A 4OMMA 1UJ0A 4J9BA 1PHTA 1AEYA 1ZUUA 1QLYA 1ZX6A 1QCFA 2OI3A 4RTTA 1AWJA 1UHFA 3VS4A 2W0ZA 2NWMA 2KYBA 1K9AA 1PNJA 2KT1A 2EYXA 2JM8A 3REBB 1KFZA 5FWCA 2KRNA 1NLPC 1JEGA 2PNIA 2FRYA 1ABOA 3M0TA 1UE9A 1Z9QA 1PRLC 1YNZA 4HXJA 2OJ2A 2D8JA 1NG2A 1TUCA 5IHNA 1WXUA 2AKKA 5IHKA 4JZ3A 1AWWA 1GL5A 1WI7A 1AOJA 1X69A 2EYYA 2LX7A 4AG1C 1GFDA 2F2VA 2RF0A 2LJ1A 2KNBB 2DVJA 1LCKA 1IO6A 1KIKA 3I35A 3H41A 2HSPA 2O31A 2DA9A 1WIEA 1XOVA 2K79A 1SRLA 2ENMA 1M3BA 1V1CA 1ZBJA 4OMOA 3M0UA 2O88A 4AFQC 1U5SA 2ROTA 1GCQA 1JO8A 1QKWA 2JM9A 2EW3A 2JW4A 2J06A 2EPDA 1EFNA 4E6RA 5IHIA 4LN2A 1H8KA 1W1FA 1WX6A 4F14A 4HVUA 4RTWA 2JS0A 2VWFA 2M0YA 1UDLA 2PTKA 1MV0B 2HDAA 2YUPA 2CT4A 4QT7A 2CH4W 2C0TA 2RQUA 3NMZC 3PVQA 1QWFA 2O9SA 1SRMA 4FSSA 2K3BA 1CSKA 2D1XA 2BTTA 2DMOA 2DNUA 2ED0A 3EG1A 3UF4A 4Z88A 2DF6A 1T0JA 1M8MA 2DL3A 1FYNA 4J9DA 1B3QA 2KEAA 1UECA 2JS2A 3VS5A 4F16A 3SHWA 2AZVA 2C0IA 3H0FA 4OMQA 1M3CA 4K11A 1A0NB 1YWOA 2HCKA 4GBQA 4Z8AA 2LP5A 4HVWA 4LUDA 4CC7A 2A37A 5FWBA 2LNHB 1YCSB 2CUBA 2DX1A 2GBQA 3KFVA 1ABQA 1G2BA 1I0CA 2SRCA 1RI9A 3JV3A 1BB9A 2BZXA 2P4RA 2AZSA 4D8KA 1AVZC 2YUNA 1VYUA 2B86A 4LNPA 2AK5A 5I11A 2DBMA 4JZ4A 2DL5A 1UTIA 2KE9A 1M3AA 2RPNA 1T0HA 2ECZA 2F2XA 1PKTA 1UGVA 4OMPA 4RTZA 1UFFA 1T3SA 2EGAA 2CT3A 4J9CA 1ARKA 2FO0A 2J6OA 2EKHA 2EVRA 2MIOA 2RN8A 2FPEA 1WXTA 4R0KA 1U06A 3FJ5A 2HEQA 2YSQA 4RUGA 3I5SA 2MOXA 2DL7A 1GBQA 1AZEA 1HSQA 1BK2A 2KXCA 3EHQA 2MCNA 3NPFA 4Y92A 2DJQA 2C0OA 3LH5A 1E6HA 2OAWA 2A08A 2PZ1A 2M51A 1RLQC 5GJWB 3TSWA 2YUOA 2K9GA 1KSWA 2X3WD 3EG2A 4HVVA 1W6XA 1OPLA 2QDLA 2DL4A 1ZUYA 2KRSA 2FPDA 3THKA 2A28A 2DLPA 1WA7A 4KRTA 4AFUC 3ULRB 2GQIA 2RQVA 3UA7A 4EIKA 1WFWA 3H0HA 1I1JA 1X2QA 3VS3A 2VKNA 3IQLA 1PKSA 4GLMA 2ED1A 2HBWA 2YT6A 1MUZA 2CH4A 1E7OA 2A36A 1E6GA 3U23A 2K2MA 3TSZA 2I0NA 2JMCA 1X6GA 4LE9A 4ORZA 2KGTA 1VYVA 3VS1A 4CC4B 3M0SA 5FW9A 2J7IA 4LUEA 4ESRA 2EYZA 2L3SA 4OMLA 2RMOA 4CC2A 1S1NA 1UJYA 2EGCA 1JQQA 2DILA 3VS0A 2KROA 2D8HA 2X3XD 3M0RA 1M27C 1X2KA 1H92A 1HJDA 1N5ZA 1Y0MA 3QWYA 1Z9ZA 1VYTA 2EQIA 1MV3A 4DEXA 2LQNA 4AFSC 1TG0A 1ZUKA 2G6FX 1YN8A 1OEBA 1WDXA 5EC7A 3UA6A 2KRMA 1WYXA 2V1RA 3EG3A 1OV3A 1NYFA 3PE0A 1X27A 5L23A 1AD5A 1SPKA 2JT4A 1B07A 4J9IA 1RUWA 1OOTA 5IXBA 3GBQA 4Z89A 1AWOA 2DYBA 4JJBA 2DBKA 2LCSA 1SSHA 2DRKA 2JXBA 2DL8A 3H0IA 3NHNA 1CKAA 2DE0X 2GTJA 1M30A 1YP5A 2L0AA 2YUQA 4CC3A 2KBTA 2ESWA 1X6BA 1ZLMA 3I5RA 2EYWA 2K6DA 2CUDA 2JTEA 2BZYA 1NEBA 2CREA 2V1QA 1GRIA 1T3LA 5IXFA 2ROLA 2LJ3A 2W10A 3EHRA 4RTVA 2EGEA 4DEYA 2LZ6B 2DRMA 1GBRA 2J6FA 1AZGB 2LJ0A 2FRWA 3NGPA 4RTUA 3R6NA 4OMNA 5GJVB 1H3HA 2GGRA 1JU5C 3TVTA 3ZL7C 2KT8A 1PWTA 1GCPA 1J3TA 2XMFA 1GCQC 4ZNXA 3C0CA 1QWEA 2J05A 1RLPC 2RQWA 3A98A 2NUZA 1CKBA 3RNJA 1K76A 2YDLA 3UATA 2VVKA 1JXOA 3VS6A 1JXMA 4D8DA 3I9QA 4RTYA 2J6KA 1WLPB 4M4ZA 2RQRA 4F17A 3EG0A 4J9EA 3O5ZA 5HCKA 3RBBB 1UUEA 2L3PA 1ZSGA 2EBPA 2IIMA 2L2PA 4HCKA 5I22A 1GFCA 2E5KA 2O2OA 4A63B 1UG1A 4X1VA 1NM7A 1X43A 2RNAA 4JJDA 4WCIA 3VRYA 3CQTA 1SEMA 3REAB 5IH2A 1HD3A 2FG0A 2KXDA 1W70A 1NYGA 1BBZA
chains in the Genus database with same CATH superfamily
3GP8A 1VQ4A 2CZ7B 3FDRA 2KR3A 2ZPGB 5KYWA 1I5LA 2RQTA 5ECAA 1WXBA 2ZGWA 3VRZA 5FLXE 1NE8A 1SHGA 2L5QA 2EQUA 1NJIU 3PVLA 3HRSA 2PUKB 5C0MA 1VQ5Q 2IVWA 1N8RU 5DM7R 4M78G 2FYKA 4LDUA 2MI6A 2AKLA 1NEGA 3A8MB 1IHVA 4C8QE 1K0SA 3CCVT 2CDTA 3URGA 1SHFA 3VUBA 5GAN3 3CD6A 4M77B 1TUDA 4AFZC 5I2MA 3EGUA 4JJCA 4XTWA 1QKXA 1IHWA 1UJ0A 2KI7A 1ZX6A 1VQMT 1VQPQ 1YHQT 1QW1A 1D0ZA 1ZSZB 3SWNB 4QVCA 1WJRA 2KYBA 2K5IA 1PNJA 2KT1A 5LJ5d 2JM8A 5FWCA 1NLPC 4HCCA 4E7ZA 4JS4A 5CKDA 4ZTFA 3QUIA 3RMSA 4V2SA 3HRTA 5IHNA 3FEOA 2FB7A 4JZ3A 1AWWA 2KY9A 2EYYA 5KYWB 5FRNA 2LC4A 1WHLA 4EDUA 3RDVA 1LCKA 3CPWP 1BI1A 4RKUE 4M75D 2K57A 4D6WA 1WIEA 2PUOB 3PTAA 2BKDN 2ENMA 2CKKA 1ZBJA 2M02A 4M7AF 1YCYA 4ZN1A 3M0UA 2O88A 1WHHA 1WQWA 2OX7A 1KG1A 1YJWT 4KGZB 4N4HA 2DYIA 1P92A 1Q7YU 1TS9A 1D0XA 2KAFA 1MNEA 2QYZA 5IAYA 2LQKA 4J6XA 1MHNA 4HVUA 4RTWA 5GAOp 4OVAA 1ZQ1A 4WF2A 1VQLQ 3MP6A 3QDFA 2M0YA 3VKIA 4F7UF 2YUPA 2CT4A 4QT7A 4GLKA 3CCQT 1M8VA 1I4K1 3MEAA 3MKDA 4JJNK 3PVQA 3EGDA 2HNIA 2FHDA 2C06A 3CCSA 1VQ5T 1KQSS 1LNXA 3SFMA 4Z88A 2DF6A 2DXCA 8ATCB 5LJ5g 2E41A 3OSVA 5LJ5f 2DIQA 5DY9A 3VS5A 4F16A 2ZPIB 1SKUB 3OYHA 3H0FA 2LRQA 1SSFA 5GMKh 1LOJA 3A8OB 2DXTA 1YIJT 1ZA1B 4HVWA 4LUDA 2NLUA 3TQ7P 1YCSB 2CUBA 3DKMA 4C5HA 4C0DC 1RI9A 2QQBA 3JRZA 2AZSA 5LJ3j 1AVZC 1D1CA 1WGSA 2YUNA 3BDUA 2B86A 4LNPA 1BI2A 3FB9A 2AK5A 2NUTA 5I11A 4EMKB 4JZ4A 3HSBA 3CCMT 2RPNA 2F5KA 4PKCC 4J6YA 1WNLA 1QQJA 5D7UA 1UFFA 3QDRB 1LVKA 1B34A 2CT3A 1ARKA 4GY5A 2R57A 4QVZA 5CKFA 2DK3A 2MIOA 2RN8A 2MAMA 4O6JA 3CMET 1TTHB 3MEWA 2O4XB 2PVGB 2E64A 3L2RA 3I5SA 3RKXA 3JAME 3EGDB 2A3LA 3CBMA 3P8BB 2IG0A 3NPFA 2DJQA 2MYSA 2C0OA 3LLRA 4M77C 4C92G 2PZ1A 4M78D 3QZ5B 1Q86R 5GJWB 3CCVA 4PFPA 4M75A 5IN1A 1R77A 1ZSZC 2FPDA 3SWNC 3LW5E 3THKA 3BFMA 1G5VA 1VQMA 4FW1A 1R0CB 1RAGB 4AFUC 3ULRB 2RQVA 2A0FB 1QVFA 1WFWA 3OMGA 2LX9A 3VS3A 4MDWA 4EMGA 1YJNQ 1OX8A 4KH1B 3U23A 2RHUA 2I0NA 4VUBA 4XK8E 1QP2A 2DVEA 4ORZA 2HSEB 1W2BA 2CS7A 2KGTA 3H9NA 4QKUA 3CCRT 1RABB 2KVQG 3SD4A 1VYVA 4JUVA 3CCEQ 8AT1B 3TEEA 2D6FA 1B34B 3ZEHA 9ATCB 2EGCA 1I5OB 3OY9A 1JQQA 3OB9A 3M59A 3VS0A 3M57A 3M0RA 1M27C 1YJ9Q 4FT2A 2YXYA 1OU9A 1Y0MA 3UWNA 2COYA 1BIAA 1QVGP 1Z9ZA 1YJWA 2OAUA 2RH2A 5D6YA 3OYFA 1WDXA 3MCAB 3UA6A 1FMVA 2KMTA 2X9HA 2Y90A 3CXCA 3PE0A 5L23A 4XU2A 4C8QG 2VGNA 1B07A 4J9IA 1RUWA 3ME9A 3HP9A 2DYBA 4JJBA 3C12A 2LCSA 4B9XA 1SSHA 1D1AA 5C6SA 1MMGA 4Z02A 1FMWA 2KBTA 2RI3A 2ESWA 2XDPA 5GMKi 2K6DA 2D0QB 2LDMA 1VQ5A 2JTEA 4HKEA 2EKOA 2XU8A 1T3LA 5GAN8 2XD0A 3OBYA 3P8DA 2I2LA 1K73R 5DLQE 4RTVA 4LDYA 2LNVA 1GBRA 2J6FA 2LJ0A 2QAZA 1QVFS 3V8KA 3OSSC 1H3HA 2CZ6B 3TVTA 2KT8A 1GCPA 4KGXB 2XMFA 2DZCA 2DEUA 1VQPA 3C0CA 1YITQ 2J05A 1WHJA 2YLBA 2YWWA 2CP7A 4A4EA 1W2BS 3ZBDA 1EX4A 1K76A 3I55T 5GANj 1PSFA 1NJIR 3CCMA 4KULA 1PM3A 3QXEB 2X4JA 3FLGA 1G3SA 3EFRA 2J6KA 1WLPB 5L8RE 4M7AB 2RQRA 3RESA 1BYMA 5D6WA 3EG0A 2VXFA 4PJLA 4BE2A 3RBBB 3OW2S 1UUEA 5CK9A 3CMEA 2GQVA 5GAMj 5FU7B 2LCCA 2L2PA 3CCUQ 2P0PA 3EH2A 2V8JA 1GFCA 2K4YA 1YJ9T 4DA4A 4WTOB 3CC2Q 3CMAQ 4OGEA 4RCCA 3REAB 1HD3A 4C92D 4F7UB 3META 3CBPA 3I56Q 3CPWA 2MK5A 4ELZC 3D7SB 2H8HA 1OPKA 3OS2A 1K4US 4C8QF 1C6VX 1K1ZA 4JDSA 1UHCA 2L3QA 5KE2A 3MP8A 3O8VA 1HK9A 2D0NA 3OYIA 2GCXA 4A54A 1ZA2B 3DB3A 2XK0A 1OX9A 2BUDA 3QWXX 1PG5B 4BE1A 1YWPA 4JRIA 4IKFA 1G83A 3M58A 3N5BB 2QA4Q 2CSIA 3R6OA 4JPBW 1VUBA 4RTXA 1XNIA 3Q1JA 1AWXA 3OS1A 1U3OA 1XQHA 2F2WA 3M0PA 4AT1B 1M9SA 2DPPB 1WHGA 2DM1A 3EFSA 4XTXA 3JCMe 4J9BA 4JLIA 5GAOn 4RTTA 1UHFA 3GLXA 3TREA 3V8LA 3PFSA 4O5VA 3JB9J 2NWMA 4M75C 1K9AA 3REBB 2PU9B 2DIGA 1Z9QA 1UEBA 4LDXA 2OJ2A 5FROA 2D8JA 2L89A 1NG2A 3A1PA 2JJ9A 2QI2A 3JCMJ 2AKKA 2E6ZA 3FIFA 3H8ZA 2GFUA 1WI7A 5LJ3f 3MPUB 4C8QD 5AYFA 3CCLQ 1PCXA 2RF0A 3JB9G 2KQWA 2LJ1A 2DAQA 3FRNA 3H41A 5HK0A 2LTOA 1SRLA 4PLLA 1M3BA 3JCMP 4A4HA 4OMOA 5FU6B 1MNDA 3CPWS 4AFQC 1AT1B 1JO8A 1QKWA 2KK4A 1PSEA 4XTZA 4KBMB 4XTYA 2J06A 3CXCP 2EPDA 3EAEA 3I56T 3OBWA 1NZ9A 4PLIA 1H8KA 4F14A 5GANh 2VWFA 3T9NA 2HDAA 2EAYA 2PVDB 4E7JA 3X20B 1VQKQ 3FC3A 3A8LB 2RQUA 1QP3A 3DB4A 1QWFA 2O9SA 4J8OA 1SRMA 4FSSA 3QPHA 3I55A 4LDVA 3G6ET 3NTKA 5J39A 2LQ8A 2DNUA 1UGQB 4X9CA 1XTDA 3EG1A 4M7AC 2VYTA 4E47A 3AHUA 1T0JA 5GAMh 4M75F 2RK2A 2QA4T 1I81A 4Y28E 3JCMc 3WXMB 2KEAA 1D09B 2C0IA 5FU7C 3CPFA 4OMQA 4K11A 1N27A 2RJCA 3J80E 2HCKA 1M1GA 2A37A 4PNOA 2DX1A 5AT1B 3CCJQ 1ABQA 4C0ZA 3JCMW 2LT1A 1G2BA 1BB9A 1YJ9A 1M5Q1 5GAN2 3L2QA 1D3BB 2YLCA 2QEXT 3J81E 2RHXA 1X6OA 5GANd 1M3AA 5KYXA 1UGVA 4MDXA 2HZYA 2P0KA 2P0QA 3CC4Q 3RUXA 2V8KA 2M0OA 2EGAA 1VQ7T 2JOYA 4J9CA 1MMAA 2E10A 2J6OA 5CQXA 1QVGA 5KYUA 4ANJA 2EKHA 2RM4A 5CAIA 2DTHA 1U06A 2HEQA 1NPPA 3OYJA 2CP3A 4N4GA 2KXCA 3GNGA 5CIUA 4DBFA 4C8QA 4DBRA 2QXFA 3LH5A 1E6HA 3A8HB 1VOMA 2NUPA 1IREB 1BKBA 2MWOA 4IUQA 3GIBA 5A2QE 2K9GA 2X3WD 4HVVA 1W6XA 1MGQA 2DL4A 3CEYA 4F04B 2JTFA 2DLPA 5KH6A 1VQ6Q 4EPCA 5CO7A 1RAFB 3UA7A 4EIKA 1OULA 2P84A 2X4YA 2V26A 3G71Q 4X9DA 1YITA 2ED1A 2HBWA 1QMCA 3OYEA 3PNWC 5CKBA 4BY6B 2A36A 1E6GA 2XG8D 2K3YA 3MJXA 4DQ2A 4PJOE 1X6GA 3KXTA 2CYZB 5KYXB 3RMQA 3NTHA 3VS1A 4CC4B 4XTVA 4FYYB 4LUEA 4ESRA 5GANg 2L8DA 4M78F 4CC2A 5GANf 3JB9D 1N9SA 5FU6C 1JB0E 3OS5A 1Q82C 2DILA 2D8HA 2CZ1B 1H92A 4LD6A 2JN0A 3LWHA 4C8QB 5LL6S 1VYTA 4ZGJB 4M7DE 2LQNA 2NUPB 4AFSC 1ZUKA 2E12A 3CMAA 2OTJQ 3C95A 5KCOA 5GAMf 3F70A 2KRMA 3I56A 1VQPT 1WYXA 4C5EA 2ZPFB 3RKWA 1NYFA 3BE3A 1AD5A 1QVGS 2JT4A 3GPLA 3PIOA 1MMNA 1OOTA 5CQYA 3GBQA 1AWOA 3SDZA 1VQOQ 2DBKA 4PFOA 2JXBA 4A4KA 4MZMA 1CKAA 1M2VA 2DE0X 2WSFE 2GTJA 1H641 1YP5A 1VIEA 3S6WA 2YUQA 1NPRA 4MMLA 1RI0A 3QJYA 1ZLMA 3G6EA 2EYWA 2CUDA 2BZYA 3BDLA 4E7LA 1IZ6A 2CREA 3DLLA 1WPYA 2QA4A 2ZPHB 1G3TA 3VV0A 2YHTA 1M4ZA 4NL3A 4DEYA 4XU1A 3M4GA 1K8AC 1U1TA 2DXUA 3R6NA 5GAN4 1VQ9Q 5GJVB 2GGRA 3ZL7C 4IUUA 1PWTA 3X24B 4BDZA 1YBYA 4ZNXA 1QWEA 4A53A 4RG2A 4UC4A 2VASA 2QEXA 5J26A 1ZBXA 2R58A 4KGVB 1VQLT 7AT1B 1UGRB 3JB9I 1D0YA 1OZ3A 2DXBA 4D8DA 2XI9A 3BW1A 1IXDA 1VQ7A 4F17A 3JCMf 2NUTB 4FYVB 4BI4A 3INZA 2F5TX 1PD1A 4L6V5 4FW2A 5KE3A 3HFNA 3O5ZA 5HCKA 1QVPA 1ZSGA 2EBPA 3QBYA 4JS5A 1VQ4Q 2EFIA 5I22A 2D9TA 2M16A 2E5KA 4E7KA 1FXXA 2HKNA 1NM7A 2RJDA 4JJDA 4WCIA 3A8GB 5GAOr 5IH2A 2JZ2A 1FX7A 2LCLA 2FG0A 2OTJT 2KXDA 1KQSP 4DBHA 1TSFA 2PQWA 4M7AE 2K5FA 1NYGA 3M4YA 1VQ8Q 2DO3A 2JMAA 1I07A 4IIOA 2RD1A 4BY6C 1M90C 2DZ9A 2Z0WA 1LPLA 4J83A 2LQWA 4M75B 1K8AR 5KYNA 1VQNQ 1Y57A 4IURA 1VQKA 3CD6Q 1KJWA 4IIMA 4C5IA 4TVRA 3SEMA 5HY6A 2H3JA 4F7UE 1TWBA 1NLOC 4J5YA 5M9OA 1RACB 2E1HA 1N9RA 1FMKA 2LMJA 3M0QA 1RL2A 3VS7A 2HBPA 2HQEA 2SEMA 2FEIA 4MZTA 1RAEB 1KQ2A 1WJQA 2ATCB 1PD0A 2K5LA 4AG2C 1PRMC 2WSEE 3BY7A 2FPFA 2B8AA 2O01E 2QQSA 4II1A 2CGHA 4OMMA 4BACA 4C92F 1QCOA 1VIFA 1QLYA 4C8QC 3HTRA 4DOVA 1VQ9T 4RMOA 1AWJA 4RCBA 2P4TA 2ZCFB 1X01A 5LJ3h 4AMCA 4QW2A 2EYXA 4E2FB 3HFOA 1KFZA 1HYOA 1I8FA 5GAOl 1ABOA 3M0TA 4M78A 1PRLC 1YNZA 4HXJA 1TUCA 2ZPEB 1WXUA 3VUZA 2EJFA 1S72Q 5KYYA 3CC4A 1X69A 2LX7A 2F2VA 3V7SA 1YJNT 3LGLA 3OYGA 1BI0A 1HXDA 1IO6A 1KIKA 1U1SA 3I35A 1KQ1A 1XOVA 1GXIE 1IRXA 1V1CA 3CCET 3AT1B 5LJ5e 4DOWA 2ROTA 1GCQA 2JM9A 4PJOG 2JVVA 5HK3A 4C5GA 2NYSA 2JUFA 3PGGA 4E6RA 5IHIA 1W1FA 1WX6A 1D1BA 3CCSQ 5LJ3d 3CXCS 1UDLA 2PTKA 1MV0B 1VQ6A 2EWNA 2EJ9A 4PJJA 4HCBA 3C4SA 3G71A 3QO3A 4BD3A 1CSKA 2D1XA 4OB3B 2BTTA 3JCMX 4M78B 1VQLA 2DFUA 3UF4A 1Q82U 3OQ5A 4M7DG 1M8MA 2AIRB 2DL3A 4HCZA 4J9DA 1UECA 2HL5C 2JS2A 4EMHA 3SHWA 4MZPA 1RAIB 3FJPA 1M3CA 4N0AA 1A0NB 4Q5WA 1RAHB 2FVUA 4JRKA 2LP5A 5GAN5 1ZHIA 2KDSA 3ASKA 2GBQA 3KFVA 3E9FA 1I0CA 3QYHB 2EQKA 1Y71A 2Y4YA 5I2SA 4BDYA 2QDYB 2DL5A 2RHYA 2OTJA 1UTIA 1T0HA 2ECZA 4ZN3A 4FYXB 1DJ7B 3L1AA 4QQGA 4XTUA 1YITT 4CRIA 1T3SA 1S72T 4FT4A 4M77E 2EVRA 1VQOA 1WXTA 4R0KA 5CKEA 5LJ3g 2YSQA 4RUGA 4E7SA 2DL7A 1GBQA 4LXCA 4J7IA 1K8AU 1BK2A 2MCNA 3HHTB 3L2UA 1VQMQ 2A08A 1RLQC 1YHQQ 4PJOF 3L2WA 3TSWA 2YUOA 2FZGB 1BIBA 1JJ2P 1KSWA 4L59A 3EG2A 3CCUT 3GNFB 3OYNA 1OPLA 1ZUYA 2KRSA 1AHJB 3CC2T 3JSCA 3CMAT 1VQ9A 2F1LA 4JRPA 2GQIA 1KHCA 3M56A 3OYDA 1UGPB 3H0HA 1PKSA 4GLMA 1MUZA 2CH4A 1BI3A 3LWIA 4QVDA 4NS5A 2JMCA 4LE9A 5D6XA 3VJPA 4C92A 3UDCA 5GMKe 4M7DF 3EG9A 3RR6A 3CBOA 3QYGB 3QZ9B 3OYKA 3NTIA 1ZSZA 4R55A 4M7AG 4Y91A 1IGQA 1YJNA 2GFAA 4OGCA 2WACA 2L3SA 1Y96A 2ZZDA 4OMLA 1YJWQ 3LX7A 3RKYA 2LVMA 1KC8C 2EQJA 1UJYA 4DBQA 3E2UA 3TCJA 2KROA 4X34A 4PJNA 2CP6A 1X2KA 4LDWA 3HRUA 3CCEA 3E9GA 3OYCA 1R0BG 3OYLA 1RAAB 3KBGA 1M90U 2EQIA 5DLOA 4F7UG 1OEBA 5EC7A 3CCQQ 2E6NA 4PJOD 4HT8A 1OV3A 2HL3A 1W4SA 4BI8B 4FSXA 1SPKA 1VQ8A 1KHIA 5HKCA 1EIFA 5IXBA 4Z89A 1BCMA 4M78C 3G1JA 3NHNA 1KQSA 1IB8A 1VQNA 4CC3A 2HQXA 1X6BA 4NL2A 3JB9F 3CCLT 3SB2A 1YIJQ 2DD5A 4B6MA 4C92B 2X4XA 2V1QA 5J3BA 5IXFA 3TU4K 3HPWA 3EG9B 4M7DD 2E5QA 5GMKl 5GAMd 3S3MA 1FWZA 3LYIA 3QIIA 2EGEA 2R5MA 2LZ6B 2DRMA 2F69A 4J7FA 1Y96B 4RTUA 3HL8A 1JU5C 3CCMQ 1J3TA 3EFOA 4IUTA 2XDBA 1GCQC 2QGFB 1TU0B 1KC8R 2HD0A 3JCMh 1NBEB 3UATA 3CMEQ 1M1FA 1YFNA 4ZTJA 1OYXA 3M55A 3VS6A 3QHSA 1MMDA 1SF9A 4HT9A 1VQKT 4RTYA 4YTLA 1N6AA 1S72A 1TOVA 3OYYA 2DKGA 3E19A 3PMTA 4XAXB 4J9EA 4BE0A 2M1HA 4EMKA 3RERA 2IIMA 5GMKm 2HAXA 3CC7Q 2ZPBB 2O2OA 5IT9E 2BE9B 1UG1A 5KYUB 3L2ZA 4N0AC 2OTLQ 5FRMA 2VGMA 3M54A 4PJMA 2DJZA 3CCUA 2O4XA 4J9GA 3CCJT 2XHCA 1YI2Q 3M9QA 2RO0A 1Q86C 1M1KC 2BZ8A 2QQ9A 3EH1A 2HMAA 3CC2A 4IUPA 4XU3A 3JCMd 3EFOB 5GAMg 3CCRQ 3G4SQ 2GTOA 1K0XA 2O9VA 1H3ZA 4PJOA 1WHKA 3CC4T 1BU1A 2DERA 2CSQA 2X51A 1KD1U 2VUBA 5LJ3e 1TH7A 1K9MC 3UPUA 2K7AA 2QASA 4BB7A 2E3HA 4J9HA 2KYMA 3OS0A 3VS2A 2R5AA 2ABLA 2DD4A 1XJWB 2GNCA 4J9FA 2ZAEA 2RI2A 3PT9A 4M7AD 1VA7A 4M75E 4N4IA 1R8OB 1PHTA 1AEYA 1ZUUA 4BI3A 1QCFA 2LT4A 2OI3A 1QCNA 4M77G 3VS4A 4M7DA 1F1BB 1ACMB 2W0ZA 4JRQA 2YRCA 2KRNA 1JEGA 2E4HA 2PNIA 3X26B 2FRYA 2XKOC 1UE9A 2VC8A 1VQ6T 3EGXA 2VXEA 4RG8A 5IHKA 1GL5A 1AOJA 5KCHA 3G71T 4AG1C 3L2VA 1Q82R 1GFDA 2K2VA 2X4WA 2KNBB 2DVJA 3MP1A 4KUDK 4OF1A 1M1KR 4PJOB 2HSPA 3X28B 2O31A 3VYGA 2DA9A 1WZOA 4C92C 2K79A 1UGSB 1JRIA 3JCMg 3CC7T 2BIVA 2KSSA 3M53A 3CCLA 2VV5A 1U5SA 4LD9K 2EW3A 2JW4A 1YHQA 4FL6A 1M2VB 2MF2A 4C0FA 2K3XA 2OTLT 2QTXA 1EFNA 2L3RA 1K9MR 3OYBA 2MMPA 1TUGB 4LN2A 4FCYA 3I55Q 1YI2T 1B7TA 2JS0A 2WSCE 1Q81C 3ER0A 1K73C 2PVOB 2RB6A 2CH4W 2BE7D 3G4ST 4M7DB 2C0TA 2CZ0B 4NOYA 4FIBA 1JJ2A 1X75C 3NMZC 2H3EB 1SG5A 3QJ6A 2K3BA 1KC8U 2XIDA 2DMOA 2ED0A 2FL7A 3EGXB 1VQOT 1FYNA 1B3QA 1O75A 3E1SA 3OW2A 1NJIC 1C0MA 3QKJA 2RJFA 2AZVA 2DTOA 1N8RC 1YWOA 4OB1B 4GBQA 5I21A 3JCMV 4Z8AA 3QG1A 4CC7A 1C1AA 5FWBA 2LNHB 5EG2A 1V76A 5CR2A 2CP5A 4M77F 3S3OA 4B9WA 2SRCA 4M78E 3JV3A 2BZXA 2P4RA 4D8KA 2DTIA 1VYUA 4M7AA 3V8JA 2DBMA 2YRDA 4ME7A 2KE9A 2F2XA 1PKTA 3CCQA 4ZGDB 4OP0A 3DLMA 1Q95G 3CCJA 4OMPA 1OI1A 5GAN6 4L5GA 4RTZA 5CVIA 1EZZB 4ATOA 2FO0A 3V7RA 2QQRA 2FPEA 4F7UA 3FJ5A 2FZKB 3MEUA 2XICA 1Q81R 2MOXA 4QQ6A 1AZEA 3A5ZB 1HSQA 3EHQA 4E7HA 4OB0B 4Y92A 1WJSA 2OAWA 3OYMA 2EJGA 2M51A 3L42A 1YIJA 4A4FA 3OYAA 5GANe 1PC0A 4EMKC 2QGGA 1M90R 1Y07A 1G3WA 4KT0E 1VQ4T 2QDLA 1Y7XA 2RI5A 2A28A 4KRTA 1WA7A 5A0LA 3OMCA 2V8IA 2G3RA 1JJ2S 2QTVA 1N8RR 3ZFJA 1U8RA 1I1JA 1X2QA 2VKNA 3IQLA 5LJ5j 4M77D 1Q7YC 5GAMe 3OA6A 2YT6A 2GF7A 1VQ8T 2YRVA 1E7OA 2K2MA 4JLGA 3TSZA 5GAOm 5A0GA 4XU0A 3X25B 4P5NA 2COZA 4OB2B 3M0SA 1VQNT 5FW9A 4J6WA 3CD6T 4PJOC 2J7IA 2EYZA 2HQHA 3VYHB 3MHXA 1LJOA 1KK7A 2RMOA 1G8XA 3MEVA 5GAOq 1S1NA 4FU6A 4MMKA 2QG9B 2EYQA 3UT1A 2X3XD 1OQKA 1HJDA 5KYYB 3CC7A 1N5ZA 1V29B 1Q86U 1M1KU 3QSUA 3QWYA 1OU8A 4HA8A 2EIFA 1KD1C 4PFZA 1MV3A 4DEXA 6AT1B 1TG0A 2G6FX 1YN8A 4R56A 2JNGA 3H6ZA 3S3NA 2OTLA 4CI0C 2IPOB 2DEQA 2VB6A 4FYWB 3NFCA 4BUGA 2V1RA 4KH0B 3EG3A 4FM4B 2E70A 3G7ZA 1X27A 2RHZA 4IUVA 2M9UA 4M7DC 3G6EQ 1YI2A 3PMIA 4KUIA 1K9MU 3P8HA 3RIRA 3LGFA 2A7YA 3HKSA 4M75G 3CCRA 2DRKA 3G4SA 2MPXC 2DL8A 3H0IA 3JB9H 3V7CA 1M30A 2L0AA 4XQ3A 2EQMA 3I5RA 3PIPA 1O9SA 2DETA 1NEBA 1Q7YR 2QK0A 1QVFP 3CCVQ 1GRIA 4OMFB 2ROLA 1BCOA 2JTMA 2LJ3A 2E3IA 3GF5A 2MWPA 2W10A 3EHRA 3J7AF 4PK4A 1AZGB 2FRWA 3NGPA 2E65A 2CP2A 2X35A 2HKQB 3JCMb 1WHMA 4OMNA 2QEXQ 4E7IA 2CP0A 1W2BP 1WQ7A 2Y4XA 3C94A 1UB4A 3LH0A 1RLPC 2RQWA 4C0GA 1M2OA 3A98A 2NUZA 1VQ7Q 4C92E 1G3YA 1CKBA 3RNJA 3M5AA 2YDLA 3MO8A 3CCST 1IGUA 1JBMA 4QQDA 2VVKA 5A0DA 4A4GA 2RA2A 1JXOA 3OW2P 2AT1B 1KD1R 1JXMA 2AHJB 3I9QA 5CKHA 4M77A 4ZGEB 2RK1A 4M4ZA 1OZ2A 1D3BA 2RJEA 3GOXA 5GAN7 2L3PA 2RHIA 3VU3C 2COWA 2XDDA 3SWNA 2QQAA 4HCKA 1TXQA 4A63B 3JCMQ 4X1VA 4ELYC 1X43A 1Q81U 1RADB 2RNAA 3VRYA 3WVEB 3CQTA 1SEMA 5GMKj 1K73U 2FZCB 5CCAA 3WVDB 4C0DB 3KUFA 1W70A 4PL6A 5LJ5h 1BBZA
chains in the Genus database with same CATH topology
2H8HA 4J9GA 1OPKA 1K4US 2KR3A 2BZ8A 1K1ZA 2JMAA 1I07A 1UHCA 2RQTA 4IIOA 2L3QA 5ECAA 1WXBA 2D0NA 2GTOA 1K0XA 2LQWA 3VRZA 2O9VA 1Y57A 1SHGA 1KJWA 4IIMA 3PVLA 3SEMA 1BU1A 2CSQA 3QWXX 1YWPA 1NLOC 1G83A 2K7AA 1FMKA 2LMJA 3M0QA 3VS7A 2AKLA 2CSIA 2SEMA 1NEGA 2FEIA 4J9HA 2KYMA 1K0SA 2CDTA 1SHFA 3VS2A 4JPBW 2ABLA 4RTXA 1TUDA 2GNCA 4AFZC 1AWXA 4J9FA 4AG2C 1PRMC 3EGUA 1U3OA 2FPFA 4JJCA 2F2WA 3M0PA 1VA7A 1QKXA 2DM1A 4OMMA 1UJ0A 4J9BA 1PHTA 1AEYA 1ZUUA 1QLYA 1ZX6A 1QCFA 2OI3A 4RTTA 1AWJA 1UHFA 3VS4A 2W0ZA 2NWMA 2KYBA 1K9AA 1PNJA 2KT1A 2EYXA 2JM8A 3REBB 1KFZA 5FWCA 2KRNA 1NLPC 1JEGA 2PNIA 2FRYA 1ABOA 3M0TA 1UE9A 1Z9QA 1PRLC 1YNZA 4HXJA 2OJ2A 2D8JA 1NG2A 1TUCA 5IHNA 1WXUA 2AKKA 5IHKA 4JZ3A 1AWWA 1GL5A 1WI7A 1AOJA 1X69A 2EYYA 2LX7A 4AG1C 1GFDA 2F2VA 2RF0A 2LJ1A 2KNBB 2DVJA 1LCKA 1IO6A 1KIKA 3I35A 3H41A 2HSPA 2O31A 2DA9A 1WIEA 1XOVA 2K79A 1SRLA 2ENMA 1M3BA 1V1CA 1ZBJA 4OMOA 3M0UA 2O88A 4AFQC 1U5SA 2ROTA 1GCQA 1JO8A 1QKWA 2JM9A 2EW3A 2JW4A 2J06A 2EPDA 1EFNA 4E6RA 5IHIA 4LN2A 1H8KA 1W1FA 1WX6A 4F14A 4HVUA 4RTWA 2JS0A 2VWFA 2M0YA 1UDLA 2PTKA 1MV0B 2HDAA 2YUPA 2CT4A 4QT7A 2CH4W 2C0TA 2RQUA 3NMZC 3PVQA 1QWFA 2O9SA 1SRMA 4FSSA 2K3BA 1CSKA 2D1XA 2BTTA 2DMOA 2DNUA 2ED0A 3EG1A 3UF4A 4Z88A 2DF6A 1T0JA 1M8MA 2DL3A 1FYNA 4J9DA 1B3QA 2KEAA 1UECA 2JS2A 3VS5A 4F16A 3SHWA 2AZVA 2C0IA 3H0FA 4OMQA 1M3CA 4K11A 1A0NB 1YWOA 2HCKA 4GBQA 4Z8AA 2LP5A 4HVWA 4LUDA 4CC7A 2A37A 5FWBA 2LNHB 1YCSB 2CUBA 2DX1A 2GBQA 3KFVA 1ABQA 1G2BA 1I0CA 2SRCA 1RI9A 3JV3A 1BB9A 2BZXA 2P4RA 2AZSA 4D8KA 1AVZC 2YUNA 1VYUA 2B86A 4LNPA 2AK5A 5I11A 2DBMA 4JZ4A 2DL5A 1UTIA 2KE9A 1M3AA 2RPNA 1T0HA 2ECZA 2F2XA 1PKTA 1UGVA 4OMPA 4RTZA 1UFFA 1T3SA 2EGAA 2CT3A 4J9CA 1ARKA 2FO0A 2J6OA 2EKHA 2EVRA 2MIOA 2RN8A 2FPEA 1WXTA 4R0KA 1U06A 3FJ5A 2HEQA 2YSQA 4RUGA 3I5SA 2MOXA 2DL7A 1GBQA 1AZEA 1HSQA 1BK2A 2KXCA 3EHQA 2MCNA 3NPFA 4Y92A 2DJQA 2C0OA 3LH5A 1E6HA 2OAWA 2A08A 2PZ1A 2M51A 1RLQC 5GJWB 3TSWA 2YUOA 2K9GA 1KSWA 2X3WD 3EG2A 4HVVA 1W6XA 1OPLA 2QDLA 2DL4A 1ZUYA 2KRSA 2FPDA 3THKA 2A28A 2DLPA 1WA7A 4KRTA 4AFUC 3ULRB 2GQIA 2RQVA 3UA7A 4EIKA 1WFWA 3H0HA 1I1JA 1X2QA 3VS3A 2VKNA 3IQLA 1PKSA 4GLMA 2ED1A 2HBWA 2YT6A 1MUZA 2CH4A 1E7OA 2A36A 1E6GA 3U23A 2K2MA 3TSZA 2I0NA 2JMCA 1X6GA 4LE9A 4ORZA 2KGTA 1VYVA 3VS1A 4CC4B 3M0SA 5FW9A 2J7IA 4LUEA 4ESRA 2EYZA 2L3SA 4OMLA 2RMOA 4CC2A 1S1NA 1UJYA 2EGCA 1JQQA 2DILA 3VS0A 2KROA 2D8HA 2X3XD 3M0RA 1M27C 1X2KA 1H92A 1HJDA 1N5ZA 1Y0MA 3QWYA 1Z9ZA 1VYTA 2EQIA 1MV3A 4DEXA 2LQNA 4AFSC 1TG0A 1ZUKA 2G6FX 1YN8A 1OEBA 1WDXA 5EC7A 3UA6A 2KRMA 1WYXA 2V1RA 3EG3A 1OV3A 1NYFA 3PE0A 1X27A 5L23A 1AD5A 1SPKA 2JT4A 1B07A 4J9IA 1RUWA 1OOTA 5IXBA 3GBQA 4Z89A 1AWOA 2DYBA 4JJBA 2DBKA 2LCSA 1SSHA 2DRKA 2JXBA 2DL8A 3H0IA 3NHNA 1CKAA 2DE0X 2GTJA 1M30A 1YP5A 2L0AA 2YUQA 4CC3A 2KBTA 2ESWA 1X6BA 1ZLMA 3I5RA 2EYWA 2K6DA 2CUDA 2JTEA 2BZYA 1NEBA 2CREA 2V1QA 1GRIA 1T3LA 5IXFA 2ROLA 2LJ3A 2W10A 3EHRA 4RTVA 2EGEA 4DEYA 2LZ6B 2DRMA 1GBRA 2J6FA 1AZGB 2LJ0A 2FRWA 3NGPA 4RTUA 3R6NA 4OMNA 5GJVB 1H3HA 2GGRA 1JU5C 3TVTA 3ZL7C 2KT8A 1PWTA 1GCPA 1J3TA 2XMFA 1GCQC 4ZNXA 3C0CA 1QWEA 2J05A 1RLPC 2RQWA 3A98A 2NUZA 1CKBA 3RNJA 1K76A 2YDLA 3UATA 2VVKA 1JXOA 3VS6A 1JXMA 4D8DA 3I9QA 4RTYA 2J6KA 1WLPB 4M4ZA 2RQRA 4F17A 3EG0A 4J9EA 3O5ZA 5HCKA 3RBBB 1UUEA 2L3PA 1ZSGA 2EBPA 2IIMA 2L2PA 4HCKA 5I22A 1GFCA 2E5KA 2O2OA 4A63B 1UG1A 4X1VA 1NM7A 1X43A 2RNAA 4JJDA 4WCIA 3VRYA 3CQTA 1SEMA 3REAB 5IH2A 1HD3A 2FG0A 2KXDA 1W70A 1NYGA 1BBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H8H A;  4J9G A;  1OPK A;  1K4U S;  2KR3 A;  2BZ8 A;  1K1Z A;  2JMA A;  1I07 A;  1UHC A;  2RQT A;  4IIO A;  2L3Q A;  5ECA A;  1WXB A;  2D0N A;  2GTO A;  1K0X A;  2LQW A;  3VRZ A;  2O9V A;  1Y57 A;  1SHG A;  1KJW A;  4IIM A;  3PVL A;  3SEM A;  1BU1 A;  2CSQ A;  3QWX X;  1YWP A;  1NLO C;  1G83 A;  2K7A A;  1FMK A;  2LMJ A;  3M0Q A;  3VS7 A;  2AKL A;  2CSI A;  2SEM A;  1NEG A;  2FEI A;  4J9H A;  2KYM A;  1K0S A;  2CDT A;  1SHF A;  3VS2 A;  4JPB W;  2ABL A;  4RTX A;  1TUD A;  2GNC A;  4AFZ C;  1AWX A;  4J9F A;  4AG2 C;  1PRM C;  3EGU A;  1U3O A;  2FPF A;  4JJC A;  2F2W A;  3M0P A;  1VA7 A;  1QKX A;  2DM1 A;  4OMM A;  1UJ0 A;  4J9B A;  1PHT A;  1AEY A;  1ZUU A;  1QLY A;  1ZX6 A;  1QCF A;  2OI3 A;  4RTT A;  1AWJ A;  1UHF A;  3VS4 A;  2W0Z A;  2NWM A;  2KYB A;  1K9A A;  1PNJ A;  2KT1 A;  2EYX A;  2JM8 A;  3REB B;  1KFZ A;  5FWC A;  2KRN A;  1NLP C;  1JEG A;  2PNI A;  2FRY A;  1ABO A;  3M0T A;  1UE9 A;  1Z9Q A;  1PRL C;  1YNZ A;  4HXJ A;  2OJ2 A;  2D8J A;  1NG2 A;  1TUC A;  5IHN A;  1WXU A;  2AKK A;  5IHK A;  4JZ3 A;  1AWW A;  1GL5 A;  1WI7 A;  1AOJ A;  1X69 A;  2EYY A;  2LX7 A;  4AG1 C;  1GFD A;  2F2V A;  2RF0 A;  2LJ1 A;  2KNB B;  2DVJ A;  1LCK A;  1IO6 A;  1KIK A;  3I35 A;  3H41 A;  2HSP A;  2O31 A;  2DA9 A;  1WIE A;  1XOV A;  2K79 A;  1SRL A;  2ENM A;  1M3B A;  1V1C A;  1ZBJ A;  4OMO A;  3M0U A;  2O88 A;  4AFQ C;  1U5S A;  2ROT A;  1GCQ A;  1JO8 A;  1QKW A;  2JM9 A;  2EW3 A;  2JW4 A;  2J06 A;  2EPD A;  1EFN A;  4E6R A;  5IHI A;  4LN2 A;  1H8K A;  1W1F A;  1WX6 A;  4F14 A;  4HVU A;  4RTW A;  2JS0 A;  2VWF A;  2M0Y A;  1UDL A;  2PTK A;  1MV0 B;  2HDA A;  2YUP A;  2CT4 A;  4QT7 A;  2CH4 W;  2C0T A;  2RQU A;  3NMZ C;  3PVQ A;  1QWF A;  2O9S A;  1SRM A;  4FSS A;  2K3B A;  1CSK A;  2D1X A;  2BTT A;  2DMO A;  2DNU A;  2ED0 A;  3EG1 A;  3UF4 A;  4Z88 A;  2DF6 A;  1T0J A;  1M8M A;  2DL3 A;  1FYN A;  4J9D A;  1B3Q A;  2KEA A;  1UEC A;  2JS2 A;  3VS5 A;  4F16 A;  3SHW A;  2AZV A;  2C0I A;  3H0F A;  4OMQ A;  1M3C A;  4K11 A;  1A0N B;  1YWO A;  2HCK A;  4GBQ A;  4Z8A A;  2LP5 A;  4HVW A;  4LUD A;  4CC7 A;  2A37 A;  5FWB A;  2LNH B;  1YCS B;  2CUB A;  2DX1 A;  2GBQ A;  3KFV A;  1ABQ A;  1G2B A;  1I0C A;  2SRC A;  1RI9 A;  3JV3 A;  1BB9 A;  2BZX A;  2P4R A;  2AZS A;  4D8K A;  1AVZ C;  2YUN A;  1VYU A;  2B86 A;  4LNP A;  2AK5 A;  5I11 A;  2DBM A;  4JZ4 A;  2DL5 A;  1UTI A;  2KE9 A;  1M3A A;  2RPN A;  1T0H A;  2ECZ A;  2F2X A;  1PKT A;  1UGV A;  4OMP A;  4RTZ A;  1UFF A;  1T3S A;  2EGA A;  2CT3 A;  4J9C A;  1ARK A;  2FO0 A;  2J6O A;  2EKH A;  2EVR A;  2MIO A;  2RN8 A;  2FPE A;  1WXT A;  4R0K A;  1U06 A;  3FJ5 A;  2HEQ A;  2YSQ A;  4RUG A;  3I5S A;  2MOX A;  2DL7 A;  1GBQ A;  1AZE A;  1HSQ A;  1BK2 A;  2KXC A;  3EHQ A;  2MCN A;  3NPF A;  4Y92 A;  2DJQ A;  2C0O A;  3LH5 A;  1E6H A;  2OAW A;  2A08 A;  2PZ1 A;  2M51 A;  1RLQ C;  5GJW B;  3TSW A;  2YUO A;  2K9G A;  1KSW A;  2X3W D;  3EG2 A;  4HVV A;  1W6X A;  1OPL A;  2QDL A;  2DL4 A;  1ZUY A;  2KRS A;  2FPD A;  3THK A;  2A28 A;  2DLP A;  1WA7 A;  4KRT A;  4AFU C;  3ULR B;  2GQI A;  2RQV A;  3UA7 A;  4EIK A;  1WFW A;  3H0H A;  1I1J A;  1X2Q A;  3VS3 A;  2VKN A;  3IQL A;  1PKS A;  4GLM A;  2ED1 A;  2HBW A;  2YT6 A;  1MUZ A;  2CH4 A;  1E7O A;  2A36 A;  1E6G A;  3U23 A;  2K2M A;  3TSZ A;  2I0N A;  2JMC A;  1X6G A;  4LE9 A;  4ORZ A;  2KGT A;  1VYV A;  3VS1 A;  4CC4 B;  3M0S A;  5FW9 A;  2J7I A;  4LUE A;  4ESR A;  2EYZ A;  2L3S A;  4OML A;  2RMO A;  4CC2 A;  1S1N A;  1UJY A;  2EGC A;  1JQQ A;  2DIL A;  3VS0 A;  2KRO A;  2D8H A;  2X3X D;  3M0R A;  1M27 C;  1X2K A;  1H92 A;  1HJD A;  1N5Z A;  1Y0M A;  3QWY A;  1Z9Z A;  1VYT A;  2EQI A;  1MV3 A;  4DEX A;  2LQN A;  4AFS C;  1TG0 A;  1ZUK A;  2G6F X;  1YN8 A;  1OEB A;  1WDX A;  5EC7 A;  3UA6 A;  2KRM A;  1WYX A;  2V1R A;  3EG3 A;  1OV3 A;  1NYF A;  3PE0 A;  1X27 A;  5L23 A;  1AD5 A;  1SPK A;  2JT4 A;  1B07 A;  4J9I A;  1RUW A;  1OOT A;  5IXB A;  3GBQ A;  4Z89 A;  1AWO A;  2DYB A;  4JJB A;  2DBK A;  2LCS A;  1SSH A;  2DRK A;  2JXB A;  2DL8 A;  3H0I A;  3NHN A;  1CKA A;  2DE0 X;  2GTJ A;  1M30 A;  1YP5 A;  2L0A A;  2YUQ A;  4CC3 A;  2KBT A;  2ESW A;  1X6B A;  1ZLM A;  3I5R A;  2EYW A;  2K6D A;  2CUD A;  2JTE A;  2BZY A;  1NEB A;  2CRE A;  2V1Q A;  1GRI A;  1T3L A;  5IXF A;  2ROL A;  2LJ3 A;  2W10 A;  3EHR A;  4RTV A;  2EGE A;  4DEY A;  2LZ6 B;  2DRM A;  1GBR A;  2J6F A;  1AZG B;  2LJ0 A;  2FRW A;  3NGP A;  4RTU A;  3R6N A;  4OMN A;  5GJV B;  1H3H A;  2GGR A;  1JU5 C;  3TVT A;  3ZL7 C;  2KT8 A;  1PWT A;  1GCP A;  1J3T A;  2XMF A;  1GCQ C;  4ZNX A;  3C0C A;  1QWE A;  2J05 A;  1RLP C;  2RQW A;  3A98 A;  2NUZ A;  1CKB A;  3RNJ A;  1K76 A;  2YDL A;  3UAT A;  2VVK A;  1JXO A;  3VS6 A;  1JXM A;  4D8D A;  3I9Q A;  4RTY A;  2J6K A;  1WLP B;  4M4Z A;  2RQR A;  4F17 A;  3EG0 A;  4J9E A;  3O5Z A;  5HCK A;  3RBB B;  1UUE A;  2L3P A;  1ZSG A;  2EBP A;  2IIM A;  2L2P A;  4HCK A;  5I22 A;  1GFC A;  2E5K A;  2O2O A;  4A63 B;  1UG1 A;  4X1V A;  1NM7 A;  1X43 A;  2RNA A;  4JJD A;  4WCI A;  3VRY A;  3CQT A;  1SEM A;  3REA B;  5IH2 A;  1HD3 A;  2FG0 A;  2KXD A;  1W70 A;  1NYG A;  1BBZ A; 
#chains in the Genus database with same CATH topology
 3GP8 A;  1VQ4 A;  2CZ7 B;  3FDR A;  2KR3 A;  2ZPG B;  5KYW A;  1I5L A;  2RQT A;  5ECA A;  1WXB A;  2ZGW A;  3VRZ A;  5FLX E;  1NE8 A;  1SHG A;  2L5Q A;  2EQU A;  1NJI U;  3PVL A;  3HRS A;  2PUK B;  5C0M A;  1VQ5 Q;  2IVW A;  1N8R U;  5DM7 R;  4M78 G;  2FYK A;  4LDU A;  2MI6 A;  2AKL A;  1NEG A;  3A8M B;  1IHV A;  4C8Q E;  1K0S A;  3CCV T;  2CDT A;  3URG A;  1SHF A;  3VUB A;  5GAN 3;  3CD6 A;  4M77 B;  1TUD A;  4AFZ C;  5I2M A;  3EGU A;  4JJC A;  4XTW A;  1QKX A;  1IHW A;  1UJ0 A;  2KI7 A;  1ZX6 A;  1VQM T;  1VQP Q;  1YHQ T;  1QW1 A;  1D0Z A;  1ZSZ B;  3SWN B;  4QVC A;  1WJR A;  2KYB A;  2K5I A;  1PNJ A;  2KT1 A;  5LJ5 d;  2JM8 A;  5FWC A;  1NLP C;  4HCC A;  4E7Z A;  4JS4 A;  5CKD A;  4ZTF A;  3QUI A;  3RMS A;  4V2S A;  3HRT A;  5IHN A;  3FEO A;  2FB7 A;  4JZ3 A;  1AWW A;  2KY9 A;  2EYY A;  5KYW B;  5FRN A;  2LC4 A;  1WHL A;  4EDU A;  3RDV A;  1LCK A;  3CPW P;  1BI1 A;  4RKU E;  4M75 D;  2K57 A;  4D6W A;  1WIE A;  2PUO B;  3PTA A;  2BKD N;  2ENM A;  2CKK A;  1ZBJ A;  2M02 A;  4M7A F;  1YCY A;  4ZN1 A;  3M0U A;  2O88 A;  1WHH A;  1WQW A;  2OX7 A;  1KG1 A;  1YJW T;  4KGZ B;  4N4H A;  2DYI A;  1P92 A;  1Q7Y U;  1TS9 A;  1D0X A;  2KAF A;  1MNE A;  2QYZ A;  5IAY A;  2LQK A;  4J6X A;  1MHN A;  4HVU A;  4RTW A;  5GAO p;  4OVA A;  1ZQ1 A;  4WF2 A;  1VQL Q;  3MP6 A;  3QDF A;  2M0Y A;  3VKI A;  4F7U F;  2YUP A;  2CT4 A;  4QT7 A;  4GLK A;  3CCQ T;  1M8V A;  1I4K 1;  3MEA A;  3MKD A;  4JJN K;  3PVQ A;  3EGD A;  2HNI A;  2FHD A;  2C06 A;  3CCS A;  1VQ5 T;  1KQS S;  1LNX A;  3SFM A;  4Z88 A;  2DF6 A;  2DXC A;  8ATC B;  5LJ5 g;  2E41 A;  3OSV A;  5LJ5 f;  2DIQ A;  5DY9 A;  3VS5 A;  4F16 A;  2ZPI B;  1SKU B;  3OYH A;  3H0F A;  2LRQ A;  1SSF A;  5GMK h;  1LOJ A;  3A8O B;  2DXT A;  1YIJ T;  1ZA1 B;  4HVW A;  4LUD A;  2NLU A;  3TQ7 P;  1YCS B;  2CUB A;  3DKM A;  4C5H A;  4C0D C;  1RI9 A;  2QQB A;  3JRZ A;  2AZS A;  5LJ3 j;  1AVZ C;  1D1C A;  1WGS A;  2YUN A;  3BDU A;  2B86 A;  4LNP A;  1BI2 A;  3FB9 A;  2AK5 A;  2NUT A;  5I11 A;  4EMK B;  4JZ4 A;  3HSB A;  3CCM T;  2RPN A;  2F5K A;  4PKC C;  4J6Y A;  1WNL A;  1QQJ A;  5D7U A;  1UFF A;  3QDR B;  1LVK A;  1B34 A;  2CT3 A;  1ARK A;  4GY5 A;  2R57 A;  4QVZ A;  5CKF A;  2DK3 A;  2MIO A;  2RN8 A;  2MAM A;  4O6J A;  3CME T;  1TTH B;  3MEW A;  2O4X B;  2PVG B;  2E64 A;  3L2R A;  3I5S A;  3RKX A;  3JAM E;  3EGD B;  2A3L A;  3CBM A;  3P8B B;  2IG0 A;  3NPF A;  2DJQ A;  2MYS A;  2C0O A;  3LLR A;  4M77 C;  4C92 G;  2PZ1 A;  4M78 D;  3QZ5 B;  1Q86 R;  5GJW B;  3CCV A;  4PFP A;  4M75 A;  5IN1 A;  1R77 A;  1ZSZ C;  2FPD A;  3SWN C;  3LW5 E;  3THK A;  3BFM A;  1G5V A;  1VQM A;  4FW1 A;  1R0C B;  1RAG B;  4AFU C;  3ULR B;  2RQV A;  2A0F B;  1QVF A;  1WFW A;  3OMG A;  2LX9 A;  3VS3 A;  4MDW A;  4EMG A;  1YJN Q;  1OX8 A;  4KH1 B;  3U23 A;  2RHU A;  2I0N A;  4VUB A;  4XK8 E;  1QP2 A;  2DVE A;  4ORZ A;  2HSE B;  1W2B A;  2CS7 A;  2KGT A;  3H9N A;  4QKU A;  3CCR T;  1RAB B;  2KVQ G;  3SD4 A;  1VYV A;  4JUV A;  3CCE Q;  8AT1 B;  3TEE A;  2D6F A;  1B34 B;  3ZEH A;  9ATC B;  2EGC A;  1I5O B;  3OY9 A;  1JQQ A;  3OB9 A;  3M59 A;  3VS0 A;  3M57 A;  3M0R A;  1M27 C;  1YJ9 Q;  4FT2 A;  2YXY A;  1OU9 A;  1Y0M A;  3UWN A;  2COY A;  1BIA A;  1QVG P;  1Z9Z A;  1YJW A;  2OAU A;  2RH2 A;  5D6Y A;  3OYF A;  1WDX A;  3MCA B;  3UA6 A;  1FMV A;  2KMT A;  2X9H A;  2Y90 A;  3CXC A;  3PE0 A;  5L23 A;  4XU2 A;  4C8Q G;  2VGN A;  1B07 A;  4J9I A;  1RUW A;  3ME9 A;  3HP9 A;  2DYB A;  4JJB A;  3C12 A;  2LCS A;  4B9X A;  1SSH A;  1D1A A;  5C6S A;  1MMG A;  4Z02 A;  1FMW A;  2KBT A;  2RI3 A;  2ESW A;  2XDP A;  5GMK i;  2K6D A;  2D0Q B;  2LDM A;  1VQ5 A;  2JTE A;  4HKE A;  2EKO A;  2XU8 A;  1T3L A;  5GAN 8;  2XD0 A;  3OBY A;  3P8D A;  2I2L A;  1K73 R;  5DLQ E;  4RTV A;  4LDY A;  2LNV A;  1GBR A;  2J6F A;  2LJ0 A;  2QAZ A;  1QVF S;  3V8K A;  3OSS C;  1H3H A;  2CZ6 B;  3TVT A;  2KT8 A;  1GCP A;  4KGX B;  2XMF A;  2DZC A;  2DEU A;  1VQP A;  3C0C A;  1YIT Q;  2J05 A;  1WHJ A;  2YLB A;  2YWW A;  2CP7 A;  4A4E A;  1W2B S;  3ZBD A;  1EX4 A;  1K76 A;  3I55 T;  5GAN j;  1PSF A;  1NJI R;  3CCM A;  4KUL A;  1PM3 A;  3QXE B;  2X4J A;  3FLG A;  1G3S A;  3EFR A;  2J6K A;  1WLP B;  5L8R E;  4M7A B;  2RQR A;  3RES A;  1BYM A;  5D6W A;  3EG0 A;  2VXF A;  4PJL A;  4BE2 A;  3RBB B;  3OW2 S;  1UUE A;  5CK9 A;  3CME A;  2GQV A;  5GAM j;  5FU7 B;  2LCC A;  2L2P A;  3CCU Q;  2P0P A;  3EH2 A;  2V8J A;  1GFC A;  2K4Y A;  1YJ9 T;  4DA4 A;  4WTO B;  3CC2 Q;  3CMA Q;  4OGE A;  4RCC A;  3REA B;  1HD3 A;  4C92 D;  4F7U B;  3MET A;  3CBP A;  3I56 Q;  3CPW A;  2MK5 A;  4ELZ C;  3D7S B;  2H8H A;  1OPK A;  3OS2 A;  1K4U S;  4C8Q F;  1C6V X;  1K1Z A;  4JDS A;  1UHC A;  2L3Q A;  5KE2 A;  3MP8 A;  3O8V A;  1HK9 A;  2D0N A;  3OYI A;  2GCX A;  4A54 A;  1ZA2 B;  3DB3 A;  2XK0 A;  1OX9 A;  2BUD A;  3QWX X;  1PG5 B;  4BE1 A;  1YWP A;  4JRI A;  4IKF A;  1G83 A;  3M58 A;  3N5B B;  2QA4 Q;  2CSI A;  3R6O A;  4JPB W;  1VUB A;  4RTX A;  1XNI A;  3Q1J A;  1AWX A;  3OS1 A;  1U3O A;  1XQH A;  2F2W A;  3M0P A;  4AT1 B;  1M9S A;  2DPP B;  1WHG A;  2DM1 A;  3EFS A;  4XTX A;  3JCM e;  4J9B A;  4JLI A;  5GAO n;  4RTT A;  1UHF A;  3GLX A;  3TRE A;  3V8L A;  3PFS A;  4O5V A;  3JB9 J;  2NWM A;  4M75 C;  1K9A A;  3REB B;  2PU9 B;  2DIG A;  1Z9Q A;  1UEB A;  4LDX A;  2OJ2 A;  5FRO A;  2D8J A;  2L89 A;  1NG2 A;  3A1P A;  2JJ9 A;  2QI2 A;  3JCM J;  2AKK A;  2E6Z A;  3FIF A;  3H8Z A;  2GFU A;  1WI7 A;  5LJ3 f;  3MPU B;  4C8Q D;  5AYF A;  3CCL Q;  1PCX A;  2RF0 A;  3JB9 G;  2KQW A;  2LJ1 A;  2DAQ A;  3FRN A;  3H41 A;  5HK0 A;  2LTO A;  1SRL A;  4PLL A;  1M3B A;  3JCM P;  4A4H A;  4OMO A;  5FU6 B;  1MND A;  3CPW S;  4AFQ C;  1AT1 B;  1JO8 A;  1QKW A;  2KK4 A;  1PSE A;  4XTZ A;  4KBM B;  4XTY A;  2J06 A;  3CXC P;  2EPD A;  3EAE A;  3I56 T;  3OBW A;  1NZ9 A;  4PLI A;  1H8K A;  4F14 A;  5GAN h;  2VWF A;  3T9N A;  2HDA A;  2EAY A;  2PVD B;  4E7J A;  3X20 B;  1VQK Q;  3FC3 A;  3A8L B;  2RQU A;  1QP3 A;  3DB4 A;  1QWF A;  2O9S A;  4J8O A;  1SRM A;  4FSS A;  3QPH A;  3I55 A;  4LDV A;  3G6E T;  3NTK A;  5J39 A;  2LQ8 A;  2DNU A;  1UGQ B;  4X9C A;  1XTD A;  3EG1 A;  4M7A C;  2VYT A;  4E47 A;  3AHU A;  1T0J A;  5GAM h;  4M75 F;  2RK2 A;  2QA4 T;  1I81 A;  4Y28 E;  3JCM c;  3WXM B;  2KEA A;  1D09 B;  2C0I A;  5FU7 C;  3CPF A;  4OMQ A;  4K11 A;  1N27 A;  2RJC A;  3J80 E;  2HCK A;  1M1G A;  2A37 A;  4PNO A;  2DX1 A;  5AT1 B;  3CCJ Q;  1ABQ A;  4C0Z A;  3JCM W;  2LT1 A;  1G2B A;  1BB9 A;  1YJ9 A;  1M5Q 1;  5GAN 2;  3L2Q A;  1D3B B;  2YLC A;  2QEX T;  3J81 E;  2RHX A;  1X6O A;  5GAN d;  1M3A A;  5KYX A;  1UGV A;  4MDX A;  2HZY A;  2P0K A;  2P0Q A;  3CC4 Q;  3RUX A;  2V8K A;  2M0O A;  2EGA A;  1VQ7 T;  2JOY A;  4J9C A;  1MMA A;  2E10 A;  2J6O A;  5CQX A;  1QVG A;  5KYU A;  4ANJ A;  2EKH A;  2RM4 A;  5CAI A;  2DTH A;  1U06 A;  2HEQ A;  1NPP A;  3OYJ A;  2CP3 A;  4N4G A;  2KXC A;  3GNG A;  5CIU A;  4DBF A;  4C8Q A;  4DBR A;  2QXF A;  3LH5 A;  1E6H A;  3A8H B;  1VOM A;  2NUP A;  1IRE B;  1BKB A;  2MWO A;  4IUQ A;  3GIB A;  5A2Q E;  2K9G A;  2X3W D;  4HVV A;  1W6X A;  1MGQ A;  2DL4 A;  3CEY A;  4F04 B;  2JTF A;  2DLP A;  5KH6 A;  1VQ6 Q;  4EPC A;  5CO7 A;  1RAF B;  3UA7 A;  4EIK A;  1OUL A;  2P84 A;  2X4Y A;  2V26 A;  3G71 Q;  4X9D A;  1YIT A;  2ED1 A;  2HBW A;  1QMC A;  3OYE A;  3PNW C;  5CKB A;  4BY6 B;  2A36 A;  1E6G A;  2XG8 D;  2K3Y A;  3MJX A;  4DQ2 A;  4PJO E;  1X6G A;  3KXT A;  2CYZ B;  5KYX B;  3RMQ A;  3NTH A;  3VS1 A;  4CC4 B;  4XTV A;  4FYY B;  4LUE A;  4ESR A;  5GAN g;  2L8D A;  4M78 F;  4CC2 A;  5GAN f;  3JB9 D;  1N9S A;  5FU6 C;  1JB0 E;  3OS5 A;  1Q82 C;  2DIL A;  2D8H A;  2CZ1 B;  1H92 A;  4LD6 A;  2JN0 A;  3LWH A;  4C8Q B;  5LL6 S;  1VYT A;  4ZGJ B;  4M7D E;  2LQN A;  2NUP B;  4AFS C;  1ZUK A;  2E12 A;  3CMA A;  2OTJ Q;  3C95 A;  5KCO A;  5GAM f;  3F70 A;  2KRM A;  3I56 A;  1VQP T;  1WYX A;  4C5E A;  2ZPF B;  3RKW A;  1NYF A;  3BE3 A;  1AD5 A;  1QVG S;  2JT4 A;  3GPL A;  3PIO A;  1MMN A;  1OOT A;  5CQY A;  3GBQ A;  1AWO A;  3SDZ A;  1VQO Q;  2DBK A;  4PFO A;  2JXB A;  4A4K A;  4MZM A;  1CKA A;  1M2V A;  2DE0 X;  2WSF E;  2GTJ A;  1H64 1;  1YP5 A;  1VIE A;  3S6W A;  2YUQ A;  1NPR A;  4MML A;  1RI0 A;  3QJY A;  1ZLM A;  3G6E A;  2EYW A;  2CUD A;  2BZY A;  3BDL A;  4E7L A;  1IZ6 A;  2CRE A;  3DLL A;  1WPY A;  2QA4 A;  2ZPH B;  1G3T A;  3VV0 A;  2YHT A;  1M4Z A;  4NL3 A;  4DEY A;  4XU1 A;  3M4G A;  1K8A C;  1U1T A;  2DXU A;  3R6N A;  5GAN 4;  1VQ9 Q;  5GJV B;  2GGR A;  3ZL7 C;  4IUU A;  1PWT A;  3X24 B;  4BDZ A;  1YBY A;  4ZNX A;  1QWE A;  4A53 A;  4RG2 A;  4UC4 A;  2VAS A;  2QEX A;  5J26 A;  1ZBX A;  2R58 A;  4KGV B;  1VQL T;  7AT1 B;  1UGR B;  3JB9 I;  1D0Y A;  1OZ3 A;  2DXB A;  4D8D A;  2XI9 A;  3BW1 A;  1IXD A;  1VQ7 A;  4F17 A;  3JCM f;  2NUT B;  4FYV B;  4BI4 A;  3INZ A;  2F5T X;  1PD1 A;  4L6V 5;  4FW2 A;  5KE3 A;  3HFN A;  3O5Z A;  5HCK A;  1QVP A;  1ZSG A;  2EBP A;  3QBY A;  4JS5 A;  1VQ4 Q;  2EFI A;  5I22 A;  2D9T A;  2M16 A;  2E5K A;  4E7K A;  1FXX A;  2HKN A;  1NM7 A;  2RJD A;  4JJD A;  4WCI A;  3A8G B;  5GAO r;  5IH2 A;  2JZ2 A;  1FX7 A;  2LCL A;  2FG0 A;  2OTJ T;  2KXD A;  1KQS P;  4DBH A;  1TSF A;  2PQW A;  4M7A E;  2K5F A;  1NYG A;  3M4Y A;  1VQ8 Q;  2DO3 A;  2JMA A;  1I07 A;  4IIO A;  2RD1 A;  4BY6 C;  1M90 C;  2DZ9 A;  2Z0W A;  1LPL A;  4J83 A;  2LQW A;  4M75 B;  1K8A R;  5KYN A;  1VQN Q;  1Y57 A;  4IUR A;  1VQK A;  3CD6 Q;  1KJW A;  4IIM A;  4C5I A;  4TVR A;  3SEM A;  5HY6 A;  2H3J A;  4F7U E;  1TWB A;  1NLO C;  4J5Y A;  5M9O A;  1RAC B;  2E1H A;  1N9R A;  1FMK A;  2LMJ A;  3M0Q A;  1RL2 A;  3VS7 A;  2HBP A;  2HQE A;  2SEM A;  2FEI A;  4MZT A;  1RAE B;  1KQ2 A;  1WJQ A;  2ATC B;  1PD0 A;  2K5L A;  4AG2 C;  1PRM C;  2WSE E;  3BY7 A;  2FPF A;  2B8A A;  2O01 E;  2QQS A;  4II1 A;  2CGH A;  4OMM A;  4BAC A;  4C92 F;  1QCO A;  1VIF A;  1QLY A;  4C8Q C;  3HTR A;  4DOV A;  1VQ9 T;  4RMO A;  1AWJ A;  4RCB A;  2P4T A;  2ZCF B;  1X01 A;  5LJ3 h;  4AMC A;  4QW2 A;  2EYX A;  4E2F B;  3HFO A;  1KFZ A;  1HYO A;  1I8F A;  5GAO l;  1ABO A;  3M0T A;  4M78 A;  1PRL C;  1YNZ A;  4HXJ A;  1TUC A;  2ZPE B;  1WXU A;  3VUZ A;  2EJF A;  1S72 Q;  5KYY A;  3CC4 A;  1X69 A;  2LX7 A;  2F2V A;  3V7S A;  1YJN T;  3LGL A;  3OYG A;  1BI0 A;  1HXD A;  1IO6 A;  1KIK A;  1U1S A;  3I35 A;  1KQ1 A;  1XOV A;  1GXI E;  1IRX A;  1V1C A;  3CCE T;  3AT1 B;  5LJ5 e;  4DOW A;  2ROT A;  1GCQ A;  2JM9 A;  4PJO G;  2JVV A;  5HK3 A;  4C5G A;  2NYS A;  2JUF A;  3PGG A;  4E6R A;  5IHI A;  1W1F A;  1WX6 A;  1D1B A;  3CCS Q;  5LJ3 d;  3CXC S;  1UDL A;  2PTK A;  1MV0 B;  1VQ6 A;  2EWN A;  2EJ9 A;  4PJJ A;  4HCB A;  3C4S A;  3G71 A;  3QO3 A;  4BD3 A;  1CSK A;  2D1X A;  4OB3 B;  2BTT A;  3JCM X;  4M78 B;  1VQL A;  2DFU A;  3UF4 A;  1Q82 U;  3OQ5 A;  4M7D G;  1M8M A;  2AIR B;  2DL3 A;  4HCZ A;  4J9D A;  1UEC A;  2HL5 C;  2JS2 A;  4EMH A;  3SHW A;  4MZP A;  1RAI B;  3FJP A;  1M3C A;  4N0A A;  1A0N B;  4Q5W A;  1RAH B;  2FVU A;  4JRK A;  2LP5 A;  5GAN 5;  1ZHI A;  2KDS A;  3ASK A;  2GBQ A;  3KFV A;  3E9F A;  1I0C A;  3QYH B;  2EQK A;  1Y71 A;  2Y4Y A;  5I2S A;  4BDY A;  2QDY B;  2DL5 A;  2RHY A;  2OTJ A;  1UTI A;  1T0H A;  2ECZ A;  4ZN3 A;  4FYX B;  1DJ7 B;  3L1A A;  4QQG A;  4XTU A;  1YIT T;  4CRI A;  1T3S A;  1S72 T;  4FT4 A;  4M77 E;  2EVR A;  1VQO A;  1WXT A;  4R0K A;  5CKE A;  5LJ3 g;  2YSQ A;  4RUG A;  4E7S A;  2DL7 A;  1GBQ A;  4LXC A;  4J7I A;  1K8A U;  1BK2 A;  2MCN A;  3HHT B;  3L2U A;  1VQM Q;  2A08 A;  1RLQ C;  1YHQ Q;  4PJO F;  3L2W A;  3TSW A;  2YUO A;  2FZG B;  1BIB A;  1JJ2 P;  1KSW A;  4L59 A;  3EG2 A;  3CCU T;  3GNF B;  3OYN A;  1OPL A;  1ZUY A;  2KRS A;  1AHJ B;  3CC2 T;  3JSC A;  3CMA T;  1VQ9 A;  2F1L A;  4JRP A;  2GQI A;  1KHC A;  3M56 A;  3OYD A;  1UGP B;  3H0H A;  1PKS A;  4GLM A;  1MUZ A;  2CH4 A;  1BI3 A;  3LWI A;  4QVD A;  4NS5 A;  2JMC A;  4LE9 A;  5D6X A;  3VJP A;  4C92 A;  3UDC A;  5GMK e;  4M7D F;  3EG9 A;  3RR6 A;  3CBO A;  3QYG B;  3QZ9 B;  3OYK A;  3NTI A;  1ZSZ A;  4R55 A;  4M7A G;  4Y91 A;  1IGQ A;  1YJN A;  2GFA A;  4OGC A;  2WAC A;  2L3S A;  1Y96 A;  2ZZD A;  4OML A;  1YJW Q;  3LX7 A;  3RKY A;  2LVM A;  1KC8 C;  2EQJ A;  1UJY A;  4DBQ A;  3E2U A;  3TCJ A;  2KRO A;  4X34 A;  4PJN A;  2CP6 A;  1X2K A;  4LDW A;  3HRU A;  3CCE A;  3E9G A;  3OYC A;  1R0B G;  3OYL A;  1RAA B;  3KBG A;  1M90 U;  2EQI A;  5DLO A;  4F7U G;  1OEB A;  5EC7 A;  3CCQ Q;  2E6N A;  4PJO D;  4HT8 A;  1OV3 A;  2HL3 A;  1W4S A;  4BI8 B;  4FSX A;  1SPK A;  1VQ8 A;  1KHI A;  5HKC A;  1EIF A;  5IXB A;  4Z89 A;  1BCM A;  4M78 C;  3G1J A;  3NHN A;  1KQS A;  1IB8 A;  1VQN A;  4CC3 A;  2HQX A;  1X6B A;  4NL2 A;  3JB9 F;  3CCL T;  3SB2 A;  1YIJ Q;  2DD5 A;  4B6M A;  4C92 B;  2X4X A;  2V1Q A;  5J3B A;  5IXF A;  3TU4 K;  3HPW A;  3EG9 B;  4M7D D;  2E5Q A;  5GMK l;  5GAM d;  3S3M A;  1FWZ A;  3LYI A;  3QII A;  2EGE A;  2R5M A;  2LZ6 B;  2DRM A;  2F69 A;  4J7F A;  1Y96 B;  4RTU A;  3HL8 A;  1JU5 C;  3CCM Q;  1J3T A;  3EFO A;  4IUT A;  2XDB A;  1GCQ C;  2QGF B;  1TU0 B;  1KC8 R;  2HD0 A;  3JCM h;  1NBE B;  3UAT A;  3CME Q;  1M1F A;  1YFN A;  4ZTJ A;  1OYX A;  3M55 A;  3VS6 A;  3QHS A;  1MMD A;  1SF9 A;  4HT9 A;  1VQK T;  4RTY A;  4YTL A;  1N6A A;  1S72 A;  1TOV A;  3OYY A;  2DKG A;  3E19 A;  3PMT A;  4XAX B;  4J9E A;  4BE0 A;  2M1H A;  4EMK A;  3RER A;  2IIM A;  5GMK m;  2HAX A;  3CC7 Q;  2ZPB B;  2O2O A;  5IT9 E;  2BE9 B;  1UG1 A;  5KYU B;  3L2Z A;  4N0A C;  2OTL Q;  5FRM A;  2VGM A;  3M54 A;  4PJM A;  2DJZ A;  3CCU A;  2O4X A;  4J9G A;  3CCJ T;  2XHC A;  1YI2 Q;  3M9Q A;  2RO0 A;  1Q86 C;  1M1K C;  2BZ8 A;  2QQ9 A;  3EH1 A;  2HMA A;  3CC2 A;  4IUP A;  4XU3 A;  3JCM d;  3EFO B;  5GAM g;  3CCR Q;  3G4S Q;  2GTO A;  1K0X A;  2O9V A;  1H3Z A;  4PJO A;  1WHK A;  3CC4 T;  1BU1 A;  2DER A;  2CSQ A;  2X51 A;  1KD1 U;  2VUB A;  5LJ3 e;  1TH7 A;  1K9M C;  3UPU A;  2K7A A;  2QAS A;  4BB7 A;  2E3H A;  4J9H A;  2KYM A;  3OS0 A;  3VS2 A;  2R5A A;  2ABL A;  2DD4 A;  1XJW B;  2GNC A;  4J9F A;  2ZAE A;  2RI2 A;  3PT9 A;  4M7A D;  1VA7 A;  4M75 E;  4N4I A;  1R8O B;  1PHT A;  1AEY A;  1ZUU A;  4BI3 A;  1QCF A;  2LT4 A;  2OI3 A;  1QCN A;  4M77 G;  3VS4 A;  4M7D A;  1F1B B;  1ACM B;  2W0Z A;  4JRQ A;  2YRC A;  2KRN A;  1JEG A;  2E4H A;  2PNI A;  3X26 B;  2FRY A;  2XKO C;  1UE9 A;  2VC8 A;  1VQ6 T;  3EGX A;  2VXE A;  4RG8 A;  5IHK A;  1GL5 A;  1AOJ A;  5KCH A;  3G71 T;  4AG1 C;  3L2V A;  1Q82 R;  1GFD A;  2K2V A;  2X4W A;  2KNB B;  2DVJ A;  3MP1 A;  4KUD K;  4OF1 A;  1M1K R;  4PJO B;  2HSP A;  3X28 B;  2O31 A;  3VYG A;  2DA9 A;  1WZO A;  4C92 C;  2K79 A;  1UGS B;  1JRI A;  3JCM g;  3CC7 T;  2BIV A;  2KSS A;  3M53 A;  3CCL A;  2VV5 A;  1U5S A;  4LD9 K;  2EW3 A;  2JW4 A;  1YHQ A;  4FL6 A;  1M2V B;  2MF2 A;  4C0F A;  2K3X A;  2OTL T;  2QTX A;  1EFN A;  2L3R A;  1K9M R;  3OYB A;  2MMP A;  1TUG B;  4LN2 A;  4FCY A;  3I55 Q;  1YI2 T;  1B7T A;  2JS0 A;  2WSC E;  1Q81 C;  3ER0 A;  1K73 C;  2PVO B;  2RB6 A;  2CH4 W;  2BE7 D;  3G4S T;  4M7D B;  2C0T A;  2CZ0 B;  4NOY A;  4FIB A;  1JJ2 A;  1X75 C;  3NMZ C;  2H3E B;  1SG5 A;  3QJ6 A;  2K3B A;  1KC8 U;  2XID A;  2DMO A;  2ED0 A;  2FL7 A;  3EGX B;  1VQO T;  1FYN A;  1B3Q A;  1O75 A;  3E1S A;  3OW2 A;  1NJI C;  1C0M A;  3QKJ A;  2RJF A;  2AZV A;  2DTO A;  1N8R C;  1YWO A;  4OB1 B;  4GBQ A;  5I21 A;  3JCM V;  4Z8A A;  3QG1 A;  4CC7 A;  1C1A A;  5FWB A;  2LNH B;  5EG2 A;  1V76 A;  5CR2 A;  2CP5 A;  4M77 F;  3S3O A;  4B9W A;  2SRC A;  4M78 E;  3JV3 A;  2BZX A;  2P4R A;  4D8K A;  2DTI A;  1VYU A;  4M7A A;  3V8J A;  2DBM A;  2YRD A;  4ME7 A;  2KE9 A;  2F2X A;  1PKT A;  3CCQ A;  4ZGD B;  4OP0 A;  3DLM A;  1Q95 G;  3CCJ A;  4OMP A;  1OI1 A;  5GAN 6;  4L5G A;  4RTZ A;  5CVI A;  1EZZ B;  4ATO A;  2FO0 A;  3V7R A;  2QQR A;  2FPE A;  4F7U A;  3FJ5 A;  2FZK B;  3MEU A;  2XIC A;  1Q81 R;  2MOX A;  4QQ6 A;  1AZE A;  3A5Z B;  1HSQ A;  3EHQ A;  4E7H A;  4OB0 B;  4Y92 A;  1WJS A;  2OAW A;  3OYM A;  2EJG A;  2M51 A;  3L42 A;  1YIJ A;  4A4F A;  3OYA A;  5GAN e;  1PC0 A;  4EMK C;  2QGG A;  1M90 R;  1Y07 A;  1G3W A;  4KT0 E;  1VQ4 T;  2QDL A;  1Y7X A;  2RI5 A;  2A28 A;  4KRT A;  1WA7 A;  5A0L A;  3OMC A;  2V8I A;  2G3R A;  1JJ2 S;  2QTV A;  1N8R R;  3ZFJ A;  1U8R A;  1I1J A;  1X2Q A;  2VKN A;  3IQL A;  5LJ5 j;  4M77 D;  1Q7Y C;  5GAM e;  3OA6 A;  2YT6 A;  2GF7 A;  1VQ8 T;  2YRV A;  1E7O A;  2K2M A;  4JLG A;  3TSZ A;  5GAO m;  5A0G A;  4XU0 A;  3X25 B;  4P5N A;  2COZ A;  4OB2 B;  3M0S A;  1VQN T;  5FW9 A;  4J6W A;  3CD6 T;  4PJO C;  2J7I A;  2EYZ A;  2HQH A;  3VYH B;  3MHX A;  1LJO A;  1KK7 A;  2RMO A;  1G8X A;  3MEV A;  5GAO q;  1S1N A;  4FU6 A;  4MMK A;  2QG9 B;  2EYQ A;  3UT1 A;  2X3X D;  1OQK A;  1HJD A;  5KYY B;  3CC7 A;  1N5Z A;  1V29 B;  1Q86 U;  1M1K U;  3QSU A;  3QWY A;  1OU8 A;  4HA8 A;  2EIF A;  1KD1 C;  4PFZ A;  1MV3 A;  4DEX A;  6AT1 B;  1TG0 A;  2G6F X;  1YN8 A;  4R56 A;  2JNG A;  3H6Z A;  3S3N A;  2OTL A;  4CI0 C;  2IPO B;  2DEQ A;  2VB6 A;  4FYW B;  3NFC A;  4BUG A;  2V1R A;  4KH0 B;  3EG3 A;  4FM4 B;  2E70 A;  3G7Z A;  1X27 A;  2RHZ A;  4IUV A;  2M9U A;  4M7D C;  3G6E Q;  1YI2 A;  3PMI A;  4KUI A;  1K9M U;  3P8H A;  3RIR A;  3LGF A;  2A7Y A;  3HKS A;  4M75 G;  3CCR A;  2DRK A;  3G4S A;  2MPX C;  2DL8 A;  3H0I A;  3JB9 H;  3V7C A;  1M30 A;  2L0A A;  4XQ3 A;  2EQM A;  3I5R A;  3PIP A;  1O9S A;  2DET A;  1NEB A;  1Q7Y R;  2QK0 A;  1QVF P;  3CCV Q;  1GRI A;  4OMF B;  2ROL A;  1BCO A;  2JTM A;  2LJ3 A;  2E3I A;  3GF5 A;  2MWP A;  2W10 A;  3EHR A;  3J7A F;  4PK4 A;  1AZG B;  2FRW A;  3NGP A;  2E65 A;  2CP2 A;  2X35 A;  2HKQ B;  3JCM b;  1WHM A;  4OMN A;  2QEX Q;  4E7I A;  2CP0 A;  1W2B P;  1WQ7 A;  2Y4X A;  3C94 A;  1UB4 A;  3LH0 A;  1RLP C;  2RQW A;  4C0G A;  1M2O A;  3A98 A;  2NUZ A;  1VQ7 Q;  4C92 E;  1G3Y A;  1CKB A;  3RNJ A;  3M5A A;  2YDL A;  3MO8 A;  3CCS T;  1IGU A;  1JBM A;  4QQD A;  2VVK A;  5A0D A;  4A4G A;  2RA2 A;  1JXO A;  3OW2 P;  2AT1 B;  1KD1 R;  1JXM A;  2AHJ B;  3I9Q A;  5CKH A;  4M77 A;  4ZGE B;  2RK1 A;  4M4Z A;  1OZ2 A;  1D3B A;  2RJE A;  3GOX A;  5GAN 7;  2L3P A;  2RHI A;  3VU3 C;  2COW A;  2XDD A;  3SWN A;  2QQA A;  4HCK A;  1TXQ A;  4A63 B;  3JCM Q;  4X1V A;  4ELY C;  1X43 A;  1Q81 U;  1RAD B;  2RNA A;  3VRY A;  3WVE B;  3CQT A;  1SEM A;  5GMK j;  1K73 U;  2FZC B;  5CCA A;  3WVD B;  4C0D B;  3KUF A;  1W70 A;  4PL6 A;  5LJ5 h;  1BBZ A; 
#chains in the Genus database with same CATH homology
 2H8H A;  4J9G A;  1OPK A;  1K4U S;  2KR3 A;  2BZ8 A;  1K1Z A;  2JMA A;  1I07 A;  1UHC A;  2RQT A;  4IIO A;  2L3Q A;  5ECA A;  1WXB A;  2D0N A;  2GTO A;  1K0X A;  2LQW A;  3VRZ A;  2O9V A;  1Y57 A;  1SHG A;  1KJW A;  4IIM A;  3PVL A;  3SEM A;  1BU1 A;  2CSQ A;  3QWX X;  1YWP A;  1NLO C;  1G83 A;  2K7A A;  1FMK A;  2LMJ A;  3M0Q A;  3VS7 A;  2AKL A;  2CSI A;  2SEM A;  1NEG A;  2FEI A;  4J9H A;  2KYM A;  1K0S A;  2CDT A;  1SHF A;  3VS2 A;  4JPB W;  2ABL A;  4RTX A;  1TUD A;  2GNC A;  4AFZ C;  1AWX A;  4J9F A;  4AG2 C;  1PRM C;  3EGU A;  1U3O A;  2FPF A;  4JJC A;  2F2W A;  3M0P A;  1VA7 A;  1QKX A;  2DM1 A;  4OMM A;  1UJ0 A;  4J9B A;  1PHT A;  1AEY A;  1ZUU A;  1QLY A;  1ZX6 A;  1QCF A;  2OI3 A;  4RTT A;  1AWJ A;  1UHF A;  3VS4 A;  2W0Z A;  2NWM A;  2KYB A;  1K9A A;  1PNJ A;  2KT1 A;  2EYX A;  2JM8 A;  3REB B;  1KFZ A;  5FWC A;  2KRN A;  1NLP C;  1JEG A;  2PNI A;  2FRY A;  1ABO A;  3M0T A;  1UE9 A;  1Z9Q A;  1PRL C;  1YNZ A;  4HXJ A;  2OJ2 A;  2D8J A;  1NG2 A;  1TUC A;  5IHN A;  1WXU A;  2AKK A;  5IHK A;  4JZ3 A;  1AWW A;  1GL5 A;  1WI7 A;  1AOJ A;  1X69 A;  2EYY A;  2LX7 A;  4AG1 C;  1GFD A;  2F2V A;  2RF0 A;  2LJ1 A;  2KNB B;  2DVJ A;  1LCK A;  1IO6 A;  1KIK A;  3I35 A;  3H41 A;  2HSP A;  2O31 A;  2DA9 A;  1WIE A;  1XOV A;  2K79 A;  1SRL A;  2ENM A;  1M3B A;  1V1C A;  1ZBJ A;  4OMO A;  3M0U A;  2O88 A;  4AFQ C;  1U5S A;  2ROT A;  1GCQ A;  1JO8 A;  1QKW A;  2JM9 A;  2EW3 A;  2JW4 A;  2J06 A;  2EPD A;  1EFN A;  4E6R A;  5IHI A;  4LN2 A;  1H8K A;  1W1F A;  1WX6 A;  4F14 A;  4HVU A;  4RTW A;  2JS0 A;  2VWF A;  2M0Y A;  1UDL A;  2PTK A;  1MV0 B;  2HDA A;  2YUP A;  2CT4 A;  4QT7 A;  2CH4 W;  2C0T A;  2RQU A;  3NMZ C;  3PVQ A;  1QWF A;  2O9S A;  1SRM A;  4FSS A;  2K3B A;  1CSK A;  2D1X A;  2BTT A;  2DMO A;  2DNU A;  2ED0 A;  3EG1 A;  3UF4 A;  4Z88 A;  2DF6 A;  1T0J A;  1M8M A;  2DL3 A;  1FYN A;  4J9D A;  1B3Q A;  2KEA A;  1UEC A;  2JS2 A;  3VS5 A;  4F16 A;  3SHW A;  2AZV A;  2C0I A;  3H0F A;  4OMQ A;  1M3C A;  4K11 A;  1A0N B;  1YWO A;  2HCK A;  4GBQ A;  4Z8A A;  2LP5 A;  4HVW A;  4LUD A;  4CC7 A;  2A37 A;  5FWB A;  2LNH B;  1YCS B;  2CUB A;  2DX1 A;  2GBQ A;  3KFV A;  1ABQ A;  1G2B A;  1I0C A;  2SRC A;  1RI9 A;  3JV3 A;  1BB9 A;  2BZX A;  2P4R A;  2AZS A;  4D8K A;  1AVZ C;  2YUN A;  1VYU A;  2B86 A;  4LNP A;  2AK5 A;  5I11 A;  2DBM A;  4JZ4 A;  2DL5 A;  1UTI A;  2KE9 A;  1M3A A;  2RPN A;  1T0H A;  2ECZ A;  2F2X A;  1PKT A;  1UGV A;  4OMP A;  4RTZ A;  1UFF A;  1T3S A;  2EGA A;  2CT3 A;  4J9C A;  1ARK A;  2FO0 A;  2J6O A;  2EKH A;  2EVR A;  2MIO A;  2RN8 A;  2FPE A;  1WXT A;  4R0K A;  1U06 A;  3FJ5 A;  2HEQ A;  2YSQ A;  4RUG A;  3I5S A;  2MOX A;  2DL7 A;  1GBQ A;  1AZE A;  1HSQ A;  1BK2 A;  2KXC A;  3EHQ A;  2MCN A;  3NPF A;  4Y92 A;  2DJQ A;  2C0O A;  3LH5 A;  1E6H A;  2OAW A;  2A08 A;  2PZ1 A;  2M51 A;  1RLQ C;  5GJW B;  3TSW A;  2YUO A;  2K9G A;  1KSW A;  2X3W D;  3EG2 A;  4HVV A;  1W6X A;  1OPL A;  2QDL A;  2DL4 A;  1ZUY A;  2KRS A;  2FPD A;  3THK A;  2A28 A;  2DLP A;  1WA7 A;  4KRT A;  4AFU C;  3ULR B;  2GQI A;  2RQV A;  3UA7 A;  4EIK A;  1WFW A;  3H0H A;  1I1J A;  1X2Q A;  3VS3 A;  2VKN A;  3IQL A;  1PKS A;  4GLM A;  2ED1 A;  2HBW A;  2YT6 A;  1MUZ A;  2CH4 A;  1E7O A;  2A36 A;  1E6G A;  3U23 A;  2K2M A;  3TSZ A;  2I0N A;  2JMC A;  1X6G A;  4LE9 A;  4ORZ A;  2KGT A;  1VYV A;  3VS1 A;  4CC4 B;  3M0S A;  5FW9 A;  2J7I A;  4LUE A;  4ESR A;  2EYZ A;  2L3S A;  4OML A;  2RMO A;  4CC2 A;  1S1N A;  1UJY A;  2EGC A;  1JQQ A;  2DIL A;  3VS0 A;  2KRO A;  2D8H A;  2X3X D;  3M0R A;  1M27 C;  1X2K A;  1H92 A;  1HJD A;  1N5Z A;  1Y0M A;  3QWY A;  1Z9Z A;  1VYT A;  2EQI A;  1MV3 A;  4DEX A;  2LQN A;  4AFS C;  1TG0 A;  1ZUK A;  2G6F X;  1YN8 A;  1OEB A;  1WDX A;  5EC7 A;  3UA6 A;  2KRM A;  1WYX A;  2V1R A;  3EG3 A;  1OV3 A;  1NYF A;  3PE0 A;  1X27 A;  5L23 A;  1AD5 A;  1SPK A;  2JT4 A;  1B07 A;  4J9I A;  1RUW A;  1OOT A;  5IXB A;  3GBQ A;  4Z89 A;  1AWO A;  2DYB A;  4JJB A;  2DBK A;  2LCS A;  1SSH A;  2DRK A;  2JXB A;  2DL8 A;  3H0I A;  3NHN A;  1CKA A;  2DE0 X;  2GTJ A;  1M30 A;  1YP5 A;  2L0A A;  2YUQ A;  4CC3 A;  2KBT A;  2ESW A;  1X6B A;  1ZLM A;  3I5R A;  2EYW A;  2K6D A;  2CUD A;  2JTE A;  2BZY A;  1NEB A;  2CRE A;  2V1Q A;  1GRI A;  1T3L A;  5IXF A;  2ROL A;  2LJ3 A;  2W10 A;  3EHR A;  4RTV A;  2EGE A;  4DEY A;  2LZ6 B;  2DRM A;  1GBR A;  2J6F A;  1AZG B;  2LJ0 A;  2FRW A;  3NGP A;  4RTU A;  3R6N A;  4OMN A;  5GJV B;  1H3H A;  2GGR A;  1JU5 C;  3TVT A;  3ZL7 C;  2KT8 A;  1PWT A;  1GCP A;  1J3T A;  2XMF A;  1GCQ C;  4ZNX A;  3C0C A;  1QWE A;  2J05 A;  1RLP C;  2RQW A;  3A98 A;  2NUZ A;  1CKB A;  3RNJ A;  1K76 A;  2YDL A;  3UAT A;  2VVK A;  1JXO A;  3VS6 A;  1JXM A;  4D8D A;  3I9Q A;  4RTY A;  2J6K A;  1WLP B;  4M4Z A;  2RQR A;  4F17 A;  3EG0 A;  4J9E A;  3O5Z A;  5HCK A;  3RBB B;  1UUE A;  2L3P A;  1ZSG A;  2EBP A;  2IIM A;  2L2P A;  4HCK A;  5I22 A;  1GFC A;  2E5K A;  2O2O A;  4A63 B;  1UG1 A;  4X1V A;  1NM7 A;  1X43 A;  2RNA A;  4JJD A;  4WCI A;  3VRY A;  3CQT A;  1SEM A;  3REA B;  5IH2 A;  1HD3 A;  2FG0 A;  2KXD A;  1W70 A;  1NYG A;  1BBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...