4JJDA

Crystal structure of the n114a abl-sh3 domain mutant at ph4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
59
Chain Sequence
MENDPNLFVALYDFVATLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 12
structure length 59
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjdA00
2KBTA 1HJDA 4ESRA 5IHIA 2FRWA 3PVLA 1MV0B 1AWJA 1AVZC 2DL5A 2EBPA 1W70A 3A98A 1WYXA 2EW3A 2E5KA 4GLMA 1SRMA 1Y0MA 2RQRA 2MOXA 2YUNA 3QWXX 1PRMC 2JS0A 1MUZA 1LCKA 2DLPA 1CKBA 3EHRA 3VS6A 4J9IA 1YWPA 3GBQA 1WFWA 2JMCA 1GBQA 2AK5A 1I1JA 1UFFA 2K7AA 3U23A 1KFZA 1M8MA 4Y92A 4CC7A 1PKSA 1WXBA 2KYBA 1N5ZA 2L3PA 1M27C 2G6FX 2KYMA 2JS2A 2J6FA 3UATA 3EG0A 2M51A 1K0XA 1CKAA 2DA9A 1NLOC 1S1NA 1YP5A 1ABQA 2LQWA 4RUGA 3H0FA 1AWXA 1IO6A 4JZ4A 2HCKA 1OPKA 1BB9A 1E7OA 1GFDA 1TG0A 2SEMA 1UJ0A 2DX1A 4RTWA 1MV3A 1AWWA 2M0YA 1PRLC 1WI7A 2BZXA 1Y57A 4D8DA 2DYBA 3PVQA 2C0TA 4AFUC 1PWTA 5EC7A 2NUZA 5GJWB 2L2PA 3ULRB 4JJDA 2J05A 1WXTA 2VKNA 2YSQA 4K11A 1JO8A 2X3WD 4D8KA 1WIEA 3VS7A 2YUPA 1SRLA 2CDTA 1T0JA 3IQLA 2D8JA 3M0RA 1NEBA 1T3SA 2DL4A 4RTUA 2J06A 1HD3A 1KIKA 2YDLA 2DM1A 3I5RA 4J9BA 4HCKA 4Z88A 4CC2A 3THKA 2JT4A 2DF6A 2EYXA 1BBZA 2V1QA 2KT1A 3C0CA 4JJCA 2ED1A 1E6HA 2RQWA 4J9EA 4LN2A 1K76A 4X1VA 3CQTA 3UF4A 2JM9A 4E6RA 1Z9ZA 2LMJA 1B07A 2EQIA 1ABOA 2GGRA 3FJ5A 1AZEA 2RQVA 2OAWA 2DVJA 3NHNA 2RQTA 3RBBB 1HSQA 2KRMA 1K9AA 2FPEA 1FYNA 2ESWA 2BZ8A 2CREA 2GBQA 1X6GA 1JXOA 1ZX6A 2RPNA 4ZNXA 2C0OA 2LP5A 2VWFA 3VS2A 2YUOA 3VS4A 2K6DA 1ZUYA 1H92A 1NYGA 1RLQC 4HVVA 2W10A 3M0TA 2H8HA 1OOTA 3EGUA 2JTEA 3SHWA 2F2XA 5FWCA 2CUBA 1T0HA 4Z89A 1GRIA 1NG2A 1YWOA 1G2BA 2LNHB 1YNZA 3REAB 1NLPC 4FSSA 4KRTA 1VYVA 1X2QA 1RLPC 2SRCA 1NM7A 2CH4W 3LH5A 3QWYA 4J9HA 2KXCA 2ABLA 4JJBA 5ECAA 1UE9A 2DL7A 2KROA 2JXBA 2PZ1A 1AOJA 2QDLA 2FEIA 2GQIA 2AKLA 2EGAA 4HVWA 2KRNA 2EPDA 2EGEA 1UJYA 1K0SA 2MIOA 1E6GA 3H41A 3M0PA 4R0KA 4F17A 2I0NA 2K79A 5HCKA 1VA7A 2K3BA 1NEGA 1UDLA 2CUDA 2DRKA 2L3QA 1H3HA 1WLPB 1VYUA 4RTZA 2KXDA 4CC3A 5FWBA 3I9QA 1QKWA 1JQQA 5IHNA 2GTJA 1GL5A 3VRYA 1J3TA 2PNIA 2LJ1A 1QKXA 2VVKA 4AFZC 2K2MA 2LJ3A 3RNJA 5IHKA 4M4ZA 3VS1A 1M3BA 4OMLA 1GCQA 2ENMA 4OMOA 1GCQC 2RMOA 4HVUA 2J6OA 1VYTA 2A08A 2AKKA 2JW4A 4J9CA 2LQNA 2EYWA 1JU5C 4HXJA 1X6BA 2DE0X 2HEQA 1T3LA 2LZ6B 2DMOA 2K9GA 1YCSB 3TVTA 1SHFA 1SPKA 1UHFA 4JPBW 4LUDA 1SSHA 1QWEA 1ZUUA 2RF0A 2RQUA 1BU1A 3TSWA 3M0QA 4AFQC 2DBKA 2CSQA 3O5ZA 4J9GA 1SEMA 4RTTA 2BTTA 1TUDA 2PTKA 3UA7A 3VS0A 1KSWA 1UHCA 1NYFA 1YN8A 1U06A 1OPLA 2HSPA 4OMPA 3I35A 3ZL7C 1K1ZA 2FO0A 2FG0A 3M0SA 2KT8A 2FPDA 3SEMA 1OEBA 2EGCA 4A63B 5IXBA 3VS5A 2W0ZA 2CT4A 2GNCA 2AZSA 2CT3A 1PHTA 2LX7A 3REBB 1FMKA 4QT7A 1WA7A 1H8KA 1QCFA 2ROLA 4WCIA 1W1FA 1AEYA 1UGVA 1XOVA 2LJ0A 1U5SA 3NPFA 4F16A 1M3CA 3PE0A 2RN8A 2L3SA 3H0HA 1GBRA 3TSZA 2HBWA 2RNAA 5IXFA 2X3XD 1WX6A 2O9VA 2FPFA 1UTIA 3EG2A 4DEXA 2DNUA 1KJWA 2O9SA 4GBQA 2DBMA 5L23A 1Z9QA 4IIMA 1V1CA 2IIMA 2JM8A 2O2OA 2LCSA 1GFCA 2A28A 1ZLMA 4J9DA 3EHQA 2ROTA 2DRMA 2ED0A 3VS3A 2MCNA 2CH4A 2OI3A 3JV3A 2D1XA 4JZ3A 1WXUA 2D8HA 4OMMA 1CSKA 2F2VA 1B3QA 4LE9A 2CSIA 1JEGA 2P4RA 2EYZA 3EG1A 1SHGA 2YT6A 3M0UA 4RTYA 2OJ2A 5FW9A 2J6KA 1WDXA 1AZGB 1W6XA 3NGPA 4RTXA 5I22A 1G83A 1EFNA 3EG3A 3I5SA 1ZUKA 1QLYA 1AD5A 2AZVA 1TUCA 1U3OA 4LUEA 2KR3A 3H0IA 2KEAA 2DILA 2ECZA 2KGTA 1K4US 4OMNA 1X69A 4Z8AA 1OV3A 3R6NA 2L0AA 4AG1C 2EKHA 1PKTA 4RTVA 2HDAA 4AG2C 3UA6A 4F14A 2NWMA 1QWFA 1BK2A 1AWOA 3VRZA 1X43A 2A37A 5GJVB 2DL3A 3KFVA 4CC4B 1I0CA 2A36A 2YUQA 1UUEA 2DL8A 1JXMA 1X27A 1UG1A 2J7IA 2GTOA 4AFSC 4OMQA 2JMAA 1X2KA 1I07A 1RI9A 4IIOA 2KNBB 2D0NA 2KRSA 2F2WA 2B86A 2EVRA 2O88A 4LNPA 1M3AA 1M30A 1RUWA 1ZBJA 1ARKA 3NMZC 1A0NB 4J9FA 4EIKA 2FRYA 1ZSGA 2C0IA 2O31A 1UECA 4ORZA 2BZYA 2KE9A 2XMFA 1GCPA 5I11A 4DEYA 2DJQA 5IH2A 2V1RA 2EYYA 1PNJA
chains in the Genus database with same CATH superfamily
3OW2A 1HJDA 1ZA1B 2FRWA 5GANh 1MV0B 5LJ3d 4M7DG 5GAOm 3A98A 1QMCA 3GLXA 2QEXA 1VQ6A 1BKBA 1SRMA 2E12A 2C06A 1QQJA 1LCKA 2DLPA 3X28B 5KYNA 3EHRA 4FL6A 1MGQA 5LJ3j 2A7YA 1YWPA 2BIVA 1VQ9Q 3GBQA 3QYHB 1WFWA 1WPYA 2JMCA 1GBQA 3WXMB 4V2SA 1VQMQ 1D1CA 3X26B 4C0ZA 4Y92A 1PKSA 1N5ZA 3ZFJA 2G6FX 2KYMA 2JS2A 4JS4A 1Q86R 3O8VA 4QQGA 1OZ3A 1PD0A 2RJDA 4E7JA 1S1NA 4OB0B 1Y96B 2RB6A 4RCBA 1AWXA 3G7ZA 2Y90A 3G71Q 2VV5A 1Q7YR 1BB9A 1E7OA 1GFDA 1IGQA 3VUBA 1BI2A 1TG0A 2MF2A 2QA4A 1PRLC 3ME9A 4C8QE 3JB9H 3RKYA 2DD4A 2OAUA 1PWTA 2NUZA 1M1FA 2VGMA 4XTZA 1WXTA 3NTIA 1R8OB 3ZEHA 5GMKi 3CMAT 3CCVA 2F1LA 2D8JA 1MNDA 5C6SA 2CP2A 1WJQA 2P0KA 3SB2A 3JCMb 1Q7YC 2L89A 1KD1R 1I81A 3LYIA 4RTUA 4PKCC 1KIKA 1VQLQ 4ZTFA 2DM1A 1VQOQ 3THKA 4ZGEB 2P0PA 5HKCA 2ZPHB 5GAMf 4ELYC 4KULA 3CQTA 1M4ZA 3UF4A 1Z9ZA 2LMJA 2EQIA 2GGRA 3FJ5A 3NHNA 1M90R 1X6OA 1FYNA 1N8RU 1HK9A 2ZPEB 2E6ZA 3LX7A 3MEAA 3RESA 3J80E 2LC4A 3NTHA 3L2WA 2RM4A 4PFZA 4RCCA 1NE8A 3EG9A 5CQXA 4B9XA 1KC8U 3M0TA 1D3BB 2H8HA 2D6FA 3CCQT 4DBHA 3CD6A 3SHWA 4QKUA 4C92D 3G6EA 1WHMA 2FVUA 3TREA 1T0HA 3LGLA 4PJOB 4Z89A 1GRIA 1WZOA 3MJXA 1M90C 1YWOA 2MMPA 2VUBA 4FSSA 4HCZA 3EGXA 4KRTA 1RLPC 2SRCA 4DBFA 2CH4W 4IUUA 2PUOB 3QWYA 3PFSA 2KXCA 2ABLA 4JJBA 1UE9A 2NUPB 2ATCB 4VUBA 2PZ1A 1DJ7B 2EGAA 1FWZA 3OYIA 4A4KA 3HRTA 1YJNA 3OS5A 1BI1A 2NUTB 2MIOA 1Q82U 3C12A 3M0PA 4KT0E 3E1SA 3CPWS 1OULA 4F7UE 1WGSA 1UDLA 2QQSA 2L3QA 5LJ5j 2EFIA 4M7DD 4RTZA 4HCCA 1WJRA 3HRSA 1TXQA 1YITT 3VV0A 3PGGA 3QDRB 5HY6A 3A8GB 1Y96A 3V8KA 5FU6B 1QVGS 1NJIC 3OW2P 5GAN7 4HCBA 2ZZDA 3VS1A 1M3BA 3CCMQ 2JJ9A 3HKSA 4BDYA 4HT8A 2ENMA 2XDBA 2QI2A 1WQ7A 3J81E 2CS7A 1YIJQ 4XK8E 2RHXA 3OA6A 4J83A 2EYWA 4J8OA 1X6BA 2HEQA 2E4HA 3SDZA 2VXFA 2Z0WA 1R0CB 3L2UA 1SHFA 4FCYA 2JTMA 4C8QF 3GOXA 1K9MR 4HA8A 2D9TA 2QAZA 2RF0A 3CCLT 1OQKA 4J9GA 2XI9A 4LDUA 1MMDA 4M77F 5CKEA 1WQWA 3JCMg 2HSPA 1M8VA 3ZL7C 3QZ5B 2LVMA 2FO0A 2LTOA 3CC7T 1BIBA 4M7AA 4A63B 4C8QG 1K9MC 4M7AC 3VS5A 4JS5A 2GNCA 1RAHB 1VUBA 3CBOA 1PHTA 4BE0A 1TOVA 1QCFA 3I56T 2CYZB 3QG1A 4WCIA 1WHJA 1XOVA 4M77G 2DEUA 4QW2A 1U5SA 5KYUB 2RN8A 1TU0B 1VQ4T 4R56A 2QDYB 5CAIA 4J6YA 2FZKB 5J3BA 4MMLA 4MDXA 1ZSZC 1GBRA 3TSZA 2X3XD 2O9VA 4M75A 3OBWA 4M75C 3F70A 2MAMA 5GAN5 3EG2A 2CP5A 4DEXA 1KG1A 5GAMd 1B34B 3CC2A 2EJFA 3PMIA 3RERA 3CCJT 4JRQA 2P84A 5DY9A 4IIMA 1YHQT 3X24B 1QVGA 2EAYA 1VQ8T 3CMEQ 4N4GA 1M2VB 3URGA 3LWHA 1GFCA 2A28A 2YRDA 4C92E 5GAMj 2ROTA 2DRMA 1OU9A 3QDFA 2DVEA 4R55A 2M1HA 3JV3A 3CXCS 2Y4XA 1WXUA 1KQSP 2KAFA 2RI3A 1Y7XA 4LE9A 1EIFA 2GF7A 1JEGA 2P4RA 1NZ9A 2JTFA 1I8FA 1SHGA 2YT6A 4RTYA 5FW9A 2V26A 1WDXA 4KH1B 4RTXA 3FLGA 1G83A 3HFNA 1G3WA 3MO8A 5HK0A 1QLYA 3EFSA 1TUCA 1D0XA 2KR3A 3H0IA 2DILA 1VQ9A 1K4US 1RAEB 3MP6A 1X69A 2VXEA 1YITQ 3R6NA 2EKHA 3SD4A 1VQMA 2FHDA 1KHCA 4E7ZA 1K73U 8ATCB 3OYHA 3EH1A 4E2FB 2RI2A 2EQMA 1X43A 1HXDA 4EDUA 1LJOA 1UUEA 5KYWB 2DL8A 2K5FA 1UG1A 5EG2A 2J7IA 2GTOA 3S3MA 4AFSC 5GMKj 3G71A 2JMAA 4F7UB 1I07A 3H9NA 2OTLT 4RG2A 2E64A 4J6WA 3E19A 1M3AA 3A1PA 1QCOA 2A0FB 1M30A 1ZBJA 2EJ9A 4J9FA 4EIKA 4ORZA 3AT1B 3D7SB 4E47A 3M4YA 3JCMe 5GAN2 5I11A 1N8RR 3P8DA 1VQKT 1BIAA 5IH2A 1NPPA 2CGHA 3CC7Q 3Q1JA 2KBTA 4ESRA 2JOYA 2RJFA 3PVLA 4IURA 4M77C 1AWJA 1VQPT 1KC8R 1VQLA 1VQ5T 1AVZC 2EBPA 1WYXA 1VQOA 1VIFA 3I56Q 3CPFA 5GAOr 2RQRA 3OSSC 2YUNA 3CC4T 3QWXX 2QK0A 1PRMC 1RAGB 4D6WA 1MUZA 2JS0A 3VS6A 5KYUA 4J9IA 5IT9E 5LL6S 4C8QD 2XU8A 1VQ4Q 4FW1A 3L2QA 2AK5A 2K7AA 1KFZA 1BI0A 4CC7A 3OYKA 3OYGA 1M27C 1KC8C 3OB9A 4N4HA 1K0XA 3CCJQ 1OZ2A 1G3TA 3OBYA 2CZ7B 3MP1A 4JLIA 2DYIA 4OF1A 3JCMh 4BUGA 1Q82R 4M7AE 1VQ8Q 1M2VA 3H0FA 3OSVA 4JZ4A 4C5IA 4BD3A 3BFMA 5LJ3g 2SEMA 3SWNB 4RTWA 1WI7A 2DZCA 2BZXA 1K8AR 1Y57A 1FX7A 2DYBA 3PVQA 5EC7A 1WJSA 3CPWP 4C0DC 1YFNA 2X9HA 3M4GA 2J05A 1B7TA 2VKNA 2YSQA 4C5GA 1JO8A 3HHTB 4D8KA 4GLKA 3WVDB 1Q82C 3VS7A 4M75E 3RR6A 1I4K1 3TU4K 1QVPA 3QYGB 4OB1B 2VGNA 1IREB 2K2VA 1NEBA 1VQ7Q 2YWWA 4JUVA 2YDLA 3I5RA 5L8RE 4Z88A 4LDXA 1D0ZA 2EYXA 5CK9A 1SG5A 3C0CA 5GMKl 3CCUT 2ED1A 1E6HA 2RQWA 5IN1A 1D1BA 1K76A 4X1VA 3CCRT 3MKDA 4ZGJB 4E6RA 3JCMW 5DM7R 3GP8A 1B07A 5KYWA 1AZEA 2RQVA 2OAWA 1G3YA 2DVJA 2RQTA 1IRXA 1JXOA 1ZX6A 2RPNA 4ZNXA 4IUVA 3CCMA 3EAEA 2VWFA 1LVKA 3A8LB 2WACA 5CKHA 2OTLQ 3NFCA 4OMFB 3PIOA 1YIJA 3VS4A 1YBYA 1ZUYA 1H92A 4HVVA 2W10A 2I2LA 5AYFA 2YLCA 2COZA 3CBPA 5FWCA 2CUBA 4M7DB 1NPRA 1H641 2P4TA 1YNZA 3REAB 4BY6B 1KQSS 3RKWA 1NLPC 2BE7D 1VQKQ 3OYEA 1X2QA 3JSCA 1NM7A 2CZ0B 3R6OA 1FMVA 4PFPA 4FIBA 2JXBA 2QDLA 1AOJA 2PUKB 2O4XB 3SFMA 1VQ5Q 4L59A 1KQ2A 4HVWA 1PD1A 4X9DA 1LPLA 4C5HA 2OTJT 3EFOB 3BW1A 1K0SA 4CI0C 2XDPA 3VJPA 4QVZA 1H3HA 2EQKA 2ZAEA 4OB3B 3I55T 1AHJB 5KCHA 3I9QA 1QKWA 2EQUA 1JQQA 1S72T 2HKNA 1Q86C 1RABB 1J3TA 2LJ1A 1QKXA 2A3LA 3RNJA 1RAFB 4M77E 4M4ZA 3OYJA 3CXCP 4OMLA 1WHGA 3SWNA 2RMOA 5LJ5g 3SWNC 3H8ZA 4HVUA 4M7AF 2K57A 5LJ3e 4M78A 1VYTA 2AKKA 4J9CA 4M78C 2GFUA 4HXJA 2DE0X 1C6VX 2QEXT 1T3LA 3CMEA 2LZ6B 3ER0A 2K9GA 3TVTA 3QSUA 3M58A 1IHWA 1N9RA 3C4SA 3S3OA 2F5KA 2RQUA 3M56A 2RD1A 2KSSA 1WHKA 4AFQC 1AT1B 2DBKA 2CSQA 4WTOB 4RTTA 1K73R 3J7AF 2BTTA 1TUDA 4XU2A 1TWBA 2DJZA 1ZHIA 1KD1C 4M7AG 3G1JA 4M75F 2JNGA 2NLUA 3X25B 1KQSA 4EMKB 4LDWA 4MMKA 2FG0A 3M0SA 3GIBA 1N6AA 1M1KU 1JBMA 3CCUQ 4PNOA 2YXYA 3M59A 1FMKA 2DETA 1K73C 2M0OA 3FC3A 3CCRQ 3OYFA 2QA4T 4KGVB 1AEYA 5LJ3h 1YITA 2EWNA 4M75G 3RUXA 4F16A 4ME7A 4LDVA 6AT1B 2L3SA 3H0HA 5I2SA 1IXDA 2YRVA 5IAYA 2RNAA 5IXFA 2BE9B 1WX6A 2BKDN 2PVGB 1UTIA 3EGDB 3JCMf 3FJPA 3A8MB 5L23A 1Z9QA 2HZYA 2KY9A 1C0MA 1QCNA 3VYHB 2QASA 2IIMA 2JM8A 2O2OA 2MK5A 4BI4A 2M02A 3VKIA 2YHTA 1QVFS 1SKUB 1UGQB 3RDVA 5J39A 2MCNA 1K8AU 4JZ3A 2D8HA 4EMGA 1XTDA 3CC7A 1YJ9T 5D6WA 4KUIA 2QGGA 2XHCA 2HQHA 3OS0A 3HL8A 1W6XA 3L1AA 1EFNA 3I56A 5GAMg 3EG3A 3I5SA 3M9QA 2LQKA 1AD5A 4LUEA 3I55Q 4O6JA 2RJCA 3CD6T 5FLXE 2ECZA 1VQ4A 2GCXA 1S72Q 4PJJA 1OV3A 4FT4A 4Z8AA 3HSBA 4PJLA 2LQ8A 2V8IA 3VUZA 2DO3A 4F14A 3CMAQ 4IKFA 1QWFA 3CCJA 3VRZA 3KFVA 2M16A 1I0CA 2HL3A 4A4FA 4C5EA 3LH0A 5LJ5e 1X27A 5GANf 1VQ8A 3CCST 3E2UA 4A4GA 4OMQA 5KH6A 1X2KA 4IIOA 1RI9A 2B8AA 2F2WA 2B86A 2EVRA 9ATCB 2WSEE 3VU3C 3MP8A 2RHZA 4C8QB 2JVVA 1RUWA 1F1BB 4BB7A 3JAME 2BZYA 3QIIA 2XMFA 1JRIA 3CPWA 4XTYA 2YLBA 4WF2A 3WVEB 2EJGA 4BI3A 1XNIA 2DXCA 2EKOA 5IHIA 3OMCA 1VQ7A 4QQDA 4UC4A 4IUTA 4M78E 1W70A 1D3BA 4M7AD 2DXUA 3FDRA 4PFOA 4GLMA 3CCQQ 3CCET 5LJ5h 3PT9A 5FU7B 3KBGA 4PJOA 5M9OA 4XU1A 4PJOC 2CKKA 1BI3A 5CCAA 1M8MA 2KDSA 2DD5A 1M9SA 2NUPA 3UATA 1OI1A 2R58A 3EG0A 4M75D 3MEVA 2OTLA 1O9SA 2E5QA 1YP5A 4MZPA 2NUTA 2LQWA 5DLOA 2HCKA 1OPKA 1WNLA 5CQYA 1MV3A 1AWWA 4Z02A 3TQ7P 2RHUA 4D8DA 1U8RA 4E7SA 3PNWC 4NL2A 2L2PA 3ULRB 1UGPB 3G4ST 3EH2A 4ZN3A 1VQKA 3T9NA 4K11A 1YJ9Q 4E7KA 1W4SA 2CDTA 1T0JA 1W2BS 3IQLA 5FU6C 1VQ5A 3JCMJ 4XTUA 4GY5A 1T3SA 5GAMe 2H3EB 2J06A 4IUPA 1HD3A 2XD0A 2DPPB 2RO0A 4J9BA 4HCKA 5CVIA 1JJ2S 2DF6A 2M9UA 1BBZA 2V1QA 5LJ3f 4JJCA 4J9EA 3QBYA 2R5MA 3FRNA 5CIUA 3CCLQ 3V8LA 1OU8A 3GPLA 3OYDA 2DZ9A 2DXTA 2ZGWA 1U1SA 1FXXA 1ABOA 1BCOA 2RA2A 3RBBB 1HSQA 4LD9K 5CO7A 2FPEA 2ESWA 1U1TA 4J6XA 3CCSQ 2CREA 2GBQA 1X6GA 2QXFA 1V29B 2V8JA 1KQ1A 1M1KR 5C0MA 3CXCA 4AMCA 2VYTA 2X51A 4QVDA 2FL7A 1OOTA 2CP6A 3GNFB 5GAOl 4BE1A 2JTEA 1PC0A 4PLLA 2F69A 1I5OB 5GAMh 1BYMA 1ZA2B 2LCCA 5CKDA 5GANd 1UGRB 3GF5A 1N8RC 1VYVA 2DTHA 2HQXA 3LH5A 5GMKe 1M1KC 5HK3A 2IPOB 1X01A 1NBEB 1QP2A 2NYSA 1B34A 2Y4YA 3A8OB 3M53A 3MPUB 2EPDA 5GANj 4M77D 1C1AA 4XAXB 3OS1A 1M1GA 1Y07A 4B6MA 2EGEA 3CCEQ 1NJIU 3CCUA 1PSEA 1UJYA 4M78F 1E6GA 1YHQQ 3G71T 2FZCB 4R0KA 4F17A 5HCKA 1I5LA 2K3BA 1NEGA 2CUDA 2DRKA 3CCRA 3FEOA 3HFOA 3RIRA 2KXDA 2JN0A 3DLMA 4NOYA 5IHNA 1GL5A 3VRYA 1OYXA 1QVFP 4ZGDB 2E10A 2K2MA 1UGSB 2LJ3A 3JCMV 4M78G 2WSCE 4C0GA 4E7HA 1RACB 2RHIA 3UPUA 4OMOA 5D6YA 2CZ6B 4L5GA 3HRUA 5GMKh 3C94A 2J6OA 3QUIA 3PMTA 2LQNA 1JU5C 2DKGA 1K8AC 2HD0A 1YCSB 2COYA 3G4SQ 3DKMA 2ZCFB 1SPKA 4LUDA 1SSHA 3OY9A 1QWEA 1ZUUA 4C92B 3CEYA 1BU1A 3TSWA 3M5AA 1IB8A 3M0QA 3QPHA 5AT1B 1RAIB 2QQAA 1Q81U 4KGZB 1YJWT 1UHCA 3MEUA 1MMNA 1NYFA 4N4IA 1U06A 2X4YA 1UB4A 4OMPA 2E3IA 3OQ5A 2K5LA 3L2VA 1VOMA 3E9FA 2FPDA 3SEMA 2KK4A 4F7UA 2W0ZA 2CT4A 3EG9B 5FRMA 5LJ5f 2DK3A 2DTIA 2CT3A 3L42A 3GNGA 3REBB 3BDUA 3MHXA 2XKOC 1G8XA 4QT7A 3I55A 1WA7A 1TS9A 4XTWA 2RJEA 2ROLA 1S72A 1YI2T 3L2RA 1UGVA 4X9CA 4L6V5 2MPXC 1GXIE 3BE3A 3NPFA 1KHIA 3FB9A 3CMAA 2YRCA 2XIDA 2DIGA 4XU3A 2FPFA 4E7IA 2JUFA 3LGFA 2E3HA 4PK4A 1VQPQ 2EYQA 4PLIA 2DBMA 1ZBXA 5J26A 3CC4Q 4EPCA 2LCSA 4OGEA 1TH7A 1ZLMA 2KI7A 4OGCA 3VS3A 4O5VA 1VQNT 3DLLA 4A54A 4OMMA 1CSKA 2F2VA 1B3QA 4MDWA 1M5Q1 2DEQA 3EG1A 4A4HA 2GQVA 3M0UA 2OJ2A 3CCMT 2J6KA 1RI0A 1WHLA 5I22A 5DLQE 1YIJT 3CCQA 1X75C 2ZPIB 1N9SA 2IVWA 1VQ6T 2KGTA 4RMOA 2XDDA 4AG1C 2K3YA 1PKTA 2E65A 2HDAA 4FU6A 2BUDA 4AG2C 3FIFA 1OX8A 3HP9A 2O01E 1LNXA 3KXTA 4OVAA 1BK2A 1AWOA 4BE2A 5KCOA 2A37A 2DL3A 4CC4B 2X35A 3RMQA 4B9WA 1MNEA 1W2BP 3VYGA 4M7AB 4M78D 1WHHA 5GMKm 2H3JA 2KRSA 1EZZB 4C92A 4LNPA 4C92C 3BY7A 4PJOF 5A0GA 3NMZC 1JJ2P 4JRPA 1SF9A 1YJWQ 4FYYB 2FRYA 3OS2A 1YJ9A 4J7FA 2MWPA 2KE9A 1GCPA 2MI6A 1PSFA 4DEYA 1ZSZB 4JDSA 4JLGA 4IUQA 3ASKA 2EYYA 4M75B 4QQ6A 4QVCA 3QXEB 2EQJA 4Y28E 1G3SA 1IHVA 3CCVT 2GFAA 1RAAB 2DL5A 4PJOG 4ELZC 2KQWA 2EW3A 1MMGA 2E5KA 5D6XA 2QQRA 1Y0MA 1YI2Q 2MOXA 1PG5B 4XTVA 3V7SA 2ZPFB 3CMET 4NS5A 4M7DA 2CZ1B 3OYBA 1CKBA 4M7DC 2OX7A 3CCLA 3PTAA 3OYAA 5CKBA 2XICA 1M2OA 4BY6C 1I1JA 1UFFA 1YCYA 3U23A 1TSFA 2QQ9A 1WXBA 2KYBA 5LJ5d 2L3PA 2HKQB 2QTVA 2J6FA 3CCSA 2FYKA 1IZ6A 5A0LA 2M51A 2O4XA 2HL5C 2HSEB 1CKAA 2DA9A 1NLOC 3EFOA 1NJIR 2OTJQ 1ABQA 3OYCA 4RUGA 4AT1B 1IO6A 2RI5A 2COWA 5CR2A 2PQWA 2QQBA 3JB9F 1N27A 5I2MA 1UJ0A 1R0BG 2DX1A 2DERA 2HQEA 2M0YA 4KBMB 5FROA 1XJWB 1VQNQ 2C0TA 4AFUC 4PJMA 4FYWB 5GJWB 2HMAA 1XQHA 1D1AA 2P0QA 4JJDA 1PCXA 3UT1A 3G6ET 2HNIA 1OX9A 2LCLA 4KH0B 3HPWA 2X3WD 3V8JA 2AHJB 1WIEA 2YUPA 1SRLA 4DA4A 4DOWA 2VB6A 2PVOB 3JB9G 2FB7A 5CKFA 4ATOA 3M0RA 3LW5E 2DL4A 3CCEA 4MZMA 1YHQA 1BCMA 1HYOA 2QEXQ 4CC2A 4TVRA 2JT4A 1VQ6Q 4ANJA 2LNVA 3L2ZA 2KT1A 1YJNT 4JRKA 2PU9B 4LDYA 2AIRB 4LN2A 3S6WA 4BACA 2RH2A 1Q81R 2JM9A 3JCMX 1G5VA 1EX4A 3QO3A 4OP0A 4BDZA 3ZBDA 2KRMA 1K9AA 2BZ8A 2CP3A 3N5BB 2L8DA 1IGUA 4EMKA 4NL3A 4A53A 4EMKC 1QVFA 2C0OA 2LP5A 4FW2A 3VS2A 4M77B 3INZA 1RADB 2YUOA 1LOJA 2F5TX 2K6DA 1NYGA 1RLQC 2LDMA 2IG0A 4RG8A 4Y91A 1Q95G 3EGUA 2WSFE 3V7RA 1Q81C 3G4SA 3E9GA 2F2XA 2K5IA 4OB2B 1MMAA 2QA4Q 4HKEA 7AT1B 1NG2A 4JRIA 3X20B 2VC8A 1G2BA 1SSFA 2LNHB 3A5ZB 1ZSZA 5KYXB 3AHUA 3DB3A 4DBQA 2HBPA 3LWIA 2CP7A 3MCAB 2RK1A 4J9HA 2JZ2A 1VIEA 5ECAA 3EGDA 3CCVQ 2DL7A 2X4JA 2KROA 5GAN4 1Q86U 2EIFA 2FEIA 2L3RA 2GQIA 2AKLA 2KRNA 1RL2A 4ZN1A 2QG9B 4Q5WA 4C0FA 3H41A 4FYXB 3OYMA 2I0NA 2K79A 3KUFA 4JJNK 1VA7A 3P8BB 1Q7YU 1QW1A 2KMTA 4A4EA 1WLPB 1VYUA 4PJOD 4X34A 4PJNA 2CP0A 2E6NA 4C0DB 2MYSA 4CC3A 5FWBA 3OYYA 5KE3A 3HTRA 3M54A 2R5AA 3JCMd 3OYNA 2GTJA 2L5QA 2DIQA 1D0YA 5KE2A 1FMWA 2PNIA 5GANg 2VVKA 4AFZC 3M57A 3OYLA 3QJYA 1JB0E 5A2QE 4F04B 5IHKA 1VQPA 5GAN8 1GCQA 1KD1U 2LX9A 1GCQC 1VQ7T 1R77A 2A08A 4F7UF 2JW4A 3CC2T 3CC4A 4EMHA 2QTXA 2DMOA 2KVQG 4M7DE 3CD6Q 4FSXA 1UHFA 5D7UA 4JPBW 3G6EQ 2V8KA 1V76A 3DB4A 4CRIA 2FZGB 4ZTJA 2X4WA 4PL6A 2DTOA 2PVDB 3JB9I 3O5ZA 1KK7A 1SEMA 1D09B 2PTKA 2ZPGB 4DQ2A 3UA7A 3META 3VS0A 5A0DA 1KSWA 4N0AA 4N0AC 1YN8A 4LD6A 1OPLA 4F7UG 1M90U 3I35A 2K4YA 1K1ZA 1UEBA 2KT8A 5KYYB 1OEBA 2EGCA 5IXBA 1YJNQ 2AZSA 3QZ9B 4P5NA 2LX7A 3LLRA 3JB9D 3BDLA 1H8KA 5GAOq 3QHSA 3JCMc 4C8QA 8AT1B 3EFRA 1W1FA 4C8QC 2LJ0A 2R57A 1TUGB 1M3CA 3PE0A 1VQ9T 2HBWA 1VQMT 4M77A 2D0QB 2LT1A 5GAOn 4KGXB 2DNUA 1KJWA 2O9SA 5FRNA 4GBQA 5GAN3 3MEWA 1ACMB 1V1CA 4E7LA 1W2BA 2E41A 5FU7C 5I21A 5KYXA 3PIPA 3P8HA 2RHYA 4J9DA 3EHQA 4DBRA 2ED0A 1YJWA 3A8HB 2DFUA 2CH4A 3JB9J 3UDCA 3OW2S 2OI3A 2D1XA 1PM3A 2ZPBB 4FM4B 1JJ2A 3TCJA 1QP3A 2X4XA 2CSIA 2QGFB 4II1A 3QKJA 2EYZA 2AT1B 2MWOA 3TEEA 4RKUE 1AZGB 1Y71A 3NGPA 2XK0A 3M55A 3RMSA 4J5YA 4M78B 1YI2A 1TTHB 1ZUKA 3JCMP 2HAXA 4C92F 2AZVA 1U3OA 1VQLT 3NTKA 1VQOT 2KEAA 4XQ3A 4DOVA 2LRQA 4OMNA 4PJOE 1K9MU 2L0AA 3JCMQ 2LT4A 4FT2A 4HT9A 5GAN6 3QJ6A 4RTVA 4FYVB 5GANe 3UA6A 2DAQA 2NWMA 4BI8B 1P92A 3S3NA 5GJVB 2VASA 2A36A 3UWNA 2QYZA 2YUQA 1MHNA 1QVGP 1JXMA 4C92G 2OTJA 3CC2Q 4KUDK 4MZTA 3CBMA 4LXCA 2E1HA 3OMGA 2KNBB 3C95A 2D0NA 2O88A 2RK2A 1H3ZA 1VQNA 4M7DF 4J7IA 1ARKA 3JRZA 3RKXA 1A0NB 1O75A 2DXBA 4XU0A 2K3XA 1ZSGA 2C0IA 2E70A 1UECA 2O31A 2XG8D 5GAOp 3V7CA 1ZQ1A 4YTLA 4XTXA 2G3RA 3H6ZA 2DJQA 3EGXB 2V1RA 5KYYA 1PNJA
chains in the Genus database with same CATH topology
2KBTA 1HJDA 4ESRA 5IHIA 2FRWA 3PVLA 1MV0B 1AWJA 1AVZC 2DL5A 2EBPA 1W70A 3A98A 1WYXA 2EW3A 2E5KA 4GLMA 1SRMA 1Y0MA 2RQRA 2MOXA 2YUNA 3QWXX 1PRMC 2JS0A 1MUZA 1LCKA 2DLPA 1CKBA 3EHRA 3VS6A 4J9IA 1YWPA 3GBQA 1WFWA 2JMCA 1GBQA 2AK5A 1I1JA 1UFFA 2K7AA 3U23A 1KFZA 1M8MA 4Y92A 4CC7A 1PKSA 1WXBA 2KYBA 1N5ZA 2L3PA 1M27C 2G6FX 2KYMA 2JS2A 2J6FA 3UATA 3EG0A 2M51A 1K0XA 1CKAA 2DA9A 1NLOC 1S1NA 1YP5A 1ABQA 2LQWA 4RUGA 3H0FA 1AWXA 1IO6A 4JZ4A 2HCKA 1OPKA 1BB9A 1E7OA 1GFDA 1TG0A 2SEMA 1UJ0A 2DX1A 4RTWA 1MV3A 1AWWA 2M0YA 1PRLC 1WI7A 2BZXA 1Y57A 4D8DA 2DYBA 3PVQA 2C0TA 4AFUC 1PWTA 5EC7A 2NUZA 5GJWB 2L2PA 3ULRB 4JJDA 2J05A 1WXTA 2VKNA 2YSQA 4K11A 1JO8A 2X3WD 4D8KA 1WIEA 3VS7A 2YUPA 1SRLA 2CDTA 1T0JA 3IQLA 2D8JA 3M0RA 1NEBA 1T3SA 2DL4A 4RTUA 2J06A 1HD3A 1KIKA 2YDLA 2DM1A 3I5RA 4J9BA 4HCKA 4Z88A 4CC2A 3THKA 2JT4A 2DF6A 2EYXA 1BBZA 2V1QA 2KT1A 3C0CA 4JJCA 2ED1A 1E6HA 2RQWA 4J9EA 4LN2A 1K76A 4X1VA 3CQTA 3UF4A 2JM9A 4E6RA 1Z9ZA 2LMJA 1B07A 2EQIA 1ABOA 2GGRA 3FJ5A 1AZEA 2RQVA 2OAWA 2DVJA 3NHNA 2RQTA 3RBBB 1HSQA 2KRMA 1K9AA 2FPEA 1FYNA 2ESWA 2BZ8A 2CREA 2GBQA 1X6GA 1JXOA 1ZX6A 2RPNA 4ZNXA 2C0OA 2LP5A 2VWFA 3VS2A 2YUOA 3VS4A 2K6DA 1ZUYA 1H92A 1NYGA 1RLQC 4HVVA 2W10A 3M0TA 2H8HA 1OOTA 3EGUA 2JTEA 3SHWA 2F2XA 5FWCA 2CUBA 1T0HA 4Z89A 1GRIA 1NG2A 1YWOA 1G2BA 2LNHB 1YNZA 3REAB 1NLPC 4FSSA 4KRTA 1VYVA 1X2QA 1RLPC 2SRCA 1NM7A 2CH4W 3LH5A 3QWYA 4J9HA 2KXCA 2ABLA 4JJBA 5ECAA 1UE9A 2DL7A 2KROA 2JXBA 2PZ1A 1AOJA 2QDLA 2FEIA 2GQIA 2AKLA 2EGAA 4HVWA 2KRNA 2EPDA 2EGEA 1UJYA 1K0SA 2MIOA 1E6GA 3H41A 3M0PA 4R0KA 4F17A 2I0NA 2K79A 5HCKA 1VA7A 2K3BA 1NEGA 1UDLA 2CUDA 2DRKA 2L3QA 1H3HA 1WLPB 1VYUA 4RTZA 2KXDA 4CC3A 5FWBA 3I9QA 1QKWA 1JQQA 5IHNA 2GTJA 1GL5A 3VRYA 1J3TA 2PNIA 2LJ1A 1QKXA 2VVKA 4AFZC 2K2MA 2LJ3A 3RNJA 5IHKA 4M4ZA 3VS1A 1M3BA 4OMLA 1GCQA 2ENMA 4OMOA 1GCQC 2RMOA 4HVUA 2J6OA 1VYTA 2A08A 2AKKA 2JW4A 4J9CA 2LQNA 2EYWA 1JU5C 4HXJA 1X6BA 2DE0X 2HEQA 1T3LA 2LZ6B 2DMOA 2K9GA 1YCSB 3TVTA 1SHFA 1SPKA 1UHFA 4JPBW 4LUDA 1SSHA 1QWEA 1ZUUA 2RF0A 2RQUA 1BU1A 3TSWA 3M0QA 4AFQC 2DBKA 2CSQA 3O5ZA 4J9GA 1SEMA 4RTTA 2BTTA 1TUDA 2PTKA 3UA7A 3VS0A 1KSWA 1UHCA 1NYFA 1YN8A 1U06A 1OPLA 2HSPA 4OMPA 3I35A 3ZL7C 1K1ZA 2FO0A 2FG0A 3M0SA 2KT8A 2FPDA 3SEMA 1OEBA 2EGCA 4A63B 5IXBA 3VS5A 2W0ZA 2CT4A 2GNCA 2AZSA 2CT3A 1PHTA 2LX7A 3REBB 1FMKA 4QT7A 1WA7A 1H8KA 1QCFA 2ROLA 4WCIA 1W1FA 1AEYA 1UGVA 1XOVA 2LJ0A 1U5SA 3NPFA 4F16A 1M3CA 3PE0A 2RN8A 2L3SA 3H0HA 1GBRA 3TSZA 2HBWA 2RNAA 5IXFA 2X3XD 1WX6A 2O9VA 2FPFA 1UTIA 3EG2A 4DEXA 2DNUA 1KJWA 2O9SA 4GBQA 2DBMA 5L23A 1Z9QA 4IIMA 1V1CA 2IIMA 2JM8A 2O2OA 2LCSA 1GFCA 2A28A 1ZLMA 4J9DA 3EHQA 2ROTA 2DRMA 2ED0A 3VS3A 2MCNA 2CH4A 2OI3A 3JV3A 2D1XA 4JZ3A 1WXUA 2D8HA 4OMMA 1CSKA 2F2VA 1B3QA 4LE9A 2CSIA 1JEGA 2P4RA 2EYZA 3EG1A 1SHGA 2YT6A 3M0UA 4RTYA 2OJ2A 5FW9A 2J6KA 1WDXA 1AZGB 1W6XA 3NGPA 4RTXA 5I22A 1G83A 1EFNA 3EG3A 3I5SA 1ZUKA 1QLYA 1AD5A 2AZVA 1TUCA 1U3OA 4LUEA 2KR3A 3H0IA 2KEAA 2DILA 2ECZA 2KGTA 1K4US 4OMNA 1X69A 4Z8AA 1OV3A 3R6NA 2L0AA 4AG1C 2EKHA 1PKTA 4RTVA 2HDAA 4AG2C 3UA6A 4F14A 2NWMA 1QWFA 1BK2A 1AWOA 3VRZA 1X43A 2A37A 5GJVB 2DL3A 3KFVA 4CC4B 1I0CA 2A36A 2YUQA 1UUEA 2DL8A 1JXMA 1X27A 1UG1A 2J7IA 2GTOA 4AFSC 4OMQA 2JMAA 1X2KA 1I07A 1RI9A 4IIOA 2KNBB 2D0NA 2KRSA 2F2WA 2B86A 2EVRA 2O88A 4LNPA 1M3AA 1M30A 1RUWA 1ZBJA 1ARKA 3NMZC 1A0NB 4J9FA 4EIKA 2FRYA 1ZSGA 2C0IA 2O31A 1UECA 4ORZA 2BZYA 2KE9A 2XMFA 1GCPA 5I11A 4DEYA 2DJQA 5IH2A 2V1RA 2EYYA 1PNJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KBT A;  1HJD A;  4ESR A;  5IHI A;  2FRW A;  3PVL A;  1MV0 B;  1AWJ A;  1AVZ C;  2DL5 A;  2EBP A;  1W70 A;  3A98 A;  1WYX A;  2EW3 A;  2E5K A;  4GLM A;  1SRM A;  1Y0M A;  2RQR A;  2MOX A;  2YUN A;  3QWX X;  1PRM C;  2JS0 A;  1MUZ A;  1LCK A;  2DLP A;  1CKB A;  3EHR A;  3VS6 A;  4J9I A;  1YWP A;  3GBQ A;  1WFW A;  2JMC A;  1GBQ A;  2AK5 A;  1I1J A;  1UFF A;  2K7A A;  3U23 A;  1KFZ A;  1M8M A;  4Y92 A;  4CC7 A;  1PKS A;  1WXB A;  2KYB A;  1N5Z A;  2L3P A;  1M27 C;  2G6F X;  2KYM A;  2JS2 A;  2J6F A;  3UAT A;  3EG0 A;  2M51 A;  1K0X A;  1CKA A;  2DA9 A;  1NLO C;  1S1N A;  1YP5 A;  1ABQ A;  2LQW A;  4RUG A;  3H0F A;  1AWX A;  1IO6 A;  4JZ4 A;  2HCK A;  1OPK A;  1BB9 A;  1E7O A;  1GFD A;  1TG0 A;  2SEM A;  1UJ0 A;  2DX1 A;  4RTW A;  1MV3 A;  1AWW A;  2M0Y A;  1PRL C;  1WI7 A;  2BZX A;  1Y57 A;  4D8D A;  2DYB A;  3PVQ A;  2C0T A;  4AFU C;  1PWT A;  5EC7 A;  2NUZ A;  5GJW B;  2L2P A;  3ULR B;  4JJD A;  2J05 A;  1WXT A;  2VKN A;  2YSQ A;  4K11 A;  1JO8 A;  2X3W D;  4D8K A;  1WIE A;  3VS7 A;  2YUP A;  1SRL A;  2CDT A;  1T0J A;  3IQL A;  2D8J A;  3M0R A;  1NEB A;  1T3S A;  2DL4 A;  4RTU A;  2J06 A;  1HD3 A;  1KIK A;  2YDL A;  2DM1 A;  3I5R A;  4J9B A;  4HCK A;  4Z88 A;  4CC2 A;  3THK A;  2JT4 A;  2DF6 A;  2EYX A;  1BBZ A;  2V1Q A;  2KT1 A;  3C0C A;  4JJC A;  2ED1 A;  1E6H A;  2RQW A;  4J9E A;  4LN2 A;  1K76 A;  4X1V A;  3CQT A;  3UF4 A;  2JM9 A;  4E6R A;  1Z9Z A;  2LMJ A;  1B07 A;  2EQI A;  1ABO A;  2GGR A;  3FJ5 A;  1AZE A;  2RQV A;  2OAW A;  2DVJ A;  3NHN A;  2RQT A;  3RBB B;  1HSQ A;  2KRM A;  1K9A A;  2FPE A;  1FYN A;  2ESW A;  2BZ8 A;  2CRE A;  2GBQ A;  1X6G A;  1JXO A;  1ZX6 A;  2RPN A;  4ZNX A;  2C0O A;  2LP5 A;  2VWF A;  3VS2 A;  2YUO A;  3VS4 A;  2K6D A;  1ZUY A;  1H92 A;  1NYG A;  1RLQ C;  4HVV A;  2W10 A;  3M0T A;  2H8H A;  1OOT A;  3EGU A;  2JTE A;  3SHW A;  2F2X A;  5FWC A;  2CUB A;  1T0H A;  4Z89 A;  1GRI A;  1NG2 A;  1YWO A;  1G2B A;  2LNH B;  1YNZ A;  3REA B;  1NLP C;  4FSS A;  4KRT A;  1VYV A;  1X2Q A;  1RLP C;  2SRC A;  1NM7 A;  2CH4 W;  3LH5 A;  3QWY A;  4J9H A;  2KXC A;  2ABL A;  4JJB A;  5ECA A;  1UE9 A;  2DL7 A;  2KRO A;  2JXB A;  2PZ1 A;  1AOJ A;  2QDL A;  2FEI A;  2GQI A;  2AKL A;  2EGA A;  4HVW A;  2KRN A;  2EPD A;  2EGE A;  1UJY A;  1K0S A;  2MIO A;  1E6G A;  3H41 A;  3M0P A;  4R0K A;  4F17 A;  2I0N A;  2K79 A;  5HCK A;  1VA7 A;  2K3B A;  1NEG A;  1UDL A;  2CUD A;  2DRK A;  2L3Q A;  1H3H A;  1WLP B;  1VYU A;  4RTZ A;  2KXD A;  4CC3 A;  5FWB A;  3I9Q A;  1QKW A;  1JQQ A;  5IHN A;  2GTJ A;  1GL5 A;  3VRY A;  1J3T A;  2PNI A;  2LJ1 A;  1QKX A;  2VVK A;  4AFZ C;  2K2M A;  2LJ3 A;  3RNJ A;  5IHK A;  4M4Z A;  3VS1 A;  1M3B A;  4OML A;  1GCQ A;  2ENM A;  4OMO A;  1GCQ C;  2RMO A;  4HVU A;  2J6O A;  1VYT A;  2A08 A;  2AKK A;  2JW4 A;  4J9C A;  2LQN A;  2EYW A;  1JU5 C;  4HXJ A;  1X6B A;  2DE0 X;  2HEQ A;  1T3L A;  2LZ6 B;  2DMO A;  2K9G A;  1YCS B;  3TVT A;  1SHF A;  1SPK A;  1UHF A;  4JPB W;  4LUD A;  1SSH A;  1QWE A;  1ZUU A;  2RF0 A;  2RQU A;  1BU1 A;  3TSW A;  3M0Q A;  4AFQ C;  2DBK A;  2CSQ A;  3O5Z A;  4J9G A;  1SEM A;  4RTT A;  2BTT A;  1TUD A;  2PTK A;  3UA7 A;  3VS0 A;  1KSW A;  1UHC A;  1NYF A;  1YN8 A;  1U06 A;  1OPL A;  2HSP A;  4OMP A;  3I35 A;  3ZL7 C;  1K1Z A;  2FO0 A;  2FG0 A;  3M0S A;  2KT8 A;  2FPD A;  3SEM A;  1OEB A;  2EGC A;  4A63 B;  5IXB A;  3VS5 A;  2W0Z A;  2CT4 A;  2GNC A;  2AZS A;  2CT3 A;  1PHT A;  2LX7 A;  3REB B;  1FMK A;  4QT7 A;  1WA7 A;  1H8K A;  1QCF A;  2ROL A;  4WCI A;  1W1F A;  1AEY A;  1UGV A;  1XOV A;  2LJ0 A;  1U5S A;  3NPF A;  4F16 A;  1M3C A;  3PE0 A;  2RN8 A;  2L3S A;  3H0H A;  1GBR A;  3TSZ A;  2HBW A;  2RNA A;  5IXF A;  2X3X D;  1WX6 A;  2O9V A;  2FPF A;  1UTI A;  3EG2 A;  4DEX A;  2DNU A;  1KJW A;  2O9S A;  4GBQ A;  2DBM A;  5L23 A;  1Z9Q A;  4IIM A;  1V1C A;  2IIM A;  2JM8 A;  2O2O A;  2LCS A;  1GFC A;  2A28 A;  1ZLM A;  4J9D A;  3EHQ A;  2ROT A;  2DRM A;  2ED0 A;  3VS3 A;  2MCN A;  2CH4 A;  2OI3 A;  3JV3 A;  2D1X A;  4JZ3 A;  1WXU A;  2D8H A;  4OMM A;  1CSK A;  2F2V A;  1B3Q A;  4LE9 A;  2CSI A;  1JEG A;  2P4R A;  2EYZ A;  3EG1 A;  1SHG A;  2YT6 A;  3M0U A;  4RTY A;  2OJ2 A;  5FW9 A;  2J6K A;  1WDX A;  1AZG B;  1W6X A;  3NGP A;  4RTX A;  5I22 A;  1G83 A;  1EFN A;  3EG3 A;  3I5S A;  1ZUK A;  1QLY A;  1AD5 A;  2AZV A;  1TUC A;  1U3O A;  4LUE A;  2KR3 A;  3H0I A;  2KEA A;  2DIL A;  2ECZ A;  2KGT A;  1K4U S;  4OMN A;  1X69 A;  4Z8A A;  1OV3 A;  3R6N A;  2L0A A;  4AG1 C;  2EKH A;  1PKT A;  4RTV A;  2HDA A;  4AG2 C;  3UA6 A;  4F14 A;  2NWM A;  1QWF A;  1BK2 A;  1AWO A;  3VRZ A;  1X43 A;  2A37 A;  5GJV B;  2DL3 A;  3KFV A;  4CC4 B;  1I0C A;  2A36 A;  2YUQ A;  1UUE A;  2DL8 A;  1JXM A;  1X27 A;  1UG1 A;  2J7I A;  2GTO A;  4AFS C;  4OMQ A;  2JMA A;  1X2K A;  1I07 A;  1RI9 A;  4IIO A;  2KNB B;  2D0N A;  2KRS A;  2F2W A;  2B86 A;  2EVR A;  2O88 A;  4LNP A;  1M3A A;  1M30 A;  1RUW A;  1ZBJ A;  1ARK A;  3NMZ C;  1A0N B;  4J9F A;  4EIK A;  2FRY A;  1ZSG A;  2C0I A;  2O31 A;  1UEC A;  4ORZ A;  2BZY A;  2KE9 A;  2XMF A;  1GCP A;  5I11 A;  4DEY A;  2DJQ A;  5IH2 A;  2V1R A;  2EYY A;  1PNJ A; 
#chains in the Genus database with same CATH topology
 3OW2 A;  1HJD A;  1ZA1 B;  2FRW A;  5GAN h;  1MV0 B;  5LJ3 d;  4M7D G;  5GAO m;  3A98 A;  1QMC A;  3GLX A;  2QEX A;  1VQ6 A;  1BKB A;  1SRM A;  2E12 A;  2C06 A;  1QQJ A;  1LCK A;  2DLP A;  3X28 B;  5KYN A;  3EHR A;  4FL6 A;  1MGQ A;  5LJ3 j;  2A7Y A;  1YWP A;  2BIV A;  1VQ9 Q;  3GBQ A;  3QYH B;  1WFW A;  1WPY A;  2JMC A;  1GBQ A;  3WXM B;  4V2S A;  1VQM Q;  1D1C A;  3X26 B;  4C0Z A;  4Y92 A;  1PKS A;  1N5Z A;  3ZFJ A;  2G6F X;  2KYM A;  2JS2 A;  4JS4 A;  1Q86 R;  3O8V A;  4QQG A;  1OZ3 A;  1PD0 A;  2RJD A;  4E7J A;  1S1N A;  4OB0 B;  1Y96 B;  2RB6 A;  4RCB A;  1AWX A;  3G7Z A;  2Y90 A;  3G71 Q;  2VV5 A;  1Q7Y R;  1BB9 A;  1E7O A;  1GFD A;  1IGQ A;  3VUB A;  1BI2 A;  1TG0 A;  2MF2 A;  2QA4 A;  1PRL C;  3ME9 A;  4C8Q E;  3JB9 H;  3RKY A;  2DD4 A;  2OAU A;  1PWT A;  2NUZ A;  1M1F A;  2VGM A;  4XTZ A;  1WXT A;  3NTI A;  1R8O B;  3ZEH A;  5GMK i;  3CMA T;  3CCV A;  2F1L A;  2D8J A;  1MND A;  5C6S A;  2CP2 A;  1WJQ A;  2P0K A;  3SB2 A;  3JCM b;  1Q7Y C;  2L89 A;  1KD1 R;  1I81 A;  3LYI A;  4RTU A;  4PKC C;  1KIK A;  1VQL Q;  4ZTF A;  2DM1 A;  1VQO Q;  3THK A;  4ZGE B;  2P0P A;  5HKC A;  2ZPH B;  5GAM f;  4ELY C;  4KUL A;  3CQT A;  1M4Z A;  3UF4 A;  1Z9Z A;  2LMJ A;  2EQI A;  2GGR A;  3FJ5 A;  3NHN A;  1M90 R;  1X6O A;  1FYN A;  1N8R U;  1HK9 A;  2ZPE B;  2E6Z A;  3LX7 A;  3MEA A;  3RES A;  3J80 E;  2LC4 A;  3NTH A;  3L2W A;  2RM4 A;  4PFZ A;  4RCC A;  1NE8 A;  3EG9 A;  5CQX A;  4B9X A;  1KC8 U;  3M0T A;  1D3B B;  2H8H A;  2D6F A;  3CCQ T;  4DBH A;  3CD6 A;  3SHW A;  4QKU A;  4C92 D;  3G6E A;  1WHM A;  2FVU A;  3TRE A;  1T0H A;  3LGL A;  4PJO B;  4Z89 A;  1GRI A;  1WZO A;  3MJX A;  1M90 C;  1YWO A;  2MMP A;  2VUB A;  4FSS A;  4HCZ A;  3EGX A;  4KRT A;  1RLP C;  2SRC A;  4DBF A;  2CH4 W;  4IUU A;  2PUO B;  3QWY A;  3PFS A;  2KXC A;  2ABL A;  4JJB A;  1UE9 A;  2NUP B;  2ATC B;  4VUB A;  2PZ1 A;  1DJ7 B;  2EGA A;  1FWZ A;  3OYI A;  4A4K A;  3HRT A;  1YJN A;  3OS5 A;  1BI1 A;  2NUT B;  2MIO A;  1Q82 U;  3C12 A;  3M0P A;  4KT0 E;  3E1S A;  3CPW S;  1OUL A;  4F7U E;  1WGS A;  1UDL A;  2QQS A;  2L3Q A;  5LJ5 j;  2EFI A;  4M7D D;  4RTZ A;  4HCC A;  1WJR A;  3HRS A;  1TXQ A;  1YIT T;  3VV0 A;  3PGG A;  3QDR B;  5HY6 A;  3A8G B;  1Y96 A;  3V8K A;  5FU6 B;  1QVG S;  1NJI C;  3OW2 P;  5GAN 7;  4HCB A;  2ZZD A;  3VS1 A;  1M3B A;  3CCM Q;  2JJ9 A;  3HKS A;  4BDY A;  4HT8 A;  2ENM A;  2XDB A;  2QI2 A;  1WQ7 A;  3J81 E;  2CS7 A;  1YIJ Q;  4XK8 E;  2RHX A;  3OA6 A;  4J83 A;  2EYW A;  4J8O A;  1X6B A;  2HEQ A;  2E4H A;  3SDZ A;  2VXF A;  2Z0W A;  1R0C B;  3L2U A;  1SHF A;  4FCY A;  2JTM A;  4C8Q F;  3GOX A;  1K9M R;  4HA8 A;  2D9T A;  2QAZ A;  2RF0 A;  3CCL T;  1OQK A;  4J9G A;  2XI9 A;  4LDU A;  1MMD A;  4M77 F;  5CKE A;  1WQW A;  3JCM g;  2HSP A;  1M8V A;  3ZL7 C;  3QZ5 B;  2LVM A;  2FO0 A;  2LTO A;  3CC7 T;  1BIB A;  4M7A A;  4A63 B;  4C8Q G;  1K9M C;  4M7A C;  3VS5 A;  4JS5 A;  2GNC A;  1RAH B;  1VUB A;  3CBO A;  1PHT A;  4BE0 A;  1TOV A;  1QCF A;  3I56 T;  2CYZ B;  3QG1 A;  4WCI A;  1WHJ A;  1XOV A;  4M77 G;  2DEU A;  4QW2 A;  1U5S A;  5KYU B;  2RN8 A;  1TU0 B;  1VQ4 T;  4R56 A;  2QDY B;  5CAI A;  4J6Y A;  2FZK B;  5J3B A;  4MML A;  4MDX A;  1ZSZ C;  1GBR A;  3TSZ A;  2X3X D;  2O9V A;  4M75 A;  3OBW A;  4M75 C;  3F70 A;  2MAM A;  5GAN 5;  3EG2 A;  2CP5 A;  4DEX A;  1KG1 A;  5GAM d;  1B34 B;  3CC2 A;  2EJF A;  3PMI A;  3RER A;  3CCJ T;  4JRQ A;  2P84 A;  5DY9 A;  4IIM A;  1YHQ T;  3X24 B;  1QVG A;  2EAY A;  1VQ8 T;  3CME Q;  4N4G A;  1M2V B;  3URG A;  3LWH A;  1GFC A;  2A28 A;  2YRD A;  4C92 E;  5GAM j;  2ROT A;  2DRM A;  1OU9 A;  3QDF A;  2DVE A;  4R55 A;  2M1H A;  3JV3 A;  3CXC S;  2Y4X A;  1WXU A;  1KQS P;  2KAF A;  2RI3 A;  1Y7X A;  4LE9 A;  1EIF A;  2GF7 A;  1JEG A;  2P4R A;  1NZ9 A;  2JTF A;  1I8F A;  1SHG A;  2YT6 A;  4RTY A;  5FW9 A;  2V26 A;  1WDX A;  4KH1 B;  4RTX A;  3FLG A;  1G83 A;  3HFN A;  1G3W A;  3MO8 A;  5HK0 A;  1QLY A;  3EFS A;  1TUC A;  1D0X A;  2KR3 A;  3H0I A;  2DIL A;  1VQ9 A;  1K4U S;  1RAE B;  3MP6 A;  1X69 A;  2VXE A;  1YIT Q;  3R6N A;  2EKH A;  3SD4 A;  1VQM A;  2FHD A;  1KHC A;  4E7Z A;  1K73 U;  8ATC B;  3OYH A;  3EH1 A;  4E2F B;  2RI2 A;  2EQM A;  1X43 A;  1HXD A;  4EDU A;  1LJO A;  1UUE A;  5KYW B;  2DL8 A;  2K5F A;  1UG1 A;  5EG2 A;  2J7I A;  2GTO A;  3S3M A;  4AFS C;  5GMK j;  3G71 A;  2JMA A;  4F7U B;  1I07 A;  3H9N A;  2OTL T;  4RG2 A;  2E64 A;  4J6W A;  3E19 A;  1M3A A;  3A1P A;  1QCO A;  2A0F B;  1M30 A;  1ZBJ A;  2EJ9 A;  4J9F A;  4EIK A;  4ORZ A;  3AT1 B;  3D7S B;  4E47 A;  3M4Y A;  3JCM e;  5GAN 2;  5I11 A;  1N8R R;  3P8D A;  1VQK T;  1BIA A;  5IH2 A;  1NPP A;  2CGH A;  3CC7 Q;  3Q1J A;  2KBT A;  4ESR A;  2JOY A;  2RJF A;  3PVL A;  4IUR A;  4M77 C;  1AWJ A;  1VQP T;  1KC8 R;  1VQL A;  1VQ5 T;  1AVZ C;  2EBP A;  1WYX A;  1VQO A;  1VIF A;  3I56 Q;  3CPF A;  5GAO r;  2RQR A;  3OSS C;  2YUN A;  3CC4 T;  3QWX X;  2QK0 A;  1PRM C;  1RAG B;  4D6W A;  1MUZ A;  2JS0 A;  3VS6 A;  5KYU A;  4J9I A;  5IT9 E;  5LL6 S;  4C8Q D;  2XU8 A;  1VQ4 Q;  4FW1 A;  3L2Q A;  2AK5 A;  2K7A A;  1KFZ A;  1BI0 A;  4CC7 A;  3OYK A;  3OYG A;  1M27 C;  1KC8 C;  3OB9 A;  4N4H A;  1K0X A;  3CCJ Q;  1OZ2 A;  1G3T A;  3OBY A;  2CZ7 B;  3MP1 A;  4JLI A;  2DYI A;  4OF1 A;  3JCM h;  4BUG A;  1Q82 R;  4M7A E;  1VQ8 Q;  1M2V A;  3H0F A;  3OSV A;  4JZ4 A;  4C5I A;  4BD3 A;  3BFM A;  5LJ3 g;  2SEM A;  3SWN B;  4RTW A;  1WI7 A;  2DZC A;  2BZX A;  1K8A R;  1Y57 A;  1FX7 A;  2DYB A;  3PVQ A;  5EC7 A;  1WJS A;  3CPW P;  4C0D C;  1YFN A;  2X9H A;  3M4G A;  2J05 A;  1B7T A;  2VKN A;  2YSQ A;  4C5G A;  1JO8 A;  3HHT B;  4D8K A;  4GLK A;  3WVD B;  1Q82 C;  3VS7 A;  4M75 E;  3RR6 A;  1I4K 1;  3TU4 K;  1QVP A;  3QYG B;  4OB1 B;  2VGN A;  1IRE B;  2K2V A;  1NEB A;  1VQ7 Q;  2YWW A;  4JUV A;  2YDL A;  3I5R A;  5L8R E;  4Z88 A;  4LDX A;  1D0Z A;  2EYX A;  5CK9 A;  1SG5 A;  3C0C A;  5GMK l;  3CCU T;  2ED1 A;  1E6H A;  2RQW A;  5IN1 A;  1D1B A;  1K76 A;  4X1V A;  3CCR T;  3MKD A;  4ZGJ B;  4E6R A;  3JCM W;  5DM7 R;  3GP8 A;  1B07 A;  5KYW A;  1AZE A;  2RQV A;  2OAW A;  1G3Y A;  2DVJ A;  2RQT A;  1IRX A;  1JXO A;  1ZX6 A;  2RPN A;  4ZNX A;  4IUV A;  3CCM A;  3EAE A;  2VWF A;  1LVK A;  3A8L B;  2WAC A;  5CKH A;  2OTL Q;  3NFC A;  4OMF B;  3PIO A;  1YIJ A;  3VS4 A;  1YBY A;  1ZUY A;  1H92 A;  4HVV A;  2W10 A;  2I2L A;  5AYF A;  2YLC A;  2COZ A;  3CBP A;  5FWC A;  2CUB A;  4M7D B;  1NPR A;  1H64 1;  2P4T A;  1YNZ A;  3REA B;  4BY6 B;  1KQS S;  3RKW A;  1NLP C;  2BE7 D;  1VQK Q;  3OYE A;  1X2Q A;  3JSC A;  1NM7 A;  2CZ0 B;  3R6O A;  1FMV A;  4PFP A;  4FIB A;  2JXB A;  2QDL A;  1AOJ A;  2PUK B;  2O4X B;  3SFM A;  1VQ5 Q;  4L59 A;  1KQ2 A;  4HVW A;  1PD1 A;  4X9D A;  1LPL A;  4C5H A;  2OTJ T;  3EFO B;  3BW1 A;  1K0S A;  4CI0 C;  2XDP A;  3VJP A;  4QVZ A;  1H3H A;  2EQK A;  2ZAE A;  4OB3 B;  3I55 T;  1AHJ B;  5KCH A;  3I9Q A;  1QKW A;  2EQU A;  1JQQ A;  1S72 T;  2HKN A;  1Q86 C;  1RAB B;  1J3T A;  2LJ1 A;  1QKX A;  2A3L A;  3RNJ A;  1RAF B;  4M77 E;  4M4Z A;  3OYJ A;  3CXC P;  4OML A;  1WHG A;  3SWN A;  2RMO A;  5LJ5 g;  3SWN C;  3H8Z A;  4HVU A;  4M7A F;  2K57 A;  5LJ3 e;  4M78 A;  1VYT A;  2AKK A;  4J9C A;  4M78 C;  2GFU A;  4HXJ A;  2DE0 X;  1C6V X;  2QEX T;  1T3L A;  3CME A;  2LZ6 B;  3ER0 A;  2K9G A;  3TVT A;  3QSU A;  3M58 A;  1IHW A;  1N9R A;  3C4S A;  3S3O A;  2F5K A;  2RQU A;  3M56 A;  2RD1 A;  2KSS A;  1WHK A;  4AFQ C;  1AT1 B;  2DBK A;  2CSQ A;  4WTO B;  4RTT A;  1K73 R;  3J7A F;  2BTT A;  1TUD A;  4XU2 A;  1TWB A;  2DJZ A;  1ZHI A;  1KD1 C;  4M7A G;  3G1J A;  4M75 F;  2JNG A;  2NLU A;  3X25 B;  1KQS A;  4EMK B;  4LDW A;  4MMK A;  2FG0 A;  3M0S A;  3GIB A;  1N6A A;  1M1K U;  1JBM A;  3CCU Q;  4PNO A;  2YXY A;  3M59 A;  1FMK A;  2DET A;  1K73 C;  2M0O A;  3FC3 A;  3CCR Q;  3OYF A;  2QA4 T;  4KGV B;  1AEY A;  5LJ3 h;  1YIT A;  2EWN A;  4M75 G;  3RUX A;  4F16 A;  4ME7 A;  4LDV A;  6AT1 B;  2L3S A;  3H0H A;  5I2S A;  1IXD A;  2YRV A;  5IAY A;  2RNA A;  5IXF A;  2BE9 B;  1WX6 A;  2BKD N;  2PVG B;  1UTI A;  3EGD B;  3JCM f;  3FJP A;  3A8M B;  5L23 A;  1Z9Q A;  2HZY A;  2KY9 A;  1C0M A;  1QCN A;  3VYH B;  2QAS A;  2IIM A;  2JM8 A;  2O2O A;  2MK5 A;  4BI4 A;  2M02 A;  3VKI A;  2YHT A;  1QVF S;  1SKU B;  1UGQ B;  3RDV A;  5J39 A;  2MCN A;  1K8A U;  4JZ3 A;  2D8H A;  4EMG A;  1XTD A;  3CC7 A;  1YJ9 T;  5D6W A;  4KUI A;  2QGG A;  2XHC A;  2HQH A;  3OS0 A;  3HL8 A;  1W6X A;  3L1A A;  1EFN A;  3I56 A;  5GAM g;  3EG3 A;  3I5S A;  3M9Q A;  2LQK A;  1AD5 A;  4LUE A;  3I55 Q;  4O6J A;  2RJC A;  3CD6 T;  5FLX E;  2ECZ A;  1VQ4 A;  2GCX A;  1S72 Q;  4PJJ A;  1OV3 A;  4FT4 A;  4Z8A A;  3HSB A;  4PJL A;  2LQ8 A;  2V8I A;  3VUZ A;  2DO3 A;  4F14 A;  3CMA Q;  4IKF A;  1QWF A;  3CCJ A;  3VRZ A;  3KFV A;  2M16 A;  1I0C A;  2HL3 A;  4A4F A;  4C5E A;  3LH0 A;  5LJ5 e;  1X27 A;  5GAN f;  1VQ8 A;  3CCS T;  3E2U A;  4A4G A;  4OMQ A;  5KH6 A;  1X2K A;  4IIO A;  1RI9 A;  2B8A A;  2F2W A;  2B86 A;  2EVR A;  9ATC B;  2WSE E;  3VU3 C;  3MP8 A;  2RHZ A;  4C8Q B;  2JVV A;  1RUW A;  1F1B B;  4BB7 A;  3JAM E;  2BZY A;  3QII A;  2XMF A;  1JRI A;  3CPW A;  4XTY A;  2YLB A;  4WF2 A;  3WVE B;  2EJG A;  4BI3 A;  1XNI A;  2DXC A;  2EKO A;  5IHI A;  3OMC A;  1VQ7 A;  4QQD A;  4UC4 A;  4IUT A;  4M78 E;  1W70 A;  1D3B A;  4M7A D;  2DXU A;  3FDR A;  4PFO A;  4GLM A;  3CCQ Q;  3CCE T;  5LJ5 h;  3PT9 A;  5FU7 B;  3KBG A;  4PJO A;  5M9O A;  4XU1 A;  4PJO C;  2CKK A;  1BI3 A;  5CCA A;  1M8M A;  2KDS A;  2DD5 A;  1M9S A;  2NUP A;  3UAT A;  1OI1 A;  2R58 A;  3EG0 A;  4M75 D;  3MEV A;  2OTL A;  1O9S A;  2E5Q A;  1YP5 A;  4MZP A;  2NUT A;  2LQW A;  5DLO A;  2HCK A;  1OPK A;  1WNL A;  5CQY A;  1MV3 A;  1AWW A;  4Z02 A;  3TQ7 P;  2RHU A;  4D8D A;  1U8R A;  4E7S A;  3PNW C;  4NL2 A;  2L2P A;  3ULR B;  1UGP B;  3G4S T;  3EH2 A;  4ZN3 A;  1VQK A;  3T9N A;  4K11 A;  1YJ9 Q;  4E7K A;  1W4S A;  2CDT A;  1T0J A;  1W2B S;  3IQL A;  5FU6 C;  1VQ5 A;  3JCM J;  4XTU A;  4GY5 A;  1T3S A;  5GAM e;  2H3E B;  2J06 A;  4IUP A;  1HD3 A;  2XD0 A;  2DPP B;  2RO0 A;  4J9B A;  4HCK A;  5CVI A;  1JJ2 S;  2DF6 A;  2M9U A;  1BBZ A;  2V1Q A;  5LJ3 f;  4JJC A;  4J9E A;  3QBY A;  2R5M A;  3FRN A;  5CIU A;  3CCL Q;  3V8L A;  1OU8 A;  3GPL A;  3OYD A;  2DZ9 A;  2DXT A;  2ZGW A;  1U1S A;  1FXX A;  1ABO A;  1BCO A;  2RA2 A;  3RBB B;  1HSQ A;  4LD9 K;  5CO7 A;  2FPE A;  2ESW A;  1U1T A;  4J6X A;  3CCS Q;  2CRE A;  2GBQ A;  1X6G A;  2QXF A;  1V29 B;  2V8J A;  1KQ1 A;  1M1K R;  5C0M A;  3CXC A;  4AMC A;  2VYT A;  2X51 A;  4QVD A;  2FL7 A;  1OOT A;  2CP6 A;  3GNF B;  5GAO l;  4BE1 A;  2JTE A;  1PC0 A;  4PLL A;  2F69 A;  1I5O B;  5GAM h;  1BYM A;  1ZA2 B;  2LCC A;  5CKD A;  5GAN d;  1UGR B;  3GF5 A;  1N8R C;  1VYV A;  2DTH A;  2HQX A;  3LH5 A;  5GMK e;  1M1K C;  5HK3 A;  2IPO B;  1X01 A;  1NBE B;  1QP2 A;  2NYS A;  1B34 A;  2Y4Y A;  3A8O B;  3M53 A;  3MPU B;  2EPD A;  5GAN j;  4M77 D;  1C1A A;  4XAX B;  3OS1 A;  1M1G A;  1Y07 A;  4B6M A;  2EGE A;  3CCE Q;  1NJI U;  3CCU A;  1PSE A;  1UJY A;  4M78 F;  1E6G A;  1YHQ Q;  3G71 T;  2FZC B;  4R0K A;  4F17 A;  5HCK A;  1I5L A;  2K3B A;  1NEG A;  2CUD A;  2DRK A;  3CCR A;  3FEO A;  3HFO A;  3RIR A;  2KXD A;  2JN0 A;  3DLM A;  4NOY A;  5IHN A;  1GL5 A;  3VRY A;  1OYX A;  1QVF P;  4ZGD B;  2E10 A;  2K2M A;  1UGS B;  2LJ3 A;  3JCM V;  4M78 G;  2WSC E;  4C0G A;  4E7H A;  1RAC B;  2RHI A;  3UPU A;  4OMO A;  5D6Y A;  2CZ6 B;  4L5G A;  3HRU A;  5GMK h;  3C94 A;  2J6O A;  3QUI A;  3PMT A;  2LQN A;  1JU5 C;  2DKG A;  1K8A C;  2HD0 A;  1YCS B;  2COY A;  3G4S Q;  3DKM A;  2ZCF B;  1SPK A;  4LUD A;  1SSH A;  3OY9 A;  1QWE A;  1ZUU A;  4C92 B;  3CEY A;  1BU1 A;  3TSW A;  3M5A A;  1IB8 A;  3M0Q A;  3QPH A;  5AT1 B;  1RAI B;  2QQA A;  1Q81 U;  4KGZ B;  1YJW T;  1UHC A;  3MEU A;  1MMN A;  1NYF A;  4N4I A;  1U06 A;  2X4Y A;  1UB4 A;  4OMP A;  2E3I A;  3OQ5 A;  2K5L A;  3L2V A;  1VOM A;  3E9F A;  2FPD A;  3SEM A;  2KK4 A;  4F7U A;  2W0Z A;  2CT4 A;  3EG9 B;  5FRM A;  5LJ5 f;  2DK3 A;  2DTI A;  2CT3 A;  3L42 A;  3GNG A;  3REB B;  3BDU A;  3MHX A;  2XKO C;  1G8X A;  4QT7 A;  3I55 A;  1WA7 A;  1TS9 A;  4XTW A;  2RJE A;  2ROL A;  1S72 A;  1YI2 T;  3L2R A;  1UGV A;  4X9C A;  4L6V 5;  2MPX C;  1GXI E;  3BE3 A;  3NPF A;  1KHI A;  3FB9 A;  3CMA A;  2YRC A;  2XID A;  2DIG A;  4XU3 A;  2FPF A;  4E7I A;  2JUF A;  3LGF A;  2E3H A;  4PK4 A;  1VQP Q;  2EYQ A;  4PLI A;  2DBM A;  1ZBX A;  5J26 A;  3CC4 Q;  4EPC A;  2LCS A;  4OGE A;  1TH7 A;  1ZLM A;  2KI7 A;  4OGC A;  3VS3 A;  4O5V A;  1VQN T;  3DLL A;  4A54 A;  4OMM A;  1CSK A;  2F2V A;  1B3Q A;  4MDW A;  1M5Q 1;  2DEQ A;  3EG1 A;  4A4H A;  2GQV A;  3M0U A;  2OJ2 A;  3CCM T;  2J6K A;  1RI0 A;  1WHL A;  5I22 A;  5DLQ E;  1YIJ T;  3CCQ A;  1X75 C;  2ZPI B;  1N9S A;  2IVW A;  1VQ6 T;  2KGT A;  4RMO A;  2XDD A;  4AG1 C;  2K3Y A;  1PKT A;  2E65 A;  2HDA A;  4FU6 A;  2BUD A;  4AG2 C;  3FIF A;  1OX8 A;  3HP9 A;  2O01 E;  1LNX A;  3KXT A;  4OVA A;  1BK2 A;  1AWO A;  4BE2 A;  5KCO A;  2A37 A;  2DL3 A;  4CC4 B;  2X35 A;  3RMQ A;  4B9W A;  1MNE A;  1W2B P;  3VYG A;  4M7A B;  4M78 D;  1WHH A;  5GMK m;  2H3J A;  2KRS A;  1EZZ B;  4C92 A;  4LNP A;  4C92 C;  3BY7 A;  4PJO F;  5A0G A;  3NMZ C;  1JJ2 P;  4JRP A;  1SF9 A;  1YJW Q;  4FYY B;  2FRY A;  3OS2 A;  1YJ9 A;  4J7F A;  2MWP A;  2KE9 A;  1GCP A;  2MI6 A;  1PSF A;  4DEY A;  1ZSZ B;  4JDS A;  4JLG A;  4IUQ A;  3ASK A;  2EYY A;  4M75 B;  4QQ6 A;  4QVC A;  3QXE B;  2EQJ A;  4Y28 E;  1G3S A;  1IHV A;  3CCV T;  2GFA A;  1RAA B;  2DL5 A;  4PJO G;  4ELZ C;  2KQW A;  2EW3 A;  1MMG A;  2E5K A;  5D6X A;  2QQR A;  1Y0M A;  1YI2 Q;  2MOX A;  1PG5 B;  4XTV A;  3V7S A;  2ZPF B;  3CME T;  4NS5 A;  4M7D A;  2CZ1 B;  3OYB A;  1CKB A;  4M7D C;  2OX7 A;  3CCL A;  3PTA A;  3OYA A;  5CKB A;  2XIC A;  1M2O A;  4BY6 C;  1I1J A;  1UFF A;  1YCY A;  3U23 A;  1TSF A;  2QQ9 A;  1WXB A;  2KYB A;  5LJ5 d;  2L3P A;  2HKQ B;  2QTV A;  2J6F A;  3CCS A;  2FYK A;  1IZ6 A;  5A0L A;  2M51 A;  2O4X A;  2HL5 C;  2HSE B;  1CKA A;  2DA9 A;  1NLO C;  3EFO A;  1NJI R;  2OTJ Q;  1ABQ A;  3OYC A;  4RUG A;  4AT1 B;  1IO6 A;  2RI5 A;  2COW A;  5CR2 A;  2PQW A;  2QQB A;  3JB9 F;  1N27 A;  5I2M A;  1UJ0 A;  1R0B G;  2DX1 A;  2DER A;  2HQE A;  2M0Y A;  4KBM B;  5FRO A;  1XJW B;  1VQN Q;  2C0T A;  4AFU C;  4PJM A;  4FYW B;  5GJW B;  2HMA A;  1XQH A;  1D1A A;  2P0Q A;  4JJD A;  1PCX A;  3UT1 A;  3G6E T;  2HNI A;  1OX9 A;  2LCL A;  4KH0 B;  3HPW A;  2X3W D;  3V8J A;  2AHJ B;  1WIE A;  2YUP A;  1SRL A;  4DA4 A;  4DOW A;  2VB6 A;  2PVO B;  3JB9 G;  2FB7 A;  5CKF A;  4ATO A;  3M0R A;  3LW5 E;  2DL4 A;  3CCE A;  4MZM A;  1YHQ A;  1BCM A;  1HYO A;  2QEX Q;  4CC2 A;  4TVR A;  2JT4 A;  1VQ6 Q;  4ANJ A;  2LNV A;  3L2Z A;  2KT1 A;  1YJN T;  4JRK A;  2PU9 B;  4LDY A;  2AIR B;  4LN2 A;  3S6W A;  4BAC A;  2RH2 A;  1Q81 R;  2JM9 A;  3JCM X;  1G5V A;  1EX4 A;  3QO3 A;  4OP0 A;  4BDZ A;  3ZBD A;  2KRM A;  1K9A A;  2BZ8 A;  2CP3 A;  3N5B B;  2L8D A;  1IGU A;  4EMK A;  4NL3 A;  4A53 A;  4EMK C;  1QVF A;  2C0O A;  2LP5 A;  4FW2 A;  3VS2 A;  4M77 B;  3INZ A;  1RAD B;  2YUO A;  1LOJ A;  2F5T X;  2K6D A;  1NYG A;  1RLQ C;  2LDM A;  2IG0 A;  4RG8 A;  4Y91 A;  1Q95 G;  3EGU A;  2WSF E;  3V7R A;  1Q81 C;  3G4S A;  3E9G A;  2F2X A;  2K5I A;  4OB2 B;  1MMA A;  2QA4 Q;  4HKE A;  7AT1 B;  1NG2 A;  4JRI A;  3X20 B;  2VC8 A;  1G2B A;  1SSF A;  2LNH B;  3A5Z B;  1ZSZ A;  5KYX B;  3AHU A;  3DB3 A;  4DBQ A;  2HBP A;  3LWI A;  2CP7 A;  3MCA B;  2RK1 A;  4J9H A;  2JZ2 A;  1VIE A;  5ECA A;  3EGD A;  3CCV Q;  2DL7 A;  2X4J A;  2KRO A;  5GAN 4;  1Q86 U;  2EIF A;  2FEI A;  2L3R A;  2GQI A;  2AKL A;  2KRN A;  1RL2 A;  4ZN1 A;  2QG9 B;  4Q5W A;  4C0F A;  3H41 A;  4FYX B;  3OYM A;  2I0N A;  2K79 A;  3KUF A;  4JJN K;  1VA7 A;  3P8B B;  1Q7Y U;  1QW1 A;  2KMT A;  4A4E A;  1WLP B;  1VYU A;  4PJO D;  4X34 A;  4PJN A;  2CP0 A;  2E6N A;  4C0D B;  2MYS A;  4CC3 A;  5FWB A;  3OYY A;  5KE3 A;  3HTR A;  3M54 A;  2R5A A;  3JCM d;  3OYN A;  2GTJ A;  2L5Q A;  2DIQ A;  1D0Y A;  5KE2 A;  1FMW A;  2PNI A;  5GAN g;  2VVK A;  4AFZ C;  3M57 A;  3OYL A;  3QJY A;  1JB0 E;  5A2Q E;  4F04 B;  5IHK A;  1VQP A;  5GAN 8;  1GCQ A;  1KD1 U;  2LX9 A;  1GCQ C;  1VQ7 T;  1R77 A;  2A08 A;  4F7U F;  2JW4 A;  3CC2 T;  3CC4 A;  4EMH A;  2QTX A;  2DMO A;  2KVQ G;  4M7D E;  3CD6 Q;  4FSX A;  1UHF A;  5D7U A;  4JPB W;  3G6E Q;  2V8K A;  1V76 A;  3DB4 A;  4CRI A;  2FZG B;  4ZTJ A;  2X4W A;  4PL6 A;  2DTO A;  2PVD B;  3JB9 I;  3O5Z A;  1KK7 A;  1SEM A;  1D09 B;  2PTK A;  2ZPG B;  4DQ2 A;  3UA7 A;  3MET A;  3VS0 A;  5A0D A;  1KSW A;  4N0A A;  4N0A C;  1YN8 A;  4LD6 A;  1OPL A;  4F7U G;  1M90 U;  3I35 A;  2K4Y A;  1K1Z A;  1UEB A;  2KT8 A;  5KYY B;  1OEB A;  2EGC A;  5IXB A;  1YJN Q;  2AZS A;  3QZ9 B;  4P5N A;  2LX7 A;  3LLR A;  3JB9 D;  3BDL A;  1H8K A;  5GAO q;  3QHS A;  3JCM c;  4C8Q A;  8AT1 B;  3EFR A;  1W1F A;  4C8Q C;  2LJ0 A;  2R57 A;  1TUG B;  1M3C A;  3PE0 A;  1VQ9 T;  2HBW A;  1VQM T;  4M77 A;  2D0Q B;  2LT1 A;  5GAO n;  4KGX B;  2DNU A;  1KJW A;  2O9S A;  5FRN A;  4GBQ A;  5GAN 3;  3MEW A;  1ACM B;  1V1C A;  4E7L A;  1W2B A;  2E41 A;  5FU7 C;  5I21 A;  5KYX A;  3PIP A;  3P8H A;  2RHY A;  4J9D A;  3EHQ A;  4DBR A;  2ED0 A;  1YJW A;  3A8H B;  2DFU A;  2CH4 A;  3JB9 J;  3UDC A;  3OW2 S;  2OI3 A;  2D1X A;  1PM3 A;  2ZPB B;  4FM4 B;  1JJ2 A;  3TCJ A;  1QP3 A;  2X4X A;  2CSI A;  2QGF B;  4II1 A;  3QKJ A;  2EYZ A;  2AT1 B;  2MWO A;  3TEE A;  4RKU E;  1AZG B;  1Y71 A;  3NGP A;  2XK0 A;  3M55 A;  3RMS A;  4J5Y A;  4M78 B;  1YI2 A;  1TTH B;  1ZUK A;  3JCM P;  2HAX A;  4C92 F;  2AZV A;  1U3O A;  1VQL T;  3NTK A;  1VQO T;  2KEA A;  4XQ3 A;  4DOV A;  2LRQ A;  4OMN A;  4PJO E;  1K9M U;  2L0A A;  3JCM Q;  2LT4 A;  4FT2 A;  4HT9 A;  5GAN 6;  3QJ6 A;  4RTV A;  4FYV B;  5GAN e;  3UA6 A;  2DAQ A;  2NWM A;  4BI8 B;  1P92 A;  3S3N A;  5GJV B;  2VAS A;  2A36 A;  3UWN A;  2QYZ A;  2YUQ A;  1MHN A;  1QVG P;  1JXM A;  4C92 G;  2OTJ A;  3CC2 Q;  4KUD K;  4MZT A;  3CBM A;  4LXC A;  2E1H A;  3OMG A;  2KNB B;  3C95 A;  2D0N A;  2O88 A;  2RK2 A;  1H3Z A;  1VQN A;  4M7D F;  4J7I A;  1ARK A;  3JRZ A;  3RKX A;  1A0N B;  1O75 A;  2DXB A;  4XU0 A;  2K3X A;  1ZSG A;  2C0I A;  2E70 A;  1UEC A;  2O31 A;  2XG8 D;  5GAO p;  3V7C A;  1ZQ1 A;  4YTL A;  4XTX A;  2G3R A;  3H6Z A;  2DJQ A;  3EGX B;  2V1R A;  5KYY A;  1PNJ A; 
#chains in the Genus database with same CATH homology
 2KBT A;  1HJD A;  4ESR A;  5IHI A;  2FRW A;  3PVL A;  1MV0 B;  1AWJ A;  1AVZ C;  2DL5 A;  2EBP A;  1W70 A;  3A98 A;  1WYX A;  2EW3 A;  2E5K A;  4GLM A;  1SRM A;  1Y0M A;  2RQR A;  2MOX A;  2YUN A;  3QWX X;  1PRM C;  2JS0 A;  1MUZ A;  1LCK A;  2DLP A;  1CKB A;  3EHR A;  3VS6 A;  4J9I A;  1YWP A;  3GBQ A;  1WFW A;  2JMC A;  1GBQ A;  2AK5 A;  1I1J A;  1UFF A;  2K7A A;  3U23 A;  1KFZ A;  1M8M A;  4Y92 A;  4CC7 A;  1PKS A;  1WXB A;  2KYB A;  1N5Z A;  2L3P A;  1M27 C;  2G6F X;  2KYM A;  2JS2 A;  2J6F A;  3UAT A;  3EG0 A;  2M51 A;  1K0X A;  1CKA A;  2DA9 A;  1NLO C;  1S1N A;  1YP5 A;  1ABQ A;  2LQW A;  4RUG A;  3H0F A;  1AWX A;  1IO6 A;  4JZ4 A;  2HCK A;  1OPK A;  1BB9 A;  1E7O A;  1GFD A;  1TG0 A;  2SEM A;  1UJ0 A;  2DX1 A;  4RTW A;  1MV3 A;  1AWW A;  2M0Y A;  1PRL C;  1WI7 A;  2BZX A;  1Y57 A;  4D8D A;  2DYB A;  3PVQ A;  2C0T A;  4AFU C;  1PWT A;  5EC7 A;  2NUZ A;  5GJW B;  2L2P A;  3ULR B;  4JJD A;  2J05 A;  1WXT A;  2VKN A;  2YSQ A;  4K11 A;  1JO8 A;  2X3W D;  4D8K A;  1WIE A;  3VS7 A;  2YUP A;  1SRL A;  2CDT A;  1T0J A;  3IQL A;  2D8J A;  3M0R A;  1NEB A;  1T3S A;  2DL4 A;  4RTU A;  2J06 A;  1HD3 A;  1KIK A;  2YDL A;  2DM1 A;  3I5R A;  4J9B A;  4HCK A;  4Z88 A;  4CC2 A;  3THK A;  2JT4 A;  2DF6 A;  2EYX A;  1BBZ A;  2V1Q A;  2KT1 A;  3C0C A;  4JJC A;  2ED1 A;  1E6H A;  2RQW A;  4J9E A;  4LN2 A;  1K76 A;  4X1V A;  3CQT A;  3UF4 A;  2JM9 A;  4E6R A;  1Z9Z A;  2LMJ A;  1B07 A;  2EQI A;  1ABO A;  2GGR A;  3FJ5 A;  1AZE A;  2RQV A;  2OAW A;  2DVJ A;  3NHN A;  2RQT A;  3RBB B;  1HSQ A;  2KRM A;  1K9A A;  2FPE A;  1FYN A;  2ESW A;  2BZ8 A;  2CRE A;  2GBQ A;  1X6G A;  1JXO A;  1ZX6 A;  2RPN A;  4ZNX A;  2C0O A;  2LP5 A;  2VWF A;  3VS2 A;  2YUO A;  3VS4 A;  2K6D A;  1ZUY A;  1H92 A;  1NYG A;  1RLQ C;  4HVV A;  2W10 A;  3M0T A;  2H8H A;  1OOT A;  3EGU A;  2JTE A;  3SHW A;  2F2X A;  5FWC A;  2CUB A;  1T0H A;  4Z89 A;  1GRI A;  1NG2 A;  1YWO A;  1G2B A;  2LNH B;  1YNZ A;  3REA B;  1NLP C;  4FSS A;  4KRT A;  1VYV A;  1X2Q A;  1RLP C;  2SRC A;  1NM7 A;  2CH4 W;  3LH5 A;  3QWY A;  4J9H A;  2KXC A;  2ABL A;  4JJB A;  5ECA A;  1UE9 A;  2DL7 A;  2KRO A;  2JXB A;  2PZ1 A;  1AOJ A;  2QDL A;  2FEI A;  2GQI A;  2AKL A;  2EGA A;  4HVW A;  2KRN A;  2EPD A;  2EGE A;  1UJY A;  1K0S A;  2MIO A;  1E6G A;  3H41 A;  3M0P A;  4R0K A;  4F17 A;  2I0N A;  2K79 A;  5HCK A;  1VA7 A;  2K3B A;  1NEG A;  1UDL A;  2CUD A;  2DRK A;  2L3Q A;  1H3H A;  1WLP B;  1VYU A;  4RTZ A;  2KXD A;  4CC3 A;  5FWB A;  3I9Q A;  1QKW A;  1JQQ A;  5IHN A;  2GTJ A;  1GL5 A;  3VRY A;  1J3T A;  2PNI A;  2LJ1 A;  1QKX A;  2VVK A;  4AFZ C;  2K2M A;  2LJ3 A;  3RNJ A;  5IHK A;  4M4Z A;  3VS1 A;  1M3B A;  4OML A;  1GCQ A;  2ENM A;  4OMO A;  1GCQ C;  2RMO A;  4HVU A;  2J6O A;  1VYT A;  2A08 A;  2AKK A;  2JW4 A;  4J9C A;  2LQN A;  2EYW A;  1JU5 C;  4HXJ A;  1X6B A;  2DE0 X;  2HEQ A;  1T3L A;  2LZ6 B;  2DMO A;  2K9G A;  1YCS B;  3TVT A;  1SHF A;  1SPK A;  1UHF A;  4JPB W;  4LUD A;  1SSH A;  1QWE A;  1ZUU A;  2RF0 A;  2RQU A;  1BU1 A;  3TSW A;  3M0Q A;  4AFQ C;  2DBK A;  2CSQ A;  3O5Z A;  4J9G A;  1SEM A;  4RTT A;  2BTT A;  1TUD A;  2PTK A;  3UA7 A;  3VS0 A;  1KSW A;  1UHC A;  1NYF A;  1YN8 A;  1U06 A;  1OPL A;  2HSP A;  4OMP A;  3I35 A;  3ZL7 C;  1K1Z A;  2FO0 A;  2FG0 A;  3M0S A;  2KT8 A;  2FPD A;  3SEM A;  1OEB A;  2EGC A;  4A63 B;  5IXB A;  3VS5 A;  2W0Z A;  2CT4 A;  2GNC A;  2AZS A;  2CT3 A;  1PHT A;  2LX7 A;  3REB B;  1FMK A;  4QT7 A;  1WA7 A;  1H8K A;  1QCF A;  2ROL A;  4WCI A;  1W1F A;  1AEY A;  1UGV A;  1XOV A;  2LJ0 A;  1U5S A;  3NPF A;  4F16 A;  1M3C A;  3PE0 A;  2RN8 A;  2L3S A;  3H0H A;  1GBR A;  3TSZ A;  2HBW A;  2RNA A;  5IXF A;  2X3X D;  1WX6 A;  2O9V A;  2FPF A;  1UTI A;  3EG2 A;  4DEX A;  2DNU A;  1KJW A;  2O9S A;  4GBQ A;  2DBM A;  5L23 A;  1Z9Q A;  4IIM A;  1V1C A;  2IIM A;  2JM8 A;  2O2O A;  2LCS A;  1GFC A;  2A28 A;  1ZLM A;  4J9D A;  3EHQ A;  2ROT A;  2DRM A;  2ED0 A;  3VS3 A;  2MCN A;  2CH4 A;  2OI3 A;  3JV3 A;  2D1X A;  4JZ3 A;  1WXU A;  2D8H A;  4OMM A;  1CSK A;  2F2V A;  1B3Q A;  4LE9 A;  2CSI A;  1JEG A;  2P4R A;  2EYZ A;  3EG1 A;  1SHG A;  2YT6 A;  3M0U A;  4RTY A;  2OJ2 A;  5FW9 A;  2J6K A;  1WDX A;  1AZG B;  1W6X A;  3NGP A;  4RTX A;  5I22 A;  1G83 A;  1EFN A;  3EG3 A;  3I5S A;  1ZUK A;  1QLY A;  1AD5 A;  2AZV A;  1TUC A;  1U3O A;  4LUE A;  2KR3 A;  3H0I A;  2KEA A;  2DIL A;  2ECZ A;  2KGT A;  1K4U S;  4OMN A;  1X69 A;  4Z8A A;  1OV3 A;  3R6N A;  2L0A A;  4AG1 C;  2EKH A;  1PKT A;  4RTV A;  2HDA A;  4AG2 C;  3UA6 A;  4F14 A;  2NWM A;  1QWF A;  1BK2 A;  1AWO A;  3VRZ A;  1X43 A;  2A37 A;  5GJV B;  2DL3 A;  3KFV A;  4CC4 B;  1I0C A;  2A36 A;  2YUQ A;  1UUE A;  2DL8 A;  1JXM A;  1X27 A;  1UG1 A;  2J7I A;  2GTO A;  4AFS C;  4OMQ A;  2JMA A;  1X2K A;  1I07 A;  1RI9 A;  4IIO A;  2KNB B;  2D0N A;  2KRS A;  2F2W A;  2B86 A;  2EVR A;  2O88 A;  4LNP A;  1M3A A;  1M30 A;  1RUW A;  1ZBJ A;  1ARK A;  3NMZ C;  1A0N B;  4J9F A;  4EIK A;  2FRY A;  1ZSG A;  2C0I A;  2O31 A;  1UEC A;  4ORZ A;  2BZY A;  2KE9 A;  2XMF A;  1GCP A;  5I11 A;  4DEY A;  2DJQ A;  5IH2 A;  2V1R A;  2EYY A;  1PNJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...