4JJDA

Crystal structure of the n114a abl-sh3 domain mutant at ph4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
59
Chain Sequence
MENDPNLFVALYDFVATLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
total genus 12
structure length 59
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjdA00
5GJVB 2AKLA 2O2OA 3H0IA 2DRMA 1SHGA 3EG1A 3REAB 4R0KA 5FW9A 2RQRA 3UA6A 3VRYA 1AEYA 1WFWA 1AWJA 1VYTA 1X6GA 2KRSA 1UTIA 2OAWA 2EQIA 3ZL7C 1K1ZA 4RTWA 2JT4A 1UECA 1UJ0A 2JXBA 4Y92A 4J9CA 1Z9ZA 2LMJA 1X2KA 2W0ZA 3R6NA 2J06A 1ARKA 2DILA 2CUBA 1M8MA 1OOTA 2DMOA 2DYBA 2J05A 3GBQA 1K9AA 1GCQC 2KRNA 2KYBA 4RTYA 1JXOA 2AK5A 4D8KA 3U23A 2KRMA 3A98A 1HD3A 2RQTA 1QWFA 1PKTA 1N5ZA 1X27A 2KT1A 2W10A 1T0JA 4JPBW 1I1JA 4CC7A 2CREA 1LCKA 2LQNA 4RTZA 2X3WD 3EG3A 1PNJA 1PHTA 2MCNA 2VKNA 2DBKA 1SHFA 4Z89A 2V1RA 1MUZA 2PZ1A 2LJ0A 1SEMA 2CH4W 2YUQA 3H0FA 1ZLMA 2EVRA 3NMZC 2ABLA 1AZGB 1JO8A 2AKKA 4Z8AA 1WXTA 2DA9A 2KT8A 1X2QA 5FWCA 1M3AA 1UG1A 2C0OA 2K2MA 2A37A 2JTEA 2D8JA 1MV3A 3TVTA 3M0SA 2CH4A 2DVJA 4HXJA 2KNBB 3PVQA 2DL3A 2BZYA 1FYNA 4LNPA 1AWXA 1YCSB 2HSPA 3VS4A 1ABOA 2LZ6B 2CDTA 3SHWA 1I0CA 2I0NA 2L3SA 1NYFA 2DF6A 1K4US 1BBZA 1GBRA 1JXMA 2CT4A 5L23A 2M0YA 2EPDA 1NM7A 3EG2A 1BB9A 4F14A 2CT3A 1ZUUA 2L0AA 3NHNA 3M0TA 2ED1A 3VS2A 2LP5A 1JU5C 4ORZA 3TSZA 2LQWA 1KFZA 2EYWA 1PKSA 2GGRA 3FJ5A 3M0QA 2D1XA 1GBQA 4RTXA 2ENMA 1AWWA 1Z9QA 1BK2A 2DL7A 1W1FA 5GJWB 3NGPA 1VYVA 2K3BA 1CKAA 1E6GA 1GCPA 2YUOA 1UJYA 1HJDA 2EYYA 4GLMA 3QWYA 1G83A 2JMAA 2G6FX 4RUGA 1EFNA 2BZ8A 2H8HA 4M4ZA 3H0HA 1AOJA 1YP5A 2F2VA 5HCKA 2VVKA 2AZVA 2FRWA 2NWMA 2KBTA 2ROLA 1ZX6A 2IIMA 2OI3A 4F16A 3I5SA 5I11A 2K7AA 3KFVA 1TUCA 2O88A 2YUNA 4RTUA 4AFUC 3NPFA 4K11A 1B3QA 5IXBA 1WA7A 2EGEA 3RBBB 3UATA 3VS7A 1T3SA 1U06A 2AZSA 1T0HA 2JW4A 1ABQA 4CC4B 2KE9A 1QCFA 2MOXA 1W70A 1NG2A 2O9VA 2YDLA 4RTVA 2KYMA 3SEMA 1CSKA 2VWFA 2EW3A 2J6FA 2JMCA 5I22A 2FG0A 3PVLA 1KSWA 1JQQA 2ESWA 1H3HA 1WXUA 3M0RA 4X1VA 1E7OA 2O31A 1OPLA 1KIKA 1J3TA 2GNCA 3H41A 3VS0A 1AWOA 4DEYA 2GQIA 2RPNA 1PRMC 1WDXA 1AVZC 1AD5A 4AFSC 2DX1A 3VS3A 1NLOC 2KXCA 2YUPA 4OMQA 1NYGA 2JS0A 2KGTA 3CQTA 1PRLC 1I07A 1MV0B 1QWEA 1XOVA 2A36A 3REBB 1PWTA 5ECAA 3IQLA 1A0NB 1WIEA 3EGUA 2M51A 3EG0A 1K0SA 2LX7A 1OV3A 4FSSA 5FWBA 1M30A 4ESRA 1OEBA 1BU1A 4AFZC 1GL5A 2XMFA 4JZ4A 2E5KA 1M3CA 1VYUA 5IHKA 3UF4A 4JJBA 1WXBA 3I35A 4LN2A 4AFQC 2YSQA 2K9GA 2F2XA 1UHCA 1NEGA 1OPKA 2DM1A 2YT6A 4DEXA 1ZUKA 2EBPA 1YWPA 4HVVA 1E6HA 1B07A 2GBQA 4RTTA 1X43A 1AZEA 1U3OA 1TUDA 4AG2C 3EHQA 2EYXA 4LE9A 2L3PA 3PE0A 4HVUA 5IHNA 5IH2A 4GBQA 3TSWA 1H92A 1NLPC 2HEQA 4J9IA 3I5RA 1Y57A 1QKXA 3M0PA 2ED0A 2KEAA 2KXDA 1UE9A 2DL8A 1TG0A 4OMPA 2GTJA 2DLPA 1H8KA 4LUDA 4Z88A 1YWOA 2RQUA 2LJ3A 1IO6A 2B86A 1GFCA 2V1QA 2RQWA 1RLQC 1Y0MA 2L3QA 4KRTA 4OMLA 2JM9A 1SSHA 3EHRA 3I9QA 4QT7A 4ZNXA 3VRZA 4J9GA 1WX6A 2D8HA 1JEGA 1U5SA 3LH5A 2NUZA 1ZBJA 2RNAA 1RUWA 4JZ3A 2FEIA 2LCSA 1W6XA 2CUDA 2DL4A 2SEMA 2DE0X 4JJCA 5IHIA 2FRYA 3THKA 4J9HA 2X3XD 1V1CA 1VA7A 4J9EA 3JV3A 2DJQA 2J7IA 2DL5A 1SPKA 3QWXX 1K76A 3C0CA 1WYXA 2ROTA 2BZXA 2ECZA 4IIOA 4F17A 1GFDA 2QDLA 2P4RA 1GRIA 2LJ1A 2PTKA 2BTTA 2K79A 1M3BA 1ZSGA 1UGVA 4CC3A 4HVWA 1RLPC 2PNIA 1SRLA 2DNUA 2RF0A 2KROA 3O5ZA 5EC7A 2FO0A 5IXFA 2LNHB 2F2WA 1NEBA 2C0IA 1S1NA 2C0TA 2L2PA 2D0NA 1QLYA 2CSIA 2SRCA 1KJWA 1WLPB 2RMOA 3M0UA 4EIKA 4J9BA 1UDLA 1G2BA 2DRKA 1X69A 4JJDA 2A28A 2DBMA 2J6OA 2O9SA 1WI7A 4AG1C 1HSQA 4OMOA 1ZUYA 3VS1A 4A63B 4IIMA 4J9DA 2K6DA 1K0XA 1YN8A 3RNJA 2EGCA 4D8DA 1FMKA 3VS5A 2FPDA 1GCQA 2GTOA 1QKWA 2JM8A 2EKHA 2HBWA 1UFFA 1X6BA 2J6KA 1UHFA 1CKBA 2HCKA 1YNZA 4HCKA 1UUEA 2FPFA 2MIOA 2HDAA 4CC2A 4E6RA 2CSQA 2RQVA 2FPEA 2EGAA 1M27C 1T3LA 2A08A 4LUEA 1RI9A 4OMMA 1SRMA 2JS2A 4OMNA 2EYZA 2KR3A 4J9FA 3ULRB 3UA7A 2OJ2A 2RN8A 3VS6A 4WCIA
chains in the Genus database with same CATH superfamily
4FM4B 2O2OA 3H0IA 1TS9A 2QQRA 2RHXA 5FW9A 3JCMd 5GMKl 1WFWA 4PJOG 1UTIA 1WJSA 2OTJA 1NJIR 4MDWA 5GAN4 3OYNA 4M78C 1UECA 3MEVA 4J9CA 5GAOm 1JJ2P 1Z9ZA 3QIIA 4F7UA 3A8LB 3VV0A 2W0ZA 3R6NA 1WJRA 2XIDA 4BUGA 1VQ5A 2DILA 3OYEA 1OOTA 3GBQA 4J6XA 2YRDA 4DOVA 4FU6A 1NJIU 2KRNA 1O9SA 4IUQA 4VUBA 1QVGS 1VQNQ 2M9UA 3CCJT 1R0CB 2RQTA 2A0FB 1PKTA 4JPBW 5DY9A 2DEQA 1YITT 3OW2A 1PNJA 2MCNA 1W2BS 3MJXA 1KD1R 2DZCA 2KAFA 2VV5A 1D0ZA 2CH4W 2E5QA 2EVRA 3NMZC 2ABLA 2DTOA 1VIFA 4M78B 5J26A 3JCMf 3CCVT 1VQ4T 2DA9A 3CCLT 3CMAA 2C0OA 2LNVA 2K2MA 1KD1U 3D7SB 3TVTA 2CH4A 3VU3C 2QG9B 1ZBXA 2LCLA 4M7AF 3PVQA 2RB6A 3OYAA 1Q81C 5HK0A 1PG5B 1ZA2B 2O4XA 4LNPA 3GIBA 2MK5A 2OTJQ 1ABOA 2LZ6B 1WHLA 3SHWA 4FW2A 1I0CA 2I0NA 1NYFA 1TTHB 3CC2Q 1GBRA 5L23A 3LWIA 5M9OA 2M0YA 2EPDA 1H3ZA 3EG2A 4DBFA 7AT1B 3MKDA 2L0AA 5GMKe 3M0TA 2Y4XA 2ED1A 4DBRA 3T9NA 3VS2A 2WSEE 4M7DG 3L1AA 4ORZA 4C0ZA 1KFZA 4JDSA 1BIAA 1GBQA 4ZTFA 3EGXB 4RTXA 1QCNA 1Z9QA 1K73R 2EQUA 1YJNQ 3RKXA 1E6GA 3CCQT 1P92A 2VB6A 4C92G 4KGZB 4N4HA 2V8IA 3C4SA 2JTMA 5DLQE 1XJWB 4PFOA 4EPCA 1G83A 2JMAA 2XDDA 3OB9A 5FU6C 3LGLA 2CP5A 4C8QF 1K73U 1X6OA 1C1AA 4PJOD 3G4SA 4HCBA 3DKMA 1ZX6A 3I5SA 5I11A 1YJWA 3KFVA 4BY6B 3FRNA 3VKIA 4HCZA 3UPUA 3JB9F 4K11A 2E1HA 2GFAA 4OB2B 1YJ9T 2GFUA 2JUFA 2CZ7B 1KQSA 2PUOB 2BKDN 2HQEA 2ZPHB 3EH1A 1ABQA 1NE8A 1VQ8A 1QCFA 4F7UF 4DBHA 2YDLA 4RTVA 5CVIA 3JB9J 1LNXA 2VWFA 3X28B 2EW3A 2JMCA 1S72A 2DD5A 4JLGA 2EKOA 1WHKA 5KYUA 1UGSB 2ESWA 4ME7A 4X1VA 2E6NA 2RK1A 5KYYA 2X35A 4C5HA 1AWOA 2RM4A 3GP8A 5KYXB 1AVZC 3CCJQ 4BDYA 4JRQA 1OZ3A 5GAN6 4ELZC 4C5IA 3M4GA 4OMQA 2KGTA 1PRLC 1I07A 1XOVA 3NFCA 3V8KA 2A36A 3G6ET 4M75E 2RA2A 3NTHA 2EJFA 3HRUA 5GAOp 2DKGA 2DTHA 4KULA 1ZHIA 1WIEA 2M51A 1QVGP 1R0BG 2M02A 5GAOn 2VGNA 5C0MA 3QDRB 5FWBA 2ATCB 3OYJA 1JB0E 3CCVQ 1VQ4Q 3EFSA 3CCLQ 2YXYA 1M3CA 4JRKA 2MI6A 3UF4A 3G4SQ 1Y96A 3MO8A 4M7DA 3M4YA 1W2BP 1EX4A 4IKFA 8AT1B 3CCUQ 3A5ZB 1JRIA 1M1GA 3DB3A 1OZ2A 2BE7D 1ZUKA 2EBPA 2HNIA 4HVVA 4L6V5 1EZZB 5FU7C 3PIOA 3NTIA 2AHJB 3CCST 1ZSZC 3CC4A 1SKUB 1KQ1A 2L3PA 5GAMe 8ATCB 4XTYA 5KCHA 5HK3A 5D6XA 2V26A 1VQ6T 4C92D 4B9XA 1UE9A 5KCOA 3JCMh 1TG0A 4OMPA 2DLPA 2QQBA 5GANe 1VQOT 2VXFA 1PD1A 3Q1JA 1WHGA 2ZPIB 2RQUA 3CCQQ 1GFCA 1K73C 5GAN3 3KBGA 4C0DC 3LYIA 4ELYC 3I56A 1VQLA 2KDSA 5IAYA 4ANJA 3GF5A 4J9GA 1OX9A 1JEGA 5LJ5e 1YHQQ 1ZSZB 2HKQB 2CP2A 5LL6S 2C06A 4KBMB 1YJ9Q 4LDWA 2NLUA 2HBPA 4J9HA 3LW5E 5CCAA 4PFZA 1M8VA 1V1CA 1VA7A 4J9EA 3CCET 2K4YA 2DJQA 2DL5A 3V8JA 1YI2Q 3RIRA 3CCRQ 2BZXA 4IIOA 4PJOC 2QDLA 5FROA 3A8HB 4QVCA 3A8GB 1YCYA 4XQ3A 3M58A 2GQVA 3LGFA 3OBYA 1ZSGA 1NPPA 3P8DA 4A4FA 4C0DB 2O4XB 4HVWA 1G3TA 1N9RA 5IT9E 5EC7A 1OX8A 3EAEA 1S1NA 2L2PA 2CSIA 2QEXQ 3DB4A 3M0UA 4EIKA 2QQSA 4M78A 3QYHB 4QKUA 2HAXA 5KYWB 4A63B 4J9DA 2NYSA 4FYWB 3MEAA 1WHHA 4D8DA 2XDPA 3FLGA 3PNWC 1IHVA 4M77G 2D6FA 4PJOB 4M7DF 2JM8A 2EKHA 2I2LA 3JCMX 2J6KA 1YNZA 4HCKA 3OBWA 4FIBA 1UUEA 1KQSS 4CC2A 3OMCA 4E6RA 1M27C 4X9CA 2DFUA 2A08A 2QYZA 3CCSQ 1IRXA 2DYIA 1SRMA 1Q7YR 4LDVA 1YFNA 2KR3A 4ZN3A 3QYGB 2DJZA 2ZPGB 3EGXA 5GJVB 4J83A 2RQRA 1VQ6Q 2K2VA 2XK0A 5LJ3g 4KH1B 1Q7YU 2PUKB 4N0AA 4WF2A 4O6JA 2CP3A 1UJ0A 4Y92A 1UGQB 3QO3A 4M7DC 2QQ9A 3JAME 2J06A 4E7ZA 3RKWA 4F04B 3CMET 4M7AE 3P8BB 1PSFA 2DYBA 1K9AA 4JUVA 3X25B 3N5BB 1FWZA 3FIFA 4D8KA 4C92C 2EIFA 1B7TA 1G8XA 1HD3A 1QWFA 1N5ZA 2KT1A 4J7FA 1T0JA 4HCCA 4KGVB 1LCKA 2LQNA 1M90R 3HFOA 1X01A 3OW2P 4UC4A 1QP3A 1Q81R 1PHTA 3OYLA 3E2UA 3CCEQ 5A0DA 1SHFA 4A54A 3UWNA 1MUZA 3FDRA 2LJ0A 1SEMA 5D7UA 2QASA 3H0FA 1ZLMA 1QCOA 5LJ3d 5KYXA 5GAOl 4XU3A 2AKKA 1VQ7A 4Z8AA 1M90U 2OTJT 1Q81U 1X2QA 2BUDA 4PKCC 1UG1A 2LCCA 4MMKA 1D3BB 2D8JA 4FCYA 1RAIB 1VQMA 4HXJA 2E6ZA 4NL3A 2DL3A 2BZYA 2VC8A 1N27A 2L89A 1VQ5T 4R55A 5CQYA 2LC4A 2QI2A 1FYNA 4C8QE 1QVFA 3KXTA 4C92B 4OGCA 3ZEHA 4CRIA 3VS4A 3S3MA 4M78F 2EFIA 4QVDA 1G5VA 2M1HA 3RDVA 1BBZA 3OA6A 2CT4A 4NS5A 4FYXB 2ZPEB 4M77D 1PC0A 4F14A 2CT3A 4FT4A 3META 3QJYA 2Z0WA 2LP5A 1JU5C 4RCCA 4J6YA 4F7UE 2LQWA 2LT1A 4OP0A 2DL7A 1N8RC 1W1FA 1VYVA 2K3BA 4XU0A 5CO7A 4RKUE 1GCPA 2LVMA 4FT2A 5LJ3f 3JCMJ 3CMAT 3URGA 2KVQG 3M5AA 1WGSA 1HJDA 2LRQA 2G6FX 3I55A 2BZ8A 3MHXA 3R6OA 4BE1A 3MP8A 2F2VA 3EGDB 2RJEA 2BIVA 5HCKA 3RERA 2AZVA 2NWMA 4A4HA 2KBTA 3FC3A 2EJ9A 2QXFA 5D6WA 3WXMB 3CXCS 2VGMA 1TUCA 1Q7YC 2YUNA 2YLBA 4RTUA 1WA7A 2ZPBB 1KQSP 1U06A 3RMQA 1VQ9A 2MOXA 3OSSC 3X24B 2MPXC 2O9VA 2CZ0B 3SEMA 2RJCA 1BKBA 1FXXA 5I22A 3J7AF 2R5MA 4Q5WA 3A1PA 1Q86R 1H3HA 3CMEQ 1ZSZA 5CKFA 3EH2A 1OPLA 1IB8A 3TREA 1KIKA 3H41A 3HFNA 4XAXB 4DEYA 2QA4Q 1WHMA 2K5FA 2RPNA 1PRMC 2DX1A 2FZKB 1RAGB 1Q86U 2X51A 3FB9A 3O8VA 2JS0A 2OX7A 3CQTA 1NBEB 3G4ST 3BE3A 2QDYB 3WVEB 1PWTA 1YJWT 4RCBA 3V8LA 2PVGB 2MYSA 1M90C 1A0NB 3EG0A 3JSCA 3CCUT 4N0AC 1Q82R 2LX7A 1OV3A 3OY9A 4FSSA 3CCMA 5GAOr 3I55Q 2K5IA 1VQ8T 1UB4A 4LXCA 4JJBA 4AFQC 4BY6C 1S72T 1Q82U 1UHCA 2DIQA 4RG2A 2ZCFB 1VQ5Q 3QDFA 3OSVA 2DM1A 2YT6A 2CGHA 5KYWA 4XU1A 2HQXA 1E6HA 2ZAEA 1D1AA 2GBQA 1RL2A 1X43A 4RTTA 2L3RA 4LDUA 4AMCA 1TUDA 2X4JA 5CIUA 1MMAA 1D0XA 4LE9A 2HMAA 3M57A 4PJOA 4GBQA 4RMOA 2CYZB 2HEQA 4J9IA 1UEBA 4C0GA 1HYOA 3I5RA 1Y57A 1QKXA 3RKYA 2ED0A 2KXDA 1WNLA 2JJ9A 6AT1B 2MWPA 4M75G 5KH6A 4KH0B 2GTJA 1YITA 3CPWA 2NUTB 1MNEA 4OGEA 1YWOA 1YHQT 2LJ3A 4LDYA 1YIJA 3VUBA 2RQWA 3CMAQ 1RLQC 1Y0MA 4PJMA 2L3QA 4M77C 4QQDA 4KRTA 2AT1B 3EHRA 1Y7XA 1XQHA 2EYQA 3I9QA 4QT7A 3QHSA 4QVZA 3VRZA 2RJDA 3JRZA 1WX6A 3EFRA 3LH5A 1YI2T 3CCRT 1V76A 2CS7A 1RAFB 4JZ3A 2RI2A 1W6XA 3X20B 1MNDA 3CC4T 4EMHA 2SEMA 4OF1A 2JVVA 2X3XD 3WVDB 9ATCB 1C6VX 1ZA1B 4XU2A 3SWNC 1K76A 3QG1A 1R8OB 4PLLA 2JN0A 4F17A 2EJGA 2RHYA 3QBYA 3CXCP 1M1FA 3JB9H 2PTKA 3QZ9B 2BTTA 2NUPB 5LJ3h 2QEXT 2LT4A 2EQMA 4M77B 1Q86C 4CC3A 1UGPB 3CBOA 1ZQ1A 3MCAB 2KMTA 2RF0A 3HTRA 3O5ZA 1VQLT 5IXFA 3BDLA 2LX9A 2C0IA 2HL3A 2YWWA 2C0TA 2RI5A 2JZ2A 3J81E 3H8ZA 4BI8B 2ZPFB 4J9BA 4KGXB 2E3HA 1G2BA 1M9SA 2WACA 2CZ6B 4WTOB 4JJDA 4C5EA 1YJWQ 2DBMA 2P84A 3RR6A 3CD6A 3LX7A 1HSQA 2RH2A 3VS1A 1D3BA 2KK4A 1C0MA 4DOWA 4IIMA 4EDUA 3SWNB 1YN8A 3RNJA 4BB7A 2FPDA 1VQ8Q 1Q82C 1OULA 2YRCA 4E7KA 1QKWA 1WPYA 4R56A 4J7IA 1I5OB 4C92A 3JCMP 3L2WA 1UFFA 1X6BA 1VOMA 1S72Q 3QPHA 1UHFA 1CKBA 2HCKA 2DK3A 1LJOA 2HDAA 3LLRA 4D6WA 2COYA 1NPRA 2EGAA 2XKOC 1T3LA 4LUEA 1QQJA 4OMMA 4PJOF 1VUBA 5GMKi 5FLXE 3UA7A 2P4TA 2OJ2A 5CKDA 4M75D 1AHJB 2DRMA 3REAB 4R0KA 3OW2S 3MPUB 3UA6A 2DETA 2E3IA 3QKJA 1AWJA 1X6GA 2KRSA 2E65A 2OAWA 3BY7A 2EQIA 3ZL7C 2XI9A 3G6EA 1F1BB 2F5KA 4OB0B 1H641 4E7HA 3EGDA 2M16A 4BI3A 3EG9B 1X2KA 1RAHB 2DVEA 4BE0A 5GAMg 1M8MA 2DMOA 2LQ8A 1FX7A 1QVPA 1GCQC 4RTYA 3NTKA 2AK5A 1OU9A 2KRMA 2VXEA 4M78E 4DQ2A 3ASKA 3GNFB 2VUBA 2W10A 4JRIA 5GANg 3OYKA 4CC7A 3CC4Q 3PGGA 2X3WD 5HKCA 1D0YA 1MMDA 2EQKA 3M9QA 3UT1A 3CC7A 2RD1A 4Z89A 2V1RA 2DXTA 1FMWA 4OVAA 3LH0A 1AZGB 4O5VA 5CKHA 2K3XA 4XTXA 5LJ5g 3GNGA 2FZGB 1M3AA 3SDZA 4C5GA 1MV3A 2CP7A 2DVJA 3VUZA 3JCMW 4A4EA 3UDCA 3HHTB 5GAMd 3I56Q 1VQLQ 2FYKA 1VQOA 4IUPA 1G3SA 3VJPA 1AWXA 1YCSB 2P0KA 4FSXA 1WJQA 2HSPA 1KQ2A 1N8RR 3GOXA 5LJ3j 2L3SA 4M7AG 2DF6A 3TCJA 2R57A 1JBMA 1NM7A 2D9TA 5GANd 1BB9A 2QQAA 1ZUUA 3JCMc 2OTLA 2Y90A 1RADB 5L8RE 1N8RU 5EG2A 1IHWA 3TSZA 3OMGA 4C92F 3C95A 4X9DA 3M0QA 2D1XA 4N4GA 3C94A 5GJWB 3NGPA 4ZGJB 5LJ5d 1VQ7T 2YUOA 2EYYA 4IUUA 1VQMT 2H8HA 1PCXA 4M4ZA 3H0HA 1M1KC 1G3WA 1AOJA 3E9GA 3TEEA 1HXDA 3V7RA 2ROLA 2RJFA 2OI3A 5FRNA 4GLKA 1BI3A 1VQPA 2NUTA 1PSEA 1N9SA 5CK9A 4V2SA 5IXBA 2DZ9A 4DA4A 2EGEA 4C8QG 3CBMA 3UATA 1T3SA 2FVUA 2AZSA 1T0HA 5KYNA 2JW4A 1OYXA 1M4ZA 1VQKA 2RI3A 2KSSA 3MEUA 4FW1A 2PVDB 2QA4T 1W70A 1NG2A 2KQWA 2DAQA 2X4YA 3HPWA 2JOYA 2KYMA 3S6WA 3PVLA 1KSWA 1KHCA 1YBYA 4MZMA 1JQQA 3JCMe 1WXUA 3HRTA 3M0RA 3JCMQ 4M75C 2GNCA 2KY9A 4F7UG 1DJ7B 3VS0A 2L8DA 1RI0A 2CP6A 4YTLA 2V8KA 3G71A 5C6SA 2Y4YA 4QW2A 1NLOC 3TU4K 3I55T 2KXCA 1D1CA 1NYGA 2M0OA 3MP1A 3FEOA 1KC8C 5GMKh 1D09B 3REBB 2FB7A 2NUPA 3M56A 4CI0C 2IG0A 1LVKA 1K0SA 4M77A 1IGUA 3VYHB 3L2VA 1M30A 3OYCA 3OYFA 1OEBA 1RACB 1BU1A 4AFZC 1GL5A 4JZ4A 1VYUA 4X34A 2AIRB 5IHKA 1VQ9T 3I35A 2YSQA 1EIFA 4M75B 1VQPQ 4M7AD 3TQ7P 1I81A 2OAUA 1VQNA 1NEGA 3M55A 1OPKA 1B07A 4BDZA 3OYGA 4MDXA 3SWNA 4L59A 2EYXA 2H3EB 1IXDA 3JB9I 4B9WA 3PE0A 4HVUA 2RHZA 4E7SA 5IHNA 5IH2A 4IUTA 5AYFA 5GAN2 1NLPC 4HT8A 1V29B 4EMGA 5CR2A 2MWOA 4XTUA 3RMSA 2QAZA 2WSFE 2DXUA 3VYGA 3INZA 3E1SA 4A4KA 3L2QA 4LUDA 1N6AA 4Z88A 4QQ6A 3L2ZA 2IVWA 1VQ7Q 3OYMA 3EFOB 1WQWA 4EMKC 2K57A 2JM9A 3BFMA 1SSHA 3DLLA 1VQMQ 2F1LA 2HD0A 5J39A 4PJNA 2CZ1B 4ZNXA 4C8QD 4MZPA 3ER0A 2D8HA 2FL7A 4C0FA 3CC2A 2NUZA 1ZBJA 2RNAA 4MMLA 1RUWA 1K8AC 3LWHA 2RK2A 4TVRA 2LCSA 4IURA 3JB9D 2RHIA 2DTIA 3CEYA 1BCMA 4HA8A 2K3YA 2G3RA 2EQJA 2FRYA 3EG9A 3THKA 2PQWA 3SB2A 3JV3A 5GAOq 1KK7A 2J7IA 3HL8A 1SPKA 3C0CA 5I2MA 2ROTA 1YJNA 4II1A 1GRIA 1BIBA 3E9FA 2K79A 1UGVA 4EMKB 3GLXA 2E41A 4LDXA 1YIJT 1Y71A 2PNIA 4Z02A 5GAN5 1TXQA 5IN1A 2KROA 3A8OB 1U8RA 1B34B 1NEBA 2D0NA 4FYVB 3G1JA 4PJOE 2SRCA 1KJWA 5GAMh 1WLPB 2XG8D 2RMOA 4BD3A 1X75C 2H3JA 1M2OA 2DRKA 1X69A 4ZN1A 2ZZDA 2A28A 4OB1B 4M77F 4AG1C 4E2FB 3L2UA 4OMOA 3OYDA 2D0QB 3HRSA 2DPPB 2K6DA 5GMKm 1K0XA 5GANh 2QGGA 2DD4A 1FMKA 3VS5A 3L42A 1GCQA 1RABB 1VQ9Q 2DXBA 5GMKj 4BACA 1G3YA 3OS0A 2EAYA 1ACMB 4KUDK 1LOJA 2X9HA 1IREB 2A7YA 2DEUA 2QK0A 4IUVA 3PMTA 2FPFA 2MIOA 2E10A 2V8JA 5I21A 3CCJA 5LJ5h 2CSQA 2COZA 2FPEA 2F5TX 3G7ZA 4PJJA 2YHTA 2RO0A 2CKKA 2JS2A 1SG5A 1Y07A 2EYZA 2CP0A 3ULRB 2FZCB 3VS6A 3P8HA 4WCIA 5CKBA 2AKLA 1SHGA 3EG1A 4M7AC 3H9NA 3VRYA 1AEYA 3CD6T 1QP2A 1XNIA 1K9MC 1VYTA 3FJPA 4QQGA 3CCVA 1VQ4A 1I5LA 2HKNA 1TWBA 3CCLA 4J8OA 3OYBA 3KUFA 2E70A 3CCMQ 4E7IA 1K1ZA 4RTWA 2JT4A 4XTZA 2DERA 2JXBA 1BCOA 1OU8A 1M2VB 4NL2A 5I2SA 1JJ2A 2LMJA 4Y28E 3AT1B 3CCUA 4BE2A 1ARKA 3HKSA 1TUGB 1NZ9A 2CUBA 2J05A 3JCMb 4E7JA 4B6MA 2KYBA 1PD0A 1JXOA 2XDBA 3U23A 1QVFS 2LTOA 3A98A 4KUIA 1NJIC 1PM3A 1X27A 4M7DE 3PIPA 1I1JA 3QSUA 3A8MB 2CREA 4RTZA 1IZ6A 2K5LA 3EG3A 3OS5A 4JJNK 1HK9A 2F69A 4M7AB 4PFPA 2VKNA 2DBKA 2DXCA 4PLIA 5GAN7 5KE3A 2PZ1A 5FU6B 2YUQA 3OQ5A 2GCXA 4C92E 3I56T 4C8QC 1RAAB 1SF9A 3JCMV 1JO8A 3CCQA 1WXTA 1AT1B 2KT8A 5FWCA 2MAMA 1YITQ 2VASA 4PK4A 2A37A 2JTEA 3RESA 3M0SA 5A0LA 1YIJQ 2KNBB 2HZYA 3ME9A 4ZGEB 1VIEA 2RHUA 1KD1C 4PNOA 1YHQA 4ATOA 3RUXA 2CDTA 4FYYB 3PMIA 5A2QE 3MEWA 1K4US 1IGQA 2JNGA 1JXMA 2IPOB 1YJ9A 2QGFB 1Q95G 3NHNA 3HP9A 4M78G 4M75A 2GF7A 2KI7A 4JRPA 1M1KR 1YI2A 4RG8A 3CCRA 5GAMj 4C8QB 3CC7T 2EYWA 1PKSA 2GGRA 3FJ5A 3OYIA 1U1SA 4M7DD 2ENMA 3GPLA 1AWWA 1BK2A 4LD6A 1BI0A 1CKAA 3AHUA 1M1KU 1UJYA 5GANj 4GLMA 2R58A 3QWYA 4RUGA 1EFNA 1OQKA 4AT1B 1YP5A 4F7UB 4KT0E 2QEXA 2DIGA 2VVKA 2FRWA 2IIMA 3PT9A 4F16A 2K7AA 2O88A 4OB3B 2E4HA 2A3LA 4AFUC 5LJ5j 3NPFA 1B3QA 3CD6Q 3RBBB 3VS7A 3EFOA 3QJ6A 3PFSA 4CC4B 2KE9A 2OTLT 3QUIA 4HKEA 5FU7B 1CSKA 2J6FA 3PTAA 1KC8R 2FG0A 2P0PA 5KE2A 3QZ5B 1D1BA 1E7OA 2O31A 1J3TA 1I4K1 3HSBA 1QW1A 2GQIA 2P0QA 1WDXA 4BI4A 3CCSA 2HSEB 1AD5A 4AFSC 1KC8U 3VS3A 3CXCA 2XHCA 2YUPA 1MV0B 1QWEA 4PL6A 4GY5A 1VQ6A 5ECAA 3IQLA 1VQPT 3EGUA 4EMKA 1QVGA 1WHJA 3F70A 1QVFP 4ESRA 3BDUA 1VQKT 3SFMA 5CKEA 2XMFA 2E5KA 4ZTJA 2R5AA 2B8AA 3G6EQ 1B34A 4LD9K 4HT9A 3CPWS 1WXBA 4LN2A 2K9GA 2F2XA 3S3NA 1W2BA 3CBPA 5LJ3e 4DEXA 1YWPA 2QTVA 1WZOA 2LQKA 3QXEB 1BYMA 1UGRB 4M78D 1AZEA 2X4XA 1U3OA 4AG2C 4J6WA 3G71T 5A0GA 2XICA 2WSCE 3EHQA 1BI1A 5AT1B 2PVOB 1JJ2S 4M75F 3CCEA 4MZTA 3V7SA 1H92A 3TSWA 3ZFJA 3M0PA 2LDMA 3CC7Q 2KEAA 4E7LA 2YLCA 2DL8A 1GXIE 1MMNA 1U1TA 3M54A 1K8AR 1H8KA 1MHNA 5DM7R 5D6YA 5FRMA 5GAMf 1IO6A 2B86A 2V1QA 4JS4A 3M53A 2MF2A 4OMLA 1WQ7A 1SSFA 3J80E 2X4WA 3ZBDA 5CAIA 1K8AU 1O75A 4XTVA 1TU0B 3BW1A 3L2RA 1VQOQ 1VQNT 4PJLA 5HY6A 5GANf 5KYUB 1U5SA 3SD4A 3JB9G 5KYYB 2FEIA 2MMPA 2CUDA 1M5Q1 1MMGA 4M77E 1M2VA 2DL4A 3OYYA 4JS5A 2DE0X 4JJCA 5IHIA 2XD0A 1TOVA 1XTDA 1MGQA 2YRVA 2OTLQ 3V7CA 2L5QA 3QWXX 3OS1A 5LJ5f 1WYXA 4P5NA 4JLIA 2ECZA 2DO3A 4A4GA 1GFDA 2P4RA 1TH7A 2QTXA 2LJ1A 4A53A 1M3BA 4XTWA 1I8FA 3OS2A 3CPFA 1RLPC 1SRLA 2DNUA 4M7AA 3DLMA 2BE9B 2FO0A 3E19A 2LNHB 2EWNA 2F2WA 4FL6A 1W4SA 1QLYA 1Y96B 2ZGWA 1KHIA 4M7DB 2PU9B 4Y91A 3CC2T 1UDLA 3JCMg 3MP6A 1FMVA 2J6OA 2O9SA 1WI7A 1RAEB 3S3OA 1ZUYA 2E64A 5DLOA 1BI2A 1R77A 2JTFA 2E12A 2EGCA 1VQKQ 2GTOA 4N4IA 5GAN8 5CQXA 3CMEA 4ZGDB 2XU8A 2HBWA 2COWA 1YJNT 1KG1A 2HL5C 1OI1A 4J5YA 3C12A 2QA4A 1K9MR 1TSFA 2VYTA 3OYHA 4E47A 2RQVA 4NOYA 3H6ZA 4OMFB 4XK8E 3G71Q 1RI9A 5J3BA 2FHDA 1LPLA 2HQHA 2O01E 3CPWP 4OMNA 3CCMT 4L5GA 4C8QA 4J9FA 4DBQA 1QMCA 2RN8A 1K9MU 3M59A 3X26B
chains in the Genus database with same CATH topology
5GJVB 2AKLA 2O2OA 3H0IA 2DRMA 1SHGA 3EG1A 3REAB 4R0KA 5FW9A 2RQRA 3UA6A 3VRYA 1AEYA 1WFWA 1AWJA 1VYTA 1X6GA 2KRSA 1UTIA 2OAWA 2EQIA 3ZL7C 1K1ZA 4RTWA 2JT4A 1UECA 1UJ0A 2JXBA 4Y92A 4J9CA 1Z9ZA 2LMJA 1X2KA 2W0ZA 3R6NA 2J06A 1ARKA 2DILA 2CUBA 1M8MA 1OOTA 2DMOA 2DYBA 2J05A 3GBQA 1K9AA 1GCQC 2KRNA 2KYBA 4RTYA 1JXOA 2AK5A 4D8KA 3U23A 2KRMA 3A98A 1HD3A 2RQTA 1QWFA 1PKTA 1N5ZA 1X27A 2KT1A 2W10A 1T0JA 4JPBW 1I1JA 4CC7A 2CREA 1LCKA 2LQNA 4RTZA 2X3WD 3EG3A 1PNJA 1PHTA 2MCNA 2VKNA 2DBKA 1SHFA 4Z89A 2V1RA 1MUZA 2PZ1A 2LJ0A 1SEMA 2CH4W 2YUQA 3H0FA 1ZLMA 2EVRA 3NMZC 2ABLA 1AZGB 1JO8A 2AKKA 4Z8AA 1WXTA 2DA9A 2KT8A 1X2QA 5FWCA 1M3AA 1UG1A 2C0OA 2K2MA 2A37A 2JTEA 2D8JA 1MV3A 3TVTA 3M0SA 2CH4A 2DVJA 4HXJA 2KNBB 3PVQA 2DL3A 2BZYA 1FYNA 4LNPA 1AWXA 1YCSB 2HSPA 3VS4A 1ABOA 2LZ6B 2CDTA 3SHWA 1I0CA 2I0NA 2L3SA 1NYFA 2DF6A 1K4US 1BBZA 1GBRA 1JXMA 2CT4A 5L23A 2M0YA 2EPDA 1NM7A 3EG2A 1BB9A 4F14A 2CT3A 1ZUUA 2L0AA 3NHNA 3M0TA 2ED1A 3VS2A 2LP5A 1JU5C 4ORZA 3TSZA 2LQWA 1KFZA 2EYWA 1PKSA 2GGRA 3FJ5A 3M0QA 2D1XA 1GBQA 4RTXA 2ENMA 1AWWA 1Z9QA 1BK2A 2DL7A 1W1FA 5GJWB 3NGPA 1VYVA 2K3BA 1CKAA 1E6GA 1GCPA 2YUOA 1UJYA 1HJDA 2EYYA 4GLMA 3QWYA 1G83A 2JMAA 2G6FX 4RUGA 1EFNA 2BZ8A 2H8HA 4M4ZA 3H0HA 1AOJA 1YP5A 2F2VA 5HCKA 2VVKA 2AZVA 2FRWA 2NWMA 2KBTA 2ROLA 1ZX6A 2IIMA 2OI3A 4F16A 3I5SA 5I11A 2K7AA 3KFVA 1TUCA 2O88A 2YUNA 4RTUA 4AFUC 3NPFA 4K11A 1B3QA 5IXBA 1WA7A 2EGEA 3RBBB 3UATA 3VS7A 1T3SA 1U06A 2AZSA 1T0HA 2JW4A 1ABQA 4CC4B 2KE9A 1QCFA 2MOXA 1W70A 1NG2A 2O9VA 2YDLA 4RTVA 2KYMA 3SEMA 1CSKA 2VWFA 2EW3A 2J6FA 2JMCA 5I22A 2FG0A 3PVLA 1KSWA 1JQQA 2ESWA 1H3HA 1WXUA 3M0RA 4X1VA 1E7OA 2O31A 1OPLA 1KIKA 1J3TA 2GNCA 3H41A 3VS0A 1AWOA 4DEYA 2GQIA 2RPNA 1PRMC 1WDXA 1AVZC 1AD5A 4AFSC 2DX1A 3VS3A 1NLOC 2KXCA 2YUPA 4OMQA 1NYGA 2JS0A 2KGTA 3CQTA 1PRLC 1I07A 1MV0B 1QWEA 1XOVA 2A36A 3REBB 1PWTA 5ECAA 3IQLA 1A0NB 1WIEA 3EGUA 2M51A 3EG0A 1K0SA 2LX7A 1OV3A 4FSSA 5FWBA 1M30A 4ESRA 1OEBA 1BU1A 4AFZC 1GL5A 2XMFA 4JZ4A 2E5KA 1M3CA 1VYUA 5IHKA 3UF4A 4JJBA 1WXBA 3I35A 4LN2A 4AFQC 2YSQA 2K9GA 2F2XA 1UHCA 1NEGA 1OPKA 2DM1A 2YT6A 4DEXA 1ZUKA 2EBPA 1YWPA 4HVVA 1E6HA 1B07A 2GBQA 4RTTA 1X43A 1AZEA 1U3OA 1TUDA 4AG2C 3EHQA 2EYXA 4LE9A 2L3PA 3PE0A 4HVUA 5IHNA 5IH2A 4GBQA 3TSWA 1H92A 1NLPC 2HEQA 4J9IA 3I5RA 1Y57A 1QKXA 3M0PA 2ED0A 2KEAA 2KXDA 1UE9A 2DL8A 1TG0A 4OMPA 2GTJA 2DLPA 1H8KA 4LUDA 4Z88A 1YWOA 2RQUA 2LJ3A 1IO6A 2B86A 1GFCA 2V1QA 2RQWA 1RLQC 1Y0MA 2L3QA 4KRTA 4OMLA 2JM9A 1SSHA 3EHRA 3I9QA 4QT7A 4ZNXA 3VRZA 4J9GA 1WX6A 2D8HA 1JEGA 1U5SA 3LH5A 2NUZA 1ZBJA 2RNAA 1RUWA 4JZ3A 2FEIA 2LCSA 1W6XA 2CUDA 2DL4A 2SEMA 2DE0X 4JJCA 5IHIA 2FRYA 3THKA 4J9HA 2X3XD 1V1CA 1VA7A 4J9EA 3JV3A 2DJQA 2J7IA 2DL5A 1SPKA 3QWXX 1K76A 3C0CA 1WYXA 2ROTA 2BZXA 2ECZA 4IIOA 4F17A 1GFDA 2QDLA 2P4RA 1GRIA 2LJ1A 2PTKA 2BTTA 2K79A 1M3BA 1ZSGA 1UGVA 4CC3A 4HVWA 1RLPC 2PNIA 1SRLA 2DNUA 2RF0A 2KROA 3O5ZA 5EC7A 2FO0A 5IXFA 2LNHB 2F2WA 1NEBA 2C0IA 1S1NA 2C0TA 2L2PA 2D0NA 1QLYA 2CSIA 2SRCA 1KJWA 1WLPB 2RMOA 3M0UA 4EIKA 4J9BA 1UDLA 1G2BA 2DRKA 1X69A 4JJDA 2A28A 2DBMA 2J6OA 2O9SA 1WI7A 4AG1C 1HSQA 4OMOA 1ZUYA 3VS1A 4A63B 4IIMA 4J9DA 2K6DA 1K0XA 1YN8A 3RNJA 2EGCA 4D8DA 1FMKA 3VS5A 2FPDA 1GCQA 2GTOA 1QKWA 2JM8A 2EKHA 2HBWA 1UFFA 1X6BA 2J6KA 1UHFA 1CKBA 2HCKA 1YNZA 4HCKA 1UUEA 2FPFA 2MIOA 2HDAA 4CC2A 4E6RA 2CSQA 2RQVA 2FPEA 2EGAA 1M27C 1T3LA 2A08A 4LUEA 1RI9A 4OMMA 1SRMA 2JS2A 4OMNA 2EYZA 2KR3A 4J9FA 3ULRB 3UA7A 2OJ2A 2RN8A 3VS6A 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GJV B;  2AKL A;  2O2O A;  3H0I A;  2DRM A;  1SHG A;  3EG1 A;  3REA B;  4R0K A;  5FW9 A;  2RQR A;  3UA6 A;  3VRY A;  1AEY A;  1WFW A;  1AWJ A;  1VYT A;  1X6G A;  2KRS A;  1UTI A;  2OAW A;  2EQI A;  3ZL7 C;  1K1Z A;  4RTW A;  2JT4 A;  1UEC A;  1UJ0 A;  2JXB A;  4Y92 A;  4J9C A;  1Z9Z A;  2LMJ A;  1X2K A;  2W0Z A;  3R6N A;  2J06 A;  1ARK A;  2DIL A;  2CUB A;  1M8M A;  1OOT A;  2DMO A;  2DYB A;  2J05 A;  3GBQ A;  1K9A A;  1GCQ C;  2KRN A;  2KYB A;  4RTY A;  1JXO A;  2AK5 A;  4D8K A;  3U23 A;  2KRM A;  3A98 A;  1HD3 A;  2RQT A;  1QWF A;  1PKT A;  1N5Z A;  1X27 A;  2KT1 A;  2W10 A;  1T0J A;  4JPB W;  1I1J A;  4CC7 A;  2CRE A;  1LCK A;  2LQN A;  4RTZ A;  2X3W D;  3EG3 A;  1PNJ A;  1PHT A;  2MCN A;  2VKN A;  2DBK A;  1SHF A;  4Z89 A;  2V1R A;  1MUZ A;  2PZ1 A;  2LJ0 A;  1SEM A;  2CH4 W;  2YUQ A;  3H0F A;  1ZLM A;  2EVR A;  3NMZ C;  2ABL A;  1AZG B;  1JO8 A;  2AKK A;  4Z8A A;  1WXT A;  2DA9 A;  2KT8 A;  1X2Q A;  5FWC A;  1M3A A;  1UG1 A;  2C0O A;  2K2M A;  2A37 A;  2JTE A;  2D8J A;  1MV3 A;  3TVT A;  3M0S A;  2CH4 A;  2DVJ A;  4HXJ A;  2KNB B;  3PVQ A;  2DL3 A;  2BZY A;  1FYN A;  4LNP A;  1AWX A;  1YCS B;  2HSP A;  3VS4 A;  1ABO A;  2LZ6 B;  2CDT A;  3SHW A;  1I0C A;  2I0N A;  2L3S A;  1NYF A;  2DF6 A;  1K4U S;  1BBZ A;  1GBR A;  1JXM A;  2CT4 A;  5L23 A;  2M0Y A;  2EPD A;  1NM7 A;  3EG2 A;  1BB9 A;  4F14 A;  2CT3 A;  1ZUU A;  2L0A A;  3NHN A;  3M0T A;  2ED1 A;  3VS2 A;  2LP5 A;  1JU5 C;  4ORZ A;  3TSZ A;  2LQW A;  1KFZ A;  2EYW A;  1PKS A;  2GGR A;  3FJ5 A;  3M0Q A;  2D1X A;  1GBQ A;  4RTX A;  2ENM A;  1AWW A;  1Z9Q A;  1BK2 A;  2DL7 A;  1W1F A;  5GJW B;  3NGP A;  1VYV A;  2K3B A;  1CKA A;  1E6G A;  1GCP A;  2YUO A;  1UJY A;  1HJD A;  2EYY A;  4GLM A;  3QWY A;  1G83 A;  2JMA A;  2G6F X;  4RUG A;  1EFN A;  2BZ8 A;  2H8H A;  4M4Z A;  3H0H A;  1AOJ A;  1YP5 A;  2F2V A;  5HCK A;  2VVK A;  2AZV A;  2FRW A;  2NWM A;  2KBT A;  2ROL A;  1ZX6 A;  2IIM A;  2OI3 A;  4F16 A;  3I5S A;  5I11 A;  2K7A A;  3KFV A;  1TUC A;  2O88 A;  2YUN A;  4RTU A;  4AFU C;  3NPF A;  4K11 A;  1B3Q A;  5IXB A;  1WA7 A;  2EGE A;  3RBB B;  3UAT A;  3VS7 A;  1T3S A;  1U06 A;  2AZS A;  1T0H A;  2JW4 A;  1ABQ A;  4CC4 B;  2KE9 A;  1QCF A;  2MOX A;  1W70 A;  1NG2 A;  2O9V A;  2YDL A;  4RTV A;  2KYM A;  3SEM A;  1CSK A;  2VWF A;  2EW3 A;  2J6F A;  2JMC A;  5I22 A;  2FG0 A;  3PVL A;  1KSW A;  1JQQ A;  2ESW A;  1H3H A;  1WXU A;  3M0R A;  4X1V A;  1E7O A;  2O31 A;  1OPL A;  1KIK A;  1J3T A;  2GNC A;  3H41 A;  3VS0 A;  1AWO A;  4DEY A;  2GQI A;  2RPN A;  1PRM C;  1WDX A;  1AVZ C;  1AD5 A;  4AFS C;  2DX1 A;  3VS3 A;  1NLO C;  2KXC A;  2YUP A;  4OMQ A;  1NYG A;  2JS0 A;  2KGT A;  3CQT A;  1PRL C;  1I07 A;  1MV0 B;  1QWE A;  1XOV A;  2A36 A;  3REB B;  1PWT A;  5ECA A;  3IQL A;  1A0N B;  1WIE A;  3EGU A;  2M51 A;  3EG0 A;  1K0S A;  2LX7 A;  1OV3 A;  4FSS A;  5FWB A;  1M30 A;  4ESR A;  1OEB A;  1BU1 A;  4AFZ C;  1GL5 A;  2XMF A;  4JZ4 A;  2E5K A;  1M3C A;  1VYU A;  5IHK A;  3UF4 A;  4JJB A;  1WXB A;  3I35 A;  4LN2 A;  4AFQ C;  2YSQ A;  2K9G A;  2F2X A;  1UHC A;  1NEG A;  1OPK A;  2DM1 A;  2YT6 A;  4DEX A;  1ZUK A;  2EBP A;  1YWP A;  4HVV A;  1E6H A;  1B07 A;  2GBQ A;  4RTT A;  1X43 A;  1AZE A;  1U3O A;  1TUD A;  4AG2 C;  3EHQ A;  2EYX A;  4LE9 A;  2L3P A;  3PE0 A;  4HVU A;  5IHN A;  5IH2 A;  4GBQ A;  3TSW A;  1H92 A;  1NLP C;  2HEQ A;  4J9I A;  3I5R A;  1Y57 A;  1QKX A;  3M0P A;  2ED0 A;  2KEA A;  2KXD A;  1UE9 A;  2DL8 A;  1TG0 A;  4OMP A;  2GTJ A;  2DLP A;  1H8K A;  4LUD A;  4Z88 A;  1YWO A;  2RQU A;  2LJ3 A;  1IO6 A;  2B86 A;  1GFC A;  2V1Q A;  2RQW A;  1RLQ C;  1Y0M A;  2L3Q A;  4KRT A;  4OML A;  2JM9 A;  1SSH A;  3EHR A;  3I9Q A;  4QT7 A;  4ZNX A;  3VRZ A;  4J9G A;  1WX6 A;  2D8H A;  1JEG A;  1U5S A;  3LH5 A;  2NUZ A;  1ZBJ A;  2RNA A;  1RUW A;  4JZ3 A;  2FEI A;  2LCS A;  1W6X A;  2CUD A;  2DL4 A;  2SEM A;  2DE0 X;  4JJC A;  5IHI A;  2FRY A;  3THK A;  4J9H A;  2X3X D;  1V1C A;  1VA7 A;  4J9E A;  3JV3 A;  2DJQ A;  2J7I A;  2DL5 A;  1SPK A;  3QWX X;  1K76 A;  3C0C A;  1WYX A;  2ROT A;  2BZX A;  2ECZ A;  4IIO A;  4F17 A;  1GFD A;  2QDL A;  2P4R A;  1GRI A;  2LJ1 A;  2PTK A;  2BTT A;  2K79 A;  1M3B A;  1ZSG A;  1UGV A;  4CC3 A;  4HVW A;  1RLP C;  2PNI A;  1SRL A;  2DNU A;  2RF0 A;  2KRO A;  3O5Z A;  5EC7 A;  2FO0 A;  5IXF A;  2LNH B;  2F2W A;  1NEB A;  2C0I A;  1S1N A;  2C0T A;  2L2P A;  2D0N A;  1QLY A;  2CSI A;  2SRC A;  1KJW A;  1WLP B;  2RMO A;  3M0U A;  4EIK A;  4J9B A;  1UDL A;  1G2B A;  2DRK A;  1X69 A;  4JJD A;  2A28 A;  2DBM A;  2J6O A;  2O9S A;  1WI7 A;  4AG1 C;  1HSQ A;  4OMO A;  1ZUY A;  3VS1 A;  4A63 B;  4IIM A;  4J9D A;  2K6D A;  1K0X A;  1YN8 A;  3RNJ A;  2EGC A;  4D8D A;  1FMK A;  3VS5 A;  2FPD A;  1GCQ A;  2GTO A;  1QKW A;  2JM8 A;  2EKH A;  2HBW A;  1UFF A;  1X6B A;  2J6K A;  1UHF A;  1CKB A;  2HCK A;  1YNZ A;  4HCK A;  1UUE A;  2FPF A;  2MIO A;  2HDA A;  4CC2 A;  4E6R A;  2CSQ A;  2RQV A;  2FPE A;  2EGA A;  1M27 C;  1T3L A;  2A08 A;  4LUE A;  1RI9 A;  4OMM A;  1SRM A;  2JS2 A;  4OMN A;  2EYZ A;  2KR3 A;  4J9F A;  3ULR B;  3UA7 A;  2OJ2 A;  2RN8 A;  3VS6 A;  4WCI A; 
#chains in the Genus database with same CATH topology
 4FM4 B;  2O2O A;  3H0I A;  1TS9 A;  2QQR A;  2RHX A;  5FW9 A;  3JCM d;  5GMK l;  1WFW A;  4PJO G;  1UTI A;  1WJS A;  2OTJ A;  1NJI R;  4MDW A;  5GAN 4;  3OYN A;  4M78 C;  1UEC A;  3MEV A;  4J9C A;  5GAO m;  1JJ2 P;  1Z9Z A;  3QII A;  4F7U A;  3A8L B;  3VV0 A;  2W0Z A;  3R6N A;  1WJR A;  2XID A;  4BUG A;  1VQ5 A;  2DIL A;  3OYE A;  1OOT A;  3GBQ A;  4J6X A;  2YRD A;  4DOV A;  4FU6 A;  1NJI U;  2KRN A;  1O9S A;  4IUQ A;  4VUB A;  1QVG S;  1VQN Q;  2M9U A;  3CCJ T;  1R0C B;  2RQT A;  2A0F B;  1PKT A;  4JPB W;  5DY9 A;  2DEQ A;  1YIT T;  3OW2 A;  1PNJ A;  2MCN A;  1W2B S;  3MJX A;  1KD1 R;  2DZC A;  2KAF A;  2VV5 A;  1D0Z A;  2CH4 W;  2E5Q A;  2EVR A;  3NMZ C;  2ABL A;  2DTO A;  1VIF A;  4M78 B;  5J26 A;  3JCM f;  3CCV T;  1VQ4 T;  2DA9 A;  3CCL T;  3CMA A;  2C0O A;  2LNV A;  2K2M A;  1KD1 U;  3D7S B;  3TVT A;  2CH4 A;  3VU3 C;  2QG9 B;  1ZBX A;  2LCL A;  4M7A F;  3PVQ A;  2RB6 A;  3OYA A;  1Q81 C;  5HK0 A;  1PG5 B;  1ZA2 B;  2O4X A;  4LNP A;  3GIB A;  2MK5 A;  2OTJ Q;  1ABO A;  2LZ6 B;  1WHL A;  3SHW A;  4FW2 A;  1I0C A;  2I0N A;  1NYF A;  1TTH B;  3CC2 Q;  1GBR A;  5L23 A;  3LWI A;  5M9O A;  2M0Y A;  2EPD A;  1H3Z A;  3EG2 A;  4DBF A;  7AT1 B;  3MKD A;  2L0A A;  5GMK e;  3M0T A;  2Y4X A;  2ED1 A;  4DBR A;  3T9N A;  3VS2 A;  2WSE E;  4M7D G;  3L1A A;  4ORZ A;  4C0Z A;  1KFZ A;  4JDS A;  1BIA A;  1GBQ A;  4ZTF A;  3EGX B;  4RTX A;  1QCN A;  1Z9Q A;  1K73 R;  2EQU A;  1YJN Q;  3RKX A;  1E6G A;  3CCQ T;  1P92 A;  2VB6 A;  4C92 G;  4KGZ B;  4N4H A;  2V8I A;  3C4S A;  2JTM A;  5DLQ E;  1XJW B;  4PFO A;  4EPC A;  1G83 A;  2JMA A;  2XDD A;  3OB9 A;  5FU6 C;  3LGL A;  2CP5 A;  4C8Q F;  1K73 U;  1X6O A;  1C1A A;  4PJO D;  3G4S A;  4HCB A;  3DKM A;  1ZX6 A;  3I5S A;  5I11 A;  1YJW A;  3KFV A;  4BY6 B;  3FRN A;  3VKI A;  4HCZ A;  3UPU A;  3JB9 F;  4K11 A;  2E1H A;  2GFA A;  4OB2 B;  1YJ9 T;  2GFU A;  2JUF A;  2CZ7 B;  1KQS A;  2PUO B;  2BKD N;  2HQE A;  2ZPH B;  3EH1 A;  1ABQ A;  1NE8 A;  1VQ8 A;  1QCF A;  4F7U F;  4DBH A;  2YDL A;  4RTV A;  5CVI A;  3JB9 J;  1LNX A;  2VWF A;  3X28 B;  2EW3 A;  2JMC A;  1S72 A;  2DD5 A;  4JLG A;  2EKO A;  1WHK A;  5KYU A;  1UGS B;  2ESW A;  4ME7 A;  4X1V A;  2E6N A;  2RK1 A;  5KYY A;  2X35 A;  4C5H A;  1AWO A;  2RM4 A;  3GP8 A;  5KYX B;  1AVZ C;  3CCJ Q;  4BDY A;  4JRQ A;  1OZ3 A;  5GAN 6;  4ELZ C;  4C5I A;  3M4G A;  4OMQ A;  2KGT A;  1PRL C;  1I07 A;  1XOV A;  3NFC A;  3V8K A;  2A36 A;  3G6E T;  4M75 E;  2RA2 A;  3NTH A;  2EJF A;  3HRU A;  5GAO p;  2DKG A;  2DTH A;  4KUL A;  1ZHI A;  1WIE A;  2M51 A;  1QVG P;  1R0B G;  2M02 A;  5GAO n;  2VGN A;  5C0M A;  3QDR B;  5FWB A;  2ATC B;  3OYJ A;  1JB0 E;  3CCV Q;  1VQ4 Q;  3EFS A;  3CCL Q;  2YXY A;  1M3C A;  4JRK A;  2MI6 A;  3UF4 A;  3G4S Q;  1Y96 A;  3MO8 A;  4M7D A;  3M4Y A;  1W2B P;  1EX4 A;  4IKF A;  8AT1 B;  3CCU Q;  3A5Z B;  1JRI A;  1M1G A;  3DB3 A;  1OZ2 A;  2BE7 D;  1ZUK A;  2EBP A;  2HNI A;  4HVV A;  4L6V 5;  1EZZ B;  5FU7 C;  3PIO A;  3NTI A;  2AHJ B;  3CCS T;  1ZSZ C;  3CC4 A;  1SKU B;  1KQ1 A;  2L3P A;  5GAM e;  8ATC B;  4XTY A;  5KCH A;  5HK3 A;  5D6X A;  2V26 A;  1VQ6 T;  4C92 D;  4B9X A;  1UE9 A;  5KCO A;  3JCM h;  1TG0 A;  4OMP A;  2DLP A;  2QQB A;  5GAN e;  1VQO T;  2VXF A;  1PD1 A;  3Q1J A;  1WHG A;  2ZPI B;  2RQU A;  3CCQ Q;  1GFC A;  1K73 C;  5GAN 3;  3KBG A;  4C0D C;  3LYI A;  4ELY C;  3I56 A;  1VQL A;  2KDS A;  5IAY A;  4ANJ A;  3GF5 A;  4J9G A;  1OX9 A;  1JEG A;  5LJ5 e;  1YHQ Q;  1ZSZ B;  2HKQ B;  2CP2 A;  5LL6 S;  2C06 A;  4KBM B;  1YJ9 Q;  4LDW A;  2NLU A;  2HBP A;  4J9H A;  3LW5 E;  5CCA A;  4PFZ A;  1M8V A;  1V1C A;  1VA7 A;  4J9E A;  3CCE T;  2K4Y A;  2DJQ A;  2DL5 A;  3V8J A;  1YI2 Q;  3RIR A;  3CCR Q;  2BZX A;  4IIO A;  4PJO C;  2QDL A;  5FRO A;  3A8H B;  4QVC A;  3A8G B;  1YCY A;  4XQ3 A;  3M58 A;  2GQV A;  3LGF A;  3OBY A;  1ZSG A;  1NPP A;  3P8D A;  4A4F A;  4C0D B;  2O4X B;  4HVW A;  1G3T A;  1N9R A;  5IT9 E;  5EC7 A;  1OX8 A;  3EAE A;  1S1N A;  2L2P A;  2CSI A;  2QEX Q;  3DB4 A;  3M0U A;  4EIK A;  2QQS A;  4M78 A;  3QYH B;  4QKU A;  2HAX A;  5KYW B;  4A63 B;  4J9D A;  2NYS A;  4FYW B;  3MEA A;  1WHH A;  4D8D A;  2XDP A;  3FLG A;  3PNW C;  1IHV A;  4M77 G;  2D6F A;  4PJO B;  4M7D F;  2JM8 A;  2EKH A;  2I2L A;  3JCM X;  2J6K A;  1YNZ A;  4HCK A;  3OBW A;  4FIB A;  1UUE A;  1KQS S;  4CC2 A;  3OMC A;  4E6R A;  1M27 C;  4X9C A;  2DFU A;  2A08 A;  2QYZ A;  3CCS Q;  1IRX A;  2DYI A;  1SRM A;  1Q7Y R;  4LDV A;  1YFN A;  2KR3 A;  4ZN3 A;  3QYG B;  2DJZ A;  2ZPG B;  3EGX A;  5GJV B;  4J83 A;  2RQR A;  1VQ6 Q;  2K2V A;  2XK0 A;  5LJ3 g;  4KH1 B;  1Q7Y U;  2PUK B;  4N0A A;  4WF2 A;  4O6J A;  2CP3 A;  1UJ0 A;  4Y92 A;  1UGQ B;  3QO3 A;  4M7D C;  2QQ9 A;  3JAM E;  2J06 A;  4E7Z A;  3RKW A;  4F04 B;  3CME T;  4M7A E;  3P8B B;  1PSF A;  2DYB A;  1K9A A;  4JUV A;  3X25 B;  3N5B B;  1FWZ A;  3FIF A;  4D8K A;  4C92 C;  2EIF A;  1B7T A;  1G8X A;  1HD3 A;  1QWF A;  1N5Z A;  2KT1 A;  4J7F A;  1T0J A;  4HCC A;  4KGV B;  1LCK A;  2LQN A;  1M90 R;  3HFO A;  1X01 A;  3OW2 P;  4UC4 A;  1QP3 A;  1Q81 R;  1PHT A;  3OYL A;  3E2U A;  3CCE Q;  5A0D A;  1SHF A;  4A54 A;  3UWN A;  1MUZ A;  3FDR A;  2LJ0 A;  1SEM A;  5D7U A;  2QAS A;  3H0F A;  1ZLM A;  1QCO A;  5LJ3 d;  5KYX A;  5GAO l;  4XU3 A;  2AKK A;  1VQ7 A;  4Z8A A;  1M90 U;  2OTJ T;  1Q81 U;  1X2Q A;  2BUD A;  4PKC C;  1UG1 A;  2LCC A;  4MMK A;  1D3B B;  2D8J A;  4FCY A;  1RAI B;  1VQM A;  4HXJ A;  2E6Z A;  4NL3 A;  2DL3 A;  2BZY A;  2VC8 A;  1N27 A;  2L89 A;  1VQ5 T;  4R55 A;  5CQY A;  2LC4 A;  2QI2 A;  1FYN A;  4C8Q E;  1QVF A;  3KXT A;  4C92 B;  4OGC A;  3ZEH A;  4CRI A;  3VS4 A;  3S3M A;  4M78 F;  2EFI A;  4QVD A;  1G5V A;  2M1H A;  3RDV A;  1BBZ A;  3OA6 A;  2CT4 A;  4NS5 A;  4FYX B;  2ZPE B;  4M77 D;  1PC0 A;  4F14 A;  2CT3 A;  4FT4 A;  3MET A;  3QJY A;  2Z0W A;  2LP5 A;  1JU5 C;  4RCC A;  4J6Y A;  4F7U E;  2LQW A;  2LT1 A;  4OP0 A;  2DL7 A;  1N8R C;  1W1F A;  1VYV A;  2K3B A;  4XU0 A;  5CO7 A;  4RKU E;  1GCP A;  2LVM A;  4FT2 A;  5LJ3 f;  3JCM J;  3CMA T;  3URG A;  2KVQ G;  3M5A A;  1WGS A;  1HJD A;  2LRQ A;  2G6F X;  3I55 A;  2BZ8 A;  3MHX A;  3R6O A;  4BE1 A;  3MP8 A;  2F2V A;  3EGD B;  2RJE A;  2BIV A;  5HCK A;  3RER A;  2AZV A;  2NWM A;  4A4H A;  2KBT A;  3FC3 A;  2EJ9 A;  2QXF A;  5D6W A;  3WXM B;  3CXC S;  2VGM A;  1TUC A;  1Q7Y C;  2YUN A;  2YLB A;  4RTU A;  1WA7 A;  2ZPB B;  1KQS P;  1U06 A;  3RMQ A;  1VQ9 A;  2MOX A;  3OSS C;  3X24 B;  2MPX C;  2O9V A;  2CZ0 B;  3SEM A;  2RJC A;  1BKB A;  1FXX A;  5I22 A;  3J7A F;  2R5M A;  4Q5W A;  3A1P A;  1Q86 R;  1H3H A;  3CME Q;  1ZSZ A;  5CKF A;  3EH2 A;  1OPL A;  1IB8 A;  3TRE A;  1KIK A;  3H41 A;  3HFN A;  4XAX B;  4DEY A;  2QA4 Q;  1WHM A;  2K5F A;  2RPN A;  1PRM C;  2DX1 A;  2FZK B;  1RAG B;  1Q86 U;  2X51 A;  3FB9 A;  3O8V A;  2JS0 A;  2OX7 A;  3CQT A;  1NBE B;  3G4S T;  3BE3 A;  2QDY B;  3WVE B;  1PWT A;  1YJW T;  4RCB A;  3V8L A;  2PVG B;  2MYS A;  1M90 C;  1A0N B;  3EG0 A;  3JSC A;  3CCU T;  4N0A C;  1Q82 R;  2LX7 A;  1OV3 A;  3OY9 A;  4FSS A;  3CCM A;  5GAO r;  3I55 Q;  2K5I A;  1VQ8 T;  1UB4 A;  4LXC A;  4JJB A;  4AFQ C;  4BY6 C;  1S72 T;  1Q82 U;  1UHC A;  2DIQ A;  4RG2 A;  2ZCF B;  1VQ5 Q;  3QDF A;  3OSV A;  2DM1 A;  2YT6 A;  2CGH A;  5KYW A;  4XU1 A;  2HQX A;  1E6H A;  2ZAE A;  1D1A A;  2GBQ A;  1RL2 A;  1X43 A;  4RTT A;  2L3R A;  4LDU A;  4AMC A;  1TUD A;  2X4J A;  5CIU A;  1MMA A;  1D0X A;  4LE9 A;  2HMA A;  3M57 A;  4PJO A;  4GBQ A;  4RMO A;  2CYZ B;  2HEQ A;  4J9I A;  1UEB A;  4C0G A;  1HYO A;  3I5R A;  1Y57 A;  1QKX A;  3RKY A;  2ED0 A;  2KXD A;  1WNL A;  2JJ9 A;  6AT1 B;  2MWP A;  4M75 G;  5KH6 A;  4KH0 B;  2GTJ A;  1YIT A;  3CPW A;  2NUT B;  1MNE A;  4OGE A;  1YWO A;  1YHQ T;  2LJ3 A;  4LDY A;  1YIJ A;  3VUB A;  2RQW A;  3CMA Q;  1RLQ C;  1Y0M A;  4PJM A;  2L3Q A;  4M77 C;  4QQD A;  4KRT A;  2AT1 B;  3EHR A;  1Y7X A;  1XQH A;  2EYQ A;  3I9Q A;  4QT7 A;  3QHS A;  4QVZ A;  3VRZ A;  2RJD A;  3JRZ A;  1WX6 A;  3EFR A;  3LH5 A;  1YI2 T;  3CCR T;  1V76 A;  2CS7 A;  1RAF B;  4JZ3 A;  2RI2 A;  1W6X A;  3X20 B;  1MND A;  3CC4 T;  4EMH A;  2SEM A;  4OF1 A;  2JVV A;  2X3X D;  3WVD B;  9ATC B;  1C6V X;  1ZA1 B;  4XU2 A;  3SWN C;  1K76 A;  3QG1 A;  1R8O B;  4PLL A;  2JN0 A;  4F17 A;  2EJG A;  2RHY A;  3QBY A;  3CXC P;  1M1F A;  3JB9 H;  2PTK A;  3QZ9 B;  2BTT A;  2NUP B;  5LJ3 h;  2QEX T;  2LT4 A;  2EQM A;  4M77 B;  1Q86 C;  4CC3 A;  1UGP B;  3CBO A;  1ZQ1 A;  3MCA B;  2KMT A;  2RF0 A;  3HTR A;  3O5Z A;  1VQL T;  5IXF A;  3BDL A;  2LX9 A;  2C0I A;  2HL3 A;  2YWW A;  2C0T A;  2RI5 A;  2JZ2 A;  3J81 E;  3H8Z A;  4BI8 B;  2ZPF B;  4J9B A;  4KGX B;  2E3H A;  1G2B A;  1M9S A;  2WAC A;  2CZ6 B;  4WTO B;  4JJD A;  4C5E A;  1YJW Q;  2DBM A;  2P84 A;  3RR6 A;  3CD6 A;  3LX7 A;  1HSQ A;  2RH2 A;  3VS1 A;  1D3B A;  2KK4 A;  1C0M A;  4DOW A;  4IIM A;  4EDU A;  3SWN B;  1YN8 A;  3RNJ A;  4BB7 A;  2FPD A;  1VQ8 Q;  1Q82 C;  1OUL A;  2YRC A;  4E7K A;  1QKW A;  1WPY A;  4R56 A;  4J7I A;  1I5O B;  4C92 A;  3JCM P;  3L2W A;  1UFF A;  1X6B A;  1VOM A;  1S72 Q;  3QPH A;  1UHF A;  1CKB A;  2HCK A;  2DK3 A;  1LJO A;  2HDA A;  3LLR A;  4D6W A;  2COY A;  1NPR A;  2EGA A;  2XKO C;  1T3L A;  4LUE A;  1QQJ A;  4OMM A;  4PJO F;  1VUB A;  5GMK i;  5FLX E;  3UA7 A;  2P4T A;  2OJ2 A;  5CKD A;  4M75 D;  1AHJ B;  2DRM A;  3REA B;  4R0K A;  3OW2 S;  3MPU B;  3UA6 A;  2DET A;  2E3I A;  3QKJ A;  1AWJ A;  1X6G A;  2KRS A;  2E65 A;  2OAW A;  3BY7 A;  2EQI A;  3ZL7 C;  2XI9 A;  3G6E A;  1F1B B;  2F5K A;  4OB0 B;  1H64 1;  4E7H A;  3EGD A;  2M16 A;  4BI3 A;  3EG9 B;  1X2K A;  1RAH B;  2DVE A;  4BE0 A;  5GAM g;  1M8M A;  2DMO A;  2LQ8 A;  1FX7 A;  1QVP A;  1GCQ C;  4RTY A;  3NTK A;  2AK5 A;  1OU9 A;  2KRM A;  2VXE A;  4M78 E;  4DQ2 A;  3ASK A;  3GNF B;  2VUB A;  2W10 A;  4JRI A;  5GAN g;  3OYK A;  4CC7 A;  3CC4 Q;  3PGG A;  2X3W D;  5HKC A;  1D0Y A;  1MMD A;  2EQK A;  3M9Q A;  3UT1 A;  3CC7 A;  2RD1 A;  4Z89 A;  2V1R A;  2DXT A;  1FMW A;  4OVA A;  3LH0 A;  1AZG B;  4O5V A;  5CKH A;  2K3X A;  4XTX A;  5LJ5 g;  3GNG A;  2FZG B;  1M3A A;  3SDZ A;  4C5G A;  1MV3 A;  2CP7 A;  2DVJ A;  3VUZ A;  3JCM W;  4A4E A;  3UDC A;  3HHT B;  5GAM d;  3I56 Q;  1VQL Q;  2FYK A;  1VQO A;  4IUP A;  1G3S A;  3VJP A;  1AWX A;  1YCS B;  2P0K A;  4FSX A;  1WJQ A;  2HSP A;  1KQ2 A;  1N8R R;  3GOX A;  5LJ3 j;  2L3S A;  4M7A G;  2DF6 A;  3TCJ A;  2R57 A;  1JBM A;  1NM7 A;  2D9T A;  5GAN d;  1BB9 A;  2QQA A;  1ZUU A;  3JCM c;  2OTL A;  2Y90 A;  1RAD B;  5L8R E;  1N8R U;  5EG2 A;  1IHW A;  3TSZ A;  3OMG A;  4C92 F;  3C95 A;  4X9D A;  3M0Q A;  2D1X A;  4N4G A;  3C94 A;  5GJW B;  3NGP A;  4ZGJ B;  5LJ5 d;  1VQ7 T;  2YUO A;  2EYY A;  4IUU A;  1VQM T;  2H8H A;  1PCX A;  4M4Z A;  3H0H A;  1M1K C;  1G3W A;  1AOJ A;  3E9G A;  3TEE A;  1HXD A;  3V7R A;  2ROL A;  2RJF A;  2OI3 A;  5FRN A;  4GLK A;  1BI3 A;  1VQP A;  2NUT A;  1PSE A;  1N9S A;  5CK9 A;  4V2S A;  5IXB A;  2DZ9 A;  4DA4 A;  2EGE A;  4C8Q G;  3CBM A;  3UAT A;  1T3S A;  2FVU A;  2AZS A;  1T0H A;  5KYN A;  2JW4 A;  1OYX A;  1M4Z A;  1VQK A;  2RI3 A;  2KSS A;  3MEU A;  4FW1 A;  2PVD B;  2QA4 T;  1W70 A;  1NG2 A;  2KQW A;  2DAQ A;  2X4Y A;  3HPW A;  2JOY A;  2KYM A;  3S6W A;  3PVL A;  1KSW A;  1KHC A;  1YBY A;  4MZM A;  1JQQ A;  3JCM e;  1WXU A;  3HRT A;  3M0R A;  3JCM Q;  4M75 C;  2GNC A;  2KY9 A;  4F7U G;  1DJ7 B;  3VS0 A;  2L8D A;  1RI0 A;  2CP6 A;  4YTL A;  2V8K A;  3G71 A;  5C6S A;  2Y4Y A;  4QW2 A;  1NLO C;  3TU4 K;  3I55 T;  2KXC A;  1D1C A;  1NYG A;  2M0O A;  3MP1 A;  3FEO A;  1KC8 C;  5GMK h;  1D09 B;  3REB B;  2FB7 A;  2NUP A;  3M56 A;  4CI0 C;  2IG0 A;  1LVK A;  1K0S A;  4M77 A;  1IGU A;  3VYH B;  3L2V A;  1M30 A;  3OYC A;  3OYF A;  1OEB A;  1RAC B;  1BU1 A;  4AFZ C;  1GL5 A;  4JZ4 A;  1VYU A;  4X34 A;  2AIR B;  5IHK A;  1VQ9 T;  3I35 A;  2YSQ A;  1EIF A;  4M75 B;  1VQP Q;  4M7A D;  3TQ7 P;  1I81 A;  2OAU A;  1VQN A;  1NEG A;  3M55 A;  1OPK A;  1B07 A;  4BDZ A;  3OYG A;  4MDX A;  3SWN A;  4L59 A;  2EYX A;  2H3E B;  1IXD A;  3JB9 I;  4B9W A;  3PE0 A;  4HVU A;  2RHZ A;  4E7S A;  5IHN A;  5IH2 A;  4IUT A;  5AYF A;  5GAN 2;  1NLP C;  4HT8 A;  1V29 B;  4EMG A;  5CR2 A;  2MWO A;  4XTU A;  3RMS A;  2QAZ A;  2WSF E;  2DXU A;  3VYG A;  3INZ A;  3E1S A;  4A4K A;  3L2Q A;  4LUD A;  1N6A A;  4Z88 A;  4QQ6 A;  3L2Z A;  2IVW A;  1VQ7 Q;  3OYM A;  3EFO B;  1WQW A;  4EMK C;  2K57 A;  2JM9 A;  3BFM A;  1SSH A;  3DLL A;  1VQM Q;  2F1L A;  2HD0 A;  5J39 A;  4PJN A;  2CZ1 B;  4ZNX A;  4C8Q D;  4MZP A;  3ER0 A;  2D8H A;  2FL7 A;  4C0F A;  3CC2 A;  2NUZ A;  1ZBJ A;  2RNA A;  4MML A;  1RUW A;  1K8A C;  3LWH A;  2RK2 A;  4TVR A;  2LCS A;  4IUR A;  3JB9 D;  2RHI A;  2DTI A;  3CEY A;  1BCM A;  4HA8 A;  2K3Y A;  2G3R A;  2EQJ A;  2FRY A;  3EG9 A;  3THK A;  2PQW A;  3SB2 A;  3JV3 A;  5GAO q;  1KK7 A;  2J7I A;  3HL8 A;  1SPK A;  3C0C A;  5I2M A;  2ROT A;  1YJN A;  4II1 A;  1GRI A;  1BIB A;  3E9F A;  2K79 A;  1UGV A;  4EMK B;  3GLX A;  2E41 A;  4LDX A;  1YIJ T;  1Y71 A;  2PNI A;  4Z02 A;  5GAN 5;  1TXQ A;  5IN1 A;  2KRO A;  3A8O B;  1U8R A;  1B34 B;  1NEB A;  2D0N A;  4FYV B;  3G1J A;  4PJO E;  2SRC A;  1KJW A;  5GAM h;  1WLP B;  2XG8 D;  2RMO A;  4BD3 A;  1X75 C;  2H3J A;  1M2O A;  2DRK A;  1X69 A;  4ZN1 A;  2ZZD A;  2A28 A;  4OB1 B;  4M77 F;  4AG1 C;  4E2F B;  3L2U A;  4OMO A;  3OYD A;  2D0Q B;  3HRS A;  2DPP B;  2K6D A;  5GMK m;  1K0X A;  5GAN h;  2QGG A;  2DD4 A;  1FMK A;  3VS5 A;  3L42 A;  1GCQ A;  1RAB B;  1VQ9 Q;  2DXB A;  5GMK j;  4BAC A;  1G3Y A;  3OS0 A;  2EAY A;  1ACM B;  4KUD K;  1LOJ A;  2X9H A;  1IRE B;  2A7Y A;  2DEU A;  2QK0 A;  4IUV A;  3PMT A;  2FPF A;  2MIO A;  2E10 A;  2V8J A;  5I21 A;  3CCJ A;  5LJ5 h;  2CSQ A;  2COZ A;  2FPE A;  2F5T X;  3G7Z A;  4PJJ A;  2YHT A;  2RO0 A;  2CKK A;  2JS2 A;  1SG5 A;  1Y07 A;  2EYZ A;  2CP0 A;  3ULR B;  2FZC B;  3VS6 A;  3P8H A;  4WCI A;  5CKB A;  2AKL A;  1SHG A;  3EG1 A;  4M7A C;  3H9N A;  3VRY A;  1AEY A;  3CD6 T;  1QP2 A;  1XNI A;  1K9M C;  1VYT A;  3FJP A;  4QQG A;  3CCV A;  1VQ4 A;  1I5L A;  2HKN A;  1TWB A;  3CCL A;  4J8O A;  3OYB A;  3KUF A;  2E70 A;  3CCM Q;  4E7I A;  1K1Z A;  4RTW A;  2JT4 A;  4XTZ A;  2DER A;  2JXB A;  1BCO A;  1OU8 A;  1M2V B;  4NL2 A;  5I2S A;  1JJ2 A;  2LMJ A;  4Y28 E;  3AT1 B;  3CCU A;  4BE2 A;  1ARK A;  3HKS A;  1TUG B;  1NZ9 A;  2CUB A;  2J05 A;  3JCM b;  4E7J A;  4B6M A;  2KYB A;  1PD0 A;  1JXO A;  2XDB A;  3U23 A;  1QVF S;  2LTO A;  3A98 A;  4KUI A;  1NJI C;  1PM3 A;  1X27 A;  4M7D E;  3PIP A;  1I1J A;  3QSU A;  3A8M B;  2CRE A;  4RTZ A;  1IZ6 A;  2K5L A;  3EG3 A;  3OS5 A;  4JJN K;  1HK9 A;  2F69 A;  4M7A B;  4PFP A;  2VKN A;  2DBK A;  2DXC A;  4PLI A;  5GAN 7;  5KE3 A;  2PZ1 A;  5FU6 B;  2YUQ A;  3OQ5 A;  2GCX A;  4C92 E;  3I56 T;  4C8Q C;  1RAA B;  1SF9 A;  3JCM V;  1JO8 A;  3CCQ A;  1WXT A;  1AT1 B;  2KT8 A;  5FWC A;  2MAM A;  1YIT Q;  2VAS A;  4PK4 A;  2A37 A;  2JTE A;  3RES A;  3M0S A;  5A0L A;  1YIJ Q;  2KNB B;  2HZY A;  3ME9 A;  4ZGE B;  1VIE A;  2RHU A;  1KD1 C;  4PNO A;  1YHQ A;  4ATO A;  3RUX A;  2CDT A;  4FYY B;  3PMI A;  5A2Q E;  3MEW A;  1K4U S;  1IGQ A;  2JNG A;  1JXM A;  2IPO B;  1YJ9 A;  2QGF B;  1Q95 G;  3NHN A;  3HP9 A;  4M78 G;  4M75 A;  2GF7 A;  2KI7 A;  4JRP A;  1M1K R;  1YI2 A;  4RG8 A;  3CCR A;  5GAM j;  4C8Q B;  3CC7 T;  2EYW A;  1PKS A;  2GGR A;  3FJ5 A;  3OYI A;  1U1S A;  4M7D D;  2ENM A;  3GPL A;  1AWW A;  1BK2 A;  4LD6 A;  1BI0 A;  1CKA A;  3AHU A;  1M1K U;  1UJY A;  5GAN j;  4GLM A;  2R58 A;  3QWY A;  4RUG A;  1EFN A;  1OQK A;  4AT1 B;  1YP5 A;  4F7U B;  4KT0 E;  2QEX A;  2DIG A;  2VVK A;  2FRW A;  2IIM A;  3PT9 A;  4F16 A;  2K7A A;  2O88 A;  4OB3 B;  2E4H A;  2A3L A;  4AFU C;  5LJ5 j;  3NPF A;  1B3Q A;  3CD6 Q;  3RBB B;  3VS7 A;  3EFO A;  3QJ6 A;  3PFS A;  4CC4 B;  2KE9 A;  2OTL T;  3QUI A;  4HKE A;  5FU7 B;  1CSK A;  2J6F A;  3PTA A;  1KC8 R;  2FG0 A;  2P0P A;  5KE2 A;  3QZ5 B;  1D1B A;  1E7O A;  2O31 A;  1J3T A;  1I4K 1;  3HSB A;  1QW1 A;  2GQI A;  2P0Q A;  1WDX A;  4BI4 A;  3CCS A;  2HSE B;  1AD5 A;  4AFS C;  1KC8 U;  3VS3 A;  3CXC A;  2XHC A;  2YUP A;  1MV0 B;  1QWE A;  4PL6 A;  4GY5 A;  1VQ6 A;  5ECA A;  3IQL A;  1VQP T;  3EGU A;  4EMK A;  1QVG A;  1WHJ A;  3F70 A;  1QVF P;  4ESR A;  3BDU A;  1VQK T;  3SFM A;  5CKE A;  2XMF A;  2E5K A;  4ZTJ A;  2R5A A;  2B8A A;  3G6E Q;  1B34 A;  4LD9 K;  4HT9 A;  3CPW S;  1WXB A;  4LN2 A;  2K9G A;  2F2X A;  3S3N A;  1W2B A;  3CBP A;  5LJ3 e;  4DEX A;  1YWP A;  2QTV A;  1WZO A;  2LQK A;  3QXE B;  1BYM A;  1UGR B;  4M78 D;  1AZE A;  2X4X A;  1U3O A;  4AG2 C;  4J6W A;  3G71 T;  5A0G A;  2XIC A;  2WSC E;  3EHQ A;  1BI1 A;  5AT1 B;  2PVO B;  1JJ2 S;  4M75 F;  3CCE A;  4MZT A;  3V7S A;  1H92 A;  3TSW A;  3ZFJ A;  3M0P A;  2LDM A;  3CC7 Q;  2KEA A;  4E7L A;  2YLC A;  2DL8 A;  1GXI E;  1MMN A;  1U1T A;  3M54 A;  1K8A R;  1H8K A;  1MHN A;  5DM7 R;  5D6Y A;  5FRM A;  5GAM f;  1IO6 A;  2B86 A;  2V1Q A;  4JS4 A;  3M53 A;  2MF2 A;  4OML A;  1WQ7 A;  1SSF A;  3J80 E;  2X4W A;  3ZBD A;  5CAI A;  1K8A U;  1O75 A;  4XTV A;  1TU0 B;  3BW1 A;  3L2R A;  1VQO Q;  1VQN T;  4PJL A;  5HY6 A;  5GAN f;  5KYU B;  1U5S A;  3SD4 A;  3JB9 G;  5KYY B;  2FEI A;  2MMP A;  2CUD A;  1M5Q 1;  1MMG A;  4M77 E;  1M2V A;  2DL4 A;  3OYY A;  4JS5 A;  2DE0 X;  4JJC A;  5IHI A;  2XD0 A;  1TOV A;  1XTD A;  1MGQ A;  2YRV A;  2OTL Q;  3V7C A;  2L5Q A;  3QWX X;  3OS1 A;  5LJ5 f;  1WYX A;  4P5N A;  4JLI A;  2ECZ A;  2DO3 A;  4A4G A;  1GFD A;  2P4R A;  1TH7 A;  2QTX A;  2LJ1 A;  4A53 A;  1M3B A;  4XTW A;  1I8F A;  3OS2 A;  3CPF A;  1RLP C;  1SRL A;  2DNU A;  4M7A A;  3DLM A;  2BE9 B;  2FO0 A;  3E19 A;  2LNH B;  2EWN A;  2F2W A;  4FL6 A;  1W4S A;  1QLY A;  1Y96 B;  2ZGW A;  1KHI A;  4M7D B;  2PU9 B;  4Y91 A;  3CC2 T;  1UDL A;  3JCM g;  3MP6 A;  1FMV A;  2J6O A;  2O9S A;  1WI7 A;  1RAE B;  3S3O A;  1ZUY A;  2E64 A;  5DLO A;  1BI2 A;  1R77 A;  2JTF A;  2E12 A;  2EGC A;  1VQK Q;  2GTO A;  4N4I A;  5GAN 8;  5CQX A;  3CME A;  4ZGD B;  2XU8 A;  2HBW A;  2COW A;  1YJN T;  1KG1 A;  2HL5 C;  1OI1 A;  4J5Y A;  3C12 A;  2QA4 A;  1K9M R;  1TSF A;  2VYT A;  3OYH A;  4E47 A;  2RQV A;  4NOY A;  3H6Z A;  4OMF B;  4XK8 E;  3G71 Q;  1RI9 A;  5J3B A;  2FHD A;  1LPL A;  2HQH A;  2O01 E;  3CPW P;  4OMN A;  3CCM T;  4L5G A;  4C8Q A;  4J9F A;  4DBQ A;  1QMC A;  2RN8 A;  1K9M U;  3M59 A;  3X26 B; 
#chains in the Genus database with same CATH homology
 5GJV B;  2AKL A;  2O2O A;  3H0I A;  2DRM A;  1SHG A;  3EG1 A;  3REA B;  4R0K A;  5FW9 A;  2RQR A;  3UA6 A;  3VRY A;  1AEY A;  1WFW A;  1AWJ A;  1VYT A;  1X6G A;  2KRS A;  1UTI A;  2OAW A;  2EQI A;  3ZL7 C;  1K1Z A;  4RTW A;  2JT4 A;  1UEC A;  1UJ0 A;  2JXB A;  4Y92 A;  4J9C A;  1Z9Z A;  2LMJ A;  1X2K A;  2W0Z A;  3R6N A;  2J06 A;  1ARK A;  2DIL A;  2CUB A;  1M8M A;  1OOT A;  2DMO A;  2DYB A;  2J05 A;  3GBQ A;  1K9A A;  1GCQ C;  2KRN A;  2KYB A;  4RTY A;  1JXO A;  2AK5 A;  4D8K A;  3U23 A;  2KRM A;  3A98 A;  1HD3 A;  2RQT A;  1QWF A;  1PKT A;  1N5Z A;  1X27 A;  2KT1 A;  2W10 A;  1T0J A;  4JPB W;  1I1J A;  4CC7 A;  2CRE A;  1LCK A;  2LQN A;  4RTZ A;  2X3W D;  3EG3 A;  1PNJ A;  1PHT A;  2MCN A;  2VKN A;  2DBK A;  1SHF A;  4Z89 A;  2V1R A;  1MUZ A;  2PZ1 A;  2LJ0 A;  1SEM A;  2CH4 W;  2YUQ A;  3H0F A;  1ZLM A;  2EVR A;  3NMZ C;  2ABL A;  1AZG B;  1JO8 A;  2AKK A;  4Z8A A;  1WXT A;  2DA9 A;  2KT8 A;  1X2Q A;  5FWC A;  1M3A A;  1UG1 A;  2C0O A;  2K2M A;  2A37 A;  2JTE A;  2D8J A;  1MV3 A;  3TVT A;  3M0S A;  2CH4 A;  2DVJ A;  4HXJ A;  2KNB B;  3PVQ A;  2DL3 A;  2BZY A;  1FYN A;  4LNP A;  1AWX A;  1YCS B;  2HSP A;  3VS4 A;  1ABO A;  2LZ6 B;  2CDT A;  3SHW A;  1I0C A;  2I0N A;  2L3S A;  1NYF A;  2DF6 A;  1K4U S;  1BBZ A;  1GBR A;  1JXM A;  2CT4 A;  5L23 A;  2M0Y A;  2EPD A;  1NM7 A;  3EG2 A;  1BB9 A;  4F14 A;  2CT3 A;  1ZUU A;  2L0A A;  3NHN A;  3M0T A;  2ED1 A;  3VS2 A;  2LP5 A;  1JU5 C;  4ORZ A;  3TSZ A;  2LQW A;  1KFZ A;  2EYW A;  1PKS A;  2GGR A;  3FJ5 A;  3M0Q A;  2D1X A;  1GBQ A;  4RTX A;  2ENM A;  1AWW A;  1Z9Q A;  1BK2 A;  2DL7 A;  1W1F A;  5GJW B;  3NGP A;  1VYV A;  2K3B A;  1CKA A;  1E6G A;  1GCP A;  2YUO A;  1UJY A;  1HJD A;  2EYY A;  4GLM A;  3QWY A;  1G83 A;  2JMA A;  2G6F X;  4RUG A;  1EFN A;  2BZ8 A;  2H8H A;  4M4Z A;  3H0H A;  1AOJ A;  1YP5 A;  2F2V A;  5HCK A;  2VVK A;  2AZV A;  2FRW A;  2NWM A;  2KBT A;  2ROL A;  1ZX6 A;  2IIM A;  2OI3 A;  4F16 A;  3I5S A;  5I11 A;  2K7A A;  3KFV A;  1TUC A;  2O88 A;  2YUN A;  4RTU A;  4AFU C;  3NPF A;  4K11 A;  1B3Q A;  5IXB A;  1WA7 A;  2EGE A;  3RBB B;  3UAT A;  3VS7 A;  1T3S A;  1U06 A;  2AZS A;  1T0H A;  2JW4 A;  1ABQ A;  4CC4 B;  2KE9 A;  1QCF A;  2MOX A;  1W70 A;  1NG2 A;  2O9V A;  2YDL A;  4RTV A;  2KYM A;  3SEM A;  1CSK A;  2VWF A;  2EW3 A;  2J6F A;  2JMC A;  5I22 A;  2FG0 A;  3PVL A;  1KSW A;  1JQQ A;  2ESW A;  1H3H A;  1WXU A;  3M0R A;  4X1V A;  1E7O A;  2O31 A;  1OPL A;  1KIK A;  1J3T A;  2GNC A;  3H41 A;  3VS0 A;  1AWO A;  4DEY A;  2GQI A;  2RPN A;  1PRM C;  1WDX A;  1AVZ C;  1AD5 A;  4AFS C;  2DX1 A;  3VS3 A;  1NLO C;  2KXC A;  2YUP A;  4OMQ A;  1NYG A;  2JS0 A;  2KGT A;  3CQT A;  1PRL C;  1I07 A;  1MV0 B;  1QWE A;  1XOV A;  2A36 A;  3REB B;  1PWT A;  5ECA A;  3IQL A;  1A0N B;  1WIE A;  3EGU A;  2M51 A;  3EG0 A;  1K0S A;  2LX7 A;  1OV3 A;  4FSS A;  5FWB A;  1M30 A;  4ESR A;  1OEB A;  1BU1 A;  4AFZ C;  1GL5 A;  2XMF A;  4JZ4 A;  2E5K A;  1M3C A;  1VYU A;  5IHK A;  3UF4 A;  4JJB A;  1WXB A;  3I35 A;  4LN2 A;  4AFQ C;  2YSQ A;  2K9G A;  2F2X A;  1UHC A;  1NEG A;  1OPK A;  2DM1 A;  2YT6 A;  4DEX A;  1ZUK A;  2EBP A;  1YWP A;  4HVV A;  1E6H A;  1B07 A;  2GBQ A;  4RTT A;  1X43 A;  1AZE A;  1U3O A;  1TUD A;  4AG2 C;  3EHQ A;  2EYX A;  4LE9 A;  2L3P A;  3PE0 A;  4HVU A;  5IHN A;  5IH2 A;  4GBQ A;  3TSW A;  1H92 A;  1NLP C;  2HEQ A;  4J9I A;  3I5R A;  1Y57 A;  1QKX A;  3M0P A;  2ED0 A;  2KEA A;  2KXD A;  1UE9 A;  2DL8 A;  1TG0 A;  4OMP A;  2GTJ A;  2DLP A;  1H8K A;  4LUD A;  4Z88 A;  1YWO A;  2RQU A;  2LJ3 A;  1IO6 A;  2B86 A;  1GFC A;  2V1Q A;  2RQW A;  1RLQ C;  1Y0M A;  2L3Q A;  4KRT A;  4OML A;  2JM9 A;  1SSH A;  3EHR A;  3I9Q A;  4QT7 A;  4ZNX A;  3VRZ A;  4J9G A;  1WX6 A;  2D8H A;  1JEG A;  1U5S A;  3LH5 A;  2NUZ A;  1ZBJ A;  2RNA A;  1RUW A;  4JZ3 A;  2FEI A;  2LCS A;  1W6X A;  2CUD A;  2DL4 A;  2SEM A;  2DE0 X;  4JJC A;  5IHI A;  2FRY A;  3THK A;  4J9H A;  2X3X D;  1V1C A;  1VA7 A;  4J9E A;  3JV3 A;  2DJQ A;  2J7I A;  2DL5 A;  1SPK A;  3QWX X;  1K76 A;  3C0C A;  1WYX A;  2ROT A;  2BZX A;  2ECZ A;  4IIO A;  4F17 A;  1GFD A;  2QDL A;  2P4R A;  1GRI A;  2LJ1 A;  2PTK A;  2BTT A;  2K79 A;  1M3B A;  1ZSG A;  1UGV A;  4CC3 A;  4HVW A;  1RLP C;  2PNI A;  1SRL A;  2DNU A;  2RF0 A;  2KRO A;  3O5Z A;  5EC7 A;  2FO0 A;  5IXF A;  2LNH B;  2F2W A;  1NEB A;  2C0I A;  1S1N A;  2C0T A;  2L2P A;  2D0N A;  1QLY A;  2CSI A;  2SRC A;  1KJW A;  1WLP B;  2RMO A;  3M0U A;  4EIK A;  4J9B A;  1UDL A;  1G2B A;  2DRK A;  1X69 A;  4JJD A;  2A28 A;  2DBM A;  2J6O A;  2O9S A;  1WI7 A;  4AG1 C;  1HSQ A;  4OMO A;  1ZUY A;  3VS1 A;  4A63 B;  4IIM A;  4J9D A;  2K6D A;  1K0X A;  1YN8 A;  3RNJ A;  2EGC A;  4D8D A;  1FMK A;  3VS5 A;  2FPD A;  1GCQ A;  2GTO A;  1QKW A;  2JM8 A;  2EKH A;  2HBW A;  1UFF A;  1X6B A;  2J6K A;  1UHF A;  1CKB A;  2HCK A;  1YNZ A;  4HCK A;  1UUE A;  2FPF A;  2MIO A;  2HDA A;  4CC2 A;  4E6R A;  2CSQ A;  2RQV A;  2FPE A;  2EGA A;  1M27 C;  1T3L A;  2A08 A;  4LUE A;  1RI9 A;  4OMM A;  1SRM A;  2JS2 A;  4OMN A;  2EYZ A;  2KR3 A;  4J9F A;  3ULR B;  3UA7 A;  2OJ2 A;  2RN8 A;  3VS6 A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...