4JJDA

Crystal structure of the n114a abl-sh3 domain mutant at ph4
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
63
structure length
59
Chain Sequence
MENDPNLFVALYDFVATLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSAYITPVNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Abl-SH3 domain at pH5
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Tyrosine-protein kinase ABL1
total genus 12
structure length 59
sequence length 63
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4jjdA00
3I5SA 1WX6A 1OV3A 2KR3A 2J7IA 2J6KA 3O5ZA 2DM1A 2KXCA 3H0HA 5I22A 4K11A 3VS0A 1UTIA 1NEBA 1AOJA 2M51A 2JMAA 4RTVA 1RUWA 1X6GA 2DNUA 1SHGA 2KROA 1AWJA 1HD3A 2HEQA 1UHCA 2DE0X 5I11A 3VS6A 2CDTA 2CUDA 1NLPC 2EYZA 1OPLA 2K7AA 1PWTA 1T3LA 2DRKA 1OEBA 4J9DA 2EYYA 2L3PA 1AZEA 1GBRA 1KFZA 2EGEA 4JPBW 1K0XA 2KT1A 3VRYA 1PHTA 3U23A 4J9EA 1WXTA 2J06A 1ZLMA 2BZ8A 1NEGA 2LQWA 1GCQC 4LUEA 2RNAA 2YUNA 1XOVA 2JS0A 2RPNA 3JV3A 3TSWA 4OMPA 1RLQC 5FWBA 1K1ZA 4X1VA 1SSHA 2JTEA 3PE0A 4JZ3A 4ORZA 2DBMA 3CQTA 3NHNA 4RTTA 2ROLA 1T3SA 2HSPA 3IQLA 3THKA 1M3BA 1JXOA 4J9GA 2A36A 3UA6A 4HVWA 4RUGA 1K0SA 1WYXA 1SHFA 1Z9QA 2KE9A 1OPKA 3H41A 4Z8AA 2GBQA 1H3HA 5FW9A 4Z88A 2JT4A 2K2MA 1ZUYA 3ZL7C 1ABOA 2F2WA 1QLYA 1PNJA 1JXMA 2V1RA 3EG0A 4DEYA 1FMKA 2DX1A 5IXFA 2MIOA 3A98A 3R6NA 4HVVA 1OOTA 4ZNXA 1V1CA 3FJ5A 1BU1A 5IHIA 1GCPA 3QWYA 1K9AA 2JMCA 3EGUA 1NG2A 4GBQA 4J9BA 1QKXA 2A08A 3KFVA 2EVRA 2OJ2A 4JJCA 4JJDA 1ZSGA 1X27A 2DYBA 3TSZA 1UECA 1YP5A 2I0NA 1ZUUA 5GJVB 5IH2A 4IIMA 4RTYA 1JEGA 4F17A 1N5ZA 2LMJA 4J9IA 4E6RA 4OMQA 3ULRB 2O88A 1SPKA 3EG3A 2YT6A 2W0ZA 2AKLA 2KT8A 5IHKA 2X3WD 2KRMA 2FRWA 1E7OA 2P4RA 3NGPA 2OI3A 2LCSA 1GL5A 1GFCA 3EHQA 1HJDA 1QWEA 1QCFA 5ECAA 1WFWA 4Z89A 1GFDA 2KEAA 2YDLA 2LP5A 2CSQA 1G83A 4F14A 1LCKA 2PZ1A 1YWOA 2DVJA 3H0IA 3SEMA 3RBBB 2D0NA 3PVLA 1T0HA 1B07A 1JU5C 3C0CA 1PRLC 2K9GA 1GBQA 1AWXA 2YUQA 1UDLA 2H8HA 1VA7A 3VS5A 4JJBA 2AZVA 4ESRA 1FYNA 3EHRA 2CT3A 1T0JA 4LE9A 2RQTA 2DJQA 2FPEA 2K79A 2L3QA 3VS2A 1YN8A 1I07A 2EPDA 4JZ4A 3VS1A 2KBTA 4RTUA 1UUEA 2DBKA 2AKKA 2PTKA 1AEYA 3I35A 2JXBA 4RTZA 3EG1A 1CKAA 3EG2A 4HXJA 4F16A 1TUDA 2YUPA 3VRZA 1X6BA 3SHWA 2KRSA 1ZBJA 3M0PA 2FG0A 4LUDA 2FPDA 2AK5A 2A37A 2W10A 2EYWA 1X2QA 2GTOA 2M0YA 4LN2A 1U06A 2J6FA 4QT7A 1S1NA 2YUOA 2EGAA 2BZXA 1JQQA 1H8KA 2D8JA 1YNZA 1NYGA 1TUCA 1UFFA 5IXBA 1MUZA 2LJ1A 3VS3A 1ZX6A 2QDLA 1NYFA 2NWMA 2CUBA 2FRYA 4J9HA 3I9QA 3GBQA 4AFZC 4RTXA 2F2XA 4OMNA 4D8DA 2JW4A 4M4ZA 2ROTA 4AG2C 5L23A 1WXBA 2SEMA 1I1JA 2LZ6B 4GLMA 1NM7A 2DL3A 1VYUA 1U3OA 1QKWA 4D8KA 1VYTA 2RQWA 2VVKA 3REBB 1WA7A 2DILA 2LQNA 2VKNA 2ED0A 2GGRA 1MV0B 2DL4A 5GJWB 2RMOA 1RI9A 1BBZA 2RQVA 1J3TA 2ENMA 1KIKA 4AG1C 3TVTA 1UJYA 2KNBB 4WCIA 2L3SA 2J05A 4AFUC 4J9CA 1AVZC 2C0IA 2O31A 1UGVA 2K6DA 2O2OA 3M0UA 2DL7A 2EYXA 3NMZC 1K4US 2EQIA 2YSQA 1NLOC 1WLPB 1PRMC 2DA9A 2O9VA 1BK2A 2PNIA 3UA7A 1UE9A 2V1QA 3VS7A 1MV3A 3M0TA 1IO6A 2LX7A 2ESWA 2EBPA 3M0SA 1EFNA 2K3BA 2L2PA 4CC4B 2MCNA 3NPFA 2G6FX 2FEIA 3VS4A 2KYMA 2SRCA 5IHNA 2CREA 1TG0A 5FWCA 1SRLA 4EIKA 4CC3A 2D1XA 1PKTA 2CSIA 2EKHA 2ED1A 1M30A 1GCQA 2A28A 4HVUA 2BTTA 2DF6A 2ABLA 2RF0A 1G2BA 3M0QA 2C0OA 4AFSC 3PVQA 1WI7A 1Y0MA 4HCKA 1I0CA 1UG1A 4DEXA 1YWPA 1WXUA 2HBWA 1A0NB 2DLPA 1WDXA 2RQUA 1KSWA 1E6GA 1RLPC 3QWXX 1YCSB 5EC7A 4CC7A 1ZUKA 3RNJA 4OMLA 2ECZA 1BB9A 2HCKA 1AWWA 2KYBA 2JM8A 1M27C 2RQRA 4FSSA 1PKSA 2RN8A 2FPFA 2C0TA 2DL8A 2KGTA 1GRIA 2E5KA 2MOXA 2LNHB 3H0FA 1AD5A 4AFQC 5HCKA 2JS2A 2KXDA 4IIOA 3UF4A 1M3CA 1Z9ZA 1ARKA 1SEMA 2D8HA 1U5SA 4LNPA 1W1FA 2JM9A 2FO0A 2KRNA 2F2VA 1CSKA 4A63B 2EW3A 2IIMA 1HSQA 1AZGB 4Y92A 1UHFA 1UJ0A 2CT4A 3I5RA 1W70A 1B3QA 2B86A 2BZYA 4KRTA 4R0KA 1X2KA 2O9SA 2J6OA 1H92A 1Y57A 2DL5A 2HDAA 2CH4A 1WIEA 2NUZA 4J9FA 1AWOA 2L0AA 1X69A 2DRMA 2OAWA 1VYVA 1X43A 1ABQA 1CKBA 2GNCA 3M0RA 2AZSA 2GTJA 2DMOA 1M3AA 2EGCA 1KJWA 2GQIA 2LJ0A 2VWFA 1JO8A 2XMFA 2CH4W 1SRMA 1K76A 4OMOA 1E6HA 4RTWA 3REAB 4CC2A 3UATA 2X3XD 1QWFA 4OMMA 1M8MA 3LH5A 2LJ3A 1W6XA
chains in the Genus database with same CATH superfamily
1IHWA 2I2LA 2J7IA 1RAGB 1NPRA 3VS0A 1FXXA 1KC8C 3HL8A 3EFOB 3J81E 2M51A 3GPLA 1G3YA 2JMAA 3CD6T 1QVGP 2WSCE 1HD3A 4OB3B 2OTJA 1BCOA 5I11A 1PSEA 1NLPC 4XTYA 3CCVT 1Q86R 1T3LA 1ZSZC 5HK0A 1Y96A 1OEBA 1GBRA 2DTOA 2K4YA 2XG8D 1WHLA 1YJWA 1KFZA 3LH0A 4JPBW 5GANh 1Q81R 1TUGB 2KT1A 4MMKA 1WQ7A 1VQ7T 1QP3A 4J9EA 2J06A 5AYFA 3PMIA 1RAFB 1O9SA 2ZPFB 3SWNC 2Y4YA 2CP7A 4ZGEB 5LJ5d 2JS0A 3JV3A 1RLQC 1EX4A 1BIAA 4X1VA 4JZ3A 2XDPA 1TTHB 2JN0A 3OS2A 4R55A 2LQKA 3IQLA 1M3BA 4FYVB 2CZ1B 2YRDA 3CMEA 1UGRB 1K73U 2JVVA 1TSFA 2EQKA 3GIBA 5HY6A 4F7UG 3PMTA 3CCLQ 1SHFA 2RHXA 1D3BB 2RK1A 3KXTA 2GFAA 2DO3A 3TCJA 1OU9A 2JNGA 1KQSS 1JBMA 3CCVQ 2NUTB 1IGUA 4PJJA 4DEYA 3CCJA 3QJ6A 4ELZC 3R6NA 4HVVA 1OOTA 4ZNXA 5IAYA 4FW1A 1V1CA 4BDYA 3I55A 1GCPA 5C0MA 2OTLA 4LDUA 2PUKB 1N9RA 1TU0B 2JMCA 2FZCB 3EGUA 1NG2A 1QKXA 3QO3A 3OYHA 4EMKA 1OX9A 4MZPA 4C5HA 3C95A 2VGMA 2Y4XA 3QJYA 3VUBA 1D1AA 2KSSA 1XQHA 5IH2A 5GANg 4FT2A 4OMQA 2OTJQ 3O8VA 2QEXQ 4J6WA 2HQXA 1JB0E 2W0ZA 2KT8A 4ZTJA 2MYSA 5FU6B 2FRWA 4ATOA 2C06A 2HD0A 1HJDA 4M77G 5DY9A 1W2BS 2K3XA 2NLUA 4IKFA 1YWOA 2DVJA 3SEMA 1QCOA 1ZHIA 2E3IA 2OTLT 1N8RU 1T0HA 4QVCA 2K9GA 4M7AF 1Q82R 1AWXA 2YUQA 2H8HA 1VA7A 4HCBA 4MDXA 2AZVA 1FYNA 3EHRA 1T0JA 3FEOA 2DJQA 1WGSA 2K79A 1X01A 3HRSA 3OW2P 3OMCA 1W2BA 1VQ4Q 4RTUA 1UUEA 2QXFA 1M1KC 1PD1A 3INZA 4HKEA 3CCUT 4BY6B 1JJ2A 1RI0A 2QEXA 2E4HA 3EG2A 4HXJA 4F16A 2EKOA 2YUPA 2IG0A 4DA4A 1Q86U 3VYHB 2KRSA 3G4ST 3G6ET 4P5NA 2MWOA 3EFOA 2P4TA 2FG0A 3M0PA 3QZ9B 4KGVB 2XU8A 2PVGB 4M7DB 4LUDA 5DLQE 1D0YA 3EGXB 4PFZA 1VQ9T 1RL2A 1IXDA 1O75A 2CZ7B 2HKNA 1X2QA 4LN2A 5CIUA 2NUPB 3OYYA 2EGAA 1Q81C 5KYUA 5A0DA 4PJNA 1JQQA 2E65A 1NYGA 1TUCA 3J7AF 1MUZA 4KUIA 3JCMd 1NYFA 3QXEB 1ZBXA 1UB4A 4ANJA 4C8QB 3MCAB 4D8DA 2JW4A 4M4ZA 4E2FB 2ROTA 4XK8E 3M57A 2LZ6B 4JUVA 4EMKB 1FX7A 1YBYA 1OULA 3G6EA 1QKWA 4D8KA 1VYTA 1SSFA 2DILA 2DIGA 1W4SA 2EAYA 4N0AC 2ED0A 2GGRA 2RMOA 3RUXA 1RI9A 3C94A 1BBZA 2COWA 2RQVA 1FMVA 1J3TA 1ACMB 4RMOA 2GQVA 1LJOA 2KNBB 4PJLA 1M2VA 3E2UA 1VQLT 4DQ2A 2J05A 4M7DG 1I5LA 5KYNA 2O31A 3A8MB 1UGVA 2K6DA 2DL7A 3VV0A 4XU1A 2KMTA 3A8LB 3CC2Q 3V7SA 2QG9B 2YSQA 2E10A 4XU2A 2DA9A 4FYYB 1KHCA 3SB2A 4C5GA 2DEUA 5GAOm 2LX7A 2EBPA 3M0SA 1NJIC 4HA8A 1G3WA 1X75C 5A0GA 2FEIA 2KYMA 1BCMA 5IHNA 1PM3A 1TG0A 2CREA 3CCMT 1SRLA 4CC3A 1N8RC 3PIOA 5GAMe 3CPWP 1PKTA 4Y28E 4O6JA 2ED1A 2MPXC 4C8QF 4JRIA 3CCET 1N27A 4M7AE 5GMKi 1OZ3A 2CYZB 4C92G 1K8AR 1F1BB 1QW1A 2AT1B 4UC4A 2OTLQ 4A54A 3M0QA 1NJIU 2RHIA 1Q82U 5CAIA 4M7AB 1I5OB 2A7YA 1YWPA 1BIBA 2XDDA 1WXUA 2RQUA 3H6ZA 1E6GA 1BI1A 1VQKA 2EQUA 3LWHA 1YCSB 1VUBA 1WQWA 4OMLA 2DTHA 3CCRA 1AWWA 2JM8A 4FSSA 1QVPA 4ME7A 3FC3A 3CCQT 1B34A 2L89A 2X4XA 2MOXA 1TXQA 2F69A 2DYIA 1H3ZA 4OB1B 5EG2A 1M3CA 2X9HA 2CP2A 3HP9A 2D8HA 1U5SA 4LNPA 4C0FA 1GXIE 2JM9A 1WJRA 2LTOA 2FO0A 3X25B 3JB9H 1LPLA 1QVGA 2IIMA 1BKBA 5LL6S 4Y92A 5C6SA 4M78E 1UHFA 2QQRA 4C8QA 3SWNB 2JOYA 5D6YA 2DL5A 4F7UB 2VB6A 2D0QB 2RD1A 3OW2S 4FYXB 2NUZA 1AWOA 3CCQA 1VYVA 1ABQA 1P92A 2DMOA 2YHTA 2GQIA 2VWFA 2ZGWA 3ZEHA 5GAOr 4E7HA 2HL5C 1K76A 1E6HA 4CC2A 1Y7XA 3MJXA 5GAOq 1K9MC 1QWFA 2LJ3A 1W6XA 2ATCB 2GF7A 3N5BB 4JS5A 1WX6A 4N4HA 1OV3A 1XJWB 2J6KA 2QASA 3URGA 5I22A 2JJ9A 1UTIA 1NEBA 3PT9A 1WHJA 5CO7A 2RI2A 4RTVA 1X6GA 3CCJQ 4LDWA 1SHGA 3M4YA 2KROA 3VUZA 2DE0X 1R8OB 2PUOB 4PL6A 2CUDA 5LJ3f 3EAEA 7AT1B 2K7AA 2Z0WA 1YITQ 2F1LA 2DRKA 3OB9A 3LLRA 2A0FB 2LCLA 1OX8A 1VQMT 4MZMA 4IURA 1YI2A 3M55A 4A4FA 1TS9A 2XIDA 2BZ8A 1NEGA 2LQWA 1GCQC 3HRTA 3QYGB 1Q81U 4M78C 2RPNA 3JB9I 1VQLQ 2RJCA 3OYLA 3PE0A 2LVMA 2QA4Q 1IZ6A 4ORZA 3V8LA 3NHNA 1Y07A 3LGLA 4RCBA 4C92D 3JCMP 3CC4A 1T3SA 3THKA 2PU9B 3SDZA 3OYNA 1Q86C 3META 1JXOA 4J9GA 2A36A 4HVWA 3EH2A 4FL6A 4XQ3A 1BI2A 3QHSA 1Z9QA 2KE9A 3CMAQ 3RERA 2KAFA 5D6XA 4M77B 1I8FA 4Z88A 1YIJT 2EYQA 4E7IA 1VQ7A 2KVQG 1G3SA 5KCHA 3SWNA 2DTIA 4J7IA 3ME9A 4CRIA 1D09B 1OU8A 2O01E 3OBWA 1G3TA 3DKMA 3OYMA 1VQKQ 5GANj 1M5Q1 3EGDB 2E5QA 2VYTA 1IGQA 1TOVA 2JTFA 1K8AU 5DM7R 2QQAA 3TQ7P 3CMET 2A08A 2BE7D 3KFVA 2EVRA 4XAXB 4JJDA 4JRPA 2HMAA 4C8QD 2I0NA 3X26B 1B34B 5GMKj 3RKWA 2RO0A 4RTYA 4F17A 1N5ZA 1NBEB 4J9IA 4B9XA 5GAMg 3ULRB 1SPKA 1MMNA 3E1SA 2X3WD 5M9OA 1E7OA 2P4RA 2CP0A 3NGPA 1C6VX 3HFOA 1GFCA 1K8AC 1QWEA 3H8ZA 4XTXA 2QA4T 2KEAA 2CSQA 5GMKh 3WXMB 4OMFB 2JZ2A 3MO8A 2YLBA 1B07A 1PRLC 1GBQA 4B9WA 1UDLA 3VS5A 4M78A 4JJBA 1N8RR 3RR6A 4KT0E 2V8KA 5L8RE 5LJ3h 2FPEA 1WHKA 1JRIA 1I07A 1NJIR 4JZ4A 3VS1A 2KBTA 2V8IA 2DBKA 2AKKA 2X51A 2VXFA 1YHQQ 2CZ0B 4RTZA 2RHZA 3FB9A 2KQWA 3NTHA 1CKAA 2XK0A 3QBYA 5CQXA 3CXCA 3SHWA 5GAMj 3X20B 3M5AA 3MEWA 3QUIA 2AK5A 3A1PA 1ZSZA 2GTOA 2M0YA 3RIRA 5CCAA 5A0LA 4OB2B 5J39A 5GAMf 5KH6A 2P84A 1H8KA 2D9TA 1UFFA 5IXBA 2D6FA 4PJOD 2M02A 1ZX6A 2QDLA 2NWMA 2P0PA 2QQBA 3DLMA 3HKSA 1YJ9T 1WHGA 1PC0A 2LQ8A 2F2XA 4C8QG 5GMKe 5KYYA 1HXDA 4M77D 1VQ4T 5L23A 2M0OA 2RK2A 1WXBA 4LDXA 1I1JA 2BE9B 4OGEA 3G4SA 4L6V5 2DK3A 3REBB 5GANe 1KK7A 3E9GA 3G1JA 1X6OA 3OS0A 2R5MA 3A8HB 1MV0B 3L2VA 3JCMQ 4ZGDB 2XHCA 2L8DA 2ENMA 2P0QA 4XU3A 2RHUA 5CR2A 3OQ5A 3EGXA 2FB7A 4EMHA 3CCRQ 6AT1B 3M0UA 2EYXA 3PTAA 1YJ9A 4PNOA 1NLOC 4BE1A 5GAN7 1PRMC 1SF9A 3QG1A 2PNIA 1BK2A 2V1QA 1MV3A 3M0TA 3CMAT 2B8AA 1EFNA 2BUDA 3GF5A 1WHMA 4J6XA 1KD1U 2OTJT 2DJZA 5CK9A 1K9MR 2SRCA 3F70A 4E7KA 1OI1A 1D1BA 4EIKA 3G71Q 1VQOA 2D1XA 1YJNA 5I2SA 2MWPA 4FSXA 2M9UA 2CSIA 3MP1A 4BE2A 1VQLA 2A28A 2BTTA 2ABLA 1G8XA 3L2WA 2C0OA 1VQ5A 3SD4A 1YJNQ 1VQNT 1WI7A 1Y0MA 1VQ8Q 3M56A 1M1GA 4QQGA 1VQ6Q 2HBWA 2DKGA 4GY5A 2CZ6B 5EC7A 4CC7A 5KYWA 5GAN3 3V8KA 4JRQA 4MDWA 1HYOA 3RNJA 1KD1R 2DXTA 2ECZA 2HCKA 3FRNA 5HKCA 1VQ9A 5FRMA 2FPFA 2COYA 2DL8A 4IUPA 4LXCA 2KGTA 3CCLA 3PIPA 1RACB 4ZN1A 3OY9A 4XTZA 1SG5A 5HCKA 1B7TA 2JS2A 5KYYB 1Z9ZA 5KYUB 1ARKA 3BFMA 2HL3A 2KRNA 2JUFA 1RABB 1VIEA 3UPUA 1FMWA 4RG2A 1HSQA 4NL2A 1AZGB 3I55T 3M59A 2V8JA 3I5RA 2HKQB 1VQKT 2B86A 2BZYA 4C8QE 2QGGA 2J6OA 2XICA 1Y57A 4QKUA 4LD9K 2HDAA 4A4GA 1KHIA 2X4WA 5GAN2 3CCLT 1CKBA 2GNCA 2AZSA 3CC4Q 2EGCA 4C92C 3RMSA 5GAN4 4JS4A 1KJWA 1K9MU 1M9SA 3PNWC 1M8VA 2XMFA 3CBOA 3REAB 4OMOA 1M2VB 1Q82C 4L5GA 4DOWA 1VQ8T 4PLIA 2KDSA 3JCMV 1KQSP 3I5SA 4OVAA 4PJOE 3P8DA 2KXCA 3H0HA 4XTWA 3GOXA 4K11A 3EFRA 3LGFA 1AOJA 2PVOB 2X4YA 4OF1A 8AT1B 2DNUA 2ZZDA 4QVDA 2FZKB 4RCCA 5FROA 4M7AC 4M7DC 1XTDA 4C0DB 3AT1B 1PWTA 3JCMf 3CCMA 4PJOA 1C1AA 2CGHA 2R57A 4BUGA 1LOJA 2EYYA 5GMKl 2KY9A 4J7FA 4FYWB 2EGEA 1K0XA 1QVFA 3GNGA 3OYIA 1PHTA 1ZSZB 3U23A 1RAAB 4CI0C 4BI4A 4M75D 3CMEQ 5CVIA 3OYGA 1XOVA 3JSCA 2EWNA 3NTKA 4LDVA 5FWBA 1SSHA 4M77A 3G71T 2WSEE 4E7JA 2DBMA 1U1SA 4N4IA 2VV5A 4RTTA 5FRNA 2FVUA 3C4SA 3L2RA 1U8RA 2HSPA 1S72T 4J83A 3CC2A 2FZGB 4E47A 3GP8A 8ATCB 3UA6A 1M1KU 4RUGA 1AHJB 1K0SA 4J8OA 1G5VA 1WYXA 1OYXA 3FJPA 3VKIA 3RDVA 5GAMh 3H41A 2IPOB 2R58A 3CPWS 1I4K1 2K2MA 5GAMd 1ABOA 2F2WA 2A3LA 1ZA1B 1QMCA 4X9CA 1YI2T 3I56T 3EG0A 1FMKA 3R6OA 4E7ZA 2DX1A 2X35A 5KE2A 5FU7C 2QK0A 3A5ZB 4IUUA 3G71A 3FJ5A 3CEYA 1YITA 3M58A 1BU1A 5IHIA 3HSBA 2RA2A 3QSUA 3H9NA 3QWYA 4M77F 3CC4T 3CCSA 4M7DD 1K9AA 2L3RA 5CKDA 4M75F 2DPPB 4GBQA 4JJCA 1VQ9Q 1D1CA 1X27A 1M1KR 2DYBA 3QPHA 3BDUA 4LD6A 3S3MA 5LJ3e 1VQ5Q 1ZUUA 3MKDA 4DBFA 2QI2A 4IIMA 1JEGA 3PFSA 3HTRA 2LMJA 4E6RA 5LJ5h 2M1HA 1VQ6A 4AMCA 2XI9A 4M78B 2OI3A 2LCSA 3MPUB 1WZOA 3EHQA 5ECAA 1KQ2A 1M2OA 1YCYA 1I81A 1WFWA 4XTVA 4NS5A 4Z89A 2YDLA 2E64A 2LP5A 4X34A 4F14A 2NUPA 1VQPQ 1V76A 3H0IA 2D0NA 3PVLA 2QTVA 2QQ9A 1JU5C 4PJOB 1OZ2A 1PG5B 4J5YA 3DLLA 4C5EA 1UGPB 2EJFA 4N0AA 3EGDA 4E7LA 3JCMh 2H3JA 1WJSA 3VS2A 3CC7A 3GNFB 2EPDA 1KQSA 3CBMA 3TREA 3JCMb 2PTKA 1AEYA 2E12A 3EG1A 2DERA 5GAN5 4E7SA 2BKDN 4N4GA 1X6BA 4GLKA 3CXCP 1IREB 4A4HA 1SKUB 1AT1B 4FCYA 2FPDA 2A37A 4PJMA 2W10A 2LNVA 2EYWA 4ZGJB 1U06A 1VQPA 2FL7A 5FU6C 4HCCA 3CCQQ 1S1NA 2YUOA 4AT1B 2BZXA 2K57A 5D6WA 3CC7T 1EIFA 2COZA 2LJ1A 2CUBA 2NYSA 3A8GB 2FRYA 3P8HA 1RAEB 4AFZC 2FHDA 4KH0B 3CD6Q 3ZFJA 1LNXA 4FM4B 2DEQA 3EG9A 1MMAA 2SEMA 2ZPEB 2E6ZA 1NM7A 4ELYC 1VYUA 1U3OA 5KYXA 4V2SA 2RQWA 2VVKA 4M75E 3SFMA 1D0XA 3E9FA 2HZYA 3J80E 5KE3A 3BW1A 1KIKA 3TVTA 1MMDA 1UJYA 4M7DA 4M75G 1MNEA 2HQEA 4M75A 2L3SA 4AFUC 4J9CA 2C0IA 4C8QC 2RM4A 3EFSA 4QQDA 2O2OA 1Q7YU 4FW2A 3NMZC 1R77A 2M16A 4DBQA 2YXYA 1WLPB 3UDCA 4C92F 1VQ4A 2QA4A 2ZCFB 2O9VA 4QVZA 1UE9A 1Q7YR 4ZTFA 3QYHB 2PQWA 4XU0A 2YRVA 1BYMA 3CD6A 4F7UE 2K3BA 2L2PA 2EJGA 4CC4B 2QGFB 2MCNA 3OW2A 3CCSQ 2EJ9A 3OMGA 1KC8U 3CCVA 3AHUA 1PSFA 1M90U 2VASA 2LC4A 1UEBA 3CC7Q 3EH1A 4M7DE 4HVUA 2LCCA 4C92B 4BY6C 2QAZA 2E6NA 2OAUA 4JRKA 3WVDB 4FIBA 4AFSC 3DB3A 5IN1A 3V7CA 4B6MA 1NZ9A 1MHNA 3M4GA 4HCKA 4KGZB 4KH1B 1M1FA 2RJEA 1I0CA 4PK4A 1UG1A 3CXCS 4XTUA 2DLPA 1WDXA 2MK5A 3QWXX 2DFUA 1K73C 3JRZA 3WVEB 3JCMX 1W2BP 1M27C 4MMLA 4PFPA 4KUDK 1PKSA 1WJQA 2C0TA 2EQMA 4PJOF 1YJ9Q 5GAOn 1GRIA 5GAN8 4Z02A 2DAQA 1QVFP 5I2MA 1NPPA 3H0FA 1IRXA 2HQHA 1AD5A 3HFNA 4AFQC 3FLGA 2E3HA 4IIOA 3OBYA 1SEMA 1D3BA 4BE0A 1W1FA 5GANd 3CCJT 3VU3C 1YFNA 3HPWA 3CCMQ 4C0ZA 4NOYA 2KI7A 1OQKA 3ASKA 3CCEQ 3OYBA 4KBMB 1M90C 3L2UA 2F5KA 2CT4A 3BDLA 1BI3A 2E70A 4HT8A 2K2VA 3CBPA 2CH4A 2DVEA 1WIEA 4PLLA 4J9FA 4M75B 3QDRB 4FU6A 4A53A 1X69A 2DRMA 5HK3A 4LDYA 3M0RA 3L42A 4BD3A 3TEEA 4OP0A 1YJWT 2O4XB 2K3YA 3NFCA 4EPCA 2LJ0A 1KC8R 2MAMA 2YLCA 4M75C 2CH4W 1SRMA 3M54A 1Q95G 4RTWA 3LYIA 1YHQA 4M7AD 2G3RA 3UATA 4QW2A 1M8MA 1S72Q 3LH5A 4FT4A 3JCMJ 1RAIB 2WSFE 1M4ZA 4PKCC 4R56A 2KR3A 3EG9B 3O5ZA 3OYJA 2DM1A 5CKEA 2MF2A 3S3OA 4WF2A 3CMAA 1RUWA 1AWJA 2HEQA 1UHCA 1YI2Q 3VS6A 4DBHA 2CDTA 3OYAA 2EYZA 2R5AA 1HK9A 1OPLA 3I55Q 1QVFS 1VQOT 1YJNT 4J9DA 2H3EB 2L3PA 3X24B 2JTMA 1AZEA 1QCNA 2CS7A 2DZCA 3VRYA 3MEAA 3JB9J 1R0CB 3JB9G 5GAOl 2K5FA 1YHQT 1WXTA 1UGSB 2NUTA 1ZLMA 4A4EA 2QTXA 2EFIA 4LUEA 2RNAA 3MP8A 3FDRA 2ZPHB 2YUNA 5KYWB 2DD5A 3TSWA 4OMPA 1VQNA 5GMKm 1K1ZA 2JTEA 2RJDA 5CKBA 2HNIA 2RI3A 3CQTA 3FIFA 4M78D 1PCXA 1U1TA 2ROLA 1VIFA 3KBGA 4JLGA 3VYGA 2X4JA 9ATCB 1WPYA 4VUBA 2O4XA 4BI3A 2XD0A 3MHXA 4WTOB 4BB7A 1OPKA 2LRQA 3C12A 5A2QE 4Z8AA 2GBQA 1H3HA 2PVDB 3JAME 1PD0A 5FW9A 5J26A 2JT4A 1QQJA 5KYXB 1ZUYA 2VXEA 3ZL7C 3CPWA 3PGGA 1QLYA 3JCMg 2KK4A 3OS5A 4QQ6A 4PJOG 1PNJA 1JXMA 2V1RA 1M90R 5IXFA 2MIOA 2YWWA 3OYCA 1VOMA 3A98A 1WNLA 2RHYA 2RJFA 2ZPBB 3HHTB 3OSVA 4Y91A 4M7AG 2K5LA 1VQ7Q 1S72A 3CC2T 3UWNA 2EQJA 3OSSC 4J9BA 3QIIA 3BY7A 2OJ2A 1ZSGA 3TSZA 1N6AA 1UECA 1YP5A 1K73R 3S6WA 1VQOQ 5GJVB 3OA6A 4ZN3A 3QZ5B 4KULA 2O88A 3EG3A 2YT6A 2AKLA 5IHKA 1IB8A 2QDYB 5LJ5g 2KRMA 5LJ3j 2GFUA 4EDUA 3CCUA 1GL5A 1RADB 2QEXT 5LJ5j 1QCFA 2DXCA 1VQ8A 2ZAEA 1GFDA 3RMQA 1G83A 1EZZB 1LCKA 2PZ1A 3RBBB 3JCMc 3OYEA 3JB9D 1MNDA 3C0CA 2ZPIB 3L2QA 4X9DA 4C92E 1D0ZA 1KD1C 1DJ7B 3L2ZA 4ESRA 4Q5WA 2CT3A 4LE9A 4DBRA 5DLOA 2RI5A 3OYDA 2RQTA 2L3QA 1QP2A 3BE3A 3CCEA 4BACA 4BDZA 1YN8A 3RKXA 3LW5E 4L59A 4HT9A 2LT1A 3DB4A 3QKJA 4C5IA 5GANf 5J3BA 1VQMA 1VQ5T 3CPFA 2JXBA 3I35A 4YTLA 3MEVA 3LWIA 2DD4A 3ZBDA 5GAN6 5I21A 1TUDA 3VRZA 5LJ5f 1JJ2S 3MP6A 1ZBJA 2XDBA 1TWBA 3CCRT 4IUQA 3LX7A 1TH7A 4OGCA 4EMGA 3S3NA 5LJ3g 3JCMW 2LDMA 2J6FA 3I56Q 1Y71A 3GLXA 5IT9E 4QT7A 2DETA 1Y96B 4RKUE 2DXUA 1KG1A 1RAHB 2D8JA 1YNZA 1YIJA 2V26A 2CP5A 3VS3A 4KGXB 1ZQ1A 3OYFA 4M77C 4MZTA 4J9HA 3I9QA 3M53A 3GBQA 5CKFA 4PFOA 1MMGA 4PJOC 4RTXA 3I56A 4OMNA 3V8JA 4AG2C 2VGNA 2VC8A 2RB6A 4C0DC 3HRUA 1N9SA 1IHVA 4GLMA 2DL3A 3X28B 1BI0A 3RESA 1WA7A 3OS1A 1KQ1A 2LQNA 1UGQB 3E19A 5LJ3d 2F5TX 3ER0A 4M78F 2VKNA 4C0GA 3NTIA 4D6WA 2DL4A 5GJWB 1H641 3G7ZA 5CKHA 4AG1C 3G4SQ 1MGQA 4WCIA 1YJWQ 2E1HA 2P0KA 1AVZC 1VQ6T 1ZA2B 4A4KA 3M9QA 2QQSA 1K4US 2EQIA 2DXBA 3JB9F 4BI8B 3UA7A 3VS7A 1IO6A 2DIQA 5FU7B 2ESWA 4C92A 3TU4K 1LVKA 3NPFA 3P8BB 2G6FX 4M78G 3VS4A 5CQYA 2OX7A 5FWCA 4II1A 5AT1B 4JLIA 2VUBA 3Q1JA 4F7UA 2CP6A 2EKHA 1M30A 2ZPGB 2XKOC 4F04B 1GCQA 4HCZA 3JCMe 2LX9A 2WACA 4JDSA 1XNIA 2DF6A 5FLXE 2GCXA 2RF0A 1G2BA 3MEUA 3G6EQ 4EMKC 3KUFA 5LJ5e 3PVQA 3CCUQ 2LT4A 1YIJQ 4J6YA 4DEXA 3D7SB 1A0NB 4M77E 1KSWA 2DZ9A 1RLPC 3VJPA 5KCOA 2HAXA 1ZUKA 2AIRB 1WHHA 2K5IA 2MMPA 1BB9A 2YRCA 2KYBA 3UT1A 2RQRA 4RG8A 2RN8A 1VQPT 4M7AA 4IUTA 2E5KA 2LNHB 2QYZA 2Y90A 3L1AA 1R0BG 3A8OB 2KXDA 3UF4A 3RKYA 1QVGS 2RH2A 4JJNK 1VQMQ 2E41A 2F2VA 1CSKA 2AHJB 4A63B 2EW3A 2FYKA 2CP3A 3OYKA 1NE8A 3V7RA 1YITT 4O5VA 2MI6A 1UJ0A 2L5QA 1W70A 1B3QA 1V29B 4KRTA 2CKKA 3CCST 4OB0B 4R0KA 5D7UA 1X2KA 2O9SA 1H92A 4TVRA 1VQNQ 2L0AA 4M7DF 4NL3A 2OAWA 1FWZA 3QDFA 1X43A 2EIFA 2GTJA 5GAOp 1M3AA 1Q7YC 2HBPA 1JO8A 1JJ2P 2BIVA 4IUVA 1C0MA 3T9NA 2IVWA 2X3XD 4F7UF 4DOVA 2HSEB 4OMMA
chains in the Genus database with same CATH topology
3I5SA 1WX6A 1OV3A 2KR3A 2J7IA 2J6KA 3O5ZA 2DM1A 2KXCA 3H0HA 5I22A 4K11A 3VS0A 1UTIA 1NEBA 1AOJA 2M51A 2JMAA 4RTVA 1RUWA 1X6GA 2DNUA 1SHGA 2KROA 1AWJA 1HD3A 2HEQA 1UHCA 2DE0X 5I11A 3VS6A 2CDTA 2CUDA 1NLPC 2EYZA 1OPLA 2K7AA 1PWTA 1T3LA 2DRKA 1OEBA 4J9DA 2EYYA 2L3PA 1AZEA 1GBRA 1KFZA 2EGEA 4JPBW 1K0XA 2KT1A 3VRYA 1PHTA 3U23A 4J9EA 1WXTA 2J06A 1ZLMA 2BZ8A 1NEGA 2LQWA 1GCQC 4LUEA 2RNAA 2YUNA 1XOVA 2JS0A 2RPNA 3JV3A 3TSWA 4OMPA 1RLQC 5FWBA 1K1ZA 4X1VA 1SSHA 2JTEA 3PE0A 4JZ3A 4ORZA 2DBMA 3CQTA 3NHNA 4RTTA 2ROLA 1T3SA 2HSPA 3IQLA 3THKA 1M3BA 1JXOA 4J9GA 2A36A 3UA6A 4HVWA 4RUGA 1K0SA 1WYXA 1SHFA 1Z9QA 2KE9A 1OPKA 3H41A 4Z8AA 2GBQA 1H3HA 5FW9A 4Z88A 2JT4A 2K2MA 1ZUYA 3ZL7C 1ABOA 2F2WA 1QLYA 1PNJA 1JXMA 2V1RA 3EG0A 4DEYA 1FMKA 2DX1A 5IXFA 2MIOA 3A98A 3R6NA 4HVVA 1OOTA 4ZNXA 1V1CA 3FJ5A 1BU1A 5IHIA 1GCPA 3QWYA 1K9AA 2JMCA 3EGUA 1NG2A 4GBQA 4J9BA 1QKXA 2A08A 3KFVA 2EVRA 2OJ2A 4JJCA 4JJDA 1ZSGA 1X27A 2DYBA 3TSZA 1UECA 1YP5A 2I0NA 1ZUUA 5GJVB 5IH2A 4IIMA 4RTYA 1JEGA 4F17A 1N5ZA 2LMJA 4J9IA 4E6RA 4OMQA 3ULRB 2O88A 1SPKA 3EG3A 2YT6A 2W0ZA 2AKLA 2KT8A 5IHKA 2X3WD 2KRMA 2FRWA 1E7OA 2P4RA 3NGPA 2OI3A 2LCSA 1GL5A 1GFCA 3EHQA 1HJDA 1QWEA 1QCFA 5ECAA 1WFWA 4Z89A 1GFDA 2KEAA 2YDLA 2LP5A 2CSQA 1G83A 4F14A 1LCKA 2PZ1A 1YWOA 2DVJA 3H0IA 3SEMA 3RBBB 2D0NA 3PVLA 1T0HA 1B07A 1JU5C 3C0CA 1PRLC 2K9GA 1GBQA 1AWXA 2YUQA 1UDLA 2H8HA 1VA7A 3VS5A 4JJBA 2AZVA 4ESRA 1FYNA 3EHRA 2CT3A 1T0JA 4LE9A 2RQTA 2DJQA 2FPEA 2K79A 2L3QA 3VS2A 1YN8A 1I07A 2EPDA 4JZ4A 3VS1A 2KBTA 4RTUA 1UUEA 2DBKA 2AKKA 2PTKA 1AEYA 3I35A 2JXBA 4RTZA 3EG1A 1CKAA 3EG2A 4HXJA 4F16A 1TUDA 2YUPA 3VRZA 1X6BA 3SHWA 2KRSA 1ZBJA 3M0PA 2FG0A 4LUDA 2FPDA 2AK5A 2A37A 2W10A 2EYWA 1X2QA 2GTOA 2M0YA 4LN2A 1U06A 2J6FA 4QT7A 1S1NA 2YUOA 2EGAA 2BZXA 1JQQA 1H8KA 2D8JA 1YNZA 1NYGA 1TUCA 1UFFA 5IXBA 1MUZA 2LJ1A 3VS3A 1ZX6A 2QDLA 1NYFA 2NWMA 2CUBA 2FRYA 4J9HA 3I9QA 3GBQA 4AFZC 4RTXA 2F2XA 4OMNA 4D8DA 2JW4A 4M4ZA 2ROTA 4AG2C 5L23A 1WXBA 2SEMA 1I1JA 2LZ6B 4GLMA 1NM7A 2DL3A 1VYUA 1U3OA 1QKWA 4D8KA 1VYTA 2RQWA 2VVKA 3REBB 1WA7A 2DILA 2LQNA 2VKNA 2ED0A 2GGRA 1MV0B 2DL4A 5GJWB 2RMOA 1RI9A 1BBZA 2RQVA 1J3TA 2ENMA 1KIKA 4AG1C 3TVTA 1UJYA 2KNBB 4WCIA 2L3SA 2J05A 4AFUC 4J9CA 1AVZC 2C0IA 2O31A 1UGVA 2K6DA 2O2OA 3M0UA 2DL7A 2EYXA 3NMZC 1K4US 2EQIA 2YSQA 1NLOC 1WLPB 1PRMC 2DA9A 2O9VA 1BK2A 2PNIA 3UA7A 1UE9A 2V1QA 3VS7A 1MV3A 3M0TA 1IO6A 2LX7A 2ESWA 2EBPA 3M0SA 1EFNA 2K3BA 2L2PA 4CC4B 2MCNA 3NPFA 2G6FX 2FEIA 3VS4A 2KYMA 2SRCA 5IHNA 2CREA 1TG0A 5FWCA 1SRLA 4EIKA 4CC3A 2D1XA 1PKTA 2CSIA 2EKHA 2ED1A 1M30A 1GCQA 2A28A 4HVUA 2BTTA 2DF6A 2ABLA 2RF0A 1G2BA 3M0QA 2C0OA 4AFSC 3PVQA 1WI7A 1Y0MA 4HCKA 1I0CA 1UG1A 4DEXA 1YWPA 1WXUA 2HBWA 1A0NB 2DLPA 1WDXA 2RQUA 1KSWA 1E6GA 1RLPC 3QWXX 1YCSB 5EC7A 4CC7A 1ZUKA 3RNJA 4OMLA 2ECZA 1BB9A 2HCKA 1AWWA 2KYBA 2JM8A 1M27C 2RQRA 4FSSA 1PKSA 2RN8A 2FPFA 2C0TA 2DL8A 2KGTA 1GRIA 2E5KA 2MOXA 2LNHB 3H0FA 1AD5A 4AFQC 5HCKA 2JS2A 2KXDA 4IIOA 3UF4A 1M3CA 1Z9ZA 1ARKA 1SEMA 2D8HA 1U5SA 4LNPA 1W1FA 2JM9A 2FO0A 2KRNA 2F2VA 1CSKA 4A63B 2EW3A 2IIMA 1HSQA 1AZGB 4Y92A 1UHFA 1UJ0A 2CT4A 3I5RA 1W70A 1B3QA 2B86A 2BZYA 4KRTA 4R0KA 1X2KA 2O9SA 2J6OA 1H92A 1Y57A 2DL5A 2HDAA 2CH4A 1WIEA 2NUZA 4J9FA 1AWOA 2L0AA 1X69A 2DRMA 2OAWA 1VYVA 1X43A 1ABQA 1CKBA 2GNCA 3M0RA 2AZSA 2GTJA 2DMOA 1M3AA 2EGCA 1KJWA 2GQIA 2LJ0A 2VWFA 1JO8A 2XMFA 2CH4W 1SRMA 1K76A 4OMOA 1E6HA 4RTWA 3REAB 4CC2A 3UATA 2X3XD 1QWFA 4OMMA 1M8MA 3LH5A 2LJ3A 1W6XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5S A;  1WX6 A;  1OV3 A;  2KR3 A;  2J7I A;  2J6K A;  3O5Z A;  2DM1 A;  2KXC A;  3H0H A;  5I22 A;  4K11 A;  3VS0 A;  1UTI A;  1NEB A;  1AOJ A;  2M51 A;  2JMA A;  4RTV A;  1RUW A;  1X6G A;  2DNU A;  1SHG A;  2KRO A;  1AWJ A;  1HD3 A;  2HEQ A;  1UHC A;  2DE0 X;  5I11 A;  3VS6 A;  2CDT A;  2CUD A;  1NLP C;  2EYZ A;  1OPL A;  2K7A A;  1PWT A;  1T3L A;  2DRK A;  1OEB A;  4J9D A;  2EYY A;  2L3P A;  1AZE A;  1GBR A;  1KFZ A;  2EGE A;  4JPB W;  1K0X A;  2KT1 A;  3VRY A;  1PHT A;  3U23 A;  4J9E A;  1WXT A;  2J06 A;  1ZLM A;  2BZ8 A;  1NEG A;  2LQW A;  1GCQ C;  4LUE A;  2RNA A;  2YUN A;  1XOV A;  2JS0 A;  2RPN A;  3JV3 A;  3TSW A;  4OMP A;  1RLQ C;  5FWB A;  1K1Z A;  4X1V A;  1SSH A;  2JTE A;  3PE0 A;  4JZ3 A;  4ORZ A;  2DBM A;  3CQT A;  3NHN A;  4RTT A;  2ROL A;  1T3S A;  2HSP A;  3IQL A;  3THK A;  1M3B A;  1JXO A;  4J9G A;  2A36 A;  3UA6 A;  4HVW A;  4RUG A;  1K0S A;  1WYX A;  1SHF A;  1Z9Q A;  2KE9 A;  1OPK A;  3H41 A;  4Z8A A;  2GBQ A;  1H3H A;  5FW9 A;  4Z88 A;  2JT4 A;  2K2M A;  1ZUY A;  3ZL7 C;  1ABO A;  2F2W A;  1QLY A;  1PNJ A;  1JXM A;  2V1R A;  3EG0 A;  4DEY A;  1FMK A;  2DX1 A;  5IXF A;  2MIO A;  3A98 A;  3R6N A;  4HVV A;  1OOT A;  4ZNX A;  1V1C A;  3FJ5 A;  1BU1 A;  5IHI A;  1GCP A;  3QWY A;  1K9A A;  2JMC A;  3EGU A;  1NG2 A;  4GBQ A;  4J9B A;  1QKX A;  2A08 A;  3KFV A;  2EVR A;  2OJ2 A;  4JJC A;  4JJD A;  1ZSG A;  1X27 A;  2DYB A;  3TSZ A;  1UEC A;  1YP5 A;  2I0N A;  1ZUU A;  5GJV B;  5IH2 A;  4IIM A;  4RTY A;  1JEG A;  4F17 A;  1N5Z A;  2LMJ A;  4J9I A;  4E6R A;  4OMQ A;  3ULR B;  2O88 A;  1SPK A;  3EG3 A;  2YT6 A;  2W0Z A;  2AKL A;  2KT8 A;  5IHK A;  2X3W D;  2KRM A;  2FRW A;  1E7O A;  2P4R A;  3NGP A;  2OI3 A;  2LCS A;  1GL5 A;  1GFC A;  3EHQ A;  1HJD A;  1QWE A;  1QCF A;  5ECA A;  1WFW A;  4Z89 A;  1GFD A;  2KEA A;  2YDL A;  2LP5 A;  2CSQ A;  1G83 A;  4F14 A;  1LCK A;  2PZ1 A;  1YWO A;  2DVJ A;  3H0I A;  3SEM A;  3RBB B;  2D0N A;  3PVL A;  1T0H A;  1B07 A;  1JU5 C;  3C0C A;  1PRL C;  2K9G A;  1GBQ A;  1AWX A;  2YUQ A;  1UDL A;  2H8H A;  1VA7 A;  3VS5 A;  4JJB A;  2AZV A;  4ESR A;  1FYN A;  3EHR A;  2CT3 A;  1T0J A;  4LE9 A;  2RQT A;  2DJQ A;  2FPE A;  2K79 A;  2L3Q A;  3VS2 A;  1YN8 A;  1I07 A;  2EPD A;  4JZ4 A;  3VS1 A;  2KBT A;  4RTU A;  1UUE A;  2DBK A;  2AKK A;  2PTK A;  1AEY A;  3I35 A;  2JXB A;  4RTZ A;  3EG1 A;  1CKA A;  3EG2 A;  4HXJ A;  4F16 A;  1TUD A;  2YUP A;  3VRZ A;  1X6B A;  3SHW A;  2KRS A;  1ZBJ A;  3M0P A;  2FG0 A;  4LUD A;  2FPD A;  2AK5 A;  2A37 A;  2W10 A;  2EYW A;  1X2Q A;  2GTO A;  2M0Y A;  4LN2 A;  1U06 A;  2J6F A;  4QT7 A;  1S1N A;  2YUO A;  2EGA A;  2BZX A;  1JQQ A;  1H8K A;  2D8J A;  1YNZ A;  1NYG A;  1TUC A;  1UFF A;  5IXB A;  1MUZ A;  2LJ1 A;  3VS3 A;  1ZX6 A;  2QDL A;  1NYF A;  2NWM A;  2CUB A;  2FRY A;  4J9H A;  3I9Q A;  3GBQ A;  4AFZ C;  4RTX A;  2F2X A;  4OMN A;  4D8D A;  2JW4 A;  4M4Z A;  2ROT A;  4AG2 C;  5L23 A;  1WXB A;  2SEM A;  1I1J A;  2LZ6 B;  4GLM A;  1NM7 A;  2DL3 A;  1VYU A;  1U3O A;  1QKW A;  4D8K A;  1VYT A;  2RQW A;  2VVK A;  3REB B;  1WA7 A;  2DIL A;  2LQN A;  2VKN A;  2ED0 A;  2GGR A;  1MV0 B;  2DL4 A;  5GJW B;  2RMO A;  1RI9 A;  1BBZ A;  2RQV A;  1J3T A;  2ENM A;  1KIK A;  4AG1 C;  3TVT A;  1UJY A;  2KNB B;  4WCI A;  2L3S A;  2J05 A;  4AFU C;  4J9C A;  1AVZ C;  2C0I A;  2O31 A;  1UGV A;  2K6D A;  2O2O A;  3M0U A;  2DL7 A;  2EYX A;  3NMZ C;  1K4U S;  2EQI A;  2YSQ A;  1NLO C;  1WLP B;  1PRM C;  2DA9 A;  2O9V A;  1BK2 A;  2PNI A;  3UA7 A;  1UE9 A;  2V1Q A;  3VS7 A;  1MV3 A;  3M0T A;  1IO6 A;  2LX7 A;  2ESW A;  2EBP A;  3M0S A;  1EFN A;  2K3B A;  2L2P A;  4CC4 B;  2MCN A;  3NPF A;  2G6F X;  2FEI A;  3VS4 A;  2KYM A;  2SRC A;  5IHN A;  2CRE A;  1TG0 A;  5FWC A;  1SRL A;  4EIK A;  4CC3 A;  2D1X A;  1PKT A;  2CSI A;  2EKH A;  2ED1 A;  1M30 A;  1GCQ A;  2A28 A;  4HVU A;  2BTT A;  2DF6 A;  2ABL A;  2RF0 A;  1G2B A;  3M0Q A;  2C0O A;  4AFS C;  3PVQ A;  1WI7 A;  1Y0M A;  4HCK A;  1I0C A;  1UG1 A;  4DEX A;  1YWP A;  1WXU A;  2HBW A;  1A0N B;  2DLP A;  1WDX A;  2RQU A;  1KSW A;  1E6G A;  1RLP C;  3QWX X;  1YCS B;  5EC7 A;  4CC7 A;  1ZUK A;  3RNJ A;  4OML A;  2ECZ A;  1BB9 A;  2HCK A;  1AWW A;  2KYB A;  2JM8 A;  1M27 C;  2RQR A;  4FSS A;  1PKS A;  2RN8 A;  2FPF A;  2C0T A;  2DL8 A;  2KGT A;  1GRI A;  2E5K A;  2MOX A;  2LNH B;  3H0F A;  1AD5 A;  4AFQ C;  5HCK A;  2JS2 A;  2KXD A;  4IIO A;  3UF4 A;  1M3C A;  1Z9Z A;  1ARK A;  1SEM A;  2D8H A;  1U5S A;  4LNP A;  1W1F A;  2JM9 A;  2FO0 A;  2KRN A;  2F2V A;  1CSK A;  4A63 B;  2EW3 A;  2IIM A;  1HSQ A;  1AZG B;  4Y92 A;  1UHF A;  1UJ0 A;  2CT4 A;  3I5R A;  1W70 A;  1B3Q A;  2B86 A;  2BZY A;  4KRT A;  4R0K A;  1X2K A;  2O9S A;  2J6O A;  1H92 A;  1Y57 A;  2DL5 A;  2HDA A;  2CH4 A;  1WIE A;  2NUZ A;  4J9F A;  1AWO A;  2L0A A;  1X69 A;  2DRM A;  2OAW A;  1VYV A;  1X43 A;  1ABQ A;  1CKB A;  2GNC A;  3M0R A;  2AZS A;  2GTJ A;  2DMO A;  1M3A A;  2EGC A;  1KJW A;  2GQI A;  2LJ0 A;  2VWF A;  1JO8 A;  2XMF A;  2CH4 W;  1SRM A;  1K76 A;  4OMO A;  1E6H A;  4RTW A;  3REA B;  4CC2 A;  3UAT A;  2X3X D;  1QWF A;  4OMM A;  1M8M A;  3LH5 A;  2LJ3 A;  1W6X A; 
#chains in the Genus database with same CATH topology
 1IHW A;  2I2L A;  2J7I A;  1RAG B;  1NPR A;  3VS0 A;  1FXX A;  1KC8 C;  3HL8 A;  3EFO B;  3J81 E;  2M51 A;  3GPL A;  1G3Y A;  2JMA A;  3CD6 T;  1QVG P;  2WSC E;  1HD3 A;  4OB3 B;  2OTJ A;  1BCO A;  5I11 A;  1PSE A;  1NLP C;  4XTY A;  3CCV T;  1Q86 R;  1T3L A;  1ZSZ C;  5HK0 A;  1Y96 A;  1OEB A;  1GBR A;  2DTO A;  2K4Y A;  2XG8 D;  1WHL A;  1YJW A;  1KFZ A;  3LH0 A;  4JPB W;  5GAN h;  1Q81 R;  1TUG B;  2KT1 A;  4MMK A;  1WQ7 A;  1VQ7 T;  1QP3 A;  4J9E A;  2J06 A;  5AYF A;  3PMI A;  1RAF B;  1O9S A;  2ZPF B;  3SWN C;  2Y4Y A;  2CP7 A;  4ZGE B;  5LJ5 d;  2JS0 A;  3JV3 A;  1RLQ C;  1EX4 A;  1BIA A;  4X1V A;  4JZ3 A;  2XDP A;  1TTH B;  2JN0 A;  3OS2 A;  4R55 A;  2LQK A;  3IQL A;  1M3B A;  4FYV B;  2CZ1 B;  2YRD A;  3CME A;  1UGR B;  1K73 U;  2JVV A;  1TSF A;  2EQK A;  3GIB A;  5HY6 A;  4F7U G;  3PMT A;  3CCL Q;  1SHF A;  2RHX A;  1D3B B;  2RK1 A;  3KXT A;  2GFA A;  2DO3 A;  3TCJ A;  1OU9 A;  2JNG A;  1KQS S;  1JBM A;  3CCV Q;  2NUT B;  1IGU A;  4PJJ A;  4DEY A;  3CCJ A;  3QJ6 A;  4ELZ C;  3R6N A;  4HVV A;  1OOT A;  4ZNX A;  5IAY A;  4FW1 A;  1V1C A;  4BDY A;  3I55 A;  1GCP A;  5C0M A;  2OTL A;  4LDU A;  2PUK B;  1N9R A;  1TU0 B;  2JMC A;  2FZC B;  3EGU A;  1NG2 A;  1QKX A;  3QO3 A;  3OYH A;  4EMK A;  1OX9 A;  4MZP A;  4C5H A;  3C95 A;  2VGM A;  2Y4X A;  3QJY A;  3VUB A;  1D1A A;  2KSS A;  1XQH A;  5IH2 A;  5GAN g;  4FT2 A;  4OMQ A;  2OTJ Q;  3O8V A;  2QEX Q;  4J6W A;  2HQX A;  1JB0 E;  2W0Z A;  2KT8 A;  4ZTJ A;  2MYS A;  5FU6 B;  2FRW A;  4ATO A;  2C06 A;  2HD0 A;  1HJD A;  4M77 G;  5DY9 A;  1W2B S;  2K3X A;  2NLU A;  4IKF A;  1YWO A;  2DVJ A;  3SEM A;  1QCO A;  1ZHI A;  2E3I A;  2OTL T;  1N8R U;  1T0H A;  4QVC A;  2K9G A;  4M7A F;  1Q82 R;  1AWX A;  2YUQ A;  2H8H A;  1VA7 A;  4HCB A;  4MDX A;  2AZV A;  1FYN A;  3EHR A;  1T0J A;  3FEO A;  2DJQ A;  1WGS A;  2K79 A;  1X01 A;  3HRS A;  3OW2 P;  3OMC A;  1W2B A;  1VQ4 Q;  4RTU A;  1UUE A;  2QXF A;  1M1K C;  1PD1 A;  3INZ A;  4HKE A;  3CCU T;  4BY6 B;  1JJ2 A;  1RI0 A;  2QEX A;  2E4H A;  3EG2 A;  4HXJ A;  4F16 A;  2EKO A;  2YUP A;  2IG0 A;  4DA4 A;  1Q86 U;  3VYH B;  2KRS A;  3G4S T;  3G6E T;  4P5N A;  2MWO A;  3EFO A;  2P4T A;  2FG0 A;  3M0P A;  3QZ9 B;  4KGV B;  2XU8 A;  2PVG B;  4M7D B;  4LUD A;  5DLQ E;  1D0Y A;  3EGX B;  4PFZ A;  1VQ9 T;  1RL2 A;  1IXD A;  1O75 A;  2CZ7 B;  2HKN A;  1X2Q A;  4LN2 A;  5CIU A;  2NUP B;  3OYY A;  2EGA A;  1Q81 C;  5KYU A;  5A0D A;  4PJN A;  1JQQ A;  2E65 A;  1NYG A;  1TUC A;  3J7A F;  1MUZ A;  4KUI A;  3JCM d;  1NYF A;  3QXE B;  1ZBX A;  1UB4 A;  4ANJ A;  4C8Q B;  3MCA B;  4D8D A;  2JW4 A;  4M4Z A;  4E2F B;  2ROT A;  4XK8 E;  3M57 A;  2LZ6 B;  4JUV A;  4EMK B;  1FX7 A;  1YBY A;  1OUL A;  3G6E A;  1QKW A;  4D8K A;  1VYT A;  1SSF A;  2DIL A;  2DIG A;  1W4S A;  2EAY A;  4N0A C;  2ED0 A;  2GGR A;  2RMO A;  3RUX A;  1RI9 A;  3C94 A;  1BBZ A;  2COW A;  2RQV A;  1FMV A;  1J3T A;  1ACM B;  4RMO A;  2GQV A;  1LJO A;  2KNB B;  4PJL A;  1M2V A;  3E2U A;  1VQL T;  4DQ2 A;  2J05 A;  4M7D G;  1I5L A;  5KYN A;  2O31 A;  3A8M B;  1UGV A;  2K6D A;  2DL7 A;  3VV0 A;  4XU1 A;  2KMT A;  3A8L B;  3CC2 Q;  3V7S A;  2QG9 B;  2YSQ A;  2E10 A;  4XU2 A;  2DA9 A;  4FYY B;  1KHC A;  3SB2 A;  4C5G A;  2DEU A;  5GAO m;  2LX7 A;  2EBP A;  3M0S A;  1NJI C;  4HA8 A;  1G3W A;  1X75 C;  5A0G A;  2FEI A;  2KYM A;  1BCM A;  5IHN A;  1PM3 A;  1TG0 A;  2CRE A;  3CCM T;  1SRL A;  4CC3 A;  1N8R C;  3PIO A;  5GAM e;  3CPW P;  1PKT A;  4Y28 E;  4O6J A;  2ED1 A;  2MPX C;  4C8Q F;  4JRI A;  3CCE T;  1N27 A;  4M7A E;  5GMK i;  1OZ3 A;  2CYZ B;  4C92 G;  1K8A R;  1F1B B;  1QW1 A;  2AT1 B;  4UC4 A;  2OTL Q;  4A54 A;  3M0Q A;  1NJI U;  2RHI A;  1Q82 U;  5CAI A;  4M7A B;  1I5O B;  2A7Y A;  1YWP A;  1BIB A;  2XDD A;  1WXU A;  2RQU A;  3H6Z A;  1E6G A;  1BI1 A;  1VQK A;  2EQU A;  3LWH A;  1YCS B;  1VUB A;  1WQW A;  4OML A;  2DTH A;  3CCR A;  1AWW A;  2JM8 A;  4FSS A;  1QVP A;  4ME7 A;  3FC3 A;  3CCQ T;  1B34 A;  2L89 A;  2X4X A;  2MOX A;  1TXQ A;  2F69 A;  2DYI A;  1H3Z A;  4OB1 B;  5EG2 A;  1M3C A;  2X9H A;  2CP2 A;  3HP9 A;  2D8H A;  1U5S A;  4LNP A;  4C0F A;  1GXI E;  2JM9 A;  1WJR A;  2LTO A;  2FO0 A;  3X25 B;  3JB9 H;  1LPL A;  1QVG A;  2IIM A;  1BKB A;  5LL6 S;  4Y92 A;  5C6S A;  4M78 E;  1UHF A;  2QQR A;  4C8Q A;  3SWN B;  2JOY A;  5D6Y A;  2DL5 A;  4F7U B;  2VB6 A;  2D0Q B;  2RD1 A;  3OW2 S;  4FYX B;  2NUZ A;  1AWO A;  3CCQ A;  1VYV A;  1ABQ A;  1P92 A;  2DMO A;  2YHT A;  2GQI A;  2VWF A;  2ZGW A;  3ZEH A;  5GAO r;  4E7H A;  2HL5 C;  1K76 A;  1E6H A;  4CC2 A;  1Y7X A;  3MJX A;  5GAO q;  1K9M C;  1QWF A;  2LJ3 A;  1W6X A;  2ATC B;  2GF7 A;  3N5B B;  4JS5 A;  1WX6 A;  4N4H A;  1OV3 A;  1XJW B;  2J6K A;  2QAS A;  3URG A;  5I22 A;  2JJ9 A;  1UTI A;  1NEB A;  3PT9 A;  1WHJ A;  5CO7 A;  2RI2 A;  4RTV A;  1X6G A;  3CCJ Q;  4LDW A;  1SHG A;  3M4Y A;  2KRO A;  3VUZ A;  2DE0 X;  1R8O B;  2PUO B;  4PL6 A;  2CUD A;  5LJ3 f;  3EAE A;  7AT1 B;  2K7A A;  2Z0W A;  1YIT Q;  2F1L A;  2DRK A;  3OB9 A;  3LLR A;  2A0F B;  2LCL A;  1OX8 A;  1VQM T;  4MZM A;  4IUR A;  1YI2 A;  3M55 A;  4A4F A;  1TS9 A;  2XID A;  2BZ8 A;  1NEG A;  2LQW A;  1GCQ C;  3HRT A;  3QYG B;  1Q81 U;  4M78 C;  2RPN A;  3JB9 I;  1VQL Q;  2RJC A;  3OYL A;  3PE0 A;  2LVM A;  2QA4 Q;  1IZ6 A;  4ORZ A;  3V8L A;  3NHN A;  1Y07 A;  3LGL A;  4RCB A;  4C92 D;  3JCM P;  3CC4 A;  1T3S A;  3THK A;  2PU9 B;  3SDZ A;  3OYN A;  1Q86 C;  3MET A;  1JXO A;  4J9G A;  2A36 A;  4HVW A;  3EH2 A;  4FL6 A;  4XQ3 A;  1BI2 A;  3QHS A;  1Z9Q A;  2KE9 A;  3CMA Q;  3RER A;  2KAF A;  5D6X A;  4M77 B;  1I8F A;  4Z88 A;  1YIJ T;  2EYQ A;  4E7I A;  1VQ7 A;  2KVQ G;  1G3S A;  5KCH A;  3SWN A;  2DTI A;  4J7I A;  3ME9 A;  4CRI A;  1D09 B;  1OU8 A;  2O01 E;  3OBW A;  1G3T A;  3DKM A;  3OYM A;  1VQK Q;  5GAN j;  1M5Q 1;  3EGD B;  2E5Q A;  2VYT A;  1IGQ A;  1TOV A;  2JTF A;  1K8A U;  5DM7 R;  2QQA A;  3TQ7 P;  3CME T;  2A08 A;  2BE7 D;  3KFV A;  2EVR A;  4XAX B;  4JJD A;  4JRP A;  2HMA A;  4C8Q D;  2I0N A;  3X26 B;  1B34 B;  5GMK j;  3RKW A;  2RO0 A;  4RTY A;  4F17 A;  1N5Z A;  1NBE B;  4J9I A;  4B9X A;  5GAM g;  3ULR B;  1SPK A;  1MMN A;  3E1S A;  2X3W D;  5M9O A;  1E7O A;  2P4R A;  2CP0 A;  3NGP A;  1C6V X;  3HFO A;  1GFC A;  1K8A C;  1QWE A;  3H8Z A;  4XTX A;  2QA4 T;  2KEA A;  2CSQ A;  5GMK h;  3WXM B;  4OMF B;  2JZ2 A;  3MO8 A;  2YLB A;  1B07 A;  1PRL C;  1GBQ A;  4B9W A;  1UDL A;  3VS5 A;  4M78 A;  4JJB A;  1N8R R;  3RR6 A;  4KT0 E;  2V8K A;  5L8R E;  5LJ3 h;  2FPE A;  1WHK A;  1JRI A;  1I07 A;  1NJI R;  4JZ4 A;  3VS1 A;  2KBT A;  2V8I A;  2DBK A;  2AKK A;  2X51 A;  2VXF A;  1YHQ Q;  2CZ0 B;  4RTZ A;  2RHZ A;  3FB9 A;  2KQW A;  3NTH A;  1CKA A;  2XK0 A;  3QBY A;  5CQX A;  3CXC A;  3SHW A;  5GAM j;  3X20 B;  3M5A A;  3MEW A;  3QUI A;  2AK5 A;  3A1P A;  1ZSZ A;  2GTO A;  2M0Y A;  3RIR A;  5CCA A;  5A0L A;  4OB2 B;  5J39 A;  5GAM f;  5KH6 A;  2P84 A;  1H8K A;  2D9T A;  1UFF A;  5IXB A;  2D6F A;  4PJO D;  2M02 A;  1ZX6 A;  2QDL A;  2NWM A;  2P0P A;  2QQB A;  3DLM A;  3HKS A;  1YJ9 T;  1WHG A;  1PC0 A;  2LQ8 A;  2F2X A;  4C8Q G;  5GMK e;  5KYY A;  1HXD A;  4M77 D;  1VQ4 T;  5L23 A;  2M0O A;  2RK2 A;  1WXB A;  4LDX A;  1I1J A;  2BE9 B;  4OGE A;  3G4S A;  4L6V 5;  2DK3 A;  3REB B;  5GAN e;  1KK7 A;  3E9G A;  3G1J A;  1X6O A;  3OS0 A;  2R5M A;  3A8H B;  1MV0 B;  3L2V A;  3JCM Q;  4ZGD B;  2XHC A;  2L8D A;  2ENM A;  2P0Q A;  4XU3 A;  2RHU A;  5CR2 A;  3OQ5 A;  3EGX A;  2FB7 A;  4EMH A;  3CCR Q;  6AT1 B;  3M0U A;  2EYX A;  3PTA A;  1YJ9 A;  4PNO A;  1NLO C;  4BE1 A;  5GAN 7;  1PRM C;  1SF9 A;  3QG1 A;  2PNI A;  1BK2 A;  2V1Q A;  1MV3 A;  3M0T A;  3CMA T;  2B8A A;  1EFN A;  2BUD A;  3GF5 A;  1WHM A;  4J6X A;  1KD1 U;  2OTJ T;  2DJZ A;  5CK9 A;  1K9M R;  2SRC A;  3F70 A;  4E7K A;  1OI1 A;  1D1B A;  4EIK A;  3G71 Q;  1VQO A;  2D1X A;  1YJN A;  5I2S A;  2MWP A;  4FSX A;  2M9U A;  2CSI A;  3MP1 A;  4BE2 A;  1VQL A;  2A28 A;  2BTT A;  2ABL A;  1G8X A;  3L2W A;  2C0O A;  1VQ5 A;  3SD4 A;  1YJN Q;  1VQN T;  1WI7 A;  1Y0M A;  1VQ8 Q;  3M56 A;  1M1G A;  4QQG A;  1VQ6 Q;  2HBW A;  2DKG A;  4GY5 A;  2CZ6 B;  5EC7 A;  4CC7 A;  5KYW A;  5GAN 3;  3V8K A;  4JRQ A;  4MDW A;  1HYO A;  3RNJ A;  1KD1 R;  2DXT A;  2ECZ A;  2HCK A;  3FRN A;  5HKC A;  1VQ9 A;  5FRM A;  2FPF A;  2COY A;  2DL8 A;  4IUP A;  4LXC A;  2KGT A;  3CCL A;  3PIP A;  1RAC B;  4ZN1 A;  3OY9 A;  4XTZ A;  1SG5 A;  5HCK A;  1B7T A;  2JS2 A;  5KYY B;  1Z9Z A;  5KYU B;  1ARK A;  3BFM A;  2HL3 A;  2KRN A;  2JUF A;  1RAB B;  1VIE A;  3UPU A;  1FMW A;  4RG2 A;  1HSQ A;  4NL2 A;  1AZG B;  3I55 T;  3M59 A;  2V8J A;  3I5R A;  2HKQ B;  1VQK T;  2B86 A;  2BZY A;  4C8Q E;  2QGG A;  2J6O A;  2XIC A;  1Y57 A;  4QKU A;  4LD9 K;  2HDA A;  4A4G A;  1KHI A;  2X4W A;  5GAN 2;  3CCL T;  1CKB A;  2GNC A;  2AZS A;  3CC4 Q;  2EGC A;  4C92 C;  3RMS A;  5GAN 4;  4JS4 A;  1KJW A;  1K9M U;  1M9S A;  3PNW C;  1M8V A;  2XMF A;  3CBO A;  3REA B;  4OMO A;  1M2V B;  1Q82 C;  4L5G A;  4DOW A;  1VQ8 T;  4PLI A;  2KDS A;  3JCM V;  1KQS P;  3I5S A;  4OVA A;  4PJO E;  3P8D A;  2KXC A;  3H0H A;  4XTW A;  3GOX A;  4K11 A;  3EFR A;  3LGF A;  1AOJ A;  2PVO B;  2X4Y A;  4OF1 A;  8AT1 B;  2DNU A;  2ZZD A;  4QVD A;  2FZK B;  4RCC A;  5FRO A;  4M7A C;  4M7D C;  1XTD A;  4C0D B;  3AT1 B;  1PWT A;  3JCM f;  3CCM A;  4PJO A;  1C1A A;  2CGH A;  2R57 A;  4BUG A;  1LOJ A;  2EYY A;  5GMK l;  2KY9 A;  4J7F A;  4FYW B;  2EGE A;  1K0X A;  1QVF A;  3GNG A;  3OYI A;  1PHT A;  1ZSZ B;  3U23 A;  1RAA B;  4CI0 C;  4BI4 A;  4M75 D;  3CME Q;  5CVI A;  3OYG A;  1XOV A;  3JSC A;  2EWN A;  3NTK A;  4LDV A;  5FWB A;  1SSH A;  4M77 A;  3G71 T;  2WSE E;  4E7J A;  2DBM A;  1U1S A;  4N4I A;  2VV5 A;  4RTT A;  5FRN A;  2FVU A;  3C4S A;  3L2R A;  1U8R A;  2HSP A;  1S72 T;  4J83 A;  3CC2 A;  2FZG B;  4E47 A;  3GP8 A;  8ATC B;  3UA6 A;  1M1K U;  4RUG A;  1AHJ B;  1K0S A;  4J8O A;  1G5V A;  1WYX A;  1OYX A;  3FJP A;  3VKI A;  3RDV A;  5GAM h;  3H41 A;  2IPO B;  2R58 A;  3CPW S;  1I4K 1;  2K2M A;  5GAM d;  1ABO A;  2F2W A;  2A3L A;  1ZA1 B;  1QMC A;  4X9C A;  1YI2 T;  3I56 T;  3EG0 A;  1FMK A;  3R6O A;  4E7Z A;  2DX1 A;  2X35 A;  5KE2 A;  5FU7 C;  2QK0 A;  3A5Z B;  4IUU A;  3G71 A;  3FJ5 A;  3CEY A;  1YIT A;  3M58 A;  1BU1 A;  5IHI A;  3HSB A;  2RA2 A;  3QSU A;  3H9N A;  3QWY A;  4M77 F;  3CC4 T;  3CCS A;  4M7D D;  1K9A A;  2L3R A;  5CKD A;  4M75 F;  2DPP B;  4GBQ A;  4JJC A;  1VQ9 Q;  1D1C A;  1X27 A;  1M1K R;  2DYB A;  3QPH A;  3BDU A;  4LD6 A;  3S3M A;  5LJ3 e;  1VQ5 Q;  1ZUU A;  3MKD A;  4DBF A;  2QI2 A;  4IIM A;  1JEG A;  3PFS A;  3HTR A;  2LMJ A;  4E6R A;  5LJ5 h;  2M1H A;  1VQ6 A;  4AMC A;  2XI9 A;  4M78 B;  2OI3 A;  2LCS A;  3MPU B;  1WZO A;  3EHQ A;  5ECA A;  1KQ2 A;  1M2O A;  1YCY A;  1I81 A;  1WFW A;  4XTV A;  4NS5 A;  4Z89 A;  2YDL A;  2E64 A;  2LP5 A;  4X34 A;  4F14 A;  2NUP A;  1VQP Q;  1V76 A;  3H0I A;  2D0N A;  3PVL A;  2QTV A;  2QQ9 A;  1JU5 C;  4PJO B;  1OZ2 A;  1PG5 B;  4J5Y A;  3DLL A;  4C5E A;  1UGP B;  2EJF A;  4N0A A;  3EGD A;  4E7L A;  3JCM h;  2H3J A;  1WJS A;  3VS2 A;  3CC7 A;  3GNF B;  2EPD A;  1KQS A;  3CBM A;  3TRE A;  3JCM b;  2PTK A;  1AEY A;  2E12 A;  3EG1 A;  2DER A;  5GAN 5;  4E7S A;  2BKD N;  4N4G A;  1X6B A;  4GLK A;  3CXC P;  1IRE B;  4A4H A;  1SKU B;  1AT1 B;  4FCY A;  2FPD A;  2A37 A;  4PJM A;  2W10 A;  2LNV A;  2EYW A;  4ZGJ B;  1U06 A;  1VQP A;  2FL7 A;  5FU6 C;  4HCC A;  3CCQ Q;  1S1N A;  2YUO A;  4AT1 B;  2BZX A;  2K57 A;  5D6W A;  3CC7 T;  1EIF A;  2COZ A;  2LJ1 A;  2CUB A;  2NYS A;  3A8G B;  2FRY A;  3P8H A;  1RAE B;  4AFZ C;  2FHD A;  4KH0 B;  3CD6 Q;  3ZFJ A;  1LNX A;  4FM4 B;  2DEQ A;  3EG9 A;  1MMA A;  2SEM A;  2ZPE B;  2E6Z A;  1NM7 A;  4ELY C;  1VYU A;  1U3O A;  5KYX A;  4V2S A;  2RQW A;  2VVK A;  4M75 E;  3SFM A;  1D0X A;  3E9F A;  2HZY A;  3J80 E;  5KE3 A;  3BW1 A;  1KIK A;  3TVT A;  1MMD A;  1UJY A;  4M7D A;  4M75 G;  1MNE A;  2HQE A;  4M75 A;  2L3S A;  4AFU C;  4J9C A;  2C0I A;  4C8Q C;  2RM4 A;  3EFS A;  4QQD A;  2O2O A;  1Q7Y U;  4FW2 A;  3NMZ C;  1R77 A;  2M16 A;  4DBQ A;  2YXY A;  1WLP B;  3UDC A;  4C92 F;  1VQ4 A;  2QA4 A;  2ZCF B;  2O9V A;  4QVZ A;  1UE9 A;  1Q7Y R;  4ZTF A;  3QYH B;  2PQW A;  4XU0 A;  2YRV A;  1BYM A;  3CD6 A;  4F7U E;  2K3B A;  2L2P A;  2EJG A;  4CC4 B;  2QGF B;  2MCN A;  3OW2 A;  3CCS Q;  2EJ9 A;  3OMG A;  1KC8 U;  3CCV A;  3AHU A;  1PSF A;  1M90 U;  2VAS A;  2LC4 A;  1UEB A;  3CC7 Q;  3EH1 A;  4M7D E;  4HVU A;  2LCC A;  4C92 B;  4BY6 C;  2QAZ A;  2E6N A;  2OAU A;  4JRK A;  3WVD B;  4FIB A;  4AFS C;  3DB3 A;  5IN1 A;  3V7C A;  4B6M A;  1NZ9 A;  1MHN A;  3M4G A;  4HCK A;  4KGZ B;  4KH1 B;  1M1F A;  2RJE A;  1I0C A;  4PK4 A;  1UG1 A;  3CXC S;  4XTU A;  2DLP A;  1WDX A;  2MK5 A;  3QWX X;  2DFU A;  1K73 C;  3JRZ A;  3WVE B;  3JCM X;  1W2B P;  1M27 C;  4MML A;  4PFP A;  4KUD K;  1PKS A;  1WJQ A;  2C0T A;  2EQM A;  4PJO F;  1YJ9 Q;  5GAO n;  1GRI A;  5GAN 8;  4Z02 A;  2DAQ A;  1QVF P;  5I2M A;  1NPP A;  3H0F A;  1IRX A;  2HQH A;  1AD5 A;  3HFN A;  4AFQ C;  3FLG A;  2E3H A;  4IIO A;  3OBY A;  1SEM A;  1D3B A;  4BE0 A;  1W1F A;  5GAN d;  3CCJ T;  3VU3 C;  1YFN A;  3HPW A;  3CCM Q;  4C0Z A;  4NOY A;  2KI7 A;  1OQK A;  3ASK A;  3CCE Q;  3OYB A;  4KBM B;  1M90 C;  3L2U A;  2F5K A;  2CT4 A;  3BDL A;  1BI3 A;  2E70 A;  4HT8 A;  2K2V A;  3CBP A;  2CH4 A;  2DVE A;  1WIE A;  4PLL A;  4J9F A;  4M75 B;  3QDR B;  4FU6 A;  4A53 A;  1X69 A;  2DRM A;  5HK3 A;  4LDY A;  3M0R A;  3L42 A;  4BD3 A;  3TEE A;  4OP0 A;  1YJW T;  2O4X B;  2K3Y A;  3NFC A;  4EPC A;  2LJ0 A;  1KC8 R;  2MAM A;  2YLC A;  4M75 C;  2CH4 W;  1SRM A;  3M54 A;  1Q95 G;  4RTW A;  3LYI A;  1YHQ A;  4M7A D;  2G3R A;  3UAT A;  4QW2 A;  1M8M A;  1S72 Q;  3LH5 A;  4FT4 A;  3JCM J;  1RAI B;  2WSF E;  1M4Z A;  4PKC C;  4R56 A;  2KR3 A;  3EG9 B;  3O5Z A;  3OYJ A;  2DM1 A;  5CKE A;  2MF2 A;  3S3O A;  4WF2 A;  3CMA A;  1RUW A;  1AWJ A;  2HEQ A;  1UHC A;  1YI2 Q;  3VS6 A;  4DBH A;  2CDT A;  3OYA A;  2EYZ A;  2R5A A;  1HK9 A;  1OPL A;  3I55 Q;  1QVF S;  1VQO T;  1YJN T;  4J9D A;  2H3E B;  2L3P A;  3X24 B;  2JTM A;  1AZE A;  1QCN A;  2CS7 A;  2DZC A;  3VRY A;  3MEA A;  3JB9 J;  1R0C B;  3JB9 G;  5GAO l;  2K5F A;  1YHQ T;  1WXT A;  1UGS B;  2NUT A;  1ZLM A;  4A4E A;  2QTX A;  2EFI A;  4LUE A;  2RNA A;  3MP8 A;  3FDR A;  2ZPH B;  2YUN A;  5KYW B;  2DD5 A;  3TSW A;  4OMP A;  1VQN A;  5GMK m;  1K1Z A;  2JTE A;  2RJD A;  5CKB A;  2HNI A;  2RI3 A;  3CQT A;  3FIF A;  4M78 D;  1PCX A;  1U1T A;  2ROL A;  1VIF A;  3KBG A;  4JLG A;  3VYG A;  2X4J A;  9ATC B;  1WPY A;  4VUB A;  2O4X A;  4BI3 A;  2XD0 A;  3MHX A;  4WTO B;  4BB7 A;  1OPK A;  2LRQ A;  3C12 A;  5A2Q E;  4Z8A A;  2GBQ A;  1H3H A;  2PVD B;  3JAM E;  1PD0 A;  5FW9 A;  5J26 A;  2JT4 A;  1QQJ A;  5KYX B;  1ZUY A;  2VXE A;  3ZL7 C;  3CPW A;  3PGG A;  1QLY A;  3JCM g;  2KK4 A;  3OS5 A;  4QQ6 A;  4PJO G;  1PNJ A;  1JXM A;  2V1R A;  1M90 R;  5IXF A;  2MIO A;  2YWW A;  3OYC A;  1VOM A;  3A98 A;  1WNL A;  2RHY A;  2RJF A;  2ZPB B;  3HHT B;  3OSV A;  4Y91 A;  4M7A G;  2K5L A;  1VQ7 Q;  1S72 A;  3CC2 T;  3UWN A;  2EQJ A;  3OSS C;  4J9B A;  3QII A;  3BY7 A;  2OJ2 A;  1ZSG A;  3TSZ A;  1N6A A;  1UEC A;  1YP5 A;  1K73 R;  3S6W A;  1VQO Q;  5GJV B;  3OA6 A;  4ZN3 A;  3QZ5 B;  4KUL A;  2O88 A;  3EG3 A;  2YT6 A;  2AKL A;  5IHK A;  1IB8 A;  2QDY B;  5LJ5 g;  2KRM A;  5LJ3 j;  2GFU A;  4EDU A;  3CCU A;  1GL5 A;  1RAD B;  2QEX T;  5LJ5 j;  1QCF A;  2DXC A;  1VQ8 A;  2ZAE A;  1GFD A;  3RMQ A;  1G83 A;  1EZZ B;  1LCK A;  2PZ1 A;  3RBB B;  3JCM c;  3OYE A;  3JB9 D;  1MND A;  3C0C A;  2ZPI B;  3L2Q A;  4X9D A;  4C92 E;  1D0Z A;  1KD1 C;  1DJ7 B;  3L2Z A;  4ESR A;  4Q5W A;  2CT3 A;  4LE9 A;  4DBR A;  5DLO A;  2RI5 A;  3OYD A;  2RQT A;  2L3Q A;  1QP2 A;  3BE3 A;  3CCE A;  4BAC A;  4BDZ A;  1YN8 A;  3RKX A;  3LW5 E;  4L59 A;  4HT9 A;  2LT1 A;  3DB4 A;  3QKJ A;  4C5I A;  5GAN f;  5J3B A;  1VQM A;  1VQ5 T;  3CPF A;  2JXB A;  3I35 A;  4YTL A;  3MEV A;  3LWI A;  2DD4 A;  3ZBD A;  5GAN 6;  5I21 A;  1TUD A;  3VRZ A;  5LJ5 f;  1JJ2 S;  3MP6 A;  1ZBJ A;  2XDB A;  1TWB A;  3CCR T;  4IUQ A;  3LX7 A;  1TH7 A;  4OGC A;  4EMG A;  3S3N A;  5LJ3 g;  3JCM W;  2LDM A;  2J6F A;  3I56 Q;  1Y71 A;  3GLX A;  5IT9 E;  4QT7 A;  2DET A;  1Y96 B;  4RKU E;  2DXU A;  1KG1 A;  1RAH B;  2D8J A;  1YNZ A;  1YIJ A;  2V26 A;  2CP5 A;  3VS3 A;  4KGX B;  1ZQ1 A;  3OYF A;  4M77 C;  4MZT A;  4J9H A;  3I9Q A;  3M53 A;  3GBQ A;  5CKF A;  4PFO A;  1MMG A;  4PJO C;  4RTX A;  3I56 A;  4OMN A;  3V8J A;  4AG2 C;  2VGN A;  2VC8 A;  2RB6 A;  4C0D C;  3HRU A;  1N9S A;  1IHV A;  4GLM A;  2DL3 A;  3X28 B;  1BI0 A;  3RES A;  1WA7 A;  3OS1 A;  1KQ1 A;  2LQN A;  1UGQ B;  3E19 A;  5LJ3 d;  2F5T X;  3ER0 A;  4M78 F;  2VKN A;  4C0G A;  3NTI A;  4D6W A;  2DL4 A;  5GJW B;  1H64 1;  3G7Z A;  5CKH A;  4AG1 C;  3G4S Q;  1MGQ A;  4WCI A;  1YJW Q;  2E1H A;  2P0K A;  1AVZ C;  1VQ6 T;  1ZA2 B;  4A4K A;  3M9Q A;  2QQS A;  1K4U S;  2EQI A;  2DXB A;  3JB9 F;  4BI8 B;  3UA7 A;  3VS7 A;  1IO6 A;  2DIQ A;  5FU7 B;  2ESW A;  4C92 A;  3TU4 K;  1LVK A;  3NPF A;  3P8B B;  2G6F X;  4M78 G;  3VS4 A;  5CQY A;  2OX7 A;  5FWC A;  4II1 A;  5AT1 B;  4JLI A;  2VUB A;  3Q1J A;  4F7U A;  2CP6 A;  2EKH A;  1M30 A;  2ZPG B;  2XKO C;  4F04 B;  1GCQ A;  4HCZ A;  3JCM e;  2LX9 A;  2WAC A;  4JDS A;  1XNI A;  2DF6 A;  5FLX E;  2GCX A;  2RF0 A;  1G2B A;  3MEU A;  3G6E Q;  4EMK C;  3KUF A;  5LJ5 e;  3PVQ A;  3CCU Q;  2LT4 A;  1YIJ Q;  4J6Y A;  4DEX A;  3D7S B;  1A0N B;  4M77 E;  1KSW A;  2DZ9 A;  1RLP C;  3VJP A;  5KCO A;  2HAX A;  1ZUK A;  2AIR B;  1WHH A;  2K5I A;  2MMP A;  1BB9 A;  2YRC A;  2KYB A;  3UT1 A;  2RQR A;  4RG8 A;  2RN8 A;  1VQP T;  4M7A A;  4IUT A;  2E5K A;  2LNH B;  2QYZ A;  2Y90 A;  3L1A A;  1R0B G;  3A8O B;  2KXD A;  3UF4 A;  3RKY A;  1QVG S;  2RH2 A;  4JJN K;  1VQM Q;  2E41 A;  2F2V A;  1CSK A;  2AHJ B;  4A63 B;  2EW3 A;  2FYK A;  2CP3 A;  3OYK A;  1NE8 A;  3V7R A;  1YIT T;  4O5V A;  2MI6 A;  1UJ0 A;  2L5Q A;  1W70 A;  1B3Q A;  1V29 B;  4KRT A;  2CKK A;  3CCS T;  4OB0 B;  4R0K A;  5D7U A;  1X2K A;  2O9S A;  1H92 A;  4TVR A;  1VQN Q;  2L0A A;  4M7D F;  4NL3 A;  2OAW A;  1FWZ A;  3QDF A;  1X43 A;  2EIF A;  2GTJ A;  5GAO p;  1M3A A;  1Q7Y C;  2HBP A;  1JO8 A;  1JJ2 P;  2BIV A;  4IUV A;  1C0M A;  3T9N A;  2IVW A;  2X3X D;  4F7U F;  4DOV A;  2HSE B;  4OMM A; 
#chains in the Genus database with same CATH homology
 3I5S A;  1WX6 A;  1OV3 A;  2KR3 A;  2J7I A;  2J6K A;  3O5Z A;  2DM1 A;  2KXC A;  3H0H A;  5I22 A;  4K11 A;  3VS0 A;  1UTI A;  1NEB A;  1AOJ A;  2M51 A;  2JMA A;  4RTV A;  1RUW A;  1X6G A;  2DNU A;  1SHG A;  2KRO A;  1AWJ A;  1HD3 A;  2HEQ A;  1UHC A;  2DE0 X;  5I11 A;  3VS6 A;  2CDT A;  2CUD A;  1NLP C;  2EYZ A;  1OPL A;  2K7A A;  1PWT A;  1T3L A;  2DRK A;  1OEB A;  4J9D A;  2EYY A;  2L3P A;  1AZE A;  1GBR A;  1KFZ A;  2EGE A;  4JPB W;  1K0X A;  2KT1 A;  3VRY A;  1PHT A;  3U23 A;  4J9E A;  1WXT A;  2J06 A;  1ZLM A;  2BZ8 A;  1NEG A;  2LQW A;  1GCQ C;  4LUE A;  2RNA A;  2YUN A;  1XOV A;  2JS0 A;  2RPN A;  3JV3 A;  3TSW A;  4OMP A;  1RLQ C;  5FWB A;  1K1Z A;  4X1V A;  1SSH A;  2JTE A;  3PE0 A;  4JZ3 A;  4ORZ A;  2DBM A;  3CQT A;  3NHN A;  4RTT A;  2ROL A;  1T3S A;  2HSP A;  3IQL A;  3THK A;  1M3B A;  1JXO A;  4J9G A;  2A36 A;  3UA6 A;  4HVW A;  4RUG A;  1K0S A;  1WYX A;  1SHF A;  1Z9Q A;  2KE9 A;  1OPK A;  3H41 A;  4Z8A A;  2GBQ A;  1H3H A;  5FW9 A;  4Z88 A;  2JT4 A;  2K2M A;  1ZUY A;  3ZL7 C;  1ABO A;  2F2W A;  1QLY A;  1PNJ A;  1JXM A;  2V1R A;  3EG0 A;  4DEY A;  1FMK A;  2DX1 A;  5IXF A;  2MIO A;  3A98 A;  3R6N A;  4HVV A;  1OOT A;  4ZNX A;  1V1C A;  3FJ5 A;  1BU1 A;  5IHI A;  1GCP A;  3QWY A;  1K9A A;  2JMC A;  3EGU A;  1NG2 A;  4GBQ A;  4J9B A;  1QKX A;  2A08 A;  3KFV A;  2EVR A;  2OJ2 A;  4JJC A;  4JJD A;  1ZSG A;  1X27 A;  2DYB A;  3TSZ A;  1UEC A;  1YP5 A;  2I0N A;  1ZUU A;  5GJV B;  5IH2 A;  4IIM A;  4RTY A;  1JEG A;  4F17 A;  1N5Z A;  2LMJ A;  4J9I A;  4E6R A;  4OMQ A;  3ULR B;  2O88 A;  1SPK A;  3EG3 A;  2YT6 A;  2W0Z A;  2AKL A;  2KT8 A;  5IHK A;  2X3W D;  2KRM A;  2FRW A;  1E7O A;  2P4R A;  3NGP A;  2OI3 A;  2LCS A;  1GL5 A;  1GFC A;  3EHQ A;  1HJD A;  1QWE A;  1QCF A;  5ECA A;  1WFW A;  4Z89 A;  1GFD A;  2KEA A;  2YDL A;  2LP5 A;  2CSQ A;  1G83 A;  4F14 A;  1LCK A;  2PZ1 A;  1YWO A;  2DVJ A;  3H0I A;  3SEM A;  3RBB B;  2D0N A;  3PVL A;  1T0H A;  1B07 A;  1JU5 C;  3C0C A;  1PRL C;  2K9G A;  1GBQ A;  1AWX A;  2YUQ A;  1UDL A;  2H8H A;  1VA7 A;  3VS5 A;  4JJB A;  2AZV A;  4ESR A;  1FYN A;  3EHR A;  2CT3 A;  1T0J A;  4LE9 A;  2RQT A;  2DJQ A;  2FPE A;  2K79 A;  2L3Q A;  3VS2 A;  1YN8 A;  1I07 A;  2EPD A;  4JZ4 A;  3VS1 A;  2KBT A;  4RTU A;  1UUE A;  2DBK A;  2AKK A;  2PTK A;  1AEY A;  3I35 A;  2JXB A;  4RTZ A;  3EG1 A;  1CKA A;  3EG2 A;  4HXJ A;  4F16 A;  1TUD A;  2YUP A;  3VRZ A;  1X6B A;  3SHW A;  2KRS A;  1ZBJ A;  3M0P A;  2FG0 A;  4LUD A;  2FPD A;  2AK5 A;  2A37 A;  2W10 A;  2EYW A;  1X2Q A;  2GTO A;  2M0Y A;  4LN2 A;  1U06 A;  2J6F A;  4QT7 A;  1S1N A;  2YUO A;  2EGA A;  2BZX A;  1JQQ A;  1H8K A;  2D8J A;  1YNZ A;  1NYG A;  1TUC A;  1UFF A;  5IXB A;  1MUZ A;  2LJ1 A;  3VS3 A;  1ZX6 A;  2QDL A;  1NYF A;  2NWM A;  2CUB A;  2FRY A;  4J9H A;  3I9Q A;  3GBQ A;  4AFZ C;  4RTX A;  2F2X A;  4OMN A;  4D8D A;  2JW4 A;  4M4Z A;  2ROT A;  4AG2 C;  5L23 A;  1WXB A;  2SEM A;  1I1J A;  2LZ6 B;  4GLM A;  1NM7 A;  2DL3 A;  1VYU A;  1U3O A;  1QKW A;  4D8K A;  1VYT A;  2RQW A;  2VVK A;  3REB B;  1WA7 A;  2DIL A;  2LQN A;  2VKN A;  2ED0 A;  2GGR A;  1MV0 B;  2DL4 A;  5GJW B;  2RMO A;  1RI9 A;  1BBZ A;  2RQV A;  1J3T A;  2ENM A;  1KIK A;  4AG1 C;  3TVT A;  1UJY A;  2KNB B;  4WCI A;  2L3S A;  2J05 A;  4AFU C;  4J9C A;  1AVZ C;  2C0I A;  2O31 A;  1UGV A;  2K6D A;  2O2O A;  3M0U A;  2DL7 A;  2EYX A;  3NMZ C;  1K4U S;  2EQI A;  2YSQ A;  1NLO C;  1WLP B;  1PRM C;  2DA9 A;  2O9V A;  1BK2 A;  2PNI A;  3UA7 A;  1UE9 A;  2V1Q A;  3VS7 A;  1MV3 A;  3M0T A;  1IO6 A;  2LX7 A;  2ESW A;  2EBP A;  3M0S A;  1EFN A;  2K3B A;  2L2P A;  4CC4 B;  2MCN A;  3NPF A;  2G6F X;  2FEI A;  3VS4 A;  2KYM A;  2SRC A;  5IHN A;  2CRE A;  1TG0 A;  5FWC A;  1SRL A;  4EIK A;  4CC3 A;  2D1X A;  1PKT A;  2CSI A;  2EKH A;  2ED1 A;  1M30 A;  1GCQ A;  2A28 A;  4HVU A;  2BTT A;  2DF6 A;  2ABL A;  2RF0 A;  1G2B A;  3M0Q A;  2C0O A;  4AFS C;  3PVQ A;  1WI7 A;  1Y0M A;  4HCK A;  1I0C A;  1UG1 A;  4DEX A;  1YWP A;  1WXU A;  2HBW A;  1A0N B;  2DLP A;  1WDX A;  2RQU A;  1KSW A;  1E6G A;  1RLP C;  3QWX X;  1YCS B;  5EC7 A;  4CC7 A;  1ZUK A;  3RNJ A;  4OML A;  2ECZ A;  1BB9 A;  2HCK A;  1AWW A;  2KYB A;  2JM8 A;  1M27 C;  2RQR A;  4FSS A;  1PKS A;  2RN8 A;  2FPF A;  2C0T A;  2DL8 A;  2KGT A;  1GRI A;  2E5K A;  2MOX A;  2LNH B;  3H0F A;  1AD5 A;  4AFQ C;  5HCK A;  2JS2 A;  2KXD A;  4IIO A;  3UF4 A;  1M3C A;  1Z9Z A;  1ARK A;  1SEM A;  2D8H A;  1U5S A;  4LNP A;  1W1F A;  2JM9 A;  2FO0 A;  2KRN A;  2F2V A;  1CSK A;  4A63 B;  2EW3 A;  2IIM A;  1HSQ A;  1AZG B;  4Y92 A;  1UHF A;  1UJ0 A;  2CT4 A;  3I5R A;  1W70 A;  1B3Q A;  2B86 A;  2BZY A;  4KRT A;  4R0K A;  1X2K A;  2O9S A;  2J6O A;  1H92 A;  1Y57 A;  2DL5 A;  2HDA A;  2CH4 A;  1WIE A;  2NUZ A;  4J9F A;  1AWO A;  2L0A A;  1X69 A;  2DRM A;  2OAW A;  1VYV A;  1X43 A;  1ABQ A;  1CKB A;  2GNC A;  3M0R A;  2AZS A;  2GTJ A;  2DMO A;  1M3A A;  2EGC A;  1KJW A;  2GQI A;  2LJ0 A;  2VWF A;  1JO8 A;  2XMF A;  2CH4 W;  1SRM A;  1K76 A;  4OMO A;  1E6H A;  4RTW A;  3REA B;  4CC2 A;  3UAT A;  2X3X D;  1QWF A;  4OMM A;  1M8M A;  3LH5 A;  2LJ3 A;  1W6X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...