4GY5A

Crystal structure of the tandem tudor domain and plant homeodomain of uhrf1 with histone h3k9me3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
215
Chain Sequence
b'FLYKVNEYVDARDTNMGAWFEAQVVRVTRKEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 215
sequence length 232
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A01
2.30.30.1150 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A02
2RI3A 4PLLA 3OYKA 3NTHA 1WJSA 3LYIA 2EQKA 2L8DA 3C4SA 3FDRA 3KUFA 2LCCA 2RO0A 3PNWC 4N4HA 4QW2A 3S6WA 3L2VA 2RHXA 3EAEA 4N4IA 2LDMA 4UC4A 2F5KA 5D6WA 4E7LA 3MEVA 2MWOA 5KE2A 3OB9A 3H8ZA 3OMGA 4ZTFA 4HCZA 3NTKA 2HQXA 3FC3A 4QQ6A 3OY9A 1WGSA 3ASKA 2RI5A 4A4FA 2EQJA 4FU6A 2R5AA 3OYLA 2O4XB 1OYXA 4IUUA 2QQRA 3L2WA 2M1HA 3DB4A 2L3RA 3MEWA 3M9QA 3QKJA 2M16A 1OI1A 3MP1A 1WJQA 2DIGA 3PMIA 5CIUA 3H6ZA 5C6SA 4FL6A 3OYBA 3UT1A 2K3YA 4IUTA 4X34A 4C5EA 5KE3A 4Z02A 5FRMA 3OYDA 2EQMA 3LGFA 2G3RA 2XK0A 3MEUA 3OS0A 3OQ5A 2E5QA 3DLMA 2DIQA 4E7IA 2EKOA 1H3ZA 4RG2A 3S3NA 2GFUA 2RJCA 2IG0A 4L59A 5D6XA 1WJRA 3QBYA 3NTIA 2EFIA 2GF7A 2LVMA 2L89A 2MWPA 2QQSA 2WACA 3OS1A 3BDLA 3OYHA 4BE2A 3OYGA 3CEYA 2B8AA 2NLUA 2XDPA 3QIIA 2O4XA 4IUQA 3OYAA 1G5VA 2FHDA 4E7HA 4E7JA 3PFSA 3OYNA 5D6YA 3FLGA 2BKDN 2BUDA 4BE1A 2RHZA 1OZ3A 1OZ2A 3Q1JA 5J26A 4BDZA 4QQDA 5M9OA 4PL6A 5FRNA 3FEOA 3L2RA 2CKKA 3L42A 4C5HA 2RHYA 2LRQA 5KH6A 4IURA 3LH0A 3OMCA 3OA6A 2R57A 4GY5A 3GOXA 2K3XA 4N4GA 4B9XA 4OVAA 1RI0A 2RHIA 3QJ6A 4A4HA 4IUPA 3F70A 2RJEA 3MP8A 4BD3A 3S3MA 4NS5A 2EQUA 2JTFA 2RHUA 2M0OA 2RI2A 5IAYA 3ME9A 3OYJA 4EDUA 3P8HA 2HQEA 4IKFA 4E7KA 2X35A 3UWNA 3P8DA 3MP6A 2X4XA 2R58A 2VYTA 2LTOA 2JZ2A 5FROA 3OYEA 3META 3OS2A 3E9FA 5IN1A 2X4WA 4II1A 2RJFA 3SD4A 2YRVA 4CRIA 1N27A 2R5MA 2PQWA 2RJDA 3L2UA 2P0KA 3MO8A 3OYCA 2DAQA 3O8VA 4ZTJA 4QVZA 3ZEHA 1KHCA 3LGLA 4A4GA 4BE0A 4B9WA 3E9GA 4PLIA 4Q5WA 4C5GA 4QQGA 3OYFA 4A4EA 5J39A 3MEAA 3DB3A 2X4YA 4IUVA 3L2QA 3OYIA 2BIVA 3LX7A 1MHNA 2GFAA 3S3OA 1XNIA 4C5IA 5KCHA 2E6NA 3PMTA 5C0MA 2D9TA 4LD6A 3LLRA 5KCOA 4BACA 3OYMA 4BDYA 1SSFA
chains in the Genus database with same CATH superfamily
1QCOA 4D8DA 1IXDA 4VUBA 2LDMA 2P0PA 2ATCB 2KEAA 3NTKA 1PKSA 1MNEA 4QQ6A 4XU0A 1H92A 2JOYA 5A0DA 2DPPB 2OAWA 1D3BA 3M9QA 2GGRA 4X9DA 3C94A 2DZ9A 3KBGA 4FL6A 2RK2A 4JS5A 2KROA 3LGFA 3KXTA 4CC4B 3OS0A 2ZZDA 5CK9A 4PNOA 1QCFA 2DNUA 3QG1A 4Z88A 4M7DC 3CBMA 2QEXA 1Y7XA 3QBYA 2EFIA 1ZBXA 4RTWA 1W6XA 2Z0WA 2DL3A 2LJ3A 4OB3B 4BE1A 2KMTA 3PGGA 1VQ8A 3PIOA 2NUPA 3FEOA 5FU6B 4PJOG 5GAN5 2L3SA 4M75E 1E6HA 1LCKA 4EMKB 1NG2A 1JBMA 3CCMQ 3CCJQ 1M1FA 2K3XA 4PJOB 1VQNQ 3CPFA 1RADB 2EWNA 3TVTA 2FO0A 2EQUA 4PJJA 1Y0MA 4OGCA 3UPUA 4M77E 2LMJA 2HNIA 3RKWA 4C92D 1WHLA 2VYTA 1UECA 1SPKA 2JMAA 2LQWA 4AFZC 2IPOB 1OOTA 1GBQA 5LJ3d 4J9BA 4OMNA 4DA4A 2JM8A 4C5GA 4J9FA 2L3QA 3RESA 1TOVA 2BZ8A 3J80E 4IUVA 3REBB 3GIBA 3PE0A 5FU7B 4C8QF 1MMAA 2DK3A 1Q82C 4DBRA 2DM1A 1OX9A 1YWOA 4M78F 3LYIA 1QP3A 3KUFA 3MJXA 3S6WA 5GAOr 1M1KU 4BI3A 4N4IA 5KYYB 2LQKA 3GPLA 1NYFA 5DLOA 1UE9A 1NZ9A 4RUGA 1SHFA 4KH0B 2ENMA 4M75C 2EYXA 3HFNA 1B34B 1H641 2RF0A 5KYWA 3CCVQ 4C5EA 1X2QA 3CCRQ 1Q7YC 1I5LA 1YJ9T 4OB0B 1QVFP 4JZ3A 1C0MA 3CPWA 4F16A 5GANe 5GMKe 4OMMA 1EFNA 1Q82R 2ECZA 4E7ZA 2B8AA 4BB7A 4ESRA 1JJ2A 4FM4B 4PJOE 4YTLA 3OSSC 4OGEA 2CREA 2C0TA 3EGXA 1MV0B 4M7DF 1K9AA 3OA6A 1SRMA 3NFCA 3RIRA 1VQOA 3VUBA 4B9XA 2DERA 4JJNK 2CYZB 3A8LB 1OPKA 3I55A 1K9MC 2ZPIB 2ABLA 2DTHA 1Q7YR 2CH4W 5CQYA 3OYJA 1JXMA 2WSFE 1RABB 4M7AA 2VGNA 2PUOB 2HBWA 4BE0A 3I9QA 3JCMV 1R77A 2ZGWA 1AWJA 2JMCA 3EG9A 3E1SA 3PMTA 5J3BA 5C0MA 4ME7A 3CCST 2HSPA 4EMKC 4C0GA 4BACA 2E1HA 5DLQE 1OV3A 1X75C 3PNWC 4KRTA 1WNLA 4QW2A 4TVRA 1RACB 2BZYA 5IXBA 1K9MR 3CCEA 1PSEA 4FSSA 1WGSA 1YFNA 4PFZA 1YITA 1G3SA 4OMLA 3S3OA 2BTTA 1VQPQ 5CQXA 1HYOA 1RL2A 3SHWA 3CC7Q 2OTJA 2YUOA 2DEUA 1BBZA 4C0DC 3OW2A 4XTUA 2EQIA 3OS1A 3HRUA 1F1BB 1PC0A 2F2XA 3FJPA 1K8AU 2KXDA 3CC4Q 1M4ZA 5L8RE 5GAN8 5FRNA 2QEXT 3L2RA 2XI9A 1VQMT 2KSSA 3M4GA 5GAN6 3RNJA 1UUEA 1HK9A 1YCSB 1KC8U 3JCMP 1K0SA 3G71T 5LJ3f 3SEMA 2QAZA 1OU8A 3VRYA 1G2BA 2RJDA 3JCMb 3JV3A 2PZ1A 3MO8A 2DAQA 1V1CA 2CS7A 4B9WA 1VQ7T 3EGDB 1K73U 4QQGA 1Q81U 2JTMA 3EFRA 5LJ3e 3L2QA 4DEYA 4LDXA 1XNIA 2L0AA 4LD6A 1HSQA 1SF9A 4HCKA 2J6OA 4CC2A 1ABQA 4JJCA 4JRKA 3IQLA 4FSXA 5GAMf 1BIBA 2KQWA 2JNGA 4PFOA 4J7FA 4A54A 1S72T 2CP2A 2LQ8A 4FU6A 2R5AA 3QYHB 2DJZA 2RQTA 1WXUA 2QA4T 1YHQQ 3CC7T 3C0CA 5KYUA 5GAMe 2CSQA 2CP3A 1VQ4Q 1RAIB 1WXBA 1XQHA 2G3RA 2RH2A 3H41A 3EGUA 3LWIA 2XD0A 2LZ6B 4D6WA 1LJOA 3I5RA 1G3YA 1QVFS 1Y07A 2VV5A 3CC4T 3M57A 2HQHA 1WQ7A 1VQ9Q 1LPLA 1IB8A 4QVDA 3OYNA 3JCMW 2EYZA 4M7AF 2K5FA 2O9VA 2RHZA 2C06A 1OZ2A 2RQWA 4PL6A 3V7RA 2QGGA 2OTLQ 2DVEA 2L3PA 1QKWA 1JQQA 4HVWA 3S3MA 5I2SA 4QKUA 3E2UA 4JPBW 2RNAA 1U1TA 3ZBDA 3OYEA 2LT4A 3SD4A 5AYFA 4HT8A 3CD6Q 1RI9A 2VVKA 1PRLC 1OEBA 2QDLA 1U8RA 1DJ7B 3I55T 1X43A 1EZZB 2HBPA 1VQ5T 1VQKA 2FZCB 1PWTA 1X01A 2XDBA 1TUCA 3RUXA 5GMKm 4LUEA 1SSFA 1K8AC 4ZNXA 1YN8A 3OYYA 1E6GA 1S1NA 4KH1B 3MEVA 2A28A 1VUBA 4C8QD 3OY9A 1FYNA 4HCCA 2DO3A 3L2WA 2KK4A 3X26B 4M78D 3CCQQ 4Z8AA 3GBQA 1YCYA 3JSCA 4FYYB 2MIOA 1CKAA 2J05A 2NYSA 4HCBA 5HY6A 2D0QB 3HFOA 4KGZB 2NUTB 3CCET 2IG0A 2HKQB 1YJ9A 2WSCE 3QWXX 1YITT 4XTYA 3JCMc 2O4XA 2SEMA 2FHDA 1K8AR 2XG8D 1K73C 2CUDA 2BKDN 2J06A 3GNGA 1PSFA 1YWPA 3JRZA 2JXBA 2AZSA 2CH4A 4C8QA 1D09B 3CCMA 1UGVA 1P92A 1QVPA 2DL8A 3L42A 1VQNA 2X3XD 3GLXA 3ZFJA 1TTHB 2RHIA 3QHSA 1NJIU 2X9HA 4DBHA 5LJ3g 3NGPA 3HRSA 2A36A 2LC4A 4EDUA 4IKFA 3L2ZA 1N5ZA 1V76A 4MMLA 4M7DD 2KAFA 2V26A 4ANJA 1JRIA 1M2VB 1N27A 2DF6A 4DOVA 4HXJA 3A8MB 1YIJT 1QVFA 2EIFA 1OULA 2FZKB 1TU0B 1N6AA 4DOWA 2LT1A 3TQ7P 3CBOA 5GAMg 3LLRA 3A1PA 5KCOA 2F2WA 3OBWA 3CCSA 3C4SA 3EAEA 3NMZC 5HKCA 4NL2A 4OP0A 4ZGDB 4M77G 2XU8A 1ZUUA 2RB6A 1GCQC 2SRCA 2DE0X 3CCRA 2O88A 1BI0A 3TREA 2K2VA 4XU2A 2AK5A 2CDTA 5A0GA 1TUGB 1NPRA 3PIPA 3DLMA 4FYWB 2QK0A 4KGVB 2QDYB 3NTIA 2D8HA 4FW1A 1AZEA 2O9SA 4B6MA 1Y96B 3OYAA 3JCMh 4BUGA 1B3QA 3PFSA 1KQSP 2YLCA 3H0IA 2CT3A 5FLXE 1IHWA 5GJWB 3VV0A 1KG1A 5IHNA 1RUWA 4J9EA 2LRQA 2M02A 1QLYA 3LH0A 4M75D 5HCKA 4GY5A 4N0AC 1VQLQ 2E70A 3QJ6A 2E10A 4XTVA 1U5SA 1VQMA 2RJEA 4AFQC 4BD3A 4C92B 2RHUA 1ABOA 1YI2Q 1M8VA 4PFPA 3UATA 1PM3A 2R58A 2RK1A 1QMCA 1TS9A 2KRMA 1M90C 1I4K1 2AIRB 1K4US 3G71A 3CMET 1KSWA 2DL4A 4XAXB 1AEYA 4JZ4A 7AT1B 1PHTA 5GAN3 3G4ST 3LGLA 3E9GA 5GAN2 1GL5A 3I56Q 1QVGP 1VQ7A 4L6V5 1X69A 4XTZA 2BIVA 3LX7A 1MHNA 3CC2T 2DX1A 1D1BA 2VXFA 4GLMA 2DL7A 5DY9A 2AT1B 2LJ0A 3L2VA 4M75A 3WXMB 2ED1A 3OW2S 2HMAA 1WHGA 4ZTFA 2X4JA 1AWOA 4F7UG 1UHFA 2KRNA 1GXIE 2KVQG 3SWNB 2D0NA 4E7SA 1VQKT 3JB9H 2K79A 1KD1C 5FW9A 1WZOA 1MUZA 4KUDK 1M90R 1S72A 3VKIA 3MP1A 1PD1A 3BY7A 4M77A 4F7UB 4BI8B 4MZPA 2QA4A 4JDSA 3CC7A 1TSFA 1K0XA 2M9UA 2VC8A 4EMHA 1N8RU 4QVCA 2KY9A 3VS2A 2W10A 3JCMg 5D6XA 3VUZA 5IHKA 5EG2A 2COWA 4R55A 3FJ5A 2JUFA 2XMFA 1WA7A 3CC4A 5DM7R 2VKNA 4C92E 2VASA 5GANf 1Z9ZA 2E64A 3V7SA 5CAIA 3PVLA 4C0FA 5GAOn 2A08A 1QQJA 1KD1R 3FB9A 2L2PA 4IURA 4M77C 1ZSZB 2LQNA 1X6GA 2F5TX 4LNPA 4M7AD 4A4HA 4X9CA 2HL3A 2E5KA 4V2SA 1M3CA 2RQVA 1SG5A 5IH2A 3M0QA 5L23A 1NPPA 5LJ5d 5FROA 3CCMT 2B86A 3CCJT 2V8JA 2FRWA 2X4WA 4CRIA 3BE3A 1VQNT 3LWHA 2OJ2A 2FB7A 5GJVB 4EMKA 4PJOA 1RLQC 2QGFB 5GMKj 4CI0C 4F7UE 3EG1A 1VQ5A 2KXCA 3NPFA 4GBQA 2RI3A 5IHIA 3NTHA 1NLOC 4RKUE 2DFUA 2GBQA 2MWOA 4XU1A 5CVIA 3QDRB 1V29B 3H8ZA 3MPUB 2NUZA 1FWZA 2KBTA 2NWMA 4ATOA 2ZCFB 2ZAEA 3OYLA 2RA2A 3MCAB 5EC7A 5FU6C 1R8OB 2HKNA 4DBQA 4ELYC 3PTAA 2YSQA 2XK0A 3OQ5A 1A0NB 4PJOC 3QPHA 1VQ6Q 1T0JA 2CZ7B 8AT1B 1VQ8Q 5KYYA 1WHKA 2PTKA 4R56A 4NL3A 1VQ9A 2AHJB 2LVMA 3CCVT 3J81E 2MWPA 1RAFB 4ELZC 2VB6A 3QIIA 1MMDA 2DRKA 5GMKl 3CCRT 1U1SA 5GMKh 1Z9QA 3EFOB 1B34A 1VIFA 4LXCA 4HA8A 2OTLA 3X25B 2EAYA 2COYA 4DEXA 1WX6A 5GAOm 1KK7A 5FWBA 1U3OA 3SDZA 4JRQA 5FU7C 2DL5A 2JTEA 1FXXA 5FWCA 2ESWA 2E3HA 2RI2A 5KYUB 3HSBA 1PG5B 4M75F 1NE8A 1D1CA 2DD5A 3CD6A 4AG1C 1H8KA 2V8IA 4II1A 1GBRA 3CBPA 3JB9G 2MYSA 1YJNQ 2D8JA 1N8RC 1ZQ1A 1M1KC 4M77F 3FRNA 3G1JA 4Q5WA 4R0KA 1VYUA 2LNVA 1YIJA 4OMFB 1QVGS 5CKHA 2FL7A 4LD9K 2K5IA 1GFDA 1HD3A 2GTJA 1QW1A 2C0IA 1BCOA 3CXCP 4BI4A 3AHUA 3CCUQ 1SHGA 4BE2A 4J9GA 2KYMA 2RO0A 1AZGB 2ZPBB 4UC4A 5D6WA 2QI2A 4JRIA 4O5VA 2O01E 3RDVA 1M1GA 2KNBB 3CCQA 4K11A 3OBYA 2RQRA 2XKOC 2Y90A 3DB4A 3MEWA 4P5NA 1OI1A 4FT4A 3HL8A 3H6ZA 1ZLMA 1G8XA 1N8RR 4RMOA 1WQWA 1M1KR 3TU4K 3G6EQ 1D1AA 1LVKA 3M54A 1Q86U 2IVWA 4XQ3A 5GANg 1VQPT 2FZGB 2QQSA 3OYHA 3UA6A 2EYQA 4LDUA 5LL6S 3VS0A 2DD4A 1VQOQ 1VOMA 1MNDA 1M3AA 5D6YA 3N5BB 1QWEA 1PNJA 2BUDA 1NLPC 3HRTA 5LJ3j 1QP2A 4E47A 2KGTA 1UJYA 1KJWA 2A0FB 4M4ZA 4PJOF 2P0QA 3HKSA 1NEBA 2CKKA 3CMAQ 2CP5A 3DLLA 4AFSC 2R57A 5KYXB 3E19A 1N9RA 2LP5A 2XHCA 4J9DA 3DKMA 2CUBA 1VA7A 4NS5A 5LJ5f 2M0OA 4AMCA 1IREB 2GCXA 1YJNT 2E6ZA 4J83A 4E7KA 1UFFA 2X4XA 4MZMA 3OS2A 2K2MA 5GAMj 5GAOp 3VS3A 1W4SA 4HKEA 2OI3A 1AD5A 4F17A 2JN0A 2MMPA 3CMEA 1MMGA 5LJ5e 5GMKi 2O2OA 1IGUA 1M8MA 4KUIA 3JB9J 2QXFA 1BYMA 2DETA 3G4SA 2DVJA 2GFAA 1MV3A 5KCHA 1WPYA 2LX7A 1O9SA 4BDYA 1WFWA 1I81A 4OMPA 4X1VA 3CC2A 5LJ3h 4RTUA 3VRZA 2AKKA 2EQKA 2L8DA 4C8QB 5CR2A 1KQSA 4N4HA 1LNXA 2RHXA 1ZA2B 1PCXA 4LDYA 2QYZA 2YUPA 1IO6A 4M78B 2DRMA 4WTOB 2DYIA 2OTJQ 1KIKA 1IRXA 3EGDA 4F04B 1SEMA 2DXBA 3WVDB 1RAGB 1D0YA 2K3YA 4FW2A 2PU9B 4MZTA 1Y57A 5FRMA 8ATCB 1AHJB 1AWXA 2FG0A 2P4TA 4ZN3A 2DTIA 5GAMh 1YJWQ 4FYXB 2KDSA 1LOJA 4L59A 1WJRA 3M0UA 1AOJA 1YHQT 2L89A 4C0ZA 2J6KA 1VQ4T 3M58A 3CQTA 4XTXA 2HD0A 2MPXC 1M27C 4E2FB 3A8OB 3FLGA 1QVGA 3MKDA 2K4YA 1WHHA 5ECAA 1K76A 4BDZA 2QQAA 3VS4A 1NBEB 4AFUC 1WXTA 4RTTA 1KC8C 4GLKA 1VQ9T 4C5HA 3VS5A 1NEGA 1CKBA 3EHRA 4RTYA 3HHTB 1QWFA 2F1LA 4M7DB 3SFMA 1UEBA 2RPNA 5HK0A 2OTLT 1Q81C 3VJPA 4J9IA 1H3HA 1BI2A 3V7CA 4E6RA 2YRVA 4C8QE 2R5MA 2H8HA 2PQWA 2VGMA 3CCJA 3THKA 3I56A 2FPFA 2JS2A 2KT1A 1KHCA 3LH5A 4M78E 5J39A 1BI1A 1Q86C 1D3BB 1UGPB 3CD6T 1KC8R 2XDDA 2Y4XA 3ZL7C 4WCIA 1ACMB 3CXCS 3RR6A 4E7LA 1GCQA 2DA9A 2FYKA 5I22A 3LW5E 4JJBA 1K73R 3VS1A 3M4YA 1Q82U 1UJ0A 1Q81R 1AVZC 2EPDA 2YDLA 1XOVA 4LE9A 6AT1B 3BFMA 2L3RA 3QKJA 2M16A 1W2BP 3L1AA 3R6NA 1QKXA 3QUIA 2YWWA 2FEIA 4J9CA 2NUPB 4E7IA 1Q86R 4AG2C 4EPCA 1O75A 4HVUA 3S3NA 4LDWA 3CCQT 1GFCA 2WACA 2GQIA 2GQVA 1VYVA 3JCMX 2DJQA 2E3IA 3CCVA 4M7DE 2EJGA 1K1ZA 1Q7YU 1TG0A 4N0AA 1YBYA 2FPEA 3HTRA 4JS4A 3Q1JA 5J26A 1IGQA 4RTXA 5M9OA 2I0NA 2PVDB 1JEGA 1TWBA 2RHYA 2ZPHB 2NUTA 5KH6A 3J7AF 5AT1B 3EFSA 2H3JA 2G6FX 4NOYA 1BKBA 1JO8A 4FT2A 4PKCC 1M9SA 4D8KA 3ME9A 1Y71A 3UWNA 2MOXA 3MP6A 5IXFA 2LTOA 2P4RA 2RJFA 2JW4A 3EG3A 2K9GA 3TCJA 3L2UA 2OX7A 4C92G 4J6YA 3CCLQ 1K9MU 4JUVA 3UDCA 1M3BA 4A4EA 1ZBJA 3M0RA 3VS6A 3MEAA 1UTIA 2BE7D 4LUDA 3QXEB 2DBMA 4PK4A 2MI6A 5KYWB 2E6NA 1G3WA 4OB2B 3GF5A 3OYKA 4M77D 1M2VA 2FVUA 5GAOl 3EG2A 4RCBA 2KYBA 4EIKA 2F5KA 1FMKA 1PRMC 2DEQA 2J6FA 1YJ9Q 4A4FA 2ROTA 3PT9A 2EYWA 4L5GA 4OMOA 5KE3A 4JLGA 1VQ6A 1TUDA 5CKEA 3VYGA 2YUQA 2CSIA 4ZN1A 1MGQA 3EGXB 1I1JA 1RAHB 2RQUA 1ZX6A 2JT4A 4DQ2A 1PD0A 2NLUA 2XICA 1VQPA 3V8LA 4M7AG 1NJIC 3RMSA 2WSEE 4OMQA 4RCCA 2FRYA 2E4HA 4M7AB 1ZUKA 2CGHA 1T0HA 1UGRB 2CZ6B 3P8BB 5KYNA 3CXCA 2CZ1B 2QG9B 3C95A 1J3TA 2QQBA 2LCSA 5D7UA 1MMNA 1Y96A 4J7IA 1UHCA 3EG9B 4C0DB 4ZGJB 3TSZA 3UA7A 3P8HA 4PJOD 2IIMA 1E7OA 3CCLT 2YHTA 1YJNA 3JCMJ 4A63B 3E9FA 5IN1A 1VQLT 4BY6B 2EGEA 2HDAA 4PJMA 3CCSQ 2COZA 1WYXA 1UGQB 4QVZA 1VIEA 2KT8A 4A4GA 5GAMd 4PLIA 1HXDA 2PVOB 1YI2T 2EGAA 1NJIR 1OPLA 1RAAB 4ZGEB 2E65A 1WDXA 4C92A 2D6FA 1I5OB 3V8KA 3CCUA 3EHQA 3H9NA 3A98A 3QZ5B 3T9NA 2C0OA 2YRDA 4PLLA 4DBFA 4J9HA 3I56T 3GNFB 1GCPA 1M2OA 3BW1A 1WIEA 1FX7A 3OMGA 2QQ9A 3ASKA 3QWYA 2JJ9A 4RG8A 4IUUA 2ZPEB 5GANj 1NYGA 3PMIA 5C6SA 1WJQA 1WLPB 2BZXA 3OYBA 3UT1A 1W2BS 1IZ6A 3M55A 2A37A 2EYYA 3G6EA 3MEUA 1D0ZA 2RN8A 4PJNA 2BE9B 4J6WA 4C92C 4M7AE 4RG2A 2RJCA 4EMGA 5I2MA 3UF4A 4CC3A 3SWNA 3QO3A 2QEXQ 1VYTA 3URGA 1YHQA 2XDPA 1XTDA 1EX4A 2JM9A 3I5SA 4E7HA 1VQ4A 4A53A 2KE9A 4XTWA 4F7UA 1VQMQ 2X3WD 2LJ1A 2ROLA 4FCYA 5A2QE 3CMAA 2LNHB 4KT0E 4IIOA 1SSHA 1C1AA 3M0TA 1ZA1B 2CZ0B 4JJDA 5CKFA 5A0LA 3G71Q 2CP0A 3QDFA 2ED0A 2CP6A 2J7IA 2V1QA 1RI0A 3O5ZA 4IUPA 4QT7A 4MDXA 2JTFA 3X28B 1QCNA 5IAYA 5GANh 1VQ7Q 1KFZA 2X35A 1KQSS 2VWFA 4Y91A 3I35A 2RM4A 3SWNC 4Y28E 5I11A 1SRLA 1KQ2A 1Q95G 3H0HA 2P0KA 3OYCA 3H0FA 1ZSZA 3V8JA 4HT9A 2KI7A 3REAB 2M51A 2YUNA 2L5QA 4M7AC 1KQ1A 1ZHIA 1S72Q 3NHNA 1FMVA 2PVGB 5GAOq 1BCMA 2QA4Q 1WJSA 3FDRA 2LCCA 2E12A 1C6VX 1WHJA 3JCMQ 3OB9A 3A8GB 3FC3A 1XJWB 2MAMA 1W1FA 2GTOA 2QASA 2GNCA 2RI5A 2EQJA 1T3LA 5HK3A 3EH1A 4Y92A 3JB9I 2ZPFB 1R0BG 4BY6C 5CKDA 5CIUA 1AWWA 3M59A 2DXTA 3JCMd 2DXUA 1YJWA 1ZSZC 2KRSA 1I8FA 1TH7A 1SKUB 2EBPA 3RKYA 2QTVA 2HAXA 2D1XA 4WF2A 4IUQA 2V1RA 1B7TA 4FYVB 2XIDA 2DXCA 2CP7A 1VQ6T 1VQ8T 1OZ3A 4QQDA 2EGCA 4JLIA 5CKBA 1PKTA 5CO7A 1WHMA 2MK5A 4C92F 3M53A 4LN2A 1ARKA 5IT9E 4OVAA 1G3TA 2HSEB 1I07A 1BB9A 1OQKA 3EH2A 3QZ9B 3JB9D 2F2VA 3EFOA 3I55Q 3P8DA 1G83A 3AT1B 4O6JA 1I0CA 1VQ5Q 3A8HB 4LDVA 2RMOA 3CPWP 1W2BA 4J8OA 2YT6A 1JJ2P 1UB4A 4CC7A 3GP8A 1X27A 3DB3A 2X4YA 4PJLA 1BK2A 3OYIA 3FIFA 3G7ZA 4HVVA 4RTVA 4IIMA 3ZEHA 4XK8E 5KE2A 1CSKA 2MF2A 2HQXA 4F7UF 3ULRB 2O4XB 1OYXA 2QQRA 3A5ZB 3CCEQ 2M1HA 3CCUT 1N9SA 4C8QG 1YITQ 2JS0A 4Z02A 2EQMA 3RMQA 4M78G 4XU3A 4ORZA 2E5QA 2E41A 1X6BA 2EKOA 1H3ZA 3PVQA 4JRPA 2EJFA 4OF1A 3BDLA 3OYGA 3CEYA 2K6DA 5LJ5j 1G5VA 1ZSGA 1M30A 3OS5A 3G6ET 2EKHA 3TEEA 4FIBA 1RAEB 1AT1B 2Y4YA 1VQOT 1OX8A 3OMCA 4N4GA 3F70A 2F69A 1B07A 2DYBA 1YP5A 1GRIA 2K7AA 2W0ZA 1FMWA 2I2LA 1YIJQ 2HQEA 3CMAT 2YRCA 2LCLA 3ER0A 3QSUA 2RD1A 1BI3A 1BU1A 3META 9ATCB 3BDUA 1JXOA 1R0CB 3CCLA 3R6OA 3OW2P 1OU9A 1D0XA 3M0SA 3QJYA 3MHXA 2HEQA 1VQLA 3O8VA 2HL5C 4ZTJA 4M7DG 3RBBB 2DLPA 3VU3C 5KYXA 3INZA 5GAN7 3M0PA 1U06A 4KBMB 2P84A 2VUBA 1YI2A 3X20B 2PNIA 5LJ5h 1M90U 1JU5C 4C5IA 2D9TA 3EG0A 3OYMA 3QYGB 4RTZA 1NM7A 1UDLA 2EW3A 5I21A 3X24B 1WI7A 1M5Q1 2A3LA 4J5YA 1IHVA 2PUKB 4F14A 2VXEA 4HCZA 1YNZA 3OSVA 2K5LA 1RLPC 2MCNA 3SB2A 3JCMf 2DIGA 2ZPGB 4IUTA 4X34A 2FPDA 2K3BA 4MMKA 3OYDA 2OTJT 3JAME 5GANd 2DIQA 1X2KA 1T3SA 2YXYA 3JCMe 2GFUA 1KD1U 1W70A 4M78A 3D7SB 2GF7A 1ZUYA 1BIAA 2KR3A 1UG1A 2O31A 2QTXA 4E7JA 5CCAA 1YJWT 2DBKA 2DILA 1JB0E 2DTOA 4Z89A 2OAUA 2EVRA 2DMOA 1KHIA 1HJDA 2HCKA 2JVVA 4A4KA 2M0YA 5GAN4 3GOXA 2H3EB 2K57A 3CMEQ 2CT4A 4J6XA 4KULA 3MP8A 2HZYA 4C8QC 4M75G 3G4SQ 2DKGA 3HP9A 2X51A 2AKLA 4M78C 2YLBA 2JZ2A 4M75B 2LX9A 3CC2Q 3CPWS 4OB1B 4AT1B 3C12A 3JB9F 3M56A 1JJ2S 5LJ5g 1X6OA 3M5AA 2AZVA 1TXQA 3OYFA 3RERA 2A7YA 3WVEB 3KFVA 3U23A 4M7DA 3RKXA 3TSWA 4MDWA 4M77B 4KGXB 2EJ9A 2V8KA 1UGSB 1EIFA 3HPWA 3VYHB 2DZCA 1VQKQ 3VS7A
chains in the Genus database with same CATH topology
4BI4A 4PLLA 1K8AC 3AHUA 4BE2A 2RO0A 3OYYA 4VUBA 3I56T 2ZPBB 3GNFB 4UC4A 2LDMA 5D6WA 2QI2A 3MEVA 3BW1A 4JRIA 1S72A 1FX7A 4O5VA 3OMGA 2P0PA 3NTKA 1VUBA 2O01E 4C8QD 4QQ6A 3OY9A 1M1GA 4XU0A 3CCQA 2QQ9A 3ASKA 4RG8A 4HCCA 2JOYA 5A0DA 2DPPB 3OBYA 2DO3A 4IUUA 2ZPEB 3L2WA 2KK4A 1D3BA 2XKOC 2Y90A 3DB4A 3M9QA 3MEWA 4M78D 1OI1A 3PMIA 1WJQA 2DZ9A 3C94A 3HL8A 3H6ZA 4FT4A 3KBGA 4FL6A 3UT1A 2RK2A 1YCYA 3JSCA 4JS5A 1W2BS 1IZ6A 3M55A 4RMOA 3G6EA 3LGFA 3KXTA 1WQWA 3MEUA 4HCBA 3OS0A 3TU4K 5HY6A 2ZZDA 5CK9A 4PNOA 2D0QB 4J6WA 3QG1A 4C92C 3HFOA 4M7DC 4M7AE 3CBMA 4RG2A 5C6SA 3M54A 3CCET 2QEXA 1Y7XA 2IG0A 2IVWA 2RJCA 1Q86U 4EMGA 1YJ9A 3QBYA 2EFIA 4XQ3A 5GANg 1VQPT 2WSCE 5I2MA 1ZBXA 2QQSA 3OYHA 1YITT 2EYQA 4LDUA 3QO3A 3SWNA 4XTYA 5LL6S 3JCMc 3URGA 1YHQA 2XDPA 1XTDA 2DD4A 2O4XA 2FHDA 2XG8D 4E7HA 1VQ4A 1K73C 4A53A 4XTWA 4F7UA 5D6YA 3N5BB 3GNGA 2BKDN 4OB3B 1PSFA 2BUDA 5A2QE 3HRTA 5LJ3j 4BE1A 1QP2A 2KMTA 4E47A 3JRZA 3CMAA 3PGGA 4KT0E 1VQ8A 3PIOA 4C8QA 3FEOA 5FU6B 4PJOG 5GAN5 1P92A 3CCMA 4M75E 1QVPA 2P0QA 3HKSA 2CZ0B 2CKKA 3L42A 4PJOF 5CKFA 5A0LA 1VQNA 4EMKB 3DLLA 1JBMA 2R57A 3E19A 1N9RA 1M1FA 2K3XA 2XHCA 3GLXA 3ZFJA 3DKMA 4PJOB 1RI0A 2RHIA 3QHSA 1NJIU 4IUPA 3CPFA 2EWNA 4NS5A 5LJ3g 2EQUA 4MDXA 2JTFA 3X28B 5LJ5f 2M0OA 3HRSA 5IAYA 4OGCA 2LC4A 5GANh 3UPUA 3QSUA 1IREB 4EDUA 2GCXA 4M77E 1YJNT 2E6ZA 4J83A 4IKFA 4E7KA 2X35A 3L2ZA 2HNIA 4MMLA 3RKWA 4C92D 1KQSS 4M7DD 2X4XA 2KAFA 2VYTA 4Y91A 4MZMA 1JRIA 2RM4A 3OS2A 3SWNC 5GAMj 5GAOp 4Y28E 1N27A 1W4SA 4HKEA 1KQ2A 2P0KA 3OYCA 2JN0A 2MMPA 5LJ3d 4DOVA 3CMEA 5LJ5e 5GMKi 3A8MB 4DA4A 4C5GA 1YIJT 1QVFA 4KUIA 2EIFA 3V8JA 3JB9J 2QXFA 4HT9A 1BYMA 1N6AA 3G4SA 4DOWA 3RESA 2LT1A 3J80E 4IUVA 2L5QA 3GIBA 4M7AC 1KQ1A 3CBOA 2GFAA 5FU7B 4C8QF 5GAMg 5KCHA 1WPYA 1ZHIA 2DK3A 1Q82C 1O9SA 3LLRA 5KCOA 4BDYA 2PVGB 1I81A 5GAOq 3CC2A 3OBWA 5LJ3h 3CCSA 4M78F 1WJSA 3LYIA 1QP3A 2EQKA 2L8DA 3C4SA 3FDRA 2LCCA 3KUFA 4N4HA 3S6WA 5CR2A 1LNXA 2E12A 4BI3A 2RHXA 3EAEA 4N4IA 4LDYA 5HKCA 4NL2A 2LQKA 4OP0A 3GPLA 3JCMQ 3OB9A 4M78B 5DLOA 4ZGDB 3A8GB 3FC3A 4M77G 1NZ9A 2MAMA 2RI5A 2EQJA 2DXBA 2XU8A 5HK3A 4M75C 3JB9I 2ZPFB 3WVDB 4BY6C 2RB6A 5CKDA 5CIUA 3M59A 3HFNA 1B34B 1H641 2K3YA 4C5EA 3CCRA 1BI0A 2PU9B 4MZTA 2DXTA 3JCMd 3TREA 2DXUA 2K2VA 4XU2A 1YJWA 1VQLT 5FRMA 5A0GA 1AHJB 2P4TA 4ZN3A 1NPRA 1Q7YC 3PIPA 1I8FA 1TH7A 3DLMA 1I5LA 2DTIA 1YJ9T 5GAMh 4OB0B 3RKYA 3CCUT 2KDSA 1LOJA 4L59A 1WJRA 3CPWA 2QDYB 3NTIA 5GANe 1YHQT 5GMKe 2L89A 4C0ZA 2HAXA 1VQ4T 2B8AA 4BB7A 3M58A 1JJ2A 4WF2A 1Y96B 4FM4B 4IUQA 4XTXA 3OYAA 3JCMh 4PJOE 4BUGA 2HD0A 4YTLA 3OSSC 4X9DA 3PFSA 2XIDA 2DXCA 3A8OB 4OGEA 3FLGA 1VQ6T 1QVGA 1VQ8T 1OZ3A 2K4YA 2YLCA 4BDZA 4QQDA 5FLXE 2QQAA 3VV0A 4JLIA 5CKBA 1KG1A 1KC8C 5CO7A 4GLKA 1VQ9T 4C5HA 2LRQA 4C92F 3M53A 4M7DF 5IT9E 3LH0A 4M75D 3OA6A 4GY5A 4N0AC 3NFCA 3RIRA 1VQOA 3VUBA 2E70A 4OVAA 4B9XA 3QJ6A 2E10A 4XTVA 4JJNK 3HHTB 1G3TA 2CYZB 3A8LB 2RJEA 4BD3A 4C92B 1VQMA 3I55A 4M7DB 3SFMA 1K9MC 2RHUA 2ZPIB 2DTHA 1UEBA 5CQYA 3QZ9B 3JB9D 3OYJA 5HK0A 2OTLT 1M8VA 1Q81C 3P8DA 3VJPA 1BI2A 2R58A 2RK1A 1M90C 2WSFE 4O6JA 1I4K1 3V7CA 3A8HB 4LDVA 1W2BA 2YRVA 3G71A 4XAXB 3CMET 4M7AA 2VGNA 2R5MA 2PQWA 4J8OA 4C8QE 2VGMA 3CCJA 3I56A 2PUOB 5GAN3 1UB4A 1KHCA 3LGLA 3G4ST 4BE0A 3E9GA 3GP8A 5GAN2 4M78E 5J39A 1BI1A 1Q86C 3DB3A 2X4YA 3JCMV 4L6V5 1VQ7A 1D3BB 1UGPB 4XTZA 3OYIA 3FIFA 2BIVA 2ZGWA 1MHNA 3LX7A 3E1SA 3G7ZA 3CC2T 3CD6T 3PMTA 5J3BA 5C0MA 4ME7A 2XDDA 3CCST 4EMKC 4C0GA 4BACA 2VXFA 2Y4XA 2E1HA 5DLQE 5DY9A 3ZEHA 3CXCS 1X75C 3PNWC 3L2VA 4M75A 1WNLA 4QW2A 4TVRA 4XK8E 4E7LA 3WXMB 5KE2A 3OW2S 2FYKA 4ZTFA 2X4JA 2MF2A 3LW5E 4F7UG 2HQXA 1GXIE 4F7UF 3CCEA 2KVQG 3SWNB 1PSEA 1WGSA 3M4YA 1Q82U 1VQKT 3JB9H 2O4XB 1OYXA 1KD1C 1XOVA 1YITA 2QQRA 3A5ZB 4KUDK 2M1HA 3BFMA 1G3SA 2L3RA 1N9SA 3QKJA 2M16A 3BY7A 3MP1A 4M77A 3VKIA 4F7UB 4C8QG 3S3OA 5CQXA 4BI8B 4MZPA 2QA4A 3L1AA 4JDSA 1RL2A 3QUIA 4Z02A 3CC7A 2EQMA 2M9UA 2VC8A 4EMHA 1N8RU 3RMQA 4M78G 4XU3A 2KY9A 4QVCA 2E5QA 2E41A 4E7IA 2OTJA 2EKOA 1H3ZA 4EPCA 1O75A 3S3NA 3JCMg 4JRPA 2EJFA 4C0DC 5D6XA 4LDWA 3VUZA 3CCQT 5EG2A 3OW2A 4XTUA 2WACA 4R55A 3OS1A 2GQVA 2JUFA 3BDLA 4OF1A 3CEYA 3JCMX 3OYGA 3HRUA 3CC4A 5LJ5j 5DM7R 3CCVA 1G5VA 3FJPA 4C92E 4M7DE 2EJGA 1K8AU 5GANf 1Q7YU 3OS5A 3G6ET 2E64A 1M4ZA 4N0AA 1YBYA 5L8RE 3V7SA 5GAN8 4JS4A 3Q1JA 5J26A 3TEEA 5M9OA 5CAIA 4FIBA 2PVDB 5FRNA 4C0FA 5GAOn 2QEXT 3L2RA 2XI9A 2Y4YA 1VQOT 3FB9A 2RHYA 2ZPHB 5KH6A 4IURA 4M77C 3J7AF 2F5TX 3OMCA 1VQMT 3EFSA 2H3JA 4M7AD 4N4GA 4NOYA 1BKBA 4A4HA 2KSSA 4FT2A 3M4GA 4PKCC 3F70A 1M9SA 4X9CA 5GAN6 2F69A 1HK9A 4V2SA 3ME9A 1KC8U 2I2LA 2HQEA 1Y71A 3JCMP 3CMAT 3UWNA 3G71T 2LCLA 1NPPA 3ER0A 3MP6A 2RD1A 5LJ3f 1BI3A 2LTOA 5FROA 5LJ5d 3META 3CCMT 3CCJT 2V8JA 3BDUA 2X4WA 2RJFA 3CCLA 4CRIA 3R6OA 1VQNT 3LWHA 2RJDA 3TCJA 3JCMb 3L2UA 3QJYA 3MHXA 3MO8A 1VQLA 2DAQA 3O8VA 4C92G 4J6YA 2FB7A 4EMKA 3OYBA 4ZTJA 1K9MU 4M7DG 3VU3C 4B9WA 2CS7A 1VQ7T 4JUVA 3UDCA 1K73U 3INZA 4QQGA 5GAN7 4A4EA 4C8QB 1KQSA 4PJOA 3MEAA 4HT8A 1Q81U 3QXEB 4KBMB 2JTMA 2VUBA 3EFRA 5LJ3e 3X20B 3L2QA 5GMKj 1YI2A 5LJ5h 4CI0C 1M90U 4LDXA 1XNIA 2MI6A 4C5IA 2E6NA 2D9TA 4LD6A 4F7UE 1G3WA 4OB2B 3OYMA 1VQ5A 3QYGB 3GF5A 2RI3A 5I21A 3X24B 3OYKA 3NTHA 1M5Q1 4M77D 2A3LA 4J5YA 2FVUA 4JRKA 4FSXA 5GAOl 5GAMf 4RCBA 4RKUE 1BIBA 2PUKB 2F5KA 2KQWA 2MWOA 4XU1A 5CVIA 2JNGA 1V29B 3H8ZA 2VXEA 3QDRB 4HCZA 1FWZA 4J7FA 2DEQA 3OSVA 4A54A 1S72T 4ATOA 2K5LA 2LQ8A 2ZCFB 4A4FA 4FU6A 2R5AA 3QYHB 3OYLA 2DJZA 3SB2A 3JCMf 3PT9A 2QA4T 2RA2A 3MCAB 4P5NA 5GAOr 2DIGA 4L5GA 3CC7T 5FU6C 5GAMe 1R8OB 2ZPGB 4IUTA 4X34A 5KE3A 4MMKA 4JLGA 1VQ6A 1XQHA 5CKEA 3VYGA 4ELYC 2G3RA 3OYDA 2RH2A 5GANd 2XK0A 3JAME 3PTAA 2OTJT 3OQ5A 3LWIA 4PJOC 2XD0A 2DIQA 3QPHA 4ZN1A 1MGQA 4D6WA 1LJOA 2CZ7B 3JCMe 2GFUA 1G3YA 1KD1U 1QVFS 4R56A 1Y07A 4NL3A 4M78A 1VQ9A 2VV5A 2AHJB 2GF7A 2LVMA 3CC4T 3CCVT 3J81E 1BIAA 2MWPA 3M57A 4DQ2A 4ELZC 1WQ7A 2NLUA 2XICA 3QIIA 1VQPA 2QTXA 3V8LA 5GMKl 3CCRT 1U1SA 4E7JA 5GMKh 4M7AG 4QVDA 5CCAA 3OYNA 3JCMW 1YJWT 1B34A 4M7AF 1NJIC 3RMSA 2K5FA 1JB0E 2WSEE 1VIFA 2RHZA 2DTOA 4HA8A 3X26B 1OZ2A 2C06A 2OTLA 2OAUA 4PL6A 4RCCA 3X25B 1M1KC 4M7AB 2EAYA 3V7RA 2CZ6B 2CGHA 3P8BB 1UGRB 1KHIA 2DVEA 3CXCA 4M7DA 5GAOm 2JVVA 2CZ1B 4A4KA 3SDZA 4JRQA 3C95A 5FU7C 2QQBA 5GAN4 3GOXA 2K57A 4J6XA 4KULA 1FXXA 3MP8A 1Y96A 4J7IA 3S3MA 4C8QC 5I2SA 2RI2A 4C0DB 1M1KU 4M75G 3HSBA 4ZGJB 4M75F 1U1TA 2DKGA 1NE8A 2DD5A 3ZBDA 3P8HA 4PJOD 3HP9A 3CD6A 3CCLT 2YHTA 4M78C 2YLBA 3OYEA 2JZ2A 1YJNA 3JCMJ 3E9FA 2LT4A 2V8IA 4II1A 4M75B 5AYFA 5IN1A 3SD4A 2LX9A 4BY6B 3CBPA 5GANj 3JB9G 3CPWS 4OB1B 3JB9F 3C12A 3M56A 1N8RC 1UGQB 4QVZA 1ZQ1A 1VIEA 5LJ5g 1JJ2S 4A4GA 1U8RA 1X6OA 3M5AA 1HXDA 2PVOB 3FRNA 4M77F 4PLIA 4Q5WA 1DJ7B 5GAMd 3OYFA 3I55T 1YI2T 2LNVA 3RERA 4ZGEB 2E65A 2A7YA 3WVEB 4C92A 2D6FA 3RKXA 1YIJA 4OMFB 1QVGS 2HBPA 5CKHA 4MDWA 1VQ5T 4M77B 2FL7A 1VQKA 2K5IA 1X01A 4LD9K 2EJ9A 2V8KA 1UGSB 1EIFA 3HPWA 3V8KA 2XDBA 3RUXA 3CCUA 3VYHB 2DZCA 1QW1A 5GMKm 3QZ5B 3T9NA 1SSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RI3 A;  4PLL A;  3OYK A;  3NTH A;  1WJS A;  3LYI A;  2EQK A;  2L8D A;  3C4S A;  3FDR A;  3KUF A;  2LCC A;  2RO0 A;  3PNW C;  4N4H A;  4QW2 A;  3S6W A;  3L2V A;  2RHX A;  3EAE A;  4N4I A;  2LDM A;  4UC4 A;  2F5K A;  5D6W A;  4E7L A;  3MEV A;  2MWO A;  5KE2 A;  3OB9 A;  3H8Z A;  3OMG A;  4ZTF A;  4HCZ A;  3NTK A;  2HQX A;  3FC3 A;  4QQ6 A;  3OY9 A;  1WGS A;  3ASK A;  2RI5 A;  4A4F A;  2EQJ A;  4FU6 A;  2R5A A;  3OYL A;  2O4X B;  1OYX A;  4IUU A;  2QQR A;  3L2W A;  2M1H A;  3DB4 A;  2L3R A;  3MEW A;  3M9Q A;  3QKJ A;  2M16 A;  1OI1 A;  3MP1 A;  1WJQ A;  2DIG A;  3PMI A;  5CIU A;  3H6Z A;  5C6S A;  4FL6 A;  3OYB A;  3UT1 A;  2K3Y A;  4IUT A;  4X34 A;  4C5E A;  5KE3 A;  4Z02 A;  5FRM A;  3OYD A;  2EQM A;  3LGF A;  2G3R A;  2XK0 A;  3MEU A;  3OS0 A;  3OQ5 A;  2E5Q A;  3DLM A;  2DIQ A;  4E7I A;  2EKO A;  1H3Z A;  4RG2 A;  3S3N A;  2GFU A;  2RJC A;  2IG0 A;  4L59 A;  5D6X A;  1WJR A;  3QBY A;  3NTI A;  2EFI A;  2GF7 A;  2LVM A;  2L89 A;  2MWP A;  2QQS A;  2WAC A;  3OS1 A;  3BDL A;  3OYH A;  4BE2 A;  3OYG A;  3CEY A;  2B8A A;  2NLU A;  2XDP A;  3QII A;  2O4X A;  4IUQ A;  3OYA A;  1G5V A;  2FHD A;  4E7H A;  4E7J A;  3PFS A;  3OYN A;  5D6Y A;  3FLG A;  2BKD N;  2BUD A;  4BE1 A;  2RHZ A;  1OZ3 A;  1OZ2 A;  3Q1J A;  5J26 A;  4BDZ A;  4QQD A;  5M9O A;  4PL6 A;  5FRN A;  3FEO A;  3L2R A;  2CKK A;  3L42 A;  4C5H A;  2RHY A;  2LRQ A;  5KH6 A;  4IUR A;  3LH0 A;  3OMC A;  3OA6 A;  2R57 A;  4GY5 A;  3GOX A;  2K3X A;  4N4G A;  4B9X A;  4OVA A;  1RI0 A;  2RHI A;  3QJ6 A;  4A4H A;  4IUP A;  3F70 A;  2RJE A;  3MP8 A;  4BD3 A;  3S3M A;  4NS5 A;  2EQU A;  2JTF A;  2RHU A;  2M0O A;  2RI2 A;  5IAY A;  3ME9 A;  3OYJ A;  4EDU A;  3P8H A;  2HQE A;  4IKF A;  4E7K A;  2X35 A;  3UWN A;  3P8D A;  3MP6 A;  2X4X A;  2R58 A;  2VYT A;  2LTO A;  2JZ2 A;  5FRO A;  3OYE A;  3MET A;  3OS2 A;  3E9F A;  5IN1 A;  2X4W A;  4II1 A;  2RJF A;  3SD4 A;  2YRV A;  4CRI A;  1N27 A;  2R5M A;  2PQW A;  2RJD A;  3L2U A;  2P0K A;  3MO8 A;  3OYC A;  2DAQ A;  3O8V A;  4ZTJ A;  4QVZ A;  3ZEH A;  1KHC A;  3LGL A;  4A4G A;  4BE0 A;  4B9W A;  3E9G A;  4PLI A;  4Q5W A;  4C5G A;  4QQG A;  3OYF A;  4A4E A;  5J39 A;  3MEA A;  3DB3 A;  2X4Y A;  4IUV A;  3L2Q A;  3OYI A;  2BIV A;  3LX7 A;  1MHN A;  2GFA A;  3S3O A;  1XNI A;  4C5I A;  5KCH A;  2E6N A;  3PMT A;  5C0M A;  2D9T A;  4LD6 A;  3LLR A;  5KCO A;  4BAC A;  3OYM A;  4BDY A;  1SSF A; 
#chains in the Genus database with same CATH topology
 1QCO A;  4D8D A;  1IXD A;  4VUB A;  2LDM A;  2P0P A;  2ATC B;  2KEA A;  3NTK A;  1PKS A;  1MNE A;  4QQ6 A;  4XU0 A;  1H92 A;  2JOY A;  5A0D A;  2DPP B;  2OAW A;  1D3B A;  3M9Q A;  2GGR A;  4X9D A;  3C94 A;  2DZ9 A;  3KBG A;  4FL6 A;  2RK2 A;  4JS5 A;  2KRO A;  3LGF A;  3KXT A;  4CC4 B;  3OS0 A;  2ZZD A;  5CK9 A;  4PNO A;  1QCF A;  2DNU A;  3QG1 A;  4Z88 A;  4M7D C;  3CBM A;  2QEX A;  1Y7X A;  3QBY A;  2EFI A;  1ZBX A;  4RTW A;  1W6X A;  2Z0W A;  2DL3 A;  2LJ3 A;  4OB3 B;  4BE1 A;  2KMT A;  3PGG A;  1VQ8 A;  3PIO A;  2NUP A;  3FEO A;  5FU6 B;  4PJO G;  5GAN 5;  2L3S A;  4M75 E;  1E6H A;  1LCK A;  4EMK B;  1NG2 A;  1JBM A;  3CCM Q;  3CCJ Q;  1M1F A;  2K3X A;  4PJO B;  1VQN Q;  3CPF A;  1RAD B;  2EWN A;  3TVT A;  2FO0 A;  2EQU A;  4PJJ A;  1Y0M A;  4OGC A;  3UPU A;  4M77 E;  2LMJ A;  2HNI A;  3RKW A;  4C92 D;  1WHL A;  2VYT A;  1UEC A;  1SPK A;  2JMA A;  2LQW A;  4AFZ C;  2IPO B;  1OOT A;  1GBQ A;  5LJ3 d;  4J9B A;  4OMN A;  4DA4 A;  2JM8 A;  4C5G A;  4J9F A;  2L3Q A;  3RES A;  1TOV A;  2BZ8 A;  3J80 E;  4IUV A;  3REB B;  3GIB A;  3PE0 A;  5FU7 B;  4C8Q F;  1MMA A;  2DK3 A;  1Q82 C;  4DBR A;  2DM1 A;  1OX9 A;  1YWO A;  4M78 F;  3LYI A;  1QP3 A;  3KUF A;  3MJX A;  3S6W A;  5GAO r;  1M1K U;  4BI3 A;  4N4I A;  5KYY B;  2LQK A;  3GPL A;  1NYF A;  5DLO A;  1UE9 A;  1NZ9 A;  4RUG A;  1SHF A;  4KH0 B;  2ENM A;  4M75 C;  2EYX A;  3HFN A;  1B34 B;  1H64 1;  2RF0 A;  5KYW A;  3CCV Q;  4C5E A;  1X2Q A;  3CCR Q;  1Q7Y C;  1I5L A;  1YJ9 T;  4OB0 B;  1QVF P;  4JZ3 A;  1C0M A;  3CPW A;  4F16 A;  5GAN e;  5GMK e;  4OMM A;  1EFN A;  1Q82 R;  2ECZ A;  4E7Z A;  2B8A A;  4BB7 A;  4ESR A;  1JJ2 A;  4FM4 B;  4PJO E;  4YTL A;  3OSS C;  4OGE A;  2CRE A;  2C0T A;  3EGX A;  1MV0 B;  4M7D F;  1K9A A;  3OA6 A;  1SRM A;  3NFC A;  3RIR A;  1VQO A;  3VUB A;  4B9X A;  2DER A;  4JJN K;  2CYZ B;  3A8L B;  1OPK A;  3I55 A;  1K9M C;  2ZPI B;  2ABL A;  2DTH A;  1Q7Y R;  2CH4 W;  5CQY A;  3OYJ A;  1JXM A;  2WSF E;  1RAB B;  4M7A A;  2VGN A;  2PUO B;  2HBW A;  4BE0 A;  3I9Q A;  3JCM V;  1R77 A;  2ZGW A;  1AWJ A;  2JMC A;  3EG9 A;  3E1S A;  3PMT A;  5J3B A;  5C0M A;  4ME7 A;  3CCS T;  2HSP A;  4EMK C;  4C0G A;  4BAC A;  2E1H A;  5DLQ E;  1OV3 A;  1X75 C;  3PNW C;  4KRT A;  1WNL A;  4QW2 A;  4TVR A;  1RAC B;  2BZY A;  5IXB A;  1K9M R;  3CCE A;  1PSE A;  4FSS A;  1WGS A;  1YFN A;  4PFZ A;  1YIT A;  1G3S A;  4OML A;  3S3O A;  2BTT A;  1VQP Q;  5CQX A;  1HYO A;  1RL2 A;  3SHW A;  3CC7 Q;  2OTJ A;  2YUO A;  2DEU A;  1BBZ A;  4C0D C;  3OW2 A;  4XTU A;  2EQI A;  3OS1 A;  3HRU A;  1F1B B;  1PC0 A;  2F2X A;  3FJP A;  1K8A U;  2KXD A;  3CC4 Q;  1M4Z A;  5L8R E;  5GAN 8;  5FRN A;  2QEX T;  3L2R A;  2XI9 A;  1VQM T;  2KSS A;  3M4G A;  5GAN 6;  3RNJ A;  1UUE A;  1HK9 A;  1YCS B;  1KC8 U;  3JCM P;  1K0S A;  3G71 T;  5LJ3 f;  3SEM A;  2QAZ A;  1OU8 A;  3VRY A;  1G2B A;  2RJD A;  3JCM b;  3JV3 A;  2PZ1 A;  3MO8 A;  2DAQ A;  1V1C A;  2CS7 A;  4B9W A;  1VQ7 T;  3EGD B;  1K73 U;  4QQG A;  1Q81 U;  2JTM A;  3EFR A;  5LJ3 e;  3L2Q A;  4DEY A;  4LDX A;  1XNI A;  2L0A A;  4LD6 A;  1HSQ A;  1SF9 A;  4HCK A;  2J6O A;  4CC2 A;  1ABQ A;  4JJC A;  4JRK A;  3IQL A;  4FSX A;  5GAM f;  1BIB A;  2KQW A;  2JNG A;  4PFO A;  4J7F A;  4A54 A;  1S72 T;  2CP2 A;  2LQ8 A;  4FU6 A;  2R5A A;  3QYH B;  2DJZ A;  2RQT A;  1WXU A;  2QA4 T;  1YHQ Q;  3CC7 T;  3C0C A;  5KYU A;  5GAM e;  2CSQ A;  2CP3 A;  1VQ4 Q;  1RAI B;  1WXB A;  1XQH A;  2G3R A;  2RH2 A;  3H41 A;  3EGU A;  3LWI A;  2XD0 A;  2LZ6 B;  4D6W A;  1LJO A;  3I5R A;  1G3Y A;  1QVF S;  1Y07 A;  2VV5 A;  3CC4 T;  3M57 A;  2HQH A;  1WQ7 A;  1VQ9 Q;  1LPL A;  1IB8 A;  4QVD A;  3OYN A;  3JCM W;  2EYZ A;  4M7A F;  2K5F A;  2O9V A;  2RHZ A;  2C06 A;  1OZ2 A;  2RQW A;  4PL6 A;  3V7R A;  2QGG A;  2OTL Q;  2DVE A;  2L3P A;  1QKW A;  1JQQ A;  4HVW A;  3S3M A;  5I2S A;  4QKU A;  3E2U A;  4JPB W;  2RNA A;  1U1T A;  3ZBD A;  3OYE A;  2LT4 A;  3SD4 A;  5AYF A;  4HT8 A;  3CD6 Q;  1RI9 A;  2VVK A;  1PRL C;  1OEB A;  2QDL A;  1U8R A;  1DJ7 B;  3I55 T;  1X43 A;  1EZZ B;  2HBP A;  1VQ5 T;  1VQK A;  2FZC B;  1PWT A;  1X01 A;  2XDB A;  1TUC A;  3RUX A;  5GMK m;  4LUE A;  1SSF A;  1K8A C;  4ZNX A;  1YN8 A;  3OYY A;  1E6G A;  1S1N A;  4KH1 B;  3MEV A;  2A28 A;  1VUB A;  4C8Q D;  3OY9 A;  1FYN A;  4HCC A;  2DO3 A;  3L2W A;  2KK4 A;  3X26 B;  4M78 D;  3CCQ Q;  4Z8A A;  3GBQ A;  1YCY A;  3JSC A;  4FYY B;  2MIO A;  1CKA A;  2J05 A;  2NYS A;  4HCB A;  5HY6 A;  2D0Q B;  3HFO A;  4KGZ B;  2NUT B;  3CCE T;  2IG0 A;  2HKQ B;  1YJ9 A;  2WSC E;  3QWX X;  1YIT T;  4XTY A;  3JCM c;  2O4X A;  2SEM A;  2FHD A;  1K8A R;  2XG8 D;  1K73 C;  2CUD A;  2BKD N;  2J06 A;  3GNG A;  1PSF A;  1YWP A;  3JRZ A;  2JXB A;  2AZS A;  2CH4 A;  4C8Q A;  1D09 B;  3CCM A;  1UGV A;  1P92 A;  1QVP A;  2DL8 A;  3L42 A;  1VQN A;  2X3X D;  3GLX A;  3ZFJ A;  1TTH B;  2RHI A;  3QHS A;  1NJI U;  2X9H A;  4DBH A;  5LJ3 g;  3NGP A;  3HRS A;  2A36 A;  2LC4 A;  4EDU A;  4IKF A;  3L2Z A;  1N5Z A;  1V76 A;  4MML A;  4M7D D;  2KAF A;  2V26 A;  4ANJ A;  1JRI A;  1M2V B;  1N27 A;  2DF6 A;  4DOV A;  4HXJ A;  3A8M B;  1YIJ T;  1QVF A;  2EIF A;  1OUL A;  2FZK B;  1TU0 B;  1N6A A;  4DOW A;  2LT1 A;  3TQ7 P;  3CBO A;  5GAM g;  3LLR A;  3A1P A;  5KCO A;  2F2W A;  3OBW A;  3CCS A;  3C4S A;  3EAE A;  3NMZ C;  5HKC A;  4NL2 A;  4OP0 A;  4ZGD B;  4M77 G;  2XU8 A;  1ZUU A;  2RB6 A;  1GCQ C;  2SRC A;  2DE0 X;  3CCR A;  2O88 A;  1BI0 A;  3TRE A;  2K2V A;  4XU2 A;  2AK5 A;  2CDT A;  5A0G A;  1TUG B;  1NPR A;  3PIP A;  3DLM A;  4FYW B;  2QK0 A;  4KGV B;  2QDY B;  3NTI A;  2D8H A;  4FW1 A;  1AZE A;  2O9S A;  4B6M A;  1Y96 B;  3OYA A;  3JCM h;  4BUG A;  1B3Q A;  3PFS A;  1KQS P;  2YLC A;  3H0I A;  2CT3 A;  5FLX E;  1IHW A;  5GJW B;  3VV0 A;  1KG1 A;  5IHN A;  1RUW A;  4J9E A;  2LRQ A;  2M02 A;  1QLY A;  3LH0 A;  4M75 D;  5HCK A;  4GY5 A;  4N0A C;  1VQL Q;  2E70 A;  3QJ6 A;  2E10 A;  4XTV A;  1U5S A;  1VQM A;  2RJE A;  4AFQ C;  4BD3 A;  4C92 B;  2RHU A;  1ABO A;  1YI2 Q;  1M8V A;  4PFP A;  3UAT A;  1PM3 A;  2R58 A;  2RK1 A;  1QMC A;  1TS9 A;  2KRM A;  1M90 C;  1I4K 1;  2AIR B;  1K4U S;  3G71 A;  3CME T;  1KSW A;  2DL4 A;  4XAX B;  1AEY A;  4JZ4 A;  7AT1 B;  1PHT A;  5GAN 3;  3G4S T;  3LGL A;  3E9G A;  5GAN 2;  1GL5 A;  3I56 Q;  1QVG P;  1VQ7 A;  4L6V 5;  1X69 A;  4XTZ A;  2BIV A;  3LX7 A;  1MHN A;  3CC2 T;  2DX1 A;  1D1B A;  2VXF A;  4GLM A;  2DL7 A;  5DY9 A;  2AT1 B;  2LJ0 A;  3L2V A;  4M75 A;  3WXM B;  2ED1 A;  3OW2 S;  2HMA A;  1WHG A;  4ZTF A;  2X4J A;  1AWO A;  4F7U G;  1UHF A;  2KRN A;  1GXI E;  2KVQ G;  3SWN B;  2D0N A;  4E7S A;  1VQK T;  3JB9 H;  2K79 A;  1KD1 C;  5FW9 A;  1WZO A;  1MUZ A;  4KUD K;  1M90 R;  1S72 A;  3VKI A;  3MP1 A;  1PD1 A;  3BY7 A;  4M77 A;  4F7U B;  4BI8 B;  4MZP A;  2QA4 A;  4JDS A;  3CC7 A;  1TSF A;  1K0X A;  2M9U A;  2VC8 A;  4EMH A;  1N8R U;  4QVC A;  2KY9 A;  3VS2 A;  2W10 A;  3JCM g;  5D6X A;  3VUZ A;  5IHK A;  5EG2 A;  2COW A;  4R55 A;  3FJ5 A;  2JUF A;  2XMF A;  1WA7 A;  3CC4 A;  5DM7 R;  2VKN A;  4C92 E;  2VAS A;  5GAN f;  1Z9Z A;  2E64 A;  3V7S A;  5CAI A;  3PVL A;  4C0F A;  5GAO n;  2A08 A;  1QQJ A;  1KD1 R;  3FB9 A;  2L2P A;  4IUR A;  4M77 C;  1ZSZ B;  2LQN A;  1X6G A;  2F5T X;  4LNP A;  4M7A D;  4A4H A;  4X9C A;  2HL3 A;  2E5K A;  4V2S A;  1M3C A;  2RQV A;  1SG5 A;  5IH2 A;  3M0Q A;  5L23 A;  1NPP A;  5LJ5 d;  5FRO A;  3CCM T;  2B86 A;  3CCJ T;  2V8J A;  2FRW A;  2X4W A;  4CRI A;  3BE3 A;  1VQN T;  3LWH A;  2OJ2 A;  2FB7 A;  5GJV B;  4EMK A;  4PJO A;  1RLQ C;  2QGF B;  5GMK j;  4CI0 C;  4F7U E;  3EG1 A;  1VQ5 A;  2KXC A;  3NPF A;  4GBQ A;  2RI3 A;  5IHI A;  3NTH A;  1NLO C;  4RKU E;  2DFU A;  2GBQ A;  2MWO A;  4XU1 A;  5CVI A;  3QDR B;  1V29 B;  3H8Z A;  3MPU B;  2NUZ A;  1FWZ A;  2KBT A;  2NWM A;  4ATO A;  2ZCF B;  2ZAE A;  3OYL A;  2RA2 A;  3MCA B;  5EC7 A;  5FU6 C;  1R8O B;  2HKN A;  4DBQ A;  4ELY C;  3PTA A;  2YSQ A;  2XK0 A;  3OQ5 A;  1A0N B;  4PJO C;  3QPH A;  1VQ6 Q;  1T0J A;  2CZ7 B;  8AT1 B;  1VQ8 Q;  5KYY A;  1WHK A;  2PTK A;  4R56 A;  4NL3 A;  1VQ9 A;  2AHJ B;  2LVM A;  3CCV T;  3J81 E;  2MWP A;  1RAF B;  4ELZ C;  2VB6 A;  3QII A;  1MMD A;  2DRK A;  5GMK l;  3CCR T;  1U1S A;  5GMK h;  1Z9Q A;  3EFO B;  1B34 A;  1VIF A;  4LXC A;  4HA8 A;  2OTL A;  3X25 B;  2EAY A;  2COY A;  4DEX A;  1WX6 A;  5GAO m;  1KK7 A;  5FWB A;  1U3O A;  3SDZ A;  4JRQ A;  5FU7 C;  2DL5 A;  2JTE A;  1FXX A;  5FWC A;  2ESW A;  2E3H A;  2RI2 A;  5KYU B;  3HSB A;  1PG5 B;  4M75 F;  1NE8 A;  1D1C A;  2DD5 A;  3CD6 A;  4AG1 C;  1H8K A;  2V8I A;  4II1 A;  1GBR A;  3CBP A;  3JB9 G;  2MYS A;  1YJN Q;  2D8J A;  1N8R C;  1ZQ1 A;  1M1K C;  4M77 F;  3FRN A;  3G1J A;  4Q5W A;  4R0K A;  1VYU A;  2LNV A;  1YIJ A;  4OMF B;  1QVG S;  5CKH A;  2FL7 A;  4LD9 K;  2K5I A;  1GFD A;  1HD3 A;  2GTJ A;  1QW1 A;  2C0I A;  1BCO A;  3CXC P;  4BI4 A;  3AHU A;  3CCU Q;  1SHG A;  4BE2 A;  4J9G A;  2KYM A;  2RO0 A;  1AZG B;  2ZPB B;  4UC4 A;  5D6W A;  2QI2 A;  4JRI A;  4O5V A;  2O01 E;  3RDV A;  1M1G A;  2KNB B;  3CCQ A;  4K11 A;  3OBY A;  2RQR A;  2XKO C;  2Y90 A;  3DB4 A;  3MEW A;  4P5N A;  1OI1 A;  4FT4 A;  3HL8 A;  3H6Z A;  1ZLM A;  1G8X A;  1N8R R;  4RMO A;  1WQW A;  1M1K R;  3TU4 K;  3G6E Q;  1D1A A;  1LVK A;  3M54 A;  1Q86 U;  2IVW A;  4XQ3 A;  5GAN g;  1VQP T;  2FZG B;  2QQS A;  3OYH A;  3UA6 A;  2EYQ A;  4LDU A;  5LL6 S;  3VS0 A;  2DD4 A;  1VQO Q;  1VOM A;  1MND A;  1M3A A;  5D6Y A;  3N5B B;  1QWE A;  1PNJ A;  2BUD A;  1NLP C;  3HRT A;  5LJ3 j;  1QP2 A;  4E47 A;  2KGT A;  1UJY A;  1KJW A;  2A0F B;  4M4Z A;  4PJO F;  2P0Q A;  3HKS A;  1NEB A;  2CKK A;  3CMA Q;  2CP5 A;  3DLL A;  4AFS C;  2R57 A;  5KYX B;  3E19 A;  1N9R A;  2LP5 A;  2XHC A;  4J9D A;  3DKM A;  2CUB A;  1VA7 A;  4NS5 A;  5LJ5 f;  2M0O A;  4AMC A;  1IRE B;  2GCX A;  1YJN T;  2E6Z A;  4J83 A;  4E7K A;  1UFF A;  2X4X A;  4MZM A;  3OS2 A;  2K2M A;  5GAM j;  5GAO p;  3VS3 A;  1W4S A;  4HKE A;  2OI3 A;  1AD5 A;  4F17 A;  2JN0 A;  2MMP A;  3CME A;  1MMG A;  5LJ5 e;  5GMK i;  2O2O A;  1IGU A;  1M8M A;  4KUI A;  3JB9 J;  2QXF A;  1BYM A;  2DET A;  3G4S A;  2DVJ A;  2GFA A;  1MV3 A;  5KCH A;  1WPY A;  2LX7 A;  1O9S A;  4BDY A;  1WFW A;  1I81 A;  4OMP A;  4X1V A;  3CC2 A;  5LJ3 h;  4RTU A;  3VRZ A;  2AKK A;  2EQK A;  2L8D A;  4C8Q B;  5CR2 A;  1KQS A;  4N4H A;  1LNX A;  2RHX A;  1ZA2 B;  1PCX A;  4LDY A;  2QYZ A;  2YUP A;  1IO6 A;  4M78 B;  2DRM A;  4WTO B;  2DYI A;  2OTJ Q;  1KIK A;  1IRX A;  3EGD A;  4F04 B;  1SEM A;  2DXB A;  3WVD B;  1RAG B;  1D0Y A;  2K3Y A;  4FW2 A;  2PU9 B;  4MZT A;  1Y57 A;  5FRM A;  8ATC B;  1AHJ B;  1AWX A;  2FG0 A;  2P4T A;  4ZN3 A;  2DTI A;  5GAM h;  1YJW Q;  4FYX B;  2KDS A;  1LOJ A;  4L59 A;  1WJR A;  3M0U A;  1AOJ A;  1YHQ T;  2L89 A;  4C0Z A;  2J6K A;  1VQ4 T;  3M58 A;  3CQT A;  4XTX A;  2HD0 A;  2MPX C;  1M27 C;  4E2F B;  3A8O B;  3FLG A;  1QVG A;  3MKD A;  2K4Y A;  1WHH A;  5ECA A;  1K76 A;  4BDZ A;  2QQA A;  3VS4 A;  1NBE B;  4AFU C;  1WXT A;  4RTT A;  1KC8 C;  4GLK A;  1VQ9 T;  4C5H A;  3VS5 A;  1NEG A;  1CKB A;  3EHR A;  4RTY A;  3HHT B;  1QWF A;  2F1L A;  4M7D B;  3SFM A;  1UEB A;  2RPN A;  5HK0 A;  2OTL T;  1Q81 C;  3VJP A;  4J9I A;  1H3H A;  1BI2 A;  3V7C A;  4E6R A;  2YRV A;  4C8Q E;  2R5M A;  2H8H A;  2PQW A;  2VGM A;  3CCJ A;  3THK A;  3I56 A;  2FPF A;  2JS2 A;  2KT1 A;  1KHC A;  3LH5 A;  4M78 E;  5J39 A;  1BI1 A;  1Q86 C;  1D3B B;  1UGP B;  3CD6 T;  1KC8 R;  2XDD A;  2Y4X A;  3ZL7 C;  4WCI A;  1ACM B;  3CXC S;  3RR6 A;  4E7L A;  1GCQ A;  2DA9 A;  2FYK A;  5I22 A;  3LW5 E;  4JJB A;  1K73 R;  3VS1 A;  3M4Y A;  1Q82 U;  1UJ0 A;  1Q81 R;  1AVZ C;  2EPD A;  2YDL A;  1XOV A;  4LE9 A;  6AT1 B;  3BFM A;  2L3R A;  3QKJ A;  2M16 A;  1W2B P;  3L1A A;  3R6N A;  1QKX A;  3QUI A;  2YWW A;  2FEI A;  4J9C A;  2NUP B;  4E7I A;  1Q86 R;  4AG2 C;  4EPC A;  1O75 A;  4HVU A;  3S3N A;  4LDW A;  3CCQ T;  1GFC A;  2WAC A;  2GQI A;  2GQV A;  1VYV A;  3JCM X;  2DJQ A;  2E3I A;  3CCV A;  4M7D E;  2EJG A;  1K1Z A;  1Q7Y U;  1TG0 A;  4N0A A;  1YBY A;  2FPE A;  3HTR A;  4JS4 A;  3Q1J A;  5J26 A;  1IGQ A;  4RTX A;  5M9O A;  2I0N A;  2PVD B;  1JEG A;  1TWB A;  2RHY A;  2ZPH B;  2NUT A;  5KH6 A;  3J7A F;  5AT1 B;  3EFS A;  2H3J A;  2G6F X;  4NOY A;  1BKB A;  1JO8 A;  4FT2 A;  4PKC C;  1M9S A;  4D8K A;  3ME9 A;  1Y71 A;  3UWN A;  2MOX A;  3MP6 A;  5IXF A;  2LTO A;  2P4R A;  2RJF A;  2JW4 A;  3EG3 A;  2K9G A;  3TCJ A;  3L2U A;  2OX7 A;  4C92 G;  4J6Y A;  3CCL Q;  1K9M U;  4JUV A;  3UDC A;  1M3B A;  4A4E A;  1ZBJ A;  3M0R A;  3VS6 A;  3MEA A;  1UTI A;  2BE7 D;  4LUD A;  3QXE B;  2DBM A;  4PK4 A;  2MI6 A;  5KYW B;  2E6N A;  1G3W A;  4OB2 B;  3GF5 A;  3OYK A;  4M77 D;  1M2V A;  2FVU A;  5GAO l;  3EG2 A;  4RCB A;  2KYB A;  4EIK A;  2F5K A;  1FMK A;  1PRM C;  2DEQ A;  2J6F A;  1YJ9 Q;  4A4F A;  2ROT A;  3PT9 A;  2EYW A;  4L5G A;  4OMO A;  5KE3 A;  4JLG A;  1VQ6 A;  1TUD A;  5CKE A;  3VYG A;  2YUQ A;  2CSI A;  4ZN1 A;  1MGQ A;  3EGX B;  1I1J A;  1RAH B;  2RQU A;  1ZX6 A;  2JT4 A;  4DQ2 A;  1PD0 A;  2NLU A;  2XIC A;  1VQP A;  3V8L A;  4M7A G;  1NJI C;  3RMS A;  2WSE E;  4OMQ A;  4RCC A;  2FRY A;  2E4H A;  4M7A B;  1ZUK A;  2CGH A;  1T0H A;  1UGR B;  2CZ6 B;  3P8B B;  5KYN A;  3CXC A;  2CZ1 B;  2QG9 B;  3C95 A;  1J3T A;  2QQB A;  2LCS A;  5D7U A;  1MMN A;  1Y96 A;  4J7I A;  1UHC A;  3EG9 B;  4C0D B;  4ZGJ B;  3TSZ A;  3UA7 A;  3P8H A;  4PJO D;  2IIM A;  1E7O A;  3CCL T;  2YHT A;  1YJN A;  3JCM J;  4A63 B;  3E9F A;  5IN1 A;  1VQL T;  4BY6 B;  2EGE A;  2HDA A;  4PJM A;  3CCS Q;  2COZ A;  1WYX A;  1UGQ B;  4QVZ A;  1VIE A;  2KT8 A;  4A4G A;  5GAM d;  4PLI A;  1HXD A;  2PVO B;  1YI2 T;  2EGA A;  1NJI R;  1OPL A;  1RAA B;  4ZGE B;  2E65 A;  1WDX A;  4C92 A;  2D6F A;  1I5O B;  3V8K A;  3CCU A;  3EHQ A;  3H9N A;  3A98 A;  3QZ5 B;  3T9N A;  2C0O A;  2YRD A;  4PLL A;  4DBF A;  4J9H A;  3I56 T;  3GNF B;  1GCP A;  1M2O A;  3BW1 A;  1WIE A;  1FX7 A;  3OMG A;  2QQ9 A;  3ASK A;  3QWY A;  2JJ9 A;  4RG8 A;  4IUU A;  2ZPE B;  5GAN j;  1NYG A;  3PMI A;  5C6S A;  1WJQ A;  1WLP B;  2BZX A;  3OYB A;  3UT1 A;  1W2B S;  1IZ6 A;  3M55 A;  2A37 A;  2EYY A;  3G6E A;  3MEU A;  1D0Z A;  2RN8 A;  4PJN A;  2BE9 B;  4J6W A;  4C92 C;  4M7A E;  4RG2 A;  2RJC A;  4EMG A;  5I2M A;  3UF4 A;  4CC3 A;  3SWN A;  3QO3 A;  2QEX Q;  1VYT A;  3URG A;  1YHQ A;  2XDP A;  1XTD A;  1EX4 A;  2JM9 A;  3I5S A;  4E7H A;  1VQ4 A;  4A53 A;  2KE9 A;  4XTW A;  4F7U A;  1VQM Q;  2X3W D;  2LJ1 A;  2ROL A;  4FCY A;  5A2Q E;  3CMA A;  2LNH B;  4KT0 E;  4IIO A;  1SSH A;  1C1A A;  3M0T A;  1ZA1 B;  2CZ0 B;  4JJD A;  5CKF A;  5A0L A;  3G71 Q;  2CP0 A;  3QDF A;  2ED0 A;  2CP6 A;  2J7I A;  2V1Q A;  1RI0 A;  3O5Z A;  4IUP A;  4QT7 A;  4MDX A;  2JTF A;  3X28 B;  1QCN A;  5IAY A;  5GAN h;  1VQ7 Q;  1KFZ A;  2X35 A;  1KQS S;  2VWF A;  4Y91 A;  3I35 A;  2RM4 A;  3SWN C;  4Y28 E;  5I11 A;  1SRL A;  1KQ2 A;  1Q95 G;  3H0H A;  2P0K A;  3OYC A;  3H0F A;  1ZSZ A;  3V8J A;  4HT9 A;  2KI7 A;  3REA B;  2M51 A;  2YUN A;  2L5Q A;  4M7A C;  1KQ1 A;  1ZHI A;  1S72 Q;  3NHN A;  1FMV A;  2PVG B;  5GAO q;  1BCM A;  2QA4 Q;  1WJS A;  3FDR A;  2LCC A;  2E12 A;  1C6V X;  1WHJ A;  3JCM Q;  3OB9 A;  3A8G B;  3FC3 A;  1XJW B;  2MAM A;  1W1F A;  2GTO A;  2QAS A;  2GNC A;  2RI5 A;  2EQJ A;  1T3L A;  5HK3 A;  3EH1 A;  4Y92 A;  3JB9 I;  2ZPF B;  1R0B G;  4BY6 C;  5CKD A;  5CIU A;  1AWW A;  3M59 A;  2DXT A;  3JCM d;  2DXU A;  1YJW A;  1ZSZ C;  2KRS A;  1I8F A;  1TH7 A;  1SKU B;  2EBP A;  3RKY A;  2QTV A;  2HAX A;  2D1X A;  4WF2 A;  4IUQ A;  2V1R A;  1B7T A;  4FYV B;  2XID A;  2DXC A;  2CP7 A;  1VQ6 T;  1VQ8 T;  1OZ3 A;  4QQD A;  2EGC A;  4JLI A;  5CKB A;  1PKT A;  5CO7 A;  1WHM A;  2MK5 A;  4C92 F;  3M53 A;  4LN2 A;  1ARK A;  5IT9 E;  4OVA A;  1G3T A;  2HSE B;  1I07 A;  1BB9 A;  1OQK A;  3EH2 A;  3QZ9 B;  3JB9 D;  2F2V A;  3EFO A;  3I55 Q;  3P8D A;  1G83 A;  3AT1 B;  4O6J A;  1I0C A;  1VQ5 Q;  3A8H B;  4LDV A;  2RMO A;  3CPW P;  1W2B A;  4J8O A;  2YT6 A;  1JJ2 P;  1UB4 A;  4CC7 A;  3GP8 A;  1X27 A;  3DB3 A;  2X4Y A;  4PJL A;  1BK2 A;  3OYI A;  3FIF A;  3G7Z A;  4HVV A;  4RTV A;  4IIM A;  3ZEH A;  4XK8 E;  5KE2 A;  1CSK A;  2MF2 A;  2HQX A;  4F7U F;  3ULR B;  2O4X B;  1OYX A;  2QQR A;  3A5Z B;  3CCE Q;  2M1H A;  3CCU T;  1N9S A;  4C8Q G;  1YIT Q;  2JS0 A;  4Z02 A;  2EQM A;  3RMQ A;  4M78 G;  4XU3 A;  4ORZ A;  2E5Q A;  2E41 A;  1X6B A;  2EKO A;  1H3Z A;  3PVQ A;  4JRP A;  2EJF A;  4OF1 A;  3BDL A;  3OYG A;  3CEY A;  2K6D A;  5LJ5 j;  1G5V A;  1ZSG A;  1M30 A;  3OS5 A;  3G6E T;  2EKH A;  3TEE A;  4FIB A;  1RAE B;  1AT1 B;  2Y4Y A;  1VQO T;  1OX8 A;  3OMC A;  4N4G A;  3F70 A;  2F69 A;  1B07 A;  2DYB A;  1YP5 A;  1GRI A;  2K7A A;  2W0Z A;  1FMW A;  2I2L A;  1YIJ Q;  2HQE A;  3CMA T;  2YRC A;  2LCL A;  3ER0 A;  3QSU A;  2RD1 A;  1BI3 A;  1BU1 A;  3MET A;  9ATC B;  3BDU A;  1JXO A;  1R0C B;  3CCL A;  3R6O A;  3OW2 P;  1OU9 A;  1D0X A;  3M0S A;  3QJY A;  3MHX A;  2HEQ A;  1VQL A;  3O8V A;  2HL5 C;  4ZTJ A;  4M7D G;  3RBB B;  2DLP A;  3VU3 C;  5KYX A;  3INZ A;  5GAN 7;  3M0P A;  1U06 A;  4KBM B;  2P84 A;  2VUB A;  1YI2 A;  3X20 B;  2PNI A;  5LJ5 h;  1M90 U;  1JU5 C;  4C5I A;  2D9T A;  3EG0 A;  3OYM A;  3QYG B;  4RTZ A;  1NM7 A;  1UDL A;  2EW3 A;  5I21 A;  3X24 B;  1WI7 A;  1M5Q 1;  2A3L A;  4J5Y A;  1IHV A;  2PUK B;  4F14 A;  2VXE A;  4HCZ A;  1YNZ A;  3OSV A;  2K5L A;  1RLP C;  2MCN A;  3SB2 A;  3JCM f;  2DIG A;  2ZPG B;  4IUT A;  4X34 A;  2FPD A;  2K3B A;  4MMK A;  3OYD A;  2OTJ T;  3JAM E;  5GAN d;  2DIQ A;  1X2K A;  1T3S A;  2YXY A;  3JCM e;  2GFU A;  1KD1 U;  1W70 A;  4M78 A;  3D7S B;  2GF7 A;  1ZUY A;  1BIA A;  2KR3 A;  1UG1 A;  2O31 A;  2QTX A;  4E7J A;  5CCA A;  1YJW T;  2DBK A;  2DIL A;  1JB0 E;  2DTO A;  4Z89 A;  2OAU A;  2EVR A;  2DMO A;  1KHI A;  1HJD A;  2HCK A;  2JVV A;  4A4K A;  2M0Y A;  5GAN 4;  3GOX A;  2H3E B;  2K57 A;  3CME Q;  2CT4 A;  4J6X A;  4KUL A;  3MP8 A;  2HZY A;  4C8Q C;  4M75 G;  3G4S Q;  2DKG A;  3HP9 A;  2X51 A;  2AKL A;  4M78 C;  2YLB A;  2JZ2 A;  4M75 B;  2LX9 A;  3CC2 Q;  3CPW S;  4OB1 B;  4AT1 B;  3C12 A;  3JB9 F;  3M56 A;  1JJ2 S;  5LJ5 g;  1X6O A;  3M5A A;  2AZV A;  1TXQ A;  3OYF A;  3RER A;  2A7Y A;  3WVE B;  3KFV A;  3U23 A;  4M7D A;  3RKX A;  3TSW A;  4MDW A;  4M77 B;  4KGX B;  2EJ9 A;  2V8K A;  1UGS B;  1EIF A;  3HPW A;  3VYH B;  2DZC A;  1VQK Q;  3VS7 A; 
#chains in the Genus database with same CATH homology
 4BI4 A;  4PLL A;  1K8A C;  3AHU A;  4BE2 A;  2RO0 A;  3OYY A;  4VUB A;  3I56 T;  2ZPB B;  3GNF B;  4UC4 A;  2LDM A;  5D6W A;  2QI2 A;  3MEV A;  3BW1 A;  4JRI A;  1S72 A;  1FX7 A;  4O5V A;  3OMG A;  2P0P A;  3NTK A;  1VUB A;  2O01 E;  4C8Q D;  4QQ6 A;  3OY9 A;  1M1G A;  4XU0 A;  3CCQ A;  2QQ9 A;  3ASK A;  4RG8 A;  4HCC A;  2JOY A;  5A0D A;  2DPP B;  3OBY A;  2DO3 A;  4IUU A;  2ZPE B;  3L2W A;  2KK4 A;  1D3B A;  2XKO C;  2Y90 A;  3DB4 A;  3M9Q A;  3MEW A;  4M78 D;  1OI1 A;  3PMI A;  1WJQ A;  2DZ9 A;  3C94 A;  3HL8 A;  3H6Z A;  4FT4 A;  3KBG A;  4FL6 A;  3UT1 A;  2RK2 A;  1YCY A;  3JSC A;  4JS5 A;  1W2B S;  1IZ6 A;  3M55 A;  4RMO A;  3G6E A;  3LGF A;  3KXT A;  1WQW A;  3MEU A;  4HCB A;  3OS0 A;  3TU4 K;  5HY6 A;  2ZZD A;  5CK9 A;  4PNO A;  2D0Q B;  4J6W A;  3QG1 A;  4C92 C;  3HFO A;  4M7D C;  4M7A E;  3CBM A;  4RG2 A;  5C6S A;  3M54 A;  3CCE T;  2QEX A;  1Y7X A;  2IG0 A;  2IVW A;  2RJC A;  1Q86 U;  4EMG A;  1YJ9 A;  3QBY A;  2EFI A;  4XQ3 A;  5GAN g;  1VQP T;  2WSC E;  5I2M A;  1ZBX A;  2QQS A;  3OYH A;  1YIT T;  2EYQ A;  4LDU A;  3QO3 A;  3SWN A;  4XTY A;  5LL6 S;  3JCM c;  3URG A;  1YHQ A;  2XDP A;  1XTD A;  2DD4 A;  2O4X A;  2FHD A;  2XG8 D;  4E7H A;  1VQ4 A;  1K73 C;  4A53 A;  4XTW A;  4F7U A;  5D6Y A;  3N5B B;  3GNG A;  2BKD N;  4OB3 B;  1PSF A;  2BUD A;  5A2Q E;  3HRT A;  5LJ3 j;  4BE1 A;  1QP2 A;  2KMT A;  4E47 A;  3JRZ A;  3CMA A;  3PGG A;  4KT0 E;  1VQ8 A;  3PIO A;  4C8Q A;  3FEO A;  5FU6 B;  4PJO G;  5GAN 5;  1P92 A;  3CCM A;  4M75 E;  1QVP A;  2P0Q A;  3HKS A;  2CZ0 B;  2CKK A;  3L42 A;  4PJO F;  5CKF A;  5A0L A;  1VQN A;  4EMK B;  3DLL A;  1JBM A;  2R57 A;  3E19 A;  1N9R A;  1M1F A;  2K3X A;  2XHC A;  3GLX A;  3ZFJ A;  3DKM A;  4PJO B;  1RI0 A;  2RHI A;  3QHS A;  1NJI U;  4IUP A;  3CPF A;  2EWN A;  4NS5 A;  5LJ3 g;  2EQU A;  4MDX A;  2JTF A;  3X28 B;  5LJ5 f;  2M0O A;  3HRS A;  5IAY A;  4OGC A;  2LC4 A;  5GAN h;  3UPU A;  3QSU A;  1IRE B;  4EDU A;  2GCX A;  4M77 E;  1YJN T;  2E6Z A;  4J83 A;  4IKF A;  4E7K A;  2X35 A;  3L2Z A;  2HNI A;  4MML A;  3RKW A;  4C92 D;  1KQS S;  4M7D D;  2X4X A;  2KAF A;  2VYT A;  4Y91 A;  4MZM A;  1JRI A;  2RM4 A;  3OS2 A;  3SWN C;  5GAM j;  5GAO p;  4Y28 E;  1N27 A;  1W4S A;  4HKE A;  1KQ2 A;  2P0K A;  3OYC A;  2JN0 A;  2MMP A;  5LJ3 d;  4DOV A;  3CME A;  5LJ5 e;  5GMK i;  3A8M B;  4DA4 A;  4C5G A;  1YIJ T;  1QVF A;  4KUI A;  2EIF A;  3V8J A;  3JB9 J;  2QXF A;  4HT9 A;  1BYM A;  1N6A A;  3G4S A;  4DOW A;  3RES A;  2LT1 A;  3J80 E;  4IUV A;  2L5Q A;  3GIB A;  4M7A C;  1KQ1 A;  3CBO A;  2GFA A;  5FU7 B;  4C8Q F;  5GAM g;  5KCH A;  1WPY A;  1ZHI A;  2DK3 A;  1Q82 C;  1O9S A;  3LLR A;  5KCO A;  4BDY A;  2PVG B;  1I81 A;  5GAO q;  3CC2 A;  3OBW A;  5LJ3 h;  3CCS A;  4M78 F;  1WJS A;  3LYI A;  1QP3 A;  2EQK A;  2L8D A;  3C4S A;  3FDR A;  2LCC A;  3KUF A;  4N4H A;  3S6W A;  5CR2 A;  1LNX A;  2E12 A;  4BI3 A;  2RHX A;  3EAE A;  4N4I A;  4LDY A;  5HKC A;  4NL2 A;  2LQK A;  4OP0 A;  3GPL A;  3JCM Q;  3OB9 A;  4M78 B;  5DLO A;  4ZGD B;  3A8G B;  3FC3 A;  4M77 G;  1NZ9 A;  2MAM A;  2RI5 A;  2EQJ A;  2DXB A;  2XU8 A;  5HK3 A;  4M75 C;  3JB9 I;  2ZPF B;  3WVD B;  4BY6 C;  2RB6 A;  5CKD A;  5CIU A;  3M59 A;  3HFN A;  1B34 B;  1H64 1;  2K3Y A;  4C5E A;  3CCR A;  1BI0 A;  2PU9 B;  4MZT A;  2DXT A;  3JCM d;  3TRE A;  2DXU A;  2K2V A;  4XU2 A;  1YJW A;  1VQL T;  5FRM A;  5A0G A;  1AHJ B;  2P4T A;  4ZN3 A;  1NPR A;  1Q7Y C;  3PIP A;  1I8F A;  1TH7 A;  3DLM A;  1I5L A;  2DTI A;  1YJ9 T;  5GAM h;  4OB0 B;  3RKY A;  3CCU T;  2KDS A;  1LOJ A;  4L59 A;  1WJR A;  3CPW A;  2QDY B;  3NTI A;  5GAN e;  1YHQ T;  5GMK e;  2L89 A;  4C0Z A;  2HAX A;  1VQ4 T;  2B8A A;  4BB7 A;  3M58 A;  1JJ2 A;  4WF2 A;  1Y96 B;  4FM4 B;  4IUQ A;  4XTX A;  3OYA A;  3JCM h;  4PJO E;  4BUG A;  2HD0 A;  4YTL A;  3OSS C;  4X9D A;  3PFS A;  2XID A;  2DXC A;  3A8O B;  4OGE A;  3FLG A;  1VQ6 T;  1QVG A;  1VQ8 T;  1OZ3 A;  2K4Y A;  2YLC A;  4BDZ A;  4QQD A;  5FLX E;  2QQA A;  3VV0 A;  4JLI A;  5CKB A;  1KG1 A;  1KC8 C;  5CO7 A;  4GLK A;  1VQ9 T;  4C5H A;  2LRQ A;  4C92 F;  3M53 A;  4M7D F;  5IT9 E;  3LH0 A;  4M75 D;  3OA6 A;  4GY5 A;  4N0A C;  3NFC A;  3RIR A;  1VQO A;  3VUB A;  2E70 A;  4OVA A;  4B9X A;  3QJ6 A;  2E10 A;  4XTV A;  4JJN K;  3HHT B;  1G3T A;  2CYZ B;  3A8L B;  2RJE A;  4BD3 A;  4C92 B;  1VQM A;  3I55 A;  4M7D B;  3SFM A;  1K9M C;  2RHU A;  2ZPI B;  2DTH A;  1UEB A;  5CQY A;  3QZ9 B;  3JB9 D;  3OYJ A;  5HK0 A;  2OTL T;  1M8V A;  1Q81 C;  3P8D A;  3VJP A;  1BI2 A;  2R58 A;  2RK1 A;  1M90 C;  2WSF E;  4O6J A;  1I4K 1;  3V7C A;  3A8H B;  4LDV A;  1W2B A;  2YRV A;  3G71 A;  4XAX B;  3CME T;  4M7A A;  2VGN A;  2R5M A;  2PQW A;  4J8O A;  4C8Q E;  2VGM A;  3CCJ A;  3I56 A;  2PUO B;  5GAN 3;  1UB4 A;  1KHC A;  3LGL A;  3G4S T;  4BE0 A;  3E9G A;  3GP8 A;  5GAN 2;  4M78 E;  5J39 A;  1BI1 A;  1Q86 C;  3DB3 A;  2X4Y A;  3JCM V;  4L6V 5;  1VQ7 A;  1D3B B;  1UGP B;  4XTZ A;  3OYI A;  3FIF A;  2BIV A;  2ZGW A;  1MHN A;  3LX7 A;  3E1S A;  3G7Z A;  3CC2 T;  3CD6 T;  3PMT A;  5J3B A;  5C0M A;  4ME7 A;  2XDD A;  3CCS T;  4EMK C;  4C0G A;  4BAC A;  2VXF A;  2Y4X A;  2E1H A;  5DLQ E;  5DY9 A;  3ZEH A;  3CXC S;  1X75 C;  3PNW C;  3L2V A;  4M75 A;  1WNL A;  4QW2 A;  4TVR A;  4XK8 E;  4E7L A;  3WXM B;  5KE2 A;  3OW2 S;  2FYK A;  4ZTF A;  2X4J A;  2MF2 A;  3LW5 E;  4F7U G;  2HQX A;  1GXI E;  4F7U F;  3CCE A;  2KVQ G;  3SWN B;  1PSE A;  1WGS A;  3M4Y A;  1Q82 U;  1VQK T;  3JB9 H;  2O4X B;  1OYX A;  1KD1 C;  1XOV A;  1YIT A;  2QQR A;  3A5Z B;  4KUD K;  2M1H A;  3BFM A;  1G3S A;  2L3R A;  1N9S A;  3QKJ A;  2M16 A;  3BY7 A;  3MP1 A;  4M77 A;  3VKI A;  4F7U B;  4C8Q G;  3S3O A;  5CQX A;  4BI8 B;  4MZP A;  2QA4 A;  3L1A A;  4JDS A;  1RL2 A;  3QUI A;  4Z02 A;  3CC7 A;  2EQM A;  2M9U A;  2VC8 A;  4EMH A;  1N8R U;  3RMQ A;  4M78 G;  4XU3 A;  2KY9 A;  4QVC A;  2E5Q A;  2E41 A;  4E7I A;  2OTJ A;  2EKO A;  1H3Z A;  4EPC A;  1O75 A;  3S3N A;  3JCM g;  4JRP A;  2EJF A;  4C0D C;  5D6X A;  4LDW A;  3VUZ A;  3CCQ T;  5EG2 A;  3OW2 A;  4XTU A;  2WAC A;  4R55 A;  3OS1 A;  2GQV A;  2JUF A;  3BDL A;  4OF1 A;  3CEY A;  3JCM X;  3OYG A;  3HRU A;  3CC4 A;  5LJ5 j;  5DM7 R;  3CCV A;  1G5V A;  3FJP A;  4C92 E;  4M7D E;  2EJG A;  1K8A U;  5GAN f;  1Q7Y U;  3OS5 A;  3G6E T;  2E64 A;  1M4Z A;  4N0A A;  1YBY A;  5L8R E;  3V7S A;  5GAN 8;  4JS4 A;  3Q1J A;  5J26 A;  3TEE A;  5M9O A;  5CAI A;  4FIB A;  2PVD B;  5FRN A;  4C0F A;  5GAO n;  2QEX T;  3L2R A;  2XI9 A;  2Y4Y A;  1VQO T;  3FB9 A;  2RHY A;  2ZPH B;  5KH6 A;  4IUR A;  4M77 C;  3J7A F;  2F5T X;  3OMC A;  1VQM T;  3EFS A;  2H3J A;  4M7A D;  4N4G A;  4NOY A;  1BKB A;  4A4H A;  2KSS A;  4FT2 A;  3M4G A;  4PKC C;  3F70 A;  1M9S A;  4X9C A;  5GAN 6;  2F69 A;  1HK9 A;  4V2S A;  3ME9 A;  1KC8 U;  2I2L A;  2HQE A;  1Y71 A;  3JCM P;  3CMA T;  3UWN A;  3G71 T;  2LCL A;  1NPP A;  3ER0 A;  3MP6 A;  2RD1 A;  5LJ3 f;  1BI3 A;  2LTO A;  5FRO A;  5LJ5 d;  3MET A;  3CCM T;  3CCJ T;  2V8J A;  3BDU A;  2X4W A;  2RJF A;  3CCL A;  4CRI A;  3R6O A;  1VQN T;  3LWH A;  2RJD A;  3TCJ A;  3JCM b;  3L2U A;  3QJY A;  3MHX A;  3MO8 A;  1VQL A;  2DAQ A;  3O8V A;  4C92 G;  4J6Y A;  2FB7 A;  4EMK A;  3OYB A;  4ZTJ A;  1K9M U;  4M7D G;  3VU3 C;  4B9W A;  2CS7 A;  1VQ7 T;  4JUV A;  3UDC A;  1K73 U;  3INZ A;  4QQG A;  5GAN 7;  4A4E A;  4C8Q B;  1KQS A;  4PJO A;  3MEA A;  4HT8 A;  1Q81 U;  3QXE B;  4KBM B;  2JTM A;  2VUB A;  3EFR A;  5LJ3 e;  3X20 B;  3L2Q A;  5GMK j;  1YI2 A;  5LJ5 h;  4CI0 C;  1M90 U;  4LDX A;  1XNI A;  2MI6 A;  4C5I A;  2E6N A;  2D9T A;  4LD6 A;  4F7U E;  1G3W A;  4OB2 B;  3OYM A;  1VQ5 A;  3QYG B;  3GF5 A;  2RI3 A;  5I21 A;  3X24 B;  3OYK A;  3NTH A;  1M5Q 1;  4M77 D;  2A3L A;  4J5Y A;  2FVU A;  4JRK A;  4FSX A;  5GAO l;  5GAM f;  4RCB A;  4RKU E;  1BIB A;  2PUK B;  2F5K A;  2KQW A;  2MWO A;  4XU1 A;  5CVI A;  2JNG A;  1V29 B;  3H8Z A;  2VXE A;  3QDR B;  4HCZ A;  1FWZ A;  4J7F A;  2DEQ A;  3OSV A;  4A54 A;  1S72 T;  4ATO A;  2K5L A;  2LQ8 A;  2ZCF B;  4A4F A;  4FU6 A;  2R5A A;  3QYH B;  3OYL A;  2DJZ A;  3SB2 A;  3JCM f;  3PT9 A;  2QA4 T;  2RA2 A;  3MCA B;  4P5N A;  5GAO r;  2DIG A;  4L5G A;  3CC7 T;  5FU6 C;  5GAM e;  1R8O B;  2ZPG B;  4IUT A;  4X34 A;  5KE3 A;  4MMK A;  4JLG A;  1VQ6 A;  1XQH A;  5CKE A;  3VYG A;  4ELY C;  2G3R A;  3OYD A;  2RH2 A;  5GAN d;  2XK0 A;  3JAM E;  3PTA A;  2OTJ T;  3OQ5 A;  3LWI A;  4PJO C;  2XD0 A;  2DIQ A;  3QPH A;  4ZN1 A;  1MGQ A;  4D6W A;  1LJO A;  2CZ7 B;  3JCM e;  2GFU A;  1G3Y A;  1KD1 U;  1QVF S;  4R56 A;  1Y07 A;  4NL3 A;  4M78 A;  1VQ9 A;  2VV5 A;  2AHJ B;  2GF7 A;  2LVM A;  3CC4 T;  3CCV T;  3J81 E;  1BIA A;  2MWP A;  3M57 A;  4DQ2 A;  4ELZ C;  1WQ7 A;  2NLU A;  2XIC A;  3QII A;  1VQP A;  2QTX A;  3V8L A;  5GMK l;  3CCR T;  1U1S A;  4E7J A;  5GMK h;  4M7A G;  4QVD A;  5CCA A;  3OYN A;  3JCM W;  1YJW T;  1B34 A;  4M7A F;  1NJI C;  3RMS A;  2K5F A;  1JB0 E;  2WSE E;  1VIF A;  2RHZ A;  2DTO A;  4HA8 A;  3X26 B;  1OZ2 A;  2C06 A;  2OTL A;  2OAU A;  4PL6 A;  4RCC A;  3X25 B;  1M1K C;  4M7A B;  2EAY A;  3V7R A;  2CZ6 B;  2CGH A;  3P8B B;  1UGR B;  1KHI A;  2DVE A;  3CXC A;  4M7D A;  5GAO m;  2JVV A;  2CZ1 B;  4A4K A;  3SDZ A;  4JRQ A;  3C95 A;  5FU7 C;  2QQB A;  5GAN 4;  3GOX A;  2K57 A;  4J6X A;  4KUL A;  1FXX A;  3MP8 A;  1Y96 A;  4J7I A;  3S3M A;  4C8Q C;  5I2S A;  2RI2 A;  4C0D B;  1M1K U;  4M75 G;  3HSB A;  4ZGJ B;  4M75 F;  1U1T A;  2DKG A;  1NE8 A;  2DD5 A;  3ZBD A;  3P8H A;  4PJO D;  3HP9 A;  3CD6 A;  3CCL T;  2YHT A;  4M78 C;  2YLB A;  3OYE A;  2JZ2 A;  1YJN A;  3JCM J;  3E9F A;  2LT4 A;  2V8I A;  4II1 A;  4M75 B;  5AYF A;  5IN1 A;  3SD4 A;  2LX9 A;  4BY6 B;  3CBP A;  5GAN j;  3JB9 G;  3CPW S;  4OB1 B;  3JB9 F;  3C12 A;  3M56 A;  1N8R C;  1UGQ B;  4QVZ A;  1ZQ1 A;  1VIE A;  5LJ5 g;  1JJ2 S;  4A4G A;  1U8R A;  1X6O A;  3M5A A;  1HXD A;  2PVO B;  3FRN A;  4M77 F;  4PLI A;  4Q5W A;  1DJ7 B;  5GAM d;  3OYF A;  3I55 T;  1YI2 T;  2LNV A;  3RER A;  4ZGE B;  2E65 A;  2A7Y A;  3WVE B;  4C92 A;  2D6F A;  3RKX A;  1YIJ A;  4OMF B;  1QVG S;  2HBP A;  5CKH A;  4MDW A;  1VQ5 T;  4M77 B;  2FL7 A;  1VQK A;  2K5I A;  1X01 A;  4LD9 K;  2EJ9 A;  2V8K A;  1UGS B;  1EIF A;  3HPW A;  3V8K A;  2XDB A;  3RUX A;  3CCU A;  3VYH B;  2DZC A;  1QW1 A;  5GMK m;  3QZ5 B;  3T9N A;  1SSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...