4GY5A

Crystal structure of the tandem tudor domain and plant homeodomain of uhrf1 with histone h3k9me3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
215
Chain Sequence
FLYKVNEYVDARDTNMGAWFEAQVVRVTRKEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 215
sequence length 232
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A01
2.30.30.1150 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A02
2VYTA 2MWPA 2X35A 2RJDA 4N4HA 4EDUA 1RI0A 5D6WA 3OYBA 3S3NA 2O4XB 2G3RA 4FU6A 1XNIA 1WJSA 3OY9A 3FLGA 3EAEA 2EQMA 2JZ2A 3OYLA 4C5HA 4B9XA 2M16A 3ME9A 4IUQA 3E9FA 4C5EA 2EKOA 3CEYA 4QQGA 3KUFA 3NTKA 4Z02A 3UWNA 2MWOA 4QQDA 5KCOA 2LVMA 4BE0A 3H6ZA 2RO0A 2L89A 3M9QA 4RG2A 2CKKA 3FDRA 3MEVA 3LGLA 3BDLA 3META 2E6NA 4C5GA 5CIUA 5D6XA 3P8HA 5IAYA 4N4GA 4E7LA 4QW2A 2RJCA 2RHIA 4PL6A 1WJRA 3OYJA 3L2VA 2GF7A 3MO8A 2GFUA 2PQWA 3MEAA 2BUDA 2RI5A 4BD3A 3ZEHA 5C0MA 4BE1A 2RJEA 2BKDN 2RHXA 5D6YA 3S3MA 1OZ3A 1WJQA 3GOXA 4BDYA 2DIGA 4BDZA 2BIVA 3QJ6A 1H3ZA 2M0OA 5J26A 5FROA 5KCHA 3OS2A 3OB9A 4ZTFA 4HCZA 4UC4A 2GFAA 2QQRA 4IUTA 4IUUA 3OYAA 3L2WA 3MP1A 4A4GA 2DIQA 2X4YA 3OMGA 5KH6A 3O8VA 2K3XA 4PLIA 4PLLA 3OYGA 2DAQA 3MEUA 2NLUA 3DB3A 4BACA 4E7KA 4II1A 2X4XA 2RI2A 2IG0A 3PFSA 3OYHA 4A4EA 4FL6A 2EFIA 2K3YA 2RHZA 3P8DA 4LD6A 1OZ2A 2P0KA 2XK0A 1MHNA 1KHCA 3QKJA 4A4HA 3L2UA 3S3OA 5KE2A 2R5MA 3MP6A 3FEOA 4C5IA 4IKFA 2QQSA 3NTIA 3PMTA 3LYIA 4NS5A 3S6WA 2E5QA 3E9GA 4A4FA 2EQUA 2L3RA 2RI3A 2R58A 5M9OA 5FRNA 3NTHA 2WACA 2RJFA 3H8ZA 1N27A 3F70A 4N4IA 2JTFA 2LRQA 2YRVA 5IN1A 3OS0A 3OYMA 2L8DA 1OI1A 3LH0A 3C4SA 4GY5A 2HQXA 2B8AA 3OYKA 4IURA 3LLRA 3OYNA 4IUPA 5KE3A 4BE2A 3OYFA 2X4WA 3DB4A 2EQKA 3OYDA 5C6SA 3OQ5A 4QVZA 2D9TA 3MP8A 3QBYA 4Q5WA 3L2RA 2R57A 2M1HA 1WGSA 2XDPA 4QQ6A 4ZTJA 3Q1JA 5J39A 4E7JA 2LTOA 4E7IA 3FC3A 1G5VA 3L2QA 2F5KA 3SD4A 5FRMA 3LX7A 4E7HA 3OYIA 3OYCA 2LCCA 4OVAA 2HQEA 4CRIA 2O4XA 3LGFA 3MEWA 3OS1A 2R5AA 4X34A 3DLMA 3OMCA 2LDMA 3PMIA 2RHUA 3PNWC 3L42A 4L59A 1OYXA 1SSFA 2RHYA 3ASKA 3QIIA 4B9WA 2EQJA 3UT1A 3OA6A 4IUVA 2FHDA 3OYEA
chains in the Genus database with same CATH superfamily
3CCVT 3OBYA 1NJIC 4C0GA 5GAMh 1YJ9A 4C8QF 3NHNA 2CH4W 3CEYA 2E70A 4J9HA 3QYGB 2PNIA 2L2PA 4GBQA 4C0DC 4M75E 4CC7A 1BI2A 1QKWA 1YNZA 3EFOA 3JCMP 5IAYA 2YLCA 2D1XA 2DX1A 1WJRA 1XQHA 1TG0A 4BD3A 3ZEHA 4AMCA 1OQKA 1YJWQ 2P0QA 1X2QA 2JS2A 1ZSZB 4BDZA 4XK8E 2E1HA 5GAN5 3G7ZA 2VWFA 2K3XA 2QEXQ 1K0XA 3EGUA 3CC7Q 4MMLA 1VQ6T 3LW5E 1PRLC 2PUKB 2QK0A 4HVUA 3CXCA 2XK0A 3S6WA 1QVGP 2E5QA 2DXBA 1U1SA 2EQUA 5GANd 1VQ6A 1IHVA 5M9OA 2QGGA 2ED1A 5CQYA 3QZ5B 1ZBJA 4AG2C 3EGDB 3M56A 1KQSA 2AZVA 3QO3A 1QLYA 3SWNB 1G2BA 2KAFA 2F5TX 2HQHA 1M3AA 4RTVA 3A8GB 2BE9B 4FSSA 3VRZA 3LX7A 4E7HA 3EFSA 4OVAA 1VQ9A 2O4XA 3EFRA 1Q7YR 2X51A 1ABQA 1D1BA 1PM3A 2JM8A 1I0CA 3VRYA 2KRNA 2EQJA 3RMSA 1EX4A 4A53A 2AKKA 2AT1B 2D0QB 3OW2A 4LDYA 2P0PA 3CPWP 2YRDA 4J7FA 2J05A 4C5HA 2EKHA 3ZL7C 3E9FA 4Z88A 1WFWA 4FM4B 4J8OA 1ZA1B 2DXTA 4LDVA 4F7UG 4M75A 3CXCS 3WVEB 2FZGB 1NJIR 4C92C 3JRZA 2DK3A 1RLQC 3EGXB 5D6YA 2A36A 4LNPA 2P4RA 3KXTA 1W2BP 1NPRA 3CCRT 1KQSS 1QQJA 1WHHA 3UF4A 3HTRA 4EIKA 4J5YA 4F14A 3VS7A 1FWZA 6AT1B 1H641 1PKTA 4OGCA 3CCRA 2FG0A 3THKA 2PVGB 1AZEA 5KYUA 2KT8A 1H92A 3PVLA 3A1PA 1B34B 3JB9I 4C5IA 1BYMA 2CUDA 5GANe 1KIKA 2CT4A 1J3TA 2L3QA 3E9GA 2DA9A 5FRNA 4OP0A 2OAUA 3BW1A 1GBRA 3JB9H 2JTFA 1TXQA 3REBB 1OI1A 2EYQA 3VYHB 5KE3A 2V26A 3CCST 1UFFA 3EG0A 2EPDA 2PTKA 4M78G 4RTUA 3JCMJ 3G4ST 5IXFA 4C8QE 4OB3B 5I2SA 3CCSA 3OYIA 2ZPHB 3QZ9B 4EMKC 2JVVA 3CPFA 5GAOn 1BI0A 2R5AA 4E7ZA 3G4SA 4B9WA 5HK3A 5LJ5d 2DL5A 2VYTA 3MJXA 1SKUB 3I55T 1UGVA 4KGXB 4XTWA 1EZZB 5LJ3f 2QYZA 3OY9A 3G71A 4XQ3A 1AWOA 3RERA 1VQPQ 1H8KA 3KUFA 2QQAA 5A0GA 3I55A 3CMEQ 1B3QA 1K9MU 1E6HA 1B07A 1W6XA 3LGLA 3QUIA 1VQ7A 4OMPA 3TSZA 3G6ET 1YWPA 2COZA 4M78C 3MCAB 2ROLA 2FZKB 4KULA 3PIOA 2WSFE 4OMMA 3SHWA 2PQWA 2BUDA 2E4HA 2RMOA 5AYFA 2RHXA 3S3MA 2LJ3A 4EPCA 2FRYA 4C92A 2RNAA 1G8XA 5FROA 3OS2A 2V1QA 1VQ4T 5LJ5h 2RQWA 1JQQA 2GQVA 3HRTA 1QMCA 1KJWA 4LN2A 4E7KA 4C92D 2E3IA 4XU0A 4FT4A 4L6V5 1RUWA 1VQ4A 2DTHA 2P0KA 2NUPB 4WCIA 5FLXE 3UPUA 1GCQC 1S72Q 1VUBA 5KYYA 3OSSC 2A7YA 4ZN3A 1M30A 5IN1A 3OYMA 4J6YA 4GY5A 3RESA 2FEIA 4DBQA 1U1TA 2RQRA 3TREA 1TUCA 2M1HA 1AOJA 2DERA 5GMKe 5FU7B 1K8AC 3JB9G 3CQTA 3X25B 5LL6S 4PFOA 2CT3A 3QIIA 4ZN1A 1AEYA 5LJ5e 1T3SA 4X9CA 1T0JA 2O4XB 4FU6A 1QWFA 1I81A 1MMAA 2SRCA 1KC8U 5GMKm 5KCOA 3H6ZA 1NPPA 2L89A 3M0QA 4ZGDB 2HL5C 3BDLA 2ZPBB 2E6NA 1QVFP 2BZYA 2O88A 2V8IA 4M77G 1R8OB 1Q82U 3KFVA 1M90U 2RJCA 2OTLT 3JSCA 2C06A 4PNOA 3IQLA 1YI2Q 1RLPC 1X2KA 2M02A 1M1KC 4K11A 4C0DB 1M9SA 2KRMA 2W0ZA 3M0SA 1VQ5T 2EGEA 4OF1A 1NLOC 1VQMA 2L3PA 2X4YA 1QP2A 3OMGA 4JRQA 1GRIA 1NBEB 3WXMB 4XTXA 1QVPA 2O2OA 4PLIA 1UTIA 1OV3A 1WHJA 3OYHA 1TU0B 2LNVA 4RCBA 3GF5A 2CGHA 5KE2A 1JO8A 1OPKA 4LDUA 5KYUB 2KMTA 4M75F 1GCQA 2VXEA 3U23A 4JZ3A 2V8KA 5GANf 2HQXA 3RKXA 1MV0B 2KE9A 4RKUE 5C6SA 3I56A 1QVGA 1TUGB 4J9GA 1SRMA 3L2QA 2CZ0B 2MI6A 5KYNA 4BI3A 4FW1A 5DLOA 5IHNA 3HRSA 2LCLA 1O75A 1D1AA 2DBKA 2I2LA 4DA4A 2CDTA 2NWMA 1XNIA 2J6FA 1VQKT 4NL3A 2JZ2A 1YJNT 1XJWB 1K8AR 5GAOm 3HP9A 3UWNA 4BE0A 4QQDA 2F2VA 5KYWA 2K7AA 1BU1A 2QXFA 3META 1VQKA 3JCMV 3ZFJA 5DLQE 2ZPFB 1TH7A 2DL4A 4J9FA 3CPWA 4IIOA 1IGUA 2I0NA 1VQLQ 5GANg 1WXUA 4JLIA 4XU1A 2DPPB 2LJ1A 2DD5A 1JRIA 1K9AA 4A54A 4PFZA 2GBQA 5CQXA 5GAN2 2LP5A 1ZQ1A 3RKWA 4ZTFA 3VU3C 4D6WA 3L1AA 2CYZB 4C92B 1X6OA 4A4GA 3E2UA 3O8VA 2AK5A 4CC4B 3CCJT 2D6FA 1VYUA 2JOYA 1ZA2B 4R0KA 4M7AC 1W2BA 3JCMc 1LCKA 4KUIA 4R55A 4XU2A 3CCLQ 1D09B 1UHCA 3FEOA 2YUOA 2VGNA 4Z89A 3CCJA 2QDLA 4FYWB 4XTZA 1YJWA 2D0NA 3RBBB 2YDLA 2HCKA 3OYNA 1VQ8Q 5KYYB 5ECAA 2JN0A 3NPFA 5CKEA 4J83A 4C92F 2D9TA 2MIOA 4DBHA 3EG3A 1NG2A 3CC7A 2F5KA 3A5ZB 3OYCA 3M4YA 2AIRB 3DLMA 3OMCA 2DYIA 4DQ2A 3CC2Q 2IVWA 1Q7YC 4N4HA 2YHTA 1BBZA 4HKEA 5LJ5f 3CCQQ 3VUZA 1Q81R 2FYKA 3HSBA 2DETA 1RABB 2RO0A 2RH2A 4RG2A 1ZUKA 2EJGA 5IHIA 4C5GA 4IIMA 2COYA 3CBOA 1W2BS 1VIEA 4EMGA 1IHWA 2QG9B 1FMWA 2DL7A 4BI4A 5I22A 1WXTA 2J7IA 1YN8A 2JUFA 2OAWA 1AVZC 2XIDA 1UB4A 1WJQA 5I2MA 2KDSA 4HT9A 4Y92A 1BK2A 2HDAA 1HYOA 4M78B 5DY9A 2KR3A 1HJDA 3C12A 4OB2B 1OPLA 1ZSGA 4AFUC 2E6ZA 1O9SA 2L0AA 2C0OA 3O5ZA 2K3YA 2BE7D 1YCSB 2YXYA 1OZ2A 3WVDB 2DEUA 5IXBA 1M8MA 3MP6A 1WQ7A 4MZMA 2O9SA 2GQIA 2EJFA 4BI8B 2L3SA 3F70A 3NGPA 4OMQA 2XICA 4ELYC 1VQNQ 2NUPA 4HT8A 2LX9A 2ABLA 2X4WA 3I9QA 3CD6T 2HAXA 1HSQA 3R6NA 2M9UA 1BB9A 4M7AD 1W1FA 1VQOQ 1WPYA 3MKDA 2QA4Q 2E64A 3AT1B 5GAMe 3CD6A 2ROTA 2HQEA 4RMOA 3JCMf 3CC4T 2NUTB 1K76A 4TVRA 1OYXA 2EAYA 3QWXX 1H3HA 2HMAA 4EDUA 2LC4A 2NYSA 1M2VA 1M1KU 1ZX6A 1VQ9T 2QI2A 3CC4A 1OEBA 3RDVA 2GCXA 2MPXC 3M0RA 3QPHA 4PJOG 4R56A 2OTJQ 2KYBA 3FDRA 2JS0A 4JUVA 1YHQQ 5CR2A 4N4GA 5I11A 2DNUA 2VVKA 2JW4A 2K57A 5KYWB 5IT9E 2KNBB 1LOJA 3CMAQ 2RI5A 2HKNA 3M59A 4MDXA 4BY6C 1QVFA 1VQPT 3C94A 3ER0A 4E47A 4O5VA 1NZ9A 5CKBA 1YJ9Q 1MMGA 2FB7A 1JJ2P 4HCZA 3H0HA 4XTYA 2LMJA 2AKLA 1YIJQ 3JCMg 3HFNA 2F2WA 3EHQA 3UA6A 4FIBA 2LT4A 2DILA 2YUQA 1VQPA 4PLLA 5EG2A 4J9BA 4CI0C 3CCVQ 1QCNA 1X69A 3CMEA 2DRKA 4PJOC 3PFSA 4C92E 4JJNK 1UJYA 3L2UA 1MHNA 2PVDB 3PGGA 4X9DA 4M7DG 4HVVA 1M2OA 3NTHA 1V1CA 1OU8A 1WHKA 3QYHB 1KD1U 2K79A 1ABOA 3QXEB 4JS5A 2IPOB 2O9VA 4RCCA 4DEXA 1IB8A 1M8VA 4DEYA 1GXIE 1FYNA 2DD4A 2LCSA 1AHJB 1I8FA 4C8QG 1X6GA 1GFDA 2K4YA 1S72T 3SD4A 1FMKA 2CSIA 3HKSA 1X6BA 3OW2S 2MF2A 4X34A 4F7UE 2YSQA 3C0CA 3M58A 2KRSA 3PMIA 4L59A 3GNGA 2ZAEA 2DYBA 4E7SA 4Y28E 2FPDA 1S72A 2FVUA 2DJZA 1Z9ZA 3INZA 1SHFA 2P84A 1PNJA 3OYBA 2G3RA 2KVQG 1PSEA 1V76A 1GCPA 2M51A 3CCMQ 1C0MA 2M16A 1SRLA 1KFZA 1IGQA 3NTKA 2JXBA 2X3XD 1NE8A 1WLPB 1IREB 3J81E 3G71T 5D6XA 2EQIA 4QW2A 3PTAA 4JLGA 4PL6A 4CC2A 4D8DA 4FYYB 1VQ7T 1VIFA 2M0YA 3FRNA 2FPEA 1WI7A 1Y71A 3C95A 4KRTA 1Y57A 1DJ7B 2GFAA 2QQRA 4BUGA 2CREA 1LVKA 4ELZC 2HEQA 3CCEQ 2KXDA 1CKBA 5CCAA 1KSWA 2XD0A 2RPNA 3MEUA 1UUEA 4KT0E 4BACA 4DBFA 1VOMA 2DZ9A 2VC8A 4M78E 1TS9A 3X28B 2CUBA 3ZBDA 2MAMA 2RHZA 3S3OA 4ME7A 2ZGWA 4B6MA 4E2FB 2LX7A 3QDFA 4NS5A 3QWYA 3JCMX 3V7SA 7AT1B 1Q7YU 2RJFA 4HA8A 1SPKA 4AT1B 1YI2A 1D0XA 1PSFA 3VS3A 1PHTA 2B8AA 2LJ0A 3OYKA 5L8RE 2H3EB 2XG8D 1UJ0A 3FIFA 3M53A 4M7AB 2KEAA 2Y4YA 3CBPA 2R57A 1VYTA 4FCYA 2XDPA 2JTMA 5LJ3g 1M5Q1 1YP5A 2G6FX 1ZSZC 2HZYA 2X3WD 2F69A 2DJQA 2DRMA 4F7UA 5GAMf 2ESWA 1NJIU 1QW1A 2A0FB 1PC0A 2A3LA 2DKGA 1LNXA 1V29B 4XAXB 4RTXA 2MYSA 4OMOA 1XOVA 4FSXA 5FW9A 2MWOA 4MZTA 3CXCP 1M2VB 1RADB 4N0AC 3TEEA 2H8HA 1UGPB 1MNDA 1T0HA 2FPFA 4KGVB 4EMKA 1UHFA 4KH1B 2DTIA 1ZLMA 1TSFA 3G4SQ 2ENMA 2MCNA 2QASA 1WIEA 1BI3A 1N9SA 1RAIB 3PIPA 1I07A 3SB2A 4BDYA 2QQ9A 3JV3A 5IHKA 3UATA 3SFMA 2BIVA 2K2MA 2ED0A 1BI1A 4J6WA 5KYXA 1X01A 2RB6A 1Y7XA 3H41A 2HD0A 1GL5A 3I55Q 2YT6A 4O6JA 5GAMg 2AHJB 1N6AA 2HKQB 1FX7A 4ZGEB 1LJOA 3QHSA 4M78A 1VQMT 2K2VA 1SSHA 1X27A 3M5AA 4C0ZA 1F1BB 4KUDK 1VQLA 2L3RA 2QGFB 3FB9A 3G6EQ 4YTLA 1RACB 3QSUA 2LRQA 1RAHB 1PD0A 1JXMA 9ATCB 2LZ6B 2QDYB 4GLKA 1BCOA 3JCMW 4M78D 2EYZA 4FYVB 1MGQA 5EC7A 1U5SA 3RUXA 2CSQA 1FXXA 1N8RR 1Q86R 1U06A 2LQWA 4E6RA 4D8KA 2GGRA 4M77C 2HBPA 1PRMC 3I56T 1BIAA 1ZUYA 4AFQC 3CCLA 3OYEA 4HCBA 4HCCA 4OB1B 1ZBXA 2X4JA 1VQ8T 5D6WA 3QG1A 4A63B 4V2SA 1WJSA 2EQMA 4Y91A 2NUTA 2KROA 3ME9A 4C5EA 3GP8A 2EKOA 1K73R 2DF6A 4Z02A 2LVMA 1YCYA 4J9DA 5GANj 1VQ8A 1KG1A 1UEBA 1QCFA 2ZPGB 1Q81C 3M4GA 2DBMA 2HSEB 1M27C 2DXUA 8AT1B 2VXFA 2VUBA 3HRUA 4E7LA 4DOVA 3OYJA 2GF7A 3EG9A 2GFUA 1W70A 1Y96A 2KQWA 2BKDN 3FJPA 3I5SA 2XI9A 2KBTA 4QVCA 4EMHA 2RK2A 2KI7A 3CC2A 3GOXA 3M0PA 1BIBA 3A8LB 2LNHB 1H3ZA 2JNGA 1RAAB 3SDZA 5J3BA 3CCQA 4LE9A 1Y0MA 2W10A 2C0IA 1PG5B 4KH0B 4BY6B 3OBWA 2ZPEB 1NYFA 2J6OA 2AZSA 1I5OB 2MMPA 2DVJA 4FW2A 1C6VX 2QQSA 1JJ2A 4OMFB 4PJLA 2R58A 2QAZA 2RA2A 1N27A 1RL2A 3VJPA 1QVGS 2E12A 2K5FA 2OTLQ 2RQUA 3TVTA 3LLRA 3LWHA 4IUPA 4RTYA 3EG2A 2YWWA 4J7IA 3DB4A 1U3OA 3OYDA 3L2ZA 4AFZC 1TTHB 4JZ4A 3MPUB 2YUNA 1YJWT 3KBGA 3JB9D 3RKYA 1VQ5Q 4M7AE 2DLPA 3GIBA 4CRIA 3MEWA 2LDMA 5I21A 1SSFA 3UT1A 1Z9QA 1VQNT 4M77A 2RJDA 2QEXT 3CC7T 2X9HA 2KSSA 2COWA 4B9XA 4F7UB 2FL7A 1VQNA 3CPWS 5LJ3h 2QA4T 2QEXA 4FT2A 1WDXA 4M77D 1NLPC 2YRCA 1X43A 2HNIA 4F04B 4WTOB 1VQOA 5CKHA 2QA4A 3J80E 3HHTB 3TQ7P 1ZHIA 5GAN6 3RNJA 2PVOB 1WYXA 2DIGA 1LPLA 4EMKB 2RK1A 5GMKj 2M0OA 3VS6A 2EW3A 3OB9A 1PD1A 4M75G 4F7UF 1RI9A 4JRKA 2KK4A 4IUUA 5CO7A 2DL8A 2NLUA 1PCXA 2V8JA 2OTJA 1AD5A 2EYYA 1YJNQ 3CMAT 2EGCA 5KYXB 2CP6A 1I1JA 1Y07A 1EIFA 3QKJA 2MOXA 5GJWB 4IKFA 3LYIA 4A4FA 3CMAA 2LT1A 5FWBA 3C4SA 4HCKA 1YIJT 3GNFB 2CH4A 1YBYA 4QVDA 2CP2A 2K3BA 4PJNA 4Q5WA 1K8AU 2A08A 2HSPA 4ZTJA 1YIJA 4M75C 3RR6A 5LJ5g 2Y90A 2OX7A 1ACMB 2WSEE 3CCVA 2WSCE 1MNEA 2CZ1B 5GAOr 1N9RA 4M7AA 3OS1A 3HFOA 2RHYA 2XMFA 3CCJQ 5FU6C 2MWPA 1HK9A 1G3WA 1UGQB 1TOVA 1IRXA 4M78F 2Y4XA 2ZZDA 3LWIA 1S1NA 1MMNA 1KC8C 1M1FA 1E7OA 1D0YA 2FZCB 1M3BA 4RTTA 1UGRB 2DM1A 3VKIA 3MEAA 1Q82C 1M90C 1RAGB 1VYVA 3CCMT 5GAOl 2DFUA 1K9MR 3EG9B 1BCMA 5KCHA 1YITQ 3VS1A 5GAOp 1Y96B 1WHMA 4UC4A 3CCUQ 1IO6A 1ARKA 1D3BA 3H9NA 2CP0A 3CCMA 4RTWA 3DB3A 1JU5C 4XTVA 4C92G 4LDWA 2EFIA 3AHUA 3TU4K 2JM9A 1K1ZA 1R0CB 3VYGA 4FYXB 3E1SA 3UDCA 3CMET 1A0NB 4JDSA 4N4IA 2YRVA 2A28A 2L8DA 4MZPA 1SEMA 5AT1B 1M3CA 4OMLA 3CCET 2F1LA 2E10A 4LXCA 2CP7A 5CAIA 2SEMA 2D8JA 2DVEA 4QVZA 4XU3A 5GANh 1OULA 4QQ6A 2DXCA 2EYWA 1M1GA 1Q81U 4PJOE 3QDRB 4VUBA 3CCEA 1AT1B 3SEMA 3LGFA 2E5KA 2E65A 4IUVA 3FJ5A 1W4SA 2XU8A 4L5GA 2X35A 3GPLA 2DTOA 2E3HA 3EAEA 4RUGA 1CKAA 4QQGA 2RD1A 4M77B 1MUZA 4M75D 3JB9F 1QCOA 3M9QA 1JXOA 5FWCA 2P4TA 5A0LA 5HK0A 2DE0X 4J9IA 5CK9A 2KT1A 5CIUA 3X24B 3BY7A 3CD6Q 2H3JA 3EHRA 1QVFS 2RHIA 1VQ6Q 1GBQA 1ZUUA 3A8MB 2CP3A 3L2VA 4MMKA 2EBPA 4BE1A 1KC8R 4M4ZA 4M7DC 3I35A 2CP5A 2PU9B 4M7DE 4J9EA 3CC4Q 2RM4A 2Z0WA 2VKNA 2CZ7B 2FRWA 2FO0A 3X20B 4ZGJB 4JRIA 2ZPIB 3H0IA 4M77F 3MP1A 1WXBA 1Q82R 4NL2A 1M90R 1VQ9Q 3BFMA 4C8QC 3VV0A 4LUEA 4ATOA 4KBMB 5GJVB 1KHCA 2J06A 2XHCA 3JCMb 3OSVA 3PMTA 3E19A 5L23A 2RI3A 2WACA 3H8ZA 3VS5A 2PUOB 4PK4A 1KQ1A 4RTZA 1UE9A 3M55A 3TCJA 5LJ3j 8ATCB 1JEGA 4XTUA 1OX9A 1GFCA 1UGSB 2A37A 3QBYA 4J6XA 1WGSA 1YI2T 1UDLA 5A0DA 1NYGA 3FC3A 5CKFA 2JTEA 1N8RC 4PJOA 1Q86C 1IZ6A 2EYXA 1MV3A 2LQ8A 4PKCC 2RHUA 3RIRA 1QP3A 3ASKA 2FHDA 3Q1JA 5GAN4 4QKUA 3V7RA 3GBQA 3T9NA 1RI0A 2OJ2A 4LUDA 3VS0A 3FLGA 3G6EA 4HXJA 1X75C 5GMKh 3EFOB 4PJOD 4RG8A 3QJYA 2GNCA 3R6OA 3VS2A 4JJDA 4PJJA 3CCRQ 4JS4A 1WHGA 3V8LA 2CKKA 2ECZA 1K73C 4JJBA 2VB6A 1WHLA 1I4K1 2L5QA 1D0ZA 1G83A 3VS4A 1N5ZA 4Z8AA 5C0MA 1NEGA 2KGTA 2RJEA 2O31A 3JB9J 3HPWA 4BB7A 3H0FA 2VGMA 4JJCA 1OZ3A 4M7AF 5GAMj 4P5NA 1G3SA 1QWEA 4M7DA 1RAEB 1AWWA 3NMZC 3N5BB 3CCSQ 2DAQA 2GTOA 3LH5A 2RI2A 1WX6A 5HCKA 2VV5A 3SWNC 1KQSP 4LD6A 3D7SB 3JCMd 1D3BB 4M7DD 2R5MA 4C8QA 1AZGB 3I5RA 1MMDA 4JPBW 2ZCFB 3G71Q 1UECA 2PZ1A 5A2QE 1OU9A 1R0BG 2K6DA 1TUDA 2VASA 4CC3A 3LH0A 1YWOA 4BE2A 1HXDA 4J9CA 3OYFA 1VQLT 1VQ7Q 4C8QD 2OI3A 1IXDA 3OW2P 5J39A 1CSKA 2LTOA 4E7IA 3A8OB 2NUZA 1G3TA 4MDWA 3DKMA 2RQVA 1R77A 2EWNA 2V1RA 1AWJA 3OS5A 3M57A 1SG5A 2BTTA 1BKBA 5CVIA 4WF2A 3JCMh 4DOWA 5HKCA 4M75B 3ULRB 1VA7A 2BZ8A 3HL8A 4IUQA 2KYMA 2BZXA 2OTLA 3V7CA 3CCLT 4LD9K 1VQ4Q 3PE0A 4AFSC 2XKOC 2DEQA 2KY9A 5FU6B 4M77E 1WA7A 1B7TA 1D1CA 1ZSZA 4OGEA 1VQ5A 2XDBA 4PJMA 1P92A 2YLBA 3JAME 2LQKA 1G3YA 2DZCA 2JMAA 2DMOA 2HL3A 2EGAA 3QJ6A 5HY6A 2LQNA 3TSWA 4IUTA 5KH6A 1WNLA 3CC2T 3OYGA 4N0AA 4JRPA 4ESRA 2X4XA 4DBRA 1KQ2A 5IH2A 2IG0A 2YUPA 1KK7A 4GLMA 4FL6A 4NOYA 3JCMe 3DLLA 2EJ9A 3EGDA 3CCQT 1WQWA 4OMNA 1SHGA 3BDUA 3NTIA 3URGA 3SWNA 1I5LA 3BE3A 2B86A 3OS0A 4PFPA 2DO3A 2QTXA 2K5LA 3NFCA 5GAOq 1KD1C 3MHXA 2QQBA 1EFNA 2CS7A 3L2RA 3EH2A 3X26B 1K0SA 2RF0A 2JMCA 1OOTA 1G5VA 4A4KA 4M7AG 2C0TA 3J7AF 1YJNA 4LDXA 5LJ3d 3V8JA 2K9GA 2QTVA 1C1AA 1AWXA 3PT9A 3RMQA 3JCMQ 4PJOB 4ZNXA 3S3NA 2RN8A 5GMKi 5GAN8 1VQMQ 3A98A 3OYLA 3GLXA 3EG1A 2ATCB 4QT7A 1HD3A 3V8KA 1NM7A 3MEVA 2D8HA 4F17A 4X1VA 3EGXA 4OB0B 1JB0E 1WZOA 3EH1A 3P8HA 1YFNA 1QKXA 2J6KA 2KXCA 3G1JA 1PKSA 3MO8A 3UA7A 1M1KR 3M0TA 5GAN3 4C0FA 4F16A 3REAB 1Q95G 4PJOF 3A8HB 1VQOT 1SF9A 1RAFB 5J26A 3PVQA 4ANJA 3I56Q 3M54A 1M4ZA 3P8BB 1K9MC 3L2WA 3OYAA 4AG1C 2JT4A 2DIQA 2JJ9A 4ORZA 1B34A 2E41A 2GTJA 1JJ2S 4II1A 5GAN7 2EIFA 4M7DB 2EVRA 4A4EA 1N8RU 3P8DA 4A4HA 1Q86U 1NEBA 5GMKl 2HBWA 5GAMd 1U8RA 2RQTA 1KHIA 2MK5A 3OYYA 1OX8A 2XDDA 1K4US 5FU7C 2OTJT 5D7UA 1YITT 1T3LA 1TWBA 3CCUT 2IIMA 1YHQT 1JBMA 1UG1A 3CBMA 4IURA 5LJ5j 4C8QB 4HVWA 2DL3A 2EQKA 1VQKQ 1YITA 3OQ5A 2K5IA 3MP8A 2O01E 3CCUA 1E6GA 3VUBA 5CKDA 4E7JA 1YHQA 5DM7R 3M0UA 1K73U 5FRMA 4M7DF 1FMVA 2F2XA 2CZ6B 2LCCA 1XTDA 5LJ3e 3PNWC 1YJ9T 3L42A 3OA6A 4KGZB 1KD1R 1PWTA
chains in the Genus database with same CATH topology
1O75A 2I2LA 1QW1A 4DA4A 4L5GA 2X35A 3GPLA 2A3LA 2DKGA 1LNXA 1V29B 3CCVT 2DTOA 3OBYA 1NJIC 4XAXB 1XNIA 1VQKT 4C0GA 3EAEA 4NL3A 5GAMh 1YJ9A 2JZ2A 1XOVA 1YJNT 5GAOm 3HP9A 4C8QF 4FSXA 3CEYA 4QQGA 2E70A 2RD1A 4M77B 3UWNA 2MWOA 4M75D 4QQDA 4BE0A 3JB9F 4MZTA 3M9QA 3QYGB 4C0DC 2QXFA 4N0AC 3META 2P4TA 4M75E 5A0LA 1VQKA 3JCMV 3ZFJA 3TEEA 5HK0A 5DLQE 2ZPFB 1TH7A 5CK9A 1BI2A 5CIUA 3X24B 3JCMP 5IAYA 3BY7A 3CPWA 1UGPB 2YLCA 2H3JA 1QVFS 2RHIA 4EMKA 5GANg 3A8MB 1WJRA 4JLIA 3L2VA 1XQHA 4XU1A 2DTIA 4MMKA 2DPPB 4BD3A 4BE1A 2DD5A 3ZEHA 1BI3A 1N9SA 1JRIA 4A54A 4M7DC 2P0QA 3PIPA 3SB2A 4BDYA 2PU9B 4M7DE 2QQ9A 5CQXA 5GAN2 4BDZA 4XK8E 3SFMA 2BIVA 1ZQ1A 3RKWA 2E1HA 2RM4A 4ZTFA 3VU3C 5GAN5 4D6WA 3G7ZA 1BI1A 2CZ7B 4J6WA 3X20B 3L1AA 1X01A 4ZGJB 4JRIA 2CYZB 2ZPIB 4M77F 1X6OA 2RB6A 1Y7XA 3MP1A 2HD0A 4A4GA 4C92B 3O8VA 2K3XA 4MMLA 4NL2A 4O6JA 5GAMg 3CCJT 2D6FA 2AHJB 2JOYA 1N6AA 3BFMA 1VQ6T 4C8QC 3LW5E 3VV0A 2PUKB 4M7AC 1W2BA 4ATOA 1FX7A 4KUIA 3JCMc 1LJOA 3QHSA 4M78A 4KBMB 2K2VA 2XK0A 4XU2A 1KHCA 4R55A 3CXCA 1VQMT 3M5AA 2XHCA 3FEOA 3JCMb 2VGNA 4C0ZA 3OSVA 3PMTA 3S6WA 2E5QA 2DXBA 3CCJA 3E19A 4KUDK 1U1SA 2EQUA 2L3RA 2RI3A 3FB9A 5M9OA 5GANd 1VQLA 1VQ6A 4YTLA 4XTZA 2WACA 3H8ZA 5GAMf 2PUOB 3QSUA 2LRQA 3QZ5B 1KQ1A 5CQYA 1YJWA 3M55A 3TCJA 5LJ3j 2QDYB 4GLKA 4XTUA 3OYNA 3JCMW 3M56A 4M78D 1KQSA 2JN0A 3QO3A 1MGQA 3SWNB 5CKEA 2KAFA 1UGSB 4J83A 3RUXA 2F5TX 4C92F 2D9TA 3QBYA 1FXXA 3A8GB 4J6XA 1WGSA 1YI2T 5A0DA 3FC3A 5CKFA 3CC7A 2F5KA 3LX7A 3A5ZB 4E7HA 1N8RC 4PJOA 3EFSA 3OYCA 4OVAA 1Q86C 3M4YA 2O4XA 2HBPA 4M77C 1VQ9A 3EFRA 1IZ6A 3DLMA 3OMCA 2LQ8A 4PKCC 2RHUA 3RIRA 1BIAA 1QP3A 3I56T 3ASKA 4DQ2A 2EQJA 2IVWA 2FHDA 3Q1JA 3RMSA 5GAN4 1Q7YC 3OYEA 3CCLA 4HCCA 4OB1B 3V7RA 4HCBA 1ZBXA 2X4JA 4N4HA 1VQ8T 4A53A 2D0QB 2YHTA 3T9NA 1RI0A 5D6WA 3OW2A 3QG1A 4V2SA 4LDYA 2P0PA 1WJSA 3FLGA 3G6EA 5GMKh 1X75C 4HKEA 4J7FA 2EQMA 5LJ5f 4PJOD 4RG8A 4Y91A 3QJYA 4C5HA 3VUZA 3R6OA 3ME9A 4C5EA 3GP8A 3E9FA 2EKOA 2FYKA 4Z02A 3HSBA 2LVMA 1YCYA 1VQ8A 4JS4A 3V8LA 4FM4B 2RO0A 1UEBA 4J8OA 5GANj 2RH2A 4RG2A 2CKKA 1KG1A 2ZPGB 1Q81C 2EJGA 3M4GA 1K73C 4C5GA 3CBOA 1W2BS 2DXTA 2DXUA 1VIEA 4LDVA 4F7UG 4EMGA 4M75A 3CXCS 2VXFA 2VUBA 3HRUA 3WVEB 1I4K1 2L5QA 4E7LA 4C92C 4DOVA 3JRZA 3OYJA 2GF7A 4BI4A 2DK3A 2GFUA 5C0MA 1Y96A 2JUFA 2KQWA 2RJEA 2BKDN 5D6YA 3FJPA 2XI9A 2XIDA 3JB9J 4QVCA 1UB4A 3HPWA 4BB7A 2RK2A 4EMHA 2VGMA 3CC2A 1OZ3A 1WJQA 3GOXA 5I2MA 1BIBA 3KXTA 4M7AF 1NPRA 3CCRT 3A8LB 2KDSA 5GAMj 1KQSS 4HT9A 1H3ZA 2JNGA 4P5NA 1G3SA 4M7DA 3SDZA 5J3BA 4M78B 5DY9A 4J5YA 3CCQA 1FWZA 3N5BB 3C12A 4OB2B 2DAQA 1H641 4OGCA 3CCRA 2E6ZA 2PVGB 1O9SA 2RI2A 4BY6B 3OBWA 2K3YA 2VV5A 2ZPEB 3SWNC 4LD6A 1OZ2A 1D3BB 2MMPA 3WVDB 3JCMd 1B34B 3JB9I 2R5MA 3MP6A 4C5IA 4M7DD 1BYMA 1WQ7A 2QQSA 1JJ2A 5GANe 4OMFB 4C8QA 3E9GA 4MZMA 2ZCFB 2EJFA 2R58A 4BI8B 5FRNA 4OP0A 2OAUA 2RA2A 3BW1A 1N27A 3F70A 4ZGEB 5A2QE 3JB9H 2JTFA 1RL2A 2XICA 3VJPA 4ELYC 1QVGS 1OI1A 2E12A 2K5FA 3LH0A 2EYQA 3VYHB 3LLRA 3LWHA 4IUPA 5KE3A 4BE2A 4HT8A 1HXDA 2LX9A 3OYFA 3CCST 2X4WA 3CD6T 4J7IA 3DB4A 3OYDA 3L2ZA 1VQLT 2HAXA 4M78G 4C8QD 2M9UA 3JCMJ 3G4ST 4M7AD 1YJWT 3KBGA 5J39A 3JB9D 4C8QE 4OB3B 2LTOA 3RKYA 3A8OB 1WPYA 4E7IA 1G3TA 2E64A 4M7AE 5GAMe 5I2SA 4MDWA 3CCSA 3OYIA 3CD6A 3GIBA 2ZPHB 3DKMA 3QZ9B 2HQEA 4CRIA 4EMKC 2EWNA 2JVVA 3CPFA 3MEWA 5GAOn 1BI0A 2R5AA 3M57A 3OS5A 3JCMf 4RMOA 3CC4T 2LDMA 3G4SA 1BKBA 4TVRA 5I21A 1OYXA 1SSFA 2EAYA 4B9WA 3UT1A 5HK3A 5LJ5d 1VQNT 5CVIA 4M77A 4WF2A 2VYTA 3I55T 2RJDA 4EDUA 2LC4A 3JCMh 2QEXT 3CC7T 4DOWA 1M1KU 5LJ3f 4XTWA 1VQ9T 5HKCA 2QI2A 3OY9A 2OTLA 3CC4A 2KSSA 3G71A 4M75B 4XQ3A 2GCXA 4B9XA 4F7UB 3HL8A 4IUQA 3RERA 2FL7A 3KUFA 3QPHA 2QQAA 4PJOG 3V7CA 5LJ3h 5A0GA 4R56A 3CPWS 3CCLT 3I55A 2QEXA 2QA4T 4FT2A 1K9MU 4LD9K 3FDRA 3LGLA 3QUIA 4M77D 1VQ7A 2XKOC 2HNIA 4JUVA 2DEQA 3G6ET 2KY9A 5FU6B 5CR2A 4M77E 4M78C 3MCAB 4N4GA 1VQOA 4KULA 5CKHA 2QA4A 4OGEA 3PIOA 1VQ5A 2K57A 2WSFE 2XDBA 5IT9E 1P92A 2YLBA 1LOJA 3JAME 3J80E 3HHTB 2PQWA 2BUDA 2RI5A 2LQKA 5AYFA 2RHXA 3S3MA 1G3YA 1ZHIA 3M59A 2DZCA 4EPCA 4C92A 5GAN6 4MDXA 2OTJT 4BY6C 1QVFA 1VQPT 3C94A 2PVOB 3ER0A 2DIGA 4E47A 4EMKB 5GMKj 2RK1A 3QJ6A 5HY6A 2M0OA 4O5VA 5FROA 1NZ9A 3OB9A 5CKBA 3OS2A 1VQ4T 2FB7A 5LJ5h 4HCZA 4M75G 4F7UF 4JRKA 4IUTA 2KK4A 4XTYA 2GQVA 4IUUA 3JCMg 3HRTA 3HFNA 5KH6A 4FIBA 2LT4A 1WNLA 1VQPA 3CC2T 5CO7A 4PLLA 5EG2A 3OYGA 4CI0C 2NLUA 4E7KA 4N0AA 4C92D 4JRPA 2V8JA 2OTJA 2X4XA 3CMEA 4XU0A 4FT4A 1KQ2A 4L6V5 1VQ4A 4PJOC 2IG0A 3PFSA 4C92E 3CMAT 4NOYA 3DLLA 4FL6A 2DTHA 3JCMe 2EJ9A 4JJNK 2P0KA 3L2UA 5FLXE 1MHNA 1Y07A 1EIFA 2PVDB 3QKJA 1WQWA 3PGGA 3CCQT 3UPUA 4X9DA 3BDUA 4IKFA 3NTIA 1VUBA 3LYIA 4A4FA 3OSSC 3URGA 2A7YA 4M7DG 4ZN3A 3SWNA 1I5LA 3NTHA 3CMAA 5IN1A 3QYHB 3OS0A 3OYMA 1KD1U 2LT1A 4J6YA 3C4SA 4GY5A 2DO3A 1YIJT 2QTXA 3QXEB 3RESA 4JS5A 3GNFB 4RCCA 2K5LA 3NFCA 5GAOq 1KD1C 3MHXA 2QQBA 1YBYA 2CS7A 1M8VA 1U1TA 4QVDA 1GXIE 2DD4A 1W4SA 3TREA 3L2RA 4Q5WA 3X26B 1AHJB 2M1HA 1K8AU 4ZTJA 1I8FA 4C8QG 1YIJA 4M75C 1G5VA 5LJ5g 4A4KA 2Y90A 5FU7B 5GMKe 2K4YA 1S72T 3SD4A 1K8AC 4M7AG 3JB9G 3X25B 2WSEE 3HKSA 2WSCE 3CCVA 2CZ1B 5GAOr 1N9RA 5LL6S 3OS1A 3OW2S 2MF2A 1VQNA 4X34A 4F7UE 4M7AA 3J7AF 3M58A 3PMIA 3HFOA 1YJNA 4LDXA 5LJ3d 4L59A 3QIIA 3V8JA 2RHYA 3GNGA 4ZN1A 5LJ5e 4Y28E 5FU6C 4X9CA 1S72A 3PT9A 2FVUA 2DJZA 2MWPA 3RMQA 1HK9A 3INZA 3JCMQ 4PJOB 1G3WA 3S3NA 1UGQB 3OYBA 2O4XB 2G3RA 4FU6A 5GMKi 4M78F 5GAN8 2KVQG 1I81A 1PSEA 2Y4XA 3OYLA 1KC8U 5GMKm 2M16A 2ZZDA 3GLXA 3LWIA 3NTKA 5KCOA 1KC8C 3H6ZA 1M1FA 1NE8A 1NPPA 2L89A 3V8KA 4ZGDB 3MEVA 3BDLA 2ZPBB 2E6NA 4OB0B 1IREB 1JB0E 3J81E 3G71T 2V8IA 1UGRB 4M77G 3P8HA 5D6XA 1R8OB 1Q82U 4QW2A 3PTAA 1M90U 2OTLT 2RJCA 4JLGA 4PL6A 3JSCA 2C06A 3MO8A 4PNOA 3VKIA 3MEAA 1Q82C 1M90C 5GAN3 4C0FA 1VQ7T 1VIFA 1M1KC 4PJOF 3CCMT 3FRNA 4C0DB 5GAOl 3A8HB 1M9SA 1Y71A 3C95A 1VQOT 1VQ5T 5J26A 5KCHA 4OF1A 5GAOp 1Y96B 3M54A 1DJ7B 4UC4A 2GFAA 1M4ZA 2QQRA 3P8BB 4BUGA 1VQMA 1K9MC 3L2WA 3OYAA 1D3BA 4ELZC 2DIQA 1QP2A 2X4YA 3OMGA 1B34A 4JRQA 3WXMB 3CCMA 2E41A 4XTXA 5CCAA 2XD0A 1QVPA 4PLIA 3MEUA 3DB3A 4KT0E 4BACA 1JJ2S 4II1A 2DZ9A 5GAN7 2VC8A 4M78E 2EIFA 4XTVA 4M7DB 3OYHA 3X28B 4A4EA 4C92G 4LDWA 2EFIA 3AHUA 3ZBDA 2MAMA 2RHZA 3TU4K 2LNVA 3P8DA 1N8RU 4RCBA 4A4HA 3S3OA 1Q86U 3GF5A 2CGHA 4ME7A 2ZGWA 5KE2A 3VYGA 5GMKl 4NS5A 5GAMd 1U8RA 1KHIA 4LDUA 3OYYA 2XDDA 3E1SA 5FU7C 2KMTA 3UDCA 3V7SA 3JCMX 3CMET 1YITT 4M75F 2RJFA 4JDSA 1Q7YU 4N4IA 4HA8A 2YRVA 2VXEA 1YI2A 3CCUT 1PSFA 2L8DA 4MZPA 1YHQT 2V8KA 5GANf 2B8AA 1JBMA 2HQXA 3CBMA 4IURA 5LJ5j 3OYKA 5L8RE 3CCET 4C8QB 2E10A 3RKXA 2XG8D 3FIFA 3M53A 4RKUE 5CAIA 4M7AB 2EQKA 2DVEA 5C6SA 1YITA 3OQ5A 2K5IA 2Y4YA 3CBPA 4QVZA 3MP8A 3I56A 4XU3A 5GANh 2O01E 1QVGA 2R57A 3CCUA 2XDPA 2DXCA 2JTMA 4QQ6A 3VUBA 5CKDA 5LJ3g 4E7JA 1M1GA 1YHQA 5DM7R 1Q81U 4PJOE 1M5Q1 3QDRB 4VUBA 3CCEA 1K73U 3L2QA 2CZ0B 2MI6A 5FRMA 4M7DF 2CZ6B 2LCCA 3LGFA 4BI3A 2E65A 1XTDA 5DLOA 5LJ3e 3PNWC 1YJ9T 3HRSA 3L42A 3OA6A 2F69A 4F7UA 4IUVA 2LCLA 1NJIU 2XU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VYT A;  2MWP A;  2X35 A;  2RJD A;  4N4H A;  4EDU A;  1RI0 A;  5D6W A;  3OYB A;  3S3N A;  2O4X B;  2G3R A;  4FU6 A;  1XNI A;  1WJS A;  3OY9 A;  3FLG A;  3EAE A;  2EQM A;  2JZ2 A;  3OYL A;  4C5H A;  4B9X A;  2M16 A;  3ME9 A;  4IUQ A;  3E9F A;  4C5E A;  2EKO A;  3CEY A;  4QQG A;  3KUF A;  3NTK A;  4Z02 A;  3UWN A;  2MWO A;  4QQD A;  5KCO A;  2LVM A;  4BE0 A;  3H6Z A;  2RO0 A;  2L89 A;  3M9Q A;  4RG2 A;  2CKK A;  3FDR A;  3MEV A;  3LGL A;  3BDL A;  3MET A;  2E6N A;  4C5G A;  5CIU A;  5D6X A;  3P8H A;  5IAY A;  4N4G A;  4E7L A;  4QW2 A;  2RJC A;  2RHI A;  4PL6 A;  1WJR A;  3OYJ A;  3L2V A;  2GF7 A;  3MO8 A;  2GFU A;  2PQW A;  3MEA A;  2BUD A;  2RI5 A;  4BD3 A;  3ZEH A;  5C0M A;  4BE1 A;  2RJE A;  2BKD N;  2RHX A;  5D6Y A;  3S3M A;  1OZ3 A;  1WJQ A;  3GOX A;  4BDY A;  2DIG A;  4BDZ A;  2BIV A;  3QJ6 A;  1H3Z A;  2M0O A;  5J26 A;  5FRO A;  5KCH A;  3OS2 A;  3OB9 A;  4ZTF A;  4HCZ A;  4UC4 A;  2GFA A;  2QQR A;  4IUT A;  4IUU A;  3OYA A;  3L2W A;  3MP1 A;  4A4G A;  2DIQ A;  2X4Y A;  3OMG A;  5KH6 A;  3O8V A;  2K3X A;  4PLI A;  4PLL A;  3OYG A;  2DAQ A;  3MEU A;  2NLU A;  3DB3 A;  4BAC A;  4E7K A;  4II1 A;  2X4X A;  2RI2 A;  2IG0 A;  3PFS A;  3OYH A;  4A4E A;  4FL6 A;  2EFI A;  2K3Y A;  2RHZ A;  3P8D A;  4LD6 A;  1OZ2 A;  2P0K A;  2XK0 A;  1MHN A;  1KHC A;  3QKJ A;  4A4H A;  3L2U A;  3S3O A;  5KE2 A;  2R5M A;  3MP6 A;  3FEO A;  4C5I A;  4IKF A;  2QQS A;  3NTI A;  3PMT A;  3LYI A;  4NS5 A;  3S6W A;  2E5Q A;  3E9G A;  4A4F A;  2EQU A;  2L3R A;  2RI3 A;  2R58 A;  5M9O A;  5FRN A;  3NTH A;  2WAC A;  2RJF A;  3H8Z A;  1N27 A;  3F70 A;  4N4I A;  2JTF A;  2LRQ A;  2YRV A;  5IN1 A;  3OS0 A;  3OYM A;  2L8D A;  1OI1 A;  3LH0 A;  3C4S A;  4GY5 A;  2HQX A;  2B8A A;  3OYK A;  4IUR A;  3LLR A;  3OYN A;  4IUP A;  5KE3 A;  4BE2 A;  3OYF A;  2X4W A;  3DB4 A;  2EQK A;  3OYD A;  5C6S A;  3OQ5 A;  4QVZ A;  2D9T A;  3MP8 A;  3QBY A;  4Q5W A;  3L2R A;  2R57 A;  2M1H A;  1WGS A;  2XDP A;  4QQ6 A;  4ZTJ A;  3Q1J A;  5J39 A;  4E7J A;  2LTO A;  4E7I A;  3FC3 A;  1G5V A;  3L2Q A;  2F5K A;  3SD4 A;  5FRM A;  3LX7 A;  4E7H A;  3OYI A;  3OYC A;  2LCC A;  4OVA A;  2HQE A;  4CRI A;  2O4X A;  3LGF A;  3MEW A;  3OS1 A;  2R5A A;  4X34 A;  3DLM A;  3OMC A;  2LDM A;  3PMI A;  2RHU A;  3PNW C;  3L42 A;  4L59 A;  1OYX A;  1SSF A;  2RHY A;  3ASK A;  3QII A;  4B9W A;  2EQJ A;  3UT1 A;  3OA6 A;  4IUV A;  2FHD A;  3OYE A; 
#chains in the Genus database with same CATH topology
 3CCV T;  3OBY A;  1NJI C;  4C0G A;  5GAM h;  1YJ9 A;  4C8Q F;  3NHN A;  2CH4 W;  3CEY A;  2E70 A;  4J9H A;  3QYG B;  2PNI A;  2L2P A;  4GBQ A;  4C0D C;  4M75 E;  4CC7 A;  1BI2 A;  1QKW A;  1YNZ A;  3EFO A;  3JCM P;  5IAY A;  2YLC A;  2D1X A;  2DX1 A;  1WJR A;  1XQH A;  1TG0 A;  4BD3 A;  3ZEH A;  4AMC A;  1OQK A;  1YJW Q;  2P0Q A;  1X2Q A;  2JS2 A;  1ZSZ B;  4BDZ A;  4XK8 E;  2E1H A;  5GAN 5;  3G7Z A;  2VWF A;  2K3X A;  2QEX Q;  1K0X A;  3EGU A;  3CC7 Q;  4MML A;  1VQ6 T;  3LW5 E;  1PRL C;  2PUK B;  2QK0 A;  4HVU A;  3CXC A;  2XK0 A;  3S6W A;  1QVG P;  2E5Q A;  2DXB A;  1U1S A;  2EQU A;  5GAN d;  1VQ6 A;  1IHV A;  5M9O A;  2QGG A;  2ED1 A;  5CQY A;  3QZ5 B;  1ZBJ A;  4AG2 C;  3EGD B;  3M56 A;  1KQS A;  2AZV A;  3QO3 A;  1QLY A;  3SWN B;  1G2B A;  2KAF A;  2F5T X;  2HQH A;  1M3A A;  4RTV A;  3A8G B;  2BE9 B;  4FSS A;  3VRZ A;  3LX7 A;  4E7H A;  3EFS A;  4OVA A;  1VQ9 A;  2O4X A;  3EFR A;  1Q7Y R;  2X51 A;  1ABQ A;  1D1B A;  1PM3 A;  2JM8 A;  1I0C A;  3VRY A;  2KRN A;  2EQJ A;  3RMS A;  1EX4 A;  4A53 A;  2AKK A;  2AT1 B;  2D0Q B;  3OW2 A;  4LDY A;  2P0P A;  3CPW P;  2YRD A;  4J7F A;  2J05 A;  4C5H A;  2EKH A;  3ZL7 C;  3E9F A;  4Z88 A;  1WFW A;  4FM4 B;  4J8O A;  1ZA1 B;  2DXT A;  4LDV A;  4F7U G;  4M75 A;  3CXC S;  3WVE B;  2FZG B;  1NJI R;  4C92 C;  3JRZ A;  2DK3 A;  1RLQ C;  3EGX B;  5D6Y A;  2A36 A;  4LNP A;  2P4R A;  3KXT A;  1W2B P;  1NPR A;  3CCR T;  1KQS S;  1QQJ A;  1WHH A;  3UF4 A;  3HTR A;  4EIK A;  4J5Y A;  4F14 A;  3VS7 A;  1FWZ A;  6AT1 B;  1H64 1;  1PKT A;  4OGC A;  3CCR A;  2FG0 A;  3THK A;  2PVG B;  1AZE A;  5KYU A;  2KT8 A;  1H92 A;  3PVL A;  3A1P A;  1B34 B;  3JB9 I;  4C5I A;  1BYM A;  2CUD A;  5GAN e;  1KIK A;  2CT4 A;  1J3T A;  2L3Q A;  3E9G A;  2DA9 A;  5FRN A;  4OP0 A;  2OAU A;  3BW1 A;  1GBR A;  3JB9 H;  2JTF A;  1TXQ A;  3REB B;  1OI1 A;  2EYQ A;  3VYH B;  5KE3 A;  2V26 A;  3CCS T;  1UFF A;  3EG0 A;  2EPD A;  2PTK A;  4M78 G;  4RTU A;  3JCM J;  3G4S T;  5IXF A;  4C8Q E;  4OB3 B;  5I2S A;  3CCS A;  3OYI A;  2ZPH B;  3QZ9 B;  4EMK C;  2JVV A;  3CPF A;  5GAO n;  1BI0 A;  2R5A A;  4E7Z A;  3G4S A;  4B9W A;  5HK3 A;  5LJ5 d;  2DL5 A;  2VYT A;  3MJX A;  1SKU B;  3I55 T;  1UGV A;  4KGX B;  4XTW A;  1EZZ B;  5LJ3 f;  2QYZ A;  3OY9 A;  3G71 A;  4XQ3 A;  1AWO A;  3RER A;  1VQP Q;  1H8K A;  3KUF A;  2QQA A;  5A0G A;  3I55 A;  3CME Q;  1B3Q A;  1K9M U;  1E6H A;  1B07 A;  1W6X A;  3LGL A;  3QUI A;  1VQ7 A;  4OMP A;  3TSZ A;  3G6E T;  1YWP A;  2COZ A;  4M78 C;  3MCA B;  2ROL A;  2FZK B;  4KUL A;  3PIO A;  2WSF E;  4OMM A;  3SHW A;  2PQW A;  2BUD A;  2E4H A;  2RMO A;  5AYF A;  2RHX A;  3S3M A;  2LJ3 A;  4EPC A;  2FRY A;  4C92 A;  2RNA A;  1G8X A;  5FRO A;  3OS2 A;  2V1Q A;  1VQ4 T;  5LJ5 h;  2RQW A;  1JQQ A;  2GQV A;  3HRT A;  1QMC A;  1KJW A;  4LN2 A;  4E7K A;  4C92 D;  2E3I A;  4XU0 A;  4FT4 A;  4L6V 5;  1RUW A;  1VQ4 A;  2DTH A;  2P0K A;  2NUP B;  4WCI A;  5FLX E;  3UPU A;  1GCQ C;  1S72 Q;  1VUB A;  5KYY A;  3OSS C;  2A7Y A;  4ZN3 A;  1M30 A;  5IN1 A;  3OYM A;  4J6Y A;  4GY5 A;  3RES A;  2FEI A;  4DBQ A;  1U1T A;  2RQR A;  3TRE A;  1TUC A;  2M1H A;  1AOJ A;  2DER A;  5GMK e;  5FU7 B;  1K8A C;  3JB9 G;  3CQT A;  3X25 B;  5LL6 S;  4PFO A;  2CT3 A;  3QII A;  4ZN1 A;  1AEY A;  5LJ5 e;  1T3S A;  4X9C A;  1T0J A;  2O4X B;  4FU6 A;  1QWF A;  1I81 A;  1MMA A;  2SRC A;  1KC8 U;  5GMK m;  5KCO A;  3H6Z A;  1NPP A;  2L89 A;  3M0Q A;  4ZGD B;  2HL5 C;  3BDL A;  2ZPB B;  2E6N A;  1QVF P;  2BZY A;  2O88 A;  2V8I A;  4M77 G;  1R8O B;  1Q82 U;  3KFV A;  1M90 U;  2RJC A;  2OTL T;  3JSC A;  2C06 A;  4PNO A;  3IQL A;  1YI2 Q;  1RLP C;  1X2K A;  2M02 A;  1M1K C;  4K11 A;  4C0D B;  1M9S A;  2KRM A;  2W0Z A;  3M0S A;  1VQ5 T;  2EGE A;  4OF1 A;  1NLO C;  1VQM A;  2L3P A;  2X4Y A;  1QP2 A;  3OMG A;  4JRQ A;  1GRI A;  1NBE B;  3WXM B;  4XTX A;  1QVP A;  2O2O A;  4PLI A;  1UTI A;  1OV3 A;  1WHJ A;  3OYH A;  1TU0 B;  2LNV A;  4RCB A;  3GF5 A;  2CGH A;  5KE2 A;  1JO8 A;  1OPK A;  4LDU A;  5KYU B;  2KMT A;  4M75 F;  1GCQ A;  2VXE A;  3U23 A;  4JZ3 A;  2V8K A;  5GAN f;  2HQX A;  3RKX A;  1MV0 B;  2KE9 A;  4RKU E;  5C6S A;  3I56 A;  1QVG A;  1TUG B;  4J9G A;  1SRM A;  3L2Q A;  2CZ0 B;  2MI6 A;  5KYN A;  4BI3 A;  4FW1 A;  5DLO A;  5IHN A;  3HRS A;  2LCL A;  1O75 A;  1D1A A;  2DBK A;  2I2L A;  4DA4 A;  2CDT A;  2NWM A;  1XNI A;  2J6F A;  1VQK T;  4NL3 A;  2JZ2 A;  1YJN T;  1XJW B;  1K8A R;  5GAO m;  3HP9 A;  3UWN A;  4BE0 A;  4QQD A;  2F2V A;  5KYW A;  2K7A A;  1BU1 A;  2QXF A;  3MET A;  1VQK A;  3JCM V;  3ZFJ A;  5DLQ E;  2ZPF B;  1TH7 A;  2DL4 A;  4J9F A;  3CPW A;  4IIO A;  1IGU A;  2I0N A;  1VQL Q;  5GAN g;  1WXU A;  4JLI A;  4XU1 A;  2DPP B;  2LJ1 A;  2DD5 A;  1JRI A;  1K9A A;  4A54 A;  4PFZ A;  2GBQ A;  5CQX A;  5GAN 2;  2LP5 A;  1ZQ1 A;  3RKW A;  4ZTF A;  3VU3 C;  4D6W A;  3L1A A;  2CYZ B;  4C92 B;  1X6O A;  4A4G A;  3E2U A;  3O8V A;  2AK5 A;  4CC4 B;  3CCJ T;  2D6F A;  1VYU A;  2JOY A;  1ZA2 B;  4R0K A;  4M7A C;  1W2B A;  3JCM c;  1LCK A;  4KUI A;  4R55 A;  4XU2 A;  3CCL Q;  1D09 B;  1UHC A;  3FEO A;  2YUO A;  2VGN A;  4Z89 A;  3CCJ A;  2QDL A;  4FYW B;  4XTZ A;  1YJW A;  2D0N A;  3RBB B;  2YDL A;  2HCK A;  3OYN A;  1VQ8 Q;  5KYY B;  5ECA A;  2JN0 A;  3NPF A;  5CKE A;  4J83 A;  4C92 F;  2D9T A;  2MIO A;  4DBH A;  3EG3 A;  1NG2 A;  3CC7 A;  2F5K A;  3A5Z B;  3OYC A;  3M4Y A;  2AIR B;  3DLM A;  3OMC A;  2DYI A;  4DQ2 A;  3CC2 Q;  2IVW A;  1Q7Y C;  4N4H A;  2YHT A;  1BBZ A;  4HKE A;  5LJ5 f;  3CCQ Q;  3VUZ A;  1Q81 R;  2FYK A;  3HSB A;  2DET A;  1RAB B;  2RO0 A;  2RH2 A;  4RG2 A;  1ZUK A;  2EJG A;  5IHI A;  4C5G A;  4IIM A;  2COY A;  3CBO A;  1W2B S;  1VIE A;  4EMG A;  1IHW A;  2QG9 B;  1FMW A;  2DL7 A;  4BI4 A;  5I22 A;  1WXT A;  2J7I A;  1YN8 A;  2JUF A;  2OAW A;  1AVZ C;  2XID A;  1UB4 A;  1WJQ A;  5I2M A;  2KDS A;  4HT9 A;  4Y92 A;  1BK2 A;  2HDA A;  1HYO A;  4M78 B;  5DY9 A;  2KR3 A;  1HJD A;  3C12 A;  4OB2 B;  1OPL A;  1ZSG A;  4AFU C;  2E6Z A;  1O9S A;  2L0A A;  2C0O A;  3O5Z A;  2K3Y A;  2BE7 D;  1YCS B;  2YXY A;  1OZ2 A;  3WVD B;  2DEU A;  5IXB A;  1M8M A;  3MP6 A;  1WQ7 A;  4MZM A;  2O9S A;  2GQI A;  2EJF A;  4BI8 B;  2L3S A;  3F70 A;  3NGP A;  4OMQ A;  2XIC A;  4ELY C;  1VQN Q;  2NUP A;  4HT8 A;  2LX9 A;  2ABL A;  2X4W A;  3I9Q A;  3CD6 T;  2HAX A;  1HSQ A;  3R6N A;  2M9U A;  1BB9 A;  4M7A D;  1W1F A;  1VQO Q;  1WPY A;  3MKD A;  2QA4 Q;  2E64 A;  3AT1 B;  5GAM e;  3CD6 A;  2ROT A;  2HQE A;  4RMO A;  3JCM f;  3CC4 T;  2NUT B;  1K76 A;  4TVR A;  1OYX A;  2EAY A;  3QWX X;  1H3H A;  2HMA A;  4EDU A;  2LC4 A;  2NYS A;  1M2V A;  1M1K U;  1ZX6 A;  1VQ9 T;  2QI2 A;  3CC4 A;  1OEB A;  3RDV A;  2GCX A;  2MPX C;  3M0R A;  3QPH A;  4PJO G;  4R56 A;  2OTJ Q;  2KYB A;  3FDR A;  2JS0 A;  4JUV A;  1YHQ Q;  5CR2 A;  4N4G A;  5I11 A;  2DNU A;  2VVK A;  2JW4 A;  2K57 A;  5KYW B;  5IT9 E;  2KNB B;  1LOJ A;  3CMA Q;  2RI5 A;  2HKN A;  3M59 A;  4MDX A;  4BY6 C;  1QVF A;  1VQP T;  3C94 A;  3ER0 A;  4E47 A;  4O5V A;  1NZ9 A;  5CKB A;  1YJ9 Q;  1MMG A;  2FB7 A;  1JJ2 P;  4HCZ A;  3H0H A;  4XTY A;  2LMJ A;  2AKL A;  1YIJ Q;  3JCM g;  3HFN A;  2F2W A;  3EHQ A;  3UA6 A;  4FIB A;  2LT4 A;  2DIL A;  2YUQ A;  1VQP A;  4PLL A;  5EG2 A;  4J9B A;  4CI0 C;  3CCV Q;  1QCN A;  1X69 A;  3CME A;  2DRK A;  4PJO C;  3PFS A;  4C92 E;  4JJN K;  1UJY A;  3L2U A;  1MHN A;  2PVD B;  3PGG A;  4X9D A;  4M7D G;  4HVV A;  1M2O A;  3NTH A;  1V1C A;  1OU8 A;  1WHK A;  3QYH B;  1KD1 U;  2K79 A;  1ABO A;  3QXE B;  4JS5 A;  2IPO B;  2O9V A;  4RCC A;  4DEX A;  1IB8 A;  1M8V A;  4DEY A;  1GXI E;  1FYN A;  2DD4 A;  2LCS A;  1AHJ B;  1I8F A;  4C8Q G;  1X6G A;  1GFD A;  2K4Y A;  1S72 T;  3SD4 A;  1FMK A;  2CSI A;  3HKS A;  1X6B A;  3OW2 S;  2MF2 A;  4X34 A;  4F7U E;  2YSQ A;  3C0C A;  3M58 A;  2KRS A;  3PMI A;  4L59 A;  3GNG A;  2ZAE A;  2DYB A;  4E7S A;  4Y28 E;  2FPD A;  1S72 A;  2FVU A;  2DJZ A;  1Z9Z A;  3INZ A;  1SHF A;  2P84 A;  1PNJ A;  3OYB A;  2G3R A;  2KVQ G;  1PSE A;  1V76 A;  1GCP A;  2M51 A;  3CCM Q;  1C0M A;  2M16 A;  1SRL A;  1KFZ A;  1IGQ A;  3NTK A;  2JXB A;  2X3X D;  1NE8 A;  1WLP B;  1IRE B;  3J81 E;  3G71 T;  5D6X A;  2EQI A;  4QW2 A;  3PTA A;  4JLG A;  4PL6 A;  4CC2 A;  4D8D A;  4FYY B;  1VQ7 T;  1VIF A;  2M0Y A;  3FRN A;  2FPE A;  1WI7 A;  1Y71 A;  3C95 A;  4KRT A;  1Y57 A;  1DJ7 B;  2GFA A;  2QQR A;  4BUG A;  2CRE A;  1LVK A;  4ELZ C;  2HEQ A;  3CCE Q;  2KXD A;  1CKB A;  5CCA A;  1KSW A;  2XD0 A;  2RPN A;  3MEU A;  1UUE A;  4KT0 E;  4BAC A;  4DBF A;  1VOM A;  2DZ9 A;  2VC8 A;  4M78 E;  1TS9 A;  3X28 B;  2CUB A;  3ZBD A;  2MAM A;  2RHZ A;  3S3O A;  4ME7 A;  2ZGW A;  4B6M A;  4E2F B;  2LX7 A;  3QDF A;  4NS5 A;  3QWY A;  3JCM X;  3V7S A;  7AT1 B;  1Q7Y U;  2RJF A;  4HA8 A;  1SPK A;  4AT1 B;  1YI2 A;  1D0X A;  1PSF A;  3VS3 A;  1PHT A;  2B8A A;  2LJ0 A;  3OYK A;  5L8R E;  2H3E B;  2XG8 D;  1UJ0 A;  3FIF A;  3M53 A;  4M7A B;  2KEA A;  2Y4Y A;  3CBP A;  2R57 A;  1VYT A;  4FCY A;  2XDP A;  2JTM A;  5LJ3 g;  1M5Q 1;  1YP5 A;  2G6F X;  1ZSZ C;  2HZY A;  2X3W D;  2F69 A;  2DJQ A;  2DRM A;  4F7U A;  5GAM f;  2ESW A;  1NJI U;  1QW1 A;  2A0F B;  1PC0 A;  2A3L A;  2DKG A;  1LNX A;  1V29 B;  4XAX B;  4RTX A;  2MYS A;  4OMO A;  1XOV A;  4FSX A;  5FW9 A;  2MWO A;  4MZT A;  3CXC P;  1M2V B;  1RAD B;  4N0A C;  3TEE A;  2H8H A;  1UGP B;  1MND A;  1T0H A;  2FPF A;  4KGV B;  4EMK A;  1UHF A;  4KH1 B;  2DTI A;  1ZLM A;  1TSF A;  3G4S Q;  2ENM A;  2MCN A;  2QAS A;  1WIE A;  1BI3 A;  1N9S A;  1RAI B;  3PIP A;  1I07 A;  3SB2 A;  4BDY A;  2QQ9 A;  3JV3 A;  5IHK A;  3UAT A;  3SFM A;  2BIV A;  2K2M A;  2ED0 A;  1BI1 A;  4J6W A;  5KYX A;  1X01 A;  2RB6 A;  1Y7X A;  3H41 A;  2HD0 A;  1GL5 A;  3I55 Q;  2YT6 A;  4O6J A;  5GAM g;  2AHJ B;  1N6A A;  2HKQ B;  1FX7 A;  4ZGE B;  1LJO A;  3QHS A;  4M78 A;  1VQM T;  2K2V A;  1SSH A;  1X27 A;  3M5A A;  4C0Z A;  1F1B B;  4KUD K;  1VQL A;  2L3R A;  2QGF B;  3FB9 A;  3G6E Q;  4YTL A;  1RAC B;  3QSU A;  2LRQ A;  1RAH B;  1PD0 A;  1JXM A;  9ATC B;  2LZ6 B;  2QDY B;  4GLK A;  1BCO A;  3JCM W;  4M78 D;  2EYZ A;  4FYV B;  1MGQ A;  5EC7 A;  1U5S A;  3RUX A;  2CSQ A;  1FXX A;  1N8R R;  1Q86 R;  1U06 A;  2LQW A;  4E6R A;  4D8K A;  2GGR A;  4M77 C;  2HBP A;  1PRM C;  3I56 T;  1BIA A;  1ZUY A;  4AFQ C;  3CCL A;  3OYE A;  4HCB A;  4HCC A;  4OB1 B;  1ZBX A;  2X4J A;  1VQ8 T;  5D6W A;  3QG1 A;  4A63 B;  4V2S A;  1WJS A;  2EQM A;  4Y91 A;  2NUT A;  2KRO A;  3ME9 A;  4C5E A;  3GP8 A;  2EKO A;  1K73 R;  2DF6 A;  4Z02 A;  2LVM A;  1YCY A;  4J9D A;  5GAN j;  1VQ8 A;  1KG1 A;  1UEB A;  1QCF A;  2ZPG B;  1Q81 C;  3M4G A;  2DBM A;  2HSE B;  1M27 C;  2DXU A;  8AT1 B;  2VXF A;  2VUB A;  3HRU A;  4E7L A;  4DOV A;  3OYJ A;  2GF7 A;  3EG9 A;  2GFU A;  1W70 A;  1Y96 A;  2KQW A;  2BKD N;  3FJP A;  3I5S A;  2XI9 A;  2KBT A;  4QVC A;  4EMH A;  2RK2 A;  2KI7 A;  3CC2 A;  3GOX A;  3M0P A;  1BIB A;  3A8L B;  2LNH B;  1H3Z A;  2JNG A;  1RAA B;  3SDZ A;  5J3B A;  3CCQ A;  4LE9 A;  1Y0M A;  2W10 A;  2C0I A;  1PG5 B;  4KH0 B;  4BY6 B;  3OBW A;  2ZPE B;  1NYF A;  2J6O A;  2AZS A;  1I5O B;  2MMP A;  2DVJ A;  4FW2 A;  1C6V X;  2QQS A;  1JJ2 A;  4OMF B;  4PJL A;  2R58 A;  2QAZ A;  2RA2 A;  1N27 A;  1RL2 A;  3VJP A;  1QVG S;  2E12 A;  2K5F A;  2OTL Q;  2RQU A;  3TVT A;  3LLR A;  3LWH A;  4IUP A;  4RTY A;  3EG2 A;  2YWW A;  4J7I A;  3DB4 A;  1U3O A;  3OYD A;  3L2Z A;  4AFZ C;  1TTH B;  4JZ4 A;  3MPU B;  2YUN A;  1YJW T;  3KBG A;  3JB9 D;  3RKY A;  1VQ5 Q;  4M7A E;  2DLP A;  3GIB A;  4CRI A;  3MEW A;  2LDM A;  5I21 A;  1SSF A;  3UT1 A;  1Z9Q A;  1VQN T;  4M77 A;  2RJD A;  2QEX T;  3CC7 T;  2X9H A;  2KSS A;  2COW A;  4B9X A;  4F7U B;  2FL7 A;  1VQN A;  3CPW S;  5LJ3 h;  2QA4 T;  2QEX A;  4FT2 A;  1WDX A;  4M77 D;  1NLP C;  2YRC A;  1X43 A;  2HNI A;  4F04 B;  4WTO B;  1VQO A;  5CKH A;  2QA4 A;  3J80 E;  3HHT B;  3TQ7 P;  1ZHI A;  5GAN 6;  3RNJ A;  2PVO B;  1WYX A;  2DIG A;  1LPL A;  4EMK B;  2RK1 A;  5GMK j;  2M0O A;  3VS6 A;  2EW3 A;  3OB9 A;  1PD1 A;  4M75 G;  4F7U F;  1RI9 A;  4JRK A;  2KK4 A;  4IUU A;  5CO7 A;  2DL8 A;  2NLU A;  1PCX A;  2V8J A;  2OTJ A;  1AD5 A;  2EYY A;  1YJN Q;  3CMA T;  2EGC A;  5KYX B;  2CP6 A;  1I1J A;  1Y07 A;  1EIF A;  3QKJ A;  2MOX A;  5GJW B;  4IKF A;  3LYI A;  4A4F A;  3CMA A;  2LT1 A;  5FWB A;  3C4S A;  4HCK A;  1YIJ T;  3GNF B;  2CH4 A;  1YBY A;  4QVD A;  2CP2 A;  2K3B A;  4PJN A;  4Q5W A;  1K8A U;  2A08 A;  2HSP A;  4ZTJ A;  1YIJ A;  4M75 C;  3RR6 A;  5LJ5 g;  2Y90 A;  2OX7 A;  1ACM B;  2WSE E;  3CCV A;  2WSC E;  1MNE A;  2CZ1 B;  5GAO r;  1N9R A;  4M7A A;  3OS1 A;  3HFO A;  2RHY A;  2XMF A;  3CCJ Q;  5FU6 C;  2MWP A;  1HK9 A;  1G3W A;  1UGQ B;  1TOV A;  1IRX A;  4M78 F;  2Y4X A;  2ZZD A;  3LWI A;  1S1N A;  1MMN A;  1KC8 C;  1M1F A;  1E7O A;  1D0Y A;  2FZC B;  1M3B A;  4RTT A;  1UGR B;  2DM1 A;  3VKI A;  3MEA A;  1Q82 C;  1M90 C;  1RAG B;  1VYV A;  3CCM T;  5GAO l;  2DFU A;  1K9M R;  3EG9 B;  1BCM A;  5KCH A;  1YIT Q;  3VS1 A;  5GAO p;  1Y96 B;  1WHM A;  4UC4 A;  3CCU Q;  1IO6 A;  1ARK A;  1D3B A;  3H9N A;  2CP0 A;  3CCM A;  4RTW A;  3DB3 A;  1JU5 C;  4XTV A;  4C92 G;  4LDW A;  2EFI A;  3AHU A;  3TU4 K;  2JM9 A;  1K1Z A;  1R0C B;  3VYG A;  4FYX B;  3E1S A;  3UDC A;  3CME T;  1A0N B;  4JDS A;  4N4I A;  2YRV A;  2A28 A;  2L8D A;  4MZP A;  1SEM A;  5AT1 B;  1M3C A;  4OML A;  3CCE T;  2F1L A;  2E10 A;  4LXC A;  2CP7 A;  5CAI A;  2SEM A;  2D8J A;  2DVE A;  4QVZ A;  4XU3 A;  5GAN h;  1OUL A;  4QQ6 A;  2DXC A;  2EYW A;  1M1G A;  1Q81 U;  4PJO E;  3QDR B;  4VUB A;  3CCE A;  1AT1 B;  3SEM A;  3LGF A;  2E5K A;  2E65 A;  4IUV A;  3FJ5 A;  1W4S A;  2XU8 A;  4L5G A;  2X35 A;  3GPL A;  2DTO A;  2E3H A;  3EAE A;  4RUG A;  1CKA A;  4QQG A;  2RD1 A;  4M77 B;  1MUZ A;  4M75 D;  3JB9 F;  1QCO A;  3M9Q A;  1JXO A;  5FWC A;  2P4T A;  5A0L A;  5HK0 A;  2DE0 X;  4J9I A;  5CK9 A;  2KT1 A;  5CIU A;  3X24 B;  3BY7 A;  3CD6 Q;  2H3J A;  3EHR A;  1QVF S;  2RHI A;  1VQ6 Q;  1GBQ A;  1ZUU A;  3A8M B;  2CP3 A;  3L2V A;  4MMK A;  2EBP A;  4BE1 A;  1KC8 R;  4M4Z A;  4M7D C;  3I35 A;  2CP5 A;  2PU9 B;  4M7D E;  4J9E A;  3CC4 Q;  2RM4 A;  2Z0W A;  2VKN A;  2CZ7 B;  2FRW A;  2FO0 A;  3X20 B;  4ZGJ B;  4JRI A;  2ZPI B;  3H0I A;  4M77 F;  3MP1 A;  1WXB A;  1Q82 R;  4NL2 A;  1M90 R;  1VQ9 Q;  3BFM A;  4C8Q C;  3VV0 A;  4LUE A;  4ATO A;  4KBM B;  5GJV B;  1KHC A;  2J06 A;  2XHC A;  3JCM b;  3OSV A;  3PMT A;  3E19 A;  5L23 A;  2RI3 A;  2WAC A;  3H8Z A;  3VS5 A;  2PUO B;  4PK4 A;  1KQ1 A;  4RTZ A;  1UE9 A;  3M55 A;  3TCJ A;  5LJ3 j;  8ATC B;  1JEG A;  4XTU A;  1OX9 A;  1GFC A;  1UGS B;  2A37 A;  3QBY A;  4J6X A;  1WGS A;  1YI2 T;  1UDL A;  5A0D A;  1NYG A;  3FC3 A;  5CKF A;  2JTE A;  1N8R C;  4PJO A;  1Q86 C;  1IZ6 A;  2EYX A;  1MV3 A;  2LQ8 A;  4PKC C;  2RHU A;  3RIR A;  1QP3 A;  3ASK A;  2FHD A;  3Q1J A;  5GAN 4;  4QKU A;  3V7R A;  3GBQ A;  3T9N A;  1RI0 A;  2OJ2 A;  4LUD A;  3VS0 A;  3FLG A;  3G6E A;  4HXJ A;  1X75 C;  5GMK h;  3EFO B;  4PJO D;  4RG8 A;  3QJY A;  2GNC A;  3R6O A;  3VS2 A;  4JJD A;  4PJJ A;  3CCR Q;  4JS4 A;  1WHG A;  3V8L A;  2CKK A;  2ECZ A;  1K73 C;  4JJB A;  2VB6 A;  1WHL A;  1I4K 1;  2L5Q A;  1D0Z A;  1G83 A;  3VS4 A;  1N5Z A;  4Z8A A;  5C0M A;  1NEG A;  2KGT A;  2RJE A;  2O31 A;  3JB9 J;  3HPW A;  4BB7 A;  3H0F A;  2VGM A;  4JJC A;  1OZ3 A;  4M7A F;  5GAM j;  4P5N A;  1G3S A;  1QWE A;  4M7D A;  1RAE B;  1AWW A;  3NMZ C;  3N5B B;  3CCS Q;  2DAQ A;  2GTO A;  3LH5 A;  2RI2 A;  1WX6 A;  5HCK A;  2VV5 A;  3SWN C;  1KQS P;  4LD6 A;  3D7S B;  3JCM d;  1D3B B;  4M7D D;  2R5M A;  4C8Q A;  1AZG B;  3I5R A;  1MMD A;  4JPB W;  2ZCF B;  3G71 Q;  1UEC A;  2PZ1 A;  5A2Q E;  1OU9 A;  1R0B G;  2K6D A;  1TUD A;  2VAS A;  4CC3 A;  3LH0 A;  1YWO A;  4BE2 A;  1HXD A;  4J9C A;  3OYF A;  1VQL T;  1VQ7 Q;  4C8Q D;  2OI3 A;  1IXD A;  3OW2 P;  5J39 A;  1CSK A;  2LTO A;  4E7I A;  3A8O B;  2NUZ A;  1G3T A;  4MDW A;  3DKM A;  2RQV A;  1R77 A;  2EWN A;  2V1R A;  1AWJ A;  3OS5 A;  3M57 A;  1SG5 A;  2BTT A;  1BKB A;  5CVI A;  4WF2 A;  3JCM h;  4DOW A;  5HKC A;  4M75 B;  3ULR B;  1VA7 A;  2BZ8 A;  3HL8 A;  4IUQ A;  2KYM A;  2BZX A;  2OTL A;  3V7C A;  3CCL T;  4LD9 K;  1VQ4 Q;  3PE0 A;  4AFS C;  2XKO C;  2DEQ A;  2KY9 A;  5FU6 B;  4M77 E;  1WA7 A;  1B7T A;  1D1C A;  1ZSZ A;  4OGE A;  1VQ5 A;  2XDB A;  4PJM A;  1P92 A;  2YLB A;  3JAM E;  2LQK A;  1G3Y A;  2DZC A;  2JMA A;  2DMO A;  2HL3 A;  2EGA A;  3QJ6 A;  5HY6 A;  2LQN A;  3TSW A;  4IUT A;  5KH6 A;  1WNL A;  3CC2 T;  3OYG A;  4N0A A;  4JRP A;  4ESR A;  2X4X A;  4DBR A;  1KQ2 A;  5IH2 A;  2IG0 A;  2YUP A;  1KK7 A;  4GLM A;  4FL6 A;  4NOY A;  3JCM e;  3DLL A;  2EJ9 A;  3EGD A;  3CCQ T;  1WQW A;  4OMN A;  1SHG A;  3BDU A;  3NTI A;  3URG A;  3SWN A;  1I5L A;  3BE3 A;  2B86 A;  3OS0 A;  4PFP A;  2DO3 A;  2QTX A;  2K5L A;  3NFC A;  5GAO q;  1KD1 C;  3MHX A;  2QQB A;  1EFN A;  2CS7 A;  3L2R A;  3EH2 A;  3X26 B;  1K0S A;  2RF0 A;  2JMC A;  1OOT A;  1G5V A;  4A4K A;  4M7A G;  2C0T A;  3J7A F;  1YJN A;  4LDX A;  5LJ3 d;  3V8J A;  2K9G A;  2QTV A;  1C1A A;  1AWX A;  3PT9 A;  3RMQ A;  3JCM Q;  4PJO B;  4ZNX A;  3S3N A;  2RN8 A;  5GMK i;  5GAN 8;  1VQM Q;  3A98 A;  3OYL A;  3GLX A;  3EG1 A;  2ATC B;  4QT7 A;  1HD3 A;  3V8K A;  1NM7 A;  3MEV A;  2D8H A;  4F17 A;  4X1V A;  3EGX A;  4OB0 B;  1JB0 E;  1WZO A;  3EH1 A;  3P8H A;  1YFN A;  1QKX A;  2J6K A;  2KXC A;  3G1J A;  1PKS A;  3MO8 A;  3UA7 A;  1M1K R;  3M0T A;  5GAN 3;  4C0F A;  4F16 A;  3REA B;  1Q95 G;  4PJO F;  3A8H B;  1VQO T;  1SF9 A;  1RAF B;  5J26 A;  3PVQ A;  4ANJ A;  3I56 Q;  3M54 A;  1M4Z A;  3P8B B;  1K9M C;  3L2W A;  3OYA A;  4AG1 C;  2JT4 A;  2DIQ A;  2JJ9 A;  4ORZ A;  1B34 A;  2E41 A;  2GTJ A;  1JJ2 S;  4II1 A;  5GAN 7;  2EIF A;  4M7D B;  2EVR A;  4A4E A;  1N8R U;  3P8D A;  4A4H A;  1Q86 U;  1NEB A;  5GMK l;  2HBW A;  5GAM d;  1U8R A;  2RQT A;  1KHI A;  2MK5 A;  3OYY A;  1OX8 A;  2XDD A;  1K4U S;  5FU7 C;  2OTJ T;  5D7U A;  1YIT T;  1T3L A;  1TWB A;  3CCU T;  2IIM A;  1YHQ T;  1JBM A;  1UG1 A;  3CBM A;  4IUR A;  5LJ5 j;  4C8Q B;  4HVW A;  2DL3 A;  2EQK A;  1VQK Q;  1YIT A;  3OQ5 A;  2K5I A;  3MP8 A;  2O01 E;  3CCU A;  1E6G A;  3VUB A;  5CKD A;  4E7J A;  1YHQ A;  5DM7 R;  3M0U A;  1K73 U;  5FRM A;  4M7D F;  1FMV A;  2F2X A;  2CZ6 B;  2LCC A;  1XTD A;  5LJ3 e;  3PNW C;  1YJ9 T;  3L42 A;  3OA6 A;  4KGZ B;  1KD1 R;  1PWT A; 
#chains in the Genus database with same CATH homology
 1O75 A;  2I2L A;  1QW1 A;  4DA4 A;  4L5G A;  2X35 A;  3GPL A;  2A3L A;  2DKG A;  1LNX A;  1V29 B;  3CCV T;  2DTO A;  3OBY A;  1NJI C;  4XAX B;  1XNI A;  1VQK T;  4C0G A;  3EAE A;  4NL3 A;  5GAM h;  1YJ9 A;  2JZ2 A;  1XOV A;  1YJN T;  5GAO m;  3HP9 A;  4C8Q F;  4FSX A;  3CEY A;  4QQG A;  2E70 A;  2RD1 A;  4M77 B;  3UWN A;  2MWO A;  4M75 D;  4QQD A;  4BE0 A;  3JB9 F;  4MZT A;  3M9Q A;  3QYG B;  4C0D C;  2QXF A;  4N0A C;  3MET A;  2P4T A;  4M75 E;  5A0L A;  1VQK A;  3JCM V;  3ZFJ A;  3TEE A;  5HK0 A;  5DLQ E;  2ZPF B;  1TH7 A;  5CK9 A;  1BI2 A;  5CIU A;  3X24 B;  3JCM P;  5IAY A;  3BY7 A;  3CPW A;  1UGP B;  2YLC A;  2H3J A;  1QVF S;  2RHI A;  4EMK A;  5GAN g;  3A8M B;  1WJR A;  4JLI A;  3L2V A;  1XQH A;  4XU1 A;  2DTI A;  4MMK A;  2DPP B;  4BD3 A;  4BE1 A;  2DD5 A;  3ZEH A;  1BI3 A;  1N9S A;  1JRI A;  4A54 A;  4M7D C;  2P0Q A;  3PIP A;  3SB2 A;  4BDY A;  2PU9 B;  4M7D E;  2QQ9 A;  5CQX A;  5GAN 2;  4BDZ A;  4XK8 E;  3SFM A;  2BIV A;  1ZQ1 A;  3RKW A;  2E1H A;  2RM4 A;  4ZTF A;  3VU3 C;  5GAN 5;  4D6W A;  3G7Z A;  1BI1 A;  2CZ7 B;  4J6W A;  3X20 B;  3L1A A;  1X01 A;  4ZGJ B;  4JRI A;  2CYZ B;  2ZPI B;  4M77 F;  1X6O A;  2RB6 A;  1Y7X A;  3MP1 A;  2HD0 A;  4A4G A;  4C92 B;  3O8V A;  2K3X A;  4MML A;  4NL2 A;  4O6J A;  5GAM g;  3CCJ T;  2D6F A;  2AHJ B;  2JOY A;  1N6A A;  3BFM A;  1VQ6 T;  4C8Q C;  3LW5 E;  3VV0 A;  2PUK B;  4M7A C;  1W2B A;  4ATO A;  1FX7 A;  4KUI A;  3JCM c;  1LJO A;  3QHS A;  4M78 A;  4KBM B;  2K2V A;  2XK0 A;  4XU2 A;  1KHC A;  4R55 A;  3CXC A;  1VQM T;  3M5A A;  2XHC A;  3FEO A;  3JCM b;  2VGN A;  4C0Z A;  3OSV A;  3PMT A;  3S6W A;  2E5Q A;  2DXB A;  3CCJ A;  3E19 A;  4KUD K;  1U1S A;  2EQU A;  2L3R A;  2RI3 A;  3FB9 A;  5M9O A;  5GAN d;  1VQL A;  1VQ6 A;  4YTL A;  4XTZ A;  2WAC A;  3H8Z A;  5GAM f;  2PUO B;  3QSU A;  2LRQ A;  3QZ5 B;  1KQ1 A;  5CQY A;  1YJW A;  3M55 A;  3TCJ A;  5LJ3 j;  2QDY B;  4GLK A;  4XTU A;  3OYN A;  3JCM W;  3M56 A;  4M78 D;  1KQS A;  2JN0 A;  3QO3 A;  1MGQ A;  3SWN B;  5CKE A;  2KAF A;  1UGS B;  4J83 A;  3RUX A;  2F5T X;  4C92 F;  2D9T A;  3QBY A;  1FXX A;  3A8G B;  4J6X A;  1WGS A;  1YI2 T;  5A0D A;  3FC3 A;  5CKF A;  3CC7 A;  2F5K A;  3LX7 A;  3A5Z B;  4E7H A;  1N8R C;  4PJO A;  3EFS A;  3OYC A;  4OVA A;  1Q86 C;  3M4Y A;  2O4X A;  2HBP A;  4M77 C;  1VQ9 A;  3EFR A;  1IZ6 A;  3DLM A;  3OMC A;  2LQ8 A;  4PKC C;  2RHU A;  3RIR A;  1BIA A;  1QP3 A;  3I56 T;  3ASK A;  4DQ2 A;  2EQJ A;  2IVW A;  2FHD A;  3Q1J A;  3RMS A;  5GAN 4;  1Q7Y C;  3OYE A;  3CCL A;  4HCC A;  4OB1 B;  3V7R A;  4HCB A;  1ZBX A;  2X4J A;  4N4H A;  1VQ8 T;  4A53 A;  2D0Q B;  2YHT A;  3T9N A;  1RI0 A;  5D6W A;  3OW2 A;  3QG1 A;  4V2S A;  4LDY A;  2P0P A;  1WJS A;  3FLG A;  3G6E A;  5GMK h;  1X75 C;  4HKE A;  4J7F A;  2EQM A;  5LJ5 f;  4PJO D;  4RG8 A;  4Y91 A;  3QJY A;  4C5H A;  3VUZ A;  3R6O A;  3ME9 A;  4C5E A;  3GP8 A;  3E9F A;  2EKO A;  2FYK A;  4Z02 A;  3HSB A;  2LVM A;  1YCY A;  1VQ8 A;  4JS4 A;  3V8L A;  4FM4 B;  2RO0 A;  1UEB A;  4J8O A;  5GAN j;  2RH2 A;  4RG2 A;  2CKK A;  1KG1 A;  2ZPG B;  1Q81 C;  2EJG A;  3M4G A;  1K73 C;  4C5G A;  3CBO A;  1W2B S;  2DXT A;  2DXU A;  1VIE A;  4LDV A;  4F7U G;  4EMG A;  4M75 A;  3CXC S;  2VXF A;  2VUB A;  3HRU A;  3WVE B;  1I4K 1;  2L5Q A;  4E7L A;  4C92 C;  4DOV A;  3JRZ A;  3OYJ A;  2GF7 A;  4BI4 A;  2DK3 A;  2GFU A;  5C0M A;  1Y96 A;  2JUF A;  2KQW A;  2RJE A;  2BKD N;  5D6Y A;  3FJP A;  2XI9 A;  2XID A;  3JB9 J;  4QVC A;  1UB4 A;  3HPW A;  4BB7 A;  2RK2 A;  4EMH A;  2VGM A;  3CC2 A;  1OZ3 A;  1WJQ A;  3GOX A;  5I2M A;  1BIB A;  3KXT A;  4M7A F;  1NPR A;  3CCR T;  3A8L B;  2KDS A;  5GAM j;  1KQS S;  4HT9 A;  1H3Z A;  2JNG A;  4P5N A;  1G3S A;  4M7D A;  3SDZ A;  5J3B A;  4M78 B;  5DY9 A;  4J5Y A;  3CCQ A;  1FWZ A;  3N5B B;  3C12 A;  4OB2 B;  2DAQ A;  1H64 1;  4OGC A;  3CCR A;  2E6Z A;  2PVG B;  1O9S A;  2RI2 A;  4BY6 B;  3OBW A;  2K3Y A;  2VV5 A;  2ZPE B;  3SWN C;  4LD6 A;  1OZ2 A;  1D3B B;  2MMP A;  3WVD B;  3JCM d;  1B34 B;  3JB9 I;  2R5M A;  3MP6 A;  4C5I A;  4M7D D;  1BYM A;  1WQ7 A;  2QQS A;  1JJ2 A;  5GAN e;  4OMF B;  4C8Q A;  3E9G A;  4MZM A;  2ZCF B;  2EJF A;  2R58 A;  4BI8 B;  5FRN A;  4OP0 A;  2OAU A;  2RA2 A;  3BW1 A;  1N27 A;  3F70 A;  4ZGE B;  5A2Q E;  3JB9 H;  2JTF A;  1RL2 A;  2XIC A;  3VJP A;  4ELY C;  1QVG S;  1OI1 A;  2E12 A;  2K5F A;  3LH0 A;  2EYQ A;  3VYH B;  3LLR A;  3LWH A;  4IUP A;  5KE3 A;  4BE2 A;  4HT8 A;  1HXD A;  2LX9 A;  3OYF A;  3CCS T;  2X4W A;  3CD6 T;  4J7I A;  3DB4 A;  3OYD A;  3L2Z A;  1VQL T;  2HAX A;  4M78 G;  4C8Q D;  2M9U A;  3JCM J;  3G4S T;  4M7A D;  1YJW T;  3KBG A;  5J39 A;  3JB9 D;  4C8Q E;  4OB3 B;  2LTO A;  3RKY A;  3A8O B;  1WPY A;  4E7I A;  1G3T A;  2E64 A;  4M7A E;  5GAM e;  5I2S A;  4MDW A;  3CCS A;  3OYI A;  3CD6 A;  3GIB A;  2ZPH B;  3DKM A;  3QZ9 B;  2HQE A;  4CRI A;  4EMK C;  2EWN A;  2JVV A;  3CPF A;  3MEW A;  5GAO n;  1BI0 A;  2R5A A;  3M57 A;  3OS5 A;  3JCM f;  4RMO A;  3CC4 T;  2LDM A;  3G4S A;  1BKB A;  4TVR A;  5I21 A;  1OYX A;  1SSF A;  2EAY A;  4B9W A;  3UT1 A;  5HK3 A;  5LJ5 d;  1VQN T;  5CVI A;  4M77 A;  4WF2 A;  2VYT A;  3I55 T;  2RJD A;  4EDU A;  2LC4 A;  3JCM h;  2QEX T;  3CC7 T;  4DOW A;  1M1K U;  5LJ3 f;  4XTW A;  1VQ9 T;  5HKC A;  2QI2 A;  3OY9 A;  2OTL A;  3CC4 A;  2KSS A;  3G71 A;  4M75 B;  4XQ3 A;  2GCX A;  4B9X A;  4F7U B;  3HL8 A;  4IUQ A;  3RER A;  2FL7 A;  3KUF A;  3QPH A;  2QQA A;  4PJO G;  3V7C A;  5LJ3 h;  5A0G A;  4R56 A;  3CPW S;  3CCL T;  3I55 A;  2QEX A;  2QA4 T;  4FT2 A;  1K9M U;  4LD9 K;  3FDR A;  3LGL A;  3QUI A;  4M77 D;  1VQ7 A;  2XKO C;  2HNI A;  4JUV A;  2DEQ A;  3G6E T;  2KY9 A;  5FU6 B;  5CR2 A;  4M77 E;  4M78 C;  3MCA B;  4N4G A;  1VQO A;  4KUL A;  5CKH A;  2QA4 A;  4OGE A;  3PIO A;  1VQ5 A;  2K57 A;  2WSF E;  2XDB A;  5IT9 E;  1P92 A;  2YLB A;  1LOJ A;  3JAM E;  3J80 E;  3HHT B;  2PQW A;  2BUD A;  2RI5 A;  2LQK A;  5AYF A;  2RHX A;  3S3M A;  1G3Y A;  1ZHI A;  3M59 A;  2DZC A;  4EPC A;  4C92 A;  5GAN 6;  4MDX A;  2OTJ T;  4BY6 C;  1QVF A;  1VQP T;  3C94 A;  2PVO B;  3ER0 A;  2DIG A;  4E47 A;  4EMK B;  5GMK j;  2RK1 A;  3QJ6 A;  5HY6 A;  2M0O A;  4O5V A;  5FRO A;  1NZ9 A;  3OB9 A;  5CKB A;  3OS2 A;  1VQ4 T;  2FB7 A;  5LJ5 h;  4HCZ A;  4M75 G;  4F7U F;  4JRK A;  4IUT A;  2KK4 A;  4XTY A;  2GQV A;  4IUU A;  3JCM g;  3HRT A;  3HFN A;  5KH6 A;  4FIB A;  2LT4 A;  1WNL A;  1VQP A;  3CC2 T;  5CO7 A;  4PLL A;  5EG2 A;  3OYG A;  4CI0 C;  2NLU A;  4E7K A;  4N0A A;  4C92 D;  4JRP A;  2V8J A;  2OTJ A;  2X4X A;  3CME A;  4XU0 A;  4FT4 A;  1KQ2 A;  4L6V 5;  1VQ4 A;  4PJO C;  2IG0 A;  3PFS A;  4C92 E;  3CMA T;  4NOY A;  3DLL A;  4FL6 A;  2DTH A;  3JCM e;  2EJ9 A;  4JJN K;  2P0K A;  3L2U A;  5FLX E;  1MHN A;  1Y07 A;  1EIF A;  2PVD B;  3QKJ A;  1WQW A;  3PGG A;  3CCQ T;  3UPU A;  4X9D A;  3BDU A;  4IKF A;  3NTI A;  1VUB A;  3LYI A;  4A4F A;  3OSS C;  3URG A;  2A7Y A;  4M7D G;  4ZN3 A;  3SWN A;  1I5L A;  3NTH A;  3CMA A;  5IN1 A;  3QYH B;  3OS0 A;  3OYM A;  1KD1 U;  2LT1 A;  4J6Y A;  3C4S A;  4GY5 A;  2DO3 A;  1YIJ T;  2QTX A;  3QXE B;  3RES A;  4JS5 A;  3GNF B;  4RCC A;  2K5L A;  3NFC A;  5GAO q;  1KD1 C;  3MHX A;  2QQB A;  1YBY A;  2CS7 A;  1M8V A;  1U1T A;  4QVD A;  1GXI E;  2DD4 A;  1W4S A;  3TRE A;  3L2R A;  4Q5W A;  3X26 B;  1AHJ B;  2M1H A;  1K8A U;  4ZTJ A;  1I8F A;  4C8Q G;  1YIJ A;  4M75 C;  1G5V A;  5LJ5 g;  4A4K A;  2Y90 A;  5FU7 B;  5GMK e;  2K4Y A;  1S72 T;  3SD4 A;  1K8A C;  4M7A G;  3JB9 G;  3X25 B;  2WSE E;  3HKS A;  2WSC E;  3CCV A;  2CZ1 B;  5GAO r;  1N9R A;  5LL6 S;  3OS1 A;  3OW2 S;  2MF2 A;  1VQN A;  4X34 A;  4F7U E;  4M7A A;  3J7A F;  3M58 A;  3PMI A;  3HFO A;  1YJN A;  4LDX A;  5LJ3 d;  4L59 A;  3QII A;  3V8J A;  2RHY A;  3GNG A;  4ZN1 A;  5LJ5 e;  4Y28 E;  5FU6 C;  4X9C A;  1S72 A;  3PT9 A;  2FVU A;  2DJZ A;  2MWP A;  3RMQ A;  1HK9 A;  3INZ A;  3JCM Q;  4PJO B;  1G3W A;  3S3N A;  1UGQ B;  3OYB A;  2O4X B;  2G3R A;  4FU6 A;  5GMK i;  4M78 F;  5GAN 8;  2KVQ G;  1I81 A;  1PSE A;  2Y4X A;  3OYL A;  1KC8 U;  5GMK m;  2M16 A;  2ZZD A;  3GLX A;  3LWI A;  3NTK A;  5KCO A;  1KC8 C;  3H6Z A;  1M1F A;  1NE8 A;  1NPP A;  2L89 A;  3V8K A;  4ZGD B;  3MEV A;  3BDL A;  2ZPB B;  2E6N A;  4OB0 B;  1IRE B;  1JB0 E;  3J81 E;  3G71 T;  2V8I A;  1UGR B;  4M77 G;  3P8H A;  5D6X A;  1R8O B;  1Q82 U;  4QW2 A;  3PTA A;  1M90 U;  2OTL T;  2RJC A;  4JLG A;  4PL6 A;  3JSC A;  2C06 A;  3MO8 A;  4PNO A;  3VKI A;  3MEA A;  1Q82 C;  1M90 C;  5GAN 3;  4C0F A;  1VQ7 T;  1VIF A;  1M1K C;  4PJO F;  3CCM T;  3FRN A;  4C0D B;  5GAO l;  3A8H B;  1M9S A;  1Y71 A;  3C95 A;  1VQO T;  1VQ5 T;  5J26 A;  5KCH A;  4OF1 A;  5GAO p;  1Y96 B;  3M54 A;  1DJ7 B;  4UC4 A;  2GFA A;  1M4Z A;  2QQR A;  3P8B B;  4BUG A;  1VQM A;  1K9M C;  3L2W A;  3OYA A;  1D3B A;  4ELZ C;  2DIQ A;  1QP2 A;  2X4Y A;  3OMG A;  1B34 A;  4JRQ A;  3WXM B;  3CCM A;  2E41 A;  4XTX A;  5CCA A;  2XD0 A;  1QVP A;  4PLI A;  3MEU A;  3DB3 A;  4KT0 E;  4BAC A;  1JJ2 S;  4II1 A;  2DZ9 A;  5GAN 7;  2VC8 A;  4M78 E;  2EIF A;  4XTV A;  4M7D B;  3OYH A;  3X28 B;  4A4E A;  4C92 G;  4LDW A;  2EFI A;  3AHU A;  3ZBD A;  2MAM A;  2RHZ A;  3TU4 K;  2LNV A;  3P8D A;  1N8R U;  4RCB A;  4A4H A;  3S3O A;  1Q86 U;  3GF5 A;  2CGH A;  4ME7 A;  2ZGW A;  5KE2 A;  3VYG A;  5GMK l;  4NS5 A;  5GAM d;  1U8R A;  1KHI A;  4LDU A;  3OYY A;  2XDD A;  3E1S A;  5FU7 C;  2KMT A;  3UDC A;  3V7S A;  3JCM X;  3CME T;  1YIT T;  4M75 F;  2RJF A;  4JDS A;  1Q7Y U;  4N4I A;  4HA8 A;  2YRV A;  2VXE A;  1YI2 A;  3CCU T;  1PSF A;  2L8D A;  4MZP A;  1YHQ T;  2V8K A;  5GAN f;  2B8A A;  1JBM A;  2HQX A;  3CBM A;  4IUR A;  5LJ5 j;  3OYK A;  5L8R E;  3CCE T;  4C8Q B;  2E10 A;  3RKX A;  2XG8 D;  3FIF A;  3M53 A;  4RKU E;  5CAI A;  4M7A B;  2EQK A;  2DVE A;  5C6S A;  1YIT A;  3OQ5 A;  2K5I A;  2Y4Y A;  3CBP A;  4QVZ A;  3MP8 A;  3I56 A;  4XU3 A;  5GAN h;  2O01 E;  1QVG A;  2R57 A;  3CCU A;  2XDP A;  2DXC A;  2JTM A;  4QQ6 A;  3VUB A;  5CKD A;  5LJ3 g;  4E7J A;  1M1G A;  1YHQ A;  5DM7 R;  1Q81 U;  4PJO E;  1M5Q 1;  3QDR B;  4VUB A;  3CCE A;  1K73 U;  3L2Q A;  2CZ0 B;  2MI6 A;  5FRM A;  4M7D F;  2CZ6 B;  2LCC A;  3LGF A;  4BI3 A;  2E65 A;  1XTD A;  5DLO A;  5LJ3 e;  3PNW C;  1YJ9 T;  3HRS A;  3L42 A;  3OA6 A;  2F69 A;  4F7U A;  4IUV A;  2LCL A;  1NJI U;  2XU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...