4GY5A

Crystal structure of the tandem tudor domain and plant homeodomain of uhrf1 with histone h3k9me3
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
232
structure length
215
Chain Sequence
FLYKVNEYVDARDTNMGAWFEAQVVRVTRKEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDEVFKIERPGEGSPMVDNPMRRKSGPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPPLSSVPSEDEWYCPECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase UHRF1
publication title Structural insight into coordinated recognition of trimethylated histone H3 lysine 9 (H3K9me3) by the plant homeodomain (PHD) and tandem tudor domain (TTD) of UHRF1 (ubiquitin-like, containing PHD and RING finger domains, 1) protein
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 37
structure length 215
sequence length 232
chains with identical sequence B, C, D
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2012-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00628 PHD PHD-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A01
2.30.30.1150 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4gy5A02
4PLLA 2QQRA 4N4GA 4FL6A 4C5GA 5J39A 2RJDA 4OVAA 3OYKA 3ASKA 4X34A 2VYTA 3M9QA 3QJ6A 2JTFA 1WJSA 2R5AA 3OYHA 4Q5WA 3OYEA 3SD4A 4BD3A 2X4YA 5KE2A 5D6YA 2XDPA 4GY5A 3OYFA 3BDLA 4E7KA 2X4XA 4HCZA 5D6WA 3OYDA 3FLGA 4BACA 3OYAA 4IKFA 3OYLA 2EKOA 2M16A 2O4XB 4E7JA 1RI0A 2B8AA 1MHNA 2GF7A 2RHUA 3NTIA 4IUTA 2EQUA 1WJQA 5FRMA 1SSFA 4B9WA 3DB3A 4Z02A 2WACA 3LH0A 3MP1A 2RI3A 2EQKA 3QIIA 3QKJA 2EQJA 2L89A 5CIUA 3S6WA 3OYIA 3P8HA 4BDZA 2DAQA 5M9OA 3E9GA 3MEAA 2LVMA 2RI5A 3C4SA 4IURA 3PMIA 3OYBA 3PMTA 3ME9A 4C5IA 3KUFA 3OY9A 4C5HA 4E7HA 3LGLA 3CEYA 3OS1A 2DIGA 2QQSA 4II1A 4A4HA 3OYGA 4BDYA 4IUQA 4LD6A 4UC4A 2M1HA 3UWNA 5KH6A 4FU6A 5FROA 3DB4A 2HQEA 2R57A 3OB9A 3OQ5A 2EQMA 2K3XA 4BE1A 5IN1A 4BE0A 3OYJA 2D9TA 2R5MA 3H6ZA 3FC3A 2RI2A 3MP6A 3S3MA 2X35A 2DIQA 2RHZA 4PLIA 3OYMA 1OYXA 3L2QA 3GOXA 3MP8A 4BE2A 2FHDA 4QQ6A 3NTKA 2CKKA 2GFAA 3OYCA 3OMGA 4E7IA 3FDRA 3H8ZA 3LYIA 5C6SA 2RO0A 2IG0A 4RG2A 5KCHA 3L42A 3MEWA 2PQWA 3OMCA 2LDMA 1OZ3A 2LRQA 3O8VA 3L2VA 3L2UA 3L2WA 2R58A 3LLRA 3ZEHA 5D6XA 2X4WA 1WJRA 3S3NA 2NLUA 2EFIA 4QQGA 2G3RA 4QVZA 4A4FA 2BIVA 2F5KA 1WGSA 3NTHA 4N4IA 3LX7A 3S3OA 3UT1A 4PL6A 3EAEA 1XNIA 5IAYA 5FRNA 1OZ2A 5J26A 3DLMA 5KCOA 4C5EA 3MO8A 2MWPA 2P0KA 3META 4IUVA 4A4GA 4E7LA 2GFUA 3PFSA 4N4HA 1H3ZA 4IUUA 1G5VA 3MEVA 2RHYA 4CRIA 2LTOA 2BUDA 1KHCA 4NS5A 2E6NA 4B9XA 3OS2A 2XK0A 3E9FA 3QBYA 3FEOA 3LGFA 3OS0A 2K3YA 2O4XA 2YRVA 3OA6A 3L2RA 2E5QA 3PNWC 3OYNA 2MWOA 2RJEA 2HQXA 4IUPA 2RJCA 2RHXA 2L3RA 4EDUA 4A4EA 3MEUA 2M0OA 2L8DA 5KE3A 3Q1JA 4QW2A 1OI1A 3P8DA 5C0MA 2BKDN 4QQDA 4ZTFA 2JZ2A 2RJFA 4ZTJA 4L59A 3F70A 2RHIA 1N27A 2LCCA
chains in the Genus database with same CATH superfamily
1R77A 5CKEA 3ASKA 4AT1B 1RAGB 3OYHA 3ZBDA 4PFZA 1QKWA 1AOJA 1PWTA 2M16A 2LMJA 3I35A 3HPWA 2QAZA 1VQ8T 1Y7XA 1ZBXA 2DAQA 1VQKQ 1UDLA 5FU6C 1K73U 1F1BB 2EAYA 3PMTA 4C5IA 3E1SA 2M0YA 3OW2S 2KRNA 4E7HA 4PJMA 3REBB 4XU1A 3G4SA 1S72A 1WI7A 1Q82C 2YRDA 3S3MA 2JOYA 2DKGA 2QA4T 4C0ZA 2DIQA 2JXBA 2DXCA 4EMKC 1YJNT 5DLQE 4ORZA 2DEQA 1OX9A 2MF2A 1S1NA 2PVOB 3RKYA 1JJ2S 2EFIA 2CT4A 1ZHIA 1M30A 2J6OA 4KT0E 2CP2A 4JZ3A 2NUPB 1OZ2A 3QYGB 4BUGA 3CD6Q 5GAOr 5I22A 1H3ZA 1M1FA 1G5VA 5I2MA 2MCNA 1KHCA 3VU3C 1K0SA 3CCST 3CCVA 1VUBA 1C6VX 2OX7A 2WSFE 2ECZA 1SHGA 3PE0A 3Q1JA 4M78D 1B07A 2ENMA 1D0YA 3CPWS 1N8RR 4L6V5 1WPYA 4X34A 1H8KA 3QJ6A 5GAMj 3M57A 2SEMA 2CH4W 1D3BB 1N8RC 5FW9A 1I1JA 4GY5A 4KGVB 4KRTA 3TCJA 1SKUB 2L3PA 2OJ2A 2WSCE 3OYLA 4RTXA 1MHNA 2HKNA 2JW4A 2JM8A 3CCRQ 4HVUA 3M58A 1G8XA 4FW2A 1QVGP 2NUZA 3QKJA 2K3BA 3EFRA 2QASA 3P8HA 2CP5A 2Z0WA 4OP0A 5GAMf 5CKBA 3D7SB 1KHIA 4B6MA 3KUFA 1MMGA 1B34B 1TUGB 5GJWB 2DE0X 1NPPA 2MK5A 1ZUYA 1O75A 4J7FA 1LPLA 2FRYA 3UWNA 4FU6A 2DNUA 3CCET 1VIEA 3SB2A 4RUGA 1ZUKA 1KSWA 3QXEB 4LDXA 3V8JA 3VKIA 4C8QD 1VQ5Q 2DRMA 2LZ6B 5IHKA 2LDMA 2KNBB 5IHIA 1JXOA 2LNVA 2YUQA 3JCMP 4XTWA 2YSQA 1NJIC 1VQMQ 1CSKA 2L5QA 4PL6A 3GBQA 1G83A 2HZYA 5HY6A 2HL3A 2QXFA 1YITQ 3HRTA 3MO8A 2LT4A 2LP5A 4C8QE 4LDYA 2ED1A 2V1QA 1LCKA 2DFUA 3OS2A 2A0FB 3CCLA 3PNWC 5LL6S 2RJEA 5GAN6 3G1JA 3M0TA 3JCMh 4PFPA 3EGXA 4M7DG 4C8QC 3QWXX 3RMSA 2O01E 2P4TA 1N27A 5GAMe 1M5Q1 2P0QA 3M4GA 1VQ7T 4KGZB 1YI2A 1MNDA 2RK1A 3I5RA 2XD0A 4PFOA 3VRZA 1X6GA 2AKLA 4HT9A 1YFNA 1UHFA 2DZCA 2O9VA 2PVDB 1AWOA 4EMGA 1FWZA 2RMOA 3UATA 1OOTA 2DA9A 2J05A 3CCQQ 1OV3A 1UFFA 3LH5A 4A53A 2A28A 4OB2B 2OTLQ 2DXBA 2L89A 1MMDA 9ATCB 2DBMA 1ZUUA 2ZPFB 2KK4A 4CC4B 4PJLA 5LJ3g 3ME9A 3X20B 4MZTA 3ZL7C 3WVDB 1KQSS 4JJDA 3M5AA 5I21A 1H641 1AZGB 2K7AA 2COZA 4MMKA 5IN1A 2R5MA 1Q86R 2QEXQ 1I5OB 2PUOB 5HKCA 3OYCA 1QKXA 1U1SA 1Q86C 1OULA 2D0QB 4OB0B 3L42A 4KH1B 2M9UA 1M90R 3G4ST 2KY9A 4DBFA 3FRNA 1S72T 2MYSA 3EHRA 2EYXA 4WCIA 1M90C 4AFSC 2V1RA 2KT8A 3T9NA 1WHJA 4M75A 3I56Q 2OI3A 5FRNA 2BZ8A 2EJFA 4E7ZA 5D7UA 2OTJQ 2LX9A 2E10A 2EJ9A 2DERA 2L3QA 3FEOA 2JMCA 3MPUB 3OS0A 3RNJA 2F2WA 2K3YA 2QG9B 2HQXA 2LQNA 4F14A 3PVLA 4RCCA 3J80E 1KIKA 3SWNB 5FU6B 4QQDA 3EG9A 1K76A 2RHIA 1W2BP 3RKXA 2KT1A 5GAOn 3MCAB 3I5SA 1RAHB 1UJ0A 3VYHB 4M7DB 4HCZA 3CCVT 3FLGA 1QVGA 1PHTA 3JCMg 1Y0MA 1AT1B 2DMOA 2RQUA 3EGDB 4J6XA 2JMAA 1AWWA 1PNJA 3EFOB 2VWFA 3SDZA 4DEXA 1BKBA 1M2OA 2ZPHB 1ZQ1A 2K79A 2EWNA 1WX6A 1LVKA 4OMQA 2ZPGB 3M4YA 2WSEE 2HSPA 4PJJA 3EG0A 3V8KA 5KYWA 1GL5A 4M75F 3FC3A 1BIBA 4FT4A 3QZ9B 2X35A 4PLIA 1VQLQ 3G71A 1AD5A 4JJNK 3NTKA 2CKKA 4ZGEB 1UG1A 4XK8E 4JS5A 1G3SA 4KUIA 3OW2P 2DXUA 3BDUA 1A0NB 1OZ3A 1YIJA 1X27A 2PUKB 5D6XA 5GANj 2CUDA 1M1KC 4PJOA 1GFCA 4ELYC 4GLMA 3LX7A 2CT3A 3UT1A 5GAOq 2QYZA 3X28B 1XNIA 5LJ5d 1U8RA 1VQ4A 2BZYA 4RTUA 4DOWA 2FYKA 4IUUA 2JM9A 4DBHA 2RQRA 5GANf 2ED0A 2LTOA 4Z89A 3CC7A 3HTRA 2KR3A 2VV5A 1JJ2P 1YHQA 1TH7A 2KDSA 2PZ1A 3MEUA 2GQVA 5KE3A 5C0MA 4J8OA 4Z88A 5GMKj 2OAWA 2QA4Q 2ATCB 1J3TA 1YJNQ 1MV3A 2L3SA 2RJDA 3OYKA 1K73C 3RR6A 1TWBA 2E65A 1P92A 3CBPA 3OYEA 3SD4A 1PKSA 5KE2A 3CCJT 1VYVA 3GNGA 3CCLT 1WXBA 2K4YA 1VQOQ 4C0DC 2D0NA 4E7JA 1RI0A 2RK2A 4C92F 1V76A 1IB8A 3QIIA 4M77G 3CPWP 4JS4A 2KAFA 2NYSA 1UECA 3IQLA 2O88A 3OS1A 1NLOC 5CKFA 1JEGA 1WXUA 3CCSQ 3ZFJA 2QGGA 4IUQA 4UC4A 3TEEA 1SF9A 2RM4A 4PJOF 5GAOl 1QQJA 4EPCA 1WNLA 2XG8D 1KD1U 3CC4Q 2K5IA 1WHKA 5GANe 3GIBA 3QJYA 3L2VA 1W70A 3M59A 2X4WA 1T0JA 3S3NA 4AFZC 4MZPA 4OB1B 4QVZA 2BIVA 3NTHA 1OEBA 5GAN7 2YUPA 4AG2C 5IAYA 5LJ3d 4HCKA 4ELZC 2FG0A 4C5EA 4N4HA 2ROLA 2X4JA 2RQTA 4J6WA 3QDRB 3QHSA 4J9BA 1VQ9Q 4Y28E 2CH4A 2W0ZA 3G6EA 3OYNA 2GGRA 1W2BA 2EIFA 2QDLA 3VS0A 4EDUA 3CCEQ 4A4EA 2I0NA 1FMKA 4QW2A 1ZSGA 2HNIA 3LWIA 3A8MB 2ABLA 3F70A 4JRKA 2DLPA 4M7AA 4M78F 4Y91A 1BIAA 2CDTA 2KBTA 1C1AA 1R8OB 4J9EA 3VS2A 1X6OA 3OYDA 1I81A 2ZAEA 2O4XB 2GF7A 4FYXB 2EQUA 4HVVA 3PIOA 1SSFA 4JJBA 2EGAA 2WACA 4DOVA 4DBQA 2EQJA 5KYXA 1DJ7B 1NLPC 4D6WA 1VQKA 4M7DD 2LVMA 1B7TA 1UGQB 3OYBA 2MMPA 1X6BA 3OY9A 2E64A 5LJ5h 1K9AA 1YBYA 1JB0E 1PRLC 3LGLA 3TSZA 2DIGA 3VJPA 1IGUA 1UGSB 5KYUA 1D09B 2E1HA 4M77A 3KXTA 3CBOA 5IT9E 1JO8A 3OW2A 1QWFA 1NM7A 1HYOA 2QGFB 2J6KA 5KYYA 5GAN5 2FO0A 3CBMA 3SWNC 1NZ9A 2CZ7B 5GAOm 1VQ7Q 4M7DE 3JCMd 4J7IA 3BY7A 1KQSP 4RTVA 4LNPA 2NLUA 3V7RA 2VVKA 5DM7R 3OYYA 4N4IA 3S3OA 3NFCA 1G3TA 4M7DC 2AIRB 1HSQA 3G71T 3CD6A 2A7YA 4XQ3A 1UUEA 4M7AF 4XTUA 1JJ2A 1KFZA 3PFSA 2XIDA 2DETA 2E12A 1WXTA 1AHJB 2MIOA 1YIJT 3CCUA 2DJZA 2E5QA 4PK4A 3CCMA 2RHXA 1YWOA 4E6RA 2M0OA 2DVJA 2C0IA 4LD9K 5FWCA 4ANJA 1VQ4T 4C5GA 1PCXA 1IO6A 5A0DA 3CC7T 2V8JA 1IRXA 2XDDA 2YT6A 3G4SQ 1YHQT 3M0RA 4K11A 3HRUA 3CPWA 4M77F 4XAXB 3I55A 1BU1A 3CCRA 1K8AR 3DB3A 1E7OA 2F5TX 1BCMA 2EQKA 1IZ6A 4ZGDB 2DL3A 5FLXE 1FYNA 1WIEA 3MEAA 1SRMA 1D0ZA 5LJ3h 4J9HA 2F2XA 4N0AA 2NUTB 4HVWA 1ZLMA 1UB4A 1Y96A 1FMWA 2K2MA 2DRKA 1BB9A 4DQ2A 1WQWA 3OYMA 3GOXA 3OBWA 2A37A 1K9MU 3FDRA 3LYIA 4X9CA 5IH2A 2RO0A 1Q81R 4RTZA 2JTMA 5LJ5g 1V29B 2DZ9A 2JS0A 1VQPT 5L23A 1X2KA 1UJYA 2V8IA 2VUBA 1WA7A 3JCMX 1RAEB 2JNGA 2E41A 2HEQA 2DTHA 2K9GA 4M75G 2CSQA 3MEVA 4HA8A 1PSEA 4C0DB 1RABB 4RKUE 1MMNA 2VB6A 2YRVA 1M3CA 3L1AA 1SEMA 2XICA 4AG1C 3AHUA 2JTEA 4J9DA 4R56A 1UTIA 2KEAA 2RD1A 1H3HA 3CMEA 5HCKA 1WJSA 1PG5B 3CCJA 3G6ET 1HD3A 4HXJA 1Q7YR 1WHMA 5I2SA 1RI9A 1WJQA 3EGXB 3VYGA 4Z02A 4BDZA 3C12A 2FPEA 3E9GA 4IURA 2RI5A 2EQIA 4QT7A 1NPRA 4O5VA 5GAN2 1WQ7A 1VQ6Q 2QQSA 4LUEA 2XHCA 4FT2A 3M55A 2FEIA 1EIFA 2KGTA 2QQBA 5KH6A 1NBEB 3PGGA 3UPUA 1UGRB 5CQXA 3TREA 3VV0A 1Q82U 3OYJA 2FPFA 2MOXA 2FZGB 1IHVA 3QO3A 4C0FA 1TUDA 4E7SA 2KXDA 1VQKT 1KQSA 1VQNA 4NL3A 2YXYA 2H3EB 2QI2A 4KH0B 2ZCFB 1Z9QA 4C92G 5CO7A 3OMCA 2LRQA 4CI0C 4XTYA 2F69A 3CCLQ 7AT1B 1D1BA 3JCMJ 1KC8R 3CXCS 2MI6A 1AVZC 1FXXA 3EAEA 1MNEA 2X3XD 4J9GA 1QCOA 2KYMA 4PJOG 4AMCA 4A4GA 1K8AU 2OTJA 1JBMA 2CP0A 1YI2Q 2CYZB 4CRIA 1M27C 3QYHB 3C94A 3ER0A 4M77E 4JRIA 4Z8AA 4IUPA 1X75C 2L0AA 1K0XA 2BE7D 1Z9ZA 2KRMA 2PVGB 2CP6A 4M75B 3CD6T 4FYVB 2QQRA 4M77C 3X26B 3VUZA 5CKHA 2LQKA 5GMKi 3CCUT 3KBGA 4J9FA 2AKKA 2P4RA 1JXMA 4XU2A 1CKAA 3HL8A 4FW1A 1Q81U 3CCMT 4IKFA 2A36A 3SEMA 1YJ9A 1KD1R 2DL5A 1W6XA 4NOYA 3S6WA 3EG9B 1KD1C 3CMAA 1M8VA 5GAOp 5M9OA 2DD4A 2ZPBB 2HAXA 1U3OA 3CC2A 2RF0A 2CP3A 2DO3A 4M78G 3ULRB 4KBMB 3OYGA 2DTOA 3UF4A 2HKQB 2HQHA 3HFOA 3I55T 2HQEA 4BE0A 3CCRT 1PD0A 3EG2A 5DLOA 3KFVA 4X1VA 2HBWA 2RB6A 3BFMA 5CCAA 2DEUA 3JB9H 2CZ6B 4RG2A 1HK9A 4OB3B 3NGPA 2EBPA 3EH1A 5KCHA 1BI3A 1QVPA 1IREB 1BK2A 4EMKA 1QP3A 4A63B 1TUCA 2HSEB 1NJIU 2EYWA 3C0CA 2VC8A 3JB9I 1GXIE 1M3AA 5KYWB 1ARKA 4C92A 3U23A 1Q7YU 2C0OA 2MAMA 3I9QA 4R55A 5GAMh 1OU8A 3RMQA 2EW3A 3J7AF 4JPBW 1LNXA 3VS6A 3R6NA 4R0KA 3TSWA 1XJWB 3LGFA 3L2RA 2GCXA 1I8FA 1FX7A 1QVFA 2VKNA 2L8DA 4N0AC 1OI1A 3H0IA 4MDXA 1ZSZA 5DY9A 3X24B 4ZGJB 2LCCA 1VQ8Q 4GLKA 1YJWA 2C06A 1QVFS 2YUOA 5CVIA 4FSSA 3LWHA 2AT1B 2X4YA 5D6YA 4JUVA 1VQOA 4M7AG 3FJPA 3RDVA 4JRPA 3OSVA 3JRZA 2B8AA 1QLYA 4B9WA 2KMTA 4TVRA 4BB7A 5FWBA 3JB9F 3CMET 3G71Q 4E47A 1KC8U 4XU0A 3HHTB 5LJ5e 3JCMQ 3C4SA 2X3WD 3PMIA 3FB9A 2CZ1B 1BBZA 3VS4A 1I4K1 1JRIA 4ME7A 1MV0B 2EVRA 1I5LA 1PSFA 2J6FA 2FL7A 4AFQC 1OPKA 2YRCA 3H6ZA 1R0BG 3MP6A 3RESA 1TS9A 4X9DA 4BE2A 2Y4YA 3CC4A 2VXFA 4M78A 3HKSA 5LJ3f 3GP8A 3THKA 4F7UG 2W10A 2YUNA 3CC7Q 1T3SA 1YNZA 3LLRA 2MPXC 2E5KA 3JV3A 2C0TA 1YHQQ 5GMKl 1VQPA 1ZBJA 1WGSA 1WHHA 2DJQA 4LE9A 3VS7A 2AK5A 1XTDA 3DKMA 3QZ5B 1VQNT 2P0KA 3MHXA 2YHTA 2RH2A 5EG2A 4OF1A 2EGCA 2E6ZA 2XK0A 2VASA 3HRSA 1PRMC 2CP7A 3UA6A 3HFNA 2KVQG 4LUDA 1M8MA 2DBKA 4ZTJA 3JCMV 2EYQA 4Y92A 4PLLA 4FL6A 5J39A 2OTJT 5GAMg 1QMCA 2M51A 3RIRA 4IIMA 4C8QA 4Q5WA 2KROA 1E6GA 4MZMA 3H0HA 2EYZA 4BD3A 2XDPA 3R6OA 3OYFA 1UHCA 3BDLA 3M0UA 4V2SA 2M02A 1UE9A 5GAN3 4M75D 1Q95G 3NTIA 4IUTA 1K9MR 5FRMA 3MP1A 2LNHB 2RI3A 4PJNA 1JQQA 2O2OA 3UA7A 5LJ3e 1WFWA 4J5YA 2ROTA 3P8BB 4XTVA 4A54A 2VXEA 1NG2A 2D8HA 3UDCA 4II1A 1UEBA 3QUIA 3EHQA 2E70A 2E4HA 3JCMf 4BI4A 1M2VA 1YJ9T 2EQMA 2K3XA 4M75E 5ECAA 2J06A 4BE1A 2QQAA 2JT4A 4ATOA 5CQYA 4VUBA 3A1PA 2DL4A 3CMAT 3LW5E 1YP5A 2IVWA 4E7IA 5KYXB 2VGNA 3H8ZA 1SHFA 2BE9B 1RACB 4OMPA 4M75C 3CC2T 2XMFA 3O8VA 2HL5C 3L2UA 4C0GA 4AFUC 4BI3A 4M77B 1TTHB 2Y90A 4F7UA 1GFDA 4PKCC 1AWXA 2QQ9A 3M56A 4MMLA 3DLMA 5GMKm 4E7LA 3NMZC 5KYYB 2YLCA 4C8QF 2BUDA 2RPNA 1WLPB 5A0GA 1M3BA 4RMOA 4CC3A 1NEGA 2VGMA 4C92D 4O6JA 3CXCP 4CC7A 1R0CB 1VYUA 3RKWA 2X51A 2XDBA 2LQWA 3AT1B 3TU4K 1HXDA 1Y07A 1GBQA 4JDSA 5GJVB 2F2VA 1ZA1B 2GQIA 1WDXA 3NPFA 2JTFA 4OMLA 1EX4A 1Q82R 4PJOD 2ZGWA 1EFNA 1ABOA 4BACA 3JCMe 3FIFA 1G3WA 2XKOC 4C92E 1PC0A 1CKBA 1MUZA 1YJWT 1TXQA 1ACMB 3V7SA 2CUBA 8ATCB 1VYTA 5GANh 4C92C 1W1FA 2NWMA 1M4ZA 1VQOT 3HSBA 3O5ZA 4PJOE 4RCBA 2GNCA 2OAUA 2LJ1A 2RN8A 5FROA 3DB4A 3JSCA 2E3HA 1S72Q 2NUPA 2ZZDA 2D1XA 2FRWA 2O31A 1M9SA 4QKUA 1IGQA 4F7UF 2GTOA 1SG5A 2F1LA 2QK0A 3MP8A 2YDLA 4PJOC 1K8AC 3URGA 1RLPC 5C6SA 2PU9B 2IG0A 2SRCA 2KSSA 1ZSZC 2H3JA 2HCKA 1RLQC 3CCUQ 2D6FA 1X69A 2V26A 2XI9A 4ZNXA 1U5SA 1YCYA 5AYFA 2RA2A 3CCMQ 1Y96B 2BZXA 5GMKh 1BYMA 2DX1A 3VUBA 3MKDA 3OBYA 2HMAA 2EGEA 5J26A 3V8LA 2D8JA 3CC4T 5EC7A 1KJWA 2RNAA 4LDWA 1D1AA 2GFUA 1VQ5A 2RHYA 1D3BA 2NUTA 1SPKA 4KUDK 4B9XA 3E9FA 3OS5A 4RTYA 3A8OB 1UGVA 5A2QE 1WHLA 1X01A 1Q81C 3CCVQ 1VQMA 3I55Q 4CC2A 2K57A 4KGXB 2FZKB 2H8HA 2GTJA 2BKDN 1YITA 4M78E 3GF5A 1QW1A 1GCQA 1B34A 2VYTA 2KRSA 1QCFA 3GNFB 2YLBA 2DXTA 3JCMb 1VQ9T 2DVEA 2X4XA 4M78C 1MMAA 1PD1A 1XOVA 1RAFB 2IIMA 3EFSA 3A8GB 2RHUA 3E19A 3LH0A 4D8DA 2CS7A 5CIUA 1QVFP 2DK3A 2HD0A 4KULA 1GBRA 8AT1B 1E6HA 1VQ6A 1NJIR 3BE3A 2CREA 5CAIA 3RBBB 3GPLA 2R57A 1MGQA 3OB9A 3CCQA 2EJGA 4DEYA 5GAMd 3CQTA 4M7AD 1Q7YC 3J81E 2QTXA 2OTLA 4QQ6A 3L2ZA 4BY6C 2DL8A 4LN2A 3H9NA 3PVQA 3OMGA 3RUXA 4XU3A 1LJOA 2XU8A 2A3LA 3MEWA 5GANg 2PQWA 2KYBA 3JB9G 3VS3A 1GRIA 4DBRA 1BI0A 3WVEB 2QTVA 3JB9J 2V8KA 1FMVA 2G3RA 2FVUA 3JAME 3QSUA 1N9RA 5FU7B 4OGCA 2QEXA 4M7AE 3CMEQ 1VA7A 1WZOA 1KG1A 2DTIA 4BI8B 1B3QA 4IIOA 1T0HA 1YN8A 3M0SA 3A5ZB 2EPDA 3CXCA 3TQ7P 2HDAA 2LJ0A 1QCNA 2LCSA 4M77D 5AT1B 3CCJQ 1IXDA 3OA6A 4M7AC 3EH2A 6AT1B 1RAAB 2JS2A 2FPDA 3I56A 3PIPA 3G7ZA 2COYA 1BI1A 5IXFA 5L8RE 4ZTFA 4L59A 2AHJB 4N4GA 1KC8C 1WYXA 1RAIB 4OVAA 3QG1A 1RADB 5CR2A 4XTXA 1ABQA 5A0LA 2LC4A 2CGHA 4E7KA 4F7UE 3GLXA 4F16A 1Y71A 4MDWA 3EG3A 1AEYA 1VQNQ 2COWA 2QDYB 4RTTA 5IXBA 4C5HA 4JJCA 2DILA 3INZA 4PNOA 1N8RU 3REAB 4A4HA 1TSFA 3HP9A 2A08A 4HKEA 4LD6A 4QVDA 2KQWA 1XQHA 4FSXA 4FYWB 2D9TA 2EKHA 2CZ0B 3DLLA 4ZN1A 1JU5C 2FHDA 1N5ZA 2ZPIB 4WTOB 2K6DA 3NHNA 5LJ5j 2R58A 4RG8A 1WHGA 1HJDA 3SWNA 1D0XA 3VRYA 1SSHA 3FJ5A 4J83A 2LJ3A 4RTWA 1VQLA 1Y57A 4OMFB 4IUVA 2PNIA 1PM3A 2KE9A 2IPOB 5LJ5f 3QWYA 4M7DA 1V1CA 2DYBA 3QBYA 3A98A 1BCOA 4EMKB 2JUFA 3M0QA 3EGDA 3JCMc 2L3RA 1YJ9Q 1D1CA 1QWEA 4WF2A 1SRLA 3EFOA 3VS1A 2JZ2A 2RJFA 1PKTA 1VQ8A 1QVGS 1RUWA 4C92B 3CMAQ 1VQ5T 2CSIA 4JLGA 4YTLA 3WXMB 4DA4A 3M9QA 4FCYA 3MJXA 3CC2Q 2X9HA 1H92A 5D6WA 1VQMT 2EKOA 4C8QG 2J7IA 4OMMA 4OMNA 4PJOB 2QA4A 1YITT 4HT8A 4A4KA 1GCPA 1M1GA 1YJNA 1ZSZB 4FIBA 1RL2A 3SHWA 1KQ1A 4LDVA 1NE8A 1M1KR 4GBQA 2JN0A 2KXCA 2P84A 2L2PA 5IHNA 1G3YA 1NYFA 1VIFA 2RQVA 4JZ4A 2JJ9A 2RI2A 3N5BB 3SFMA 2LQ8A 2BTTA 2RHZA 4FM4B 3RERA 3M54A 1YWPA 1ZA2B 1VQ6T 4L5GA 4M7DF 5LJ3j 3CCSA 1G2BA 1U06A 1YIJQ 4EIKA 5J3BA 1GCQC 4QQGA 4HCCA 2JVVA 4J9CA 3CCQT 3PT9A 1N9SA 2DM1A 3H0FA 1K73R 2OTLT 3A8LB 4F04B 3META 1YJWQ 1QP2A 3X25B 4LXCA 1X2QA 1VQ4Q 1Q86U 4M78B 1ZX6A 3CPFA 2FZCB 1KK7A 2ESWA 2I2LA 3H41A 1LOJA 2MWOA 1AZEA 4JLIA 2LX7A 2O9SA 1NEBA 4P5NA 1M90U 1EZZB 4ESRA 2LCLA 2QEXT 1K1ZA 5GAN4 4J9IA 5GANd 2Y4XA 2ZPEB 1YI2T 3BW1A 2R5AA 1BI2A 5CKDA 1VQ9A 1OX8A 3OYAA 1NYGA 4J6YA 1K4US 3QDFA 3CCEA 3I56T 2DPPB 2K5FA 4BY6B 4JRQA 5KYNA 3OYIA 4OGEA 3QPHA 5HK3A 2PTKA 2AZVA 5FU7C 2DYIA 2GBQA 3CEYA 2B86A 2YWWA 4E2FB 4C8QB 1KQ2A 1VOMA 3M53A 4M4ZA 4BDYA 2M1HA 3VS5A 1VQPQ 3OSSC 3OQ5A 2DL7A 1TU0B 5GAN8 3V7CA 1IHWA 3EGUA 5I11A 1OYXA 3L2QA 3M0PA 4FYYB 2GFAA 1X43A 1O9SA 4ZN3A 2E3IA 1K9MC 1OU9A 1OPLA 1UGPB 2RQWA 2K2VA 4M7AB 2FB7A 1U1TA 3L2WA 2DF6A 4EMHA 1W4SA 3ZEHA 1C0MA 3C95A 1WJRA 2EYYA 5GMKe 3E2UA 4A4FA 2F5KA 4NL2A 3TVTA 1OQKA 1M2VB 4XTZA 1I0CA 1T3LA 3JCMW 5KCOA 2MWPA 5HK0A 3PTAA 1W2BS 2HBPA 4D8KA 2G6FX 1VQ7A 1TG0A 4NS5A 2E6NA 2KI7A 4HCBA 1AWJA 2DD5A 2O4XA 5CK9A 1M1KU 2LT1A 2P0PA 1TOVA 2RJCA 4OMOA 3G6EQ 4F17A 3EG1A 1I07A 2K5LA 4QVCA 1N6AA 5KYUB 2AZSA 3JB9D 3A8HB 1VQLT 4LDUA 1YCSB 4F7UB 3P8DA
chains in the Genus database with same CATH topology
2QQRA 4M77C 3X26B 3VUZA 2RJDA 3OYKA 1B34A 5CKEA 3ASKA 1K73C 2VYTA 2E65A 5CKHA 2LQKA 3OYHA 3ZBDA 3GNFB 5GMKi 1P92A 3CBPA 3OYEA 3SD4A 3CCUT 2YLBA 2DXTA 3KBGA 3JCMb 1VQ9T 5KE2A 3CCJT 3GNGA 3CCLT 4XU2A 2K4YA 2DVEA 3HL8A 2X4XA 4M78C 4C0DC 3CCMT 1Q81U 4IKFA 2M16A 1XOVA 4E7JA 1RI0A 3EFSA 1YJ9A 3A8GB 2RK2A 2RHUA 3HPWA 3E19A 4C92F 3LH0A 1VQ8T 1Y7XA 3QIIA 4M77G 2CS7A 4NOYA 5CIUA 3S6WA 1ZBXA 4JS4A 2DK3A 2HD0A 2KAFA 2DAQA 4KULA 5GAOp 5M9OA 3CMAA 1KD1C 2DD4A 1M8VA 5FU6C 2ZPBB 2EAYA 1K73U 3PMTA 4C5IA 3E1SA 1VQ6A 2HAXA 3OW2S 4E7HA 2D6FA 3OS1A 5CKFA 3CC2A 4XU1A 2DO3A 3G4SA 4M78G 5CAIA 3ZFJA 4KBMB 3OYGA 4IUQA 4UC4A 3TEEA 2DTOA 2RM4A 1S72A 4PJOF 3GPLA 3HFOA 3I55T 2HQEA 1MGQA 2R57A 3OB9A 3CCRT 4BE0A 3CCQA 5DLOA 5GAOl 2EJGA 1Q82C 4F7UB 5GAMd 2JOYA 2DKGA 2QA4T 4C0ZA 3S3MA 4EPCA 2DIQA 1WNLA 4M7AD 2DXCA 3J81E 2QTXA 4EMKC 1Q7YC 1YJNT 2OTLA 2RB6A 3BFMA 4QQ6A 5DLQE 3L2ZA 2XG8D 4BY6C 5CCAA 1KD1U 3JB9H 3OMGA 2CZ6B 3RUXA 2K5IA 5GANe 4RG2A 3GIBA 1HK9A 2DEQA 4OB3B 3QJYA 4XU3A 2MF2A 1LJOA 5KCHA 2XU8A 1BI3A 1QVPA 2A3LA 2PQWA 3MEWA 1IREB 2PVOB 5GANg 3L2VA 3JB9G 3RKYA 4EMKA 3M59A 1BI0A 1QP3A 3WVEB 2X4WA 3S3NA 1JJ2S 3JB9J 2EFIA 2V8KA 1NJIU 2G3RA 4MZPA 1ZHIA 4OB1B 4QVZA 2BIVA 2VC8A 2FVUA 3NTHA 3JB9I 1GXIE 4KT0E 3JAME 5GAN7 1N9RA 3QSUA 5FU7B 4C92A 5IAYA 5LJ3d 1OZ2A 1Q7YU 4OGCA 2QEXA 4ELZC 3QYGB 4M7AE 4C5EA 2MAMA 4BUGA 1KG1A 4R55A 2DTIA 5GAMh 4BI8B 5GAOr 3RMQA 4N4HA 1H3ZA 1M1FA 1G5VA 5I2MA 2X4JA 3J7AF 1LNXA 3A5ZB 4J6WA 3QDRB 3QHSA 1KHCA 3VU3C 3CXCA 3CCST 4M77D 3LGFA 4Y28E 3L2RA 3OA6A 2GCXA 1I8FA 4M7AC 3G6EA 3OYNA 1FX7A 3CCVA 1QVFA 1W2BA 1VUBA 2EIFA 2WSFE 4EDUA 4A4EA 2L8DA 3PIPA 3G7ZA 3Q1JA 3I56A 4N0AC 1BI1A 1OI1A 4QW2A 5L8RE 4MDXA 2HNIA 5DY9A 3X24B 4ZTFA 4M78D 3LWIA 3A8MB 4L59A 3F70A 4ZGJB 4JRKA 2LCCA 2AHJB 4N4GA 4GLKA 4M78F 3CPWS 4Y91A 1YJWA 1KC8C 2C06A 1QVFS 4M7AA 1BIAA 4L6V5 4OVAA 5CVIA 1WPYA 4X34A 3QG1A 3LWHA 3QJ6A 5CR2A 5GAMj 4XTXA 1R8OB 3M57A 5A0LA 1D3BB 2X4YA 2LC4A 1N8RC 5D6YA 4JUVA 2CGHA 1VQOA 1X6OA 4GY5A 4M7AG 4E7KA 3FJPA 3OYDA 3TCJA 1I81A 2WSCE 4JRPA 3OSVA 3OYLA 2O4XB 3JRZA 2B8AA 1MHNA 4F7UE 3GLXA 2GF7A 2EQUA 3PIOA 1SSFA 1Y71A 4MDWA 4B9WA 2KMTA 2WACA 3M58A 4TVRA 4BB7A 4DOVA 3QKJA 3JB9F 2EQJA 3CMET 3EFRA 3P8HA 4E47A 4OP0A 1DJ7B 4XU0A 4D6WA 5GAMf 1KC8U 1VQKA 3HHTB 5CKBA 5LJ5e 3JCMQ 4M7DD 2LVMA 3C4SA 1UGQB 3PMIA 2MMPA 1KHIA 2QDYB 2CZ1B 3FB9A 3OYBA 3OY9A 2E64A 3KUFA 5LJ5h 4C5HA 1B34B 1YBYA 1I4K1 1JB0E 3INZA 3LGLA 3VJPA 2DIGA 1JRIA 4PNOA 1N8RU 1NPPA 4A4HA 4ME7A 3HP9A 1O75A 4J7FA 4HKEA 1I5LA 1UGSB 4LD6A 4QVDA 1PSFA 2KQWA 2E1HA 4FU6A 4M77A 1XQHA 3UWNA 3CBOA 4FSXA 3KXTA 3CCET 5IT9E 2FL7A 1VIEA 2D9TA 3SB2A 3H6ZA 2CZ0B 3MP6A 3RESA 3OW2A 3QXEB 4X9DA 4LDXA 3DLLA 4ZN1A 3V8JA 3VKIA 4BE2A 2Y4YA 2FHDA 2VXFA 3CC4A 2ZPIB 4C8QD 4M78A 5GAN5 3HKSA 5LJ3f 3CBMA 3GP8A 4F7UG 3SWNC 1NZ9A 2CZ7B 5GAOm 4M7DE 2LDMA 3JCMd 4J7IA 3BY7A 5LJ5j 2R58A 3LLRA 2LNVA 4RG8A 3JCMP 4XTWA 5GMKl 2NLUA 1VQPA 3V7RA 5DM7R 1NJIC 3OYYA 1WGSA 4N4IA 3SWNA 3S3OA 3NFCA 1G3TA 2L5QA 4M7DC 4PL6A 4J83A 5HY6A 1XTDA 3DKMA 3G71T 3QZ5B 2QXFA 1VQLA 1VQNT 2A7YA 3HRTA 3MO8A 4XQ3A 2P0KA 4IUVA 3MHXA 4OMFB 3CD6A 2YHTA 4M7AF 2LT4A 2RH2A 4XTUA 1JJ2A 3PFSA 2XIDA 4C8QE 4LDYA 5EG2A 5LJ5f 2E12A 4OF1A 4M7DA 1AHJB 1YIJT 3OS2A 3CCUA 2E6ZA 2XK0A 3HRSA 3QBYA 2DJZA 3CCLA 2E5QA 3PNWC 5LL6S 2RJEA 4EMKB 5GAN6 2JUFA 3JCMc 3CCMA 2RHXA 2L3RA 3HFNA 3JCMh 2KVQG 4M7DG 2M0OA 4WF2A 4C8QC 4LD9K 3RMSA 2O01E 2JZ2A 2RJFA 4ZTJA 2P4TA 1VQ8A 3JCMV 1N27A 5GAMe 2EYQA 1QVGS 4PLLA 4C92B 1VQ4T 1M5Q1 4FL6A 4C5GA 5J39A 1VQ5T 2P0QA 4JLGA 2OTJT 5GAMg 3M4GA 4YTLA 3WXMB 4DA4A 3M9QA 2RK1A 3RIRA 5A0DA 1YI2A 1VQ7T 3CC7T 4C8QA 2XD0A 4Q5WA 2V8JA 4MZMA 2XDDA 4HT9A 4BD3A 2XDPA 1YHQT 2DZCA 3R6OA 3OYFA 3BDLA 2PVDB 4V2SA 5D6WA 3HRUA 4EMGA 1FWZA 5GAN3 4M75D 3CPWA 4M77F 2EKOA 1VQMT 4XAXB 4C8QG 3I55A 3CCRA 3NTIA 4IUTA 4PJOB 5FRMA 3DB3A 4A53A 2QA4A 2F5TX 1YITT 3MP1A 4OB2B 4A4KA 2RI3A 2EQKA 4HT8A 1M1GA 1IZ6A 2DXBA 2L89A 1YJNA 4FIBA 4ZGDB 1RL2A 2ZPFB 1KQ1A 2KK4A 4LDVA 5FLXE 5LJ3e 3MEAA 1NE8A 4J5YA 3P8BB 5LJ3g 4XTVA 3ME9A 2VXEA 5LJ3h 4A54A 3X20B 4MZTA 4N0AA 3UDCA 2JN0A 4II1A 3WVDB 1KQSS 1UEBA 3QUIA 1UB4A 1Y96A 2E70A 3M5AA 5I21A 1G3YA 1VIFA 3JCMf 1H641 4BI4A 1YJ9T 2EQMA 2K3XA 4M75E 4MMKA 5IN1A 4DQ2A 4BE1A 2R5MA 2QQAA 2RI2A 3N5BB 4ATOA 3SFMA 2LQ8A 5CQYA 1WQWA 2RHZA 4FM4B 3OYMA 3RERA 3M54A 4VUBA 3GOXA 3OBWA 3CMAT 2PUOB 3LW5E 5HKCA 3OYCA 1K9MU 2IVWA 4E7IA 2VGNA 3FDRA 3H8ZA 3LYIA 2RO0A 4X9CA 1U1SA 1VQ6T 1Q86C 4L5GA 4M75C 2JTMA 2D0QB 4OB0B 3L42A 5LJ5g 3CC2T 1V29B 2DZ9A 4M7DF 2M9UA 3G4ST 5LJ3j 3O8VA 3L2UA 2KY9A 4C0GA 3CCSA 1VQPT 3FRNA 5J3BA 1S72T 4BI3A 4QQGA 4HCCA 2JVVA 2V8IA 3CCQT 1M90C 3PT9A 1N9SA 2VUBA 4M77B 3T9NA 4M75A 3JCMX 2Y90A 4F7UA 4PKCC 2OTLT 2QQ9A 3M56A 5FRNA 2JNGA 2E41A 3A8LB 4MMLA 3DLMA 2EJFA 5GMKm 4E7LA 3META 2DTHA 1QP2A 3X25B 4M75G 3MEVA 4HA8A 1Q86U 2LX9A 2YLCA 4M78B 4C8QF 1PSEA 2BUDA 2E10A 4C0DB 3CPFA 5A0GA 2EJ9A 4RKUE 3FEOA 4RMOA 2I2LA 3OS0A 2K3YA 2YRVA 1LOJA 2MWOA 3L1AA 2HQXA 4JLIA 2VGMA 4C92D 4P5NA 2XICA 4O6JA 1M90U 4RCCA 3RKWA 3J80E 3AHUA 2XDBA 3SWNB 2LCLA 5FU6B 4QQDA 1HXDA 2QEXT 3TU4K 1Y07A 4R56A 2RD1A 2RHIA 5GAN4 4JDSA 3RKXA 5GANd 3CMEA 2Y4XA 2ZPEB 1YI2T 5GAOn 3MCAB 2JTFA 3BW1A 1WJSA 2R5AA 1BI2A 4PJOD 3VYHB 4M7DB 5CKDA 2ZGWA 1VQ9A 3CCJA 3G6ET 4HCZA 4BACA 3JCMe 3FLGA 3CCVT 3OYAA 1QVGA 4J6YA 3FIFA 5I2SA 3CCEA 3JCMg 3I56T 1G3WA 2XKOC 2DPPB 2K5FA 4BY6B 4C92E 1WJQA 4J6XA 3VYGA 4JRQA 4Z02A 3OYIA 4OGEA 1YJWT 3SDZA 4BDZA 1BKBA 3C12A 3E9GA 3QPHA 2ZPHB 2RI5A 4IURA 3V7SA 5HK3A 5FU7C 1NPRA 4O5VA 1ZQ1A 5GAN2 5GANh 1WQ7A 4C92C 2EWNA 3CEYA 2QQSA 4C8QB 1M4ZA 2XHCA 2ZPGB 3M4YA 3M55A 4FT2A 2WSEE 1VQOT 1KQ2A 1EIFA 3HSBA 2QQBA 3M53A 4BDYA 4RCBA 4PJOE 2OAUA 2M1HA 3V8KA 5KH6A 5FROA 3PGGA 3UPUA 1UGRB 3DB4A 3JSCA 3OQ5A 3OSSC 5CQXA 3TREA 3VV0A 1Q82U 2ZZDA 5GAN8 3OYJA 3V7CA 1M9SA 4M75F 3FC3A 1BIBA 4FT4A 3QO3A 3QZ9B 2X35A 4PLIA 4C0FA 4F7UF 1OYXA 3L2QA 3MP8A 3G71A 1VQKT 4JJNK 1KQSA 1VQNA 3NTKA 2CKKA 2GFAA 1O9SA 4ZGEB 4ZN3A 4XK8E 2QI2A 4NL3A 4JS5A 3URGA 1K8AC 4PJOC 1K9MC 1UGPB 1G3SA 5C6SA 2PU9B 2K2VA 2ZCFB 4KUIA 2IG0A 4C92G 4M7AB 2DXUA 2KSSA 2FB7A 3BDUA 5CO7A 1U1TA 2H3JA 3OMCA 1OZ3A 2LRQA 3L2WA 4CI0C 4EMHA 1YIJA 1W4SA 3ZEHA 2PUKB 5D6XA 5GANj 3C95A 2XI9A 1WJRA 4XTYA 2F69A 1M1KC 5GMKe 1YCYA 4PJOA 5AYFA 2RA2A 4A4FA 4ELYC 2F5KA 4NL2A 1Y96B 3JCMJ 3LX7A 5GMKh 3CXCS 3UT1A 5GAOq 2MI6A 3X28B 1BYMA 1FXXA 3EAEA 1XNIA 4XTZA 3VUBA 3OBYA 5LJ5d 5J26A 3JCMW 3V8LA 5KCOA 3CC4T 4PJOG 1U8RA 2MWPA 4A4GA 5HK0A 3PTAA 1W2BS 4LDWA 1VQ4A 2GFUA 1K8AU 1VQ5A 2HBPA 4DOWA 2OTJA 1JBMA 2FYKA 4IUUA 1VQ7A 2RHYA 1D3BA 2CYZB 5GANf 4CRIA 2LTOA 3CC7A 4NS5A 4KUDK 2E6NA 4B9XA 2VV5A 3QYHB 4HCBA 3E9FA 3C94A 3OS5A 3A8OB 2DD5A 3ER0A 4M77E 2O4XA 5CK9A 1YHQA 1M1KU 1TH7A 2LT1A 2KDSA 4JRIA 1X01A 4IUPA 5A2QE 2P0PA 1Q81C 2RJCA 1X75C 1VQMA 4QVCA 2K5LA 3MEUA 2K57A 1N6AA 2GQVA 5KE3A 3JB9D 3A8HB 2PVGB 5C0MA 4J8OA 2BKDN 5GMKj 1VQLT 4LDUA 4M75B 3CD6T 1YITA 4M78E 3P8DA 3GF5A 1QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PLL A;  2QQR A;  4N4G A;  4FL6 A;  4C5G A;  5J39 A;  2RJD A;  4OVA A;  3OYK A;  3ASK A;  4X34 A;  2VYT A;  3M9Q A;  3QJ6 A;  2JTF A;  1WJS A;  2R5A A;  3OYH A;  4Q5W A;  3OYE A;  3SD4 A;  4BD3 A;  2X4Y A;  5KE2 A;  5D6Y A;  2XDP A;  4GY5 A;  3OYF A;  3BDL A;  4E7K A;  2X4X A;  4HCZ A;  5D6W A;  3OYD A;  3FLG A;  4BAC A;  3OYA A;  4IKF A;  3OYL A;  2EKO A;  2M16 A;  2O4X B;  4E7J A;  1RI0 A;  2B8A A;  1MHN A;  2GF7 A;  2RHU A;  3NTI A;  4IUT A;  2EQU A;  1WJQ A;  5FRM A;  1SSF A;  4B9W A;  3DB3 A;  4Z02 A;  2WAC A;  3LH0 A;  3MP1 A;  2RI3 A;  2EQK A;  3QII A;  3QKJ A;  2EQJ A;  2L89 A;  5CIU A;  3S6W A;  3OYI A;  3P8H A;  4BDZ A;  2DAQ A;  5M9O A;  3E9G A;  3MEA A;  2LVM A;  2RI5 A;  3C4S A;  4IUR A;  3PMI A;  3OYB A;  3PMT A;  3ME9 A;  4C5I A;  3KUF A;  3OY9 A;  4C5H A;  4E7H A;  3LGL A;  3CEY A;  3OS1 A;  2DIG A;  2QQS A;  4II1 A;  4A4H A;  3OYG A;  4BDY A;  4IUQ A;  4LD6 A;  4UC4 A;  2M1H A;  3UWN A;  5KH6 A;  4FU6 A;  5FRO A;  3DB4 A;  2HQE A;  2R57 A;  3OB9 A;  3OQ5 A;  2EQM A;  2K3X A;  4BE1 A;  5IN1 A;  4BE0 A;  3OYJ A;  2D9T A;  2R5M A;  3H6Z A;  3FC3 A;  2RI2 A;  3MP6 A;  3S3M A;  2X35 A;  2DIQ A;  2RHZ A;  4PLI A;  3OYM A;  1OYX A;  3L2Q A;  3GOX A;  3MP8 A;  4BE2 A;  2FHD A;  4QQ6 A;  3NTK A;  2CKK A;  2GFA A;  3OYC A;  3OMG A;  4E7I A;  3FDR A;  3H8Z A;  3LYI A;  5C6S A;  2RO0 A;  2IG0 A;  4RG2 A;  5KCH A;  3L42 A;  3MEW A;  2PQW A;  3OMC A;  2LDM A;  1OZ3 A;  2LRQ A;  3O8V A;  3L2V A;  3L2U A;  3L2W A;  2R58 A;  3LLR A;  3ZEH A;  5D6X A;  2X4W A;  1WJR A;  3S3N A;  2NLU A;  2EFI A;  4QQG A;  2G3R A;  4QVZ A;  4A4F A;  2BIV A;  2F5K A;  1WGS A;  3NTH A;  4N4I A;  3LX7 A;  3S3O A;  3UT1 A;  4PL6 A;  3EAE A;  1XNI A;  5IAY A;  5FRN A;  1OZ2 A;  5J26 A;  3DLM A;  5KCO A;  4C5E A;  3MO8 A;  2MWP A;  2P0K A;  3MET A;  4IUV A;  4A4G A;  4E7L A;  2GFU A;  3PFS A;  4N4H A;  1H3Z A;  4IUU A;  1G5V A;  3MEV A;  2RHY A;  4CRI A;  2LTO A;  2BUD A;  1KHC A;  4NS5 A;  2E6N A;  4B9X A;  3OS2 A;  2XK0 A;  3E9F A;  3QBY A;  3FEO A;  3LGF A;  3OS0 A;  2K3Y A;  2O4X A;  2YRV A;  3OA6 A;  3L2R A;  2E5Q A;  3PNW C;  3OYN A;  2MWO A;  2RJE A;  2HQX A;  4IUP A;  2RJC A;  2RHX A;  2L3R A;  4EDU A;  4A4E A;  3MEU A;  2M0O A;  2L8D A;  5KE3 A;  3Q1J A;  4QW2 A;  1OI1 A;  3P8D A;  5C0M A;  2BKD N;  4QQD A;  4ZTF A;  2JZ2 A;  2RJF A;  4ZTJ A;  4L59 A;  3F70 A;  2RHI A;  1N27 A;  2LCC A; 
#chains in the Genus database with same CATH topology
 1R77 A;  5CKE A;  3ASK A;  4AT1 B;  1RAG B;  3OYH A;  3ZBD A;  4PFZ A;  1QKW A;  1AOJ A;  1PWT A;  2M16 A;  2LMJ A;  3I35 A;  3HPW A;  2QAZ A;  1VQ8 T;  1Y7X A;  1ZBX A;  2DAQ A;  1VQK Q;  1UDL A;  5FU6 C;  1K73 U;  1F1B B;  2EAY A;  3PMT A;  4C5I A;  3E1S A;  2M0Y A;  3OW2 S;  2KRN A;  4E7H A;  4PJM A;  3REB B;  4XU1 A;  3G4S A;  1S72 A;  1WI7 A;  1Q82 C;  2YRD A;  3S3M A;  2JOY A;  2DKG A;  2QA4 T;  4C0Z A;  2DIQ A;  2JXB A;  2DXC A;  4EMK C;  1YJN T;  5DLQ E;  4ORZ A;  2DEQ A;  1OX9 A;  2MF2 A;  1S1N A;  2PVO B;  3RKY A;  1JJ2 S;  2EFI A;  2CT4 A;  1ZHI A;  1M30 A;  2J6O A;  4KT0 E;  2CP2 A;  4JZ3 A;  2NUP B;  1OZ2 A;  3QYG B;  4BUG A;  3CD6 Q;  5GAO r;  5I22 A;  1H3Z A;  1M1F A;  1G5V A;  5I2M A;  2MCN A;  1KHC A;  3VU3 C;  1K0S A;  3CCS T;  3CCV A;  1VUB A;  1C6V X;  2OX7 A;  2WSF E;  2ECZ A;  1SHG A;  3PE0 A;  3Q1J A;  4M78 D;  1B07 A;  2ENM A;  1D0Y A;  3CPW S;  1N8R R;  4L6V 5;  1WPY A;  4X34 A;  1H8K A;  3QJ6 A;  5GAM j;  3M57 A;  2SEM A;  2CH4 W;  1D3B B;  1N8R C;  5FW9 A;  1I1J A;  4GY5 A;  4KGV B;  4KRT A;  3TCJ A;  1SKU B;  2L3P A;  2OJ2 A;  2WSC E;  3OYL A;  4RTX A;  1MHN A;  2HKN A;  2JW4 A;  2JM8 A;  3CCR Q;  4HVU A;  3M58 A;  1G8X A;  4FW2 A;  1QVG P;  2NUZ A;  3QKJ A;  2K3B A;  3EFR A;  2QAS A;  3P8H A;  2CP5 A;  2Z0W A;  4OP0 A;  5GAM f;  5CKB A;  3D7S B;  1KHI A;  4B6M A;  3KUF A;  1MMG A;  1B34 B;  1TUG B;  5GJW B;  2DE0 X;  1NPP A;  2MK5 A;  1ZUY A;  1O75 A;  4J7F A;  1LPL A;  2FRY A;  3UWN A;  4FU6 A;  2DNU A;  3CCE T;  1VIE A;  3SB2 A;  4RUG A;  1ZUK A;  1KSW A;  3QXE B;  4LDX A;  3V8J A;  3VKI A;  4C8Q D;  1VQ5 Q;  2DRM A;  2LZ6 B;  5IHK A;  2LDM A;  2KNB B;  5IHI A;  1JXO A;  2LNV A;  2YUQ A;  3JCM P;  4XTW A;  2YSQ A;  1NJI C;  1VQM Q;  1CSK A;  2L5Q A;  4PL6 A;  3GBQ A;  1G83 A;  2HZY A;  5HY6 A;  2HL3 A;  2QXF A;  1YIT Q;  3HRT A;  3MO8 A;  2LT4 A;  2LP5 A;  4C8Q E;  4LDY A;  2ED1 A;  2V1Q A;  1LCK A;  2DFU A;  3OS2 A;  2A0F B;  3CCL A;  3PNW C;  5LL6 S;  2RJE A;  5GAN 6;  3G1J A;  3M0T A;  3JCM h;  4PFP A;  3EGX A;  4M7D G;  4C8Q C;  3QWX X;  3RMS A;  2O01 E;  2P4T A;  1N27 A;  5GAM e;  1M5Q 1;  2P0Q A;  3M4G A;  1VQ7 T;  4KGZ B;  1YI2 A;  1MND A;  2RK1 A;  3I5R A;  2XD0 A;  4PFO A;  3VRZ A;  1X6G A;  2AKL A;  4HT9 A;  1YFN A;  1UHF A;  2DZC A;  2O9V A;  2PVD B;  1AWO A;  4EMG A;  1FWZ A;  2RMO A;  3UAT A;  1OOT A;  2DA9 A;  2J05 A;  3CCQ Q;  1OV3 A;  1UFF A;  3LH5 A;  4A53 A;  2A28 A;  4OB2 B;  2OTL Q;  2DXB A;  2L89 A;  1MMD A;  9ATC B;  2DBM A;  1ZUU A;  2ZPF B;  2KK4 A;  4CC4 B;  4PJL A;  5LJ3 g;  3ME9 A;  3X20 B;  4MZT A;  3ZL7 C;  3WVD B;  1KQS S;  4JJD A;  3M5A A;  5I21 A;  1H64 1;  1AZG B;  2K7A A;  2COZ A;  4MMK A;  5IN1 A;  2R5M A;  1Q86 R;  2QEX Q;  1I5O B;  2PUO B;  5HKC A;  3OYC A;  1QKX A;  1U1S A;  1Q86 C;  1OUL A;  2D0Q B;  4OB0 B;  3L42 A;  4KH1 B;  2M9U A;  1M90 R;  3G4S T;  2KY9 A;  4DBF A;  3FRN A;  1S72 T;  2MYS A;  3EHR A;  2EYX A;  4WCI A;  1M90 C;  4AFS C;  2V1R A;  2KT8 A;  3T9N A;  1WHJ A;  4M75 A;  3I56 Q;  2OI3 A;  5FRN A;  2BZ8 A;  2EJF A;  4E7Z A;  5D7U A;  2OTJ Q;  2LX9 A;  2E10 A;  2EJ9 A;  2DER A;  2L3Q A;  3FEO A;  2JMC A;  3MPU B;  3OS0 A;  3RNJ A;  2F2W A;  2K3Y A;  2QG9 B;  2HQX A;  2LQN A;  4F14 A;  3PVL A;  4RCC A;  3J80 E;  1KIK A;  3SWN B;  5FU6 B;  4QQD A;  3EG9 A;  1K76 A;  2RHI A;  1W2B P;  3RKX A;  2KT1 A;  5GAO n;  3MCA B;  3I5S A;  1RAH B;  1UJ0 A;  3VYH B;  4M7D B;  4HCZ A;  3CCV T;  3FLG A;  1QVG A;  1PHT A;  3JCM g;  1Y0M A;  1AT1 B;  2DMO A;  2RQU A;  3EGD B;  4J6X A;  2JMA A;  1AWW A;  1PNJ A;  3EFO B;  2VWF A;  3SDZ A;  4DEX A;  1BKB A;  1M2O A;  2ZPH B;  1ZQ1 A;  2K79 A;  2EWN A;  1WX6 A;  1LVK A;  4OMQ A;  2ZPG B;  3M4Y A;  2WSE E;  2HSP A;  4PJJ A;  3EG0 A;  3V8K A;  5KYW A;  1GL5 A;  4M75 F;  3FC3 A;  1BIB A;  4FT4 A;  3QZ9 B;  2X35 A;  4PLI A;  1VQL Q;  3G71 A;  1AD5 A;  4JJN K;  3NTK A;  2CKK A;  4ZGE B;  1UG1 A;  4XK8 E;  4JS5 A;  1G3S A;  4KUI A;  3OW2 P;  2DXU A;  3BDU A;  1A0N B;  1OZ3 A;  1YIJ A;  1X27 A;  2PUK B;  5D6X A;  5GAN j;  2CUD A;  1M1K C;  4PJO A;  1GFC A;  4ELY C;  4GLM A;  3LX7 A;  2CT3 A;  3UT1 A;  5GAO q;  2QYZ A;  3X28 B;  1XNI A;  5LJ5 d;  1U8R A;  1VQ4 A;  2BZY A;  4RTU A;  4DOW A;  2FYK A;  4IUU A;  2JM9 A;  4DBH A;  2RQR A;  5GAN f;  2ED0 A;  2LTO A;  4Z89 A;  3CC7 A;  3HTR A;  2KR3 A;  2VV5 A;  1JJ2 P;  1YHQ A;  1TH7 A;  2KDS A;  2PZ1 A;  3MEU A;  2GQV A;  5KE3 A;  5C0M A;  4J8O A;  4Z88 A;  5GMK j;  2OAW A;  2QA4 Q;  2ATC B;  1J3T A;  1YJN Q;  1MV3 A;  2L3S A;  2RJD A;  3OYK A;  1K73 C;  3RR6 A;  1TWB A;  2E65 A;  1P92 A;  3CBP A;  3OYE A;  3SD4 A;  1PKS A;  5KE2 A;  3CCJ T;  1VYV A;  3GNG A;  3CCL T;  1WXB A;  2K4Y A;  1VQO Q;  4C0D C;  2D0N A;  4E7J A;  1RI0 A;  2RK2 A;  4C92 F;  1V76 A;  1IB8 A;  3QII A;  4M77 G;  3CPW P;  4JS4 A;  2KAF A;  2NYS A;  1UEC A;  3IQL A;  2O88 A;  3OS1 A;  1NLO C;  5CKF A;  1JEG A;  1WXU A;  3CCS Q;  3ZFJ A;  2QGG A;  4IUQ A;  4UC4 A;  3TEE A;  1SF9 A;  2RM4 A;  4PJO F;  5GAO l;  1QQJ A;  4EPC A;  1WNL A;  2XG8 D;  1KD1 U;  3CC4 Q;  2K5I A;  1WHK A;  5GAN e;  3GIB A;  3QJY A;  3L2V A;  1W70 A;  3M59 A;  2X4W A;  1T0J A;  3S3N A;  4AFZ C;  4MZP A;  4OB1 B;  4QVZ A;  2BIV A;  3NTH A;  1OEB A;  5GAN 7;  2YUP A;  4AG2 C;  5IAY A;  5LJ3 d;  4HCK A;  4ELZ C;  2FG0 A;  4C5E A;  4N4H A;  2ROL A;  2X4J A;  2RQT A;  4J6W A;  3QDR B;  3QHS A;  4J9B A;  1VQ9 Q;  4Y28 E;  2CH4 A;  2W0Z A;  3G6E A;  3OYN A;  2GGR A;  1W2B A;  2EIF A;  2QDL A;  3VS0 A;  4EDU A;  3CCE Q;  4A4E A;  2I0N A;  1FMK A;  4QW2 A;  1ZSG A;  2HNI A;  3LWI A;  3A8M B;  2ABL A;  3F70 A;  4JRK A;  2DLP A;  4M7A A;  4M78 F;  4Y91 A;  1BIA A;  2CDT A;  2KBT A;  1C1A A;  1R8O B;  4J9E A;  3VS2 A;  1X6O A;  3OYD A;  1I81 A;  2ZAE A;  2O4X B;  2GF7 A;  4FYX B;  2EQU A;  4HVV A;  3PIO A;  1SSF A;  4JJB A;  2EGA A;  2WAC A;  4DOV A;  4DBQ A;  2EQJ A;  5KYX A;  1DJ7 B;  1NLP C;  4D6W A;  1VQK A;  4M7D D;  2LVM A;  1B7T A;  1UGQ B;  3OYB A;  2MMP A;  1X6B A;  3OY9 A;  2E64 A;  5LJ5 h;  1K9A A;  1YBY A;  1JB0 E;  1PRL C;  3LGL A;  3TSZ A;  2DIG A;  3VJP A;  1IGU A;  1UGS B;  5KYU A;  1D09 B;  2E1H A;  4M77 A;  3KXT A;  3CBO A;  5IT9 E;  1JO8 A;  3OW2 A;  1QWF A;  1NM7 A;  1HYO A;  2QGF B;  2J6K A;  5KYY A;  5GAN 5;  2FO0 A;  3CBM A;  3SWN C;  1NZ9 A;  2CZ7 B;  5GAO m;  1VQ7 Q;  4M7D E;  3JCM d;  4J7I A;  3BY7 A;  1KQS P;  4RTV A;  4LNP A;  2NLU A;  3V7R A;  2VVK A;  5DM7 R;  3OYY A;  4N4I A;  3S3O A;  3NFC A;  1G3T A;  4M7D C;  2AIR B;  1HSQ A;  3G71 T;  3CD6 A;  2A7Y A;  4XQ3 A;  1UUE A;  4M7A F;  4XTU A;  1JJ2 A;  1KFZ A;  3PFS A;  2XID A;  2DET A;  2E12 A;  1WXT A;  1AHJ B;  2MIO A;  1YIJ T;  3CCU A;  2DJZ A;  2E5Q A;  4PK4 A;  3CCM A;  2RHX A;  1YWO A;  4E6R A;  2M0O A;  2DVJ A;  2C0I A;  4LD9 K;  5FWC A;  4ANJ A;  1VQ4 T;  4C5G A;  1PCX A;  1IO6 A;  5A0D A;  3CC7 T;  2V8J A;  1IRX A;  2XDD A;  2YT6 A;  3G4S Q;  1YHQ T;  3M0R A;  4K11 A;  3HRU A;  3CPW A;  4M77 F;  4XAX B;  3I55 A;  1BU1 A;  3CCR A;  1K8A R;  3DB3 A;  1E7O A;  2F5T X;  1BCM A;  2EQK A;  1IZ6 A;  4ZGD B;  2DL3 A;  5FLX E;  1FYN A;  1WIE A;  3MEA A;  1SRM A;  1D0Z A;  5LJ3 h;  4J9H A;  2F2X A;  4N0A A;  2NUT B;  4HVW A;  1ZLM A;  1UB4 A;  1Y96 A;  1FMW A;  2K2M A;  2DRK A;  1BB9 A;  4DQ2 A;  1WQW A;  3OYM A;  3GOX A;  3OBW A;  2A37 A;  1K9M U;  3FDR A;  3LYI A;  4X9C A;  5IH2 A;  2RO0 A;  1Q81 R;  4RTZ A;  2JTM A;  5LJ5 g;  1V29 B;  2DZ9 A;  2JS0 A;  1VQP T;  5L23 A;  1X2K A;  1UJY A;  2V8I A;  2VUB A;  1WA7 A;  3JCM X;  1RAE B;  2JNG A;  2E41 A;  2HEQ A;  2DTH A;  2K9G A;  4M75 G;  2CSQ A;  3MEV A;  4HA8 A;  1PSE A;  4C0D B;  1RAB B;  4RKU E;  1MMN A;  2VB6 A;  2YRV A;  1M3C A;  3L1A A;  1SEM A;  2XIC A;  4AG1 C;  3AHU A;  2JTE A;  4J9D A;  4R56 A;  1UTI A;  2KEA A;  2RD1 A;  1H3H A;  3CME A;  5HCK A;  1WJS A;  1PG5 B;  3CCJ A;  3G6E T;  1HD3 A;  4HXJ A;  1Q7Y R;  1WHM A;  5I2S A;  1RI9 A;  1WJQ A;  3EGX B;  3VYG A;  4Z02 A;  4BDZ A;  3C12 A;  2FPE A;  3E9G A;  4IUR A;  2RI5 A;  2EQI A;  4QT7 A;  1NPR A;  4O5V A;  5GAN 2;  1WQ7 A;  1VQ6 Q;  2QQS A;  4LUE A;  2XHC A;  4FT2 A;  3M55 A;  2FEI A;  1EIF A;  2KGT A;  2QQB A;  5KH6 A;  1NBE B;  3PGG A;  3UPU A;  1UGR B;  5CQX A;  3TRE A;  3VV0 A;  1Q82 U;  3OYJ A;  2FPF A;  2MOX A;  2FZG B;  1IHV A;  3QO3 A;  4C0F A;  1TUD A;  4E7S A;  2KXD A;  1VQK T;  1KQS A;  1VQN A;  4NL3 A;  2YXY A;  2H3E B;  2QI2 A;  4KH0 B;  2ZCF B;  1Z9Q A;  4C92 G;  5CO7 A;  3OMC A;  2LRQ A;  4CI0 C;  4XTY A;  2F69 A;  3CCL Q;  7AT1 B;  1D1B A;  3JCM J;  1KC8 R;  3CXC S;  2MI6 A;  1AVZ C;  1FXX A;  3EAE A;  1MNE A;  2X3X D;  4J9G A;  1QCO A;  2KYM A;  4PJO G;  4AMC A;  4A4G A;  1K8A U;  2OTJ A;  1JBM A;  2CP0 A;  1YI2 Q;  2CYZ B;  4CRI A;  1M27 C;  3QYH B;  3C94 A;  3ER0 A;  4M77 E;  4JRI A;  4Z8A A;  4IUP A;  1X75 C;  2L0A A;  1K0X A;  2BE7 D;  1Z9Z A;  2KRM A;  2PVG B;  2CP6 A;  4M75 B;  3CD6 T;  4FYV B;  2QQR A;  4M77 C;  3X26 B;  3VUZ A;  5CKH A;  2LQK A;  5GMK i;  3CCU T;  3KBG A;  4J9F A;  2AKK A;  2P4R A;  1JXM A;  4XU2 A;  1CKA A;  3HL8 A;  4FW1 A;  1Q81 U;  3CCM T;  4IKF A;  2A36 A;  3SEM A;  1YJ9 A;  1KD1 R;  2DL5 A;  1W6X A;  4NOY A;  3S6W A;  3EG9 B;  1KD1 C;  3CMA A;  1M8V A;  5GAO p;  5M9O A;  2DD4 A;  2ZPB B;  2HAX A;  1U3O A;  3CC2 A;  2RF0 A;  2CP3 A;  2DO3 A;  4M78 G;  3ULR B;  4KBM B;  3OYG A;  2DTO A;  3UF4 A;  2HKQ B;  2HQH A;  3HFO A;  3I55 T;  2HQE A;  4BE0 A;  3CCR T;  1PD0 A;  3EG2 A;  5DLO A;  3KFV A;  4X1V A;  2HBW A;  2RB6 A;  3BFM A;  5CCA A;  2DEU A;  3JB9 H;  2CZ6 B;  4RG2 A;  1HK9 A;  4OB3 B;  3NGP A;  2EBP A;  3EH1 A;  5KCH A;  1BI3 A;  1QVP A;  1IRE B;  1BK2 A;  4EMK A;  1QP3 A;  4A63 B;  1TUC A;  2HSE B;  1NJI U;  2EYW A;  3C0C A;  2VC8 A;  3JB9 I;  1GXI E;  1M3A A;  5KYW B;  1ARK A;  4C92 A;  3U23 A;  1Q7Y U;  2C0O A;  2MAM A;  3I9Q A;  4R55 A;  5GAM h;  1OU8 A;  3RMQ A;  2EW3 A;  3J7A F;  4JPB W;  1LNX A;  3VS6 A;  3R6N A;  4R0K A;  3TSW A;  1XJW B;  3LGF A;  3L2R A;  2GCX A;  1I8F A;  1FX7 A;  1QVF A;  2VKN A;  2L8D A;  4N0A C;  1OI1 A;  3H0I A;  4MDX A;  1ZSZ A;  5DY9 A;  3X24 B;  4ZGJ B;  2LCC A;  1VQ8 Q;  4GLK A;  1YJW A;  2C06 A;  1QVF S;  2YUO A;  5CVI A;  4FSS A;  3LWH A;  2AT1 B;  2X4Y A;  5D6Y A;  4JUV A;  1VQO A;  4M7A G;  3FJP A;  3RDV A;  4JRP A;  3OSV A;  3JRZ A;  2B8A A;  1QLY A;  4B9W A;  2KMT A;  4TVR A;  4BB7 A;  5FWB A;  3JB9 F;  3CME T;  3G71 Q;  4E47 A;  1KC8 U;  4XU0 A;  3HHT B;  5LJ5 e;  3JCM Q;  3C4S A;  2X3W D;  3PMI A;  3FB9 A;  2CZ1 B;  1BBZ A;  3VS4 A;  1I4K 1;  1JRI A;  4ME7 A;  1MV0 B;  2EVR A;  1I5L A;  1PSF A;  2J6F A;  2FL7 A;  4AFQ C;  1OPK A;  2YRC A;  3H6Z A;  1R0B G;  3MP6 A;  3RES A;  1TS9 A;  4X9D A;  4BE2 A;  2Y4Y A;  3CC4 A;  2VXF A;  4M78 A;  3HKS A;  5LJ3 f;  3GP8 A;  3THK A;  4F7U G;  2W10 A;  2YUN A;  3CC7 Q;  1T3S A;  1YNZ A;  3LLR A;  2MPX C;  2E5K A;  3JV3 A;  2C0T A;  1YHQ Q;  5GMK l;  1VQP A;  1ZBJ A;  1WGS A;  1WHH A;  2DJQ A;  4LE9 A;  3VS7 A;  2AK5 A;  1XTD A;  3DKM A;  3QZ5 B;  1VQN T;  2P0K A;  3MHX A;  2YHT A;  2RH2 A;  5EG2 A;  4OF1 A;  2EGC A;  2E6Z A;  2XK0 A;  2VAS A;  3HRS A;  1PRM C;  2CP7 A;  3UA6 A;  3HFN A;  2KVQ G;  4LUD A;  1M8M A;  2DBK A;  4ZTJ A;  3JCM V;  2EYQ A;  4Y92 A;  4PLL A;  4FL6 A;  5J39 A;  2OTJ T;  5GAM g;  1QMC A;  2M51 A;  3RIR A;  4IIM A;  4C8Q A;  4Q5W A;  2KRO A;  1E6G A;  4MZM A;  3H0H A;  2EYZ A;  4BD3 A;  2XDP A;  3R6O A;  3OYF A;  1UHC A;  3BDL A;  3M0U A;  4V2S A;  2M02 A;  1UE9 A;  5GAN 3;  4M75 D;  1Q95 G;  3NTI A;  4IUT A;  1K9M R;  5FRM A;  3MP1 A;  2LNH B;  2RI3 A;  4PJN A;  1JQQ A;  2O2O A;  3UA7 A;  5LJ3 e;  1WFW A;  4J5Y A;  2ROT A;  3P8B B;  4XTV A;  4A54 A;  2VXE A;  1NG2 A;  2D8H A;  3UDC A;  4II1 A;  1UEB A;  3QUI A;  3EHQ A;  2E70 A;  2E4H A;  3JCM f;  4BI4 A;  1M2V A;  1YJ9 T;  2EQM A;  2K3X A;  4M75 E;  5ECA A;  2J06 A;  4BE1 A;  2QQA A;  2JT4 A;  4ATO A;  5CQY A;  4VUB A;  3A1P A;  2DL4 A;  3CMA T;  3LW5 E;  1YP5 A;  2IVW A;  4E7I A;  5KYX B;  2VGN A;  3H8Z A;  1SHF A;  2BE9 B;  1RAC B;  4OMP A;  4M75 C;  3CC2 T;  2XMF A;  3O8V A;  2HL5 C;  3L2U A;  4C0G A;  4AFU C;  4BI3 A;  4M77 B;  1TTH B;  2Y90 A;  4F7U A;  1GFD A;  4PKC C;  1AWX A;  2QQ9 A;  3M56 A;  4MML A;  3DLM A;  5GMK m;  4E7L A;  3NMZ C;  5KYY B;  2YLC A;  4C8Q F;  2BUD A;  2RPN A;  1WLP B;  5A0G A;  1M3B A;  4RMO A;  4CC3 A;  1NEG A;  2VGM A;  4C92 D;  4O6J A;  3CXC P;  4CC7 A;  1R0C B;  1VYU A;  3RKW A;  2X51 A;  2XDB A;  2LQW A;  3AT1 B;  3TU4 K;  1HXD A;  1Y07 A;  1GBQ A;  4JDS A;  5GJV B;  2F2V A;  1ZA1 B;  2GQI A;  1WDX A;  3NPF A;  2JTF A;  4OML A;  1EX4 A;  1Q82 R;  4PJO D;  2ZGW A;  1EFN A;  1ABO A;  4BAC A;  3JCM e;  3FIF A;  1G3W A;  2XKO C;  4C92 E;  1PC0 A;  1CKB A;  1MUZ A;  1YJW T;  1TXQ A;  1ACM B;  3V7S A;  2CUB A;  8ATC B;  1VYT A;  5GAN h;  4C92 C;  1W1F A;  2NWM A;  1M4Z A;  1VQO T;  3HSB A;  3O5Z A;  4PJO E;  4RCB A;  2GNC A;  2OAU A;  2LJ1 A;  2RN8 A;  5FRO A;  3DB4 A;  3JSC A;  2E3H A;  1S72 Q;  2NUP A;  2ZZD A;  2D1X A;  2FRW A;  2O31 A;  1M9S A;  4QKU A;  1IGQ A;  4F7U F;  2GTO A;  1SG5 A;  2F1L A;  2QK0 A;  3MP8 A;  2YDL A;  4PJO C;  1K8A C;  3URG A;  1RLP C;  5C6S A;  2PU9 B;  2IG0 A;  2SRC A;  2KSS A;  1ZSZ C;  2H3J A;  2HCK A;  1RLQ C;  3CCU Q;  2D6F A;  1X69 A;  2V26 A;  2XI9 A;  4ZNX A;  1U5S A;  1YCY A;  5AYF A;  2RA2 A;  3CCM Q;  1Y96 B;  2BZX A;  5GMK h;  1BYM A;  2DX1 A;  3VUB A;  3MKD A;  3OBY A;  2HMA A;  2EGE A;  5J26 A;  3V8L A;  2D8J A;  3CC4 T;  5EC7 A;  1KJW A;  2RNA A;  4LDW A;  1D1A A;  2GFU A;  1VQ5 A;  2RHY A;  1D3B A;  2NUT A;  1SPK A;  4KUD K;  4B9X A;  3E9F A;  3OS5 A;  4RTY A;  3A8O B;  1UGV A;  5A2Q E;  1WHL A;  1X01 A;  1Q81 C;  3CCV Q;  1VQM A;  3I55 Q;  4CC2 A;  2K57 A;  4KGX B;  2FZK B;  2H8H A;  2GTJ A;  2BKD N;  1YIT A;  4M78 E;  3GF5 A;  1QW1 A;  1GCQ A;  1B34 A;  2VYT A;  2KRS A;  1QCF A;  3GNF B;  2YLB A;  2DXT A;  3JCM b;  1VQ9 T;  2DVE A;  2X4X A;  4M78 C;  1MMA A;  1PD1 A;  1XOV A;  1RAF B;  2IIM A;  3EFS A;  3A8G B;  2RHU A;  3E19 A;  3LH0 A;  4D8D A;  2CS7 A;  5CIU A;  1QVF P;  2DK3 A;  2HD0 A;  4KUL A;  1GBR A;  8AT1 B;  1E6H A;  1VQ6 A;  1NJI R;  3BE3 A;  2CRE A;  5CAI A;  3RBB B;  3GPL A;  2R57 A;  1MGQ A;  3OB9 A;  3CCQ A;  2EJG A;  4DEY A;  5GAM d;  3CQT A;  4M7A D;  1Q7Y C;  3J81 E;  2QTX A;  2OTL A;  4QQ6 A;  3L2Z A;  4BY6 C;  2DL8 A;  4LN2 A;  3H9N A;  3PVQ A;  3OMG A;  3RUX A;  4XU3 A;  1LJO A;  2XU8 A;  2A3L A;  3MEW A;  5GAN g;  2PQW A;  2KYB A;  3JB9 G;  3VS3 A;  1GRI A;  4DBR A;  1BI0 A;  3WVE B;  2QTV A;  3JB9 J;  2V8K A;  1FMV A;  2G3R A;  2FVU A;  3JAM E;  3QSU A;  1N9R A;  5FU7 B;  4OGC A;  2QEX A;  4M7A E;  3CME Q;  1VA7 A;  1WZO A;  1KG1 A;  2DTI A;  4BI8 B;  1B3Q A;  4IIO A;  1T0H A;  1YN8 A;  3M0S A;  3A5Z B;  2EPD A;  3CXC A;  3TQ7 P;  2HDA A;  2LJ0 A;  1QCN A;  2LCS A;  4M77 D;  5AT1 B;  3CCJ Q;  1IXD A;  3OA6 A;  4M7A C;  3EH2 A;  6AT1 B;  1RAA B;  2JS2 A;  2FPD A;  3I56 A;  3PIP A;  3G7Z A;  2COY A;  1BI1 A;  5IXF A;  5L8R E;  4ZTF A;  4L59 A;  2AHJ B;  4N4G A;  1KC8 C;  1WYX A;  1RAI B;  4OVA A;  3QG1 A;  1RAD B;  5CR2 A;  4XTX A;  1ABQ A;  5A0L A;  2LC4 A;  2CGH A;  4E7K A;  4F7U E;  3GLX A;  4F16 A;  1Y71 A;  4MDW A;  3EG3 A;  1AEY A;  1VQN Q;  2COW A;  2QDY B;  4RTT A;  5IXB A;  4C5H A;  4JJC A;  2DIL A;  3INZ A;  4PNO A;  1N8R U;  3REA B;  4A4H A;  1TSF A;  3HP9 A;  2A08 A;  4HKE A;  4LD6 A;  4QVD A;  2KQW A;  1XQH A;  4FSX A;  4FYW B;  2D9T A;  2EKH A;  2CZ0 B;  3DLL A;  4ZN1 A;  1JU5 C;  2FHD A;  1N5Z A;  2ZPI B;  4WTO B;  2K6D A;  3NHN A;  5LJ5 j;  2R58 A;  4RG8 A;  1WHG A;  1HJD A;  3SWN A;  1D0X A;  3VRY A;  1SSH A;  3FJ5 A;  4J83 A;  2LJ3 A;  4RTW A;  1VQL A;  1Y57 A;  4OMF B;  4IUV A;  2PNI A;  1PM3 A;  2KE9 A;  2IPO B;  5LJ5 f;  3QWY A;  4M7D A;  1V1C A;  2DYB A;  3QBY A;  3A98 A;  1BCO A;  4EMK B;  2JUF A;  3M0Q A;  3EGD A;  3JCM c;  2L3R A;  1YJ9 Q;  1D1C A;  1QWE A;  4WF2 A;  1SRL A;  3EFO A;  3VS1 A;  2JZ2 A;  2RJF A;  1PKT A;  1VQ8 A;  1QVG S;  1RUW A;  4C92 B;  3CMA Q;  1VQ5 T;  2CSI A;  4JLG A;  4YTL A;  3WXM B;  4DA4 A;  3M9Q A;  4FCY A;  3MJX A;  3CC2 Q;  2X9H A;  1H92 A;  5D6W A;  1VQM T;  2EKO A;  4C8Q G;  2J7I A;  4OMM A;  4OMN A;  4PJO B;  2QA4 A;  1YIT T;  4HT8 A;  4A4K A;  1GCP A;  1M1G A;  1YJN A;  1ZSZ B;  4FIB A;  1RL2 A;  3SHW A;  1KQ1 A;  4LDV A;  1NE8 A;  1M1K R;  4GBQ A;  2JN0 A;  2KXC A;  2P84 A;  2L2P A;  5IHN A;  1G3Y A;  1NYF A;  1VIF A;  2RQV A;  4JZ4 A;  2JJ9 A;  2RI2 A;  3N5B B;  3SFM A;  2LQ8 A;  2BTT A;  2RHZ A;  4FM4 B;  3RER A;  3M54 A;  1YWP A;  1ZA2 B;  1VQ6 T;  4L5G A;  4M7D F;  5LJ3 j;  3CCS A;  1G2B A;  1U06 A;  1YIJ Q;  4EIK A;  5J3B A;  1GCQ C;  4QQG A;  4HCC A;  2JVV A;  4J9C A;  3CCQ T;  3PT9 A;  1N9S A;  2DM1 A;  3H0F A;  1K73 R;  2OTL T;  3A8L B;  4F04 B;  3MET A;  1YJW Q;  1QP2 A;  3X25 B;  4LXC A;  1X2Q A;  1VQ4 Q;  1Q86 U;  4M78 B;  1ZX6 A;  3CPF A;  2FZC B;  1KK7 A;  2ESW A;  2I2L A;  3H41 A;  1LOJ A;  2MWO A;  1AZE A;  4JLI A;  2LX7 A;  2O9S A;  1NEB A;  4P5N A;  1M90 U;  1EZZ B;  4ESR A;  2LCL A;  2QEX T;  1K1Z A;  5GAN 4;  4J9I A;  5GAN d;  2Y4X A;  2ZPE B;  1YI2 T;  3BW1 A;  2R5A A;  1BI2 A;  5CKD A;  1VQ9 A;  1OX8 A;  3OYA A;  1NYG A;  4J6Y A;  1K4U S;  3QDF A;  3CCE A;  3I56 T;  2DPP B;  2K5F A;  4BY6 B;  4JRQ A;  5KYN A;  3OYI A;  4OGE A;  3QPH A;  5HK3 A;  2PTK A;  2AZV A;  5FU7 C;  2DYI A;  2GBQ A;  3CEY A;  2B86 A;  2YWW A;  4E2F B;  4C8Q B;  1KQ2 A;  1VOM A;  3M53 A;  4M4Z A;  4BDY A;  2M1H A;  3VS5 A;  1VQP Q;  3OSS C;  3OQ5 A;  2DL7 A;  1TU0 B;  5GAN 8;  3V7C A;  1IHW A;  3EGU A;  5I11 A;  1OYX A;  3L2Q A;  3M0P A;  4FYY B;  2GFA A;  1X43 A;  1O9S A;  4ZN3 A;  2E3I A;  1K9M C;  1OU9 A;  1OPL A;  1UGP B;  2RQW A;  2K2V A;  4M7A B;  2FB7 A;  1U1T A;  3L2W A;  2DF6 A;  4EMH A;  1W4S A;  3ZEH A;  1C0M A;  3C95 A;  1WJR A;  2EYY A;  5GMK e;  3E2U A;  4A4F A;  2F5K A;  4NL2 A;  3TVT A;  1OQK A;  1M2V B;  4XTZ A;  1I0C A;  1T3L A;  3JCM W;  5KCO A;  2MWP A;  5HK0 A;  3PTA A;  1W2B S;  2HBP A;  4D8K A;  2G6F X;  1VQ7 A;  1TG0 A;  4NS5 A;  2E6N A;  2KI7 A;  4HCB A;  1AWJ A;  2DD5 A;  2O4X A;  5CK9 A;  1M1K U;  2LT1 A;  2P0P A;  1TOV A;  2RJC A;  4OMO A;  3G6E Q;  4F17 A;  3EG1 A;  1I07 A;  2K5L A;  4QVC A;  1N6A A;  5KYU B;  2AZS A;  3JB9 D;  3A8H B;  1VQL T;  4LDU A;  1YCS B;  4F7U B;  3P8D A; 
#chains in the Genus database with same CATH homology
 2QQR A;  4M77 C;  3X26 B;  3VUZ A;  2RJD A;  3OYK A;  1B34 A;  5CKE A;  3ASK A;  1K73 C;  2VYT A;  2E65 A;  5CKH A;  2LQK A;  3OYH A;  3ZBD A;  3GNF B;  5GMK i;  1P92 A;  3CBP A;  3OYE A;  3SD4 A;  3CCU T;  2YLB A;  2DXT A;  3KBG A;  3JCM b;  1VQ9 T;  5KE2 A;  3CCJ T;  3GNG A;  3CCL T;  4XU2 A;  2K4Y A;  2DVE A;  3HL8 A;  2X4X A;  4M78 C;  4C0D C;  3CCM T;  1Q81 U;  4IKF A;  2M16 A;  1XOV A;  4E7J A;  1RI0 A;  3EFS A;  1YJ9 A;  3A8G B;  2RK2 A;  2RHU A;  3HPW A;  3E19 A;  4C92 F;  3LH0 A;  1VQ8 T;  1Y7X A;  3QII A;  4M77 G;  2CS7 A;  4NOY A;  5CIU A;  3S6W A;  1ZBX A;  4JS4 A;  2DK3 A;  2HD0 A;  2KAF A;  2DAQ A;  4KUL A;  5GAO p;  5M9O A;  3CMA A;  1KD1 C;  2DD4 A;  1M8V A;  5FU6 C;  2ZPB B;  2EAY A;  1K73 U;  3PMT A;  4C5I A;  3E1S A;  1VQ6 A;  2HAX A;  3OW2 S;  4E7H A;  2D6F A;  3OS1 A;  5CKF A;  3CC2 A;  4XU1 A;  2DO3 A;  3G4S A;  4M78 G;  5CAI A;  3ZFJ A;  4KBM B;  3OYG A;  4IUQ A;  4UC4 A;  3TEE A;  2DTO A;  2RM4 A;  1S72 A;  4PJO F;  3GPL A;  3HFO A;  3I55 T;  2HQE A;  1MGQ A;  2R57 A;  3OB9 A;  3CCR T;  4BE0 A;  3CCQ A;  5DLO A;  5GAO l;  2EJG A;  1Q82 C;  4F7U B;  5GAM d;  2JOY A;  2DKG A;  2QA4 T;  4C0Z A;  3S3M A;  4EPC A;  2DIQ A;  1WNL A;  4M7A D;  2DXC A;  3J81 E;  2QTX A;  4EMK C;  1Q7Y C;  1YJN T;  2OTL A;  2RB6 A;  3BFM A;  4QQ6 A;  5DLQ E;  3L2Z A;  2XG8 D;  4BY6 C;  5CCA A;  1KD1 U;  3JB9 H;  3OMG A;  2CZ6 B;  3RUX A;  2K5I A;  5GAN e;  4RG2 A;  3GIB A;  1HK9 A;  2DEQ A;  4OB3 B;  3QJY A;  4XU3 A;  2MF2 A;  1LJO A;  5KCH A;  2XU8 A;  1BI3 A;  1QVP A;  2A3L A;  2PQW A;  3MEW A;  1IRE B;  2PVO B;  5GAN g;  3L2V A;  3JB9 G;  3RKY A;  4EMK A;  3M59 A;  1BI0 A;  1QP3 A;  3WVE B;  2X4W A;  3S3N A;  1JJ2 S;  3JB9 J;  2EFI A;  2V8K A;  1NJI U;  2G3R A;  4MZP A;  1ZHI A;  4OB1 B;  4QVZ A;  2BIV A;  2VC8 A;  2FVU A;  3NTH A;  3JB9 I;  1GXI E;  4KT0 E;  3JAM E;  5GAN 7;  1N9R A;  3QSU A;  5FU7 B;  4C92 A;  5IAY A;  5LJ3 d;  1OZ2 A;  1Q7Y U;  4OGC A;  2QEX A;  4ELZ C;  3QYG B;  4M7A E;  4C5E A;  2MAM A;  4BUG A;  1KG1 A;  4R55 A;  2DTI A;  5GAM h;  4BI8 B;  5GAO r;  3RMQ A;  4N4H A;  1H3Z A;  1M1F A;  1G5V A;  5I2M A;  2X4J A;  3J7A F;  1LNX A;  3A5Z B;  4J6W A;  3QDR B;  3QHS A;  1KHC A;  3VU3 C;  3CXC A;  3CCS T;  4M77 D;  3LGF A;  4Y28 E;  3L2R A;  3OA6 A;  2GCX A;  1I8F A;  4M7A C;  3G6E A;  3OYN A;  1FX7 A;  3CCV A;  1QVF A;  1W2B A;  1VUB A;  2EIF A;  2WSF E;  4EDU A;  4A4E A;  2L8D A;  3PIP A;  3G7Z A;  3Q1J A;  3I56 A;  4N0A C;  1BI1 A;  1OI1 A;  4QW2 A;  5L8R E;  4MDX A;  2HNI A;  5DY9 A;  3X24 B;  4ZTF A;  4M78 D;  3LWI A;  3A8M B;  4L59 A;  3F70 A;  4ZGJ B;  4JRK A;  2LCC A;  2AHJ B;  4N4G A;  4GLK A;  4M78 F;  3CPW S;  4Y91 A;  1YJW A;  1KC8 C;  2C06 A;  1QVF S;  4M7A A;  1BIA A;  4L6V 5;  4OVA A;  5CVI A;  1WPY A;  4X34 A;  3QG1 A;  3LWH A;  3QJ6 A;  5CR2 A;  5GAM j;  4XTX A;  1R8O B;  3M57 A;  5A0L A;  1D3B B;  2X4Y A;  2LC4 A;  1N8R C;  5D6Y A;  4JUV A;  2CGH A;  1VQO A;  1X6O A;  4GY5 A;  4M7A G;  4E7K A;  3FJP A;  3OYD A;  3TCJ A;  1I81 A;  2WSC E;  4JRP A;  3OSV A;  3OYL A;  2O4X B;  3JRZ A;  2B8A A;  1MHN A;  4F7U E;  3GLX A;  2GF7 A;  2EQU A;  3PIO A;  1SSF A;  1Y71 A;  4MDW A;  4B9W A;  2KMT A;  2WAC A;  3M58 A;  4TVR A;  4BB7 A;  4DOV A;  3QKJ A;  3JB9 F;  2EQJ A;  3CME T;  3EFR A;  3P8H A;  4E47 A;  4OP0 A;  1DJ7 B;  4XU0 A;  4D6W A;  5GAM f;  1KC8 U;  1VQK A;  3HHT B;  5CKB A;  5LJ5 e;  3JCM Q;  4M7D D;  2LVM A;  3C4S A;  1UGQ B;  3PMI A;  2MMP A;  1KHI A;  2QDY B;  2CZ1 B;  3FB9 A;  3OYB A;  3OY9 A;  2E64 A;  3KUF A;  5LJ5 h;  4C5H A;  1B34 B;  1YBY A;  1I4K 1;  1JB0 E;  3INZ A;  3LGL A;  3VJP A;  2DIG A;  1JRI A;  4PNO A;  1N8R U;  1NPP A;  4A4H A;  4ME7 A;  3HP9 A;  1O75 A;  4J7F A;  4HKE A;  1I5L A;  1UGS B;  4LD6 A;  4QVD A;  1PSF A;  2KQW A;  2E1H A;  4FU6 A;  4M77 A;  1XQH A;  3UWN A;  3CBO A;  4FSX A;  3KXT A;  3CCE T;  5IT9 E;  2FL7 A;  1VIE A;  2D9T A;  3SB2 A;  3H6Z A;  2CZ0 B;  3MP6 A;  3RES A;  3OW2 A;  3QXE B;  4X9D A;  4LDX A;  3DLL A;  4ZN1 A;  3V8J A;  3VKI A;  4BE2 A;  2Y4Y A;  2FHD A;  2VXF A;  3CC4 A;  2ZPI B;  4C8Q D;  4M78 A;  5GAN 5;  3HKS A;  5LJ3 f;  3CBM A;  3GP8 A;  4F7U G;  3SWN C;  1NZ9 A;  2CZ7 B;  5GAO m;  4M7D E;  2LDM A;  3JCM d;  4J7I A;  3BY7 A;  5LJ5 j;  2R58 A;  3LLR A;  2LNV A;  4RG8 A;  3JCM P;  4XTW A;  5GMK l;  2NLU A;  1VQP A;  3V7R A;  5DM7 R;  1NJI C;  3OYY A;  1WGS A;  4N4I A;  3SWN A;  3S3O A;  3NFC A;  1G3T A;  2L5Q A;  4M7D C;  4PL6 A;  4J83 A;  5HY6 A;  1XTD A;  3DKM A;  3G71 T;  3QZ5 B;  2QXF A;  1VQL A;  1VQN T;  2A7Y A;  3HRT A;  3MO8 A;  4XQ3 A;  2P0K A;  4IUV A;  3MHX A;  4OMF B;  3CD6 A;  2YHT A;  4M7A F;  2LT4 A;  2RH2 A;  4XTU A;  1JJ2 A;  3PFS A;  2XID A;  4C8Q E;  4LDY A;  5EG2 A;  5LJ5 f;  2E12 A;  4OF1 A;  4M7D A;  1AHJ B;  1YIJ T;  3OS2 A;  3CCU A;  2E6Z A;  2XK0 A;  3HRS A;  3QBY A;  2DJZ A;  3CCL A;  2E5Q A;  3PNW C;  5LL6 S;  2RJE A;  4EMK B;  5GAN 6;  2JUF A;  3JCM c;  3CCM A;  2RHX A;  2L3R A;  3HFN A;  3JCM h;  2KVQ G;  4M7D G;  2M0O A;  4WF2 A;  4C8Q C;  4LD9 K;  3RMS A;  2O01 E;  2JZ2 A;  2RJF A;  4ZTJ A;  2P4T A;  1VQ8 A;  3JCM V;  1N27 A;  5GAM e;  2EYQ A;  1QVG S;  4PLL A;  4C92 B;  1VQ4 T;  1M5Q 1;  4FL6 A;  4C5G A;  5J39 A;  1VQ5 T;  2P0Q A;  4JLG A;  2OTJ T;  5GAM g;  3M4G A;  4YTL A;  3WXM B;  4DA4 A;  3M9Q A;  2RK1 A;  3RIR A;  5A0D A;  1YI2 A;  1VQ7 T;  3CC7 T;  4C8Q A;  2XD0 A;  4Q5W A;  2V8J A;  4MZM A;  2XDD A;  4HT9 A;  4BD3 A;  2XDP A;  1YHQ T;  2DZC A;  3R6O A;  3OYF A;  3BDL A;  2PVD B;  4V2S A;  5D6W A;  3HRU A;  4EMG A;  1FWZ A;  5GAN 3;  4M75 D;  3CPW A;  4M77 F;  2EKO A;  1VQM T;  4XAX B;  4C8Q G;  3I55 A;  3CCR A;  3NTI A;  4IUT A;  4PJO B;  5FRM A;  3DB3 A;  4A53 A;  2QA4 A;  2F5T X;  1YIT T;  3MP1 A;  4OB2 B;  4A4K A;  2RI3 A;  2EQK A;  4HT8 A;  1M1G A;  1IZ6 A;  2DXB A;  2L89 A;  1YJN A;  4FIB A;  4ZGD B;  1RL2 A;  2ZPF B;  1KQ1 A;  2KK4 A;  4LDV A;  5FLX E;  5LJ3 e;  3MEA A;  1NE8 A;  4J5Y A;  3P8B B;  5LJ3 g;  4XTV A;  3ME9 A;  2VXE A;  5LJ3 h;  4A54 A;  3X20 B;  4MZT A;  4N0A A;  3UDC A;  2JN0 A;  4II1 A;  3WVD B;  1KQS S;  1UEB A;  3QUI A;  1UB4 A;  1Y96 A;  2E70 A;  3M5A A;  5I21 A;  1G3Y A;  1VIF A;  3JCM f;  1H64 1;  4BI4 A;  1YJ9 T;  2EQM A;  2K3X A;  4M75 E;  4MMK A;  5IN1 A;  4DQ2 A;  4BE1 A;  2R5M A;  2QQA A;  2RI2 A;  3N5B B;  4ATO A;  3SFM A;  2LQ8 A;  5CQY A;  1WQW A;  2RHZ A;  4FM4 B;  3OYM A;  3RER A;  3M54 A;  4VUB A;  3GOX A;  3OBW A;  3CMA T;  2PUO B;  3LW5 E;  5HKC A;  3OYC A;  1K9M U;  2IVW A;  4E7I A;  2VGN A;  3FDR A;  3H8Z A;  3LYI A;  2RO0 A;  4X9C A;  1U1S A;  1VQ6 T;  1Q86 C;  4L5G A;  4M75 C;  2JTM A;  2D0Q B;  4OB0 B;  3L42 A;  5LJ5 g;  3CC2 T;  1V29 B;  2DZ9 A;  4M7D F;  2M9U A;  3G4S T;  5LJ3 j;  3O8V A;  3L2U A;  2KY9 A;  4C0G A;  3CCS A;  1VQP T;  3FRN A;  5J3B A;  1S72 T;  4BI3 A;  4QQG A;  4HCC A;  2JVV A;  2V8I A;  3CCQ T;  1M90 C;  3PT9 A;  1N9S A;  2VUB A;  4M77 B;  3T9N A;  4M75 A;  3JCM X;  2Y90 A;  4F7U A;  4PKC C;  2OTL T;  2QQ9 A;  3M56 A;  5FRN A;  2JNG A;  2E41 A;  3A8L B;  4MML A;  3DLM A;  2EJF A;  5GMK m;  4E7L A;  3MET A;  2DTH A;  1QP2 A;  3X25 B;  4M75 G;  3MEV A;  4HA8 A;  1Q86 U;  2LX9 A;  2YLC A;  4M78 B;  4C8Q F;  1PSE A;  2BUD A;  2E10 A;  4C0D B;  3CPF A;  5A0G A;  2EJ9 A;  4RKU E;  3FEO A;  4RMO A;  2I2L A;  3OS0 A;  2K3Y A;  2YRV A;  1LOJ A;  2MWO A;  3L1A A;  2HQX A;  4JLI A;  2VGM A;  4C92 D;  4P5N A;  2XIC A;  4O6J A;  1M90 U;  4RCC A;  3RKW A;  3J80 E;  3AHU A;  2XDB A;  3SWN B;  2LCL A;  5FU6 B;  4QQD A;  1HXD A;  2QEX T;  3TU4 K;  1Y07 A;  4R56 A;  2RD1 A;  2RHI A;  5GAN 4;  4JDS A;  3RKX A;  5GAN d;  3CME A;  2Y4X A;  2ZPE B;  1YI2 T;  5GAO n;  3MCA B;  2JTF A;  3BW1 A;  1WJS A;  2R5A A;  1BI2 A;  4PJO D;  3VYH B;  4M7D B;  5CKD A;  2ZGW A;  1VQ9 A;  3CCJ A;  3G6E T;  4HCZ A;  4BAC A;  3JCM e;  3FLG A;  3CCV T;  3OYA A;  1QVG A;  4J6Y A;  3FIF A;  5I2S A;  3CCE A;  3JCM g;  3I56 T;  1G3W A;  2XKO C;  2DPP B;  2K5F A;  4BY6 B;  4C92 E;  1WJQ A;  4J6X A;  3VYG A;  4JRQ A;  4Z02 A;  3OYI A;  4OGE A;  1YJW T;  3SDZ A;  4BDZ A;  1BKB A;  3C12 A;  3E9G A;  3QPH A;  2ZPH B;  2RI5 A;  4IUR A;  3V7S A;  5HK3 A;  5FU7 C;  1NPR A;  4O5V A;  1ZQ1 A;  5GAN 2;  5GAN h;  1WQ7 A;  4C92 C;  2EWN A;  3CEY A;  2QQS A;  4C8Q B;  1M4Z A;  2XHC A;  2ZPG B;  3M4Y A;  3M55 A;  4FT2 A;  2WSE E;  1VQO T;  1KQ2 A;  1EIF A;  3HSB A;  2QQB A;  3M53 A;  4BDY A;  4RCB A;  4PJO E;  2OAU A;  2M1H A;  3V8K A;  5KH6 A;  5FRO A;  3PGG A;  3UPU A;  1UGR B;  3DB4 A;  3JSC A;  3OQ5 A;  3OSS C;  5CQX A;  3TRE A;  3VV0 A;  1Q82 U;  2ZZD A;  5GAN 8;  3OYJ A;  3V7C A;  1M9S A;  4M75 F;  3FC3 A;  1BIB A;  4FT4 A;  3QO3 A;  3QZ9 B;  2X35 A;  4PLI A;  4C0F A;  4F7U F;  1OYX A;  3L2Q A;  3MP8 A;  3G71 A;  1VQK T;  4JJN K;  1KQS A;  1VQN A;  3NTK A;  2CKK A;  2GFA A;  1O9S A;  4ZGE B;  4ZN3 A;  4XK8 E;  2QI2 A;  4NL3 A;  4JS5 A;  3URG A;  1K8A C;  4PJO C;  1K9M C;  1UGP B;  1G3S A;  5C6S A;  2PU9 B;  2K2V A;  2ZCF B;  4KUI A;  2IG0 A;  4C92 G;  4M7A B;  2DXU A;  2KSS A;  2FB7 A;  3BDU A;  5CO7 A;  1U1T A;  2H3J A;  3OMC A;  1OZ3 A;  2LRQ A;  3L2W A;  4CI0 C;  4EMH A;  1YIJ A;  1W4S A;  3ZEH A;  2PUK B;  5D6X A;  5GAN j;  3C95 A;  2XI9 A;  1WJR A;  4XTY A;  2F69 A;  1M1K C;  5GMK e;  1YCY A;  4PJO A;  5AYF A;  2RA2 A;  4A4F A;  4ELY C;  2F5K A;  4NL2 A;  1Y96 B;  3JCM J;  3LX7 A;  5GMK h;  3CXC S;  3UT1 A;  5GAO q;  2MI6 A;  3X28 B;  1BYM A;  1FXX A;  3EAE A;  1XNI A;  4XTZ A;  3VUB A;  3OBY A;  5LJ5 d;  5J26 A;  3JCM W;  3V8L A;  5KCO A;  3CC4 T;  4PJO G;  1U8R A;  2MWP A;  4A4G A;  5HK0 A;  3PTA A;  1W2B S;  4LDW A;  1VQ4 A;  2GFU A;  1K8A U;  1VQ5 A;  2HBP A;  4DOW A;  2OTJ A;  1JBM A;  2FYK A;  4IUU A;  1VQ7 A;  2RHY A;  1D3B A;  2CYZ B;  5GAN f;  4CRI A;  2LTO A;  3CC7 A;  4NS5 A;  4KUD K;  2E6N A;  4B9X A;  2VV5 A;  3QYH B;  4HCB A;  3E9F A;  3C94 A;  3OS5 A;  3A8O B;  2DD5 A;  3ER0 A;  4M77 E;  2O4X A;  5CK9 A;  1YHQ A;  1M1K U;  1TH7 A;  2LT1 A;  2KDS A;  4JRI A;  1X01 A;  4IUP A;  5A2Q E;  2P0P A;  1Q81 C;  2RJC A;  1X75 C;  1VQM A;  4QVC A;  2K5L A;  3MEU A;  2K57 A;  1N6A A;  2GQV A;  5KE3 A;  3JB9 D;  3A8H B;  2PVG B;  5C0M A;  4J8O A;  2BKD N;  5GMK j;  1VQL T;  4LDU A;  4M75 B;  3CD6 T;  1YIT A;  4M78 E;  3P8D A;  3GF5 A;  1QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...