1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
3X25B 3A8OB 3A8GB 4OB1B 2ZPFB 3A8HB 2PUKB 3X26B 1QP2A 4FM4B 2QDYB 4Y28E 3WVDB 2WSFE 3A8LB 2CZ1B 2ZPHB 2AHJB 1AHJB 2ZPGB 4L6V5 1PSFA 3QZ9B 2PVDB 2DD4A 2DXBA 3QXEB 4OB0B 4ZGEB 4RKUE 3QYGB 4ZGJB 1GXIE 2CZ7B 3A8MB 3X20B 1PSEA 2PVGB 1UGPB 2PVOB 4OB2B 1UGRB 4KT0E 4XK8E 3VYHB 3X28B 3VYGA 4ZGDB 2ZPBB 2ZZDA 3X24B 2O01E 2WSCE 1DJ7B 1IREB 1UGSB 2D0QB 2PU9B 1JB0E 2WSEE 2DPPB 2ZPEB 3HHTB 3WVEB 1V29B 3LW5E 2CZ6B 4OB3B 3QYHB 1UGQB 1QP3A 2DD5A 2ZCFB 2ZPIB 2DXCA 5L8RE 2CYZB 2PUOB 3QZ5B 2CZ0B
chains in the Genus database with same CATH superfamily
4ESRA 4RTYA 2CH4W 1VQMQ 3L42A 2CZ1B 3MPUB 1SF9A 4J9EA 2OI3A 3OYCA 1M4ZA 4Z89A 3HL8A 3THKA 4B9WA 1B7TA 2RQRA 4OMMA 4JJBA 2CZ0B 4M77G 2RQWA 1YFNA 2A37A 2R5AA 2CT4A 2LP5A 1VYTA 2CT3A 1SG5A 4OMLA 3URGA 2MWOA 3X24B 4M7AE 3KBGA 5J3BA 5IHKA 1KC8C 3GBQA 4PJLA 5J39A 2CUDA 3OSVA 2CREA 2YRVA 4RCCA 1PNJA 1KJWA 1MV0B 2DERA 2LTOA 4M78A 4CI0C 2DXUA 5GAN7 3G71Q 4FYVB 3BE3A 4MZPA 1BIBA 4XU1A 5LJ3d 4EPCA 3RNJA 1WFWA 4IUPA 4E7IA 2DLPA 3OBWA 1BI1A 5GAOl 4LN2A 1RAEB 2VB6A 3AT1B 4HCZA 2JN0A 1VQ9A 2RMOA 3FC3A 4FIBA 2FPDA 3H9NA 5GAN2 4MZMA 1HJDA 5DLOA 5IHIA 1X69A 5HK0A 3PVQA 3QDRB 1YJNT 1BYMA 2XG8D 2CGHA 4ORZA 1VQ5A 3CBOA 4CC3A 3JB9G 2M02A 1MMGA 3C4SA 2GBQA 3A98A 2OTLA 3CCJQ 3QYHB 2E5QA 2HZYA 1YP5A 4IUQA 1OX9A 2K5LA 4NL2A 3QKJA 1LCKA 3LH5A 4F7UE 1EZZB 4E2FB 4IURA 5GAN4 1I5OB 2K2MA 2FG0A 4OMQA 3CCVA 1Q7YC 4PJOD 3SDZA 3VS0A 2DX1A 3G4ST 4QQDA 2JZ2A 1KQ1A 5CKDA 2DRKA 1ACMB 2XIDA 3MEVA 5GJVB 3OMCA 3LW5E 4XU2A 3OYLA 4J8OA 2DETA 1WHLA 1ZUYA 3G7ZA 3RMSA 4C8QE 2XDDA 1ZUKA 4MZTA 3UA6A 2YUPA 1KC8R 3JCMc 1Y96A 1KFZA 1E6GA 4AMCA 3OYBA 4QKUA 3M0PA 2QA4A 3EGDB 2XMFA 3RIRA 1OU9A 2E65A 1ZUUA 2K57A 4HA8A 4M75C 1RL2A 1O9SA 3OMGA 3I35A 2QQAA 4XAXB 1WXBA 1T3LA 2CP3A 2OTJQ 4M75A 2VASA 2AT1B 3OS0A 1UGVA 1VQ9Q 3EGUA 3P8HA 2DRMA 1Q86U 4Z88A 2NUPA 2JUFA 2BIVA 4KUDK 3LGFA 3HHTB 1QVGA 4DBRA 1HD3A 2P4RA 2XHCA 3NPFA 1VQ6A 5KE2A 1M3CA 3Q1JA 2DL3A 2L3RA 3FJPA 2LNHB 4GY5A 4M4ZA 5CQYA 2BUDA 1R0CB 2RI5A 1RAHB 3QHSA 3RMQA 2DJQA 4EIKA 3I55T 1K1ZA 3M0RA 3EG0A 4C92F 4EDUA 2KYBA 1K0SA 1VOMA 4XTUA 1HSQA 1YN8A 5I2SA 4ME7A 2HL5C 3VUBA 2CP2A 2E6NA 1K4US 4ZN1A 3DB3A 3H6ZA 1X6OA 2QEXT 5IH2A 1JXMA 4C8QC 1Q86C 2XDPA 3VS6A 2LC4A 3QYGB 1GL5A 3M58A 2DKGA 2RB6A 4PJOA 5LJ3e 3JCMg 2ZGWA 2HNIA 4PL6A 1YHQT 2KROA 2BTTA 3OBYA 4OF1A 2QI2A 5GAN8 2KEAA 3OYEA 2FO0A 6AT1B 2HSPA 5C6SA 1GFCA 3EGDA 1IHWA 1K76A 1QP2A 1B3QA 3MEAA 4J9BA 1ABOA 2ECZA 1BCOA 4OB0B 2DD4A 2EAYA 3LX7A 5LJ5f 4C8QG 1M2OA 2X4YA 5EC7A 3VS7A 4DBHA 1TS9A 2JMCA 3LYIA 3JCMQ 1U5SA 2M51A 2X4JA 3PVLA 4OMPA 2GCXA 3CXCP 2JOYA 2XK0A 4LDVA 1YJ9T 4XTVA 2C0IA 5GAOq 3M56A 1WQWA 5GANf 3CCMT 1AEYA 3R6OA 4M78C 5I22A 1S72T 1OQKA 3M9QA 2EWNA 2GTJA 1SKUB 4HVWA 2DTHA 2VV5A 2D0QB 4XU3A 4M7DD 2EKOA 2M1HA 2J7IA 5IHNA 1I4K1 2KYMA 1MMDA 3M4YA 4PJOE 3LWHA 3QBYA 2ZPHB 4XTZA 5GAN3 1G83A 4PLIA 2VYTA 2DL5A 3FB9A 4J6WA 3A8MB 5LJ3j 4FU6A 3GIBA 1V1CA 4DQ2A 2DZ9A 5CCAA 3M0SA 3UF4A 5KYUB 1VQMA 2DEUA 3CCEA 1RI0A 1NJIC 3NMZC 2VXEA 2RJFA 4Z8AA 3SWNB 2OTJT 4RTUA 1CSKA 4A54A 1LNXA 3CXCS 3CCLQ 3J81E 2V8IA 3CMET 3HFOA 1UEBA 1SSHA 2KT8A 2DAQA 4RTTA 4DOVA 1BI0A 3RKWA 4TVRA 1D3BA 1PSEA 3CCQA 1PD0A 5CK9A 4J9CA 4NS5A 7AT1B 2V1RA 2HKNA 2RHXA 1UE9A 2ZPEB 3HTRA 2J06A 1M1KC 5C0MA 3H0FA 1Y07A 4C5EA 4EMGA 2HD0A 5KE3A 3H0HA 3PFSA 1M27C 3JCMP 4QVZA 2D0NA 4GBQA 2EJ9A 2RD1A 1OYXA 2WSFE 2P0KA 3L2UA 4J9FA 3VS1A 2DO3A 3MKDA 4YTLA 2VUBA 5LJ3g 2V26A 1TXQA 3M4GA 3QPHA 4D8KA 1QKWA 3L2WA 3ZFJA 4MDXA 2LJ1A 4F14A 1PCXA 4C5GA 2DD5A 2O9SA 2PUKB 2NLUA 4OMNA 4BD3A 2KMTA 3MP6A 4OP0A 4M77A 4Y92A 2DVJA 1Q95G 2CP5A 5J26A 2KK4A 1VIEA 1H92A 3JAME 2DYBA 1QWFA 1UTIA 4LD9K 1KD1C 4FYWB 4JLGA 2X51A 2DEQA 2JM9A 2DF6A 2QK0A 1WGSA 3U23A 2EQKA 4M77C 2R57A 2ZCFB 1YJWQ 3KUFA 2JJ9A 1VQKT 1WJRA 4M78G 4O5VA 1WDXA 4QW2A 1Z9QA 1Q86R 1RADB 2P4TA 4DBFA 3CCLA 2DE0X 2DNUA 2JM8A 1VQ9T 1MMNA 1I8FA 1XTDA 4O6JA 4CC7A 4C0GA 3E9GA 3HP9A 4JRKA 4WTOB 2WSEE 5LJ3h 3CCRA 4DOWA 4M7AC 1YJNA 3S6WA 1YIJQ 4JJDA 5A2QE 3G71A 5DLQE 5GMKe 4M7AF 5HK3A 4HVUA 4ZTJA 4OMOA 1C6VX 4HT8A 1ZX6A 3JCMX 1RUWA 2GTOA 3EG9A 4FSSA 3EGXA 4DA4A 1K9MC 3TVTA 4C5IA 4KH1B 1I81A 2YUNA 3M55A 2EQUA 5KYXB 3NGPA 4DEYA 2K2VA 2HSEB 1QVFA 1WXTA 3JB9D 3HRUA 2H3JA 2DL7A 2RO0A 1QVGP 2QEXQ 2I0NA 1PSFA 2F2XA 1BKBA 1W4SA 2PVDB 3DKMA 1G2BA 4F7UA 2X9HA 1YJWT 2XD0A 3META 2JT4A 2NUTA 4M7DF 2QAZA 2LNVA 2CZ6B 2EYYA 2RNAA 3UPUA 1D1BA 2EW3A 2LX9A 2MWPA 1VQOT 1WNLA 1MV3A 2DTIA 2JS0A 2V1QA 1LJOA 1ABQA 4M75E 2KR3A 4E47A 4FT4A 2KT1A 2HEQA 1JBMA 1FX7A 1X6GA 1ZSZC 3BFMA 3EG3A 3OW2S 2JTEA 4A4KA 3CCUT 1IREB 4E7ZA 1VA7A 1W1FA 2KBTA 2M9UA 1QW1A 3VS4A 2LCCA 2QYZA 1QCFA 1PD1A 5FU7C 3OW2P 1K73R 4E7KA 3X26B 2E5KA 4FL6A 4ELYC 5KYYA 5GMKh 3CPWS 1R77A 2FRWA 4KGXB 2DFUA 2KQWA 4PK4A 1G3YA 4DEXA 4KGVB 3BDUA 3UA7A 1NZ9A 3EG9B 5GANe 1VQ8T 3L2QA 2NUTB 2EQJA 3L2VA 2FL7A 2WACA 2RM4A 4F17A 1U1SA 2E3IA 5LJ5h 2RHIA 1ZSZA 1ZBJA 2FZCB 3OB9A 4N4HA 1GXIE 4M7AB 2DMOA 1MHNA 4E7JA 3JB9J 1ZSGA 2GF7A 1VQNQ 1UGQB 1PRMC 2HBWA 2JVVA 4IUUA 3FDRA 2YLCA 1KK7A 4C0ZA 1D1CA 1AWOA 1YJNQ 3EFOB 1WHGA 3SFMA 4CC2A 5CKHA 5KCHA 3OS2A 1UJ0A 3CCET 2CKKA 2DILA 1KQSA 1V76A 4D8DA 2G6FX 4C8QA 3MO8A 2KRSA 2O9VA 4C92B 4A4GA 2RH2A 4IUTA 4RUGA 2F1LA 2JTFA 3CC2A 1YBYA 3ZEHA 4JLIA 1M2VB 1Y71A 2FEIA 3V8KA 2DK3A 2XI9A 5A0DA 1BI3A 1ZSZB 3UATA 4PJMA 1GFDA 3EG1A 1UGPB 2YUQA 1NEBA 2PTKA 1W2BA 3M53A 2BZ8A 2X35A 3LWIA 3H41A 4M7AA 1VQ7T 4C92C 2L3QA 2K4YA 2DL4A 2AHJB 1AHJB 2MAMA 3I56Q 2B86A 1ZBXA 2DYIA 4OMFB 5I11A 1EFNA 1VQNA 1MNEA 1TH7A 1U1TA 1G5VA 2L89A 3JRZA 2EYXA 1VQLT 2QQBA 5FWCA 2F5TX 4JRPA 3OY9A 4UC4A 5CKBA 4L6V5 3CPWP 3JCMW 2ATCB 2HQXA 1WLPB 2P0PA 1JJ2A 1WYXA 4FT2A 3MP8A 4GLKA 2P84A 2AZSA 3OYFA 1OI1A 1YITA 4L59A 4A4FA 3FRNA 4IUVA 2KY9A 3MHXA 3L1AA 2KNBB 3A8GB 4JZ4A 5CR2A 5GAMh 2FYKA 1SSFA 4PLLA 1QVFP 4XTYA 1OV3A 1Q82U 2HAXA 3LLRA 2RJEA 1KG1A 3HRTA 1RAFB 2XDBA 1WZOA 2CP7A 1J3TA 5FWBA 1AZEA 1Y0MA 2RQVA 4X34A 1BBZA 3SWNC 5KYXA 1NM7A 3IQLA 2ENMA 2A28A 2JS2A 1U8RA 3GLXA 4J6YA 3QIIA 5GAOr 3WVDB 3QUIA 4ZTFA 2YSQA 2CUBA 2BKDN 3J80E 2RJCA 4DBQA 4J9IA 1G3TA 1ZA1B 1A0NB 1UGRB 5LJ5e 4XK8E 3SWNA 5FU6B 1FMWA 4KGZB 2SEMA 4F7UF 3ASKA 3D7SB 5GAOm 4NL3A 4LE9A 4RG8A 2YRDA 2K6DA 2NWMA 3OW2A 3RKXA 4M7DG 3CCEQ 2JNGA 2PNIA 1VUBA 3VRZA 2KI7A 4J6XA 4F16A 3O8VA 1VQPQ 2EYQA 2JTMA 4M78F 1KC8U 5FW9A 4A4HA 1NBEB 2YRCA 4BI3A 2LX7A 3C12A 1BB9A 5FLXE 4JRQA 4BY6B 4M77B 1C1AA 4XU0A 2AIRB 1IRXA 4J7FA 1UHFA 1RLPC 1OZ3A 2KXDA 5CKFA 1D0XA 4OB3B 2C0TA 3OYNA 1I07A 2GFUA 2XICA 5GAN6 2PQWA 3TCJA 4BUGA 4C8QD 1G8XA 3NHNA 2DVEA 1YJ9A 2L2PA 1AZGB 3CC4A 4PJJA 4JJNK 2D9TA 3PNWC 4KUIA 1M3BA 1UUEA 1Y7XA 2K3XA 1DJ7B 4BACA 2ED0A 3FIFA 2RK2A 4FCYA 1JQQA 3UT1A 3JV3A 1V29B 2VXFA 4ZNXA 2K3YA 1VQ8Q 4KBMB 3OS5A 3FJ5A 3JCMe 2DM1A 1G3SA 2GGRA 2MI6A 2X4WA 4J7IA 2IG0A 4AFZC 2HMAA 3OSSC 3GPLA 3OYAA 1VQ8A 3X20B 3V7SA 3MP1A 2KAFA 3P8DA 4QT7A 1YIJT 1FMKA 1N9SA 3ZL7C 4BE2A 4D6WA 2PUOB 2DBMA 2ROTA 3WXMB 3CCUQ 2K5FA 4LUDA 3GOXA 2C06A 2CP0A 2MMPA 4PJOC 4M75G 2I2LA 2RHZA 3VU3C 4RTWA 2PVGB 5IN1A 5L23A 1ZQ1A 4FW1A 5CIUA 4AT1B 5HKCA 1QQJA 1N6AA 3OYGA 2EBPA 1BIAA 4CC4B 4JPBW 3TEEA 3A8OB 3C0CA 3A5ZB 3QDFA 1E7OA 5D6XA 4M7AG 2YXYA 1M8VA 2RF0A 5CVIA 3BW1A 1WHJA 2LT1A 2EJGA 1AWJA 3PMTA 3QZ9B 3QG1A 4M77E 4F04B 3G6ET 4N0AA 1PKSA 4J5YA 4M75D 3CMAT 2OTJA 1S1NA 3NTIA 3CD6A 2VC8A 4OB1B 1ZA2B 2BZYA 4FSXA 4E7LA 2QA4Q 3I56T 2K3BA 1WJQA 1NE8A 1XQHA 3H8ZA 3VYGA 1OZ2A 1VQKQ 3BY7A 3BDLA 5AYFA 1UG1A 1QP3A 3GNGA 1AD5A 3O5ZA 2A08A 1YCYA 3CMEQ 1NPPA 1UECA 1UJYA 2L8DA 4FYXB 1R8OB 2QTXA 5DY9A 1NLPC 3TSZA 4EMKA 1PWTA 1FWZA 1HYOA 3G71T 1KQ2A 2FPEA 4RMOA 3G4SA 3CC4T 3EFOA 2J6FA 4JUVA 3DLLA 2MCNA 1RACB 3RR6A 1OPLA 2V8KA 1H3HA 3CCVQ 2H3EB 1YI2A 2P0QA 2LRQA 1F1BB 4PKCC 4VUBA 1U3OA 4RKUE 1VQ7Q 4OB2B 3MJXA 4PFPA 3M0UA 2YT6A 3JSCA 1X2QA 1X43A 2DPPB 1QMCA 5GMKi 4XTWA 2AZVA 1NPRA 3AHUA 2J6KA 1IXDA 4PJNA 1IGUA 5CKEA 1WI7A 1SRLA 2DIGA 1Q81R 4RTZA 2ZAEA 4EMKC 2LQ8A 3JCMb 1QVGS 1I5LA 2MOXA 3FLGA 2YDLA 3JCMh 4M77D 4BE1A 3RDVA 3G4SQ 4AFSC 2Z0WA 2M0YA 3CD6T 3OS1A 4J9GA 2KE9A 3OA6A 5M9OA 2Y4YA 2L5QA 2VGNA 5KCOA 2EJFA 2X3XD 3VV0A 2EIFA 4M7DB 2ROLA 1YNZA 2KSSA 2CS7A 3CCQT 4A53A 3HKSA 3CBMA 2HCKA 1P92A 2BE7D 3MCAB 2D1XA 3CCST 3T9NA 4HCKA 5CAIA 2RHYA 1T3SA 2AK5A 3VRYA 4M7DA 3QXEB 4F7UB 2WSCE 2VWFA 5KYNA 4KRTA 2XKOC 3INZA 2GFAA 5D6YA 3J7AF 5GANj 1W2BS 3F70A 4AG1C 1VQ4Q 2HKQB 3V7RA 2QDLA 2DJZA 4QQGA 4JDSA 3EHRA 2RA2A 5FRNA 4HKEA 1W2BP 5CO7A 4AFUC 1QCOA 2HQEA 3CMEA 2DTOA 4A63B 3OYHA 1X27A 2ZPIB 1QVFS 3EG2A 3HFNA 4LUEA 5CQXA 3SD4A 5KYWA 3CPFA 2ZPFB 3TQ7P 2R5MA 3CBPA 2YLBA 1YCSB 3M57A 3JCMf 1VQ5Q 3RUXA 3DLMA 3PIOA 8ATCB 2QQRA 2F2VA 2LVMA 1B07A 3RKYA 3V7CA 3CCRT 3N5BB 3CCVT 1X01A 3JCMd 3S3NA 2MF2A 2QG9B 2ZPGB 2W10A 1MMAA 4PFOA 5DM7R 4M7DE 1M1FA 1W70A 1VYUA 2OAWA 1M1KR 1K8AC 1PC0A 2FZKB 3QWYA 1D09B 2DBKA 3G1JA 1NG2A 1NJIR 1I1JA 5GMKj 5GANg 1K9AA 3LH0A 1TUCA 1FYNA 1TG0A 3OYKA 2ABLA 1VQ4A 1VQOQ 2CDTA 2CSIA 1IGQA 3X28B 1OULA 2QASA 1UB4A 2O01E 2YHTA 2FHDA 3L2ZA 3I55A 1VQLQ 1JB0E 2EYWA 2DXTA 2QQ9A 2QEXA 1GCPA 4C0DB 2VGMA 4QVDA 1BI2A 2JMAA 3QWXX 4M75B 2K79A 3ME9A 5GAOp 3JCMJ 2DZCA 1UHCA 1NEGA 4M7AD 3EHQA 8AT1B 2C0OA 2M0OA 1TUDA 4MDWA 3GF5A 3FEOA 4MMLA 2FRYA 4B9XA 4PNOA 2R58A 4J83A 1PM3A 4XTXA 2PZ1A 4WCIA 5LJ3f 2EQMA 1TSFA 4PFZA 1X6BA 1UDLA 1VIFA 1RI9A 1YIJA 4C0DC 1M30A 2F5KA 2O31A 2O2OA 4C8QF 4ZN3A 2CZ7B 4BE0A 1RAAB 2RK1A 4QVCA 3SHWA 4ANJA 3QO3A 1MGQA 1X2KA 4HVVA 5L8RE 2QQSA 2HL3A 3OYJA 3M0TA 3H0IA 2A36A 1PKTA 2ESWA 2E1HA 1IB8A 3G6EQ 1Q7YU 3EFSA 4XQ3A 3HSBA 5ECAA 2X4XA 1YJWA 4ZGEB 1BK2A 2NUPB 1XJWB 1GBQA 3PTAA 2ZZDA 1I0CA 2E64A 2EGEA 1BCMA 4K11A 4HCBA 3A1PA 3REAB 1Q82C 1JRIA 1VQ7A 2B8AA 3ULRB 5GAMe 4M7DC 4Z02A 2KRMA 1RAGB 2JW4A 1G3WA 2BZXA 1M1GA 2COZA 4E6RA 1OU8A 3GP8A 3JB9H 2D8HA 4QQ6A 4ZGJB 1VQ5T 1N27A 3OYMA 1SHGA 2CSQA 4RCBA 2D6FA 4C92E 1N8RR 3CD6Q 3X25B 1N9RA 2JXBA 2EYZA 1BU1A 2LT4A 4Y28E 3VJPA 4OGEA 3PT9A 2E3HA 1YWOA 4RG2A 2IVWA 1D1AA 2LQWA 4M78B 3E9FA 1E6HA 1KIKA 3CC7T 4E7SA 2MK5A 2PU9B 3HRSA 1VQKA 4C92A 5KH6A 3CMAQ 2J6OA 1WHMA 3OYYA 1H641 2LCSA 3EGXB 1NYGA 3KXTA 1NYFA 3A8HB 4C8QB 2Y4XA 2QDYB 1SEMA 4F7UG 1Q7YR 2O4XB 2GNCA 3CC2T 3I55Q 4JJCA 1K9MR 1QWEA 4L5GA 3C95A 5HY6A 4EMKB 5GAOn 2RJDA 2W0ZA 3VS3A 4JS5A 1Z9ZA 2KGTA 4LD6A 3UWNA 2FZGB 1Q82R 3WVEB 4GLMA 5LJ5g 4M77F 1XNIA 2HQHA 1JO8A 4LDWA 1B34B 1WXUA 3LGLA 2KXCA 3NFCA 3ER0A 3VS5A 2E12A 3EAEA 5IXBA 5LL6S 2MYSA 1SHFA 1W6XA 2F2WA 1K73C 2FPFA 3CPWA 4LDXA 2SRCA 2A7YA 3UDCA 1YHQA 1D0ZA 4IKFA 3S3MA 2E6ZA 4LDYA 4PJOF 1KHIA 1D0YA 3E19A 2QGGA 2EVRA 4P5NA 2COYA 4KULA 1WQ7A 2FVUA 1IZ6A 3NTKA 4X9DA 2E70A 2RHUA 1ARKA 2X3WD 1K8AR 3GNFB 4BY6C 5FU7B 1YITT 2CYZB 1OEBA 2M16A 1T0JA 1LOJA 2A0FB 1KD1U 1M3AA 4Q5WA 4Y91A 3E1SA 2OAUA 1IO6A 1KHCA 4JRIA 3V8LA 2Y90A 3DB4A 1Q81U 2V8JA 5D7UA 4M78E 2IPOB 1EIFA 1JJ2S 1GRIA 4M78D 2K9GA 3OYDA 1MNDA 4AG2C 1WHHA 2ED1A 3CC2Q 4KT0E 3CCJT 2RI3A 3M5AA 5GMKl 1HK9A 2QA4T 2KDSA 1TOVA 1YI2Q 1R0BG 3VS2A 1B34A 1M2VA 5IT9E 5FROA 1OPKA 2RPNA 3VKIA 4LXCA 4BDZA 3V8JA 1FMVA 1OOTA 3TU4K 2YUOA 2QXFA 5GAMf 2BE9B 2DIQA 2DL8A 5GANh 1H3ZA 2A3LA 1M90U 3A8LB 4BDYA 3CXCA 4R0KA 5GAMj 2VKNA 4V2SA 4LNPA 3MEWA 5I2MA 2PVOB 1S72A 1VQPA 4X9CA 3MEUA 4OVAA 2DA9A 2RI2A 1RLQC 1VQ4T 4E7HA 4CRIA 1T0HA 3NTHA 4FM4B 2QTVA 4J9DA 2O88A 4FYYB 1VQ6Q 2OJ2A 2GQVA 2DXBA 1NJIU 1FXXA 1SRMA 2GQIA 3CMAA 1KQSS 1WA7A 1M8MA 5GANd 3E2UA 4KH0B 1CKAA 1KD1R 1VQPT 4PJOB 1S72Q 3JB9F 1C0MA 2K7AA 1UFFA 3TSWA 5GAN5 3QZ5B 1LVKA 1OX8A 4J9HA 5GMKm 1YWPA 1PHTA 2AKKA 3OQ5A 3I9QA 5LJ5d 5A0LA 1IHVA 3JCMV 1AWWA 3CCRQ 1M90C 4R56A 1QLYA 2G3RA 4IIMA 3M54A 3I5SA 1Y57A 1O75A 5IAYA 2XU8A 3CC4Q 1H8KA 3G6EA 9ATCB 3CEYA 2NUZA 2COWA 4PJOG 3I5RA 1TTHB 5GJWB 4EMHA 2EGAA 1M5Q1 2EFIA 1N5ZA 5GAMg 1K0XA 3CCUA 1QKXA 5IXFA 2NYSA 1M9SA 1LPLA 2RN8A 2LQNA 5HCKA 1TUGB 2RQTA 3SB2A 1VYVA 5KYWB 1JEGA 2OX7A 1AOJA 1JU5C 1N8RU 1PG5B 1YITQ 1YHQQ 3PIPA 2F69A 5FRMA 4HXJA 2HBPA 1ZLMA 5D6WA 3ZBDA 1AWXA 1NLOC 2L3PA 1Q81C 2ZPBB 5I21A 1RAIB 1CKBA 4FW2A 5AT1B 3TREA 4A4EA 3RBBB 1VQNT 4C0FA 1GCQC 1HXDA 2AKLA 1D3BB 1WJSA 3VUZA 3CCSA 3R6NA 3C94A 1GCQA 2MPXC 1YJ9Q 2IIMA 1K9MU 1VQLA 1ZHIA 1YI2T 3RERA 2LQKA 2L3SA 4N4IA 4ELZC 1JJ2P 4M75F 3EH1A 4JS4A 3CCMQ 1VQOA 5KYUA 4LDUA 3CCQQ 2YWWA 3QJYA 1Y96B 1QVPA 1WPYA 3SEMA 1M1KU 1EX4A 3L2RA 4R55A 4IIOA 4BB7A 2QGFB 4C92D 1MUZA 3QSUA 3P8BB 3QJ6A 3CC7A 3M0QA 4RTXA 4RTVA 1WIEA 1VQMT 2H8HA 2O4XA 1WHKA 4MMKA 4C5HA 3CCMA 2FB7A 2EQIA 4ATOA 2OTLT 4NOYA 1TWBA 1RABB 2KRNA 2LCLA 1N8RC 3CCSQ 1AVZC 3EFRA 4N0AC 2HDAA 3REBB 4JZ3A 2RQUA 2LMJA 1PRLC 5LJ5j 1WX6A 2L0AA 4X1VA 3M59A 2MIOA 4II1A 4OGCA 1JXOA 4BI8B 2DXCA 4C92G 4B6MA 3CCLT 3CQTA 1XOVA 4HT9A 3CCJA 1U06A 3RESA 3KFVA 2EKHA 1SPKA 3PMIA 4AFQC 5KYYB 2CH4A 2KVQG 1GBRA 2EGCA 2LDMA 3VYHB 1KQSP 3I56A 1UGSB 1KSWA 4BI4A 1AT1B 2D8JA 1K73U 5A0GA 2LJ0A 4HCCA 2K5IA 2VVKA 3OYIA 1K8AU 2LJ3A 3JB9I 1TU0B 1X75C 5FU6C 3S3OA 3PE0A 2E41A 3PGGA 2J05A 3CC7Q 3EH2A 2E10A 4ZGDB 2OTLQ 5EG2A 3HPWA 4WF2A 2LZ6B 1VQ6T 2CP6A 2E4HA 2EPDA 1M90R 5GAMd 4N4GA 1QCNA
chains in the Genus database with same CATH topology
3X25B 1VQKT 1WJRA 1N9RA 4M78G 4O5VA 2K5FA 3WXMB 3GOXA 4QW2A 2LT4A 2C06A 3L42A 4Y28E 3VJPA 2MMPA 4PJOC 4OGEA 2CZ1B 3PT9A 2P4TA 4M75G 2I2LA 2RHZA 3CCLA 4RG2A 2IVWA 3VU3C 3OYCA 1M4ZA 3HL8A 2PVGB 4M78B 1VQ9T 3E9FA 5IN1A 1I8FA 1XTDA 1ZQ1A 4O6JA 3CC7T 4B9WA 3E9GA 3HP9A 4JRKA 2PU9B 3HRSA 5CIUA 4C0GA 4C92A 5KH6A 2WSEE 5HKCA 1VQKA 5LJ3h 1N6AA 3CCRA 4DOWA 4M7AC 3OYGA 1YJNA 1BIAA 3TEEA 3S6WA 3OYYA 2CZ0B 1H641 3A8OB 4M77G 5A2QE 3A5ZB 3G71A 3KXTA 3A8HB 4C8QB 2Y4XA 5DLQE 5GMKe 2QDYB 2R5AA 5D6XA 4F7UG 4M7AG 2O4XB 1M8VA 5CVIA 3BW1A 4M7AF 2LT1A 2EJGA 3CC2T 3PMTA 3QZ9B 5HK3A 4ZTJA 4HT8A 3QG1A 3JCMX 1KQ2A 4M77E 4L5GA 3C95A 5HY6A 4EMKB 3URGA 2MWOA 2RJDA 3X24B 5GAOn 4DA4A 3KBGA 5J3BA 4JS5A 1KC8C 3UWNA 1K9MC 4LD6A 3G6ET 4N0AA 4C5IA 3WVEB 4J5YA 5J39A 5LJ5g 3OSVA 1I81A 4M77F 4M75D 3M55A 2EQUA 1XNIA 2YRVA 3CMAT 2OTJA 4RCCA 3NTIA 3CD6A 2K2VA 2VC8A 1QVFA 3LGLA 1B34B 4LDWA 4OB1B 3JB9D 3NFCA 3HRUA 2LTOA 4M78A 3ER0A 4CI0C 2H3JA 2RO0A 2DXUA 4FSXA 4E7LA 2E12A 3EAEA 5GAN7 1PSFA 5LL6S 1BKBA 1W4SA 2PVDB 3DKMA 4MZPA 3I56T 1BIBA 4XU1A 5LJ3d 1WJQA 4EPCA 4F7UA 1NE8A 1XQHA 3H8ZA 4IUPA 3VYGA 4E7IA 1YJWT 2XD0A 3OBWA 1BI1A 3META 1OZ2A 5GAOl 4M7DF 3BY7A 3BDLA 2LNVA 2CZ6B 4HCZA 3UPUA 5AYFA 1QP3A 1K73C 2JN0A 2LX9A 3FC3A 1VQ9A 2MWPA 4FIBA 1WNLA 3CPWA 1VQOT 3GNGA 4LDXA 2DTIA 2A7YA 3UDCA 5GAN2 1YCYA 4MZMA 1NPPA 1YHQA 1LJOA 2L8DA 5DLOA 4M75E 4IKFA 4E47A 1R8OB 4FT4A 3S3MA 1JBMA 2QTXA 2E6ZA 4LDYA 5DY9A 5HK0A 4PJOF 1KHIA 3E19A 3QDRB 4P5NA 4EMKA 1FX7A 1YJNT 1BYMA 3BFMA 4KULA 1WQ7A 2XG8D 1FWZA 1IZ6A 2FVUA 2CGHA 3OW2S 4A4KA 1VQ5A 3NTKA 4X9DA 2E70A 1IREB 3CBOA 3G71T 2RHUA 3CCUT 3JB9G 4RMOA 3G4SA 3C4SA 3CC4T 4JUVA 2M9UA 2OTLA 1QW1A 3DLLA 3GNFB 3QYHB 4BY6C 2LCCA 5FU7B 1YITT 2CYZB 2E5QA 2M16A 2V8KA 4IUQA 4NL2A 2K5LA 1LOJA 1KD1U 3QKJA 5FU7C 1YI2A 4Q5WA 4F7UE 4E7KA 4Y91A 3E1SA 2OAUA 2P0QA 2LRQA 4IURA 3X26B 5GAN4 1KHCA 4JRIA 4PKCC 3V8LA 2Y90A 4FL6A 3DB4A 4VUBA 4ELYC 5GMKh 3CCVA 3CPWS 1Q81U 2V8JA 1Q7YC 4RKUE 2KQWA 4PJOD 4M78E 1G3YA 3SDZA 1EIFA 4OB2B 4QQDA 3G4ST 2JZ2A 3BDUA 1JJ2S 1KQ1A 3JSCA 5CKDA 4M78D 1NZ9A 3OYDA 2XIDA 5GANe 3MEVA 2DPPB 3OMCA 3LW5E 1VQ8T 4XU2A 3L2QA 2EQJA 5GMKi 2FL7A 3L2VA 3OYLA 4J8OA 4XTWA 2WACA 2RM4A 4KT0E 3CCJT 1U1SA 3G7ZA 1NPRA 3RMSA 3AHUA 4C8QE 2RI3A 3M5AA 5GMKl 1HK9A 2XDDA 2QA4T 4MZTA 5CKEA 5LJ5h 2RHIA 2KDSA 2DIGA 4EMKC 3JCMb 2LQ8A 1QVGS 1I5LA 3OB9A 4N4HA 3FLGA 1GXIE 3JCMc 1Y96A 1B34A 4M7AB 5IT9E 3JCMh 4M77D 4BE1A 1MHNA 4E7JA 5FROA 3VKIA 3JB9J 2GF7A 3OYBA 4BDZA 3V8JA 1UGQB 3CD6T 2QA4A 3OS1A 2JVVA 3TU4K 4IUUA 2QXFA 5GAMf 3FDRA 3RIRA 2DIQA 2E65A 2YLCA 5GANh 5M9OA 3OA6A 4C0ZA 2K57A 4HA8A 2A3LA 2Y4YA 4M75C 1RL2A 1H3ZA 1M90U 3A8LB 2L5QA 3SFMA 4BDYA 1O9SA 2VGNA 3OMGA 3CXCA 5CKHA 5KCHA 5KCOA 2QQAA 4XAXB 3OS2A 3CCET 4BE2A 2CKKA 4M7AE 2EJFA 4M75A 3VV0A 2EIFA 5GAMj 4M7DB 4V2SA 3OS0A 1KQSA 3MEWA 3P8HA 1Q86U 5I2MA 2PVOB 1S72A 1VQPA 2JUFA 4X9CA 2KSSA 2CS7A 3MEUA 4C8QA 4OVAA 2BIVA 4A53A 3CCQT 3HKSA 4KUDK 3CBMA 3LGFA 3HHTB 3MO8A 1QVGA 4C92B 4A4GA 2RI2A 2RH2A 1P92A 4IUTA 3MCAB 2JTFA 2XHCA 3CC2A 1YBYA 1VQ6A 1VQ4T 5KE2A 4E7HA 3Q1JA 4CRIA 3CCST 2L3RA 3ZEHA 3FJPA 4JLIA 3NTHA 4FM4B 3T9NA 4GY5A 1Y71A 5CQYA 5CAIA 2RHYA 3V8KA 2BUDA 2DK3A 2RI5A 2GQVA 2XI9A 1BI3A 5A0DA 3QXEB 2DXBA 4M7DA 3QHSA 3RMQA 4F7UB 3I55T 1NJIU 1FXXA 4EDUA 4C92F 3CMAA 1UGPB 1KQSS 5GANd 2WSCE 4XTUA 1VQPT 4PJOB 1W2BA 3JB9F 3M53A 2X35A 5I2SA 4ME7A 2XKOC 3LWIA 5GAN5 3VUBA 3QZ5B 4M7AA 3INZA 2E6NA 2GFAA 5D6YA 3J7AF 1VQ7T 4C92C 5GMKm 5GANj 1W2BS 3F70A 4ZN1A 3DB3A 2K4YA 1X6OA 3H6ZA 2QEXT 3V7RA 2AHJB 1AHJB 2MAMA 3OQ5A 4C8QC 1Q86C 2XDPA 2DJZA 4QQGA 4JDSA 2LC4A 3QYGB 5LJ5d 1ZBXA 2RA2A 4OMFB 3M58A 5A0LA 5FRNA 2DKGA 3JCMV 4HKEA 1VQNA 2RB6A 4PJOA 2HAXA 1TH7A 1U1TA 5LJ3e 1M90C 3JCMg 2ZGWA 4R56A 2HNIA 5CO7A 4PL6A 2G3RA 1YHQT 3M54A 2HQEA 3OBYA 4OF1A 3CMEA 2DTOA 1O75A 2QI2A 5IAYA 5GAN8 2ZPIB 2XU8A 3OYHA 1QVFS 2L89A 3JRZA 3OYEA 3G6EA 1G5VA 3HFNA 1VQLT 3CEYA 5CQXA 5C6SA 3SD4A 3CPFA 2QQBA 4PJOG 2ZPFB 2F5TX 1QP2A 4JRPA 4EMHA 3MEAA 3OY9A 1M5Q1 2EFIA 2R5MA 4UC4A 3CBPA 5CKBA 2YLBA 4L6V5 5GAMg 3M57A 3CCUA 3JCMW 4OB0B 3JCMf 2DD4A 2EAYA 2HQXA 3LX7A 3RUXA 2P0PA 1M9SA 4C8QG 3DLMA 4FT2A 5LJ5f 1JJ2A 3MP8A 2X4YA 4GLKA 3PIOA 3OYFA 1OI1A 1YITA 3SB2A 4L59A 4A4FA 3FRNA 4IUVA 3LYIA 3JCMQ 2QQRA 2KY9A 3MHXA 1N8RU 3L1AA 2LVMA 3V7CA 3RKYA 2X4JA 3CCRT 3N5BB 3PIPA 3CCVT 1X01A 2GCXA 3A8GB 2JOYA 2XK0A 3JCMd 2F69A 5FRMA 4LDVA 3S3NA 5CR2A 5GAMh 1YJ9T 2FYKA 2MF2A 1SSFA 4XTVA 4PLLA 2HBPA 5GAOq 3M56A 4XTYA 2ZPGB 1WQWA 5GANf 5D6WA 1Q82U 5DM7R 3CCMT 3LLRA 3R6OA 2RJEA 4M78C 1M1FA 3HRTA 3ZBDA 4M7DE 1Q81C 1KG1A 1S72T 2XDBA 3M9QA 2EWNA 2ZPBB 2DTHA 2VV5A 5I21A 4X34A 1K8AC 2D0QB 4XU3A 3SWNC 4M7DD 3TREA 4A4EA 2EKOA 2M1HA 1I4K1 1VQNT 5GMKj 5GANg 3M4YA 4C0FA 4PJOE 1HXDA 3LH0A 3GLXA 1U8RA 4J6YA 3QIIA 1D3BB 3OYKA 1WJSA 5GAOr 3VUZA 3QUIA 3WVDB 3LWHA 3CCSA 4ZTFA 3QBYA 1VQ4A 2ZPHB 3C94A 4XTZA 5GAN3 1K9MU 4PLIA 1ZHIA 1YI2T 2BKDN 2VYTA 3FB9A 3J80E 1VQLA 3RERA 2LQKA 2RJCA 4J6WA 3A8MB 4N4IA 5LJ3j 4FU6A 3GIBA 1G3TA 4ELZC 1UGRB 4DQ2A 4XK8E 5LJ5e 4M75F 3SWNA 3X28B 4JS4A 3L2ZA 5FU6B 1UB4A 2O01E 2YHTA 2FHDA 3I55A 2DZ9A 1VQOA 4F7UF 1JB0E 5CCAA 4LDUA 1VQMA 3ASKA 2DXTA 3QJYA 1Y96B 1WPYA 1QVPA 3CCEA 5GAOm 2QQ9A 1RI0A 4NL3A 1NJIC 2QEXA 1M1KU 3L2RA 4RG8A 2VXEA 2RJFA 4C0DB 2VGMA 4QVDA 3SWNB 1BI2A 4R55A 4BB7A 3OW2A 4M75B 3ME9A 3RKXA 5GAOp 2OTJT 4C92D 4M7DG 3QSUA 2JNGA 3P8BB 3QJ6A 3CC7A 1VUBA 3JCMJ 1VQMT 2DZCA 2O4XA 4A54A 4M7AD 4MMKA 4C5HA 1LNXA 3CCMA 3CXCS 3J81E 2FB7A 2M0OA 4J6XA 4MDWA 4ATOA 3GF5A 3FEOA 4MMLA 4B9XA 4PNOA 3O8VA 2R58A 2EYQA 2JTMA 4J83A 4M78F 1KC8U 4XTXA 2V8IA 4A4HA 2OTLT 5LJ3f 4NOYA 3CMET 2LCLA 1N8RC 2EQMA 4BI3A 3HFOA 1UEBA 3EFRA 1VIFA 4N0AC 3C12A 1YIJA 4C0DC 2DAQA 5FLXE 2F5KA 4DOVA 1BI0A 3RKWA 4C8QF 4ZN3A 5LJ5j 4JRQA 2CZ7B 4BE0A 4TVRA 1D3BA 1PSEA 4BY6B 4M77B 4J7FA 4XU0A 5CK9A 3CCQA 4NS5A 2RK1A 2RHXA 4QVCA 1OZ3A 3M59A 3QO3A 5CKFA 1MGQA 2ZPEB 4II1A 4OGCA 4OB3B 4BI8B 1M1KC 5L8RE 2QQSA 3OYNA 2DXCA 4C92G 5C0MA 2GFUA 1Y07A 2XICA 4C5EA 2HD0A 4EMGA 5KE3A 3OYJA 5GAN6 2PQWA 3CCLT 3PFSA 1XOVA 3TCJA 4BUGA 2E1HA 2DVEA 4QVZA 4C8QD 3CCJA 3JCMP 1YJ9A 1Q7YU 3CC4A 4HT9A 2EJ9A 3RESA 2RD1A 1OYXA 2WSFE 3EFSA 2P0KA 4XQ3A 3L2UA 3HSBA 4JJNK 2DO3A 4YTLA 2D9TA 3PMIA 2VUBA 3PNWC 2X4XA 5LJ3g 1YJWA 4ZGEB 4KUIA 3M4GA 3QPHA 2KVQG 3L2WA 2LDMA 1Y7XA 3VYHB 2K3XA 2ZZDA 3PTAA 3I56A 1DJ7B 4BACA 3ZFJA 1UGSB 2E64A 4MDXA 3FIFA 2RK2A 3UT1A 1V29B 2VXFA 4HCBA 4C5GA 2DD5A 2K3YA 4BI4A 4KBMB 2PUKB 3OS5A 1Q82C 1JRIA 3JCMe 1VQ7A 2NLUA 2B8AA 5A0GA 1K73U 4BD3A 5GAMe 1G3SA 2KMTA 3MP6A 4Z02A 4M7DC 4OP0A 1G3WA 4HCCA 1M1GA 2K5IA 4M77A 2MI6A 3OYIA 1K8AU 2X4WA 2KK4A 1VIEA 4J7IA 5J26A 3JB9I 2IG0A 1X75C 5FU6C 3GP8A 3S3OA 3JB9H 3JAME 3OSSC 3GPLA 2E41A 4QQ6A 3OYAA 3PGGA 4ZGJB 1KD1C 1VQ5T 1VQ8A 4LD9K 1N27A 4JLGA 3X20B 3V7SA 2E10A 4ZGDB 2DEQA 3HPWA 3MP1A 2KAFA 4WF2A 5EG2A 3OYMA 3P8DA 1WGSA 1YIJT 1VQ6T 2EQKA 1N9SA 4M77C 4RCBA 5GAMd 2R57A 2ZCFB 4C92E 4D6WA 4N4GA 2PUOB 3KUFA 2D6FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X25 B;  3A8O B;  3A8G B;  4OB1 B;  2ZPF B;  3A8H B;  2PUK B;  3X26 B;  1QP2 A;  4FM4 B;  2QDY B;  4Y28 E;  3WVD B;  2WSF E;  3A8L B;  2CZ1 B;  2ZPH B;  2AHJ B;  1AHJ B;  2ZPG B;  4L6V 5;  1PSF A;  3QZ9 B;  2PVD B;  2DD4 A;  2DXB A;  3QXE B;  4OB0 B;  4ZGE B;  4RKU E;  3QYG B;  4ZGJ B;  1GXI E;  2CZ7 B;  3A8M B;  3X20 B;  1PSE A;  2PVG B;  1UGP B;  2PVO B;  4OB2 B;  1UGR B;  4KT0 E;  4XK8 E;  3VYH B;  3X28 B;  3VYG A;  4ZGD B;  2ZPB B;  2ZZD A;  3X24 B;  2O01 E;  2WSC E;  1DJ7 B;  1IRE B;  1UGS B;  2D0Q B;  2PU9 B;  1JB0 E;  2WSE E;  2DPP B;  2ZPE B;  3HHT B;  3WVE B;  1V29 B;  3LW5 E;  2CZ6 B;  4OB3 B;  3QYH B;  1UGQ B;  1QP3 A;  2DD5 A;  2ZCF B;  2ZPI B;  2DXC A;  5L8R E;  2CYZ B;  2PUO B;  3QZ5 B;  2CZ0 B; 
#chains in the Genus database with same CATH topology
 4ESR A;  4RTY A;  2CH4 W;  1VQM Q;  3L42 A;  2CZ1 B;  3MPU B;  1SF9 A;  4J9E A;  2OI3 A;  3OYC A;  1M4Z A;  4Z89 A;  3HL8 A;  3THK A;  4B9W A;  1B7T A;  2RQR A;  4OMM A;  4JJB A;  2CZ0 B;  4M77 G;  2RQW A;  1YFN A;  2A37 A;  2R5A A;  2CT4 A;  2LP5 A;  1VYT A;  2CT3 A;  1SG5 A;  4OML A;  3URG A;  2MWO A;  3X24 B;  4M7A E;  3KBG A;  5J3B A;  5IHK A;  1KC8 C;  3GBQ A;  4PJL A;  5J39 A;  2CUD A;  3OSV A;  2CRE A;  2YRV A;  4RCC A;  1PNJ A;  1KJW A;  1MV0 B;  2DER A;  2LTO A;  4M78 A;  4CI0 C;  2DXU A;  5GAN 7;  3G71 Q;  4FYV B;  3BE3 A;  4MZP A;  1BIB A;  4XU1 A;  5LJ3 d;  4EPC A;  3RNJ A;  1WFW A;  4IUP A;  4E7I A;  2DLP A;  3OBW A;  1BI1 A;  5GAO l;  4LN2 A;  1RAE B;  2VB6 A;  3AT1 B;  4HCZ A;  2JN0 A;  1VQ9 A;  2RMO A;  3FC3 A;  4FIB A;  2FPD A;  3H9N A;  5GAN 2;  4MZM A;  1HJD A;  5DLO A;  5IHI A;  1X69 A;  5HK0 A;  3PVQ A;  3QDR B;  1YJN T;  1BYM A;  2XG8 D;  2CGH A;  4ORZ A;  1VQ5 A;  3CBO A;  4CC3 A;  3JB9 G;  2M02 A;  1MMG A;  3C4S A;  2GBQ A;  3A98 A;  2OTL A;  3CCJ Q;  3QYH B;  2E5Q A;  2HZY A;  1YP5 A;  4IUQ A;  1OX9 A;  2K5L A;  4NL2 A;  3QKJ A;  1LCK A;  3LH5 A;  4F7U E;  1EZZ B;  4E2F B;  4IUR A;  5GAN 4;  1I5O B;  2K2M A;  2FG0 A;  4OMQ A;  3CCV A;  1Q7Y C;  4PJO D;  3SDZ A;  3VS0 A;  2DX1 A;  3G4S T;  4QQD A;  2JZ2 A;  1KQ1 A;  5CKD A;  2DRK A;  1ACM B;  2XID A;  3MEV A;  5GJV B;  3OMC A;  3LW5 E;  4XU2 A;  3OYL A;  4J8O A;  2DET A;  1WHL A;  1ZUY A;  3G7Z A;  3RMS A;  4C8Q E;  2XDD A;  1ZUK A;  4MZT A;  3UA6 A;  2YUP A;  1KC8 R;  3JCM c;  1Y96 A;  1KFZ A;  1E6G A;  4AMC A;  3OYB A;  4QKU A;  3M0P A;  2QA4 A;  3EGD B;  2XMF A;  3RIR A;  1OU9 A;  2E65 A;  1ZUU A;  2K57 A;  4HA8 A;  4M75 C;  1RL2 A;  1O9S A;  3OMG A;  3I35 A;  2QQA A;  4XAX B;  1WXB A;  1T3L A;  2CP3 A;  2OTJ Q;  4M75 A;  2VAS A;  2AT1 B;  3OS0 A;  1UGV A;  1VQ9 Q;  3EGU A;  3P8H A;  2DRM A;  1Q86 U;  4Z88 A;  2NUP A;  2JUF A;  2BIV A;  4KUD K;  3LGF A;  3HHT B;  1QVG A;  4DBR A;  1HD3 A;  2P4R A;  2XHC A;  3NPF A;  1VQ6 A;  5KE2 A;  1M3C A;  3Q1J A;  2DL3 A;  2L3R A;  3FJP A;  2LNH B;  4GY5 A;  4M4Z A;  5CQY A;  2BUD A;  1R0C B;  2RI5 A;  1RAH B;  3QHS A;  3RMQ A;  2DJQ A;  4EIK A;  3I55 T;  1K1Z A;  3M0R A;  3EG0 A;  4C92 F;  4EDU A;  2KYB A;  1K0S A;  1VOM A;  4XTU A;  1HSQ A;  1YN8 A;  5I2S A;  4ME7 A;  2HL5 C;  3VUB A;  2CP2 A;  2E6N A;  1K4U S;  4ZN1 A;  3DB3 A;  3H6Z A;  1X6O A;  2QEX T;  5IH2 A;  1JXM A;  4C8Q C;  1Q86 C;  2XDP A;  3VS6 A;  2LC4 A;  3QYG B;  1GL5 A;  3M58 A;  2DKG A;  2RB6 A;  4PJO A;  5LJ3 e;  3JCM g;  2ZGW A;  2HNI A;  4PL6 A;  1YHQ T;  2KRO A;  2BTT A;  3OBY A;  4OF1 A;  2QI2 A;  5GAN 8;  2KEA A;  3OYE A;  2FO0 A;  6AT1 B;  2HSP A;  5C6S A;  1GFC A;  3EGD A;  1IHW A;  1K76 A;  1QP2 A;  1B3Q A;  3MEA A;  4J9B A;  1ABO A;  2ECZ A;  1BCO A;  4OB0 B;  2DD4 A;  2EAY A;  3LX7 A;  5LJ5 f;  4C8Q G;  1M2O A;  2X4Y A;  5EC7 A;  3VS7 A;  4DBH A;  1TS9 A;  2JMC A;  3LYI A;  3JCM Q;  1U5S A;  2M51 A;  2X4J A;  3PVL A;  4OMP A;  2GCX A;  3CXC P;  2JOY A;  2XK0 A;  4LDV A;  1YJ9 T;  4XTV A;  2C0I A;  5GAO q;  3M56 A;  1WQW A;  5GAN f;  3CCM T;  1AEY A;  3R6O A;  4M78 C;  5I22 A;  1S72 T;  1OQK A;  3M9Q A;  2EWN A;  2GTJ A;  1SKU B;  4HVW A;  2DTH A;  2VV5 A;  2D0Q B;  4XU3 A;  4M7D D;  2EKO A;  2M1H A;  2J7I A;  5IHN A;  1I4K 1;  2KYM A;  1MMD A;  3M4Y A;  4PJO E;  3LWH A;  3QBY A;  2ZPH B;  4XTZ A;  5GAN 3;  1G83 A;  4PLI A;  2VYT A;  2DL5 A;  3FB9 A;  4J6W A;  3A8M B;  5LJ3 j;  4FU6 A;  3GIB A;  1V1C A;  4DQ2 A;  2DZ9 A;  5CCA A;  3M0S A;  3UF4 A;  5KYU B;  1VQM A;  2DEU A;  3CCE A;  1RI0 A;  1NJI C;  3NMZ C;  2VXE A;  2RJF A;  4Z8A A;  3SWN B;  2OTJ T;  4RTU A;  1CSK A;  4A54 A;  1LNX A;  3CXC S;  3CCL Q;  3J81 E;  2V8I A;  3CME T;  3HFO A;  1UEB A;  1SSH A;  2KT8 A;  2DAQ A;  4RTT A;  4DOV A;  1BI0 A;  3RKW A;  4TVR A;  1D3B A;  1PSE A;  3CCQ A;  1PD0 A;  5CK9 A;  4J9C A;  4NS5 A;  7AT1 B;  2V1R A;  2HKN A;  2RHX A;  1UE9 A;  2ZPE B;  3HTR A;  2J06 A;  1M1K C;  5C0M A;  3H0F A;  1Y07 A;  4C5E A;  4EMG A;  2HD0 A;  5KE3 A;  3H0H A;  3PFS A;  1M27 C;  3JCM P;  4QVZ A;  2D0N A;  4GBQ A;  2EJ9 A;  2RD1 A;  1OYX A;  2WSF E;  2P0K A;  3L2U A;  4J9F A;  3VS1 A;  2DO3 A;  3MKD A;  4YTL A;  2VUB A;  5LJ3 g;  2V26 A;  1TXQ A;  3M4G A;  3QPH A;  4D8K A;  1QKW A;  3L2W A;  3ZFJ A;  4MDX A;  2LJ1 A;  4F14 A;  1PCX A;  4C5G A;  2DD5 A;  2O9S A;  2PUK B;  2NLU A;  4OMN A;  4BD3 A;  2KMT A;  3MP6 A;  4OP0 A;  4M77 A;  4Y92 A;  2DVJ A;  1Q95 G;  2CP5 A;  5J26 A;  2KK4 A;  1VIE A;  1H92 A;  3JAM E;  2DYB A;  1QWF A;  1UTI A;  4LD9 K;  1KD1 C;  4FYW B;  4JLG A;  2X51 A;  2DEQ A;  2JM9 A;  2DF6 A;  2QK0 A;  1WGS A;  3U23 A;  2EQK A;  4M77 C;  2R57 A;  2ZCF B;  1YJW Q;  3KUF A;  2JJ9 A;  1VQK T;  1WJR A;  4M78 G;  4O5V A;  1WDX A;  4QW2 A;  1Z9Q A;  1Q86 R;  1RAD B;  2P4T A;  4DBF A;  3CCL A;  2DE0 X;  2DNU A;  2JM8 A;  1VQ9 T;  1MMN A;  1I8F A;  1XTD A;  4O6J A;  4CC7 A;  4C0G A;  3E9G A;  3HP9 A;  4JRK A;  4WTO B;  2WSE E;  5LJ3 h;  3CCR A;  4DOW A;  4M7A C;  1YJN A;  3S6W A;  1YIJ Q;  4JJD A;  5A2Q E;  3G71 A;  5DLQ E;  5GMK e;  4M7A F;  5HK3 A;  4HVU A;  4ZTJ A;  4OMO A;  1C6V X;  4HT8 A;  1ZX6 A;  3JCM X;  1RUW A;  2GTO A;  3EG9 A;  4FSS A;  3EGX A;  4DA4 A;  1K9M C;  3TVT A;  4C5I A;  4KH1 B;  1I81 A;  2YUN A;  3M55 A;  2EQU A;  5KYX B;  3NGP A;  4DEY A;  2K2V A;  2HSE B;  1QVF A;  1WXT A;  3JB9 D;  3HRU A;  2H3J A;  2DL7 A;  2RO0 A;  1QVG P;  2QEX Q;  2I0N A;  1PSF A;  2F2X A;  1BKB A;  1W4S A;  2PVD B;  3DKM A;  1G2B A;  4F7U A;  2X9H A;  1YJW T;  2XD0 A;  3MET A;  2JT4 A;  2NUT A;  4M7D F;  2QAZ A;  2LNV A;  2CZ6 B;  2EYY A;  2RNA A;  3UPU A;  1D1B A;  2EW3 A;  2LX9 A;  2MWP A;  1VQO T;  1WNL A;  1MV3 A;  2DTI A;  2JS0 A;  2V1Q A;  1LJO A;  1ABQ A;  4M75 E;  2KR3 A;  4E47 A;  4FT4 A;  2KT1 A;  2HEQ A;  1JBM A;  1FX7 A;  1X6G A;  1ZSZ C;  3BFM A;  3EG3 A;  3OW2 S;  2JTE A;  4A4K A;  3CCU T;  1IRE B;  4E7Z A;  1VA7 A;  1W1F A;  2KBT A;  2M9U A;  1QW1 A;  3VS4 A;  2LCC A;  2QYZ A;  1QCF A;  1PD1 A;  5FU7 C;  3OW2 P;  1K73 R;  4E7K A;  3X26 B;  2E5K A;  4FL6 A;  4ELY C;  5KYY A;  5GMK h;  3CPW S;  1R77 A;  2FRW A;  4KGX B;  2DFU A;  2KQW A;  4PK4 A;  1G3Y A;  4DEX A;  4KGV B;  3BDU A;  3UA7 A;  1NZ9 A;  3EG9 B;  5GAN e;  1VQ8 T;  3L2Q A;  2NUT B;  2EQJ A;  3L2V A;  2FL7 A;  2WAC A;  2RM4 A;  4F17 A;  1U1S A;  2E3I A;  5LJ5 h;  2RHI A;  1ZSZ A;  1ZBJ A;  2FZC B;  3OB9 A;  4N4H A;  1GXI E;  4M7A B;  2DMO A;  1MHN A;  4E7J A;  3JB9 J;  1ZSG A;  2GF7 A;  1VQN Q;  1UGQ B;  1PRM C;  2HBW A;  2JVV A;  4IUU A;  3FDR A;  2YLC A;  1KK7 A;  4C0Z A;  1D1C A;  1AWO A;  1YJN Q;  3EFO B;  1WHG A;  3SFM A;  4CC2 A;  5CKH A;  5KCH A;  3OS2 A;  1UJ0 A;  3CCE T;  2CKK A;  2DIL A;  1KQS A;  1V76 A;  4D8D A;  2G6F X;  4C8Q A;  3MO8 A;  2KRS A;  2O9V A;  4C92 B;  4A4G A;  2RH2 A;  4IUT A;  4RUG A;  2F1L A;  2JTF A;  3CC2 A;  1YBY A;  3ZEH A;  4JLI A;  1M2V B;  1Y71 A;  2FEI A;  3V8K A;  2DK3 A;  2XI9 A;  5A0D A;  1BI3 A;  1ZSZ B;  3UAT A;  4PJM A;  1GFD A;  3EG1 A;  1UGP B;  2YUQ A;  1NEB A;  2PTK A;  1W2B A;  3M53 A;  2BZ8 A;  2X35 A;  3LWI A;  3H41 A;  4M7A A;  1VQ7 T;  4C92 C;  2L3Q A;  2K4Y A;  2DL4 A;  2AHJ B;  1AHJ B;  2MAM A;  3I56 Q;  2B86 A;  1ZBX A;  2DYI A;  4OMF B;  5I11 A;  1EFN A;  1VQN A;  1MNE A;  1TH7 A;  1U1T A;  1G5V A;  2L89 A;  3JRZ A;  2EYX A;  1VQL T;  2QQB A;  5FWC A;  2F5T X;  4JRP A;  3OY9 A;  4UC4 A;  5CKB A;  4L6V 5;  3CPW P;  3JCM W;  2ATC B;  2HQX A;  1WLP B;  2P0P A;  1JJ2 A;  1WYX A;  4FT2 A;  3MP8 A;  4GLK A;  2P84 A;  2AZS A;  3OYF A;  1OI1 A;  1YIT A;  4L59 A;  4A4F A;  3FRN A;  4IUV A;  2KY9 A;  3MHX A;  3L1A A;  2KNB B;  3A8G B;  4JZ4 A;  5CR2 A;  5GAM h;  2FYK A;  1SSF A;  4PLL A;  1QVF P;  4XTY A;  1OV3 A;  1Q82 U;  2HAX A;  3LLR A;  2RJE A;  1KG1 A;  3HRT A;  1RAF B;  2XDB A;  1WZO A;  2CP7 A;  1J3T A;  5FWB A;  1AZE A;  1Y0M A;  2RQV A;  4X34 A;  1BBZ A;  3SWN C;  5KYX A;  1NM7 A;  3IQL A;  2ENM A;  2A28 A;  2JS2 A;  1U8R A;  3GLX A;  4J6Y A;  3QII A;  5GAO r;  3WVD B;  3QUI A;  4ZTF A;  2YSQ A;  2CUB A;  2BKD N;  3J80 E;  2RJC A;  4DBQ A;  4J9I A;  1G3T A;  1ZA1 B;  1A0N B;  1UGR B;  5LJ5 e;  4XK8 E;  3SWN A;  5FU6 B;  1FMW A;  4KGZ B;  2SEM A;  4F7U F;  3ASK A;  3D7S B;  5GAO m;  4NL3 A;  4LE9 A;  4RG8 A;  2YRD A;  2K6D A;  2NWM A;  3OW2 A;  3RKX A;  4M7D G;  3CCE Q;  2JNG A;  2PNI A;  1VUB A;  3VRZ A;  2KI7 A;  4J6X A;  4F16 A;  3O8V A;  1VQP Q;  2EYQ A;  2JTM A;  4M78 F;  1KC8 U;  5FW9 A;  4A4H A;  1NBE B;  2YRC A;  4BI3 A;  2LX7 A;  3C12 A;  1BB9 A;  5FLX E;  4JRQ A;  4BY6 B;  4M77 B;  1C1A A;  4XU0 A;  2AIR B;  1IRX A;  4J7F A;  1UHF A;  1RLP C;  1OZ3 A;  2KXD A;  5CKF A;  1D0X A;  4OB3 B;  2C0T A;  3OYN A;  1I07 A;  2GFU A;  2XIC A;  5GAN 6;  2PQW A;  3TCJ A;  4BUG A;  4C8Q D;  1G8X A;  3NHN A;  2DVE A;  1YJ9 A;  2L2P A;  1AZG B;  3CC4 A;  4PJJ A;  4JJN K;  2D9T A;  3PNW C;  4KUI A;  1M3B A;  1UUE A;  1Y7X A;  2K3X A;  1DJ7 B;  4BAC A;  2ED0 A;  3FIF A;  2RK2 A;  4FCY A;  1JQQ A;  3UT1 A;  3JV3 A;  1V29 B;  2VXF A;  4ZNX A;  2K3Y A;  1VQ8 Q;  4KBM B;  3OS5 A;  3FJ5 A;  3JCM e;  2DM1 A;  1G3S A;  2GGR A;  2MI6 A;  2X4W A;  4J7I A;  2IG0 A;  4AFZ C;  2HMA A;  3OSS C;  3GPL A;  3OYA A;  1VQ8 A;  3X20 B;  3V7S A;  3MP1 A;  2KAF A;  3P8D A;  4QT7 A;  1YIJ T;  1FMK A;  1N9S A;  3ZL7 C;  4BE2 A;  4D6W A;  2PUO B;  2DBM A;  2ROT A;  3WXM B;  3CCU Q;  2K5F A;  4LUD A;  3GOX A;  2C06 A;  2CP0 A;  2MMP A;  4PJO C;  4M75 G;  2I2L A;  2RHZ A;  3VU3 C;  4RTW A;  2PVG B;  5IN1 A;  5L23 A;  1ZQ1 A;  4FW1 A;  5CIU A;  4AT1 B;  5HKC A;  1QQJ A;  1N6A A;  3OYG A;  2EBP A;  1BIA A;  4CC4 B;  4JPB W;  3TEE A;  3A8O B;  3C0C A;  3A5Z B;  3QDF A;  1E7O A;  5D6X A;  4M7A G;  2YXY A;  1M8V A;  2RF0 A;  5CVI A;  3BW1 A;  1WHJ A;  2LT1 A;  2EJG A;  1AWJ A;  3PMT A;  3QZ9 B;  3QG1 A;  4M77 E;  4F04 B;  3G6E T;  4N0A A;  1PKS A;  4J5Y A;  4M75 D;  3CMA T;  2OTJ A;  1S1N A;  3NTI A;  3CD6 A;  2VC8 A;  4OB1 B;  1ZA2 B;  2BZY A;  4FSX A;  4E7L A;  2QA4 Q;  3I56 T;  2K3B A;  1WJQ A;  1NE8 A;  1XQH A;  3H8Z A;  3VYG A;  1OZ2 A;  1VQK Q;  3BY7 A;  3BDL A;  5AYF A;  1UG1 A;  1QP3 A;  3GNG A;  1AD5 A;  3O5Z A;  2A08 A;  1YCY A;  3CME Q;  1NPP A;  1UEC A;  1UJY A;  2L8D A;  4FYX B;  1R8O B;  2QTX A;  5DY9 A;  1NLP C;  3TSZ A;  4EMK A;  1PWT A;  1FWZ A;  1HYO A;  3G71 T;  1KQ2 A;  2FPE A;  4RMO A;  3G4S A;  3CC4 T;  3EFO A;  2J6F A;  4JUV A;  3DLL A;  2MCN A;  1RAC B;  3RR6 A;  1OPL A;  2V8K A;  1H3H A;  3CCV Q;  2H3E B;  1YI2 A;  2P0Q A;  2LRQ A;  1F1B B;  4PKC C;  4VUB A;  1U3O A;  4RKU E;  1VQ7 Q;  4OB2 B;  3MJX A;  4PFP A;  3M0U A;  2YT6 A;  3JSC A;  1X2Q A;  1X43 A;  2DPP B;  1QMC A;  5GMK i;  4XTW A;  2AZV A;  1NPR A;  3AHU A;  2J6K A;  1IXD A;  4PJN A;  1IGU A;  5CKE A;  1WI7 A;  1SRL A;  2DIG A;  1Q81 R;  4RTZ A;  2ZAE A;  4EMK C;  2LQ8 A;  3JCM b;  1QVG S;  1I5L A;  2MOX A;  3FLG A;  2YDL A;  3JCM h;  4M77 D;  4BE1 A;  3RDV A;  3G4S Q;  4AFS C;  2Z0W A;  2M0Y A;  3CD6 T;  3OS1 A;  4J9G A;  2KE9 A;  3OA6 A;  5M9O A;  2Y4Y A;  2L5Q A;  2VGN A;  5KCO A;  2EJF A;  2X3X D;  3VV0 A;  2EIF A;  4M7D B;  2ROL A;  1YNZ A;  2KSS A;  2CS7 A;  3CCQ T;  4A53 A;  3HKS A;  3CBM A;  2HCK A;  1P92 A;  2BE7 D;  3MCA B;  2D1X A;  3CCS T;  3T9N A;  4HCK A;  5CAI A;  2RHY A;  1T3S A;  2AK5 A;  3VRY A;  4M7D A;  3QXE B;  4F7U B;  2WSC E;  2VWF A;  5KYN A;  4KRT A;  2XKO C;  3INZ A;  2GFA A;  5D6Y A;  3J7A F;  5GAN j;  1W2B S;  3F70 A;  4AG1 C;  1VQ4 Q;  2HKQ B;  3V7R A;  2QDL A;  2DJZ A;  4QQG A;  4JDS A;  3EHR A;  2RA2 A;  5FRN A;  4HKE A;  1W2B P;  5CO7 A;  4AFU C;  1QCO A;  2HQE A;  3CME A;  2DTO A;  4A63 B;  3OYH A;  1X27 A;  2ZPI B;  1QVF S;  3EG2 A;  3HFN A;  4LUE A;  5CQX A;  3SD4 A;  5KYW A;  3CPF A;  2ZPF B;  3TQ7 P;  2R5M A;  3CBP A;  2YLB A;  1YCS B;  3M57 A;  3JCM f;  1VQ5 Q;  3RUX A;  3DLM A;  3PIO A;  8ATC B;  2QQR A;  2F2V A;  2LVM A;  1B07 A;  3RKY A;  3V7C A;  3CCR T;  3N5B B;  3CCV T;  1X01 A;  3JCM d;  3S3N A;  2MF2 A;  2QG9 B;  2ZPG B;  2W10 A;  1MMA A;  4PFO A;  5DM7 R;  4M7D E;  1M1F A;  1W70 A;  1VYU A;  2OAW A;  1M1K R;  1K8A C;  1PC0 A;  2FZK B;  3QWY A;  1D09 B;  2DBK A;  3G1J A;  1NG2 A;  1NJI R;  1I1J A;  5GMK j;  5GAN g;  1K9A A;  3LH0 A;  1TUC A;  1FYN A;  1TG0 A;  3OYK A;  2ABL A;  1VQ4 A;  1VQO Q;  2CDT A;  2CSI A;  1IGQ A;  3X28 B;  1OUL A;  2QAS A;  1UB4 A;  2O01 E;  2YHT A;  2FHD A;  3L2Z A;  3I55 A;  1VQL Q;  1JB0 E;  2EYW A;  2DXT A;  2QQ9 A;  2QEX A;  1GCP A;  4C0D B;  2VGM A;  4QVD A;  1BI2 A;  2JMA A;  3QWX X;  4M75 B;  2K79 A;  3ME9 A;  5GAO p;  3JCM J;  2DZC A;  1UHC A;  1NEG A;  4M7A D;  3EHQ A;  8AT1 B;  2C0O A;  2M0O A;  1TUD A;  4MDW A;  3GF5 A;  3FEO A;  4MML A;  2FRY A;  4B9X A;  4PNO A;  2R58 A;  4J83 A;  1PM3 A;  4XTX A;  2PZ1 A;  4WCI A;  5LJ3 f;  2EQM A;  1TSF A;  4PFZ A;  1X6B A;  1UDL A;  1VIF A;  1RI9 A;  1YIJ A;  4C0D C;  1M30 A;  2F5K A;  2O31 A;  2O2O A;  4C8Q F;  4ZN3 A;  2CZ7 B;  4BE0 A;  1RAA B;  2RK1 A;  4QVC A;  3SHW A;  4ANJ A;  3QO3 A;  1MGQ A;  1X2K A;  4HVV A;  5L8R E;  2QQS A;  2HL3 A;  3OYJ A;  3M0T A;  3H0I A;  2A36 A;  1PKT A;  2ESW A;  2E1H A;  1IB8 A;  3G6E Q;  1Q7Y U;  3EFS A;  4XQ3 A;  3HSB A;  5ECA A;  2X4X A;  1YJW A;  4ZGE B;  1BK2 A;  2NUP B;  1XJW B;  1GBQ A;  3PTA A;  2ZZD A;  1I0C A;  2E64 A;  2EGE A;  1BCM A;  4K11 A;  4HCB A;  3A1P A;  3REA B;  1Q82 C;  1JRI A;  1VQ7 A;  2B8A A;  3ULR B;  5GAM e;  4M7D C;  4Z02 A;  2KRM A;  1RAG B;  2JW4 A;  1G3W A;  2BZX A;  1M1G A;  2COZ A;  4E6R A;  1OU8 A;  3GP8 A;  3JB9 H;  2D8H A;  4QQ6 A;  4ZGJ B;  1VQ5 T;  1N27 A;  3OYM A;  1SHG A;  2CSQ A;  4RCB A;  2D6F A;  4C92 E;  1N8R R;  3CD6 Q;  3X25 B;  1N9R A;  2JXB A;  2EYZ A;  1BU1 A;  2LT4 A;  4Y28 E;  3VJP A;  4OGE A;  3PT9 A;  2E3H A;  1YWO A;  4RG2 A;  2IVW A;  1D1A A;  2LQW A;  4M78 B;  3E9F A;  1E6H A;  1KIK A;  3CC7 T;  4E7S A;  2MK5 A;  2PU9 B;  3HRS A;  1VQK A;  4C92 A;  5KH6 A;  3CMA Q;  2J6O A;  1WHM A;  3OYY A;  1H64 1;  2LCS A;  3EGX B;  1NYG A;  3KXT A;  1NYF A;  3A8H B;  4C8Q B;  2Y4X A;  2QDY B;  1SEM A;  4F7U G;  1Q7Y R;  2O4X B;  2GNC A;  3CC2 T;  3I55 Q;  4JJC A;  1K9M R;  1QWE A;  4L5G A;  3C95 A;  5HY6 A;  4EMK B;  5GAO n;  2RJD A;  2W0Z A;  3VS3 A;  4JS5 A;  1Z9Z A;  2KGT A;  4LD6 A;  3UWN A;  2FZG B;  1Q82 R;  3WVE B;  4GLM A;  5LJ5 g;  4M77 F;  1XNI A;  2HQH A;  1JO8 A;  4LDW A;  1B34 B;  1WXU A;  3LGL A;  2KXC A;  3NFC A;  3ER0 A;  3VS5 A;  2E12 A;  3EAE A;  5IXB A;  5LL6 S;  2MYS A;  1SHF A;  1W6X A;  2F2W A;  1K73 C;  2FPF A;  3CPW A;  4LDX A;  2SRC A;  2A7Y A;  3UDC A;  1YHQ A;  1D0Z A;  4IKF A;  3S3M A;  2E6Z A;  4LDY A;  4PJO F;  1KHI A;  1D0Y A;  3E19 A;  2QGG A;  2EVR A;  4P5N A;  2COY A;  4KUL A;  1WQ7 A;  2FVU A;  1IZ6 A;  3NTK A;  4X9D A;  2E70 A;  2RHU A;  1ARK A;  2X3W D;  1K8A R;  3GNF B;  4BY6 C;  5FU7 B;  1YIT T;  2CYZ B;  1OEB A;  2M16 A;  1T0J A;  1LOJ A;  2A0F B;  1KD1 U;  1M3A A;  4Q5W A;  4Y91 A;  3E1S A;  2OAU A;  1IO6 A;  1KHC A;  4JRI A;  3V8L A;  2Y90 A;  3DB4 A;  1Q81 U;  2V8J A;  5D7U A;  4M78 E;  2IPO B;  1EIF A;  1JJ2 S;  1GRI A;  4M78 D;  2K9G A;  3OYD A;  1MND A;  4AG2 C;  1WHH A;  2ED1 A;  3CC2 Q;  4KT0 E;  3CCJ T;  2RI3 A;  3M5A A;  5GMK l;  1HK9 A;  2QA4 T;  2KDS A;  1TOV A;  1YI2 Q;  1R0B G;  3VS2 A;  1B34 A;  1M2V A;  5IT9 E;  5FRO A;  1OPK A;  2RPN A;  3VKI A;  4LXC A;  4BDZ A;  3V8J A;  1FMV A;  1OOT A;  3TU4 K;  2YUO A;  2QXF A;  5GAM f;  2BE9 B;  2DIQ A;  2DL8 A;  5GAN h;  1H3Z A;  2A3L A;  1M90 U;  3A8L B;  4BDY A;  3CXC A;  4R0K A;  5GAM j;  2VKN A;  4V2S A;  4LNP A;  3MEW A;  5I2M A;  2PVO B;  1S72 A;  1VQP A;  4X9C A;  3MEU A;  4OVA A;  2DA9 A;  2RI2 A;  1RLQ C;  1VQ4 T;  4E7H A;  4CRI A;  1T0H A;  3NTH A;  4FM4 B;  2QTV A;  4J9D A;  2O88 A;  4FYY B;  1VQ6 Q;  2OJ2 A;  2GQV A;  2DXB A;  1NJI U;  1FXX A;  1SRM A;  2GQI A;  3CMA A;  1KQS S;  1WA7 A;  1M8M A;  5GAN d;  3E2U A;  4KH0 B;  1CKA A;  1KD1 R;  1VQP T;  4PJO B;  1S72 Q;  3JB9 F;  1C0M A;  2K7A A;  1UFF A;  3TSW A;  5GAN 5;  3QZ5 B;  1LVK A;  1OX8 A;  4J9H A;  5GMK m;  1YWP A;  1PHT A;  2AKK A;  3OQ5 A;  3I9Q A;  5LJ5 d;  5A0L A;  1IHV A;  3JCM V;  1AWW A;  3CCR Q;  1M90 C;  4R56 A;  1QLY A;  2G3R A;  4IIM A;  3M54 A;  3I5S A;  1Y57 A;  1O75 A;  5IAY A;  2XU8 A;  3CC4 Q;  1H8K A;  3G6E A;  9ATC B;  3CEY A;  2NUZ A;  2COW A;  4PJO G;  3I5R A;  1TTH B;  5GJW B;  4EMH A;  2EGA A;  1M5Q 1;  2EFI A;  1N5Z A;  5GAM g;  1K0X A;  3CCU A;  1QKX A;  5IXF A;  2NYS A;  1M9S A;  1LPL A;  2RN8 A;  2LQN A;  5HCK A;  1TUG B;  2RQT A;  3SB2 A;  1VYV A;  5KYW B;  1JEG A;  2OX7 A;  1AOJ A;  1JU5 C;  1N8R U;  1PG5 B;  1YIT Q;  1YHQ Q;  3PIP A;  2F69 A;  5FRM A;  4HXJ A;  2HBP A;  1ZLM A;  5D6W A;  3ZBD A;  1AWX A;  1NLO C;  2L3P A;  1Q81 C;  2ZPB B;  5I21 A;  1RAI B;  1CKB A;  4FW2 A;  5AT1 B;  3TRE A;  4A4E A;  3RBB B;  1VQN T;  4C0F A;  1GCQ C;  1HXD A;  2AKL A;  1D3B B;  1WJS A;  3VUZ A;  3CCS A;  3R6N A;  3C94 A;  1GCQ A;  2MPX C;  1YJ9 Q;  2IIM A;  1K9M U;  1VQL A;  1ZHI A;  1YI2 T;  3RER A;  2LQK A;  2L3S A;  4N4I A;  4ELZ C;  1JJ2 P;  4M75 F;  3EH1 A;  4JS4 A;  3CCM Q;  1VQO A;  5KYU A;  4LDU A;  3CCQ Q;  2YWW A;  3QJY A;  1Y96 B;  1QVP A;  1WPY A;  3SEM A;  1M1K U;  1EX4 A;  3L2R A;  4R55 A;  4IIO A;  4BB7 A;  2QGF B;  4C92 D;  1MUZ A;  3QSU A;  3P8B B;  3QJ6 A;  3CC7 A;  3M0Q A;  4RTX A;  4RTV A;  1WIE A;  1VQM T;  2H8H A;  2O4X A;  1WHK A;  4MMK A;  4C5H A;  3CCM A;  2FB7 A;  2EQI A;  4ATO A;  2OTL T;  4NOY A;  1TWB A;  1RAB B;  2KRN A;  2LCL A;  1N8R C;  3CCS Q;  1AVZ C;  3EFR A;  4N0A C;  2HDA A;  3REB B;  4JZ3 A;  2RQU A;  2LMJ A;  1PRL C;  5LJ5 j;  1WX6 A;  2L0A A;  4X1V A;  3M59 A;  2MIO A;  4II1 A;  4OGC A;  1JXO A;  4BI8 B;  2DXC A;  4C92 G;  4B6M A;  3CCL T;  3CQT A;  1XOV A;  4HT9 A;  3CCJ A;  1U06 A;  3RES A;  3KFV A;  2EKH A;  1SPK A;  3PMI A;  4AFQ C;  5KYY B;  2CH4 A;  2KVQ G;  1GBR A;  2EGC A;  2LDM A;  3VYH B;  1KQS P;  3I56 A;  1UGS B;  1KSW A;  4BI4 A;  1AT1 B;  2D8J A;  1K73 U;  5A0G A;  2LJ0 A;  4HCC A;  2K5I A;  2VVK A;  3OYI A;  1K8A U;  2LJ3 A;  3JB9 I;  1TU0 B;  1X75 C;  5FU6 C;  3S3O A;  3PE0 A;  2E41 A;  3PGG A;  2J05 A;  3CC7 Q;  3EH2 A;  2E10 A;  4ZGD B;  2OTL Q;  5EG2 A;  3HPW A;  4WF2 A;  2LZ6 B;  1VQ6 T;  2CP6 A;  2E4H A;  2EPD A;  1M90 R;  5GAM d;  4N4G A;  1QCN A; 
#chains in the Genus database with same CATH homology
 3X25 B;  1VQK T;  1WJR A;  1N9R A;  4M78 G;  4O5V A;  2K5F A;  3WXM B;  3GOX A;  4QW2 A;  2LT4 A;  2C06 A;  3L42 A;  4Y28 E;  3VJP A;  2MMP A;  4PJO C;  4OGE A;  2CZ1 B;  3PT9 A;  2P4T A;  4M75 G;  2I2L A;  2RHZ A;  3CCL A;  4RG2 A;  2IVW A;  3VU3 C;  3OYC A;  1M4Z A;  3HL8 A;  2PVG B;  4M78 B;  1VQ9 T;  3E9F A;  5IN1 A;  1I8F A;  1XTD A;  1ZQ1 A;  4O6J A;  3CC7 T;  4B9W A;  3E9G A;  3HP9 A;  4JRK A;  2PU9 B;  3HRS A;  5CIU A;  4C0G A;  4C92 A;  5KH6 A;  2WSE E;  5HKC A;  1VQK A;  5LJ3 h;  1N6A A;  3CCR A;  4DOW A;  4M7A C;  3OYG A;  1YJN A;  1BIA A;  3TEE A;  3S6W A;  3OYY A;  2CZ0 B;  1H64 1;  3A8O B;  4M77 G;  5A2Q E;  3A5Z B;  3G71 A;  3KXT A;  3A8H B;  4C8Q B;  2Y4X A;  5DLQ E;  5GMK e;  2QDY B;  2R5A A;  5D6X A;  4F7U G;  4M7A G;  2O4X B;  1M8V A;  5CVI A;  3BW1 A;  4M7A F;  2LT1 A;  2EJG A;  3CC2 T;  3PMT A;  3QZ9 B;  5HK3 A;  4ZTJ A;  4HT8 A;  3QG1 A;  3JCM X;  1KQ2 A;  4M77 E;  4L5G A;  3C95 A;  5HY6 A;  4EMK B;  3URG A;  2MWO A;  2RJD A;  3X24 B;  5GAO n;  4DA4 A;  3KBG A;  5J3B A;  4JS5 A;  1KC8 C;  3UWN A;  1K9M C;  4LD6 A;  3G6E T;  4N0A A;  4C5I A;  3WVE B;  4J5Y A;  5J39 A;  5LJ5 g;  3OSV A;  1I81 A;  4M77 F;  4M75 D;  3M55 A;  2EQU A;  1XNI A;  2YRV A;  3CMA T;  2OTJ A;  4RCC A;  3NTI A;  3CD6 A;  2K2V A;  2VC8 A;  1QVF A;  3LGL A;  1B34 B;  4LDW A;  4OB1 B;  3JB9 D;  3NFC A;  3HRU A;  2LTO A;  4M78 A;  3ER0 A;  4CI0 C;  2H3J A;  2RO0 A;  2DXU A;  4FSX A;  4E7L A;  2E12 A;  3EAE A;  5GAN 7;  1PSF A;  5LL6 S;  1BKB A;  1W4S A;  2PVD B;  3DKM A;  4MZP A;  3I56 T;  1BIB A;  4XU1 A;  5LJ3 d;  1WJQ A;  4EPC A;  4F7U A;  1NE8 A;  1XQH A;  3H8Z A;  4IUP A;  3VYG A;  4E7I A;  1YJW T;  2XD0 A;  3OBW A;  1BI1 A;  3MET A;  1OZ2 A;  5GAO l;  4M7D F;  3BY7 A;  3BDL A;  2LNV A;  2CZ6 B;  4HCZ A;  3UPU A;  5AYF A;  1QP3 A;  1K73 C;  2JN0 A;  2LX9 A;  3FC3 A;  1VQ9 A;  2MWP A;  4FIB A;  1WNL A;  3CPW A;  1VQO T;  3GNG A;  4LDX A;  2DTI A;  2A7Y A;  3UDC A;  5GAN 2;  1YCY A;  4MZM A;  1NPP A;  1YHQ A;  1LJO A;  2L8D A;  5DLO A;  4M75 E;  4IKF A;  4E47 A;  1R8O B;  4FT4 A;  3S3M A;  1JBM A;  2QTX A;  2E6Z A;  4LDY A;  5DY9 A;  5HK0 A;  4PJO F;  1KHI A;  3E19 A;  3QDR B;  4P5N A;  4EMK A;  1FX7 A;  1YJN T;  1BYM A;  3BFM A;  4KUL A;  1WQ7 A;  2XG8 D;  1FWZ A;  1IZ6 A;  2FVU A;  2CGH A;  3OW2 S;  4A4K A;  1VQ5 A;  3NTK A;  4X9D A;  2E70 A;  1IRE B;  3CBO A;  3G71 T;  2RHU A;  3CCU T;  3JB9 G;  4RMO A;  3G4S A;  3C4S A;  3CC4 T;  4JUV A;  2M9U A;  2OTL A;  1QW1 A;  3DLL A;  3GNF B;  3QYH B;  4BY6 C;  2LCC A;  5FU7 B;  1YIT T;  2CYZ B;  2E5Q A;  2M16 A;  2V8K A;  4IUQ A;  4NL2 A;  2K5L A;  1LOJ A;  1KD1 U;  3QKJ A;  5FU7 C;  1YI2 A;  4Q5W A;  4F7U E;  4E7K A;  4Y91 A;  3E1S A;  2OAU A;  2P0Q A;  2LRQ A;  4IUR A;  3X26 B;  5GAN 4;  1KHC A;  4JRI A;  4PKC C;  3V8L A;  2Y90 A;  4FL6 A;  3DB4 A;  4VUB A;  4ELY C;  5GMK h;  3CCV A;  3CPW S;  1Q81 U;  2V8J A;  1Q7Y C;  4RKU E;  2KQW A;  4PJO D;  4M78 E;  1G3Y A;  3SDZ A;  1EIF A;  4OB2 B;  4QQD A;  3G4S T;  2JZ2 A;  3BDU A;  1JJ2 S;  1KQ1 A;  3JSC A;  5CKD A;  4M78 D;  1NZ9 A;  3OYD A;  2XID A;  5GAN e;  3MEV A;  2DPP B;  3OMC A;  3LW5 E;  1VQ8 T;  4XU2 A;  3L2Q A;  2EQJ A;  5GMK i;  2FL7 A;  3L2V A;  3OYL A;  4J8O A;  4XTW A;  2WAC A;  2RM4 A;  4KT0 E;  3CCJ T;  1U1S A;  3G7Z A;  1NPR A;  3RMS A;  3AHU A;  4C8Q E;  2RI3 A;  3M5A A;  5GMK l;  1HK9 A;  2XDD A;  2QA4 T;  4MZT A;  5CKE A;  5LJ5 h;  2RHI A;  2KDS A;  2DIG A;  4EMK C;  3JCM b;  2LQ8 A;  1QVG S;  1I5L A;  3OB9 A;  4N4H A;  3FLG A;  1GXI E;  3JCM c;  1Y96 A;  1B34 A;  4M7A B;  5IT9 E;  3JCM h;  4M77 D;  4BE1 A;  1MHN A;  4E7J A;  5FRO A;  3VKI A;  3JB9 J;  2GF7 A;  3OYB A;  4BDZ A;  3V8J A;  1UGQ B;  3CD6 T;  2QA4 A;  3OS1 A;  2JVV A;  3TU4 K;  4IUU A;  2QXF A;  5GAM f;  3FDR A;  3RIR A;  2DIQ A;  2E65 A;  2YLC A;  5GAN h;  5M9O A;  3OA6 A;  4C0Z A;  2K57 A;  4HA8 A;  2A3L A;  2Y4Y A;  4M75 C;  1RL2 A;  1H3Z A;  1M90 U;  3A8L B;  2L5Q A;  3SFM A;  4BDY A;  1O9S A;  2VGN A;  3OMG A;  3CXC A;  5CKH A;  5KCH A;  5KCO A;  2QQA A;  4XAX B;  3OS2 A;  3CCE T;  4BE2 A;  2CKK A;  4M7A E;  2EJF A;  4M75 A;  3VV0 A;  2EIF A;  5GAM j;  4M7D B;  4V2S A;  3OS0 A;  1KQS A;  3MEW A;  3P8H A;  1Q86 U;  5I2M A;  2PVO B;  1S72 A;  1VQP A;  2JUF A;  4X9C A;  2KSS A;  2CS7 A;  3MEU A;  4C8Q A;  4OVA A;  2BIV A;  4A53 A;  3CCQ T;  3HKS A;  4KUD K;  3CBM A;  3LGF A;  3HHT B;  3MO8 A;  1QVG A;  4C92 B;  4A4G A;  2RI2 A;  2RH2 A;  1P92 A;  4IUT A;  3MCA B;  2JTF A;  2XHC A;  3CC2 A;  1YBY A;  1VQ6 A;  1VQ4 T;  5KE2 A;  4E7H A;  3Q1J A;  4CRI A;  3CCS T;  2L3R A;  3ZEH A;  3FJP A;  4JLI A;  3NTH A;  4FM4 B;  3T9N A;  4GY5 A;  1Y71 A;  5CQY A;  5CAI A;  2RHY A;  3V8K A;  2BUD A;  2DK3 A;  2RI5 A;  2GQV A;  2XI9 A;  1BI3 A;  5A0D A;  3QXE B;  2DXB A;  4M7D A;  3QHS A;  3RMQ A;  4F7U B;  3I55 T;  1NJI U;  1FXX A;  4EDU A;  4C92 F;  3CMA A;  1UGP B;  1KQS S;  5GAN d;  2WSC E;  4XTU A;  1VQP T;  4PJO B;  1W2B A;  3JB9 F;  3M53 A;  2X35 A;  5I2S A;  4ME7 A;  2XKO C;  3LWI A;  5GAN 5;  3VUB A;  3QZ5 B;  4M7A A;  3INZ A;  2E6N A;  2GFA A;  5D6Y A;  3J7A F;  1VQ7 T;  4C92 C;  5GMK m;  5GAN j;  1W2B S;  3F70 A;  4ZN1 A;  3DB3 A;  2K4Y A;  1X6O A;  3H6Z A;  2QEX T;  3V7R A;  2AHJ B;  1AHJ B;  2MAM A;  3OQ5 A;  4C8Q C;  1Q86 C;  2XDP A;  2DJZ A;  4QQG A;  4JDS A;  2LC4 A;  3QYG B;  5LJ5 d;  1ZBX A;  2RA2 A;  4OMF B;  3M58 A;  5A0L A;  5FRN A;  2DKG A;  3JCM V;  4HKE A;  1VQN A;  2RB6 A;  4PJO A;  2HAX A;  1TH7 A;  1U1T A;  5LJ3 e;  1M90 C;  3JCM g;  2ZGW A;  4R56 A;  2HNI A;  5CO7 A;  4PL6 A;  2G3R A;  1YHQ T;  3M54 A;  2HQE A;  3OBY A;  4OF1 A;  3CME A;  2DTO A;  1O75 A;  2QI2 A;  5IAY A;  5GAN 8;  2ZPI B;  2XU8 A;  3OYH A;  1QVF S;  2L89 A;  3JRZ A;  3OYE A;  3G6E A;  1G5V A;  3HFN A;  1VQL T;  3CEY A;  5CQX A;  5C6S A;  3SD4 A;  3CPF A;  2QQB A;  4PJO G;  2ZPF B;  2F5T X;  1QP2 A;  4JRP A;  4EMH A;  3MEA A;  3OY9 A;  1M5Q 1;  2EFI A;  2R5M A;  4UC4 A;  3CBP A;  5CKB A;  2YLB A;  4L6V 5;  5GAM g;  3M57 A;  3CCU A;  3JCM W;  4OB0 B;  3JCM f;  2DD4 A;  2EAY A;  2HQX A;  3LX7 A;  3RUX A;  2P0P A;  1M9S A;  4C8Q G;  3DLM A;  4FT2 A;  5LJ5 f;  1JJ2 A;  3MP8 A;  2X4Y A;  4GLK A;  3PIO A;  3OYF A;  1OI1 A;  1YIT A;  3SB2 A;  4L59 A;  4A4F A;  3FRN A;  4IUV A;  3LYI A;  3JCM Q;  2QQR A;  2KY9 A;  3MHX A;  1N8R U;  3L1A A;  2LVM A;  3V7C A;  3RKY A;  2X4J A;  3CCR T;  3N5B B;  3PIP A;  3CCV T;  1X01 A;  2GCX A;  3A8G B;  2JOY A;  2XK0 A;  3JCM d;  2F69 A;  5FRM A;  4LDV A;  3S3N A;  5CR2 A;  5GAM h;  1YJ9 T;  2FYK A;  2MF2 A;  1SSF A;  4XTV A;  4PLL A;  2HBP A;  5GAO q;  3M56 A;  4XTY A;  2ZPG B;  1WQW A;  5GAN f;  5D6W A;  1Q82 U;  5DM7 R;  3CCM T;  3LLR A;  3R6O A;  2RJE A;  4M78 C;  1M1F A;  3HRT A;  3ZBD A;  4M7D E;  1Q81 C;  1KG1 A;  1S72 T;  2XDB A;  3M9Q A;  2EWN A;  2ZPB B;  2DTH A;  2VV5 A;  5I21 A;  4X34 A;  1K8A C;  2D0Q B;  4XU3 A;  3SWN C;  4M7D D;  3TRE A;  4A4E A;  2EKO A;  2M1H A;  1I4K 1;  1VQN T;  5GMK j;  5GAN g;  3M4Y A;  4C0F A;  4PJO E;  1HXD A;  3LH0 A;  3GLX A;  1U8R A;  4J6Y A;  3QII A;  1D3B B;  3OYK A;  1WJS A;  5GAO r;  3VUZ A;  3QUI A;  3WVD B;  3LWH A;  3CCS A;  4ZTF A;  3QBY A;  1VQ4 A;  2ZPH B;  3C94 A;  4XTZ A;  5GAN 3;  1K9M U;  4PLI A;  1ZHI A;  1YI2 T;  2BKD N;  2VYT A;  3FB9 A;  3J80 E;  1VQL A;  3RER A;  2LQK A;  2RJC A;  4J6W A;  3A8M B;  4N4I A;  5LJ3 j;  4FU6 A;  3GIB A;  1G3T A;  4ELZ C;  1UGR B;  4DQ2 A;  4XK8 E;  5LJ5 e;  4M75 F;  3SWN A;  3X28 B;  4JS4 A;  3L2Z A;  5FU6 B;  1UB4 A;  2O01 E;  2YHT A;  2FHD A;  3I55 A;  2DZ9 A;  1VQO A;  4F7U F;  1JB0 E;  5CCA A;  4LDU A;  1VQM A;  3ASK A;  2DXT A;  3QJY A;  1Y96 B;  1WPY A;  1QVP A;  3CCE A;  5GAO m;  2QQ9 A;  1RI0 A;  4NL3 A;  1NJI C;  2QEX A;  1M1K U;  3L2R A;  4RG8 A;  2VXE A;  2RJF A;  4C0D B;  2VGM A;  4QVD A;  3SWN B;  1BI2 A;  4R55 A;  4BB7 A;  3OW2 A;  4M75 B;  3ME9 A;  3RKX A;  5GAO p;  2OTJ T;  4C92 D;  4M7D G;  3QSU A;  2JNG A;  3P8B B;  3QJ6 A;  3CC7 A;  1VUB A;  3JCM J;  1VQM T;  2DZC A;  2O4X A;  4A54 A;  4M7A D;  4MMK A;  4C5H A;  1LNX A;  3CCM A;  3CXC S;  3J81 E;  2FB7 A;  2M0O A;  4J6X A;  4MDW A;  4ATO A;  3GF5 A;  3FEO A;  4MML A;  4B9X A;  4PNO A;  3O8V A;  2R58 A;  2EYQ A;  2JTM A;  4J83 A;  4M78 F;  1KC8 U;  4XTX A;  2V8I A;  4A4H A;  2OTL T;  5LJ3 f;  4NOY A;  3CME T;  2LCL A;  1N8R C;  2EQM A;  4BI3 A;  3HFO A;  1UEB A;  3EFR A;  1VIF A;  4N0A C;  3C12 A;  1YIJ A;  4C0D C;  2DAQ A;  5FLX E;  2F5K A;  4DOV A;  1BI0 A;  3RKW A;  4C8Q F;  4ZN3 A;  5LJ5 j;  4JRQ A;  2CZ7 B;  4BE0 A;  4TVR A;  1D3B A;  1PSE A;  4BY6 B;  4M77 B;  4J7F A;  4XU0 A;  5CK9 A;  3CCQ A;  4NS5 A;  2RK1 A;  2RHX A;  4QVC A;  1OZ3 A;  3M59 A;  3QO3 A;  5CKF A;  1MGQ A;  2ZPE B;  4II1 A;  4OGC A;  4OB3 B;  4BI8 B;  1M1K C;  5L8R E;  2QQS A;  3OYN A;  2DXC A;  4C92 G;  5C0M A;  2GFU A;  1Y07 A;  2XIC A;  4C5E A;  2HD0 A;  4EMG A;  5KE3 A;  3OYJ A;  5GAN 6;  2PQW A;  3CCL T;  3PFS A;  1XOV A;  3TCJ A;  4BUG A;  2E1H A;  2DVE A;  4QVZ A;  4C8Q D;  3CCJ A;  3JCM P;  1YJ9 A;  1Q7Y U;  3CC4 A;  4HT9 A;  2EJ9 A;  3RES A;  2RD1 A;  1OYX A;  2WSF E;  3EFS A;  2P0K A;  4XQ3 A;  3L2U A;  3HSB A;  4JJN K;  2DO3 A;  4YTL A;  2D9T A;  3PMI A;  2VUB A;  3PNW C;  2X4X A;  5LJ3 g;  1YJW A;  4ZGE B;  4KUI A;  3M4G A;  3QPH A;  2KVQ G;  3L2W A;  2LDM A;  1Y7X A;  3VYH B;  2K3X A;  2ZZD A;  3PTA A;  3I56 A;  1DJ7 B;  4BAC A;  3ZFJ A;  1UGS B;  2E64 A;  4MDX A;  3FIF A;  2RK2 A;  3UT1 A;  1V29 B;  2VXF A;  4HCB A;  4C5G A;  2DD5 A;  2K3Y A;  4BI4 A;  4KBM B;  2PUK B;  3OS5 A;  1Q82 C;  1JRI A;  3JCM e;  1VQ7 A;  2NLU A;  2B8A A;  5A0G A;  1K73 U;  4BD3 A;  5GAM e;  1G3S A;  2KMT A;  3MP6 A;  4Z02 A;  4M7D C;  4OP0 A;  1G3W A;  4HCC A;  1M1G A;  2K5I A;  4M77 A;  2MI6 A;  3OYI A;  1K8A U;  2X4W A;  2KK4 A;  1VIE A;  4J7I A;  5J26 A;  3JB9 I;  2IG0 A;  1X75 C;  5FU6 C;  3GP8 A;  3S3O A;  3JB9 H;  3JAM E;  3OSS C;  3GPL A;  2E41 A;  4QQ6 A;  3OYA A;  3PGG A;  4ZGJ B;  1KD1 C;  1VQ5 T;  1VQ8 A;  4LD9 K;  1N27 A;  4JLG A;  3X20 B;  3V7S A;  2E10 A;  4ZGD B;  2DEQ A;  3HPW A;  3MP1 A;  2KAF A;  4WF2 A;  5EG2 A;  3OYM A;  3P8D A;  1WGS A;  1YIJ T;  1VQ6 T;  2EQK A;  1N9S A;  4M77 C;  4RCB A;  5GAM d;  2R57 A;  2ZCF B;  4C92 E;  4D6W A;  4N4G A;  2PUO B;  3KUF A;  2D6F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...