1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
b'MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
2ZPGB 1QP3A 2DXCA 2PUKB 1UGQB 2DD5A 2PVOB 2D0QB 2WSFE 1PSEA 2DD4A 4ZGJB 1QP2A 4Y28E 3VYHB 3QZ9B 4OB2B 1UGRB 4OB0B 2O01E 4ZGDB 3X26B 2WSEE 2PVGB 2ZPBB 3X28B 5L8RE 3A8LB 1AHJB 1IREB 3X25B 3WVEB 3X24B 2CYZB 2ZPFB 2CZ0B 1UGSB 1V29B 4OB1B 3A8HB 4KT0E 3QZ5B 4XK8E 2CZ1B 4ZGEB 4FM4B 2CZ7B 3LW5E 3X20B 3A8GB 2ZZDA 1JB0E 2CZ6B 1DJ7B 2ZPIB 3QXEB 2ZPHB 4RKUE 1PSFA 2WSCE 2AHJB 2DPPB 2ZCFB 1GXIE 2PU9B 1UGPB 2PVDB 2ZPEB 2PUOB 3VYGA 2DXBA 3QYHB 2QDYB 3A8OB 3HHTB 3QYGB 4OB3B 3A8MB 4L6V5 3WVDB
chains in the Genus database with same CATH superfamily
2JJ9A 3H0FA 5CQYA 3OYEA 1ZX6A 1B34A 1YN8A 2LMJA 1BBZA 1F1BB 3EH2A 2BE9B 1TS9A 2EPDA 2C0IA 2FHDA 4PK4A 3ZL7C 4QW2A 1BU1A 2X35A 3VV0A 2A36A 4QQDA 2QEXA 3TCJA 1OX9A 2BE7D 1FMKA 2FEIA 4QVCA 4C92E 2O01E 1IHVA 1JXOA 3GF5A 4E7ZA 5AYFA 2YXYA 3E2UA 2EYWA 2Y4YA 4F7UG 2QAZA 2FL7A 4WTOB 3EFOA 2R57A 3LLRA 3PTAA 4XTVA 2VXEA 4B6MA 3EG9A 2NUTA 3JCMJ 1VYTA 1NJIU 2RF0A 4JRIA 3RMSA 1PKSA 4ATOA 3QJ6A 3UA7A 2JNGA 4LN2A 1YJNT 2CZ0B 1Z9ZA 2DL3A 2KSSA 1VQOQ 2C0TA 1D1CA 3MP1A 4KT0E 4PFZA 1MV0B 4PFOA 1QVPA 4M77G 4PJJA 1G2BA 3HP9A 2ZZDA 1RAIB 1R0CB 4D6WA 4DBFA 1D0ZA 3OYCA 3CC4T 2DEUA 4CI0C 1YIJQ 1PC0A 2XK0A 2QA4Q 3C94A 1OPLA 5C6SA 1RABB 2GTJA 3LWHA 5HY6A 2XKOC 3JB9H 4RUGA 3QDRB 2HBPA 2LTOA 2L5QA 4EMKC 2LZ6B 3LGFA 1VQ4T 2ABLA 4A4KA 3G4ST 1OZ2A 1K0SA 1NJIC 4X9DA 3FEOA 2LC4A 3VYGA 3I56A 1W2BS 2CUBA 1D3BB 4M77D 3OYHA 3ZEHA 1OOTA 3A8MB 2F2VA 3UDCA 1WZOA 4F7UF 1VQLA 1VQ6Q 3EGDA 4PL6A 2XIDA 5AT1B 2NWMA 2PUKB 2RHXA 4F7UE 3OS5A 1KQSS 3EAEA 1Y7XA 2LT4A 4MZTA 5CO7A 4M7AG 3OW2P 1ACMB 3I9QA 2JMCA 3CC2Q 1M1KC 4AMCA 4ZN1A 3CCRT 1VYVA 5KYWB 3AHUA 1D1BA 1WGSA 4A63B 5DLOA 1W4SA 1TSFA 4Q5WA 1SHGA 2GGRA 3OYGA 2PVGB 4R0KA 1FMVA 4BY6B 4M77F 1G3YA 3S3OA 5GAMg 2KRNA 1WXBA 4YTLA 5LJ3d 2DBKA 2E70A 2CP2A 4M77E 5I11A 3JB9I 2IG0A 4M7AD 1UGSB 1OULA 2KNBB 1HXDA 2KR3A 1K73R 4XAXB 2AT1B 3V8JA 1W2BP 2E5QA 2CP3A 2H3EB 3SWNB 2E6NA 4Y91A 1I5OB 2FRYA 2EGCA 2YRVA 3SEMA 1AWOA 1IGQA 2CT4A 3X20B 5GAMe 1XNIA 2QXFA 1VA7A 3OYAA 1Y57A 4JPBW 1KQSP 4QQGA 2DVJA 2RA2A 4PJLA 2AHJB 5GAN3 3CCUA 4J6YA 1GXIE 2F5KA 4M7DC 4LD9K 3CCJA 1YJ9Q 1M3CA 4II1A 1Q95G 4M7AF 3S6WA 1WJSA 1TUCA 2QDYB 3G71Q 3I55A 5LJ5g 4M7AE 3RIRA 1W2BA 2MWPA 5FWBA 2GQIA 4J9FA 3KFVA 1XOVA 1EFNA 1WX6A 2CKKA 2QQRA 1Q82R 4JLGA 3M0QA 3TU4K 1VQKT 4C92A 2X4JA 3JCMP 1PSEA 2YHTA 1M27C 2KI7A 5KH6A 2RH2A 1Y96A 3CCQT 4AFSC 4XTZA 4M75F 3OQ5A 2DBMA 1SSFA 2K2MA 2VVKA 4KRTA 5LJ5e 1EX4A 1SRMA 3MO8A 3O8VA 2RM4A 4M75E 5D6WA 3M55A 3X28B 2V1QA 1WHGA 3REBB 4RTUA 1M90U 2X9HA 3CCVQ 4QT7A 1TG0A 4HVWA 3GPLA 2OTLT 3JAME 1M9SA 1YITT 4C8QB 4BD3A 3JCMb 4DQ2A 5D6XA 3VS4A 2YUOA 2CSIA 2ZPFB 3OYMA 3UF4A 2KXCA 3GNFB 3QWYA 1K8AU 3OBYA 2CREA 2QGGA 3PMTA 4HCCA 3VUBA 4PLLA 1JEGA 3SHWA 5KCOA 4DA4A 3T9NA 2KXDA 2MAMA 2KAFA 1M3AA 1FYNA 1KD1U 2L89A 3CC7A 4A4HA 2COWA 5GAOq 1BCOA 1RADB 3LX7A 4J9HA 1WFWA 1MNDA 5LJ5f 2FZCB 3KBGA 1GCQA 4QKUA 1I4K1 3VS3A 1M90C 3RKYA 1RL2A 2I2LA 2DO3A 4P5NA 2OTJQ 2PUOB 3MKDA 2DXBA 1RI9A 4CC4B 5DM7R 1VQOT 4HVVA 1C6VX 4F7UA 4OVAA 1AVZC 4FL6A 1K8AC 1KC8C 1VQ9Q 4PJOB 2QI2A 4DBHA 3GLXA 3CCUQ 2VUBA 2DL8A 4MZPA 1KG1A 1LOJA 4FYYB 2QASA 1S72A 3MCAB 3JCMd 2ATCB 4VUBA 4A54A 1YIJT 1QP2A 3I55Q 2QA4T 1KD1C 4Y28E 3VYHB 1YI2A 5LJ3j 1RLQC 4FT2A 1VQMQ 1I07A 1YNZA 3OSSC 4M77A 2O2OA 1M30A 1QCOA 3HKSA 3DLLA 7AT1B 2WACA 1LVKA 5CIUA 2JUFA 3A8LB 2R5MA 4QQ6A 2L2PA 3OA6A 1QCFA 1MGQA 1RAHB 1KFZA 5KYYA 3TVTA 2HQHA 3GBQA 4J9CA 2CP5A 2CYZB 2M02A 4Y92A 5GMKl 1VQ6T 5J26A 2FB7A 3OY9A 1MUZA 4LUEA 3TQ7P 4HT8A 2KE9A 1HK9A 2CP6A 1KHCA 2J6KA 4XQ3A 4JJDA 4LD6A 2RJCA 2QGFB 3CC2T 3CXCP 5GAN7 4PLIA 3P8HA 2RK1A 5FW9A 4EMHA 4D8DA 2OJ2A 5GAOn 1RAAB 3DLMA 2FYKA 4N4IA 2RHZA 4FIBA 3JCMQ 5GANh 2K5FA 3M0RA 2DK3A 4M7AA 2ED1A 2PU9B 2R5AA 3PFSA 3JV3A 3V7RA 3M0PA 5GAN2 4Z8AA 2DAQA 2YUPA 4M78G 4FW1A 4CC7A 2FG0A 3NHNA 3EG1A 4EDUA 4OMNA 2FPEA 3HSBA 4OF1A 2KYBA 1UUEA 5I22A 1Q81R 2DM1A 3L2RA 2ZPGB 1YWPA 1QP3A 3PIOA 2V8KA 3JB9J 3E19A 5I2SA 1QKWA 3IQLA 4J9GA 3RNJA 2RHUA 3TREA 2RHYA 1YHQA 1IB8A 4E7LA 5FLXE 4M78D 1K0XA 3M58A 5GMKm 1I1JA 1B34B 3QO3A 2EKHA 3JB9F 1YJ9T 3A98A 1WHHA 1MHNA 5LJ3f 2DEQA 5CCAA 3CCSQ 2KK4A 4X34A 1X2QA 2KQWA 3G71T 2AIRB 3QBYA 4R55A 4FYWB 1PNJA 2P0PA 4PJNA 2CGHA 2DZCA 2F69A 3MEVA 3EFOB 2JW4A 3EG0A 2ZGWA 3EG9B 4IUPA 2DYIA 4OMQA 2HCKA 4M78F 1I5LA 4X9CA 1M3BA 2EYXA 4MMLA 2RI3A 3GP8A 3OS2A 4J7IA 4WF2A 4M78E 3R6NA 4V2SA 1A0NB 4E7KA 2FO0A 3M53A 2ZPIB 1S1NA 3QXEB 2CT3A 2RB6A 3VS7A 3V7CA 1W70A 4A4GA 4FSSA 4RTWA 3CCVT 3V8KA 2HQEA 1AT1B 3VUZA 1SEMA 3OYFA 5GMKh 3QYHB 1MV3A 1IHWA 1Q7YC 2MMPA 2NUPA 1JO8A 4BE0A 2X4XA 1HJDA 4GY5A 1H641 4R56A 1N8RR 3EGXA 2HBWA 1GFDA 4OGCA 4OMMA 1YP5A 1O9SA 2CP7A 3OB9A 3FJPA 5KYUA 2K5IA 1ZUUA 2KRSA 3CMAQ 1C1AA 1VQPQ 2M16A 5IHIA 2JS2A 3ME9A 3RMQA 1X6OA 5GMKj 3EGDB 2Y4XA 1TU0B 2CUDA 1KQ2A 4ZGDB 2JTMA 1M2VA 1I8FA 3X26B 2GBQA 3M0SA 2QK0A 1PD1A 2E65A 2EQMA 2GF7A 2HSPA 2GQVA 2OTJT 1YJWA 4BUGA 4BY6C 3QUIA 4FYXB 3DB3A 1BI3A 4RTYA 4C92F 1IREB 1VQ9T 2DXUA 3CCUT 5FU7B 3CMEQ 2O4XB 3M54A 2Z0WA 1AWJA 2EQUA 4IIMA 1G3WA 3A8HB 1Q86C 2RPNA 4JJCA 3RESA 3OMGA 3FB9A 4Z89A 3I55T 2CZ7B 2LT1A 3M57A 4PFPA 1ZHIA 4CC2A 3SWNC 1NYFA 2GFUA 4RCBA 1U5SA 1VQMT 1M1FA 3M5AA 5CKFA 1GCPA 1PSFA 3VS2A 2D8JA 3L2ZA 4C0FA 1WLPB 2O9VA 3GIBA 3EG2A 4M4ZA 2VASA 3G1JA 4BDYA 3I5SA 2JOYA 4GLKA 2XG8D 1UECA 2KGTA 4C0GA 1HD3A 4FT4A 1ZSZA 3LGLA 2D6FA 1RAEB 3E1SA 3DB4A 3TEEA 1UJYA 2QDLA 2EKOA 2MPXC 2YLCA 3JCMf 4LDYA 1ZUYA 2LJ3A 2PVOB 2WSFE 4KGVB 1SPKA 2W10A 3Q1JA 5GAMh 4OB2B 3PE0A 5A0LA 3VKIA 1I0CA 1OU8A 4J9IA 2LQ8A 4C92B 4E47A 2HSEB 1UE9A 3LH0A 3VS1A 2O88A 2EJFA 5HK0A 1UEBA 5IT9E 1Y96B 4J8OA 1VQ5A 2BKDN 5LL6S 2K9GA 3X25B 2D9TA 5IXFA 2HL5C 3EG3A 1AZGB 1KQ1A 1V29B 4C8QC 5GAMj 1K9MU 2SRCA 2O9SA 3THKA 5I2MA 3NTKA 3PVQA 4M78A 2ED0A 5CVIA 3CCLA 1SHFA 1G8XA 2NYSA 1XQHA 4DBQA 1VQ7A 5IAYA 2FZGB 1VQ8A 2CH4A 1AZEA 1JJ2S 2RJEA 2QEXQ 2P0KA 1BI2A 2HL3A 4CC3A 2BIVA 4MZMA 2XMFA 3ZBDA 6AT1B 3CCST 1T3LA 5LJ5h 1T3SA 4IUUA 1G3TA 2VV5A 2EQJA 2K57A 2DF6A 2XICA 3CCEA 1Y07A 3META 4RTXA 2LCSA 2RO0A 1NBEB 4GBQA 4KGZB 4M7DG 1NJIR 3MHXA 4LXCA 5EG2A 1WJQA 4DBRA 1PHTA 1UJ0A 2HZYA 1K9MC 2KYMA 1SKUB 2E4HA 2B86A 5HK3A 2CS7A 4ZTJA 4C0DB 4PJOC 1NEBA 1PG5B 2D0QB 3M0UA 4F7UB 4LDXA 4M75C 4JS5A 4LDWA 2P4TA 4J9BA 3QZ9B 4M7DD 2DL5A 4B9XA 1M1KR 1H92A 2RJFA 4RCCA 2KT1A 3CPFA 3QSUA 5A0GA 2QQ9A 1JJ2P 1R0BG 5GJWB 4LE9A 1RAFB 3EHRA 3URGA 3JCMW 2JMAA 3I56Q 4QVZA 5KE2A 2KT8A 4M77B 2VGMA 4C0ZA 1D3BA 4N0AC 4D8KA 1VQLQ 5GANd 2RD1A 2E10A 4OB1B 3F70A 2BUDA 3QPHA 2P0QA 3E9GA 2RNAA 4C5GA 3QZ5B 2V26A 2RMOA 2EIFA 3FIFA 3AT1B 2KEAA 2ECZA 2OI3A 1QVGS 3CBMA 3CMAT 5KYYB 1OEBA 2B8AA 1VQPT 1VQ5Q 4XTXA 1M1GA 2F5TX 1QQJA 2KY9A 2OAWA 2JM9A 3MEWA 3RR6A 4M7DE 4MDXA 2HQXA 2EAYA 4CRIA 1JJ2A 1ZA2B 4O6JA 3CC4A 3V7SA 4RKUE 2DTHA 1W1FA 3REAB 4ELZC 3CCLQ 4A4FA 3OYIA 1UGPB 2K5LA 1WHKA 5GAOl 1VQ7Q 3OYYA 1N6AA 1VQ4A 5KYNA 3ULRB 1FMWA 1MMDA 3CMET 3MP6A 2J6OA 1PRMC 2D0NA 2QQBA 3QDFA 4J6WA 4M7AB 2XU8A 1N9RA 2HMAA 1OV3A 1U1SA 1EIFA 3JSCA 4FU6A 5IHKA 3EFSA 1QLYA 2G3RA 5GAN5 3CCEQ 3L2VA 1WXUA 1JU5C 3H8ZA 4FW2A 4L59A 1YFNA 2EYQA 3HRSA 2DL4A 1OI1A 1E7OA 4E7SA 5CKDA 3VU3C 1MMGA 2C06A 2MWOA 4ESRA 2KMTA 3CCRA 2WSEE 1NEGA 2NUZA 4J83A 4RTVA 1ABOA 5FU6B 2GTOA 1KK7A 3CCJQ 1W6XA 4M75B 1D0XA 2YWWA 1K9AA 4UC4A 2CDTA 2K3XA 2R58A 2LQWA 3RKWA 2E12A 3X24B 4O5VA 4BI4A 4JDSA 2X4WA 2DYBA 5I21A 4KH0B 2HEQA 4EMKA 1VUBA 3NTIA 1X2KA 3OYBA 4LDUA 5GAOm 1U3OA 3P8DA 1QVGA 2RN8A 4OMLA 2DVEA 1NM7A 2EQKA 3G6EA 1H3ZA 2AK5A 1GRIA 1OU9A 1ZBJA 2K4YA 2ZPHB 3BFMA 5LJ3g 2DLPA 1LNXA 2DPPB 1OYXA 4DOWA 1WHJA 3ER0A 1ZA1B 1OX8A 3TSWA 1M90R 1PWTA 2FVUA 3UPUA 1MNEA 1UB4A 4JLIA 3CEYA 1X6BA 3JRZA 5CK9A 2EW3A 3CCMA 2MK5A 1OQKA 1N5ZA 4IURA 1KC8R 2DX1A 1PD0A 3PMIA 5GAN8 5LJ3e 1WHLA 2DERA 4PJMA 1LJOA 2QEXT 2XI9A 5EC7A 1VQKA 3QJYA 1WHMA 2P4RA 1VIEA 4LUDA 3CC7Q 1PKTA 3M4GA 1UGRB 1KD1R 3CD6A 2AKLA 2FRWA 3CCQA 2QTVA 3NPFA 3P8BB 3UT1A 5KYUB 3BDLA 1TUDA 2D1XA 5GANj 3PIPA 1NPRA 3OYLA 1U8RA 2L3PA 3M9QA 3OYDA 1V76A 3CQTA 1K1ZA 2P84A 2JVVA 2VGNA 1TTHB 3NFCA 1WDXA 1M2VB 2OTLA 4PNOA 4HXJA 1K76A 1LPLA 1ZUKA 5KE3A 1BYMA 3MPUB 4F04B 1YCYA 5FU7C 2QQSA 4XK8E 1KJWA 4M7DA 3OYJA 3S3MA 4F17A 1S72Q 1OPKA 3VRZA 3C0CA 3C95A 4N4GA 2K6DA 2LQKA 5DLQE 1QVFA 1YI2Q 3MEUA 3DKMA 4J6XA 1M8VA 4J9EA 2HKNA 1CKAA 3MEAA 4JS4A 3CBOA 3CBPA 1TH7A 2XHCA 1H3HA 1T0JA 2H8HA 2NUTB 2I0NA 8ATCB 3L2WA 3A5ZB 2DTIA 3C12A 3I56T 5KYXA 4AFQC 2E64A 2CSQA 4JRKA 3BDUA 5FRNA 2A7YA 3G6EQ 2JTFA 2PZ1A 5GAMd 3PVLA 3JCMc 1VQLT 4FCYA 1KSWA 1NE8A 1MMAA 3INZA 4N4HA 1VQOA 1WQWA 1G83A 3HFNA 4IUTA 5GAN6 1VOMA 1NYGA 5ECAA 2E3IA 3H6ZA 1RACB 4HA8A 2ESWA 2DD5A 2HDAA 1VQ5T 3OMCA 2XD0A 1G3SA 1PCXA 2LX9A 1JRIA 2JM8A 4E7IA 4BB7A 3V8LA 2QA4A 3CCMQ 5CKEA 4JUVA 3CCLT 2PNIA 2E6ZA 2PQWA 4E2FB 1RUWA 1VQ7T 1RLPC 2LQNA 2IVWA 1D09B 2YRDA 2L0AA 1P92A 1GFCA 1WYXA 4C92C 4BACA 1C0MA 5KCHA 5GANf 1G5VA 2ROTA 3CD6Q 4MDWA 1NPPA 3JCMg 3NGPA 1ARKA 1IRXA 2EGEA 2DJQA 1M4ZA 5LJ5d 1VYUA 5D7UA 4ORZA 1BK2A 2O31A 1YHQQ 2EJGA 1JB0E 2VYTA 1IXDA 1E6GA 1WNLA 2GFAA 3ASKA 4DEXA 1ZBXA 2DE0X 3RDVA 4M78B 2RK2A 2LNVA 5CQXA 3CCJT 1MMNA 1QKXA 2VC8A 3JCMe 1FXXA 5CR2A 4IUVA 1CSKA 1NLPC 2X3WD 4B9WA 4XU1A 1UTIA 2ENMA 3HHTB 4X1VA 2DRMA 2LP5A 5GAOr 2F2XA 3WVDB 2RHIA 1K73U 1RI0A 1Q7YR 1GCQC 2RJDA 2MIOA 4A53A 4HCBA 2BZ8A 3L1AA 3CPWA 5CKHA 1UGQB 5J3BA 5GMKe 4C0DC 2YSQA 5FRMA 2DD4A 2FZKB 1BI1A 4OMPA 1LCKA 2KVQG 2DIQA 3HFOA 1BCMA 4BI3A 2EYZA 2MYSA 2DMOA 1WJRA 3HPWA 2M1HA 1UDLA 3OW2S 2G6FX 2RQUA 2YRCA 3SFMA 1XJWB 3RBBB 4KULA 2A08A 4WCIA 3HTRA 2HKQB 3PNWC 1YJ9A 4RTTA 1GL5A 3VRYA 2AZVA 1B7TA 1OZ3A 4Z02A 1N9SA 5GAN4 3G71A 3UWNA 3FJ5A 1SG5A 1M1KU 1VQNA 1YWOA 2QG9B 4ME7A 1K73C 5FROA 3JCMV 2CH4W 4M77C 1ZQ1A 5GAOp 1Q82U 4AFUC 4RTZA 2OX7A 1HYOA 2M0YA 4C8QG 1Q86R 3J81E 1WPYA 3L2UA 2J06A 2DJZA 2K2VA 3A8GB 3CC7T 1J3TA 1QCNA 2JN0A 2BTTA 2A37A 2QTXA 3N5BB 4EPCA 4PKCC 1AWWA 1ABQA 2DL7A 1AOJA 1X6GA 2FPDA 3RERA 4JJBA 1YJWQ 3CCVA 3E9FA 4C8QD 3J80E 1Y0MA 1U06A 2EYYA 4IIOA 4OB3B 2KDSA 3NTHA 2K7AA 2YT6A 1IO6A 2MI6A 1Q82C 2O4XA 2RQVA 1S72T 1SSHA 4M7AC 2E41A 4OMFB 4KUIA 2MCNA 2K79A 1YI2T 4F14A 5A2QE 4XU2A 2J05A 4C5HA 4PJOG 4M75G 4OB0B 4AG2C 3HRUA 1M5Q1 4C8QF 3OW2A 2ZPBB 2V1RA 3L42A 4HCKA 4BI8B 3QWXX 5LJ5j 1BB9A 3G6ET 5FU6C 4C8QE 2L3QA 3FRNA 1JXMA 4HCZA 2OTJA 4J5YA 2F1LA 1Y71A 5FWCA 4PJOD 1QMCA 1VQ9A 2L3RA 2JT4A 4M75D 2IPOB 3I5RA 2VKNA 4NL2A 2DA9A 1YCSB 1ZSGA 5CKBA 3SDZA 4EMGA 3MJXA 3EGUA 2E3HA 3OYKA 3CCMT 1VQNQ 4KGXB 3OBWA 4OP0A 2CZ6B 2EFIA 2HNIA 4IKFA 1KIKA 4EMKB 1RAGB 2YLBA 1VQMA 2RI5A 4FSXA 4AFZC 4AT1B 2WSCE 1YJNA 3H0HA 1FX7A 2V8IA 3I35A 2PVDB 2DZ9A 8AT1B 1N27A 4PJOF 2COZA 5DY9A 2VB6A 3GOXA 4M7DF 5GAMf 1KQSA 4XTUA 4QVDA 3CD6T 1WQ7A 2FPFA 3LYIA 1E6HA 4PJOE 4L5GA 4ANJA 4KH1B 4AG1C 2DETA 1TWBA 5KYWA 5D6YA 1K9MR 2A0FB 2LCCA 1M2OA 2DIGA 4C5IA 2GCXA 2XDPA 1YHQT 3SB2A 3M4YA 2MF2A 1O75A 1VQ8Q 4RG8A 1YBYA 4ZGJB 3EHQA 2LJ0A 1PM3A 4ELYC 3G4SA 2BZYA 1KHIA 3HL8A 1GBRA 2E1HA 1KC8U 4JZ3A 2KBTA 2CP0A 1SF9A 4XTYA 2QQAA 2X4YA 4J7FA 4OMOA 5L8RE 1QWEA 2A28A 1TUGB 2M51A 3EFRA 2M9UA 3SWNA 2RQTA 1FWZA 1X43A 4JRPA 1CKBA 1TXQA 4XTWA 3RKXA 3EH1A 1Q81U 3O5ZA 1QVGP 2XDDA 3PGGA 3ZFJA 2J7IA 4ZNXA 2F2WA 4JJNK 2CZ1B 2DXTA 3LWIA 5IHNA 5LJ3h 4K11A 3LW5E 1WIEA 2EQIA 3FDRA 4C5EA 3M56A 1B3QA 4DOVA 4ZN3A 2JTEA 3CXCS 1NZ9A 5GMKi 2LRQA 4M7DB 3SD4A 2L8DA 2DFUA 4TVRA 4OGEA 2Y90A 3CCSA 2ZAEA 1HSQA 2GNCA 2LJ1A 2NLUA 1WA7A 1QVFS 2MOXA 1ZLMA 3VS6A 1U1TA 1NG2A 3A8OB 3PT9A 2EBPA 3QYGB 3KXTA 2ROLA 1Q81C 5CAIA 1UHFA 1R8OB 1BKBA 1UGVA 1AD5A 1YJNQ 3RUXA 9ATCB 2YUQA 3BW1A 5KYXB 3JCMX 3M59A 2JS0A 4XU3A 1BIAA 2W0ZA 4BDZA 2IIMA 3OS1A 4XU0A 3OYNA 4GLMA 2EGAA 1X27A 2DNUA 1ZSZC 3CC4Q 4C8QA 1T0HA 3M0TA 3H9NA 3L2QA 3VS0A 2LDMA 3S3NA 2LVMA 1K8AR 4JRQA 1JBMA 3JB9G 1UHCA 3HRTA 1YJWT 2YDLA 2XDBA 3G7ZA 1VQ4Q 4LNPA 3G4SQ 1I81A 1M8MA 2X51A 4HVUA 1AHJB 2NUPB 1X75C 5J39A 3VS5A 1NLOC 1K4US 4RG2A 3EGXB 4Z88A 1N8RU 1R77A 5IN1A 2H3JA 5C0MA 1QVFP 2HD0A 2E5KA 3BY7A 5M9OA 2EJ9A 4DEYA 4EIKA 1XTDA 2J6FA 3JB9D 2K3YA 3OS0A 2X3XD 1EZZB 3NMZC 3CMAA 4HT9A 2VXFA 1VIFA 1VQPA 3KUFA 2DTOA 3QIIA 2L3SA 1YITA 3LH5A 3CCRQ 1SRLA 3CXCA 1B07A 1IZ6A 2ZCFB 4M78C 4PJOA 2RQWA 2SEMA 5A0DA 3UA6A 2ZPEB 4KBMB 3VJPA 4M75A 5GANg 4A4EA 1JQQA 4F16A 2LCLA 4ZTFA 4L6V5 1N8RC 3CMEA 4E7JA 2LX7A 1QW1A 2PTKA 2KRMA 1TOVA 3QKJA 2DXCA 3UATA 1H8KA 1BIBA 3FLGA 1PRLC 4E7HA 2EWNA 2AZSA 2QYZA 1V1CA 1VQNT 2M0OA 2DRKA 4KUDK 2JXBA 4FYVB 4HKEA 2DKGA 1UFFA 1Q7YU 5GANe 4NL3A 2V8JA 4N0AA 2A3LA 2EVRA 3CPWS 3A1PA 4IUQA 2VWFA 2COYA 1AEYA 3QHSA 3TSZA 3D7SB 3JCMh 4BE1A 2KROA 3OSVA 4RMOA 1Z9QA 4E6RA 5HKCA 1ZSZB 1BI0A 4C92G 3WVEB 3QG1A 1YIJA 2OAUA 1D1AA 1D0YA 2AKKA 4NOYA 1X01A 5L23A 1X69A 2D8HA 3FC3A 4ZGEB 1WXTA 1VQ8T 4FM4B 3WXMB 1AWXA 2K3BA 1VQKQ 3R6OA 2C0OA 2JZ2A 4JZ4A 4BE2A 3H41A 4J9DA 5IXBA 1DJ7B 4LDVA 2BZXA 5GJVB 2DILA 3CCQQ 1WI7A 4C92D 3MP8A 2HAXA 1VQ6A 1Q86U 3H0IA 1IGUA 3CCET 4MMKA 1QWFA 2RI2A 3GNGA 4NS5A 3C4SA 2LNHB 2YUNA 1GBQA 5HCKA 5IH2A 3CPWP 3J7AF 2OTLQ 3U23A 1UG1A 3CC2A 1YITQ 3BE3A 2RQRA
chains in the Genus database with same CATH topology
2MI6A 2QQBA 4J6WA 4M7AB 2XU8A 5CQYA 1N9RA 1Q82C 2O4XA 3OYEA 1U1SA 1EIFA 3L2RA 2ZPGB 3JSCA 4FU6A 1S72T 3EFSA 1B34A 1QP3A 4M7AC 3PIOA 2G3RA 2V8KA 5GAN5 2E41A 3JB9J 4OMFB 4KUIA 3E19A 5I2SA 3L2VA 3H8ZA 2FHDA 2RHUA 1YI2T 4L59A 3TREA 2EYQA 3HRSA 4XU2A 4QW2A 4C5HA 5A2QE 2RHYA 4PJOG 2X35A 1YHQA 3VV0A 1OI1A 5CKDA 4QQDA 3VU3C 2QEXA 3TCJA 4E7LA 5FLXE 2C06A 4M78D 3M58A 4M75G 4QVCA 5GMKm 2MWOA 4OB0B 2O01E 4C92E 2KMTA 1B34B 3GF5A 3QO3A 5AYFA 3CCRA 3JB9F 2WSEE 3HRUA 1M5Q1 1YJ9T 4J83A 4C8QF 3OW2A 2Y4YA 4F7UG 1MHNA 2ZPBB 5FU6B 5LJ3f 2DEQA 5CCAA 2FL7A 3L42A 3LLRA 2R57A 4M75B 3PTAA 4BI8B 2KK4A 4XTVA 5LJ5j 2VXEA 3G6ET 4X34A 5FU6C 2KQWA 3FRNA 4C8QE 3G71T 3JCMJ 4HCZA 4UC4A 1NJIU 4JRIA 2OTJA 3RMSA 4J5YA 2K3XA 4ATOA 3QBYA 3QJ6A 4R55A 2R58A 3RKWA 2JNGA 2E12A 3X24B 2P0PA 1YJNT 1Y71A 2CZ0B 2CGHA 4O5VA 4JDSA 4BI4A 4PJOD 2X4WA 2KSSA 1VQ9A 5I21A 2DZCA 2F69A 3MEVA 2L3RA 3MP1A 4KT0E 4EMKA 4M75D 1VUBA 3NTIA 2ZGWA 4IUPA 4NL2A 3OYBA 1QVPA 4M77G 4LDUA 4M78F 1I5LA 5GAOm 3HP9A 3P8DA 4X9CA 5CKBA 3SDZA 1QVGA 4MMLA 2RI3A 4EMGA 2ZZDA 3GP8A 4D6WA 3OS2A 2DVEA 4J7IA 2EQKA 3OYCA 3OYKA 4WF2A 3CC4T 3G6EA 3CCMT 1H3ZA 4M78E 4CI0C 3OBWA 4OP0A 2CZ6B 2EFIA 4V2SA 2K4YA 2XK0A 3C94A 5C6SA 4E7KA 3M53A 2HNIA 2ZPIB 4IKFA 4EMKB 2YLBA 2ZPHB 3QXEB 2RB6A 3BFMA 1VQMA 2RI5A 3LWHA 4FSXA 5HY6A 2WSCE 2XKOC 5LJ3g 3JB9H 1YJNA 3QDRB 1FX7A 1LNXA 2HBPA 2V8IA 3V7CA 2LTOA 2L5QA 4A4GA 4EMKC 2DPPB 3CCVT 2PVDB 3LGFA 3V8KA 2DZ9A 1VQ4T 2HQEA 1OYXA 4DOWA 4A4KA 3ER0A 3G4ST 1OZ2A 1N27A 4PJOF 3VUZA 1NJIC 5DY9A 3OYFA 4X9DA 3GOXA 5GAMf 1KQSA 4M7DF 5GMKh 3FEOA 2LC4A 3VYGA 4XTUA 2FVUA 4QVDA 3QYHB 3I56A 3CD6T 1W2BS 1WQ7A 1D3BB 4M77D 3OYHA 3UPUA 3LYIA 3ZEHA 1UB4A 4PJOE 4L5GA 2MMPA 1Q7YC 3A8MB 4JLIA 3UDCA 3CEYA 4BE0A 3JRZA 5CK9A 2X4XA 3CCMA 4F7UF 1VQLA 4GY5A 1H641 4R56A 5D6YA 4PL6A 4IURA 2XIDA 2LCCA 4OGCA 2DIGA 1O9SA 3PMIA 5GAN8 2PUKB 5LJ3e 4C5IA 2RHXA 3FJPA 3OB9A 3OS5A 4F7UE 2GCXA 1KQSS 2XDPA 1YHQT 3EAEA 3SB2A 3M4YA 2MF2A 1LJOA 1O75A 1Y7XA 2K5IA 2XI9A 2LT4A 2QEXT 4MZTA 4RG8A 1YBYA 5CO7A 4ZGJB 1VQKA 4M7AG 3QJYA 4ELYC 3G4SA 1KHIA 2M16A 1VIEA 3HL8A 2E1HA 3ME9A 1X6OA 3RMQA 5GMKj 1M1KC 3M4GA 1UGRB 4ZN1A 3CCRT 3AHUA 2Y4XA 1KQ2A 1WGSA 3CD6A 1KC8U 3CCQA 4ZGDB 5DLOA 2JTMA 3P8BB 1I8FA 1W4SA 3UT1A 3X26B 4Q5WA 4XTYA 3BDLA 2QQAA 2X4YA 2PVGB 4J7FA 3OYGA 2E65A 2EQMA 2GF7A 4BY6B 5L8RE 4M77F 1G3YA 5GANj 3PIPA 2GQVA 1NPRA 5GAMg 3S3OA 2OTJT 3EFRA 4YTLA 3OYLA 5LJ3d 1YJWA 1U8RA 4BUGA 3M9QA 4BY6C 3OYDA 3QUIA 2E70A 2M9UA 4M77E 3SWNA 3DB3A 1BI3A 4C92F 1FWZA 2JVVA 3JB9I 1IREB 2IG0A 2VGNA 3NFCA 1VQ9T 2OTLA 4PNOA 2DXUA 4JRPA 4M7AD 1UGSB 5FU7B 4XTWA 2O4XB 3M54A 3RKXA 3CCUT 5KE3A 1Q81U 2EQUA 2XDDA 3PGGA 3ZFJA 1BYMA 1G3WA 3A8HB 1HXDA 1Q86C 1YCYA 5FU7C 2QQSA 4XK8E 4XAXB 4M7DA 4JJNK 2CZ1B 2DXTA 3V8JA 3RESA 3OMGA 3FB9A 3OYJA 3S3MA 2E5QA 3LWIA 3SWNB 2E6NA 4Y91A 3I55T 2CZ7B 2YRVA 5LJ3h 3LW5E 2LT1A 3X20B 3M57A 3C95A 1ZHIA 3FDRA 4N4GA 4C5EA 5GAMe 3SWNC 1XNIA 2LQKA 5DLQE 2GFUA 1QVFA 4RCBA 2QXFA 3MEUA 3M56A 3DKMA 1VQMT 1M1FA 4J6XA 1M8VA 4DOVA 4ZN3A 3OYAA 3CXCS 1NZ9A 5GMKi 3M5AA 3MEAA 5CKFA 2LRQA 4JS4A 3CBOA 4M7DB 3SD4A 4QQGA 1PSFA 2L8DA 2RA2A 3L2ZA 2AHJB 3CBPA 1TH7A 2XHCA 4TVRA 4OGEA 4C0FA 5GAN3 3CCUA 4J6YA 1GXIE 2F5KA 4M7DC 2Y90A 4LD9K 3CCSA 3CCJA 3GIBA 2NLUA 4II1A 3A5ZB 2DTIA 3C12A 3L2WA 3I56T 4M7AF 2E64A 1QVFS 3S6WA 4JRKA 3BDUA 4BDYA 1WJSA 5FRNA 2A7YA 2QDYB 1U1TA 2JTFA 3I55A 2JOYA 3A8OB 3PT9A 4GLKA 5LJ5g 2XG8D 3QYGB 5GAMd 3KXTA 4M7AE 3JCMc 1VQLT 3RIRA 4C0GA 1NE8A 4FT4A 1W2BA 5CAIA 3LGLA 1Q81C 2MWPA 3INZA 1R8OB 1BKBA 4N4HA 1VQOA 1WQWA 2D6FA 3E1SA 3RUXA 3DB4A 3TEEA 1XOVA 3HFNA 4IUTA 5GAN6 2CKKA 2EKOA 2YLCA 3BW1A 3H6ZA 3JCMf 2QQRA 3M59A 3JCMX 4HA8A 4LDYA 4JLGA 4XU3A 2DD5A 1BIAA 1VQ5T 2PVOB 3OMCA 3TU4K 1VQKT 2XD0A 4C92A 1G3SA 2WSFE 2X4JA 3JCMP 1PSEA 4BDZA 2LX9A 2YHTA 1JRIA 4E7IA 3Q1JA 4BB7A 4XU0A 5GAMh 5KH6A 2RH2A 1Y96A 3V8LA 3OS1A 3OYNA 3CCQT 4OB2B 4XTZA 4M75F 3OQ5A 2QA4A 1SSFA 5A0LA 3VKIA 4C8QA 5CKEA 4JUVA 3CCLT 5LJ5e 2E6ZA 3L2QA 3MO8A 2LDMA 2LQ8A 2PQWA 3O8VA 3S3NA 2LVMA 2RM4A 1VQ7T 4JRQA 1JBMA 4M75E 2IVWA 4C92B 3JB9G 5D6WA 3M55A 3HRTA 3X28B 4E47A 1YJWT 2XDBA 1P92A 3LH0A 1M90U 4C92C 2EJFA 5HK0A 4BACA 1UEBA 5IT9E 3G7ZA 1Y96B 5KCHA 3GPLA 4J8OA 2OTLT 1I81A 3JAME 1VQ5A 1AHJB 2BKDN 1M9SA 5LL6S 1YITT 4C8QB 4BD3A 3JCMb 4DQ2A 1X75C 2D9TA 5D6XA 3X25B 5J39A 5GANf 1G5VA 2ZPFB 3OYMA 4MDWA 3GNFB 4RG2A 1NPPA 1KQ1A 1V29B 4C8QC 3OBYA 5GAMj 1N8RU 1K8AU 5IN1A 1K9MU 3JCMg 2H3JA 5I2MA 5C0MA 3PMTA 4HCCA 2HD0A 1M4ZA 5LJ5d 3NTKA 4M78A 3BY7A 5CVIA 5M9OA 3VUBA 4PLLA 3CCLA 2EJ9A 5KCOA 4DA4A 1XTDA 1XQHA 3JB9D 3T9NA 1VQ7A 2K3YA 5IAYA 3OS0A 1VQ8A 3CMAA 2MAMA 2EJGA 2KAFA 1JJ2S 1JB0E 2RJEA 2VXFA 4HT9A 1VIFA 2P0KA 1VQPA 2VYTA 2L89A 1KD1U 3KUFA 1WNLA 1BI2A 2DTOA 3CC7A 2GFAA 3ASKA 4A4HA 5GAOq 1ZBXA 3QIIA 2BIVA 3LX7A 4MZMA 1YITA 4M78B 2RK2A 5LJ5f 2LNVA 3ZBDA 3KBGA 5CQXA 3CCST 1I4K1 3CCJT 3CXCA 5LJ5h 4IUUA 2VC8A 1IZ6A 1G3TA 2VV5A 2ZCFB 4M78C 4PJOA 2EQJA 3JCMe 2K57A 1M90C 5A0DA 1FXXA 2XICA 5CR2A 4IUVA 3CCEA 2ZPEB 1Y07A 3META 3RKYA 1RL2A 2I2LA 4KBMB 2DO3A 2RO0A 4P5NA 4M75A 2PUOB 3VJPA 2DXBA 5GANg 4M7DG 4B9WA 4XU1A 3MHXA 4A4EA 3HHTB 1WJQA 5EG2A 5DM7R 1VQOT 4F7UA 4OVAA 5GAOr 4FL6A 1K8AC 2LCLA 4ZTFA 4L6V5 1N8RC 3WVDB 1K9MC 3CMEA 4E7JA 1KC8C 2RHIA 5HK3A 4PJOB 2CS7A 2QI2A 1K73U 1RI0A 1QW1A 3GLXA 2RJDA 2VUBA 4ZTJA 4C0DB 4A53A 4HCBA 3L1AA 4MZPA 3QKJA 1KG1A 1LOJA 3CPWA 4PJOC 2DXCA 5CKHA 1UGQB 5J3BA 1BIBA 5GMKe 2D0QB 3FLGA 4C0DC 4E7HA 3MCAB 3JCMd 2EWNA 1S72A 5FRMA 4VUBA 2DD4A 1BI1A 1VQNT 4F7UB 2M0OA 4M75C 4A54A 1YIJT 1QP2A 4LDXA 4KUDK 2QA4T 2KVQG 4JS5A 2DIQA 2P4TA 4LDWA 4Y28E 3HFOA 4BI3A 3VYHB 4HKEA 1YI2A 1KD1C 5LJ3j 3QZ9B 2DKGA 1WJRA 1Q7YU 3HPWA 5GANe 4NL3A 4M7DD 2V8JA 4N0AA 2M1HA 4B9XA 3OW2S 2A3LA 4FT2A 3OSSC 4M77A 3CPWS 2RJFA 3SFMA 4IUQA 4RCCA 4KULA 3QHSA 3CPFA 3HKSA 5A0GA 3DLLA 3QSUA 2QQ9A 2WACA 5CIUA 3PNWC 1YJ9A 2JUFA 3A8LB 3JCMh 2R5MA 4BE1A 4QQ6A 3URGA 3JCMW 1OZ3A 3OSVA 3OA6A 1MGQA 4Z02A 4RMOA 4QVZA 1N9SA 5GAN4 5HKCA 5KE2A 3G71A 3UWNA 1BI0A 4C92G 3WVEB 1M1KU 5GMKl 2CYZB 3QG1A 2VGMA 4M77B 4C0ZA 1D3BA 1VQ6T 1VQNA 1YIJA 2OAUA 4ME7A 4N0AC 1K73C 5J26A 2FB7A 3OY9A 5FROA 3JCMV 5GANd 2RD1A 2E10A 4OB1B 3F70A 4M77C 2BUDA 1ZQ1A 3QPHA 2P0QA 4NOYA 3E9GA 5GAOp 4C5GA 1Q82U 4HT8A 1X01A 3QZ5B 3FC3A 2EIFA 3FIFA 4ZGEB 1HK9A 4C8QG 1QVGS 1KHCA 3J81E 1VQ8T 4XQ3A 4FM4B 3CBMA 3CMAT 3WXMB 1WPYA 3L2UA 2DJZA 2K2VA 2RJCA 4LD6A 2B8AA 1VQPT 3A8GB 3CC2T 3CC7T 4XTXA 1M1GA 2F5TX 3R6OA 2JZ2A 2KY9A 5GAN7 4PLIA 4BE2A 3MEWA 3P8HA 2RK1A 4MDXA 5GAOn 4EMHA 4M7DE 2HQXA 1DJ7B 2EAYA 4LDVA 4CRIA 1JJ2A 3DLMA 2FYKA 2JN0A 4O6JA 3CC4A 4N4IA 2RHZA 2QTXA 4FIBA 4RKUE 2DTHA 3N5BB 3V7SA 3JCMQ 4EPCA 4PKCC 4C92D 5GANh 3MP8A 2HAXA 1VQ6A 1Q86U 4ELZC 3CCET 2K5FA 4A4FA 3OYIA 2DK3A 4MMKA 4M7AA 2PU9B 1UGPB 3RERA 2R5AA 2K5LA 3PFSA 5GAOl 2RI2A 3GNGA 1N6AA 3OYYA 4NS5A 3C4SA 3V7RA 3CCVA 5GAN2 3E9FA 1VQ4A 4C8QD 2DAQA 4M78G 3J80E 3CMET 4EDUA 3J7AF 4OB3B 2KDSA 3CC2A 3MP6A 3HSBA 3NTHA 4OF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPG B;  1QP3 A;  2DXC A;  2PUK B;  1UGQ B;  2DD5 A;  2PVO B;  2D0Q B;  2WSF E;  1PSE A;  2DD4 A;  4ZGJ B;  1QP2 A;  4Y28 E;  3VYH B;  3QZ9 B;  4OB2 B;  1UGR B;  4OB0 B;  2O01 E;  4ZGD B;  3X26 B;  2WSE E;  2PVG B;  2ZPB B;  3X28 B;  5L8R E;  3A8L B;  1AHJ B;  1IRE B;  3X25 B;  3WVE B;  3X24 B;  2CYZ B;  2ZPF B;  2CZ0 B;  1UGS B;  1V29 B;  4OB1 B;  3A8H B;  4KT0 E;  3QZ5 B;  4XK8 E;  2CZ1 B;  4ZGE B;  4FM4 B;  2CZ7 B;  3LW5 E;  3X20 B;  3A8G B;  2ZZD A;  1JB0 E;  2CZ6 B;  1DJ7 B;  2ZPI B;  3QXE B;  2ZPH B;  4RKU E;  1PSF A;  2WSC E;  2AHJ B;  2DPP B;  2ZCF B;  1GXI E;  2PU9 B;  1UGP B;  2PVD B;  2ZPE B;  2PUO B;  3VYG A;  2DXB A;  3QYH B;  2QDY B;  3A8O B;  3HHT B;  3QYG B;  4OB3 B;  3A8M B;  4L6V 5;  3WVD B; 
#chains in the Genus database with same CATH topology
 2JJ9 A;  3H0F A;  5CQY A;  3OYE A;  1ZX6 A;  1B34 A;  1YN8 A;  2LMJ A;  1BBZ A;  1F1B B;  3EH2 A;  2BE9 B;  1TS9 A;  2EPD A;  2C0I A;  2FHD A;  4PK4 A;  3ZL7 C;  4QW2 A;  1BU1 A;  2X35 A;  3VV0 A;  2A36 A;  4QQD A;  2QEX A;  3TCJ A;  1OX9 A;  2BE7 D;  1FMK A;  2FEI A;  4QVC A;  4C92 E;  2O01 E;  1IHV A;  1JXO A;  3GF5 A;  4E7Z A;  5AYF A;  2YXY A;  3E2U A;  2EYW A;  2Y4Y A;  4F7U G;  2QAZ A;  2FL7 A;  4WTO B;  3EFO A;  2R57 A;  3LLR A;  3PTA A;  4XTV A;  2VXE A;  4B6M A;  3EG9 A;  2NUT A;  3JCM J;  1VYT A;  1NJI U;  2RF0 A;  4JRI A;  3RMS A;  1PKS A;  4ATO A;  3QJ6 A;  3UA7 A;  2JNG A;  4LN2 A;  1YJN T;  2CZ0 B;  1Z9Z A;  2DL3 A;  2KSS A;  1VQO Q;  2C0T A;  1D1C A;  3MP1 A;  4KT0 E;  4PFZ A;  1MV0 B;  4PFO A;  1QVP A;  4M77 G;  4PJJ A;  1G2B A;  3HP9 A;  2ZZD A;  1RAI B;  1R0C B;  4D6W A;  4DBF A;  1D0Z A;  3OYC A;  3CC4 T;  2DEU A;  4CI0 C;  1YIJ Q;  1PC0 A;  2XK0 A;  2QA4 Q;  3C94 A;  1OPL A;  5C6S A;  1RAB B;  2GTJ A;  3LWH A;  5HY6 A;  2XKO C;  3JB9 H;  4RUG A;  3QDR B;  2HBP A;  2LTO A;  2L5Q A;  4EMK C;  2LZ6 B;  3LGF A;  1VQ4 T;  2ABL A;  4A4K A;  3G4S T;  1OZ2 A;  1K0S A;  1NJI C;  4X9D A;  3FEO A;  2LC4 A;  3VYG A;  3I56 A;  1W2B S;  2CUB A;  1D3B B;  4M77 D;  3OYH A;  3ZEH A;  1OOT A;  3A8M B;  2F2V A;  3UDC A;  1WZO A;  4F7U F;  1VQL A;  1VQ6 Q;  3EGD A;  4PL6 A;  2XID A;  5AT1 B;  2NWM A;  2PUK B;  2RHX A;  4F7U E;  3OS5 A;  1KQS S;  3EAE A;  1Y7X A;  2LT4 A;  4MZT A;  5CO7 A;  4M7A G;  3OW2 P;  1ACM B;  3I9Q A;  2JMC A;  3CC2 Q;  1M1K C;  4AMC A;  4ZN1 A;  3CCR T;  1VYV A;  5KYW B;  3AHU A;  1D1B A;  1WGS A;  4A63 B;  5DLO A;  1W4S A;  1TSF A;  4Q5W A;  1SHG A;  2GGR A;  3OYG A;  2PVG B;  4R0K A;  1FMV A;  4BY6 B;  4M77 F;  1G3Y A;  3S3O A;  5GAM g;  2KRN A;  1WXB A;  4YTL A;  5LJ3 d;  2DBK A;  2E70 A;  2CP2 A;  4M77 E;  5I11 A;  3JB9 I;  2IG0 A;  4M7A D;  1UGS B;  1OUL A;  2KNB B;  1HXD A;  2KR3 A;  1K73 R;  4XAX B;  2AT1 B;  3V8J A;  1W2B P;  2E5Q A;  2CP3 A;  2H3E B;  3SWN B;  2E6N A;  4Y91 A;  1I5O B;  2FRY A;  2EGC A;  2YRV A;  3SEM A;  1AWO A;  1IGQ A;  2CT4 A;  3X20 B;  5GAM e;  1XNI A;  2QXF A;  1VA7 A;  3OYA A;  1Y57 A;  4JPB W;  1KQS P;  4QQG A;  2DVJ A;  2RA2 A;  4PJL A;  2AHJ B;  5GAN 3;  3CCU A;  4J6Y A;  1GXI E;  2F5K A;  4M7D C;  4LD9 K;  3CCJ A;  1YJ9 Q;  1M3C A;  4II1 A;  1Q95 G;  4M7A F;  3S6W A;  1WJS A;  1TUC A;  2QDY B;  3G71 Q;  3I55 A;  5LJ5 g;  4M7A E;  3RIR A;  1W2B A;  2MWP A;  5FWB A;  2GQI A;  4J9F A;  3KFV A;  1XOV A;  1EFN A;  1WX6 A;  2CKK A;  2QQR A;  1Q82 R;  4JLG A;  3M0Q A;  3TU4 K;  1VQK T;  4C92 A;  2X4J A;  3JCM P;  1PSE A;  2YHT A;  1M27 C;  2KI7 A;  5KH6 A;  2RH2 A;  1Y96 A;  3CCQ T;  4AFS C;  4XTZ A;  4M75 F;  3OQ5 A;  2DBM A;  1SSF A;  2K2M A;  2VVK A;  4KRT A;  5LJ5 e;  1EX4 A;  1SRM A;  3MO8 A;  3O8V A;  2RM4 A;  4M75 E;  5D6W A;  3M55 A;  3X28 B;  2V1Q A;  1WHG A;  3REB B;  4RTU A;  1M90 U;  2X9H A;  3CCV Q;  4QT7 A;  1TG0 A;  4HVW A;  3GPL A;  2OTL T;  3JAM E;  1M9S A;  1YIT T;  4C8Q B;  4BD3 A;  3JCM b;  4DQ2 A;  5D6X A;  3VS4 A;  2YUO A;  2CSI A;  2ZPF B;  3OYM A;  3UF4 A;  2KXC A;  3GNF B;  3QWY A;  1K8A U;  3OBY A;  2CRE A;  2QGG A;  3PMT A;  4HCC A;  3VUB A;  4PLL A;  1JEG A;  3SHW A;  5KCO A;  4DA4 A;  3T9N A;  2KXD A;  2MAM A;  2KAF A;  1M3A A;  1FYN A;  1KD1 U;  2L89 A;  3CC7 A;  4A4H A;  2COW A;  5GAO q;  1BCO A;  1RAD B;  3LX7 A;  4J9H A;  1WFW A;  1MND A;  5LJ5 f;  2FZC B;  3KBG A;  1GCQ A;  4QKU A;  1I4K 1;  3VS3 A;  1M90 C;  3RKY A;  1RL2 A;  2I2L A;  2DO3 A;  4P5N A;  2OTJ Q;  2PUO B;  3MKD A;  2DXB A;  1RI9 A;  4CC4 B;  5DM7 R;  1VQO T;  4HVV A;  1C6V X;  4F7U A;  4OVA A;  1AVZ C;  4FL6 A;  1K8A C;  1KC8 C;  1VQ9 Q;  4PJO B;  2QI2 A;  4DBH A;  3GLX A;  3CCU Q;  2VUB A;  2DL8 A;  4MZP A;  1KG1 A;  1LOJ A;  4FYY B;  2QAS A;  1S72 A;  3MCA B;  3JCM d;  2ATC B;  4VUB A;  4A54 A;  1YIJ T;  1QP2 A;  3I55 Q;  2QA4 T;  1KD1 C;  4Y28 E;  3VYH B;  1YI2 A;  5LJ3 j;  1RLQ C;  4FT2 A;  1VQM Q;  1I07 A;  1YNZ A;  3OSS C;  4M77 A;  2O2O A;  1M30 A;  1QCO A;  3HKS A;  3DLL A;  7AT1 B;  2WAC A;  1LVK A;  5CIU A;  2JUF A;  3A8L B;  2R5M A;  4QQ6 A;  2L2P A;  3OA6 A;  1QCF A;  1MGQ A;  1RAH B;  1KFZ A;  5KYY A;  3TVT A;  2HQH A;  3GBQ A;  4J9C A;  2CP5 A;  2CYZ B;  2M02 A;  4Y92 A;  5GMK l;  1VQ6 T;  5J26 A;  2FB7 A;  3OY9 A;  1MUZ A;  4LUE A;  3TQ7 P;  4HT8 A;  2KE9 A;  1HK9 A;  2CP6 A;  1KHC A;  2J6K A;  4XQ3 A;  4JJD A;  4LD6 A;  2RJC A;  2QGF B;  3CC2 T;  3CXC P;  5GAN 7;  4PLI A;  3P8H A;  2RK1 A;  5FW9 A;  4EMH A;  4D8D A;  2OJ2 A;  5GAO n;  1RAA B;  3DLM A;  2FYK A;  4N4I A;  2RHZ A;  4FIB A;  3JCM Q;  5GAN h;  2K5F A;  3M0R A;  2DK3 A;  4M7A A;  2ED1 A;  2PU9 B;  2R5A A;  3PFS A;  3JV3 A;  3V7R A;  3M0P A;  5GAN 2;  4Z8A A;  2DAQ A;  2YUP A;  4M78 G;  4FW1 A;  4CC7 A;  2FG0 A;  3NHN A;  3EG1 A;  4EDU A;  4OMN A;  2FPE A;  3HSB A;  4OF1 A;  2KYB A;  1UUE A;  5I22 A;  1Q81 R;  2DM1 A;  3L2R A;  2ZPG B;  1YWP A;  1QP3 A;  3PIO A;  2V8K A;  3JB9 J;  3E19 A;  5I2S A;  1QKW A;  3IQL A;  4J9G A;  3RNJ A;  2RHU A;  3TRE A;  2RHY A;  1YHQ A;  1IB8 A;  4E7L A;  5FLX E;  4M78 D;  1K0X A;  3M58 A;  5GMK m;  1I1J A;  1B34 B;  3QO3 A;  2EKH A;  3JB9 F;  1YJ9 T;  3A98 A;  1WHH A;  1MHN A;  5LJ3 f;  2DEQ A;  5CCA A;  3CCS Q;  2KK4 A;  4X34 A;  1X2Q A;  2KQW A;  3G71 T;  2AIR B;  3QBY A;  4R55 A;  4FYW B;  1PNJ A;  2P0P A;  4PJN A;  2CGH A;  2DZC A;  2F69 A;  3MEV A;  3EFO B;  2JW4 A;  3EG0 A;  2ZGW A;  3EG9 B;  4IUP A;  2DYI A;  4OMQ A;  2HCK A;  4M78 F;  1I5L A;  4X9C A;  1M3B A;  2EYX A;  4MML A;  2RI3 A;  3GP8 A;  3OS2 A;  4J7I A;  4WF2 A;  4M78 E;  3R6N A;  4V2S A;  1A0N B;  4E7K A;  2FO0 A;  3M53 A;  2ZPI B;  1S1N A;  3QXE B;  2CT3 A;  2RB6 A;  3VS7 A;  3V7C A;  1W70 A;  4A4G A;  4FSS A;  4RTW A;  3CCV T;  3V8K A;  2HQE A;  1AT1 B;  3VUZ A;  1SEM A;  3OYF A;  5GMK h;  3QYH B;  1MV3 A;  1IHW A;  1Q7Y C;  2MMP A;  2NUP A;  1JO8 A;  4BE0 A;  2X4X A;  1HJD A;  4GY5 A;  1H64 1;  4R56 A;  1N8R R;  3EGX A;  2HBW A;  1GFD A;  4OGC A;  4OMM A;  1YP5 A;  1O9S A;  2CP7 A;  3OB9 A;  3FJP A;  5KYU A;  2K5I A;  1ZUU A;  2KRS A;  3CMA Q;  1C1A A;  1VQP Q;  2M16 A;  5IHI A;  2JS2 A;  3ME9 A;  3RMQ A;  1X6O A;  5GMK j;  3EGD B;  2Y4X A;  1TU0 B;  2CUD A;  1KQ2 A;  4ZGD B;  2JTM A;  1M2V A;  1I8F A;  3X26 B;  2GBQ A;  3M0S A;  2QK0 A;  1PD1 A;  2E65 A;  2EQM A;  2GF7 A;  2HSP A;  2GQV A;  2OTJ T;  1YJW A;  4BUG A;  4BY6 C;  3QUI A;  4FYX B;  3DB3 A;  1BI3 A;  4RTY A;  4C92 F;  1IRE B;  1VQ9 T;  2DXU A;  3CCU T;  5FU7 B;  3CME Q;  2O4X B;  3M54 A;  2Z0W A;  1AWJ A;  2EQU A;  4IIM A;  1G3W A;  3A8H B;  1Q86 C;  2RPN A;  4JJC A;  3RES A;  3OMG A;  3FB9 A;  4Z89 A;  3I55 T;  2CZ7 B;  2LT1 A;  3M57 A;  4PFP A;  1ZHI A;  4CC2 A;  3SWN C;  1NYF A;  2GFU A;  4RCB A;  1U5S A;  1VQM T;  1M1F A;  3M5A A;  5CKF A;  1GCP A;  1PSF A;  3VS2 A;  2D8J A;  3L2Z A;  4C0F A;  1WLP B;  2O9V A;  3GIB A;  3EG2 A;  4M4Z A;  2VAS A;  3G1J A;  4BDY A;  3I5S A;  2JOY A;  4GLK A;  2XG8 D;  1UEC A;  2KGT A;  4C0G A;  1HD3 A;  4FT4 A;  1ZSZ A;  3LGL A;  2D6F A;  1RAE B;  3E1S A;  3DB4 A;  3TEE A;  1UJY A;  2QDL A;  2EKO A;  2MPX C;  2YLC A;  3JCM f;  4LDY A;  1ZUY A;  2LJ3 A;  2PVO B;  2WSF E;  4KGV B;  1SPK A;  2W10 A;  3Q1J A;  5GAM h;  4OB2 B;  3PE0 A;  5A0L A;  3VKI A;  1I0C A;  1OU8 A;  4J9I A;  2LQ8 A;  4C92 B;  4E47 A;  2HSE B;  1UE9 A;  3LH0 A;  3VS1 A;  2O88 A;  2EJF A;  5HK0 A;  1UEB A;  5IT9 E;  1Y96 B;  4J8O A;  1VQ5 A;  2BKD N;  5LL6 S;  2K9G A;  3X25 B;  2D9T A;  5IXF A;  2HL5 C;  3EG3 A;  1AZG B;  1KQ1 A;  1V29 B;  4C8Q C;  5GAM j;  1K9M U;  2SRC A;  2O9S A;  3THK A;  5I2M A;  3NTK A;  3PVQ A;  4M78 A;  2ED0 A;  5CVI A;  3CCL A;  1SHF A;  1G8X A;  2NYS A;  1XQH A;  4DBQ A;  1VQ7 A;  5IAY A;  2FZG B;  1VQ8 A;  2CH4 A;  1AZE A;  1JJ2 S;  2RJE A;  2QEX Q;  2P0K A;  1BI2 A;  2HL3 A;  4CC3 A;  2BIV A;  4MZM A;  2XMF A;  3ZBD A;  6AT1 B;  3CCS T;  1T3L A;  5LJ5 h;  1T3S A;  4IUU A;  1G3T A;  2VV5 A;  2EQJ A;  2K57 A;  2DF6 A;  2XIC A;  3CCE A;  1Y07 A;  3MET A;  4RTX A;  2LCS A;  2RO0 A;  1NBE B;  4GBQ A;  4KGZ B;  4M7D G;  1NJI R;  3MHX A;  4LXC A;  5EG2 A;  1WJQ A;  4DBR A;  1PHT A;  1UJ0 A;  2HZY A;  1K9M C;  2KYM A;  1SKU B;  2E4H A;  2B86 A;  5HK3 A;  2CS7 A;  4ZTJ A;  4C0D B;  4PJO C;  1NEB A;  1PG5 B;  2D0Q B;  3M0U A;  4F7U B;  4LDX A;  4M75 C;  4JS5 A;  4LDW A;  2P4T A;  4J9B A;  3QZ9 B;  4M7D D;  2DL5 A;  4B9X A;  1M1K R;  1H92 A;  2RJF A;  4RCC A;  2KT1 A;  3CPF A;  3QSU A;  5A0G A;  2QQ9 A;  1JJ2 P;  1R0B G;  5GJW B;  4LE9 A;  1RAF B;  3EHR A;  3URG A;  3JCM W;  2JMA A;  3I56 Q;  4QVZ A;  5KE2 A;  2KT8 A;  4M77 B;  2VGM A;  4C0Z A;  1D3B A;  4N0A C;  4D8K A;  1VQL Q;  5GAN d;  2RD1 A;  2E10 A;  4OB1 B;  3F70 A;  2BUD A;  3QPH A;  2P0Q A;  3E9G A;  2RNA A;  4C5G A;  3QZ5 B;  2V26 A;  2RMO A;  2EIF A;  3FIF A;  3AT1 B;  2KEA A;  2ECZ A;  2OI3 A;  1QVG S;  3CBM A;  3CMA T;  5KYY B;  1OEB A;  2B8A A;  1VQP T;  1VQ5 Q;  4XTX A;  1M1G A;  2F5T X;  1QQJ A;  2KY9 A;  2OAW A;  2JM9 A;  3MEW A;  3RR6 A;  4M7D E;  4MDX A;  2HQX A;  2EAY A;  4CRI A;  1JJ2 A;  1ZA2 B;  4O6J A;  3CC4 A;  3V7S A;  4RKU E;  2DTH A;  1W1F A;  3REA B;  4ELZ C;  3CCL Q;  4A4F A;  3OYI A;  1UGP B;  2K5L A;  1WHK A;  5GAO l;  1VQ7 Q;  3OYY A;  1N6A A;  1VQ4 A;  5KYN A;  3ULR B;  1FMW A;  1MMD A;  3CME T;  3MP6 A;  2J6O A;  1PRM C;  2D0N A;  2QQB A;  3QDF A;  4J6W A;  4M7A B;  2XU8 A;  1N9R A;  2HMA A;  1OV3 A;  1U1S A;  1EIF A;  3JSC A;  4FU6 A;  5IHK A;  3EFS A;  1QLY A;  2G3R A;  5GAN 5;  3CCE Q;  3L2V A;  1WXU A;  1JU5 C;  3H8Z A;  4FW2 A;  4L59 A;  1YFN A;  2EYQ A;  3HRS A;  2DL4 A;  1OI1 A;  1E7O A;  4E7S A;  5CKD A;  3VU3 C;  1MMG A;  2C06 A;  2MWO A;  4ESR A;  2KMT A;  3CCR A;  2WSE E;  1NEG A;  2NUZ A;  4J83 A;  4RTV A;  1ABO A;  5FU6 B;  2GTO A;  1KK7 A;  3CCJ Q;  1W6X A;  4M75 B;  1D0X A;  2YWW A;  1K9A A;  4UC4 A;  2CDT A;  2K3X A;  2R58 A;  2LQW A;  3RKW A;  2E12 A;  3X24 B;  4O5V A;  4BI4 A;  4JDS A;  2X4W A;  2DYB A;  5I21 A;  4KH0 B;  2HEQ A;  4EMK A;  1VUB A;  3NTI A;  1X2K A;  3OYB A;  4LDU A;  5GAO m;  1U3O A;  3P8D A;  1QVG A;  2RN8 A;  4OML A;  2DVE A;  1NM7 A;  2EQK A;  3G6E A;  1H3Z A;  2AK5 A;  1GRI A;  1OU9 A;  1ZBJ A;  2K4Y A;  2ZPH B;  3BFM A;  5LJ3 g;  2DLP A;  1LNX A;  2DPP B;  1OYX A;  4DOW A;  1WHJ A;  3ER0 A;  1ZA1 B;  1OX8 A;  3TSW A;  1M90 R;  1PWT A;  2FVU A;  3UPU A;  1MNE A;  1UB4 A;  4JLI A;  3CEY A;  1X6B A;  3JRZ A;  5CK9 A;  2EW3 A;  3CCM A;  2MK5 A;  1OQK A;  1N5Z A;  4IUR A;  1KC8 R;  2DX1 A;  1PD0 A;  3PMI A;  5GAN 8;  5LJ3 e;  1WHL A;  2DER A;  4PJM A;  1LJO A;  2QEX T;  2XI9 A;  5EC7 A;  1VQK A;  3QJY A;  1WHM A;  2P4R A;  1VIE A;  4LUD A;  3CC7 Q;  1PKT A;  3M4G A;  1UGR B;  1KD1 R;  3CD6 A;  2AKL A;  2FRW A;  3CCQ A;  2QTV A;  3NPF A;  3P8B B;  3UT1 A;  5KYU B;  3BDL A;  1TUD A;  2D1X A;  5GAN j;  3PIP A;  1NPR A;  3OYL A;  1U8R A;  2L3P A;  3M9Q A;  3OYD A;  1V76 A;  3CQT A;  1K1Z A;  2P84 A;  2JVV A;  2VGN A;  1TTH B;  3NFC A;  1WDX A;  1M2V B;  2OTL A;  4PNO A;  4HXJ A;  1K76 A;  1LPL A;  1ZUK A;  5KE3 A;  1BYM A;  3MPU B;  4F04 B;  1YCY A;  5FU7 C;  2QQS A;  4XK8 E;  1KJW A;  4M7D A;  3OYJ A;  3S3M A;  4F17 A;  1S72 Q;  1OPK A;  3VRZ A;  3C0C A;  3C95 A;  4N4G A;  2K6D A;  2LQK A;  5DLQ E;  1QVF A;  1YI2 Q;  3MEU A;  3DKM A;  4J6X A;  1M8V A;  4J9E A;  2HKN A;  1CKA A;  3MEA A;  4JS4 A;  3CBO A;  3CBP A;  1TH7 A;  2XHC A;  1H3H A;  1T0J A;  2H8H A;  2NUT B;  2I0N A;  8ATC B;  3L2W A;  3A5Z B;  2DTI A;  3C12 A;  3I56 T;  5KYX A;  4AFQ C;  2E64 A;  2CSQ A;  4JRK A;  3BDU A;  5FRN A;  2A7Y A;  3G6E Q;  2JTF A;  2PZ1 A;  5GAM d;  3PVL A;  3JCM c;  1VQL T;  4FCY A;  1KSW A;  1NE8 A;  1MMA A;  3INZ A;  4N4H A;  1VQO A;  1WQW A;  1G83 A;  3HFN A;  4IUT A;  5GAN 6;  1VOM A;  1NYG A;  5ECA A;  2E3I A;  3H6Z A;  1RAC B;  4HA8 A;  2ESW A;  2DD5 A;  2HDA A;  1VQ5 T;  3OMC A;  2XD0 A;  1G3S A;  1PCX A;  2LX9 A;  1JRI A;  2JM8 A;  4E7I A;  4BB7 A;  3V8L A;  2QA4 A;  3CCM Q;  5CKE A;  4JUV A;  3CCL T;  2PNI A;  2E6Z A;  2PQW A;  4E2F B;  1RUW A;  1VQ7 T;  1RLP C;  2LQN A;  2IVW A;  1D09 B;  2YRD A;  2L0A A;  1P92 A;  1GFC A;  1WYX A;  4C92 C;  4BAC A;  1C0M A;  5KCH A;  5GAN f;  1G5V A;  2ROT A;  3CD6 Q;  4MDW A;  1NPP A;  3JCM g;  3NGP A;  1ARK A;  1IRX A;  2EGE A;  2DJQ A;  1M4Z A;  5LJ5 d;  1VYU A;  5D7U A;  4ORZ A;  1BK2 A;  2O31 A;  1YHQ Q;  2EJG A;  1JB0 E;  2VYT A;  1IXD A;  1E6G A;  1WNL A;  2GFA A;  3ASK A;  4DEX A;  1ZBX A;  2DE0 X;  3RDV A;  4M78 B;  2RK2 A;  2LNV A;  5CQX A;  3CCJ T;  1MMN A;  1QKX A;  2VC8 A;  3JCM e;  1FXX A;  5CR2 A;  4IUV A;  1CSK A;  1NLP C;  2X3W D;  4B9W A;  4XU1 A;  1UTI A;  2ENM A;  3HHT B;  4X1V A;  2DRM A;  2LP5 A;  5GAO r;  2F2X A;  3WVD B;  2RHI A;  1K73 U;  1RI0 A;  1Q7Y R;  1GCQ C;  2RJD A;  2MIO A;  4A53 A;  4HCB A;  2BZ8 A;  3L1A A;  3CPW A;  5CKH A;  1UGQ B;  5J3B A;  5GMK e;  4C0D C;  2YSQ A;  5FRM A;  2DD4 A;  2FZK B;  1BI1 A;  4OMP A;  1LCK A;  2KVQ G;  2DIQ A;  3HFO A;  1BCM A;  4BI3 A;  2EYZ A;  2MYS A;  2DMO A;  1WJR A;  3HPW A;  2M1H A;  1UDL A;  3OW2 S;  2G6F X;  2RQU A;  2YRC A;  3SFM A;  1XJW B;  3RBB B;  4KUL A;  2A08 A;  4WCI A;  3HTR A;  2HKQ B;  3PNW C;  1YJ9 A;  4RTT A;  1GL5 A;  3VRY A;  2AZV A;  1B7T A;  1OZ3 A;  4Z02 A;  1N9S A;  5GAN 4;  3G71 A;  3UWN A;  3FJ5 A;  1SG5 A;  1M1K U;  1VQN A;  1YWO A;  2QG9 B;  4ME7 A;  1K73 C;  5FRO A;  3JCM V;  2CH4 W;  4M77 C;  1ZQ1 A;  5GAO p;  1Q82 U;  4AFU C;  4RTZ A;  2OX7 A;  1HYO A;  2M0Y A;  4C8Q G;  1Q86 R;  3J81 E;  1WPY A;  3L2U A;  2J06 A;  2DJZ A;  2K2V A;  3A8G B;  3CC7 T;  1J3T A;  1QCN A;  2JN0 A;  2BTT A;  2A37 A;  2QTX A;  3N5B B;  4EPC A;  4PKC C;  1AWW A;  1ABQ A;  2DL7 A;  1AOJ A;  1X6G A;  2FPD A;  3RER A;  4JJB A;  1YJW Q;  3CCV A;  3E9F A;  4C8Q D;  3J80 E;  1Y0M A;  1U06 A;  2EYY A;  4IIO A;  4OB3 B;  2KDS A;  3NTH A;  2K7A A;  2YT6 A;  1IO6 A;  2MI6 A;  1Q82 C;  2O4X A;  2RQV A;  1S72 T;  1SSH A;  4M7A C;  2E41 A;  4OMF B;  4KUI A;  2MCN A;  2K79 A;  1YI2 T;  4F14 A;  5A2Q E;  4XU2 A;  2J05 A;  4C5H A;  4PJO G;  4M75 G;  4OB0 B;  4AG2 C;  3HRU A;  1M5Q 1;  4C8Q F;  3OW2 A;  2ZPB B;  2V1R A;  3L42 A;  4HCK A;  4BI8 B;  3QWX X;  5LJ5 j;  1BB9 A;  3G6E T;  5FU6 C;  4C8Q E;  2L3Q A;  3FRN A;  1JXM A;  4HCZ A;  2OTJ A;  4J5Y A;  2F1L A;  1Y71 A;  5FWC A;  4PJO D;  1QMC A;  1VQ9 A;  2L3R A;  2JT4 A;  4M75 D;  2IPO B;  3I5R A;  2VKN A;  4NL2 A;  2DA9 A;  1YCS B;  1ZSG A;  5CKB A;  3SDZ A;  4EMG A;  3MJX A;  3EGU A;  2E3H A;  3OYK A;  3CCM T;  1VQN Q;  4KGX B;  3OBW A;  4OP0 A;  2CZ6 B;  2EFI A;  2HNI A;  4IKF A;  1KIK A;  4EMK B;  1RAG B;  2YLB A;  1VQM A;  2RI5 A;  4FSX A;  4AFZ C;  4AT1 B;  2WSC E;  1YJN A;  3H0H A;  1FX7 A;  2V8I A;  3I35 A;  2PVD B;  2DZ9 A;  8AT1 B;  1N27 A;  4PJO F;  2COZ A;  5DY9 A;  2VB6 A;  3GOX A;  4M7D F;  5GAM f;  1KQS A;  4XTU A;  4QVD A;  3CD6 T;  1WQ7 A;  2FPF A;  3LYI A;  1E6H A;  4PJO E;  4L5G A;  4ANJ A;  4KH1 B;  4AG1 C;  2DET A;  1TWB A;  5KYW A;  5D6Y A;  1K9M R;  2A0F B;  2LCC A;  1M2O A;  2DIG A;  4C5I A;  2GCX A;  2XDP A;  1YHQ T;  3SB2 A;  3M4Y A;  2MF2 A;  1O75 A;  1VQ8 Q;  4RG8 A;  1YBY A;  4ZGJ B;  3EHQ A;  2LJ0 A;  1PM3 A;  4ELY C;  3G4S A;  2BZY A;  1KHI A;  3HL8 A;  1GBR A;  2E1H A;  1KC8 U;  4JZ3 A;  2KBT A;  2CP0 A;  1SF9 A;  4XTY A;  2QQA A;  2X4Y A;  4J7F A;  4OMO A;  5L8R E;  1QWE A;  2A28 A;  1TUG B;  2M51 A;  3EFR A;  2M9U A;  3SWN A;  2RQT A;  1FWZ A;  1X43 A;  4JRP A;  1CKB A;  1TXQ A;  4XTW A;  3RKX A;  3EH1 A;  1Q81 U;  3O5Z A;  1QVG P;  2XDD A;  3PGG A;  3ZFJ A;  2J7I A;  4ZNX A;  2F2W A;  4JJN K;  2CZ1 B;  2DXT A;  3LWI A;  5IHN A;  5LJ3 h;  4K11 A;  3LW5 E;  1WIE A;  2EQI A;  3FDR A;  4C5E A;  3M56 A;  1B3Q A;  4DOV A;  4ZN3 A;  2JTE A;  3CXC S;  1NZ9 A;  5GMK i;  2LRQ A;  4M7D B;  3SD4 A;  2L8D A;  2DFU A;  4TVR A;  4OGE A;  2Y90 A;  3CCS A;  2ZAE A;  1HSQ A;  2GNC A;  2LJ1 A;  2NLU A;  1WA7 A;  1QVF S;  2MOX A;  1ZLM A;  3VS6 A;  1U1T A;  1NG2 A;  3A8O B;  3PT9 A;  2EBP A;  3QYG B;  3KXT A;  2ROL A;  1Q81 C;  5CAI A;  1UHF A;  1R8O B;  1BKB A;  1UGV A;  1AD5 A;  1YJN Q;  3RUX A;  9ATC B;  2YUQ A;  3BW1 A;  5KYX B;  3JCM X;  3M59 A;  2JS0 A;  4XU3 A;  1BIA A;  2W0Z A;  4BDZ A;  2IIM A;  3OS1 A;  4XU0 A;  3OYN A;  4GLM A;  2EGA A;  1X27 A;  2DNU A;  1ZSZ C;  3CC4 Q;  4C8Q A;  1T0H A;  3M0T A;  3H9N A;  3L2Q A;  3VS0 A;  2LDM A;  3S3N A;  2LVM A;  1K8A R;  4JRQ A;  1JBM A;  3JB9 G;  1UHC A;  3HRT A;  1YJW T;  2YDL A;  2XDB A;  3G7Z A;  1VQ4 Q;  4LNP A;  3G4S Q;  1I81 A;  1M8M A;  2X51 A;  4HVU A;  1AHJ B;  2NUP B;  1X75 C;  5J39 A;  3VS5 A;  1NLO C;  1K4U S;  4RG2 A;  3EGX B;  4Z88 A;  1N8R U;  1R77 A;  5IN1 A;  2H3J A;  5C0M A;  1QVF P;  2HD0 A;  2E5K A;  3BY7 A;  5M9O A;  2EJ9 A;  4DEY A;  4EIK A;  1XTD A;  2J6F A;  3JB9 D;  2K3Y A;  3OS0 A;  2X3X D;  1EZZ B;  3NMZ C;  3CMA A;  4HT9 A;  2VXF A;  1VIF A;  1VQP A;  3KUF A;  2DTO A;  3QII A;  2L3S A;  1YIT A;  3LH5 A;  3CCR Q;  1SRL A;  3CXC A;  1B07 A;  1IZ6 A;  2ZCF B;  4M78 C;  4PJO A;  2RQW A;  2SEM A;  5A0D A;  3UA6 A;  2ZPE B;  4KBM B;  3VJP A;  4M75 A;  5GAN g;  4A4E A;  1JQQ A;  4F16 A;  2LCL A;  4ZTF A;  4L6V 5;  1N8R C;  3CME A;  4E7J A;  2LX7 A;  1QW1 A;  2PTK A;  2KRM A;  1TOV A;  3QKJ A;  2DXC A;  3UAT A;  1H8K A;  1BIB A;  3FLG A;  1PRL C;  4E7H A;  2EWN A;  2AZS A;  2QYZ A;  1V1C A;  1VQN T;  2M0O A;  2DRK A;  4KUD K;  2JXB A;  4FYV B;  4HKE A;  2DKG A;  1UFF A;  1Q7Y U;  5GAN e;  4NL3 A;  2V8J A;  4N0A A;  2A3L A;  2EVR A;  3CPW S;  3A1P A;  4IUQ A;  2VWF A;  2COY A;  1AEY A;  3QHS A;  3TSZ A;  3D7S B;  3JCM h;  4BE1 A;  2KRO A;  3OSV A;  4RMO A;  1Z9Q A;  4E6R A;  5HKC A;  1ZSZ B;  1BI0 A;  4C92 G;  3WVE B;  3QG1 A;  1YIJ A;  2OAU A;  1D1A A;  1D0Y A;  2AKK A;  4NOY A;  1X01 A;  5L23 A;  1X69 A;  2D8H A;  3FC3 A;  4ZGE B;  1WXT A;  1VQ8 T;  4FM4 B;  3WXM B;  1AWX A;  2K3B A;  1VQK Q;  3R6O A;  2C0O A;  2JZ2 A;  4JZ4 A;  4BE2 A;  3H41 A;  4J9D A;  5IXB A;  1DJ7 B;  4LDV A;  2BZX A;  5GJV B;  2DIL A;  3CCQ Q;  1WI7 A;  4C92 D;  3MP8 A;  2HAX A;  1VQ6 A;  1Q86 U;  3H0I A;  1IGU A;  3CCE T;  4MMK A;  1QWF A;  2RI2 A;  3GNG A;  4NS5 A;  3C4S A;  2LNH B;  2YUN A;  1GBQ A;  5HCK A;  5IH2 A;  3CPW P;  3J7A F;  2OTL Q;  3U23 A;  1UG1 A;  3CC2 A;  1YIT Q;  3BE3 A;  2RQR A; 
#chains in the Genus database with same CATH homology
 2MI6 A;  2QQB A;  4J6W A;  4M7A B;  2XU8 A;  5CQY A;  1N9R A;  1Q82 C;  2O4X A;  3OYE A;  1U1S A;  1EIF A;  3L2R A;  2ZPG B;  3JSC A;  4FU6 A;  1S72 T;  3EFS A;  1B34 A;  1QP3 A;  4M7A C;  3PIO A;  2G3R A;  2V8K A;  5GAN 5;  2E41 A;  3JB9 J;  4OMF B;  4KUI A;  3E19 A;  5I2S A;  3L2V A;  3H8Z A;  2FHD A;  2RHU A;  1YI2 T;  4L59 A;  3TRE A;  2EYQ A;  3HRS A;  4XU2 A;  4QW2 A;  4C5H A;  5A2Q E;  2RHY A;  4PJO G;  2X35 A;  1YHQ A;  3VV0 A;  1OI1 A;  5CKD A;  4QQD A;  3VU3 C;  2QEX A;  3TCJ A;  4E7L A;  5FLX E;  2C06 A;  4M78 D;  3M58 A;  4M75 G;  4QVC A;  5GMK m;  2MWO A;  4OB0 B;  2O01 E;  4C92 E;  2KMT A;  1B34 B;  3GF5 A;  3QO3 A;  5AYF A;  3CCR A;  3JB9 F;  2WSE E;  3HRU A;  1M5Q 1;  1YJ9 T;  4J83 A;  4C8Q F;  3OW2 A;  2Y4Y A;  4F7U G;  1MHN A;  2ZPB B;  5FU6 B;  5LJ3 f;  2DEQ A;  5CCA A;  2FL7 A;  3L42 A;  3LLR A;  2R57 A;  4M75 B;  3PTA A;  4BI8 B;  2KK4 A;  4XTV A;  5LJ5 j;  2VXE A;  3G6E T;  4X34 A;  5FU6 C;  2KQW A;  3FRN A;  4C8Q E;  3G71 T;  3JCM J;  4HCZ A;  4UC4 A;  1NJI U;  4JRI A;  2OTJ A;  3RMS A;  4J5Y A;  2K3X A;  4ATO A;  3QBY A;  3QJ6 A;  4R55 A;  2R58 A;  3RKW A;  2JNG A;  2E12 A;  3X24 B;  2P0P A;  1YJN T;  1Y71 A;  2CZ0 B;  2CGH A;  4O5V A;  4JDS A;  4BI4 A;  4PJO D;  2X4W A;  2KSS A;  1VQ9 A;  5I21 A;  2DZC A;  2F69 A;  3MEV A;  2L3R A;  3MP1 A;  4KT0 E;  4EMK A;  4M75 D;  1VUB A;  3NTI A;  2ZGW A;  4IUP A;  4NL2 A;  3OYB A;  1QVP A;  4M77 G;  4LDU A;  4M78 F;  1I5L A;  5GAO m;  3HP9 A;  3P8D A;  4X9C A;  5CKB A;  3SDZ A;  1QVG A;  4MML A;  2RI3 A;  4EMG A;  2ZZD A;  3GP8 A;  4D6W A;  3OS2 A;  2DVE A;  4J7I A;  2EQK A;  3OYC A;  3OYK A;  4WF2 A;  3CC4 T;  3G6E A;  3CCM T;  1H3Z A;  4M78 E;  4CI0 C;  3OBW A;  4OP0 A;  2CZ6 B;  2EFI A;  4V2S A;  2K4Y A;  2XK0 A;  3C94 A;  5C6S A;  4E7K A;  3M53 A;  2HNI A;  2ZPI B;  4IKF A;  4EMK B;  2YLB A;  2ZPH B;  3QXE B;  2RB6 A;  3BFM A;  1VQM A;  2RI5 A;  3LWH A;  4FSX A;  5HY6 A;  2WSC E;  2XKO C;  5LJ3 g;  3JB9 H;  1YJN A;  3QDR B;  1FX7 A;  1LNX A;  2HBP A;  2V8I A;  3V7C A;  2LTO A;  2L5Q A;  4A4G A;  4EMK C;  2DPP B;  3CCV T;  2PVD B;  3LGF A;  3V8K A;  2DZ9 A;  1VQ4 T;  2HQE A;  1OYX A;  4DOW A;  4A4K A;  3ER0 A;  3G4S T;  1OZ2 A;  1N27 A;  4PJO F;  3VUZ A;  1NJI C;  5DY9 A;  3OYF A;  4X9D A;  3GOX A;  5GAM f;  1KQS A;  4M7D F;  5GMK h;  3FEO A;  2LC4 A;  3VYG A;  4XTU A;  2FVU A;  4QVD A;  3QYH B;  3I56 A;  3CD6 T;  1W2B S;  1WQ7 A;  1D3B B;  4M77 D;  3OYH A;  3UPU A;  3LYI A;  3ZEH A;  1UB4 A;  4PJO E;  4L5G A;  2MMP A;  1Q7Y C;  3A8M B;  4JLI A;  3UDC A;  3CEY A;  4BE0 A;  3JRZ A;  5CK9 A;  2X4X A;  3CCM A;  4F7U F;  1VQL A;  4GY5 A;  1H64 1;  4R56 A;  5D6Y A;  4PL6 A;  4IUR A;  2XID A;  2LCC A;  4OGC A;  2DIG A;  1O9S A;  3PMI A;  5GAN 8;  2PUK B;  5LJ3 e;  4C5I A;  2RHX A;  3FJP A;  3OB9 A;  3OS5 A;  4F7U E;  2GCX A;  1KQS S;  2XDP A;  1YHQ T;  3EAE A;  3SB2 A;  3M4Y A;  2MF2 A;  1LJO A;  1O75 A;  1Y7X A;  2K5I A;  2XI9 A;  2LT4 A;  2QEX T;  4MZT A;  4RG8 A;  1YBY A;  5CO7 A;  4ZGJ B;  1VQK A;  4M7A G;  3QJY A;  4ELY C;  3G4S A;  1KHI A;  2M16 A;  1VIE A;  3HL8 A;  2E1H A;  3ME9 A;  1X6O A;  3RMQ A;  5GMK j;  1M1K C;  3M4G A;  1UGR B;  4ZN1 A;  3CCR T;  3AHU A;  2Y4X A;  1KQ2 A;  1WGS A;  3CD6 A;  1KC8 U;  3CCQ A;  4ZGD B;  5DLO A;  2JTM A;  3P8B B;  1I8F A;  1W4S A;  3UT1 A;  3X26 B;  4Q5W A;  4XTY A;  3BDL A;  2QQA A;  2X4Y A;  2PVG B;  4J7F A;  3OYG A;  2E65 A;  2EQM A;  2GF7 A;  4BY6 B;  5L8R E;  4M77 F;  1G3Y A;  5GAN j;  3PIP A;  2GQV A;  1NPR A;  5GAM g;  3S3O A;  2OTJ T;  3EFR A;  4YTL A;  3OYL A;  5LJ3 d;  1YJW A;  1U8R A;  4BUG A;  3M9Q A;  4BY6 C;  3OYD A;  3QUI A;  2E70 A;  2M9U A;  4M77 E;  3SWN A;  3DB3 A;  1BI3 A;  4C92 F;  1FWZ A;  2JVV A;  3JB9 I;  1IRE B;  2IG0 A;  2VGN A;  3NFC A;  1VQ9 T;  2OTL A;  4PNO A;  2DXU A;  4JRP A;  4M7A D;  1UGS B;  5FU7 B;  4XTW A;  2O4X B;  3M54 A;  3RKX A;  3CCU T;  5KE3 A;  1Q81 U;  2EQU A;  2XDD A;  3PGG A;  3ZFJ A;  1BYM A;  1G3W A;  3A8H B;  1HXD A;  1Q86 C;  1YCY A;  5FU7 C;  2QQS A;  4XK8 E;  4XAX B;  4M7D A;  4JJN K;  2CZ1 B;  2DXT A;  3V8J A;  3RES A;  3OMG A;  3FB9 A;  3OYJ A;  3S3M A;  2E5Q A;  3LWI A;  3SWN B;  2E6N A;  4Y91 A;  3I55 T;  2CZ7 B;  2YRV A;  5LJ3 h;  3LW5 E;  2LT1 A;  3X20 B;  3M57 A;  3C95 A;  1ZHI A;  3FDR A;  4N4G A;  4C5E A;  5GAM e;  3SWN C;  1XNI A;  2LQK A;  5DLQ E;  2GFU A;  1QVF A;  4RCB A;  2QXF A;  3MEU A;  3M56 A;  3DKM A;  1VQM T;  1M1F A;  4J6X A;  1M8V A;  4DOV A;  4ZN3 A;  3OYA A;  3CXC S;  1NZ9 A;  5GMK i;  3M5A A;  3MEA A;  5CKF A;  2LRQ A;  4JS4 A;  3CBO A;  4M7D B;  3SD4 A;  4QQG A;  1PSF A;  2L8D A;  2RA2 A;  3L2Z A;  2AHJ B;  3CBP A;  1TH7 A;  2XHC A;  4TVR A;  4OGE A;  4C0F A;  5GAN 3;  3CCU A;  4J6Y A;  1GXI E;  2F5K A;  4M7D C;  2Y90 A;  4LD9 K;  3CCS A;  3CCJ A;  3GIB A;  2NLU A;  4II1 A;  3A5Z B;  2DTI A;  3C12 A;  3L2W A;  3I56 T;  4M7A F;  2E64 A;  1QVF S;  3S6W A;  4JRK A;  3BDU A;  4BDY A;  1WJS A;  5FRN A;  2A7Y A;  2QDY B;  1U1T A;  2JTF A;  3I55 A;  2JOY A;  3A8O B;  3PT9 A;  4GLK A;  5LJ5 g;  2XG8 D;  3QYG B;  5GAM d;  3KXT A;  4M7A E;  3JCM c;  1VQL T;  3RIR A;  4C0G A;  1NE8 A;  4FT4 A;  1W2B A;  5CAI A;  3LGL A;  1Q81 C;  2MWP A;  3INZ A;  1R8O B;  1BKB A;  4N4H A;  1VQO A;  1WQW A;  2D6F A;  3E1S A;  3RUX A;  3DB4 A;  3TEE A;  1XOV A;  3HFN A;  4IUT A;  5GAN 6;  2CKK A;  2EKO A;  2YLC A;  3BW1 A;  3H6Z A;  3JCM f;  2QQR A;  3M59 A;  3JCM X;  4HA8 A;  4LDY A;  4JLG A;  4XU3 A;  2DD5 A;  1BIA A;  1VQ5 T;  2PVO B;  3OMC A;  3TU4 K;  1VQK T;  2XD0 A;  4C92 A;  1G3S A;  2WSF E;  2X4J A;  3JCM P;  1PSE A;  4BDZ A;  2LX9 A;  2YHT A;  1JRI A;  4E7I A;  3Q1J A;  4BB7 A;  4XU0 A;  5GAM h;  5KH6 A;  2RH2 A;  1Y96 A;  3V8L A;  3OS1 A;  3OYN A;  3CCQ T;  4OB2 B;  4XTZ A;  4M75 F;  3OQ5 A;  2QA4 A;  1SSF A;  5A0L A;  3VKI A;  4C8Q A;  5CKE A;  4JUV A;  3CCL T;  5LJ5 e;  2E6Z A;  3L2Q A;  3MO8 A;  2LDM A;  2LQ8 A;  2PQW A;  3O8V A;  3S3N A;  2LVM A;  2RM4 A;  1VQ7 T;  4JRQ A;  1JBM A;  4M75 E;  2IVW A;  4C92 B;  3JB9 G;  5D6W A;  3M55 A;  3HRT A;  3X28 B;  4E47 A;  1YJW T;  2XDB A;  1P92 A;  3LH0 A;  1M90 U;  4C92 C;  2EJF A;  5HK0 A;  4BAC A;  1UEB A;  5IT9 E;  3G7Z A;  1Y96 B;  5KCH A;  3GPL A;  4J8O A;  2OTL T;  1I81 A;  3JAM E;  1VQ5 A;  1AHJ B;  2BKD N;  1M9S A;  5LL6 S;  1YIT T;  4C8Q B;  4BD3 A;  3JCM b;  4DQ2 A;  1X75 C;  2D9T A;  5D6X A;  3X25 B;  5J39 A;  5GAN f;  1G5V A;  2ZPF B;  3OYM A;  4MDW A;  3GNF B;  4RG2 A;  1NPP A;  1KQ1 A;  1V29 B;  4C8Q C;  3OBY A;  5GAM j;  1N8R U;  1K8A U;  5IN1 A;  1K9M U;  3JCM g;  2H3J A;  5I2M A;  5C0M A;  3PMT A;  4HCC A;  2HD0 A;  1M4Z A;  5LJ5 d;  3NTK A;  4M78 A;  3BY7 A;  5CVI A;  5M9O A;  3VUB A;  4PLL A;  3CCL A;  2EJ9 A;  5KCO A;  4DA4 A;  1XTD A;  1XQH A;  3JB9 D;  3T9N A;  1VQ7 A;  2K3Y A;  5IAY A;  3OS0 A;  1VQ8 A;  3CMA A;  2MAM A;  2EJG A;  2KAF A;  1JJ2 S;  1JB0 E;  2RJE A;  2VXF A;  4HT9 A;  1VIF A;  2P0K A;  1VQP A;  2VYT A;  2L89 A;  1KD1 U;  3KUF A;  1WNL A;  1BI2 A;  2DTO A;  3CC7 A;  2GFA A;  3ASK A;  4A4H A;  5GAO q;  1ZBX A;  3QII A;  2BIV A;  3LX7 A;  4MZM A;  1YIT A;  4M78 B;  2RK2 A;  5LJ5 f;  2LNV A;  3ZBD A;  3KBG A;  5CQX A;  3CCS T;  1I4K 1;  3CCJ T;  3CXC A;  5LJ5 h;  4IUU A;  2VC8 A;  1IZ6 A;  1G3T A;  2VV5 A;  2ZCF B;  4M78 C;  4PJO A;  2EQJ A;  3JCM e;  2K57 A;  1M90 C;  5A0D A;  1FXX A;  2XIC A;  5CR2 A;  4IUV A;  3CCE A;  2ZPE B;  1Y07 A;  3MET A;  3RKY A;  1RL2 A;  2I2L A;  4KBM B;  2DO3 A;  2RO0 A;  4P5N A;  4M75 A;  2PUO B;  3VJP A;  2DXB A;  5GAN g;  4M7D G;  4B9W A;  4XU1 A;  3MHX A;  4A4E A;  3HHT B;  1WJQ A;  5EG2 A;  5DM7 R;  1VQO T;  4F7U A;  4OVA A;  5GAO r;  4FL6 A;  1K8A C;  2LCL A;  4ZTF A;  4L6V 5;  1N8R C;  3WVD B;  1K9M C;  3CME A;  4E7J A;  1KC8 C;  2RHI A;  5HK3 A;  4PJO B;  2CS7 A;  2QI2 A;  1K73 U;  1RI0 A;  1QW1 A;  3GLX A;  2RJD A;  2VUB A;  4ZTJ A;  4C0D B;  4A53 A;  4HCB A;  3L1A A;  4MZP A;  3QKJ A;  1KG1 A;  1LOJ A;  3CPW A;  4PJO C;  2DXC A;  5CKH A;  1UGQ B;  5J3B A;  1BIB A;  5GMK e;  2D0Q B;  3FLG A;  4C0D C;  4E7H A;  3MCA B;  3JCM d;  2EWN A;  1S72 A;  5FRM A;  4VUB A;  2DD4 A;  1BI1 A;  1VQN T;  4F7U B;  2M0O A;  4M75 C;  4A54 A;  1YIJ T;  1QP2 A;  4LDX A;  4KUD K;  2QA4 T;  2KVQ G;  4JS5 A;  2DIQ A;  2P4T A;  4LDW A;  4Y28 E;  3HFO A;  4BI3 A;  3VYH B;  4HKE A;  1YI2 A;  1KD1 C;  5LJ3 j;  3QZ9 B;  2DKG A;  1WJR A;  1Q7Y U;  3HPW A;  5GAN e;  4NL3 A;  4M7D D;  2V8J A;  4N0A A;  2M1H A;  4B9X A;  3OW2 S;  2A3L A;  4FT2 A;  3OSS C;  4M77 A;  3CPW S;  2RJF A;  3SFM A;  4IUQ A;  4RCC A;  4KUL A;  3QHS A;  3CPF A;  3HKS A;  5A0G A;  3DLL A;  3QSU A;  2QQ9 A;  2WAC A;  5CIU A;  3PNW C;  1YJ9 A;  2JUF A;  3A8L B;  3JCM h;  2R5M A;  4BE1 A;  4QQ6 A;  3URG A;  3JCM W;  1OZ3 A;  3OSV A;  3OA6 A;  1MGQ A;  4Z02 A;  4RMO A;  4QVZ A;  1N9S A;  5GAN 4;  5HKC A;  5KE2 A;  3G71 A;  3UWN A;  1BI0 A;  4C92 G;  3WVE B;  1M1K U;  5GMK l;  2CYZ B;  3QG1 A;  2VGM A;  4M77 B;  4C0Z A;  1D3B A;  1VQ6 T;  1VQN A;  1YIJ A;  2OAU A;  4ME7 A;  4N0A C;  1K73 C;  5J26 A;  2FB7 A;  3OY9 A;  5FRO A;  3JCM V;  5GAN d;  2RD1 A;  2E10 A;  4OB1 B;  3F70 A;  4M77 C;  2BUD A;  1ZQ1 A;  3QPH A;  2P0Q A;  4NOY A;  3E9G A;  5GAO p;  4C5G A;  1Q82 U;  4HT8 A;  1X01 A;  3QZ5 B;  3FC3 A;  2EIF A;  3FIF A;  4ZGE B;  1HK9 A;  4C8Q G;  1QVG S;  1KHC A;  3J81 E;  1VQ8 T;  4XQ3 A;  4FM4 B;  3CBM A;  3CMA T;  3WXM B;  1WPY A;  3L2U A;  2DJZ A;  2K2V A;  2RJC A;  4LD6 A;  2B8A A;  1VQP T;  3A8G B;  3CC2 T;  3CC7 T;  4XTX A;  1M1G A;  2F5T X;  3R6O A;  2JZ2 A;  2KY9 A;  5GAN 7;  4PLI A;  4BE2 A;  3MEW A;  3P8H A;  2RK1 A;  4MDX A;  5GAO n;  4EMH A;  4M7D E;  2HQX A;  1DJ7 B;  2EAY A;  4LDV A;  4CRI A;  1JJ2 A;  3DLM A;  2FYK A;  2JN0 A;  4O6J A;  3CC4 A;  4N4I A;  2RHZ A;  2QTX A;  4FIB A;  4RKU E;  2DTH A;  3N5B B;  3V7S A;  3JCM Q;  4EPC A;  4PKC C;  4C92 D;  5GAN h;  3MP8 A;  2HAX A;  1VQ6 A;  1Q86 U;  4ELZ C;  3CCE T;  2K5F A;  4A4F A;  3OYI A;  2DK3 A;  4MMK A;  4M7A A;  2PU9 B;  1UGP B;  3RER A;  2R5A A;  2K5L A;  3PFS A;  5GAO l;  2RI2 A;  3GNG A;  1N6A A;  3OYY A;  4NS5 A;  3C4S A;  3V7R A;  3CCV A;  5GAN 2;  3E9F A;  1VQ4 A;  4C8Q D;  2DAQ A;  4M78 G;  3J80 E;  3CME T;  4EDU A;  3J7A F;  4OB3 B;  2KDS A;  3CC2 A;  3MP6 A;  3HSB A;  3NTH A;  4OF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...