1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
3A8MB 4OB1B 3LW5E 2DPPB 2DD4A 2WSEE 3HHTB 1V29B 3X28B 2PU9B 2ZPBB 1PSEA 2CZ7B 2O01E 2WSFE 3X24B 1DJ7B 1UGSB 4Y28E 1QP3A 4ZGJB 3X20B 2CZ6B 3QZ9B 2PUKB 2ZPEB 3X25B 2AHJB 4OB3B 4ZGEB 4OB0B 1PSFA 4FM4B 4L6V5 3A8LB 2DXCA 1UGQB 4RKUE 2ZPIB 2CYZB 2ZCFB 2ZZDA 2QDYB 1JB0E 2DD5A 2CZ1B 1QP2A 4KT0E 3A8HB 1UGPB 5L8RE 2PUOB 4XK8E 2D0QB 3A8OB 3X26B 2ZPFB 2CZ0B 2PVOB 3QXEB 3VYHB 2DXBA 2ZPHB 3A8GB 3QZ5B 3VYGA 2WSCE 1GXIE 4OB2B 3WVEB 4ZGDB 3QYGB 1IREB 2PVGB 1AHJB 3QYHB 3WVDB 2ZPGB 1UGRB 2PVDB
chains in the Genus database with same CATH superfamily
2B8AA 3S6WA 4C8QF 3GBQA 1Q86U 2KK4A 4M75F 1OQKA 3GIBA 5D6XA 2XD0A 3M4YA 3FDRA 2X4JA 5D6WA 5AT1B 1YCSB 4RTZA 1OZ3A 3V7CA 2R5MA 1NPPA 3T9NA 2CZ7B 2MYSA 3DB4A 2QA4A 4M7AA 4JLGA 1M2OA 5GAOl 2OX7A 1K0SA 2QI2A 1Y7XA 3DLMA 4BE1A 1D0YA 2YWWA 3CCMQ 4OVAA 4ELZC 1RAIB 4XU1A 4ZGJB 2QASA 3M59A 4EMKA 2KXDA 2OAUA 3ZBDA 5IN1A 3PVLA 2DXUA 1YITA 2RPNA 2EYZA 1VQKQ 1T0HA 4M4ZA 4PNOA 5LJ3h 1PHTA 2XHCA 1ZA2B 5IAYA 4C0DC 2K3XA 4J9FA 1W6XA 3M0RA 4C8QC 2FHDA 2DE0X 2HMAA 2KY9A 3EHQA 3CBMA 1ZUUA 4GBQA 4BUGA 1PM3A 4C92B 2YT6A 1ZQ1A 2E6NA 3I56Q 2GFAA 4F14A 4X34A 4C0DB 4E47A 2ZGWA 2DTHA 3ER0A 1IGQA 3JCMh 5CQXA 4HT8A 1K73C 1VQ5A 4IURA 2ZPFB 4M75B 1H641 2PVOB 1I4K1 3CCUQ 1VQOT 2A36A 1QLYA 2E5QA 2EKOA 2GNCA 2W0ZA 3L1AA 3OW2S 2NLUA 4XTYA 5GAMh 3CC7Q 3QYGB 3RERA 4LUEA 2LVMA 3M0PA 2QK0A 2ZPGB 4A4GA 3J7AF 4C0FA 1KC8R 4KULA 4NL2A 3G4ST 1RL2A 1X6OA 4M7DA 1GFCA 3JCMV 3WXMB 1D3BA 3OSSC 2DYIA 4FSXA 1YCYA 2DBKA 1QVFP 2KBTA 4PJOG 4A4EA 2CUBA 2FRYA 5LJ3e 1U5SA 2OTLQ 1M90U 2R5AA 2WSFE 1VUBA 1B34B 4A4FA 1M2VA 2ESWA 2HQEA 4JLIA 2CT4A 1OULA 2KT8A 3H0FA 3I5SA 1VQOA 3CCQA 2CP3A 3X20B 1A0NB 1YJWT 3VS0A 2LQNA 2ROLA 3JCMg 2O88A 1CSKA 8ATCB 4ZGEB 4QT7A 1KK7A 4LE9A 3UF4A 3CCEQ 1B07A 5CKHA 2YUPA 1N27A 3G4SA 3VUZA 2VGMA 4Z8AA 1IHWA 2DX1A 2ZCFB 2E41A 4O5VA 2L5QA 4A53A 5GJWB 2HBWA 3EFOB 2EVRA 1UHCA 1PKSA 5EC7A 3P8HA 1AZGB 2LRQA 3URGA 1KJWA 1TOVA 1UHFA 2HDAA 5FU6C 2RQTA 1Q82R 3KXTA 4OF1A 2MF2A 1W70A 2FG0A 1ZX6A 3FIFA 3NFCA 4FIBA 3CCVQ 4FYXB 4HA8A 3BW1A 3JCMJ 3GF5A 4QQGA 3A8GB 3CC4A 1YJWA 2EQJA 1JJ2A 5GAOn 4JS4A 3SWNA 2RJEA 3GOXA 1ZBJA 2FEIA 4OMLA 2DJZA 3BDLA 5LJ5j 2BZYA 3EGXB 3L2QA 1PNJA 4N4HA 3JCMb 3PIOA 4OB1B 5FLXE 4E7IA 3SDZA 4O6JA 3JCMd 4IUTA 5A2QE 2X4XA 1AEYA 3LLRA 5L23A 4MMLA 5DY9A 2LNVA 1W2BP 2D0NA 4C8QG 1V76A 5GAMd 5IHKA 2QDLA 2E12A 1TUDA 2JN0A 3CD6T 1YI2T 4MZTA 4DBQA 1D0XA 3CEYA 2LQWA 1TWBA 2H3JA 2RHXA 2JTFA 3FRNA 2CZ6B 4Z89A 2ATCB 2KROA 2DETA 3JSCA 2NUTA 2LCSA 1VQ7T 2PZ1A 1TUGB 2IVWA 4AFUC 2HSEB 4DEXA 4FM4B 2JMCA 2L0AA 1VQ6T 2E6ZA 3KUFA 5KYXB 4F7UF 4N4IA 2AIRB 1ACMB 2CDTA 1E6GA 1GCQA 1IXDA 1BK2A 1MMAA 3MKDA 3CCST 1Y0MA 4JJNK 1SPKA 1QVGP 4L5GA 2RQWA 5HK0A 4B9XA 5GANh 2NWMA 1I8FA 4J6XA 4IIMA 3QBYA 1NZ9A 2EBPA 3OB9A 2X9HA 3CMAQ 2RHIA 4LD6A 2QG9B 1VYTA 1MHNA 1SF9A 1K9MC 1BI3A 5CQYA 3FEOA 4EMGA 1QCFA 2QEXA 2F69A 4FW2A 3FC3A 2B86A 2LZ6B 2DL7A 2DL3A 2EYXA 1M1FA 1BI0A 3CPWP 1KQSS 4HXJA 5HY6A 2BTTA 2QQSA 4AFSC 3CXCP 1VQLT 1RAHB 1S72Q 1VQPT 4IIOA 1NJIC 1VQ6A 2DD4A 1FWZA 3OW2A 1WHJA 3RKXA 3OYGA 3CCRT 1V29B 1M1KU 1PRLC 2QTXA 5IXFA 4M78D 3CCSA 5GMKh 2J7IA 2M9UA 4HCKA 2I2LA 4MDXA 2RI3A 4ZTFA 1N6AA 3VS3A 2GGRA 4DOWA 4R56A 1G3SA 2C06A 4PJOE 5CCAA 2L8DA 3OYHA 4M77A 1X6GA 4PJMA 2LX7A 1Y96B 4C5EA 1OX8A 1VIEA 2V1RA 1VQMA 2LQKA 2HD0A 2KGTA 2K4YA 4OGCA 1U8RA 3REBB 1PD0A 1VIFA 1VQ8T 2RF0A 4R55A 1PG5B 1PSFA 1N8RC 2LJ3A 1WHLA 2F2VA 3BY7A 4AFZC 1Y71A 1U1SA 1NM7A 4RTYA 1VQPA 2MI6A 1N9SA 2E3IA 3OYMA 4Q5WA 2DEQA 2M16A 3CCRA 1WXUA 1YFNA 1MV3A 1VQNT 2F5TX 2CP5A 4M7AB 2RHUA 2LC4A 2RHYA 5GAN8 3R6NA 4M7DF 1UECA 4XTVA 5GMKe 2CH4W 1YIJQ 3GNGA 1Q95G 2HBPA 4EMKB 2CSQA 5CAIA 2R58A 3M5AA 4OB2B 2LT1A 4ZGDB 5A0LA 3P8DA 1HSQA 4Z88A 4OP0A 4CC4B 2HKQB 5GANd 3BFMA 5I11A 5LJ5f 3RMQA 1NEGA 2GTJA 5CKFA 4KBMB 2KDSA 3Q1JA 1RUWA 3QHSA 1K4US 1Q7YC 4HT9A 4BY6B 4M78F 4M75D 2LTOA 1D09B 2XDPA 2X3WD 1Q81R 3A98A 1YHQT 4KUIA 3UPUA 4J7FA 2FRWA 1LCKA 1ZLMA 3I35A 4C8QE 3CMET 4DOVA 4AT1B 4M75E 3HL8A 2C0IA 2EYYA 4HVVA 5IT9E 5CK9A 4PJJA 5LJ3j 5GAOr 3OMCA 2VWFA 1U3OA 1YBYA 3NPFA 3G6ET 3RNJA 4M7DB 1BI2A 1BB9A 4C0ZA 5I22A 1ZSZA 2CYZB 5EG2A 2CP6A 2DAQA 2HL3A 5DM7R 1G83A 3META 3MP6A 4PJLA 2DD5A 2JVVA 4OGEA 2CZ1B 2DM1A 3A8HB 1NEBA 1OOTA 4E7LA 3VJPA 2PNIA 5J39A 2K5IA 1G5VA 4M78C 1M2VB 1OU9A 4F7UG 1QWFA 3CCMA 3C12A 4XU0A 2O9VA 2LCLA 4AFQC 1YHQA 2LQ8A 1M3CA 3C4SA 1YN8A 2DXTA 2FZKB 3VYGA 3FJ5A 2HQHA 3CMEA 1AWXA 4TVRA 2BKDN 5CKDA 4E7JA 1IREB 2D9TA 3V8LA 1M1GA 1SEMA 3HRTA 4QVZA 1VQKA 4ESRA 3LWHA 2RK1A 4Z02A 2DBMA 1JO8A 2F2XA 3M58A 3G6EA 3C94A 3HHTB 2P0PA 5KYUA 1K8AR 4E2FB 1YJ9Q 2J6OA 1JRIA 4BI4A 3JB9H 3VKIA 3CC2T 4LNPA 3EG1A 1KQSA 4F04B 3CCJQ 3PIPA 4E7ZA 3LX7A 1AVZC 1K1ZA 3MO8A 2KYBA 4C92F 1D0ZA 1QVFS 3UA6A 2P0QA 2CGHA 2RI5A 2EIFA 2CP0A 3I55Q 2M1HA 3E9FA 2XKOC 3CCUA 2RJDA 1NYGA 1I81A 2YRCA 2SEMA 3EFSA 2GQIA 1HXDA 5HK3A 2QQAA 5CIUA 3ASKA 3QIIA 4RTWA 1RADB 5KYYA 1D1BA 5FU7B 2O31A 4NL3A 1MGQA 5DLQE 3CC7A 3SWNB 1VQ5T 1E7OA 3EAEA 1OZ2A 2MIOA 5C0MA 1WQWA 3H8ZA 3SEMA 4XTXA 5KH6A 1H92A 1XOVA 4L59A 5CVIA 4B9WA 4ZN1A 3CC2A 1NLPC 2DL8A 2Y90A 2OTLA 4N0AC 4C92C 3RR6A 3TQ7P 1VQ4T 3CBOA 2KQWA 1EZZB 3MEVA 5GAOm 1M3BA 1UUEA 4M75C 3GNFB 2RI2A 1BBZA 2COYA 4DEYA 4WTOB 2FVUA 4GY5A 4BACA 4IKFA 3CCLQ 2DRMA 5GAN4 2NUTB 2RD1A 4JJDA 3QYHB 2KRMA 1KD1R 1I07A 2PVDB 3O5ZA 4RCCA 1X27A 3MJXA 2F5KA 2MWOA 2VASA 2DTIA 2WSEE 3HFNA 3CCQT 5D6YA 4KRTA 3OS0A 1GFDA 5A0DA 4HVUA 1R0CB 1T3LA 1TSFA 2QYZA 2LT4A 4RTUA 2PTKA 2ABLA 3X24B 1H3HA 5GAOp 2OTJT 2FPFA 3VS5A 1B3QA 1UTIA 1K9MU 2DIGA 4JRKA 1VQ4A 1GBQA 1UB4A 2BIVA 2X4WA 3OBWA 1NLOC 3I9QA 2WACA 3JCMW 1R0BG 1IZ6A 3PMTA 4CC3A 1JJ2P 5KCOA 4J9GA 1FMVA 2PUKB 2ZAEA 1LJOA 2ZPEB 4M78G 2QA4Q 3OY9A 2RA2A 4XU2A 3JCMQ 2YUQA 2P0KA 1ZHIA 1M1KR 5CR2A 4ELYC 2EYQA 1JU5C 3DKMA 4KGZB 2EKHA 1NJIU 5LJ3f 2ZPIB 1WJQA 3UA7A 2ZZDA 1GL5A 3CC4T 2XU8A 3JCMe 2VC8A 3TVTA 2VKNA 1YITQ 5L8RE 2K2MA 1RLQC 2CP2A 1IO6A 2OTJA 3VRZA 4M77B 2AKKA 4PJOA 3OBYA 5GAMe 1AOJA 1JEGA 3V8JA 4PKCC 1X01A 5GAN2 3EG9A 1MMNA 3PT9A 4F7UE 4EIKA 3QDFA 2V8KA 3WVDB 4EDUA 2G3RA 2HKNA 2KXCA 3S3OA 1WJSA 1WZOA 1N8RU 5LL6S 1MMGA 4CC2A 4JDSA 2RQRA 4XTUA 1WYXA 2J06A 2COWA 5GMKj 2GQVA 1WHMA 2VV5A 4M7AD 2HCKA 3M0UA 3H9NA 1YP5A 2DZCA 2HL5C 3CMAA 3M0QA 1X2KA 3PFSA 4J9IA 2MMPA 1R77A 4D8KA 1WQ7A 3F70A 1YWOA 4ORZA 1T0JA 2YRDA 4C92G 1PC0A 5KYNA 3QG1A 2P4TA 3OYFA 1OPKA 3HP9A 3D7SB 2H3EB 1B7TA 5I21A 3OYLA 2EQKA 2RN8A 3A8LB 4M75G 3OW2P 3EH1A 2FZGB 1LPLA 5J3BA 2K2VA 1TH7A 2QEXT 1YJNT 2IG0A 1JB0E 1K73R 4XU3A 3H41A 1WDXA 4GLKA 4PFPA 4A4KA 1BKBA 3MEWA 1M3AA 1JXMA 4RG2A 1I5OB 2E64A 1O75A 1TS9A 1J3TA 3CQTA 4KH0B 1Q7YU 2D0QB 4C0GA 3OA6A 2V8JA 4FYYB 3E9GA 2XK0A 4RTXA 2E1HA 2MK5A 4LUDA 3G4SQ 2XDBA 4BE0A 1OEBA 1MNDA 1TXQA 4EMHA 5GAN5 2A08A 2EJGA 3NTKA 2KRNA 2YLBA 5FW9A 2Z0WA 1JQQA 4JJCA 4E7KA 4X9DA 4BI8B 4C8QA 3EGDA 1KFZA 1PD1A 2CT3A 4JRIA 2G6FX 2FPDA 2EJ9A 1E6HA 4M7DD 2EGAA 1BCMA 2YDLA 3LGLA 3QPHA 4X9CA 1LVKA 1RACB 1VA7A 1VQMT 4BI3A 2DVJA 1YJNA 5A0GA 1S1NA 4NS5A 3NTIA 4M7DE 1X43A 4X1VA 1CKAA 4LDWA 1G8XA 4AG1C 4N4GA 4M7AF 2EYWA 1PCXA 3A5ZB 1WXTA 4A4HA 1KC8U 1YIJA 2K7AA 2HSPA 3NTHA 3BE3A 2JMAA 3P8BB 3OS2A 1UJYA 4KH1B 1SRMA 5KYWA 5D7UA 3SFMA 3ZL7C 4ZNXA 1ZSGA 1G3YA 2JTMA 2J05A 2DA9A 1NBEB 5KYUB 4M78E 5GANe 2AT1B 3M56A 1Q86R 1SHGA 2CSIA 3OYYA 3ZFJA 2KI7A 1WHGA 2DFUA 2FL7A 2GTOA 1RAAB 3G71T 5KE2A 2NYSA 3N5BB 2R57A 2KT1A 2DJQA 1RABB 2RO0A 4M7AC 2VVKA 2NUPA 3OQ5A 1Z9QA 2ED1A 2QQBA 4JS5A 2D8JA 1KQ2A 2K5LA 4XQ3A 2WSCE 1IHVA 5KYYB 1TU0B 1M30A 1WGSA 3KFVA 2PQWA 3OYNA 5GMKm 4J7IA 2JNGA 2RH2A 4EMKC 2C0TA 3DB3A 2I0NA 3CD6Q 5I2MA 2CREA 1YI2Q 3RKYA 4JRQA 2CKKA 2A37A 4PL6A 1QKXA 3QUIA 2ZPBB 3HRSA 1AWOA 3RBBB 2QQ9A 2JT4A 1PSEA 1VQ7Q 1KSWA 4Y91A 2E5KA 1WIEA 2K79A 2EFIA 2F2WA 4K11A 4BD3A 1FXXA 3G71A 4JZ4A 1VQ6Q 1WA7A 4IUPA 2E70A 4BY6C 1PKTA 3JCMX 2XDDA 3EG3A 1ABOA 3OYEA 4C92D 1QQJA 3MPUB 4RTTA 3CCSQ 2XICA 5ECAA 2YXYA 4C5GA 1WFWA 1RAEB 5LJ5g 1RLPC 2VUBA 4MZMA 4OB0B 4XTWA 1M8VA 4PK4A 3SD4A 3CCMT 4QW2A 4RKUE 4C92E 2V26A 4JUVA 2YLCA 2JM9A 1KQSP 3G7ZA 4KGVB 4M7DC 4J83A 2OI3A 1MMDA 3RMSA 1WHHA 1UGPB 3MP1A 1K9MR 1SKUB 5J26A 1SSHA 2COZA 2QXFA 3HPWA 1VQKT 1KG1A 2XI9A 2J6FA 5FWBA 1MUZA 1GCPA 3VRYA 1VQ9Q 1VQLQ 3RDVA 1VQPQ 3I55A 3OYKA 2FZCB 1KD1C 3MP8A 1D3BB 3DLLA 2Y4YA 1M90R 1WI7A 3I56T 4E7SA 1UG1A 1NJIR 2E65A 4FU6A 2RQUA 4RTVA 1FMKA 4PJNA 1IB8A 2A28A 2D6FA 3RESA 3M0SA 2D8HA 3A8MB 2LJ1A 3IQLA 1KHIA 3NGPA 3PMIA 2DLPA 3CCUT 1YNZA 7AT1B 1AZEA 2JS0A 3QJYA 4RCBA 5LJ5d 2KVQG 1KC8C 1O9SA 3EGUA 1HJDA 3ZEHA 1VOMA 2C0OA 3CC7T 5GAMj 1QVPA 3J81E 1W1FA 2EJFA 1VQ8Q 2OAWA 4QVCA 5GJVB 4CI0C 3UWNA 1C1AA 2O4XA 4VUBA 4RG8A 4M77D 3OYCA 5CKBA 4PJOB 5GAN3 1N8RR 1QMCA 3I56A 1SRLA 3EG9B 1RI0A 2LNHB 1N5ZA 2MOXA 3X25B 2OTLT 1VQNQ 2KAFA 4ZN3A 1SHFA 4M7AG 3EH2A 4F7UA 2X51A 2GFUA 5FU7C 1JBMA 2A7YA 2DXCA 2LCCA 3SWNC 3SB2A 2DVEA 1K0XA 1LOJA 2RNAA 3REAB 4BB7A 1QWEA 4HCCA 2KYMA 3L2VA 4KT0E 4QQDA 4LD9K 1WHKA 4DQ2A 3LH0A 2V8IA 1AWJA 2L2PA 3VS7A 3OYJA 2RB6A 4LDVA 3VS6A 3CCET 2X4YA 2CZ0B 3JV3A 4BDZA 1MV0B 2DRKA 2L3PA 1OV3A 2DXBA 2ZPHB 3RUXA 3VS1A 4KUDK 2HEQA 3PGGA 1X2QA 2W10A 4IUUA 3G1JA 1Q82C 1GBRA 2RHZA 5IH2A 1WPYA 5C6SA 3OYIA 1BYMA 4J9DA 2XG8D 2MCNA 4E7HA 3MCAB 3OSVA 4FYVB 5GAN7 2ROTA 1EIFA 4RMOA 1IGUA 2DPPB 3QO3A 2DL5A 1YHQQ 2ECZA 3CCVT 4XAXB 1Q7YR 5KE3A 2FB7A 2LMJA 2PU9B 2DYBA 3EFRA 3CMEQ 1AD5A 2EAYA 2QAZA 3UT1A 2KEAA 1XQHA 5IXBA 4CC7A 1GCQC 5HCKA 1G3WA 2EQUA 8AT1B 1QCOA 1I0CA 3CCEA 3G6EQ 2DIQA 4M7DG 4BE2A 1TTHB 4IUVA 3H0IA 2VGNA 3MEUA 4M77F 2H8HA 4JRPA 4JJBA 1NPRA 1T3SA 4C8QB 3EGDB 1TG0A 2KE9A 3AT1B 1XNIA 2RM4A 2DILA 1UGQB 5I2SA 1W2BS 4QQ6A 1I5LA 3QJ6A 3VU3C 1PRMC 2DF6A 2KNBB 3I5RA 2DZ9A 3M4GA 4JPBW 3CCVA 1R8OB 1VYUA 1Q81U 5IHIA 2JXBA 3V8KA 2KSSA 1U1TA 2XMFA 2MAMA 1RAFB 4QKUA 4LXCA 2E4HA 1M27C 2GBQA 5DLOA 4C5IA 3JB9J 2A0FB 2JJ9A 1ZBXA 1AWWA 3CC2Q 2EGCA 4FL6A 4OMMA 4OMQA 3M0TA 4A63B 4EPCA 1UJ0A 4M77C 1ABQA 5GANj 3L2WA 5LJ3g 5KYWB 2CUDA 3JB9D 3CMAT 1QVGS 3JCMf 1EX4A 2L3QA 1QKWA 3THKA 1ZUYA 1OU8A 2YSQA 3E1SA 3EG0A 1NG2A 4Y92A 3X28B 4M78A 3QSUA 2YRVA 4C5HA 4BDYA 2JTEA 1VQ5Q 3HKSA 2GF7A 2MWPA 4KGXB 5GAMf 1S72T 1M8MA 2LP5A 5GAOq 3CPWS 2K3BA 3E19A 4RUGA 3CXCS 2NUPB 9ATCB 5GAMg 1Y57A 1K8AU 5FWCA 1C0MA 3V7SA 3OS1A 4OMFB 1YWPA 4L6V5 3J80E 1Q86C 1RAGB 1VQ4Q 5LJ3d 3QWYA 2X3XD 2L89A 2BZXA 4AMCA 4XTZA 2GCXA 2L3RA 5FU6B 4M7AE 4UC4A 3PTAA 1QVFA 4IUQA 3HRUA 4FYWB 2CP7A 3X26B 1MNEA 2YHTA 2E3HA 1S72A 2FYKA 1FMWA 6AT1B 2P84A 4FCYA 2M51A 2DMOA 4DBRA 2HQXA 1VQOQ 3CCQQ 2DNUA 2RJCA 2RK2A 4J6YA 2X35A 5CKEA 1GXIE 1SG5A 2JUFA 2FO0A 4OMNA 2Y4XA 2DEUA 1UGRB 4II1A 1M5Q1 2XIDA 4JZ3A 2OTJQ 3JB9F 4DBHA 5CO7A 1G3TA 3JCMc 3L2UA 1W4SA 4FT2A 1TUCA 2DTOA 1YIJT 2BZ8A 2HZYA 4N0AA 4C92A 2IPOB 2DERA 4OMOA 3HSBA 1JXOA 4J9BA 1U06A 1ZSZC 4PFZA 2M0YA 5AYFA 4J9CA 3FB9A 3NHNA 4LDYA 4M75A 4J9HA 3RIRA 3QDRB 1H8KA 1KD1U 1NYFA 4OMPA 1ZSZB 2KMTA 1I1JA 1HYOA 5FROA 4HCZA 2K57A 4LDXA 2O9SA 1AT1B 2RMOA 1BIAA 2LX9A 3VS2A 3CC4Q 1YJWQ 1Q81C 1OI1A 4V2SA 4E6RA 2DK3A 1D1CA 4DA4A 5GAN6 4F16A 4AG2C 3CD6A 4FSSA 3QWXX 1YI2A 4WF2A 3GLXA 4ZTJA 1LNXA 4M77G 3M55A 3BDUA 4HKEA 3HTRA 4DBFA 1FYNA 5FRMA 3UDCA 1VQ7A 1HK9A 1M90C 4ME7A 1VQ9T 3A8OB 4HVWA 4FW1A 3E2UA 1B34A 3FLGA 2CH4A 3H0HA 1W2BA 4LN2A 2O4XB 1KQ1A 3L2ZA 2D1XA 4ATOA 1BCOA 4QVDA 4PJOD 2V1QA 1FX7A 3C0CA 3A1PA 3WVEB 2ENMA 3CPFA 3LGFA 3M53A 5LJ5h 4F7UB 3TEEA 5GANf 4MZPA 2BE7D 3UATA 1K9AA 2YUOA 3S3MA 5GMKl 3M57A 1N9RA 3EFOA 5FRNA 5GANg 2JOYA 3O8VA 3RKWA 5GMKi 2EW3A 1QVGA 1K8AC 1Z9ZA 4PLLA 4D8DA 3S3NA 3JRZA 3SHWA 4WCIA 1VQ9A 3LH5A 1CKBA 4A54A 1VQLA 1DJ7B 1KIKA 4Y28E 1YJ9T 3M9QA 3QKJA 1XTDA 2QEXQ 4B6MA 1F1BB 1YJNQ 2BE9B 1Q82U 3FJPA 3CCJT 2RJFA 1UGVA 3HFOA 1G2BA 1WLPB 1BU1A 4NOYA 1X75C 4CRIA 2AHJB 4OB3B 2EQMA 3EGXA 3CPWA 2QQRA 1BIBA 3I55T 3CXCA 3OYDA 4J8OA 1IRXA 1HD3A 2FPEA 4D6WA 2QDYB 2VB6A 3V7RA 4ANJA 4MMKA 2MPXC 3NMZC 3GPLA 1X6BA 1NE8A 3U23A 3LWIA 1M9SA 2L3SA 2VXEA 3ME9A 5LJ5e 2QGFB 1OYXA 2K3YA 3PNWC 3CBPA 4XK8E 4P5NA 1VQ8A 2QTVA 2A3LA 3OYBA 3QXEB 2SRCA 1ZUKA 2DL4A 1YJ9A 1VQMQ 3QZ5B 2RQVA 4PJOF 3PE0A 3CCJA 2PVGB 1XJWB 4C8QD 2LJ0A 1VQNA 1K73U 3VUBA 1M4ZA 2EWNA 5KCHA 3TSWA 3LW5E 2ED0A 4FT4A 2OJ2A 1QCNA 2CS7A 2JW4A 5KYXA 3MEAA 3L42A 1UE9A 3CCLT 2M0OA 3CCRQ 1KHCA 1ZA1B 4J9EA 1EFNA 2HAXA 3MHXA 2O01E 4PLIA 4HCBA 2NUZA 5IHNA 1QW1A 5HKCA 3JB9G 3M54A 3JAME 1PWTA 1UGSB 2QGGA 3EHRA 5M9OA 1H3ZA 2AKLA 3TU4K 1V1CA 1WX6A 2F1LA 3C95A 2KR3A 3TREA 2M02A 1QP3A 1K76A 3H6ZA 3L2RA 3QZ9B 3KBGA 3R6OA 4GLMA 2O2OA 3GP8A 3JCMP 4PJOC 1SSFA 2IIMA 4J6WA 3VV0A 3ULRB 3G71Q 1ARKA 1X69A 2JS2A 2E10A 2EQIA 3INZA 3OS5A 3VS4A 1UDLA 2BUDA 1Y07A 2DO3A 3TCJA 2J6KA 1M1KC 2EPDA 2K6DA 2JZ2A 3OYAA 2EGEA 4M78B 3CCLA 1QP2A 4YTLA 2QA4T 1BI1A 2YUNA 2PUOB 2VYTA 1WXBA 1P92A 1JJ2S 2AZVA 2P4RA 4J5YA 4M77E 2AK5A 4R0KA 1VYVA 3VYHB 1UFFA 4MDWA 2K9GA 3LYIA 2LDMA 1D1AA 2AZSA 2K5FA 1RI9A 1UEBA 3JB9I 1Y96A 3AHUA 3OMGA 3PVQA 4LDUA 4PFOA 1WJRA 1YITT 1C6VX 1OPLA 1OX9A 3TSZA 3EG2A 1AHJB 2HNIA 4F17A 2DKGA 2JM8A 1GRIA 1WNLA 2KRSA 2VXFA
chains in the Genus database with same CATH topology
5GANd 2B8AA 3S6WA 4C8QF 4M7DD 3BFMA 3JCMf 1Q86U 2KK4A 4M75F 3LGLA 3QPHA 4X9CA 5LJ5f 3GIBA 5D6XA 2XD0A 3M4YA 3RMQA 3FDRA 2X4JA 5CKFA 5D6WA 4KBMB 3E1SA 1VQMT 4BI3A 2KDSA 1YJNA 3X28B 5A0GA 3Q1JA 1OZ3A 3V7CA 2R5MA 4M78A 3QSUA 3QHSA 4NS5A 2YRVA 3NTIA 1NPPA 3T9NA 2CZ7B 4C5HA 4BDYA 4M7DE 1Q7YC 4HT9A 3DB4A 2QA4A 4M7AA 4BY6B 4JLGA 4M78F 3HKSA 5GAOl 2QI2A 1Y7XA 2GF7A 2MWPA 3DLMA 4LDWA 4M75D 5GAMf 4BE1A 1S72T 2LTOA 4N4GA 2XDPA 4M7AF 3A5ZB 5GAOq 3CPWS 1YHQT 4KUIA 4OVAA 4A4HA 3UPUA 4J7FA 1KC8U 3E19A 4ELZC 3CXCS 4XU1A 4ZGJB 1YIJA 3M59A 4C8QE 5GAMg 4EMKA 3CMET 4DOVA 3NTHA 2OAUA 3HL8A 4M75E 5IN1A 3ZBDA 1K8AU 3P8BB 3OS2A 3V7SA 2DXUA 3OS1A 1YITA 4OMFB 5IT9E 5CK9A 4PNOA 5LJ3h 5LJ3j 2XHCA 3SFMA 3OMCA 5GAOr 5IAYA 4C0DC 4L6V5 1YBYA 2K3XA 3G6ET 3J80E 1Q86C 4M7DB 1BI2A 1G3YA 2JTMA 4C0ZA 4C8QC 5LJ3d 2CYZB 5EG2A 2FHDA 2KY9A 2DAQA 4M78E 3CBMA 2L89A 5DM7R 3META 3MP6A 4BUGA 4XTZA 4C92B 5GANe 2DD5A 2GCXA 3RERA 1ZQ1A 2E6NA 2JVVA 2L3RA 4OGEA 5FU6B 2GFAA 4M7AE 4UC4A 4X34A 2CZ1B 3PTAA 1QVFA 3M56A 4C0DB 3A8HB 2ZGWA 4E47A 4IUQA 3HRUA 2DTHA 3ER0A 3JCMh 3OYYA 3ZFJA 4E7LA 5CQXA 4HT8A 3VJPA 2FL7A 5J39A 1K73C 1VQ5A 3X26B 2K5IA 4IURA 1G5VA 2YHTA 2ZPFB 4M75B 4M78C 3G71T 1H641 5KE2A 2PVOB 2R57A 3N5BB 4F7UG 1S72A 2FYKA 1I4K1 2RO0A 1VQOT 3CCMA 3C12A 4XU0A 4M7AC 2E5QA 2HQXA 2LCLA 2EKOA 1YHQA 2LQ8A 3OQ5A 2QQBA 4JS5A 3C4SA 3L1AA 2K5LA 2RJCA 2DXTA 2RK2A 2NLUA 4XQ3A 4J6YA 3OW2S 2X35A 3VYGA 4XTYA 2WSCE 5CKEA 1GXIE 5GAMh 3CMEA 4TVRA 2BKDN 1WGSA 3QYGB 2PQWA 5CKDA 2LVMA 1IREB 2D9TA 3OYNA 3V8LA 4E7JA 2JUFA 1M1GA 5GMKm 4J7IA 2JNGA 2Y4XA 2ZPGB 3HRTA 4QVZA 1UGRB 2RH2A 4A4GA 1VQKA 3J7AF 4C0FA 4EMKC 4II1A 4KULA 4NL2A 3G4ST 1RL2A 3DB3A 2RK1A 1X6OA 4Z02A 3LWHA 4M7DA 1M5Q1 2XIDA 3JCMV 3WXMB 1YJ9T 3JB9F 3M58A 5CO7A 1G3TA 3JCMc 3L2UA 3G6EA 1D3BA 5I2MA 1W4SA 3C94A 3HHTB 2P0PA 3OSSC 4FT2A 3RKYA 4JRQA 2CKKA 2DTOA 4FSXA 1JRIA 1YIJT 4BI4A 1YCYA 4N0AA 3JB9H 3VKIA 4C92A 3CC2T 4PL6A 4PJOG 4A4EA 3HSBA 3QUIA 1KQSA 2ZPBB 3HRSA 3PIPA 5LJ3e 2QQ9A 3LX7A 5AYFA 4C92F 1PSEA 3MO8A 4Y91A 1M90U 1QVFS 2R5AA 3FB9A 2WSFE 4LDYA 1VUBA 2EFIA 1B34B 2P0QA 4M75A 4A4FA 2CGHA 2HQEA 4BD3A 3RIRA 3QDRB 2RI5A 1FXXA 2EIFA 4JLIA 3G71A 2M1HA 3E9FA 2XKOC 4IUPA 3CCUA 2E70A 2RJDA 4BY6C 3JCMX 1KD1U 2KMTA 2XDDA 1VQOA 3CCQA 1I81A 5FROA 3OYEA 4HCZA 2K57A 3EFSA 3X20B 4C92D 1HXDA 5HK3A 2QQAA 5CIUA 1YJWT 1BIAA 2LX9A 3ASKA 3QIIA 1Q81C 5FU7B 4NL3A 2XICA 1MGQA 5DLQE 3CC7A 3JCMg 4C5GA 1OI1A 4V2SA 3SWNB 2DK3A 2VUBA 5LJ5g 3EAEA 1VQ5T 4ZGEB 4MZMA 4OB0B 4XTWA 4DA4A 1OZ2A 1M8VA 5GAN6 5C0MA 5CKHA 1N27A 3SD4A 3G4SA 3VUZA 2VGMA 4QW2A 1WQWA 3CCMT 4RKUE 4C92E 2ZCFB 2E41A 4O5VA 3H8ZA 3CD6A 4JUVA 1YI2A 2L5QA 4A53A 4WF2A 2YLCA 3GLXA 4XTXA 5KH6A 4ZTJA 1LNXA 1KQ2A 4M77G 3M55A 3G7ZA 1XOVA 3BDUA 4HKEA 4M7DC 4J83A 4L59A 5CVIA 4B9WA 4ZN1A 3CC2A 3P8HA 3RMSA 5FRMA 3UDCA 1UGPB 2LRQA 1VQ7A 3MP1A 1HK9A 2Y90A 5J26A 4N0AC 3HPWA 2QXFA 4ME7A 3URGA 4C92C 1VQ9T 2XI9A 1VQKT 3A8OB 1KG1A 5FU6C 3FLGA 1B34A 1W2BA 3KXTA 4OF1A 2MF2A 3I55A 3OYKA 1VQ4T 2O4XB 1KQ1A 3CBOA 2KQWA 3L2ZA 3FIFA 3MEVA 3MP8A 3NFCA 4FIBA 5GAOm 1KD1C 1D3BB 4ATOA 3DLLA 4QVDA 4HA8A 4M75C 2Y4YA 3BW1A 3GNFB 4PJOD 2RI2A 3JCMJ 3GF5A 4QQGA 4BACA 2FVUA 4GY5A 3I56T 1FX7A 4IKFA 3A8GB 3CC4A 1YJWA 3WVEB 5GAN4 2EQJA 2RD1A 1JJ2A 5GAOn 4JS4A 2E65A 3CPFA 3QYHB 4FU6A 2RJEA 3SWNA 3GOXA 2DJZA 3LGFA 2D6FA 3BDLA 2PVDB 3M53A 5LJ5h 5LJ5j 3L2QA 4F7UB 3RESA 3TEEA 4RCCA 5GANf 4N4HA 3JCMb 3PIOA 3A8MB 4OB1B 4MZPA 1KHIA 2F5KA 3PMIA 3SDZA 4O6JA 5FLXE 3CCUT 3JCMd 4E7IA 2MWOA 3QJYA 2DTIA 2WSEE 4RCBA 5LJ5d 2KVQG 4IUTA 3S3MA 3HFNA 3CCQT 1KC8C 5D6YA 1O9SA 5GMKl 3M57A 1N9RA 3OS0A 5FRNA 5A2QE 2X4XA 3ZEHA 5GANg 2JOYA 3O8VA 3LLRA 3RKWA 3CC7T 5A0DA 5GMKi 5GAMj 1QVPA 3J81E 1QVGA 4MMLA 1K8AC 5DY9A 2LNVA 2LT4A 4PLLA 2EJFA 3S3NA 3JRZA 4C8QG 1VQ9A 3X24B 4QVCA 5GAMd 4A54A 1VQLA 1DJ7B 5GAOp 4CI0C 2OTJT 3UWNA 2O4XA 4VUBA 2E12A 3CD6T 2JN0A 4DQ2A 4Y28E 1YI2T 1K9MU 2DIGA 4JRKA 4M77D 4MZTA 1UB4A 3CEYA 4RG8A 2BIVA 2X4WA 3M9QA 3OBWA 3QKJA 3OYCA 1XTDA 2H3JA 5CKBA 2WACA 3JCMW 2RHXA 4PJOB 1IZ6A 3PMTA 1Q82U 2JTFA 5GAN3 3FJPA 3FRNA 2CZ6B 5KCOA 2PUKB 3I56A 2RJFA 3JSCA 3CCJT 3HFOA 1RI0A 1LJOA 1VQ7T 2ZPEB 4M78G 2IVWA 4NOYA 3X25B 2OTLT 1X75C 4CRIA 2KAFA 2AHJB 2RA2A 4OB3B 4XU2A 4ZN3A 3JCMQ 3OY9A 4M7AG 2EQMA 2P0KA 4F7UA 1ZHIA 4FM4B 3CPWA 2QQRA 5CR2A 2GFUA 1BIBA 1JBMA 2EYQA 2A7YA 5FU7C 3DKMA 2DXCA 4ELYC 3I55T 1VQ6T 2E6ZA 2LCCA 3CXCA 1NJIU 5LJ3f 3SWNC 3KUFA 4J8OA 3SB2A 2DVEA 2ZPIB 3OYDA 4F7UF 1LOJA 4N4IA 1WJQA 4D6WA 2ZZDA 2QDYB 3V7RA 4BB7A 4MMKA 3CCST 3GPLA 4JJNK 4HCCA 3CC4T 2XU8A 4L5GA 1NE8A 5HK0A 3JCMe 3LWIA 4B9XA 4KT0E 3L2VA 1M9SA 2VC8A 2VXEA 5GANh 3ME9A 5LJ5e 1I8FA 4QQDA 4LD9K 5L8RE 4J6XA 3QBYA 1OYXA 2K3YA 3LH0A 2V8IA 3CBPA 1NZ9A 3PNWC 4P5NA 3OB9A 4XK8E 1VQ8A 3OYJA 2A3LA 4LDXA 2RB6A 4LDVA 2RHIA 3CCET 2X4YA 2CZ0B 4LD6A 3OYBA 3QXEB 1VQ4A 4BDZA 1MHNA 2OTJA 2DXBA 2ZPHB 1K9MC 3RUXA 1BI3A 4KUDK 5CQYA 3FEOA 4M77B 3PGGA 4EMGA 4PJOA 1YJ9A 2QEXA 2F69A 3OBYA 5GAMe 4IUUA 3FC3A 3V8JA 1Q82C 2RHZA 1WPYA 4PKCC 3QZ5B 1X01A 5C6SA 5GAN2 3OYIA 4PJOF 1M90C 3PT9A 4F7UE 3CCJA 2PVGB 1BI0A 1M1FA 4C8QD 1BYMA 2V8KA 2XG8D 3WVDB 2G3RA 4EDUA 4E7HA 1KQSS 1K73U 5HY6A 3MCAB 3VUBA 1VQNA 1M4ZA 3S3OA 2EWNA 2QQSA 5KCHA 1WJSA 1N8RU 1VQLT 3OSVA 5GAN7 1VQPT 5LL6S 3LW5E 1EIFA 4FT4A 1NJIC 2CS7A 4RMOA 1VQ6A 2DPPB 2DD4A 1FWZA 3MEAA 3QO3A 3OW2A 3L42A 3RKXA 3CCVT 4XAXB 3OYGA 4JDSA 5KE3A 3CCRT 1V29B 1M1KU 2FB7A 2QTXA 4XTUA 3CCLT 2M0OA 1KHCA 2PU9B 4M78D 3EFRA 2EAYA 3UT1A 5GMKh 5GMKj 3CCSA 2GQVA 2M9UA 3MHXA 2HAXA 2I2LA 1XQHA 2VV5A 4M7AD 2O01E 4PLIA 1G3WA 4MDXA 2RI3A 4ZTFA 4HCBA 2DZCA 3CMAA 1QW1A 5HKCA 2EQUA 3JB9G 1N6AA 3M54A 3JAME 5M9OA 1UGSB 4DOWA 4R56A 3CCEA 1G3SA 1H3ZA 2C06A 4PJOE 2DIQA 3TU4K 4M7DG 4BE2A 3C95A 3PFSA 5CCAA 2L8DA 3TREA 3OYHA 4M77A 1Y96B 4C5EA 4IUVA 2MMPA 1QP3A 3H6ZA 1WQ7A 1VIEA 3F70A 2VGNA 1VQMA 2LQKA 2HD0A 3L2RA 4C92G 3QZ9B 3MEUA 3KBGA 4M77F 4JRPA 3QG1A 2P4TA 2K4YA 3R6OA 3OYFA 1NPRA 4OGCA 1U8RA 3HP9A 3GP8A 3JCMP 4C8QB 1VIFA 4PJOC 1VQ8T 1SSFA 4R55A 4J6WA 5I21A 3OYLA 1PSFA 2EQKA 3VV0A 1N8RC 3A8LB 3BY7A 4M75G 1Y71A 1XNIA 2E10A 2RM4A 1U1SA 1UGQB 5I2SA 1VQPA 3INZA 3OS5A 4QQ6A 1W2BS 1I5LA 3QJ6A 5J3BA 2BUDA 1Y07A 2K2VA 3VU3C 1TH7A 2DO3A 3TCJA 2MI6A 1N9SA 3M4GA 2DZ9A 2QEXT 3CCVA 1YJNT 1R8OB 3OYMA 2IG0A 1JB0E 1M1KC 4Q5WA 2DEQA 4XU3A 4A4KA 4GLKA 2M16A 2JZ2A 3OYAA 3CCRA 1Q81U 1BKBA 3MEWA 4M78B 4RG2A 1QP2A 3CCLA 2E64A 1O75A 4YTLA 2QA4T 1BI1A 2OTLA 2F5TX 3V8KA 1VQNT 1Q7YU 2KSSA 2PUOB 2VYTA 2D0QB 4M7AB 2RHUA 4C0GA 3OA6A 2V8JA 1U1TA 1P92A 1JJ2S 2LC4A 3E9GA 4J5YA 2XK0A 2MAMA 2E1HA 2RHYA 4M77E 5GAN8 2XDBA 3VYHB 4MDWA 3LYIA 4BE0A 2LDMA 2K5FA 4EMHA 1UEBA 4M7DF 4XTVA 5DLOA 1Y96A 5GAN5 4C5IA 5GMKe 3JB9I 3JB9J 3GNGA 3AHUA 1ZBXA 2EJGA 2HBPA 3NTKA 4FL6A 4EMKB 3OMGA 5CAIA 2R58A 3M5AA 4LDUA 4OB2B 1WJRA 2LT1A 2YLBA 4ZGDB 4EPCA 1YITT 4M77C 5GANj 3L2WA 5A0LA 3P8DA 1AHJB 4X9DA 2HNIA 4BI8B 4C8QA 5LJ3g 4E7KA 4OP0A 2DKGA 3JB9D 3CMAT 1QVGS 4JRIA 1WNLA 2EJ9A 2VXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A8M B;  4OB1 B;  3LW5 E;  2DPP B;  2DD4 A;  2WSE E;  3HHT B;  1V29 B;  3X28 B;  2PU9 B;  2ZPB B;  1PSE A;  2CZ7 B;  2O01 E;  2WSF E;  3X24 B;  1DJ7 B;  1UGS B;  4Y28 E;  1QP3 A;  4ZGJ B;  3X20 B;  2CZ6 B;  3QZ9 B;  2PUK B;  2ZPE B;  3X25 B;  2AHJ B;  4OB3 B;  4ZGE B;  4OB0 B;  1PSF A;  4FM4 B;  4L6V 5;  3A8L B;  2DXC A;  1UGQ B;  4RKU E;  2ZPI B;  2CYZ B;  2ZCF B;  2ZZD A;  2QDY B;  1JB0 E;  2DD5 A;  2CZ1 B;  1QP2 A;  4KT0 E;  3A8H B;  1UGP B;  5L8R E;  2PUO B;  4XK8 E;  2D0Q B;  3A8O B;  3X26 B;  2ZPF B;  2CZ0 B;  2PVO B;  3QXE B;  3VYH B;  2DXB A;  2ZPH B;  3A8G B;  3QZ5 B;  3VYG A;  2WSC E;  1GXI E;  4OB2 B;  3WVE B;  4ZGD B;  3QYG B;  1IRE B;  2PVG B;  1AHJ B;  3QYH B;  3WVD B;  2ZPG B;  1UGR B;  2PVD B; 
#chains in the Genus database with same CATH topology
 2B8A A;  3S6W A;  4C8Q F;  3GBQ A;  1Q86 U;  2KK4 A;  4M75 F;  1OQK A;  3GIB A;  5D6X A;  2XD0 A;  3M4Y A;  3FDR A;  2X4J A;  5D6W A;  5AT1 B;  1YCS B;  4RTZ A;  1OZ3 A;  3V7C A;  2R5M A;  1NPP A;  3T9N A;  2CZ7 B;  2MYS A;  3DB4 A;  2QA4 A;  4M7A A;  4JLG A;  1M2O A;  5GAO l;  2OX7 A;  1K0S A;  2QI2 A;  1Y7X A;  3DLM A;  4BE1 A;  1D0Y A;  2YWW A;  3CCM Q;  4OVA A;  4ELZ C;  1RAI B;  4XU1 A;  4ZGJ B;  2QAS A;  3M59 A;  4EMK A;  2KXD A;  2OAU A;  3ZBD A;  5IN1 A;  3PVL A;  2DXU A;  1YIT A;  2RPN A;  2EYZ A;  1VQK Q;  1T0H A;  4M4Z A;  4PNO A;  5LJ3 h;  1PHT A;  2XHC A;  1ZA2 B;  5IAY A;  4C0D C;  2K3X A;  4J9F A;  1W6X A;  3M0R A;  4C8Q C;  2FHD A;  2DE0 X;  2HMA A;  2KY9 A;  3EHQ A;  3CBM A;  1ZUU A;  4GBQ A;  4BUG A;  1PM3 A;  4C92 B;  2YT6 A;  1ZQ1 A;  2E6N A;  3I56 Q;  2GFA A;  4F14 A;  4X34 A;  4C0D B;  4E47 A;  2ZGW A;  2DTH A;  3ER0 A;  1IGQ A;  3JCM h;  5CQX A;  4HT8 A;  1K73 C;  1VQ5 A;  4IUR A;  2ZPF B;  4M75 B;  1H64 1;  2PVO B;  1I4K 1;  3CCU Q;  1VQO T;  2A36 A;  1QLY A;  2E5Q A;  2EKO A;  2GNC A;  2W0Z A;  3L1A A;  3OW2 S;  2NLU A;  4XTY A;  5GAM h;  3CC7 Q;  3QYG B;  3RER A;  4LUE A;  2LVM A;  3M0P A;  2QK0 A;  2ZPG B;  4A4G A;  3J7A F;  4C0F A;  1KC8 R;  4KUL A;  4NL2 A;  3G4S T;  1RL2 A;  1X6O A;  4M7D A;  1GFC A;  3JCM V;  3WXM B;  1D3B A;  3OSS C;  2DYI A;  4FSX A;  1YCY A;  2DBK A;  1QVF P;  2KBT A;  4PJO G;  4A4E A;  2CUB A;  2FRY A;  5LJ3 e;  1U5S A;  2OTL Q;  1M90 U;  2R5A A;  2WSF E;  1VUB A;  1B34 B;  4A4F A;  1M2V A;  2ESW A;  2HQE A;  4JLI A;  2CT4 A;  1OUL A;  2KT8 A;  3H0F A;  3I5S A;  1VQO A;  3CCQ A;  2CP3 A;  3X20 B;  1A0N B;  1YJW T;  3VS0 A;  2LQN A;  2ROL A;  3JCM g;  2O88 A;  1CSK A;  8ATC B;  4ZGE B;  4QT7 A;  1KK7 A;  4LE9 A;  3UF4 A;  3CCE Q;  1B07 A;  5CKH A;  2YUP A;  1N27 A;  3G4S A;  3VUZ A;  2VGM A;  4Z8A A;  1IHW A;  2DX1 A;  2ZCF B;  2E41 A;  4O5V A;  2L5Q A;  4A53 A;  5GJW B;  2HBW A;  3EFO B;  2EVR A;  1UHC A;  1PKS A;  5EC7 A;  3P8H A;  1AZG B;  2LRQ A;  3URG A;  1KJW A;  1TOV A;  1UHF A;  2HDA A;  5FU6 C;  2RQT A;  1Q82 R;  3KXT A;  4OF1 A;  2MF2 A;  1W70 A;  2FG0 A;  1ZX6 A;  3FIF A;  3NFC A;  4FIB A;  3CCV Q;  4FYX B;  4HA8 A;  3BW1 A;  3JCM J;  3GF5 A;  4QQG A;  3A8G B;  3CC4 A;  1YJW A;  2EQJ A;  1JJ2 A;  5GAO n;  4JS4 A;  3SWN A;  2RJE A;  3GOX A;  1ZBJ A;  2FEI A;  4OML A;  2DJZ A;  3BDL A;  5LJ5 j;  2BZY A;  3EGX B;  3L2Q A;  1PNJ A;  4N4H A;  3JCM b;  3PIO A;  4OB1 B;  5FLX E;  4E7I A;  3SDZ A;  4O6J A;  3JCM d;  4IUT A;  5A2Q E;  2X4X A;  1AEY A;  3LLR A;  5L23 A;  4MML A;  5DY9 A;  2LNV A;  1W2B P;  2D0N A;  4C8Q G;  1V76 A;  5GAM d;  5IHK A;  2QDL A;  2E12 A;  1TUD A;  2JN0 A;  3CD6 T;  1YI2 T;  4MZT A;  4DBQ A;  1D0X A;  3CEY A;  2LQW A;  1TWB A;  2H3J A;  2RHX A;  2JTF A;  3FRN A;  2CZ6 B;  4Z89 A;  2ATC B;  2KRO A;  2DET A;  3JSC A;  2NUT A;  2LCS A;  1VQ7 T;  2PZ1 A;  1TUG B;  2IVW A;  4AFU C;  2HSE B;  4DEX A;  4FM4 B;  2JMC A;  2L0A A;  1VQ6 T;  2E6Z A;  3KUF A;  5KYX B;  4F7U F;  4N4I A;  2AIR B;  1ACM B;  2CDT A;  1E6G A;  1GCQ A;  1IXD A;  1BK2 A;  1MMA A;  3MKD A;  3CCS T;  1Y0M A;  4JJN K;  1SPK A;  1QVG P;  4L5G A;  2RQW A;  5HK0 A;  4B9X A;  5GAN h;  2NWM A;  1I8F A;  4J6X A;  4IIM A;  3QBY A;  1NZ9 A;  2EBP A;  3OB9 A;  2X9H A;  3CMA Q;  2RHI A;  4LD6 A;  2QG9 B;  1VYT A;  1MHN A;  1SF9 A;  1K9M C;  1BI3 A;  5CQY A;  3FEO A;  4EMG A;  1QCF A;  2QEX A;  2F69 A;  4FW2 A;  3FC3 A;  2B86 A;  2LZ6 B;  2DL7 A;  2DL3 A;  2EYX A;  1M1F A;  1BI0 A;  3CPW P;  1KQS S;  4HXJ A;  5HY6 A;  2BTT A;  2QQS A;  4AFS C;  3CXC P;  1VQL T;  1RAH B;  1S72 Q;  1VQP T;  4IIO A;  1NJI C;  1VQ6 A;  2DD4 A;  1FWZ A;  3OW2 A;  1WHJ A;  3RKX A;  3OYG A;  3CCR T;  1V29 B;  1M1K U;  1PRL C;  2QTX A;  5IXF A;  4M78 D;  3CCS A;  5GMK h;  2J7I A;  2M9U A;  4HCK A;  2I2L A;  4MDX A;  2RI3 A;  4ZTF A;  1N6A A;  3VS3 A;  2GGR A;  4DOW A;  4R56 A;  1G3S A;  2C06 A;  4PJO E;  5CCA A;  2L8D A;  3OYH A;  4M77 A;  1X6G A;  4PJM A;  2LX7 A;  1Y96 B;  4C5E A;  1OX8 A;  1VIE A;  2V1R A;  1VQM A;  2LQK A;  2HD0 A;  2KGT A;  2K4Y A;  4OGC A;  1U8R A;  3REB B;  1PD0 A;  1VIF A;  1VQ8 T;  2RF0 A;  4R55 A;  1PG5 B;  1PSF A;  1N8R C;  2LJ3 A;  1WHL A;  2F2V A;  3BY7 A;  4AFZ C;  1Y71 A;  1U1S A;  1NM7 A;  4RTY A;  1VQP A;  2MI6 A;  1N9S A;  2E3I A;  3OYM A;  4Q5W A;  2DEQ A;  2M16 A;  3CCR A;  1WXU A;  1YFN A;  1MV3 A;  1VQN T;  2F5T X;  2CP5 A;  4M7A B;  2RHU A;  2LC4 A;  2RHY A;  5GAN 8;  3R6N A;  4M7D F;  1UEC A;  4XTV A;  5GMK e;  2CH4 W;  1YIJ Q;  3GNG A;  1Q95 G;  2HBP A;  4EMK B;  2CSQ A;  5CAI A;  2R58 A;  3M5A A;  4OB2 B;  2LT1 A;  4ZGD B;  5A0L A;  3P8D A;  1HSQ A;  4Z88 A;  4OP0 A;  4CC4 B;  2HKQ B;  5GAN d;  3BFM A;  5I11 A;  5LJ5 f;  3RMQ A;  1NEG A;  2GTJ A;  5CKF A;  4KBM B;  2KDS A;  3Q1J A;  1RUW A;  3QHS A;  1K4U S;  1Q7Y C;  4HT9 A;  4BY6 B;  4M78 F;  4M75 D;  2LTO A;  1D09 B;  2XDP A;  2X3W D;  1Q81 R;  3A98 A;  1YHQ T;  4KUI A;  3UPU A;  4J7F A;  2FRW A;  1LCK A;  1ZLM A;  3I35 A;  4C8Q E;  3CME T;  4DOV A;  4AT1 B;  4M75 E;  3HL8 A;  2C0I A;  2EYY A;  4HVV A;  5IT9 E;  5CK9 A;  4PJJ A;  5LJ3 j;  5GAO r;  3OMC A;  2VWF A;  1U3O A;  1YBY A;  3NPF A;  3G6E T;  3RNJ A;  4M7D B;  1BI2 A;  1BB9 A;  4C0Z A;  5I22 A;  1ZSZ A;  2CYZ B;  5EG2 A;  2CP6 A;  2DAQ A;  2HL3 A;  5DM7 R;  1G83 A;  3MET A;  3MP6 A;  4PJL A;  2DD5 A;  2JVV A;  4OGE A;  2CZ1 B;  2DM1 A;  3A8H B;  1NEB A;  1OOT A;  4E7L A;  3VJP A;  2PNI A;  5J39 A;  2K5I A;  1G5V A;  4M78 C;  1M2V B;  1OU9 A;  4F7U G;  1QWF A;  3CCM A;  3C12 A;  4XU0 A;  2O9V A;  2LCL A;  4AFQ C;  1YHQ A;  2LQ8 A;  1M3C A;  3C4S A;  1YN8 A;  2DXT A;  2FZK B;  3VYG A;  3FJ5 A;  2HQH A;  3CME A;  1AWX A;  4TVR A;  2BKD N;  5CKD A;  4E7J A;  1IRE B;  2D9T A;  3V8L A;  1M1G A;  1SEM A;  3HRT A;  4QVZ A;  1VQK A;  4ESR A;  3LWH A;  2RK1 A;  4Z02 A;  2DBM A;  1JO8 A;  2F2X A;  3M58 A;  3G6E A;  3C94 A;  3HHT B;  2P0P A;  5KYU A;  1K8A R;  4E2F B;  1YJ9 Q;  2J6O A;  1JRI A;  4BI4 A;  3JB9 H;  3VKI A;  3CC2 T;  4LNP A;  3EG1 A;  1KQS A;  4F04 B;  3CCJ Q;  3PIP A;  4E7Z A;  3LX7 A;  1AVZ C;  1K1Z A;  3MO8 A;  2KYB A;  4C92 F;  1D0Z A;  1QVF S;  3UA6 A;  2P0Q A;  2CGH A;  2RI5 A;  2EIF A;  2CP0 A;  3I55 Q;  2M1H A;  3E9F A;  2XKO C;  3CCU A;  2RJD A;  1NYG A;  1I81 A;  2YRC A;  2SEM A;  3EFS A;  2GQI A;  1HXD A;  5HK3 A;  2QQA A;  5CIU A;  3ASK A;  3QII A;  4RTW A;  1RAD B;  5KYY A;  1D1B A;  5FU7 B;  2O31 A;  4NL3 A;  1MGQ A;  5DLQ E;  3CC7 A;  3SWN B;  1VQ5 T;  1E7O A;  3EAE A;  1OZ2 A;  2MIO A;  5C0M A;  1WQW A;  3H8Z A;  3SEM A;  4XTX A;  5KH6 A;  1H92 A;  1XOV A;  4L59 A;  5CVI A;  4B9W A;  4ZN1 A;  3CC2 A;  1NLP C;  2DL8 A;  2Y90 A;  2OTL A;  4N0A C;  4C92 C;  3RR6 A;  3TQ7 P;  1VQ4 T;  3CBO A;  2KQW A;  1EZZ B;  3MEV A;  5GAO m;  1M3B A;  1UUE A;  4M75 C;  3GNF B;  2RI2 A;  1BBZ A;  2COY A;  4DEY A;  4WTO B;  2FVU A;  4GY5 A;  4BAC A;  4IKF A;  3CCL Q;  2DRM A;  5GAN 4;  2NUT B;  2RD1 A;  4JJD A;  3QYH B;  2KRM A;  1KD1 R;  1I07 A;  2PVD B;  3O5Z A;  4RCC A;  1X27 A;  3MJX A;  2F5K A;  2MWO A;  2VAS A;  2DTI A;  2WSE E;  3HFN A;  3CCQ T;  5D6Y A;  4KRT A;  3OS0 A;  1GFD A;  5A0D A;  4HVU A;  1R0C B;  1T3L A;  1TSF A;  2QYZ A;  2LT4 A;  4RTU A;  2PTK A;  2ABL A;  3X24 B;  1H3H A;  5GAO p;  2OTJ T;  2FPF A;  3VS5 A;  1B3Q A;  1UTI A;  1K9M U;  2DIG A;  4JRK A;  1VQ4 A;  1GBQ A;  1UB4 A;  2BIV A;  2X4W A;  3OBW A;  1NLO C;  3I9Q A;  2WAC A;  3JCM W;  1R0B G;  1IZ6 A;  3PMT A;  4CC3 A;  1JJ2 P;  5KCO A;  4J9G A;  1FMV A;  2PUK B;  2ZAE A;  1LJO A;  2ZPE B;  4M78 G;  2QA4 Q;  3OY9 A;  2RA2 A;  4XU2 A;  3JCM Q;  2YUQ A;  2P0K A;  1ZHI A;  1M1K R;  5CR2 A;  4ELY C;  2EYQ A;  1JU5 C;  3DKM A;  4KGZ B;  2EKH A;  1NJI U;  5LJ3 f;  2ZPI B;  1WJQ A;  3UA7 A;  2ZZD A;  1GL5 A;  3CC4 T;  2XU8 A;  3JCM e;  2VC8 A;  3TVT A;  2VKN A;  1YIT Q;  5L8R E;  2K2M A;  1RLQ C;  2CP2 A;  1IO6 A;  2OTJ A;  3VRZ A;  4M77 B;  2AKK A;  4PJO A;  3OBY A;  5GAM e;  1AOJ A;  1JEG A;  3V8J A;  4PKC C;  1X01 A;  5GAN 2;  3EG9 A;  1MMN A;  3PT9 A;  4F7U E;  4EIK A;  3QDF A;  2V8K A;  3WVD B;  4EDU A;  2G3R A;  2HKN A;  2KXC A;  3S3O A;  1WJS A;  1WZO A;  1N8R U;  5LL6 S;  1MMG A;  4CC2 A;  4JDS A;  2RQR A;  4XTU A;  1WYX A;  2J06 A;  2COW A;  5GMK j;  2GQV A;  1WHM A;  2VV5 A;  4M7A D;  2HCK A;  3M0U A;  3H9N A;  1YP5 A;  2DZC A;  2HL5 C;  3CMA A;  3M0Q A;  1X2K A;  3PFS A;  4J9I A;  2MMP A;  1R77 A;  4D8K A;  1WQ7 A;  3F70 A;  1YWO A;  4ORZ A;  1T0J A;  2YRD A;  4C92 G;  1PC0 A;  5KYN A;  3QG1 A;  2P4T A;  3OYF A;  1OPK A;  3HP9 A;  3D7S B;  2H3E B;  1B7T A;  5I21 A;  3OYL A;  2EQK A;  2RN8 A;  3A8L B;  4M75 G;  3OW2 P;  3EH1 A;  2FZG B;  1LPL A;  5J3B A;  2K2V A;  1TH7 A;  2QEX T;  1YJN T;  2IG0 A;  1JB0 E;  1K73 R;  4XU3 A;  3H41 A;  1WDX A;  4GLK A;  4PFP A;  4A4K A;  1BKB A;  3MEW A;  1M3A A;  1JXM A;  4RG2 A;  1I5O B;  2E64 A;  1O75 A;  1TS9 A;  1J3T A;  3CQT A;  4KH0 B;  1Q7Y U;  2D0Q B;  4C0G A;  3OA6 A;  2V8J A;  4FYY B;  3E9G A;  2XK0 A;  4RTX A;  2E1H A;  2MK5 A;  4LUD A;  3G4S Q;  2XDB A;  4BE0 A;  1OEB A;  1MND A;  1TXQ A;  4EMH A;  5GAN 5;  2A08 A;  2EJG A;  3NTK A;  2KRN A;  2YLB A;  5FW9 A;  2Z0W A;  1JQQ A;  4JJC A;  4E7K A;  4X9D A;  4BI8 B;  4C8Q A;  3EGD A;  1KFZ A;  1PD1 A;  2CT3 A;  4JRI A;  2G6F X;  2FPD A;  2EJ9 A;  1E6H A;  4M7D D;  2EGA A;  1BCM A;  2YDL A;  3LGL A;  3QPH A;  4X9C A;  1LVK A;  1RAC B;  1VA7 A;  1VQM T;  4BI3 A;  2DVJ A;  1YJN A;  5A0G A;  1S1N A;  4NS5 A;  3NTI A;  4M7D E;  1X43 A;  4X1V A;  1CKA A;  4LDW A;  1G8X A;  4AG1 C;  4N4G A;  4M7A F;  2EYW A;  1PCX A;  3A5Z B;  1WXT A;  4A4H A;  1KC8 U;  1YIJ A;  2K7A A;  2HSP A;  3NTH A;  3BE3 A;  2JMA A;  3P8B B;  3OS2 A;  1UJY A;  4KH1 B;  1SRM A;  5KYW A;  5D7U A;  3SFM A;  3ZL7 C;  4ZNX A;  1ZSG A;  1G3Y A;  2JTM A;  2J05 A;  2DA9 A;  1NBE B;  5KYU B;  4M78 E;  5GAN e;  2AT1 B;  3M56 A;  1Q86 R;  1SHG A;  2CSI A;  3OYY A;  3ZFJ A;  2KI7 A;  1WHG A;  2DFU A;  2FL7 A;  2GTO A;  1RAA B;  3G71 T;  5KE2 A;  2NYS A;  3N5B B;  2R57 A;  2KT1 A;  2DJQ A;  1RAB B;  2RO0 A;  4M7A C;  2VVK A;  2NUP A;  3OQ5 A;  1Z9Q A;  2ED1 A;  2QQB A;  4JS5 A;  2D8J A;  1KQ2 A;  2K5L A;  4XQ3 A;  2WSC E;  1IHV A;  5KYY B;  1TU0 B;  1M30 A;  1WGS A;  3KFV A;  2PQW A;  3OYN A;  5GMK m;  4J7I A;  2JNG A;  2RH2 A;  4EMK C;  2C0T A;  3DB3 A;  2I0N A;  3CD6 Q;  5I2M A;  2CRE A;  1YI2 Q;  3RKY A;  4JRQ A;  2CKK A;  2A37 A;  4PL6 A;  1QKX A;  3QUI A;  2ZPB B;  3HRS A;  1AWO A;  3RBB B;  2QQ9 A;  2JT4 A;  1PSE A;  1VQ7 Q;  1KSW A;  4Y91 A;  2E5K A;  1WIE A;  2K79 A;  2EFI A;  2F2W A;  4K11 A;  4BD3 A;  1FXX A;  3G71 A;  4JZ4 A;  1VQ6 Q;  1WA7 A;  4IUP A;  2E70 A;  4BY6 C;  1PKT A;  3JCM X;  2XDD A;  3EG3 A;  1ABO A;  3OYE A;  4C92 D;  1QQJ A;  3MPU B;  4RTT A;  3CCS Q;  2XIC A;  5ECA A;  2YXY A;  4C5G A;  1WFW A;  1RAE B;  5LJ5 g;  1RLP C;  2VUB A;  4MZM A;  4OB0 B;  4XTW A;  1M8V A;  4PK4 A;  3SD4 A;  3CCM T;  4QW2 A;  4RKU E;  4C92 E;  2V26 A;  4JUV A;  2YLC A;  2JM9 A;  1KQS P;  3G7Z A;  4KGV B;  4M7D C;  4J83 A;  2OI3 A;  1MMD A;  3RMS A;  1WHH A;  1UGP B;  3MP1 A;  1K9M R;  1SKU B;  5J26 A;  1SSH A;  2COZ A;  2QXF A;  3HPW A;  1VQK T;  1KG1 A;  2XI9 A;  2J6F A;  5FWB A;  1MUZ A;  1GCP A;  3VRY A;  1VQ9 Q;  1VQL Q;  3RDV A;  1VQP Q;  3I55 A;  3OYK A;  2FZC B;  1KD1 C;  3MP8 A;  1D3B B;  3DLL A;  2Y4Y A;  1M90 R;  1WI7 A;  3I56 T;  4E7S A;  1UG1 A;  1NJI R;  2E65 A;  4FU6 A;  2RQU A;  4RTV A;  1FMK A;  4PJN A;  1IB8 A;  2A28 A;  2D6F A;  3RES A;  3M0S A;  2D8H A;  3A8M B;  2LJ1 A;  3IQL A;  1KHI A;  3NGP A;  3PMI A;  2DLP A;  3CCU T;  1YNZ A;  7AT1 B;  1AZE A;  2JS0 A;  3QJY A;  4RCB A;  5LJ5 d;  2KVQ G;  1KC8 C;  1O9S A;  3EGU A;  1HJD A;  3ZEH A;  1VOM A;  2C0O A;  3CC7 T;  5GAM j;  1QVP A;  3J81 E;  1W1F A;  2EJF A;  1VQ8 Q;  2OAW A;  4QVC A;  5GJV B;  4CI0 C;  3UWN A;  1C1A A;  2O4X A;  4VUB A;  4RG8 A;  4M77 D;  3OYC A;  5CKB A;  4PJO B;  5GAN 3;  1N8R R;  1QMC A;  3I56 A;  1SRL A;  3EG9 B;  1RI0 A;  2LNH B;  1N5Z A;  2MOX A;  3X25 B;  2OTL T;  1VQN Q;  2KAF A;  4ZN3 A;  1SHF A;  4M7A G;  3EH2 A;  4F7U A;  2X51 A;  2GFU A;  5FU7 C;  1JBM A;  2A7Y A;  2DXC A;  2LCC A;  3SWN C;  3SB2 A;  2DVE A;  1K0X A;  1LOJ A;  2RNA A;  3REA B;  4BB7 A;  1QWE A;  4HCC A;  2KYM A;  3L2V A;  4KT0 E;  4QQD A;  4LD9 K;  1WHK A;  4DQ2 A;  3LH0 A;  2V8I A;  1AWJ A;  2L2P A;  3VS7 A;  3OYJ A;  2RB6 A;  4LDV A;  3VS6 A;  3CCE T;  2X4Y A;  2CZ0 B;  3JV3 A;  4BDZ A;  1MV0 B;  2DRK A;  2L3P A;  1OV3 A;  2DXB A;  2ZPH B;  3RUX A;  3VS1 A;  4KUD K;  2HEQ A;  3PGG A;  1X2Q A;  2W10 A;  4IUU A;  3G1J A;  1Q82 C;  1GBR A;  2RHZ A;  5IH2 A;  1WPY A;  5C6S A;  3OYI A;  1BYM A;  4J9D A;  2XG8 D;  2MCN A;  4E7H A;  3MCA B;  3OSV A;  4FYV B;  5GAN 7;  2ROT A;  1EIF A;  4RMO A;  1IGU A;  2DPP B;  3QO3 A;  2DL5 A;  1YHQ Q;  2ECZ A;  3CCV T;  4XAX B;  1Q7Y R;  5KE3 A;  2FB7 A;  2LMJ A;  2PU9 B;  2DYB A;  3EFR A;  3CME Q;  1AD5 A;  2EAY A;  2QAZ A;  3UT1 A;  2KEA A;  1XQH A;  5IXB A;  4CC7 A;  1GCQ C;  5HCK A;  1G3W A;  2EQU A;  8AT1 B;  1QCO A;  1I0C A;  3CCE A;  3G6E Q;  2DIQ A;  4M7D G;  4BE2 A;  1TTH B;  4IUV A;  3H0I A;  2VGN A;  3MEU A;  4M77 F;  2H8H A;  4JRP A;  4JJB A;  1NPR A;  1T3S A;  4C8Q B;  3EGD B;  1TG0 A;  2KE9 A;  3AT1 B;  1XNI A;  2RM4 A;  2DIL A;  1UGQ B;  5I2S A;  1W2B S;  4QQ6 A;  1I5L A;  3QJ6 A;  3VU3 C;  1PRM C;  2DF6 A;  2KNB B;  3I5R A;  2DZ9 A;  3M4G A;  4JPB W;  3CCV A;  1R8O B;  1VYU A;  1Q81 U;  5IHI A;  2JXB A;  3V8K A;  2KSS A;  1U1T A;  2XMF A;  2MAM A;  1RAF B;  4QKU A;  4LXC A;  2E4H A;  1M27 C;  2GBQ A;  5DLO A;  4C5I A;  3JB9 J;  2A0F B;  2JJ9 A;  1ZBX A;  1AWW A;  3CC2 Q;  2EGC A;  4FL6 A;  4OMM A;  4OMQ A;  3M0T A;  4A63 B;  4EPC A;  1UJ0 A;  4M77 C;  1ABQ A;  5GAN j;  3L2W A;  5LJ3 g;  5KYW B;  2CUD A;  3JB9 D;  3CMA T;  1QVG S;  3JCM f;  1EX4 A;  2L3Q A;  1QKW A;  3THK A;  1ZUY A;  1OU8 A;  2YSQ A;  3E1S A;  3EG0 A;  1NG2 A;  4Y92 A;  3X28 B;  4M78 A;  3QSU A;  2YRV A;  4C5H A;  4BDY A;  2JTE A;  1VQ5 Q;  3HKS A;  2GF7 A;  2MWP A;  4KGX B;  5GAM f;  1S72 T;  1M8M A;  2LP5 A;  5GAO q;  3CPW S;  2K3B A;  3E19 A;  4RUG A;  3CXC S;  2NUP B;  9ATC B;  5GAM g;  1Y57 A;  1K8A U;  5FWC A;  1C0M A;  3V7S A;  3OS1 A;  4OMF B;  1YWP A;  4L6V 5;  3J80 E;  1Q86 C;  1RAG B;  1VQ4 Q;  5LJ3 d;  3QWY A;  2X3X D;  2L89 A;  2BZX A;  4AMC A;  4XTZ A;  2GCX A;  2L3R A;  5FU6 B;  4M7A E;  4UC4 A;  3PTA A;  1QVF A;  4IUQ A;  3HRU A;  4FYW B;  2CP7 A;  3X26 B;  1MNE A;  2YHT A;  2E3H A;  1S72 A;  2FYK A;  1FMW A;  6AT1 B;  2P84 A;  4FCY A;  2M51 A;  2DMO A;  4DBR A;  2HQX A;  1VQO Q;  3CCQ Q;  2DNU A;  2RJC A;  2RK2 A;  4J6Y A;  2X35 A;  5CKE A;  1GXI E;  1SG5 A;  2JUF A;  2FO0 A;  4OMN A;  2Y4X A;  2DEU A;  1UGR B;  4II1 A;  1M5Q 1;  2XID A;  4JZ3 A;  2OTJ Q;  3JB9 F;  4DBH A;  5CO7 A;  1G3T A;  3JCM c;  3L2U A;  1W4S A;  4FT2 A;  1TUC A;  2DTO A;  1YIJ T;  2BZ8 A;  2HZY A;  4N0A A;  4C92 A;  2IPO B;  2DER A;  4OMO A;  3HSB A;  1JXO A;  4J9B A;  1U06 A;  1ZSZ C;  4PFZ A;  2M0Y A;  5AYF A;  4J9C A;  3FB9 A;  3NHN A;  4LDY A;  4M75 A;  4J9H A;  3RIR A;  3QDR B;  1H8K A;  1KD1 U;  1NYF A;  4OMP A;  1ZSZ B;  2KMT A;  1I1J A;  1HYO A;  5FRO A;  4HCZ A;  2K57 A;  4LDX A;  2O9S A;  1AT1 B;  2RMO A;  1BIA A;  2LX9 A;  3VS2 A;  3CC4 Q;  1YJW Q;  1Q81 C;  1OI1 A;  4V2S A;  4E6R A;  2DK3 A;  1D1C A;  4DA4 A;  5GAN 6;  4F16 A;  4AG2 C;  3CD6 A;  4FSS A;  3QWX X;  1YI2 A;  4WF2 A;  3GLX A;  4ZTJ A;  1LNX A;  4M77 G;  3M55 A;  3BDU A;  4HKE A;  3HTR A;  4DBF A;  1FYN A;  5FRM A;  3UDC A;  1VQ7 A;  1HK9 A;  1M90 C;  4ME7 A;  1VQ9 T;  3A8O B;  4HVW A;  4FW1 A;  3E2U A;  1B34 A;  3FLG A;  2CH4 A;  3H0H A;  1W2B A;  4LN2 A;  2O4X B;  1KQ1 A;  3L2Z A;  2D1X A;  4ATO A;  1BCO A;  4QVD A;  4PJO D;  2V1Q A;  1FX7 A;  3C0C A;  3A1P A;  3WVE B;  2ENM A;  3CPF A;  3LGF A;  3M53 A;  5LJ5 h;  4F7U B;  3TEE A;  5GAN f;  4MZP A;  2BE7 D;  3UAT A;  1K9A A;  2YUO A;  3S3M A;  5GMK l;  3M57 A;  1N9R A;  3EFO A;  5FRN A;  5GAN g;  2JOY A;  3O8V A;  3RKW A;  5GMK i;  2EW3 A;  1QVG A;  1K8A C;  1Z9Z A;  4PLL A;  4D8D A;  3S3N A;  3JRZ A;  3SHW A;  4WCI A;  1VQ9 A;  3LH5 A;  1CKB A;  4A54 A;  1VQL A;  1DJ7 B;  1KIK A;  4Y28 E;  1YJ9 T;  3M9Q A;  3QKJ A;  1XTD A;  2QEX Q;  4B6M A;  1F1B B;  1YJN Q;  2BE9 B;  1Q82 U;  3FJP A;  3CCJ T;  2RJF A;  1UGV A;  3HFO A;  1G2B A;  1WLP B;  1BU1 A;  4NOY A;  1X75 C;  4CRI A;  2AHJ B;  4OB3 B;  2EQM A;  3EGX A;  3CPW A;  2QQR A;  1BIB A;  3I55 T;  3CXC A;  3OYD A;  4J8O A;  1IRX A;  1HD3 A;  2FPE A;  4D6W A;  2QDY B;  2VB6 A;  3V7R A;  4ANJ A;  4MMK A;  2MPX C;  3NMZ C;  3GPL A;  1X6B A;  1NE8 A;  3U23 A;  3LWI A;  1M9S A;  2L3S A;  2VXE A;  3ME9 A;  5LJ5 e;  2QGF B;  1OYX A;  2K3Y A;  3PNW C;  3CBP A;  4XK8 E;  4P5N A;  1VQ8 A;  2QTV A;  2A3L A;  3OYB A;  3QXE B;  2SRC A;  1ZUK A;  2DL4 A;  1YJ9 A;  1VQM Q;  3QZ5 B;  2RQV A;  4PJO F;  3PE0 A;  3CCJ A;  2PVG B;  1XJW B;  4C8Q D;  2LJ0 A;  1VQN A;  1K73 U;  3VUB A;  1M4Z A;  2EWN A;  5KCH A;  3TSW A;  3LW5 E;  2ED0 A;  4FT4 A;  2OJ2 A;  1QCN A;  2CS7 A;  2JW4 A;  5KYX A;  3MEA A;  3L42 A;  1UE9 A;  3CCL T;  2M0O A;  3CCR Q;  1KHC A;  1ZA1 B;  4J9E A;  1EFN A;  2HAX A;  3MHX A;  2O01 E;  4PLI A;  4HCB A;  2NUZ A;  5IHN A;  1QW1 A;  5HKC A;  3JB9 G;  3M54 A;  3JAM E;  1PWT A;  1UGS B;  2QGG A;  3EHR A;  5M9O A;  1H3Z A;  2AKL A;  3TU4 K;  1V1C A;  1WX6 A;  2F1L A;  3C95 A;  2KR3 A;  3TRE A;  2M02 A;  1QP3 A;  1K76 A;  3H6Z A;  3L2R A;  3QZ9 B;  3KBG A;  3R6O A;  4GLM A;  2O2O A;  3GP8 A;  3JCM P;  4PJO C;  1SSF A;  2IIM A;  4J6W A;  3VV0 A;  3ULR B;  3G71 Q;  1ARK A;  1X69 A;  2JS2 A;  2E10 A;  2EQI A;  3INZ A;  3OS5 A;  3VS4 A;  1UDL A;  2BUD A;  1Y07 A;  2DO3 A;  3TCJ A;  2J6K A;  1M1K C;  2EPD A;  2K6D A;  2JZ2 A;  3OYA A;  2EGE A;  4M78 B;  3CCL A;  1QP2 A;  4YTL A;  2QA4 T;  1BI1 A;  2YUN A;  2PUO B;  2VYT A;  1WXB A;  1P92 A;  1JJ2 S;  2AZV A;  2P4R A;  4J5Y A;  4M77 E;  2AK5 A;  4R0K A;  1VYV A;  3VYH B;  1UFF A;  4MDW A;  2K9G A;  3LYI A;  2LDM A;  1D1A A;  2AZS A;  2K5F A;  1RI9 A;  1UEB A;  3JB9 I;  1Y96 A;  3AHU A;  3OMG A;  3PVQ A;  4LDU A;  4PFO A;  1WJR A;  1YIT T;  1C6V X;  1OPL A;  1OX9 A;  3TSZ A;  3EG2 A;  1AHJ B;  2HNI A;  4F17 A;  2DKG A;  2JM8 A;  1GRI A;  1WNL A;  2KRS A;  2VXF A; 
#chains in the Genus database with same CATH homology
 5GAN d;  2B8A A;  3S6W A;  4C8Q F;  4M7D D;  3BFM A;  3JCM f;  1Q86 U;  2KK4 A;  4M75 F;  3LGL A;  3QPH A;  4X9C A;  5LJ5 f;  3GIB A;  5D6X A;  2XD0 A;  3M4Y A;  3RMQ A;  3FDR A;  2X4J A;  5CKF A;  5D6W A;  4KBM B;  3E1S A;  1VQM T;  4BI3 A;  2KDS A;  1YJN A;  3X28 B;  5A0G A;  3Q1J A;  1OZ3 A;  3V7C A;  2R5M A;  4M78 A;  3QSU A;  3QHS A;  4NS5 A;  2YRV A;  3NTI A;  1NPP A;  3T9N A;  2CZ7 B;  4C5H A;  4BDY A;  4M7D E;  1Q7Y C;  4HT9 A;  3DB4 A;  2QA4 A;  4M7A A;  4BY6 B;  4JLG A;  4M78 F;  3HKS A;  5GAO l;  2QI2 A;  1Y7X A;  2GF7 A;  2MWP A;  3DLM A;  4LDW A;  4M75 D;  5GAM f;  4BE1 A;  1S72 T;  2LTO A;  4N4G A;  2XDP A;  4M7A F;  3A5Z B;  5GAO q;  3CPW S;  1YHQ T;  4KUI A;  4OVA A;  4A4H A;  3UPU A;  4J7F A;  1KC8 U;  3E19 A;  4ELZ C;  3CXC S;  4XU1 A;  4ZGJ B;  1YIJ A;  3M59 A;  4C8Q E;  5GAM g;  4EMK A;  3CME T;  4DOV A;  3NTH A;  2OAU A;  3HL8 A;  4M75 E;  5IN1 A;  3ZBD A;  1K8A U;  3P8B B;  3OS2 A;  3V7S A;  2DXU A;  3OS1 A;  1YIT A;  4OMF B;  5IT9 E;  5CK9 A;  4PNO A;  5LJ3 h;  5LJ3 j;  2XHC A;  3SFM A;  3OMC A;  5GAO r;  5IAY A;  4C0D C;  4L6V 5;  1YBY A;  2K3X A;  3G6E T;  3J80 E;  1Q86 C;  4M7D B;  1BI2 A;  1G3Y A;  2JTM A;  4C0Z A;  4C8Q C;  5LJ3 d;  2CYZ B;  5EG2 A;  2FHD A;  2KY9 A;  2DAQ A;  4M78 E;  3CBM A;  2L89 A;  5DM7 R;  3MET A;  3MP6 A;  4BUG A;  4XTZ A;  4C92 B;  5GAN e;  2DD5 A;  2GCX A;  3RER A;  1ZQ1 A;  2E6N A;  2JVV A;  2L3R A;  4OGE A;  5FU6 B;  2GFA A;  4M7A E;  4UC4 A;  4X34 A;  2CZ1 B;  3PTA A;  1QVF A;  3M56 A;  4C0D B;  3A8H B;  2ZGW A;  4E47 A;  4IUQ A;  3HRU A;  2DTH A;  3ER0 A;  3JCM h;  3OYY A;  3ZFJ A;  4E7L A;  5CQX A;  4HT8 A;  3VJP A;  2FL7 A;  5J39 A;  1K73 C;  1VQ5 A;  3X26 B;  2K5I A;  4IUR A;  1G5V A;  2YHT A;  2ZPF B;  4M75 B;  4M78 C;  3G71 T;  1H64 1;  5KE2 A;  2PVO B;  2R57 A;  3N5B B;  4F7U G;  1S72 A;  2FYK A;  1I4K 1;  2RO0 A;  1VQO T;  3CCM A;  3C12 A;  4XU0 A;  4M7A C;  2E5Q A;  2HQX A;  2LCL A;  2EKO A;  1YHQ A;  2LQ8 A;  3OQ5 A;  2QQB A;  4JS5 A;  3C4S A;  3L1A A;  2K5L A;  2RJC A;  2DXT A;  2RK2 A;  2NLU A;  4XQ3 A;  4J6Y A;  3OW2 S;  2X35 A;  3VYG A;  4XTY A;  2WSC E;  5CKE A;  1GXI E;  5GAM h;  3CME A;  4TVR A;  2BKD N;  1WGS A;  3QYG B;  2PQW A;  5CKD A;  2LVM A;  1IRE B;  2D9T A;  3OYN A;  3V8L A;  4E7J A;  2JUF A;  1M1G A;  5GMK m;  4J7I A;  2JNG A;  2Y4X A;  2ZPG B;  3HRT A;  4QVZ A;  1UGR B;  2RH2 A;  4A4G A;  1VQK A;  3J7A F;  4C0F A;  4EMK C;  4II1 A;  4KUL A;  4NL2 A;  3G4S T;  1RL2 A;  3DB3 A;  2RK1 A;  1X6O A;  4Z02 A;  3LWH A;  4M7D A;  1M5Q 1;  2XID A;  3JCM V;  3WXM B;  1YJ9 T;  3JB9 F;  3M58 A;  5CO7 A;  1G3T A;  3JCM c;  3L2U A;  3G6E A;  1D3B A;  5I2M A;  1W4S A;  3C94 A;  3HHT B;  2P0P A;  3OSS C;  4FT2 A;  3RKY A;  4JRQ A;  2CKK A;  2DTO A;  4FSX A;  1JRI A;  1YIJ T;  4BI4 A;  1YCY A;  4N0A A;  3JB9 H;  3VKI A;  4C92 A;  3CC2 T;  4PL6 A;  4PJO G;  4A4E A;  3HSB A;  3QUI A;  1KQS A;  2ZPB B;  3HRS A;  3PIP A;  5LJ3 e;  2QQ9 A;  3LX7 A;  5AYF A;  4C92 F;  1PSE A;  3MO8 A;  4Y91 A;  1M90 U;  1QVF S;  2R5A A;  3FB9 A;  2WSF E;  4LDY A;  1VUB A;  2EFI A;  1B34 B;  2P0Q A;  4M75 A;  4A4F A;  2CGH A;  2HQE A;  4BD3 A;  3RIR A;  3QDR B;  2RI5 A;  1FXX A;  2EIF A;  4JLI A;  3G71 A;  2M1H A;  3E9F A;  2XKO C;  4IUP A;  3CCU A;  2E70 A;  2RJD A;  4BY6 C;  3JCM X;  1KD1 U;  2KMT A;  2XDD A;  1VQO A;  3CCQ A;  1I81 A;  5FRO A;  3OYE A;  4HCZ A;  2K57 A;  3EFS A;  3X20 B;  4C92 D;  1HXD A;  5HK3 A;  2QQA A;  5CIU A;  1YJW T;  1BIA A;  2LX9 A;  3ASK A;  3QII A;  1Q81 C;  5FU7 B;  4NL3 A;  2XIC A;  1MGQ A;  5DLQ E;  3CC7 A;  3JCM g;  4C5G A;  1OI1 A;  4V2S A;  3SWN B;  2DK3 A;  2VUB A;  5LJ5 g;  3EAE A;  1VQ5 T;  4ZGE B;  4MZM A;  4OB0 B;  4XTW A;  4DA4 A;  1OZ2 A;  1M8V A;  5GAN 6;  5C0M A;  5CKH A;  1N27 A;  3SD4 A;  3G4S A;  3VUZ A;  2VGM A;  4QW2 A;  1WQW A;  3CCM T;  4RKU E;  4C92 E;  2ZCF B;  2E41 A;  4O5V A;  3H8Z A;  3CD6 A;  4JUV A;  1YI2 A;  2L5Q A;  4A53 A;  4WF2 A;  2YLC A;  3GLX A;  4XTX A;  5KH6 A;  4ZTJ A;  1LNX A;  1KQ2 A;  4M77 G;  3M55 A;  3G7Z A;  1XOV A;  3BDU A;  4HKE A;  4M7D C;  4J83 A;  4L59 A;  5CVI A;  4B9W A;  4ZN1 A;  3CC2 A;  3P8H A;  3RMS A;  5FRM A;  3UDC A;  1UGP B;  2LRQ A;  1VQ7 A;  3MP1 A;  1HK9 A;  2Y90 A;  5J26 A;  4N0A C;  3HPW A;  2QXF A;  4ME7 A;  3URG A;  4C92 C;  1VQ9 T;  2XI9 A;  1VQK T;  3A8O B;  1KG1 A;  5FU6 C;  3FLG A;  1B34 A;  1W2B A;  3KXT A;  4OF1 A;  2MF2 A;  3I55 A;  3OYK A;  1VQ4 T;  2O4X B;  1KQ1 A;  3CBO A;  2KQW A;  3L2Z A;  3FIF A;  3MEV A;  3MP8 A;  3NFC A;  4FIB A;  5GAO m;  1KD1 C;  1D3B B;  4ATO A;  3DLL A;  4QVD A;  4HA8 A;  4M75 C;  2Y4Y A;  3BW1 A;  3GNF B;  4PJO D;  2RI2 A;  3JCM J;  3GF5 A;  4QQG A;  4BAC A;  2FVU A;  4GY5 A;  3I56 T;  1FX7 A;  4IKF A;  3A8G B;  3CC4 A;  1YJW A;  3WVE B;  5GAN 4;  2EQJ A;  2RD1 A;  1JJ2 A;  5GAO n;  4JS4 A;  2E65 A;  3CPF A;  3QYH B;  4FU6 A;  2RJE A;  3SWN A;  3GOX A;  2DJZ A;  3LGF A;  2D6F A;  3BDL A;  2PVD B;  3M53 A;  5LJ5 h;  5LJ5 j;  3L2Q A;  4F7U B;  3RES A;  3TEE A;  4RCC A;  5GAN f;  4N4H A;  3JCM b;  3PIO A;  3A8M B;  4OB1 B;  4MZP A;  1KHI A;  2F5K A;  3PMI A;  3SDZ A;  4O6J A;  5FLX E;  3CCU T;  3JCM d;  4E7I A;  2MWO A;  3QJY A;  2DTI A;  2WSE E;  4RCB A;  5LJ5 d;  2KVQ G;  4IUT A;  3S3M A;  3HFN A;  3CCQ T;  1KC8 C;  5D6Y A;  1O9S A;  5GMK l;  3M57 A;  1N9R A;  3OS0 A;  5FRN A;  5A2Q E;  2X4X A;  3ZEH A;  5GAN g;  2JOY A;  3O8V A;  3LLR A;  3RKW A;  3CC7 T;  5A0D A;  5GMK i;  5GAM j;  1QVP A;  3J81 E;  1QVG A;  4MML A;  1K8A C;  5DY9 A;  2LNV A;  2LT4 A;  4PLL A;  2EJF A;  3S3N A;  3JRZ A;  4C8Q G;  1VQ9 A;  3X24 B;  4QVC A;  5GAM d;  4A54 A;  1VQL A;  1DJ7 B;  5GAO p;  4CI0 C;  2OTJ T;  3UWN A;  2O4X A;  4VUB A;  2E12 A;  3CD6 T;  2JN0 A;  4DQ2 A;  4Y28 E;  1YI2 T;  1K9M U;  2DIG A;  4JRK A;  4M77 D;  4MZT A;  1UB4 A;  3CEY A;  4RG8 A;  2BIV A;  2X4W A;  3M9Q A;  3OBW A;  3QKJ A;  3OYC A;  1XTD A;  2H3J A;  5CKB A;  2WAC A;  3JCM W;  2RHX A;  4PJO B;  1IZ6 A;  3PMT A;  1Q82 U;  2JTF A;  5GAN 3;  3FJP A;  3FRN A;  2CZ6 B;  5KCO A;  2PUK B;  3I56 A;  2RJF A;  3JSC A;  3CCJ T;  3HFO A;  1RI0 A;  1LJO A;  1VQ7 T;  2ZPE B;  4M78 G;  2IVW A;  4NOY A;  3X25 B;  2OTL T;  1X75 C;  4CRI A;  2KAF A;  2AHJ B;  2RA2 A;  4OB3 B;  4XU2 A;  4ZN3 A;  3JCM Q;  3OY9 A;  4M7A G;  2EQM A;  2P0K A;  4F7U A;  1ZHI A;  4FM4 B;  3CPW A;  2QQR A;  5CR2 A;  2GFU A;  1BIB A;  1JBM A;  2EYQ A;  2A7Y A;  5FU7 C;  3DKM A;  2DXC A;  4ELY C;  3I55 T;  1VQ6 T;  2E6Z A;  2LCC A;  3CXC A;  1NJI U;  5LJ3 f;  3SWN C;  3KUF A;  4J8O A;  3SB2 A;  2DVE A;  2ZPI B;  3OYD A;  4F7U F;  1LOJ A;  4N4I A;  1WJQ A;  4D6W A;  2ZZD A;  2QDY B;  3V7R A;  4BB7 A;  4MMK A;  3CCS T;  3GPL A;  4JJN K;  4HCC A;  3CC4 T;  2XU8 A;  4L5G A;  1NE8 A;  5HK0 A;  3JCM e;  3LWI A;  4B9X A;  4KT0 E;  3L2V A;  1M9S A;  2VC8 A;  2VXE A;  5GAN h;  3ME9 A;  5LJ5 e;  1I8F A;  4QQD A;  4LD9 K;  5L8R E;  4J6X A;  3QBY A;  1OYX A;  2K3Y A;  3LH0 A;  2V8I A;  3CBP A;  1NZ9 A;  3PNW C;  4P5N A;  3OB9 A;  4XK8 E;  1VQ8 A;  3OYJ A;  2A3L A;  4LDX A;  2RB6 A;  4LDV A;  2RHI A;  3CCE T;  2X4Y A;  2CZ0 B;  4LD6 A;  3OYB A;  3QXE B;  1VQ4 A;  4BDZ A;  1MHN A;  2OTJ A;  2DXB A;  2ZPH B;  1K9M C;  3RUX A;  1BI3 A;  4KUD K;  5CQY A;  3FEO A;  4M77 B;  3PGG A;  4EMG A;  4PJO A;  1YJ9 A;  2QEX A;  2F69 A;  3OBY A;  5GAM e;  4IUU A;  3FC3 A;  3V8J A;  1Q82 C;  2RHZ A;  1WPY A;  4PKC C;  3QZ5 B;  1X01 A;  5C6S A;  5GAN 2;  3OYI A;  4PJO F;  1M90 C;  3PT9 A;  4F7U E;  3CCJ A;  2PVG B;  1BI0 A;  1M1F A;  4C8Q D;  1BYM A;  2V8K A;  2XG8 D;  3WVD B;  2G3R A;  4EDU A;  4E7H A;  1KQS S;  1K73 U;  5HY6 A;  3MCA B;  3VUB A;  1VQN A;  1M4Z A;  3S3O A;  2EWN A;  2QQS A;  5KCH A;  1WJS A;  1N8R U;  1VQL T;  3OSV A;  5GAN 7;  1VQP T;  5LL6 S;  3LW5 E;  1EIF A;  4FT4 A;  1NJI C;  2CS7 A;  4RMO A;  1VQ6 A;  2DPP B;  2DD4 A;  1FWZ A;  3MEA A;  3QO3 A;  3OW2 A;  3L42 A;  3RKX A;  3CCV T;  4XAX B;  3OYG A;  4JDS A;  5KE3 A;  3CCR T;  1V29 B;  1M1K U;  2FB7 A;  2QTX A;  4XTU A;  3CCL T;  2M0O A;  1KHC A;  2PU9 B;  4M78 D;  3EFR A;  2EAY A;  3UT1 A;  5GMK h;  5GMK j;  3CCS A;  2GQV A;  2M9U A;  3MHX A;  2HAX A;  2I2L A;  1XQH A;  2VV5 A;  4M7A D;  2O01 E;  4PLI A;  1G3W A;  4MDX A;  2RI3 A;  4ZTF A;  4HCB A;  2DZC A;  3CMA A;  1QW1 A;  5HKC A;  2EQU A;  3JB9 G;  1N6A A;  3M54 A;  3JAM E;  5M9O A;  1UGS B;  4DOW A;  4R56 A;  3CCE A;  1G3S A;  1H3Z A;  2C06 A;  4PJO E;  2DIQ A;  3TU4 K;  4M7D G;  4BE2 A;  3C95 A;  3PFS A;  5CCA A;  2L8D A;  3TRE A;  3OYH A;  4M77 A;  1Y96 B;  4C5E A;  4IUV A;  2MMP A;  1QP3 A;  3H6Z A;  1WQ7 A;  1VIE A;  3F70 A;  2VGN A;  1VQM A;  2LQK A;  2HD0 A;  3L2R A;  4C92 G;  3QZ9 B;  3MEU A;  3KBG A;  4M77 F;  4JRP A;  3QG1 A;  2P4T A;  2K4Y A;  3R6O A;  3OYF A;  1NPR A;  4OGC A;  1U8R A;  3HP9 A;  3GP8 A;  3JCM P;  4C8Q B;  1VIF A;  4PJO C;  1VQ8 T;  1SSF A;  4R55 A;  4J6W A;  5I21 A;  3OYL A;  1PSF A;  2EQK A;  3VV0 A;  1N8R C;  3A8L B;  3BY7 A;  4M75 G;  1Y71 A;  1XNI A;  2E10 A;  2RM4 A;  1U1S A;  1UGQ B;  5I2S A;  1VQP A;  3INZ A;  3OS5 A;  4QQ6 A;  1W2B S;  1I5L A;  3QJ6 A;  5J3B A;  2BUD A;  1Y07 A;  2K2V A;  3VU3 C;  1TH7 A;  2DO3 A;  3TCJ A;  2MI6 A;  1N9S A;  3M4G A;  2DZ9 A;  2QEX T;  3CCV A;  1YJN T;  1R8O B;  3OYM A;  2IG0 A;  1JB0 E;  1M1K C;  4Q5W A;  2DEQ A;  4XU3 A;  4A4K A;  4GLK A;  2M16 A;  2JZ2 A;  3OYA A;  3CCR A;  1Q81 U;  1BKB A;  3MEW A;  4M78 B;  4RG2 A;  1QP2 A;  3CCL A;  2E64 A;  1O75 A;  4YTL A;  2QA4 T;  1BI1 A;  2OTL A;  2F5T X;  3V8K A;  1VQN T;  1Q7Y U;  2KSS A;  2PUO B;  2VYT A;  2D0Q B;  4M7A B;  2RHU A;  4C0G A;  3OA6 A;  2V8J A;  1U1T A;  1P92 A;  1JJ2 S;  2LC4 A;  3E9G A;  4J5Y A;  2XK0 A;  2MAM A;  2E1H A;  2RHY A;  4M77 E;  5GAN 8;  2XDB A;  3VYH B;  4MDW A;  3LYI A;  4BE0 A;  2LDM A;  2K5F A;  4EMH A;  1UEB A;  4M7D F;  4XTV A;  5DLO A;  1Y96 A;  5GAN 5;  4C5I A;  5GMK e;  3JB9 I;  3JB9 J;  3GNG A;  3AHU A;  1ZBX A;  2EJG A;  2HBP A;  3NTK A;  4FL6 A;  4EMK B;  3OMG A;  5CAI A;  2R58 A;  3M5A A;  4LDU A;  4OB2 B;  1WJR A;  2LT1 A;  2YLB A;  4ZGD B;  4EPC A;  1YIT T;  4M77 C;  5GAN j;  3L2W A;  5A0L A;  3P8D A;  1AHJ B;  4X9D A;  2HNI A;  4BI8 B;  4C8Q A;  5LJ3 g;  4E7K A;  4OP0 A;  2DKG A;  3JB9 D;  3CMA T;  1QVG S;  4JRI A;  1WNL A;  2EJ9 A;  2VXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...