1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
4OB0B 2DXCA 2PVGB 2CZ7B 2PUKB 3QZ5B 3VYGA 2O01E 3WVEB 2QDYB 2ZPEB 2PUOB 3X26B 1IREB 2WSCE 3X25B 2ZPBB 1UGSB 3QYHB 1GXIE 2DPPB 2CZ0B 2PU9B 3QXEB 2CZ6B 1PSEA 3X24B 1UGRB 2DD5A 4RKUE 3A8LB 3VYHB 3A8GB 1AHJB 4ZGJB 2D0QB 4L6V5 3X20B 1JB0E 3QYGB 2ZPGB 3X28B 3A8HB 2ZPIB 1QP2A 4OB3B 2ZCFB 2ZZDA 2PVOB 2WSEE 4XK8E 4ZGDB 3HHTB 1UGQB 2CYZB 3QZ9B 1UGPB 2DXBA 4FM4B 2DD4A 2ZPHB 1V29B 5L8RE 3WVDB 4KT0E 3A8MB 1DJ7B 4Y28E 2AHJB 2ZPFB 2PVDB 2WSFE 4ZGEB 2CZ1B 3A8OB 1QP3A 4OB2B 1PSFA 3LW5E 4OB1B
chains in the Genus database with same CATH superfamily
2KRSA 1BI1A 4RTYA 2VB6A 4M77E 2R57A 3G4SQ 3P8BB 3L2ZA 1SRMA 2DL7A 4HXJA 4XTYA 3ME9A 1EIFA 1KHIA 2OX7A 2EFIA 3G7ZA 4A4HA 5GANg 4WF2A 4E7HA 2AKKA 4XTZA 3HL8A 1FXXA 4XQ3A 2RO0A 4L59A 2DVJA 2RQUA 2GBQA 1ABQA 3GF5A 4C0DC 1XNIA 1UGRB 3OYMA 2PNIA 4X9CA 4LDUA 4F04B 3JB9D 1O9SA 2K3YA 2CT4A 2HQXA 3OY9A 2RNAA 2JT4A 4PJOB 3VRZA 1BI0A 2LCLA 3R6NA 3VS3A 3I9QA 1RAAB 1UFFA 1SHFA 2DMOA 1AWJA 4JRPA 5LJ5g 3KBGA 3V7SA 2HEQA 4OB3B 4LDVA 4E47A 2PVOB 3LWHA 1GCPA 3HPWA 1BIAA 1D0ZA 4DQ2A 1C6VX 3CXCS 3VU3C 3QZ9B 4AFQC 2RI2A 4BUGA 3JB9F 4QVDA 4FM4B 4BY6C 1KD1U 1XTDA 3I56A 5I22A 2YLCA 3CCVA 1BU1A 2L8DA 3REBB 3TVTA 1VQOT 3A8MB 1BI2A 1BK2A 2EWNA 5ECAA 2I0NA 2EW3A 3LX7A 5CKEA 2VGNA 1M1KU 2VKNA 1K8AU 5GAOq 5LJ3d 2KE9A 5D7UA 2BZXA 2NUPA 2VYTA 4OB0B 2Z0WA 1IGUA 2RHZA 5IHIA 8AT1B 4R56A 2RJCA 1D3BB 2PVGB 1SG5A 5I2MA 2DXTA 4CC7A 1YITA 1H8KA 4EMGA 4Z88A 1YBYA 3OYNA 2KVQG 3VYGA 4OP0A 1Q86U 2L89A 3E9GA 2QG9B 3TU4K 2MIOA 2JVVA 1HD3A 2MF2A 3IQLA 3LYIA 4E7LA 1JJ2A 4C8QA 2P0KA 4ZN3A 3UT1A 2C0IA 2LX9A 2DPPB 1SSFA 2VVKA 4ATOA 1M2VB 1UGVA 3M0RA 3H0HA 5LJ3e 2CUBA 4O5VA 2DNUA 1I4K1 2M02A 5KH6A 1WXUA 2D9TA 4FSXA 2NLUA 4M75F 2RJDA 4E2FB 1M8MA 1RABB 4M7AG 1U06A 2FRWA 2LVMA 2EKOA 4J7IA 4M7DA 1T0JA 1NEGA 3S3NA 1RAFB 4HCZA 1VQ7A 1VQMA 3LH0A 3ER0A 4M7AF 4JUVA 1W6XA 3CCST 1QP2A 5DLOA 1TG0A 2YRDA 1VUBA 2DEQA 8ATCB 2G3RA 1WXTA 1NG2A 4EIKA 1CSKA 4FSSA 4RMOA 2GTOA 2IIMA 1R77A 4PJOC 3CXCA 1VQ5Q 1MMAA 4JJBA 2CGHA 1OX8A 1OPLA 2HQHA 3L2VA 2DD4A 1K73C 2DL5A 2JNGA 3RNJA 3SB2A 1ZUUA 3C0CA 5L8RE 3PIOA 4M78G 5M9OA 4EPCA 2EGAA 3J81E 3V8JA 1TOVA 1VQ6T 3FEOA 3G6EA 4LXCA 4F17A 4JRKA 5CKHA 2FPDA 3OYBA 3FDRA 5CK9A 5IH2A 2QXFA 1MMNA 1RL2A 5GAMf 1K73R 3CC4A 1PHTA 2XHCA 2YWWA 1YWPA 1JJ2P 1QWFA 1Q7YC 3META 3FC3A 1YJNA 3CCJA 2SRCA 1NJIC 2R58A 1KC8U 4M75E 1Q86R 4HVWA 2ZPBB 4FYWB 3VS7A 1UGSB 1VQOQ 1TWBA 2BZ8A 2CZ0B 1S72Q 2HL3A 3OW2S 2DA9A 2ED0A 2XDPA 1Q7YR 1K0SA 2G6FX 2DD5A 2DTOA 1WJSA 5KYYB 1YFNA 1IHWA 4LDXA 2XG8D 2MCNA 4J8OA 2COWA 7AT1B 2KBTA 1TUCA 4M7DD 2EKHA 5EC7A 4ZGJB 2JMCA 1GRIA 2DF6A 3RBBB 2DBMA 3G71A 3TREA 2LCCA 3FB9A 2AKLA 2EQMA 1PCXA 2K2MA 2ZPIB 5KYXB 2DE0X 4J9GA 2HL5C 3CXCP 4UC4A 4BI8B 3I5RA 3OS2A 4HVUA 3EGUA 1LOJA 2X4YA 2BE9B 2FB7A 2K4YA 4PFZA 1X6BA 3HRSA 4BACA 1QCNA 2H3JA 2YUPA 2CYZB 1ZBJA 4D6WA 1F1BB 3JCMd 1VQLQ 2RQWA 2R5AA 4ME7A 4J9BA 2VASA 2ED1A 4A54A 4OGEA 1OU8A 1ZA2B 1G3WA 2LQWA 4XU3A 2CP5A 2P4TA 3JCMc 3H8ZA 2DYIA 3A8OB 4Z8AA 1N8RC 1KC8C 4LUDA 4M7AB 4OB2B 1YJ9T 4OMOA 4JRIA 2E4HA 1IRXA 1P92A 3LW5E 1VQ9Q 5FRMA 2D8JA 2QQAA 4RCBA 3JCMe 2FL7A 5A0GA 3PGGA 2M9UA 4PJOA 2QQBA 3CMAA 1YJWT 3AT1B 3MO8A 2EJFA 1WA7A 4C92G 5KCHA 3MPUB 1QVFS 2JTEA 1N8RR 4FT4A 1KC8R 2WSCE 1WYXA 3T9NA 2JJ9A 5D6YA 3CCET 4PJNA 1B07A 1VIEA 3CBPA 3NPFA 2Y90A 4C92F 5FLXE 3L2UA 2D1XA 3OW2A 2MWPA 1WPYA 2FHDA 2YLBA 4JJNK 3MP1A 3UPUA 2JZ2A 4LDYA 2J06A 3GNFB 5FWBA 3EG9B 1NLOC 2E64A 5FW9A 1JXOA 2LRQA 1VQPT 1WHJA 1KQ2A 4KGZB 1FMVA 1R8OB 1NE8A 1VQKT 3A98A 5J26A 2PTKA 3QKJA 3H6ZA 2DRMA 3CC7Q 3EFOB 1WI7A 4CI0C 3JSCA 1KQ1A 4DEXA 5D6XA 3J80E 2QASA 1YIJQ 2CKKA 1D3BA 2RM4A 2KRNA 3GNGA 1WXBA 1X2QA 1SRLA 1NEBA 2O31A 2RI3A 1AT1B 2LMJA 1MMGA 3OYFA 2XI9A 2QQRA 1X27A 4NL2A 1UDLA 2ZGWA 5DM7R 1TXQA 2KDSA 1U1SA 3CCLQ 2ZPFB 1MNEA 2WSFE 3CCMT 2V8KA 5FU7B 2VWFA 2M51A 1SHGA 2COYA 2DILA 2GTJA 4E7IA 3CC2Q 2IPOB 1IHVA 2LC4A 4M75C 4K11A 1BYMA 2K7AA 1RADB 3M0TA 2OTLQ 3OW2P 2X35A 4JJCA 4IKFA 5LL6S 2PUOB 1RI0A 1QVFA 2A3LA 1N5ZA 1AWWA 4E7JA 2E12A 3QYHB 5GMKi 1AD5A 1GXIE 4DBFA 3QO3A 4E7KA 4M7AC 1M1FA 3BFMA 4C0DB 3EH1A 4OVAA 3JCMJ 2RHXA 4OF1A 5CVIA 2DTIA 4N4IA 1OV3A 2J05A 4M77G 4C5IA 1OZ3A 1LCKA 1YCYA 2RF0A 4J6YA 1VQNT 2HZYA 3QPHA 2DZCA 3RMQA 5GAOm 1FMKA 2DL3A 1YI2A 2EYXA 2HAXA 1NYGA 4Z89A 3CCEQ 4M77F 3JV3A 2LCSA 2OTJT 2GQVA 2QK0A 3OYGA 3RDVA 4RTZA 1VQ4A 3JB9I 4A4KA 3OYDA 5KE2A 3ZEHA 2HNIA 9ATCB 2LQ8A 4RG2A 4C92B 5KYUB 3S3OA 1XJWB 4F7UF 2DETA 1OOTA 1RAEB 3ZBDA 3CCRA 2QYZA 1QKXA 3OYIA 1M3AA 5CQXA 2MOXA 1SKUB 1G3TA 3OYHA 2DFUA 3PVQA 1JEGA 1RLQC 2F1LA 5GMKm 3FRNA 3WXMB 1OQKA 2BIVA 2RPNA 1H92A 4OMFB 2JM9A 1EZZB 1FYNA 4PL6A 5GAN7 3M59A 2LQKA 2KEAA 2EQJA 4NOYA 2GFAA 1OI1A 1EX4A 1QVFP 4MDWA 3CPWS 3OSSC 2LT1A 1VIFA 3HSBA 3ULRB 1VQ8A 2FG0A 3URGA 2PZ1A 5AT1B 2O01E 1M90C 1YJ9A 3JCMX 1BCMA 1X75C 3M5AA 4QKUA 2RHIA 5KYXA 2A0FB 5CR2A 5FU7C 3CMET 4R55A 4KGXB 3CCMQ 1I07A 3DLMA 2E5QA 3A5ZB 3L2QA 3L2RA 2MAMA 2LJ0A 4X34A 1M90R 4DA4A 5C0MA 3A8GB 3U23A 1OX9A 2ESWA 4V2SA 4KGVB 1IGQA 1M2OA 3CCVQ 3JCMh 4MMKA 3THKA 1TTHB 2E10A 4F7UE 2MWOA 3A8HB 1GCQC 3UDCA 4MZMA 5GANf 1BIBA 2KMTA 1PD1A 1K76A 5GANd 4M7AA 3P8HA 4A53A 4XU2A 2X4JA 2LDMA 2LNHB 4ANJA 1VQ5T 4HKEA 1KG1A 1HXDA 4C0FA 1VYVA 4QVZA 3VS2A 3OYLA 1AEYA 2HD0A 2L3PA 5CIUA 1YHQA 2H3EB 1KK7A 2DM1A 1SEMA 1VQNQ 4N0AA 2QA4T 1NPRA 4AT1B 3CCQA 2HBPA 3CQTA 2A28A 3EGDB 3JB9G 5LJ5f 1FX7A 1M3BA 2DL4A 2ABLA 2OTJQ 1SF9A 1JRIA 2FPEA 2XK0A 3QBYA 4C92C 1JO8A 4M77B 1WQ7A 1U1TA 1N27A 3VS0A 4M78A 3EHRA 3D7SB 3NGPA 1WX6A 1UE9A 2HQEA 2K6DA 1KSWA 3I55A 5D6WA 4AG1C 1RAGB 1LPLA 3OSVA 1VQ7Q 1VQMQ 4MMLA 3EG9A 1S72T 1QWEA 2CT3A 3RERA 3V8KA 3G4SA 4R0KA 1E6HA 3M58A 3GIBA 1K73U 1I0CA 2LJ3A 2O9VA 4C5EA 4KUIA 3EFOA 4BDZA 2A37A 4A63B 1WHGA 4XTVA 4JLIA 3NFCA 2HMAA 2X3XD 2KNBB 4L6V5 2K3BA 2DTHA 4EMKB 1M5Q1 4M75G 5DLQE 1I5OB 1Q7YU 3G6EQ 1NJIU 4RTXA 3CMEQ 2F5KA 3DKMA 2J6OA 4IUVA 2E70A 1VQLT 3SFMA 4B6MA 2KT1A 3TEEA 4MDXA 2K5IA 1NPPA 1YJNQ 2DYBA 3M4YA 3CCJQ 4AG2C 1MMDA 2KSSA 1JBMA 2CSQA 2RHUA 4ZNXA 2FZKB 1MV3A 2DBKA 3PIPA 3TSZA 3BY7A 2K3XA 3OQ5A 3KXTA 1WZOA 4OMNA 1U8RA 4PFOA 5J39A 1VQ9T 4IIOA 2XKOC 4GBQA 5I2SA 3OYAA 3UA7A 4EDUA 4LD9K 2OI3A 1N9SA 2DIQA 1G83A 4XU1A 3E19A 4M78D 1AWXA 4M4ZA 2EJGA 2KT8A 2J6FA 1J3TA 2KR3A 2GF7A 1M8VA 4MZTA 3EAEA 2EYWA 1M1GA 2QQ9A 3LGFA 2QA4Q 1BCOA 2YUNA 3JB9J 3P8DA 2A08A 2YUOA 2COZA 4LUEA 2XMFA 4M77C 3JCMW 1D1CA 2J6KA 3SD4A 1AVZC 3CD6A 4HT9A 5GAMd 5GAOr 3QDFA 3A8LB 2EQKA 4C92A 5KYUA 4DOWA 5HK3A 1N8RU 1QVGS 2LJ1A 5DY9A 1R0CB 3LGLA 1WGSA 4C8QD 1WJQA 2GCXA 2VGMA 2CSIA 1B34B 1X6GA 3GBQA 5KYNA 4ORZA 4IUUA 2X3WD 3NTKA 3CC7T 3A1PA 4D8KA 2XD0A 1S1NA 1JQQA 3RIRA 1YIJT 1ZSGA 2P0QA 1NJIR 4E7ZA 2AZSA 4RTVA 1AOJA 5GAMe 2WACA 4IURA 2DXUA 2AT1B 4ZGDB 1GFCA 3INZA 4HCBA 4IIMA 3HKSA 4DBQA 2NUTB 4MZPA 1X43A 2AIRB 1OPKA 4EMKC 5IXBA 2L3RA 4F16A 4II1A 4PK4A 2EQUA 3CCLT 3KFVA 1DJ7B 2AHJB 1QW1A 3EG1A 3FJ5A 4ZGEB 1VYTA 1N6AA 1GL5A 3CC2T 3S6WA 1G8XA 2CP0A 4IUTA 3MKDA 2DEUA 5C6SA 3BW1A 2OTLT 3M4GA 2DXCA 3JCMg 4M75B 2PUKB 4LD6A 4WTOB 4M7DF 2RI5A 2RK2A 3JCMP 4DOVA 2E6NA 2I2LA 2J7IA 2M0YA 5IHKA 2VUBA 3VJPA 4M78E 1ACMB 4Z02A 2E41A 3OB9A 1ABOA 4L5GA 1YP5A 1Y07A 1UG1A 1PRMC 2MK5A 2DL8A 2HSPA 1PWTA 1MUZA 3OYKA 1Q81C 1W4SA 2JTMA 1VQOA 3CCUT 2BKDN 5LJ3j 4RKUE 4ELZC 2RK1A 5I11A 4JRQA 1B3QA 3OS0A 4JLGA 1YN8A 1QVGA 4KUDK 4PFPA 2QEXT 2KY9A 2YSQA 3JCMV 3FLGA 3MP6A 3X20B 4FT2A 5GAOl 1M3CA 1Q81R 1OZ2A 2FPFA 3EGDA 2OAWA 1X01A 2HCKA 2JOYA 1PD0A 4NL3A 2EGCA 4C8QE 2BZYA 3RMSA 4M77A 2QAZA 5IAYA 3G1JA 3M53A 1D1AA 4FYYB 2V8JA 2E65A 1ZSZB 3E9FA 3QJYA 1LJOA 2O88A 4M7DE 4HCCA 1FWZA 1WIEA 4J6XA 2DVEA 1WDXA 3MP8A 1WQWA 4PNOA 5GMKe 2X4WA 4LE9A 1H3HA 3PE0A 4QVCA 1PSFA 4QQ6A 5LJ3h 3CCSA 1KJWA 2C06A 2BTTA 4PJJA 2GGRA 3FJPA 2BUDA 4EMKA 4QW2A 2K57A 1M2VA 3JRZA 1QCOA 3X26B 2X9HA 3LWIA 4FIBA 1V76A 5CKBA 3PFSA 1QVGP 2KQWA 2GFUA 2FZGB 1VQ4Q 1MV0B 1I5LA 4PJOD 3MEWA 1NBEB 3M0PA 4FW1A 4TVRA 1VQ6A 3S3MA 1PM3A 5GAMj 2K79A 3CCVT 2E3HA 3CCRQ 1RAHB 1M27C 1TSFA 2KYMA 2V26A 1KFZA 1TH7A 4IUQA 2RD1A 5GAN6 1AHJB 2D0QB 3REAB 3VV0A 1BBZA 3MEVA 2QGGA 4XAXB 1QMCA 2L2PA 1W1FA 4GLMA 2EYQA 1A0NB 1M90U 3QSUA 1C1AA 1YITT 2L5QA 3SHWA 1Y71A 4XK8E 1NLPC 2JM8A 3CCUQ 1UUEA 1QVPA 1UJ0A 3NTIA 2QGFB 2DRKA 2EVRA 1M9SA 2P84A 2EJ9A 1X2KA 1E6GA 4A4FA 2KI7A 3MJXA 2LTOA 2AK5A 4YTLA 2QEXQ 1V29B 1IB8A 4KT0E 2QTXA 4F7UG 5FU6B 1X69A 1WHKA 1K9AA 2RJEA 2W0ZA 2QQSA 2W10A 2FEIA 1E7OA 2DJQA 4JZ4A 2M16A 3H41A 1GBRA 5GAMh 2NWMA 1I1JA 4E6RA 1VQ7T 1VQMT 2VC8A 4AFZC 1ZSZC 3BE3A 3EG2A 4HT8A 1B34A 2QDYB 2E6ZA 1YCSB 5GAN5 1IREB 3X25B 2NYSA 2NUZA 5KE3A 2XU8A 1UJYA 2JTFA 5KYYA 2VXFA 3QHSA 1PSEA 3AHUA 4HCKA 3UWNA 3QWXX 2HKQB 3OS1A 1K9MU 4AMCA 3VYHB 2NUTA 1QLYA 2O4XB 1SSHA 1UB4A 2DAQA 4J9IA 3G6ET 2RB6A 2YHTA 3OBWA 3CCQQ 2IG0A 4J9HA 4PJOE 4CC2A 1AZEA 3E1SA 3OBYA 1YJWA 3O8VA 2H8HA 3CC4T 3MEUA 4DEYA 2YT6A 1BI3A 4Y91A 5GAN8 4BDYA 1EFNA 1YJNT 3CCEA 3CCJT 5GMKj 1NM7A 4A4EA 4F14A 5IT9E 1VYUA 2KYBA 5HY6A 3QWYA 3I56Q 4M75A 3I55Q 1UGPB 2F2WA 3M56A 4KH1B 1YNZA 5CKDA 3C95A 3EG0A 4PLLA 4M7DC 4HA8A 1V1CA 1WHHA 2QDLA 3PT9A 1OU9A 3VS4A 1D1BA 1JJ2S 2XDBA 3FIFA 2CDTA 1T0HA 2D0NA 3QUIA 1YITQ 1VQPA 4A4GA 1VQKA 2JUFA 3G71T 3SEMA 5AYFA 1AZGB 2CZ7B 1IZ6A 3NHNA 4B9XA 1U3OA 5GAN4 2D8HA 3JAME 2HKNA 3SWNB 5I21A 1IXDA 1G2BA 1SPKA 4BE1A 4JS5A 3WVEB 3Q1JA 3C12A 1K9MC 5FU6C 2LX7A 5GANe 2GQIA 5LJ5d 2DLPA 2PU9B 3QXEB 3VUBA 4BI4A 2JN0A 4ELYC 4QT7A 4CC4B 3MHXA 4PJMA 5GMKh 3CPWA 2Y4XA 3L2WA 2ZAEA 3CCMA 5CCAA 1K9MR 4ZTFA 3I5SA 1OULA 2E3IA 3HTRA 2JMAA 1Y96B 4F7UB 3VS6A 2C0TA 3DB3A 1YWOA 1ZSZA 4CC3A 1M30A 5LJ5e 5LJ3g 1ARKA 2FRYA 4P5NA 2WSEE 5L23A 3CMAT 3EH2A 2XIDA 4JPBW 2XICA 5LJ3f 4DBHA 1OEBA 4M75D 1CKAA 1UECA 3LLRA 2ROLA 2KROA 4GY5A 4EMHA 2BE7D 1UTIA 2F5TX 4JDSA 2CUDA 4M7AD 1HK9A 1NYFA 1VQNA 3CC4Q 2LNVA 3JCMQ 5GAN2 2YXYA 3CD6Q 4OGCA 4XU0A 1H3ZA 2DIGA 3CEYA 3LH5A 2OAUA 2A36A 2EIFA 2YRVA 3J7AF 2OTJA 3RR6A 2M1HA 2K9GA 4KULA 2ENMA 3RUXA 2RQRA 4J9CA 1RLPC 3VS5A 2O9SA 1TUGB 1N9RA 1GCQA 1M4ZA 3QG1A 3CPWP 1KHCA 1AWOA 4FYXB 2KRMA 4J9DA 2V1RA 3GPLA 1K0XA 4E7SA 4B9WA 2CZ6B 4LDWA 3NTHA 1I8FA 4BB7A 1WFWA 1KD1C 1UHCA 2YRCA 3SWNC 3G71Q 3ASKA 3HP9A 3SDZA 3UATA 2LQNA 5KCOA 3QYGB 2RHYA 2ZPGB 1XOVA 1M1KC 1K8AC 3EGXB 4O6JA 4C0GA 2DZ9A 1KD1R 2YUQA 3V7RA 1RUWA 3ZL7C 1T3LA 3H0FA 2HBWA 1G3YA 5GAMg 4BE2A 1RACB 4OMQA 2QTVA 2PQWA 3CMEA 3M54A 3QJ6A 1Q86C 4M78F 4PLIA 3RKYA 2CH4A 1M1KR 2CH4W 1KQSS 4PJLA 3M55A 1Q81U 1K8AR 2O2OA 2FO0A 3HRTA 2ZPHB 1D0XA 2RQTA 1WHLA 1WJRA 3HFNA 5CO7A 3MEAA 4BD3A 3EFRA 4Y28E 3OA6A 1NZ9A 4KH0B 1RAIB 2MMPA 2PVDB 1QQJA 2CS7A 2L3QA 2CZ1B 5GANj 3L1AA 3UA6A 3F70A 4J9EA 4AFUC 4OMPA 4C8QG 4QQDA 2MI6A 3CMAQ 3O5ZA 1Z9QA 4OB1B 5FROA 5A2QE 1MGQA 2RJFA 2EBPA 1VA7A 4M7AE 2O4XA 1Q95G 1ZQ1A 4DBRA 4D8DA 2V1QA 2LT4A 3OMGA 1VQ5A 1PC0A 1ZUYA 1YI2T 1IO6A 4C8QF 2SEMA 5FRNA 4RTUA 1ZHIA 3EG3A 3GOXA 3DLLA 2HSEB 1WNLA 2K5LA 3CBOA 1W2BS 5KYWB 2JW4A 1VQ4T 5GJVB 4FYVB 1MNDA 2Y4YA 4X9DA 4M7DG 2QA4A 5LJ5j 3X24B 3CCRT 1QKWA 4JS4A 5EG2A 4WCIA 1C0MA 3ZFJA 4X1VA 2OJ2A 4FU6A 1UHFA 4J7FA 1U5SA 2RQVA 4C5GA 2ECZA 3VUZA 3JCMf 2KXDA 1QCFA 3PVLA 2CREA 4ESRA 4FCYA 1UEBA 1Z9ZA 1GFDA 2L0AA 4N4GA 1HYOA 4CRIA 3PMIA 1LNXA 5J3BA 3CPFA 2DX1A 2ZCFB 2RN8A 4C92D 2GNCA 4BI3A 1S72A 5GANh 3CCSQ 1WLPB 1VQ8T 1ZLMA 1MHNA 1UGQB 2MYSA 5CAIA 2P0PA 2CP6A 1X6OA 1HSQA 1KQSA 3OYCA 3SWNA 5IXFA 4Q5WA 1G5VA 4J5YA 1PG5B 3TQ7P 3GP8A 4C0ZA 2RA2A 2MPXC 2R5MA 4RTTA 3M0QA 1FMWA 1QP3A 5LJ5h 3HRUA 2QI2A 3OMCA 1VQ6Q 4LN2A 2LP5A 2VV5A 3M9QA 3V8LA 5HKCA 3M0UA 1Y96A 4F7UA 4HVVA 5GMKl 3PNWC 1ZBXA 1VQLA 2K5FA 3VKIA 4M78B 3GLXA 1HJDA 1BKBA 1PKTA 2ZPEB 2KGTA 4RUGA 1W2BA 3NMZC 2RMOA 5IN1A 2B8AA 3PTAA 1Q82U 1CKBA 3C4SA 3EHQA 1YHQT 3C94A 2JXBA 2X4XA 5A0LA 2E5KA 3TSWA 4Y92A 2VXEA 2NUPB 4RCCA 1VQ9A 4XTUA 1ZUKA 5HCKA 2DERA 3H9NA 3V7CA 3CCQT 3RKXA 4J6WA 1PKSA 4RG8A 1YI2Q 3JB9H 1PRLC 4ZN1A 2KAFA 4N4HA 1JB0E 1TS9A 1LVKA 6AT1B 5CKFA 1GBQA 4C8QB 3JCMb 1KQSP 2FVUA 2ZZDA 3I56T 3I55T 4C5HA 2D6FA 1XQHA 4J83A 2DKGA 3E2UA 2F2VA 4XTWA 3DB4A 1B7TA 3L42A 3MCAB 3G4ST 2FZCB 3OYYA 4KRTA 2L3SA 1OYXA 4QQGA 4C92E 4M7DB 4IUPA 2DO3A 2A7YA 3R6OA 4PJOG 5GAN3 3N5BB 4M77D 2C0OA 1RI9A 2P4RA 1JU5C 1K4US 3CC7A 1Y7XA 1Y57A 2AZVA 2EAYA 1R0BG 4PJOF 1VQ8Q 2XDDA 2X51A 4VUBA 1YIJA 1JXMA 4XTXA 2JS0A 2EYYA 2EYZA 5FWCA 1YJ9Q 2EGEA 1W2BP 2KXCA 1KIKA 3QZ5B 1Q82C 2ROTA 1H641 2E1HA 2ATCB 3BDLA 1D09B 2CP7A 1TU0B 2CP2A 1D0YA 2KK4A 4N0AC 1YJWQ 3EGXA 2F69A 4ZTJA 4PKCC 4NS5A 3UF4A 5CQYA 4RTWA 4FL6A 3CCLA 2HDAA 2IVWA 3M57A 3OYEA 3EFSA 2B86A 2DK3A 3I35A 3OYJA 3H0IA 2FYKA 3M0SA 4LNPA 4OMLA 1Q82R 4FW2A 1PNJA 3HFOA 2F2XA 3QDRB 1W70A 3CC2A 5GAOn 4M78C 2CP3A 3BDUA 2YDLA 2EQIA 3RESA 1T3SA 2RH2A 1ZA1B 4GLKA 2OTLA 2K2VA 4OMMA 3QIIA 3X28B 4BY6B 5HK0A 3OS5A 2JS2A 5GJWB 5A0DA 5GAOp 3KUFA 4AFSC 1VQPQ 3VS1A 1G3SA 1YHQQ 3PMTA 1VQKQ 2EPDA 3CBMA 3HHTB 4KBMB 4J9FA 3RKWA 1BB9A 1O75A 1WHMA 5IHNA 3TCJA 3CCUA 2DXBA 1I81A 4JJDA 2M0OA 4C8QC 3WVDB 2LZ6B 4BE0A 3CD6T 5KYWA 1TUDA 1Y0MA 2QEXA 4JZ3A 3VRYA 1K1ZA 2V8IA 1VOMA 2DJZA 1ZX6A
chains in the Genus database with same CATH topology
2EIFA 2YRVA 3BW1A 2OTLT 1BI1A 3M4GA 3J7AF 2OTJA 2DXCA 2M1HA 2LC4A 3JCMg 4M75B 4KULA 2PUKB 4LD6A 4M75C 4M77E 3RUXA 4M7DF 1BYMA 2R57A 2RI5A 3P8BB 3L2ZA 2RK2A 3JCMP 4DOVA 4XTYA 3ME9A 2X35A 2E6NA 5LL6S 2PUOB 2I2LA 1EIFA 1KHIA 1RI0A 1N9RA 2EFIA 3QG1A 1M4ZA 3G7ZA 4A4HA 1KHCA 2A3LA 2VUBA 5GANg 4WF2A 3VJPA 4E7HA 4M78E 4XTZA 2E12A 3QYHB 2E41A 3OB9A 4Z02A 3HL8A 5GMKi 4E7JA 3GPLA 1GXIE 4L5GA 1FXXA 3QO3A 4XQ3A 4E7KA 4M7AC 2RO0A 4B9WA 1Y07A 4L59A 2CZ6B 1M1FA 3BFMA 3OYKA 1W4SA 1Q81C 3GF5A 4LDWA 2JTMA 3NTHA 4C0DB 4C0DC 1XNIA 2BKDN 3CCUT 4OVAA 1I8FA 4BB7A 1UGRB 5LJ3j 3OYMA 4RKUE 4X9CA 1KD1C 4ELZC 4LDUA 3JB9D 2RK1A 2RHXA 3JCMJ 4JRQA 1O9SA 2K3YA 4OF1A 3SWNC 2HQXA 5CVIA 3OS0A 4JLGA 3OY9A 2DTIA 3ASKA 4N4IA 3HP9A 1QVGA 4PJOB 4KUDK 4M77G 3SDZA 4C5IA 1OZ3A 1BI0A 1YCYA 2LCLA 4J6YA 2QEXT 1VQNT 1QVFA 2KY9A 3JCMV 3FLGA 3MP6A 3QPHA 4FT2A 3X20B 2DZCA 3RMQA 5KCOA 5GAOl 3QYGB 2RHYA 2ZPGB 1XOVA 1M1KC 5GAOm 1OZ2A 1K8AC 4JRPA 5LJ5g 1YI2A 3KBGA 4O6JA 3V7SA 2HAXA 4C0GA 2DZ9A 1X01A 2JOYA 4M77F 3V7RA 4OB3B 4NL3A 4LDVA 4E47A 2OTJT 2GQVA 3OYGA 1G3YA 2PVOB 5GAMg 4C8QE 4BE2A 3LWHA 3RMSA 4M77A 1VQ4A 3JB9I 2PQWA 4A4KA 3CMEA 3OYDA 5KE2A 3ZEHA 3HPWA 3M54A 3QJ6A 1Q86C 5IAYA 1BIAA 2HNIA 4M78F 4DQ2A 3CXCS 2LQ8A 4RG2A 4PLIA 3RKYA 3VU3C 4C92B 3S3OA 1KQSS 3QZ9B 3M53A 4F7UF 1VQOA 3M55A 2RI2A 1Q81U 3CCRA 3ZBDA 4BUGA 3OYIA 3JB9F 3HRTA 4QVDA 4FM4B 4BY6C 2ZPHB 1KD1U 5CQXA 2V8JA 2E65A 1XTDA 1G3TA 3E9FA 3I56A 3OYHA 3QJYA 1LJOA 2YLCA 3CCVA 1WJRA 3HFNA 5CO7A 2L8DA 5GMKm 3MEAA 3FRNA 3WXMB 4BD3A 3A8MB 3EFRA 4Y28E 1VQOT 2BIVA 4M7DE 3OA6A 4HCCA 1FWZA 1BI2A 1NZ9A 4J6XA 2DVEA 2MMPA 2PVDB 4OMFB 2EWNA 3MP8A 1WQWA 2CS7A 4PNOA 2X4WA 5GMKe 2CZ1B 5GANj 3L1AA 3LX7A 5CKEA 2VGNA 4PL6A 1M1KU 5GAN7 4QVCA 3M59A 3F70A 2LQKA 1PSFA 1K8AU 5GAOq 4QQ6A 5LJ3h 5LJ3d 2EQJA 4QQDA 4C8QG 2MI6A 4NOYA 2GFAA 3CCSA 4OB1B 5FROA 1OI1A 5A2QE 1MGQA 2C06A 2VYTA 4OB0B 2RJFA 2RHZA 4MDWA 3CPWS 3OSSC 2RJCA 1D3BB 2LT1A 2O4XA 2PVGB 1VIFA 1ZQ1A 2DXTA 5I2MA 2LT4A 3OMGA 1YITA 1VQ5A 3HSBA 4EMGA 1YI2T 3FJPA 4M7AE 1VQ8A 1YBYA 3OYNA 2KVQG 4C8QF 5FRNA 3URGA 3VYGA 1ZHIA 2BUDA 4OP0A 4QW2A 4EMKA 1Q86U 3GOXA 2O01E 2K57A 1M90C 3DLLA 1YJ9A 2L89A 3JCMX 3E9GA 3JRZA 3X26B 1X75C 3M5AA 3TU4K 1WNLA 2K5LA 2RHIA 2JVVA 2MF2A 3CBOA 3LYIA 3LWIA 4FIBA 4E7LA 4C8QA 2P0KA 1W2BS 1JJ2A 5CR2A 4ZN3A 1VQ4T 3UT1A 5FU7C 3CMET 2LX9A 2Y4YA 4X9DA 2DPPB 1SSFA 4R55A 4ATOA 4M7DG 2QA4A 5CKBA 3PFSA 2KQWA 5LJ5j 2GFUA 3DLMA 3X24B 3CCRT 2E5QA 3A5ZB 5LJ3e 3L2QA 4JS4A 1I5LA 4PJOD 4O5VA 5EG2A 3L2RA 3MEWA 4TVRA 1I4K1 1VQ6A 2MAMA 3S3MA 5KH6A 4X34A 2D9TA 3ZFJA 4FSXA 2NLUA 5GAMj 4M75F 2RJDA 4FU6A 5C0MA 3CCVT 4DA4A 3A8GB 4J7FA 4C5GA 4M7AG 4V2SA 1TH7A 2LVMA 2EKOA 4IUQA 3VUZA 3JCMf 2RD1A 5GAN6 4J7IA 4M7DA 1AHJB 3S3NA 2D0QB 4HCZA 3JCMh 1UEBA 4MMKA 1VQ7A 3VV0A 3LH0A 1VQMA 4N4GA 2E10A 4F7UE 2MWOA 3A8HB 3ER0A 4M7AF 4CRIA 3MEVA 4JUVA 3PMIA 3UDCA 4XAXB 3CCST 1QP2A 1LNXA 5J3BA 5DLOA 3CPFA 4MZMA 5GANf 1BIBA 2ZCFB 2KMTA 2EYQA 4C92D 1VUBA 2DEQA 1M90U 4BI3A 1S72A 5GANh 5GANd 3QSUA 4M7AA 2G3RA 3P8HA 4A53A 4XU2A 2X4JA 2L5QA 2LDMA 1YITT 1VQ5T 4HKEA 1Y71A 4XK8E 1VQ8T 1QVPA 1KG1A 1MHNA 1HXDA 1UGQB 4C0FA 4RMOA 3NTIA 4QVZA 5CAIA 3OYLA 2P0PA 1M9SA 4PJOC 2EJ9A 3CXCA 2HD0A 5CIUA 2CGHA 1X6OA 1YHQA 4A4FA 1KQSA 3OYCA 3SWNA 3L2VA 2LTOA 2DD4A 1K73C 4YTLA 1V29B 2JNGA 3SB2A 4N0AA 4Q5WA 5L8RE 3PIOA 2QA4T 4M78G 1G5VA 5M9OA 4J5YA 4EPCA 1NPRA 4KT0E 3CCQA 2HBPA 2QTXA 4F7UG 3J81E 3V8JA 3GP8A 5FU6B 4C0ZA 1VQ6T 2RA2A 3FEOA 3JB9G 5LJ5f 3G6EA 1FX7A 4JRKA 2R5MA 2RJEA 5CKHA 1QP3A 5LJ5h 2QQSA 1JRIA 3OYBA 2XK0A 3QBYA 3FDRA 3HRUA 4C92C 5CK9A 2QI2A 3OMCA 2QXFA 1RL2A 5GAMf 4M77B 3CC4A 2VV5A 1U1TA 1WQ7A 2XHCA 1N27A 2M16A 3M9QA 3V8LA 4M78A 5GAMh 5HKCA 1VQ7T 1VQMT 2VC8A 1Q7YC 1Y96A 2HQEA 3META 3FC3A 1YJNA 4F7UA 3I55A 5GMKl 3CCJA 3PNWC 5D6WA 4HT8A 1ZBXA 1NJIC 1B34A 2K5FA 3VKIA 1VQLA 4M78B 3GLXA 2R58A 3OSVA 1KC8U 1BKBA 2QDYB 2E6ZA 4MMLA 2ZPEB 4M75E 1S72T 5GAN5 1IREB 3X25B 3RERA 2ZPBB 3V8KA 3G4SA 1UGSB 5KE3A 2XU8A 3M58A 3GIBA 1W2BA 1K73U 2CZ0B 5IN1A 2JTFA 4C5EA 2B8AA 3PTAA 2VXFA 3QHSA 4KUIA 3OW2S 1PSEA 2XDPA 1Q82U 3AHUA 3C4SA 1YHQT 3C94A 4BDZA 3UWNA 2DD5A 2DTOA 1WJSA 5A0LA 2X4XA 3OS1A 1K9MU 4LDXA 2VXEA 4RCCA 2XG8D 1VQ9A 4XTUA 4J8OA 3VYHB 3V7CA 4XTVA 2O4XB 1UB4A 4JLIA 3CCQT 3RKXA 2DAQA 3NFCA 4M7DD 4J6WA 4RG8A 3JB9H 4ZGJB 4ZN1A 2KAFA 4L6V5 3G6ET 2DTHA 2RB6A 2YHTA 4N4HA 1M5Q1 3OBWA 1JB0E 3TREA 4EMKB 3G71A 2LCCA 3FB9A 2IG0A 2EQMA 4M75G 5DLQE 1Q7YU 5CKFA 4PJOE 2ZPIB 3E1SA 3OBYA 1YJWA 3O8VA 4C8QB 3JCMb 4E7IA 3CC4T 1NJIU 3MEUA 4UC4A 4BI8B 3OS2A 1BI3A 4Y91A 2FVUA 5GAN8 2ZZDA 1LOJA 2F5KA 2X4YA 3DKMA 4BDYA 2FB7A 3I56T 1YJNT 2K4YA 3I55T 3HRSA 4IUVA 2E70A 3CCEA 3CCJT 5GMKj 4C5HA 4BACA 1VQLT 3SFMA 4A4EA 2D6FA 1XQHA 5IT9E 4J83A 2H3JA 5HY6A 3TEEA 4MDXA 2CYZB 2K5IA 2DKGA 4D6WA 1NPPA 4R56A 4M75A 3M4YA 1UGPB 3DB4A 3L42A 4XTWA 3MCAB 3JCMd 3M56A 2KSSA 1JBMA 2RHUA 3G4ST 3OYYA 5CKDA 1OYXA 3C95A 4QQGA 4C92E 4PLLA 4M7DB 4M7DC 3PIPA 4HA8A 4IUPA 2DO3A 3BY7A 2A7YA 2K3XA 3OQ5A 2R5AA 4ME7A 3KXTA 3PT9A 3R6OA 1U8RA 4PJOG 5GAN3 3N5BB 4M77D 4A54A 4OGEA 5J39A 1JJ2S 1G3WA 2XDBA 4XU3A 3FIFA 1VQ9T 2P4TA 2XKOC 3H8ZA 3A8OB 3JCMc 5I2SA 3OYAA 1N8RC 1KC8C 4EDUA 4M7AB 3CC7A 1Y7XA 3QUIA 4OB2B 1YJ9T 4LD9K 1VQPA 4JRIA 1N9SA 2DIQA 2EAYA 1P92A 4PJOF 4XU1A 3LW5E 2XDDA 3E19A 4M78D 4A4GA 5FRMA 1VQKA 2JUFA 2EJGA 4VUBA 3G71T 1YIJA 4XTXA 2QQAA 4RCBA 5AYFA 2CZ7B 3JCMe 2FL7A 5A0GA 1IZ6A 3PGGA 4B9XA 2M9UA 3QZ5B 4PJOA 1Q82C 2QQBA 5GAN4 3CMAA 3JAME 1H641 2E1HA 3SWNB 1YJWT 3BDLA 2GF7A 1M8VA 5I21A 4MZTA 3MO8A 3EAEA 2EJFA 4BE1A 4JS5A 4C92G 3WVEB 3Q1JA 1M1GA 5KCHA 1QVFS 2QQ9A 3C12A 1K9MC 3LGFA 5FU6C 2KK4A 4FT4A 4N0AC 2WSCE 2F69A 5GANe 3T9NA 4ZTJA 3JB9J 3P8DA 4PKCC 4NS5A 5D6YA 3CCET 5LJ5d 5CQYA 4FL6A 1VIEA 3CBPA 2PU9B 3CCLA 2IVWA 3M57A 2Y90A 3QXEB 3VUBA 4C92F 3OYEA 4BI4A 3EFSA 2DK3A 4M77C 5FLXE 3JCMW 3L2UA 3SD4A 4HT9A 3OW2A 2JN0A 4ELYC 3CD6A 3OYJA 5GAMd 5GAOr 2MWPA 3MHXA 2FYKA 5GMKh 3CPWA 3A8LB 2EQKA 2Y4XA 3L2WA 4C92A 3HFOA 4DOWA 3CCMA 5CCAA 1WPYA 3QDRB 5HK3A 4IKFA 3CC2A 5GAOn 4ZTFA 1N8RU 2FHDA 2YLBA 4M78C 1QVGS 3BDUA 4JJNK 3MP1A 5DY9A 3UPUA 1Y96B 2JZ2A 3LGLA 1WGSA 4C8QD 4F7UB 4LDYA 1WJQA 2GCXA 3DB3A 2VGMA 3GNFB 1B34B 2RH2A 3RESA 4GLKA 2OTLA 2K2VA 3QIIA 4IUUA 3X28B 4BY6B 2E64A 3NTKA 5HK0A 3CC7T 2XD0A 1KQ2A 2LRQA 5LJ5e 1VQPT 3OS5A 1R8OB 5A0DA 5LJ3g 5GAOp 1NE8A 3KUFA 1VQKT 3RIRA 1YIJT 5J26A 3QKJA 2P0QA 3H6ZA 4P5NA 5GAMe 1G3SA 2WSEE 4CI0C 2WACA 3PMTA 4IURA 3JSCA 1KQ1A 2DXUA 3CMAT 5D6XA 4ZGDB 2XIDA 3J80E 3CBMA 3HHTB 4KBMB 2XICA 5LJ3f 3RKWA 2CKKA 3INZA 4M75D 4HCBA 3HKSA 1D3BA 2RM4A 3LLRA 1O75A 4MZPA 3GNGA 4EMKC 3TCJA 3CCUA 2DXBA 4GY5A 2L3RA 4EMHA 1I81A 4II1A 2RI3A 2M0OA 2EQUA 3CCLT 3OYFA 4C8QC 2XI9A 3WVDB 2F5TX 2QQRA 4NL2A 4JDSA 4BE0A 4M7AD 3CD6T 2ZGWA 1DJ7B 5DM7R 2AHJB 2KDSA 1U1SA 1QW1A 1HK9A 2ZPFB 2QEXA 2WSFE 4ZGEB 1VQNA 2LNVA 3JCMQ 3CCMT 5GAN2 2V8KA 1N6AA 3CC2T 4OGCA 5FU7B 4XU0A 1H3ZA 2DIGA 2V8IA 3CEYA 3S6WA 2OAUA 2DJZA 4IUTA 5C6SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OB0 B;  2DXC A;  2PVG B;  2CZ7 B;  2PUK B;  3QZ5 B;  3VYG A;  2O01 E;  3WVE B;  2QDY B;  2ZPE B;  2PUO B;  3X26 B;  1IRE B;  2WSC E;  3X25 B;  2ZPB B;  1UGS B;  3QYH B;  1GXI E;  2DPP B;  2CZ0 B;  2PU9 B;  3QXE B;  2CZ6 B;  1PSE A;  3X24 B;  1UGR B;  2DD5 A;  4RKU E;  3A8L B;  3VYH B;  3A8G B;  1AHJ B;  4ZGJ B;  2D0Q B;  4L6V 5;  3X20 B;  1JB0 E;  3QYG B;  2ZPG B;  3X28 B;  3A8H B;  2ZPI B;  1QP2 A;  4OB3 B;  2ZCF B;  2ZZD A;  2PVO B;  2WSE E;  4XK8 E;  4ZGD B;  3HHT B;  1UGQ B;  2CYZ B;  3QZ9 B;  1UGP B;  2DXB A;  4FM4 B;  2DD4 A;  2ZPH B;  1V29 B;  5L8R E;  3WVD B;  4KT0 E;  3A8M B;  1DJ7 B;  4Y28 E;  2AHJ B;  2ZPF B;  2PVD B;  2WSF E;  4ZGE B;  2CZ1 B;  3A8O B;  1QP3 A;  4OB2 B;  1PSF A;  3LW5 E;  4OB1 B; 
#chains in the Genus database with same CATH topology
 2KRS A;  1BI1 A;  4RTY A;  2VB6 A;  4M77 E;  2R57 A;  3G4S Q;  3P8B B;  3L2Z A;  1SRM A;  2DL7 A;  4HXJ A;  4XTY A;  3ME9 A;  1EIF A;  1KHI A;  2OX7 A;  2EFI A;  3G7Z A;  4A4H A;  5GAN g;  4WF2 A;  4E7H A;  2AKK A;  4XTZ A;  3HL8 A;  1FXX A;  4XQ3 A;  2RO0 A;  4L59 A;  2DVJ A;  2RQU A;  2GBQ A;  1ABQ A;  3GF5 A;  4C0D C;  1XNI A;  1UGR B;  3OYM A;  2PNI A;  4X9C A;  4LDU A;  4F04 B;  3JB9 D;  1O9S A;  2K3Y A;  2CT4 A;  2HQX A;  3OY9 A;  2RNA A;  2JT4 A;  4PJO B;  3VRZ A;  1BI0 A;  2LCL A;  3R6N A;  3VS3 A;  3I9Q A;  1RAA B;  1UFF A;  1SHF A;  2DMO A;  1AWJ A;  4JRP A;  5LJ5 g;  3KBG A;  3V7S A;  2HEQ A;  4OB3 B;  4LDV A;  4E47 A;  2PVO B;  3LWH A;  1GCP A;  3HPW A;  1BIA A;  1D0Z A;  4DQ2 A;  1C6V X;  3CXC S;  3VU3 C;  3QZ9 B;  4AFQ C;  2RI2 A;  4BUG A;  3JB9 F;  4QVD A;  4FM4 B;  4BY6 C;  1KD1 U;  1XTD A;  3I56 A;  5I22 A;  2YLC A;  3CCV A;  1BU1 A;  2L8D A;  3REB B;  3TVT A;  1VQO T;  3A8M B;  1BI2 A;  1BK2 A;  2EWN A;  5ECA A;  2I0N A;  2EW3 A;  3LX7 A;  5CKE A;  2VGN A;  1M1K U;  2VKN A;  1K8A U;  5GAO q;  5LJ3 d;  2KE9 A;  5D7U A;  2BZX A;  2NUP A;  2VYT A;  4OB0 B;  2Z0W A;  1IGU A;  2RHZ A;  5IHI A;  8AT1 B;  4R56 A;  2RJC A;  1D3B B;  2PVG B;  1SG5 A;  5I2M A;  2DXT A;  4CC7 A;  1YIT A;  1H8K A;  4EMG A;  4Z88 A;  1YBY A;  3OYN A;  2KVQ G;  3VYG A;  4OP0 A;  1Q86 U;  2L89 A;  3E9G A;  2QG9 B;  3TU4 K;  2MIO A;  2JVV A;  1HD3 A;  2MF2 A;  3IQL A;  3LYI A;  4E7L A;  1JJ2 A;  4C8Q A;  2P0K A;  4ZN3 A;  3UT1 A;  2C0I A;  2LX9 A;  2DPP B;  1SSF A;  2VVK A;  4ATO A;  1M2V B;  1UGV A;  3M0R A;  3H0H A;  5LJ3 e;  2CUB A;  4O5V A;  2DNU A;  1I4K 1;  2M02 A;  5KH6 A;  1WXU A;  2D9T A;  4FSX A;  2NLU A;  4M75 F;  2RJD A;  4E2F B;  1M8M A;  1RAB B;  4M7A G;  1U06 A;  2FRW A;  2LVM A;  2EKO A;  4J7I A;  4M7D A;  1T0J A;  1NEG A;  3S3N A;  1RAF B;  4HCZ A;  1VQ7 A;  1VQM A;  3LH0 A;  3ER0 A;  4M7A F;  4JUV A;  1W6X A;  3CCS T;  1QP2 A;  5DLO A;  1TG0 A;  2YRD A;  1VUB A;  2DEQ A;  8ATC B;  2G3R A;  1WXT A;  1NG2 A;  4EIK A;  1CSK A;  4FSS A;  4RMO A;  2GTO A;  2IIM A;  1R77 A;  4PJO C;  3CXC A;  1VQ5 Q;  1MMA A;  4JJB A;  2CGH A;  1OX8 A;  1OPL A;  2HQH A;  3L2V A;  2DD4 A;  1K73 C;  2DL5 A;  2JNG A;  3RNJ A;  3SB2 A;  1ZUU A;  3C0C A;  5L8R E;  3PIO A;  4M78 G;  5M9O A;  4EPC A;  2EGA A;  3J81 E;  3V8J A;  1TOV A;  1VQ6 T;  3FEO A;  3G6E A;  4LXC A;  4F17 A;  4JRK A;  5CKH A;  2FPD A;  3OYB A;  3FDR A;  5CK9 A;  5IH2 A;  2QXF A;  1MMN A;  1RL2 A;  5GAM f;  1K73 R;  3CC4 A;  1PHT A;  2XHC A;  2YWW A;  1YWP A;  1JJ2 P;  1QWF A;  1Q7Y C;  3MET A;  3FC3 A;  1YJN A;  3CCJ A;  2SRC A;  1NJI C;  2R58 A;  1KC8 U;  4M75 E;  1Q86 R;  4HVW A;  2ZPB B;  4FYW B;  3VS7 A;  1UGS B;  1VQO Q;  1TWB A;  2BZ8 A;  2CZ0 B;  1S72 Q;  2HL3 A;  3OW2 S;  2DA9 A;  2ED0 A;  2XDP A;  1Q7Y R;  1K0S A;  2G6F X;  2DD5 A;  2DTO A;  1WJS A;  5KYY B;  1YFN A;  1IHW A;  4LDX A;  2XG8 D;  2MCN A;  4J8O A;  2COW A;  7AT1 B;  2KBT A;  1TUC A;  4M7D D;  2EKH A;  5EC7 A;  4ZGJ B;  2JMC A;  1GRI A;  2DF6 A;  3RBB B;  2DBM A;  3G71 A;  3TRE A;  2LCC A;  3FB9 A;  2AKL A;  2EQM A;  1PCX A;  2K2M A;  2ZPI B;  5KYX B;  2DE0 X;  4J9G A;  2HL5 C;  3CXC P;  4UC4 A;  4BI8 B;  3I5R A;  3OS2 A;  4HVU A;  3EGU A;  1LOJ A;  2X4Y A;  2BE9 B;  2FB7 A;  2K4Y A;  4PFZ A;  1X6B A;  3HRS A;  4BAC A;  1QCN A;  2H3J A;  2YUP A;  2CYZ B;  1ZBJ A;  4D6W A;  1F1B B;  3JCM d;  1VQL Q;  2RQW A;  2R5A A;  4ME7 A;  4J9B A;  2VAS A;  2ED1 A;  4A54 A;  4OGE A;  1OU8 A;  1ZA2 B;  1G3W A;  2LQW A;  4XU3 A;  2CP5 A;  2P4T A;  3JCM c;  3H8Z A;  2DYI A;  3A8O B;  4Z8A A;  1N8R C;  1KC8 C;  4LUD A;  4M7A B;  4OB2 B;  1YJ9 T;  4OMO A;  4JRI A;  2E4H A;  1IRX A;  1P92 A;  3LW5 E;  1VQ9 Q;  5FRM A;  2D8J A;  2QQA A;  4RCB A;  3JCM e;  2FL7 A;  5A0G A;  3PGG A;  2M9U A;  4PJO A;  2QQB A;  3CMA A;  1YJW T;  3AT1 B;  3MO8 A;  2EJF A;  1WA7 A;  4C92 G;  5KCH A;  3MPU B;  1QVF S;  2JTE A;  1N8R R;  4FT4 A;  1KC8 R;  2WSC E;  1WYX A;  3T9N A;  2JJ9 A;  5D6Y A;  3CCE T;  4PJN A;  1B07 A;  1VIE A;  3CBP A;  3NPF A;  2Y90 A;  4C92 F;  5FLX E;  3L2U A;  2D1X A;  3OW2 A;  2MWP A;  1WPY A;  2FHD A;  2YLB A;  4JJN K;  3MP1 A;  3UPU A;  2JZ2 A;  4LDY A;  2J06 A;  3GNF B;  5FWB A;  3EG9 B;  1NLO C;  2E64 A;  5FW9 A;  1JXO A;  2LRQ A;  1VQP T;  1WHJ A;  1KQ2 A;  4KGZ B;  1FMV A;  1R8O B;  1NE8 A;  1VQK T;  3A98 A;  5J26 A;  2PTK A;  3QKJ A;  3H6Z A;  2DRM A;  3CC7 Q;  3EFO B;  1WI7 A;  4CI0 C;  3JSC A;  1KQ1 A;  4DEX A;  5D6X A;  3J80 E;  2QAS A;  1YIJ Q;  2CKK A;  1D3B A;  2RM4 A;  2KRN A;  3GNG A;  1WXB A;  1X2Q A;  1SRL A;  1NEB A;  2O31 A;  2RI3 A;  1AT1 B;  2LMJ A;  1MMG A;  3OYF A;  2XI9 A;  2QQR A;  1X27 A;  4NL2 A;  1UDL A;  2ZGW A;  5DM7 R;  1TXQ A;  2KDS A;  1U1S A;  3CCL Q;  2ZPF B;  1MNE A;  2WSF E;  3CCM T;  2V8K A;  5FU7 B;  2VWF A;  2M51 A;  1SHG A;  2COY A;  2DIL A;  2GTJ A;  4E7I A;  3CC2 Q;  2IPO B;  1IHV A;  2LC4 A;  4M75 C;  4K11 A;  1BYM A;  2K7A A;  1RAD B;  3M0T A;  2OTL Q;  3OW2 P;  2X35 A;  4JJC A;  4IKF A;  5LL6 S;  2PUO B;  1RI0 A;  1QVF A;  2A3L A;  1N5Z A;  1AWW A;  4E7J A;  2E12 A;  3QYH B;  5GMK i;  1AD5 A;  1GXI E;  4DBF A;  3QO3 A;  4E7K A;  4M7A C;  1M1F A;  3BFM A;  4C0D B;  3EH1 A;  4OVA A;  3JCM J;  2RHX A;  4OF1 A;  5CVI A;  2DTI A;  4N4I A;  1OV3 A;  2J05 A;  4M77 G;  4C5I A;  1OZ3 A;  1LCK A;  1YCY A;  2RF0 A;  4J6Y A;  1VQN T;  2HZY A;  3QPH A;  2DZC A;  3RMQ A;  5GAO m;  1FMK A;  2DL3 A;  1YI2 A;  2EYX A;  2HAX A;  1NYG A;  4Z89 A;  3CCE Q;  4M77 F;  3JV3 A;  2LCS A;  2OTJ T;  2GQV A;  2QK0 A;  3OYG A;  3RDV A;  4RTZ A;  1VQ4 A;  3JB9 I;  4A4K A;  3OYD A;  5KE2 A;  3ZEH A;  2HNI A;  9ATC B;  2LQ8 A;  4RG2 A;  4C92 B;  5KYU B;  3S3O A;  1XJW B;  4F7U F;  2DET A;  1OOT A;  1RAE B;  3ZBD A;  3CCR A;  2QYZ A;  1QKX A;  3OYI A;  1M3A A;  5CQX A;  2MOX A;  1SKU B;  1G3T A;  3OYH A;  2DFU A;  3PVQ A;  1JEG A;  1RLQ C;  2F1L A;  5GMK m;  3FRN A;  3WXM B;  1OQK A;  2BIV A;  2RPN A;  1H92 A;  4OMF B;  2JM9 A;  1EZZ B;  1FYN A;  4PL6 A;  5GAN 7;  3M59 A;  2LQK A;  2KEA A;  2EQJ A;  4NOY A;  2GFA A;  1OI1 A;  1EX4 A;  1QVF P;  4MDW A;  3CPW S;  3OSS C;  2LT1 A;  1VIF A;  3HSB A;  3ULR B;  1VQ8 A;  2FG0 A;  3URG A;  2PZ1 A;  5AT1 B;  2O01 E;  1M90 C;  1YJ9 A;  3JCM X;  1BCM A;  1X75 C;  3M5A A;  4QKU A;  2RHI A;  5KYX A;  2A0F B;  5CR2 A;  5FU7 C;  3CME T;  4R55 A;  4KGX B;  3CCM Q;  1I07 A;  3DLM A;  2E5Q A;  3A5Z B;  3L2Q A;  3L2R A;  2MAM A;  2LJ0 A;  4X34 A;  1M90 R;  4DA4 A;  5C0M A;  3A8G B;  3U23 A;  1OX9 A;  2ESW A;  4V2S A;  4KGV B;  1IGQ A;  1M2O A;  3CCV Q;  3JCM h;  4MMK A;  3THK A;  1TTH B;  2E10 A;  4F7U E;  2MWO A;  3A8H B;  1GCQ C;  3UDC A;  4MZM A;  5GAN f;  1BIB A;  2KMT A;  1PD1 A;  1K76 A;  5GAN d;  4M7A A;  3P8H A;  4A53 A;  4XU2 A;  2X4J A;  2LDM A;  2LNH B;  4ANJ A;  1VQ5 T;  4HKE A;  1KG1 A;  1HXD A;  4C0F A;  1VYV A;  4QVZ A;  3VS2 A;  3OYL A;  1AEY A;  2HD0 A;  2L3P A;  5CIU A;  1YHQ A;  2H3E B;  1KK7 A;  2DM1 A;  1SEM A;  1VQN Q;  4N0A A;  2QA4 T;  1NPR A;  4AT1 B;  3CCQ A;  2HBP A;  3CQT A;  2A28 A;  3EGD B;  3JB9 G;  5LJ5 f;  1FX7 A;  1M3B A;  2DL4 A;  2ABL A;  2OTJ Q;  1SF9 A;  1JRI A;  2FPE A;  2XK0 A;  3QBY A;  4C92 C;  1JO8 A;  4M77 B;  1WQ7 A;  1U1T A;  1N27 A;  3VS0 A;  4M78 A;  3EHR A;  3D7S B;  3NGP A;  1WX6 A;  1UE9 A;  2HQE A;  2K6D A;  1KSW A;  3I55 A;  5D6W A;  4AG1 C;  1RAG B;  1LPL A;  3OSV A;  1VQ7 Q;  1VQM Q;  4MML A;  3EG9 A;  1S72 T;  1QWE A;  2CT3 A;  3RER A;  3V8K A;  3G4S A;  4R0K A;  1E6H A;  3M58 A;  3GIB A;  1K73 U;  1I0C A;  2LJ3 A;  2O9V A;  4C5E A;  4KUI A;  3EFO A;  4BDZ A;  2A37 A;  4A63 B;  1WHG A;  4XTV A;  4JLI A;  3NFC A;  2HMA A;  2X3X D;  2KNB B;  4L6V 5;  2K3B A;  2DTH A;  4EMK B;  1M5Q 1;  4M75 G;  5DLQ E;  1I5O B;  1Q7Y U;  3G6E Q;  1NJI U;  4RTX A;  3CME Q;  2F5K A;  3DKM A;  2J6O A;  4IUV A;  2E70 A;  1VQL T;  3SFM A;  4B6M A;  2KT1 A;  3TEE A;  4MDX A;  2K5I A;  1NPP A;  1YJN Q;  2DYB A;  3M4Y A;  3CCJ Q;  4AG2 C;  1MMD A;  2KSS A;  1JBM A;  2CSQ A;  2RHU A;  4ZNX A;  2FZK B;  1MV3 A;  2DBK A;  3PIP A;  3TSZ A;  3BY7 A;  2K3X A;  3OQ5 A;  3KXT A;  1WZO A;  4OMN A;  1U8R A;  4PFO A;  5J39 A;  1VQ9 T;  4IIO A;  2XKO C;  4GBQ A;  5I2S A;  3OYA A;  3UA7 A;  4EDU A;  4LD9 K;  2OI3 A;  1N9S A;  2DIQ A;  1G83 A;  4XU1 A;  3E19 A;  4M78 D;  1AWX A;  4M4Z A;  2EJG A;  2KT8 A;  2J6F A;  1J3T A;  2KR3 A;  2GF7 A;  1M8V A;  4MZT A;  3EAE A;  2EYW A;  1M1G A;  2QQ9 A;  3LGF A;  2QA4 Q;  1BCO A;  2YUN A;  3JB9 J;  3P8D A;  2A08 A;  2YUO A;  2COZ A;  4LUE A;  2XMF A;  4M77 C;  3JCM W;  1D1C A;  2J6K A;  3SD4 A;  1AVZ C;  3CD6 A;  4HT9 A;  5GAM d;  5GAO r;  3QDF A;  3A8L B;  2EQK A;  4C92 A;  5KYU A;  4DOW A;  5HK3 A;  1N8R U;  1QVG S;  2LJ1 A;  5DY9 A;  1R0C B;  3LGL A;  1WGS A;  4C8Q D;  1WJQ A;  2GCX A;  2VGM A;  2CSI A;  1B34 B;  1X6G A;  3GBQ A;  5KYN A;  4ORZ A;  4IUU A;  2X3W D;  3NTK A;  3CC7 T;  3A1P A;  4D8K A;  2XD0 A;  1S1N A;  1JQQ A;  3RIR A;  1YIJ T;  1ZSG A;  2P0Q A;  1NJI R;  4E7Z A;  2AZS A;  4RTV A;  1AOJ A;  5GAM e;  2WAC A;  4IUR A;  2DXU A;  2AT1 B;  4ZGD B;  1GFC A;  3INZ A;  4HCB A;  4IIM A;  3HKS A;  4DBQ A;  2NUT B;  4MZP A;  1X43 A;  2AIR B;  1OPK A;  4EMK C;  5IXB A;  2L3R A;  4F16 A;  4II1 A;  4PK4 A;  2EQU A;  3CCL T;  3KFV A;  1DJ7 B;  2AHJ B;  1QW1 A;  3EG1 A;  3FJ5 A;  4ZGE B;  1VYT A;  1N6A A;  1GL5 A;  3CC2 T;  3S6W A;  1G8X A;  2CP0 A;  4IUT A;  3MKD A;  2DEU A;  5C6S A;  3BW1 A;  2OTL T;  3M4G A;  2DXC A;  3JCM g;  4M75 B;  2PUK B;  4LD6 A;  4WTO B;  4M7D F;  2RI5 A;  2RK2 A;  3JCM P;  4DOV A;  2E6N A;  2I2L A;  2J7I A;  2M0Y A;  5IHK A;  2VUB A;  3VJP A;  4M78 E;  1ACM B;  4Z02 A;  2E41 A;  3OB9 A;  1ABO A;  4L5G A;  1YP5 A;  1Y07 A;  1UG1 A;  1PRM C;  2MK5 A;  2DL8 A;  2HSP A;  1PWT A;  1MUZ A;  3OYK A;  1Q81 C;  1W4S A;  2JTM A;  1VQO A;  3CCU T;  2BKD N;  5LJ3 j;  4RKU E;  4ELZ C;  2RK1 A;  5I11 A;  4JRQ A;  1B3Q A;  3OS0 A;  4JLG A;  1YN8 A;  1QVG A;  4KUD K;  4PFP A;  2QEX T;  2KY9 A;  2YSQ A;  3JCM V;  3FLG A;  3MP6 A;  3X20 B;  4FT2 A;  5GAO l;  1M3C A;  1Q81 R;  1OZ2 A;  2FPF A;  3EGD A;  2OAW A;  1X01 A;  2HCK A;  2JOY A;  1PD0 A;  4NL3 A;  2EGC A;  4C8Q E;  2BZY A;  3RMS A;  4M77 A;  2QAZ A;  5IAY A;  3G1J A;  3M53 A;  1D1A A;  4FYY B;  2V8J A;  2E65 A;  1ZSZ B;  3E9F A;  3QJY A;  1LJO A;  2O88 A;  4M7D E;  4HCC A;  1FWZ A;  1WIE A;  4J6X A;  2DVE A;  1WDX A;  3MP8 A;  1WQW A;  4PNO A;  5GMK e;  2X4W A;  4LE9 A;  1H3H A;  3PE0 A;  4QVC A;  1PSF A;  4QQ6 A;  5LJ3 h;  3CCS A;  1KJW A;  2C06 A;  2BTT A;  4PJJ A;  2GGR A;  3FJP A;  2BUD A;  4EMK A;  4QW2 A;  2K57 A;  1M2V A;  3JRZ A;  1QCO A;  3X26 B;  2X9H A;  3LWI A;  4FIB A;  1V76 A;  5CKB A;  3PFS A;  1QVG P;  2KQW A;  2GFU A;  2FZG B;  1VQ4 Q;  1MV0 B;  1I5L A;  4PJO D;  3MEW A;  1NBE B;  3M0P A;  4FW1 A;  4TVR A;  1VQ6 A;  3S3M A;  1PM3 A;  5GAM j;  2K79 A;  3CCV T;  2E3H A;  3CCR Q;  1RAH B;  1M27 C;  1TSF A;  2KYM A;  2V26 A;  1KFZ A;  1TH7 A;  4IUQ A;  2RD1 A;  5GAN 6;  1AHJ B;  2D0Q B;  3REA B;  3VV0 A;  1BBZ A;  3MEV A;  2QGG A;  4XAX B;  1QMC A;  2L2P A;  1W1F A;  4GLM A;  2EYQ A;  1A0N B;  1M90 U;  3QSU A;  1C1A A;  1YIT T;  2L5Q A;  3SHW A;  1Y71 A;  4XK8 E;  1NLP C;  2JM8 A;  3CCU Q;  1UUE A;  1QVP A;  1UJ0 A;  3NTI A;  2QGF B;  2DRK A;  2EVR A;  1M9S A;  2P84 A;  2EJ9 A;  1X2K A;  1E6G A;  4A4F A;  2KI7 A;  3MJX A;  2LTO A;  2AK5 A;  4YTL A;  2QEX Q;  1V29 B;  1IB8 A;  4KT0 E;  2QTX A;  4F7U G;  5FU6 B;  1X69 A;  1WHK A;  1K9A A;  2RJE A;  2W0Z A;  2QQS A;  2W10 A;  2FEI A;  1E7O A;  2DJQ A;  4JZ4 A;  2M16 A;  3H41 A;  1GBR A;  5GAM h;  2NWM A;  1I1J A;  4E6R A;  1VQ7 T;  1VQM T;  2VC8 A;  4AFZ C;  1ZSZ C;  3BE3 A;  3EG2 A;  4HT8 A;  1B34 A;  2QDY B;  2E6Z A;  1YCS B;  5GAN 5;  1IRE B;  3X25 B;  2NYS A;  2NUZ A;  5KE3 A;  2XU8 A;  1UJY A;  2JTF A;  5KYY A;  2VXF A;  3QHS A;  1PSE A;  3AHU A;  4HCK A;  3UWN A;  3QWX X;  2HKQ B;  3OS1 A;  1K9M U;  4AMC A;  3VYH B;  2NUT A;  1QLY A;  2O4X B;  1SSH A;  1UB4 A;  2DAQ A;  4J9I A;  3G6E T;  2RB6 A;  2YHT A;  3OBW A;  3CCQ Q;  2IG0 A;  4J9H A;  4PJO E;  4CC2 A;  1AZE A;  3E1S A;  3OBY A;  1YJW A;  3O8V A;  2H8H A;  3CC4 T;  3MEU A;  4DEY A;  2YT6 A;  1BI3 A;  4Y91 A;  5GAN 8;  4BDY A;  1EFN A;  1YJN T;  3CCE A;  3CCJ T;  5GMK j;  1NM7 A;  4A4E A;  4F14 A;  5IT9 E;  1VYU A;  2KYB A;  5HY6 A;  3QWY A;  3I56 Q;  4M75 A;  3I55 Q;  1UGP B;  2F2W A;  3M56 A;  4KH1 B;  1YNZ A;  5CKD A;  3C95 A;  3EG0 A;  4PLL A;  4M7D C;  4HA8 A;  1V1C A;  1WHH A;  2QDL A;  3PT9 A;  1OU9 A;  3VS4 A;  1D1B A;  1JJ2 S;  2XDB A;  3FIF A;  2CDT A;  1T0H A;  2D0N A;  3QUI A;  1YIT Q;  1VQP A;  4A4G A;  1VQK A;  2JUF A;  3G71 T;  3SEM A;  5AYF A;  1AZG B;  2CZ7 B;  1IZ6 A;  3NHN A;  4B9X A;  1U3O A;  5GAN 4;  2D8H A;  3JAM E;  2HKN A;  3SWN B;  5I21 A;  1IXD A;  1G2B A;  1SPK A;  4BE1 A;  4JS5 A;  3WVE B;  3Q1J A;  3C12 A;  1K9M C;  5FU6 C;  2LX7 A;  5GAN e;  2GQI A;  5LJ5 d;  2DLP A;  2PU9 B;  3QXE B;  3VUB A;  4BI4 A;  2JN0 A;  4ELY C;  4QT7 A;  4CC4 B;  3MHX A;  4PJM A;  5GMK h;  3CPW A;  2Y4X A;  3L2W A;  2ZAE A;  3CCM A;  5CCA A;  1K9M R;  4ZTF A;  3I5S A;  1OUL A;  2E3I A;  3HTR A;  2JMA A;  1Y96 B;  4F7U B;  3VS6 A;  2C0T A;  3DB3 A;  1YWO A;  1ZSZ A;  4CC3 A;  1M30 A;  5LJ5 e;  5LJ3 g;  1ARK A;  2FRY A;  4P5N A;  2WSE E;  5L23 A;  3CMA T;  3EH2 A;  2XID A;  4JPB W;  2XIC A;  5LJ3 f;  4DBH A;  1OEB A;  4M75 D;  1CKA A;  1UEC A;  3LLR A;  2ROL A;  2KRO A;  4GY5 A;  4EMH A;  2BE7 D;  1UTI A;  2F5T X;  4JDS A;  2CUD A;  4M7A D;  1HK9 A;  1NYF A;  1VQN A;  3CC4 Q;  2LNV A;  3JCM Q;  5GAN 2;  2YXY A;  3CD6 Q;  4OGC A;  4XU0 A;  1H3Z A;  2DIG A;  3CEY A;  3LH5 A;  2OAU A;  2A36 A;  2EIF A;  2YRV A;  3J7A F;  2OTJ A;  3RR6 A;  2M1H A;  2K9G A;  4KUL A;  2ENM A;  3RUX A;  2RQR A;  4J9C A;  1RLP C;  3VS5 A;  2O9S A;  1TUG B;  1N9R A;  1GCQ A;  1M4Z A;  3QG1 A;  3CPW P;  1KHC A;  1AWO A;  4FYX B;  2KRM A;  4J9D A;  2V1R A;  3GPL A;  1K0X A;  4E7S A;  4B9W A;  2CZ6 B;  4LDW A;  3NTH A;  1I8F A;  4BB7 A;  1WFW A;  1KD1 C;  1UHC A;  2YRC A;  3SWN C;  3G71 Q;  3ASK A;  3HP9 A;  3SDZ A;  3UAT A;  2LQN A;  5KCO A;  3QYG B;  2RHY A;  2ZPG B;  1XOV A;  1M1K C;  1K8A C;  3EGX B;  4O6J A;  4C0G A;  2DZ9 A;  1KD1 R;  2YUQ A;  3V7R A;  1RUW A;  3ZL7 C;  1T3L A;  3H0F A;  2HBW A;  1G3Y A;  5GAM g;  4BE2 A;  1RAC B;  4OMQ A;  2QTV A;  2PQW A;  3CME A;  3M54 A;  3QJ6 A;  1Q86 C;  4M78 F;  4PLI A;  3RKY A;  2CH4 A;  1M1K R;  2CH4 W;  1KQS S;  4PJL A;  3M55 A;  1Q81 U;  1K8A R;  2O2O A;  2FO0 A;  3HRT A;  2ZPH B;  1D0X A;  2RQT A;  1WHL A;  1WJR A;  3HFN A;  5CO7 A;  3MEA A;  4BD3 A;  3EFR A;  4Y28 E;  3OA6 A;  1NZ9 A;  4KH0 B;  1RAI B;  2MMP A;  2PVD B;  1QQJ A;  2CS7 A;  2L3Q A;  2CZ1 B;  5GAN j;  3L1A A;  3UA6 A;  3F70 A;  4J9E A;  4AFU C;  4OMP A;  4C8Q G;  4QQD A;  2MI6 A;  3CMA Q;  3O5Z A;  1Z9Q A;  4OB1 B;  5FRO A;  5A2Q E;  1MGQ A;  2RJF A;  2EBP A;  1VA7 A;  4M7A E;  2O4X A;  1Q95 G;  1ZQ1 A;  4DBR A;  4D8D A;  2V1Q A;  2LT4 A;  3OMG A;  1VQ5 A;  1PC0 A;  1ZUY A;  1YI2 T;  1IO6 A;  4C8Q F;  2SEM A;  5FRN A;  4RTU A;  1ZHI A;  3EG3 A;  3GOX A;  3DLL A;  2HSE B;  1WNL A;  2K5L A;  3CBO A;  1W2B S;  5KYW B;  2JW4 A;  1VQ4 T;  5GJV B;  4FYV B;  1MND A;  2Y4Y A;  4X9D A;  4M7D G;  2QA4 A;  5LJ5 j;  3X24 B;  3CCR T;  1QKW A;  4JS4 A;  5EG2 A;  4WCI A;  1C0M A;  3ZFJ A;  4X1V A;  2OJ2 A;  4FU6 A;  1UHF A;  4J7F A;  1U5S A;  2RQV A;  4C5G A;  2ECZ A;  3VUZ A;  3JCM f;  2KXD A;  1QCF A;  3PVL A;  2CRE A;  4ESR A;  4FCY A;  1UEB A;  1Z9Z A;  1GFD A;  2L0A A;  4N4G A;  1HYO A;  4CRI A;  3PMI A;  1LNX A;  5J3B A;  3CPF A;  2DX1 A;  2ZCF B;  2RN8 A;  4C92 D;  2GNC A;  4BI3 A;  1S72 A;  5GAN h;  3CCS Q;  1WLP B;  1VQ8 T;  1ZLM A;  1MHN A;  1UGQ B;  2MYS A;  5CAI A;  2P0P A;  2CP6 A;  1X6O A;  1HSQ A;  1KQS A;  3OYC A;  3SWN A;  5IXF A;  4Q5W A;  1G5V A;  4J5Y A;  1PG5 B;  3TQ7 P;  3GP8 A;  4C0Z A;  2RA2 A;  2MPX C;  2R5M A;  4RTT A;  3M0Q A;  1FMW A;  1QP3 A;  5LJ5 h;  3HRU A;  2QI2 A;  3OMC A;  1VQ6 Q;  4LN2 A;  2LP5 A;  2VV5 A;  3M9Q A;  3V8L A;  5HKC A;  3M0U A;  1Y96 A;  4F7U A;  4HVV A;  5GMK l;  3PNW C;  1ZBX A;  1VQL A;  2K5F A;  3VKI A;  4M78 B;  3GLX A;  1HJD A;  1BKB A;  1PKT A;  2ZPE B;  2KGT A;  4RUG A;  1W2B A;  3NMZ C;  2RMO A;  5IN1 A;  2B8A A;  3PTA A;  1Q82 U;  1CKB A;  3C4S A;  3EHQ A;  1YHQ T;  3C94 A;  2JXB A;  2X4X A;  5A0L A;  2E5K A;  3TSW A;  4Y92 A;  2VXE A;  2NUP B;  4RCC A;  1VQ9 A;  4XTU A;  1ZUK A;  5HCK A;  2DER A;  3H9N A;  3V7C A;  3CCQ T;  3RKX A;  4J6W A;  1PKS A;  4RG8 A;  1YI2 Q;  3JB9 H;  1PRL C;  4ZN1 A;  2KAF A;  4N4H A;  1JB0 E;  1TS9 A;  1LVK A;  6AT1 B;  5CKF A;  1GBQ A;  4C8Q B;  3JCM b;  1KQS P;  2FVU A;  2ZZD A;  3I56 T;  3I55 T;  4C5H A;  2D6F A;  1XQH A;  4J83 A;  2DKG A;  3E2U A;  2F2V A;  4XTW A;  3DB4 A;  1B7T A;  3L42 A;  3MCA B;  3G4S T;  2FZC B;  3OYY A;  4KRT A;  2L3S A;  1OYX A;  4QQG A;  4C92 E;  4M7D B;  4IUP A;  2DO3 A;  2A7Y A;  3R6O A;  4PJO G;  5GAN 3;  3N5B B;  4M77 D;  2C0O A;  1RI9 A;  2P4R A;  1JU5 C;  1K4U S;  3CC7 A;  1Y7X A;  1Y57 A;  2AZV A;  2EAY A;  1R0B G;  4PJO F;  1VQ8 Q;  2XDD A;  2X51 A;  4VUB A;  1YIJ A;  1JXM A;  4XTX A;  2JS0 A;  2EYY A;  2EYZ A;  5FWC A;  1YJ9 Q;  2EGE A;  1W2B P;  2KXC A;  1KIK A;  3QZ5 B;  1Q82 C;  2ROT A;  1H64 1;  2E1H A;  2ATC B;  3BDL A;  1D09 B;  2CP7 A;  1TU0 B;  2CP2 A;  1D0Y A;  2KK4 A;  4N0A C;  1YJW Q;  3EGX A;  2F69 A;  4ZTJ A;  4PKC C;  4NS5 A;  3UF4 A;  5CQY A;  4RTW A;  4FL6 A;  3CCL A;  2HDA A;  2IVW A;  3M57 A;  3OYE A;  3EFS A;  2B86 A;  2DK3 A;  3I35 A;  3OYJ A;  3H0I A;  2FYK A;  3M0S A;  4LNP A;  4OML A;  1Q82 R;  4FW2 A;  1PNJ A;  3HFO A;  2F2X A;  3QDR B;  1W70 A;  3CC2 A;  5GAO n;  4M78 C;  2CP3 A;  3BDU A;  2YDL A;  2EQI A;  3RES A;  1T3S A;  2RH2 A;  1ZA1 B;  4GLK A;  2OTL A;  2K2V A;  4OMM A;  3QII A;  3X28 B;  4BY6 B;  5HK0 A;  3OS5 A;  2JS2 A;  5GJW B;  5A0D A;  5GAO p;  3KUF A;  4AFS C;  1VQP Q;  3VS1 A;  1G3S A;  1YHQ Q;  3PMT A;  1VQK Q;  2EPD A;  3CBM A;  3HHT B;  4KBM B;  4J9F A;  3RKW A;  1BB9 A;  1O75 A;  1WHM A;  5IHN A;  3TCJ A;  3CCU A;  2DXB A;  1I81 A;  4JJD A;  2M0O A;  4C8Q C;  3WVD B;  2LZ6 B;  4BE0 A;  3CD6 T;  5KYW A;  1TUD A;  1Y0M A;  2QEX A;  4JZ3 A;  3VRY A;  1K1Z A;  2V8I A;  1VOM A;  2DJZ A;  1ZX6 A; 
#chains in the Genus database with same CATH homology
 2EIF A;  2YRV A;  3BW1 A;  2OTL T;  1BI1 A;  3M4G A;  3J7A F;  2OTJ A;  2DXC A;  2M1H A;  2LC4 A;  3JCM g;  4M75 B;  4KUL A;  2PUK B;  4LD6 A;  4M75 C;  4M77 E;  3RUX A;  4M7D F;  1BYM A;  2R57 A;  2RI5 A;  3P8B B;  3L2Z A;  2RK2 A;  3JCM P;  4DOV A;  4XTY A;  3ME9 A;  2X35 A;  2E6N A;  5LL6 S;  2PUO B;  2I2L A;  1EIF A;  1KHI A;  1RI0 A;  1N9R A;  2EFI A;  3QG1 A;  1M4Z A;  3G7Z A;  4A4H A;  1KHC A;  2A3L A;  2VUB A;  5GAN g;  4WF2 A;  3VJP A;  4E7H A;  4M78 E;  4XTZ A;  2E12 A;  3QYH B;  2E41 A;  3OB9 A;  4Z02 A;  3HL8 A;  5GMK i;  4E7J A;  3GPL A;  1GXI E;  4L5G A;  1FXX A;  3QO3 A;  4XQ3 A;  4E7K A;  4M7A C;  2RO0 A;  4B9W A;  1Y07 A;  4L59 A;  2CZ6 B;  1M1F A;  3BFM A;  3OYK A;  1W4S A;  1Q81 C;  3GF5 A;  4LDW A;  2JTM A;  3NTH A;  4C0D B;  4C0D C;  1XNI A;  2BKD N;  3CCU T;  4OVA A;  1I8F A;  4BB7 A;  1UGR B;  5LJ3 j;  3OYM A;  4RKU E;  4X9C A;  1KD1 C;  4ELZ C;  4LDU A;  3JB9 D;  2RK1 A;  2RHX A;  3JCM J;  4JRQ A;  1O9S A;  2K3Y A;  4OF1 A;  3SWN C;  2HQX A;  5CVI A;  3OS0 A;  4JLG A;  3OY9 A;  2DTI A;  3ASK A;  4N4I A;  3HP9 A;  1QVG A;  4PJO B;  4KUD K;  4M77 G;  3SDZ A;  4C5I A;  1OZ3 A;  1BI0 A;  1YCY A;  2LCL A;  4J6Y A;  2QEX T;  1VQN T;  1QVF A;  2KY9 A;  3JCM V;  3FLG A;  3MP6 A;  3QPH A;  4FT2 A;  3X20 B;  2DZC A;  3RMQ A;  5KCO A;  5GAO l;  3QYG B;  2RHY A;  2ZPG B;  1XOV A;  1M1K C;  5GAO m;  1OZ2 A;  1K8A C;  4JRP A;  5LJ5 g;  1YI2 A;  3KBG A;  4O6J A;  3V7S A;  2HAX A;  4C0G A;  2DZ9 A;  1X01 A;  2JOY A;  4M77 F;  3V7R A;  4OB3 B;  4NL3 A;  4LDV A;  4E47 A;  2OTJ T;  2GQV A;  3OYG A;  1G3Y A;  2PVO B;  5GAM g;  4C8Q E;  4BE2 A;  3LWH A;  3RMS A;  4M77 A;  1VQ4 A;  3JB9 I;  2PQW A;  4A4K A;  3CME A;  3OYD A;  5KE2 A;  3ZEH A;  3HPW A;  3M54 A;  3QJ6 A;  1Q86 C;  5IAY A;  1BIA A;  2HNI A;  4M78 F;  4DQ2 A;  3CXC S;  2LQ8 A;  4RG2 A;  4PLI A;  3RKY A;  3VU3 C;  4C92 B;  3S3O A;  1KQS S;  3QZ9 B;  3M53 A;  4F7U F;  1VQO A;  3M55 A;  2RI2 A;  1Q81 U;  3CCR A;  3ZBD A;  4BUG A;  3OYI A;  3JB9 F;  3HRT A;  4QVD A;  4FM4 B;  4BY6 C;  2ZPH B;  1KD1 U;  5CQX A;  2V8J A;  2E65 A;  1XTD A;  1G3T A;  3E9F A;  3I56 A;  3OYH A;  3QJY A;  1LJO A;  2YLC A;  3CCV A;  1WJR A;  3HFN A;  5CO7 A;  2L8D A;  5GMK m;  3MEA A;  3FRN A;  3WXM B;  4BD3 A;  3A8M B;  3EFR A;  4Y28 E;  1VQO T;  2BIV A;  4M7D E;  3OA6 A;  4HCC A;  1FWZ A;  1BI2 A;  1NZ9 A;  4J6X A;  2DVE A;  2MMP A;  2PVD B;  4OMF B;  2EWN A;  3MP8 A;  1WQW A;  2CS7 A;  4PNO A;  2X4W A;  5GMK e;  2CZ1 B;  5GAN j;  3L1A A;  3LX7 A;  5CKE A;  2VGN A;  4PL6 A;  1M1K U;  5GAN 7;  4QVC A;  3M59 A;  3F70 A;  2LQK A;  1PSF A;  1K8A U;  5GAO q;  4QQ6 A;  5LJ3 h;  5LJ3 d;  2EQJ A;  4QQD A;  4C8Q G;  2MI6 A;  4NOY A;  2GFA A;  3CCS A;  4OB1 B;  5FRO A;  1OI1 A;  5A2Q E;  1MGQ A;  2C06 A;  2VYT A;  4OB0 B;  2RJF A;  2RHZ A;  4MDW A;  3CPW S;  3OSS C;  2RJC A;  1D3B B;  2LT1 A;  2O4X A;  2PVG B;  1VIF A;  1ZQ1 A;  2DXT A;  5I2M A;  2LT4 A;  3OMG A;  1YIT A;  1VQ5 A;  3HSB A;  4EMG A;  1YI2 T;  3FJP A;  4M7A E;  1VQ8 A;  1YBY A;  3OYN A;  2KVQ G;  4C8Q F;  5FRN A;  3URG A;  3VYG A;  1ZHI A;  2BUD A;  4OP0 A;  4QW2 A;  4EMK A;  1Q86 U;  3GOX A;  2O01 E;  2K57 A;  1M90 C;  3DLL A;  1YJ9 A;  2L89 A;  3JCM X;  3E9G A;  3JRZ A;  3X26 B;  1X75 C;  3M5A A;  3TU4 K;  1WNL A;  2K5L A;  2RHI A;  2JVV A;  2MF2 A;  3CBO A;  3LYI A;  3LWI A;  4FIB A;  4E7L A;  4C8Q A;  2P0K A;  1W2B S;  1JJ2 A;  5CR2 A;  4ZN3 A;  1VQ4 T;  3UT1 A;  5FU7 C;  3CME T;  2LX9 A;  2Y4Y A;  4X9D A;  2DPP B;  1SSF A;  4R55 A;  4ATO A;  4M7D G;  2QA4 A;  5CKB A;  3PFS A;  2KQW A;  5LJ5 j;  2GFU A;  3DLM A;  3X24 B;  3CCR T;  2E5Q A;  3A5Z B;  5LJ3 e;  3L2Q A;  4JS4 A;  1I5L A;  4PJO D;  4O5V A;  5EG2 A;  3L2R A;  3MEW A;  4TVR A;  1I4K 1;  1VQ6 A;  2MAM A;  3S3M A;  5KH6 A;  4X34 A;  2D9T A;  3ZFJ A;  4FSX A;  2NLU A;  5GAM j;  4M75 F;  2RJD A;  4FU6 A;  5C0M A;  3CCV T;  4DA4 A;  3A8G B;  4J7F A;  4C5G A;  4M7A G;  4V2S A;  1TH7 A;  2LVM A;  2EKO A;  4IUQ A;  3VUZ A;  3JCM f;  2RD1 A;  5GAN 6;  4J7I A;  4M7D A;  1AHJ B;  3S3N A;  2D0Q B;  4HCZ A;  3JCM h;  1UEB A;  4MMK A;  1VQ7 A;  3VV0 A;  3LH0 A;  1VQM A;  4N4G A;  2E10 A;  4F7U E;  2MWO A;  3A8H B;  3ER0 A;  4M7A F;  4CRI A;  3MEV A;  4JUV A;  3PMI A;  3UDC A;  4XAX B;  3CCS T;  1QP2 A;  1LNX A;  5J3B A;  5DLO A;  3CPF A;  4MZM A;  5GAN f;  1BIB A;  2ZCF B;  2KMT A;  2EYQ A;  4C92 D;  1VUB A;  2DEQ A;  1M90 U;  4BI3 A;  1S72 A;  5GAN h;  5GAN d;  3QSU A;  4M7A A;  2G3R A;  3P8H A;  4A53 A;  4XU2 A;  2X4J A;  2L5Q A;  2LDM A;  1YIT T;  1VQ5 T;  4HKE A;  1Y71 A;  4XK8 E;  1VQ8 T;  1QVP A;  1KG1 A;  1MHN A;  1HXD A;  1UGQ B;  4C0F A;  4RMO A;  3NTI A;  4QVZ A;  5CAI A;  3OYL A;  2P0P A;  1M9S A;  4PJO C;  2EJ9 A;  3CXC A;  2HD0 A;  5CIU A;  2CGH A;  1X6O A;  1YHQ A;  4A4F A;  1KQS A;  3OYC A;  3SWN A;  3L2V A;  2LTO A;  2DD4 A;  1K73 C;  4YTL A;  1V29 B;  2JNG A;  3SB2 A;  4N0A A;  4Q5W A;  5L8R E;  3PIO A;  2QA4 T;  4M78 G;  1G5V A;  5M9O A;  4J5Y A;  4EPC A;  1NPR A;  4KT0 E;  3CCQ A;  2HBP A;  2QTX A;  4F7U G;  3J81 E;  3V8J A;  3GP8 A;  5FU6 B;  4C0Z A;  1VQ6 T;  2RA2 A;  3FEO A;  3JB9 G;  5LJ5 f;  3G6E A;  1FX7 A;  4JRK A;  2R5M A;  2RJE A;  5CKH A;  1QP3 A;  5LJ5 h;  2QQS A;  1JRI A;  3OYB A;  2XK0 A;  3QBY A;  3FDR A;  3HRU A;  4C92 C;  5CK9 A;  2QI2 A;  3OMC A;  2QXF A;  1RL2 A;  5GAM f;  4M77 B;  3CC4 A;  2VV5 A;  1U1T A;  1WQ7 A;  2XHC A;  1N27 A;  2M16 A;  3M9Q A;  3V8L A;  4M78 A;  5GAM h;  5HKC A;  1VQ7 T;  1VQM T;  2VC8 A;  1Q7Y C;  1Y96 A;  2HQE A;  3MET A;  3FC3 A;  1YJN A;  4F7U A;  3I55 A;  5GMK l;  3CCJ A;  3PNW C;  5D6W A;  4HT8 A;  1ZBX A;  1NJI C;  1B34 A;  2K5F A;  3VKI A;  1VQL A;  4M78 B;  3GLX A;  2R58 A;  3OSV A;  1KC8 U;  1BKB A;  2QDY B;  2E6Z A;  4MML A;  2ZPE B;  4M75 E;  1S72 T;  5GAN 5;  1IRE B;  3X25 B;  3RER A;  2ZPB B;  3V8K A;  3G4S A;  1UGS B;  5KE3 A;  2XU8 A;  3M58 A;  3GIB A;  1W2B A;  1K73 U;  2CZ0 B;  5IN1 A;  2JTF A;  4C5E A;  2B8A A;  3PTA A;  2VXF A;  3QHS A;  4KUI A;  3OW2 S;  1PSE A;  2XDP A;  1Q82 U;  3AHU A;  3C4S A;  1YHQ T;  3C94 A;  4BDZ A;  3UWN A;  2DD5 A;  2DTO A;  1WJS A;  5A0L A;  2X4X A;  3OS1 A;  1K9M U;  4LDX A;  2VXE A;  4RCC A;  2XG8 D;  1VQ9 A;  4XTU A;  4J8O A;  3VYH B;  3V7C A;  4XTV A;  2O4X B;  1UB4 A;  4JLI A;  3CCQ T;  3RKX A;  2DAQ A;  3NFC A;  4M7D D;  4J6W A;  4RG8 A;  3JB9 H;  4ZGJ B;  4ZN1 A;  2KAF A;  4L6V 5;  3G6E T;  2DTH A;  2RB6 A;  2YHT A;  4N4H A;  1M5Q 1;  3OBW A;  1JB0 E;  3TRE A;  4EMK B;  3G71 A;  2LCC A;  3FB9 A;  2IG0 A;  2EQM A;  4M75 G;  5DLQ E;  1Q7Y U;  5CKF A;  4PJO E;  2ZPI B;  3E1S A;  3OBY A;  1YJW A;  3O8V A;  4C8Q B;  3JCM b;  4E7I A;  3CC4 T;  1NJI U;  3MEU A;  4UC4 A;  4BI8 B;  3OS2 A;  1BI3 A;  4Y91 A;  2FVU A;  5GAN 8;  2ZZD A;  1LOJ A;  2F5K A;  2X4Y A;  3DKM A;  4BDY A;  2FB7 A;  3I56 T;  1YJN T;  2K4Y A;  3I55 T;  3HRS A;  4IUV A;  2E70 A;  3CCE A;  3CCJ T;  5GMK j;  4C5H A;  4BAC A;  1VQL T;  3SFM A;  4A4E A;  2D6F A;  1XQH A;  5IT9 E;  4J83 A;  2H3J A;  5HY6 A;  3TEE A;  4MDX A;  2CYZ B;  2K5I A;  2DKG A;  4D6W A;  1NPP A;  4R56 A;  4M75 A;  3M4Y A;  1UGP B;  3DB4 A;  3L42 A;  4XTW A;  3MCA B;  3JCM d;  3M56 A;  2KSS A;  1JBM A;  2RHU A;  3G4S T;  3OYY A;  5CKD A;  1OYX A;  3C95 A;  4QQG A;  4C92 E;  4PLL A;  4M7D B;  4M7D C;  3PIP A;  4HA8 A;  4IUP A;  2DO3 A;  3BY7 A;  2A7Y A;  2K3X A;  3OQ5 A;  2R5A A;  4ME7 A;  3KXT A;  3PT9 A;  3R6O A;  1U8R A;  4PJO G;  5GAN 3;  3N5B B;  4M77 D;  4A54 A;  4OGE A;  5J39 A;  1JJ2 S;  1G3W A;  2XDB A;  4XU3 A;  3FIF A;  1VQ9 T;  2P4T A;  2XKO C;  3H8Z A;  3A8O B;  3JCM c;  5I2S A;  3OYA A;  1N8R C;  1KC8 C;  4EDU A;  4M7A B;  3CC7 A;  1Y7X A;  3QUI A;  4OB2 B;  1YJ9 T;  4LD9 K;  1VQP A;  4JRI A;  1N9S A;  2DIQ A;  2EAY A;  1P92 A;  4PJO F;  4XU1 A;  3LW5 E;  2XDD A;  3E19 A;  4M78 D;  4A4G A;  5FRM A;  1VQK A;  2JUF A;  2EJG A;  4VUB A;  3G71 T;  1YIJ A;  4XTX A;  2QQA A;  4RCB A;  5AYF A;  2CZ7 B;  3JCM e;  2FL7 A;  5A0G A;  1IZ6 A;  3PGG A;  4B9X A;  2M9U A;  3QZ5 B;  4PJO A;  1Q82 C;  2QQB A;  5GAN 4;  3CMA A;  3JAM E;  1H64 1;  2E1H A;  3SWN B;  1YJW T;  3BDL A;  2GF7 A;  1M8V A;  5I21 A;  4MZT A;  3MO8 A;  3EAE A;  2EJF A;  4BE1 A;  4JS5 A;  4C92 G;  3WVE B;  3Q1J A;  1M1G A;  5KCH A;  1QVF S;  2QQ9 A;  3C12 A;  1K9M C;  3LGF A;  5FU6 C;  2KK4 A;  4FT4 A;  4N0A C;  2WSC E;  2F69 A;  5GAN e;  3T9N A;  4ZTJ A;  3JB9 J;  3P8D A;  4PKC C;  4NS5 A;  5D6Y A;  3CCE T;  5LJ5 d;  5CQY A;  4FL6 A;  1VIE A;  3CBP A;  2PU9 B;  3CCL A;  2IVW A;  3M57 A;  2Y90 A;  3QXE B;  3VUB A;  4C92 F;  3OYE A;  4BI4 A;  3EFS A;  2DK3 A;  4M77 C;  5FLX E;  3JCM W;  3L2U A;  3SD4 A;  4HT9 A;  3OW2 A;  2JN0 A;  4ELY C;  3CD6 A;  3OYJ A;  5GAM d;  5GAO r;  2MWP A;  3MHX A;  2FYK A;  5GMK h;  3CPW A;  3A8L B;  2EQK A;  2Y4X A;  3L2W A;  4C92 A;  3HFO A;  4DOW A;  3CCM A;  5CCA A;  1WPY A;  3QDR B;  5HK3 A;  4IKF A;  3CC2 A;  5GAO n;  4ZTF A;  1N8R U;  2FHD A;  2YLB A;  4M78 C;  1QVG S;  3BDU A;  4JJN K;  3MP1 A;  5DY9 A;  3UPU A;  1Y96 B;  2JZ2 A;  3LGL A;  1WGS A;  4C8Q D;  4F7U B;  4LDY A;  1WJQ A;  2GCX A;  3DB3 A;  2VGM A;  3GNF B;  1B34 B;  2RH2 A;  3RES A;  4GLK A;  2OTL A;  2K2V A;  3QII A;  4IUU A;  3X28 B;  4BY6 B;  2E64 A;  3NTK A;  5HK0 A;  3CC7 T;  2XD0 A;  1KQ2 A;  2LRQ A;  5LJ5 e;  1VQP T;  3OS5 A;  1R8O B;  5A0D A;  5LJ3 g;  5GAO p;  1NE8 A;  3KUF A;  1VQK T;  3RIR A;  1YIJ T;  5J26 A;  3QKJ A;  2P0Q A;  3H6Z A;  4P5N A;  5GAM e;  1G3S A;  2WSE E;  4CI0 C;  2WAC A;  3PMT A;  4IUR A;  3JSC A;  1KQ1 A;  2DXU A;  3CMA T;  5D6X A;  4ZGD B;  2XID A;  3J80 E;  3CBM A;  3HHT B;  4KBM B;  2XIC A;  5LJ3 f;  3RKW A;  2CKK A;  3INZ A;  4M75 D;  4HCB A;  3HKS A;  1D3B A;  2RM4 A;  3LLR A;  1O75 A;  4MZP A;  3GNG A;  4EMK C;  3TCJ A;  3CCU A;  2DXB A;  4GY5 A;  2L3R A;  4EMH A;  1I81 A;  4II1 A;  2RI3 A;  2M0O A;  2EQU A;  3CCL T;  3OYF A;  4C8Q C;  2XI9 A;  3WVD B;  2F5T X;  2QQR A;  4NL2 A;  4JDS A;  4BE0 A;  4M7A D;  3CD6 T;  2ZGW A;  1DJ7 B;  5DM7 R;  2AHJ B;  2KDS A;  1U1S A;  1QW1 A;  1HK9 A;  2ZPF B;  2QEX A;  2WSF E;  4ZGE B;  1VQN A;  2LNV A;  3JCM Q;  3CCM T;  5GAN 2;  2V8K A;  1N6A A;  3CC2 T;  4OGC A;  5FU7 B;  4XU0 A;  1H3Z A;  2DIG A;  2V8I A;  3CEY A;  3S6W A;  2OAU A;  2DJZ A;  4IUT A;  5C6S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...