1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
molecule keywords PROTEIN (PSAE PROTEIN)
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
1DJ7B 2PVDB 1QP3A 2WSCE 2WSFE 3X25B 2PVGB 4KT0E 4OB0B 2ZPEB 1UGSB 2PUOB 3A8HB 4Y28E 3X24B 4ZGDB 1AHJB 1V29B 2QDYB 5L8RE 1UGRB 4ZGEB 4OB3B 3A8MB 2DXCA 3A8GB 4OB2B 2ZPBB 2DPPB 2ZPFB 2ZPGB 1IREB 1JB0E 3A8OB 3QYGB 3VYGA 3X28B 2DXBA 3QZ9B 3WVDB 3A8LB 1GXIE 1PSFA 4L6V5 1QP2A 2D0QB 3WVEB 2PU9B 2ZPHB 2WSEE 4OB1B 2CYZB 2DD5A 3QYHB 3VYHB 3QZ5B 2O01E 3HHTB 2AHJB 2PVOB 2CZ6B 2CZ1B 3LW5E 2ZZDA 4RKUE 2DD4A 2ZCFB 1UGPB 2PUKB 2CZ0B 4ZGJB 3X20B 3X26B 4XK8E 4FM4B 1PSEA 2ZPIB 1UGQB 2CZ7B 3QXEB
chains in the Genus database with same CATH superfamily
4HA8A 2O88A 2MF2A 2EJFA 2P4TA 3OYJA 2DYIA 3C4SA 1BCMA 3CCJQ 3MO8A 5IHNA 1LNXA 2DL5A 1K8AR 2BIVA 3L2UA 4C0DB 2RO0A 3RKYA 3V7SA 2ESWA 2O9SA 1W2BS 3M57A 1WNLA 1VQ6Q 2HD0A 4F16A 3CPWP 3GPLA 2ZGWA 5KYUB 4B9XA 1YHQQ 2E6NA 2XKOC 4FT2A 4Y28E 3BY7A 2YUQA 2XDPA 1N8RC 1M9SA 1ZBJA 1YJ9A 3LX7A 1YCSB 3KBGA 5FRNA 4TVRA 2LP5A 4C92F 3CPWA 4M7AB 5CQYA 4M7DF 5DLOA 2O4XB 3NTHA 1RAFB 1Y07A 4ZN3A 2XI9A 1VQ4Q 1TH7A 2L3SA 5FW9A 3UA7A 3MKDA 4PK4A 2EQIA 3VS3A 3QIIA 1WLPB 3RR6A 4BE1A 1JRIA 3A8GB 1LOJA 1OULA 2ZPGB 3TSWA 4F14A 1VIFA 3WVDB 2RMOA 4M78A 5GAOl 2NUPA 3CMAA 4M7AC 2HQEA 3WVEB 3G71A 4MMKA 4A4HA 2XICA 2CZ6B 2DVJA 4IIMA 1Z9ZA 4QVCA 1D0YA 4JJNK 4KRTA 4M77A 1OPLA 5J3BA 3CCQQ 1UTIA 2RHXA 1CSKA 1N27A 3H0FA 1M1FA 1UE9A 5GANd 4X1VA 3OMGA 4YTLA 4PJOC 1JO8A 5CVIA 2F2WA 3JB9F 3OS0A 3RESA 1ARKA 4DEYA 1TU0B 2Y4YA 1VQKA 1PRMC 1FMVA 3CCRQ 2RHUA 5KE3A 1F1BB 1I81A 1X43A 3JCMd 4N4IA 1WFWA 4AG2C 3QYHB 2LT1A 3VS6A 3OSSC 3CXCA 4DOVA 4KULA 4XQ3A 5EG2A 5I11A 4QQ6A 3UDCA 3CCSQ 1PWTA 2ATCB 4LDXA 3A8MB 2DPPB 1VQNQ 2A08A 2E5QA 2V8IA 3QG1A 1G83A 4M75B 2E12A 2RI3A 4Z88A 3LW5E 4OP0A 2RQRA 3GLXA 1I07A 1NPRA 2YLCA 3M0SA 3HP9A 1VYVA 4HT9A 3JB9H 1YJWT 4JRIA 3CCLA 1QVFS 1IGUA 1K0XA 2KGTA 3I56T 3L2VA 2M51A 3HRTA 3JCMW 4M7AD 5A2QE 2E5KA 4BI4A 1YIJQ 2DNUA 2COZA 4JJBA 1T0HA 1G3TA 3V8JA 3EGDB 7AT1B 5HCKA 2L3RA 3P8BB 4C0GA 1TG0A 2PQWA 3S3NA 4O6JA 3GIBA 2DL8A 2OAWA 4OB3B 1QVGS 1JEGA 5FROA 5DLQE 1QCNA 4AFSC 4BY6B 3I5SA 2DD5A 4M7DA 2EGCA 5KH6A 5L23A 1OU9A 1NYGA 3TQ7P 2LQNA 4M7DE 4FU6A 4FM4B 4C92E 3M9QA 1GXIE 3PVQA 1PHTA 3EH1A 4CC7A 1VQ6A 5HY6A 1KIKA 3KUFA 1VQLT 2L3QA 2YUNA 2CKKA 1BI3A 3M54A 3MEUA 1OU8A 1MV3A 3LWHA 1NM7A 2YUOA 3HHTB 1BU1A 5AYFA 1VQMA 1LVKA 2K3XA 3I55T 4M78F 4JS5A 2DTIA 4A63B 2LX7A 2LCCA 2XHCA 1YJ9T 4CC2A 3OA6A 1B3QA 3Q1JA 1OI1A 2LVMA 3QZ9B 3CCMQ 2FZCB 1PSFA 1M2VA 2YXYA 2M0OA 3E9FA 4C92A 5HK3A 1AVZC 1IGQA 2L2PA 3UPUA 3E2UA 2VV5A 2KXCA 1I0CA 3A5ZB 4MZTA 3OW2S 2L89A 2RA2A 1G3WA 1YI2A 5CQXA 1GRIA 4LD6A 1NJIR 1QKWA 3VRZA 1WHMA 2LCLA 3VS4A 1Q81C 2K2MA 1P92A 1PM3A 1X27A 2M16A 4MDWA 1WYXA 4XTWA 4J83A 3QBYA 1VQ9Q 3CCQT 2ZPEB 3CMET 5IT9E 4IIOA 4ELYC 2DZCA 3M0RA 5I21A 2ZPBB 3EHRA 3ZL7C 3CCEA 3LH0A 3RKXA 2ZPHB 4HVWA 1S72A 1QWEA 3QZ5B 3O5ZA 1AZEA 2L3PA 3R6NA 3ULRB 1T3LA 2V26A 4CRIA 1NEGA 3MEAA 3V7CA 5L8RE 4OF1A 2YLBA 1VYUA 2XG8D 2PTKA 1SHGA 3R6OA 4M77E 3JCMc 1Q82R 1WA7A 4RTZA 3FIFA 2NUPB 2FZGB 1NLOC 4PJOF 3PTAA 4Y91A 1CKAA 1QQJA 1U1TA 1HJDA 2KROA 3MPUB 1G3YA 3ZBDA 2Z0WA 4LDWA 2LC4A 3FEOA 1AOJA 2LMJA 4J9IA 4M78E 2K2VA 2RB6A 3CCST 2CP3A 4L5GA 2QASA 4ME7A 2BZ8A 1YJ9Q 3L2ZA 1QMCA 1X01A 2CSQA 1TUGB 1D0ZA 3JCMg 3QSUA 1M1KC 4B9WA 3SD4A 3TU4K 1WHJA 2MMPA 3CCLQ 4M7AF 4IUVA 1BI2A 1D09B 3H0IA 2SRCA 4RMOA 3PMTA 1VUBA 1VQ7Q 1EFNA 2EJGA 1M1GA 9ATCB 4ORZA 1KHIA 2K5LA 3GF5A 3LH5A 3OYLA 1K73R 2FEIA 3JCMe 1YIJT 3MEVA 3QJ6A 4IUUA 1RL2A 1S1NA 1N9SA 2L0AA 2M1HA 1YBYA 3VJPA 3ZFJA 5LJ5d 2CT3A 2MYSA 1T3SA 2M0YA 2LCSA 4PFPA 2GFUA 5GANh 4JRKA 1Y96A 4KT0E 3U23A 3L42A 2IVWA 3RMSA 1Y96B 2MCNA 3MP8A 3OYAA 2DBMA 2B8AA 2RJEA 4OB1B 2MWOA 2NUTA 4X34A 1RAIB 1JXMA 1LPLA 4LE9A 2KRSA 1VQNT 3VS5A 1Q82C 2MOXA 1ZSZC 4XU0A 2DXCA 2AZSA 3X25B 2X3WD 3A1PA 3EAEA 4DA4A 5A0LA 3LGFA 3CCRA 4BI8B 2X35A 2RJFA 2VASA 1PKSA 2FRWA 2KT1A 5DY9A 3CCET 3JCMJ 4M75A 3I56A 1WJQA 2KSSA 2ROLA 3CCSA 4MDXA 2OJ2A 3S6WA 1ZSZA 1UGRB 1N8RR 2F5TX 1VQNA 1LJOA 4C8QG 2AKLA 1VQPA 2DLPA 1WHLA 4II1A 4AFZC 2EYZA 2MAMA 3V8LA 3TCJA 2GQIA 3SB2A 1B07A 3DLLA 1R0CB 1WHKA 5GAOq 2RHIA 4PJJA 1ZA1B 1QCOA 1VQ7T 1N6AA 4FYYB 1PCXA 2X3XD 1V29B 1YITT 1WDXA 3VU3C 5C6SA 1JJ2P 2RHZA 4HXJA 1MNEA 4AT1B 1ABOA 1UJ0A 5FWBA 2EVRA 4XTUA 1UG1A 4XU2A 3UT1A 4GY5A 2EYXA 2KXDA 3RNJA 4XTZA 4EMKB 1BIAA 3RKWA 3AHUA 4C8QF 2RI5A 1ZUUA 2HMAA 1RADB 5GJVB 1HXDA 4F7UF 3CMEQ 5D6XA 4FYWB 1Q86U 3GBQA 4KBMB 2JTMA 1RLPC 1BCOA 1TUDA 1RAAB 5GAMd 4IUTA 2GNCA 1V76A 1M90R 2K5FA 5CKEA 1RACB 5GANg 3NHNA 1ZLMA 2E1HA 1Z9QA 2OI3A 3A8HB 3L2QA 2D0NA 1Y7XA 3JCMf 3CCQA 5GAOr 1G8XA 1UJYA 5GAN6 5KCOA 5CIUA 3VS0A 1KC8R 1X2KA 1T0JA 2RM4A 4UC4A 1SKUB 2EBPA 1KG1A 1VQ8Q 4NL2A 1OPKA 5I2MA 1G5VA 3HSBA 4BI3A 2VXEA 3THKA 2KYMA 3F70A 1M1KU 2GTOA 1N8RU 3HTRA 3JCMX 2QDLA 3L1AA 3ER0A 2IIMA 3OYDA 2K57A 1H3ZA 1VQKQ 3HL8A 8ATCB 3S3MA 4A4FA 4J9FA 3CCMA 4OMMA 2MIOA 4E7HA 4JRQA 1IHWA 1G3SA 2QA4A 5KE2A 3OBWA 4FCYA 5LJ3j 2QTXA 3HRUA 4KGZB 2FPEA 3VV0A 5GAN5 1H641 2LNHB 4FYXB 2GCXA 4JUVA 3I9QA 2HNIA 5GAN3 2RNAA 2H3JA 3MHXA 1QKXA 1KD1R 2K7AA 1M4ZA 3MCAB 2K3BA 5FRMA 1ZUYA 4M77G 2AZVA 1WXBA 2ZZDA 4FSXA 5LJ3f 4E2FB 2DL3A 1OX9A 2R58A 3NPFA 5GMKm 5GANj 5HK0A 2EGAA 4AFUC 1AWXA 5GAOm 3G1JA 2LT4A 3VKIA 3OYFA 5GAMj 2C0OA 4M78C 1X2QA 3A8LB 2QYZA 5KYWA 3QKJA 1TTHB 4A4GA 1ZX6A 2XDDA 1YIJA 4PJOD 1KJWA 2YRCA 3EFOB 1SHFA 2NWMA 1PD1A 2X4YA 1WIEA 1IZ6A 2JM9A 2QGFB 1TXQA 5GAMh 2EYQA 3CCLT 4FL6A 2J6KA 2EQUA 2KYBA 4OMLA 5GAMe 3FLGA 1K4US 5KYYB 3PFSA 4PJNA 2BUDA 5LJ3g 4PJOA 3S3OA 2OTLA 3BE3A 4M78D 2VGNA 4XK8E 4F7UE 4F04B 1DJ7B 2G6FX 2YUPA 2GF7A 1I5OB 5KYNA 4GLMA 1SEMA 3QYGB 2H8HA 3M58A 1YP5A 2MI6A 2AIRB 1VQOA 4QVZA 3MP1A 1M90U 2CP5A 5LJ3h 3PIPA 3CMAT 2VB6A 2PUKB 4AMCA 2NLUA 1HSQA 2GBQA 1YN8A 3VS2A 2A36A 3L2RA 3G4SA 2VWFA 1JXOA 2MPXC 3VUBA 1YITQ 3UWNA 4M75E 2E70A 5CK9A 3CC4T 5LJ5e 1KC8U 4J6YA 3OW2P 3DKMA 5FU7C 3BDLA 6AT1B 2K79A 2XK0A 3CCRT 5D6YA 2QEXA 5A0GA 3QUIA 2PUOB 2CH4W 2RQVA 4QT7A 2KVQG 4C92G 1AWOA 2E3IA 4M7DG 3JB9D 1AEYA 1NZ9A 2JNGA 3QHSA 2DM1A 2IG0A 1MHNA 4B6MA 1KQ1A 4RTWA 5GMKj 4Z8AA 3BDUA 3RMQA 1U06A 1I8FA 1KHCA 4VUBA 2H3EB 1FYNA 1TWBA 3IQLA 1KD1U 2Y4XA 2DRKA 2QQSA 2CGHA 3OS2A 3RERA 4PLLA 4LUDA 1AT1B 1S72Q 4C5EA 4M7DD 4RTXA 2JTFA 1H92A 1M3CA 1XOVA 1W2BP 3I56Q 5KYXB 1PSEA 2VYTA 1H8KA 1IXDA 1OZ3A 2HL3A 4RG8A 2JJ9A 2RH2A 2COYA 1VQPQ 4C8QC 2E41A 2JS2A 2LX9A 4NS5A 3X28B 2C06A 4HCZA 2EQKA 4FIBA 3SHWA 3CMAQ 4ESRA 2B86A 3EGXB 1I1JA 2AK5A 2DJZA 2AKKA 4DBFA 1D1CA 4DBQA 1R0BG 5KYUA 1ZUKA 1KQSS 3JCMQ 1D1AA 1QP2A 5CKHA 1QVFA 2QI2A 1JJ2S 3MEWA 3HKSA 3G4ST 4C5GA 1WQWA 2EIFA 1VQ7A 3OYBA 1VQ5A 1GCQA 4WTOB 1VQ8T 3KFVA 1MNDA 2QGGA 3BW1A 4ZN1A 4FT4A 4XU3A 3FC3A 2LJ0A 3CXCS 2KR3A 2ENMA 1QVGA 2YSQA 4HT8A 1M2VB 4CC4B 4V2SA 2C0IA 1FWZA 4HVUA 2J6FA 4E7ZA 4J9DA 4LNPA 3SDZA 1ZA2B 4BDZA 2HBWA 1KK7A 1YJWA 1SG5A 3CCVT 2J05A 1M3BA 2PZ1A 3M55A 3NGPA 2DA9A 1S72T 1WGSA 5HKCA 3OYGA 2DETA 1WQ7A 4A4KA 1Q95G 4C0DC 1MMGA 5CR2A 2PVGB 2LJ3A 3WXMB 1IO6A 2QQ9A 3A98A 3PVLA 4PFOA 5D6WA 1VQ9T 2RJCA 2LTOA 1YCYA 2F2XA 3REBB 4RTVA 2DFUA 2O2OA 3PNWC 2K9GA 2A7YA 4M77D 3INZA 1JQQA 5CO7A 2VUBA 3CC4Q 2XU8A 2DMOA 3JB9G 1W6XA 2JT4A 4KGXB 1PD0A 4XU1A 3VS1A 2E3HA 2SEMA 2PU9B 1VQOT 2RK2A 4FW2A 1UB4A 3H6ZA 3NTIA 1OX8A 1UGPB 1BYMA 1LCKA 4J9BA 2EYWA 3EG9B 4M7AG 3TSZA 3QWYA 3UA6A 5LJ5g 2D1XA 1VIEA 3NTKA 2DXBA 4JDSA 2E6ZA 1NJIU 2V8JA 4AFQC 1Y71A 1QVFP 1KFZA 3L2WA 1M1KR 1XNIA 2PVOB 4C92C 5GAOp 2DL4A 1WJSA 5KYWB 2EQJA 2X9HA 3EFRA 3TEEA 1XQHA 1Q7YU 1C0MA 1WXUA 2PVDB 4D8DA 2FPFA 3JB9J 3JCMb 2KAFA 3X24B 4DBHA 3CMEA 1C1AA 2QTVA 1UGVA 1NPPA 3FRNA 2GTJA 1D0XA 3JV3A 5LL6S 3CC7Q 1IREB 4KH1B 4EMKA 2O9VA 2FPDA 5FWCA 1Q81U 1U5SA 2AHJB 4LD9K 5I22A 2JOYA 3EH2A 3PT9A 4IURA 4BY6C 3J80E 2NYSA 3CCJA 5GJWB 5DM7R 4X9CA 4HCCA 2XIDA 1ZSZB 2V1RA 1CKBA 3ME9A 1M5Q1 3OYIA 1K9MC 1WX6A 2VXFA 1QW1A 4C92D 4OMQA 3EGDA 3VYGA 4M75F 3OYCA 1R8OB 4RCCA 4J9GA 2HQHA 5J39A 2DRMA 4EIKA 2J7IA 1VQLA 2GGRA 3QXEB 2YWWA 3V7RA 1V1CA 1KQSA 2E4HA 4HVVA 2C0TA 4PJOG 2HZYA 4E6RA 2DO3A 2RF0A 1SRLA 1M2OA 3I55A 4DEXA 1HD3A 1KD1C 1EX4A 3DB4A 5IXBA 2QA4Q 4O5VA 2QK0A 2P0KA 1W4SA 1VQ5Q 1QLYA 4RUGA 1BKBA 2FZKB 1UGQB 1MGQA 2HL5C 1IHVA 4ZNXA 2F5KA 2OTJA 4JS4A 3JRZA 4BE2A 1NEBA 3UATA 1QCFA 2LJ1A 1PC0A 2KY9A 3EGUA 4J9CA 4LUEA 1YWOA 2CH4A 1VQPT 2O4XA 2FG0A 4M75D 1SSFA 4MZMA 3OB9A 2K5IA 3KXTA 2GQVA 4OMOA 4DOWA 2QQRA 2JN0A 4JRPA 1KQSP 4M7AE 1OZ2A 2A0FB 2R5AA 4JPBW 4OGCA 4RTYA 4PL6A 2G3RA 1UEBA 1O75A 3CCUQ 1Q81R 1W70A 2CP2A 2DX1A 3G6EQ 4HCBA 4KUIA 1UUEA 1PNJA 1FX7A 2D8HA 1X6GA 2DK3A 2KBTA 2ECZA 2ZPIB 3M0QA 2YT6A 1M90C 1K9AA 1M8MA 4FSSA 3JSCA 2K4YA 4J8OA 4DQ2A 2JW4A 3H0HA 3M56A 3OS5A 2P0PA 3MJXA 1YNZA 2HBPA 4Q5WA 1UHCA 1MMAA 1KC8C 2RHYA 2DD4A 3GP8A 3CC4A 2HKNA 5GMKl 4OMNA 4J9EA 3EHQA 5CAIA 1VQ6T 3QJYA 2FO0A 1R77A 3CC2Q 2COWA 1YHQT 4C5IA 2BE9B 1NBEB 4PLIA 1VQOQ 2JXBA 2EAYA 3SWNB 2RQTA 1WPYA 3CEYA 3OQ5A 4KUDK 4ZTFA 2VVKA 4M75C 3CCVQ 5LJ5f 2E10A 1IRXA 1NE8A 2HDAA 1WZOA 1GL5A 2DAQA 4OB2B 5C0MA 3EG9A 4E7LA 2KNBB 4HKEA 4M77B 3OYNA 5D7UA 3VUZA 3PGGA 2XD0A 2KRMA 2BZYA 2QXFA 2KRNA 1NJIC 3E9GA 4RKUE 3PMIA 1RAEB 1PRLC 2QEXQ 4OMPA 3C12A 2YDLA 3OYKA 1ZSGA 5EC7A 5IH2A 2QDYB 2FL7A 1ZQ1A 4ZGEB 1N9RA 1Q86R 3LGLA 3LWIA 1PG5B 1BK2A 4JLIA 5GAN4 4CI0C 2K3YA 4FYVB 2ABLA 3GNFB 5GAMf 2CP0A 4HCKA 2RK1A 3CQTA 2DXUA 3OW2A 2F2VA 5FU6C 1WXTA 3OSVA 3FJ5A 1BBZA 4QVDA 2HSEB 2DL7A 1MV0B 4J5YA 1GBQA 4E7JA 2YRDA 2K6DA 1VQMQ 4BUGA 2HCKA 2BZXA 4A53A 2KEAA 2JVVA 1PKTA 3CD6A 3X26B 1M30A 4D6WA 4E7KA 2LQ8A 3QO3A 3URGA 2KE9A 1AD5A 4N4HA 1AZGB 2L8DA 3META 1GCPA 1XJWB 1QWFA 4BDYA 3SWNC 2I0NA 1JU5C 1YJNT 5GAN7 3H8ZA 1SF9A 4E7IA 4N4GA 4DBRA 1VOMA 4C0ZA 2LQWA 2QA4T 1B7TA 2CYZB 3OYYA 4P5NA 2ZCFB 2EYYA 2W0ZA 2HEQA 4JLGA 2OTJQ 3OY9A 1HYOA 4C8QD 2BTTA 1KSWA 1OOTA 5IAYA 2RD1A 4JZ4A 3EFOA 1Q82U 5FLXE 3GOXA 3N5BB 5GAOn 1X75C 1RAGB 2O01E 3HFOA 1VQ9A 1FMWA 2CZ0B 1N5ZA 2DKGA 2HAXA 2LZ6B 2DF6A 1VQ8A 3OBYA 2LDMA 1KQ2A 2W10A 2JZ2A 1B34B 1M3AA 2RJDA 3UF4A 5GMKi 3G6ET 4ANJA 4M77C 5KCHA 3TREA 4M75G 1ZHIA 4J7IA 3V8KA 1K8AC 1A0NB 2DBKA 3RUXA 1QP3A 2D8JA 3M53A 1MMDA 2J6OA 3SEMA 2CP6A 2DIQA 2FVUA 3C95A 1GCQC 2QQAA 3SFMA 1VQMT 4LXCA 3FDRA 2FYKA 2QAZA 1XTDA 1K8AU 2LRQA 2JUFA 3E19A 3C0CA 1BB9A 1VQLQ 4LDVA 2JTEA 3CC2A 2V1QA 2CP7A 3QPHA 3MP6A 1OQKA 2DTOA 2YHTA 3ZEHA 4IKFA 4F7UG 4EDUA 2X4XA 3CC2T 4RTTA 2EGEA 3I55Q 2OX7A 4EMHA 1WHHA 3CPFA 2DJQA 2KQWA 2DEUA 2Y90A 3AT1B 1ZBXA 4NOYA 1OV3A 2EKHA 1U8RA 4C8QB 4XTVA 4N0AA 5LJ3d 3CCUT 1YWPA 3X20B 2FB7A 1D3BA 3HRSA 1OEBA 2DIGA 3P8DA 1GBRA 2KDSA 2WSFE 4QW2A 2DVEA 2M02A 1J3TA 3P8HA 3JCMV 2EPDA 3O8VA 3M0UA 3OMCA 5FU6B 3T9NA 4FW1A 2MK5A 4JJDA 2P84A 1QVGP 2NUTB 1IB8A 2CZ1B 2F69A 4WCIA 4F17A 2DE0X 1Y0MA 1UECA 3NMZC 1EIFA 2OTLQ 3E1SA 3M0PA 1AHJB 4J7FA 1VYTA 5M9OA 4KH0B 4CC3A 1SRMA 2D9TA 1E6GA 3CD6T 4A54A 1NLPC 5IHIA 1K9MR 1SPKA 4M78B 1QVPA 4BE0A 3JCMP 4GLKA 2M9UA 1RABB 2RQUA 2KK4A 2WACA 1YHQA 1BIBA 2DZ9A 1O9SA 2XMFA 4OB0B 2LQKA 2IPOB 2L5QA 2EFIA 2EQMA 1WI7A 3RDVA 2KI7A 3CBMA 2OAUA 2EJ9A 3EGXA 3QWXX 1K73U 3G4SQ 1RLQC 4RG2A 5IHKA 4MMLA 3M59A 2WSEE 4IUPA 2ED0A 1K1ZA 4Y92A 4X9DA 1I4K1 1M8VA 2EWNA 4ZGJB 2HQXA 4EMGA 1H3HA 5GAN2 1TUCA 2CS7A 1YJNQ 1E7OA 2QEXT 3CBOA 1W2BA 1G2BA 2GFAA 4K11A 3VYHB 1B34A 3G71Q 5IN1A 4C0FA 1C6VX 3EG3A 2V8KA 2OTJT 4OMFB 1RUWA 2J06A 4PJLA 2E64A 4ZTJA 4PKCC 1MMNA 2F1LA 3NFCA 1OYXA 1D1BA 3EFSA 3RIRA 3PE0A 1UFFA 3HFNA 4C8QA 4BACA 4BD3A 3J81E 2BE7D 2FHDA 3CBPA 1X69A 5AT1B 4M7AA 2VKNA 3M5AA 2WSCE 2RQWA 4J6WA 3EG2A 2HKQB 4KGVB 4ATOA 2ZPFB 4E47A 3A8OB 1K73C 1ACMB 3JAME 1K9MU 4LN2A 4Z02A 4PJOB 2RN8A 5KYYA 4R0KA 1NG2A 2A3LA 3EG0A 3D7SB 4XAXB 3BFMA 4C8QE 1YI2Q 3GNGA 1D3BB 4ZGDB 2QG9B 4BB7A 1ABQA 1M27C 3G7ZA 2X51A 4EMKC 5LJ3e 4PJMA 5ECAA 3CCUA 4ELZC 3JB9I 1HK9A 2BKDN 3M4YA 4C92B 3VRYA 1SSHA 3G6EA 1Q7YC 3H9NA 4M7DB 4PNOA 5FU7B 1I5LA 2MWPA 1VQ4T 2PNIA 4XTYA 4R56A 4LDYA 3FJPA 5GAN8 2JMCA 1VQ4A 8AT1B 5CKDA 2DERA 4Z89A 3CCEQ 2JM8A 2R57A 2CSIA 3EG1A 3JCMh 1YFNA 2E65A 3HPWA 4EPCA 1NYFA 3TVTA 4LDUA 2R5MA 4OGEA 2X4WA 2EKOA 2QQBA 3DB3A 4C5HA 3CC7T 2XDBA 2ZAEA 2RPNA 4F7UB 3M4GA 3RBBB 4XTXA 3VS7A 2HSPA 3LYIA 2KMTA 4RCBA 1TSFA 2AT1B 2CDTA 3DLMA 1EZZB 4J6XA 4QKUA 2ROTA 1BI0A 2A37A 2EW3A 1YJWQ 2YRVA 2A28A 3OYEA 5GMKh 4QQGA 2CREA 2DTHA 1E6HA 1RI0A 4L59A 1JJ2A 3CCVA 1X6OA 3QDRB 2DILA 2DYBA 3C94A 3CCJT 2I2LA 4PFZA 3I35A 3SWNA 1UHFA 2DEQA 4NL3A 2CUDA 2VGMA 2JS0A 3OYMA 5CKFA 1W1FA 2CUBA 1Y57A 1AWWA 3QDFA 1FMKA 1TS9A 5CCAA 4AG1C 4PJOE 1GFDA 1WJRA 4OVAA 3CPWS 2CZ7B 5GANe 1U3OA 2VC8A 1Q7YR 1UGSB 1YI2T 5CKBA 5KYXA 2D6FA 4R55A 1VQ5T 4E7SA 3ASKA 3CXCP 4M78G 1BI1A 4L6V5 4N0AC 2D0QB 2JMAA 5J26A 3PIOA 1K76A 2RI2A 4WF2A 2KT8A 1AWJA 2DXTA 4RTUA 1YJNA 5LJ5j 1VA7A 4JZ3A 2CT4A 1Q86C 3REAB 1JBMA 5I2SA 3OS1A 2X4JA 5IXFA 5GAMg 1JB0E 1WHGA 1RAHB 4D8KA 4F7UA 2FRYA 3H41A 4J9HA 2OTLT 1RI9A 3G71T 4IUQA 1TOVA 4GBQA 3OYHA 4M7DC 3FB9A 1FXXA 1VQKT 1UDLA 1YITA 4JJCA 3CD6Q 3CCMT 4MZPA 1U1SA 1GFCA 3I5RA 2ED1A 3M0TA 4M4ZA 5A0DA 1X6BA 2P4RA 3J7AF 4M77F 5GANf 3CC7A 2LNVA 5GMKe 2NUZA 1K0SA 4A4EA 2P0QA 4QQDA 2O31A 5LJ5h 3LLRA 1MUZA
chains in the Genus database with same CATH topology
4HA8A 3X25B 1VQ8A 2MF2A 3SDZA 3OBYA 2EJFA 4BDZA 2P4TA 3OYJA 3EAEA 4DA4A 1YJWA 3C4SA 5A0LA 2LDMA 3LGFA 3MO8A 3CCRA 1LNXA 1KQ2A 2BIVA 3L2UA 4C0DB 2JZ2A 2RO0A 1B34B 2X35A 3RKYA 4BI8B 3CCVT 3V7SA 2RJFA 2RJDA 1W2BS 3M57A 1WNLA 5GMKi 2HD0A 3M55A 3G6ET 3GPLA 2ZGWA 4M77C 1S72T 4B9XA 1WGSA 5DY9A 5KCHA 3TREA 3CCET 5HKCA 3OYGA 4M75A 3JCMJ 2E6NA 2XKOC 1ZHIA 1WQ7A 4M75G 4J7IA 3V8KA 4FT2A 1WJQA 3I56A 1K8AC 4A4KA 2KSSA 3RUXA 4C0DC 1QP3A 3M53A 5CR2A 2PVGB 4Y28E 3BY7A 3CCSA 4MDXA 1N8RC 2XDPA 3WXMB 1M9SA 3S6WA 1UGRB 1YJ9A 2QQ9A 2F5TX 1VQNA 1LJOA 3LX7A 4C8QG 2DIQA 2FVUA 1VQPA 3KBGA 5FRNA 3C95A 4II1A 4TVRA 2QQAA 2MAMA 3SFMA 5D6WA 3V8LA 4C92F 3CPWA 3TCJA 4M7AB 2RJCA 5CQYA 1VQMT 1VQ9T 4M7DF 3SB2A 2O4XB 3FDRA 2FYKA 2LTOA 1YCYA 5DLOA 3DLLA 1XTDA 3NTHA 1Y07A 2LRQA 1K8AU 2JUFA 3E19A 4ZN3A 5GAOq 2RHIA 2XI9A 4LDVA 3PNWC 3CC2A 1TH7A 1VQ7T 3QPHA 2A7YA 1N6AA 2DTOA 2YHTA 3MP6A 4M77D 3QIIA 3ZEHA 4IKFA 3INZA 4F7UG 1V29B 4EDUA 2X4XA 4BE1A 5CO7A 2VUBA 1YITT 3CC2T 1JRIA 2XU8A 3VU3C 3A8GB 2RHZA 1LOJA 5C6SA 3JB9G 2ZPGB 1VIFA 4EMHA 3CPFA 4LDXA 3WVDB 2KQWA 4M78A 4XTUA 4XU1A 5GAOl 2Y90A 3CMAA 4M7AC 4XU2A 2HQEA 3UT1A 3WVEB 2PU9B 4GY5A 3G71A 4MMKA 1ZBXA 1VQOT 4A4HA 2XICA 2RK2A 4NOYA 2CZ6B 4XTZA 1UB4A 1U8RA 3H6ZA 3NTIA 4EMKB 4C8QB 4QVCA 4XTVA 1BIAA 1UGPB 4N0AA 3RKWA 1BYMA 5LJ3d 3CCUT 3X20B 2FB7A 1D3BA 3HRSA 2DIGA 4C8QF 3P8DA 2RI5A 4JJNK 4M77A 3AHUA 4M7AG 2KDSA 2WSFE 5J3BA 1HXDA 4QW2A 4F7UF 2DVEA 5LJ5g 5D6XA 2RHXA 1N27A 1Q86U 1VIEA 3NTKA 3P8HA 4KBMB 3JCMV 1M1FA 2JTMA 3O8VA 2DXBA 3OMCA 4JDSA 2E6ZA 1NJIU 2V8JA 5FU6B 3T9NA 1Y71A 5GANd 3OMGA 5GAMd 3L2WA 4YTLA 1XNIA 2PVOB 4IUTA 2CZ1B 4C92C 5GAOp 4PJOC 2F69A 5CVIA 1WJSA 3LLRA 2EQJA 3EFRA 2K5FA 3TEEA 5CKEA 3JB9F 3OS0A 3RESA 1XQHA 1EIFA 5GANg 1Q7YU 2PVDB 2E1HA 3E1SA 3JB9J 3A8HB 3JCMb 3L2QA 2KAFA 3X24B 1AHJB 1Y7XA 4J7FA 3JCMf 3CMEA 3CCQA 1NPPA 3FRNA 5M9OA 2Y4YA 5GAOr 1VQKA 5LL6S 5GAN6 2D9TA 1IREB 5CIUA 5KCOA 4EMKA 2RHUA 5KE3A 1I81A 3CD6T 3JCMd 4A54A 4N4IA 2RM4A 1Q81U 3QYHB 4UC4A 2LT1A 4M78B 2AHJB 4LD9K 1QVPA 4BE0A 3JCMP 1KG1A 2JOYA 4GLKA 4NL2A 2M9UA 3OSSC 3PT9A 3CXCA 4IURA 5I2MA 4BY6C 3J80E 1G5VA 2KK4A 2WACA 4BI3A 4DOVA 3CCJA 1YHQA 1BIBA 4KULA 3HSBA 4XQ3A 2VXEA 3F70A 5DM7R 2DZ9A 5EG2A 4QQ6A 4X9CA 1O9SA 4HCCA 2XIDA 3UDCA 4OB0B 1M1KU 2LQKA 3ME9A 1N8RU 1M5Q1 3OYIA 2L5QA 2EFIA 2EQMA 3JCMX 1K9MC 2VXFA 3ER0A 1QW1A 3L1AA 2K57A 2OAUA 2EJ9A 3A8MB 3CBMA 4C92D 3OYDA 2DPPB 3HL8A 3S3MA 3VYGA 1H3ZA 4A4FA 1K73U 4M75F 3OYCA 3CCMA 1R8OB 4E7HA 4RG2A 4RCCA 4MMLA 4JRQA 2E5QA 2V8IA 3QG1A 1G3SA 3M59A 4M75B 2QA4A 5J39A 2WSEE 2E12A 2RI3A 4IUPA 3OBWA 5KE2A 5LJ3j 2QTXA 3LW5E 4OP0A 3GLXA 1NPRA 2YLCA 4X9DA 1I4K1 3HP9A 1M8VA 3HRUA 1VQLA 2EWNA 4ZGJB 3VV0A 5GAN5 4HT9A 1H641 2HQXA 3QXEB 4EMGA 1YJWT 3JB9H 4JRIA 3CCLA 3V7RA 1QVFS 2GCXA 4JUVA 1KQSA 2HNIA 5GAN3 4PJOG 5GAN2 2DO3A 2CS7A 2H3JA 3MHXA 3I56T 3L2VA 2QEXT 3CBOA 3HRTA 3I55A 3JCMW 1W2BA 4M7AD 5A2QE 1M4ZA 1KD1C 3MCAB 2GFAA 4BI4A 3DB4A 5FRMA 4O5VA 3VYHB 1B34A 4M77G 1G3TA 3V8JA 2ZZDA 2P0KA 1W4SA 5IN1A 4FSXA 5LJ3f 2L3RA 3P8BB 4C0GA 4C0FA 2V8KA 2R58A 5GMKm 4OMFB 5GANj 2OTJT 5HK0A 1BKBA 1UGQB 2E64A 5GAOm 4ZTJA 1MGQA 2PQWA 3S3NA 4PKCC 4O6JA 2LT4A 3GIBA 3VKIA 3NFCA 2F5KA 1OYXA 3EFSA 4OB3B 3RIRA 4JS4A 1QVGS 2OTJA 3JRZA 3HFNA 3OYFA 4C8QA 5GAMj 4M78C 4BE2A 5FROA 3A8LB 4BACA 5DLQE 4BD3A 3J81E 3QKJA 4BY6B 2DD5A 2FHDA 4A4GA 2XDDA 2KY9A 1YIJA 4M7DA 3CBPA 5KH6A 4PJOD 1VQPT 2O4XA 4M7AA 2X4YA 4M7DE 1SSFA 1IZ6A 4FU6A 4M75D 3M5AA 3OB9A 2K5IA 4FM4B 4MZMA 4C92E 3KXTA 2GQVA 3M9QA 4DOWA 2QQRA 2WSCE 2JN0A 4JRPA 1GXIE 4M7AE 4J6WA 5GAMh 1OZ2A 2R5AA 2EYQA 4OGCA 3CCLT 4FL6A 1VQ6A 4PL6A 5HY6A 3KUFA 2G3RA 1VQLT 2ZPFB 4ATOA 1UEBA 4E47A 3A8OB 1K73C 2CKKA 1BI3A 1O75A 2EQUA 3M54A 3MEUA 3JAME 1K9MU 5GAMe 3FLGA 3PFSA 2BUDA 5LJ3g 3LWHA 4PJOA 3HHTB 4Z02A 4HCBA 3S3OA 4KUIA 2OTLA 4PJOB 1FX7A 4M78D 5AYFA 1VQMA 2K3XA 3I55T 2A3LA 2DK3A 4M78F 2VGNA 4JS5A 4XK8E 4F7UE 2DTIA 2ZPIB 4XAXB 3BFMA 1DJ7B 4C8QE 2LCCA 2GF7A 3GNGA 1D3BB 2XHCA 4ZGDB 1YJ9T 1M90C 4BB7A 3OA6A 3JSCA 3Q1JA 2K4YA 3G7ZA 4J8OA 3QYGB 4DQ2A 4EMKC 1OI1A 3M58A 2LVMA 5LJ3e 3M56A 3OS5A 3QZ9B 2P0PA 2MI6A 1PSFA 4ELZC 3CCUA 3JB9I 1HK9A 1VQOA 4QVZA 3E9FA 2HBPA 2M0OA 4Q5WA 4C92A 5HK3A 2BKDN 3M4YA 3MP1A 4C92B 1M90U 3G6EA 1Q7YC 4M7DB 1KC8C 2RHYA 2DD4A 5LJ3h 3PIPA 3CMAT 4PNOA 2PUKB 3UPUA 2NLUA 5FU7B 1I5LA 2VV5A 3GP8A 3CC4A 2MWPA 5GMKl 1VQ4T 4XTYA 3L2RA 3A5ZB 4MZTA 5CAIA 4R56A 3OW2S 2L89A 2RA2A 4LDYA 3FJPA 1G3WA 3G4SA 1VQ6T 1YI2A 3VUBA 3QJYA 5CQXA 3UWNA 5GAN8 1VQ4A 4M75E 2E70A 5CK9A 3CC4T 4LD6A 5CKDA 5LJ5e 1KC8U 4J6YA 1YHQT 4C5IA 2R57A 3JCMh 3HPWA 2E65A 3DKMA 4EPCA 2LCLA 5FU7C 4PLIA 3BDLA 1Q81C 4LDUA 2R5MA 2EAYA 2X4WA 4OGEA 3SWNB 2EKOA 2QQBA 1P92A 3DB3A 2XK0A 4C5HA 1WPYA 3CC7T 2XDBA 3CCRT 3CEYA 3OQ5A 5D6YA 4KUDK 2QEXA 4ZTFA 4M75C 4F7UB 5A0GA 5LJ5f 2E10A 2M16A 3M4GA 3QUIA 4MDWA 4XTWA 4J83A 1NE8A 3QBYA 4XTXA 3CCQT 2ZPEB 2PUOB 3CMET 5IT9E 2KVQG 4C92G 3LYIA 2DZCA 4ELYC 2DAQA 2KMTA 5I21A 3JB9D 4M7DG 4RCBA 4OB2B 5C0MA 2ZPBB 4E7LA 4HKEA 3CCEA 4M77B 3DLMA 3OYNA 3LH0A 4J6XA 1BI0A 1NZ9A 3RKXA 3VUZA 3PGGA 2JNGA 2YRVA 3QHSA 3OYEA 5GMKh 2ZPHB 2IG0A 2XD0A 1MHNA 4QQGA 1S72A 2QXFA 2DTHA 3QZ5B 1KQ1A 1RI0A 1NJIC 3E9GA 4RKUE 3PMIA 4L59A 5GMKj 1JJ2A 4CRIA 3CCVA 3BDUA 3RMQA 3C12A 3OYKA 3MEAA 1I8FA 3V7CA 1X6OA 1KHCA 3QDRB 4VUBA 3C94A 2QDYB 3CCJT 2FL7A 1ZQ1A 4OF1A 2I2LA 5L8RE 2YLBA 4ZGEB 1N9RA 2XG8D 1KD1U 3SWNA 3R6OA 2Y4XA 3LGLA 2DEQA 2QQSA 2CGHA 4M77E 3JCMc 4NL3A 3OS2A 3LWIA 3RERA 2VGMA 4PLLA 3FIFA 4PJOF 3PTAA 4JLIA 4Y91A 1U1TA 4CI0C 2K3YA 5GAN4 3OYMA 5CKFA 3GNFB 5GAMf 4C5EA 2RK1A 4M7DD 2JTFA 1G3YA 3ZBDA 1XOVA 4LDWA 5CCAA 2LC4A 2DXUA 3FEOA 4PJOE 1WJRA 4OVAA 3OW2A 3CPWS 5FU6C 4M78E 1PSEA 2CZ7B 2K2VA 3OSVA 2VYTA 5GANe 2RB6A 2VC8A 1OZ3A 4RG8A 1UGSB 3CCST 2RH2A 4L5GA 4QVDA 1YI2T 4ME7A 5CKBA 3L2ZA 2D6FA 4J5YA 4R55A 1VQ5T 4C8QC 1X01A 2E41A 2LX9A 3ASKA 4E7JA 4NS5A 4M78G 3X28B 1BI1A 3JCMg 4L6V5 4BUGA 1M1KC 4N0AC 4B9WA 3QSUA 2D0QB 3SD4A 3TU4K 5J26A 4A53A 2C06A 2MMPA 4HCZA 3PIOA 2EQKA 4FIBA 4M7AF 4IUVA 2RI2A 1BI2A 4WF2A 2JVVA 2DXTA 3PMTA 4RMOA 3CD6A 3X26B 4D6WA 4E7KA 2LQ8A 3QO3A 3URGA 1VUBA 1YJNA 4N4HA 5LJ5j 2DJZA 2EJGA 1M1GA 2L8DA 1Q86C 3META 1JBMA 1KHIA 5I2SA 2K5LA 4BDYA 3GF5A 3SWNC 3OS1A 2X4JA 5GAMg 3OYLA 1JB0E 1YJNT 5GAN7 3H8ZA 4E7IA 4N4GA 3JCMe 4F7UA 1KQSS 3JCMQ 2OTLT 1YIJT 3MEVA 1QP2A 3QJ6A 1RL2A 4IUUA 4C0ZA 5CKHA 2QA4T 2CYZB 3OYYA 1QVFA 3G71T 4IUQA 3OYHA 4M7DC 4P5NA 2QI2A 1N9SA 1JJ2S 2M1HA 1YBYA 3VJPA 2ZCFB 3FB9A 1FXXA 3MEWA 3ZFJA 5LJ5d 1VQKT 1YITA 3HKSA 4JLGA 3G4ST 4C5GA 3OY9A 3CCMT 1WQWA 2GFUA 2EIFA 1U1SA 4JRKA 1Y96A 4KT0E 4MZPA 5GANh 3OYBA 1VQ5A 1VQ7A 4C8QD 3L42A 1VQ8T 2IVWA 5IAYA 3RMSA 3BW1A 1Y96B 2RD1A 4ZN1A 1Q82U 5FLXE 5A0DA 3GOXA 4FT4A 3N5BB 4XU3A 5GAOn 3MP8A 3FC3A 3OYAA 1X75C 3J7AF 4M77F 2B8AA 2RJEA 4OB1B 5GANf 2LNVA 2MWOA 5GMKe 3CXCS 4X34A 3CC7A 2O01E 4A4EA 1QVGA 3HFOA 1VQ9A 2P0QA 4HT8A 4QQDA 1VQNT 1Q82C 2CZ0B 2DKGA 4V2SA 2HAXA 1FWZA 4XU0A 5LJ5h 2DXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DJ7 B;  2PVD B;  1QP3 A;  2WSC E;  2WSF E;  3X25 B;  2PVG B;  4KT0 E;  4OB0 B;  2ZPE B;  1UGS B;  2PUO B;  3A8H B;  4Y28 E;  3X24 B;  4ZGD B;  1AHJ B;  1V29 B;  2QDY B;  5L8R E;  1UGR B;  4ZGE B;  4OB3 B;  3A8M B;  2DXC A;  3A8G B;  4OB2 B;  2ZPB B;  2DPP B;  2ZPF B;  2ZPG B;  1IRE B;  1JB0 E;  3A8O B;  3QYG B;  3VYG A;  3X28 B;  2DXB A;  3QZ9 B;  3WVD B;  3A8L B;  1GXI E;  1PSF A;  4L6V 5;  1QP2 A;  2D0Q B;  3WVE B;  2PU9 B;  2ZPH B;  2WSE E;  4OB1 B;  2CYZ B;  2DD5 A;  3QYH B;  3VYH B;  3QZ5 B;  2O01 E;  3HHT B;  2AHJ B;  2PVO B;  2CZ6 B;  2CZ1 B;  3LW5 E;  2ZZD A;  4RKU E;  2DD4 A;  2ZCF B;  1UGP B;  2PUK B;  2CZ0 B;  4ZGJ B;  3X20 B;  3X26 B;  4XK8 E;  4FM4 B;  1PSE A;  2ZPI B;  1UGQ B;  2CZ7 B;  3QXE B; 
#chains in the Genus database with same CATH topology
 4HA8 A;  2O88 A;  2MF2 A;  2EJF A;  2P4T A;  3OYJ A;  2DYI A;  3C4S A;  1BCM A;  3CCJ Q;  3MO8 A;  5IHN A;  1LNX A;  2DL5 A;  1K8A R;  2BIV A;  3L2U A;  4C0D B;  2RO0 A;  3RKY A;  3V7S A;  2ESW A;  2O9S A;  1W2B S;  3M57 A;  1WNL A;  1VQ6 Q;  2HD0 A;  4F16 A;  3CPW P;  3GPL A;  2ZGW A;  5KYU B;  4B9X A;  1YHQ Q;  2E6N A;  2XKO C;  4FT2 A;  4Y28 E;  3BY7 A;  2YUQ A;  2XDP A;  1N8R C;  1M9S A;  1ZBJ A;  1YJ9 A;  3LX7 A;  1YCS B;  3KBG A;  5FRN A;  4TVR A;  2LP5 A;  4C92 F;  3CPW A;  4M7A B;  5CQY A;  4M7D F;  5DLO A;  2O4X B;  3NTH A;  1RAF B;  1Y07 A;  4ZN3 A;  2XI9 A;  1VQ4 Q;  1TH7 A;  2L3S A;  5FW9 A;  3UA7 A;  3MKD A;  4PK4 A;  2EQI A;  3VS3 A;  3QII A;  1WLP B;  3RR6 A;  4BE1 A;  1JRI A;  3A8G B;  1LOJ A;  1OUL A;  2ZPG B;  3TSW A;  4F14 A;  1VIF A;  3WVD B;  2RMO A;  4M78 A;  5GAO l;  2NUP A;  3CMA A;  4M7A C;  2HQE A;  3WVE B;  3G71 A;  4MMK A;  4A4H A;  2XIC A;  2CZ6 B;  2DVJ A;  4IIM A;  1Z9Z A;  4QVC A;  1D0Y A;  4JJN K;  4KRT A;  4M77 A;  1OPL A;  5J3B A;  3CCQ Q;  1UTI A;  2RHX A;  1CSK A;  1N27 A;  3H0F A;  1M1F A;  1UE9 A;  5GAN d;  4X1V A;  3OMG A;  4YTL A;  4PJO C;  1JO8 A;  5CVI A;  2F2W A;  3JB9 F;  3OS0 A;  3RES A;  1ARK A;  4DEY A;  1TU0 B;  2Y4Y A;  1VQK A;  1PRM C;  1FMV A;  3CCR Q;  2RHU A;  5KE3 A;  1F1B B;  1I81 A;  1X43 A;  3JCM d;  4N4I A;  1WFW A;  4AG2 C;  3QYH B;  2LT1 A;  3VS6 A;  3OSS C;  3CXC A;  4DOV A;  4KUL A;  4XQ3 A;  5EG2 A;  5I11 A;  4QQ6 A;  3UDC A;  3CCS Q;  1PWT A;  2ATC B;  4LDX A;  3A8M B;  2DPP B;  1VQN Q;  2A08 A;  2E5Q A;  2V8I A;  3QG1 A;  1G83 A;  4M75 B;  2E12 A;  2RI3 A;  4Z88 A;  3LW5 E;  4OP0 A;  2RQR A;  3GLX A;  1I07 A;  1NPR A;  2YLC A;  3M0S A;  3HP9 A;  1VYV A;  4HT9 A;  3JB9 H;  1YJW T;  4JRI A;  3CCL A;  1QVF S;  1IGU A;  1K0X A;  2KGT A;  3I56 T;  3L2V A;  2M51 A;  3HRT A;  3JCM W;  4M7A D;  5A2Q E;  2E5K A;  4BI4 A;  1YIJ Q;  2DNU A;  2COZ A;  4JJB A;  1T0H A;  1G3T A;  3V8J A;  3EGD B;  7AT1 B;  5HCK A;  2L3R A;  3P8B B;  4C0G A;  1TG0 A;  2PQW A;  3S3N A;  4O6J A;  3GIB A;  2DL8 A;  2OAW A;  4OB3 B;  1QVG S;  1JEG A;  5FRO A;  5DLQ E;  1QCN A;  4AFS C;  4BY6 B;  3I5S A;  2DD5 A;  4M7D A;  2EGC A;  5KH6 A;  5L23 A;  1OU9 A;  1NYG A;  3TQ7 P;  2LQN A;  4M7D E;  4FU6 A;  4FM4 B;  4C92 E;  3M9Q A;  1GXI E;  3PVQ A;  1PHT A;  3EH1 A;  4CC7 A;  1VQ6 A;  5HY6 A;  1KIK A;  3KUF A;  1VQL T;  2L3Q A;  2YUN A;  2CKK A;  1BI3 A;  3M54 A;  3MEU A;  1OU8 A;  1MV3 A;  3LWH A;  1NM7 A;  2YUO A;  3HHT B;  1BU1 A;  5AYF A;  1VQM A;  1LVK A;  2K3X A;  3I55 T;  4M78 F;  4JS5 A;  2DTI A;  4A63 B;  2LX7 A;  2LCC A;  2XHC A;  1YJ9 T;  4CC2 A;  3OA6 A;  1B3Q A;  3Q1J A;  1OI1 A;  2LVM A;  3QZ9 B;  3CCM Q;  2FZC B;  1PSF A;  1M2V A;  2YXY A;  2M0O A;  3E9F A;  4C92 A;  5HK3 A;  1AVZ C;  1IGQ A;  2L2P A;  3UPU A;  3E2U A;  2VV5 A;  2KXC A;  1I0C A;  3A5Z B;  4MZT A;  3OW2 S;  2L89 A;  2RA2 A;  1G3W A;  1YI2 A;  5CQX A;  1GRI A;  4LD6 A;  1NJI R;  1QKW A;  3VRZ A;  1WHM A;  2LCL A;  3VS4 A;  1Q81 C;  2K2M A;  1P92 A;  1PM3 A;  1X27 A;  2M16 A;  4MDW A;  1WYX A;  4XTW A;  4J83 A;  3QBY A;  1VQ9 Q;  3CCQ T;  2ZPE B;  3CME T;  5IT9 E;  4IIO A;  4ELY C;  2DZC A;  3M0R A;  5I21 A;  2ZPB B;  3EHR A;  3ZL7 C;  3CCE A;  3LH0 A;  3RKX A;  2ZPH B;  4HVW A;  1S72 A;  1QWE A;  3QZ5 B;  3O5Z A;  1AZE A;  2L3P A;  3R6N A;  3ULR B;  1T3L A;  2V26 A;  4CRI A;  1NEG A;  3MEA A;  3V7C A;  5L8R E;  4OF1 A;  2YLB A;  1VYU A;  2XG8 D;  2PTK A;  1SHG A;  3R6O A;  4M77 E;  3JCM c;  1Q82 R;  1WA7 A;  4RTZ A;  3FIF A;  2NUP B;  2FZG B;  1NLO C;  4PJO F;  3PTA A;  4Y91 A;  1CKA A;  1QQJ A;  1U1T A;  1HJD A;  2KRO A;  3MPU B;  1G3Y A;  3ZBD A;  2Z0W A;  4LDW A;  2LC4 A;  3FEO A;  1AOJ A;  2LMJ A;  4J9I A;  4M78 E;  2K2V A;  2RB6 A;  3CCS T;  2CP3 A;  4L5G A;  2QAS A;  4ME7 A;  2BZ8 A;  1YJ9 Q;  3L2Z A;  1QMC A;  1X01 A;  2CSQ A;  1TUG B;  1D0Z A;  3JCM g;  3QSU A;  1M1K C;  4B9W A;  3SD4 A;  3TU4 K;  1WHJ A;  2MMP A;  3CCL Q;  4M7A F;  4IUV A;  1BI2 A;  1D09 B;  3H0I A;  2SRC A;  4RMO A;  3PMT A;  1VUB A;  1VQ7 Q;  1EFN A;  2EJG A;  1M1G A;  9ATC B;  4ORZ A;  1KHI A;  2K5L A;  3GF5 A;  3LH5 A;  3OYL A;  1K73 R;  2FEI A;  3JCM e;  1YIJ T;  3MEV A;  3QJ6 A;  4IUU A;  1RL2 A;  1S1N A;  1N9S A;  2L0A A;  2M1H A;  1YBY A;  3VJP A;  3ZFJ A;  5LJ5 d;  2CT3 A;  2MYS A;  1T3S A;  2M0Y A;  2LCS A;  4PFP A;  2GFU A;  5GAN h;  4JRK A;  1Y96 A;  4KT0 E;  3U23 A;  3L42 A;  2IVW A;  3RMS A;  1Y96 B;  2MCN A;  3MP8 A;  3OYA A;  2DBM A;  2B8A A;  2RJE A;  4OB1 B;  2MWO A;  2NUT A;  4X34 A;  1RAI B;  1JXM A;  1LPL A;  4LE9 A;  2KRS A;  1VQN T;  3VS5 A;  1Q82 C;  2MOX A;  1ZSZ C;  4XU0 A;  2DXC A;  2AZS A;  3X25 B;  2X3W D;  3A1P A;  3EAE A;  4DA4 A;  5A0L A;  3LGF A;  3CCR A;  4BI8 B;  2X35 A;  2RJF A;  2VAS A;  1PKS A;  2FRW A;  2KT1 A;  5DY9 A;  3CCE T;  3JCM J;  4M75 A;  3I56 A;  1WJQ A;  2KSS A;  2ROL A;  3CCS A;  4MDX A;  2OJ2 A;  3S6W A;  1ZSZ A;  1UGR B;  1N8R R;  2F5T X;  1VQN A;  1LJO A;  4C8Q G;  2AKL A;  1VQP A;  2DLP A;  1WHL A;  4II1 A;  4AFZ C;  2EYZ A;  2MAM A;  3V8L A;  3TCJ A;  2GQI A;  3SB2 A;  1B07 A;  3DLL A;  1R0C B;  1WHK A;  5GAO q;  2RHI A;  4PJJ A;  1ZA1 B;  1QCO A;  1VQ7 T;  1N6A A;  4FYY B;  1PCX A;  2X3X D;  1V29 B;  1YIT T;  1WDX A;  3VU3 C;  5C6S A;  1JJ2 P;  2RHZ A;  4HXJ A;  1MNE A;  4AT1 B;  1ABO A;  1UJ0 A;  5FWB A;  2EVR A;  4XTU A;  1UG1 A;  4XU2 A;  3UT1 A;  4GY5 A;  2EYX A;  2KXD A;  3RNJ A;  4XTZ A;  4EMK B;  1BIA A;  3RKW A;  3AHU A;  4C8Q F;  2RI5 A;  1ZUU A;  2HMA A;  1RAD B;  5GJV B;  1HXD A;  4F7U F;  3CME Q;  5D6X A;  4FYW B;  1Q86 U;  3GBQ A;  4KBM B;  2JTM A;  1RLP C;  1BCO A;  1TUD A;  1RAA B;  5GAM d;  4IUT A;  2GNC A;  1V76 A;  1M90 R;  2K5F A;  5CKE A;  1RAC B;  5GAN g;  3NHN A;  1ZLM A;  2E1H A;  1Z9Q A;  2OI3 A;  3A8H B;  3L2Q A;  2D0N A;  1Y7X A;  3JCM f;  3CCQ A;  5GAO r;  1G8X A;  1UJY A;  5GAN 6;  5KCO A;  5CIU A;  3VS0 A;  1KC8 R;  1X2K A;  1T0J A;  2RM4 A;  4UC4 A;  1SKU B;  2EBP A;  1KG1 A;  1VQ8 Q;  4NL2 A;  1OPK A;  5I2M A;  1G5V A;  3HSB A;  4BI3 A;  2VXE A;  3THK A;  2KYM A;  3F70 A;  1M1K U;  2GTO A;  1N8R U;  3HTR A;  3JCM X;  2QDL A;  3L1A A;  3ER0 A;  2IIM A;  3OYD A;  2K57 A;  1H3Z A;  1VQK Q;  3HL8 A;  8ATC B;  3S3M A;  4A4F A;  4J9F A;  3CCM A;  4OMM A;  2MIO A;  4E7H A;  4JRQ A;  1IHW A;  1G3S A;  2QA4 A;  5KE2 A;  3OBW A;  4FCY A;  5LJ3 j;  2QTX A;  3HRU A;  4KGZ B;  2FPE A;  3VV0 A;  5GAN 5;  1H64 1;  2LNH B;  4FYX B;  2GCX A;  4JUV A;  3I9Q A;  2HNI A;  5GAN 3;  2RNA A;  2H3J A;  3MHX A;  1QKX A;  1KD1 R;  2K7A A;  1M4Z A;  3MCA B;  2K3B A;  5FRM A;  1ZUY A;  4M77 G;  2AZV A;  1WXB A;  2ZZD A;  4FSX A;  5LJ3 f;  4E2F B;  2DL3 A;  1OX9 A;  2R58 A;  3NPF A;  5GMK m;  5GAN j;  5HK0 A;  2EGA A;  4AFU C;  1AWX A;  5GAO m;  3G1J A;  2LT4 A;  3VKI A;  3OYF A;  5GAM j;  2C0O A;  4M78 C;  1X2Q A;  3A8L B;  2QYZ A;  5KYW A;  3QKJ A;  1TTH B;  4A4G A;  1ZX6 A;  2XDD A;  1YIJ A;  4PJO D;  1KJW A;  2YRC A;  3EFO B;  1SHF A;  2NWM A;  1PD1 A;  2X4Y A;  1WIE A;  1IZ6 A;  2JM9 A;  2QGF B;  1TXQ A;  5GAM h;  2EYQ A;  3CCL T;  4FL6 A;  2J6K A;  2EQU A;  2KYB A;  4OML A;  5GAM e;  3FLG A;  1K4U S;  5KYY B;  3PFS A;  4PJN A;  2BUD A;  5LJ3 g;  4PJO A;  3S3O A;  2OTL A;  3BE3 A;  4M78 D;  2VGN A;  4XK8 E;  4F7U E;  4F04 B;  1DJ7 B;  2G6F X;  2YUP A;  2GF7 A;  1I5O B;  5KYN A;  4GLM A;  1SEM A;  3QYG B;  2H8H A;  3M58 A;  1YP5 A;  2MI6 A;  2AIR B;  1VQO A;  4QVZ A;  3MP1 A;  1M90 U;  2CP5 A;  5LJ3 h;  3PIP A;  3CMA T;  2VB6 A;  2PUK B;  4AMC A;  2NLU A;  1HSQ A;  2GBQ A;  1YN8 A;  3VS2 A;  2A36 A;  3L2R A;  3G4S A;  2VWF A;  1JXO A;  2MPX C;  3VUB A;  1YIT Q;  3UWN A;  4M75 E;  2E70 A;  5CK9 A;  3CC4 T;  5LJ5 e;  1KC8 U;  4J6Y A;  3OW2 P;  3DKM A;  5FU7 C;  3BDL A;  6AT1 B;  2K79 A;  2XK0 A;  3CCR T;  5D6Y A;  2QEX A;  5A0G A;  3QUI A;  2PUO B;  2CH4 W;  2RQV A;  4QT7 A;  2KVQ G;  4C92 G;  1AWO A;  2E3I A;  4M7D G;  3JB9 D;  1AEY A;  1NZ9 A;  2JNG A;  3QHS A;  2DM1 A;  2IG0 A;  1MHN A;  4B6M A;  1KQ1 A;  4RTW A;  5GMK j;  4Z8A A;  3BDU A;  3RMQ A;  1U06 A;  1I8F A;  1KHC A;  4VUB A;  2H3E B;  1FYN A;  1TWB A;  3IQL A;  1KD1 U;  2Y4X A;  2DRK A;  2QQS A;  2CGH A;  3OS2 A;  3RER A;  4PLL A;  4LUD A;  1AT1 B;  1S72 Q;  4C5E A;  4M7D D;  4RTX A;  2JTF A;  1H92 A;  1M3C A;  1XOV A;  1W2B P;  3I56 Q;  5KYX B;  1PSE A;  2VYT A;  1H8K A;  1IXD A;  1OZ3 A;  2HL3 A;  4RG8 A;  2JJ9 A;  2RH2 A;  2COY A;  1VQP Q;  4C8Q C;  2E41 A;  2JS2 A;  2LX9 A;  4NS5 A;  3X28 B;  2C06 A;  4HCZ A;  2EQK A;  4FIB A;  3SHW A;  3CMA Q;  4ESR A;  2B86 A;  3EGX B;  1I1J A;  2AK5 A;  2DJZ A;  2AKK A;  4DBF A;  1D1C A;  4DBQ A;  1R0B G;  5KYU A;  1ZUK A;  1KQS S;  3JCM Q;  1D1A A;  1QP2 A;  5CKH A;  1QVF A;  2QI2 A;  1JJ2 S;  3MEW A;  3HKS A;  3G4S T;  4C5G A;  1WQW A;  2EIF A;  1VQ7 A;  3OYB A;  1VQ5 A;  1GCQ A;  4WTO B;  1VQ8 T;  3KFV A;  1MND A;  2QGG A;  3BW1 A;  4ZN1 A;  4FT4 A;  4XU3 A;  3FC3 A;  2LJ0 A;  3CXC S;  2KR3 A;  2ENM A;  1QVG A;  2YSQ A;  4HT8 A;  1M2V B;  4CC4 B;  4V2S A;  2C0I A;  1FWZ A;  4HVU A;  2J6F A;  4E7Z A;  4J9D A;  4LNP A;  3SDZ A;  1ZA2 B;  4BDZ A;  2HBW A;  1KK7 A;  1YJW A;  1SG5 A;  3CCV T;  2J05 A;  1M3B A;  2PZ1 A;  3M55 A;  3NGP A;  2DA9 A;  1S72 T;  1WGS A;  5HKC A;  3OYG A;  2DET A;  1WQ7 A;  4A4K A;  1Q95 G;  4C0D C;  1MMG A;  5CR2 A;  2PVG B;  2LJ3 A;  3WXM B;  1IO6 A;  2QQ9 A;  3A98 A;  3PVL A;  4PFO A;  5D6W A;  1VQ9 T;  2RJC A;  2LTO A;  1YCY A;  2F2X A;  3REB B;  4RTV A;  2DFU A;  2O2O A;  3PNW C;  2K9G A;  2A7Y A;  4M77 D;  3INZ A;  1JQQ A;  5CO7 A;  2VUB A;  3CC4 Q;  2XU8 A;  2DMO A;  3JB9 G;  1W6X A;  2JT4 A;  4KGX B;  1PD0 A;  4XU1 A;  3VS1 A;  2E3H A;  2SEM A;  2PU9 B;  1VQO T;  2RK2 A;  4FW2 A;  1UB4 A;  3H6Z A;  3NTI A;  1OX8 A;  1UGP B;  1BYM A;  1LCK A;  4J9B A;  2EYW A;  3EG9 B;  4M7A G;  3TSZ A;  3QWY A;  3UA6 A;  5LJ5 g;  2D1X A;  1VIE A;  3NTK A;  2DXB A;  4JDS A;  2E6Z A;  1NJI U;  2V8J A;  4AFQ C;  1Y71 A;  1QVF P;  1KFZ A;  3L2W A;  1M1K R;  1XNI A;  2PVO B;  4C92 C;  5GAO p;  2DL4 A;  1WJS A;  5KYW B;  2EQJ A;  2X9H A;  3EFR A;  3TEE A;  1XQH A;  1Q7Y U;  1C0M A;  1WXU A;  2PVD B;  4D8D A;  2FPF A;  3JB9 J;  3JCM b;  2KAF A;  3X24 B;  4DBH A;  3CME A;  1C1A A;  2QTV A;  1UGV A;  1NPP A;  3FRN A;  2GTJ A;  1D0X A;  3JV3 A;  5LL6 S;  3CC7 Q;  1IRE B;  4KH1 B;  4EMK A;  2O9V A;  2FPD A;  5FWC A;  1Q81 U;  1U5S A;  2AHJ B;  4LD9 K;  5I22 A;  2JOY A;  3EH2 A;  3PT9 A;  4IUR A;  4BY6 C;  3J80 E;  2NYS A;  3CCJ A;  5GJW B;  5DM7 R;  4X9C A;  4HCC A;  2XID A;  1ZSZ B;  2V1R A;  1CKB A;  3ME9 A;  1M5Q 1;  3OYI A;  1K9M C;  1WX6 A;  2VXF A;  1QW1 A;  4C92 D;  4OMQ A;  3EGD A;  3VYG A;  4M75 F;  3OYC A;  1R8O B;  4RCC A;  4J9G A;  2HQH A;  5J39 A;  2DRM A;  4EIK A;  2J7I A;  1VQL A;  2GGR A;  3QXE B;  2YWW A;  3V7R A;  1V1C A;  1KQS A;  2E4H A;  4HVV A;  2C0T A;  4PJO G;  2HZY A;  4E6R A;  2DO3 A;  2RF0 A;  1SRL A;  1M2O A;  3I55 A;  4DEX A;  1HD3 A;  1KD1 C;  1EX4 A;  3DB4 A;  5IXB A;  2QA4 Q;  4O5V A;  2QK0 A;  2P0K A;  1W4S A;  1VQ5 Q;  1QLY A;  4RUG A;  1BKB A;  2FZK B;  1UGQ B;  1MGQ A;  2HL5 C;  1IHV A;  4ZNX A;  2F5K A;  2OTJ A;  4JS4 A;  3JRZ A;  4BE2 A;  1NEB A;  3UAT A;  1QCF A;  2LJ1 A;  1PC0 A;  2KY9 A;  3EGU A;  4J9C A;  4LUE A;  1YWO A;  2CH4 A;  1VQP T;  2O4X A;  2FG0 A;  4M75 D;  1SSF A;  4MZM A;  3OB9 A;  2K5I A;  3KXT A;  2GQV A;  4OMO A;  4DOW A;  2QQR A;  2JN0 A;  4JRP A;  1KQS P;  4M7A E;  1OZ2 A;  2A0F B;  2R5A A;  4JPB W;  4OGC A;  4RTY A;  4PL6 A;  2G3R A;  1UEB A;  1O75 A;  3CCU Q;  1Q81 R;  1W70 A;  2CP2 A;  2DX1 A;  3G6E Q;  4HCB A;  4KUI A;  1UUE A;  1PNJ A;  1FX7 A;  2D8H A;  1X6G A;  2DK3 A;  2KBT A;  2ECZ A;  2ZPI B;  3M0Q A;  2YT6 A;  1M90 C;  1K9A A;  1M8M A;  4FSS A;  3JSC A;  2K4Y A;  4J8O A;  4DQ2 A;  2JW4 A;  3H0H A;  3M56 A;  3OS5 A;  2P0P A;  3MJX A;  1YNZ A;  2HBP A;  4Q5W A;  1UHC A;  1MMA A;  1KC8 C;  2RHY A;  2DD4 A;  3GP8 A;  3CC4 A;  2HKN A;  5GMK l;  4OMN A;  4J9E A;  3EHQ A;  5CAI A;  1VQ6 T;  3QJY A;  2FO0 A;  1R77 A;  3CC2 Q;  2COW A;  1YHQ T;  4C5I A;  2BE9 B;  1NBE B;  4PLI A;  1VQO Q;  2JXB A;  2EAY A;  3SWN B;  2RQT A;  1WPY A;  3CEY A;  3OQ5 A;  4KUD K;  4ZTF A;  2VVK A;  4M75 C;  3CCV Q;  5LJ5 f;  2E10 A;  1IRX A;  1NE8 A;  2HDA A;  1WZO A;  1GL5 A;  2DAQ A;  4OB2 B;  5C0M A;  3EG9 A;  4E7L A;  2KNB B;  4HKE A;  4M77 B;  3OYN A;  5D7U A;  3VUZ A;  3PGG A;  2XD0 A;  2KRM A;  2BZY A;  2QXF A;  2KRN A;  1NJI C;  3E9G A;  4RKU E;  3PMI A;  1RAE B;  1PRL C;  2QEX Q;  4OMP A;  3C12 A;  2YDL A;  3OYK A;  1ZSG A;  5EC7 A;  5IH2 A;  2QDY B;  2FL7 A;  1ZQ1 A;  4ZGE B;  1N9R A;  1Q86 R;  3LGL A;  3LWI A;  1PG5 B;  1BK2 A;  4JLI A;  5GAN 4;  4CI0 C;  2K3Y A;  4FYV B;  2ABL A;  3GNF B;  5GAM f;  2CP0 A;  4HCK A;  2RK1 A;  3CQT A;  2DXU A;  3OW2 A;  2F2V A;  5FU6 C;  1WXT A;  3OSV A;  3FJ5 A;  1BBZ A;  4QVD A;  2HSE B;  2DL7 A;  1MV0 B;  4J5Y A;  1GBQ A;  4E7J A;  2YRD A;  2K6D A;  1VQM Q;  4BUG A;  2HCK A;  2BZX A;  4A53 A;  2KEA A;  2JVV A;  1PKT A;  3CD6 A;  3X26 B;  1M30 A;  4D6W A;  4E7K A;  2LQ8 A;  3QO3 A;  3URG A;  2KE9 A;  1AD5 A;  4N4H A;  1AZG B;  2L8D A;  3MET A;  1GCP A;  1XJW B;  1QWF A;  4BDY A;  3SWN C;  2I0N A;  1JU5 C;  1YJN T;  5GAN 7;  3H8Z A;  1SF9 A;  4E7I A;  4N4G A;  4DBR A;  1VOM A;  4C0Z A;  2LQW A;  2QA4 T;  1B7T A;  2CYZ B;  3OYY A;  4P5N A;  2ZCF B;  2EYY A;  2W0Z A;  2HEQ A;  4JLG A;  2OTJ Q;  3OY9 A;  1HYO A;  4C8Q D;  2BTT A;  1KSW A;  1OOT A;  5IAY A;  2RD1 A;  4JZ4 A;  3EFO A;  1Q82 U;  5FLX E;  3GOX A;  3N5B B;  5GAO n;  1X75 C;  1RAG B;  2O01 E;  3HFO A;  1VQ9 A;  1FMW A;  2CZ0 B;  1N5Z A;  2DKG A;  2HAX A;  2LZ6 B;  2DF6 A;  1VQ8 A;  3OBY A;  2LDM A;  1KQ2 A;  2W10 A;  2JZ2 A;  1B34 B;  1M3A A;  2RJD A;  3UF4 A;  5GMK i;  3G6E T;  4ANJ A;  4M77 C;  5KCH A;  3TRE A;  4M75 G;  1ZHI A;  4J7I A;  3V8K A;  1K8A C;  1A0N B;  2DBK A;  3RUX A;  1QP3 A;  2D8J A;  3M53 A;  1MMD A;  2J6O A;  3SEM A;  2CP6 A;  2DIQ A;  2FVU A;  3C95 A;  1GCQ C;  2QQA A;  3SFM A;  1VQM T;  4LXC A;  3FDR A;  2FYK A;  2QAZ A;  1XTD A;  1K8A U;  2LRQ A;  2JUF A;  3E19 A;  3C0C A;  1BB9 A;  1VQL Q;  4LDV A;  2JTE A;  3CC2 A;  2V1Q A;  2CP7 A;  3QPH A;  3MP6 A;  1OQK A;  2DTO A;  2YHT A;  3ZEH A;  4IKF A;  4F7U G;  4EDU A;  2X4X A;  3CC2 T;  4RTT A;  2EGE A;  3I55 Q;  2OX7 A;  4EMH A;  1WHH A;  3CPF A;  2DJQ A;  2KQW A;  2DEU A;  2Y90 A;  3AT1 B;  1ZBX A;  4NOY A;  1OV3 A;  2EKH A;  1U8R A;  4C8Q B;  4XTV A;  4N0A A;  5LJ3 d;  3CCU T;  1YWP A;  3X20 B;  2FB7 A;  1D3B A;  3HRS A;  1OEB A;  2DIG A;  3P8D A;  1GBR A;  2KDS A;  2WSF E;  4QW2 A;  2DVE A;  2M02 A;  1J3T A;  3P8H A;  3JCM V;  2EPD A;  3O8V A;  3M0U A;  3OMC A;  5FU6 B;  3T9N A;  4FW1 A;  2MK5 A;  4JJD A;  2P84 A;  1QVG P;  2NUT B;  1IB8 A;  2CZ1 B;  2F69 A;  4WCI A;  4F17 A;  2DE0 X;  1Y0M A;  1UEC A;  3NMZ C;  1EIF A;  2OTL Q;  3E1S A;  3M0P A;  1AHJ B;  4J7F A;  1VYT A;  5M9O A;  4KH0 B;  4CC3 A;  1SRM A;  2D9T A;  1E6G A;  3CD6 T;  4A54 A;  1NLP C;  5IHI A;  1K9M R;  1SPK A;  4M78 B;  1QVP A;  4BE0 A;  3JCM P;  4GLK A;  2M9U A;  1RAB B;  2RQU A;  2KK4 A;  2WAC A;  1YHQ A;  1BIB A;  2DZ9 A;  1O9S A;  2XMF A;  4OB0 B;  2LQK A;  2IPO B;  2L5Q A;  2EFI A;  2EQM A;  1WI7 A;  3RDV A;  2KI7 A;  3CBM A;  2OAU A;  2EJ9 A;  3EGX A;  3QWX X;  1K73 U;  3G4S Q;  1RLQ C;  4RG2 A;  5IHK A;  4MML A;  3M59 A;  2WSE E;  4IUP A;  2ED0 A;  1K1Z A;  4Y92 A;  4X9D A;  1I4K 1;  1M8V A;  2EWN A;  4ZGJ B;  2HQX A;  4EMG A;  1H3H A;  5GAN 2;  1TUC A;  2CS7 A;  1YJN Q;  1E7O A;  2QEX T;  3CBO A;  1W2B A;  1G2B A;  2GFA A;  4K11 A;  3VYH B;  1B34 A;  3G71 Q;  5IN1 A;  4C0F A;  1C6V X;  3EG3 A;  2V8K A;  2OTJ T;  4OMF B;  1RUW A;  2J06 A;  4PJL A;  2E64 A;  4ZTJ A;  4PKC C;  1MMN A;  2F1L A;  3NFC A;  1OYX A;  1D1B A;  3EFS A;  3RIR A;  3PE0 A;  1UFF A;  3HFN A;  4C8Q A;  4BAC A;  4BD3 A;  3J81 E;  2BE7 D;  2FHD A;  3CBP A;  1X69 A;  5AT1 B;  4M7A A;  2VKN A;  3M5A A;  2WSC E;  2RQW A;  4J6W A;  3EG2 A;  2HKQ B;  4KGV B;  4ATO A;  2ZPF B;  4E47 A;  3A8O B;  1K73 C;  1ACM B;  3JAM E;  1K9M U;  4LN2 A;  4Z02 A;  4PJO B;  2RN8 A;  5KYY A;  4R0K A;  1NG2 A;  2A3L A;  3EG0 A;  3D7S B;  4XAX B;  3BFM A;  4C8Q E;  1YI2 Q;  3GNG A;  1D3B B;  4ZGD B;  2QG9 B;  4BB7 A;  1ABQ A;  1M27 C;  3G7Z A;  2X51 A;  4EMK C;  5LJ3 e;  4PJM A;  5ECA A;  3CCU A;  4ELZ C;  3JB9 I;  1HK9 A;  2BKD N;  3M4Y A;  4C92 B;  3VRY A;  1SSH A;  3G6E A;  1Q7Y C;  3H9N A;  4M7D B;  4PNO A;  5FU7 B;  1I5L A;  2MWP A;  1VQ4 T;  2PNI A;  4XTY A;  4R56 A;  4LDY A;  3FJP A;  5GAN 8;  2JMC A;  1VQ4 A;  8AT1 B;  5CKD A;  2DER A;  4Z89 A;  3CCE Q;  2JM8 A;  2R57 A;  2CSI A;  3EG1 A;  3JCM h;  1YFN A;  2E65 A;  3HPW A;  4EPC A;  1NYF A;  3TVT A;  4LDU A;  2R5M A;  4OGE A;  2X4W A;  2EKO A;  2QQB A;  3DB3 A;  4C5H A;  3CC7 T;  2XDB A;  2ZAE A;  2RPN A;  4F7U B;  3M4G A;  3RBB B;  4XTX A;  3VS7 A;  2HSP A;  3LYI A;  2KMT A;  4RCB A;  1TSF A;  2AT1 B;  2CDT A;  3DLM A;  1EZZ B;  4J6X A;  4QKU A;  2ROT A;  1BI0 A;  2A37 A;  2EW3 A;  1YJW Q;  2YRV A;  2A28 A;  3OYE A;  5GMK h;  4QQG A;  2CRE A;  2DTH A;  1E6H A;  1RI0 A;  4L59 A;  1JJ2 A;  3CCV A;  1X6O A;  3QDR B;  2DIL A;  2DYB A;  3C94 A;  3CCJ T;  2I2L A;  4PFZ A;  3I35 A;  3SWN A;  1UHF A;  2DEQ A;  4NL3 A;  2CUD A;  2VGM A;  2JS0 A;  3OYM A;  5CKF A;  1W1F A;  2CUB A;  1Y57 A;  1AWW A;  3QDF A;  1FMK A;  1TS9 A;  5CCA A;  4AG1 C;  4PJO E;  1GFD A;  1WJR A;  4OVA A;  3CPW S;  2CZ7 B;  5GAN e;  1U3O A;  2VC8 A;  1Q7Y R;  1UGS B;  1YI2 T;  5CKB A;  5KYX A;  2D6F A;  4R55 A;  1VQ5 T;  4E7S A;  3ASK A;  3CXC P;  4M78 G;  1BI1 A;  4L6V 5;  4N0A C;  2D0Q B;  2JMA A;  5J26 A;  3PIO A;  1K76 A;  2RI2 A;  4WF2 A;  2KT8 A;  1AWJ A;  2DXT A;  4RTU A;  1YJN A;  5LJ5 j;  1VA7 A;  4JZ3 A;  2CT4 A;  1Q86 C;  3REA B;  1JBM A;  5I2S A;  3OS1 A;  2X4J A;  5IXF A;  5GAM g;  1JB0 E;  1WHG A;  1RAH B;  4D8K A;  4F7U A;  2FRY A;  3H41 A;  4J9H A;  2OTL T;  1RI9 A;  3G71 T;  4IUQ A;  1TOV A;  4GBQ A;  3OYH A;  4M7D C;  3FB9 A;  1FXX A;  1VQK T;  1UDL A;  1YIT A;  4JJC A;  3CD6 Q;  3CCM T;  4MZP A;  1U1S A;  1GFC A;  3I5R A;  2ED1 A;  3M0T A;  4M4Z A;  5A0D A;  1X6B A;  2P4R A;  3J7A F;  4M77 F;  5GAN f;  3CC7 A;  2LNV A;  5GMK e;  2NUZ A;  1K0S A;  4A4E A;  2P0Q A;  4QQD A;  2O31 A;  5LJ5 h;  3LLR A;  1MUZ A; 
#chains in the Genus database with same CATH homology
 4HA8 A;  3X25 B;  1VQ8 A;  2MF2 A;  3SDZ A;  3OBY A;  2EJF A;  4BDZ A;  2P4T A;  3OYJ A;  3EAE A;  4DA4 A;  1YJW A;  3C4S A;  5A0L A;  2LDM A;  3LGF A;  3MO8 A;  3CCR A;  1LNX A;  1KQ2 A;  2BIV A;  3L2U A;  4C0D B;  2JZ2 A;  2RO0 A;  1B34 B;  2X35 A;  3RKY A;  4BI8 B;  3CCV T;  3V7S A;  2RJF A;  2RJD A;  1W2B S;  3M57 A;  1WNL A;  5GMK i;  2HD0 A;  3M55 A;  3G6E T;  3GPL A;  2ZGW A;  4M77 C;  1S72 T;  4B9X A;  1WGS A;  5DY9 A;  5KCH A;  3TRE A;  3CCE T;  5HKC A;  3OYG A;  4M75 A;  3JCM J;  2E6N A;  2XKO C;  1ZHI A;  1WQ7 A;  4M75 G;  4J7I A;  3V8K A;  4FT2 A;  1WJQ A;  3I56 A;  1K8A C;  4A4K A;  2KSS A;  3RUX A;  4C0D C;  1QP3 A;  3M53 A;  5CR2 A;  2PVG B;  4Y28 E;  3BY7 A;  3CCS A;  4MDX A;  1N8R C;  2XDP A;  3WXM B;  1M9S A;  3S6W A;  1UGR B;  1YJ9 A;  2QQ9 A;  2F5T X;  1VQN A;  1LJO A;  3LX7 A;  4C8Q G;  2DIQ A;  2FVU A;  1VQP A;  3KBG A;  5FRN A;  3C95 A;  4II1 A;  4TVR A;  2QQA A;  2MAM A;  3SFM A;  5D6W A;  3V8L A;  4C92 F;  3CPW A;  3TCJ A;  4M7A B;  2RJC A;  5CQY A;  1VQM T;  1VQ9 T;  4M7D F;  3SB2 A;  2O4X B;  3FDR A;  2FYK A;  2LTO A;  1YCY A;  5DLO A;  3DLL A;  1XTD A;  3NTH A;  1Y07 A;  2LRQ A;  1K8A U;  2JUF A;  3E19 A;  4ZN3 A;  5GAO q;  2RHI A;  2XI9 A;  4LDV A;  3PNW C;  3CC2 A;  1TH7 A;  1VQ7 T;  3QPH A;  2A7Y A;  1N6A A;  2DTO A;  2YHT A;  3MP6 A;  4M77 D;  3QII A;  3ZEH A;  4IKF A;  3INZ A;  4F7U G;  1V29 B;  4EDU A;  2X4X A;  4BE1 A;  5CO7 A;  2VUB A;  1YIT T;  3CC2 T;  1JRI A;  2XU8 A;  3VU3 C;  3A8G B;  2RHZ A;  1LOJ A;  5C6S A;  3JB9 G;  2ZPG B;  1VIF A;  4EMH A;  3CPF A;  4LDX A;  3WVD B;  2KQW A;  4M78 A;  4XTU A;  4XU1 A;  5GAO l;  2Y90 A;  3CMA A;  4M7A C;  4XU2 A;  2HQE A;  3UT1 A;  3WVE B;  2PU9 B;  4GY5 A;  3G71 A;  4MMK A;  1ZBX A;  1VQO T;  4A4H A;  2XIC A;  2RK2 A;  4NOY A;  2CZ6 B;  4XTZ A;  1UB4 A;  1U8R A;  3H6Z A;  3NTI A;  4EMK B;  4C8Q B;  4QVC A;  4XTV A;  1BIA A;  1UGP B;  4N0A A;  3RKW A;  1BYM A;  5LJ3 d;  3CCU T;  3X20 B;  2FB7 A;  1D3B A;  3HRS A;  2DIG A;  4C8Q F;  3P8D A;  2RI5 A;  4JJN K;  4M77 A;  3AHU A;  4M7A G;  2KDS A;  2WSF E;  5J3B A;  1HXD A;  4QW2 A;  4F7U F;  2DVE A;  5LJ5 g;  5D6X A;  2RHX A;  1N27 A;  1Q86 U;  1VIE A;  3NTK A;  3P8H A;  4KBM B;  3JCM V;  1M1F A;  2JTM A;  3O8V A;  2DXB A;  3OMC A;  4JDS A;  2E6Z A;  1NJI U;  2V8J A;  5FU6 B;  3T9N A;  1Y71 A;  5GAN d;  3OMG A;  5GAM d;  3L2W A;  4YTL A;  1XNI A;  2PVO B;  4IUT A;  2CZ1 B;  4C92 C;  5GAO p;  4PJO C;  2F69 A;  5CVI A;  1WJS A;  3LLR A;  2EQJ A;  3EFR A;  2K5F A;  3TEE A;  5CKE A;  3JB9 F;  3OS0 A;  3RES A;  1XQH A;  1EIF A;  5GAN g;  1Q7Y U;  2PVD B;  2E1H A;  3E1S A;  3JB9 J;  3A8H B;  3JCM b;  3L2Q A;  2KAF A;  3X24 B;  1AHJ B;  1Y7X A;  4J7F A;  3JCM f;  3CME A;  3CCQ A;  1NPP A;  3FRN A;  5M9O A;  2Y4Y A;  5GAO r;  1VQK A;  5LL6 S;  5GAN 6;  2D9T A;  1IRE B;  5CIU A;  5KCO A;  4EMK A;  2RHU A;  5KE3 A;  1I81 A;  3CD6 T;  3JCM d;  4A54 A;  4N4I A;  2RM4 A;  1Q81 U;  3QYH B;  4UC4 A;  2LT1 A;  4M78 B;  2AHJ B;  4LD9 K;  1QVP A;  4BE0 A;  3JCM P;  1KG1 A;  2JOY A;  4GLK A;  4NL2 A;  2M9U A;  3OSS C;  3PT9 A;  3CXC A;  4IUR A;  5I2M A;  4BY6 C;  3J80 E;  1G5V A;  2KK4 A;  2WAC A;  4BI3 A;  4DOV A;  3CCJ A;  1YHQ A;  1BIB A;  4KUL A;  3HSB A;  4XQ3 A;  2VXE A;  3F70 A;  5DM7 R;  2DZ9 A;  5EG2 A;  4QQ6 A;  4X9C A;  1O9S A;  4HCC A;  2XID A;  3UDC A;  4OB0 B;  1M1K U;  2LQK A;  3ME9 A;  1N8R U;  1M5Q 1;  3OYI A;  2L5Q A;  2EFI A;  2EQM A;  3JCM X;  1K9M C;  2VXF A;  3ER0 A;  1QW1 A;  3L1A A;  2K57 A;  2OAU A;  2EJ9 A;  3A8M B;  3CBM A;  4C92 D;  3OYD A;  2DPP B;  3HL8 A;  3S3M A;  3VYG A;  1H3Z A;  4A4F A;  1K73 U;  4M75 F;  3OYC A;  3CCM A;  1R8O B;  4E7H A;  4RG2 A;  4RCC A;  4MML A;  4JRQ A;  2E5Q A;  2V8I A;  3QG1 A;  1G3S A;  3M59 A;  4M75 B;  2QA4 A;  5J39 A;  2WSE E;  2E12 A;  2RI3 A;  4IUP A;  3OBW A;  5KE2 A;  5LJ3 j;  2QTX A;  3LW5 E;  4OP0 A;  3GLX A;  1NPR A;  2YLC A;  4X9D A;  1I4K 1;  3HP9 A;  1M8V A;  3HRU A;  1VQL A;  2EWN A;  4ZGJ B;  3VV0 A;  5GAN 5;  4HT9 A;  1H64 1;  2HQX A;  3QXE B;  4EMG A;  1YJW T;  3JB9 H;  4JRI A;  3CCL A;  3V7R A;  1QVF S;  2GCX A;  4JUV A;  1KQS A;  2HNI A;  5GAN 3;  4PJO G;  5GAN 2;  2DO3 A;  2CS7 A;  2H3J A;  3MHX A;  3I56 T;  3L2V A;  2QEX T;  3CBO A;  3HRT A;  3I55 A;  3JCM W;  1W2B A;  4M7A D;  5A2Q E;  1M4Z A;  1KD1 C;  3MCA B;  2GFA A;  4BI4 A;  3DB4 A;  5FRM A;  4O5V A;  3VYH B;  1B34 A;  4M77 G;  1G3T A;  3V8J A;  2ZZD A;  2P0K A;  1W4S A;  5IN1 A;  4FSX A;  5LJ3 f;  2L3R A;  3P8B B;  4C0G A;  4C0F A;  2V8K A;  2R58 A;  5GMK m;  4OMF B;  5GAN j;  2OTJ T;  5HK0 A;  1BKB A;  1UGQ B;  2E64 A;  5GAO m;  4ZTJ A;  1MGQ A;  2PQW A;  3S3N A;  4PKC C;  4O6J A;  2LT4 A;  3GIB A;  3VKI A;  3NFC A;  2F5K A;  1OYX A;  3EFS A;  4OB3 B;  3RIR A;  4JS4 A;  1QVG S;  2OTJ A;  3JRZ A;  3HFN A;  3OYF A;  4C8Q A;  5GAM j;  4M78 C;  4BE2 A;  5FRO A;  3A8L B;  4BAC A;  5DLQ E;  4BD3 A;  3J81 E;  3QKJ A;  4BY6 B;  2DD5 A;  2FHD A;  4A4G A;  2XDD A;  2KY9 A;  1YIJ A;  4M7D A;  3CBP A;  5KH6 A;  4PJO D;  1VQP T;  2O4X A;  4M7A A;  2X4Y A;  4M7D E;  1SSF A;  1IZ6 A;  4FU6 A;  4M75 D;  3M5A A;  3OB9 A;  2K5I A;  4FM4 B;  4MZM A;  4C92 E;  3KXT A;  2GQV A;  3M9Q A;  4DOW A;  2QQR A;  2WSC E;  2JN0 A;  4JRP A;  1GXI E;  4M7A E;  4J6W A;  5GAM h;  1OZ2 A;  2R5A A;  2EYQ A;  4OGC A;  3CCL T;  4FL6 A;  1VQ6 A;  4PL6 A;  5HY6 A;  3KUF A;  2G3R A;  1VQL T;  2ZPF B;  4ATO A;  1UEB A;  4E47 A;  3A8O B;  1K73 C;  2CKK A;  1BI3 A;  1O75 A;  2EQU A;  3M54 A;  3MEU A;  3JAM E;  1K9M U;  5GAM e;  3FLG A;  3PFS A;  2BUD A;  5LJ3 g;  3LWH A;  4PJO A;  3HHT B;  4Z02 A;  4HCB A;  3S3O A;  4KUI A;  2OTL A;  4PJO B;  1FX7 A;  4M78 D;  5AYF A;  1VQM A;  2K3X A;  3I55 T;  2A3L A;  2DK3 A;  4M78 F;  2VGN A;  4JS5 A;  4XK8 E;  4F7U E;  2DTI A;  2ZPI B;  4XAX B;  3BFM A;  1DJ7 B;  4C8Q E;  2LCC A;  2GF7 A;  3GNG A;  1D3B B;  2XHC A;  4ZGD B;  1YJ9 T;  1M90 C;  4BB7 A;  3OA6 A;  3JSC A;  3Q1J A;  2K4Y A;  3G7Z A;  4J8O A;  3QYG B;  4DQ2 A;  4EMK C;  1OI1 A;  3M58 A;  2LVM A;  5LJ3 e;  3M56 A;  3OS5 A;  3QZ9 B;  2P0P A;  2MI6 A;  1PSF A;  4ELZ C;  3CCU A;  3JB9 I;  1HK9 A;  1VQO A;  4QVZ A;  3E9F A;  2HBP A;  2M0O A;  4Q5W A;  4C92 A;  5HK3 A;  2BKD N;  3M4Y A;  3MP1 A;  4C92 B;  1M90 U;  3G6E A;  1Q7Y C;  4M7D B;  1KC8 C;  2RHY A;  2DD4 A;  5LJ3 h;  3PIP A;  3CMA T;  4PNO A;  2PUK B;  3UPU A;  2NLU A;  5FU7 B;  1I5L A;  2VV5 A;  3GP8 A;  3CC4 A;  2MWP A;  5GMK l;  1VQ4 T;  4XTY A;  3L2R A;  3A5Z B;  4MZT A;  5CAI A;  4R56 A;  3OW2 S;  2L89 A;  2RA2 A;  4LDY A;  3FJP A;  1G3W A;  3G4S A;  1VQ6 T;  1YI2 A;  3VUB A;  3QJY A;  5CQX A;  3UWN A;  5GAN 8;  1VQ4 A;  4M75 E;  2E70 A;  5CK9 A;  3CC4 T;  4LD6 A;  5CKD A;  5LJ5 e;  1KC8 U;  4J6Y A;  1YHQ T;  4C5I A;  2R57 A;  3JCM h;  3HPW A;  2E65 A;  3DKM A;  4EPC A;  2LCL A;  5FU7 C;  4PLI A;  3BDL A;  1Q81 C;  4LDU A;  2R5M A;  2EAY A;  2X4W A;  4OGE A;  3SWN B;  2EKO A;  2QQB A;  1P92 A;  3DB3 A;  2XK0 A;  4C5H A;  1WPY A;  3CC7 T;  2XDB A;  3CCR T;  3CEY A;  3OQ5 A;  5D6Y A;  4KUD K;  2QEX A;  4ZTF A;  4M75 C;  4F7U B;  5A0G A;  5LJ5 f;  2E10 A;  2M16 A;  3M4G A;  3QUI A;  4MDW A;  4XTW A;  4J83 A;  1NE8 A;  3QBY A;  4XTX A;  3CCQ T;  2ZPE B;  2PUO B;  3CME T;  5IT9 E;  2KVQ G;  4C92 G;  3LYI A;  2DZC A;  4ELY C;  2DAQ A;  2KMT A;  5I21 A;  3JB9 D;  4M7D G;  4RCB A;  4OB2 B;  5C0M A;  2ZPB B;  4E7L A;  4HKE A;  3CCE A;  4M77 B;  3DLM A;  3OYN A;  3LH0 A;  4J6X A;  1BI0 A;  1NZ9 A;  3RKX A;  3VUZ A;  3PGG A;  2JNG A;  2YRV A;  3QHS A;  3OYE A;  5GMK h;  2ZPH B;  2IG0 A;  2XD0 A;  1MHN A;  4QQG A;  1S72 A;  2QXF A;  2DTH A;  3QZ5 B;  1KQ1 A;  1RI0 A;  1NJI C;  3E9G A;  4RKU E;  3PMI A;  4L59 A;  5GMK j;  1JJ2 A;  4CRI A;  3CCV A;  3BDU A;  3RMQ A;  3C12 A;  3OYK A;  3MEA A;  1I8F A;  3V7C A;  1X6O A;  1KHC A;  3QDR B;  4VUB A;  3C94 A;  2QDY B;  3CCJ T;  2FL7 A;  1ZQ1 A;  4OF1 A;  2I2L A;  5L8R E;  2YLB A;  4ZGE B;  1N9R A;  2XG8 D;  1KD1 U;  3SWN A;  3R6O A;  2Y4X A;  3LGL A;  2DEQ A;  2QQS A;  2CGH A;  4M77 E;  3JCM c;  4NL3 A;  3OS2 A;  3LWI A;  3RER A;  2VGM A;  4PLL A;  3FIF A;  4PJO F;  3PTA A;  4JLI A;  4Y91 A;  1U1T A;  4CI0 C;  2K3Y A;  5GAN 4;  3OYM A;  5CKF A;  3GNF B;  5GAM f;  4C5E A;  2RK1 A;  4M7D D;  2JTF A;  1G3Y A;  3ZBD A;  1XOV A;  4LDW A;  5CCA A;  2LC4 A;  2DXU A;  3FEO A;  4PJO E;  1WJR A;  4OVA A;  3OW2 A;  3CPW S;  5FU6 C;  4M78 E;  1PSE A;  2CZ7 B;  2K2V A;  3OSV A;  2VYT A;  5GAN e;  2RB6 A;  2VC8 A;  1OZ3 A;  4RG8 A;  1UGS B;  3CCS T;  2RH2 A;  4L5G A;  4QVD A;  1YI2 T;  4ME7 A;  5CKB A;  3L2Z A;  2D6F A;  4J5Y A;  4R55 A;  1VQ5 T;  4C8Q C;  1X01 A;  2E41 A;  2LX9 A;  3ASK A;  4E7J A;  4NS5 A;  4M78 G;  3X28 B;  1BI1 A;  3JCM g;  4L6V 5;  4BUG A;  1M1K C;  4N0A C;  4B9W A;  3QSU A;  2D0Q B;  3SD4 A;  3TU4 K;  5J26 A;  4A53 A;  2C06 A;  2MMP A;  4HCZ A;  3PIO A;  2EQK A;  4FIB A;  4M7A F;  4IUV A;  2RI2 A;  1BI2 A;  4WF2 A;  2JVV A;  2DXT A;  3PMT A;  4RMO A;  3CD6 A;  3X26 B;  4D6W A;  4E7K A;  2LQ8 A;  3QO3 A;  3URG A;  1VUB A;  1YJN A;  4N4H A;  5LJ5 j;  2DJZ A;  2EJG A;  1M1G A;  2L8D A;  1Q86 C;  3MET A;  1JBM A;  1KHI A;  5I2S A;  2K5L A;  4BDY A;  3GF5 A;  3SWN C;  3OS1 A;  2X4J A;  5GAM g;  3OYL A;  1JB0 E;  1YJN T;  5GAN 7;  3H8Z A;  4E7I A;  4N4G A;  3JCM e;  4F7U A;  1KQS S;  3JCM Q;  2OTL T;  1YIJ T;  3MEV A;  1QP2 A;  3QJ6 A;  1RL2 A;  4IUU A;  4C0Z A;  5CKH A;  2QA4 T;  2CYZ B;  3OYY A;  1QVF A;  3G71 T;  4IUQ A;  3OYH A;  4M7D C;  4P5N A;  2QI2 A;  1N9S A;  1JJ2 S;  2M1H A;  1YBY A;  3VJP A;  2ZCF B;  3FB9 A;  1FXX A;  3MEW A;  3ZFJ A;  5LJ5 d;  1VQK T;  1YIT A;  3HKS A;  4JLG A;  3G4S T;  4C5G A;  3OY9 A;  3CCM T;  1WQW A;  2GFU A;  2EIF A;  1U1S A;  4JRK A;  1Y96 A;  4KT0 E;  4MZP A;  5GAN h;  3OYB A;  1VQ5 A;  1VQ7 A;  4C8Q D;  3L42 A;  1VQ8 T;  2IVW A;  5IAY A;  3RMS A;  3BW1 A;  1Y96 B;  2RD1 A;  4ZN1 A;  1Q82 U;  5FLX E;  5A0D A;  3GOX A;  4FT4 A;  3N5B B;  4XU3 A;  5GAO n;  3MP8 A;  3FC3 A;  3OYA A;  1X75 C;  3J7A F;  4M77 F;  2B8A A;  2RJE A;  4OB1 B;  5GAN f;  2LNV A;  2MWO A;  5GMK e;  3CXC S;  4X34 A;  3CC7 A;  2O01 E;  4A4E A;  1QVG A;  3HFO A;  1VQ9 A;  2P0Q A;  4HT8 A;  4QQD A;  1VQN T;  1Q82 C;  2CZ0 B;  2DKG A;  4V2S A;  2HAX A;  1FWZ A;  4XU0 A;  5LJ5 h;  2DXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...