1QP3A

Solution structure of photosystem i accessory protein e from the cyanobacterium nostoc sp. strain pcc 8009
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
70
structure length
70
Chain Sequence
MVQRGSKVRILRPESYWFQDVGTVASVDQSGIKYPVIVRFEKVNYSGINTNNFAEDELVEVEAPKAKPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (PSAE PROTEIN)
publication title The solution structure of photosystem I accessory protein E from the cyanobacterium Nostoc sp. strain PCC 8009.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Electron transport
total genus 7
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1999-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02427 PSI_PsaE Photosystem I reaction centre subunit IV / PsaE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 1qp3A00
1AHJB 2DD4A 3QZ9B 3HHTB 2PVOB 4ZGDB 2WSFE 1QP3A 5L8RE 1QP2A 2ZCFB 2PUOB 1UGQB 2DXCA 1UGRB 2CYZB 4ZGJB 3A8LB 3QXEB 3X25B 3WVDB 4OB0B 1GXIE 3QYHB 2AHJB 2DPPB 3QYGB 3A8MB 3A8HB 2ZZDA 1UGSB 2ZPBB 2WSCE 1UGPB 2PVGB 2PVDB 2O01E 2PU9B 4RKUE 2WSEE 4ZGEB 2ZPEB 3X20B 2DXBA 1PSFA 2ZPIB 4OB3B 2DD5A 2D0QB 2QDYB 4OB2B 4OB1B 3WVEB 3LW5E 2ZPHB 2CZ6B 4KT0E 3X28B 3VYGA 2CZ7B 1DJ7B 3X26B 3A8GB 2CZ0B 2CZ1B 4XK8E 2ZPGB 2PUKB 2ZPFB 4L6V5 3X24B 4FM4B 1V29B 3A8OB 1IREB 1JB0E 3QZ5B 3VYHB 1PSEA 4Y28E
chains in the Genus database with same CATH superfamily
5LJ3j 3OS2A 3QZ9B 3CCEA 1VQ4A 1SF9A 2KAFA 4E7LA 4XU1A 1XOVA 2V8IA 2L3PA 1YJNA 4ELYC 2EPDA 4M7AD 2D8HA 3OYEA 4X9DA 4J5YA 1ARKA 1UE9A 2X3WD 2DIQA 1JJ2P 4E7HA 1N9RA 1GXIE 2EJFA 3H6ZA 1YJ9Q 4C8QA 3G6ET 4IUQA 4RCBA 3H41A 1WHMA 2HNIA 3LX7A 1UJ0A 3ZL7C 5KYXB 4PJOF 2AZSA 3QO3A 2K79A 3VS5A 1GCQC 2RF0A 1Q81C 3FC3A 1VQ8A 2X9HA 3GNGA 1KQ2A 3EFOB 3OYJA 4ME7A 2LNHB 2DEUA 2XMFA 2K3XA 3G6EQ 4HCKA 1UB4A 3J81E 3JCMV 5A0DA 4FSSA 1PHTA 2A28A 1PWTA 2A37A 2EAYA 4Y91A 2HL3A 4II1A 2KDSA 6AT1B 2DL7A 1ABQA 3S6WA 4F7UB 1K9MR 1X6OA 2LJ0A 2DRMA 3M9QA 1VQ7T 1R0CB 1NJIC 3OYKA 1WGSA 2E5KA 1F1BB 3X24B 3RERA 3QJYA 1FMKA 1Y96A 4CRIA 1MMGA 3JB9D 2VYTA 2AIRB 2I0NA 3MCAB 4LDVA 2YXYA 4IIOA 2LNVA 4JRQA 1FX7A 1JB0E 1N8RR 2CT4A 1X75C 4LDYA 5GMKi 1QW1A 1PSEA 5GAMj 1WXBA 3H0HA 1GCPA 2YRDA 4PL6A 5LJ3f 1ZHIA 1UGQB 4FL6A 5GANh 3FIFA 3PIOA 3SWNB 5IHKA 1KC8R 4PFOA 1W70A 2KRSA 1P92A 1ZBJA 1D0ZA 2QQRA 4OB0B 1I0CA 3CCVA 2RH2A 2QDLA 3M0RA 1GL5A 4LXCA 5J26A 2R57A 2CP5A 2VKNA 1KQSP 2A36A 1PRMC 1RLPC 1W4SA 4F17A 4FYYB 1YJ9A 2V1RA 2P0QA 1YJWT 4C92E 2EQKA 1E6HA 5CKHA 2D0NA 1LJOA 1NEBA 1NYFA 3M0PA 4J9BA 3EGUA 1BCMA 4L59A 8ATCB 2L3RA 2F5TX 2DKGA 2QGGA 2QDYB 4OB2B 2DZCA 1K8AU 1NLOC 1G3SA 4EPCA 2NUZA 5GJVB 2OX7A 2KBTA 2V8JA 4PJOC 1YJWQ 3G6EA 5KH6A 2L2PA 5IHNA 2YHTA 1VUBA 2NWMA 1BU1A 5KYNA 3OW2A 2BTTA 3DKMA 1VYVA 2F2WA 2JTMA 4GY5A 1I1JA 2DYBA 5KYWB 2LT1A 4HVUA 3L1AA 1HJDA 2KXCA 3UF4A 4E7IA 2XHCA 4JS5A 1K1ZA 1Y7XA 5KCOA 2EKOA 2LJ1A 3R6OA 4M75B 1D09B 4M77A 3RKXA 4IKFA 5KYUB 1YBYA 4PJLA 3VV0A 1B7TA 1QMCA 2NUTA 2YDLA 1I8FA 3IQLA 3QDRB 1WHJA 2RQVA 3OW2S 1E6GA 4BI8B 5FW9A 2FVUA 5GAMf 3CMAT 1U3OA 4F04B 4BD3A 2CP3A 2G6FX 3H8ZA 3OY9A 2CH4A 4HCCA 2DILA 4PJNA 2EW3A 2O31A 1YNZA 3UA6A 4KUDK 4PLIA 5GMKe 3SEMA 3BDLA 3F70A 5LJ5e 4PJJA 2EYYA 2J6FA 2MMPA 4J9CA 3CMAQ 2HBWA 3V7RA 2PU9B 4M7AC 1KHIA 4JJNK 2M0OA 1W6XA 1OQKA 2DA9A 2LTOA 4PKCC 4CC2A 3E2UA 4F7UE 2IIMA 3E19A 1X27A 2DD5A 4M7AB 4DOVA 4NL3A 1CSKA 4EIKA 2CKKA 3NMZC 5LJ5d 3CPWA 1NPRA 2MK5A 3M53A 3DB4A 3MP1A 4N0AA 3EG1A 1ZA2B 1GBQA 1JEGA 1TSFA 3H9NA 4JRPA 3ER0A 2NLUA 1TS9A 3E1SA 2DX1A 1KHCA 4L6V5 1YJWA 3KXTA 5HK0A 5FROA 3CPWP 1D0XA 4XU3A 5KYYA 3QDFA 2CS7A 2SEMA 1IZ6A 4ZNXA 3BW1A 1YFNA 2KRNA 5GANg 3HRSA 4E6RA 3JAME 1TUGB 1KFZA 4RCCA 4BY6C 1RUWA 4ZGDB 2NYSA 4R0KA 4C5GA 2OTLT 3TVTA 2E12A 2QQBA 3EFSA 4JPBW 3VS6A 2OTJT 1AEYA 2M9UA 4M78A 4BY6B 3LGFA 2L3QA 3A5ZB 2DXCA 2E10A 4X9CA 4FYXB 1X6GA 2CP7A 4A4GA 4EMKA 1K9MU 1MGQA 3S3OA 3C94A 4LDXA 3FRNA 3CD6A 4HKEA 2H8HA 2IPOB 3OSSC 4BDZA 1BI0A 2OTLQ 2KRMA 2KT1A 1UGSB 2OTJQ 2EYQA 2DXTA 2WSEE 2BIVA 5I21A 2KY9A 4C92F 2FG0A 2GTOA 3CEYA 2KT8A 3CMAA 2V1QA 1VQLT 4J9IA 4LN2A 1WA7A 2VASA 2MWOA 5FRNA 4BDYA 2JNGA 4FSXA 3VS3A 4M7AG 1NYGA 3ME9A 2P0PA 1C1AA 2MYSA 3RMSA 2M16A 2K2VA 3NTHA 2JMAA 1EZZB 1DJ7B 3EHRA 3THKA 5LJ3g 1GFCA 3CCMT 3HL8A 1VQLQ 2RHXA 1FXXA 1ZUKA 2CT3A 1W2BP 1MHNA 1YHQT 2HL5C 3M4GA 1SKUB 2RQUA 2KQWA 3LWHA 1RAGB 3VS4A 3KBGA 5A0LA 2DL8A 5EC7A 1UECA 2J7IA 3L2ZA 4Y28E 4PFZA 3ULRB 2L0AA 3CCLT 2EWNA 2V8KA 3CCMQ 4HT9A 4JS4A 2DBKA 2Z0WA 4NS5A 3REBB 1YHQQ 2ENMA 2A0FB 2QYZA 2JVVA 3G71A 4JRIA 1KG1A 1G5VA 4JLIA 1YITT 4QQGA 4HVVA 1TG0A 3NFCA 1V1CA 3PVLA 1VQ9T 1BIBA 3CCLQ 3A8HB 2LP5A 2RD1A 4KH0B 1VQ5Q 1T0HA 1K8AR 3OMGA 4M7AE 3I5RA 3JCMf 1RI9A 2HKNA 1OPKA 4JJCA 4AFSC 2DJQA 1I5LA 1PD1A 2VC8A 2A7YA 1ZX6A 3MEUA 4AFZC 4B9WA 4M77D 5GANj 1D1CA 4OB3B 1M3BA 1AWWA 2RHYA 1VQ9Q 2OI3A 1GFDA 2DETA 4F7UF 2XG8D 1WHGA 2YUNA 4EMHA 1N27A 5I2SA 1IGUA 1LVKA 2LCSA 2EJ9A 1QCNA 3LW5E 2GF7A 2O4XB 4HA8A 2IVWA 3UA7A 1LPLA 3X28B 1M1KR 3L2VA 1VQPQ 1M2VA 2DTIA 4C92C 1BK2A 3L42A 2RJCA 2L5QA 2LX9A 2DVEA 1ZBXA 1VOMA 3PMTA 1H92A 3OYMA 4QW2A 3INZA 3MEVA 1VQLA 4OMOA 1IXDA 1OZ2A 4FT4A 5CIUA 4PK4A 2EGCA 3OS5A 1KQ1A 2MIOA 1HXDA 5C0MA 2D8JA 1OOTA 4A4KA 5GAN3 2R5MA 4RTZA 4BI4A 2DTHA 2WSFE 2GGRA 5L8RE 3JCMX 1RI0A 1FYNA 4E7SA 4K11A 4JZ4A 4WF2A 1JBMA 2C0IA 4CC3A 4RTXA 3BE3A 5KE3A 1OPLA 1QCOA 2KK4A 3PMIA 3CCUT 4JJDA 3OS0A 3Q1JA 4C5IA 3O5ZA 2F1LA 2M02A 1JJ2A 2BE7D 2RQRA 1NG2A 1Y57A 1T0JA 2XICA 3CCST 1KD1U 2FZGB 5CKEA 3FLGA 2DMOA 5HKCA 5J39A 3QWXX 1BIAA 2DLPA 4PFPA 2KMTA 2DBMA 2FO0A 1VQ5A 3M54A 1OZ3A 4A63B 3EH2A 2E6ZA 3CCUQ 2K57A 4RTWA 4J9DA 2JJ9A 1ACMB 2RQTA 5I22A 2RI3A 4XU0A 1VYUA 1VQ6T 4DQ2A 3CCSQ 5GANf 1RAAB 1WJSA 4C5HA 1JJ2S 3L2RA 1YWPA 4M78D 3EFRA 4OMNA 1VQ9A 1X2QA 3VS0A 1QQJA 4KULA 5CAIA 2CZ6B 2AKKA 1QKXA 1WXUA 3I5SA 1Y96B 3JSCA 4C0ZA 2JTEA 2HQHA 4M75F 3OMCA 2QEXA 1LNXA 3I56T 1TH7A 4MZPA 1PKSA 1VQ6Q 1VQPA 1T3SA 2XU8A 1WQWA 1OYXA 3EGXB 3A8OB 5FWCA 1YN8A 1OX8A 3QZ5B 4E7KA 2COZA 4C92G 2QTVA 3C12A 5D6XA 1NM7A 4Z02A 3GF5A 2DJZA 1XQHA 1ZA1B 2DK3A 2EQJA 4J9FA 3SHWA 3EAEA 1SPKA 1U1TA 3I56Q 1IGQA 4J83A 4HVWA 2FB7A 1R0BG 3G1JA 2JT4A 1RADB 3A8LB 1SG5A 3X25B 3AHUA 3FJ5A 1IHWA 2GFAA 1BI2A 1KJWA 2LT4A 2VGNA 4HT8A 3MJXA 1VQ7Q 3SWNC 2QA4T 3UPUA 4IIMA 1GCQA 2XDBA 2X4JA 3QPHA 3RDVA 1KQSA 4M7AF 4M7DA 3DB3A 3OYCA 5GAN2 2CGHA 1BI1A 5GMKh 1M90R 4LD9K 5LJ5h 1ZUUA 5D6WA 3ZEHA 2VWFA 2QK0A 1EIFA 2QA4Q 2J6KA 3EGDA 2LZ6B 2RJFA 3R6NA 3WVEB 3VRYA 2XD0A 4YTLA 1Q82R 4XTZA 1K9MC 2K5LA 4ELZC 5HY6A 4KT0E 1M1FA 1KQSS 1BI3A 2ABLA 4AMCA 4XAXB 4XK8E 4LUDA 1Q7YR 3G4ST 2A3LA 5A0GA 1X43A 4RMOA 4M4ZA 2BUDA 3OYHA 1N8RC 4M77B 1M2OA 4IUPA 4N4GA 3M0QA 2O9SA 2NUTB 3NPFA 4IURA 1VQ6A 2K3BA 1G83A 4LNPA 1MNDA 1TUDA 2KVQG 2RO0A 1WYXA 2ROLA 3I55T 3JCMg 5FRMA 4F7UG 1QP3A 1B3QA 4UC4A 1LCKA 1SRMA 3HFOA 2Y90A 1UHCA 3G4SQ 2NUPB 2X3XD 4M75C 1KC8C 3RIRA 4C5EA 1RABB 3TU4K 1Y07A 3JB9F 2M0YA 2AZVA 2F69A 2HSEB 3DLMA 4L5GA 3VU3C 4WTOB 3CC4T 2EYWA 3G7ZA 1M1KU 2DPPB 2FPDA 2LQKA 3EHQA 3A8MB 3I55Q 2ZZDA 4VUBA 4RTUA 4C0DB 5DY9A 3V8JA 4OP0A 2FPEA 2M51A 1M8VA 1UGPB 2YUQA 1VQ7A 4EMGA 2C0TA 4ZGEB 4X34A 2KYMA 3CC4Q 1HYOA 5CKBA 5GJWB 3RUXA 2K3YA 3FJPA 3VJPA 1SHGA 2JW4A 4PLLA 4Q5WA 4PJOA 1AWXA 2RI5A 4CI0C 2XDPA 4JUVA 4BE2A 3NTKA 1X01A 5GAN4 3J80E 1ZLMA 2E3HA 2DF6A 5GAN6 2ECZA 3VYGA 5GANe 1MMNA 5KYYB 4JLGA 3HRTA 3CCQT 3VRZA 1NBEB 3A1PA 1ZQ1A 1BB9A 1NPPA 3QWYA 3MP6A 4DA4A 1I81A 3OYDA 2CP0A 4FIBA 2LQWA 2MF2A 4M78C 1G8XA 2SRCA 7AT1B 2B8AA 3SFMA 3CC2T 1NJIU 4M78B 5GAOn 3CCQQ 2JM9A 1KD1R 4C8QD 3P8HA 1XNIA 2FRWA 3PNWC 2LCLA 1UJYA 2E65A 2RNAA 2OAWA 4EMKB 2E1HA 5J3BA 4J8OA 3C4SA 2KGTA 1VA7A 1HK9A 3QXEB 2PQWA 1GBRA 3WVDB 1Q86R 3CPWS 3VKIA 4QVDA 3D7SB 4M75G 3VUZA 5D6YA 1VQOT 2LJ3A 3M0SA 1U1SA 1ZSZA 3EG3A 2DE0X 1B34B 1K0XA 2DL5A 1UFFA 4KUIA 2RJDA 2DFUA 2F2XA 2FRYA 4LE9A 1CKBA 3V8KA 5LJ3e 3L2QA 2RA2A 5IH2A 2YUPA 1VQOQ 3QBYA 1WI7A 4QKUA 4E7JA 2DRKA 2DAQA 1C6VX 4CC4B 1A0NB 2CSQA 3LH5A 2E41A 3MPUB 1KIKA 4M77E 4ORZA 3A8GB 4HCBA 5HCKA 4XTXA 3RR6A 3MO8A 1KD1C 5LJ3d 5CQXA 2KSSA 5FWBA 2QI2A 1UHFA 5LL6S 3H0IA 2K5FA 3QHSA 5ECAA 2F2VA 3OYFA 1W2BA 4N4IA 1VQKT 4M7DD 2D6FA 2XDDA 1M90U 2RHZA 1K0SA 4NOYA 4GLMA 3V7CA 4M75E 1H8KA 1G3TA 4C8QF 2RK1A 4B6MA 3JB9J 3U23A 2LDMA 4M78G 3QJ6A 1Q82U 2PTKA 1VQKQ 3CBOA 4TVRA 5EG2A 4A4FA 1W2BS 4HCZA 2MI6A 1M27C 4FYWB 4RG8A 3KUFA 3OSVA 3QYGB 2CSIA 4D8KA 1E7OA 1Q7YU 2RHIA 1Z9QA 1TWBA 2VGMA 4QVZA 3CCET 1VQ4T 2DTOA 3CC7T 5IT9E 1VQNT 2XIDA 1MNEA 2LCCA 4JJBA 1Z9ZA 1YJNT 2O2OA 2RMOA 2M1HA 3GLXA 1PSFA 1JXOA 1SSFA 8AT1B 1WJRA 2F5KA 5GAMe 2MOXA 5FU6C 2JN0A 4BACA 4QQDA 2MWPA 4WCIA 2HQEA 1G3YA 2GBQA 2AT1B 4KGXB 3JB9G 1VQ4Q 3CC7Q 5FU6B 1K73R 4RTYA 1VQNQ 3CMET 1VQOA 1M2VB 4ATOA 1YJNQ 4QT7A 2OTLA 4FT2A 2OTJA 2ED0A 1YITQ 2LMJA 1ZSGA 3UDCA 2BZYA 2HSPA 1VQ8T 2QGFB 5GAMd 5LJ5j 4O5VA 1QVGP 2MPXC 1I07A 2JS0A 3BFMA 4M78E 1PNJA 1M3AA 2EVRA 2EFIA 1PC0A 2RK2A 4DBFA 3OYNA 2RJEA 3CMEQ 2JTFA 3S3NA 1OX9A 1YWOA 2JOYA 1NLPC 2DD4A 5CR2A 1M8MA 3META 1MMAA 2IG0A 3PIPA 3OYBA 3PTAA 3OYGA 1VIEA 1VQ8Q 4Z88A 4PJOD 3HPWA 2CP6A 3CCRT 2E6NA 3M56A 1KK7A 4OMFB 1UGRB 3EG9B 2LRQA 4ZGJB 1QVFP 5CK9A 3O8VA 2EBPA 1WIEA 2D1XA 1R8OB 5I11A 4MMKA 1HD3A 1M9SA 3JCMQ 1K8AC 2G3RA 2RQWA 1NEGA 4KH1B 5CKDA 5FU7B 3CCRQ 1IO6A 3VS2A 4C8QC 1Y71A 3CCMA 2K6DA 4RKUE 3QG1A 1IHVA 1UUEA 3HSBA 2QQAA 1S72T 1Q81R 2QAZA 3RMQA 4DBHA 1WXTA 4BB7A 4BE0A 4C8QB 2VUBA 1YHQA 4J6WA 1SHFA 3M5AA 1UEBA 4RUGA 1XJWB 1RLQC 1R77A 3GP8A 2COYA 1AZEA 3CCVT 2XI9A 2HBPA 4XTUA 2K9GA 2CUBA 3M58A 3CBPA 1I5OB 3CCLA 2K2MA 4C92A 2ZPHB 1M1KC 1ZUYA 3OYAA 1VQMT 2VXFA 4NL2A 2DM1A 2V26A 1S72Q 5IN1A 5FLXE 1Q86U 5CVIA 4ZTFA 1YJ9T 5CKFA 3M0TA 1D3BA 1JO8A 3CC7A 4M77F 1WQ7A 4GBQA 2W10A 1VQNA 2ZPGB 4A54A 2PUKB 1NJIR 5GAN8 4IUVA 4FM4B 1K4US 2YRCA 1SEMA 2KXDA 3VUBA 1YITA 1BKBA 3CCVQ 3P8DA 3JV3A 4XQ3A 2W0ZA 5GMKl 1IREB 2YWWA 1M30A 5LJ5f 1WHKA 3OYYA 1WHLA 1WX6A 5KE2A 1WPYA 2DL4A 3BY7A 3GOXA 1VQMQ 3QIIA 2HZYA 1BYMA 4RG2A 1G2BA 1WJQA 2J06A 3CMEA 3QSUA 4BUGA 1SRLA 4DBQA 2MAMA 1QP2A 4JDSA 2CUDA 3TEEA 4FW1A 3OB9A 1MMDA 2QQSA 2CYZB 1AD5A 3GBQA 1AOJA 4MMLA 2HDAA 2EQMA 3MEAA 1VIFA 2YUOA 5GAOq 1UDLA 1D1BA 2HKQB 3PGGA 4M7DC 3CPFA 2YLBA 4BI3A 5CQYA 1FMVA 3LGLA 4M7DB 1N9SA 2WSCE 2PVGB 4J7IA 1VYTA 2FL7A 1RAIB 2PVDB 5KYXA 2O01E 2VXEA 3EG2A 1UTIA 3JCMJ 3M59A 3J7AF 2DERA 3N5BB 1M3CA 2K5IA 3CCRA 1X6BA 2ESWA 2O9VA 1V76A 3EGDB 3E9GA 2C06A 1MV3A 2CP2A 4E47A 2DL3A 2YSQA 1JQQA 3KFVA 2D0QB 3EFOA 4C8QG 4CC7A 3SDZA 3JCMP 1RAFB 3I9QA 2GFUA 3EGXA 4OGEA 2E3IA 1BBZA 1N5ZA 4QVCA 2C0OA 4GLKA 2KYBA 3RKWA 2WACA 4A53A 4F7UA 3JCMe 1D0YA 2EYZA 2DEQA 1S72A 3CCUA 3CCJT 1V29B 1UGVA 2JMCA 2RHUA 2QTXA 2PNIA 3M57A 5KCHA 4M78F 1YP5A 1OULA 1X69A 2R58A 1Y0MA 3CCSA 3MHXA 3TSZA 2DYIA 3URGA 2P0KA 2OAUA 1FWZA 2Y4YA 1WLPB 3HHTB 1U5SA 5A2QE 4OMQA 1LOJA 2PVOB 3JCMd 4M77C 1VQMA 1U06A 5GAOl 4OF1A 1O75A 4FCYA 5D7UA 2PUOB 3CCJQ 2EKHA 2R5AA 2J6OA 1K73U 2EYXA 2KI7A 3SWNA 4C0FA 2XKOC 3QYHB 3FB9A 4J7FA 2BZ8A 4MZMA 4DEYA 4ANJA 3ASKA 4C8QE 3MKDA 2FZKB 4A4EA 4B9XA 4OMLA 4BE1A 3PT9A 4Y92A 3EG0A 2JXBA 1M90C 3PE0A 5HK3A 4M7DG 2LC4A 3SB2A 3GIBA 3X20B 1MUZA 3I56A 4J9HA 3JB9I 4PJOB 4C0DC 4X1VA 2DXUA 3CXCA 3OYIA 4N4HA 2JS2A 1QVPA 1TTHB 1MV0B 1Q82C 5LJ3h 4J6XA 3CD6T 1S1NA 3LH0A 2E5QA 5L23A 3OW2P 3MEWA 4AT1B 4LDWA 2ED1A 3CXCP 2CZ7B 4MDWA 3ZFJA 2EGAA 1Q7YC 2RN8A 4N0AC 2ZPFB 3UWNA 3REAB 3JCMW 4OVAA 1GRIA 4QQ6A 1M1GA 3CXCS 1OEBA 2NUPA 1OV3A 5KYWA 3CD6Q 4PNOA 1JRIA 2QA4A 3L2WA 1Q81U 1W1FA 4M75A 1U8RA 2FEIA 5KYUA 3GNFB 2Y4XA 1PG5B 2GCXA 1K76A 4P5NA 4DEXA 2EJGA 5DLQE 1WHHA 4M7DE 2KR3A 1YCSB 1ZSZC 4C92D 3FDRA 4PJMA 1N6AA 1C0MA 1H641 2PZ1A 3CCJA 3T9NA 4M77G 1EX4A 1M4ZA 2B86A 1H3HA 5GANd 1FMWA 1ZSZB 5GAN7 1G3WA 4KRTA 5GMKm 1X2KA 4Z89A 4C0GA 4EMKC 4XU2A 3WXMB 3C95A 2BE9B 2QG9B 3QKJA 5DM7R 2H3JA 2YLCA 4ZTJA 2X51A 2L3SA 1YIJT 1YI2T 1TXQA 1JXMA 4J9GA 4V2SA 2A08A 3G4SA 3RESA 3G71T 3NHNA 2H3EB 3OQ5A 2ZGWA 3M55A 2AK5A 1H3ZA 5CO7A 3CC2Q 2LVMA 3LYIA 4PJOG 5LJ5g 1CKAA 5I2MA 4O6JA 4M7AA 1Q95G 2ZAEA 1RAHB 2BKDN 3HRUA 4KGVB 4RTVA 5AT1B 2P84A 3HKSA 5GAMh 4AG2C 2HMAA 4LD6A 3I55A 2CDTA 1YIJQ 3UT1A 2MCNA 1YI2Q 2BZXA 2FZCB 2CZ1B 4LDUA 2AKLA 4R55A 3G71Q 4D8DA 3JCMc 2RI2A 4OMMA 2QASA 3BDUA 3CC4A 5GAN5 3PFSA 5IAYA 3CBMA 1AWJA 1RACB 3NTIA 3OS1A 3P8BB 1TUCA 2ATCB 1XTDA 2GQIA 4J6YA 1AHJB 4RTTA 1WDXA 2E70A 3M4YA 3I35A 1NZ9A 1QCFA 2ZCFB 1ABOA 3E9FA 4HXJA 4F16A 3TREA 3V7SA 4MDXA 1B34A 2LQ8A 1N8RU 3HTRA 1QWEA 1PRLC 2FHDA 3AT1B 3VS1A 2HCKA 3SD4A 1Q86C 1IB8A 4ZN1A 4AFUC 2AHJB 1EFNA 3FEOA 3LWIA 2VV5A 3PVQA 1OU8A 4J9EA 1J3TA 2KNBB 2RPNA 4PJOE 2CH4W 2E4HA 2O88A 3OYLA 4LUEA 3S3MA 2D9TA 1WZOA 4IUTA 2KE9A 1BCOA 1KC8U 3LLRA 2FPFA 3TQ7P 5CCAA 3VS7A 2J05A 3C0CA 4EDUA 3CCQA 2I2LA 2ZPEB 1M5Q1 2DXBA 4IUUA 5GAOm 2DZ9A 3HFNA 2RB6A 2YRVA 1AZGB 1HSQA 5IXFA 1AT1B 1D1AA 4KBMB 2L89A 4Z8AA 3JB9H 5DLOA 1PCXA 4OB1B 5IXBA 2XK0A 3QUIA 4AG1C 4JZ3A 3OA6A 2JM8A 2X35A 3CC2A 2EQUA 2DIGA 3JCMb 4FU6A 1TOVA 4ESRA 2JUFA 2P4RA 2COWA 2KEAA 2LX7A 4F14A 2YT6A 1YIJA 2EIFA 1VQ5T 1YI2A 1B07A 1OI1A 1O9SA 2DNUA 2X4YA 2LQNA 5GAOp 3TSWA 3CCEQ 3TCJA 2ROTA 1QVGA 2VB6A 3L2UA 1OU9A 4FW2A 3VYHB 2DVJA 3ZBDA 4JRKA 1PKTA 3A98A 5GAOr 4XTWA 1WFWA 2P4TA 5GMKj 1QLYA 1T3LA 1QKWA 1QWFA 2QEXT 3JRZA 1VQPT 5AYFA 4M7DF 2HEQA 2DO3A 1QVFA 1QVGS 5M9OA 2GNCA 2OJ2A 4A4HA 2HD0A 3CQTA 3H0FA 4E2FB 1K9AA 3UATA 9ATCB 2X4WA 1WNLA 5IHIA 1PD0A 1YCYA 1I4K1 2E64A 2ZPBB 4DBRA 1RAEB 4KGZB 2HAXA 4D6WA 3OBWA 1AVZC 2QEXQ 2EQIA 4FYVB 1IRXA 1PM3A 2ZPIB 2JZ2A 3M0UA 1TU0B 1RL2A 4DOWA 3V8LA 5C6SA 5GAMg 4E7ZA 5FU7C 4M75D 2GTJA 4OGCA 3DLLA 4OMPA 3GPLA 2QQ9A 3MP8A 1VQKA 1QVFS 4C92B 2K7AA 1K73C 4XTYA 2FYKA 3EH1A 1UG1A 2K4YA 4AFQC 2GQVA 2QXFA 4MZTA 1D3BB 3X26B 2RM4A 2L8DA 2CZ0B 2O4XA 3NGPA 1SSHA 3RNJA 2X4XA 3OBYA 3HP9A 2HQXA 1AWOA 2VVKA 3RKYA 4ZN3A 1NE8A 1KSWA 3RBBB 4XTVA 3JCMh 1JU5C 2EGEA 2CREA 4R56A 3EG9A 2KROA
chains in the Genus database with same CATH topology
3URGA 5LJ3j 2P0KA 2OAUA 3OS2A 1FWZA 2Y4YA 3HHTB 3QZ9B 2EWNA 2B8AA 2V8KA 3SFMA 5A2QE 2KAFA 3CCEA 3CCLT 4XU1A 4E7LA 1LOJA 2PVOB 3CC2T 1NJIU 1XOVA 2V8IA 4M78B 4HT9A 4JS4A 3JCMd 5GAOn 4M77C 4C8QD 3P8HA 1VQMA 5GAOl 1YJNA 1XNIA 1O75A 4NS5A 4OF1A 2PUOB 3PNWC 4ELYC 4M7AD 2LCLA 2R5AA 3OYEA 2E65A 2JVVA 4X9DA 3G71A 4J5YA 4JRIA 4EMKB 1K73U 1KG1A 2E1HA 5J3BA 4J8OA 1G5VA 3C4SA 3SWNA 2DIQA 4JLIA 1YITT 4C0FA 1HK9A 3QXEB 4QQGA 2PQWA 1N9RA 2XKOC 3WVDB 4E7HA 3CPWS 1GXIE 3QYHB 3FB9A 2EJFA 3H6ZA 3VKIA 3NFCA 4J7FA 4QVDA 4MZMA 1VQ9T 1BIBA 4M75G 4C8QA 3A8HB 3VUZA 5D6YA 1VQOT 3G6ET 3ASKA 2RD1A 4IUQA 4C8QE 4RCBA 1U1SA 4A4EA 2HNIA 3OMGA 3LX7A 4B9XA 4BE1A 4M7AE 1B34B 4PJOF 3JCMf 3QO3A 3PT9A 1M90C 5HK3A 1Q81C 4M7DG 2LC4A 3SB2A 3FC3A 1VQ8A 3GIBA 3GNGA 1I5LA 2VC8A 4KUIA 2A7YA 2RJDA 3X20B 3I56A 3MEUA 1KQ2A 4B9WA 4M77D 5GANj 3JB9I 3V8KA 3OYJA 4PJOB 4C0DC 5LJ3e 4ME7A 2RA2A 4OB3B 3L2QA 2DXUA 3CXCA 2RHYA 3OYIA 4N4HA 2K3XA 4F7UF 1QVPA 2XG8D 1UB4A 3J81E 3JCMV 4EMHA 1N27A 1Q82C 3QBYA 5LJ3h 5A0DA 5I2SA 2EAYA 4J6XA 3CD6T 3LH0A 2EJ9A 4Y91A 3LW5E 4II1A 4E7JA 2E5QA 2GF7A 2DAQA 2O4XB 2KDSA 3MEWA 3S6WA 4HA8A 4LDWA 2IVWA 4F7UB 2E41A 3X28B 4M77E 2CZ7B 1X6OA 3L2VA 3A8GB 4MDWA 3ZFJA 4HCBA 4XTXA 2DTIA 3M9QA 1VQ7T 1NJIC 3MO8A 4C92C 3OYKA 1Q7YC 1KD1C 1WGSA 2RJCA 3L42A 5CQXA 5LJ3d 2KSSA 4N0AC 2ZPFB 2L5QA 3UWNA 3X24B 2LX9A 3JCMW 2DVEA 1ZBXA 3RERA 2QI2A 4OVAA 3PMTA 3QJYA 1Y96A 3OYMA 4QQ6A 5LL6S 4CRIA 1M1GA 3CXCS 2VYTA 3JB9D 3MCAB 4QW2A 2K5FA 3INZA 3MEVA 3QHSA 4LDVA 3OYFA 1W2BA 1VQLA 2LNVA 1OZ2A 1FX7A 1JB0E 4FT4A 5CIUA 4LDYA 1X75C 4N4IA 4PNOA 1JRIA 5GMKi 1VQKT 3OS5A 1KQ1A 2QA4A 2D6FA 2XDDA 1QW1A 3L2WA 1M90U 2RHZA 1Q81U 1HXDA 5C0MA 1PSEA 4M7DD 4M75A 4A4KA 1U8RA 4NOYA 3V7CA 4M75E 5GAMj 5GAN3 2R5MA 4BI4A 2DTHA 2WSFE 1G3TA 5L8RE 3GNFB 3JCMX 2Y4XA 4C8QF 2RK1A 1RI0A 4PL6A 5LJ3f 2GCXA 1ZHIA 1UGQB 4FL6A 5GANh 3JB9J 3FIFA 4WF2A 4P5NA 1JBMA 2LDMA 4M78G 3SWNB 3PIOA 3QJ6A 1VQ4A 1Q82U 2EJGA 5DLQE 4M7DE 5KE3A 4C92D 1P92A 2KK4A 3FDRA 2QQRA 3PMIA 3CCUT 3CBOA 4TVRA 5EG2A 4A4FA 1W2BS 1N6AA 4HCZA 1H641 2MI6A 3OS0A 4OB0B 3Q1JA 3CCJA 3T9NA 4C5IA 3CCVA 2RH2A 4M77G 4RG8A 1M4ZA 3KUFA 3OSVA 3QYGB 5J26A 5GANd 5GAN7 1JJ2A 1G3WA 2R57A 5GMKm 1Q7YU 2RHIA 1KD1U 2XICA 4C0GA 3CCST 4EMKC 4XU2A 3WXMB 3C95A 2VGMA 3QKJA 1W4SA 5DM7R 4QVZA 3CCET 5CKEA 2DTOA 3FLGA 1VQ4T 5HKCA 2H3JA 2YLCA 5J39A 5IT9E 1BIAA 4ZTJA 1YJ9A 2P0QA 1YIJT 2KMTA 1VQNT 2XIDA 1YJWT 4C92E 1YI2T 4V2SA 2LCCA 1VQ5A 1YJNT 2EQKA 3M54A 1OZ3A 5CKHA 3G4SA 2M1HA 2E6ZA 3RESA 3GLXA 2K57A 1LJOA 1PSFA 1SSFA 3G71T 4L59A 2L3RA 3OQ5A 1WJRA 2F5KA 2ZGWA 3M55A 5GAMe 2F5TX 5FU6C 4BACA 2JN0A 2RI3A 2DKGA 4QQDA 5CO7A 4XU0A 1H3ZA 2MWPA 2QDYB 4OB2B 2DZCA 2LVMA 3LYIA 2HQEA 1G3YA 4PJOG 4DQ2A 5LJ5g 5GANf 5I2MA 1G3SA 1K8AU 4O6JA 4M7AA 1WJSA 4C5HA 4EPCA 1JJ2S 3L2RA 3JB9G 2BKDN 3HRUA 4M78D 3HKSA 5GAMh 3EFRA 5FU6B 4LD6A 3I55A 1VQ9A 2V8JA 4PJOC 3CMET 3UT1A 1VQOA 4KULA 3G6EA 5CAIA 5KH6A 2CZ6B 4ATOA 2OTLA 4FT2A 2OTJA 2YHTA 1VUBA 3OW2A 2CZ1B 4LDUA 3UDCA 1Y96B 3DKMA 4R55A 3JSCA 4C0ZA 1VQ8T 2JTMA 4M75F 4GY5A 3OMCA 2RI2A 3JCMc 1LNXA 5GAMd 2QEXA 3I56T 5LJ5j 1TH7A 2LT1A 3BDUA 4O5VA 4MZPA 3CC4A 5GAN5 1VQPA 3PFSA 3BFMA 2XU8A 3CBMA 3L1AA 5IAYA 4M78E 1WQWA 1OYXA 3NTIA 3A8OB 3OS1A 3P8BB 4E7IA 2XHCA 2EFIA 3QZ5B 1Y7XA 2RK2A 3OYNA 5KCOA 2RJEA 2EKOA 4M75B 3R6OA 4C92G 4E7KA 2JTFA 4M77A 3RKXA 3S3NA 1XTDA 4IKFA 2JOYA 1YBYA 4J6YA 3VV0A 3C12A 1AHJB 2DD4A 5CR2A 3META 5D6XA 2IG0A 4Z02A 2E70A 1I8FA 3GF5A 2DJZA 3PIPA 1XQHA 2EQJA 2DK3A 3QDRB 3OYBA 3PTAA 3M4YA 3OYGA 1VIEA 3EAEA 1NZ9A 3OW2S 1U1TA 4PJOD 3HPWA 2ZCFB 4J83A 3E9FA 3CCRT 2FB7A 2E6NA 3TREA 3M56A 3V7SA 2FVUA 4BI8B 5GAMf 3CMAT 4OMFB 1UGRB 4BD3A 4MDXA 2LRQA 1B34A 2LQ8A 4ZGJB 5CK9A 4JRQA 1N8RU 2FHDA 3O8VA 3A8LB 3H8ZA 3SD4A 1Q86C 3OY9A 1R8OB 4ZN1A 3X25B 3AHUA 2GFAA 1BI2A 4MMKA 2LT4A 2VGNA 4HCCA 2AHJB 4HT8A 3FEOA 1M9SA 3LWIA 2VV5A 4KUDK 3SWNC 3JCMQ 2QA4T 3UPUA 1K8AC 2XDBA 2G3RA 4PLIA 5GMKe 4PJOE 2X4JA 3BDLA 3F70A 5CKDA 5FU7B 5LJ5e 3OYLA 3S3MA 3QPHA 2D9TA 4C8QC 1KQSA 2MMPA 1Y71A 4IUTA 3CCMA 1KC8U 4M7AF 3LLRA 3DB3A 3OYCA 4M7DA 5GAN2 3V7RA 2CGHA 1BI1A 5CCAA 5GMKh 2PU9B 3QG1A 4RKUE 4EDUA 2I2LA 3CCQA 2ZPEB 4LD9K 4M7AC 1M5Q1 3HSBA 2QQAA 1S72T 2DXBA 4IUUA 5LJ5h 1KHIA 3RMQA 5D6WA 4JJNK 2M0OA 3ZEHA 4BB7A 4C8QB 5GAOm 2VUBA 4BE0A 2DZ9A 1YHQA 3HFNA 4J6WA 2RB6A 2YRVA 3M5AA 1UEBA 2LTOA 4PKCC 4F7UE 1EIFA 3E19A 2DD5A 4M7AB 4KBMB 4DOVA 4NL3A 2L89A 3GP8A 3JB9H 5DLOA 3CCVT 2XI9A 2RJFA 2CKKA 2HBPA 4OB1B 3WVEB 4XTUA 2XD0A 2XK0A 3QUIA 5LJ5d 4YTLA 3CPWA 1NPRA 3M58A 3OA6A 3CBPA 3CCLA 3M53A 4XTZA 4C92A 2X35A 2ZPHB 3DB4A 3CC2A 2EQUA 1K9MC 3MP1A 1M1KC 2DIGA 4N0AA 2K5LA 4ELZC 5HY6A 3OYAA 4KT0E 1VQMT 1M1FA 3JCMb 4FU6A 2VXFA 4NL2A 1KQSS 5IN1A 5FLXE 1Q86U 3CC7T 1BI3A 5CVIA 4JRPA 4ZTFA 2JUFA 3ER0A 5CKFA 2NLUA 1D3BA 1YJ9T 3CC7A 4M77F 4XAXB 4XK8E 1WQ7A 3E1SA 1YIJA 1VQNA 2ZPGB 4A54A 2PUKB 1KHCA 2EIFA 4L6V5 1YI2A 1OI1A 1YJWA 1VQ5T 3KXTA 5HK0A 5FROA 5GAN8 3G4ST 4IUVA 2A3LA 1O9SA 4FM4B 4XU3A 3VUBA 5A0GA 1BKBA 1YITA 2CS7A 4RMOA 3P8DA 2X4YA 2BUDA 5GAOp 4XQ3A 3OYHA 1N8RC 4M77B 4IUPA 5GMKl 1IREB 1IZ6A 3TCJA 4N4GA 1QVGA 4IURA 5LJ5f 3L2UA 3OYYA 3BW1A 3VYHB 1VQ6A 5KE2A 1WPYA 3GOXA 3BY7A 5GANg 3ZBDA 4JRKA 2KVQG 3HRSA 2RO0A 3JAME 3QIIA 1BYMA 3I55T 4RCCA 4BY6C 3JCMg 5GAOr 5FRMA 4XTWA 4RG2A 1WJQA 4ZGDB 4F7UG 3CMEA 1QP3A 3QSUA 4UC4A 4BUGA 2P4TA 4C5GA 3HFOA 5GMKj 2E12A 2QQBA 3EFSA 2Y90A 2OTLT 2OTJT 2MAMA 2M9UA 1QP2A 4JDSA 4M75C 3TEEA 4M78A 3OB9A 4BY6B 1KC8C 3RIRA 4C5EA 3LGFA 3TU4K 1Y07A 3JB9F 3A5ZB 2DXCA 2QQSA 2E10A 2CYZB 2QEXT 2F69A 4L5GA 3DLMA 4MMLA 4X9CA 3JRZA 3VU3C 3CC4T 1VQPT 2EQMA 3G7ZA 5AYFA 3MEAA 1VIFA 4A4GA 2DO3A 4EMKA 1K9MU 1M1KU 1MGQA 3S3OA 5GAOq 1QVFA 3PGGA 3C94A 5M9OA 1QVGS 4M7DC 4JS5A 2DPPB 2LQKA 4LDXA 3FRNA 3A8MB 3CD6A 4HKEA 4A4HA 2HD0A 3OSSC 3CPFA 2YLBA 2ZZDA 4BI3A 4BDZA 4VUBA 5CQYA 1BI0A 2X4WA 1WNLA 4C0DB 3LGLA 1UGSB 5DY9A 1N9SA 1YCYA 1I4K1 4OP0A 3V8JA 4M7DB 2E64A 2EYQA 2ZPBB 2WSCE 1M8VA 2DXTA 1UGPB 2PVGB 4J7IA 1VQ7A 4EMGA 2HAXA 4D6WA 2FL7A 3OBWA 2PVDB 2O01E 2VXEA 2WSEE 2BIVA 4ZGEB 5I21A 3JCMJ 2KY9A 4X34A 3M59A 3J7AF 4C92F 3N5BB 2ZPIB 3RUXA 5CKBA 2K5IA 3CEYA 2JZ2A 2K3YA 3CCRA 5C6SA 1RL2A 4DOWA 3V8LA 3FJPA 5GAMg 3E9GA 3CMAA 2C06A 5FU7C 4M75D 1VQLT 3VJPA 4E47A 4OGCA 4PLLA 4Q5WA 3DLLA 2D0QB 4PJOA 4C8QG 2MWOA 2QQ9A 2RI5A 3MP8A 4CI0C 2XDPA 3GPLA 1VQKA 1QVFS 5FRNA 3SDZA 4M7DF 4JUVA 3JCMP 4BDYA 4C92B 4BE2A 2JNGA 3NTKA 4FSXA 1K73C 1X01A 4XTYA 5GAN4 4M7AG 2FYKA 3ME9A 2P0PA 3J80E 1VQ6T 3RMSA 2M16A 2K4YA 2GQVA 2QXFA 5GAN6 4MZTA 2GFUA 4OGEA 1D3BB 2K2VA 3NTHA 3VYGA 1DJ7B 3X26B 2RM4A 2L8DA 2CZ0B 2O4XA 5GANe 4QVCA 5LJ3g 3CCMT 3HL8A 4GLKA 3RKWA 2WACA 4A53A 2X4XA 3OBYA 4F7UA 3HP9A 2HQXA 4JLGA 3HRTA 3JCMe 3CCQT 2RHXA 1FXXA 1ZQ1A 3RKYA 2DEQA 1S72A 3CCUA 3CCJT 1MHNA 1V29B 1YHQT 4ZN3A 1NPPA 1NE8A 2RHUA 3MP6A 3M4GA 4DA4A 2QTXA 4XTVA 1I81A 3JCMh 2KQWA 3M57A 5KCHA 4M78F 3LWHA 3OYDA 3KBGA 2R58A 5A0LA 4FIBA 4R56A 2MF2A 4M78C 3CCSA 3L2ZA 3MHXA 4Y28E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHJ B;  2DD4 A;  3QZ9 B;  3HHT B;  2PVO B;  4ZGD B;  2WSF E;  1QP3 A;  5L8R E;  1QP2 A;  2ZCF B;  2PUO B;  1UGQ B;  2DXC A;  1UGR B;  2CYZ B;  4ZGJ B;  3A8L B;  3QXE B;  3X25 B;  3WVD B;  4OB0 B;  1GXI E;  3QYH B;  2AHJ B;  2DPP B;  3QYG B;  3A8M B;  3A8H B;  2ZZD A;  1UGS B;  2ZPB B;  2WSC E;  1UGP B;  2PVG B;  2PVD B;  2O01 E;  2PU9 B;  4RKU E;  2WSE E;  4ZGE B;  2ZPE B;  3X20 B;  2DXB A;  1PSF A;  2ZPI B;  4OB3 B;  2DD5 A;  2D0Q B;  2QDY B;  4OB2 B;  4OB1 B;  3WVE B;  3LW5 E;  2ZPH B;  2CZ6 B;  4KT0 E;  3X28 B;  3VYG A;  2CZ7 B;  1DJ7 B;  3X26 B;  3A8G B;  2CZ0 B;  2CZ1 B;  4XK8 E;  2ZPG B;  2PUK B;  2ZPF B;  4L6V 5;  3X24 B;  4FM4 B;  1V29 B;  3A8O B;  1IRE B;  1JB0 E;  3QZ5 B;  3VYH B;  1PSE A;  4Y28 E; 
#chains in the Genus database with same CATH topology
 5LJ3 j;  3OS2 A;  3QZ9 B;  3CCE A;  1VQ4 A;  1SF9 A;  2KAF A;  4E7L A;  4XU1 A;  1XOV A;  2V8I A;  2L3P A;  1YJN A;  4ELY C;  2EPD A;  4M7A D;  2D8H A;  3OYE A;  4X9D A;  4J5Y A;  1ARK A;  1UE9 A;  2X3W D;  2DIQ A;  1JJ2 P;  4E7H A;  1N9R A;  1GXI E;  2EJF A;  3H6Z A;  1YJ9 Q;  4C8Q A;  3G6E T;  4IUQ A;  4RCB A;  3H41 A;  1WHM A;  2HNI A;  3LX7 A;  1UJ0 A;  3ZL7 C;  5KYX B;  4PJO F;  2AZS A;  3QO3 A;  2K79 A;  3VS5 A;  1GCQ C;  2RF0 A;  1Q81 C;  3FC3 A;  1VQ8 A;  2X9H A;  3GNG A;  1KQ2 A;  3EFO B;  3OYJ A;  4ME7 A;  2LNH B;  2DEU A;  2XMF A;  2K3X A;  3G6E Q;  4HCK A;  1UB4 A;  3J81 E;  3JCM V;  5A0D A;  4FSS A;  1PHT A;  2A28 A;  1PWT A;  2A37 A;  2EAY A;  4Y91 A;  2HL3 A;  4II1 A;  2KDS A;  6AT1 B;  2DL7 A;  1ABQ A;  3S6W A;  4F7U B;  1K9M R;  1X6O A;  2LJ0 A;  2DRM A;  3M9Q A;  1VQ7 T;  1R0C B;  1NJI C;  3OYK A;  1WGS A;  2E5K A;  1F1B B;  3X24 B;  3RER A;  3QJY A;  1FMK A;  1Y96 A;  4CRI A;  1MMG A;  3JB9 D;  2VYT A;  2AIR B;  2I0N A;  3MCA B;  4LDV A;  2YXY A;  4IIO A;  2LNV A;  4JRQ A;  1FX7 A;  1JB0 E;  1N8R R;  2CT4 A;  1X75 C;  4LDY A;  5GMK i;  1QW1 A;  1PSE A;  5GAM j;  1WXB A;  3H0H A;  1GCP A;  2YRD A;  4PL6 A;  5LJ3 f;  1ZHI A;  1UGQ B;  4FL6 A;  5GAN h;  3FIF A;  3PIO A;  3SWN B;  5IHK A;  1KC8 R;  4PFO A;  1W70 A;  2KRS A;  1P92 A;  1ZBJ A;  1D0Z A;  2QQR A;  4OB0 B;  1I0C A;  3CCV A;  2RH2 A;  2QDL A;  3M0R A;  1GL5 A;  4LXC A;  5J26 A;  2R57 A;  2CP5 A;  2VKN A;  1KQS P;  2A36 A;  1PRM C;  1RLP C;  1W4S A;  4F17 A;  4FYY B;  1YJ9 A;  2V1R A;  2P0Q A;  1YJW T;  4C92 E;  2EQK A;  1E6H A;  5CKH A;  2D0N A;  1LJO A;  1NEB A;  1NYF A;  3M0P A;  4J9B A;  3EGU A;  1BCM A;  4L59 A;  8ATC B;  2L3R A;  2F5T X;  2DKG A;  2QGG A;  2QDY B;  4OB2 B;  2DZC A;  1K8A U;  1NLO C;  1G3S A;  4EPC A;  2NUZ A;  5GJV B;  2OX7 A;  2KBT A;  2V8J A;  4PJO C;  1YJW Q;  3G6E A;  5KH6 A;  2L2P A;  5IHN A;  2YHT A;  1VUB A;  2NWM A;  1BU1 A;  5KYN A;  3OW2 A;  2BTT A;  3DKM A;  1VYV A;  2F2W A;  2JTM A;  4GY5 A;  1I1J A;  2DYB A;  5KYW B;  2LT1 A;  4HVU A;  3L1A A;  1HJD A;  2KXC A;  3UF4 A;  4E7I A;  2XHC A;  4JS5 A;  1K1Z A;  1Y7X A;  5KCO A;  2EKO A;  2LJ1 A;  3R6O A;  4M75 B;  1D09 B;  4M77 A;  3RKX A;  4IKF A;  5KYU B;  1YBY A;  4PJL A;  3VV0 A;  1B7T A;  1QMC A;  2NUT A;  2YDL A;  1I8F A;  3IQL A;  3QDR B;  1WHJ A;  2RQV A;  3OW2 S;  1E6G A;  4BI8 B;  5FW9 A;  2FVU A;  5GAM f;  3CMA T;  1U3O A;  4F04 B;  4BD3 A;  2CP3 A;  2G6F X;  3H8Z A;  3OY9 A;  2CH4 A;  4HCC A;  2DIL A;  4PJN A;  2EW3 A;  2O31 A;  1YNZ A;  3UA6 A;  4KUD K;  4PLI A;  5GMK e;  3SEM A;  3BDL A;  3F70 A;  5LJ5 e;  4PJJ A;  2EYY A;  2J6F A;  2MMP A;  4J9C A;  3CMA Q;  2HBW A;  3V7R A;  2PU9 B;  4M7A C;  1KHI A;  4JJN K;  2M0O A;  1W6X A;  1OQK A;  2DA9 A;  2LTO A;  4PKC C;  4CC2 A;  3E2U A;  4F7U E;  2IIM A;  3E19 A;  1X27 A;  2DD5 A;  4M7A B;  4DOV A;  4NL3 A;  1CSK A;  4EIK A;  2CKK A;  3NMZ C;  5LJ5 d;  3CPW A;  1NPR A;  2MK5 A;  3M53 A;  3DB4 A;  3MP1 A;  4N0A A;  3EG1 A;  1ZA2 B;  1GBQ A;  1JEG A;  1TSF A;  3H9N A;  4JRP A;  3ER0 A;  2NLU A;  1TS9 A;  3E1S A;  2DX1 A;  1KHC A;  4L6V 5;  1YJW A;  3KXT A;  5HK0 A;  5FRO A;  3CPW P;  1D0X A;  4XU3 A;  5KYY A;  3QDF A;  2CS7 A;  2SEM A;  1IZ6 A;  4ZNX A;  3BW1 A;  1YFN A;  2KRN A;  5GAN g;  3HRS A;  4E6R A;  3JAM E;  1TUG B;  1KFZ A;  4RCC A;  4BY6 C;  1RUW A;  4ZGD B;  2NYS A;  4R0K A;  4C5G A;  2OTL T;  3TVT A;  2E12 A;  2QQB A;  3EFS A;  4JPB W;  3VS6 A;  2OTJ T;  1AEY A;  2M9U A;  4M78 A;  4BY6 B;  3LGF A;  2L3Q A;  3A5Z B;  2DXC A;  2E10 A;  4X9C A;  4FYX B;  1X6G A;  2CP7 A;  4A4G A;  4EMK A;  1K9M U;  1MGQ A;  3S3O A;  3C94 A;  4LDX A;  3FRN A;  3CD6 A;  4HKE A;  2H8H A;  2IPO B;  3OSS C;  4BDZ A;  1BI0 A;  2OTL Q;  2KRM A;  2KT1 A;  1UGS B;  2OTJ Q;  2EYQ A;  2DXT A;  2WSE E;  2BIV A;  5I21 A;  2KY9 A;  4C92 F;  2FG0 A;  2GTO A;  3CEY A;  2KT8 A;  3CMA A;  2V1Q A;  1VQL T;  4J9I A;  4LN2 A;  1WA7 A;  2VAS A;  2MWO A;  5FRN A;  4BDY A;  2JNG A;  4FSX A;  3VS3 A;  4M7A G;  1NYG A;  3ME9 A;  2P0P A;  1C1A A;  2MYS A;  3RMS A;  2M16 A;  2K2V A;  3NTH A;  2JMA A;  1EZZ B;  1DJ7 B;  3EHR A;  3THK A;  5LJ3 g;  1GFC A;  3CCM T;  3HL8 A;  1VQL Q;  2RHX A;  1FXX A;  1ZUK A;  2CT3 A;  1W2B P;  1MHN A;  1YHQ T;  2HL5 C;  3M4G A;  1SKU B;  2RQU A;  2KQW A;  3LWH A;  1RAG B;  3VS4 A;  3KBG A;  5A0L A;  2DL8 A;  5EC7 A;  1UEC A;  2J7I A;  3L2Z A;  4Y28 E;  4PFZ A;  3ULR B;  2L0A A;  3CCL T;  2EWN A;  2V8K A;  3CCM Q;  4HT9 A;  4JS4 A;  2DBK A;  2Z0W A;  4NS5 A;  3REB B;  1YHQ Q;  2ENM A;  2A0F B;  2QYZ A;  2JVV A;  3G71 A;  4JRI A;  1KG1 A;  1G5V A;  4JLI A;  1YIT T;  4QQG A;  4HVV A;  1TG0 A;  3NFC A;  1V1C A;  3PVL A;  1VQ9 T;  1BIB A;  3CCL Q;  3A8H B;  2LP5 A;  2RD1 A;  4KH0 B;  1VQ5 Q;  1T0H A;  1K8A R;  3OMG A;  4M7A E;  3I5R A;  3JCM f;  1RI9 A;  2HKN A;  1OPK A;  4JJC A;  4AFS C;  2DJQ A;  1I5L A;  1PD1 A;  2VC8 A;  2A7Y A;  1ZX6 A;  3MEU A;  4AFZ C;  4B9W A;  4M77 D;  5GAN j;  1D1C A;  4OB3 B;  1M3B A;  1AWW A;  2RHY A;  1VQ9 Q;  2OI3 A;  1GFD A;  2DET A;  4F7U F;  2XG8 D;  1WHG A;  2YUN A;  4EMH A;  1N27 A;  5I2S A;  1IGU A;  1LVK A;  2LCS A;  2EJ9 A;  1QCN A;  3LW5 E;  2GF7 A;  2O4X B;  4HA8 A;  2IVW A;  3UA7 A;  1LPL A;  3X28 B;  1M1K R;  3L2V A;  1VQP Q;  1M2V A;  2DTI A;  4C92 C;  1BK2 A;  3L42 A;  2RJC A;  2L5Q A;  2LX9 A;  2DVE A;  1ZBX A;  1VOM A;  3PMT A;  1H92 A;  3OYM A;  4QW2 A;  3INZ A;  3MEV A;  1VQL A;  4OMO A;  1IXD A;  1OZ2 A;  4FT4 A;  5CIU A;  4PK4 A;  2EGC A;  3OS5 A;  1KQ1 A;  2MIO A;  1HXD A;  5C0M A;  2D8J A;  1OOT A;  4A4K A;  5GAN 3;  2R5M A;  4RTZ A;  4BI4 A;  2DTH A;  2WSF E;  2GGR A;  5L8R E;  3JCM X;  1RI0 A;  1FYN A;  4E7S A;  4K11 A;  4JZ4 A;  4WF2 A;  1JBM A;  2C0I A;  4CC3 A;  4RTX A;  3BE3 A;  5KE3 A;  1OPL A;  1QCO A;  2KK4 A;  3PMI A;  3CCU T;  4JJD A;  3OS0 A;  3Q1J A;  4C5I A;  3O5Z A;  2F1L A;  2M02 A;  1JJ2 A;  2BE7 D;  2RQR A;  1NG2 A;  1Y57 A;  1T0J A;  2XIC A;  3CCS T;  1KD1 U;  2FZG B;  5CKE A;  3FLG A;  2DMO A;  5HKC A;  5J39 A;  3QWX X;  1BIA A;  2DLP A;  4PFP A;  2KMT A;  2DBM A;  2FO0 A;  1VQ5 A;  3M54 A;  1OZ3 A;  4A63 B;  3EH2 A;  2E6Z A;  3CCU Q;  2K57 A;  4RTW A;  4J9D A;  2JJ9 A;  1ACM B;  2RQT A;  5I22 A;  2RI3 A;  4XU0 A;  1VYU A;  1VQ6 T;  4DQ2 A;  3CCS Q;  5GAN f;  1RAA B;  1WJS A;  4C5H A;  1JJ2 S;  3L2R A;  1YWP A;  4M78 D;  3EFR A;  4OMN A;  1VQ9 A;  1X2Q A;  3VS0 A;  1QQJ A;  4KUL A;  5CAI A;  2CZ6 B;  2AKK A;  1QKX A;  1WXU A;  3I5S A;  1Y96 B;  3JSC A;  4C0Z A;  2JTE A;  2HQH A;  4M75 F;  3OMC A;  2QEX A;  1LNX A;  3I56 T;  1TH7 A;  4MZP A;  1PKS A;  1VQ6 Q;  1VQP A;  1T3S A;  2XU8 A;  1WQW A;  1OYX A;  3EGX B;  3A8O B;  5FWC A;  1YN8 A;  1OX8 A;  3QZ5 B;  4E7K A;  2COZ A;  4C92 G;  2QTV A;  3C12 A;  5D6X A;  1NM7 A;  4Z02 A;  3GF5 A;  2DJZ A;  1XQH A;  1ZA1 B;  2DK3 A;  2EQJ A;  4J9F A;  3SHW A;  3EAE A;  1SPK A;  1U1T A;  3I56 Q;  1IGQ A;  4J83 A;  4HVW A;  2FB7 A;  1R0B G;  3G1J A;  2JT4 A;  1RAD B;  3A8L B;  1SG5 A;  3X25 B;  3AHU A;  3FJ5 A;  1IHW A;  2GFA A;  1BI2 A;  1KJW A;  2LT4 A;  2VGN A;  4HT8 A;  3MJX A;  1VQ7 Q;  3SWN C;  2QA4 T;  3UPU A;  4IIM A;  1GCQ A;  2XDB A;  2X4J A;  3QPH A;  3RDV A;  1KQS A;  4M7A F;  4M7D A;  3DB3 A;  3OYC A;  5GAN 2;  2CGH A;  1BI1 A;  5GMK h;  1M90 R;  4LD9 K;  5LJ5 h;  1ZUU A;  5D6W A;  3ZEH A;  2VWF A;  2QK0 A;  1EIF A;  2QA4 Q;  2J6K A;  3EGD A;  2LZ6 B;  2RJF A;  3R6N A;  3WVE B;  3VRY A;  2XD0 A;  4YTL A;  1Q82 R;  4XTZ A;  1K9M C;  2K5L A;  4ELZ C;  5HY6 A;  4KT0 E;  1M1F A;  1KQS S;  1BI3 A;  2ABL A;  4AMC A;  4XAX B;  4XK8 E;  4LUD A;  1Q7Y R;  3G4S T;  2A3L A;  5A0G A;  1X43 A;  4RMO A;  4M4Z A;  2BUD A;  3OYH A;  1N8R C;  4M77 B;  1M2O A;  4IUP A;  4N4G A;  3M0Q A;  2O9S A;  2NUT B;  3NPF A;  4IUR A;  1VQ6 A;  2K3B A;  1G83 A;  4LNP A;  1MND A;  1TUD A;  2KVQ G;  2RO0 A;  1WYX A;  2ROL A;  3I55 T;  3JCM g;  5FRM A;  4F7U G;  1QP3 A;  1B3Q A;  4UC4 A;  1LCK A;  1SRM A;  3HFO A;  2Y90 A;  1UHC A;  3G4S Q;  2NUP B;  2X3X D;  4M75 C;  1KC8 C;  3RIR A;  4C5E A;  1RAB B;  3TU4 K;  1Y07 A;  3JB9 F;  2M0Y A;  2AZV A;  2F69 A;  2HSE B;  3DLM A;  4L5G A;  3VU3 C;  4WTO B;  3CC4 T;  2EYW A;  3G7Z A;  1M1K U;  2DPP B;  2FPD A;  2LQK A;  3EHQ A;  3A8M B;  3I55 Q;  2ZZD A;  4VUB A;  4RTU A;  4C0D B;  5DY9 A;  3V8J A;  4OP0 A;  2FPE A;  2M51 A;  1M8V A;  1UGP B;  2YUQ A;  1VQ7 A;  4EMG A;  2C0T A;  4ZGE B;  4X34 A;  2KYM A;  3CC4 Q;  1HYO A;  5CKB A;  5GJW B;  3RUX A;  2K3Y A;  3FJP A;  3VJP A;  1SHG A;  2JW4 A;  4PLL A;  4Q5W A;  4PJO A;  1AWX A;  2RI5 A;  4CI0 C;  2XDP A;  4JUV A;  4BE2 A;  3NTK A;  1X01 A;  5GAN 4;  3J80 E;  1ZLM A;  2E3H A;  2DF6 A;  5GAN 6;  2ECZ A;  3VYG A;  5GAN e;  1MMN A;  5KYY B;  4JLG A;  3HRT A;  3CCQ T;  3VRZ A;  1NBE B;  3A1P A;  1ZQ1 A;  1BB9 A;  1NPP A;  3QWY A;  3MP6 A;  4DA4 A;  1I81 A;  3OYD A;  2CP0 A;  4FIB A;  2LQW A;  2MF2 A;  4M78 C;  1G8X A;  2SRC A;  7AT1 B;  2B8A A;  3SFM A;  3CC2 T;  1NJI U;  4M78 B;  5GAO n;  3CCQ Q;  2JM9 A;  1KD1 R;  4C8Q D;  3P8H A;  1XNI A;  2FRW A;  3PNW C;  2LCL A;  1UJY A;  2E65 A;  2RNA A;  2OAW A;  4EMK B;  2E1H A;  5J3B A;  4J8O A;  3C4S A;  2KGT A;  1VA7 A;  1HK9 A;  3QXE B;  2PQW A;  1GBR A;  3WVD B;  1Q86 R;  3CPW S;  3VKI A;  4QVD A;  3D7S B;  4M75 G;  3VUZ A;  5D6Y A;  1VQO T;  2LJ3 A;  3M0S A;  1U1S A;  1ZSZ A;  3EG3 A;  2DE0 X;  1B34 B;  1K0X A;  2DL5 A;  1UFF A;  4KUI A;  2RJD A;  2DFU A;  2F2X A;  2FRY A;  4LE9 A;  1CKB A;  3V8K A;  5LJ3 e;  3L2Q A;  2RA2 A;  5IH2 A;  2YUP A;  1VQO Q;  3QBY A;  1WI7 A;  4QKU A;  4E7J A;  2DRK A;  2DAQ A;  1C6V X;  4CC4 B;  1A0N B;  2CSQ A;  3LH5 A;  2E41 A;  3MPU B;  1KIK A;  4M77 E;  4ORZ A;  3A8G B;  4HCB A;  5HCK A;  4XTX A;  3RR6 A;  3MO8 A;  1KD1 C;  5LJ3 d;  5CQX A;  2KSS A;  5FWB A;  2QI2 A;  1UHF A;  5LL6 S;  3H0I A;  2K5F A;  3QHS A;  5ECA A;  2F2V A;  3OYF A;  1W2B A;  4N4I A;  1VQK T;  4M7D D;  2D6F A;  2XDD A;  1M90 U;  2RHZ A;  1K0S A;  4NOY A;  4GLM A;  3V7C A;  4M75 E;  1H8K A;  1G3T A;  4C8Q F;  2RK1 A;  4B6M A;  3JB9 J;  3U23 A;  2LDM A;  4M78 G;  3QJ6 A;  1Q82 U;  2PTK A;  1VQK Q;  3CBO A;  4TVR A;  5EG2 A;  4A4F A;  1W2B S;  4HCZ A;  2MI6 A;  1M27 C;  4FYW B;  4RG8 A;  3KUF A;  3OSV A;  3QYG B;  2CSI A;  4D8K A;  1E7O A;  1Q7Y U;  2RHI A;  1Z9Q A;  1TWB A;  2VGM A;  4QVZ A;  3CCE T;  1VQ4 T;  2DTO A;  3CC7 T;  5IT9 E;  1VQN T;  2XID A;  1MNE A;  2LCC A;  4JJB A;  1Z9Z A;  1YJN T;  2O2O A;  2RMO A;  2M1H A;  3GLX A;  1PSF A;  1JXO A;  1SSF A;  8AT1 B;  1WJR A;  2F5K A;  5GAM e;  2MOX A;  5FU6 C;  2JN0 A;  4BAC A;  4QQD A;  2MWP A;  4WCI A;  2HQE A;  1G3Y A;  2GBQ A;  2AT1 B;  4KGX B;  3JB9 G;  1VQ4 Q;  3CC7 Q;  5FU6 B;  1K73 R;  4RTY A;  1VQN Q;  3CME T;  1VQO A;  1M2V B;  4ATO A;  1YJN Q;  4QT7 A;  2OTL A;  4FT2 A;  2OTJ A;  2ED0 A;  1YIT Q;  2LMJ A;  1ZSG A;  3UDC A;  2BZY A;  2HSP A;  1VQ8 T;  2QGF B;  5GAM d;  5LJ5 j;  4O5V A;  1QVG P;  2MPX C;  1I07 A;  2JS0 A;  3BFM A;  4M78 E;  1PNJ A;  1M3A A;  2EVR A;  2EFI A;  1PC0 A;  2RK2 A;  4DBF A;  3OYN A;  2RJE A;  3CME Q;  2JTF A;  3S3N A;  1OX9 A;  1YWO A;  2JOY A;  1NLP C;  2DD4 A;  5CR2 A;  1M8M A;  3MET A;  1MMA A;  2IG0 A;  3PIP A;  3OYB A;  3PTA A;  3OYG A;  1VIE A;  1VQ8 Q;  4Z88 A;  4PJO D;  3HPW A;  2CP6 A;  3CCR T;  2E6N A;  3M56 A;  1KK7 A;  4OMF B;  1UGR B;  3EG9 B;  2LRQ A;  4ZGJ B;  1QVF P;  5CK9 A;  3O8V A;  2EBP A;  1WIE A;  2D1X A;  1R8O B;  5I11 A;  4MMK A;  1HD3 A;  1M9S A;  3JCM Q;  1K8A C;  2G3R A;  2RQW A;  1NEG A;  4KH1 B;  5CKD A;  5FU7 B;  3CCR Q;  1IO6 A;  3VS2 A;  4C8Q C;  1Y71 A;  3CCM A;  2K6D A;  4RKU E;  3QG1 A;  1IHV A;  1UUE A;  3HSB A;  2QQA A;  1S72 T;  1Q81 R;  2QAZ A;  3RMQ A;  4DBH A;  1WXT A;  4BB7 A;  4BE0 A;  4C8Q B;  2VUB A;  1YHQ A;  4J6W A;  1SHF A;  3M5A A;  1UEB A;  4RUG A;  1XJW B;  1RLQ C;  1R77 A;  3GP8 A;  2COY A;  1AZE A;  3CCV T;  2XI9 A;  2HBP A;  4XTU A;  2K9G A;  2CUB A;  3M58 A;  3CBP A;  1I5O B;  3CCL A;  2K2M A;  4C92 A;  2ZPH B;  1M1K C;  1ZUY A;  3OYA A;  1VQM T;  2VXF A;  4NL2 A;  2DM1 A;  2V26 A;  1S72 Q;  5IN1 A;  5FLX E;  1Q86 U;  5CVI A;  4ZTF A;  1YJ9 T;  5CKF A;  3M0T A;  1D3B A;  1JO8 A;  3CC7 A;  4M77 F;  1WQ7 A;  4GBQ A;  2W10 A;  1VQN A;  2ZPG B;  4A54 A;  2PUK B;  1NJI R;  5GAN 8;  4IUV A;  4FM4 B;  1K4U S;  2YRC A;  1SEM A;  2KXD A;  3VUB A;  1YIT A;  1BKB A;  3CCV Q;  3P8D A;  3JV3 A;  4XQ3 A;  2W0Z A;  5GMK l;  1IRE B;  2YWW A;  1M30 A;  5LJ5 f;  1WHK A;  3OYY A;  1WHL A;  1WX6 A;  5KE2 A;  1WPY A;  2DL4 A;  3BY7 A;  3GOX A;  1VQM Q;  3QII A;  2HZY A;  1BYM A;  4RG2 A;  1G2B A;  1WJQ A;  2J06 A;  3CME A;  3QSU A;  4BUG A;  1SRL A;  4DBQ A;  2MAM A;  1QP2 A;  4JDS A;  2CUD A;  3TEE A;  4FW1 A;  3OB9 A;  1MMD A;  2QQS A;  2CYZ B;  1AD5 A;  3GBQ A;  1AOJ A;  4MML A;  2HDA A;  2EQM A;  3MEA A;  1VIF A;  2YUO A;  5GAO q;  1UDL A;  1D1B A;  2HKQ B;  3PGG A;  4M7D C;  3CPF A;  2YLB A;  4BI3 A;  5CQY A;  1FMV A;  3LGL A;  4M7D B;  1N9S A;  2WSC E;  2PVG B;  4J7I A;  1VYT A;  2FL7 A;  1RAI B;  2PVD B;  5KYX A;  2O01 E;  2VXE A;  3EG2 A;  1UTI A;  3JCM J;  3M59 A;  3J7A F;  2DER A;  3N5B B;  1M3C A;  2K5I A;  3CCR A;  1X6B A;  2ESW A;  2O9V A;  1V76 A;  3EGD B;  3E9G A;  2C06 A;  1MV3 A;  2CP2 A;  4E47 A;  2DL3 A;  2YSQ A;  1JQQ A;  3KFV A;  2D0Q B;  3EFO A;  4C8Q G;  4CC7 A;  3SDZ A;  3JCM P;  1RAF B;  3I9Q A;  2GFU A;  3EGX A;  4OGE A;  2E3I A;  1BBZ A;  1N5Z A;  4QVC A;  2C0O A;  4GLK A;  2KYB A;  3RKW A;  2WAC A;  4A53 A;  4F7U A;  3JCM e;  1D0Y A;  2EYZ A;  2DEQ A;  1S72 A;  3CCU A;  3CCJ T;  1V29 B;  1UGV A;  2JMC A;  2RHU A;  2QTX A;  2PNI A;  3M57 A;  5KCH A;  4M78 F;  1YP5 A;  1OUL A;  1X69 A;  2R58 A;  1Y0M A;  3CCS A;  3MHX A;  3TSZ A;  2DYI A;  3URG A;  2P0K A;  2OAU A;  1FWZ A;  2Y4Y A;  1WLP B;  3HHT B;  1U5S A;  5A2Q E;  4OMQ A;  1LOJ A;  2PVO B;  3JCM d;  4M77 C;  1VQM A;  1U06 A;  5GAO l;  4OF1 A;  1O75 A;  4FCY A;  5D7U A;  2PUO B;  3CCJ Q;  2EKH A;  2R5A A;  2J6O A;  1K73 U;  2EYX A;  2KI7 A;  3SWN A;  4C0F A;  2XKO C;  3QYH B;  3FB9 A;  4J7F A;  2BZ8 A;  4MZM A;  4DEY A;  4ANJ A;  3ASK A;  4C8Q E;  3MKD A;  2FZK B;  4A4E A;  4B9X A;  4OML A;  4BE1 A;  3PT9 A;  4Y92 A;  3EG0 A;  2JXB A;  1M90 C;  3PE0 A;  5HK3 A;  4M7D G;  2LC4 A;  3SB2 A;  3GIB A;  3X20 B;  1MUZ A;  3I56 A;  4J9H A;  3JB9 I;  4PJO B;  4C0D C;  4X1V A;  2DXU A;  3CXC A;  3OYI A;  4N4H A;  2JS2 A;  1QVP A;  1TTH B;  1MV0 B;  1Q82 C;  5LJ3 h;  4J6X A;  3CD6 T;  1S1N A;  3LH0 A;  2E5Q A;  5L23 A;  3OW2 P;  3MEW A;  4AT1 B;  4LDW A;  2ED1 A;  3CXC P;  2CZ7 B;  4MDW A;  3ZFJ A;  2EGA A;  1Q7Y C;  2RN8 A;  4N0A C;  2ZPF B;  3UWN A;  3REA B;  3JCM W;  4OVA A;  1GRI A;  4QQ6 A;  1M1G A;  3CXC S;  1OEB A;  2NUP A;  1OV3 A;  5KYW A;  3CD6 Q;  4PNO A;  1JRI A;  2QA4 A;  3L2W A;  1Q81 U;  1W1F A;  4M75 A;  1U8R A;  2FEI A;  5KYU A;  3GNF B;  2Y4X A;  1PG5 B;  2GCX A;  1K76 A;  4P5N A;  4DEX A;  2EJG A;  5DLQ E;  1WHH A;  4M7D E;  2KR3 A;  1YCS B;  1ZSZ C;  4C92 D;  3FDR A;  4PJM A;  1N6A A;  1C0M A;  1H64 1;  2PZ1 A;  3CCJ A;  3T9N A;  4M77 G;  1EX4 A;  1M4Z A;  2B86 A;  1H3H A;  5GAN d;  1FMW A;  1ZSZ B;  5GAN 7;  1G3W A;  4KRT A;  5GMK m;  1X2K A;  4Z89 A;  4C0G A;  4EMK C;  4XU2 A;  3WXM B;  3C95 A;  2BE9 B;  2QG9 B;  3QKJ A;  5DM7 R;  2H3J A;  2YLC A;  4ZTJ A;  2X51 A;  2L3S A;  1YIJ T;  1YI2 T;  1TXQ A;  1JXM A;  4J9G A;  4V2S A;  2A08 A;  3G4S A;  3RES A;  3G71 T;  3NHN A;  2H3E B;  3OQ5 A;  2ZGW A;  3M55 A;  2AK5 A;  1H3Z A;  5CO7 A;  3CC2 Q;  2LVM A;  3LYI A;  4PJO G;  5LJ5 g;  1CKA A;  5I2M A;  4O6J A;  4M7A A;  1Q95 G;  2ZAE A;  1RAH B;  2BKD N;  3HRU A;  4KGV B;  4RTV A;  5AT1 B;  2P84 A;  3HKS A;  5GAM h;  4AG2 C;  2HMA A;  4LD6 A;  3I55 A;  2CDT A;  1YIJ Q;  3UT1 A;  2MCN A;  1YI2 Q;  2BZX A;  2FZC B;  2CZ1 B;  4LDU A;  2AKL A;  4R55 A;  3G71 Q;  4D8D A;  3JCM c;  2RI2 A;  4OMM A;  2QAS A;  3BDU A;  3CC4 A;  5GAN 5;  3PFS A;  5IAY A;  3CBM A;  1AWJ A;  1RAC B;  3NTI A;  3OS1 A;  3P8B B;  1TUC A;  2ATC B;  1XTD A;  2GQI A;  4J6Y A;  1AHJ B;  4RTT A;  1WDX A;  2E70 A;  3M4Y A;  3I35 A;  1NZ9 A;  1QCF A;  2ZCF B;  1ABO A;  3E9F A;  4HXJ A;  4F16 A;  3TRE A;  3V7S A;  4MDX A;  1B34 A;  2LQ8 A;  1N8R U;  3HTR A;  1QWE A;  1PRL C;  2FHD A;  3AT1 B;  3VS1 A;  2HCK A;  3SD4 A;  1Q86 C;  1IB8 A;  4ZN1 A;  4AFU C;  2AHJ B;  1EFN A;  3FEO A;  3LWI A;  2VV5 A;  3PVQ A;  1OU8 A;  4J9E A;  1J3T A;  2KNB B;  2RPN A;  4PJO E;  2CH4 W;  2E4H A;  2O88 A;  3OYL A;  4LUE A;  3S3M A;  2D9T A;  1WZO A;  4IUT A;  2KE9 A;  1BCO A;  1KC8 U;  3LLR A;  2FPF A;  3TQ7 P;  5CCA A;  3VS7 A;  2J05 A;  3C0C A;  4EDU A;  3CCQ A;  2I2L A;  2ZPE B;  1M5Q 1;  2DXB A;  4IUU A;  5GAO m;  2DZ9 A;  3HFN A;  2RB6 A;  2YRV A;  1AZG B;  1HSQ A;  5IXF A;  1AT1 B;  1D1A A;  4KBM B;  2L89 A;  4Z8A A;  3JB9 H;  5DLO A;  1PCX A;  4OB1 B;  5IXB A;  2XK0 A;  3QUI A;  4AG1 C;  4JZ3 A;  3OA6 A;  2JM8 A;  2X35 A;  3CC2 A;  2EQU A;  2DIG A;  3JCM b;  4FU6 A;  1TOV A;  4ESR A;  2JUF A;  2P4R A;  2COW A;  2KEA A;  2LX7 A;  4F14 A;  2YT6 A;  1YIJ A;  2EIF A;  1VQ5 T;  1YI2 A;  1B07 A;  1OI1 A;  1O9S A;  2DNU A;  2X4Y A;  2LQN A;  5GAO p;  3TSW A;  3CCE Q;  3TCJ A;  2ROT A;  1QVG A;  2VB6 A;  3L2U A;  1OU9 A;  4FW2 A;  3VYH B;  2DVJ A;  3ZBD A;  4JRK A;  1PKT A;  3A98 A;  5GAO r;  4XTW A;  1WFW A;  2P4T A;  5GMK j;  1QLY A;  1T3L A;  1QKW A;  1QWF A;  2QEX T;  3JRZ A;  1VQP T;  5AYF A;  4M7D F;  2HEQ A;  2DO3 A;  1QVF A;  1QVG S;  5M9O A;  2GNC A;  2OJ2 A;  4A4H A;  2HD0 A;  3CQT A;  3H0F A;  4E2F B;  1K9A A;  3UAT A;  9ATC B;  2X4W A;  1WNL A;  5IHI A;  1PD0 A;  1YCY A;  1I4K 1;  2E64 A;  2ZPB B;  4DBR A;  1RAE B;  4KGZ B;  2HAX A;  4D6W A;  3OBW A;  1AVZ C;  2QEX Q;  2EQI A;  4FYV B;  1IRX A;  1PM3 A;  2ZPI B;  2JZ2 A;  3M0U A;  1TU0 B;  1RL2 A;  4DOW A;  3V8L A;  5C6S A;  5GAM g;  4E7Z A;  5FU7 C;  4M75 D;  2GTJ A;  4OGC A;  3DLL A;  4OMP A;  3GPL A;  2QQ9 A;  3MP8 A;  1VQK A;  1QVF S;  4C92 B;  2K7A A;  1K73 C;  4XTY A;  2FYK A;  3EH1 A;  1UG1 A;  2K4Y A;  4AFQ C;  2GQV A;  2QXF A;  4MZT A;  1D3B B;  3X26 B;  2RM4 A;  2L8D A;  2CZ0 B;  2O4X A;  3NGP A;  1SSH A;  3RNJ A;  2X4X A;  3OBY A;  3HP9 A;  2HQX A;  1AWO A;  2VVK A;  3RKY A;  4ZN3 A;  1NE8 A;  1KSW A;  3RBB B;  4XTV A;  3JCM h;  1JU5 C;  2EGE A;  2CRE A;  4R56 A;  3EG9 A;  2KRO A; 
#chains in the Genus database with same CATH homology
 3URG A;  5LJ3 j;  2P0K A;  2OAU A;  3OS2 A;  1FWZ A;  2Y4Y A;  3HHT B;  3QZ9 B;  2EWN A;  2B8A A;  2V8K A;  3SFM A;  5A2Q E;  2KAF A;  3CCE A;  3CCL T;  4XU1 A;  4E7L A;  1LOJ A;  2PVO B;  3CC2 T;  1NJI U;  1XOV A;  2V8I A;  4M78 B;  4HT9 A;  4JS4 A;  3JCM d;  5GAO n;  4M77 C;  4C8Q D;  3P8H A;  1VQM A;  5GAO l;  1YJN A;  1XNI A;  1O75 A;  4NS5 A;  4OF1 A;  2PUO B;  3PNW C;  4ELY C;  4M7A D;  2LCL A;  2R5A A;  3OYE A;  2E65 A;  2JVV A;  4X9D A;  3G71 A;  4J5Y A;  4JRI A;  4EMK B;  1K73 U;  1KG1 A;  2E1H A;  5J3B A;  4J8O A;  1G5V A;  3C4S A;  3SWN A;  2DIQ A;  4JLI A;  1YIT T;  4C0F A;  1HK9 A;  3QXE B;  4QQG A;  2PQW A;  1N9R A;  2XKO C;  3WVD B;  4E7H A;  3CPW S;  1GXI E;  3QYH B;  3FB9 A;  2EJF A;  3H6Z A;  3VKI A;  3NFC A;  4J7F A;  4QVD A;  4MZM A;  1VQ9 T;  1BIB A;  4M75 G;  4C8Q A;  3A8H B;  3VUZ A;  5D6Y A;  1VQO T;  3G6E T;  3ASK A;  2RD1 A;  4IUQ A;  4C8Q E;  4RCB A;  1U1S A;  4A4E A;  2HNI A;  3OMG A;  3LX7 A;  4B9X A;  4BE1 A;  4M7A E;  1B34 B;  4PJO F;  3JCM f;  3QO3 A;  3PT9 A;  1M90 C;  5HK3 A;  1Q81 C;  4M7D G;  2LC4 A;  3SB2 A;  3FC3 A;  1VQ8 A;  3GIB A;  3GNG A;  1I5L A;  2VC8 A;  4KUI A;  2A7Y A;  2RJD A;  3X20 B;  3I56 A;  3MEU A;  1KQ2 A;  4B9W A;  4M77 D;  5GAN j;  3JB9 I;  3V8K A;  3OYJ A;  4PJO B;  4C0D C;  5LJ3 e;  4ME7 A;  2RA2 A;  4OB3 B;  3L2Q A;  2DXU A;  3CXC A;  2RHY A;  3OYI A;  4N4H A;  2K3X A;  4F7U F;  1QVP A;  2XG8 D;  1UB4 A;  3J81 E;  3JCM V;  4EMH A;  1N27 A;  1Q82 C;  3QBY A;  5LJ3 h;  5A0D A;  5I2S A;  2EAY A;  4J6X A;  3CD6 T;  3LH0 A;  2EJ9 A;  4Y91 A;  3LW5 E;  4II1 A;  4E7J A;  2E5Q A;  2GF7 A;  2DAQ A;  2O4X B;  2KDS A;  3MEW A;  3S6W A;  4HA8 A;  4LDW A;  2IVW A;  4F7U B;  2E41 A;  3X28 B;  4M77 E;  2CZ7 B;  1X6O A;  3L2V A;  3A8G B;  4MDW A;  3ZFJ A;  4HCB A;  4XTX A;  2DTI A;  3M9Q A;  1VQ7 T;  1NJI C;  3MO8 A;  4C92 C;  3OYK A;  1Q7Y C;  1KD1 C;  1WGS A;  2RJC A;  3L42 A;  5CQX A;  5LJ3 d;  2KSS A;  4N0A C;  2ZPF B;  2L5Q A;  3UWN A;  3X24 B;  2LX9 A;  3JCM W;  2DVE A;  1ZBX A;  3RER A;  2QI2 A;  4OVA A;  3PMT A;  3QJY A;  1Y96 A;  3OYM A;  4QQ6 A;  5LL6 S;  4CRI A;  1M1G A;  3CXC S;  2VYT A;  3JB9 D;  3MCA B;  4QW2 A;  2K5F A;  3INZ A;  3MEV A;  3QHS A;  4LDV A;  3OYF A;  1W2B A;  1VQL A;  2LNV A;  1OZ2 A;  1FX7 A;  1JB0 E;  4FT4 A;  5CIU A;  4LDY A;  1X75 C;  4N4I A;  4PNO A;  1JRI A;  5GMK i;  1VQK T;  3OS5 A;  1KQ1 A;  2QA4 A;  2D6F A;  2XDD A;  1QW1 A;  3L2W A;  1M90 U;  2RHZ A;  1Q81 U;  1HXD A;  5C0M A;  1PSE A;  4M7D D;  4M75 A;  4A4K A;  1U8R A;  4NOY A;  3V7C A;  4M75 E;  5GAM j;  5GAN 3;  2R5M A;  4BI4 A;  2DTH A;  2WSF E;  1G3T A;  5L8R E;  3GNF B;  3JCM X;  2Y4X A;  4C8Q F;  2RK1 A;  1RI0 A;  4PL6 A;  5LJ3 f;  2GCX A;  1ZHI A;  1UGQ B;  4FL6 A;  5GAN h;  3JB9 J;  3FIF A;  4WF2 A;  4P5N A;  1JBM A;  2LDM A;  4M78 G;  3SWN B;  3PIO A;  3QJ6 A;  1VQ4 A;  1Q82 U;  2EJG A;  5DLQ E;  4M7D E;  5KE3 A;  4C92 D;  1P92 A;  2KK4 A;  3FDR A;  2QQR A;  3PMI A;  3CCU T;  3CBO A;  4TVR A;  5EG2 A;  4A4F A;  1W2B S;  1N6A A;  4HCZ A;  1H64 1;  2MI6 A;  3OS0 A;  4OB0 B;  3Q1J A;  3CCJ A;  3T9N A;  4C5I A;  3CCV A;  2RH2 A;  4M77 G;  4RG8 A;  1M4Z A;  3KUF A;  3OSV A;  3QYG B;  5J26 A;  5GAN d;  5GAN 7;  1JJ2 A;  1G3W A;  2R57 A;  5GMK m;  1Q7Y U;  2RHI A;  1KD1 U;  2XIC A;  4C0G A;  3CCS T;  4EMK C;  4XU2 A;  3WXM B;  3C95 A;  2VGM A;  3QKJ A;  1W4S A;  5DM7 R;  4QVZ A;  3CCE T;  5CKE A;  2DTO A;  3FLG A;  1VQ4 T;  5HKC A;  2H3J A;  2YLC A;  5J39 A;  5IT9 E;  1BIA A;  4ZTJ A;  1YJ9 A;  2P0Q A;  1YIJ T;  2KMT A;  1VQN T;  2XID A;  1YJW T;  4C92 E;  1YI2 T;  4V2S A;  2LCC A;  1VQ5 A;  1YJN T;  2EQK A;  3M54 A;  1OZ3 A;  5CKH A;  3G4S A;  2M1H A;  2E6Z A;  3RES A;  3GLX A;  2K57 A;  1LJO A;  1PSF A;  1SSF A;  3G71 T;  4L59 A;  2L3R A;  3OQ5 A;  1WJR A;  2F5K A;  2ZGW A;  3M55 A;  5GAM e;  2F5T X;  5FU6 C;  4BAC A;  2JN0 A;  2RI3 A;  2DKG A;  4QQD A;  5CO7 A;  4XU0 A;  1H3Z A;  2MWP A;  2QDY B;  4OB2 B;  2DZC A;  2LVM A;  3LYI A;  2HQE A;  1G3Y A;  4PJO G;  4DQ2 A;  5LJ5 g;  5GAN f;  5I2M A;  1G3S A;  1K8A U;  4O6J A;  4M7A A;  1WJS A;  4C5H A;  4EPC A;  1JJ2 S;  3L2R A;  3JB9 G;  2BKD N;  3HRU A;  4M78 D;  3HKS A;  5GAM h;  3EFR A;  5FU6 B;  4LD6 A;  3I55 A;  1VQ9 A;  2V8J A;  4PJO C;  3CME T;  3UT1 A;  1VQO A;  4KUL A;  3G6E A;  5CAI A;  5KH6 A;  2CZ6 B;  4ATO A;  2OTL A;  4FT2 A;  2OTJ A;  2YHT A;  1VUB A;  3OW2 A;  2CZ1 B;  4LDU A;  3UDC A;  1Y96 B;  3DKM A;  4R55 A;  3JSC A;  4C0Z A;  1VQ8 T;  2JTM A;  4M75 F;  4GY5 A;  3OMC A;  2RI2 A;  3JCM c;  1LNX A;  5GAM d;  2QEX A;  3I56 T;  5LJ5 j;  1TH7 A;  2LT1 A;  3BDU A;  4O5V A;  4MZP A;  3CC4 A;  5GAN 5;  1VQP A;  3PFS A;  3BFM A;  2XU8 A;  3CBM A;  3L1A A;  5IAY A;  4M78 E;  1WQW A;  1OYX A;  3NTI A;  3A8O B;  3OS1 A;  3P8B B;  4E7I A;  2XHC A;  2EFI A;  3QZ5 B;  1Y7X A;  2RK2 A;  3OYN A;  5KCO A;  2RJE A;  2EKO A;  4M75 B;  3R6O A;  4C92 G;  4E7K A;  2JTF A;  4M77 A;  3RKX A;  3S3N A;  1XTD A;  4IKF A;  2JOY A;  1YBY A;  4J6Y A;  3VV0 A;  3C12 A;  1AHJ B;  2DD4 A;  5CR2 A;  3MET A;  5D6X A;  2IG0 A;  4Z02 A;  2E70 A;  1I8F A;  3GF5 A;  2DJZ A;  3PIP A;  1XQH A;  2EQJ A;  2DK3 A;  3QDR B;  3OYB A;  3PTA A;  3M4Y A;  3OYG A;  1VIE A;  3EAE A;  1NZ9 A;  3OW2 S;  1U1T A;  4PJO D;  3HPW A;  2ZCF B;  4J83 A;  3E9F A;  3CCR T;  2FB7 A;  2E6N A;  3TRE A;  3M56 A;  3V7S A;  2FVU A;  4BI8 B;  5GAM f;  3CMA T;  4OMF B;  1UGR B;  4BD3 A;  4MDX A;  2LRQ A;  1B34 A;  2LQ8 A;  4ZGJ B;  5CK9 A;  4JRQ A;  1N8R U;  2FHD A;  3O8V A;  3A8L B;  3H8Z A;  3SD4 A;  1Q86 C;  3OY9 A;  1R8O B;  4ZN1 A;  3X25 B;  3AHU A;  2GFA A;  1BI2 A;  4MMK A;  2LT4 A;  2VGN A;  4HCC A;  2AHJ B;  4HT8 A;  3FEO A;  1M9S A;  3LWI A;  2VV5 A;  4KUD K;  3SWN C;  3JCM Q;  2QA4 T;  3UPU A;  1K8A C;  2XDB A;  2G3R A;  4PLI A;  5GMK e;  4PJO E;  2X4J A;  3BDL A;  3F70 A;  5CKD A;  5FU7 B;  5LJ5 e;  3OYL A;  3S3M A;  3QPH A;  2D9T A;  4C8Q C;  1KQS A;  2MMP A;  1Y71 A;  4IUT A;  3CCM A;  1KC8 U;  4M7A F;  3LLR A;  3DB3 A;  3OYC A;  4M7D A;  5GAN 2;  3V7R A;  2CGH A;  1BI1 A;  5CCA A;  5GMK h;  2PU9 B;  3QG1 A;  4RKU E;  4EDU A;  2I2L A;  3CCQ A;  2ZPE B;  4LD9 K;  4M7A C;  1M5Q 1;  3HSB A;  2QQA A;  1S72 T;  2DXB A;  4IUU A;  5LJ5 h;  1KHI A;  3RMQ A;  5D6W A;  4JJN K;  2M0O A;  3ZEH A;  4BB7 A;  4C8Q B;  5GAO m;  2VUB A;  4BE0 A;  2DZ9 A;  1YHQ A;  3HFN A;  4J6W A;  2RB6 A;  2YRV A;  3M5A A;  1UEB A;  2LTO A;  4PKC C;  4F7U E;  1EIF A;  3E19 A;  2DD5 A;  4M7A B;  4KBM B;  4DOV A;  4NL3 A;  2L89 A;  3GP8 A;  3JB9 H;  5DLO A;  3CCV T;  2XI9 A;  2RJF A;  2CKK A;  2HBP A;  4OB1 B;  3WVE B;  4XTU A;  2XD0 A;  2XK0 A;  3QUI A;  5LJ5 d;  4YTL A;  3CPW A;  1NPR A;  3M58 A;  3OA6 A;  3CBP A;  3CCL A;  3M53 A;  4XTZ A;  4C92 A;  2X35 A;  2ZPH B;  3DB4 A;  3CC2 A;  2EQU A;  1K9M C;  3MP1 A;  1M1K C;  2DIG A;  4N0A A;  2K5L A;  4ELZ C;  5HY6 A;  3OYA A;  4KT0 E;  1VQM T;  1M1F A;  3JCM b;  4FU6 A;  2VXF A;  4NL2 A;  1KQS S;  5IN1 A;  5FLX E;  1Q86 U;  3CC7 T;  1BI3 A;  5CVI A;  4JRP A;  4ZTF A;  2JUF A;  3ER0 A;  5CKF A;  2NLU A;  1D3B A;  1YJ9 T;  3CC7 A;  4M77 F;  4XAX B;  4XK8 E;  1WQ7 A;  3E1S A;  1YIJ A;  1VQN A;  2ZPG B;  4A54 A;  2PUK B;  1KHC A;  2EIF A;  4L6V 5;  1YI2 A;  1OI1 A;  1YJW A;  1VQ5 T;  3KXT A;  5HK0 A;  5FRO A;  5GAN 8;  3G4S T;  4IUV A;  2A3L A;  1O9S A;  4FM4 B;  4XU3 A;  3VUB A;  5A0G A;  1BKB A;  1YIT A;  2CS7 A;  4RMO A;  3P8D A;  2X4Y A;  2BUD A;  5GAO p;  4XQ3 A;  3OYH A;  1N8R C;  4M77 B;  4IUP A;  5GMK l;  1IRE B;  1IZ6 A;  3TCJ A;  4N4G A;  1QVG A;  4IUR A;  5LJ5 f;  3L2U A;  3OYY A;  3BW1 A;  3VYH B;  1VQ6 A;  5KE2 A;  1WPY A;  3GOX A;  3BY7 A;  5GAN g;  3ZBD A;  4JRK A;  2KVQ G;  3HRS A;  2RO0 A;  3JAM E;  3QII A;  1BYM A;  3I55 T;  4RCC A;  4BY6 C;  3JCM g;  5GAO r;  5FRM A;  4XTW A;  4RG2 A;  1WJQ A;  4ZGD B;  4F7U G;  3CME A;  1QP3 A;  3QSU A;  4UC4 A;  4BUG A;  2P4T A;  4C5G A;  3HFO A;  5GMK j;  2E12 A;  2QQB A;  3EFS A;  2Y90 A;  2OTL T;  2OTJ T;  2MAM A;  2M9U A;  1QP2 A;  4JDS A;  4M75 C;  3TEE A;  4M78 A;  3OB9 A;  4BY6 B;  1KC8 C;  3RIR A;  4C5E A;  3LGF A;  3TU4 K;  1Y07 A;  3JB9 F;  3A5Z B;  2DXC A;  2QQS A;  2E10 A;  2CYZ B;  2QEX T;  2F69 A;  4L5G A;  3DLM A;  4MML A;  4X9C A;  3JRZ A;  3VU3 C;  3CC4 T;  1VQP T;  2EQM A;  3G7Z A;  5AYF A;  3MEA A;  1VIF A;  4A4G A;  2DO3 A;  4EMK A;  1K9M U;  1M1K U;  1MGQ A;  3S3O A;  5GAO q;  1QVF A;  3PGG A;  3C94 A;  5M9O A;  1QVG S;  4M7D C;  4JS5 A;  2DPP B;  2LQK A;  4LDX A;  3FRN A;  3A8M B;  3CD6 A;  4HKE A;  4A4H A;  2HD0 A;  3OSS C;  3CPF A;  2YLB A;  2ZZD A;  4BI3 A;  4BDZ A;  4VUB A;  5CQY A;  1BI0 A;  2X4W A;  1WNL A;  4C0D B;  3LGL A;  1UGS B;  5DY9 A;  1N9S A;  1YCY A;  1I4K 1;  4OP0 A;  3V8J A;  4M7D B;  2E64 A;  2EYQ A;  2ZPB B;  2WSC E;  1M8V A;  2DXT A;  1UGP B;  2PVG B;  4J7I A;  1VQ7 A;  4EMG A;  2HAX A;  4D6W A;  2FL7 A;  3OBW A;  2PVD B;  2O01 E;  2VXE A;  2WSE E;  2BIV A;  4ZGE B;  5I21 A;  3JCM J;  2KY9 A;  4X34 A;  3M59 A;  3J7A F;  4C92 F;  3N5B B;  2ZPI B;  3RUX A;  5CKB A;  2K5I A;  3CEY A;  2JZ2 A;  2K3Y A;  3CCR A;  5C6S A;  1RL2 A;  4DOW A;  3V8L A;  3FJP A;  5GAM g;  3E9G A;  3CMA A;  2C06 A;  5FU7 C;  4M75 D;  1VQL T;  3VJP A;  4E47 A;  4OGC A;  4PLL A;  4Q5W A;  3DLL A;  2D0Q B;  4PJO A;  4C8Q G;  2MWO A;  2QQ9 A;  2RI5 A;  3MP8 A;  4CI0 C;  2XDP A;  3GPL A;  1VQK A;  1QVF S;  5FRN A;  3SDZ A;  4M7D F;  4JUV A;  3JCM P;  4BDY A;  4C92 B;  4BE2 A;  2JNG A;  3NTK A;  4FSX A;  1K73 C;  1X01 A;  4XTY A;  5GAN 4;  4M7A G;  2FYK A;  3ME9 A;  2P0P A;  3J80 E;  1VQ6 T;  3RMS A;  2M16 A;  2K4Y A;  2GQV A;  2QXF A;  5GAN 6;  4MZT A;  2GFU A;  4OGE A;  1D3B B;  2K2V A;  3NTH A;  3VYG A;  1DJ7 B;  3X26 B;  2RM4 A;  2L8D A;  2CZ0 B;  2O4X A;  5GAN e;  4QVC A;  5LJ3 g;  3CCM T;  3HL8 A;  4GLK A;  3RKW A;  2WAC A;  4A53 A;  2X4X A;  3OBY A;  4F7U A;  3HP9 A;  2HQX A;  4JLG A;  3HRT A;  3JCM e;  3CCQ T;  2RHX A;  1FXX A;  1ZQ1 A;  3RKY A;  2DEQ A;  1S72 A;  3CCU A;  3CCJ T;  1MHN A;  1V29 B;  1YHQ T;  4ZN3 A;  1NPP A;  1NE8 A;  2RHU A;  3MP6 A;  3M4G A;  4DA4 A;  2QTX A;  4XTV A;  1I81 A;  3JCM h;  2KQW A;  3M57 A;  5KCH A;  4M78 F;  3LWH A;  3OYD A;  3KBG A;  2R58 A;  5A0L A;  4FIB A;  4R56 A;  2MF2 A;  4M78 C;  3CCS A;  3L2Z A;  3MHX A;  4Y28 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...