2DD4A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
b'VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase alpha subunit
molecule tags Hydrolase
source organism Thiobacillus thioparus
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
total genus 26
structure length 118
sequence length 118
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd4A00
1PSFA 4OB0B 2PU9B 4Y28E 1QP3A 2AHJB 1AHJB 2ZPHB 4L6V5 2ZZDA 4ZGDB 4ZGEB 2QDYB 3A8GB 1QP2A 1UGQB 2ZPGB 3A8MB 4OB2B 3VYHB 3QXEB 4ZGJB 2WSEE 3WVDB 2DPPB 3X28B 2CZ7B 4OB1B 2PUKB 1IREB 2PVOB 3X20B 5L8RE 2ZPEB 3QYHB 1UGSB 2WSCE 3LW5E 1GXIE 2DXBA 2CZ1B 3QZ9B 2D0QB 2ZPIB 3WVEB 3X26B 1V29B 4KT0E 3A8HB 4RKUE 2PVGB 2WSFE 2ZPFB 3VYGA 2CYZB 1PSEA 1UGPB 3X25B 2CZ6B 1UGRB 3A8OB 2CZ0B 4FM4B 2O01E 2DD5A 2DD4A 2ZPBB 3HHTB 3QYGB 1JB0E 1DJ7B 4OB3B 4XK8E 2PVDB 2ZCFB 3A8LB 3QZ5B 3X24B 2DXCA 2PUOB
chains in the Genus database with same CATH superfamily
3JB9F 2L89A 5J26A 3MEWA 1MMAA 3N5BB 3VUZA 2ZPGB 1KC8U 3EG9A 2QASA 5KYYA 1YITT 1Q81U 1KHCA 1BIAA 3JV3A 5LJ3g 2AKLA 5LJ3h 1VUBA 2EYZA 4M7DF 3OYNA 2DRKA 4XTUA 2RQTA 2IPOB 5IAYA 3M0QA 4FSXA 2M51A 3CCJQ 1ZUUA 3I5SA 3L2QA 3R6NA 3CCVA 3JCMd 1KIKA 3MEAA 3RESA 2ATCB 3EG9B 1XJWB 4JJNK 1VQOA 1TWBA 4ZGJB 4E7JA 4HXJA 1EZZB 2XICA 5KYWA 4E6RA 5HK3A 1TXQA 3D7SB 3LW5E 4NL3A 2ENMA 4BE1A 3OYKA 4EMKC 2PVGB 3DLMA 1VYVA 1UGPB 2DL5A 3RMSA 5LJ3j 3CCQA 1WHKA 2FO0A 1ZBXA 2XIDA 1YI2A 1WHJA 4O5VA 4PJOF 5IHNA 3CCSQ 2PUKB 2C06A 5D6YA 4XTZA 1I8FA 5LJ5f 2YRDA 1C6VX 2WSFE 1EIFA 4OMLA 4PLIA 2EYWA 2RF0A 2L3SA 5GAOq 2L3QA 2DTOA 2L0AA 1NJIC 2GFUA 1NJIU 5CAIA 3KUFA 5GAMf 3QJYA 1JJ2S 2I2LA 2LT4A 2FHDA 3WVEB 4XTVA 2E6ZA 2DZCA 2E64A 2SRCA 5KE2A 4A63B 2MIOA 4DQ2A 2OTLT 5CR2A 2YRCA 2QQRA 2QK0A 2J6FA 3CEYA 1KC8C 1WQWA 2DF6A 2FPFA 1YJ9A 2YLCA 3F70A 5GJWB 2XDDA 1K8AC 3A5ZB 1IHVA 1YWOA 5LJ3f 2QXFA 1NYFA 2DA9A 1RI0A 2BZYA 2E41A 3H6ZA 1CSKA 1N5ZA 2HL5C 1BB9A 5KYNA 4CI0C 3SFMA 2B86A 1IO6A 1VQNA 5A0DA 5GANg 2PUOB 1YIJQ 4FT4A 2ZPHB 1VQPT 2CP5A 2JJ9A 4ZGDB 1E7OA 5IXBA 5DLOA 4OGCA 2DJQA 3ME9A 2WSEE 1VQ4T 3VRYA 1D0YA 3P8HA 1OPKA 1YCYA 2VYTA 1W70A 4L59A 4K11A 3S3NA 4KRTA 1UEBA 3OYFA 3CPFA 1YJNT 4TVRA 2CSQA 5DM7R 2LZ6B 4PKCC 1I1JA 2HEQA 2W10A 3HRUA 3OYJA 3BDUA 3CXCS 4RTYA 1WLPB 3OY9A 1N27A 2ROTA 1UGRB 1WDXA 2LVMA 2KYMA 3UF4A 3T9NA 2QQAA 4XK8E 3CCSA 5GAOm 1T0JA 4F7UE 1M30A 1KQSP 1VYUA 2DLPA 2AK5A 2E65A 5HCKA 1G2BA 1N8RR 2JMAA 3PE0A 3PT9A 4M75E 3H0IA 3URGA 4DBRA 4LDXA 2MWPA 3H0HA 4CC3A 1FXXA 2CDTA 1HD3A 2D1XA 4LDVA 1OZ3A 3JCMJ 1VQMQ 1KFZA 1UG1A 3X24B 3GIBA 4AFSC 3GBQA 3M53A 1O75A 2F2VA 3TCJA 4J9EA 1SSFA 5LJ5e 3UDCA 1UGQB 4PJMA 4QQGA 3SD4A 3QG1A 3L2VA 1LNXA 5KCOA 2RHUA 1G83A 3CCJA 3RBBB 1KG1A 5CKDA 3CCMQ 5CK9A 3A8OB 4C8QF 4MMLA 3M54A 1R0CB 1ZSZA 1AOJA 1B07A 4HKEA 2F2WA 1C1AA 4M78B 2DYBA 4JJDA 1UGVA 3G71Q 3C0CA 2D9TA 1NJIR 2EYYA 2YT6A 2OI3A 1TTHB 2DVEA 4II1A 3JB9G 1ZA1B 2HMAA 2ZCFB 2LCSA 1B3QA 1YI2Q 3JB9I 5HKCA 1AD5A 5C0MA 1U5SA 4KBMB 2CZ1B 1T3SA 2YUOA 4LD9K 1V29B 1Y96B 2DBKA 4F14A 2E5KA 3AHUA 4LDYA 1UHFA 2GF7A 4N4HA 4C0FA 2DD5A 2RHYA 3L1AA 3J81E 3I35A 2ZAEA 3CCRT 3RKYA 4ZTJA 3EGDB 3RIRA 1K9MC 1VQNT 4Y91A 1OU9A 4JRIA 5LJ5d 3A1PA 5A0GA 2RHIA 5GMKh 2AKKA 3CPWA 2VKNA 2EVRA 5GAN7 3VUBA 1JEGA 5GMKe 3C4SA 2H3JA 1Q82C 4PJOD 2QTVA 2YXYA 2D8JA 5CQYA 3NGPA 3DLLA 2QQBA 4IUPA 5FU7B 5CVIA 3I56A 1YJ9T 1U1SA 1YHQA 4XU3A 5D7UA 2CUBA 2ED0A 3M56A 1QWFA 5I22A 4PFOA 4J5YA 3P8BB 1ZBJA 4JLIA 1K0SA 1VYTA 2CH4A 4E47A 4RG8A 3WXMB 5IHKA 2RQUA 5ECAA 1S72A 1NEBA 1T3LA 2DNUA 2EAYA 2V1RA 2A28A 1VQKQ 2JN0A 5GMKi 3LGLA 2YLBA 4M7DD 3TEEA 4P5NA 2ZGWA 1VQ5T 2JW4A 1KD1U 3E9GA 1GCQA 5LJ5g 1W1FA 2IIMA 3CCQT 4JZ3A 2FZKB 4RTTA 4J6WA 2J6KA 4ME7A 1LJOA 4JDSA 2CZ7B 5KYXA 3GPLA 2O31A 4M75D 2WACA 1TSFA 2EYXA 3CCJT 4JUVA 2V8JA 3JCMW 1U1TA 2XMFA 4DOWA 2EIFA 4C0ZA 4DEYA 3EG3A 1RAHB 3I55T 4ANJA 4M7AF 4MZTA 4M75G 4M78F 4C5IA 5GMKm 2ABLA 1KD1R 1YJWT 5CKFA 4NL2A 2FL7A 2K79A 4OP0A 4FYVB 3OW2A 1X01A 4A4FA 4DOVA 3BFMA 2O4XB 1Q86C 1H3HA 3GP8A 3UATA 3H9NA 2CP6A 3OB9A 1OPLA 4OB0B 5LJ3e 2LJ0A 1UJYA 4ELZC 2X9HA 2AHJB 4Q5WA 4BE0A 1AEYA 2QDYB 2EJGA 2JT4A 1W2BA 3L2UA 3CD6Q 1IREB 3CCUT 1TH7A 4F7UB 1HK9A 2SEMA 4HVWA 4XTXA 1RABB 1K76A 2CKKA 2LP5A 1BBZA 3OYCA 1AT1B 3OYHA 3CC4Q 3JCMQ 2A7YA 1WNLA 1AVZC 1JB0E 1VQ4Q 3JB9H 5GAN4 2JS2A 5HY6A 2Y4YA 3CC2Q 1ZSGA 1UE9A 1OV3A 2YWWA 2YDLA 1WX6A 1AWXA 2MCNA 2LQKA 4C92D 3UPUA 1X27A 3RKXA 4PJOC 1VQPA 3C95A 5GAMe 1X43A 2QYZA 1PG5B 3QXEB 2RHZA 3OQ5A 3E19A 4M7DA 5KYYB 3X26B 1PNJA 4KT0E 1M3BA 4KH1B 2RNAA 1YP5A 2X3XD 1VQ8A 4M77E 3M0PA 4C5GA 4RG2A 2HQEA 1VQ9Q 2CT4A 5FW9A 1IGUA 4AFZC 2DXUA 4C0DB 2DIQA 4F04B 3CC2T 5KCHA 1Y57A 3SHWA 4C8QE 1YNZA 3OYLA 3CCEA 3KBGA 1NLOC 2GFAA 3QZ9B 4J9IA 1JU5C 3CMET 1HXDA 4IUUA 1QCNA 2QI2A 3REAB 3C94A 4EMKA 4IIOA 2COZA 4LE9A 3TSZA 4Z89A 1NG2A 2EPDA 2F69A 3JCMV 1N8RC 1W2BS 3QYHB 1KQ1A 3L2RA 1KSWA 3TSWA 5IHIA 3OBYA 1FMKA 1QW1A 4M75F 4M78G 3PTAA 1PD1A 2EGAA 2RMOA 1M3AA 4J9GA 1VQLQ 2JTMA 1XOVA 4BY6C 3L2WA 4M77A 4NOYA 1IZ6A 3I9QA 3META 1OYXA 2HSPA 4J9CA 4OF1A 4C5EA 2BZXA 1UGSB 1VQ6A 2XD0A 1M2OA 2HNIA 2IVWA 4QQDA 4RTUA 2L3PA 4JS5A 2QGFB 4MDXA 2PZ1A 1FYNA 4RCBA 4J8OA 4XTYA 1EX4A 1TOVA 3LH0A 2KMTA 2DEUA 2K6DA 3UT1A 1Q7YU 1PD0A 2RI5A 1H641 4JRPA 4HVVA 1VQ8T 3KXTA 4PJOA 4BACA 4BDZA 8AT1B 1S72T 1UB4A 2W0ZA 1VQLT 4C92E 2YUNA 2KT8A 4ZN1A 5CCAA 1SHFA 1X69A 3JCMP 3EG2A 1KQSS 2VGMA 2DL8A 5GJVB 1VQ5A 4F7UF 1VQ9T 3CBPA 3G4SA 1KD1C 1YHQT 3RMQA 3A8HB 1QVFP 4X9DA 3JB9J 3NMZC 1JJ2P 3JCMf 2COYA 3CCEQ 4OMOA 5CIUA 2RJDA 2RHXA 1AZEA 1WYXA 1GBQA 2JOYA 4LDWA 3GLXA 4WF2A 2CUDA 3QIIA 2JTEA 3M57A 5GANd 1RAIB 1VQ8Q 2A37A 3CC4T 5EC7A 1UDLA 5GMKj 2X51A 4EIKA 5CKEA 2RD1A 3CPWS 2KRSA 3CXCP 4FCYA 3EH1A 4C92G 1RADB 3NHNA 2OAUA 3BW1A 1Q86R 5GAOl 4HT8A 5LL6S 3EG0A 2V8IA 3VS0A 3CC2A 4M7AE 3M4GA 1VQLA 2HL3A 3EFOB 2OTJT 5GANj 2E70A 1CKAA 1PC0A 1K73R 4M7AG 1WHLA 2MF2A 3M0SA 4M77C 1LPLA 4FIBA 2O4XA 1OULA 3TQ7P 2CS7A 2VV5A 3GNGA 2H8HA 3Q1JA 5HK0A 1I0CA 2LNVA 2EGCA 2AIRB 1QQJA 4J9HA 2EGEA 2DPPB 4C8QC 5GAN6 5GANe 4M75B 1N9RA 4C8QD 2KEAA 3MP6A 1FMWA 3MO8A 5GAMd 4BI3A 4OMQA 3M9QA 3CCRQ 3IQLA 2KYBA 4LN2A 4BB7A 2CH4W 2E3HA 2Z0WA 1SPKA 2K2MA 2EJ9A 2K2VA 4L6V5 4X34A 2DILA 5FWBA 3UA6A 1R0BG 1VIEA 3ZL7C 2MK5A 1YI2T 2KROA 3LGFA 2BIVA 3ASKA 3M0RA 1VQKT 4KULA 2PQWA 3CCST 2KVQG 4FW2A 2EQKA 4F7UG 3QJ6A 3QDRB 2ESWA 4N0AC 1RI9A 4C92C 4M7DC 2PVOB 3UWNA 3HTRA 3VRZA 4J9DA 1MMNA 2NLUA 2VWFA 3QUIA 1K0XA 5LJ3d 1G8XA 3J80E 4M7DG 2CZ0B 3RNJA 1Q95G 2KQWA 3NTKA 3PIPA 4MZPA 2D6FA 2DL7A 3CD6A 2CT3A 2NUTB 1BI0A 2QG9B 1M90C 3QHSA 3JCMc 1PCXA 4UC4A 3SWNC 3X20B 3G7ZA 1YJWQ 4A4GA 3VS6A 2CP7A 4QKUA 2JUFA 4QW2A 1YITQ 4VUBA 2DZ9A 1GCQC 1D1AA 1K9MU 5J3BA 3FEOA 2EYQA 3OBWA 1I5LA 1KK7A 1LCKA 2P0QA 2CP2A 9ATCB 1X2KA 2RQVA 2E5QA 2GCXA 3OYEA 2L5QA 4C8QA 3MJXA 1QMCA 2E12A 2K5IA 1QKXA 5DY9A 1SRMA 1ZA2B 3VS1A 1WHMA 4QQ6A 2V8KA 3HRTA 4BDYA 1OU8A 1K9AA 1Q86U 3J7AF 1NM7A 1TG0A 3G4ST 1RACB 3QDFA 4IURA 4OMNA 2X4WA 1WGSA 1QLYA 3JAME 3H0FA 2Y90A 2KI7A 2RPNA 4ORZA 1M5Q1 2O2OA 1WPYA 2FZCB 1D09B 3X28B 3MP8A 2OX7A 1WJSA 3MKDA 5KYUB 2KR3A 1RAEB 2AZVA 2V1QA 4J7FA 3HHTB 2XG8D 2RK1A 2D0NA 5I11A 3EFOA 1RLPC 5GAN8 1Y71A 2QEXT 3OYAA 2RN8A 2KBTA 2X4JA 1Q81R 5I21A 1UHCA 2FG0A 2IG0A 5GAMg 2CZ6B 4QVDA 4EMKB 2G3RA 2HAXA 3G71A 4EPCA 1TUGB 4YTLA 2C0OA 5AYFA 1ZUKA 2KXCA 3V7RA 3CMEA 2RJFA 4FU6A 4GY5A 4F17A 2MMPA 2WSCE 3CPWP 1MHNA 2F5KA 5KYWB 3OW2S 2CSIA 5C6SA 3BY7A 3QZ5B 1YWPA 2XDBA 1QP3A 2KXDA 2ZZDA 4PL6A 3CCMT 2JTFA 4JS4A 4B9WA 2BE9B 2OJ2A 2JXBA 4JRKA 1VQMA 5A2QE 2J7IA 2LRQA 1BU1A 1X6BA 2FYKA 2LCCA 4ELYC 2RM4A 1BIBA 1IXDA 4O6JA 1A0NB 2L3RA 2LJ3A 1NPRA 4GLMA 1H92A 1AHJB 1P92A 4HCZA 5FWCA 4DBHA 1T0HA 2RJCA 4J6XA 4M7AA 1VA7A 4C92B 1JO8A 1SSHA 4D6WA 3I56T 4FYWB 2VB6A 4A54A 3FC3A 2MAMA 2DAQA 2FRYA 2RO0A 2L8DA 2LQ8A 2QDLA 5A0LA 1I5OB 1QCOA 5FLXE 3OSVA 1G3WA 3PMIA 1GRIA 5M9OA 2C0TA 2DEQA 2R58A 3CCMA 2A0FB 5CO7A 3HPWA 2GQVA 3MCAB 1NBEB 1NYGA 2EJFA 1D0ZA 3NTHA 2X3WD 1WFWA 2DM1A 2DXTA 3JCMe 1K73C 2KDSA 4C8QG 4AMCA 1PSFA 3CXCA 2QGGA 3OS5A 4OMMA 4EDUA 4M78D 1YIJA 2BUDA 4M75C 2ZPEB 3CCLA 4DBQA 2JVVA 3OMCA 2RQWA 2COWA 1PKSA 4FYXB 4KGXB 4OB3B 3L42A 5L23A 1Q7YR 4HT9A 2GBQA 3O8VA 4V2SA 1YJ9Q 3TVTA 2QTXA 2NUTA 2YUPA 4AG2C 3LYIA 1QVGP 1UUEA 2YUQA 4N4GA 1Q82R 1PRLC 2NUPB 3QPHA 5FU6C 5FRNA 2P84A 3GOXA 4JJCA 3MP1A 1QWEA 1SKUB 1IRXA 1K73U 1NPPA 3E1SA 1GBRA 3BE3A 2K57A 2EKOA 3HFNA 3VS4A 1U06A 1BCMA 3EHQA 4KUDK 1QVGA 1FMVA 2JM8A 4BI4A 1G3TA 5J39A 1G5VA 4C5HA 3LX7A 1WJQA 2LMJA 4MDWA 1D1CA 3MEUA 1NE8A 3QO3A 1K4US 2CP0A 2DTIA 3CC7T 1F1BB 1VQNQ 1YFNA 2XK0A 1ZLMA 5KYUA 5CKBA 4PFPA 3V8JA 2F5TX 3VKIA 5GAN2 2CP3A 3OW2P 1JJ2A 1ARKA 3SWNB 1MUZA 4GBQA 5FROA 3CCLQ 4R56A 4LNPA 4ZNXA 2HBWA 1BCOA 2ED1A 3FRNA 3MPUB 3OYDA 2O88A 1IGQA 1YN8A 2DX1A 4M7AC 1YBYA 2GTJA 1VQ6T 3BDLA 2E10A 1V1CA 5GANf 1AWWA 1FWZA 4PJNA 4J7IA 4KH0B 2J05A 2XU8A 2J06A 3EFRA 3CMEQ 3M5AA 4E7IA 1IB8A 4DA4A 2M0YA 1WXTA 4M7AB 2J6OA 3TREA 4M4ZA 1AZGB 1KQ2A 1S1NA 3G6EA 2HQHA 4RKUE 1GCPA 2D8HA 2DKGA 4JLGA 3VS3A 5GMKl 3EGXB 4E2FB 1I4K1 1SHGA 3PIOA 3OYIA 2DL3A 1WXBA 2EBPA 2KT1A 3RR6A 3LLRA 4HA8A 4AFUC 1ZQ1A 2E4HA 3EHRA 3CCQQ 3JSCA 2VGNA 2FEIA 4PJLA 1OQKA 3HKSA 2K5LA 4FL6A 1X75C 3JCMb 2HQXA 3JRZA 5DLQE 4A4EA 5KE3A 4E7HA 1HJDA 3INZA 1VQOQ 5GAN3 7AT1B 2XHCA 2JS0A 4M77B 5IH2A 1MV3A 4M78E 1KC8R 3CCVQ 2GGRA 2VC8A 1K8AR 2DE0X 4FT2A 4RTXA 3M4YA 1W2BP 3GNFB 4RTZA 1D0XA 3A8LB 2KRNA 1WI7A 4PJOG 4PK4A 2EFIA 2KRMA 4WCIA 1CKBA 1NZ9A 1JQQA 1R77A 4M7AD 3OS0A 2HBPA 4HVUA 4M7DB 2OTJA 1I07A 1YITA 3M59A 2A08A 1HYOA 3HRSA 4E7ZA 3LWHA 3CBMA 3HFOA 1AWJA 4DBFA 1H8KA 2LT1A 1TUCA 3SB2A 3OA6A 2LC4A 1YJWA 8ATCB 2HKNA 3AT1B 2MOXA 4Y28E 3ZBDA 1KJWA 3RERA 4IUVA 2BTTA 1JRIA 2EQIA 1KHIA 4C92A 5EG2A 4R0KA 1WHGA 1ACMB 1BI3A 2DVJA 2DXBA 4ATOA 2Y4XA 2QQ9A 2RI2A 2JZ2A 1OX9A 5I2MA 1VQ7A 1ZSZB 4M7DE 3EAEA 1SRLA 3CMAT 4QVZA 1G3SA 1DJ7B 3TU4K 2CREA 1OZ2A 2DXCA 3QKJA 4D8KA 4AG1C 1XQHA 1GFDA 3EGDA 1K1ZA 2QA4Q 3A8GB 3PVLA 4C92F 1YJNA 1NEGA 3E2UA 3CCVT 1U8RA 1MV0B 2LX9A 4CC7A 2R57A 2M02A 2P4TA 1MMDA 2RJEA 2RQRA 1M2VA 4MMKA 3X25B 4XTWA 2PVDB 3SEMA 3VS2A 3S3MA 1M1FA 2K4YA 1M27C 4KGZB 3JCMg 2PTKA 3UA7A 1M8VA 2EQUA 3OYMA 2A3LA 3M0TA 2DK3A 1UFFA 3C12A 2HD0A 4RTVA 6AT1B 4JZ4A 3RKWA 3FJPA 2H3EB 4AT1B 3U23A 2OTLA 2VXFA 3CCET 3FLGA 1M1KU 3LH5A 3ZEHA 2JNGA 1RLQC 5CQXA 2VVKA 2M9UA 1Y0MA 4IUQA 1W4SA 3JCMh 3JCMX 2E1HA 1X2QA 1QVFA 1SG5A 1WA7A 3SWNA 1RAGB 4NS5A 1TS9A 5D6XA 5D6WA 3VJPA 3QYGB 4JJBA 1D3BB 4RCCA 3EH2A 4A4HA 1JXOA 2RA2A 1BKBA 1SEMA 3JB9D 1Z9QA 3I55A 4Z88A 1M1KR 1MNDA 4OGEA 4XAXB 4N0AA 3ZFJA 3H41A 3MEVA 1VIFA 2AT1B 2O01E 3H8ZA 4E7KA 2VASA 3ER0A 3G6ET 3EG1A 4LD6A 3CCLT 1RL2A 4ZTFA 2EQJA 1WHHA 3PMTA 2BE7D 2HCKA 3NPFA 3NTIA 2HZYA 3CCRA 3OYGA 4EMHA 2DETA 1PWTA 5GAOr 2NUPA 1UTIA 1B34B 4XU1A 1GFCA 2DTHA 1N8RU 2KAFA 1QVGS 1WJRA 2XI9A 1VQ5Q 3V8KA 3M0UA 2LCLA 1UECA 4ZN3A 2HSEB 3PFSA 1FX7A 4Z02A 1QP2A 3WVDB 1QCFA 4OMFB 2PNIA 1OEBA 3THKA 1M2VB 2K7AA 4XQ3A 1ZSZC 4HCKA 1QKWA 2ZPBB 3FB9A 2BZ8A 1LVKA 3VV0A 5KH6A 4JRQA 2LQNA 3OSSC 3VS7A 3CBOA 4QVCA 3DKMA 2M1HA 3CCUA 2LX7A 3V7SA 3S3OA 1K8AU 1ZUYA 5L8RE 3ULRB 2L2PA 4C8QB 1M9SA 2AZSA 2LTOA 3REBB 3OYBA 3HL8A 1OOTA 3VYGA 2DRMA 4GLKA 1VQ6Q 2DD4A 1KQSA 3CCUQ 2F1LA 4OMPA 4EMGA 3P8DA 4RMOA 2K3XA 1UJ0A 2R5AA 3E9FA 5AT1B 4OB2B 1ABQA 2K3BA 3CMAA 2QEXQ 4C0DC 4PJJA 1O9SA 2E3IA 1M4ZA 3G4SQ 4M77G 2G6FX 1B34A 2LQWA 2DL4A 3NFCA 2RB6A 4D8DA 2KGTA 1VQ7T 4R55A 4E7SA 2MYSA 4MZMA 3L2ZA 2DERA 1LOJA 2QA4T 4PJOB 2HDAA 2M16A 2NWMA 2EW3A 4B6MA 1PHTA 2P4RA 2ZPFB 2CYZB 5LJ5j 4L5GA 2QEXA 4J6YA 4RUGA 4PNOA 5GAOn 3CMAQ 2ROLA 2HKQB 4CRIA 4BD3A 3M55A 3HSBA 1E6GA 4Y92A 1BI1A 2P0PA 3MHXA 1WZOA 4RTWA 2DJZA 2RK2A 5IN1A 3S6WA 5CKHA 4C0GA 1D3BA 4KGVB 3CC7Q 1ZHIA 2NYSA 3GF5A 3I55Q 1NLPC 2KK4A 2R5MA 4PJOE 2A36A 5LJ5h 2FB7A 4ZGEB 2MI6A 2KSSA 5IT9E 3A8MB 3VYHB 1Q81C 4XU2A 3G71T 4M75A 1X6OA 4A53A 1EFNA 2C0IA 3PGGA 1GXIE 4ESRA 2ECZA 3I5RA 2I0NA 1M1KC 3HP9A 2KNBB 2K9GA 1VOMA 3FDRA 3VU3C 2VXEA 2FRWA 2MWOA 2RI3A 2BKDN 1WXUA 1WIEA 1BI2A 3QWYA 5GAOp 1IHWA 2DBMA 2RH2A 2K5FA 3FJ5A 3QBYA 1B7TA 2OAWA 2B8AA 3OMGA 4OVAA 1W6XA 3KFVA 4JPBW 1VQOT 1PSEA 1ZX6A 4KUIA 1BK2A 2F2XA 1Q7YC 4BY6B 3CQTA 5GAN5 1VQMT 4F16A 1YCSB 4LUEA 2KY9A 2PU9B 2DO3A 2LJ1A 1PM3A 4LXCA 1XNIA 4LDUA 3OYYA 4Z8AA 1VQ9A 2JM9A 4M78A 2XKOC 4X9CA 3O5ZA 4XU0A 4B9XA 3M58A 1BYMA 4FYYB 3EGUA 3DB4A 3RUXA 2DFUA 2JMCA 4WTOB 2X4XA 1YJNQ 1V76A 1M8MA 1QVPA 3V8LA 1VQPQ 2XDPA 5FU7C 1ABOA 3CC7A 3SDZA 4CC2A 4J9BA 2MPXC 1Y07A 2LNHB 1VQ4A 2GTOA 3QSUA 3CC4A 3DB3A 1VQ7Q 4FSSA 2ZPIB 5KYXB 2O9VA 5FU6B 1C0MA 1M3CA 5IXFA 1JBMA 1RAAB 1HSQA 2O9SA 3QWXX 2YSQA 2YHTA 5GANh 2GQIA 4PLLA 2X35A 4A4KA 1Z9ZA 4J83A 4N4IA 1M1GA 4J9FA 2DYIA 2OTLQ 4LUDA 1M90R 2D0QB 2FPDA 1YIJT 2QAZA 2V26A 2K3YA 4FM4B 2VUBA 2OTJQ 3EGXA 4DEXA 1SF9A 3OS1A 1TU0B 2EQMA 2FZGB 4IUTA 2X4YA 1MNEA 3A98A 2YRVA 1PKTA 1Q82U 4F7UA 3LWIA 1Y96A 1OI1A 5I2SA 4HCBA 1E6HA 3OS2A 5GAMj 4IIMA 1Y7XA 1M90U 2M0OA 3PVQA 4M77D 2P0KA 2EKHA 4E7LA 1J3TA 2QA4A 1XTDA 1JXMA 1MGQA 4AFQC 1D1BA 5GAMh 4PFZA 3G1JA 4QT7A 2EWNA 1N6AA 4OB1B 2FVUA 1OX8A 1H3ZA 4M78C 1RUWA 2QQSA 1I81A 1RAFB 2DMOA 1GL5A 4X1VA 1VQKA 1K9MR 5FRMA 4BI8B 3RDVA 4FW1A 2KE9A 3R6OA 3V7CA 4BE2A 1S72Q 2DIGA 2CGHA 1R8OB 1WQ7A 3VS5A 4IKFA 2GNCA 2NUZA 1MMGA 2LDMA 1X6GA 3EFSA 2E6NA 4CC4B 4M77F 4HCCA 3FIFA 1YHQQ 2FPEA 1PRMC 1QVFS 3I56Q 1G3YA 1AWOA 3G6EQ 1U3OA 3CD6T 3PNWC 4BUGA 1TUDA 1N9SA
chains in the Genus database with same CATH topology
4YTLA 2L89A 4OB0B 3JB9F 5J26A 3MEWA 3ZEHA 4ELZC 2JNGA 5LJ3e 2AHJB 4Q5WA 5AYFA 4BE0A 5CQXA 2QDYB 3N5BB 2M9UA 3VUZA 2EJGA 2ZPGB 1KC8U 1W2BA 3V7RA 4IUQA 1W4SA 2RJFA 3JCMh 3JCMX 3L2UA 3CMEA 1YITT 2E1HA 1Q81U 1KHCA 1IREB 4FU6A 4GY5A 3CCUT 1BIAA 1QVFA 2MMPA 2WSCE 3SWNA 1TH7A 5LJ3g 5LJ3h 1MHNA 1VUBA 2F5KA 4F7UB 1HK9A 4M7DF 3OYNA 3OW2S 4XTUA 4NS5A 5IAYA 4FSXA 4XTXA 2CKKA 5D6XA 3L2QA 5D6WA 3VJPA 3OYCA 5C6SA 3OYHA 3CCVA 3JCMQ 3QYGB 2A7YA 1D3BB 1WNLA 4RCCA 3JCMd 1JB0E 3JB9H 3BY7A 3QZ5B 5GAN4 5HY6A 2Y4YA 3MEAA 3RESA 4A4HA 2XDBA 3UPUA 4C92D 2LQKA 1QP3A 4PJOC 3RKXA 2RA2A 2ZZDA 1BKBA 4PL6A 3CCMT 1VQPA 3C95A 5GAMe 4JJNK 2JTFA 3JB9D 1VQOA 3QXEB 4ZGJB 4E7JA 3I55A 4B9WA 2XICA 2RHZA 4JS4A 5HK3A 3OQ5A 3E19A 3LW5E 4NL3A 4M7DA 4JRKA 1VQMA 5A2QE 4OGEA 4XAXB 3X26B 3OYKA 4KT0E 4BE1A 2LRQA 4N0AA 4EMKC 2PVGB 2FYKA 2LCCA 3DLMA 1UGPB 3ZFJA 1VQ8A 4M7AE 3MEVA 1VIFA 4M77E 2O01E 4ELYC 2RM4A 1BIBA 4C5GA 3RMSA 3H8ZA 4RG2A 2HQEA 5LJ3j 4E7KA 4O6JA 3ER0A 3G6ET 2L3RA 3CCQA 1NPRA 4LD6A 3CCLT 2DXUA 1RL2A 4ZTFA 2EQJA 1AHJB 1P92A 1ZBXA 2DIQA 2XIDA 3PMTA 4HCZA 4C0DB 5KCHA 1YI2A 3CC2T 4O5VA 4PJOF 2RJCA 3NTIA 4J6XA 2PUKB 4M7AA 4C8QE 3OYLA 3CCEA 3CCRA 2C06A 5D6YA 4EMHA 3KBGA 4C92B 3OYGA 4XTZA 2GFAA 1I8FA 3QZ9B 5GAOr 4D6WA 3I56T 5LJ5f 2WSFE 1B34B 1EIFA 4XU1A 3CMET 4PLIA 2DTHA 1HXDA 4A54A 4IUUA 3FC3A 1N8RU 2QI2A 2KAFA 2MAMA 4M7DD 1QVGS 5GAOq 2DAQA 2RO0A 1WJRA 2L8DA 2LQ8A 2XI9A 3C94A 3V8KA 4EMKA 2LCLA 2DTOA 1NJIC 4ZN3A 5A0LA 2GFUA 1NJIU 5CAIA 3PFSA 1FX7A 4Z02A 1QP2A 3KUFA 3OSVA 5FLXE 3WVDB 5GAMf 3QJYA 1JJ2S 1G3WA 2I2LA 2LT4A 3PMIA 4OMFB 2F69A 5M9OA 3JCMV 1N8RC 2FHDA 3QYHB 1W2BS 1KQ1A 3L2RA 2DEQA 3WVEB 2R58A 3CCMA 5CO7A 4XTVA 3HPWA 2E6ZA 2GQVA 3MCAB 3OBYA 4XQ3A 2DZCA 1QW1A 2EJFA 2E64A 4M75F 4M78G 3PTAA 5KE2A 3NTHA 2DXTA 2ZPBB 3FB9A 3VV0A 4DQ2A 5KH6A 3JCMe 2OTLT 1K73C 2KDSA 5CR2A 4JRQA 4C8QG 2JTMA 2QQRA 1XOVA 1PSFA 3OSSC 4BY6C 3L2WA 3CEYA 4M77A 3CXCA 1KC8C 1WQWA 3OS5A 3CBOA 4NOYA 4EDUA 4QVCA 1YJ9A 1IZ6A 4M78D 1YIJA 2YLCA 3F70A 3DKMA 3META 2XDDA 1K8AC 1OYXA 2M1HA 2BUDA 4OF1A 4M75C 4C5EA 3CCUA 3A5ZB 3V7SA 3S3OA 1K8AU 5L8RE 2ZPEB 1UGSB 5LJ3f 3CCLA 1VQ6A 4C8QB 2QXFA 1M9SA 1RI0A 2XD0A 2HNIA 2LTOA 2E41A 2IVWA 2JVVA 3H6ZA 3OYBA 3HL8A 3OMCA 3VYGA 4CI0C 4GLKA 4QQDA 3SFMA 2DD4A 4JS5A 1KQSA 4MDXA 4OB3B 3L42A 1VQNA 4EMGA 3O8VA 2PUOB 5A0DA 4RCBA 5GANg 4HT9A 4V2SA 4J8OA 3P8DA 4FT4A 4XTYA 2K3XA 2ZPHB 4RMOA 4ZGDB 1VQPT 2R5AA 3E9FA 2QTXA 4OB2B 4OGCA 3ME9A 5DLOA 2WSEE 1VQ4T 3LH0A 2KMTA 3P8HA 3CMAA 3LYIA 3UT1A 1Q7YU 1YCYA 2VYTA 4C0DC 4N4GA 2RI5A 4L59A 1H641 4JRPA 3S3NA 1O9SA 1UEBA 1VQ8T 3KXTA 4PJOA 4BACA 4BDZA 3OYFA 1M4ZA 5FU6C 5FRNA 3QPHA 1S72T 4M77G 1UB4A 3GOXA 1B34A 3CPFA 1YJNT 3MP1A 1VQLT 4C92E 4TVRA 4ZN1A 5CCAA 1K73U 3JCMP 3NFCA 1KQSS 5DM7R 1NPPA 3E1SA 2RB6A 1VQ7T 2VGMA 4R55A 2K57A 4PKCC 1VQ5A 4F7UF 2EKOA 3HFNA 3HRUA 4MZMA 3OYJA 1VQ9T 3L2ZA 3BDUA 3CBPA 3CXCS 3G4SA 1KD1C 1LOJA 4KUDK 1QVGA 2QA4T 4PJOB 1YHQT 3RMQA 2M16A 3A8HB 3OY9A 1N27A 2ZPFB 2CYZB 4X9DA 1UGRB 4L5GA 4BI4A 1G3TA 5LJ5j 5J39A 3JB9J 2LVMA 4J6YA 2QEXA 1G5VA 3JCMf 4PNOA 5GAOn 4C5HA 3LX7A 2QQAA 4XK8E 3T9NA 5CIUA 3CCSA 2RJDA 1WJQA 5GAOm 2RHXA 4MDWA 4F7UE 3MEUA 1NE8A 3QO3A 4CRIA 4BD3A 2E65A 2DTIA 3M55A 2JOYA 3HSBA 3CC7T 1BI1A 4LDWA 3GLXA 2XK0A 3PT9A 2P0PA 4WF2A 4M75E 3MHXA 3QIIA 3M57A 5CKBA 3URGA 5GANd 2DJZA 2F5TX 2RK2A 5IN1A 3S6WA 3V8JA 3VKIA 5GAN2 2MWPA 3CC4T 4LDXA 5CKHA 4C0GA 1JJ2A 5GMKj 1FXXA 3SWNB 1D3BA 4LDVA 1OZ3A 5CKEA 3JCMJ 1ZHIA 2RD1A 5FROA 4R56A 3CPWS 3GF5A 3X24B 3GIBA 4C92G 2KK4A 2R5MA 2OAUA 1O75A 3M53A 3FRNA 3TCJA 3BW1A 1SSFA 5LJ5h 4PJOE 3OYDA 2FB7A 4ZGEB 5GAOl 2MI6A 5LJ5e 5LL6S 4HT8A 3UDCA 2V8IA 1UGQB 2KSSA 3A8MB 3VYHB 5IT9E 1Q81C 3M4GA 4XU2A 3CC2A 4M7AC 1YBYA 3G71T 4M75A 4QQGA 1VQLA 1X6OA 4A53A 3SD4A 3QG1A 1VQ6T 2OTJT 5GANj 3L2VA 1LNXA 3PGGA 1GXIE 3BDLA 5KCOA 2RHUA 2E10A 2E70A 3CCJA 5GANf 1M1KC 1FWZA 3HP9A 5CKDA 1KG1A 4M7AG 4J7IA 2MF2A 4M77C 5CK9A 3A8OB 4C8QF 2XU8A 4MMLA 3M54A 4FIBA 2O4XA 3EFRA 3FDRA 2CS7A 3M5AA 2VV5A 3GNGA 4E7IA 3Q1JA 3VU3C 2VXEA 4DA4A 5HK0A 2MWOA 4HKEA 2RI3A 5KE3A 2BKDN 2LNVA 4M7AB 1BI2A 5GAOp 4M78B 2DPPB 2RH2A 3TREA 4C8QC 4E7HA 2K5FA 3QBYA 1KQ2A 2D9TA 5GAN6 2B8AA 5GANe 3G6EA 4M75B 1N9RA 3OMGA 4C8QD 3MP6A 2DVEA 3MO8A 4OVAA 4RKUE 4II1A 2DKGA 4JLGA 1VQOT 1PSEA 5GMKl 4KUIA 5GAMd 3JB9G 4BI3A 1Q7YC 3M9QA 4BY6B 1I4K1 4BB7A 5GAN5 2ZCFB 1VQMT 3PIOA 3OYIA 2KY9A 2PU9B 2EJ9A 2DO3A 2K2VA 4L6V5 4X34A 3LLRA 4HA8A 3JB9I 1XNIA 4LDUA 3OYYA 5HKCA 1ZQ1A 3JSCA 5C0MA 1VQ9A 2VGNA 4M78A 2XKOC 4X9CA 4KBMB 1VIEA 3HKSA 2CZ1B 4XU0A 4LD9K 2K5LA 4FL6A 1X75C 1V29B 1Y96B 3M58A 4B9XA 3LGFA 1YI2T 2BIVA 1BYMA 3ASKA 3JCMb 3AHUA 4LDYA 1VQKT 2GF7A 4KULA 4N4HA 2HQXA 3JRZA 5DLQE 3DB4A 4A4EA 4C0FA 2DD5A 2RHYA 2PQWA 3RUXA 3L1AA 3INZA 3J81E 3CCRT 2KVQG 3CCST 2X4XA 3RKYA 4ZTJA 1QVPA 3RIRA 2EQKA 3V8LA 1K9MC 1VQNT 4Y91A 4F7UG 3QJ6A 5GAN3 3QDRB 2XDPA 4JRIA 5FU7C 5LJ5d 4N0AC 3CC7A 2XHCA 3SDZA 5A0GA 2RHIA 4M77B 5GMKh 4C92C 1Y07A 4M78E 2PVOB 3UWNA 1VQ4A 3QSUA 4M7DC 3CC4A 3DB3A 3CPWA 2VC8A 2NLUA 3QUIA 2ZPIB 4FT2A 5LJ3d 3M4YA 5FU6B 5GAN7 3GNFB 3VUBA 3J80E 4M7DG 2CZ0B 1JBMA 5GMKe 3C4SA 3NTKA 2KQWA 3PIPA 2H3JA 4MZPA 2D6FA 3CD6A 1Q82C 3A8LB 4PJOD 2YHTA 4PJOG 5GANh 2EFIA 4PLLA 1BI0A 1NZ9A 2X35A 4A4KA 1M90C 4M7AD 4J83A 5CQYA 3OS0A 4N4IA 2HBPA 3QHSA 3JCMc 1M1GA 4M7DB 3DLLA 4UC4A 2OTJA 3SWNC 3X20B 2QQBA 3G7ZA 1YITA 3M59A 4IUPA 4A4GA 3HRSA 5FU7B 3LWHA 2D0QB 3CBMA 3HFOA 5CVIA 3I56A 1U1SA 1YJ9T 1YHQA 4QW2A 2JUFA 2LT1A 4XU3A 1YIJT 3OA6A 3SB2A 2K3YA 4FM4B 2LC4A 1YJWA 3M56A 2VUBA 4VUBA 2DZ9A 1K9MU 3OS1A 3FEOA 5J3BA 2EQMA 4J5YA 3P8BB 4Y28E 2EYQA 3OBWA 4JLIA 3ZBDA 1I5LA 3RERA 4E47A 2P0QA 4RG8A 4IUTA 4IUVA 2X4YA 2E5QA 2YRVA 2GCXA 3WXMB 3OYEA 2L5QA 1JRIA 1KHIA 4C92A 5EG2A 4C8QA 1Q82U 4F7UA 3LWIA 1S72A 1BI3A 1Y96A 2E12A 1OI1A 2K5IA 5DY9A 2DXBA 2EAYA 4ATOA 2Y4XA 5I2SA 4HCBA 3OS2A 4QQ6A 2QQ9A 2JN0A 2RI2A 2V8KA 5GMKi 2JZ2A 2YLBA 3LGLA 3HRTA 5I2MA 5GAMj 1Y7XA 3TEEA 1M90U 1VQ7A 4P5NA 4BDYA 2M0OA 4M7DE 3EAEA 1Q86U 2ZGWA 1VQ5T 3CMAT 4QVZA 3J7AF 1G3SA 2P0KA 4M77D 1KD1U 1DJ7B 3E9GA 5LJ5g 4E7LA 3TU4K 1OZ2A 2DXCA 3QKJA 3G4ST 3CCQT 1XQHA 4IURA 2X4WA 2QA4A 1WGSA 1XTDA 3JAME 4J6WA 1MGQA 4ME7A 3A8GB 2Y90A 4C92F 5GAMh 1LJOA 1M5Q1 4JDSA 1WPYA 2CZ7B 2EWNA 3X28B 1YJNA 1N6AA 4OB1B 2FVUA 3MP8A 3CCVT 1H3ZA 4M78C 1U8RA 2LX9A 2QQSA 3GPLA 1I81A 2R57A 1WJSA 4M75D 2WACA 2P4TA 3CCJT 2RJEA 1VQKA 4JUVA 2V8JA 3JCMW 1U1TA 4MMKA 3X25B 4BI8B 4J7FA 4DOWA 5FRMA 2EIFA 4C0ZA 4XTWA 3HHTB 3R6OA 3V7CA 3I55T 2XG8D 4BE2A 2DIGA 2CGHA 2PVDB 2RK1A 4M7AF 4MZTA 4M75G 4M78F 4C5IA 1R8OB 3S3MA 1M1FA 2K4YA 1WQ7A 4IKFA 5GAN8 3JCMg 5GMKm 2LDMA 1Y71A 2QEXT 3OYAA 1YJWT 1M8VA 5CKFA 4NL2A 2FL7A 2EQUA 3OYMA 4OP0A 3EFSA 3OW2A 1X01A 2A3LA 2E6NA 2DK3A 2X4JA 4M77F 3C12A 4A4FA 5I21A 3FIFA 4HCCA 2HD0A 3BFMA 4DOVA 2IG0A 3RKWA 1QVFS 2O4XB 1Q86C 1G3YA 5GAMg 3FJPA 2CZ6B 4QVDA 3GP8A 4EMKB 3CD6T 2G3RA 3PNWC 2HAXA 4BUGA 3G71A 2OTLA 4EPCA 1N9SA 2VXFA 3OB9A 3CCET 3FLGA 1M1KU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PSF A;  4OB0 B;  2PU9 B;  4Y28 E;  1QP3 A;  2AHJ B;  1AHJ B;  2ZPH B;  4L6V 5;  2ZZD A;  4ZGD B;  4ZGE B;  2QDY B;  3A8G B;  1QP2 A;  1UGQ B;  2ZPG B;  3A8M B;  4OB2 B;  3VYH B;  3QXE B;  4ZGJ B;  2WSE E;  3WVD B;  2DPP B;  3X28 B;  2CZ7 B;  4OB1 B;  2PUK B;  1IRE B;  2PVO B;  3X20 B;  5L8R E;  2ZPE B;  3QYH B;  1UGS B;  2WSC E;  3LW5 E;  1GXI E;  2DXB A;  2CZ1 B;  3QZ9 B;  2D0Q B;  2ZPI B;  3WVE B;  3X26 B;  1V29 B;  4KT0 E;  3A8H B;  4RKU E;  2PVG B;  2WSF E;  2ZPF B;  3VYG A;  2CYZ B;  1PSE A;  1UGP B;  3X25 B;  2CZ6 B;  1UGR B;  3A8O B;  2CZ0 B;  4FM4 B;  2O01 E;  2DD5 A;  2DD4 A;  2ZPB B;  3HHT B;  3QYG B;  1JB0 E;  1DJ7 B;  4OB3 B;  4XK8 E;  2PVD B;  2ZCF B;  3A8L B;  3QZ5 B;  3X24 B;  2DXC A;  2PUO B; 
#chains in the Genus database with same CATH topology
 3JB9 F;  2L89 A;  5J26 A;  3MEW A;  1MMA A;  3N5B B;  3VUZ A;  2ZPG B;  1KC8 U;  3EG9 A;  2QAS A;  5KYY A;  1YIT T;  1Q81 U;  1KHC A;  1BIA A;  3JV3 A;  5LJ3 g;  2AKL A;  5LJ3 h;  1VUB A;  2EYZ A;  4M7D F;  3OYN A;  2DRK A;  4XTU A;  2RQT A;  2IPO B;  5IAY A;  3M0Q A;  4FSX A;  2M51 A;  3CCJ Q;  1ZUU A;  3I5S A;  3L2Q A;  3R6N A;  3CCV A;  3JCM d;  1KIK A;  3MEA A;  3RES A;  2ATC B;  3EG9 B;  1XJW B;  4JJN K;  1VQO A;  1TWB A;  4ZGJ B;  4E7J A;  4HXJ A;  1EZZ B;  2XIC A;  5KYW A;  4E6R A;  5HK3 A;  1TXQ A;  3D7S B;  3LW5 E;  4NL3 A;  2ENM A;  4BE1 A;  3OYK A;  4EMK C;  2PVG B;  3DLM A;  1VYV A;  1UGP B;  2DL5 A;  3RMS A;  5LJ3 j;  3CCQ A;  1WHK A;  2FO0 A;  1ZBX A;  2XID A;  1YI2 A;  1WHJ A;  4O5V A;  4PJO F;  5IHN A;  3CCS Q;  2PUK B;  2C06 A;  5D6Y A;  4XTZ A;  1I8F A;  5LJ5 f;  2YRD A;  1C6V X;  2WSF E;  1EIF A;  4OML A;  4PLI A;  2EYW A;  2RF0 A;  2L3S A;  5GAO q;  2L3Q A;  2DTO A;  2L0A A;  1NJI C;  2GFU A;  1NJI U;  5CAI A;  3KUF A;  5GAM f;  3QJY A;  1JJ2 S;  2I2L A;  2LT4 A;  2FHD A;  3WVE B;  4XTV A;  2E6Z A;  2DZC A;  2E64 A;  2SRC A;  5KE2 A;  4A63 B;  2MIO A;  4DQ2 A;  2OTL T;  5CR2 A;  2YRC A;  2QQR A;  2QK0 A;  2J6F A;  3CEY A;  1KC8 C;  1WQW A;  2DF6 A;  2FPF A;  1YJ9 A;  2YLC A;  3F70 A;  5GJW B;  2XDD A;  1K8A C;  3A5Z B;  1IHV A;  1YWO A;  5LJ3 f;  2QXF A;  1NYF A;  2DA9 A;  1RI0 A;  2BZY A;  2E41 A;  3H6Z A;  1CSK A;  1N5Z A;  2HL5 C;  1BB9 A;  5KYN A;  4CI0 C;  3SFM A;  2B86 A;  1IO6 A;  1VQN A;  5A0D A;  5GAN g;  2PUO B;  1YIJ Q;  4FT4 A;  2ZPH B;  1VQP T;  2CP5 A;  2JJ9 A;  4ZGD B;  1E7O A;  5IXB A;  5DLO A;  4OGC A;  2DJQ A;  3ME9 A;  2WSE E;  1VQ4 T;  3VRY A;  1D0Y A;  3P8H A;  1OPK A;  1YCY A;  2VYT A;  1W70 A;  4L59 A;  4K11 A;  3S3N A;  4KRT A;  1UEB A;  3OYF A;  3CPF A;  1YJN T;  4TVR A;  2CSQ A;  5DM7 R;  2LZ6 B;  4PKC C;  1I1J A;  2HEQ A;  2W10 A;  3HRU A;  3OYJ A;  3BDU A;  3CXC S;  4RTY A;  1WLP B;  3OY9 A;  1N27 A;  2ROT A;  1UGR B;  1WDX A;  2LVM A;  2KYM A;  3UF4 A;  3T9N A;  2QQA A;  4XK8 E;  3CCS A;  5GAO m;  1T0J A;  4F7U E;  1M30 A;  1KQS P;  1VYU A;  2DLP A;  2AK5 A;  2E65 A;  5HCK A;  1G2B A;  1N8R R;  2JMA A;  3PE0 A;  3PT9 A;  4M75 E;  3H0I A;  3URG A;  4DBR A;  4LDX A;  2MWP A;  3H0H A;  4CC3 A;  1FXX A;  2CDT A;  1HD3 A;  2D1X A;  4LDV A;  1OZ3 A;  3JCM J;  1VQM Q;  1KFZ A;  1UG1 A;  3X24 B;  3GIB A;  4AFS C;  3GBQ A;  3M53 A;  1O75 A;  2F2V A;  3TCJ A;  4J9E A;  1SSF A;  5LJ5 e;  3UDC A;  1UGQ B;  4PJM A;  4QQG A;  3SD4 A;  3QG1 A;  3L2V A;  1LNX A;  5KCO A;  2RHU A;  1G83 A;  3CCJ A;  3RBB B;  1KG1 A;  5CKD A;  3CCM Q;  5CK9 A;  3A8O B;  4C8Q F;  4MML A;  3M54 A;  1R0C B;  1ZSZ A;  1AOJ A;  1B07 A;  4HKE A;  2F2W A;  1C1A A;  4M78 B;  2DYB A;  4JJD A;  1UGV A;  3G71 Q;  3C0C A;  2D9T A;  1NJI R;  2EYY A;  2YT6 A;  2OI3 A;  1TTH B;  2DVE A;  4II1 A;  3JB9 G;  1ZA1 B;  2HMA A;  2ZCF B;  2LCS A;  1B3Q A;  1YI2 Q;  3JB9 I;  5HKC A;  1AD5 A;  5C0M A;  1U5S A;  4KBM B;  2CZ1 B;  1T3S A;  2YUO A;  4LD9 K;  1V29 B;  1Y96 B;  2DBK A;  4F14 A;  2E5K A;  3AHU A;  4LDY A;  1UHF A;  2GF7 A;  4N4H A;  4C0F A;  2DD5 A;  2RHY A;  3L1A A;  3J81 E;  3I35 A;  2ZAE A;  3CCR T;  3RKY A;  4ZTJ A;  3EGD B;  3RIR A;  1K9M C;  1VQN T;  4Y91 A;  1OU9 A;  4JRI A;  5LJ5 d;  3A1P A;  5A0G A;  2RHI A;  5GMK h;  2AKK A;  3CPW A;  2VKN A;  2EVR A;  5GAN 7;  3VUB A;  1JEG A;  5GMK e;  3C4S A;  2H3J A;  1Q82 C;  4PJO D;  2QTV A;  2YXY A;  2D8J A;  5CQY A;  3NGP A;  3DLL A;  2QQB A;  4IUP A;  5FU7 B;  5CVI A;  3I56 A;  1YJ9 T;  1U1S A;  1YHQ A;  4XU3 A;  5D7U A;  2CUB A;  2ED0 A;  3M56 A;  1QWF A;  5I22 A;  4PFO A;  4J5Y A;  3P8B B;  1ZBJ A;  4JLI A;  1K0S A;  1VYT A;  2CH4 A;  4E47 A;  4RG8 A;  3WXM B;  5IHK A;  2RQU A;  5ECA A;  1S72 A;  1NEB A;  1T3L A;  2DNU A;  2EAY A;  2V1R A;  2A28 A;  1VQK Q;  2JN0 A;  5GMK i;  3LGL A;  2YLB A;  4M7D D;  3TEE A;  4P5N A;  2ZGW A;  1VQ5 T;  2JW4 A;  1KD1 U;  3E9G A;  1GCQ A;  5LJ5 g;  1W1F A;  2IIM A;  3CCQ T;  4JZ3 A;  2FZK B;  4RTT A;  4J6W A;  2J6K A;  4ME7 A;  1LJO A;  4JDS A;  2CZ7 B;  5KYX A;  3GPL A;  2O31 A;  4M75 D;  2WAC A;  1TSF A;  2EYX A;  3CCJ T;  4JUV A;  2V8J A;  3JCM W;  1U1T A;  2XMF A;  4DOW A;  2EIF A;  4C0Z A;  4DEY A;  3EG3 A;  1RAH B;  3I55 T;  4ANJ A;  4M7A F;  4MZT A;  4M75 G;  4M78 F;  4C5I A;  5GMK m;  2ABL A;  1KD1 R;  1YJW T;  5CKF A;  4NL2 A;  2FL7 A;  2K79 A;  4OP0 A;  4FYV B;  3OW2 A;  1X01 A;  4A4F A;  4DOV A;  3BFM A;  2O4X B;  1Q86 C;  1H3H A;  3GP8 A;  3UAT A;  3H9N A;  2CP6 A;  3OB9 A;  1OPL A;  4OB0 B;  5LJ3 e;  2LJ0 A;  1UJY A;  4ELZ C;  2X9H A;  2AHJ B;  4Q5W A;  4BE0 A;  1AEY A;  2QDY B;  2EJG A;  2JT4 A;  1W2B A;  3L2U A;  3CD6 Q;  1IRE B;  3CCU T;  1TH7 A;  4F7U B;  1HK9 A;  2SEM A;  4HVW A;  4XTX A;  1RAB B;  1K76 A;  2CKK A;  2LP5 A;  1BBZ A;  3OYC A;  1AT1 B;  3OYH A;  3CC4 Q;  3JCM Q;  2A7Y A;  1WNL A;  1AVZ C;  1JB0 E;  1VQ4 Q;  3JB9 H;  5GAN 4;  2JS2 A;  5HY6 A;  2Y4Y A;  3CC2 Q;  1ZSG A;  1UE9 A;  1OV3 A;  2YWW A;  2YDL A;  1WX6 A;  1AWX A;  2MCN A;  2LQK A;  4C92 D;  3UPU A;  1X27 A;  3RKX A;  4PJO C;  1VQP A;  3C95 A;  5GAM e;  1X43 A;  2QYZ A;  1PG5 B;  3QXE B;  2RHZ A;  3OQ5 A;  3E19 A;  4M7D A;  5KYY B;  3X26 B;  1PNJ A;  4KT0 E;  1M3B A;  4KH1 B;  2RNA A;  1YP5 A;  2X3X D;  1VQ8 A;  4M77 E;  3M0P A;  4C5G A;  4RG2 A;  2HQE A;  1VQ9 Q;  2CT4 A;  5FW9 A;  1IGU A;  4AFZ C;  2DXU A;  4C0D B;  2DIQ A;  4F04 B;  3CC2 T;  5KCH A;  1Y57 A;  3SHW A;  4C8Q E;  1YNZ A;  3OYL A;  3CCE A;  3KBG A;  1NLO C;  2GFA A;  3QZ9 B;  4J9I A;  1JU5 C;  3CME T;  1HXD A;  4IUU A;  1QCN A;  2QI2 A;  3REA B;  3C94 A;  4EMK A;  4IIO A;  2COZ A;  4LE9 A;  3TSZ A;  4Z89 A;  1NG2 A;  2EPD A;  2F69 A;  3JCM V;  1N8R C;  1W2B S;  3QYH B;  1KQ1 A;  3L2R A;  1KSW A;  3TSW A;  5IHI A;  3OBY A;  1FMK A;  1QW1 A;  4M75 F;  4M78 G;  3PTA A;  1PD1 A;  2EGA A;  2RMO A;  1M3A A;  4J9G A;  1VQL Q;  2JTM A;  1XOV A;  4BY6 C;  3L2W A;  4M77 A;  4NOY A;  1IZ6 A;  3I9Q A;  3MET A;  1OYX A;  2HSP A;  4J9C A;  4OF1 A;  4C5E A;  2BZX A;  1UGS B;  1VQ6 A;  2XD0 A;  1M2O A;  2HNI A;  2IVW A;  4QQD A;  4RTU A;  2L3P A;  4JS5 A;  2QGF B;  4MDX A;  2PZ1 A;  1FYN A;  4RCB A;  4J8O A;  4XTY A;  1EX4 A;  1TOV A;  3LH0 A;  2KMT A;  2DEU A;  2K6D A;  3UT1 A;  1Q7Y U;  1PD0 A;  2RI5 A;  1H64 1;  4JRP A;  4HVV A;  1VQ8 T;  3KXT A;  4PJO A;  4BAC A;  4BDZ A;  8AT1 B;  1S72 T;  1UB4 A;  2W0Z A;  1VQL T;  4C92 E;  2YUN A;  2KT8 A;  4ZN1 A;  5CCA A;  1SHF A;  1X69 A;  3JCM P;  3EG2 A;  1KQS S;  2VGM A;  2DL8 A;  5GJV B;  1VQ5 A;  4F7U F;  1VQ9 T;  3CBP A;  3G4S A;  1KD1 C;  1YHQ T;  3RMQ A;  3A8H B;  1QVF P;  4X9D A;  3JB9 J;  3NMZ C;  1JJ2 P;  3JCM f;  2COY A;  3CCE Q;  4OMO A;  5CIU A;  2RJD A;  2RHX A;  1AZE A;  1WYX A;  1GBQ A;  2JOY A;  4LDW A;  3GLX A;  4WF2 A;  2CUD A;  3QII A;  2JTE A;  3M57 A;  5GAN d;  1RAI B;  1VQ8 Q;  2A37 A;  3CC4 T;  5EC7 A;  1UDL A;  5GMK j;  2X51 A;  4EIK A;  5CKE A;  2RD1 A;  3CPW S;  2KRS A;  3CXC P;  4FCY A;  3EH1 A;  4C92 G;  1RAD B;  3NHN A;  2OAU A;  3BW1 A;  1Q86 R;  5GAO l;  4HT8 A;  5LL6 S;  3EG0 A;  2V8I A;  3VS0 A;  3CC2 A;  4M7A E;  3M4G A;  1VQL A;  2HL3 A;  3EFO B;  2OTJ T;  5GAN j;  2E70 A;  1CKA A;  1PC0 A;  1K73 R;  4M7A G;  1WHL A;  2MF2 A;  3M0S A;  4M77 C;  1LPL A;  4FIB A;  2O4X A;  1OUL A;  3TQ7 P;  2CS7 A;  2VV5 A;  3GNG A;  2H8H A;  3Q1J A;  5HK0 A;  1I0C A;  2LNV A;  2EGC A;  2AIR B;  1QQJ A;  4J9H A;  2EGE A;  2DPP B;  4C8Q C;  5GAN 6;  5GAN e;  4M75 B;  1N9R A;  4C8Q D;  2KEA A;  3MP6 A;  1FMW A;  3MO8 A;  5GAM d;  4BI3 A;  4OMQ A;  3M9Q A;  3CCR Q;  3IQL A;  2KYB A;  4LN2 A;  4BB7 A;  2CH4 W;  2E3H A;  2Z0W A;  1SPK A;  2K2M A;  2EJ9 A;  2K2V A;  4L6V 5;  4X34 A;  2DIL A;  5FWB A;  3UA6 A;  1R0B G;  1VIE A;  3ZL7 C;  2MK5 A;  1YI2 T;  2KRO A;  3LGF A;  2BIV A;  3ASK A;  3M0R A;  1VQK T;  4KUL A;  2PQW A;  3CCS T;  2KVQ G;  4FW2 A;  2EQK A;  4F7U G;  3QJ6 A;  3QDR B;  2ESW A;  4N0A C;  1RI9 A;  4C92 C;  4M7D C;  2PVO B;  3UWN A;  3HTR A;  3VRZ A;  4J9D A;  1MMN A;  2NLU A;  2VWF A;  3QUI A;  1K0X A;  5LJ3 d;  1G8X A;  3J80 E;  4M7D G;  2CZ0 B;  3RNJ A;  1Q95 G;  2KQW A;  3NTK A;  3PIP A;  4MZP A;  2D6F A;  2DL7 A;  3CD6 A;  2CT3 A;  2NUT B;  1BI0 A;  2QG9 B;  1M90 C;  3QHS A;  3JCM c;  1PCX A;  4UC4 A;  3SWN C;  3X20 B;  3G7Z A;  1YJW Q;  4A4G A;  3VS6 A;  2CP7 A;  4QKU A;  2JUF A;  4QW2 A;  1YIT Q;  4VUB A;  2DZ9 A;  1GCQ C;  1D1A A;  1K9M U;  5J3B A;  3FEO A;  2EYQ A;  3OBW A;  1I5L A;  1KK7 A;  1LCK A;  2P0Q A;  2CP2 A;  9ATC B;  1X2K A;  2RQV A;  2E5Q A;  2GCX A;  3OYE A;  2L5Q A;  4C8Q A;  3MJX A;  1QMC A;  2E12 A;  2K5I A;  1QKX A;  5DY9 A;  1SRM A;  1ZA2 B;  3VS1 A;  1WHM A;  4QQ6 A;  2V8K A;  3HRT A;  4BDY A;  1OU8 A;  1K9A A;  1Q86 U;  3J7A F;  1NM7 A;  1TG0 A;  3G4S T;  1RAC B;  3QDF A;  4IUR A;  4OMN A;  2X4W A;  1WGS A;  1QLY A;  3JAM E;  3H0F A;  2Y90 A;  2KI7 A;  2RPN A;  4ORZ A;  1M5Q 1;  2O2O A;  1WPY A;  2FZC B;  1D09 B;  3X28 B;  3MP8 A;  2OX7 A;  1WJS A;  3MKD A;  5KYU B;  2KR3 A;  1RAE B;  2AZV A;  2V1Q A;  4J7F A;  3HHT B;  2XG8 D;  2RK1 A;  2D0N A;  5I11 A;  3EFO A;  1RLP C;  5GAN 8;  1Y71 A;  2QEX T;  3OYA A;  2RN8 A;  2KBT A;  2X4J A;  1Q81 R;  5I21 A;  1UHC A;  2FG0 A;  2IG0 A;  5GAM g;  2CZ6 B;  4QVD A;  4EMK B;  2G3R A;  2HAX A;  3G71 A;  4EPC A;  1TUG B;  4YTL A;  2C0O A;  5AYF A;  1ZUK A;  2KXC A;  3V7R A;  3CME A;  2RJF A;  4FU6 A;  4GY5 A;  4F17 A;  2MMP A;  2WSC E;  3CPW P;  1MHN A;  2F5K A;  5KYW B;  3OW2 S;  2CSI A;  5C6S A;  3BY7 A;  3QZ5 B;  1YWP A;  2XDB A;  1QP3 A;  2KXD A;  2ZZD A;  4PL6 A;  3CCM T;  2JTF A;  4JS4 A;  4B9W A;  2BE9 B;  2OJ2 A;  2JXB A;  4JRK A;  1VQM A;  5A2Q E;  2J7I A;  2LRQ A;  1BU1 A;  1X6B A;  2FYK A;  2LCC A;  4ELY C;  2RM4 A;  1BIB A;  1IXD A;  4O6J A;  1A0N B;  2L3R A;  2LJ3 A;  1NPR A;  4GLM A;  1H92 A;  1AHJ B;  1P92 A;  4HCZ A;  5FWC A;  4DBH A;  1T0H A;  2RJC A;  4J6X A;  4M7A A;  1VA7 A;  4C92 B;  1JO8 A;  1SSH A;  4D6W A;  3I56 T;  4FYW B;  2VB6 A;  4A54 A;  3FC3 A;  2MAM A;  2DAQ A;  2FRY A;  2RO0 A;  2L8D A;  2LQ8 A;  2QDL A;  5A0L A;  1I5O B;  1QCO A;  5FLX E;  3OSV A;  1G3W A;  3PMI A;  1GRI A;  5M9O A;  2C0T A;  2DEQ A;  2R58 A;  3CCM A;  2A0F B;  5CO7 A;  3HPW A;  2GQV A;  3MCA B;  1NBE B;  1NYG A;  2EJF A;  1D0Z A;  3NTH A;  2X3W D;  1WFW A;  2DM1 A;  2DXT A;  3JCM e;  1K73 C;  2KDS A;  4C8Q G;  4AMC A;  1PSF A;  3CXC A;  2QGG A;  3OS5 A;  4OMM A;  4EDU A;  4M78 D;  1YIJ A;  2BUD A;  4M75 C;  2ZPE B;  3CCL A;  4DBQ A;  2JVV A;  3OMC A;  2RQW A;  2COW A;  1PKS A;  4FYX B;  4KGX B;  4OB3 B;  3L42 A;  5L23 A;  1Q7Y R;  4HT9 A;  2GBQ A;  3O8V A;  4V2S A;  1YJ9 Q;  3TVT A;  2QTX A;  2NUT A;  2YUP A;  4AG2 C;  3LYI A;  1QVG P;  1UUE A;  2YUQ A;  4N4G A;  1Q82 R;  1PRL C;  2NUP B;  3QPH A;  5FU6 C;  5FRN A;  2P84 A;  3GOX A;  4JJC A;  3MP1 A;  1QWE A;  1SKU B;  1IRX A;  1K73 U;  1NPP A;  3E1S A;  1GBR A;  3BE3 A;  2K57 A;  2EKO A;  3HFN A;  3VS4 A;  1U06 A;  1BCM A;  3EHQ A;  4KUD K;  1QVG A;  1FMV A;  2JM8 A;  4BI4 A;  1G3T A;  5J39 A;  1G5V A;  4C5H A;  3LX7 A;  1WJQ A;  2LMJ A;  4MDW A;  1D1C A;  3MEU A;  1NE8 A;  3QO3 A;  1K4U S;  2CP0 A;  2DTI A;  3CC7 T;  1F1B B;  1VQN Q;  1YFN A;  2XK0 A;  1ZLM A;  5KYU A;  5CKB A;  4PFP A;  3V8J A;  2F5T X;  3VKI A;  5GAN 2;  2CP3 A;  3OW2 P;  1JJ2 A;  1ARK A;  3SWN B;  1MUZ A;  4GBQ A;  5FRO A;  3CCL Q;  4R56 A;  4LNP A;  4ZNX A;  2HBW A;  1BCO A;  2ED1 A;  3FRN A;  3MPU B;  3OYD A;  2O88 A;  1IGQ A;  1YN8 A;  2DX1 A;  4M7A C;  1YBY A;  2GTJ A;  1VQ6 T;  3BDL A;  2E10 A;  1V1C A;  5GAN f;  1AWW A;  1FWZ A;  4PJN A;  4J7I A;  4KH0 B;  2J05 A;  2XU8 A;  2J06 A;  3EFR A;  3CME Q;  3M5A A;  4E7I A;  1IB8 A;  4DA4 A;  2M0Y A;  1WXT A;  4M7A B;  2J6O A;  3TRE A;  4M4Z A;  1AZG B;  1KQ2 A;  1S1N A;  3G6E A;  2HQH A;  4RKU E;  1GCP A;  2D8H A;  2DKG A;  4JLG A;  3VS3 A;  5GMK l;  3EGX B;  4E2F B;  1I4K 1;  1SHG A;  3PIO A;  3OYI A;  2DL3 A;  1WXB A;  2EBP A;  2KT1 A;  3RR6 A;  3LLR A;  4HA8 A;  4AFU C;  1ZQ1 A;  2E4H A;  3EHR A;  3CCQ Q;  3JSC A;  2VGN A;  2FEI A;  4PJL A;  1OQK A;  3HKS A;  2K5L A;  4FL6 A;  1X75 C;  3JCM b;  2HQX A;  3JRZ A;  5DLQ E;  4A4E A;  5KE3 A;  4E7H A;  1HJD A;  3INZ A;  1VQO Q;  5GAN 3;  7AT1 B;  2XHC A;  2JS0 A;  4M77 B;  5IH2 A;  1MV3 A;  4M78 E;  1KC8 R;  3CCV Q;  2GGR A;  2VC8 A;  1K8A R;  2DE0 X;  4FT2 A;  4RTX A;  3M4Y A;  1W2B P;  3GNF B;  4RTZ A;  1D0X A;  3A8L B;  2KRN A;  1WI7 A;  4PJO G;  4PK4 A;  2EFI A;  2KRM A;  4WCI A;  1CKB A;  1NZ9 A;  1JQQ A;  1R77 A;  4M7A D;  3OS0 A;  2HBP A;  4HVU A;  4M7D B;  2OTJ A;  1I07 A;  1YIT A;  3M59 A;  2A08 A;  1HYO A;  3HRS A;  4E7Z A;  3LWH A;  3CBM A;  3HFO A;  1AWJ A;  4DBF A;  1H8K A;  2LT1 A;  1TUC A;  3SB2 A;  3OA6 A;  2LC4 A;  1YJW A;  8ATC B;  2HKN A;  3AT1 B;  2MOX A;  4Y28 E;  3ZBD A;  1KJW A;  3RER A;  4IUV A;  2BTT A;  1JRI A;  2EQI A;  1KHI A;  4C92 A;  5EG2 A;  4R0K A;  1WHG A;  1ACM B;  1BI3 A;  2DVJ A;  2DXB A;  4ATO A;  2Y4X A;  2QQ9 A;  2RI2 A;  2JZ2 A;  1OX9 A;  5I2M A;  1VQ7 A;  1ZSZ B;  4M7D E;  3EAE A;  1SRL A;  3CMA T;  4QVZ A;  1G3S A;  1DJ7 B;  3TU4 K;  2CRE A;  1OZ2 A;  2DXC A;  3QKJ A;  4D8K A;  4AG1 C;  1XQH A;  1GFD A;  3EGD A;  1K1Z A;  2QA4 Q;  3A8G B;  3PVL A;  4C92 F;  1YJN A;  1NEG A;  3E2U A;  3CCV T;  1U8R A;  1MV0 B;  2LX9 A;  4CC7 A;  2R57 A;  2M02 A;  2P4T A;  1MMD A;  2RJE A;  2RQR A;  1M2V A;  4MMK A;  3X25 B;  4XTW A;  2PVD B;  3SEM A;  3VS2 A;  3S3M A;  1M1F A;  2K4Y A;  1M27 C;  4KGZ B;  3JCM g;  2PTK A;  3UA7 A;  1M8V A;  2EQU A;  3OYM A;  2A3L A;  3M0T A;  2DK3 A;  1UFF A;  3C12 A;  2HD0 A;  4RTV A;  6AT1 B;  4JZ4 A;  3RKW A;  3FJP A;  2H3E B;  4AT1 B;  3U23 A;  2OTL A;  2VXF A;  3CCE T;  3FLG A;  1M1K U;  3LH5 A;  3ZEH A;  2JNG A;  1RLQ C;  5CQX A;  2VVK A;  2M9U A;  1Y0M A;  4IUQ A;  1W4S A;  3JCM h;  3JCM X;  2E1H A;  1X2Q A;  1QVF A;  1SG5 A;  1WA7 A;  3SWN A;  1RAG B;  4NS5 A;  1TS9 A;  5D6X A;  5D6W A;  3VJP A;  3QYG B;  4JJB A;  1D3B B;  4RCC A;  3EH2 A;  4A4H A;  1JXO A;  2RA2 A;  1BKB A;  1SEM A;  3JB9 D;  1Z9Q A;  3I55 A;  4Z88 A;  1M1K R;  1MND A;  4OGE A;  4XAX B;  4N0A A;  3ZFJ A;  3H41 A;  3MEV A;  1VIF A;  2AT1 B;  2O01 E;  3H8Z A;  4E7K A;  2VAS A;  3ER0 A;  3G6E T;  3EG1 A;  4LD6 A;  3CCL T;  1RL2 A;  4ZTF A;  2EQJ A;  1WHH A;  3PMT A;  2BE7 D;  2HCK A;  3NPF A;  3NTI A;  2HZY A;  3CCR A;  3OYG A;  4EMH A;  2DET A;  1PWT A;  5GAO r;  2NUP A;  1UTI A;  1B34 B;  4XU1 A;  1GFC A;  2DTH A;  1N8R U;  2KAF A;  1QVG S;  1WJR A;  2XI9 A;  1VQ5 Q;  3V8K A;  3M0U A;  2LCL A;  1UEC A;  4ZN3 A;  2HSE B;  3PFS A;  1FX7 A;  4Z02 A;  1QP2 A;  3WVD B;  1QCF A;  4OMF B;  2PNI A;  1OEB A;  3THK A;  1M2V B;  2K7A A;  4XQ3 A;  1ZSZ C;  4HCK A;  1QKW A;  2ZPB B;  3FB9 A;  2BZ8 A;  1LVK A;  3VV0 A;  5KH6 A;  4JRQ A;  2LQN A;  3OSS C;  3VS7 A;  3CBO A;  4QVC A;  3DKM A;  2M1H A;  3CCU A;  2LX7 A;  3V7S A;  3S3O A;  1K8A U;  1ZUY A;  5L8R E;  3ULR B;  2L2P A;  4C8Q B;  1M9S A;  2AZS A;  2LTO A;  3REB B;  3OYB A;  3HL8 A;  1OOT A;  3VYG A;  2DRM A;  4GLK A;  1VQ6 Q;  2DD4 A;  1KQS A;  3CCU Q;  2F1L A;  4OMP A;  4EMG A;  3P8D A;  4RMO A;  2K3X A;  1UJ0 A;  2R5A A;  3E9F A;  5AT1 B;  4OB2 B;  1ABQ A;  2K3B A;  3CMA A;  2QEX Q;  4C0D C;  4PJJ A;  1O9S A;  2E3I A;  1M4Z A;  3G4S Q;  4M77 G;  2G6F X;  1B34 A;  2LQW A;  2DL4 A;  3NFC A;  2RB6 A;  4D8D A;  2KGT A;  1VQ7 T;  4R55 A;  4E7S A;  2MYS A;  4MZM A;  3L2Z A;  2DER A;  1LOJ A;  2QA4 T;  4PJO B;  2HDA A;  2M16 A;  2NWM A;  2EW3 A;  4B6M A;  1PHT A;  2P4R A;  2ZPF B;  2CYZ B;  5LJ5 j;  4L5G A;  2QEX A;  4J6Y A;  4RUG A;  4PNO A;  5GAO n;  3CMA Q;  2ROL A;  2HKQ B;  4CRI A;  4BD3 A;  3M55 A;  3HSB A;  1E6G A;  4Y92 A;  1BI1 A;  2P0P A;  3MHX A;  1WZO A;  4RTW A;  2DJZ A;  2RK2 A;  5IN1 A;  3S6W A;  5CKH A;  4C0G A;  1D3B A;  4KGV B;  3CC7 Q;  1ZHI A;  2NYS A;  3GF5 A;  3I55 Q;  1NLP C;  2KK4 A;  2R5M A;  4PJO E;  2A36 A;  5LJ5 h;  2FB7 A;  4ZGE B;  2MI6 A;  2KSS A;  5IT9 E;  3A8M B;  3VYH B;  1Q81 C;  4XU2 A;  3G71 T;  4M75 A;  1X6O A;  4A53 A;  1EFN A;  2C0I A;  3PGG A;  1GXI E;  4ESR A;  2ECZ A;  3I5R A;  2I0N A;  1M1K C;  3HP9 A;  2KNB B;  2K9G A;  1VOM A;  3FDR A;  3VU3 C;  2VXE A;  2FRW A;  2MWO A;  2RI3 A;  2BKD N;  1WXU A;  1WIE A;  1BI2 A;  3QWY A;  5GAO p;  1IHW A;  2DBM A;  2RH2 A;  2K5F A;  3FJ5 A;  3QBY A;  1B7T A;  2OAW A;  2B8A A;  3OMG A;  4OVA A;  1W6X A;  3KFV A;  4JPB W;  1VQO T;  1PSE A;  1ZX6 A;  4KUI A;  1BK2 A;  2F2X A;  1Q7Y C;  4BY6 B;  3CQT A;  5GAN 5;  1VQM T;  4F16 A;  1YCS B;  4LUE A;  2KY9 A;  2PU9 B;  2DO3 A;  2LJ1 A;  1PM3 A;  4LXC A;  1XNI A;  4LDU A;  3OYY A;  4Z8A A;  1VQ9 A;  2JM9 A;  4M78 A;  2XKO C;  4X9C A;  3O5Z A;  4XU0 A;  4B9X A;  3M58 A;  1BYM A;  4FYY B;  3EGU A;  3DB4 A;  3RUX A;  2DFU A;  2JMC A;  4WTO B;  2X4X A;  1YJN Q;  1V76 A;  1M8M A;  1QVP A;  3V8L A;  1VQP Q;  2XDP A;  5FU7 C;  1ABO A;  3CC7 A;  3SDZ A;  4CC2 A;  4J9B A;  2MPX C;  1Y07 A;  2LNH B;  1VQ4 A;  2GTO A;  3QSU A;  3CC4 A;  3DB3 A;  1VQ7 Q;  4FSS A;  2ZPI B;  5KYX B;  2O9V A;  5FU6 B;  1C0M A;  1M3C A;  5IXF A;  1JBM A;  1RAA B;  1HSQ A;  2O9S A;  3QWX X;  2YSQ A;  2YHT A;  5GAN h;  2GQI A;  4PLL A;  2X35 A;  4A4K A;  1Z9Z A;  4J83 A;  4N4I A;  1M1G A;  4J9F A;  2DYI A;  2OTL Q;  4LUD A;  1M90 R;  2D0Q B;  2FPD A;  1YIJ T;  2QAZ A;  2V26 A;  2K3Y A;  4FM4 B;  2VUB A;  2OTJ Q;  3EGX A;  4DEX A;  1SF9 A;  3OS1 A;  1TU0 B;  2EQM A;  2FZG B;  4IUT A;  2X4Y A;  1MNE A;  3A98 A;  2YRV A;  1PKT A;  1Q82 U;  4F7U A;  3LWI A;  1Y96 A;  1OI1 A;  5I2S A;  4HCB A;  1E6H A;  3OS2 A;  5GAM j;  4IIM A;  1Y7X A;  1M90 U;  2M0O A;  3PVQ A;  4M77 D;  2P0K A;  2EKH A;  4E7L A;  1J3T A;  2QA4 A;  1XTD A;  1JXM A;  1MGQ A;  4AFQ C;  1D1B A;  5GAM h;  4PFZ A;  3G1J A;  4QT7 A;  2EWN A;  1N6A A;  4OB1 B;  2FVU A;  1OX8 A;  1H3Z A;  4M78 C;  1RUW A;  2QQS A;  1I81 A;  1RAF B;  2DMO A;  1GL5 A;  4X1V A;  1VQK A;  1K9M R;  5FRM A;  4BI8 B;  3RDV A;  4FW1 A;  2KE9 A;  3R6O A;  3V7C A;  4BE2 A;  1S72 Q;  2DIG A;  2CGH A;  1R8O B;  1WQ7 A;  3VS5 A;  4IKF A;  2GNC A;  2NUZ A;  1MMG A;  2LDM A;  1X6G A;  3EFS A;  2E6N A;  4CC4 B;  4M77 F;  4HCC A;  3FIF A;  1YHQ Q;  2FPE A;  1PRM C;  1QVF S;  3I56 Q;  1G3Y A;  1AWO A;  3G6E Q;  1U3O A;  3CD6 T;  3PNW C;  4BUG A;  1TUD A;  1N9S A; 
#chains in the Genus database with same CATH homology
 4YTL A;  2L89 A;  4OB0 B;  3JB9 F;  5J26 A;  3MEW A;  3ZEH A;  4ELZ C;  2JNG A;  5LJ3 e;  2AHJ B;  4Q5W A;  5AYF A;  4BE0 A;  5CQX A;  2QDY B;  3N5B B;  2M9U A;  3VUZ A;  2EJG A;  2ZPG B;  1KC8 U;  1W2B A;  3V7R A;  4IUQ A;  1W4S A;  2RJF A;  3JCM h;  3JCM X;  3L2U A;  3CME A;  1YIT T;  2E1H A;  1Q81 U;  1KHC A;  1IRE B;  4FU6 A;  4GY5 A;  3CCU T;  1BIA A;  1QVF A;  2MMP A;  2WSC E;  3SWN A;  1TH7 A;  5LJ3 g;  5LJ3 h;  1MHN A;  1VUB A;  2F5K A;  4F7U B;  1HK9 A;  4M7D F;  3OYN A;  3OW2 S;  4XTU A;  4NS5 A;  5IAY A;  4FSX A;  4XTX A;  2CKK A;  5D6X A;  3L2Q A;  5D6W A;  3VJP A;  3OYC A;  5C6S A;  3OYH A;  3CCV A;  3JCM Q;  3QYG B;  2A7Y A;  1D3B B;  1WNL A;  4RCC A;  3JCM d;  1JB0 E;  3JB9 H;  3BY7 A;  3QZ5 B;  5GAN 4;  5HY6 A;  2Y4Y A;  3MEA A;  3RES A;  4A4H A;  2XDB A;  3UPU A;  4C92 D;  2LQK A;  1QP3 A;  4PJO C;  3RKX A;  2RA2 A;  2ZZD A;  1BKB A;  4PL6 A;  3CCM T;  1VQP A;  3C95 A;  5GAM e;  4JJN K;  2JTF A;  3JB9 D;  1VQO A;  3QXE B;  4ZGJ B;  4E7J A;  3I55 A;  4B9W A;  2XIC A;  2RHZ A;  4JS4 A;  5HK3 A;  3OQ5 A;  3E19 A;  3LW5 E;  4NL3 A;  4M7D A;  4JRK A;  1VQM A;  5A2Q E;  4OGE A;  4XAX B;  3X26 B;  3OYK A;  4KT0 E;  4BE1 A;  2LRQ A;  4N0A A;  4EMK C;  2PVG B;  2FYK A;  2LCC A;  3DLM A;  1UGP B;  3ZFJ A;  1VQ8 A;  4M7A E;  3MEV A;  1VIF A;  4M77 E;  2O01 E;  4ELY C;  2RM4 A;  1BIB A;  4C5G A;  3RMS A;  3H8Z A;  4RG2 A;  2HQE A;  5LJ3 j;  4E7K A;  4O6J A;  3ER0 A;  3G6E T;  2L3R A;  3CCQ A;  1NPR A;  4LD6 A;  3CCL T;  2DXU A;  1RL2 A;  4ZTF A;  2EQJ A;  1AHJ B;  1P92 A;  1ZBX A;  2DIQ A;  2XID A;  3PMT A;  4HCZ A;  4C0D B;  5KCH A;  1YI2 A;  3CC2 T;  4O5V A;  4PJO F;  2RJC A;  3NTI A;  4J6X A;  2PUK B;  4M7A A;  4C8Q E;  3OYL A;  3CCE A;  3CCR A;  2C06 A;  5D6Y A;  4EMH A;  3KBG A;  4C92 B;  3OYG A;  4XTZ A;  2GFA A;  1I8F A;  3QZ9 B;  5GAO r;  4D6W A;  3I56 T;  5LJ5 f;  2WSF E;  1B34 B;  1EIF A;  4XU1 A;  3CME T;  4PLI A;  2DTH A;  1HXD A;  4A54 A;  4IUU A;  3FC3 A;  1N8R U;  2QI2 A;  2KAF A;  2MAM A;  4M7D D;  1QVG S;  5GAO q;  2DAQ A;  2RO0 A;  1WJR A;  2L8D A;  2LQ8 A;  2XI9 A;  3C94 A;  3V8K A;  4EMK A;  2LCL A;  2DTO A;  1NJI C;  4ZN3 A;  5A0L A;  2GFU A;  1NJI U;  5CAI A;  3PFS A;  1FX7 A;  4Z02 A;  1QP2 A;  3KUF A;  3OSV A;  5FLX E;  3WVD B;  5GAM f;  3QJY A;  1JJ2 S;  1G3W A;  2I2L A;  2LT4 A;  3PMI A;  4OMF B;  2F69 A;  5M9O A;  3JCM V;  1N8R C;  2FHD A;  3QYH B;  1W2B S;  1KQ1 A;  3L2R A;  2DEQ A;  3WVE B;  2R58 A;  3CCM A;  5CO7 A;  4XTV A;  3HPW A;  2E6Z A;  2GQV A;  3MCA B;  3OBY A;  4XQ3 A;  2DZC A;  1QW1 A;  2EJF A;  2E64 A;  4M75 F;  4M78 G;  3PTA A;  5KE2 A;  3NTH A;  2DXT A;  2ZPB B;  3FB9 A;  3VV0 A;  4DQ2 A;  5KH6 A;  3JCM e;  2OTL T;  1K73 C;  2KDS A;  5CR2 A;  4JRQ A;  4C8Q G;  2JTM A;  2QQR A;  1XOV A;  1PSF A;  3OSS C;  4BY6 C;  3L2W A;  3CEY A;  4M77 A;  3CXC A;  1KC8 C;  1WQW A;  3OS5 A;  3CBO A;  4NOY A;  4EDU A;  4QVC A;  1YJ9 A;  1IZ6 A;  4M78 D;  1YIJ A;  2YLC A;  3F70 A;  3DKM A;  3MET A;  2XDD A;  1K8A C;  1OYX A;  2M1H A;  2BUD A;  4OF1 A;  4M75 C;  4C5E A;  3CCU A;  3A5Z B;  3V7S A;  3S3O A;  1K8A U;  5L8R E;  2ZPE B;  1UGS B;  5LJ3 f;  3CCL A;  1VQ6 A;  4C8Q B;  2QXF A;  1M9S A;  1RI0 A;  2XD0 A;  2HNI A;  2LTO A;  2E41 A;  2IVW A;  2JVV A;  3H6Z A;  3OYB A;  3HL8 A;  3OMC A;  3VYG A;  4CI0 C;  4GLK A;  4QQD A;  3SFM A;  2DD4 A;  4JS5 A;  1KQS A;  4MDX A;  4OB3 B;  3L42 A;  1VQN A;  4EMG A;  3O8V A;  2PUO B;  5A0D A;  4RCB A;  5GAN g;  4HT9 A;  4V2S A;  4J8O A;  3P8D A;  4FT4 A;  4XTY A;  2K3X A;  2ZPH B;  4RMO A;  4ZGD B;  1VQP T;  2R5A A;  3E9F A;  2QTX A;  4OB2 B;  4OGC A;  3ME9 A;  5DLO A;  2WSE E;  1VQ4 T;  3LH0 A;  2KMT A;  3P8H A;  3CMA A;  3LYI A;  3UT1 A;  1Q7Y U;  1YCY A;  2VYT A;  4C0D C;  4N4G A;  2RI5 A;  4L59 A;  1H64 1;  4JRP A;  3S3N A;  1O9S A;  1UEB A;  1VQ8 T;  3KXT A;  4PJO A;  4BAC A;  4BDZ A;  3OYF A;  1M4Z A;  5FU6 C;  5FRN A;  3QPH A;  1S72 T;  4M77 G;  1UB4 A;  3GOX A;  1B34 A;  3CPF A;  1YJN T;  3MP1 A;  1VQL T;  4C92 E;  4TVR A;  4ZN1 A;  5CCA A;  1K73 U;  3JCM P;  3NFC A;  1KQS S;  5DM7 R;  1NPP A;  3E1S A;  2RB6 A;  1VQ7 T;  2VGM A;  4R55 A;  2K57 A;  4PKC C;  1VQ5 A;  4F7U F;  2EKO A;  3HFN A;  3HRU A;  4MZM A;  3OYJ A;  1VQ9 T;  3L2Z A;  3BDU A;  3CBP A;  3CXC S;  3G4S A;  1KD1 C;  1LOJ A;  4KUD K;  1QVG A;  2QA4 T;  4PJO B;  1YHQ T;  3RMQ A;  2M16 A;  3A8H B;  3OY9 A;  1N27 A;  2ZPF B;  2CYZ B;  4X9D A;  1UGR B;  4L5G A;  4BI4 A;  1G3T A;  5LJ5 j;  5J39 A;  3JB9 J;  2LVM A;  4J6Y A;  2QEX A;  1G5V A;  3JCM f;  4PNO A;  5GAO n;  4C5H A;  3LX7 A;  2QQA A;  4XK8 E;  3T9N A;  5CIU A;  3CCS A;  2RJD A;  1WJQ A;  5GAO m;  2RHX A;  4MDW A;  4F7U E;  3MEU A;  1NE8 A;  3QO3 A;  4CRI A;  4BD3 A;  2E65 A;  2DTI A;  3M55 A;  2JOY A;  3HSB A;  3CC7 T;  1BI1 A;  4LDW A;  3GLX A;  2XK0 A;  3PT9 A;  2P0P A;  4WF2 A;  4M75 E;  3MHX A;  3QII A;  3M57 A;  5CKB A;  3URG A;  5GAN d;  2DJZ A;  2F5T X;  2RK2 A;  5IN1 A;  3S6W A;  3V8J A;  3VKI A;  5GAN 2;  2MWP A;  3CC4 T;  4LDX A;  5CKH A;  4C0G A;  1JJ2 A;  5GMK j;  1FXX A;  3SWN B;  1D3B A;  4LDV A;  1OZ3 A;  5CKE A;  3JCM J;  1ZHI A;  2RD1 A;  5FRO A;  4R56 A;  3CPW S;  3GF5 A;  3X24 B;  3GIB A;  4C92 G;  2KK4 A;  2R5M A;  2OAU A;  1O75 A;  3M53 A;  3FRN A;  3TCJ A;  3BW1 A;  1SSF A;  5LJ5 h;  4PJO E;  3OYD A;  2FB7 A;  4ZGE B;  5GAO l;  2MI6 A;  5LJ5 e;  5LL6 S;  4HT8 A;  3UDC A;  2V8I A;  1UGQ B;  2KSS A;  3A8M B;  3VYH B;  5IT9 E;  1Q81 C;  3M4G A;  4XU2 A;  3CC2 A;  4M7A C;  1YBY A;  3G71 T;  4M75 A;  4QQG A;  1VQL A;  1X6O A;  4A53 A;  3SD4 A;  3QG1 A;  1VQ6 T;  2OTJ T;  5GAN j;  3L2V A;  1LNX A;  3PGG A;  1GXI E;  3BDL A;  5KCO A;  2RHU A;  2E10 A;  2E70 A;  3CCJ A;  5GAN f;  1M1K C;  1FWZ A;  3HP9 A;  5CKD A;  1KG1 A;  4M7A G;  4J7I A;  2MF2 A;  4M77 C;  5CK9 A;  3A8O B;  4C8Q F;  2XU8 A;  4MML A;  3M54 A;  4FIB A;  2O4X A;  3EFR A;  3FDR A;  2CS7 A;  3M5A A;  2VV5 A;  3GNG A;  4E7I A;  3Q1J A;  3VU3 C;  2VXE A;  4DA4 A;  5HK0 A;  2MWO A;  4HKE A;  2RI3 A;  5KE3 A;  2BKD N;  2LNV A;  4M7A B;  1BI2 A;  5GAO p;  4M78 B;  2DPP B;  2RH2 A;  3TRE A;  4C8Q C;  4E7H A;  2K5F A;  3QBY A;  1KQ2 A;  2D9T A;  5GAN 6;  2B8A A;  5GAN e;  3G6E A;  4M75 B;  1N9R A;  3OMG A;  4C8Q D;  3MP6 A;  2DVE A;  3MO8 A;  4OVA A;  4RKU E;  4II1 A;  2DKG A;  4JLG A;  1VQO T;  1PSE A;  5GMK l;  4KUI A;  5GAM d;  3JB9 G;  4BI3 A;  1Q7Y C;  3M9Q A;  4BY6 B;  1I4K 1;  4BB7 A;  5GAN 5;  2ZCF B;  1VQM T;  3PIO A;  3OYI A;  2KY9 A;  2PU9 B;  2EJ9 A;  2DO3 A;  2K2V A;  4L6V 5;  4X34 A;  3LLR A;  4HA8 A;  3JB9 I;  1XNI A;  4LDU A;  3OYY A;  5HKC A;  1ZQ1 A;  3JSC A;  5C0M A;  1VQ9 A;  2VGN A;  4M78 A;  2XKO C;  4X9C A;  4KBM B;  1VIE A;  3HKS A;  2CZ1 B;  4XU0 A;  4LD9 K;  2K5L A;  4FL6 A;  1X75 C;  1V29 B;  1Y96 B;  3M58 A;  4B9X A;  3LGF A;  1YI2 T;  2BIV A;  1BYM A;  3ASK A;  3JCM b;  3AHU A;  4LDY A;  1VQK T;  2GF7 A;  4KUL A;  4N4H A;  2HQX A;  3JRZ A;  5DLQ E;  3DB4 A;  4A4E A;  4C0F A;  2DD5 A;  2RHY A;  2PQW A;  3RUX A;  3L1A A;  3INZ A;  3J81 E;  3CCR T;  2KVQ G;  3CCS T;  2X4X A;  3RKY A;  4ZTJ A;  1QVP A;  3RIR A;  2EQK A;  3V8L A;  1K9M C;  1VQN T;  4Y91 A;  4F7U G;  3QJ6 A;  5GAN 3;  3QDR B;  2XDP A;  4JRI A;  5FU7 C;  5LJ5 d;  4N0A C;  3CC7 A;  2XHC A;  3SDZ A;  5A0G A;  2RHI A;  4M77 B;  5GMK h;  4C92 C;  1Y07 A;  4M78 E;  2PVO B;  3UWN A;  1VQ4 A;  3QSU A;  4M7D C;  3CC4 A;  3DB3 A;  3CPW A;  2VC8 A;  2NLU A;  3QUI A;  2ZPI B;  4FT2 A;  5LJ3 d;  3M4Y A;  5FU6 B;  5GAN 7;  3GNF B;  3VUB A;  3J80 E;  4M7D G;  2CZ0 B;  1JBM A;  5GMK e;  3C4S A;  3NTK A;  2KQW A;  3PIP A;  2H3J A;  4MZP A;  2D6F A;  3CD6 A;  1Q82 C;  3A8L B;  4PJO D;  2YHT A;  4PJO G;  5GAN h;  2EFI A;  4PLL A;  1BI0 A;  1NZ9 A;  2X35 A;  4A4K A;  1M90 C;  4M7A D;  4J83 A;  5CQY A;  3OS0 A;  4N4I A;  2HBP A;  3QHS A;  3JCM c;  1M1G A;  4M7D B;  3DLL A;  4UC4 A;  2OTJ A;  3SWN C;  3X20 B;  2QQB A;  3G7Z A;  1YIT A;  3M59 A;  4IUP A;  4A4G A;  3HRS A;  5FU7 B;  3LWH A;  2D0Q B;  3CBM A;  3HFO A;  5CVI A;  3I56 A;  1U1S A;  1YJ9 T;  1YHQ A;  4QW2 A;  2JUF A;  2LT1 A;  4XU3 A;  1YIJ T;  3OA6 A;  3SB2 A;  2K3Y A;  4FM4 B;  2LC4 A;  1YJW A;  3M56 A;  2VUB A;  4VUB A;  2DZ9 A;  1K9M U;  3OS1 A;  3FEO A;  5J3B A;  2EQM A;  4J5Y A;  3P8B B;  4Y28 E;  2EYQ A;  3OBW A;  4JLI A;  3ZBD A;  1I5L A;  3RER A;  4E47 A;  2P0Q A;  4RG8 A;  4IUT A;  4IUV A;  2X4Y A;  2E5Q A;  2YRV A;  2GCX A;  3WXM B;  3OYE A;  2L5Q A;  1JRI A;  1KHI A;  4C92 A;  5EG2 A;  4C8Q A;  1Q82 U;  4F7U A;  3LWI A;  1S72 A;  1BI3 A;  1Y96 A;  2E12 A;  1OI1 A;  2K5I A;  5DY9 A;  2DXB A;  2EAY A;  4ATO A;  2Y4X A;  5I2S A;  4HCB A;  3OS2 A;  4QQ6 A;  2QQ9 A;  2JN0 A;  2RI2 A;  2V8K A;  5GMK i;  2JZ2 A;  2YLB A;  3LGL A;  3HRT A;  5I2M A;  5GAM j;  1Y7X A;  3TEE A;  1M90 U;  1VQ7 A;  4P5N A;  4BDY A;  2M0O A;  4M7D E;  3EAE A;  1Q86 U;  2ZGW A;  1VQ5 T;  3CMA T;  4QVZ A;  3J7A F;  1G3S A;  2P0K A;  4M77 D;  1KD1 U;  1DJ7 B;  3E9G A;  5LJ5 g;  4E7L A;  3TU4 K;  1OZ2 A;  2DXC A;  3QKJ A;  3G4S T;  3CCQ T;  1XQH A;  4IUR A;  2X4W A;  2QA4 A;  1WGS A;  1XTD A;  3JAM E;  4J6W A;  1MGQ A;  4ME7 A;  3A8G B;  2Y90 A;  4C92 F;  5GAM h;  1LJO A;  1M5Q 1;  4JDS A;  1WPY A;  2CZ7 B;  2EWN A;  3X28 B;  1YJN A;  1N6A A;  4OB1 B;  2FVU A;  3MP8 A;  3CCV T;  1H3Z A;  4M78 C;  1U8R A;  2LX9 A;  2QQS A;  3GPL A;  1I81 A;  2R57 A;  1WJS A;  4M75 D;  2WAC A;  2P4T A;  3CCJ T;  2RJE A;  1VQK A;  4JUV A;  2V8J A;  3JCM W;  1U1T A;  4MMK A;  3X25 B;  4BI8 B;  4J7F A;  4DOW A;  5FRM A;  2EIF A;  4C0Z A;  4XTW A;  3HHT B;  3R6O A;  3V7C A;  3I55 T;  2XG8 D;  4BE2 A;  2DIG A;  2CGH A;  2PVD B;  2RK1 A;  4M7A F;  4MZT A;  4M75 G;  4M78 F;  4C5I A;  1R8O B;  3S3M A;  1M1F A;  2K4Y A;  1WQ7 A;  4IKF A;  5GAN 8;  3JCM g;  5GMK m;  2LDM A;  1Y71 A;  2QEX T;  3OYA A;  1YJW T;  1M8V A;  5CKF A;  4NL2 A;  2FL7 A;  2EQU A;  3OYM A;  4OP0 A;  3EFS A;  3OW2 A;  1X01 A;  2A3L A;  2E6N A;  2DK3 A;  2X4J A;  4M77 F;  3C12 A;  4A4F A;  5I21 A;  3FIF A;  4HCC A;  2HD0 A;  3BFM A;  4DOV A;  2IG0 A;  3RKW A;  1QVF S;  2O4X B;  1Q86 C;  1G3Y A;  5GAM g;  3FJP A;  2CZ6 B;  4QVD A;  3GP8 A;  4EMK B;  3CD6 T;  2G3R A;  3PNW C;  2HAX A;  4BUG A;  3G71 A;  2OTL A;  4EPC A;  1N9S A;  2VXF A;  3OB9 A;  3CCE T;  3FLG A;  1M1K U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...