2DD4A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thiocyanate hydrolase alpha subunit
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
source organism Thiobacillus thioparus
total genus 26
structure length 118
sequence length 118
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd4A00
1UGQB 4XK8E 2AHJB 2CZ0B 2DXCA 4OB2B 2O01E 3VYGA 1UGRB 3A8HB 3X28B 1V29B 3QYGB 1PSFA 1QP2A 2DD5A 1DJ7B 3A8LB 3A8MB 4L6V5 5L8RE 2WSEE 2ZPGB 2CYZB 4Y28E 1GXIE 4FM4B 1JB0E 3LW5E 4ZGEB 3A8OB 2CZ6B 2CZ7B 3QXEB 2WSCE 2DXBA 2ZZDA 2PVDB 1IREB 2WSFE 3X20B 3X25B 2ZPEB 2QDYB 2ZPIB 3QZ9B 2ZPFB 2PVOB 4ZGJB 3VYHB 3QYHB 4OB3B 3X24B 3WVEB 1UGPB 4OB1B 3X26B 3WVDB 1UGSB 2PVGB 2DPPB 2CZ1B 2DD4A 4ZGDB 2ZPHB 2PU9B 4RKUE 2PUOB 3A8GB 4OB0B 2ZPBB 1AHJB 2PUKB 3HHTB 1PSEA 4KT0E 1QP3A 2ZCFB 3QZ5B 2D0QB
chains in the Genus database with same CATH superfamily
2W0ZA 3PT9A 3OMCA 3CCLQ 3M0SA 2HD0A 2HDAA 2H8HA 4C5EA 1V29B 1E6HA 1K73C 1YJ9A 2QDLA 5CAIA 3CCQQ 1X6BA 1FYNA 1N8RR 1WJRA 2CS7A 4BE0A 1OZ3A 4HT8A 3G71Q 4Z02A 3OYHA 4L6V5 2RD1A 3DLLA 1YNZA 1KFZA 3OS2A 3OS0A 2V26A 3C12A 4NL2A 1U1TA 2KYBA 2DL7A 4J9FA 4J6WA 3ZEHA 1TH7A 4MMLA 4RCCA 3RDVA 2A36A 2XHCA 2JTMA 3H0HA 4M78E 2CP7A 2ZZDA 1M30A 4LXCA 1VQLA 1IB8A 4KGVB 2JJ9A 2LRQA 3ASKA 4ESRA 1KC8C 2QASA 2DJQA 3FDRA 1H641 5FWBA 2CP5A 2DL3A 1QVGS 1VQ6Q 2A28A 3I56T 3VS2A 4M7DG 5LJ5f 4NL3A 3QJYA 3QWYA 1RAHB 5LJ5g 2OX7A 4FYWB 2ZGWA 3VS3A 4KBMB 1BCMA 3QIIA 3EHQA 1C1AA 1FX7A 2K5LA 4J6YA 3TU4K 3LH0A 5KYUB 1VQNA 2E5QA 5FRMA 2J6FA 4ZGDB 4M7AA 4EPCA 1WJSA 2MWOA 1OULA 1G3TA 5KYUA 3ER0A 2ZPBB 2GGRA 3OBYA 1I07A 4OF1A 4Z88A 5GMKj 1OX9A 2NYSA 1T3SA 1IXDA 4MDWA 4GLKA 3PTAA 4J83A 1W70A 4QKUA 2M02A 3FEOA 2DLPA 1BK2A 1WIEA 3L2UA 3OS5A 4IUQA 4FT2A 1UHCA 2AHJB 3JCMX 3PMIA 2DXCA 2LT4A 1Y57A 4LDVA 1Q82C 1WYXA 3UT1A 4L5GA 2VVKA 5GANf 2OTLT 1ARKA 1AWOA 4DBFA 2GNCA 2YXYA 2YHTA 1Q7YC 1K4US 4FW2A 5GAOr 5AYFA 3OQ5A 1M3AA 3MEVA 1TU0B 3MP1A 5LJ5h 3JCMV 5I2SA 2DZCA 2HAXA 4OMFB 4OP0A 1CSKA 1T3LA 2BTTA 1M2OA 1NJIU 2RQRA 2R5AA 2X4YA 2E12A 4QVCA 2WSCE 1RI0A 1J3TA 3L2ZA 4RTWA 4E6RA 2PVDB 1WZOA 1K9AA 3CC4A 1VQ8Q 1RAIB 1X2QA 1TS9A 3CD6A 2A0FB 4X9CA 2HCKA 3CCVT 4E7JA 5CCAA 4N4HA 3WVEB 1Q81R 4Y91A 2KVQG 3HRTA 3CMEA 2M0OA 1QVGA 2OTJA 4J9CA 2DTOA 2QQ9A 5GANh 3RKXA 2DPPB 3N5BB 3G6ET 5C6SA 2RHIA 4M77B 2XG8D 2QA4A 2KSSA 4M7DC 3AHUA 2JMCA 2PUKB 3I5RA 2DNUA 3EFRA 4NS5A 3M0QA 1M2VB 1WHJA 2K5IA 2O2OA 2RQVA 2L3PA 1UE9A 1UFFA 1UB4A 1UGQB 3M0RA 2EQMA 2FPFA 1ZHIA 1M2VA 3CC7A 1H8KA 1OOTA 2COWA 4WCIA 4J6XA 1PRMC 2K79A 1U8RA 1WI7A 2ENMA 2J05A 1LVKA 1RLQC 4BUGA 2PQWA 2DMOA 4PJJA 1SKUB 4QVDA 3VUBA 5GMKe 1N6AA 1TTHB 1SEMA 2EGEA 3JRZA 3C95A 4JZ4A 1OQKA 9ATCB 3JB9F 4JLIA 3CCJA 3GP8A 1N8RC 1TOVA 1WHKA 4PJOD 1QCNA 3NHNA 2VWFA 4QT7A 2CZ6B 2IPOB 2COZA 3I5SA 1AEYA 2LC4A 4C8QB 5FU7C 2RN8A 2HBWA 3JCMQ 3M56A 3MHXA 5LJ3d 3T9NA 3X25B 2QEXT 3S6WA 2IG0A 4C92B 4BE2A 2EAYA 2RB6A 1FMVA 4CC2A 4C8QA 4XTUA 2JOYA 1VQOT 1GFCA 3QYHB 2E10A 4AT1B 2QGFB 1YIJA 1PD1A 2AKLA 1SRMA 3A5ZB 2DVEA 3FB9A 6AT1B 1KD1R 4E7KA 4JRIA 2DIGA 3REBB 4M7AF 1NE8A 4PJLA 2E41A 3OB9A 4AG1C 1UJ0A 2NUPB 4PJOE 3EFSA 4OB0B 1IHVA 2MF2A 5KYXB 2V1RA 1ZSZB 1N5ZA 1SPKA 2F5TX 5EC7A 3RKWA 5GAMd 1B07A 1BYMA 2NUPA 1I0CA 1HD3A 1VQKA 3EAEA 4OGCA 4J9HA 3MO8A 2LDMA 1EX4A 2RJCA 3FRNA 3I56Q 3I35A 5GJWB 3BDLA 4E2FB 4J8OA 3CPWP 2LCSA 2CUDA 1VQ4A 2EJ9A 2VASA 3I55A 1QP2A 1UDLA 1M4ZA 2KBTA 3BW1A 3QPHA 4ELYC 1VOMA 2DAQA 3M0TA 3RERA 3ULRB 4BE1A 3BY7A 2IIMA 3JB9I 3L2QA 5D7UA 1D1AA 4WTOB 3KFVA 3JB9D 4DBRA 3META 2X4WA 3GF5A 1PC0A 2NUTB 4DEXA 4LDYA 2F5KA 1FXXA 3MJXA 3F70A 2LCCA 2E5KA 1GRIA 1EZZB 2CP0A 2Z0WA 2NUTA 1QQJA 2DRMA 2DILA 2L3RA 2DF6A 1M3CA 3LLRA 5CKDA 2PVOB 2E70A 2ED0A 2CT4A 1WFWA 3S3NA 4MZMA 5ECAA 3HFOA 1NYFA 1IZ6A 2QI2A 2EIFA 3PFSA 3UA7A 4JZ3A 2J6KA 3J80E 1WQ7A 1ZBXA 1C0MA 2HEQA 1Q81C 5LJ5e 2HMAA 1R0CB 3PVQA 2M1HA 3EG9B 1MMAA 3RESA 2JUFA 2DL4A 2XU8A 4EMKB 2VYTA 3NTKA 4A53A 4XU0A 2LP5A 1RLPC 1HSQA 1QKWA 2NUZA 2JN0A 2YRVA 2ED1A 2F2VA 4EMKA 3CCVQ 3JCMc 5EG2A 2Y90A 4M78F 3OY9A 4PJMA 5IHNA 4BD3A 5DLQE 2C0OA 2XDDA 3G4SA 5GAOm 4M78C 4A4GA 3CCSA 1W2BS 1WDXA 1BIAA 2JM9A 2A7YA 4O6JA 3EGUA 3G6EQ 2KGTA 1AZGB 1WHMA 2JT4A 3MPUB 4DA4A 1RI9A 2EGCA 2K7AA 2DERA 3CBPA 4QQDA 3OYDA 4C0FA 1VQ8T 2JMAA 1D1CA 5A0DA 1YI2Q 3QXEB 3RNJA 4ORZA 1X69A 1M90U 1K76A 3HFNA 2L2PA 2K4YA 4RG2A 4B6MA 1IREB 5AT1B 3U23A 2EYYA 1YHQA 4HVWA 2RM4A 1TSFA 3URGA 5I22A 2VUBA 1MV0B 4PJOA 1D1BA 2GTOA 3UA6A 2LVMA 1M8VA 4N4IA 2DRKA 3E9FA 1ZSGA 3X26B 2B8AA 2PNIA 1WJQA 2MCNA 1KK7A 2BE7D 2CZ1B 2LZ6B 3LWHA 2CSQA 5KE3A 1KD1C 3M57A 2QYZA 1WXBA 4BY6C 1AHJB 3EG3A 4EIKA 5GMKh 3GNFB 2OTJT 2XMFA 1Q7YU 4M77D 3M0UA 4LUEA 4PL6A 4HCZA 2JVVA 2X35A 2QEXQ 1UHFA 1X6GA 3H41A 3OYJA 1JJ2A 2QA4T 2MWPA 1VQOQ 1W4SA 2LX9A 2DJZA 3QBYA 1M1FA 2O01E 1UGRB 4LDUA 4M7DB 1QWFA 2OAWA 2YUQA 1DJ7B 2YLBA 2QGGA 5GAN7 4PNOA 2E65A 3CC7T 1U06A 2C0TA 1K0XA 2KRSA 3UATA 1VQ9Q 2G3RA 2QTVA 2AKKA 4JPBW 1W2BA 3QHSA 5KCOA 4M77E 3CPFA 2E6ZA 3GNGA 1MGQA 2A3LA 1XTDA 1SSFA 4EDUA 5HK0A 2D6FA 4M75B 2SEMA 5GAOq 3M58A 3VRZA 4C8QD 3KUFA 3SWNC 4FCYA 2YSQA 1QMCA 3MCAB 3VU3C 1RAAB 1QCOA 4YTLA 4M75A 4C92D 2EJGA 3RBBB 4XAXB 2DE0X 2D9TA 2KE9A 2RK1A 2KXCA 4D8DA 4ELZC 1VA7A 2F69A 3A1PA 3WVDB 1UGSB 3NPFA 4MMKA 5FU7B 4RTVA 4RCBA 1QVPA 1I81A 3S3OA 1M3BA 2K5FA 3DKMA 1YIJT 1YJ9Q 2LCLA 2DTIA 2KEAA 4KULA 1G5VA 3CCUA 2KXDA 1GCQA 2MIOA 2RJFA 1I5LA 1JRIA 2ROLA 1HK9A 1X6OA 4NOYA 3SFMA 2HQHA 3QDFA 1QP3A 1KHCA 3DB4A 2CH4A 4C5IA 1YJNA 5IHKA 3SD4A 2HSPA 4XTYA 2XI9A 3ZFJA 4A4EA 4C8QE 2CZ0B 3EH2A 1ZUYA 3FLGA 2SRCA 1N8RU 4HCCA 4F7UB 1VQLQ 3RMSA 3VYGA 4C92E 5A2QE 1U5SA 1VQKT 1KQ1A 1KQ2A 4Z89A 3M54A 1S72A 3JAME 4RTTA 4JJNK 2VKNA 3L2WA 4F7UA 5LJ3f 4PLLA 1I5OB 1K9MR 2JW4A 5KYYB 2AZSA 5LJ3g 4XTVA 2RQTA 2DBMA 1D0XA 4FM4B 4PKCC 2P4RA 4ZGEB 1VUBA 4OMMA 3I55T 3JB9G 2EKHA 3AT1B 2FZKB 4DOVA 1VQNQ 5KYYA 2X3XD 2GTJA 2DTHA 2YUNA 2RH2A 2LJ0A 2RHZA 1OU9A 3CCMA 2AIRB 2ZPEB 4PJOF 4J5YA 4JJBA 1MMNA 3CXCP 4RUGA 1QKXA 2EYZA 2F2WA 1WX6A 4AG2C 4BACA 2EQKA 4JJCA 2VGNA 2V1QA 1X43A 5CQYA 2E3IA 3V7SA 4ZN3A 2M16A 2DD4A 1NLPC 1OX8A 2ZAEA 1YWPA 3CBOA 3H9NA 4RKUE 4M7AG 4DQ2A 2DFUA 4XU1A 1YCYA 2QK0A 5LJ3h 2HSEB 3OSSC 4A4HA 1RUWA 3HHTB 1RAEB 1OPLA 3M0PA 5FU6C 2HKNA 3LX7A 1OV3A 3VS0A 2CREA 4FSSA 1X75C 1MUZA 4BDYA 1NEBA 3EFOB 2L0AA 3E2UA 2L8DA 1NPRA 3JCMd 1JXOA 4N0AA 1KIKA 1G3SA 5I11A 1Y07A 1VQMT 3EFOA 3VS5A 1KSWA 2FB7A 1YI2T 3H0FA 3UF4A 4JLGA 4M77A 4X9DA 5KE2A 1VQPT 1VYUA 3CD6Q 2EWNA 1FMWA 3MP8A 4FIBA 1WA7A 2FG0A 5J3BA 5M9OA 2E4HA 2DL8A 1GXIE 3CCRA 2CH4W 4C0DC 1X27A 3G4ST 1Y7XA 3CMEQ 1PKTA 2OTJQ 2A08A 1KQSP 2KK4A 3CXCS 5CKFA 1WHHA 2DXBA 1WGSA 3CC2A 1X2KA 2EJFA 2QA4Q 1Z9ZA 2OJ2A 2MPXC 2FZGB 4DOWA 2CKKA 2QTXA 3LGLA 3REAB 1Q81U 2ZPFB 5LJ5d 4M75F 5GAN3 1BKBA 3VYHB 4PJNA 1IHWA 3UPUA 1K1ZA 4A54A 5HKCA 3JB9J 1OZ2A 4DBHA 2BZXA 4F17A 1I8FA 1PRLC 3VKIA 4ZN1A 3CC7Q 4IUUA 3KXTA 1M9SA 3OA6A 3QUIA 4ZTJA 1ACMB 4OMLA 3TSZA 2DX1A 2K2VA 2PUOB 1VIEA 1G8XA 3OSVA 3HP9A 2KQWA 4C92A 3OW2S 4KT0E 4RTYA 4PLIA 3C94A 1KG1A 4TVRA 4F16A 3OYNA 1PWTA 3SB2A 3JV3A 3FJ5A 4IURA 2LTOA 1HYOA 3GLXA 2BE9B 2FL7A 1Y96B 1OI1A 3OYIA 2YUPA 3ZL7C 2OI3A 2CT3A 3LGFA 4M7AC 5GANd 1U3OA 1VQ9T 1RADB 1Y96A 2DVJA 5LJ3j 2LJ3A 3X28B 4E7LA 2P84A 4J9IA 4M78G 4HVVA 1KQSS 2EYWA 2H3EB 3MP6A 4FW1A 4DBQA 1JJ2P 5KYXA 1ZSZA 3RKYA 1YIJQ 2ZPGB 4M7DD 2JS2A 4XTWA 1TUGB 4VUBA 1SRLA 2ATCB 4ATOA 1K9MC 1JQQA 3M55A 2ABLA 2I2LA 4J9GA 5L23A 1NYGA 4HCKA 3CXCA 1W1FA 1YITA 5GAMj 4C8QG 1KD1U 2L5QA 2JTEA 4CC3A 1YJ9T 1WHLA 1W2BP 1VQKQ 4M75D 2OTLA 1Y71A 4AFUC 2D1XA 4FL6A 2YDLA 1Q86U 2NLUA 1PCXA 1R77A 4BB7A 2RF0A 1XJWB 3H0IA 1BCOA 2LNVA 4M7DE 1K8AU 1VQ4Q 1ZA1B 4E7IA 3I55Q 2HQEA 4HXJA 3RUXA 4J7IA 2PZ1A 3JCMW 4KRTA 3NGPA 1VQLT 1B7TA 4HT9A 1AZEA 4J9BA 5J39A 2PTKA 3P8DA 2H3JA 2ZCFB 2XKOC 1ZUKA 4B9XA 4OMNA 2R58A 4N4GA 2VXFA 4XTZA 1VQ7A 4RTZA 1H92A 3OW2A 2RHYA 3V7RA 3TQ7P 4JRPA 3M59A 1JJ2S 2GCXA 1AOJA 4M77F 4M75E 5D6YA 3HSBA 1WLPB 3CCVA 3QYGB 2FEIA 1K73U 4MZTA 3HL8A 1YJNT 1VQNT 1BIBA 4M77C 2C0IA 2QQAA 4R55A 5GAOp 4PFPA 1B3QA 2KY9A 2L89A 1M1KR 4BI8B 3EG9A 5CK9A 1M90R 3G6EA 1IRXA 4R56A 3LYIA 4KH1B 1CKAA 5DY9A 1KQSA 4JJDA 4RMOA 1BU1A 1PD0A 3JSCA 1UG1A 2RQWA 5LJ3e 3E1SA 1HJDA 3E19A 1QVFS 3X20B 2QG9B 1KC8U 4UC4A 2ZPIB 4IIMA 2VV5A 3QZ9B 1MNEA 1OPKA 4PFZA 3CCEA 1ABQA 1NZ9A 5I2MA 1RABB 1VQMQ 4EMHA 2X4XA 1SSHA 3V8LA 2KMTA 3G1JA 2B86A 4OB3B 2DYIA 2KI7A 4Y92A 3CCMT 1UGPB 2DZ9A 1VQPQ 1YP5A 1WQWA 2LJ1A 4BDZA 4F7UE 2YT6A 1GBRA 4C8QF 4KUIA 2DYBA 4QQGA 1SF9A 4MDXA 5CKBA 3G4SQ 4C8QC 2IVWA 4C92F 3CCSQ 2G6FX 3OS1A 1VQ5A 3M4GA 2LQNA 2P0QA 1GFDA 3CC4T 2KT8A 2X9HA 2ESWA 2AT1B 3CD6T 2CP2A 1N27A 5KYWB 1S1NA 2RHXA 1YJWA 2FPEA 2F2XA 4FYXB 2DXTA 3SEMA 1Q82U 1VQOA 3M5AA 2GBQA 3CMET 3CMAA 5KYWA 3M4YA 3PNWC 2QQSA 2D8JA 5GMKl 1YHQQ 1ZBJA 1UEBA 4IUPA 2YUOA 5FU6B 2LQ8A 2Y4XA 2WACA 1RACB 3VJPA 1JB0E 1RAFB 2CZ7B 5GAN6 1GL5A 3CCLA 2GF7A 2YRCA 3MEWA 1NEGA 2DBKA 4PFOA 2VB6A 2QAZA 2BUDA 4IUTA 3CCQA 1AVZC 1ABOA 4M7DA 3EG2A 2P0PA 3G71A 2V8IA 1VIFA 4PJOG 2RO0A 1YWOA 3OYFA 3CC2T 4FT4A 1QVFA 3SHWA 4C0DB 4C0GA 3PVLA 4JRQA 1FWZA 5CIUA 2KT1A 2C06A 3QDRB 3CCJT 1K0SA 3NTHA 2BZYA 5GAOn 5HCKA 1AWWA 2VC8A 3JCMP 2CDTA 5CKEA 2L3SA 3JCMf 2ROTA 3L2VA 3WXMB 1P92A 4A63B 4V2SA 3JCMg 1LCKA 2EFIA 1VQ6A 2JZ2A 2AK5A 1I4K1 1D0ZA 1R8OB 3O8VA 1D09B 2RI2A 1YFNA 4CRIA 2EBPA 3PIPA 1M1GA 2E6NA 4J7FA 1QLYA 4XU3A 1JBMA 2MI6A 1E6GA 3V8KA 1PNJA 2BKDN 3OYYA 3C4SA 4JS5A 3PMTA 3TREA 1V76A 3OBWA 2FHDA 1ZUUA 4HVUA 4AFQC 5CVIA 5GAOl 2XDPA 4D8KA 2J7IA 3A8MB 1SHGA 4LE9A 3R6OA 5LL6S 4F04B 2BZ8A 4EMKC 4GBQA 2DO3A 3PE0A 1M1KC 3C0CA 1BI2A 1HXDA 5FRNA 4M7AB 4XQ3A 1M90C 3CQTA 4OMPA 4AMCA 3L1AA 3VUZA 2FVUA 1XQHA 3JCMh 1NJIR 2A37A 2MAMA 1JO8A 1I1JA 2EYQA 3CCUQ 3TVTA 2KNBB 2RMOA 4J9EA 4OGEA 1VQ4T 4ZGJB 4XU2A 4RG8A 4DEYA 3X24B 1YJNQ 3EHRA 4M75G 2XD0A 2YRDA 3FIFA 1D0YA 3HTRA 4EMGA 1QW1A 4OMQA 1AT1B 2DEQA 1YITT 3OMGA 1C6VX 3OYMA 2PU9B 4JDSA 3A8GB 3ZBDA 1ZX6A 4FYYB 5IT9E 2M51A 1S72Q 4PJOC 1VQ8A 3OYKA 1IGQA 3GPLA 5GANg 5GAMf 5GMKi 1Q95G 4Q5WA 5FLXE 5HK3A 3QZ5B 5GAMg 1AWXA 1OYXA 2XIDA 1SHFA 5GAN4 1JU5C 2RHUA 1VYTA 1PM3A 2HKQB 2DL5A 4K11A 5GJVB 3CCMQ 3HPWA 1VYVA 1K9MU 1TUDA 2EYXA 1JEGA 2DD5A 2FZCB 1PKSA 2KRNA 1TWBA 1VQ7T 2FPDA 4FYVB 4F7UG 1NG2A 5L8RE 2NWMA 2KDSA 3JCMb 3TEEA 4XTXA 3OW2P 3LW5E 3A8OB 2AZVA 2K3YA 2X51A 3EG1A 4IIOA 1NBEB 3DLMA 5IN1A 5D6XA 3CC4Q 3J7AF 5KYNA 1FMKA 1G3WA 1YCSB 2GFAA 4M7DF 2WSFE 3V8JA 2QDYB 3BE3A 3VS6A 8AT1B 1YBYA 2P4TA 2RQUA 4GY5A 5GAMh 4BI3A 3QO3A 4X1VA 4A4FA 4LD6A 3CCST 1LPLA 7AT1B 2HL5C 3CCET 4QVZA 1KHIA 4M78B 2KRMA 1M8MA 3VS7A 2JTFA 1LJOA 3TCJA 3QJ6A 3HKSA 1Y0MA 2J06A 4M78A 1R0BG 1PSEA 4M75C 3L2RA 4HA8A 1OU8A 1N9SA 5J26A 3CCRQ 1G2BA 1KJWA 1YHQT 2LT1A 2HZYA 2LQWA 1EIFA 2EQIA 4FSXA 1T0JA 3LWIA 1V1CA 3OYEA 3NFCA 4QQ6A 1VQ5T 3OYGA 3BDUA 4BI4A 3CC2Q 2DK3A 3A8HB 1UUEA 2GQVA 1GCPA 3G7ZA 1PSFA 1GCQC 1MV3A 1GBQA 1NLOC 3RIRA 5HY6A 4LUDA 2GQIA 3CCJQ 4M77G 3A8LB 3VRYA 3CBMA 3HRUA 2DA9A 5GAN8 2KR3A 5LJ5j 3OYAA 2Y4YA 4A4KA 1BBZA 5IXBA 2RI5A 1YJWT 4P5NA 1M5Q1 2LNHB 1MHNA 2WSEE 2K3BA 2CYZB 4Y28E 2CSIA 3CMAT 1WPYA 5GAN5 4O5VA 1O75A 3TSWA 2HQXA 3I56A 2K9GA 3O5ZA 1IGUA 3M9QA 3EGDB 3P8HA 3RR6A 1AD5A 1LOJA 2XK0A 4F7UF 4ZTFA 4MZPA 4BY6B 2QXFA 2DM1A 2F1LA 4CC4B 1W6XA 1D3BB 1G3YA 2K2MA 3QKJA 1Q86R 3EGDA 1PG5B 3CCLT 1NJIC 1D3BA 2JM8A 1K8AR 1B34B 2RK2A 5CKHA 5IHIA 3KBGA 5C0MA 1MMDA 5FW9A 3GIBA 3CCQT 1TG0A 4CI0C 5GANj 2EVRA 2JXBA 1B34A 1H3HA 3G71T 1Z9QA 2ZPHB 2VGMA 4CC7A 3H6ZA 3EH1A 5I21A 3MEUA 5GMKm 2V8JA 2FRWA 4PK4A 4R0KA 4RTUA 5IXFA 1OEBA 2KAFA 2DXUA 1QVFP 4E7HA 3NTIA 1WNLA 4C92G 5DM7R 2KYMA 2O9VA 4E47A 2D0QB 4KUDK 1K73R 2DIQA 3JCMe 1G83A 3A98A 5DLOA 1RL2A 3S3MA 2M0YA 4OB2B 1VQ6T 1O9SA 1UJYA 1A0NB 2RA2A 4JUVA 3INZA 1ZLMA 4JRKA 3VS4A 3EGXB 3SWNB 3JB9H 2EKOA 3UWNA 1T0HA 2GFUA 2MYSA 3DB3A 3VV0A 1BI1A 1YITQ 3QWXX 2LX7A 2FYKA 2RI3A 3EGXA 3SWNA 1PHTA 2OTLQ 2P0KA 4IUVA 3CCUT 1BI0A 2CP3A 1KC8R 2EQUA 4C5GA 4LNPA 3IQLA 3MKDA 4N0AC 2EPDA 5FWCA 2RJEA 3CEYA 2VXEA 2COYA 5KH6A 1RAGB 3GBQA 2FO0A 3V7CA 2E64A 4LD9K 4WF2A 4II1A 2RPNA 2K3XA 2YWWA 4M7AD 3H8ZA 1AWJA 1BI3A 3Q1JA 4L59A 4C0ZA 2E1HA 1ZA2B 4HCBA 3FC3A 1U1SA 2RJDA 1S72T 2CGHA 3PIOA 2CUBA 1TUCA 2MOXA 3VS1A 3CPWS 1F1BB 1VQMA 1VQ7Q 1CKBA 4ANJA 3UDCA 1YI2A 4LDXA 2CP6A 2QQBA 2ECZA 2EQJA 1VQPA 1ZQ1A 2K57A 4B9WA 2LMJA 3MEAA 2OAUA 1UGVA 3FJPA 2HL3A 3JCMJ 2DKGA 3RMQA 4FU6A 1QWEA 4GLMA 2O31A 4IKFA 1MMGA 1TXQA 2QQRA 2K6DA 3ME9A 1BB9A 4Z8AA 1Q82R 4LN2A 2DEUA 1UTIA 5A0GA 4X34A 1Q7YR 4XK8E 4M7AE 5GANe 5KCHA 5IH2A 2DETA 2D0NA 2KROA 2W10A 4C5HA 1NPPA 3BFMA 1N9RA 5GAMe 1M1KU 4LDWA 2I0NA 2R57A 3GOXA 5CQXA 4C92C 3QG1A 1IO6A 4PJOB 5FROA 3CCEQ 2M9UA 3OYLA 1H3ZA 4AFSC 5IAYA 3M53A 3PGGA 5D6WA 5GAN2 1NM7A 2V8KA 2QEXA 5CR2A 2X3WD 2EW3A 2X4JA 1E7OA 1SG5A 2JS0A 4RTXA 2E3HA 4J9DA 3L42A 4D6WA 2O9SA 3I9QA 4ME7A 4ZNXA 2MMPA 4HKEA 3LH5A 3NMZC 3SDZA 5A0LA 2O88A 4M4ZA 1WHGA 3P8BB 1X01A 3R6NA 1VQ5Q 2JNGA 4JS4A 1ZSZC 1MNDA 1XOVA 4AFZC 2R5MA 3OYCA 4E7ZA 1VQ9A 1JXMA 1Q86C 4F14A 2O4XB 4OB1B 8ATCB 1QVGP 1WXTA 4OMOA 1YJWQ 2PVGB 4KH0B 2BIVA 5CO7A 2EGAA 3CCRT 1K8AC 1EFNA 1XNIA 3D7SB 3OYBA 2O4XA 3CMAQ 2D8HA 2LQKA 3THKA 4OVAA 2RNAA 2XDBA 3CPWA 2J6OA 1WXUA 1M27C 1QCFA 4KGZB 4M78D 4QW2A 1YN8A 2HBPA 3E9GA 2XICA 3J81E 1LNXA 1UECA 4KGXB 2FRYA 3HRSA 2L3QA 2MK5A 3EG0A 4E7SA 3QSUA 2YLCA 2HNIA
chains in the Genus database with same CATH topology
2JN0A 2YRVA 5GAN4 2RHUA 3PT9A 3OMCA 4EMKA 3LGFA 2HD0A 5GANd 4M7AC 3JCMc 5EG2A 2Y90A 4M78F 3OY9A 1VQ9T 4BD3A 5DLQE 1Y96A 4C5EA 5LJ3j 3X28B 1V29B 2XDDA 3G4SA 5GAOm 4E7LA 3HPWA 1K73C 1K9MU 1YJ9A 5CAIA 4M78C 1WJRA 2CS7A 4M78G 4A4GA 4BE0A 2DD5A 3CCSA 1W2BS 1OZ3A 1BIAA 2A7YA 1KQSS 4O6JA 1VQ7T 4HT8A 3MP6A 4F7UG 4Z02A 3OYHA 4L6V5 4DA4A 2RD1A 5L8RE 3RKYA 4M7DD 2ZPGB 3DLLA 2KDSA 4XTWA 3CBPA 4QQDA 3OS2A 3OS0A 3OYDA 3C12A 4C0FA 3TEEA 4VUBA 3JCMb 1VQ8T 4NL2A 4XTXA 3LW5E 1U1TA 3A8OB 3ZEHA 4J6WA 5A0DA 1TH7A 2K3YA 2XIDA 4MMLA 4RCCA 3QXEB 2XHCA 2JTMA 4ATOA 4M78E 1K9MC 3DLMA 5IN1A 2ZZDA 5D6XA 1M90U 3J7AF 3HFNA 1VQLA 2YLCA 3M55A 2I2LA 1G3WA 2K4YA 2LRQA 3ASKA 4RG2A 2GFAA 1KC8C 4M7DF 1IREB 2WSFE 3FDRA 3V8JA 2QDYB 1H641 1YBYA 1YHQA 1QVGS 2P4TA 4GY5A 3CXCA 5GAMh 1YITA 2RM4A 3URGA 4BI3A 5GAMj 2VUBA 4C8QG 3I56T 1KD1U 4M7DG 3QO3A 4PJOA 5LJ5f 2L5QA 4NL3A 2LVMA 3QJYA 1M8VA 1YJ9T 4A4FA 4N4IA 4M75D 2OTLA 5LJ5g 1Y71A 4LD6A 3CCST 2ZGWA 3E9FA 4KBMB 4FL6A 3X26B 2B8AA 1Q86U 2NLUA 3QIIA 1FX7A 2K5LA 4J6YA 3TU4K 3LH0A 4BB7A 3CCET 1VQNA 1WJQA 4QVZA 2E5QA 1KHIA 4M78B 5FRMA 2CZ1B 2LNVA 4M7DE 1K8AU 4ZGDB 5KE3A 3LWHA 4EPCA 4M7AA 4E7IA 2JTFA 1KD1C 3M57A 2HQEA 1WJSA 1LJOA 2MWOA 3TCJA 1G3TA 3RUXA 4J7IA 3QJ6A 4BY6C 3HKSA 3JCMW 3ER0A 2ZPBB 1AHJB 3OBYA 4OF1A 5GMKh 3GNFB 4M78A 5GMKj 1VQLT 2OTJT 1PSEA 4M75C 3L2RA 1Q7YU 4HA8A 4M77D 4HT9A 4PL6A 4MDWA 4GLKA 4HCZA 3PTAA 4J83A 2JVVA 5J39A 1N9SA 2X35A 3FEOA 2H3JA 3P8DA 2ZCFB 2XKOC 5J26A 4B9XA 2R58A 3OYJA 4N4GA 1YHQT 2LT1A 2VXFA 1JJ2A 2QA4T 1EIFA 2MWPA 4FSXA 4XTZA 3OS5A 4IUQA 3LWIA 3L2UA 4FT2A 3OYEA 1VQ7A 3JCMX 2AHJB 3NFCA 3PMIA 1W4SA 4QQ6A 2DXCA 2LX9A 1VQ5T 3OYGA 3OW2A 2DJZA 2RHYA 2LT4A 3QBYA 3V7RA 3BDUA 4LDVA 1Q82C 2OTLT 3UT1A 4L5GA 4BI4A 5GANf 3M59A 4JRPA 2GCXA 1M1FA 2O01E 2DK3A 1JJ2S 1UGRB 3A8HB 4M77F 4M75E 5D6YA 3HSBA 2GQVA 3G7ZA 4LDUA 2YHTA 1PSFA 3QYGB 3CCVA 1Q7YC 4M7DB 1K73U 4MZTA 3HL8A 1YJNT 1VQNT 1BIBA 4M77C 3RIRA 5GAOr 1DJ7B 5HY6A 5AYFA 2QQAA 2YLBA 3OQ5A 4M77G 3A8LB 4R55A 3CBMA 5GAOp 3HRUA 3MEVA 4PNOA 3MP1A 5GAN8 5LJ5h 5GAN7 5LJ5j 2E65A 2KY9A 3OYAA 2L89A 2Y4YA 3JCMV 4A4KA 5I2SA 4BI8B 3CC7T 2DZCA 2RI5A 1YJWT 4P5NA 5CK9A 2HAXA 1M5Q1 1KG1A 1MHNA 4OMFB 2WSEE 4OP0A 2CYZB 4Y28E 3G6EA 2G3RA 4R56A 3CMAT 3LYIA 1WPYA 5GAN5 4O5VA 5DY9A 1W2BA 1NJIU 1O75A 3QHSA 2R5AA 2HQXA 5KCOA 2X4YA 1KQSA 2E12A 4RMOA 4QVCA 3I56A 2WSCE 3JSCA 1RI0A 4M77E 3M9QA 3P8HA 3CPFA 1LOJA 2E6ZA 2XK0A 3GNGA 4F7UF 1MGQA 4ZTFA 2A3LA 4MZPA 1XTDA 5LJ3e 4BY6B 1SSFA 2QXFA 4EDUA 3L2ZA 3E1SA 3E19A 1QVFS 1D3BB 2PVDB 3X20B 5HK0A 2D6FA 1KC8U 4M75B 3CC4A 1G3YA 4UC4A 5GAOq 2ZPIB 3QKJA 3M58A 2VV5A 3QZ9B 4C8QD 3CCEA 3KUFA 3SWNC 3CD6A 1NZ9A 3MCAB 3VU3C 4X9CA 3CCLT 5I2MA 4EMHA 3CCVT 1NJIC 2X4XA 4E7JA 1D3BA 5CCAA 4N4HA 3V8LA 2KMTA 4YTLA 4M75A 1B34B 2RK2A 4OB3B 2EJGA 5CKHA 4C92D 3KBGA 4XAXB 3WVEB 2D9TA 4Y91A 2RK1A 5C0MA 1UGPB 2DZ9A 3CCMT 4ELZC 2KVQG 1WQWA 3HRTA 3CMEA 3GIBA 2M0OA 3CCQT 1QVGA 2OTJA 2F69A 3WVDB 4CI0C 4BDZA 1UGSB 4F7UE 2DTOA 2QQ9A 5GANh 5GANj 4C8QF 4KUIA 3RKXA 2DPPB 4MMKA 4QQGA 3N5BB 1B34A 5FU7B 5C6SA 2RHIA 3G6ET 3G71T 4RCBA 1QVPA 5CKBA 4MDXA 4M77B 1I81A 3S3OA 2ZPHB 2K5FA 2VGMA 2XG8D 3DKMA 4C8QC 3H6ZA 2QA4A 2IVWA 2KSSA 1YIJT 4M7DC 3AHUA 4C92F 2LCLA 2DTIA 3MEUA 5I21A 4KULA 1G5VA 3OS1A 5GMKm 1VQ5A 2V8JA 3CCUA 2PUKB 2RJFA 1I5LA 3M4GA 1JRIA 2KAFA 2DXUA 1HK9A 1X6OA 4NOYA 3SFMA 3NTIA 3EFRA 1WNLA 4NS5A 4C92G 5DM7R 2P0QA 4E7HA 1QP3A 2K5IA 3CC4T 1KHCA 4E47A 3DB4A 2D0QB 4C5IA 1YJNA 1UB4A 3CD6T 3SD4A 4KUDK 1UGQB 1N27A 2DIQA 2EQMA 4XTYA 2XI9A 3ZFJA 4A4EA 4C8QE 2CZ0B 2RHXA 5DLOA 1ZHIA 3JCMe 1RL2A 3FLGA 3S3MA 3CC7A 1N8RU 4OB2B 1YJWA 1VQ6T 1O9SA 2DXTA 4J6XA 4HCCA 4F7UB 2RA2A 4JUVA 3INZA 3M5AA 3RMSA 3VYGA 1VQOA 1U8RA 4JRKA 1Q82U 4C92E 3CMET 3CMAA 3SWNB 5A2QE 4BUGA 2PQWA 3M4YA 3JB9H 2EKOA 1VQKT 3PNWC 3UWNA 4QVDA 2QQSA 1KQ1A 2GFUA 1KQ2A 3M54A 1S72A 5GMKl 3DB3A 3VUBA 3VV0A 5GMKe 3JAME 1N6AA 4JJNK 1BI1A 3L2WA 4F7UA 3JRZA 5LJ3f 4PLLA 3C95A 1UEBA 2FYKA 4IUPA 2RI3A 3JB9F 3SWNA 4JLIA 5FU6B 5LJ3g 3GP8A 3CCJA 4XTVA 2P0KA 1N8RC 2LQ8A 2Y4XA 2WACA 4IUVA 4FM4B 4PKCC 3VJPA 3CCUT 4PJOD 1JB0E 1VUBA 4ZGEB 1BI0A 3I55T 2CZ6B 3JB9G 2EQUA 4C5GA 4N0AC 2CZ7B 4DOVA 5GAN6 2LC4A 2RJEA 3CEYA 3CCLA 2GF7A 3MEWA 4C8QB 2VXEA 5KH6A 5FU7C 3JCMQ 2DTHA 3M56A 3MHXA 3V7CA 2RH2A 2E64A 5LJ3d 2RHZA 3T9NA 4LD9K 3CCMA 3X25B 2QEXT 3S6WA 4WF2A 2BUDA 2IG0A 4C92B 2ZPEB 4IUTA 3CCQA 2EAYA 4II1A 4BE2A 2RB6A 4PJOF 4J5YA 2K3XA 4C8QA 4M7AD 3H8ZA 4XTUA 4M7DA 1BI3A 2JOYA 2P0PA 3Q1JA 4L59A 4C0ZA 1VQOT 2E1HA 4HCBA 3G71A 2V8IA 3FC3A 3QYHB 1VIFA 1U1SA 2RO0A 2E10A 4PJOG 4BACA 1YIJA 2RJDA 3OYFA 3CC2T 2EQKA 4FT4A 1S72T 1QVFA 2CGHA 3A5ZB 2DVEA 3FB9A 4C0DB 4C0GA 3PIOA 4JRQA 1VQMA 1FWZA 5CIUA 3CPWS 4E7KA 4JRIA 2VGNA 3UDCA 1YI2A 2DIGA 2C06A 4LDXA 5CQYA 3QDRB 2QQBA 3V7SA 3CCJT 4ZN3A 3OYIA 4M7AF 3NTHA 5GAOn 2EQJA 1VQPA 1NE8A 1ZQ1A 2VC8A 2E41A 2K57A 2DD4A 2M16A 3OB9A 4B9WA 3JCMP 3MEAA 2OAUA 5CKEA 3CBOA 3FJPA 4RKUE 3EFSA 3JCMf 3L2VA 4PJOE 3WXMB 1P92A 4OB0B 4M7AG 4DQ2A 4XU1A 3JCMJ 1YCYA 2DKGA 3RMQA 4FU6A 2MF2A 5LJ3h 4V2SA 3JCMg 3OSSC 4A4HA 2EFIA 3HHTB 2F5TX 5GAMd 1VQ6A 3RKWA 4IKFA 2JZ2A 1I4K1 1R8OB 1BYMA 2QQRA 3ME9A 3O8VA 2RI2A 5FU6C 3LX7A 4CRIA 1VQKA 1X75C 3EAEA 4OGCA 3PIPA 5A0GA 4BDYA 1M1GA 4X34A 3MO8A 2E6NA 4J7FA 2LDMA 4XK8E 4M7AE 2L8DA 2RJCA 3FRNA 4XU3A 5GANe 5KCHA 1JBMA 2MI6A 1NPRA 3JCMd 3BDLA 4N0AA 4J8OA 4C5HA 1NPPA 3V8KA 2BKDN 1G3SA 3OYYA 3BFMA 1N9RA 1Y07A 3C4SA 3PMTA 5GAMe 2EJ9A 3TREA 4JS5A 1VQMT 1VQ4A 1M1KU 2FB7A 4LDWA 3I55A 1QP2A 2R57A 3GOXA 3OBWA 5CQXA 1YI2T 1M4ZA 3BW1A 3QG1A 3QPHA 2FHDA 4JLGA 4M77A 4X9DA 4C92C 4ELYC 4PJOB 5FROA 5KE2A 2DAQA 2M9UA 5CVIA 3OYLA 1VQPT 3RERA 1H3ZA 5GAOl 2XDPA 2EWNA 5IAYA 3OW2S 4BE1A 3M53A 3MP8A 3BY7A 3A8MB 3PGGA 4FIBA 5D6WA 3JB9I 3L2QA 5J3BA 5GAN2 3R6OA 2V8KA 5LL6S 5M9OA 2QEXA 5CR2A 1GXIE 3CCRA 2X4JA 4C0DC 3JB9D 4EMKC 3META 3G4ST 1Y7XA 2X4WA 3GF5A 2DO3A 1M1KC 2KK4A 3L42A 4D6WA 4ME7A 3CXCS 4LDYA 2F5KA 1BI2A 2MMPA 1FXXA 1HXDA 5CKFA 5FRNA 4M7AB 4XQ3A 4HKEA 2DXBA 1M90C 1WGSA 3F70A 2LCCA 3SDZA 5A0LA 3CC2A 2EJFA 3L1AA 3VUZA 2FVUA 1XQHA 3JCMh 3P8BB 1X01A 2MAMA 4DOWA 2CKKA 2QTXA 2L3RA 3LGLA 2EYQA 2JNGA 4JS4A 3LLRA 5CKDA 1Q81U 2ZPFB 4OGEA 5LJ5d 4M75F 5GAN3 2PVOB 1BKBA 2E70A 4ZGJB 1VQ4T 3VYHB 4XU2A 1XOVA 4RG8A 2R5MA 3UPUA 3OYCA 4A54A 3X24B 5HKCA 3S3NA 4MZMA 3JB9J 4M75G 1OZ2A 3HFOA 1Q86C 1VQ9A 2XD0A 2O4XB 1IZ6A 3FIFA 2QI2A 4OB1B 4EMGA 1QW1A 1I8FA 2EIFA 3VKIA 3PFSA 4ZN1A 2DEQA 2PVGB 4IUUA 3KXTA 1YITT 3J80E 2BIVA 3OMGA 5CO7A 3CCRT 1K8AC 1M9SA 3OYMA 1XNIA 1WQ7A 1ZBXA 3QUIA 3OA6A 4ZTJA 3OYBA 2O4XA 2PU9B 1Q81C 5LJ5e 4JDSA 2LQKA 2K2VA 2PUOB 4OVAA 3A8GB 3ZBDA 1VIEA 2XDBA 3CPWA 5IT9E 2M1HA 4PJOC 3OSVA 1VQ8A 3OYKA 3HP9A 3GPLA 2KQWA 3RESA 5GANg 4M78D 4QW2A 2HBPA 3E9GA 4C92A 2XICA 3J81E 1LNXA 4KT0E 4PLIA 2JUFA 3C94A 5GAMf 5GMKi 4TVRA 3OYNA 2XU8A 4Q5WA 5FLXE 3HRSA 2VYTA 3SB2A 4EMKB 3NTKA 4A53A 4IURA 4XU0A 2LTOA 5HK3A 3QZ5B 5GAMg 3GLXA 2FL7A 3QSUA 1OYXA 1Y96B 1OI1A 2HNIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UGQ B;  4XK8 E;  2AHJ B;  2CZ0 B;  2DXC A;  4OB2 B;  2O01 E;  3VYG A;  1UGR B;  3A8H B;  3X28 B;  1V29 B;  3QYG B;  1PSF A;  1QP2 A;  2DD5 A;  1DJ7 B;  3A8L B;  3A8M B;  4L6V 5;  5L8R E;  2WSE E;  2ZPG B;  2CYZ B;  4Y28 E;  1GXI E;  4FM4 B;  1JB0 E;  3LW5 E;  4ZGE B;  3A8O B;  2CZ6 B;  2CZ7 B;  3QXE B;  2WSC E;  2DXB A;  2ZZD A;  2PVD B;  1IRE B;  2WSF E;  3X20 B;  3X25 B;  2ZPE B;  2QDY B;  2ZPI B;  3QZ9 B;  2ZPF B;  2PVO B;  4ZGJ B;  3VYH B;  3QYH B;  4OB3 B;  3X24 B;  3WVE B;  1UGP B;  4OB1 B;  3X26 B;  3WVD B;  1UGS B;  2PVG B;  2DPP B;  2CZ1 B;  2DD4 A;  4ZGD B;  2ZPH B;  2PU9 B;  4RKU E;  2PUO B;  3A8G B;  4OB0 B;  2ZPB B;  1AHJ B;  2PUK B;  3HHT B;  1PSE A;  4KT0 E;  1QP3 A;  2ZCF B;  3QZ5 B;  2D0Q B; 
#chains in the Genus database with same CATH topology
 2W0Z A;  3PT9 A;  3OMC A;  3CCL Q;  3M0S A;  2HD0 A;  2HDA A;  2H8H A;  4C5E A;  1V29 B;  1E6H A;  1K73 C;  1YJ9 A;  2QDL A;  5CAI A;  3CCQ Q;  1X6B A;  1FYN A;  1N8R R;  1WJR A;  2CS7 A;  4BE0 A;  1OZ3 A;  4HT8 A;  3G71 Q;  4Z02 A;  3OYH A;  4L6V 5;  2RD1 A;  3DLL A;  1YNZ A;  1KFZ A;  3OS2 A;  3OS0 A;  2V26 A;  3C12 A;  4NL2 A;  1U1T A;  2KYB A;  2DL7 A;  4J9F A;  4J6W A;  3ZEH A;  1TH7 A;  4MML A;  4RCC A;  3RDV A;  2A36 A;  2XHC A;  2JTM A;  3H0H A;  4M78 E;  2CP7 A;  2ZZD A;  1M30 A;  4LXC A;  1VQL A;  1IB8 A;  4KGV B;  2JJ9 A;  2LRQ A;  3ASK A;  4ESR A;  1KC8 C;  2QAS A;  2DJQ A;  3FDR A;  1H64 1;  5FWB A;  2CP5 A;  2DL3 A;  1QVG S;  1VQ6 Q;  2A28 A;  3I56 T;  3VS2 A;  4M7D G;  5LJ5 f;  4NL3 A;  3QJY A;  3QWY A;  1RAH B;  5LJ5 g;  2OX7 A;  4FYW B;  2ZGW A;  3VS3 A;  4KBM B;  1BCM A;  3QII A;  3EHQ A;  1C1A A;  1FX7 A;  2K5L A;  4J6Y A;  3TU4 K;  3LH0 A;  5KYU B;  1VQN A;  2E5Q A;  5FRM A;  2J6F A;  4ZGD B;  4M7A A;  4EPC A;  1WJS A;  2MWO A;  1OUL A;  1G3T A;  5KYU A;  3ER0 A;  2ZPB B;  2GGR A;  3OBY A;  1I07 A;  4OF1 A;  4Z88 A;  5GMK j;  1OX9 A;  2NYS A;  1T3S A;  1IXD A;  4MDW A;  4GLK A;  3PTA A;  4J83 A;  1W70 A;  4QKU A;  2M02 A;  3FEO A;  2DLP A;  1BK2 A;  1WIE A;  3L2U A;  3OS5 A;  4IUQ A;  4FT2 A;  1UHC A;  2AHJ B;  3JCM X;  3PMI A;  2DXC A;  2LT4 A;  1Y57 A;  4LDV A;  1Q82 C;  1WYX A;  3UT1 A;  4L5G A;  2VVK A;  5GAN f;  2OTL T;  1ARK A;  1AWO A;  4DBF A;  2GNC A;  2YXY A;  2YHT A;  1Q7Y C;  1K4U S;  4FW2 A;  5GAO r;  5AYF A;  3OQ5 A;  1M3A A;  3MEV A;  1TU0 B;  3MP1 A;  5LJ5 h;  3JCM V;  5I2S A;  2DZC A;  2HAX A;  4OMF B;  4OP0 A;  1CSK A;  1T3L A;  2BTT A;  1M2O A;  1NJI U;  2RQR A;  2R5A A;  2X4Y A;  2E12 A;  4QVC A;  2WSC E;  1RI0 A;  1J3T A;  3L2Z A;  4RTW A;  4E6R A;  2PVD B;  1WZO A;  1K9A A;  3CC4 A;  1VQ8 Q;  1RAI B;  1X2Q A;  1TS9 A;  3CD6 A;  2A0F B;  4X9C A;  2HCK A;  3CCV T;  4E7J A;  5CCA A;  4N4H A;  3WVE B;  1Q81 R;  4Y91 A;  2KVQ G;  3HRT A;  3CME A;  2M0O A;  1QVG A;  2OTJ A;  4J9C A;  2DTO A;  2QQ9 A;  5GAN h;  3RKX A;  2DPP B;  3N5B B;  3G6E T;  5C6S A;  2RHI A;  4M77 B;  2XG8 D;  2QA4 A;  2KSS A;  4M7D C;  3AHU A;  2JMC A;  2PUK B;  3I5R A;  2DNU A;  3EFR A;  4NS5 A;  3M0Q A;  1M2V B;  1WHJ A;  2K5I A;  2O2O A;  2RQV A;  2L3P A;  1UE9 A;  1UFF A;  1UB4 A;  1UGQ B;  3M0R A;  2EQM A;  2FPF A;  1ZHI A;  1M2V A;  3CC7 A;  1H8K A;  1OOT A;  2COW A;  4WCI A;  4J6X A;  1PRM C;  2K79 A;  1U8R A;  1WI7 A;  2ENM A;  2J05 A;  1LVK A;  1RLQ C;  4BUG A;  2PQW A;  2DMO A;  4PJJ A;  1SKU B;  4QVD A;  3VUB A;  5GMK e;  1N6A A;  1TTH B;  1SEM A;  2EGE A;  3JRZ A;  3C95 A;  4JZ4 A;  1OQK A;  9ATC B;  3JB9 F;  4JLI A;  3CCJ A;  3GP8 A;  1N8R C;  1TOV A;  1WHK A;  4PJO D;  1QCN A;  3NHN A;  2VWF A;  4QT7 A;  2CZ6 B;  2IPO B;  2COZ A;  3I5S A;  1AEY A;  2LC4 A;  4C8Q B;  5FU7 C;  2RN8 A;  2HBW A;  3JCM Q;  3M56 A;  3MHX A;  5LJ3 d;  3T9N A;  3X25 B;  2QEX T;  3S6W A;  2IG0 A;  4C92 B;  4BE2 A;  2EAY A;  2RB6 A;  1FMV A;  4CC2 A;  4C8Q A;  4XTU A;  2JOY A;  1VQO T;  1GFC A;  3QYH B;  2E10 A;  4AT1 B;  2QGF B;  1YIJ A;  1PD1 A;  2AKL A;  1SRM A;  3A5Z B;  2DVE A;  3FB9 A;  6AT1 B;  1KD1 R;  4E7K A;  4JRI A;  2DIG A;  3REB B;  4M7A F;  1NE8 A;  4PJL A;  2E41 A;  3OB9 A;  4AG1 C;  1UJ0 A;  2NUP B;  4PJO E;  3EFS A;  4OB0 B;  1IHV A;  2MF2 A;  5KYX B;  2V1R A;  1ZSZ B;  1N5Z A;  1SPK A;  2F5T X;  5EC7 A;  3RKW A;  5GAM d;  1B07 A;  1BYM A;  2NUP A;  1I0C A;  1HD3 A;  1VQK A;  3EAE A;  4OGC A;  4J9H A;  3MO8 A;  2LDM A;  1EX4 A;  2RJC A;  3FRN A;  3I56 Q;  3I35 A;  5GJW B;  3BDL A;  4E2F B;  4J8O A;  3CPW P;  2LCS A;  2CUD A;  1VQ4 A;  2EJ9 A;  2VAS A;  3I55 A;  1QP2 A;  1UDL A;  1M4Z A;  2KBT A;  3BW1 A;  3QPH A;  4ELY C;  1VOM A;  2DAQ A;  3M0T A;  3RER A;  3ULR B;  4BE1 A;  3BY7 A;  2IIM A;  3JB9 I;  3L2Q A;  5D7U A;  1D1A A;  4WTO B;  3KFV A;  3JB9 D;  4DBR A;  3MET A;  2X4W A;  3GF5 A;  1PC0 A;  2NUT B;  4DEX A;  4LDY A;  2F5K A;  1FXX A;  3MJX A;  3F70 A;  2LCC A;  2E5K A;  1GRI A;  1EZZ B;  2CP0 A;  2Z0W A;  2NUT A;  1QQJ A;  2DRM A;  2DIL A;  2L3R A;  2DF6 A;  1M3C A;  3LLR A;  5CKD A;  2PVO B;  2E70 A;  2ED0 A;  2CT4 A;  1WFW A;  3S3N A;  4MZM A;  5ECA A;  3HFO A;  1NYF A;  1IZ6 A;  2QI2 A;  2EIF A;  3PFS A;  3UA7 A;  4JZ3 A;  2J6K A;  3J80 E;  1WQ7 A;  1ZBX A;  1C0M A;  2HEQ A;  1Q81 C;  5LJ5 e;  2HMA A;  1R0C B;  3PVQ A;  2M1H A;  3EG9 B;  1MMA A;  3RES A;  2JUF A;  2DL4 A;  2XU8 A;  4EMK B;  2VYT A;  3NTK A;  4A53 A;  4XU0 A;  2LP5 A;  1RLP C;  1HSQ A;  1QKW A;  2NUZ A;  2JN0 A;  2YRV A;  2ED1 A;  2F2V A;  4EMK A;  3CCV Q;  3JCM c;  5EG2 A;  2Y90 A;  4M78 F;  3OY9 A;  4PJM A;  5IHN A;  4BD3 A;  5DLQ E;  2C0O A;  2XDD A;  3G4S A;  5GAO m;  4M78 C;  4A4G A;  3CCS A;  1W2B S;  1WDX A;  1BIA A;  2JM9 A;  2A7Y A;  4O6J A;  3EGU A;  3G6E Q;  2KGT A;  1AZG B;  1WHM A;  2JT4 A;  3MPU B;  4DA4 A;  1RI9 A;  2EGC A;  2K7A A;  2DER A;  3CBP A;  4QQD A;  3OYD A;  4C0F A;  1VQ8 T;  2JMA A;  1D1C A;  5A0D A;  1YI2 Q;  3QXE B;  3RNJ A;  4ORZ A;  1X69 A;  1M90 U;  1K76 A;  3HFN A;  2L2P A;  2K4Y A;  4RG2 A;  4B6M A;  1IRE B;  5AT1 B;  3U23 A;  2EYY A;  1YHQ A;  4HVW A;  2RM4 A;  1TSF A;  3URG A;  5I22 A;  2VUB A;  1MV0 B;  4PJO A;  1D1B A;  2GTO A;  3UA6 A;  2LVM A;  1M8V A;  4N4I A;  2DRK A;  3E9F A;  1ZSG A;  3X26 B;  2B8A A;  2PNI A;  1WJQ A;  2MCN A;  1KK7 A;  2BE7 D;  2CZ1 B;  2LZ6 B;  3LWH A;  2CSQ A;  5KE3 A;  1KD1 C;  3M57 A;  2QYZ A;  1WXB A;  4BY6 C;  1AHJ B;  3EG3 A;  4EIK A;  5GMK h;  3GNF B;  2OTJ T;  2XMF A;  1Q7Y U;  4M77 D;  3M0U A;  4LUE A;  4PL6 A;  4HCZ A;  2JVV A;  2X35 A;  2QEX Q;  1UHF A;  1X6G A;  3H41 A;  3OYJ A;  1JJ2 A;  2QA4 T;  2MWP A;  1VQO Q;  1W4S A;  2LX9 A;  2DJZ A;  3QBY A;  1M1F A;  2O01 E;  1UGR B;  4LDU A;  4M7D B;  1QWF A;  2OAW A;  2YUQ A;  1DJ7 B;  2YLB A;  2QGG A;  5GAN 7;  4PNO A;  2E65 A;  3CC7 T;  1U06 A;  2C0T A;  1K0X A;  2KRS A;  3UAT A;  1VQ9 Q;  2G3R A;  2QTV A;  2AKK A;  4JPB W;  1W2B A;  3QHS A;  5KCO A;  4M77 E;  3CPF A;  2E6Z A;  3GNG A;  1MGQ A;  2A3L A;  1XTD A;  1SSF A;  4EDU A;  5HK0 A;  2D6F A;  4M75 B;  2SEM A;  5GAO q;  3M58 A;  3VRZ A;  4C8Q D;  3KUF A;  3SWN C;  4FCY A;  2YSQ A;  1QMC A;  3MCA B;  3VU3 C;  1RAA B;  1QCO A;  4YTL A;  4M75 A;  4C92 D;  2EJG A;  3RBB B;  4XAX B;  2DE0 X;  2D9T A;  2KE9 A;  2RK1 A;  2KXC A;  4D8D A;  4ELZ C;  1VA7 A;  2F69 A;  3A1P A;  3WVD B;  1UGS B;  3NPF A;  4MMK A;  5FU7 B;  4RTV A;  4RCB A;  1QVP A;  1I81 A;  3S3O A;  1M3B A;  2K5F A;  3DKM A;  1YIJ T;  1YJ9 Q;  2LCL A;  2DTI A;  2KEA A;  4KUL A;  1G5V A;  3CCU A;  2KXD A;  1GCQ A;  2MIO A;  2RJF A;  1I5L A;  1JRI A;  2ROL A;  1HK9 A;  1X6O A;  4NOY A;  3SFM A;  2HQH A;  3QDF A;  1QP3 A;  1KHC A;  3DB4 A;  2CH4 A;  4C5I A;  1YJN A;  5IHK A;  3SD4 A;  2HSP A;  4XTY A;  2XI9 A;  3ZFJ A;  4A4E A;  4C8Q E;  2CZ0 B;  3EH2 A;  1ZUY A;  3FLG A;  2SRC A;  1N8R U;  4HCC A;  4F7U B;  1VQL Q;  3RMS A;  3VYG A;  4C92 E;  5A2Q E;  1U5S A;  1VQK T;  1KQ1 A;  1KQ2 A;  4Z89 A;  3M54 A;  1S72 A;  3JAM E;  4RTT A;  4JJN K;  2VKN A;  3L2W A;  4F7U A;  5LJ3 f;  4PLL A;  1I5O B;  1K9M R;  2JW4 A;  5KYY B;  2AZS A;  5LJ3 g;  4XTV A;  2RQT A;  2DBM A;  1D0X A;  4FM4 B;  4PKC C;  2P4R A;  4ZGE B;  1VUB A;  4OMM A;  3I55 T;  3JB9 G;  2EKH A;  3AT1 B;  2FZK B;  4DOV A;  1VQN Q;  5KYY A;  2X3X D;  2GTJ A;  2DTH A;  2YUN A;  2RH2 A;  2LJ0 A;  2RHZ A;  1OU9 A;  3CCM A;  2AIR B;  2ZPE B;  4PJO F;  4J5Y A;  4JJB A;  1MMN A;  3CXC P;  4RUG A;  1QKX A;  2EYZ A;  2F2W A;  1WX6 A;  4AG2 C;  4BAC A;  2EQK A;  4JJC A;  2VGN A;  2V1Q A;  1X43 A;  5CQY A;  2E3I A;  3V7S A;  4ZN3 A;  2M16 A;  2DD4 A;  1NLP C;  1OX8 A;  2ZAE A;  1YWP A;  3CBO A;  3H9N A;  4RKU E;  4M7A G;  4DQ2 A;  2DFU A;  4XU1 A;  1YCY A;  2QK0 A;  5LJ3 h;  2HSE B;  3OSS C;  4A4H A;  1RUW A;  3HHT B;  1RAE B;  1OPL A;  3M0P A;  5FU6 C;  2HKN A;  3LX7 A;  1OV3 A;  3VS0 A;  2CRE A;  4FSS A;  1X75 C;  1MUZ A;  4BDY A;  1NEB A;  3EFO B;  2L0A A;  3E2U A;  2L8D A;  1NPR A;  3JCM d;  1JXO A;  4N0A A;  1KIK A;  1G3S A;  5I11 A;  1Y07 A;  1VQM T;  3EFO A;  3VS5 A;  1KSW A;  2FB7 A;  1YI2 T;  3H0F A;  3UF4 A;  4JLG A;  4M77 A;  4X9D A;  5KE2 A;  1VQP T;  1VYU A;  3CD6 Q;  2EWN A;  1FMW A;  3MP8 A;  4FIB A;  1WA7 A;  2FG0 A;  5J3B A;  5M9O A;  2E4H A;  2DL8 A;  1GXI E;  3CCR A;  2CH4 W;  4C0D C;  1X27 A;  3G4S T;  1Y7X A;  3CME Q;  1PKT A;  2OTJ Q;  2A08 A;  1KQS P;  2KK4 A;  3CXC S;  5CKF A;  1WHH A;  2DXB A;  1WGS A;  3CC2 A;  1X2K A;  2EJF A;  2QA4 Q;  1Z9Z A;  2OJ2 A;  2MPX C;  2FZG B;  4DOW A;  2CKK A;  2QTX A;  3LGL A;  3REA B;  1Q81 U;  2ZPF B;  5LJ5 d;  4M75 F;  5GAN 3;  1BKB A;  3VYH B;  4PJN A;  1IHW A;  3UPU A;  1K1Z A;  4A54 A;  5HKC A;  3JB9 J;  1OZ2 A;  4DBH A;  2BZX A;  4F17 A;  1I8F A;  1PRL C;  3VKI A;  4ZN1 A;  3CC7 Q;  4IUU A;  3KXT A;  1M9S A;  3OA6 A;  3QUI A;  4ZTJ A;  1ACM B;  4OML A;  3TSZ A;  2DX1 A;  2K2V A;  2PUO B;  1VIE A;  1G8X A;  3OSV A;  3HP9 A;  2KQW A;  4C92 A;  3OW2 S;  4KT0 E;  4RTY A;  4PLI A;  3C94 A;  1KG1 A;  4TVR A;  4F16 A;  3OYN A;  1PWT A;  3SB2 A;  3JV3 A;  3FJ5 A;  4IUR A;  2LTO A;  1HYO A;  3GLX A;  2BE9 B;  2FL7 A;  1Y96 B;  1OI1 A;  3OYI A;  2YUP A;  3ZL7 C;  2OI3 A;  2CT3 A;  3LGF A;  4M7A C;  5GAN d;  1U3O A;  1VQ9 T;  1RAD B;  1Y96 A;  2DVJ A;  5LJ3 j;  2LJ3 A;  3X28 B;  4E7L A;  2P84 A;  4J9I A;  4M78 G;  4HVV A;  1KQS S;  2EYW A;  2H3E B;  3MP6 A;  4FW1 A;  4DBQ A;  1JJ2 P;  5KYX A;  1ZSZ A;  3RKY A;  1YIJ Q;  2ZPG B;  4M7D D;  2JS2 A;  4XTW A;  1TUG B;  4VUB A;  1SRL A;  2ATC B;  4ATO A;  1K9M C;  1JQQ A;  3M55 A;  2ABL A;  2I2L A;  4J9G A;  5L23 A;  1NYG A;  4HCK A;  3CXC A;  1W1F A;  1YIT A;  5GAM j;  4C8Q G;  1KD1 U;  2L5Q A;  2JTE A;  4CC3 A;  1YJ9 T;  1WHL A;  1W2B P;  1VQK Q;  4M75 D;  2OTL A;  1Y71 A;  4AFU C;  2D1X A;  4FL6 A;  2YDL A;  1Q86 U;  2NLU A;  1PCX A;  1R77 A;  4BB7 A;  2RF0 A;  1XJW B;  3H0I A;  1BCO A;  2LNV A;  4M7D E;  1K8A U;  1VQ4 Q;  1ZA1 B;  4E7I A;  3I55 Q;  2HQE A;  4HXJ A;  3RUX A;  4J7I A;  2PZ1 A;  3JCM W;  4KRT A;  3NGP A;  1VQL T;  1B7T A;  4HT9 A;  1AZE A;  4J9B A;  5J39 A;  2PTK A;  3P8D A;  2H3J A;  2ZCF B;  2XKO C;  1ZUK A;  4B9X A;  4OMN A;  2R58 A;  4N4G A;  2VXF A;  4XTZ A;  1VQ7 A;  4RTZ A;  1H92 A;  3OW2 A;  2RHY A;  3V7R A;  3TQ7 P;  4JRP A;  3M59 A;  1JJ2 S;  2GCX A;  1AOJ A;  4M77 F;  4M75 E;  5D6Y A;  3HSB A;  1WLP B;  3CCV A;  3QYG B;  2FEI A;  1K73 U;  4MZT A;  3HL8 A;  1YJN T;  1VQN T;  1BIB A;  4M77 C;  2C0I A;  2QQA A;  4R55 A;  5GAO p;  4PFP A;  1B3Q A;  2KY9 A;  2L89 A;  1M1K R;  4BI8 B;  3EG9 A;  5CK9 A;  1M90 R;  3G6E A;  1IRX A;  4R56 A;  3LYI A;  4KH1 B;  1CKA A;  5DY9 A;  1KQS A;  4JJD A;  4RMO A;  1BU1 A;  1PD0 A;  3JSC A;  1UG1 A;  2RQW A;  5LJ3 e;  3E1S A;  1HJD A;  3E19 A;  1QVF S;  3X20 B;  2QG9 B;  1KC8 U;  4UC4 A;  2ZPI B;  4IIM A;  2VV5 A;  3QZ9 B;  1MNE A;  1OPK A;  4PFZ A;  3CCE A;  1ABQ A;  1NZ9 A;  5I2M A;  1RAB B;  1VQM Q;  4EMH A;  2X4X A;  1SSH A;  3V8L A;  2KMT A;  3G1J A;  2B86 A;  4OB3 B;  2DYI A;  2KI7 A;  4Y92 A;  3CCM T;  1UGP B;  2DZ9 A;  1VQP Q;  1YP5 A;  1WQW A;  2LJ1 A;  4BDZ A;  4F7U E;  2YT6 A;  1GBR A;  4C8Q F;  4KUI A;  2DYB A;  4QQG A;  1SF9 A;  4MDX A;  5CKB A;  3G4S Q;  4C8Q C;  2IVW A;  4C92 F;  3CCS Q;  2G6F X;  3OS1 A;  1VQ5 A;  3M4G A;  2LQN A;  2P0Q A;  1GFD A;  3CC4 T;  2KT8 A;  2X9H A;  2ESW A;  2AT1 B;  3CD6 T;  2CP2 A;  1N27 A;  5KYW B;  1S1N A;  2RHX A;  1YJW A;  2FPE A;  2F2X A;  4FYX B;  2DXT A;  3SEM A;  1Q82 U;  1VQO A;  3M5A A;  2GBQ A;  3CME T;  3CMA A;  5KYW A;  3M4Y A;  3PNW C;  2QQS A;  2D8J A;  5GMK l;  1YHQ Q;  1ZBJ A;  1UEB A;  4IUP A;  2YUO A;  5FU6 B;  2LQ8 A;  2Y4X A;  2WAC A;  1RAC B;  3VJP A;  1JB0 E;  1RAF B;  2CZ7 B;  5GAN 6;  1GL5 A;  3CCL A;  2GF7 A;  2YRC A;  3MEW A;  1NEG A;  2DBK A;  4PFO A;  2VB6 A;  2QAZ A;  2BUD A;  4IUT A;  3CCQ A;  1AVZ C;  1ABO A;  4M7D A;  3EG2 A;  2P0P A;  3G71 A;  2V8I A;  1VIF A;  4PJO G;  2RO0 A;  1YWO A;  3OYF A;  3CC2 T;  4FT4 A;  1QVF A;  3SHW A;  4C0D B;  4C0G A;  3PVL A;  4JRQ A;  1FWZ A;  5CIU A;  2KT1 A;  2C06 A;  3QDR B;  3CCJ T;  1K0S A;  3NTH A;  2BZY A;  5GAO n;  5HCK A;  1AWW A;  2VC8 A;  3JCM P;  2CDT A;  5CKE A;  2L3S A;  3JCM f;  2ROT A;  3L2V A;  3WXM B;  1P92 A;  4A63 B;  4V2S A;  3JCM g;  1LCK A;  2EFI A;  1VQ6 A;  2JZ2 A;  2AK5 A;  1I4K 1;  1D0Z A;  1R8O B;  3O8V A;  1D09 B;  2RI2 A;  1YFN A;  4CRI A;  2EBP A;  3PIP A;  1M1G A;  2E6N A;  4J7F A;  1QLY A;  4XU3 A;  1JBM A;  2MI6 A;  1E6G A;  3V8K A;  1PNJ A;  2BKD N;  3OYY A;  3C4S A;  4JS5 A;  3PMT A;  3TRE A;  1V76 A;  3OBW A;  2FHD A;  1ZUU A;  4HVU A;  4AFQ C;  5CVI A;  5GAO l;  2XDP A;  4D8K A;  2J7I A;  3A8M B;  1SHG A;  4LE9 A;  3R6O A;  5LL6 S;  4F04 B;  2BZ8 A;  4EMK C;  4GBQ A;  2DO3 A;  3PE0 A;  1M1K C;  3C0C A;  1BI2 A;  1HXD A;  5FRN A;  4M7A B;  4XQ3 A;  1M90 C;  3CQT A;  4OMP A;  4AMC A;  3L1A A;  3VUZ A;  2FVU A;  1XQH A;  3JCM h;  1NJI R;  2A37 A;  2MAM A;  1JO8 A;  1I1J A;  2EYQ A;  3CCU Q;  3TVT A;  2KNB B;  2RMO A;  4J9E A;  4OGE A;  1VQ4 T;  4ZGJ B;  4XU2 A;  4RG8 A;  4DEY A;  3X24 B;  1YJN Q;  3EHR A;  4M75 G;  2XD0 A;  2YRD A;  3FIF A;  1D0Y A;  3HTR A;  4EMG A;  1QW1 A;  4OMQ A;  1AT1 B;  2DEQ A;  1YIT T;  3OMG A;  1C6V X;  3OYM A;  2PU9 B;  4JDS A;  3A8G B;  3ZBD A;  1ZX6 A;  4FYY B;  5IT9 E;  2M51 A;  1S72 Q;  4PJO C;  1VQ8 A;  3OYK A;  1IGQ A;  3GPL A;  5GAN g;  5GAM f;  5GMK i;  1Q95 G;  4Q5W A;  5FLX E;  5HK3 A;  3QZ5 B;  5GAM g;  1AWX A;  1OYX A;  2XID A;  1SHF A;  5GAN 4;  1JU5 C;  2RHU A;  1VYT A;  1PM3 A;  2HKQ B;  2DL5 A;  4K11 A;  5GJV B;  3CCM Q;  3HPW A;  1VYV A;  1K9M U;  1TUD A;  2EYX A;  1JEG A;  2DD5 A;  2FZC B;  1PKS A;  2KRN A;  1TWB A;  1VQ7 T;  2FPD A;  4FYV B;  4F7U G;  1NG2 A;  5L8R E;  2NWM A;  2KDS A;  3JCM b;  3TEE A;  4XTX A;  3OW2 P;  3LW5 E;  3A8O B;  2AZV A;  2K3Y A;  2X51 A;  3EG1 A;  4IIO A;  1NBE B;  3DLM A;  5IN1 A;  5D6X A;  3CC4 Q;  3J7A F;  5KYN A;  1FMK A;  1G3W A;  1YCS B;  2GFA A;  4M7D F;  2WSF E;  3V8J A;  2QDY B;  3BE3 A;  3VS6 A;  8AT1 B;  1YBY A;  2P4T A;  2RQU A;  4GY5 A;  5GAM h;  4BI3 A;  3QO3 A;  4X1V A;  4A4F A;  4LD6 A;  3CCS T;  1LPL A;  7AT1 B;  2HL5 C;  3CCE T;  4QVZ A;  1KHI A;  4M78 B;  2KRM A;  1M8M A;  3VS7 A;  2JTF A;  1LJO A;  3TCJ A;  3QJ6 A;  3HKS A;  1Y0M A;  2J06 A;  4M78 A;  1R0B G;  1PSE A;  4M75 C;  3L2R A;  4HA8 A;  1OU8 A;  1N9S A;  5J26 A;  3CCR Q;  1G2B A;  1KJW A;  1YHQ T;  2LT1 A;  2HZY A;  2LQW A;  1EIF A;  2EQI A;  4FSX A;  1T0J A;  3LWI A;  1V1C A;  3OYE A;  3NFC A;  4QQ6 A;  1VQ5 T;  3OYG A;  3BDU A;  4BI4 A;  3CC2 Q;  2DK3 A;  3A8H B;  1UUE A;  2GQV A;  1GCP A;  3G7Z A;  1PSF A;  1GCQ C;  1MV3 A;  1GBQ A;  1NLO C;  3RIR A;  5HY6 A;  4LUD A;  2GQI A;  3CCJ Q;  4M77 G;  3A8L B;  3VRY A;  3CBM A;  3HRU A;  2DA9 A;  5GAN 8;  2KR3 A;  5LJ5 j;  3OYA A;  2Y4Y A;  4A4K A;  1BBZ A;  5IXB A;  2RI5 A;  1YJW T;  4P5N A;  1M5Q 1;  2LNH B;  1MHN A;  2WSE E;  2K3B A;  2CYZ B;  4Y28 E;  2CSI A;  3CMA T;  1WPY A;  5GAN 5;  4O5V A;  1O75 A;  3TSW A;  2HQX A;  3I56 A;  2K9G A;  3O5Z A;  1IGU A;  3M9Q A;  3EGD B;  3P8H A;  3RR6 A;  1AD5 A;  1LOJ A;  2XK0 A;  4F7U F;  4ZTF A;  4MZP A;  4BY6 B;  2QXF A;  2DM1 A;  2F1L A;  4CC4 B;  1W6X A;  1D3B B;  1G3Y A;  2K2M A;  3QKJ A;  1Q86 R;  3EGD A;  1PG5 B;  3CCL T;  1NJI C;  1D3B A;  2JM8 A;  1K8A R;  1B34 B;  2RK2 A;  5CKH A;  5IHI A;  3KBG A;  5C0M A;  1MMD A;  5FW9 A;  3GIB A;  3CCQ T;  1TG0 A;  4CI0 C;  5GAN j;  2EVR A;  2JXB A;  1B34 A;  1H3H A;  3G71 T;  1Z9Q A;  2ZPH B;  2VGM A;  4CC7 A;  3H6Z A;  3EH1 A;  5I21 A;  3MEU A;  5GMK m;  2V8J A;  2FRW A;  4PK4 A;  4R0K A;  4RTU A;  5IXF A;  1OEB A;  2KAF A;  2DXU A;  1QVF P;  4E7H A;  3NTI A;  1WNL A;  4C92 G;  5DM7 R;  2KYM A;  2O9V A;  4E47 A;  2D0Q B;  4KUD K;  1K73 R;  2DIQ A;  3JCM e;  1G83 A;  3A98 A;  5DLO A;  1RL2 A;  3S3M A;  2M0Y A;  4OB2 B;  1VQ6 T;  1O9S A;  1UJY A;  1A0N B;  2RA2 A;  4JUV A;  3INZ A;  1ZLM A;  4JRK A;  3VS4 A;  3EGX B;  3SWN B;  3JB9 H;  2EKO A;  3UWN A;  1T0H A;  2GFU A;  2MYS A;  3DB3 A;  3VV0 A;  1BI1 A;  1YIT Q;  3QWX X;  2LX7 A;  2FYK A;  2RI3 A;  3EGX A;  3SWN A;  1PHT A;  2OTL Q;  2P0K A;  4IUV A;  3CCU T;  1BI0 A;  2CP3 A;  1KC8 R;  2EQU A;  4C5G A;  4LNP A;  3IQL A;  3MKD A;  4N0A C;  2EPD A;  5FWC A;  2RJE A;  3CEY A;  2VXE A;  2COY A;  5KH6 A;  1RAG B;  3GBQ A;  2FO0 A;  3V7C A;  2E64 A;  4LD9 K;  4WF2 A;  4II1 A;  2RPN A;  2K3X A;  2YWW A;  4M7A D;  3H8Z A;  1AWJ A;  1BI3 A;  3Q1J A;  4L59 A;  4C0Z A;  2E1H A;  1ZA2 B;  4HCB A;  3FC3 A;  1U1S A;  2RJD A;  1S72 T;  2CGH A;  3PIO A;  2CUB A;  1TUC A;  2MOX A;  3VS1 A;  3CPW S;  1F1B B;  1VQM A;  1VQ7 Q;  1CKB A;  4ANJ A;  3UDC A;  1YI2 A;  4LDX A;  2CP6 A;  2QQB A;  2ECZ A;  2EQJ A;  1VQP A;  1ZQ1 A;  2K57 A;  4B9W A;  2LMJ A;  3MEA A;  2OAU A;  1UGV A;  3FJP A;  2HL3 A;  3JCM J;  2DKG A;  3RMQ A;  4FU6 A;  1QWE A;  4GLM A;  2O31 A;  4IKF A;  1MMG A;  1TXQ A;  2QQR A;  2K6D A;  3ME9 A;  1BB9 A;  4Z8A A;  1Q82 R;  4LN2 A;  2DEU A;  1UTI A;  5A0G A;  4X34 A;  1Q7Y R;  4XK8 E;  4M7A E;  5GAN e;  5KCH A;  5IH2 A;  2DET A;  2D0N A;  2KRO A;  2W10 A;  4C5H A;  1NPP A;  3BFM A;  1N9R A;  5GAM e;  1M1K U;  4LDW A;  2I0N A;  2R57 A;  3GOX A;  5CQX A;  4C92 C;  3QG1 A;  1IO6 A;  4PJO B;  5FRO A;  3CCE Q;  2M9U A;  3OYL A;  1H3Z A;  4AFS C;  5IAY A;  3M53 A;  3PGG A;  5D6W A;  5GAN 2;  1NM7 A;  2V8K A;  2QEX A;  5CR2 A;  2X3W D;  2EW3 A;  2X4J A;  1E7O A;  1SG5 A;  2JS0 A;  4RTX A;  2E3H A;  4J9D A;  3L42 A;  4D6W A;  2O9S A;  3I9Q A;  4ME7 A;  4ZNX A;  2MMP A;  4HKE A;  3LH5 A;  3NMZ C;  3SDZ A;  5A0L A;  2O88 A;  4M4Z A;  1WHG A;  3P8B B;  1X01 A;  3R6N A;  1VQ5 Q;  2JNG A;  4JS4 A;  1ZSZ C;  1MND A;  1XOV A;  4AFZ C;  2R5M A;  3OYC A;  4E7Z A;  1VQ9 A;  1JXM A;  1Q86 C;  4F14 A;  2O4X B;  4OB1 B;  8ATC B;  1QVG P;  1WXT A;  4OMO A;  1YJW Q;  2PVG B;  4KH0 B;  2BIV A;  5CO7 A;  2EGA A;  3CCR T;  1K8A C;  1EFN A;  1XNI A;  3D7S B;  3OYB A;  2O4X A;  3CMA Q;  2D8H A;  2LQK A;  3THK A;  4OVA A;  2RNA A;  2XDB A;  3CPW A;  2J6O A;  1WXU A;  1M27 C;  1QCF A;  4KGZ B;  4M78 D;  4QW2 A;  1YN8 A;  2HBP A;  3E9G A;  2XIC A;  3J81 E;  1LNX A;  1UEC A;  4KGX B;  2FRY A;  3HRS A;  2L3Q A;  2MK5 A;  3EG0 A;  4E7S A;  3QSU A;  2YLC A;  2HNI A; 
#chains in the Genus database with same CATH homology
 2JN0 A;  2YRV A;  5GAN 4;  2RHU A;  3PT9 A;  3OMC A;  4EMK A;  3LGF A;  2HD0 A;  5GAN d;  4M7A C;  3JCM c;  5EG2 A;  2Y90 A;  4M78 F;  3OY9 A;  1VQ9 T;  4BD3 A;  5DLQ E;  1Y96 A;  4C5E A;  5LJ3 j;  3X28 B;  1V29 B;  2XDD A;  3G4S A;  5GAO m;  4E7L A;  3HPW A;  1K73 C;  1K9M U;  1YJ9 A;  5CAI A;  4M78 C;  1WJR A;  2CS7 A;  4M78 G;  4A4G A;  4BE0 A;  2DD5 A;  3CCS A;  1W2B S;  1OZ3 A;  1BIA A;  2A7Y A;  1KQS S;  4O6J A;  1VQ7 T;  4HT8 A;  3MP6 A;  4F7U G;  4Z02 A;  3OYH A;  4L6V 5;  4DA4 A;  2RD1 A;  5L8R E;  3RKY A;  4M7D D;  2ZPG B;  3DLL A;  2KDS A;  4XTW A;  3CBP A;  4QQD A;  3OS2 A;  3OS0 A;  3OYD A;  3C12 A;  4C0F A;  3TEE A;  4VUB A;  3JCM b;  1VQ8 T;  4NL2 A;  4XTX A;  3LW5 E;  1U1T A;  3A8O B;  3ZEH A;  4J6W A;  5A0D A;  1TH7 A;  2K3Y A;  2XID A;  4MML A;  4RCC A;  3QXE B;  2XHC A;  2JTM A;  4ATO A;  4M78 E;  1K9M C;  3DLM A;  5IN1 A;  2ZZD A;  5D6X A;  1M90 U;  3J7A F;  3HFN A;  1VQL A;  2YLC A;  3M55 A;  2I2L A;  1G3W A;  2K4Y A;  2LRQ A;  3ASK A;  4RG2 A;  2GFA A;  1KC8 C;  4M7D F;  1IRE B;  2WSF E;  3FDR A;  3V8J A;  2QDY B;  1H64 1;  1YBY A;  1YHQ A;  1QVG S;  2P4T A;  4GY5 A;  3CXC A;  5GAM h;  1YIT A;  2RM4 A;  3URG A;  4BI3 A;  5GAM j;  2VUB A;  4C8Q G;  3I56 T;  1KD1 U;  4M7D G;  3QO3 A;  4PJO A;  5LJ5 f;  2L5Q A;  4NL3 A;  2LVM A;  3QJY A;  1M8V A;  1YJ9 T;  4A4F A;  4N4I A;  4M75 D;  2OTL A;  5LJ5 g;  1Y71 A;  4LD6 A;  3CCS T;  2ZGW A;  3E9F A;  4KBM B;  4FL6 A;  3X26 B;  2B8A A;  1Q86 U;  2NLU A;  3QII A;  1FX7 A;  2K5L A;  4J6Y A;  3TU4 K;  3LH0 A;  4BB7 A;  3CCE T;  1VQN A;  1WJQ A;  4QVZ A;  2E5Q A;  1KHI A;  4M78 B;  5FRM A;  2CZ1 B;  2LNV A;  4M7D E;  1K8A U;  4ZGD B;  5KE3 A;  3LWH A;  4EPC A;  4M7A A;  4E7I A;  2JTF A;  1KD1 C;  3M57 A;  2HQE A;  1WJS A;  1LJO A;  2MWO A;  3TCJ A;  1G3T A;  3RUX A;  4J7I A;  3QJ6 A;  4BY6 C;  3HKS A;  3JCM W;  3ER0 A;  2ZPB B;  1AHJ B;  3OBY A;  4OF1 A;  5GMK h;  3GNF B;  4M78 A;  5GMK j;  1VQL T;  2OTJ T;  1PSE A;  4M75 C;  3L2R A;  1Q7Y U;  4HA8 A;  4M77 D;  4HT9 A;  4PL6 A;  4MDW A;  4GLK A;  4HCZ A;  3PTA A;  4J83 A;  2JVV A;  5J39 A;  1N9S A;  2X35 A;  3FEO A;  2H3J A;  3P8D A;  2ZCF B;  2XKO C;  5J26 A;  4B9X A;  2R58 A;  3OYJ A;  4N4G A;  1YHQ T;  2LT1 A;  2VXF A;  1JJ2 A;  2QA4 T;  1EIF A;  2MWP A;  4FSX A;  4XTZ A;  3OS5 A;  4IUQ A;  3LWI A;  3L2U A;  4FT2 A;  3OYE A;  1VQ7 A;  3JCM X;  2AHJ B;  3NFC A;  3PMI A;  1W4S A;  4QQ6 A;  2DXC A;  2LX9 A;  1VQ5 T;  3OYG A;  3OW2 A;  2DJZ A;  2RHY A;  2LT4 A;  3QBY A;  3V7R A;  3BDU A;  4LDV A;  1Q82 C;  2OTL T;  3UT1 A;  4L5G A;  4BI4 A;  5GAN f;  3M59 A;  4JRP A;  2GCX A;  1M1F A;  2O01 E;  2DK3 A;  1JJ2 S;  1UGR B;  3A8H B;  4M77 F;  4M75 E;  5D6Y A;  3HSB A;  2GQV A;  3G7Z A;  4LDU A;  2YHT A;  1PSF A;  3QYG B;  3CCV A;  1Q7Y C;  4M7D B;  1K73 U;  4MZT A;  3HL8 A;  1YJN T;  1VQN T;  1BIB A;  4M77 C;  3RIR A;  5GAO r;  1DJ7 B;  5HY6 A;  5AYF A;  2QQA A;  2YLB A;  3OQ5 A;  4M77 G;  3A8L B;  4R55 A;  3CBM A;  5GAO p;  3HRU A;  3MEV A;  4PNO A;  3MP1 A;  5GAN 8;  5LJ5 h;  5GAN 7;  5LJ5 j;  2E65 A;  2KY9 A;  3OYA A;  2L89 A;  2Y4Y A;  3JCM V;  4A4K A;  5I2S A;  4BI8 B;  3CC7 T;  2DZC A;  2RI5 A;  1YJW T;  4P5N A;  5CK9 A;  2HAX A;  1M5Q 1;  1KG1 A;  1MHN A;  4OMF B;  2WSE E;  4OP0 A;  2CYZ B;  4Y28 E;  3G6E A;  2G3R A;  4R56 A;  3CMA T;  3LYI A;  1WPY A;  5GAN 5;  4O5V A;  5DY9 A;  1W2B A;  1NJI U;  1O75 A;  3QHS A;  2R5A A;  2HQX A;  5KCO A;  2X4Y A;  1KQS A;  2E12 A;  4RMO A;  4QVC A;  3I56 A;  2WSC E;  3JSC A;  1RI0 A;  4M77 E;  3M9Q A;  3P8H A;  3CPF A;  1LOJ A;  2E6Z A;  2XK0 A;  3GNG A;  4F7U F;  1MGQ A;  4ZTF A;  2A3L A;  4MZP A;  1XTD A;  5LJ3 e;  4BY6 B;  1SSF A;  2QXF A;  4EDU A;  3L2Z A;  3E1S A;  3E19 A;  1QVF S;  1D3B B;  2PVD B;  3X20 B;  5HK0 A;  2D6F A;  1KC8 U;  4M75 B;  3CC4 A;  1G3Y A;  4UC4 A;  5GAO q;  2ZPI B;  3QKJ A;  3M58 A;  2VV5 A;  3QZ9 B;  4C8Q D;  3CCE A;  3KUF A;  3SWN C;  3CD6 A;  1NZ9 A;  3MCA B;  3VU3 C;  4X9C A;  3CCL T;  5I2M A;  4EMH A;  3CCV T;  1NJI C;  2X4X A;  4E7J A;  1D3B A;  5CCA A;  4N4H A;  3V8L A;  2KMT A;  4YTL A;  4M75 A;  1B34 B;  2RK2 A;  4OB3 B;  2EJG A;  5CKH A;  4C92 D;  3KBG A;  4XAX B;  3WVE B;  2D9T A;  4Y91 A;  2RK1 A;  5C0M A;  1UGP B;  2DZ9 A;  3CCM T;  4ELZ C;  2KVQ G;  1WQW A;  3HRT A;  3CME A;  3GIB A;  2M0O A;  3CCQ T;  1QVG A;  2OTJ A;  2F69 A;  3WVD B;  4CI0 C;  4BDZ A;  1UGS B;  4F7U E;  2DTO A;  2QQ9 A;  5GAN h;  5GAN j;  4C8Q F;  4KUI A;  3RKX A;  2DPP B;  4MMK A;  4QQG A;  3N5B B;  1B34 A;  5FU7 B;  5C6S A;  2RHI A;  3G6E T;  3G71 T;  4RCB A;  1QVP A;  5CKB A;  4MDX A;  4M77 B;  1I81 A;  3S3O A;  2ZPH B;  2K5F A;  2VGM A;  2XG8 D;  3DKM A;  4C8Q C;  3H6Z A;  2QA4 A;  2IVW A;  2KSS A;  1YIJ T;  4M7D C;  3AHU A;  4C92 F;  2LCL A;  2DTI A;  3MEU A;  5I21 A;  4KUL A;  1G5V A;  3OS1 A;  5GMK m;  1VQ5 A;  2V8J A;  3CCU A;  2PUK B;  2RJF A;  1I5L A;  3M4G A;  1JRI A;  2KAF A;  2DXU A;  1HK9 A;  1X6O A;  4NOY A;  3SFM A;  3NTI A;  3EFR A;  1WNL A;  4NS5 A;  4C92 G;  5DM7 R;  2P0Q A;  4E7H A;  1QP3 A;  2K5I A;  3CC4 T;  1KHC A;  4E47 A;  3DB4 A;  2D0Q B;  4C5I A;  1YJN A;  1UB4 A;  3CD6 T;  3SD4 A;  4KUD K;  1UGQ B;  1N27 A;  2DIQ A;  2EQM A;  4XTY A;  2XI9 A;  3ZFJ A;  4A4E A;  4C8Q E;  2CZ0 B;  2RHX A;  5DLO A;  1ZHI A;  3JCM e;  1RL2 A;  3FLG A;  3S3M A;  3CC7 A;  1N8R U;  4OB2 B;  1YJW A;  1VQ6 T;  1O9S A;  2DXT A;  4J6X A;  4HCC A;  4F7U B;  2RA2 A;  4JUV A;  3INZ A;  3M5A A;  3RMS A;  3VYG A;  1VQO A;  1U8R A;  4JRK A;  1Q82 U;  4C92 E;  3CME T;  3CMA A;  3SWN B;  5A2Q E;  4BUG A;  2PQW A;  3M4Y A;  3JB9 H;  2EKO A;  1VQK T;  3PNW C;  3UWN A;  4QVD A;  2QQS A;  1KQ1 A;  2GFU A;  1KQ2 A;  3M54 A;  1S72 A;  5GMK l;  3DB3 A;  3VUB A;  3VV0 A;  5GMK e;  3JAM E;  1N6A A;  4JJN K;  1BI1 A;  3L2W A;  4F7U A;  3JRZ A;  5LJ3 f;  4PLL A;  3C95 A;  1UEB A;  2FYK A;  4IUP A;  2RI3 A;  3JB9 F;  3SWN A;  4JLI A;  5FU6 B;  5LJ3 g;  3GP8 A;  3CCJ A;  4XTV A;  2P0K A;  1N8R C;  2LQ8 A;  2Y4X A;  2WAC A;  4IUV A;  4FM4 B;  4PKC C;  3VJP A;  3CCU T;  4PJO D;  1JB0 E;  1VUB A;  4ZGE B;  1BI0 A;  3I55 T;  2CZ6 B;  3JB9 G;  2EQU A;  4C5G A;  4N0A C;  2CZ7 B;  4DOV A;  5GAN 6;  2LC4 A;  2RJE A;  3CEY A;  3CCL A;  2GF7 A;  3MEW A;  4C8Q B;  2VXE A;  5KH6 A;  5FU7 C;  3JCM Q;  2DTH A;  3M56 A;  3MHX A;  3V7C A;  2RH2 A;  2E64 A;  5LJ3 d;  2RHZ A;  3T9N A;  4LD9 K;  3CCM A;  3X25 B;  2QEX T;  3S6W A;  4WF2 A;  2BUD A;  2IG0 A;  4C92 B;  2ZPE B;  4IUT A;  3CCQ A;  2EAY A;  4II1 A;  4BE2 A;  2RB6 A;  4PJO F;  4J5Y A;  2K3X A;  4C8Q A;  4M7A D;  3H8Z A;  4XTU A;  4M7D A;  1BI3 A;  2JOY A;  2P0P A;  3Q1J A;  4L59 A;  4C0Z A;  1VQO T;  2E1H A;  4HCB A;  3G71 A;  2V8I A;  3FC3 A;  3QYH B;  1VIF A;  1U1S A;  2RO0 A;  2E10 A;  4PJO G;  4BAC A;  1YIJ A;  2RJD A;  3OYF A;  3CC2 T;  2EQK A;  4FT4 A;  1S72 T;  1QVF A;  2CGH A;  3A5Z B;  2DVE A;  3FB9 A;  4C0D B;  4C0G A;  3PIO A;  4JRQ A;  1VQM A;  1FWZ A;  5CIU A;  3CPW S;  4E7K A;  4JRI A;  2VGN A;  3UDC A;  1YI2 A;  2DIG A;  2C06 A;  4LDX A;  5CQY A;  3QDR B;  2QQB A;  3V7S A;  3CCJ T;  4ZN3 A;  3OYI A;  4M7A F;  3NTH A;  5GAO n;  2EQJ A;  1VQP A;  1NE8 A;  1ZQ1 A;  2VC8 A;  2E41 A;  2K57 A;  2DD4 A;  2M16 A;  3OB9 A;  4B9W A;  3JCM P;  3MEA A;  2OAU A;  5CKE A;  3CBO A;  3FJP A;  4RKU E;  3EFS A;  3JCM f;  3L2V A;  4PJO E;  3WXM B;  1P92 A;  4OB0 B;  4M7A G;  4DQ2 A;  4XU1 A;  3JCM J;  1YCY A;  2DKG A;  3RMQ A;  4FU6 A;  2MF2 A;  5LJ3 h;  4V2S A;  3JCM g;  3OSS C;  4A4H A;  2EFI A;  3HHT B;  2F5T X;  5GAM d;  1VQ6 A;  3RKW A;  4IKF A;  2JZ2 A;  1I4K 1;  1R8O B;  1BYM A;  2QQR A;  3ME9 A;  3O8V A;  2RI2 A;  5FU6 C;  3LX7 A;  4CRI A;  1VQK A;  1X75 C;  3EAE A;  4OGC A;  3PIP A;  5A0G A;  4BDY A;  1M1G A;  4X34 A;  3MO8 A;  2E6N A;  4J7F A;  2LDM A;  4XK8 E;  4M7A E;  2L8D A;  2RJC A;  3FRN A;  4XU3 A;  5GAN e;  5KCH A;  1JBM A;  2MI6 A;  1NPR A;  3JCM d;  3BDL A;  4N0A A;  4J8O A;  4C5H A;  1NPP A;  3V8K A;  2BKD N;  1G3S A;  3OYY A;  3BFM A;  1N9R A;  1Y07 A;  3C4S A;  3PMT A;  5GAM e;  2EJ9 A;  3TRE A;  4JS5 A;  1VQM T;  1VQ4 A;  1M1K U;  2FB7 A;  4LDW A;  3I55 A;  1QP2 A;  2R57 A;  3GOX A;  3OBW A;  5CQX A;  1YI2 T;  1M4Z A;  3BW1 A;  3QG1 A;  3QPH A;  2FHD A;  4JLG A;  4M77 A;  4X9D A;  4C92 C;  4ELY C;  4PJO B;  5FRO A;  5KE2 A;  2DAQ A;  2M9U A;  5CVI A;  3OYL A;  1VQP T;  3RER A;  1H3Z A;  5GAO l;  2XDP A;  2EWN A;  5IAY A;  3OW2 S;  4BE1 A;  3M53 A;  3MP8 A;  3BY7 A;  3A8M B;  3PGG A;  4FIB A;  5D6W A;  3JB9 I;  3L2Q A;  5J3B A;  5GAN 2;  3R6O A;  2V8K A;  5LL6 S;  5M9O A;  2QEX A;  5CR2 A;  1GXI E;  3CCR A;  2X4J A;  4C0D C;  3JB9 D;  4EMK C;  3MET A;  3G4S T;  1Y7X A;  2X4W A;  3GF5 A;  2DO3 A;  1M1K C;  2KK4 A;  3L42 A;  4D6W A;  4ME7 A;  3CXC S;  4LDY A;  2F5K A;  1BI2 A;  2MMP A;  1FXX A;  1HXD A;  5CKF A;  5FRN A;  4M7A B;  4XQ3 A;  4HKE A;  2DXB A;  1M90 C;  1WGS A;  3F70 A;  2LCC A;  3SDZ A;  5A0L A;  3CC2 A;  2EJF A;  3L1A A;  3VUZ A;  2FVU A;  1XQH A;  3JCM h;  3P8B B;  1X01 A;  2MAM A;  4DOW A;  2CKK A;  2QTX A;  2L3R A;  3LGL A;  2EYQ A;  2JNG A;  4JS4 A;  3LLR A;  5CKD A;  1Q81 U;  2ZPF B;  4OGE A;  5LJ5 d;  4M75 F;  5GAN 3;  2PVO B;  1BKB A;  2E70 A;  4ZGJ B;  1VQ4 T;  3VYH B;  4XU2 A;  1XOV A;  4RG8 A;  2R5M A;  3UPU A;  3OYC A;  4A54 A;  3X24 B;  5HKC A;  3S3N A;  4MZM A;  3JB9 J;  4M75 G;  1OZ2 A;  3HFO A;  1Q86 C;  1VQ9 A;  2XD0 A;  2O4X B;  1IZ6 A;  3FIF A;  2QI2 A;  4OB1 B;  4EMG A;  1QW1 A;  1I8F A;  2EIF A;  3VKI A;  3PFS A;  4ZN1 A;  2DEQ A;  2PVG B;  4IUU A;  3KXT A;  1YIT T;  3J80 E;  2BIV A;  3OMG A;  5CO7 A;  3CCR T;  1K8A C;  1M9S A;  3OYM A;  1XNI A;  1WQ7 A;  1ZBX A;  3QUI A;  3OA6 A;  4ZTJ A;  3OYB A;  2O4X A;  2PU9 B;  1Q81 C;  5LJ5 e;  4JDS A;  2LQK A;  2K2V A;  2PUO B;  4OVA A;  3A8G B;  3ZBD A;  1VIE A;  2XDB A;  3CPW A;  5IT9 E;  2M1H A;  4PJO C;  3OSV A;  1VQ8 A;  3OYK A;  3HP9 A;  3GPL A;  2KQW A;  3RES A;  5GAN g;  4M78 D;  4QW2 A;  2HBP A;  3E9G A;  4C92 A;  2XIC A;  3J81 E;  1LNX A;  4KT0 E;  4PLI A;  2JUF A;  3C94 A;  5GAM f;  5GMK i;  4TVR A;  3OYN A;  2XU8 A;  4Q5W A;  5FLX E;  3HRS A;  2VYT A;  3SB2 A;  4EMK B;  3NTK A;  4A53 A;  4IUR A;  4XU0 A;  2LTO A;  5HK3 A;  3QZ5 B;  5GAM g;  3GLX A;  2FL7 A;  3QSU A;  1OYX A;  1Y96 B;  1OI1 A;  2HNI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...