2DD4A

Thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
118
structure length
118
Chain Sequence
VWDRTHHAKMATGIGDPQCFKGMAGKSKFNVGDRVRIKDLPDLFYTRTMTYTRGATGTIVRLVYESPAAEDEAFGNEENVEWFYSIVFAQKDLWPEYSDTFANDTLETEIPERYLEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiocyanate hydrolase alpha subunit
publication title Structure of thiocyanate hydrolase: a new nitrile hydratase family protein with a novel five-coordinate cobalt(III) center.
pubmed doi rcsb
source organism Thiobacillus thioparus
molecule tags Hydrolase
total genus 26
structure length 118
sequence length 118
chains with identical sequence D, G, J
ec nomenclature ec 3.5.5.8: Thiocyanate hydrolase.
pdb deposition date 2006-01-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02211 NHase_beta Nitrile hydratase beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.50 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2dd4A00
2ZPHB 1QP3A 1UGQB 4Y28E 1JB0E 3A8MB 2QDYB 2PUKB 3A8LB 2D0QB 3VYGA 2CZ7B 2ZPGB 3QXEB 3QYGB 3X25B 4OB0B 2CZ1B 2ZPBB 1DJ7B 3QZ5B 2DXBA 4FM4B 4XK8E 2CZ0B 3WVEB 1GXIE 3HHTB 2AHJB 3X28B 4OB3B 2ZZDA 2ZPIB 3LW5E 2PVDB 4ZGJB 3X20B 1AHJB 4OB2B 2DD5A 4KT0E 1UGPB 1UGRB 2PU9B 2CZ6B 4ZGDB 2PVOB 2WSEE 3QZ9B 3X26B 1IREB 2PUOB 2O01E 3QYHB 3A8GB 3X24B 1QP2A 3A8HB 2DXCA 2DD4A 1PSEA 2ZCFB 1PSFA 4ZGEB 4L6V5 3WVDB 4OB1B 4RKUE 1V29B 2ZPFB 2CYZB 5L8RE 3VYHB 2WSFE 3A8OB 2ZPEB 1UGSB 2PVGB 2DPPB 2WSCE
chains in the Genus database with same CATH superfamily
3L42A 2ZPHB 2NUPB 1WYXA 3LH0A 1Y96B 1YHQA 3A8MB 2DA9A 1ZA1B 3PTAA 1KC8R 1RI9A 2F1LA 3VS0A 4JRKA 5J26A 4LUEA 1MHNA 3I56Q 4V2SA 3P8BB 1Q7YR 2YHTA 2QASA 2PZ1A 1N8RR 5FW9A 5KYYB 8ATCB 2F5TX 4J9DA 4M77E 1VUBA 1UE9A 2ZPBB 1SG5A 3UA6A 3L2QA 1RLPC 4PJOG 2YUPA 1QVGS 2CZ0B 2DERA 5GANf 2O9VA 1B07A 4EPCA 4XU3A 2MMPA 1SKUB 4OMOA 1PCXA 3QO3A 2XDPA 1AOJA 3F70A 2CH4A 1W6XA 3LYIA 4J6XA 2KYBA 4ZTFA 4LD9K 5CCAA 3NTKA 2MWPA 2GFUA 3CCJA 3M0RA 2GQVA 2DD5A 4AG1C 2JUFA 3CQTA 1YWOA 1M4ZA 4J9EA 2LT1A 4RTVA 4GY5A 1IHVA 2H3EB 2DL7A 4ZTJA 1OU9A 4C0GA 2KMTA 1SSHA 2DD4A 2J6KA 2MPXC 2YUNA 2QQAA 1MGQA 1N9RA 4FYWB 2FZKB 2DZCA 3EG0A 1PG5B 4HCBA 1IZ6A 5LJ5e 1CKBA 2V8IA 4DBFA 1VQ4A 1Y0MA 2YT6A 1QCNA 1LPLA 1HJDA 1VQ8T 2WSFE 4R55A 4J7IA 5GANh 3VRYA 4N0AA 5GMKi 5EG2A 2CP5A 1GRIA 2QK0A 1VIFA 3OS1A 2MIOA 1X27A 2RQVA 5DM7R 1I1JA 3JCMP 5A0DA 2HQEA 1I5OB 2K3XA 3I55T 1M2OA 1GL5A 3FJ5A 2P0QA 1FMKA 4PFOA 5GMKm 3JCMg 2XIDA 4HCCA 2M9UA 1B34A 3I35A 1TWBA 1P92A 4JLIA 3GOXA 2IVWA 1YBYA 3GNGA 3TSWA 4L59A 3LWHA 1N9SA 2LJ0A 1ZUYA 2GF7A 1Y07A 1YJWQ 2L3RA 2QEXT 2K9GA 1Q86U 1X43A 2FRYA 1KIKA 1AWXA 5FU6B 3X28B 2JM9A 1S72T 2DVJA 2YWWA 5GAMf 1E6GA 1Q81C 1ZHIA 3UT1A 4M77F 1WXUA 4X9CA 3KXTA 1K1ZA 1IHWA 1QWEA 1SSFA 4KGZB 1Y71A 4J9FA 2RD1A 3J7AF 1QW1A 4RTYA 1NPPA 2RMOA 3QPHA 3JCMJ 4Q5WA 2PVOB 5DLOA 4XU0A 3QZ9B 3JB9H 1Q82U 4KGXB 1YITQ 3NGPA 3OW2S 3PFSA 2HEQA 1KSWA 3A8HB 3CCET 3CMAT 5CKEA 1BI2A 2A7YA 1RUWA 2DL3A 2EGCA 2KT8A 2VGNA 1VQPA 2CT4A 3JB9G 4OGEA 2D6FA 2L3SA 2DNUA 2VYTA 3M59A 1EZZB 2RNAA 1VQ4Q 5IXBA 5KH6A 3M53A 4KUIA 1ZQ1A 2MF2A 3OS0A 3CCUT 4J9IA 1WHGA 3GIBA 1KHIA 1PRLC 5GAMh 2ATCB 3G71A 3CCRQ 1PC0A 3FDRA 2HAXA 3GPLA 1I0CA 3NPFA 3V8JA 4NOYA 2DTIA 2K4YA 3NFCA 1YI2A 2FRWA 1BU1A 2HL5C 2QXFA 1SHGA 3OBWA 4FCYA 3OYCA 2ED0A 3OYDA 2DX1A 2LQKA 1J3TA 1BI3A 1LCKA 4BY6C 5M9OA 4DBHA 4E7LA 2CUDA 3M4GA 4A4HA 1VA7A 4KRTA 4M77A 1R8OB 5I2MA 2DRMA 3M58A 3G4SQ 1YJNA 2QA4T 4F7UB 4IIOA 2LZ6B 1YIJQ 3MEAA 1K8AU 2PTKA 4X1VA 2JNGA 2QI2A 1Z9ZA 1R77A 1YJ9A 1VQMA 1I5LA 4JRPA 3EG1A 3G1JA 2E4HA 1MMNA 4M75B 3QKJA 3C0CA 2HSEB 5CKFA 5I2SA 4ZGDB 3EG9A 4AT1B 1M8VA 2DXUA 2C0IA 2YLCA 5GANg 1H8KA 2DM1A 1OPKA 1QP2A 3VV0A 2L0AA 2KRSA 5GAN3 4BUGA 3REAB 1UUEA 3EFRA 4E6RA 3FLGA 1VQPQ 4Z88A 4OMPA 3SWNB 1NJIR 1RAFB 2R58A 1VQ6A 1VQ9A 2H8HA 3A8OB 1KQSP 1WXBA 1IRXA 2JOYA 1KD1R 4FW1A 4F14A 2XDDA 5CIUA 4EMHA 2PQWA 2RJDA 2A28A 1D0ZA 1QCOA 2RF0A 1Y7XA 3SDZA 3VKIA 4N4IA 2CKKA 4C8QB 2ROLA 3AHUA 2YRVA 1UHCA 1YI2Q 1W2BS 2ED1A 3CMEQ 4M78B 1SRLA 3OB9A 3OMGA 3V7RA 3QYGB 2B8AA 2F69A 4M7DB 5KE3A 4N0AC 2EQKA 1RAAB 1UTIA 4QQGA 1K76A 4LDUA 5CAIA 1RABB 2QGGA 5A2QE 1WPYA 1QWFA 1Y96A 3JSCA 2J6FA 5KCHA 3MEUA 2OTJT 5GMKe 4C5IA 1QVFS 3PMTA 3KBGA 1JBMA 2CP0A 4ESRA 4E7SA 4OMLA 4PL6A 1MMDA 3RMQA 3BDLA 2AIRB 5GANe 1VQKT 5ECAA 3G6EQ 2HKNA 4KT0E 1K9MR 1WJSA 2CDTA 2PU9B 4J6YA 1TTHB 2HBPA 2GTJA 1D1CA 1IREB 4PJMA 2O01E 1WHMA 2DTHA 3A8GB 4FSSA 5FWCA 3VS5A 4C92B 4D8DA 5GAMg 2X35A 1G5VA 1ZBXA 5CQYA 2ECZA 3RNJA 1SRMA 1N6AA 1B3QA 4AFQC 4X34A 1QVPA 3LGLA 1OX9A 1W4SA 2VXFA 4DEXA 2RJEA 3FIFA 3CC7Q 3CBMA 4M75G 1VQ6Q 4MDXA 1VQ9Q 1OU8A 3CCQQ 4FL6A 4XTWA 2NYSA 1ARKA 1RADB 2FYKA 2I2LA 3CC2T 3M57A 5J39A 3PVLA 2OAUA 3BE3A 2CGHA 3CC4Q 4OVAA 1K73U 2V1RA 3EGDA 4PJOB 2D1XA 1RAHB 3A1PA 3OYYA 3OBYA 3OS2A 2SRCA 3HSBA 1KQ2A 2RHYA 2CSQA 4OB0B 1I4K1 2FL7A 4LNPA 4Z8AA 2EGAA 4E7ZA 3EHQA 5AT1B 3KUFA 1I07A 2GGRA 4NL3A 2K5LA 3RUXA 1X2QA 2A36A 3M5AA 3PE0A 5CR2A 4OB3B 4J9GA 1ZSZB 1UEBA 3M9QA 2LMJA 4JS4A 4M7AC 4QVDA 4C8QG 4M77C 1D1AA 1AWJA 3PVQA 2RH2A 5KE2A 4HKEA 3OYIA 4M78G 4MZPA 2WSEE 3CXCP 2X4YA 4EMKB 4BDYA 1WJQA 3HFNA 2RA2A 3OYAA 4IUVA 3RESA 3JCMh 4BI8B 5LJ3d 1WHJA 4BI3A 2DYBA 2EYYA 3CXCS 4ZN1A 2A0FB 1MV0B 1M1KR 2P84A 3MJXA 1NBEB 3QJYA 1NPRA 4JLGA 4RKUE 5GAN5 3CD6A 5KYWA 3WXMB 2JS0A 4FIBA 4JDSA 1WI7A 4DOVA 2KK4A 1NLPC 2HNIA 1K9AA 4M7AD 1JXMA 4AG2C 5LL6S 1G3TA 2DPPB 1VQNT 5I11A 3C94A 3CPWP 1Q81U 1UGQB 4IUPA 4OMNA 3HTRA 1WDXA 4LD6A 1WJRA 1PM3A 2PUKB 2EBPA 4C92G 2XMFA 2DEUA 1LVKA 3A8LB 2HBWA 3VYGA 2CZ7B 1HSQA 4QKUA 1BI1A 4CRIA 5GAOn 2Z0WA 3OYGA 3V8LA 4DA4A 2LDMA 2RN8A 4BE2A 4CC3A 3X25B 3CCLT 5LJ3j 1UJ0A 5FRNA 2ZAEA 3VS3A 2LJ1A 2EYWA 5FLXE 1KC8U 4A63B 5GAOq 3UPUA 3MP6A 4RUGA 4JJCA 2EQIA 3UA7A 2O31A 2ESWA 3I9QA 3INZA 3TCJA 4KULA 3PMIA 3HHTB 1Q7YU 4DOWA 2EKOA 1N8RU 1QVGP 1VQ8A 2X3XD 3MKDA 2RM4A 4RTZA 4M7AE 1WA7A 5IHKA 3EGXA 1C1AA 2JM8A 5IHIA 3VJPA 4AFUC 2GFAA 1RACB 1M90C 1UGPB 1UGRB 2JT4A 1BBZA 2HD0A 4XTZA 1BB9A 1G2BA 3I55A 4LDVA 1ZA2B 3N5BB 3X24B 4F7UA 4LDYA 4XU2A 2V1QA 1YCYA 4M77G 3L2VA 6AT1B 1WIEA 4RCBA 3REBB 2QEXA 2DO3A 1GBRA 4PFZA 1MNDA 2LCCA 1ABOA 2CYZB 4PKCC 3CD6Q 2RB6A 1AT1B 1S72A 2PVGB 1X01A 5HK0A 3O8VA 5IN1A 3JB9I 2DBKA 4XTXA 4IUQA 4Y28E 2DMOA 4F17A 2AT1B 3CPWA 1K4US 2BE7D 3GNFB 2RK1A 2DVEA 2HZYA 3LGFA 3NMZC 1T3LA 3OSVA 3QWYA 5A0LA 2BUDA 3MHXA 3NHNA 4MMKA 2EJ9A 1PRMC 1VYTA 1VQLT 3LH5A 1O9SA 3CCEA 3CMAA 2X4XA 3EH2A 4X9DA 3E1SA 2OAWA 1PD1A 2KT1A 2CP7A 2D9TA 3EFSA 3FEOA 5AYFA 1YHQQ 3ZL7C 1JJ2P 4HT8A 1YN8A 5GAOp 3RMSA 2OX7A 3MEVA 2CT3A 1UDLA 2HQHA 2AHJB 5LJ5d 4QW2A 3OMCA 4EMGA 1YJWT 2RHIA 1M1KC 2BZXA 1M3AA 2VKNA 1M2VB 2E41A 3CCUA 2DKGA 3GBQA 5GAN8 3OYFA 4DQ2A 1JJ2S 5CK9A 2X4WA 4M7DA 4UC4A 3OYLA 2FPEA 2E3IA 3DLMA 2ENMA 4ELYC 4J5YA 3EGUA 3HRSA 1D3BA 2KBTA 4M7AF 1FX7A 2BZYA 2K5IA 3HRUA 3I55Q 4DEYA 3R6OA 3V7SA 3VUZA 3J81E 1I81A 1BIBA 5LJ3f 1UB4A 3OW2P 3TREA 3SEMA 2JTFA 4KBMB 1YITT 4Z89A 1NE8A 3RIRA 1KK7A 4PFPA 2VV5A 2DIGA 1RAEB 4VUBA 3CCJQ 3TSZA 2QA4A 1WQWA 5LJ5j 1VQ7A 2X9HA 5CVIA 1TU0B 2O88A 3QDRB 3A98A 2DF6A 2IG0A 3FC3A 4C0DB 3HKSA 3OY9A 1OPLA 3OYKA 4MZMA 1TUGB 2KVQG 4WTOB 2JW4A 4PLLA 1U5SA 4D8KA 2NLUA 2QTVA 4GLMA 3LX7A 3V8KA 2VASA 3M0QA 1Z9QA 1EFNA 1LNXA 2VVKA 4BI4A 3EHRA 5KYUA 2FHDA 3CCRT 2EKHA 3L2UA 4N4HA 2KQWA 2ZGWA 3RR6A 1IGQA 2DIQA 4RG2A 4Z02A 3DB3A 3JCMe 4BY6B 3CMAQ 2KXCA 2DETA 2K79A 4LXCA 2DRKA 4OF1A 1OOTA 3ASKA 1JRIA 5LJ3h 3I5SA 2E10A 2GNCA 1WFWA 2DTOA 1TSFA 4FU6A 1U1TA 2CREA 2C0OA 2KXDA 4M7AA 3G4ST 4QVCA 3PIPA 4RG8A 2DZ9A 4PLIA 2LT4A 1YIJT 3UATA 4PJOA 4KUDK 3QBYA 2CH4W 2VC8A 4WCIA 2CZ6B 1YFNA 1UGVA 3RKYA 5KYNA 1JQQA 1T0HA 1PKSA 1QLYA 2FVUA 3QYHB 5A0GA 2IIMA 2QYZA 4PK4A 5GJWB 2K2MA 4JPBW 4BD3A 3Q1JA 4FT2A 3DLLA 2ZCFB 2HSPA 1ZUUA 3BW1A 1WHLA 3META 4HXJA 2DJZA 3OW2A 2QQRA 1OEBA 4J9CA 4MDWA 1VQ7Q 1H92A 4BDZA 2E6NA 4LDWA 5KYXA 5C6SA 1VQPT 2KGTA 4LE9A 4EMKA 2QQSA 3S3OA 3CCMA 1H3HA 4XTVA 1VQKA 5J3BA 1NJIU 2D0QB 1U8RA 3H0FA 2V8JA 3CCVT 2F2XA 1BCOA 3EAEA 1AWWA 1KD1U 2K57A 2FB7A 1LJOA 2K6DA 3P8HA 4ELZC 1M8MA 4E7HA 2XICA 1TXQA 1W2BP 2RQTA 2KYMA 1DJ7B 2E6ZA 2DFUA 2FZGB 3H41A 2KROA 2DXBA 3CMET 1ZBJA 4FM4B 1X6OA 3G71Q 2NUZA 1M30A 2MI6A 3CCSA 3QJ6A 1PKTA 4FYXB 1CKAA 2ABLA 2G3RA 5LJ5f 1ZLMA 4XTYA 3JCMQ 1XOVA 1YNZA 2MWOA 2RQUA 3NTIA 4OMMA 3D7SB 3M54A 4ANJA 1W1FA 2K3YA 3JB9J 5GAN7 1Q86C 1OV3A 3SWNC 2E1HA 1QVFP 1MMGA 2D8HA 1B34B 4YTLA 1KFZA 1PD0A 2EFIA 2D0NA 1BKBA 3OS5A 4QQ6A 1AD5A 3RBBB 1QKWA 2VGMA 2NUPA 1R0CB 3AT1B 2COZA 1E7OA 1YJNQ 4EIKA 2KRMA 2LNHB 2M0OA 2M51A 4KH0B 4CC2A 5CKHA 1U1SA 3JAME 4J83A 2HKQB 3G6ET 2BKDN 4OMQA 1XTDA 3ZFJA 2DLPA 3CBOA 1YJ9Q 3RERA 4AMCA 1VQMQ 4E7IA 1K9MU 3KFVA 4E2FB 1Q82C 5KYYA 3OYNA 3JCMX 3RKWA 2E5QA 4M7DC 2AZSA 1NYFA 2AKKA 1NYGA 1U3OA 1KG1A 3MP1A 1SHFA 2E70A 3HFOA 4F7UE 4RTTA 3DKMA 4HCKA 5D7UA 5LJ5h 2RJCA 4HA8A 1MMAA 4FSXA 1AVZC 5LJ3g 2WACA 2NUTB 2E3HA 3ULRB 2L3PA 2R5AA 3CC7T 3CCMQ 4J9BA 2ZPGB 3FRNA 2HCKA 3ER0A 1VQ9T 4QVZA 1X69A 2JJ9A 3CCQT 1M90R 2CS7A 3ME9A 3H8ZA 3M56A 4JUVA 5IH2A 1KQSA 3QHSA 3JCMW 3HP9A 1OYXA 2CZ1B 5DLQE 1WHKA 1BIAA 3BFMA 3CC4T 3QZ5B 1B7TA 5C0MA 5IT9E 1W70A 1WX6A 3HPWA 3JCMb 1W2BA 4M7DD 2J6OA 4A4EA 4RTUA 5CO7A 5L23A 3IQLA 1D09B 3CCSQ 4IUUA 4BE0A 5GMKj 1FYNA 3EFOB 1M9SA 1KHCA 3LW5E 3R6NA 1VQNA 5FU7B 4GLKA 1M3BA 1X2KA 2QAZA 4IKFA 1G8XA 5GJVB 4NL2A 1AHJB 3OSSC 1JXOA 2YRCA 1K8AC 1SF9A 2OJ2A 2CP3A 2XKOC 4B9XA 1FMVA 1U06A 4M77B 1HXDA 4AFSC 2L89A 1VQ5T 2MCNA 1C0MA 4OMFB 3CCLA 1TG0A 3H6ZA 2DJQA 2RHUA 4JRIA 3WVDB 4XU1A 5IXFA 5HK3A 4M7DE 4PJOC 1H641 2Y4YA 5FWBA 5GAMe 1X6GA 3MP8A 5DY9A 1M27C 4ZN3A 4DBRA 2HL3A 2DBMA 2JMAA 3L2ZA 1HD3A 1NEGA 4BB7A 2M0YA 3S3MA 1GFDA 3EG9B 5CKBA 1QP3A 3TVTA 1M1KU 2DYIA 4F16A 2EJFA 1TUDA 2LTOA 2JS2A 1VQOT 2COWA 3QXEB 3VS2A 3CBPA 2O4XB 2A08A 4F7UF 1X6BA 3M0SA 4F04B 2MK5A 2R57A 2C06A 4EMKC 4FYYB 3QUIA 4PJOD 1NG2A 2LQNA 2K7AA 8AT1B 1M5Q1 4L5GA 1IB8A 1GXIE 3T9NA 2OTLT 4A4FA 4FT4A 4JJNK 2EW3A 2EIFA 1GFCA 3H9NA 1WLPB 1FMWA 4K11A 3EG3A 5GAOl 1RL2A 1VQNQ 4OB2B 3TQ7P 7AT1B 3I56T 3EH1A 3GLXA 3FJPA 4PJNA 3GP8A 4II1A 4N4GA 1VYUA 2DE0X 2P4TA 4NS5A 2QG9B 5EC7A 1MNEA 2O2OA 1AWOA 5LJ5g 1G83A 1OZ3A 3FB9A 1MV3A 1GCQA 2EQJA 4L6V5 4ORZA 2F2WA 1VQLA 3QWXX 2J05A 3CCLQ 4PJOE 2CSIA 3G7ZA 1JU5C 4Y91A 5L8RE 3M4YA 2GBQA 4E7JA 4C8QF 1PWTA 3CXCA 1IXDA 2ZPEB 2DK3A 5GAN6 4J6WA 3OYHA 3H0IA 1YJWA 1G3SA 4M7AG 4M78F 4C0FA 4KH1B 1SEMA 4M7DF 3CD6T 3L2RA 4HVVA 4A54A 2FG0A 2KE9A 2X4JA 3I5RA 1PHTA 1F1BB 2E5KA 4M75A 1RI0A 2QGFB 2VUBA 3C12A 2BE9B 3OYMA 3VS6A 3E19A 1IGUA 2K3BA 3QDFA 1G3YA 2LCSA 1C6VX 1HK9A 3VS7A 4JJDA 1K73C 1CSKA 1YITA 4XK8E 4O5VA 4BACA 5HCKA 1XQHA 3CEYA 1BCMA 3QSUA 2DL4A 2ZPIB 2RQWA 3URGA 2W10A 5D6WA 1D0YA 2MOXA 1YHQT 4C92F 3SWNA 4E47A 2CUBA 1ZSGA 4B6MA 3EGDB 5GMKh 2RK2A 1OI1A 3SFMA 2PUOB 1H3ZA 1JO8A 2DL8A 2RI5A 2JXBA 2DEQA 2Y4XA 4C8QA 3CCRA 2DXTA 2SEMA 2OI3A 2FPFA 3VS4A 1QVGA 1QQJA 3JB9D 1VQ8Q 1AEYA 4M78A 4HVUA 5FROA 1VQLQ 2L5QA 1D1BA 3GF5A 4CC7A 2K5FA 4HT9A 2WSCE 5HKCA 1M1FA 4PJOF 3G4SA 1VYVA 3CCJT 3PT9A 2NWMA 1G3WA 5I21A 1ABQA 4M4ZA 1NEBA 1YIJA 1QMCA 2JVVA 5GAN2 1Q86R 1MUZA 3PIOA 2F5KA 3OQ5A 2YUOA 1T0JA 2DAQA 1WHHA 2QQBA 2GCXA 2D8JA 1VIEA 5GMKl 2QEXQ 4J7FA 3OA6A 2EGEA 5KYWB 4JZ4A 1S72Q 4IUTA 2J06A 4XTUA 4C92A 5FU6C 1N5ZA 3J80E 2AK5A 1VQ4T 2W0ZA 3ZBDA 3VS1A 3M0UA 4J9HA 2M02A 4BE1A 2M16A 2KSSA 2NUTA 3JCMc 1Q82R 2L8DA 1KC8C 3JRZA 3JV3A 2XK0A 2JMCA 2RPNA 3CCEQ 2H3JA 5IAYA 1Q7YC 2BIVA 1E6HA 3L2WA 1N8RC 4C0DC 2P0PA 4A53A 1RAGB 3CCVA 5D6YA 1JJ2A 2FZCB 3MPUB 1PSFA 3UF4A 4ZGEB 2A37A 1AZEA 1OULA 3QG1A 2EWNA 3M0TA 2EQUA 3EFOA 3CCUQ 1OQKA 3JCMd 3EGXB 3CMEA 2EAYA 2AKLA 4D6WA 3V7CA 3TU4K 3SB2A 2EJGA 4A4KA 1KQ1A 4ATOA 2VWFA 3NTHA 1GCQC 2QDYB 1UFFA 4C5EA 1ZSZA 2XG8D 1VQ7T 3H0HA 2C0TA 3OYJA 1GBQA 2CP6A 1K8AR 9ATCB 2QA4Q 4LDXA 2OTJA 2VXEA 2KAFA 3SD4A 3G6EA 2RI2A 2KDSA 1UG1A 2EYQA 2LQWA 4C0ZA 4OP0A 2HMAA 2RJFA 3C4SA 3M0PA 1TS9A 2E64A 1FWZA 1IO6A 1ZX6A 3E9GA 3S3NA 3RKXA 5HY6A 2ZZDA 5CQXA 1UHFA 4M75C 2LNVA 2LP5A 4WF2A 2O9SA 5D6XA 3JB9F 1RAIB 3G71T 2F2VA 2O4XA 2QTXA 1V1CA 4ZGJB 2Y90A 1YI2T 2HQXA 3CC7A 1Y57A 4IIMA 3CCQA 3CCVQ 1FXXA 1PSEA 2HDAA 2LC4A 2LQ8A 2YUQA 2KRNA 3JCMV 1A0NB 3BDUA 3L1AA 3UWNA 4QQDA 1D0XA 1YJNT 2BZ8A 2LVMA 2MYSA 4OB1B 3CC4A 1KQSS 3HL8A 4MZTA 2FEIA 1V29B 3CC2A 3EG2A 1VOMA 4M75D 1WGSA 3VYHB 1YJ9T 1VQMT 1QKXA 2LJ3A 2P4RA 2KR3A 2RHXA 4LUDA 1R0BG 3MCAB 3O5ZA 4PJJA 4R0KA 4C8QC 2EYXA 4LN2A 1D3BB 1O75A 4JJBA 4PNOA 4AFZC 1WQ7A 1K0SA 4JZ3A 4M78C 2MAMA 1OX8A 5GAOr 3BY7A 2A3LA 2I0NA 1TUCA 4JS5A 4ME7A 3E2UA 4IURA 2YDLA 4RTWA 1ACMB 2YSQA 4RTXA 3RDVA 3CCMT 1VQ5A 2DL5A 1BK2A 2OTJQ 2JTMA 2M1HA 2XI9A 1SPKA 2COYA 4EDUA 1NZ9A 2LRQA 2E12A 5GANd 1VQ6T 1VQKQ 4CC4B 1M90U 4B9WA 4XQ3A 3QIIA 1XNIA 4M75E 2EQMA 4OGCA 1PNJA 2FO0A 2QDLA 2G6FX 4C8QD 4F7UG 5CKDA 1Q95G 2PVDB 1EIFA 2GTOA 2VB6A 4M78D 1TH7A 5IHNA 5KYUB 3CCST 4C92C 2KY9A 5KCOA 4CI0C 1BI0A 1VQOA 2XU8A 1S1NA 1YCSB 2CP2A 3TEEA 4A4GA 2P0KA 3ZEHA 5I22A 1GCPA 2KNBB 3C95A 1M1GA 4R56A 2DXCA 2X3WD 4RMOA 3MEWA 1WZOA 2YLBA 1WXTA 2X51A 3MO8A 2XD0A 1ZUKA 3LLRA 4HCZA 1XJWB 5GANj 1QVFA 2L3QA 3U23A 4M7AB 2FPDA 3JCMf 2V8KA 1K0XA 3CC2Q 2OTLA 1K73R 1UGSB 2L2PA 2BTTA 4C8QE 3OYEA 4ZNXA 3M55A 2XHCA 1OZ2A 1JB0E 4C92D 1UJYA 1HYOA 4M78E 1TOVA 3UDCA 2YRDA 3I56A 4J8OA 1M2VA 2V26A 2YXYA 5FU7C 2JZ2A 1EX4A 1YWPA 2KI7A 3HRTA 3THKA 5LJ3e 2RI3A 4JRQA 2LX7A 3DB4A 4FW2A 1BYMA 1V76A 2RQRA 2AZVA 4TVRA 1M3CA 1X75C 1NJIC 4Y92A 1VQ5Q 5FRMA 2B86A 3SHWA 1NM7A 1RLQC 4RCCA 1ZSZC 2PNIA 4FYVB 5KYXB 1NLOC 3WVEB 2J7IA 4M7DG 1KD1C 2IPOB 3VUBA 2K2VA 4P5NA 2RHZA 4XAXB 2EVRA 5GAMd 4DBQA 1AZGB 3CPFA 3VRZA 4O6JA 1KJWA 4QT7A 5GAOm 1QCFA 3VU3C 3X20B 4C92E 3PGGA 2JN0A 4KGVB 2QQ9A 2GQIA 2LCLA 2EYZA 2R5MA 2LX9A 3X26B 4GBQA 4M75F 2XDBA 1VQOQ 1N27A 1I8FA 1UECA 2RO0A 1WNLA 3E9FA 4PJLA 3PNWC 2JTEA 4M77D 4E7KA 5GAN4 1YP5A 2DILA 4C5HA 1Q81R 2ROTA 3S6WA 4HVWA 2E65A 4MMLA 3OYBA 2EPDA 2ZPFB 3A5ZB 5GAMj 1LOJA 3CPWS 1JEGA 1T3SA 3LWIA 2KEAA 4C5GA 1K9MC 3P8DA 2OTLQ
chains in the Genus database with same CATH topology
3L42A 2ZPHB 3LH0A 1Y96B 4PJOF 3G4SA 3CCJT 1YHQA 2QQSA 3PT9A 3S3OA 1G3WA 3A8MB 4FL6A 4XTVA 4XTWA 5I21A 3CCMA 2FYKA 3PTAA 2I2LA 1VQKA 3CC2T 3M57A 5J39A 1YIJA 2JVVA 4JRKA 5J3BA 5J26A 2OAUA 1NJIU 5GAN2 2D0QB 1U8RA 2CGHA 2V8JA 3PIOA 2F5KA 3OQ5A 3CCVT 2DAQA 3G6EA 2QQBA 4OVAA 3EAEA 2GCXA 1K73U 1MHNA 1VIEA 5GMKl 4V2SA 3P8BB 4J7FA 3OA6A 4PJOB 1KD1U 2YHTA 2K57A 2FB7A 1LJOA 3OYYA 3OBYA 3OS2A 2F5TX 3HSBA 3P8HA 4ELZC 4E7HA 2XICA 2RHYA 1KQ2A 4OB0B 4M77E 4IUTA 1I4K1 1VUBA 2ZPBB 1DJ7B 2E6ZA 4XTUA 4C92A 2FL7A 3L2QA 5FU6C 3J80E 1VQ4T 2DXBA 3KUFA 3CMET 3ZBDA 4FM4B 4PJOG 1X6OA 1QVGS 2CZ0B 2MI6A 5GANf 4NL3A 2K5LA 3CCSA 4EPCA 3RUXA 3QJ6A 4XU3A 4BE1A 2M16A 2MMPA 5FRNA 3M5AA 5CR2A 4OB3B 2KSSA 2G3RA 5LJ5f 3QO3A 2XDPA 3JCMc 2L8DA 4XTYA 3JCMQ 1UEBA 1XOVA 3M9QA 3F70A 1KC8C 2MWOA 3NTIA 3JRZA 3M54A 3GP8A 4JS4A 4M7AC 2K3YA 2XK0A 3LYIA 4QVDA 4C8QG 5GAN7 3JB9J 1Q86C 4J6XA 3SWNC 2E1HA 4ZTFA 4LD9K 5CCAA 3NTKA 2MWPA 2GFUA 3CCJA 1B34B 4M77C 5KE2A 2GQVA 4YTLA 2RH2A 2DD5A 4HKEA 2H3JA 2JUFA 5IAYA 2EFIA 4M78G 3OYIA 1Q7YC 1BKBA 4MZPA 2BIVA 3OS5A 4QQ6A 1M4ZA 2WSEE 3L2WA 1N8RC 2VGMA 2X4YA 4EMKB 4C0DC 2P0PA 4BDYA 1WJQA 4A53A 2LT1A 3HFNA 2M0OA 2RA2A 4GY5A 5D6YA 5CKHA 1U1SA 3JAME 3OYAA 3CCVA 1JJ2A 4IUVA 3RESA 4J83A 4ZTJA 3G6ET 2BKDN 4C0GA 2KMTA 3JCMh 2DD4A 1XTDA 3ZFJA 4BI8B 5LJ3d 2QQAA 1MGQA 1N9RA 1PSFA 3CBOA 4BI3A 4ZGEB 3RERA 3CXCS 4E7IA 4ZN1A 1K9MU 3QG1A 2EWNA 2DZCA 2EQUA 1NPRA 3QJYA 1Q82C 1IZ6A 4HCBA 4JLGA 4RKUE 2V8IA 5LJ5e 3JCMX 5GAN5 3WXMB 3RKWA 2E5QA 3JCMd 3OYNA 3CMEA 2EAYA 1VQ4A 4M7DC 4FIBA 4JDSA 4D6WA 3V7CA 4DOVA 1KG1A 2KK4A 1VQ8T 3MP1A 2E70A 2HNIA 2WSFE 3HFOA 4R55A 3TU4K 4J7IA 4M7AD 5GANh 4N0AA 5LL6S 3SB2A 5GMKi 2EJGA 1G3TA 3DKMA 2DPPB 4F7UE 1VQNT 5EG2A 4A4KA 3C94A 1KQ1A 1Q81U 5LJ5h 1VIFA 3OS1A 4ATOA 1UGQB 4IUPA 3NTHA 2QDYB 2RJCA 4HA8A 4LD6A 1WJRA 4FSXA 4C5EA 5LJ3g 2PUKB 2WACA 5DM7R 3JCMP 4C92G 2R5AA 2XG8D 5A0DA 3CC7T 2HQEA 1VQ7T 2K3XA 3A8LB 3VYGA 3I55T 2CZ7B 2ZPGB 2P0QA 3FRNA 3ER0A 1BI1A 4CRIA 3OYJA 1VQ9T 5GAOn 4QVZA 3OYGA 5GMKm 3JCMg 3V8LA 2XIDA 3CCQT 2M9UA 2LDMA 1B34A 4DA4A 4HCCA 2CS7A 4LDXA 3ME9A 1P92A 4BE2A 2OTJA 4JLIA 3X25B 3CCLT 3H8ZA 5LJ3j 3M56A 4JUVA 3GOXA 2VXEA 2IVWA 1YBYA 2KAFA 3GNGA 3QHSA 2RI2A 3HP9A 4L59A 1OYXA 3SD4A 1N9SA 5FLXE 3LWHA 3JCMW 2CZ1B 2GF7A 1Y07A 2KDSA 5DLQE 1KC8U 1BIAA 3BFMA 3CC4T 3QZ5B 5GAOq 2EYQA 3MP6A 5C0MA 3UPUA 3HPWA 5IT9E 3JCMb 1W2BA 4C0ZA 2L3RA 2QEXT 4M7DD 4M7AG 1Q86U 4OP0A 2RJFA 3C4SA 2E64A 4A4EA 1FWZA 5CO7A 3INZA 3TCJA 4KULA 3PMIA 3HHTB 5FU6B 3E9GA 3X28B 1Q7YU 3S3NA 1S72T 3RKXA 5HY6A 4DOWA 2ZZDA 5CQXA 4IUUA 2EKOA 5GAMf 1N8RU 4BE0A 1Q81C 5GMKj 1VQ8A 4M75C 1ZHIA 3UT1A 2LNVA 2RM4A 4M7AE 4M77F 4WF2A 1M9SA 4X9CA 1KHCA 5D6XA 3KXTA 3JB9F 3LW5E 3G71T 1SSFA 2O4XA 2QTXA 1VQNA 1Y71A 5FU7B 3VJPA 4GLKA 4IKFA 4ZGJB 2GFAA 2RD1A 2Y90A 4NL2A 1AHJB 1QW1A 3OSSC 3J7AF 1YI2T 1NPPA 1K8AC 1UGPB 1UGRB 2HQXA 3QPHA 1M90C 4XTZA 2HD0A 3JCMJ 4Q5WA 2PVOB 5DLOA 2XKOC 4XU0A 3QZ9B 3CC7A 4B9XA 3JB9H 3I55A 4LDVA 4M77B 1Q82U 1HXDA 2L89A 3N5BB 3OW2S 3PFSA 3X24B 3A8HB 1VQ5T 3CCQA 4F7UA 3CCET 1FXXA 3CMAT 4OMFB 5CKEA 1PSEA 1BI2A 2LC4A 2LQ8A 4LDYA 3JCMV 2A7YA 4XU2A 3CCLA 3H6ZA 2RHUA 3BDUA 2VGNA 1VQPA 1YCYA 3L1AA 4M77G 4QQDA 3UWNA 3L2VA 4JRIA 3WVDB 4XU1A 1YJNT 3JB9G 4OGEA 2D6FA 2LVMA 4OB1B 4RCBA 2VYTA 5HK3A 3CC4A 1KQSS 3HL8A 4MZTA 1H641 3M59A 4M7DE 4PJOC 1V29B 2Y4YA 5GAMe 2QEXA 2DO3A 3CC2A 3MP8A 2LCCA 5DY9A 2CYZB 4PKCC 4ZN3A 2RB6A 4M75D 1WGSA 3VYHB 1YJ9T 3L2ZA 5KH6A 3M53A 4KUIA 1VQMT 1ZQ1A 4BB7A 1S72A 2PVGB 1X01A 2MF2A 5HK0A 3S3MA 2RHXA 3OS0A 3O8VA 5IN1A 3JB9I 3MCAB 5CKBA 3CCUT 3GIBA 4C8QC 1KHIA 4XTXA 5GAMh 1QP3A 4IUQA 1KQSA 1M1KU 4Y28E 1D3BB 3G71A 1O75A 2EJFA 3CPWA 2HAXA 3FDRA 2LTOA 4PNOA 3GPLA 1VQOT 1WQ7A 3GNFB 2RK1A 4NOYA 3V8JA 2DVEA 2DTIA 2K4YA 4M78C 2MAMA 3LGFA 3BY7A 3NFCA 5GAOr 1YI2A 2A3LA 3QXEB 3CBPA 2QXFA 3OSVA 2O4XB 3OBWA 5A0LA 3OYCA 4F7UF 4JS5A 2BUDA 3OYDA 3MHXA 4ME7A 2LQKA 1BI3A 4IURA 4BY6C 5M9OA 4E7LA 2R57A 4MMKA 2EJ9A 3CCMT 3M4GA 1VQ5A 1VQLT 4A4HA 1O9SA 3CCEA 3CMAA 2C06A 4M77A 1R8OB 4EMKC 3QUIA 2X4XA 5I2MA 4PJOD 2JTMA 2M1HA 4X9DA 3E1SA 2XI9A 4EDUA 1NZ9A 1M5Q1 3M58A 1YJNA 2LRQA 2D9TA 2E12A 3EFSA 3FEOA 5AYFA 2QA4T 4L5GA 4F7UB 5GANd 1GXIE 4HT8A 1VQ6T 5GAOp 3RMSA 3T9NA 3MEVA 1M90U 3MEAA 4B9WA 4A4FA 4XQ3A 2AHJB 1K8AU 2OTLT 4FT4A 5LJ5d 3CD6A 4JJNK 3QIIA 1XNIA 4M75E 2EQMA 2JNGA 4OGCA 2EIFA 4QW2A 3OMCA 4EMGA 2QI2A 1YJWT 4C8QD 1YJ9A 2RHIA 1VQMA 1M1KC 1I5LA 4F7UG 5CKDA 4JRPA 2E41A 3CCUA 2DKGA 2PVDB 1EIFA 5GAN8 4DQ2A 5GAOl 4M78D 3OYFA 1JJ2S 4M75B 1TH7A 1RL2A 4OB2B 3QKJA 5CK9A 2X4WA 3CCST 4C92C 3I56T 5CKFA 2KY9A 5I2SA 5KCOA 4M7DA 4CI0C 1BI0A 3GLXA 2XU8A 4UC4A 4ZGDB 3OYLA 1VQOA 3FJPA 1M8VA 3DLMA 2DXUA 4II1A 3TEEA 4A4GA 4J5YA 2P0KA 4N4GA 4ELYC 3HRSA 3ZEHA 1D3BA 2YLCA 5GANg 4M7AF 2P4TA 4NS5A 1FX7A 2K5IA 3C95A 1M1GA 3HRUA 3R6OA 4R56A 1QP2A 3V7SA 2DXCA 5LJ5g 4RMOA 3MEWA 3VUZA 1OZ3A 1I81A 3J81E 3VV0A 2YLBA 1BIBA 3FB9A 5GAN3 4BUGA 2EQJA 3MO8A 5LJ3f 2XD0A 1UB4A 4L6V5 1VQLA 3TREA 3LLRA 3EFRA 4HCZA 2JTFA 4KBMB 4PJOE 3FLGA 1YITT 1NE8A 5GANj 3RIRA 1QVFA 2VV5A 4M7AB 2DIGA 4VUBA 3JCMf 2QA4A 2V8KA 1WQWA 3G7ZA 3SWNB 5LJ5j 1VQ7A 2R58A 4Y91A 5L8RE 3M4YA 1VQ6A 4E7JA 1VQ9A 4C8QF 3A8OB 5CVIA 2OTLA 3CXCA 2ZPEB 2DK3A 1UGSB 5GAN6 3QDRB 2JOYA 4J6WA 4C8QE 3OYHA 2IG0A 1YJWA 3FC3A 1G3SA 4C0DB 3HKSA 4M78F 5CIUA 4EMHA 3M55A 2PQWA 2XHCA 4C0FA 1OZ2A 3OYEA 3OY9A 2RJDA 3OYKA 1JB0E 4MZMA 4C92D 4M7DF 1Y7XA 2KVQG 3CD6T 4M78E 3SDZA 3VKIA 3L2RA 2XDDA 4PLLA 4N4IA 3UDCA 2CKKA 2NLUA 4C8QB 4A54A 3LX7A 3I56A 4J8OA 3V8KA 2X4JA 1LNXA 3AHUA 2YRVA 5FU7C 2JZ2A 1W2BS 4BI4A 4M75A 1RI0A 4M78B 3CCRT 2FHDA 3HRTA 3OB9A 3OMGA 3V7RA 5LJ3e 2VUBA 3C12A 2B8AA 2F69A 3QYGB 2RI3A 3OYMA 4JRQA 3E19A 3L2UA 4M7DB 3DB4A 5KE3A 1BYMA 4N0AC 4N4HA 2KQWA 2ZGWA 2EQKA 4TVRA 1G3YA 1X75C 2DIQA 4RG2A 1NJIC 4Z02A 4QQGA 3DB3A 3JCMe 4BY6B 4LDUA 5FRMA 1HK9A 5CAIA 5A2QE 1WPYA 4OF1A 4RCCA 1K73C 3ASKA 1JRIA 5LJ3h 1YITA 4XK8E 4O5VA 4BACA 3WVEB 2E10A 4M7DG 3JSCA 1Y96A 1KD1C 1XQHA 3VUBA 2K2VA 2DTOA 5KCHA 3MEUA 2RHZA 3CEYA 4FU6A 4P5NA 4XAXB 4C5IA 5GMKe 5GAMd 3QSUA 2OTJT 1QVFS 3PMTA 1U1TA 2ZPIB 3KBGA 3URGA 1JBMA 5D6WA 3CPFA 4M7AA 3G4ST 4QVCA 3PIPA 4RG8A 1YHQT 4O6JA 4PL6A 4C92F 3SWNA 3RMQA 3BDLA 4E47A 2DZ9A 5GANe 4PLIA 5GAOm 1VQKT 2LT4A 1YIJT 3VU3C 3X20B 4C92E 4PJOA 3PGGA 2JN0A 5GMKh 4KUDK 4KT0E 2RK2A 1WJSA 2QQ9A 2PU9B 3QBYA 2VC8A 4J6YA 1OI1A 2CZ6B 2LCLA 2HBPA 3RKYA 2R5MA 2LX9A 3X26B 1IREB 4M75F 3SFMA 2XDBA 2PUOB 2FVUA 2O01E 1N27A 3QYHB 2DTHA 5A0GA 3A8GB 1H3ZA 1I8FA 4C92B 2RO0A 2RI5A 1WNLA 4BD3A 3E9FA 2DEQA 2Y4XA 3PNWC 4C8QA 3CCRA 2DXTA 5GAMg 3Q1JA 4FT2A 3DLLA 2ZCFB 4M77D 4E7KA 2X35A 5GAN4 1ZBXA 3JB9D 1QVGA 1G5VA 3BW1A 4C5HA 3META 5CQYA 2DJZA 4M78A 3S6WA 1N6AA 2E65A 4MMLA 2QQRA 4X34A 2L5QA 5FROA 3OW2A 1QVPA 3LGLA 3GF5A 3OYBA 2ZPFB 3A5ZB 4MDWA 1W4SA 2VXFA 5GAMj 2RJEA 1LOJA 3FIFA 3CPWS 3CBMA 2K5FA 4BDZA 4HT9A 4M75G 3LWIA 4MDXA 2E6NA 4LDWA 4C5GA 2WSCE 5HKCA 5C6SA 3P8DA 1VQPT 1K9MC 1M1FA 4EMKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZPH B;  1QP3 A;  1UGQ B;  4Y28 E;  1JB0 E;  3A8M B;  2QDY B;  2PUK B;  3A8L B;  2D0Q B;  3VYG A;  2CZ7 B;  2ZPG B;  3QXE B;  3QYG B;  3X25 B;  4OB0 B;  2CZ1 B;  2ZPB B;  1DJ7 B;  3QZ5 B;  2DXB A;  4FM4 B;  4XK8 E;  2CZ0 B;  3WVE B;  1GXI E;  3HHT B;  2AHJ B;  3X28 B;  4OB3 B;  2ZZD A;  2ZPI B;  3LW5 E;  2PVD B;  4ZGJ B;  3X20 B;  1AHJ B;  4OB2 B;  2DD5 A;  4KT0 E;  1UGP B;  1UGR B;  2PU9 B;  2CZ6 B;  4ZGD B;  2PVO B;  2WSE E;  3QZ9 B;  3X26 B;  1IRE B;  2PUO B;  2O01 E;  3QYH B;  3A8G B;  3X24 B;  1QP2 A;  3A8H B;  2DXC A;  2DD4 A;  1PSE A;  2ZCF B;  1PSF A;  4ZGE B;  4L6V 5;  3WVD B;  4OB1 B;  4RKU E;  1V29 B;  2ZPF B;  2CYZ B;  5L8R E;  3VYH B;  2WSF E;  3A8O B;  2ZPE B;  1UGS B;  2PVG B;  2DPP B;  2WSC E; 
#chains in the Genus database with same CATH topology
 3L42 A;  2ZPH B;  2NUP B;  1WYX A;  3LH0 A;  1Y96 B;  1YHQ A;  3A8M B;  2DA9 A;  1ZA1 B;  3PTA A;  1KC8 R;  1RI9 A;  2F1L A;  3VS0 A;  4JRK A;  5J26 A;  4LUE A;  1MHN A;  3I56 Q;  4V2S A;  3P8B B;  1Q7Y R;  2YHT A;  2QAS A;  2PZ1 A;  1N8R R;  5FW9 A;  5KYY B;  8ATC B;  2F5T X;  4J9D A;  4M77 E;  1VUB A;  1UE9 A;  2ZPB B;  1SG5 A;  3UA6 A;  3L2Q A;  1RLP C;  4PJO G;  2YUP A;  1QVG S;  2CZ0 B;  2DER A;  5GAN f;  2O9V A;  1B07 A;  4EPC A;  4XU3 A;  2MMP A;  1SKU B;  4OMO A;  1PCX A;  3QO3 A;  2XDP A;  1AOJ A;  3F70 A;  2CH4 A;  1W6X A;  3LYI A;  4J6X A;  2KYB A;  4ZTF A;  4LD9 K;  5CCA A;  3NTK A;  2MWP A;  2GFU A;  3CCJ A;  3M0R A;  2GQV A;  2DD5 A;  4AG1 C;  2JUF A;  3CQT A;  1YWO A;  1M4Z A;  4J9E A;  2LT1 A;  4RTV A;  4GY5 A;  1IHV A;  2H3E B;  2DL7 A;  4ZTJ A;  1OU9 A;  4C0G A;  2KMT A;  1SSH A;  2DD4 A;  2J6K A;  2MPX C;  2YUN A;  2QQA A;  1MGQ A;  1N9R A;  4FYW B;  2FZK B;  2DZC A;  3EG0 A;  1PG5 B;  4HCB A;  1IZ6 A;  5LJ5 e;  1CKB A;  2V8I A;  4DBF A;  1VQ4 A;  1Y0M A;  2YT6 A;  1QCN A;  1LPL A;  1HJD A;  1VQ8 T;  2WSF E;  4R55 A;  4J7I A;  5GAN h;  3VRY A;  4N0A A;  5GMK i;  5EG2 A;  2CP5 A;  1GRI A;  2QK0 A;  1VIF A;  3OS1 A;  2MIO A;  1X27 A;  2RQV A;  5DM7 R;  1I1J A;  3JCM P;  5A0D A;  2HQE A;  1I5O B;  2K3X A;  3I55 T;  1M2O A;  1GL5 A;  3FJ5 A;  2P0Q A;  1FMK A;  4PFO A;  5GMK m;  3JCM g;  2XID A;  4HCC A;  2M9U A;  1B34 A;  3I35 A;  1TWB A;  1P92 A;  4JLI A;  3GOX A;  2IVW A;  1YBY A;  3GNG A;  3TSW A;  4L59 A;  3LWH A;  1N9S A;  2LJ0 A;  1ZUY A;  2GF7 A;  1Y07 A;  1YJW Q;  2L3R A;  2QEX T;  2K9G A;  1Q86 U;  1X43 A;  2FRY A;  1KIK A;  1AWX A;  5FU6 B;  3X28 B;  2JM9 A;  1S72 T;  2DVJ A;  2YWW A;  5GAM f;  1E6G A;  1Q81 C;  1ZHI A;  3UT1 A;  4M77 F;  1WXU A;  4X9C A;  3KXT A;  1K1Z A;  1IHW A;  1QWE A;  1SSF A;  4KGZ B;  1Y71 A;  4J9F A;  2RD1 A;  3J7A F;  1QW1 A;  4RTY A;  1NPP A;  2RMO A;  3QPH A;  3JCM J;  4Q5W A;  2PVO B;  5DLO A;  4XU0 A;  3QZ9 B;  3JB9 H;  1Q82 U;  4KGX B;  1YIT Q;  3NGP A;  3OW2 S;  3PFS A;  2HEQ A;  1KSW A;  3A8H B;  3CCE T;  3CMA T;  5CKE A;  1BI2 A;  2A7Y A;  1RUW A;  2DL3 A;  2EGC A;  2KT8 A;  2VGN A;  1VQP A;  2CT4 A;  3JB9 G;  4OGE A;  2D6F A;  2L3S A;  2DNU A;  2VYT A;  3M59 A;  1EZZ B;  2RNA A;  1VQ4 Q;  5IXB A;  5KH6 A;  3M53 A;  4KUI A;  1ZQ1 A;  2MF2 A;  3OS0 A;  3CCU T;  4J9I A;  1WHG A;  3GIB A;  1KHI A;  1PRL C;  5GAM h;  2ATC B;  3G71 A;  3CCR Q;  1PC0 A;  3FDR A;  2HAX A;  3GPL A;  1I0C A;  3NPF A;  3V8J A;  4NOY A;  2DTI A;  2K4Y A;  3NFC A;  1YI2 A;  2FRW A;  1BU1 A;  2HL5 C;  2QXF A;  1SHG A;  3OBW A;  4FCY A;  3OYC A;  2ED0 A;  3OYD A;  2DX1 A;  2LQK A;  1J3T A;  1BI3 A;  1LCK A;  4BY6 C;  5M9O A;  4DBH A;  4E7L A;  2CUD A;  3M4G A;  4A4H A;  1VA7 A;  4KRT A;  4M77 A;  1R8O B;  5I2M A;  2DRM A;  3M58 A;  3G4S Q;  1YJN A;  2QA4 T;  4F7U B;  4IIO A;  2LZ6 B;  1YIJ Q;  3MEA A;  1K8A U;  2PTK A;  4X1V A;  2JNG A;  2QI2 A;  1Z9Z A;  1R77 A;  1YJ9 A;  1VQM A;  1I5L A;  4JRP A;  3EG1 A;  3G1J A;  2E4H A;  1MMN A;  4M75 B;  3QKJ A;  3C0C A;  2HSE B;  5CKF A;  5I2S A;  4ZGD B;  3EG9 A;  4AT1 B;  1M8V A;  2DXU A;  2C0I A;  2YLC A;  5GAN g;  1H8K A;  2DM1 A;  1OPK A;  1QP2 A;  3VV0 A;  2L0A A;  2KRS A;  5GAN 3;  4BUG A;  3REA B;  1UUE A;  3EFR A;  4E6R A;  3FLG A;  1VQP Q;  4Z88 A;  4OMP A;  3SWN B;  1NJI R;  1RAF B;  2R58 A;  1VQ6 A;  1VQ9 A;  2H8H A;  3A8O B;  1KQS P;  1WXB A;  1IRX A;  2JOY A;  1KD1 R;  4FW1 A;  4F14 A;  2XDD A;  5CIU A;  4EMH A;  2PQW A;  2RJD A;  2A28 A;  1D0Z A;  1QCO A;  2RF0 A;  1Y7X A;  3SDZ A;  3VKI A;  4N4I A;  2CKK A;  4C8Q B;  2ROL A;  3AHU A;  2YRV A;  1UHC A;  1YI2 Q;  1W2B S;  2ED1 A;  3CME Q;  4M78 B;  1SRL A;  3OB9 A;  3OMG A;  3V7R A;  3QYG B;  2B8A A;  2F69 A;  4M7D B;  5KE3 A;  4N0A C;  2EQK A;  1RAA B;  1UTI A;  4QQG A;  1K76 A;  4LDU A;  5CAI A;  1RAB B;  2QGG A;  5A2Q E;  1WPY A;  1QWF A;  1Y96 A;  3JSC A;  2J6F A;  5KCH A;  3MEU A;  2OTJ T;  5GMK e;  4C5I A;  1QVF S;  3PMT A;  3KBG A;  1JBM A;  2CP0 A;  4ESR A;  4E7S A;  4OML A;  4PL6 A;  1MMD A;  3RMQ A;  3BDL A;  2AIR B;  5GAN e;  1VQK T;  5ECA A;  3G6E Q;  2HKN A;  4KT0 E;  1K9M R;  1WJS A;  2CDT A;  2PU9 B;  4J6Y A;  1TTH B;  2HBP A;  2GTJ A;  1D1C A;  1IRE B;  4PJM A;  2O01 E;  1WHM A;  2DTH A;  3A8G B;  4FSS A;  5FWC A;  3VS5 A;  4C92 B;  4D8D A;  5GAM g;  2X35 A;  1G5V A;  1ZBX A;  5CQY A;  2ECZ A;  3RNJ A;  1SRM A;  1N6A A;  1B3Q A;  4AFQ C;  4X34 A;  1QVP A;  3LGL A;  1OX9 A;  1W4S A;  2VXF A;  4DEX A;  2RJE A;  3FIF A;  3CC7 Q;  3CBM A;  4M75 G;  1VQ6 Q;  4MDX A;  1VQ9 Q;  1OU8 A;  3CCQ Q;  4FL6 A;  4XTW A;  2NYS A;  1ARK A;  1RAD B;  2FYK A;  2I2L A;  3CC2 T;  3M57 A;  5J39 A;  3PVL A;  2OAU A;  3BE3 A;  2CGH A;  3CC4 Q;  4OVA A;  1K73 U;  2V1R A;  3EGD A;  4PJO B;  2D1X A;  1RAH B;  3A1P A;  3OYY A;  3OBY A;  3OS2 A;  2SRC A;  3HSB A;  1KQ2 A;  2RHY A;  2CSQ A;  4OB0 B;  1I4K 1;  2FL7 A;  4LNP A;  4Z8A A;  2EGA A;  4E7Z A;  3EHQ A;  5AT1 B;  3KUF A;  1I07 A;  2GGR A;  4NL3 A;  2K5L A;  3RUX A;  1X2Q A;  2A36 A;  3M5A A;  3PE0 A;  5CR2 A;  4OB3 B;  4J9G A;  1ZSZ B;  1UEB A;  3M9Q A;  2LMJ A;  4JS4 A;  4M7A C;  4QVD A;  4C8Q G;  4M77 C;  1D1A A;  1AWJ A;  3PVQ A;  2RH2 A;  5KE2 A;  4HKE A;  3OYI A;  4M78 G;  4MZP A;  2WSE E;  3CXC P;  2X4Y A;  4EMK B;  4BDY A;  1WJQ A;  3HFN A;  2RA2 A;  3OYA A;  4IUV A;  3RES A;  3JCM h;  4BI8 B;  5LJ3 d;  1WHJ A;  4BI3 A;  2DYB A;  2EYY A;  3CXC S;  4ZN1 A;  2A0F B;  1MV0 B;  1M1K R;  2P84 A;  3MJX A;  1NBE B;  3QJY A;  1NPR A;  4JLG A;  4RKU E;  5GAN 5;  3CD6 A;  5KYW A;  3WXM B;  2JS0 A;  4FIB A;  4JDS A;  1WI7 A;  4DOV A;  2KK4 A;  1NLP C;  2HNI A;  1K9A A;  4M7A D;  1JXM A;  4AG2 C;  5LL6 S;  1G3T A;  2DPP B;  1VQN T;  5I11 A;  3C94 A;  3CPW P;  1Q81 U;  1UGQ B;  4IUP A;  4OMN A;  3HTR A;  1WDX A;  4LD6 A;  1WJR A;  1PM3 A;  2PUK B;  2EBP A;  4C92 G;  2XMF A;  2DEU A;  1LVK A;  3A8L B;  2HBW A;  3VYG A;  2CZ7 B;  1HSQ A;  4QKU A;  1BI1 A;  4CRI A;  5GAO n;  2Z0W A;  3OYG A;  3V8L A;  4DA4 A;  2LDM A;  2RN8 A;  4BE2 A;  4CC3 A;  3X25 B;  3CCL T;  5LJ3 j;  1UJ0 A;  5FRN A;  2ZAE A;  3VS3 A;  2LJ1 A;  2EYW A;  5FLX E;  1KC8 U;  4A63 B;  5GAO q;  3UPU A;  3MP6 A;  4RUG A;  4JJC A;  2EQI A;  3UA7 A;  2O31 A;  2ESW A;  3I9Q A;  3INZ A;  3TCJ A;  4KUL A;  3PMI A;  3HHT B;  1Q7Y U;  4DOW A;  2EKO A;  1N8R U;  1QVG P;  1VQ8 A;  2X3X D;  3MKD A;  2RM4 A;  4RTZ A;  4M7A E;  1WA7 A;  5IHK A;  3EGX A;  1C1A A;  2JM8 A;  5IHI A;  3VJP A;  4AFU C;  2GFA A;  1RAC B;  1M90 C;  1UGP B;  1UGR B;  2JT4 A;  1BBZ A;  2HD0 A;  4XTZ A;  1BB9 A;  1G2B A;  3I55 A;  4LDV A;  1ZA2 B;  3N5B B;  3X24 B;  4F7U A;  4LDY A;  4XU2 A;  2V1Q A;  1YCY A;  4M77 G;  3L2V A;  6AT1 B;  1WIE A;  4RCB A;  3REB B;  2QEX A;  2DO3 A;  1GBR A;  4PFZ A;  1MND A;  2LCC A;  1ABO A;  2CYZ B;  4PKC C;  3CD6 Q;  2RB6 A;  1AT1 B;  1S72 A;  2PVG B;  1X01 A;  5HK0 A;  3O8V A;  5IN1 A;  3JB9 I;  2DBK A;  4XTX A;  4IUQ A;  4Y28 E;  2DMO A;  4F17 A;  2AT1 B;  3CPW A;  1K4U S;  2BE7 D;  3GNF B;  2RK1 A;  2DVE A;  2HZY A;  3LGF A;  3NMZ C;  1T3L A;  3OSV A;  3QWY A;  5A0L A;  2BUD A;  3MHX A;  3NHN A;  4MMK A;  2EJ9 A;  1PRM C;  1VYT A;  1VQL T;  3LH5 A;  1O9S A;  3CCE A;  3CMA A;  2X4X A;  3EH2 A;  4X9D A;  3E1S A;  2OAW A;  1PD1 A;  2KT1 A;  2CP7 A;  2D9T A;  3EFS A;  3FEO A;  5AYF A;  1YHQ Q;  3ZL7 C;  1JJ2 P;  4HT8 A;  1YN8 A;  5GAO p;  3RMS A;  2OX7 A;  3MEV A;  2CT3 A;  1UDL A;  2HQH A;  2AHJ B;  5LJ5 d;  4QW2 A;  3OMC A;  4EMG A;  1YJW T;  2RHI A;  1M1K C;  2BZX A;  1M3A A;  2VKN A;  1M2V B;  2E41 A;  3CCU A;  2DKG A;  3GBQ A;  5GAN 8;  3OYF A;  4DQ2 A;  1JJ2 S;  5CK9 A;  2X4W A;  4M7D A;  4UC4 A;  3OYL A;  2FPE A;  2E3I A;  3DLM A;  2ENM A;  4ELY C;  4J5Y A;  3EGU A;  3HRS A;  1D3B A;  2KBT A;  4M7A F;  1FX7 A;  2BZY A;  2K5I A;  3HRU A;  3I55 Q;  4DEY A;  3R6O A;  3V7S A;  3VUZ A;  3J81 E;  1I81 A;  1BIB A;  5LJ3 f;  1UB4 A;  3OW2 P;  3TRE A;  3SEM A;  2JTF A;  4KBM B;  1YIT T;  4Z89 A;  1NE8 A;  3RIR A;  1KK7 A;  4PFP A;  2VV5 A;  2DIG A;  1RAE B;  4VUB A;  3CCJ Q;  3TSZ A;  2QA4 A;  1WQW A;  5LJ5 j;  1VQ7 A;  2X9H A;  5CVI A;  1TU0 B;  2O88 A;  3QDR B;  3A98 A;  2DF6 A;  2IG0 A;  3FC3 A;  4C0D B;  3HKS A;  3OY9 A;  1OPL A;  3OYK A;  4MZM A;  1TUG B;  2KVQ G;  4WTO B;  2JW4 A;  4PLL A;  1U5S A;  4D8K A;  2NLU A;  2QTV A;  4GLM A;  3LX7 A;  3V8K A;  2VAS A;  3M0Q A;  1Z9Q A;  1EFN A;  1LNX A;  2VVK A;  4BI4 A;  3EHR A;  5KYU A;  2FHD A;  3CCR T;  2EKH A;  3L2U A;  4N4H A;  2KQW A;  2ZGW A;  3RR6 A;  1IGQ A;  2DIQ A;  4RG2 A;  4Z02 A;  3DB3 A;  3JCM e;  4BY6 B;  3CMA Q;  2KXC A;  2DET A;  2K79 A;  4LXC A;  2DRK A;  4OF1 A;  1OOT A;  3ASK A;  1JRI A;  5LJ3 h;  3I5S A;  2E10 A;  2GNC A;  1WFW A;  2DTO A;  1TSF A;  4FU6 A;  1U1T A;  2CRE A;  2C0O A;  2KXD A;  4M7A A;  3G4S T;  4QVC A;  3PIP A;  4RG8 A;  2DZ9 A;  4PLI A;  2LT4 A;  1YIJ T;  3UAT A;  4PJO A;  4KUD K;  3QBY A;  2CH4 W;  2VC8 A;  4WCI A;  2CZ6 B;  1YFN A;  1UGV A;  3RKY A;  5KYN A;  1JQQ A;  1T0H A;  1PKS A;  1QLY A;  2FVU A;  3QYH B;  5A0G A;  2IIM A;  2QYZ A;  4PK4 A;  5GJW B;  2K2M A;  4JPB W;  4BD3 A;  3Q1J A;  4FT2 A;  3DLL A;  2ZCF B;  2HSP A;  1ZUU A;  3BW1 A;  1WHL A;  3MET A;  4HXJ A;  2DJZ A;  3OW2 A;  2QQR A;  1OEB A;  4J9C A;  4MDW A;  1VQ7 Q;  1H92 A;  4BDZ A;  2E6N A;  4LDW A;  5KYX A;  5C6S A;  1VQP T;  2KGT A;  4LE9 A;  4EMK A;  2QQS A;  3S3O A;  3CCM A;  1H3H A;  4XTV A;  1VQK A;  5J3B A;  1NJI U;  2D0Q B;  1U8R A;  3H0F A;  2V8J A;  3CCV T;  2F2X A;  1BCO A;  3EAE A;  1AWW A;  1KD1 U;  2K57 A;  2FB7 A;  1LJO A;  2K6D A;  3P8H A;  4ELZ C;  1M8M A;  4E7H A;  2XIC A;  1TXQ A;  1W2B P;  2RQT A;  2KYM A;  1DJ7 B;  2E6Z A;  2DFU A;  2FZG B;  3H41 A;  2KRO A;  2DXB A;  3CME T;  1ZBJ A;  4FM4 B;  1X6O A;  3G71 Q;  2NUZ A;  1M30 A;  2MI6 A;  3CCS A;  3QJ6 A;  1PKT A;  4FYX B;  1CKA A;  2ABL A;  2G3R A;  5LJ5 f;  1ZLM A;  4XTY A;  3JCM Q;  1XOV A;  1YNZ A;  2MWO A;  2RQU A;  3NTI A;  4OMM A;  3D7S B;  3M54 A;  4ANJ A;  1W1F A;  2K3Y A;  3JB9 J;  5GAN 7;  1Q86 C;  1OV3 A;  3SWN C;  2E1H A;  1QVF P;  1MMG A;  2D8H A;  1B34 B;  4YTL A;  1KFZ A;  1PD0 A;  2EFI A;  2D0N A;  1BKB A;  3OS5 A;  4QQ6 A;  1AD5 A;  3RBB B;  1QKW A;  2VGM A;  2NUP A;  1R0C B;  3AT1 B;  2COZ A;  1E7O A;  1YJN Q;  4EIK A;  2KRM A;  2LNH B;  2M0O A;  2M51 A;  4KH0 B;  4CC2 A;  5CKH A;  1U1S A;  3JAM E;  4J83 A;  2HKQ B;  3G6E T;  2BKD N;  4OMQ A;  1XTD A;  3ZFJ A;  2DLP A;  3CBO A;  1YJ9 Q;  3RER A;  4AMC A;  1VQM Q;  4E7I A;  1K9M U;  3KFV A;  4E2F B;  1Q82 C;  5KYY A;  3OYN A;  3JCM X;  3RKW A;  2E5Q A;  4M7D C;  2AZS A;  1NYF A;  2AKK A;  1NYG A;  1U3O A;  1KG1 A;  3MP1 A;  1SHF A;  2E70 A;  3HFO A;  4F7U E;  4RTT A;  3DKM A;  4HCK A;  5D7U A;  5LJ5 h;  2RJC A;  4HA8 A;  1MMA A;  4FSX A;  1AVZ C;  5LJ3 g;  2WAC A;  2NUT B;  2E3H A;  3ULR B;  2L3P A;  2R5A A;  3CC7 T;  3CCM Q;  4J9B A;  2ZPG B;  3FRN A;  2HCK A;  3ER0 A;  1VQ9 T;  4QVZ A;  1X69 A;  2JJ9 A;  3CCQ T;  1M90 R;  2CS7 A;  3ME9 A;  3H8Z A;  3M56 A;  4JUV A;  5IH2 A;  1KQS A;  3QHS A;  3JCM W;  3HP9 A;  1OYX A;  2CZ1 B;  5DLQ E;  1WHK A;  1BIA A;  3BFM A;  3CC4 T;  3QZ5 B;  1B7T A;  5C0M A;  5IT9 E;  1W70 A;  1WX6 A;  3HPW A;  3JCM b;  1W2B A;  4M7D D;  2J6O A;  4A4E A;  4RTU A;  5CO7 A;  5L23 A;  3IQL A;  1D09 B;  3CCS Q;  4IUU A;  4BE0 A;  5GMK j;  1FYN A;  3EFO B;  1M9S A;  1KHC A;  3LW5 E;  3R6N A;  1VQN A;  5FU7 B;  4GLK A;  1M3B A;  1X2K A;  2QAZ A;  4IKF A;  1G8X A;  5GJV B;  4NL2 A;  1AHJ B;  3OSS C;  1JXO A;  2YRC A;  1K8A C;  1SF9 A;  2OJ2 A;  2CP3 A;  2XKO C;  4B9X A;  1FMV A;  1U06 A;  4M77 B;  1HXD A;  4AFS C;  2L89 A;  1VQ5 T;  2MCN A;  1C0M A;  4OMF B;  3CCL A;  1TG0 A;  3H6Z A;  2DJQ A;  2RHU A;  4JRI A;  3WVD B;  4XU1 A;  5IXF A;  5HK3 A;  4M7D E;  4PJO C;  1H64 1;  2Y4Y A;  5FWB A;  5GAM e;  1X6G A;  3MP8 A;  5DY9 A;  1M27 C;  4ZN3 A;  4DBR A;  2HL3 A;  2DBM A;  2JMA A;  3L2Z A;  1HD3 A;  1NEG A;  4BB7 A;  2M0Y A;  3S3M A;  1GFD A;  3EG9 B;  5CKB A;  1QP3 A;  3TVT A;  1M1K U;  2DYI A;  4F16 A;  2EJF A;  1TUD A;  2LTO A;  2JS2 A;  1VQO T;  2COW A;  3QXE B;  3VS2 A;  3CBP A;  2O4X B;  2A08 A;  4F7U F;  1X6B A;  3M0S A;  4F04 B;  2MK5 A;  2R57 A;  2C06 A;  4EMK C;  4FYY B;  3QUI A;  4PJO D;  1NG2 A;  2LQN A;  2K7A A;  8AT1 B;  1M5Q 1;  4L5G A;  1IB8 A;  1GXI E;  3T9N A;  2OTL T;  4A4F A;  4FT4 A;  4JJN K;  2EW3 A;  2EIF A;  1GFC A;  3H9N A;  1WLP B;  1FMW A;  4K11 A;  3EG3 A;  5GAO l;  1RL2 A;  1VQN Q;  4OB2 B;  3TQ7 P;  7AT1 B;  3I56 T;  3EH1 A;  3GLX A;  3FJP A;  4PJN A;  3GP8 A;  4II1 A;  4N4G A;  1VYU A;  2DE0 X;  2P4T A;  4NS5 A;  2QG9 B;  5EC7 A;  1MNE A;  2O2O A;  1AWO A;  5LJ5 g;  1G83 A;  1OZ3 A;  3FB9 A;  1MV3 A;  1GCQ A;  2EQJ A;  4L6V 5;  4ORZ A;  2F2W A;  1VQL A;  3QWX X;  2J05 A;  3CCL Q;  4PJO E;  2CSI A;  3G7Z A;  1JU5 C;  4Y91 A;  5L8R E;  3M4Y A;  2GBQ A;  4E7J A;  4C8Q F;  1PWT A;  3CXC A;  1IXD A;  2ZPE B;  2DK3 A;  5GAN 6;  4J6W A;  3OYH A;  3H0I A;  1YJW A;  1G3S A;  4M7A G;  4M78 F;  4C0F A;  4KH1 B;  1SEM A;  4M7D F;  3CD6 T;  3L2R A;  4HVV A;  4A54 A;  2FG0 A;  2KE9 A;  2X4J A;  3I5R A;  1PHT A;  1F1B B;  2E5K A;  4M75 A;  1RI0 A;  2QGF B;  2VUB A;  3C12 A;  2BE9 B;  3OYM A;  3VS6 A;  3E19 A;  1IGU A;  2K3B A;  3QDF A;  1G3Y A;  2LCS A;  1C6V X;  1HK9 A;  3VS7 A;  4JJD A;  1K73 C;  1CSK A;  1YIT A;  4XK8 E;  4O5V A;  4BAC A;  5HCK A;  1XQH A;  3CEY A;  1BCM A;  3QSU A;  2DL4 A;  2ZPI B;  2RQW A;  3URG A;  2W10 A;  5D6W A;  1D0Y A;  2MOX A;  1YHQ T;  4C92 F;  3SWN A;  4E47 A;  2CUB A;  1ZSG A;  4B6M A;  3EGD B;  5GMK h;  2RK2 A;  1OI1 A;  3SFM A;  2PUO B;  1H3Z A;  1JO8 A;  2DL8 A;  2RI5 A;  2JXB A;  2DEQ A;  2Y4X A;  4C8Q A;  3CCR A;  2DXT A;  2SEM A;  2OI3 A;  2FPF A;  3VS4 A;  1QVG A;  1QQJ A;  3JB9 D;  1VQ8 Q;  1AEY A;  4M78 A;  4HVU A;  5FRO A;  1VQL Q;  2L5Q A;  1D1B A;  3GF5 A;  4CC7 A;  2K5F A;  4HT9 A;  2WSC E;  5HKC A;  1M1F A;  4PJO F;  3G4S A;  1VYV A;  3CCJ T;  3PT9 A;  2NWM A;  1G3W A;  5I21 A;  1ABQ A;  4M4Z A;  1NEB A;  1YIJ A;  1QMC A;  2JVV A;  5GAN 2;  1Q86 R;  1MUZ A;  3PIO A;  2F5K A;  3OQ5 A;  2YUO A;  1T0J A;  2DAQ A;  1WHH A;  2QQB A;  2GCX A;  2D8J A;  1VIE A;  5GMK l;  2QEX Q;  4J7F A;  3OA6 A;  2EGE A;  5KYW B;  4JZ4 A;  1S72 Q;  4IUT A;  2J06 A;  4XTU A;  4C92 A;  5FU6 C;  1N5Z A;  3J80 E;  2AK5 A;  1VQ4 T;  2W0Z A;  3ZBD A;  3VS1 A;  3M0U A;  4J9H A;  2M02 A;  4BE1 A;  2M16 A;  2KSS A;  2NUT A;  3JCM c;  1Q82 R;  2L8D A;  1KC8 C;  3JRZ A;  3JV3 A;  2XK0 A;  2JMC A;  2RPN A;  3CCE Q;  2H3J A;  5IAY A;  1Q7Y C;  2BIV A;  1E6H A;  3L2W A;  1N8R C;  4C0D C;  2P0P A;  4A53 A;  1RAG B;  3CCV A;  5D6Y A;  1JJ2 A;  2FZC B;  3MPU B;  1PSF A;  3UF4 A;  4ZGE B;  2A37 A;  1AZE A;  1OUL A;  3QG1 A;  2EWN A;  3M0T A;  2EQU A;  3EFO A;  3CCU Q;  1OQK A;  3JCM d;  3EGX B;  3CME A;  2EAY A;  2AKL A;  4D6W A;  3V7C A;  3TU4 K;  3SB2 A;  2EJG A;  4A4K A;  1KQ1 A;  4ATO A;  2VWF A;  3NTH A;  1GCQ C;  2QDY B;  1UFF A;  4C5E A;  1ZSZ A;  2XG8 D;  1VQ7 T;  3H0H A;  2C0T A;  3OYJ A;  1GBQ A;  2CP6 A;  1K8A R;  9ATC B;  2QA4 Q;  4LDX A;  2OTJ A;  2VXE A;  2KAF A;  3SD4 A;  3G6E A;  2RI2 A;  2KDS A;  1UG1 A;  2EYQ A;  2LQW A;  4C0Z A;  4OP0 A;  2HMA A;  2RJF A;  3C4S A;  3M0P A;  1TS9 A;  2E64 A;  1FWZ A;  1IO6 A;  1ZX6 A;  3E9G A;  3S3N A;  3RKX A;  5HY6 A;  2ZZD A;  5CQX A;  1UHF A;  4M75 C;  2LNV A;  2LP5 A;  4WF2 A;  2O9S A;  5D6X A;  3JB9 F;  1RAI B;  3G71 T;  2F2V A;  2O4X A;  2QTX A;  1V1C A;  4ZGJ B;  2Y90 A;  1YI2 T;  2HQX A;  3CC7 A;  1Y57 A;  4IIM A;  3CCQ A;  3CCV Q;  1FXX A;  1PSE A;  2HDA A;  2LC4 A;  2LQ8 A;  2YUQ A;  2KRN A;  3JCM V;  1A0N B;  3BDU A;  3L1A A;  3UWN A;  4QQD A;  1D0X A;  1YJN T;  2BZ8 A;  2LVM A;  2MYS A;  4OB1 B;  3CC4 A;  1KQS S;  3HL8 A;  4MZT A;  2FEI A;  1V29 B;  3CC2 A;  3EG2 A;  1VOM A;  4M75 D;  1WGS A;  3VYH B;  1YJ9 T;  1VQM T;  1QKX A;  2LJ3 A;  2P4R A;  2KR3 A;  2RHX A;  4LUD A;  1R0B G;  3MCA B;  3O5Z A;  4PJJ A;  4R0K A;  4C8Q C;  2EYX A;  4LN2 A;  1D3B B;  1O75 A;  4JJB A;  4PNO A;  4AFZ C;  1WQ7 A;  1K0S A;  4JZ3 A;  4M78 C;  2MAM A;  1OX8 A;  5GAO r;  3BY7 A;  2A3L A;  2I0N A;  1TUC A;  4JS5 A;  4ME7 A;  3E2U A;  4IUR A;  2YDL A;  4RTW A;  1ACM B;  2YSQ A;  4RTX A;  3RDV A;  3CCM T;  1VQ5 A;  2DL5 A;  1BK2 A;  2OTJ Q;  2JTM A;  2M1H A;  2XI9 A;  1SPK A;  2COY A;  4EDU A;  1NZ9 A;  2LRQ A;  2E12 A;  5GAN d;  1VQ6 T;  1VQK Q;  4CC4 B;  1M90 U;  4B9W A;  4XQ3 A;  3QII A;  1XNI A;  4M75 E;  2EQM A;  4OGC A;  1PNJ A;  2FO0 A;  2QDL A;  2G6F X;  4C8Q D;  4F7U G;  5CKD A;  1Q95 G;  2PVD B;  1EIF A;  2GTO A;  2VB6 A;  4M78 D;  1TH7 A;  5IHN A;  5KYU B;  3CCS T;  4C92 C;  2KY9 A;  5KCO A;  4CI0 C;  1BI0 A;  1VQO A;  2XU8 A;  1S1N A;  1YCS B;  2CP2 A;  3TEE A;  4A4G A;  2P0K A;  3ZEH A;  5I22 A;  1GCP A;  2KNB B;  3C95 A;  1M1G A;  4R56 A;  2DXC A;  2X3W D;  4RMO A;  3MEW A;  1WZO A;  2YLB A;  1WXT A;  2X51 A;  3MO8 A;  2XD0 A;  1ZUK A;  3LLR A;  4HCZ A;  1XJW B;  5GAN j;  1QVF A;  2L3Q A;  3U23 A;  4M7A B;  2FPD A;  3JCM f;  2V8K A;  1K0X A;  3CC2 Q;  2OTL A;  1K73 R;  1UGS B;  2L2P A;  2BTT A;  4C8Q E;  3OYE A;  4ZNX A;  3M55 A;  2XHC A;  1OZ2 A;  1JB0 E;  4C92 D;  1UJY A;  1HYO A;  4M78 E;  1TOV A;  3UDC A;  2YRD A;  3I56 A;  4J8O A;  1M2V A;  2V26 A;  2YXY A;  5FU7 C;  2JZ2 A;  1EX4 A;  1YWP A;  2KI7 A;  3HRT A;  3THK A;  5LJ3 e;  2RI3 A;  4JRQ A;  2LX7 A;  3DB4 A;  4FW2 A;  1BYM A;  1V76 A;  2RQR A;  2AZV A;  4TVR A;  1M3C A;  1X75 C;  1NJI C;  4Y92 A;  1VQ5 Q;  5FRM A;  2B86 A;  3SHW A;  1NM7 A;  1RLQ C;  4RCC A;  1ZSZ C;  2PNI A;  4FYV B;  5KYX B;  1NLO C;  3WVE B;  2J7I A;  4M7D G;  1KD1 C;  2IPO B;  3VUB A;  2K2V A;  4P5N A;  2RHZ A;  4XAX B;  2EVR A;  5GAM d;  4DBQ A;  1AZG B;  3CPF A;  3VRZ A;  4O6J A;  1KJW A;  4QT7 A;  5GAO m;  1QCF A;  3VU3 C;  3X20 B;  4C92 E;  3PGG A;  2JN0 A;  4KGV B;  2QQ9 A;  2GQI A;  2LCL A;  2EYZ A;  2R5M A;  2LX9 A;  3X26 B;  4GBQ A;  4M75 F;  2XDB A;  1VQO Q;  1N27 A;  1I8F A;  1UEC A;  2RO0 A;  1WNL A;  3E9F A;  4PJL A;  3PNW C;  2JTE A;  4M77 D;  4E7K A;  5GAN 4;  1YP5 A;  2DIL A;  4C5H A;  1Q81 R;  2ROT A;  3S6W A;  4HVW A;  2E65 A;  4MML A;  3OYB A;  2EPD A;  2ZPF B;  3A5Z B;  5GAM j;  1LOJ A;  3CPW S;  1JEG A;  1T3S A;  3LWI A;  2KEA A;  4C5G A;  1K9M C;  3P8D A;  2OTL Q; 
#chains in the Genus database with same CATH homology
 3L42 A;  2ZPH B;  3LH0 A;  1Y96 B;  4PJO F;  3G4S A;  3CCJ T;  1YHQ A;  2QQS A;  3PT9 A;  3S3O A;  1G3W A;  3A8M B;  4FL6 A;  4XTV A;  4XTW A;  5I21 A;  3CCM A;  2FYK A;  3PTA A;  2I2L A;  1VQK A;  3CC2 T;  3M57 A;  5J39 A;  1YIJ A;  2JVV A;  4JRK A;  5J3B A;  5J26 A;  2OAU A;  1NJI U;  5GAN 2;  2D0Q B;  1U8R A;  2CGH A;  2V8J A;  3PIO A;  2F5K A;  3OQ5 A;  3CCV T;  2DAQ A;  3G6E A;  2QQB A;  4OVA A;  3EAE A;  2GCX A;  1K73 U;  1MHN A;  1VIE A;  5GMK l;  4V2S A;  3P8B B;  4J7F A;  3OA6 A;  4PJO B;  1KD1 U;  2YHT A;  2K57 A;  2FB7 A;  1LJO A;  3OYY A;  3OBY A;  3OS2 A;  2F5T X;  3HSB A;  3P8H A;  4ELZ C;  4E7H A;  2XIC A;  2RHY A;  1KQ2 A;  4OB0 B;  4M77 E;  4IUT A;  1I4K 1;  1VUB A;  2ZPB B;  1DJ7 B;  2E6Z A;  4XTU A;  4C92 A;  2FL7 A;  3L2Q A;  5FU6 C;  3J80 E;  1VQ4 T;  2DXB A;  3KUF A;  3CME T;  3ZBD A;  4FM4 B;  4PJO G;  1X6O A;  1QVG S;  2CZ0 B;  2MI6 A;  5GAN f;  4NL3 A;  2K5L A;  3CCS A;  4EPC A;  3RUX A;  3QJ6 A;  4XU3 A;  4BE1 A;  2M16 A;  2MMP A;  5FRN A;  3M5A A;  5CR2 A;  4OB3 B;  2KSS A;  2G3R A;  5LJ5 f;  3QO3 A;  2XDP A;  3JCM c;  2L8D A;  4XTY A;  3JCM Q;  1UEB A;  1XOV A;  3M9Q A;  3F70 A;  1KC8 C;  2MWO A;  3NTI A;  3JRZ A;  3M54 A;  3GP8 A;  4JS4 A;  4M7A C;  2K3Y A;  2XK0 A;  3LYI A;  4QVD A;  4C8Q G;  5GAN 7;  3JB9 J;  1Q86 C;  4J6X A;  3SWN C;  2E1H A;  4ZTF A;  4LD9 K;  5CCA A;  3NTK A;  2MWP A;  2GFU A;  3CCJ A;  1B34 B;  4M77 C;  5KE2 A;  2GQV A;  4YTL A;  2RH2 A;  2DD5 A;  4HKE A;  2H3J A;  2JUF A;  5IAY A;  2EFI A;  4M78 G;  3OYI A;  1Q7Y C;  1BKB A;  4MZP A;  2BIV A;  3OS5 A;  4QQ6 A;  1M4Z A;  2WSE E;  3L2W A;  1N8R C;  2VGM A;  2X4Y A;  4EMK B;  4C0D C;  2P0P A;  4BDY A;  1WJQ A;  4A53 A;  2LT1 A;  3HFN A;  2M0O A;  2RA2 A;  4GY5 A;  5D6Y A;  5CKH A;  1U1S A;  3JAM E;  3OYA A;  3CCV A;  1JJ2 A;  4IUV A;  3RES A;  4J83 A;  4ZTJ A;  3G6E T;  2BKD N;  4C0G A;  2KMT A;  3JCM h;  2DD4 A;  1XTD A;  3ZFJ A;  4BI8 B;  5LJ3 d;  2QQA A;  1MGQ A;  1N9R A;  1PSF A;  3CBO A;  4BI3 A;  4ZGE B;  3RER A;  3CXC S;  4E7I A;  4ZN1 A;  1K9M U;  3QG1 A;  2EWN A;  2DZC A;  2EQU A;  1NPR A;  3QJY A;  1Q82 C;  1IZ6 A;  4HCB A;  4JLG A;  4RKU E;  2V8I A;  5LJ5 e;  3JCM X;  5GAN 5;  3WXM B;  3RKW A;  2E5Q A;  3JCM d;  3OYN A;  3CME A;  2EAY A;  1VQ4 A;  4M7D C;  4FIB A;  4JDS A;  4D6W A;  3V7C A;  4DOV A;  1KG1 A;  2KK4 A;  1VQ8 T;  3MP1 A;  2E70 A;  2HNI A;  2WSF E;  3HFO A;  4R55 A;  3TU4 K;  4J7I A;  4M7A D;  5GAN h;  4N0A A;  5LL6 S;  3SB2 A;  5GMK i;  2EJG A;  1G3T A;  3DKM A;  2DPP B;  4F7U E;  1VQN T;  5EG2 A;  4A4K A;  3C94 A;  1KQ1 A;  1Q81 U;  5LJ5 h;  1VIF A;  3OS1 A;  4ATO A;  1UGQ B;  4IUP A;  3NTH A;  2QDY B;  2RJC A;  4HA8 A;  4LD6 A;  1WJR A;  4FSX A;  4C5E A;  5LJ3 g;  2PUK B;  2WAC A;  5DM7 R;  3JCM P;  4C92 G;  2R5A A;  2XG8 D;  5A0D A;  3CC7 T;  2HQE A;  1VQ7 T;  2K3X A;  3A8L B;  3VYG A;  3I55 T;  2CZ7 B;  2ZPG B;  2P0Q A;  3FRN A;  3ER0 A;  1BI1 A;  4CRI A;  3OYJ A;  1VQ9 T;  5GAO n;  4QVZ A;  3OYG A;  5GMK m;  3JCM g;  3V8L A;  2XID A;  3CCQ T;  2M9U A;  2LDM A;  1B34 A;  4DA4 A;  4HCC A;  2CS7 A;  4LDX A;  3ME9 A;  1P92 A;  4BE2 A;  2OTJ A;  4JLI A;  3X25 B;  3CCL T;  3H8Z A;  5LJ3 j;  3M56 A;  4JUV A;  3GOX A;  2VXE A;  2IVW A;  1YBY A;  2KAF A;  3GNG A;  3QHS A;  2RI2 A;  3HP9 A;  4L59 A;  1OYX A;  3SD4 A;  1N9S A;  5FLX E;  3LWH A;  3JCM W;  2CZ1 B;  2GF7 A;  1Y07 A;  2KDS A;  5DLQ E;  1KC8 U;  1BIA A;  3BFM A;  3CC4 T;  3QZ5 B;  5GAO q;  2EYQ A;  3MP6 A;  5C0M A;  3UPU A;  3HPW A;  5IT9 E;  3JCM b;  1W2B A;  4C0Z A;  2L3R A;  2QEX T;  4M7D D;  4M7A G;  1Q86 U;  4OP0 A;  2RJF A;  3C4S A;  2E64 A;  4A4E A;  1FWZ A;  5CO7 A;  3INZ A;  3TCJ A;  4KUL A;  3PMI A;  3HHT B;  5FU6 B;  3E9G A;  3X28 B;  1Q7Y U;  3S3N A;  1S72 T;  3RKX A;  5HY6 A;  4DOW A;  2ZZD A;  5CQX A;  4IUU A;  2EKO A;  5GAM f;  1N8R U;  4BE0 A;  1Q81 C;  5GMK j;  1VQ8 A;  4M75 C;  1ZHI A;  3UT1 A;  2LNV A;  2RM4 A;  4M7A E;  4M77 F;  4WF2 A;  1M9S A;  4X9C A;  1KHC A;  5D6X A;  3KXT A;  3JB9 F;  3LW5 E;  3G71 T;  1SSF A;  2O4X A;  2QTX A;  1VQN A;  1Y71 A;  5FU7 B;  3VJP A;  4GLK A;  4IKF A;  4ZGJ B;  2GFA A;  2RD1 A;  2Y90 A;  4NL2 A;  1AHJ B;  1QW1 A;  3OSS C;  3J7A F;  1YI2 T;  1NPP A;  1K8A C;  1UGP B;  1UGR B;  2HQX A;  3QPH A;  1M90 C;  4XTZ A;  2HD0 A;  3JCM J;  4Q5W A;  2PVO B;  5DLO A;  2XKO C;  4XU0 A;  3QZ9 B;  3CC7 A;  4B9X A;  3JB9 H;  3I55 A;  4LDV A;  4M77 B;  1Q82 U;  1HXD A;  2L89 A;  3N5B B;  3OW2 S;  3PFS A;  3X24 B;  3A8H B;  1VQ5 T;  3CCQ A;  4F7U A;  3CCE T;  1FXX A;  3CMA T;  4OMF B;  5CKE A;  1PSE A;  1BI2 A;  2LC4 A;  2LQ8 A;  4LDY A;  3JCM V;  2A7Y A;  4XU2 A;  3CCL A;  3H6Z A;  2RHU A;  3BDU A;  2VGN A;  1VQP A;  1YCY A;  3L1A A;  4M77 G;  4QQD A;  3UWN A;  3L2V A;  4JRI A;  3WVD B;  4XU1 A;  1YJN T;  3JB9 G;  4OGE A;  2D6F A;  2LVM A;  4OB1 B;  4RCB A;  2VYT A;  5HK3 A;  3CC4 A;  1KQS S;  3HL8 A;  4MZT A;  1H64 1;  3M59 A;  4M7D E;  4PJO C;  1V29 B;  2Y4Y A;  5GAM e;  2QEX A;  2DO3 A;  3CC2 A;  3MP8 A;  2LCC A;  5DY9 A;  2CYZ B;  4PKC C;  4ZN3 A;  2RB6 A;  4M75 D;  1WGS A;  3VYH B;  1YJ9 T;  3L2Z A;  5KH6 A;  3M53 A;  4KUI A;  1VQM T;  1ZQ1 A;  4BB7 A;  1S72 A;  2PVG B;  1X01 A;  2MF2 A;  5HK0 A;  3S3M A;  2RHX A;  3OS0 A;  3O8V A;  5IN1 A;  3JB9 I;  3MCA B;  5CKB A;  3CCU T;  3GIB A;  4C8Q C;  1KHI A;  4XTX A;  5GAM h;  1QP3 A;  4IUQ A;  1KQS A;  1M1K U;  4Y28 E;  1D3B B;  3G71 A;  1O75 A;  2EJF A;  3CPW A;  2HAX A;  3FDR A;  2LTO A;  4PNO A;  3GPL A;  1VQO T;  1WQ7 A;  3GNF B;  2RK1 A;  4NOY A;  3V8J A;  2DVE A;  2DTI A;  2K4Y A;  4M78 C;  2MAM A;  3LGF A;  3BY7 A;  3NFC A;  5GAO r;  1YI2 A;  2A3L A;  3QXE B;  3CBP A;  2QXF A;  3OSV A;  2O4X B;  3OBW A;  5A0L A;  3OYC A;  4F7U F;  4JS5 A;  2BUD A;  3OYD A;  3MHX A;  4ME7 A;  2LQK A;  1BI3 A;  4IUR A;  4BY6 C;  5M9O A;  4E7L A;  2R57 A;  4MMK A;  2EJ9 A;  3CCM T;  3M4G A;  1VQ5 A;  1VQL T;  4A4H A;  1O9S A;  3CCE A;  3CMA A;  2C06 A;  4M77 A;  1R8O B;  4EMK C;  3QUI A;  2X4X A;  5I2M A;  4PJO D;  2JTM A;  2M1H A;  4X9D A;  3E1S A;  2XI9 A;  4EDU A;  1NZ9 A;  1M5Q 1;  3M58 A;  1YJN A;  2LRQ A;  2D9T A;  2E12 A;  3EFS A;  3FEO A;  5AYF A;  2QA4 T;  4L5G A;  4F7U B;  5GAN d;  1GXI E;  4HT8 A;  1VQ6 T;  5GAO p;  3RMS A;  3T9N A;  3MEV A;  1M90 U;  3MEA A;  4B9W A;  4A4F A;  4XQ3 A;  2AHJ B;  1K8A U;  2OTL T;  4FT4 A;  5LJ5 d;  3CD6 A;  4JJN K;  3QII A;  1XNI A;  4M75 E;  2EQM A;  2JNG A;  4OGC A;  2EIF A;  4QW2 A;  3OMC A;  4EMG A;  2QI2 A;  1YJW T;  4C8Q D;  1YJ9 A;  2RHI A;  1VQM A;  1M1K C;  1I5L A;  4F7U G;  5CKD A;  4JRP A;  2E41 A;  3CCU A;  2DKG A;  2PVD B;  1EIF A;  5GAN 8;  4DQ2 A;  5GAO l;  4M78 D;  3OYF A;  1JJ2 S;  4M75 B;  1TH7 A;  1RL2 A;  4OB2 B;  3QKJ A;  5CK9 A;  2X4W A;  3CCS T;  4C92 C;  3I56 T;  5CKF A;  2KY9 A;  5I2S A;  5KCO A;  4M7D A;  4CI0 C;  1BI0 A;  3GLX A;  2XU8 A;  4UC4 A;  4ZGD B;  3OYL A;  1VQO A;  3FJP A;  1M8V A;  3DLM A;  2DXU A;  4II1 A;  3TEE A;  4A4G A;  4J5Y A;  2P0K A;  4N4G A;  4ELY C;  3HRS A;  3ZEH A;  1D3B A;  2YLC A;  5GAN g;  4M7A F;  2P4T A;  4NS5 A;  1FX7 A;  2K5I A;  3C95 A;  1M1G A;  3HRU A;  3R6O A;  4R56 A;  1QP2 A;  3V7S A;  2DXC A;  5LJ5 g;  4RMO A;  3MEW A;  3VUZ A;  1OZ3 A;  1I81 A;  3J81 E;  3VV0 A;  2YLB A;  1BIB A;  3FB9 A;  5GAN 3;  4BUG A;  2EQJ A;  3MO8 A;  5LJ3 f;  2XD0 A;  1UB4 A;  4L6V 5;  1VQL A;  3TRE A;  3LLR A;  3EFR A;  4HCZ A;  2JTF A;  4KBM B;  4PJO E;  3FLG A;  1YIT T;  1NE8 A;  5GAN j;  3RIR A;  1QVF A;  2VV5 A;  4M7A B;  2DIG A;  4VUB A;  3JCM f;  2QA4 A;  2V8K A;  1WQW A;  3G7Z A;  3SWN B;  5LJ5 j;  1VQ7 A;  2R58 A;  4Y91 A;  5L8R E;  3M4Y A;  1VQ6 A;  4E7J A;  1VQ9 A;  4C8Q F;  3A8O B;  5CVI A;  2OTL A;  3CXC A;  2ZPE B;  2DK3 A;  1UGS B;  5GAN 6;  3QDR B;  2JOY A;  4J6W A;  4C8Q E;  3OYH A;  2IG0 A;  1YJW A;  3FC3 A;  1G3S A;  4C0D B;  3HKS A;  4M78 F;  5CIU A;  4EMH A;  3M55 A;  2PQW A;  2XHC A;  4C0F A;  1OZ2 A;  3OYE A;  3OY9 A;  2RJD A;  3OYK A;  1JB0 E;  4MZM A;  4C92 D;  4M7D F;  1Y7X A;  2KVQ G;  3CD6 T;  4M78 E;  3SDZ A;  3VKI A;  3L2R A;  2XDD A;  4PLL A;  4N4I A;  3UDC A;  2CKK A;  2NLU A;  4C8Q B;  4A54 A;  3LX7 A;  3I56 A;  4J8O A;  3V8K A;  2X4J A;  1LNX A;  3AHU A;  2YRV A;  5FU7 C;  2JZ2 A;  1W2B S;  4BI4 A;  4M75 A;  1RI0 A;  4M78 B;  3CCR T;  2FHD A;  3HRT A;  3OB9 A;  3OMG A;  3V7R A;  5LJ3 e;  2VUB A;  3C12 A;  2B8A A;  2F69 A;  3QYG B;  2RI3 A;  3OYM A;  4JRQ A;  3E19 A;  3L2U A;  4M7D B;  3DB4 A;  5KE3 A;  1BYM A;  4N0A C;  4N4H A;  2KQW A;  2ZGW A;  2EQK A;  4TVR A;  1G3Y A;  1X75 C;  2DIQ A;  4RG2 A;  1NJI C;  4Z02 A;  4QQG A;  3DB3 A;  3JCM e;  4BY6 B;  4LDU A;  5FRM A;  1HK9 A;  5CAI A;  5A2Q E;  1WPY A;  4OF1 A;  4RCC A;  1K73 C;  3ASK A;  1JRI A;  5LJ3 h;  1YIT A;  4XK8 E;  4O5V A;  4BAC A;  3WVE B;  2E10 A;  4M7D G;  3JSC A;  1Y96 A;  1KD1 C;  1XQH A;  3VUB A;  2K2V A;  2DTO A;  5KCH A;  3MEU A;  2RHZ A;  3CEY A;  4FU6 A;  4P5N A;  4XAX B;  4C5I A;  5GMK e;  5GAM d;  3QSU A;  2OTJ T;  1QVF S;  3PMT A;  1U1T A;  2ZPI B;  3KBG A;  3URG A;  1JBM A;  5D6W A;  3CPF A;  4M7A A;  3G4S T;  4QVC A;  3PIP A;  4RG8 A;  1YHQ T;  4O6J A;  4PL6 A;  4C92 F;  3SWN A;  3RMQ A;  3BDL A;  4E47 A;  2DZ9 A;  5GAN e;  4PLI A;  5GAO m;  1VQK T;  2LT4 A;  1YIJ T;  3VU3 C;  3X20 B;  4C92 E;  4PJO A;  3PGG A;  2JN0 A;  5GMK h;  4KUD K;  4KT0 E;  2RK2 A;  1WJS A;  2QQ9 A;  2PU9 B;  3QBY A;  2VC8 A;  4J6Y A;  1OI1 A;  2CZ6 B;  2LCL A;  2HBP A;  3RKY A;  2R5M A;  2LX9 A;  3X26 B;  1IRE B;  4M75 F;  3SFM A;  2XDB A;  2PUO B;  2FVU A;  2O01 E;  1N27 A;  3QYH B;  2DTH A;  5A0G A;  3A8G B;  1H3Z A;  1I8F A;  4C92 B;  2RO0 A;  2RI5 A;  1WNL A;  4BD3 A;  3E9F A;  2DEQ A;  2Y4X A;  3PNW C;  4C8Q A;  3CCR A;  2DXT A;  5GAM g;  3Q1J A;  4FT2 A;  3DLL A;  2ZCF B;  4M77 D;  4E7K A;  2X35 A;  5GAN 4;  1ZBX A;  3JB9 D;  1QVG A;  1G5V A;  3BW1 A;  4C5H A;  3MET A;  5CQY A;  2DJZ A;  4M78 A;  3S6W A;  1N6A A;  2E65 A;  4MML A;  2QQR A;  4X34 A;  2L5Q A;  5FRO A;  3OW2 A;  1QVP A;  3LGL A;  3GF5 A;  3OYB A;  2ZPF B;  3A5Z B;  4MDW A;  1W4S A;  2VXF A;  5GAM j;  2RJE A;  1LOJ A;  3FIF A;  3CPW S;  3CBM A;  2K5F A;  4BDZ A;  4HT9 A;  4M75 G;  3LWI A;  4MDX A;  2E6N A;  4LDW A;  4C5G A;  2WSC E;  5HKC A;  5C6S A;  3P8D A;  1VQP T;  1K9M C;  1M1F A;  4EMK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...