4M75C

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
70
Chain Sequence
PLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
total genus 13
structure length 70
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75C00
4C8QG 3RKYA 5LJ3d 4V2SA 1I8FA 2K57A 4M7AE 5LJ3g 3V7RA 4NL2A 3FIFA 2YLBA 3BDUA 3JB9J 5GMKl 4N0AC 1Y96A 2EAYA 3SWNC 2DEQA 3BY7A 5GAOr 4F7UF 3QO3A 1I4K1 2EWNA 4X9CA 5LJ3e 1D3BB 4EMHA 1LNXA 4C92D 2E64A 2DZCA 5GANh 1WQ7A 5GAN7 4M77A 4C8QB 3BW1A 3RIRA 2E41A 2YLCA 5I21A 4M7DF 4RCCA 3QSUA 2EJFA 1H641 3V7SA 1BIAA 2HNIA 4M75C 4J6WA 5LJ3f 4M7DG 1I5LA 2E65A 4M7AD 3BFMA 3L1AA 4M75D 2RA2A 5LJ5j 3PGGA 5GAMh 4N0AA 1U1SA 3JCMW 4HT8A 2DZ9A 4M77F 4DQ2A 2EJ9A 4XQ3A 3INZA 4QVDA 4M77G 5GANd 4C92A 5GAN2 2QTXA 3GIBA 3JB9H 1YCYA 3V7CA 2DTIA 3JCMb 2FB7A 3VU3C 4M7DB 5GAMd 4M7AA 1M5Q1 3RKXA 2DTHA 5GANe 4RCBA 4J5YA 4M75A 4XU3A 4C92C 5GAMg 5GAN4 4PJOC 4HA8A 4X9DA 4M78C 4OP0A 4F7UE 4PJOD 2DXUA 4JRIA 4M78D 2Y90A 4M77B 4C92G 1KQ2A 3JCMV 1B34A 2FYKA 3JCMh 5CAIA 5GMKe 5GAOq 5GAMe 4EMKA 4M7AC 1MGQA 5LJ5h 2EJGA 5GANf 3HSBA 4M75F 5GMKh 2RB6A 4J6XA 3V8JA 3JB9I 4M7DE 4M7AG 4XTXA 3QHSA 3L2ZA 4M75G 1N9RA 3SWNB 5GMKi 1I81A 3EFRA 3HFNA 4MMKA 4EMKC 1LJOA 3JCMc 4C8QE 4M77E 5GAMf 3JCMX 5GANg 4HT9A 4PJOA 2DXTA 3JCMd 4M78A 3RESA 1N9SA 4XTUA 3JCMg 5LJ5d 1Y96B 4EMGA 4QVCA 4JLIA 3JCMJ 3JB9D 2VC8A 4A54A 3HFOA 4M7AB 3RKWA 5LJ3j 4M75B 4Y91A 3RUXA 4C92F 2VXEA 4PJOF 2ZGWA 4M78F 3JCMe 3FB9A 1X01A 3M4GA 4PJOG 3SB2A 5LJ5e 4M78G 1HK9A 4XTZA 4XU1A 1JRIA 2YHTA 4C8QD 4EMKB 4M7AF 3FJPA 1WNLA 2VXFA 3V8KA 4F7UA 3RERA 2RD1A 4MMLA 4XU2A 4XTYA 3JCMf 4NOYA 4M75E 1M8VA 5LJ5f 5DY9A 1KQ1A 3QUIA 3JCMQ 5GAN8 3JCMP 4M7DA 5GAOn 4NL3A 4C92B 2DKGA 2E1HA 4PJOB 4M78B 1D3BA 5GMKm 2DVEA 4F7UG 3EFSA 5GAOp 4A53A 3JB9F 5LJ3h 2CGHA 4C8QA 5LJ5g 1BIBA 2DTOA 1HXDA 4XU0A 1JBMA 4JUVA 4M7DC 1WQWA 5GANj 3JB9G 2I2LA 2JN0A 5GAN6 5GAN5 5GAOl 4M7DD 4JRKA 1U1TA 2DJZA 3V8LA 3AHUA 4PNOA 5GAN3 1LOJA 1TH7A 1WPYA 2RM4A 4C92E 4WF2A 4PJOE 4C8QC 1B34B 2E10A 4M78E 4M77C 4XTWA 4XTVA 4C8QF 3SWNA 5GMKj 5GAMj 4J6YA 4M77D 5GAOm 4F7UB
chains in the Genus database with same CATH superfamily
2G6FX 1KQSP 5FRNA 2QA4Q 1AWOA 3CXCA 1W2BS 4ELYC 1CKBA 4DA4A 2JZ2A 3BE3A 5LJ3e 1D3BB 2DVJA 4DOVA 3HRUA 2DERA 1BIAA 2HNIA 4M7DG 1RI0A 2YRDA 3M55A 2R5MA 4M75D 5CQXA 5M9OA 1WI7A 3VYGA 4PJLA 1G8XA 4C92A 2D8JA 5FLXE 1KD1R 1GFCA 3QIIA 3S3MA 1RL2A 1WIEA 4J5YA 4F17A 5GAN4 2V8JA 4JRQA 3REAB 1UGSB 1B34A 4OB0B 2PUOB 5I11A 3I55T 1LPLA 2DPPB 2DRMA 4M7AG 2FO0A 3L2WA 3MCAB 1NJIU 2PQWA 2HKNA 3CCET 1VQ4A 4B9WA 4BY6B 1QWEA 1VQ9T 5L23A 2PUKB 1Q7YR 1Q82R 5DLOA 3CQTA 1FYNA 2MWOA 2QAZA 2YHTA 3L2QA 3CXCS 3OYHA 1WHGA 4J7FA 3TVTA 4E7LA 3E9FA 1T0JA 4M7DA 1EX4A 1OPKA 4PFOA 3UF4A 2L3PA 1AD5A 1HXDA 1RAIB 3CCQT 1N8RR 2LC4A 3OBYA 2PZ1A 3CCSA 1LOJA 1WJSA 2XK0A 3BDLA 2K3BA 4EPCA 3VKIA 2HQXA 3LLRA 2BZXA 2COYA 2X4YA 4N4HA 1YHQT 1VQLT 3BY7A 2LCCA 2C06A 1N6AA 2AHJB 4BY6C 1R8OB 3CMEQ 4E7HA 1E7OA 4ZNXA 1M3BA 4J9BA 3PGGA 3X20B 4CC3A 1ZBJA 2O4XB 2ED0A 4KT0E 4AG1C 4XK8E 4QVDA 1KQSA 1KHCA 1G3WA 2DTIA 2CT3A 1UDLA 5GAMd 3RKXA 2Y4YA 4DBHA 4M78D 4M77B 1W6XA 1MV3A 1K8AC 2QK0A 3JCMV 3TREA 1VQNT 1OYXA 4EMKA 1KHIA 3CC7A 2QI2A 1QCNA 2LNHB 1M3CA 2QQAA 4LUDA 4KH1B 4PK4A 3E1SA 4RG2A 4MMKA 5GAMf 3DLLA 4HT9A 2LMJA 4B9XA 2ZAEA 2DD5A 1PWTA 5LJ5d 4QVCA 4A4EA 3JCMJ 4BI8B 1MMDA 1D1CA 2YUQA 1ARKA 1VQ4T 3X28B 4XTZA 1Z9ZA 2K7AA 2JS0A 4XU2A 1OOTA 2KGTA 2ZZDA 3CC4Q 4C0DB 3CCJA 5LJ5f 4FL6A 1NJIR 4DEYA 1OX9A 1C6VX 2HD0A 1D3BA 4J9EA 5GMKm 3MJXA 1NYGA 3URGA 1BIBA 1ZUUA 3M59A 5IHNA 2LX9A 3C94A 4EIKA 2HEQA 3CCRQ 5IXBA 2HL3A 4WF2A 4M77C 1EZZB 3UWNA 1XQHA 3M0RA 3VS1A 1UE9A 2RJDA 3OS5A 2EKOA 4J9DA 1M3AA 2DBMA 1KIKA 4F7UF 2VWFA 4QW2A 1YFNA 3HTRA 2NWMA 2KYBA 1FMWA 4ZGEB 1AT1B 2F5KA 2RHUA 2ENMA 2M51A 2GFUA 2W10A 3JAME 2DZ9A 1FMVA 1YWPA 5A0LA 1GFDA 5D6WA 2DM1A 2QA4A 2QQBA 3META 1YCSB 4C0DC 4RUGA 3LH0A 2A28A 2FHDA 4RCBA 5GANe 2RH2A 4F7UE 5KYUA 2Y90A 2GQVA 1WJQA 3OSVA 1MUZA 5KYYA 3EGDA 3L2RA 4M75G 1Y71A 3SWNB 4FU6A 2D0QB 4RKUE 1E6GA 4RTYA 5FWBA 4GY5A 4J9HA 4BDZA 4FYWB 1IRXA 4JZ4A 1NLOC 2O9VA 4K11A 3CCMT 2CSQA 2GBQA 3RBBB 5DM7R 2BZYA 5LJ3j 1PD0A 2XDPA 2DAQA 1RACB 3M0SA 3H0FA 2J6OA 2ZPFB 3CCUA 2CZ1B 3OYJA 3PMIA 2YT6A 4FM4B 2LJ1A 1VQ5Q 2AK5A 1WX6A 4J9GA 1OEBA 2L89A 5KYWB 2O9SA 2E6NA 3PIPA 2ZPHB 1V29B 1I1JA 3NTKA 1SPKA 3AHUA 1S72Q 2O4XA 4JJDA 4LDUA 2J05A 3SWNC 4JRPA 2V8IA 3LWHA 3NTHA 1I4K1 2DE0X 5FU6B 1QVFP 4EMHA 1K0XA 1WQ7A 5A2QE 4M77A 4UC4A 2DIQA 1QVGP 2V8KA 1VQPQ 3BFMA 5GAMh 1AWJA 4QT7A 4E7ZA 5IHKA 1XJWB 2A08A 2NYSA 2JS2A 1MMNA 3C12A 4C0ZA 4ZN3A 1FMKA 2DYIA 4CRIA 1SF9A 1VQ8Q 2MCNA 4PJOD 3ULRB 1NZ9A 2VGMA 1ABQA 3JV3A 1OU9A 3AT1B 3CMEA 3REBB 3VJPA 3LYIA 2E5QA 2CH4A 5LJ5h 2KI7A 3QHSA 1VYUA 3OA6A 2GQIA 5GMKi 1ZX6A 1ZSZB 2RJFA 3TQ7P 1ABOA 2EYWA 3ZL7C 1R77A 2K79A 3RUXA 4GLMA 1UB4A 1X01A 2A37A 1QVPA 1WHKA 4M78G 2IPOB 2F1LA 3G6EA 4C8QD 1M2OA 2KK4A 1D0XA 2CZ6B 4CI0C 3GP8A 1Q86U 1K0SA 2P4TA 1OV3A 2PVOB 1ZA2B 1AZEA 2OTLA 1ZUYA 1KQ1A 3RNJA 3OS2A 4C92B 3MEUA 4L59A 2H8HA 2M0OA 3J7AF 2EGAA 3CCUT 4F7UG 3I56A 2J6KA 3EH1A 1ZHIA 4E2FB 3PT9A 3A8LB 4JUVA 1GL5A 3M5AA 1NBEB 2F2XA 2I2LA 2PU9B 1B34B 2YUPA 2FEIA 3VRYA 3CC4A 2PVDB 3C0CA 2CDTA 2VGNA 2DEQA 4ESRA 3L42A 5I2MA 1QCFA 1RAEB 1U06A 4BB7A 2LZ6B 1M90U 1RABB 2PNIA 3VS5A 2LNVA 1VA7A 3OS0A 1YWOA 4MZTA 3M58A 4BUGA 5A0DA 3CCRA 1JJ2A 3CC2Q 2E70A 2P4RA 3QKJA 1Y7XA 4FSXA 5KE3A 1OZ2A 2KMTA 1Q7YC 1IO6A 3DLMA 4M7DB 1XNIA 2DL5A 2P0QA 4J83A 4HVVA 4C92C 4Z89A 1KFZA 5A0GA 1QVFA 4LXCA 1OZ3A 1YJNQ 1X6BA 1QVGA 3QBYA 3DB3A 1T3SA 4J6XA 1IHWA 2OTJA 3CMAT 2KY9A 5EC7A 1VQOQ 4C8QE 1N8RC 3G71T 3OS1A 3I5RA 4M7AB 3OYFA 3A8MB 2YWWA 3CPFA 2DL4A 3OMCA 1JXMA 5KCHA 4AFUC 3JCMQ 4X34A 1VQ7A 3L2VA 4R56A 3X24B 5J39A 3LH5A 1AHJB 3EG2A 3EFSA 3VRZA 3A5ZB 1JJ2S 2OTLT 1JBMA 4M7DC 5GANj 2L3SA 4JRKA 1M2VB 2CUDA 1YITT 1PCXA 2EBPA 1BCOA 1CSKA 4V2SA 4KRTA 3CBMA 1SKUB 3FIFA 5KH6A 4N0AC 2KT8A 1RUWA 4BD3A 1VQ5A 4ZTJA 4MDXA 1I0CA 5CIUA 3CCVQ 5FWCA 4P5NA 3M57A 2LT4A 3G4ST 3GBQA 4II1A 2LP5A 2FVUA 1U1SA 2EJ9A 4FYVB 2CP3A 3PTAA 2K3YA 1W1FA 3CEYA 1ZSZA 4E7SA 4Q5WA 8AT1B 2EQKA 1YI2A 4OP0A 2JOYA 5CQYA 2VB6A 3NGPA 3CCLA 1UHFA 1V1CA 2V26A 2O88A 1NJIC 2EGEA 2KRNA 4XTXA 3MHXA 1GXIE 5I2SA 4EMKC 1QP3A 5CKBA 3KXTA 4FCYA 5KCOA 4OGEA 2OTJT 4EMGA 3GF5A 1XTDA 2DL3A 3CD6A 4BI3A 4J9IA 4DBQA 3EFOA 1VQ8A 4Y91A 1PC0A 1IREB 4PJOG 3SB2A 2SEMA 1W4SA 1OI1A 3TEEA 1YIJA 2RD1A 3CPWP 1G3YA 3OYIA 2NUZA 1WHJA 1SHGA 5CKDA 3QUIA 3JCMP 3A8HB 4O6JA 2ZPGB 2B8AA 4MZPA 2DNUA 2AT1B 4OMFB 3TCJA 4PNOA 3X26B 2CYZB 2NUTB 2ATCB 2JTFA 5KYUB 2BE7D 4XTVA 5CVIA 3O8VA 3SDZA 4C8QG 5KYYB 3EGDB 4HCZA 1TG0A 2DJQA 2EWNA 1O9SA 3F70A 1UG1A 1QKWA 1D1AA 1K73U 1FWZA 1GBQA 1MMGA 2G3RA 7AT1B 2YUOA 4JLGA 5IHIA 3OYKA 1PNJA 4N0AA 3JCMW 1VQKQ 4M77F 4DQ2A 1H8KA 2KT1A 2LJ3A 3HP9A 1D09B 1PSFA 1MV0B 2V1RA 5FU7B 5IXFA 1YJ9T 3R6OA 1X75C 3EGUA 2FRYA 4PL6A 2XD0A 4LNPA 3PIOA 3VU3C 4M7AA 1AEYA 1PSEA 4CC2A 3LX7A 1TUCA 5CKFA 5GMKe 2KYMA 3HRSA 4GLKA 1YJWQ 4J9CA 4FSSA 5GMKh 2F2WA 1YI2T 3CC2A 1FX7A 2YXYA 2GGRA 1JU5C 1LJOA 3JCMX 4M77E 1RADB 4MZMA 5GANg 4CC7A 1C1AA 2DXTA 3JCMd 1VQ6Q 3OMGA 1UUEA 3KUFA 1KC8C 2QASA 1B3QA 1N27A 1QWFA 1A0NB 1ZLMA 2YUNA 4M75B 2XICA 2HDAA 1VQMQ 1HJDA 1M2VA 3FB9A 1YJNA 1JRIA 2XU8A 3FJPA 1WNLA 3V8KA 2DETA 2MI6A 2XIDA 3JCMf 4RTVA 4NOYA 1Q81U 5CKEA 1TU0B 3VS2A 1VQOA 3X25B 2WSCE 1BU1A 3H41A 1WXTA 2A36A 3QXEB 1YIJT 1G3SA 2P84A 3NPFA 2DTOA 4RMOA 4GBQA 2EQMA 1QKXA 4OMMA 2RI2A 1WPYA 4PJNA 2XHCA 1KC8U 1WHHA 3RKYA 3CPWA 2K57A 2L3RA 1O75A 2CKKA 2YLBA 1UGVA 2D8HA 2OAWA 1YITQ 3MEVA 2X3XD 4X9CA 2QQSA 2KEAA 1HD3A 2QYZA 2F5TX 4WCIA 1QP2A 2DRKA 3IQLA 2HZYA 4M75C 4DOWA 1PRMC 2E65A 4OB1B 1I5LA 1KQSS 2RQVA 4C0GA 3M0PA 3G4SQ 3JB9H 3CCST 4L5GA 1T0HA 2AKLA 5D7UA 5GAMg 1XOVA 2X51A 5AT1B 3ASKA 1K73R 4KGVB 2QEXA 3RMQA 3VS6A 2XDDA 2ECZA 2LVMA 5CR2A 4C5GA 4RG8A 1H92A 1QLYA 3M0TA 4KGXB 3QJYA 2MOXA 2QGGA 1GCQC 2EQJA 3MPUB 2MK5A 3P8BB 1UTIA 5HK0A 4LDXA 1BI0A 2X3WD 2NUTA 2WACA 1JXOA 1PM3A 3TSZA 5FRMA 3QWYA 4FT4A 2RJCA 4MMLA 3PNWC 2DD4A 2JUFA 4F04B 2KXCA 2FZKB 5GAOn 3I55Q 3CC7T 4M78B 3MKDA 2DVEA 2GF7A 3P8HA 1UECA 2EYQA 1TWBA 1Q95G 3MP8A 3V8LA 2RHIA 5GAN3 2P0PA 3PVLA 3CCEQ 1WXBA 3M54A 1VQ9Q 4F7UB 3UA6A 2A7YA 5GMKl 1GRIA 3OYLA 2CZ7B 2MF2A 3M0UA 5IH2A 2L2PA 1M1GA 3OBWA 4BE0A 4RTUA 1IB8A 4C92D 4O5VA 3S3OA 3CCJT 2YLCA 3QSUA 3RDVA 2QTVA 2AZSA 5D6XA 2AIRB 1KC8R 1W70A 1BYMA 3FDRA 3GOXA 2F69A 3CCQQ 2W0ZA 3JSCA 1BI1A 1BI3A 1YCYA 2COWA 1MMAA 1NEGA 2RJEA 2LJ0A 4BDYA 4Z88A 2ZPEB 4M75A 2DIGA 4BE2A 4M78C 2ZPBB 1JQQA 2HAXA 2BZ8A 4JRIA 2MWPA 1YHQQ 1VQLQ 3JCMh 5CAIA 5GAMe 2CP0A 2K6DA 3GLXA 1N9RA 2QEXT 3OW2P 1QMCA 4JJBA 2L0AA 1MNDA 1WLPB 4JZ3A 2E5KA 2EPDA 2HBPA 1NYFA 4A54A 3HFOA 1PRLC 4C92F 3NMZC 2VXEA 1RAFB 4IUVA 4ZTFA 2QA4T 1Q86C 3VYHB 5LJ5e 3PVQA 3FEOA 1YJWA 2B86A 4BACA 1GCQA 3VS4A 2KE9A 1M8VA 3QJ6A 1M30A 3WXMB 1VQNQ 5CCAA 4PKCC 3GPLA 1VQ6A 3QZ9B 1TXQA 4LDYA 1W2BP 2QGFB 3JB9F 1PD1A 4E7JA 5GAN6 3I35A 5FU6C 1VQMA 2IVWA 1X43A 4C92E 1C0MA 2E10A 4XTWA 4C5IA 5KYNA 5GMKj 5GAOm 3PE0A 3A8OB 2NLUA 5LJ3d 1ZA1B 1M90C 1M4ZA 1VQ4Q 2RNAA 1Y96A 2EGCA 1SSHA 2E4HA 5HK3A 2E64A 1WGSA 2JTMA 4M7DF 4RCCA 2RHYA 3EFOB 5FROA 1H641 3V7SA 2AZVA 5LJ3f 3E9GA 3SEMA 1X6OA 4A4HA 2DA9A 1YBYA 2RK1A 2AKKA 2QTXA 4HCCA 3R6NA 1IXDA 4HVUA 2KVQG 4LE9A 2FPFA 3A1PA 3FC3A 2RF0A 1G3TA 4HA8A 4X9DA 1M1KU 1IGUA 1VUBA 1YN8A 1ZSZC 2M0YA 3VUBA 2CSIA 2HKQB 1AOJA 3FLGA 1MGQA 2VASA 2ESWA 3HSBA 4M7DE 4FIBA 2XKOC 1OU8A 3L2ZA 3QYHB 1E6HA 2K5IA 1K9MC 3CXCP 2KR3A 2DF6A 4ZN1A 3HFNA 1RAAB 1UJ0A 2IIMA 3N5BB 8ATCB 5DLQE 4M78A 3ZBDA 3RESA 4A4KA 2MIOA 2VC8A 3VS3A 2JMCA 2HSEB 3EG1A 3M4GA 1RAGB 2A3LA 3I9QA 4F7UA 1T3LA 2O01E 2KQWA 3OW2A 2LQNA 1KD1U 3CMET 2LX7A 1G83A 4Z02A 4PJOB 3HHTB 1K9MU 3OYGA 2FRWA 2EYXA 1EIFA 2EFIA 3QPHA 3QZ5B 4XU0A 5GAOl 2GTJA 3G1JA 4C0FA 3CCMQ 2LTOA 4OMNA 4JDSA 1K9AA 1OX8A 4D8KA 1U5SA 4QQDA 1BBZA 4JJNK 4RTZA 2LCLA 4RTXA 1HYOA 1SRMA 3G6ET 3I55A 3UA7A 4FW2A 1M8MA 4ZGJB 4R55A 1W2BA 1Q82U 1LCKA 4AG2C 4C8QB 4Y92A 2EJFA 4BE1A 2EYZA 1NLPC 4ME7A 3I56T 5D6YA 1VQ9A 4X1VA 1Q86R 1GCPA 5KYXB 2BKDN 3H9NA 2P0KA 2ZCFB 1QVFS 1S1NA 1Z9QA 5J3BA 1TUDA 2FB7A 2EW3A 1JB0E 4OMQA 1QVGS 3HKSA 2KNBB 1SSFA 4PJOC 5IAYA 3CC4T 1WJRA 1NPPA 4C92G 1BK2A 2LQ8A 1AWWA 5GAOq 3A8GB 3OW2S 4M7AC 2DL8A 3T9NA 1X69A 2XG8D 3EAEA 1X2QA 1S72A 1BI2A 3EFRA 2CP2A 3CCQA 4OGCA 3CCRT 4OVAA 3EH2A 3OYAA 2Z0WA 3UATA 4D6WA 1M90R 1M1KR 4ATOA 4A4FA 3H6ZA 1HK9A 4ELZC 3EHRA 1BB9A 3UT1A 1VQPA 2FG0A 3HRTA 4N4GA 2QDLA 4PLIA 2KAFA 2DKGA 1VIEA 4M4ZA 5LJ3h 1JO8A 2JN0A 3EG9B 3H0IA 1U1TA 2H3EB 3GNFB 4HXJA 3OYYA 2NUPA 1UGPB 4FYXB 2L5QA 5GAMj 4PFZA 4M77D 2LQWA 1K1ZA 2OI3A 2DXBA 1V76A 3JB9J 3UPUA 1K73C 2EAYA 1VQNA 1X6GA 4JPBW 2RPNA 4KUDK 4NS5A 1KJWA 2ABLA 4OF1A 3NTIA 1K9MR 4E7KA 4J7IA 4KULA 1VQ7T 1Y57A 4J6WA 3CCUQ 5LJ5j 1YNZA 2KDSA 3INZA 4N4IA 4F14A 4QQ6A 5GANd 3SFMA 1UGQB 5FW9A 3DKMA 2V1QA 4XU3A 3E2UA 1K76A 4AFSC 3ZEHA 3OYCA 1M27C 3OYEA 1WZOA 1TSFA 4KUIA 4LD9K 2DYBA 1VQ5T 5GANf 4M75F 3J80E 1NPRA 2F2VA 3O5ZA 4A63B 1FXXA 1I81A 3QDFA 2R57A 2VUBA 4PJOA 3EG3A 1PKSA 6AT1B 3E19A 2CP5A 1X27A 2RK2A 3OB9A 2RO0A 4JLIA 1U8RA 1S72T 3RR6A 4RTWA 1WYXA 1DJ7B 4KBMB 3KFVA 1Q81C 2LDMA 3WVEB 2YDLA 3I5SA 4XTYA 2CREA 4M75E 3CCLT 1N5ZA 2KROA 1KK7A 2C0TA 2K4YA 1VQPT 2BE9B 1KG1A 4LN2A 1TTHB 2WSFE 3CMAQ 4A53A 4C8QA 3GNGA 4L6V5 2EKHA 3HL8A 2YRVA 5GAN5 2RMOA 3QDRB 2JT4A 5GJWB 2D6FA 4R0KA 3QYGB 3H8ZA 3G71Q 1KSWA 1PG5B 3CD6T 1VQ8T 5KYXA 2PVGB 4JS4A 4HVWA 3TSWA 2BTTA 5AYFA 1IHVA 2M02A 4E47A 2ROTA 3U23A 1P92A 5FU7C 2J6FA 3PFSA 2RQUA 1AWXA 3BW1A 4EDUA 3RIRA 4LDWA 5I21A 4PLLA 3FRNA 3G6EQ 4A4GA 2VYTA 3CCMA 2R58A 2J06A 2OTLQ 4VUBA 1OULA 3LW5E 4MDWA 2M16A 2O31A 4OMLA 1VOMA 3KBGA 5GAN2 2GFAA 2A0FB 2FZCB 1QW1A 2KXDA 2COZA 2XI9A 3I56Q 3WVDB 1SEMA 4CC4B 2R5AA 1M5Q1 4IIMA 1HSQA 4FW1A 1VYVA 2FYKA 4FT2A 2DFUA 2K5FA 1K8AU 3EGXB 2XMFA 4QKUA 3OY9A 3JCMg 4DBRA 1Y96B 1D1BA 4JS5A 2RI5A 3G7ZA 3EG9A 4QQGA 3CCVA 4M78F 4LD6A 3S3NA 4IUPA 1ZBXA 4OMOA 2DEUA 4DBFA 2JM9A 3THKA 1SHFA 5L8RE 3JRZA 2C0IA 2RQTA 5DY9A 2CS7A 2YSQA 3VV0A 4NL3A 1WHMA 4D8DA 2E1HA 1QCOA 3CC2T 2EVRA 2J7IA 5GAOp 2BIVA 2CGHA 3EG0A 5LJ5g 2KBTA 3TU4K 5HCKA 4BI4A 1PKTA 1OPLA 2ROLA 3CPWS 3L2UA 3HPWA 2OTJQ 4M78E 3SHWA 2K5LA 1MHNA 4PJMA 4QVZA 1I8FA 3J81E 3A98A 1YJNT 3M0QA 1SG5A 2HMAA 1WXUA 5GAOr 2FPEA 1IGQA 1BKBA 3C95A 5GANh 5GAN7 3LGLA 2E41A 3P8DA 3OYNA 1VQOT 2FPDA 1G2BA 1ZUKA 1U3OA 3C4SA 1D0ZA 4M77G 1H3ZA 1VQ7Q 1Q81R 1RI9A 2JM8A 2QDYB 3PMTA 1WA7A 2VKNA 3JCMb 4C5EA 2CH4W 4IKFA 2DTHA 3H0HA 5ECAA 3RMSA 1BCMA 1UHCA 2L8DA 1QQJA 3CBPA 3JB9I 3ZFJA 5HKCA 3MEAA 2ZPIB 1TUGB 2MYSA 4Y28E 5HY6A 2RN8A 2H3JA 4IURA 3JCMc 1VIFA 3MEWA 2DMOA 4J8OA 2CP6A 4XTUA 4TVRA 3JB9D 1JEGA 2OX7A 3UDCA 1Y07A 2HQEA 1YJ9Q 2ZGWA 3JCMe 3MP6A 1JJ2P 4XU1A 9ATCB 2VXFA 2JW4A 3RERA 4KH0B 2JTEA 3CCVT 1K8AR 1VQKA 5KE2A 4IUQA 1YI2Q 4LUEA 4JJCA 5CKHA 2D9TA 2CP7A 2EIFA 3CCLQ 4HCBA 1I07A 3MP1A 4F16A 3VUZA 4M7DD 4C5HA 4ZGDB 3OYDA 2K2MA 1TH7A 2K9GA 2HBWA 3M53A 2OJ2A 2KRMA 1AVZC 3V7RA 2KRSA 4ANJA 4HKEA 3CD6Q 3QO3A 4OB2B 2MAMA 1LNXA 2OAUA 3M4YA 3CMAA 2DZCA 5C6SA 2DBKA 4AFQC 1B7TA 5I22A 1UJYA 4M7AD 1YIJQ 3QWXX 3G71A 2EQUA 3Q1JA 3EGXA 1WFWA 2E12A 2D0NA 2HL5C 2DXCA 1M1KC 1RLPC 1H3HA 4IUTA 2VVKA 1GBRA 1RLQC 3DB4A 2BUDA 2EYYA 3VS0A 2DILA 4FYYB 2DK3A 2LQKA 2IG0A 3V8JA 2NUPB 2CT4A 2DX1A 2WSEE 1TOVA 4OB3B 1J3TA 2CUBA 2O2OA 2RI3A 1M1FA 2E3IA 2QG9B 2JNGA 1UFFA 3OYMA 3NHNA 2DO3A 1YITA 1K4US 1VYTA 3RKWA 3LWIA 4PJOF 3CCSQ 3CBOA 2QXFA 1R0BG 5IT9E 1PHTA 3OQ5A 1KD1C 2GNCA 1LVKA 1Y0MA 4M7AF 2RQWA 1D0YA 3OSSC 1MNEA 3ME9A 3G4SA 5C0MA 2M1HA 2X35A 4PJJA 2SRCA 1VQKT 1WQWA 1X2KA 2LT1A 2X9HA 3QG1A 5EG2A 2QQRA 1SRLA 4IIOA 4PJOE 3GIBA 4C8QF 3SD4A 4AT1B 3SWNA 4B6MA 4J6YA 2X4JA 1YP5A 4WTOB 4M7AE 5LJ3g 4NL2A 3BDUA 2EQIA 1Q82C 5CK9A 1IZ6A 1YJWT 4DEXA 1EFNA 2FZGB 2LCSA 2DL7A 1UEBA 1ZQ1A 1I5OB 2HSPA 3CC7Q 3NFCA 1ZSGA 2RHXA 4AMCA 1VQ6T 2JVVA 3L1AA 2RA2A 4IUUA 4ORZA 1RAHB 2JXBA 4HT8A 4XQ3A 4YTLA 1NM7A 1VQMT 4PFPA 3V7CA 2X4XA 2YRCA 3FJ5A 5KYWA 2PTKA 2RHZA 3S6WA 1ACMB 1Q7YU 2I0NA 2QQ9A 2DXUA 4HCKA 1KQ2A 4KGZB 3M56A 5IN1A 2EJGA 1M9SA 1B07A 2E6ZA 2RB6A 2MMPA 3CCEA 2VV5A 3CCJQ 4LDVA 1NEBA 1WDXA 2DLPA 2E3HA 4RTTA 1CKAA 1N9SA 4J9FA 2LRQA 2HQHA 3D7SB 3MO8A 1AZGB 4XAXB 2FL7A 1N8RU 2GTOA 1OQKA 4OMPA 2Y4XA 2MPXC 4Z8AA 5J26A 2CZ0B 2K2VA 4EMKB 2C0OA 1TS9A 2XDBA 2RQRA 5GJVB 3ER0A 2ED1A 2HCKA 2KSSA 2GCXA 1NG2A 5GAN8 4E6RA 1G5VA 2X4WA 1R0CB 1NE8A 2JMAA 1F1BB 1UGRB 2QEXQ 1WHLA 3OYBA 2L3QA 3M9QA 3JB9G 3LGFA 2DJZA 2M9UA 4E7IA 1YJ9A 2D1XA 5LL6S 2RM4A 4AFZC 4C8QC 3VS7A 1YHQA 2K3XA 3EHQA 1VQLA 2JJ9A 5CO7A
chains in the Genus database with same CATH topology
1VQ8T 2PVGB 4JS4A 2A7YA 5FRNA 3CC4A 5AYFA 3CXCA 2PVDB 5GMKl 1W2BS 4ELYC 3OYLA 2VGNA 2CZ7B 4E47A 2DEQA 2MF2A 1P92A 3L42A 4DA4A 5I2MA 1M1GA 2JZ2A 3OBWA 4BB7A 5LJ3e 1D3BB 5FU7C 4BE0A 1M90U 4C92D 3PFSA 4O5VA 4DOVA 3S3OA 2LNVA 3CCJT 3HRUA 3OS0A 3BW1A 4EDUA 3RIRA 4LDWA 2YLCA 5I21A 4PLLA 4MZTA 3FRNA 3QSUA 1BIAA 2HNIA 3M58A 4BUGA 5D6XA 5A0DA 4M7DG 3CCRA 1RI0A 3M55A 4M75D 2R5MA 5CQXA 1JJ2A 4A4GA 2E70A 2VYTA 5M9OA 3CCMA 3QKJA 2R58A 1Y7XA 3FDRA 4FSXA 4VUBA 5KE3A 1BYMA 3VYGA 3LW5E 3GOXA 4MDWA 2F69A 2M16A 1OZ2A 3JSCA 2KMTA 4C92A 1BI1A 3KBGA 5GAN2 1BI3A 5FLXE 2GFAA 1Q7YC 1YCYA 1QW1A 2XI9A 3WVDB 3DLMA 3QIIA 3S3MA 4M7DB 1RL2A 2RJEA 1XNIA 2R5AA 1M5Q1 2P0QA 4BDYA 4J5YA 2ZPEB 4J83A 2DIGA 4M75A 4C92C 5A0GA 5GAN4 4BE2A 1QVFA 4M78C 2ZPBB 2V8JA 4JRQA 2HAXA 4JRIA 1OZ3A 2MWPA 1UGSB 1B34A 2FYKA 4OB0B 3JCMh 5CAIA 1QVGA 2PUOB 5GAMe 3I55T 3QBYA 3DB3A 4FT2A 2K5FA 4J6XA 2DPPB 3GLXA 4M7AG 2OTJA 3CMAT 3L2WA 2KY9A 3MCAB 1N9RA 2QEXT 1K8AU 1NJIU 4C8QE 2PQWA 1N8RC 3CCET 3OY9A 3JCMg 1VQ4A 1Y96B 4B9WA 4BY6B 3G71T 2HBPA 3OS1A 4A54A 4JS5A 2RI5A 1VQ9T 3G7ZA 3HFOA 4M7AB 2PUKB 4C92F 2VXEA 4QQGA 5DLOA 3OYFA 4IUVA 4M78F 3CCVA 4ZTFA 2QA4T 1Q86C 3VYHB 4LD6A 5LJ5e 3FEOA 2MWOA 3A8MB 3S3NA 2YHTA 3L2QA 3CXCS 1YJWA 4IUPA 1ZBXA 3CPFA 3OYHA 4J7FA 4BACA 3OMCA 4E7LA 3E9FA 1M8VA 3QJ6A 5L8RE 3WXMB 3JRZA 5KCHA 5DY9A 2CS7A 3JCMQ 4X34A 3VV0A 5CCAA 4PKCC 4NL3A 3GPLA 1VQ7A 4M7DA 3L2VA 4R56A 2E1HA 3X24B 5J39A 1VQ6A 1AHJB 3QZ9B 3CC2T 4LDYA 3EFSA 3A5ZB 5GAOp 3JB9F 2BIVA 2CGHA 5LJ5g 1JJ2S 2OTLT 1HXDA 1JBMA 4M7DC 4E7JA 5GANj 3TU4K 5GAN6 3CCQT 2LC4A 4JRKA 3OBYA 4BI4A 5FU6C 1VQMA 2IVWA 3CPWS 3CCSA 1LOJA 1WJSA 2XK0A 4C92E 3HPWA 3BDLA 3L2UA 2E10A 4XTWA 4M78E 4C5IA 5GMKj 5GAOm 1YITT 4EPCA 3A8OB 2NLUA 2K5LA 1MHNA 5LJ3d 2HQXA 3VKIA 4V2SA 4QVZA 1I8FA 3CBMA 3J81E 1M90C 3FIFA 5KH6A 3LLRA 2X4YA 4N4HA 1M4ZA 4N0AC 1YJNT 1Y96A 1YHQT 1VQLT 3BY7A 2LCCA 5GAOr 4BD3A 1VQ5A 5HK3A 4ZTJA 4MDXA 1BKBA 5CIUA 2C06A 2E64A 1WGSA 3C95A 5GANh 5GAN7 3LGLA 1N6AA 2AHJB 4BY6C 4P5NA 2JTMA 2E41A 3P8DA 3OYNA 1R8OB 3M57A 2RHYA 4RCCA 4E7HA 1VQOT 5FROA 4M7DF 2LT4A 1H641 3V7SA 5LJ3f 3G4ST 4II1A 2FVUA 3PGGA 1U1SA 3X20B 2O4XB 2EJ9A 3E9GA 3C4SA 1X6OA 4KT0E 4XK8E 4A4HA 4QVDA 4M77G 3PTAA 1H3ZA 1YBYA 2RK1A 1KQSA 1KHCA 2QTXA 1G3WA 2QDYB 3PMTA 2K3YA 4HCCA 2DTIA 3JCMb 3CEYA 2KVQG 5GAMd 4C5EA 4IKFA 4Q5WA 2EQKA 3RKXA 2DTHA 1YI2A 2Y4YA 3FC3A 1G3TA 4HA8A 4OP0A 4X9DA 1M1KU 2JOYA 4M78D 5CQYA 3RMSA 1VUBA 4M77B 3CCLA 3VUBA 1K8AC 2L8DA 3JCMV 3TREA 1VQNT 1OYXA 1NJIC 4EMKA 1KHIA 3FLGA 1MGQA 3CC7A 2QI2A 3CBPA 3HSBA 3JB9I 4M7DE 4FIBA 2XKOC 2QQAA 4XTXA 3ZFJA 5HKCA 3MEAA 3L2ZA 3QYHB 2ZPIB 3MHXA 2K5IA 4Y28E 1K9MC 5HY6A 3E1SA 4ZN1A 4RG2A 1GXIE 5I2SA 3HFNA 4EMKC 4MMKA 1QP3A 2H3JA 4IURA 5CKBA 3JCMc 5GAMf 3KXTA 5KCOA 1VIFA 3N5BB 5DLQE 3DLLA 3MEWA 4HT9A 4OGEA 4B9XA 4M78A 4J8OA 3ZBDA 2DD5A 3RESA 4XTUA 5LJ5d 2OTJT 4EMGA 4QVCA 4A4EA 4TVRA 4A4KA 3JCMJ 3JB9D 3GF5A 2VC8A 1XTDA 4BI8B 3CD6A 4BI3A 1VQ8A 4Y91A 3UDCA 1Y07A 2HQEA 2ZGWA 3JCMe 1IREB 3MP6A 3M4GA 4PJOG 3SB2A 1VQ4T 3X28B 2A3LA 4XTZA 4XU1A 1W4SA 2VXFA 4F7UA 3RERA 1OI1A 3TEEA 1YIJA 2RD1A 1G3YA 3OYIA 4XU2A 3CCVT 2O01E 2ZZDA 1VQKA 5KE2A 4C0DB 2KQWA 3CCJA 5LJ5f 4FL6A 4IUQA 3OW2A 1KD1U 5CKDA 3QUIA 3JCMP 3CMET 4Z02A 3A8HB 4O6JA 2ZPGB 4PJOB 2B8AA 2HD0A 1D3BA 4MZPA 5GMKm 3HHTB 1K9MU 3OYGA 5CKHA 2D9TA 2EIFA 4OMFB 3URGA 1BIBA 3M59A 3QZ5B 1EIFA 2EFIA 3MP1A 2LX9A 3QPHA 4XU0A 3C94A 3TCJA 3VUZA 5GAOl 4M7DD 4C5HA 4ZGDB 4PNOA 3X26B 2CYZB 3OYDA 2JTFA 1TH7A 4C0FA 4WF2A 4XTVA 4M77C 3M53A 2LTOA 5CVIA 3O8VA 4JDSA 3UWNA 3SDZA 4C8QG 1XQHA 4QQDA 3V7RA 4JJNK 2LCLA 2RJDA 3OS5A 4HCZA 2EKOA 3G6ET 4HKEA 4F7UF 3I55A 3QO3A 4OB2B 2EWNA 2MAMA 1O9SA 1LNXA 2OAUA 4QW2A 4ZGJB 3F70A 3M4YA 4R55A 3CMAA 1W2BA 2DZCA 1Q82U 4C8QB 1K73U 5C6SA 1FWZA 2G3RA 4ZGEB 2EJFA 2F5KA 2RHUA 4JLGA 4M7AD 4BE1A 3OYKA 4ME7A 3I56T 2GFUA 3G71A 4N0AA 3JCMW 2EQUA 3JAME 2DZ9A 3Q1JA 4M77F 4DQ2A 5D6YA 5A0LA 3HP9A 5D6WA 1VQ9A 2E12A 1PSFA 2BKDN 5FU7B 1YJ9T 2P0KA 2DXCA 2ZCFB 2QA4A 3R6OA 1M1KC 1X75C 1QVFS 2QQBA 3META 4PL6A 5J3BA 4C0DC 3PIOA 4HCBA 2XD0A 2FB7A 3VU3C 3LH0A 4IUTA 1JB0E 4M7AA 1QVGS 3HKSA 2FHDA 4RCBA 5GANe 2RH2A 1PSEA 3DB4A 1SSFA 4PJOC 4F7UE 5IAYA 2BUDA 3LX7A 3CC4T 1WJRA 1NPPA 2Y90A 4C92G 2LQ8A 2GQVA 1WJQA 5CKFA 5GMKe 3HRSA 4GLKA 3A8GB 5GAOq 3OW2S 4M7AC 2DK3A 2LQKA 2IG0A 1YI2T 5GMKh 3V8JA 2WSEE 3OSVA 3T9NA 3CC2A 2XG8D 3L2RA 3EAEA 4M75G 1S72A 1FX7A 1Y71A 3SWNB 4OB3B 1BI2A 2D0QB 4FU6A 2RI3A 1M1FA 3EFRA 4RKUE 1LJOA 3JCMX 3CCQA 4GY5A 4M77E 4MZMA 4OGCA 5GANg 4BDZA 2DXTA 3JCMd 3CCRT 2JNGA 4OVAA 3OYMA 3CCMT 2DO3A 3OYAA 1YITA 3OMGA 3KUFA 1KC8C 5DM7R 1N27A 4D6WA 3RKWA 5LJ3j 3LWIA 2XDPA 4M75B 4ATOA 2DAQA 4PJOF 2XICA 4A4FA 3FB9A 3H6ZA 3CBOA 1YJNA 2QXFA 1HK9A 5IT9E 3OQ5A 4ELZC 1KD1C 1JRIA 2XU8A 3FJPA 1WNLA 2ZPFB 3V8KA 3UT1A 4M7AF 2MI6A 3CCUA 1VQPA 2XIDA 3HRTA 3JCMf 2CZ1B 4N4GA 3PMIA 4NOYA 5CKEA 3OYJA 1Q81U 4FM4B 3OSSC 4PLIA 1VQOA 3X25B 2WSCE 2KAFA 3ME9A 2DKGA 3QXEB 3G4SA 5C0MA 2M1HA 1YIJT 1G3SA 1VIEA 2X35A 5LJ3h 1VQKT 2L89A 2DTOA 1WQWA 2E6NA 2LT1A 3PIPA 2JN0A 2ZPHB 3QG1A 4RMOA 5EG2A 1U1TA 2EQMA 3GNFB 1V29B 2QQRA 3NTKA 3OYYA 2RI2A 1WPYA 1UGPB 4PJOE 2XHCA 1KC8U 2L5QA 3AHUA 4C8QF 3SD4A 5GAMj 2O4XA 3SWNA 3GIBA 4J6YA 4M77D 2X4JA 3RKYA 3CPWA 2K57A 4M7AE 5LJ3g 2L3RA 1O75A 2CKKA 2DXBA 2YLBA 3BDUA 4LDUA 4NL2A 3JB9J 1Q82C 3UPUA 5CK9A 1K73C 3SWNC 2EAYA 3MEVA 1VQNA 4JRPA 2V8IA 1IZ6A 1YJWT 3LWHA 3NTHA 1I4K1 4NS5A 4KUDK 4X9CA 5FU6B 2QQSA 3NTIA 4OF1A 4EMHA 4E7KA 1WQ7A 5A2QE 4M77A 4J7IA 4UC4A 2DIQA 1UEBA 1ZQ1A 2F5TX 1QP2A 4KULA 1VQ7T 2V8KA 3NFCA 4M75C 2RHXA 4J6WA 4DOWA 2JVVA 2E65A 4OB1B 1I5LA 3BFMA 3L1AA 5GAMh 2RA2A 4IUUA 5LJ5j 1KQSS 4C0GA 4HT8A 4XQ3A 2KDSA 4YTLA 3INZA 4N4IA 4QQ6A 5GANd 3SFMA 1UGQB 1VQMT 3C12A 3JB9H 3CCST 3V7CA 4C0ZA 4ZN3A 4L5GA 2X4XA 4CRIA 3DKMA 2RHZA 5GAMg 1XOVA 4XU3A 3S6WA 3ZEHA 3OYCA 1Q7YU 2QQ9A 3ASKA 4PJOD 2DXUA 2QEXA 3OYEA 3RMQA 2XDDA 1NZ9A 2VGMA 1KQ2A 2LVMA 3M56A 3CMEA 4KUIA 3VJPA 3LYIA 4LD9K 2E5QA 1VQ5T 5LJ5h 5CR2A 5IN1A 2EJGA 5GANf 1VQ6T 4M75F 1M9SA 2E6ZA 1NPRA 2RB6A 2MMPA 4RG8A 4C5GA 3J80E 3CCEA 3QHSA 2VV5A 3OA6A 5GMKi 1FXXA 1I81A 4LDVA 3QJYA 2R57A 2VUBA 4PJOA 3E19A 2RK2A 2EQJA 3OB9A 1N9SA 2RO0A 3P8BB 4JLIA 1U8RA 2LRQA 2RJFA 1S72T 5HK0A 3MO8A 4LDXA 4XAXB 3RUXA 1BI0A 2FL7A 1N8RU 1DJ7B 1UB4A 4KBMB 2WACA 1X01A 2Y4XA 1Q81C 1QVPA 5J26A 2CZ0B 4M78G 2K2VA 2LDMA 5FRMA 3G6EA 4C8QD 4EMKB 3WVEB 4FT4A 2RJCA 2KK4A 2XDBA 2CZ6B 4MMLA 4CI0C 3GP8A 3PNWC 4XTYA 2P4TA 2DD4A 2PVOB 3ER0A 1Q86U 2JUFA 4M75E 2OTLA 3CCLT 2KSSA 1KQ1A 2GCXA 5GAN8 5GAOn 3OS2A 4C92B 3MEUA 3CC7T 4L59A 1G5VA 2M0OA 2K4YA 2X4WA 4M78B 3CCUT 1VQPT 3J7AF 1KG1A 1NE8A 2DVEA 2GF7A 4F7UG 3I56A 2WSFE 3P8HA 4A53A 1UGRB 4C8QA 1ZHIA 2EYQA 3GNGA 3PT9A 3A8LB 4JUVA 4L6V5 3M5AA 3HL8A 3OYBA 2YRVA 3M9QA 2I2LA 3JB9G 5GAN5 3LGFA 2DJZA 3MP8A 3QDRB 3V8LA 2D6FA 2RHIA 2M9UA 5GAN3 2P0PA 4E7IA 1YJ9A 2PU9B 3QYGB 5LL6S 2RM4A 3H8ZA 4C8QC 1B34B 3M54A 1YHQA 2K3XA 1VQLA 3CD6T 5CO7A 4F7UB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C8Q G;  3RKY A;  5LJ3 d;  4V2S A;  1I8F A;  2K57 A;  4M7A E;  5LJ3 g;  3V7R A;  4NL2 A;  3FIF A;  2YLB A;  3BDU A;  3JB9 J;  5GMK l;  4N0A C;  1Y96 A;  2EAY A;  3SWN C;  2DEQ A;  3BY7 A;  5GAO r;  4F7U F;  3QO3 A;  1I4K 1;  2EWN A;  4X9C A;  5LJ3 e;  1D3B B;  4EMH A;  1LNX A;  4C92 D;  2E64 A;  2DZC A;  5GAN h;  1WQ7 A;  5GAN 7;  4M77 A;  4C8Q B;  3BW1 A;  3RIR A;  2E41 A;  2YLC A;  5I21 A;  4M7D F;  4RCC A;  3QSU A;  2EJF A;  1H64 1;  3V7S A;  1BIA A;  2HNI A;  4M75 C;  4J6W A;  5LJ3 f;  4M7D G;  1I5L A;  2E65 A;  4M7A D;  3BFM A;  3L1A A;  4M75 D;  2RA2 A;  5LJ5 j;  3PGG A;  5GAM h;  4N0A A;  1U1S A;  3JCM W;  4HT8 A;  2DZ9 A;  4M77 F;  4DQ2 A;  2EJ9 A;  4XQ3 A;  3INZ A;  4QVD A;  4M77 G;  5GAN d;  4C92 A;  5GAN 2;  2QTX A;  3GIB A;  3JB9 H;  1YCY A;  3V7C A;  2DTI A;  3JCM b;  2FB7 A;  3VU3 C;  4M7D B;  5GAM d;  4M7A A;  1M5Q 1;  3RKX A;  2DTH A;  5GAN e;  4RCB A;  4J5Y A;  4M75 A;  4XU3 A;  4C92 C;  5GAM g;  5GAN 4;  4PJO C;  4HA8 A;  4X9D A;  4M78 C;  4OP0 A;  4F7U E;  4PJO D;  2DXU A;  4JRI A;  4M78 D;  2Y90 A;  4M77 B;  4C92 G;  1KQ2 A;  3JCM V;  1B34 A;  2FYK A;  3JCM h;  5CAI A;  5GMK e;  5GAO q;  5GAM e;  4EMK A;  4M7A C;  1MGQ A;  5LJ5 h;  2EJG A;  5GAN f;  3HSB A;  4M75 F;  5GMK h;  2RB6 A;  4J6X A;  3V8J A;  3JB9 I;  4M7D E;  4M7A G;  4XTX A;  3QHS A;  3L2Z A;  4M75 G;  1N9R A;  3SWN B;  5GMK i;  1I81 A;  3EFR A;  3HFN A;  4MMK A;  4EMK C;  1LJO A;  3JCM c;  4C8Q E;  4M77 E;  5GAM f;  3JCM X;  5GAN g;  4HT9 A;  4PJO A;  2DXT A;  3JCM d;  4M78 A;  3RES A;  1N9S A;  4XTU A;  3JCM g;  5LJ5 d;  1Y96 B;  4EMG A;  4QVC A;  4JLI A;  3JCM J;  3JB9 D;  2VC8 A;  4A54 A;  3HFO A;  4M7A B;  3RKW A;  5LJ3 j;  4M75 B;  4Y91 A;  3RUX A;  4C92 F;  2VXE A;  4PJO F;  2ZGW A;  4M78 F;  3JCM e;  3FB9 A;  1X01 A;  3M4G A;  4PJO G;  3SB2 A;  5LJ5 e;  4M78 G;  1HK9 A;  4XTZ A;  4XU1 A;  1JRI A;  2YHT A;  4C8Q D;  4EMK B;  4M7A F;  3FJP A;  1WNL A;  2VXF A;  3V8K A;  4F7U A;  3RER A;  2RD1 A;  4MML A;  4XU2 A;  4XTY A;  3JCM f;  4NOY A;  4M75 E;  1M8V A;  5LJ5 f;  5DY9 A;  1KQ1 A;  3QUI A;  3JCM Q;  5GAN 8;  3JCM P;  4M7D A;  5GAO n;  4NL3 A;  4C92 B;  2DKG A;  2E1H A;  4PJO B;  4M78 B;  1D3B A;  5GMK m;  2DVE A;  4F7U G;  3EFS A;  5GAO p;  4A53 A;  3JB9 F;  5LJ3 h;  2CGH A;  4C8Q A;  5LJ5 g;  1BIB A;  2DTO A;  1HXD A;  4XU0 A;  1JBM A;  4JUV A;  4M7D C;  1WQW A;  5GAN j;  3JB9 G;  2I2L A;  2JN0 A;  5GAN 6;  5GAN 5;  5GAO l;  4M7D D;  4JRK A;  1U1T A;  2DJZ A;  3V8L A;  3AHU A;  4PNO A;  5GAN 3;  1LOJ A;  1TH7 A;  1WPY A;  2RM4 A;  4C92 E;  4WF2 A;  4PJO E;  4C8Q C;  1B34 B;  2E10 A;  4M78 E;  4M77 C;  4XTW A;  4XTV A;  4C8Q F;  3SWN A;  5GMK j;  5GAM j;  4J6Y A;  4M77 D;  5GAO m;  4F7U B; 
#chains in the Genus database with same CATH topology
 2G6F X;  1KQS P;  5FRN A;  2QA4 Q;  1AWO A;  3CXC A;  1W2B S;  4ELY C;  1CKB A;  4DA4 A;  2JZ2 A;  3BE3 A;  5LJ3 e;  1D3B B;  2DVJ A;  4DOV A;  3HRU A;  2DER A;  1BIA A;  2HNI A;  4M7D G;  1RI0 A;  2YRD A;  3M55 A;  2R5M A;  4M75 D;  5CQX A;  5M9O A;  1WI7 A;  3VYG A;  4PJL A;  1G8X A;  4C92 A;  2D8J A;  5FLX E;  1KD1 R;  1GFC A;  3QII A;  3S3M A;  1RL2 A;  1WIE A;  4J5Y A;  4F17 A;  5GAN 4;  2V8J A;  4JRQ A;  3REA B;  1UGS B;  1B34 A;  4OB0 B;  2PUO B;  5I11 A;  3I55 T;  1LPL A;  2DPP B;  2DRM A;  4M7A G;  2FO0 A;  3L2W A;  3MCA B;  1NJI U;  2PQW A;  2HKN A;  3CCE T;  1VQ4 A;  4B9W A;  4BY6 B;  1QWE A;  1VQ9 T;  5L23 A;  2PUK B;  1Q7Y R;  1Q82 R;  5DLO A;  3CQT A;  1FYN A;  2MWO A;  2QAZ A;  2YHT A;  3L2Q A;  3CXC S;  3OYH A;  1WHG A;  4J7F A;  3TVT A;  4E7L A;  3E9F A;  1T0J A;  4M7D A;  1EX4 A;  1OPK A;  4PFO A;  3UF4 A;  2L3P A;  1AD5 A;  1HXD A;  1RAI B;  3CCQ T;  1N8R R;  2LC4 A;  3OBY A;  2PZ1 A;  3CCS A;  1LOJ A;  1WJS A;  2XK0 A;  3BDL A;  2K3B A;  4EPC A;  3VKI A;  2HQX A;  3LLR A;  2BZX A;  2COY A;  2X4Y A;  4N4H A;  1YHQ T;  1VQL T;  3BY7 A;  2LCC A;  2C06 A;  1N6A A;  2AHJ B;  4BY6 C;  1R8O B;  3CME Q;  4E7H A;  1E7O A;  4ZNX A;  1M3B A;  4J9B A;  3PGG A;  3X20 B;  4CC3 A;  1ZBJ A;  2O4X B;  2ED0 A;  4KT0 E;  4AG1 C;  4XK8 E;  4QVD A;  1KQS A;  1KHC A;  1G3W A;  2DTI A;  2CT3 A;  1UDL A;  5GAM d;  3RKX A;  2Y4Y A;  4DBH A;  4M78 D;  4M77 B;  1W6X A;  1MV3 A;  1K8A C;  2QK0 A;  3JCM V;  3TRE A;  1VQN T;  1OYX A;  4EMK A;  1KHI A;  3CC7 A;  2QI2 A;  1QCN A;  2LNH B;  1M3C A;  2QQA A;  4LUD A;  4KH1 B;  4PK4 A;  3E1S A;  4RG2 A;  4MMK A;  5GAM f;  3DLL A;  4HT9 A;  2LMJ A;  4B9X A;  2ZAE A;  2DD5 A;  1PWT A;  5LJ5 d;  4QVC A;  4A4E A;  3JCM J;  4BI8 B;  1MMD A;  1D1C A;  2YUQ A;  1ARK A;  1VQ4 T;  3X28 B;  4XTZ A;  1Z9Z A;  2K7A A;  2JS0 A;  4XU2 A;  1OOT A;  2KGT A;  2ZZD A;  3CC4 Q;  4C0D B;  3CCJ A;  5LJ5 f;  4FL6 A;  1NJI R;  4DEY A;  1OX9 A;  1C6V X;  2HD0 A;  1D3B A;  4J9E A;  5GMK m;  3MJX A;  1NYG A;  3URG A;  1BIB A;  1ZUU A;  3M59 A;  5IHN A;  2LX9 A;  3C94 A;  4EIK A;  2HEQ A;  3CCR Q;  5IXB A;  2HL3 A;  4WF2 A;  4M77 C;  1EZZ B;  3UWN A;  1XQH A;  3M0R A;  3VS1 A;  1UE9 A;  2RJD A;  3OS5 A;  2EKO A;  4J9D A;  1M3A A;  2DBM A;  1KIK A;  4F7U F;  2VWF A;  4QW2 A;  1YFN A;  3HTR A;  2NWM A;  2KYB A;  1FMW A;  4ZGE B;  1AT1 B;  2F5K A;  2RHU A;  2ENM A;  2M51 A;  2GFU A;  2W10 A;  3JAM E;  2DZ9 A;  1FMV A;  1YWP A;  5A0L A;  1GFD A;  5D6W A;  2DM1 A;  2QA4 A;  2QQB A;  3MET A;  1YCS B;  4C0D C;  4RUG A;  3LH0 A;  2A28 A;  2FHD A;  4RCB A;  5GAN e;  2RH2 A;  4F7U E;  5KYU A;  2Y90 A;  2GQV A;  1WJQ A;  3OSV A;  1MUZ A;  5KYY A;  3EGD A;  3L2R A;  4M75 G;  1Y71 A;  3SWN B;  4FU6 A;  2D0Q B;  4RKU E;  1E6G A;  4RTY A;  5FWB A;  4GY5 A;  4J9H A;  4BDZ A;  4FYW B;  1IRX A;  4JZ4 A;  1NLO C;  2O9V A;  4K11 A;  3CCM T;  2CSQ A;  2GBQ A;  3RBB B;  5DM7 R;  2BZY A;  5LJ3 j;  1PD0 A;  2XDP A;  2DAQ A;  1RAC B;  3M0S A;  3H0F A;  2J6O A;  2ZPF B;  3CCU A;  2CZ1 B;  3OYJ A;  3PMI A;  2YT6 A;  4FM4 B;  2LJ1 A;  1VQ5 Q;  2AK5 A;  1WX6 A;  4J9G A;  1OEB A;  2L89 A;  5KYW B;  2O9S A;  2E6N A;  3PIP A;  2ZPH B;  1V29 B;  1I1J A;  3NTK A;  1SPK A;  3AHU A;  1S72 Q;  2O4X A;  4JJD A;  4LDU A;  2J05 A;  3SWN C;  4JRP A;  2V8I A;  3LWH A;  3NTH A;  1I4K 1;  2DE0 X;  5FU6 B;  1QVF P;  4EMH A;  1K0X A;  1WQ7 A;  5A2Q E;  4M77 A;  4UC4 A;  2DIQ A;  1QVG P;  2V8K A;  1VQP Q;  3BFM A;  5GAM h;  1AWJ A;  4QT7 A;  4E7Z A;  5IHK A;  1XJW B;  2A08 A;  2NYS A;  2JS2 A;  1MMN A;  3C12 A;  4C0Z A;  4ZN3 A;  1FMK A;  2DYI A;  4CRI A;  1SF9 A;  1VQ8 Q;  2MCN A;  4PJO D;  3ULR B;  1NZ9 A;  2VGM A;  1ABQ A;  3JV3 A;  1OU9 A;  3AT1 B;  3CME A;  3REB B;  3VJP A;  3LYI A;  2E5Q A;  2CH4 A;  5LJ5 h;  2KI7 A;  3QHS A;  1VYU A;  3OA6 A;  2GQI A;  5GMK i;  1ZX6 A;  1ZSZ B;  2RJF A;  3TQ7 P;  1ABO A;  2EYW A;  3ZL7 C;  1R77 A;  2K79 A;  3RUX A;  4GLM A;  1UB4 A;  1X01 A;  2A37 A;  1QVP A;  1WHK A;  4M78 G;  2IPO B;  2F1L A;  3G6E A;  4C8Q D;  1M2O A;  2KK4 A;  1D0X A;  2CZ6 B;  4CI0 C;  3GP8 A;  1Q86 U;  1K0S A;  2P4T A;  1OV3 A;  2PVO B;  1ZA2 B;  1AZE A;  2OTL A;  1ZUY A;  1KQ1 A;  3RNJ A;  3OS2 A;  4C92 B;  3MEU A;  4L59 A;  2H8H A;  2M0O A;  3J7A F;  2EGA A;  3CCU T;  4F7U G;  3I56 A;  2J6K A;  3EH1 A;  1ZHI A;  4E2F B;  3PT9 A;  3A8L B;  4JUV A;  1GL5 A;  3M5A A;  1NBE B;  2F2X A;  2I2L A;  2PU9 B;  1B34 B;  2YUP A;  2FEI A;  3VRY A;  3CC4 A;  2PVD B;  3C0C A;  2CDT A;  2VGN A;  2DEQ A;  4ESR A;  3L42 A;  5I2M A;  1QCF A;  1RAE B;  1U06 A;  4BB7 A;  2LZ6 B;  1M90 U;  1RAB B;  2PNI A;  3VS5 A;  2LNV A;  1VA7 A;  3OS0 A;  1YWO A;  4MZT A;  3M58 A;  4BUG A;  5A0D A;  3CCR A;  1JJ2 A;  3CC2 Q;  2E70 A;  2P4R A;  3QKJ A;  1Y7X A;  4FSX A;  5KE3 A;  1OZ2 A;  2KMT A;  1Q7Y C;  1IO6 A;  3DLM A;  4M7D B;  1XNI A;  2DL5 A;  2P0Q A;  4J83 A;  4HVV A;  4C92 C;  4Z89 A;  1KFZ A;  5A0G A;  1QVF A;  4LXC A;  1OZ3 A;  1YJN Q;  1X6B A;  1QVG A;  3QBY A;  3DB3 A;  1T3S A;  4J6X A;  1IHW A;  2OTJ A;  3CMA T;  2KY9 A;  5EC7 A;  1VQO Q;  4C8Q E;  1N8R C;  3G71 T;  3OS1 A;  3I5R A;  4M7A B;  3OYF A;  3A8M B;  2YWW A;  3CPF A;  2DL4 A;  3OMC A;  1JXM A;  5KCH A;  4AFU C;  3JCM Q;  4X34 A;  1VQ7 A;  3L2V A;  4R56 A;  3X24 B;  5J39 A;  3LH5 A;  1AHJ B;  3EG2 A;  3EFS A;  3VRZ A;  3A5Z B;  1JJ2 S;  2OTL T;  1JBM A;  4M7D C;  5GAN j;  2L3S A;  4JRK A;  1M2V B;  2CUD A;  1YIT T;  1PCX A;  2EBP A;  1BCO A;  1CSK A;  4V2S A;  4KRT A;  3CBM A;  1SKU B;  3FIF A;  5KH6 A;  4N0A C;  2KT8 A;  1RUW A;  4BD3 A;  1VQ5 A;  4ZTJ A;  4MDX A;  1I0C A;  5CIU A;  3CCV Q;  5FWC A;  4P5N A;  3M57 A;  2LT4 A;  3G4S T;  3GBQ A;  4II1 A;  2LP5 A;  2FVU A;  1U1S A;  2EJ9 A;  4FYV B;  2CP3 A;  3PTA A;  2K3Y A;  1W1F A;  3CEY A;  1ZSZ A;  4E7S A;  4Q5W A;  8AT1 B;  2EQK A;  1YI2 A;  4OP0 A;  2JOY A;  5CQY A;  2VB6 A;  3NGP A;  3CCL A;  1UHF A;  1V1C A;  2V26 A;  2O88 A;  1NJI C;  2EGE A;  2KRN A;  4XTX A;  3MHX A;  1GXI E;  5I2S A;  4EMK C;  1QP3 A;  5CKB A;  3KXT A;  4FCY A;  5KCO A;  4OGE A;  2OTJ T;  4EMG A;  3GF5 A;  1XTD A;  2DL3 A;  3CD6 A;  4BI3 A;  4J9I A;  4DBQ A;  3EFO A;  1VQ8 A;  4Y91 A;  1PC0 A;  1IRE B;  4PJO G;  3SB2 A;  2SEM A;  1W4S A;  1OI1 A;  3TEE A;  1YIJ A;  2RD1 A;  3CPW P;  1G3Y A;  3OYI A;  2NUZ A;  1WHJ A;  1SHG A;  5CKD A;  3QUI A;  3JCM P;  3A8H B;  4O6J A;  2ZPG B;  2B8A A;  4MZP A;  2DNU A;  2AT1 B;  4OMF B;  3TCJ A;  4PNO A;  3X26 B;  2CYZ B;  2NUT B;  2ATC B;  2JTF A;  5KYU B;  2BE7 D;  4XTV A;  5CVI A;  3O8V A;  3SDZ A;  4C8Q G;  5KYY B;  3EGD B;  4HCZ A;  1TG0 A;  2DJQ A;  2EWN A;  1O9S A;  3F70 A;  1UG1 A;  1QKW A;  1D1A A;  1K73 U;  1FWZ A;  1GBQ A;  1MMG A;  2G3R A;  7AT1 B;  2YUO A;  4JLG A;  5IHI A;  3OYK A;  1PNJ A;  4N0A A;  3JCM W;  1VQK Q;  4M77 F;  4DQ2 A;  1H8K A;  2KT1 A;  2LJ3 A;  3HP9 A;  1D09 B;  1PSF A;  1MV0 B;  2V1R A;  5FU7 B;  5IXF A;  1YJ9 T;  3R6O A;  1X75 C;  3EGU A;  2FRY A;  4PL6 A;  2XD0 A;  4LNP A;  3PIO A;  3VU3 C;  4M7A A;  1AEY A;  1PSE A;  4CC2 A;  3LX7 A;  1TUC A;  5CKF A;  5GMK e;  2KYM A;  3HRS A;  4GLK A;  1YJW Q;  4J9C A;  4FSS A;  5GMK h;  2F2W A;  1YI2 T;  3CC2 A;  1FX7 A;  2YXY A;  2GGR A;  1JU5 C;  1LJO A;  3JCM X;  4M77 E;  1RAD B;  4MZM A;  5GAN g;  4CC7 A;  1C1A A;  2DXT A;  3JCM d;  1VQ6 Q;  3OMG A;  1UUE A;  3KUF A;  1KC8 C;  2QAS A;  1B3Q A;  1N27 A;  1QWF A;  1A0N B;  1ZLM A;  2YUN A;  4M75 B;  2XIC A;  2HDA A;  1VQM Q;  1HJD A;  1M2V A;  3FB9 A;  1YJN A;  1JRI A;  2XU8 A;  3FJP A;  1WNL A;  3V8K A;  2DET A;  2MI6 A;  2XID A;  3JCM f;  4RTV A;  4NOY A;  1Q81 U;  5CKE A;  1TU0 B;  3VS2 A;  1VQO A;  3X25 B;  2WSC E;  1BU1 A;  3H41 A;  1WXT A;  2A36 A;  3QXE B;  1YIJ T;  1G3S A;  2P84 A;  3NPF A;  2DTO A;  4RMO A;  4GBQ A;  2EQM A;  1QKX A;  4OMM A;  2RI2 A;  1WPY A;  4PJN A;  2XHC A;  1KC8 U;  1WHH A;  3RKY A;  3CPW A;  2K57 A;  2L3R A;  1O75 A;  2CKK A;  2YLB A;  1UGV A;  2D8H A;  2OAW A;  1YIT Q;  3MEV A;  2X3X D;  4X9C A;  2QQS A;  2KEA A;  1HD3 A;  2QYZ A;  2F5T X;  4WCI A;  1QP2 A;  2DRK A;  3IQL A;  2HZY A;  4M75 C;  4DOW A;  1PRM C;  2E65 A;  4OB1 B;  1I5L A;  1KQS S;  2RQV A;  4C0G A;  3M0P A;  3G4S Q;  3JB9 H;  3CCS T;  4L5G A;  1T0H A;  2AKL A;  5D7U A;  5GAM g;  1XOV A;  2X51 A;  5AT1 B;  3ASK A;  1K73 R;  4KGV B;  2QEX A;  3RMQ A;  3VS6 A;  2XDD A;  2ECZ A;  2LVM A;  5CR2 A;  4C5G A;  4RG8 A;  1H92 A;  1QLY A;  3M0T A;  4KGX B;  3QJY A;  2MOX A;  2QGG A;  1GCQ C;  2EQJ A;  3MPU B;  2MK5 A;  3P8B B;  1UTI A;  5HK0 A;  4LDX A;  1BI0 A;  2X3W D;  2NUT A;  2WAC A;  1JXO A;  1PM3 A;  3TSZ A;  5FRM A;  3QWY A;  4FT4 A;  2RJC A;  4MML A;  3PNW C;  2DD4 A;  2JUF A;  4F04 B;  2KXC A;  2FZK B;  5GAO n;  3I55 Q;  3CC7 T;  4M78 B;  3MKD A;  2DVE A;  2GF7 A;  3P8H A;  1UEC A;  2EYQ A;  1TWB A;  1Q95 G;  3MP8 A;  3V8L A;  2RHI A;  5GAN 3;  2P0P A;  3PVL A;  3CCE Q;  1WXB A;  3M54 A;  1VQ9 Q;  4F7U B;  3UA6 A;  2A7Y A;  5GMK l;  1GRI A;  3OYL A;  2CZ7 B;  2MF2 A;  3M0U A;  5IH2 A;  2L2P A;  1M1G A;  3OBW A;  4BE0 A;  4RTU A;  1IB8 A;  4C92 D;  4O5V A;  3S3O A;  3CCJ T;  2YLC A;  3QSU A;  3RDV A;  2QTV A;  2AZS A;  5D6X A;  2AIR B;  1KC8 R;  1W70 A;  1BYM A;  3FDR A;  3GOX A;  2F69 A;  3CCQ Q;  2W0Z A;  3JSC A;  1BI1 A;  1BI3 A;  1YCY A;  2COW A;  1MMA A;  1NEG A;  2RJE A;  2LJ0 A;  4BDY A;  4Z88 A;  2ZPE B;  4M75 A;  2DIG A;  4BE2 A;  4M78 C;  2ZPB B;  1JQQ A;  2HAX A;  2BZ8 A;  4JRI A;  2MWP A;  1YHQ Q;  1VQL Q;  3JCM h;  5CAI A;  5GAM e;  2CP0 A;  2K6D A;  3GLX A;  1N9R A;  2QEX T;  3OW2 P;  1QMC A;  4JJB A;  2L0A A;  1MND A;  1WLP B;  4JZ3 A;  2E5K A;  2EPD A;  2HBP A;  1NYF A;  4A54 A;  3HFO A;  1PRL C;  4C92 F;  3NMZ C;  2VXE A;  1RAF B;  4IUV A;  4ZTF A;  2QA4 T;  1Q86 C;  3VYH B;  5LJ5 e;  3PVQ A;  3FEO A;  1YJW A;  2B86 A;  4BAC A;  1GCQ A;  3VS4 A;  2KE9 A;  1M8V A;  3QJ6 A;  1M30 A;  3WXM B;  1VQN Q;  5CCA A;  4PKC C;  3GPL A;  1VQ6 A;  3QZ9 B;  1TXQ A;  4LDY A;  1W2B P;  2QGF B;  3JB9 F;  1PD1 A;  4E7J A;  5GAN 6;  3I35 A;  5FU6 C;  1VQM A;  2IVW A;  1X43 A;  4C92 E;  1C0M A;  2E10 A;  4XTW A;  4C5I A;  5KYN A;  5GMK j;  5GAO m;  3PE0 A;  3A8O B;  2NLU A;  5LJ3 d;  1ZA1 B;  1M90 C;  1M4Z A;  1VQ4 Q;  2RNA A;  1Y96 A;  2EGC A;  1SSH A;  2E4H A;  5HK3 A;  2E64 A;  1WGS A;  2JTM A;  4M7D F;  4RCC A;  2RHY A;  3EFO B;  5FRO A;  1H64 1;  3V7S A;  2AZV A;  5LJ3 f;  3E9G A;  3SEM A;  1X6O A;  4A4H A;  2DA9 A;  1YBY A;  2RK1 A;  2AKK A;  2QTX A;  4HCC A;  3R6N A;  1IXD A;  4HVU A;  2KVQ G;  4LE9 A;  2FPF A;  3A1P A;  3FC3 A;  2RF0 A;  1G3T A;  4HA8 A;  4X9D A;  1M1K U;  1IGU A;  1VUB A;  1YN8 A;  1ZSZ C;  2M0Y A;  3VUB A;  2CSI A;  2HKQ B;  1AOJ A;  3FLG A;  1MGQ A;  2VAS A;  2ESW A;  3HSB A;  4M7D E;  4FIB A;  2XKO C;  1OU8 A;  3L2Z A;  3QYH B;  1E6H A;  2K5I A;  1K9M C;  3CXC P;  2KR3 A;  2DF6 A;  4ZN1 A;  3HFN A;  1RAA B;  1UJ0 A;  2IIM A;  3N5B B;  8ATC B;  5DLQ E;  4M78 A;  3ZBD A;  3RES A;  4A4K A;  2MIO A;  2VC8 A;  3VS3 A;  2JMC A;  2HSE B;  3EG1 A;  3M4G A;  1RAG B;  2A3L A;  3I9Q A;  4F7U A;  1T3L A;  2O01 E;  2KQW A;  3OW2 A;  2LQN A;  1KD1 U;  3CME T;  2LX7 A;  1G83 A;  4Z02 A;  4PJO B;  3HHT B;  1K9M U;  3OYG A;  2FRW A;  2EYX A;  1EIF A;  2EFI A;  3QPH A;  3QZ5 B;  4XU0 A;  5GAO l;  2GTJ A;  3G1J A;  4C0F A;  3CCM Q;  2LTO A;  4OMN A;  4JDS A;  1K9A A;  1OX8 A;  4D8K A;  1U5S A;  4QQD A;  1BBZ A;  4JJN K;  4RTZ A;  2LCL A;  4RTX A;  1HYO A;  1SRM A;  3G6E T;  3I55 A;  3UA7 A;  4FW2 A;  1M8M A;  4ZGJ B;  4R55 A;  1W2B A;  1Q82 U;  1LCK A;  4AG2 C;  4C8Q B;  4Y92 A;  2EJF A;  4BE1 A;  2EYZ A;  1NLP C;  4ME7 A;  3I56 T;  5D6Y A;  1VQ9 A;  4X1V A;  1Q86 R;  1GCP A;  5KYX B;  2BKD N;  3H9N A;  2P0K A;  2ZCF B;  1QVF S;  1S1N A;  1Z9Q A;  5J3B A;  1TUD A;  2FB7 A;  2EW3 A;  1JB0 E;  4OMQ A;  1QVG S;  3HKS A;  2KNB B;  1SSF A;  4PJO C;  5IAY A;  3CC4 T;  1WJR A;  1NPP A;  4C92 G;  1BK2 A;  2LQ8 A;  1AWW A;  5GAO q;  3A8G B;  3OW2 S;  4M7A C;  2DL8 A;  3T9N A;  1X69 A;  2XG8 D;  3EAE A;  1X2Q A;  1S72 A;  1BI2 A;  3EFR A;  2CP2 A;  3CCQ A;  4OGC A;  3CCR T;  4OVA A;  3EH2 A;  3OYA A;  2Z0W A;  3UAT A;  4D6W A;  1M90 R;  1M1K R;  4ATO A;  4A4F A;  3H6Z A;  1HK9 A;  4ELZ C;  3EHR A;  1BB9 A;  3UT1 A;  1VQP A;  2FG0 A;  3HRT A;  4N4G A;  2QDL A;  4PLI A;  2KAF A;  2DKG A;  1VIE A;  4M4Z A;  5LJ3 h;  1JO8 A;  2JN0 A;  3EG9 B;  3H0I A;  1U1T A;  2H3E B;  3GNF B;  4HXJ A;  3OYY A;  2NUP A;  1UGP B;  4FYX B;  2L5Q A;  5GAM j;  4PFZ A;  4M77 D;  2LQW A;  1K1Z A;  2OI3 A;  2DXB A;  1V76 A;  3JB9 J;  3UPU A;  1K73 C;  2EAY A;  1VQN A;  1X6G A;  4JPB W;  2RPN A;  4KUD K;  4NS5 A;  1KJW A;  2ABL A;  4OF1 A;  3NTI A;  1K9M R;  4E7K A;  4J7I A;  4KUL A;  1VQ7 T;  1Y57 A;  4J6W A;  3CCU Q;  5LJ5 j;  1YNZ A;  2KDS A;  3INZ A;  4N4I A;  4F14 A;  4QQ6 A;  5GAN d;  3SFM A;  1UGQ B;  5FW9 A;  3DKM A;  2V1Q A;  4XU3 A;  3E2U A;  1K76 A;  4AFS C;  3ZEH A;  3OYC A;  1M27 C;  3OYE A;  1WZO A;  1TSF A;  4KUI A;  4LD9 K;  2DYB A;  1VQ5 T;  5GAN f;  4M75 F;  3J80 E;  1NPR A;  2F2V A;  3O5Z A;  4A63 B;  1FXX A;  1I81 A;  3QDF A;  2R57 A;  2VUB A;  4PJO A;  3EG3 A;  1PKS A;  6AT1 B;  3E19 A;  2CP5 A;  1X27 A;  2RK2 A;  3OB9 A;  2RO0 A;  4JLI A;  1U8R A;  1S72 T;  3RR6 A;  4RTW A;  1WYX A;  1DJ7 B;  4KBM B;  3KFV A;  1Q81 C;  2LDM A;  3WVE B;  2YDL A;  3I5S A;  4XTY A;  2CRE A;  4M75 E;  3CCL T;  1N5Z A;  2KRO A;  1KK7 A;  2C0T A;  2K4Y A;  1VQP T;  2BE9 B;  1KG1 A;  4LN2 A;  1TTH B;  2WSF E;  3CMA Q;  4A53 A;  4C8Q A;  3GNG A;  4L6V 5;  2EKH A;  3HL8 A;  2YRV A;  5GAN 5;  2RMO A;  3QDR B;  2JT4 A;  5GJW B;  2D6F A;  4R0K A;  3QYG B;  3H8Z A;  3G71 Q;  1KSW A;  1PG5 B;  3CD6 T;  1VQ8 T;  5KYX A;  2PVG B;  4JS4 A;  4HVW A;  3TSW A;  2BTT A;  5AYF A;  1IHV A;  2M02 A;  4E47 A;  2ROT A;  3U23 A;  1P92 A;  5FU7 C;  2J6F A;  3PFS A;  2RQU A;  1AWX A;  3BW1 A;  4EDU A;  3RIR A;  4LDW A;  5I21 A;  4PLL A;  3FRN A;  3G6E Q;  4A4G A;  2VYT A;  3CCM A;  2R58 A;  2J06 A;  2OTL Q;  4VUB A;  1OUL A;  3LW5 E;  4MDW A;  2M16 A;  2O31 A;  4OML A;  1VOM A;  3KBG A;  5GAN 2;  2GFA A;  2A0F B;  2FZC B;  1QW1 A;  2KXD A;  2COZ A;  2XI9 A;  3I56 Q;  3WVD B;  1SEM A;  4CC4 B;  2R5A A;  1M5Q 1;  4IIM A;  1HSQ A;  4FW1 A;  1VYV A;  2FYK A;  4FT2 A;  2DFU A;  2K5F A;  1K8A U;  3EGX B;  2XMF A;  4QKU A;  3OY9 A;  3JCM g;  4DBR A;  1Y96 B;  1D1B A;  4JS5 A;  2RI5 A;  3G7Z A;  3EG9 A;  4QQG A;  3CCV A;  4M78 F;  4LD6 A;  3S3N A;  4IUP A;  1ZBX A;  4OMO A;  2DEU A;  4DBF A;  2JM9 A;  3THK A;  1SHF A;  5L8R E;  3JRZ A;  2C0I A;  2RQT A;  5DY9 A;  2CS7 A;  2YSQ A;  3VV0 A;  4NL3 A;  1WHM A;  4D8D A;  2E1H A;  1QCO A;  3CC2 T;  2EVR A;  2J7I A;  5GAO p;  2BIV A;  2CGH A;  3EG0 A;  5LJ5 g;  2KBT A;  3TU4 K;  5HCK A;  4BI4 A;  1PKT A;  1OPL A;  2ROL A;  3CPW S;  3L2U A;  3HPW A;  2OTJ Q;  4M78 E;  3SHW A;  2K5L A;  1MHN A;  4PJM A;  4QVZ A;  1I8F A;  3J81 E;  3A98 A;  1YJN T;  3M0Q A;  1SG5 A;  2HMA A;  1WXU A;  5GAO r;  2FPE A;  1IGQ A;  1BKB A;  3C95 A;  5GAN h;  5GAN 7;  3LGL A;  2E41 A;  3P8D A;  3OYN A;  1VQO T;  2FPD A;  1G2B A;  1ZUK A;  1U3O A;  3C4S A;  1D0Z A;  4M77 G;  1H3Z A;  1VQ7 Q;  1Q81 R;  1RI9 A;  2JM8 A;  2QDY B;  3PMT A;  1WA7 A;  2VKN A;  3JCM b;  4C5E A;  2CH4 W;  4IKF A;  2DTH A;  3H0H A;  5ECA A;  3RMS A;  1BCM A;  1UHC A;  2L8D A;  1QQJ A;  3CBP A;  3JB9 I;  3ZFJ A;  5HKC A;  3MEA A;  2ZPI B;  1TUG B;  2MYS A;  4Y28 E;  5HY6 A;  2RN8 A;  2H3J A;  4IUR A;  3JCM c;  1VIF A;  3MEW A;  2DMO A;  4J8O A;  2CP6 A;  4XTU A;  4TVR A;  3JB9 D;  1JEG A;  2OX7 A;  3UDC A;  1Y07 A;  2HQE A;  1YJ9 Q;  2ZGW A;  3JCM e;  3MP6 A;  1JJ2 P;  4XU1 A;  9ATC B;  2VXF A;  2JW4 A;  3RER A;  4KH0 B;  2JTE A;  3CCV T;  1K8A R;  1VQK A;  5KE2 A;  4IUQ A;  1YI2 Q;  4LUE A;  4JJC A;  5CKH A;  2D9T A;  2CP7 A;  2EIF A;  3CCL Q;  4HCB A;  1I07 A;  3MP1 A;  4F16 A;  3VUZ A;  4M7D D;  4C5H A;  4ZGD B;  3OYD A;  2K2M A;  1TH7 A;  2K9G A;  2HBW A;  3M53 A;  2OJ2 A;  2KRM A;  1AVZ C;  3V7R A;  2KRS A;  4ANJ A;  4HKE A;  3CD6 Q;  3QO3 A;  4OB2 B;  2MAM A;  1LNX A;  2OAU A;  3M4Y A;  3CMA A;  2DZC A;  5C6S A;  2DBK A;  4AFQ C;  1B7T A;  5I22 A;  1UJY A;  4M7A D;  1YIJ Q;  3QWX X;  3G71 A;  2EQU A;  3Q1J A;  3EGX A;  1WFW A;  2E12 A;  2D0N A;  2HL5 C;  2DXC A;  1M1K C;  1RLP C;  1H3H A;  4IUT A;  2VVK A;  1GBR A;  1RLQ C;  3DB4 A;  2BUD A;  2EYY A;  3VS0 A;  2DIL A;  4FYY B;  2DK3 A;  2LQK A;  2IG0 A;  3V8J A;  2NUP B;  2CT4 A;  2DX1 A;  2WSE E;  1TOV A;  4OB3 B;  1J3T A;  2CUB A;  2O2O A;  2RI3 A;  1M1F A;  2E3I A;  2QG9 B;  2JNG A;  1UFF A;  3OYM A;  3NHN A;  2DO3 A;  1YIT A;  1K4U S;  1VYT A;  3RKW A;  3LWI A;  4PJO F;  3CCS Q;  3CBO A;  2QXF A;  1R0B G;  5IT9 E;  1PHT A;  3OQ5 A;  1KD1 C;  2GNC A;  1LVK A;  1Y0M A;  4M7A F;  2RQW A;  1D0Y A;  3OSS C;  1MNE A;  3ME9 A;  3G4S A;  5C0M A;  2M1H A;  2X35 A;  4PJJ A;  2SRC A;  1VQK T;  1WQW A;  1X2K A;  2LT1 A;  2X9H A;  3QG1 A;  5EG2 A;  2QQR A;  1SRL A;  4IIO A;  4PJO E;  3GIB A;  4C8Q F;  3SD4 A;  4AT1 B;  3SWN A;  4B6M A;  4J6Y A;  2X4J A;  1YP5 A;  4WTO B;  4M7A E;  5LJ3 g;  4NL2 A;  3BDU A;  2EQI A;  1Q82 C;  5CK9 A;  1IZ6 A;  1YJW T;  4DEX A;  1EFN A;  2FZG B;  2LCS A;  2DL7 A;  1UEB A;  1ZQ1 A;  1I5O B;  2HSP A;  3CC7 Q;  3NFC A;  1ZSG A;  2RHX A;  4AMC A;  1VQ6 T;  2JVV A;  3L1A A;  2RA2 A;  4IUU A;  4ORZ A;  1RAH B;  2JXB A;  4HT8 A;  4XQ3 A;  4YTL A;  1NM7 A;  1VQM T;  4PFP A;  3V7C A;  2X4X A;  2YRC A;  3FJ5 A;  5KYW A;  2PTK A;  2RHZ A;  3S6W A;  1ACM B;  1Q7Y U;  2I0N A;  2QQ9 A;  2DXU A;  4HCK A;  1KQ2 A;  4KGZ B;  3M56 A;  5IN1 A;  2EJG A;  1M9S A;  1B07 A;  2E6Z A;  2RB6 A;  2MMP A;  3CCE A;  2VV5 A;  3CCJ Q;  4LDV A;  1NEB A;  1WDX A;  2DLP A;  2E3H A;  4RTT A;  1CKA A;  1N9S A;  4J9F A;  2LRQ A;  2HQH A;  3D7S B;  3MO8 A;  1AZG B;  4XAX B;  2FL7 A;  1N8R U;  2GTO A;  1OQK A;  4OMP A;  2Y4X A;  2MPX C;  4Z8A A;  5J26 A;  2CZ0 B;  2K2V A;  4EMK B;  2C0O A;  1TS9 A;  2XDB A;  2RQR A;  5GJV B;  3ER0 A;  2ED1 A;  2HCK A;  2KSS A;  2GCX A;  1NG2 A;  5GAN 8;  4E6R A;  1G5V A;  2X4W A;  1R0C B;  1NE8 A;  2JMA A;  1F1B B;  1UGR B;  2QEX Q;  1WHL A;  3OYB A;  2L3Q A;  3M9Q A;  3JB9 G;  3LGF A;  2DJZ A;  2M9U A;  4E7I A;  1YJ9 A;  2D1X A;  5LL6 S;  2RM4 A;  4AFZ C;  4C8Q C;  3VS7 A;  1YHQ A;  2K3X A;  3EHQ A;  1VQL A;  2JJ9 A;  5CO7 A; 
#chains in the Genus database with same CATH homology
 1VQ8 T;  2PVG B;  4JS4 A;  2A7Y A;  5FRN A;  3CC4 A;  5AYF A;  3CXC A;  2PVD B;  5GMK l;  1W2B S;  4ELY C;  3OYL A;  2VGN A;  2CZ7 B;  4E47 A;  2DEQ A;  2MF2 A;  1P92 A;  3L42 A;  4DA4 A;  5I2M A;  1M1G A;  2JZ2 A;  3OBW A;  4BB7 A;  5LJ3 e;  1D3B B;  5FU7 C;  4BE0 A;  1M90 U;  4C92 D;  3PFS A;  4O5V A;  4DOV A;  3S3O A;  2LNV A;  3CCJ T;  3HRU A;  3OS0 A;  3BW1 A;  4EDU A;  3RIR A;  4LDW A;  2YLC A;  5I21 A;  4PLL A;  4MZT A;  3FRN A;  3QSU A;  1BIA A;  2HNI A;  3M58 A;  4BUG A;  5D6X A;  5A0D A;  4M7D G;  3CCR A;  1RI0 A;  3M55 A;  4M75 D;  2R5M A;  5CQX A;  1JJ2 A;  4A4G A;  2E70 A;  2VYT A;  5M9O A;  3CCM A;  3QKJ A;  2R58 A;  1Y7X A;  3FDR A;  4FSX A;  4VUB A;  5KE3 A;  1BYM A;  3VYG A;  3LW5 E;  3GOX A;  4MDW A;  2F69 A;  2M16 A;  1OZ2 A;  3JSC A;  2KMT A;  4C92 A;  1BI1 A;  3KBG A;  5GAN 2;  1BI3 A;  5FLX E;  2GFA A;  1Q7Y C;  1YCY A;  1QW1 A;  2XI9 A;  3WVD B;  3DLM A;  3QII A;  3S3M A;  4M7D B;  1RL2 A;  2RJE A;  1XNI A;  2R5A A;  1M5Q 1;  2P0Q A;  4BDY A;  4J5Y A;  2ZPE B;  4J83 A;  2DIG A;  4M75 A;  4C92 C;  5A0G A;  5GAN 4;  4BE2 A;  1QVF A;  4M78 C;  2ZPB B;  2V8J A;  4JRQ A;  2HAX A;  4JRI A;  1OZ3 A;  2MWP A;  1UGS B;  1B34 A;  2FYK A;  4OB0 B;  3JCM h;  5CAI A;  1QVG A;  2PUO B;  5GAM e;  3I55 T;  3QBY A;  3DB3 A;  4FT2 A;  2K5F A;  4J6X A;  2DPP B;  3GLX A;  4M7A G;  2OTJ A;  3CMA T;  3L2W A;  2KY9 A;  3MCA B;  1N9R A;  2QEX T;  1K8A U;  1NJI U;  4C8Q E;  2PQW A;  1N8R C;  3CCE T;  3OY9 A;  3JCM g;  1VQ4 A;  1Y96 B;  4B9W A;  4BY6 B;  3G71 T;  2HBP A;  3OS1 A;  4A54 A;  4JS5 A;  2RI5 A;  1VQ9 T;  3G7Z A;  3HFO A;  4M7A B;  2PUK B;  4C92 F;  2VXE A;  4QQG A;  5DLO A;  3OYF A;  4IUV A;  4M78 F;  3CCV A;  4ZTF A;  2QA4 T;  1Q86 C;  3VYH B;  4LD6 A;  5LJ5 e;  3FEO A;  2MWO A;  3A8M B;  3S3N A;  2YHT A;  3L2Q A;  3CXC S;  1YJW A;  4IUP A;  1ZBX A;  3CPF A;  3OYH A;  4J7F A;  4BAC A;  3OMC A;  4E7L A;  3E9F A;  1M8V A;  3QJ6 A;  5L8R E;  3WXM B;  3JRZ A;  5KCH A;  5DY9 A;  2CS7 A;  3JCM Q;  4X34 A;  3VV0 A;  5CCA A;  4PKC C;  4NL3 A;  3GPL A;  1VQ7 A;  4M7D A;  3L2V A;  4R56 A;  2E1H A;  3X24 B;  5J39 A;  1VQ6 A;  1AHJ B;  3QZ9 B;  3CC2 T;  4LDY A;  3EFS A;  3A5Z B;  5GAO p;  3JB9 F;  2BIV A;  2CGH A;  5LJ5 g;  1JJ2 S;  2OTL T;  1HXD A;  1JBM A;  4M7D C;  4E7J A;  5GAN j;  3TU4 K;  5GAN 6;  3CCQ T;  2LC4 A;  4JRK A;  3OBY A;  4BI4 A;  5FU6 C;  1VQM A;  2IVW A;  3CPW S;  3CCS A;  1LOJ A;  1WJS A;  2XK0 A;  4C92 E;  3HPW A;  3BDL A;  3L2U A;  2E10 A;  4XTW A;  4M78 E;  4C5I A;  5GMK j;  5GAO m;  1YIT T;  4EPC A;  3A8O B;  2NLU A;  2K5L A;  1MHN A;  5LJ3 d;  2HQX A;  3VKI A;  4V2S A;  4QVZ A;  1I8F A;  3CBM A;  3J81 E;  1M90 C;  3FIF A;  5KH6 A;  3LLR A;  2X4Y A;  4N4H A;  1M4Z A;  4N0A C;  1YJN T;  1Y96 A;  1YHQ T;  1VQL T;  3BY7 A;  2LCC A;  5GAO r;  4BD3 A;  1VQ5 A;  5HK3 A;  4ZTJ A;  4MDX A;  1BKB A;  5CIU A;  2C06 A;  2E64 A;  1WGS A;  3C95 A;  5GAN h;  5GAN 7;  3LGL A;  1N6A A;  2AHJ B;  4BY6 C;  4P5N A;  2JTM A;  2E41 A;  3P8D A;  3OYN A;  1R8O B;  3M57 A;  2RHY A;  4RCC A;  4E7H A;  1VQO T;  5FRO A;  4M7D F;  2LT4 A;  1H64 1;  3V7S A;  5LJ3 f;  3G4S T;  4II1 A;  2FVU A;  3PGG A;  1U1S A;  3X20 B;  2O4X B;  2EJ9 A;  3E9G A;  3C4S A;  1X6O A;  4KT0 E;  4XK8 E;  4A4H A;  4QVD A;  4M77 G;  3PTA A;  1H3Z A;  1YBY A;  2RK1 A;  1KQS A;  1KHC A;  2QTX A;  1G3W A;  2QDY B;  3PMT A;  2K3Y A;  4HCC A;  2DTI A;  3JCM b;  3CEY A;  2KVQ G;  5GAM d;  4C5E A;  4IKF A;  4Q5W A;  2EQK A;  3RKX A;  2DTH A;  1YI2 A;  2Y4Y A;  3FC3 A;  1G3T A;  4HA8 A;  4OP0 A;  4X9D A;  1M1K U;  2JOY A;  4M78 D;  5CQY A;  3RMS A;  1VUB A;  4M77 B;  3CCL A;  3VUB A;  1K8A C;  2L8D A;  3JCM V;  3TRE A;  1VQN T;  1OYX A;  1NJI C;  4EMK A;  1KHI A;  3FLG A;  1MGQ A;  3CC7 A;  2QI2 A;  3CBP A;  3HSB A;  3JB9 I;  4M7D E;  4FIB A;  2XKO C;  2QQA A;  4XTX A;  3ZFJ A;  5HKC A;  3MEA A;  3L2Z A;  3QYH B;  2ZPI B;  3MHX A;  2K5I A;  4Y28 E;  1K9M C;  5HY6 A;  3E1S A;  4ZN1 A;  4RG2 A;  1GXI E;  5I2S A;  3HFN A;  4EMK C;  4MMK A;  1QP3 A;  2H3J A;  4IUR A;  5CKB A;  3JCM c;  5GAM f;  3KXT A;  5KCO A;  1VIF A;  3N5B B;  5DLQ E;  3DLL A;  3MEW A;  4HT9 A;  4OGE A;  4B9X A;  4M78 A;  4J8O A;  3ZBD A;  2DD5 A;  3RES A;  4XTU A;  5LJ5 d;  2OTJ T;  4EMG A;  4QVC A;  4A4E A;  4TVR A;  4A4K A;  3JCM J;  3JB9 D;  3GF5 A;  2VC8 A;  1XTD A;  4BI8 B;  3CD6 A;  4BI3 A;  1VQ8 A;  4Y91 A;  3UDC A;  1Y07 A;  2HQE A;  2ZGW A;  3JCM e;  1IRE B;  3MP6 A;  3M4G A;  4PJO G;  3SB2 A;  1VQ4 T;  3X28 B;  2A3L A;  4XTZ A;  4XU1 A;  1W4S A;  2VXF A;  4F7U A;  3RER A;  1OI1 A;  3TEE A;  1YIJ A;  2RD1 A;  1G3Y A;  3OYI A;  4XU2 A;  3CCV T;  2O01 E;  2ZZD A;  1VQK A;  5KE2 A;  4C0D B;  2KQW A;  3CCJ A;  5LJ5 f;  4FL6 A;  4IUQ A;  3OW2 A;  1KD1 U;  5CKD A;  3QUI A;  3JCM P;  3CME T;  4Z02 A;  3A8H B;  4O6J A;  2ZPG B;  4PJO B;  2B8A A;  2HD0 A;  1D3B A;  4MZP A;  5GMK m;  3HHT B;  1K9M U;  3OYG A;  5CKH A;  2D9T A;  2EIF A;  4OMF B;  3URG A;  1BIB A;  3M59 A;  3QZ5 B;  1EIF A;  2EFI A;  3MP1 A;  2LX9 A;  3QPH A;  4XU0 A;  3C94 A;  3TCJ A;  3VUZ A;  5GAO l;  4M7D D;  4C5H A;  4ZGD B;  4PNO A;  3X26 B;  2CYZ B;  3OYD A;  2JTF A;  1TH7 A;  4C0F A;  4WF2 A;  4XTV A;  4M77 C;  3M53 A;  2LTO A;  5CVI A;  3O8V A;  4JDS A;  3UWN A;  3SDZ A;  4C8Q G;  1XQH A;  4QQD A;  3V7R A;  4JJN K;  2LCL A;  2RJD A;  3OS5 A;  4HCZ A;  2EKO A;  3G6E T;  4HKE A;  4F7U F;  3I55 A;  3QO3 A;  4OB2 B;  2EWN A;  2MAM A;  1O9S A;  1LNX A;  2OAU A;  4QW2 A;  4ZGJ B;  3F70 A;  3M4Y A;  4R55 A;  3CMA A;  1W2B A;  2DZC A;  1Q82 U;  4C8Q B;  1K73 U;  5C6S A;  1FWZ A;  2G3R A;  4ZGE B;  2EJF A;  2F5K A;  2RHU A;  4JLG A;  4M7A D;  4BE1 A;  3OYK A;  4ME7 A;  3I56 T;  2GFU A;  3G71 A;  4N0A A;  3JCM W;  2EQU A;  3JAM E;  2DZ9 A;  3Q1J A;  4M77 F;  4DQ2 A;  5D6Y A;  5A0L A;  3HP9 A;  5D6W A;  1VQ9 A;  2E12 A;  1PSF A;  2BKD N;  5FU7 B;  1YJ9 T;  2P0K A;  2DXC A;  2ZCF B;  2QA4 A;  3R6O A;  1M1K C;  1X75 C;  1QVF S;  2QQB A;  3MET A;  4PL6 A;  5J3B A;  4C0D C;  3PIO A;  4HCB A;  2XD0 A;  2FB7 A;  3VU3 C;  3LH0 A;  4IUT A;  1JB0 E;  4M7A A;  1QVG S;  3HKS A;  2FHD A;  4RCB A;  5GAN e;  2RH2 A;  1PSE A;  3DB4 A;  1SSF A;  4PJO C;  4F7U E;  5IAY A;  2BUD A;  3LX7 A;  3CC4 T;  1WJR A;  1NPP A;  2Y90 A;  4C92 G;  2LQ8 A;  2GQV A;  1WJQ A;  5CKF A;  5GMK e;  3HRS A;  4GLK A;  3A8G B;  5GAO q;  3OW2 S;  4M7A C;  2DK3 A;  2LQK A;  2IG0 A;  1YI2 T;  5GMK h;  3V8J A;  2WSE E;  3OSV A;  3T9N A;  3CC2 A;  2XG8 D;  3L2R A;  3EAE A;  4M75 G;  1S72 A;  1FX7 A;  1Y71 A;  3SWN B;  4OB3 B;  1BI2 A;  2D0Q B;  4FU6 A;  2RI3 A;  1M1F A;  3EFR A;  4RKU E;  1LJO A;  3JCM X;  3CCQ A;  4GY5 A;  4M77 E;  4MZM A;  4OGC A;  5GAN g;  4BDZ A;  2DXT A;  3JCM d;  3CCR T;  2JNG A;  4OVA A;  3OYM A;  3CCM T;  2DO3 A;  3OYA A;  1YIT A;  3OMG A;  3KUF A;  1KC8 C;  5DM7 R;  1N27 A;  4D6W A;  3RKW A;  5LJ3 j;  3LWI A;  2XDP A;  4M75 B;  4ATO A;  2DAQ A;  4PJO F;  2XIC A;  4A4F A;  3FB9 A;  3H6Z A;  3CBO A;  1YJN A;  2QXF A;  1HK9 A;  5IT9 E;  3OQ5 A;  4ELZ C;  1KD1 C;  1JRI A;  2XU8 A;  3FJP A;  1WNL A;  2ZPF B;  3V8K A;  3UT1 A;  4M7A F;  2MI6 A;  3CCU A;  1VQP A;  2XID A;  3HRT A;  3JCM f;  2CZ1 B;  4N4G A;  3PMI A;  4NOY A;  5CKE A;  3OYJ A;  1Q81 U;  4FM4 B;  3OSS C;  4PLI A;  1VQO A;  3X25 B;  2WSC E;  2KAF A;  3ME9 A;  2DKG A;  3QXE B;  3G4S A;  5C0M A;  2M1H A;  1YIJ T;  1G3S A;  1VIE A;  2X35 A;  5LJ3 h;  1VQK T;  2L89 A;  2DTO A;  1WQW A;  2E6N A;  2LT1 A;  3PIP A;  2JN0 A;  2ZPH B;  3QG1 A;  4RMO A;  5EG2 A;  1U1T A;  2EQM A;  3GNF B;  1V29 B;  2QQR A;  3NTK A;  3OYY A;  2RI2 A;  1WPY A;  1UGP B;  4PJO E;  2XHC A;  1KC8 U;  2L5Q A;  3AHU A;  4C8Q F;  3SD4 A;  5GAM j;  2O4X A;  3SWN A;  3GIB A;  4J6Y A;  4M77 D;  2X4J A;  3RKY A;  3CPW A;  2K57 A;  4M7A E;  5LJ3 g;  2L3R A;  1O75 A;  2CKK A;  2DXB A;  2YLB A;  3BDU A;  4LDU A;  4NL2 A;  3JB9 J;  1Q82 C;  3UPU A;  5CK9 A;  1K73 C;  3SWN C;  2EAY A;  3MEV A;  1VQN A;  4JRP A;  2V8I A;  1IZ6 A;  1YJW T;  3LWH A;  3NTH A;  1I4K 1;  4NS5 A;  4KUD K;  4X9C A;  5FU6 B;  2QQS A;  3NTI A;  4OF1 A;  4EMH A;  4E7K A;  1WQ7 A;  5A2Q E;  4M77 A;  4J7I A;  4UC4 A;  2DIQ A;  1UEB A;  1ZQ1 A;  2F5T X;  1QP2 A;  4KUL A;  1VQ7 T;  2V8K A;  3NFC A;  4M75 C;  2RHX A;  4J6W A;  4DOW A;  2JVV A;  2E65 A;  4OB1 B;  1I5L A;  3BFM A;  3L1A A;  5GAM h;  2RA2 A;  4IUU A;  5LJ5 j;  1KQS S;  4C0G A;  4HT8 A;  4XQ3 A;  2KDS A;  4YTL A;  3INZ A;  4N4I A;  4QQ6 A;  5GAN d;  3SFM A;  1UGQ B;  1VQM T;  3C12 A;  3JB9 H;  3CCS T;  3V7C A;  4C0Z A;  4ZN3 A;  4L5G A;  2X4X A;  4CRI A;  3DKM A;  2RHZ A;  5GAM g;  1XOV A;  4XU3 A;  3S6W A;  3ZEH A;  3OYC A;  1Q7Y U;  2QQ9 A;  3ASK A;  4PJO D;  2DXU A;  2QEX A;  3OYE A;  3RMQ A;  2XDD A;  1NZ9 A;  2VGM A;  1KQ2 A;  2LVM A;  3M56 A;  3CME A;  4KUI A;  3VJP A;  3LYI A;  4LD9 K;  2E5Q A;  1VQ5 T;  5LJ5 h;  5CR2 A;  5IN1 A;  2EJG A;  5GAN f;  1VQ6 T;  4M75 F;  1M9S A;  2E6Z A;  1NPR A;  2RB6 A;  2MMP A;  4RG8 A;  4C5G A;  3J80 E;  3CCE A;  3QHS A;  2VV5 A;  3OA6 A;  5GMK i;  1FXX A;  1I81 A;  4LDV A;  3QJY A;  2R57 A;  2VUB A;  4PJO A;  3E19 A;  2RK2 A;  2EQJ A;  3OB9 A;  1N9S A;  2RO0 A;  3P8B B;  4JLI A;  1U8R A;  2LRQ A;  2RJF A;  1S72 T;  5HK0 A;  3MO8 A;  4LDX A;  4XAX B;  3RUX A;  1BI0 A;  2FL7 A;  1N8R U;  1DJ7 B;  1UB4 A;  4KBM B;  2WAC A;  1X01 A;  2Y4X A;  1Q81 C;  1QVP A;  5J26 A;  2CZ0 B;  4M78 G;  2K2V A;  2LDM A;  5FRM A;  3G6E A;  4C8Q D;  4EMK B;  3WVE B;  4FT4 A;  2RJC A;  2KK4 A;  2XDB A;  2CZ6 B;  4MML A;  4CI0 C;  3GP8 A;  3PNW C;  4XTY A;  2P4T A;  2DD4 A;  2PVO B;  3ER0 A;  1Q86 U;  2JUF A;  4M75 E;  2OTL A;  3CCL T;  2KSS A;  1KQ1 A;  2GCX A;  5GAN 8;  5GAO n;  3OS2 A;  4C92 B;  3MEU A;  3CC7 T;  4L59 A;  1G5V A;  2M0O A;  2K4Y A;  2X4W A;  4M78 B;  3CCU T;  1VQP T;  3J7A F;  1KG1 A;  1NE8 A;  2DVE A;  2GF7 A;  4F7U G;  3I56 A;  2WSF E;  3P8H A;  4A53 A;  1UGR B;  4C8Q A;  1ZHI A;  2EYQ A;  3GNG A;  3PT9 A;  3A8L B;  4JUV A;  4L6V 5;  3M5A A;  3HL8 A;  3OYB A;  2YRV A;  3M9Q A;  2I2L A;  3JB9 G;  5GAN 5;  3LGF A;  2DJZ A;  3MP8 A;  3QDR B;  3V8L A;  2D6F A;  2RHI A;  2M9U A;  5GAN 3;  2P0P A;  4E7I A;  1YJ9 A;  2PU9 B;  3QYG B;  5LL6 S;  2RM4 A;  3H8Z A;  4C8Q C;  1B34 B;  3M54 A;  1YHQ A;  2K3X A;  1VQL A;  3CD6 T;  5CO7 A;  4F7U B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...