4M75C

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
70
Chain Sequence
PLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 13
structure length 70
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75C00
4A53A 4M7DF 4XTUA 4DQ2A 5GAOp 1KQ2A 2DEQA 1BIBA 3V7CA 5LJ3g 4J6YA 4JLIA 4M7DE 1JBMA 2YLBA 2E41A 4XTXA 3RESA 1I81A 3GIBA 4C92A 2DZCA 4N0AA 5DY9A 2VXEA 4PJOC 1YCYA 5GANh 5GAN8 4M7AD 1WNLA 4JRKA 4PJOG 3JCMc 2Y90A 3SWNB 4M75A 4M77E 2DXUA 4A54A 2DJZA 3SWNC 1B34A 4C8QA 4JRIA 1M8VA 4C92F 4J5YA 5GAMf 3L1AA 2DTHA 3RKXA 3RUXA 3JB9H 4M78A 4C92E 5GANg 1M5Q1 3BY7A 3RKWA 4XU0A 4M7AB 4M75F 2DVEA 4EMGA 4M7DD 2EJ9A 2RB6A 5GMKh 2JN0A 2EJGA 2DTIA 2FB7A 4NOYA 4M77A 4C8QF 4NL3A 4M7AC 4M75E 1N9RA 5GMKm 3JB9I 4XTZA 5GANf 5LJ5j 5GAMe 3JB9G 4C8QE 4M7AG 1Y96B 2YHTA 1HK9A 3JCMV 1I8FA 5GAN4 4PJOB 4M78F 5LJ3j 3JCMf 5GAOq 5GAMd 4M78E 3V7SA 4NL2A 1KQ1A 3VU3C 4M77F 2RA2A 3EFSA 3BDUA 3QUIA 4RCCA 4WF2A 4F7UB 3JCMQ 4Y91A 5GANe 5GAMg 3V8KA 4C92D 1WPYA 1WQ7A 4EMKB 3JCMh 5GMKi 3JCMJ 3SWNA 4HT9A 2DKGA 3QO3A 4EMKC 4XTYA 3RKYA 5GANd 2EWNA 4F7UG 4XTWA 1LNXA 4M75D 5GAN5 2DTOA 5GAOr 5GAOl 4C8QD 2RM4A 4V2SA 4XU3A 5GAOn 4J6XA 5GAN6 2I2LA 2RD1A 2E65A 2VC8A 4EMHA 2QTXA 4XTVA 3JCMg 4M78D 2E64A 2E1HA 5GMKe 1H641 4J6WA 4M77D 3HSBA 1Y96A 3JB9J 1U1SA 3FB9A 4X9CA 1BIAA 4C92G 1I5LA 3JB9F 4PJOA 3V8LA 4HT8A 5GAN7 2E10A 4M7AF 4RCBA 4XU2A 2DXTA 5LJ5h 3JCMX 4M7DB 4C8QC 3FIFA 4HA8A 1JRIA 5LJ3h 5GAN3 3RIRA 4F7UA 5GAMj 2EJFA 4M7DC 4M7AE 4C8QG 2CGHA 1WQWA 5I21A 1MGQA 2FYKA 4PJOF 3JCMe 4QVDA 4M7DG 1N9SA 3BW1A 3PGGA 3AHUA 1D3BB 2DZ9A 1U1TA 4XQ3A 3M4GA 4PJOE 3QHSA 1HXDA 4M77C 3JCMd 5LJ5g 4OP0A 5GAN2 5GANj 4F7UF 5CAIA 3BFMA 1LOJA 5GMKl 1LJOA 4M77G 4MMKA 4M7AA 2VXFA 4C92B 4F7UE 1X01A 3EFRA 2K57A 5LJ5f 3INZA 4N0AC 3SB2A 4C92C 4QVCA 3JB9D 3HFOA 4X9DA 5LJ3f 3RERA 4M75B 4XU1A 1B34B 4M75C 4JUVA 4C8QB 3JCMP 2ZGWA 2EAYA 1I4K1 2HNIA 4PJOD 5GMKj 4MMLA 3QSUA 4M75G 4M7DA 5LJ5e 3FJPA 3L2ZA 4M78B 3HFNA 4EMKA 4PNOA 5LJ3e 1TH7A 2YLCA 4M78C 5LJ5d 3JCMb 5GAOm 3V8JA 4M77B 5LJ3d 4M78G 5GAMh 1D3BA 3JCMW 3V7RA
chains in the Genus database with same CATH superfamily
3SFMA 3AT1B 3HRSA 4RTWA 2P4RA 4BI4A 2DD5A 1P92A 3LWIA 4M7AD 4BE2A 1YIJT 1JJ2A 4JRKA 2DXUA 1OYXA 4IIOA 2KR3A 2HQXA 3S3MA 4AFUC 3LH0A 1VQ6A 2XICA 1UE9A 1YJNA 3LW5E 3JB9H 4C0DC 3CPWS 1M5Q1 3BDLA 4IUVA 2EJGA 2DTIA 2XG8D 4M75E 2DRKA 4HVVA 4C8QE 2QDLA 1V76A 2E5QA 3PTAA 4PJOB 3PMIA 1AOJA 6AT1B 4M77F 3QZ9B 1UJYA 2CKKA 5KYUB 2A0FB 1VQ4Q 3CC2T 4XTYA 2YUNA 4JRQA 2KNBB 2EQJA 5GJVB 3MEUA 5GAN6 5HK3A 2XDDA 2VC8A 2E64A 2GNCA 2A3LA 2FO0A 3VS2A 3L2VA 1ZSZB 2ESWA 3FB9A 2X35A 4BDYA 4B6MA 1F1BB 4O6JA 1VQMQ 2DE0X 4C8QG 5A0DA 1N9SA 3UA6A 2MWPA 2WSFE 2PUKB 2DL4A 1C6VX 1LJOA 3CC7T 2GTJA 2VASA 3I35A 1VQ8Q 3RERA 1Y07A 4J9GA 1CKAA 4QQ6A 3JCMP 3OYHA 3PNWC 2GF7A 3ZEHA 1M1KC 4J83A 3PIPA 2R5AA 4E7JA 1I1JA 5HK0A 1UGRB 1JO8A 1QP3A 5LJ5d 1Q82R 5LJ3d 2JVVA 1VQ6T 3P8HA 4XTUA 1TSFA 1YJNT 1H92A 4J6YA 1W1FA 3G4SQ 1T3SA 2Y4YA 4QW2A 3EG9B 1YCYA 5D6WA 1NLPC 7AT1B 1WNLA 3NPFA 3SWNB 2CZ0B 1AVZC 4IIMA 2KXDA 4FYWB 2DYIA 3I55A 3OYEA 2ZZDA 4LUDA 1BI3A 2QGFB 1WZOA 2M9UA 4XU0A 5IT9E 1N6AA 1M90U 1PC0A 1BI0A 2K5LA 1VQ7A 2JTMA 1BI1A 2YSQA 5GAMe 4PFZA 4M78F 4E47A 2KRNA 1YIJQ 5IHNA 3H8ZA 3JCMf 1NM7A 4R55A 1IGUA 4FIBA 3LLRA 2DKGA 4D6WA 4E7IA 4XTWA 1JXMA 4KRTA 2EYZA 4ANJA 1NJIR 3CCLA 1AWWA 3DLLA 1U3OA 5GAOn 3MHXA 4XTVA 3EG2A 2A37A 2LX7A 4AT1B 2EGAA 4QKUA 3X26B 1QVFS 1X2QA 4M77D 3CCVA 3JB9F 3VV0A 2IVWA 1Q81R 4C5HA 1G3WA 4J7FA 4K11A 4HA8A 2CP6A 3CC2Q 3A8OB 3HL8A 3EHRA 4RTYA 4VUBA 4ATOA 1OPKA 1Q82C 3OYNA 2HAXA 1M30A 3EFRA 1YWPA 1B3QA 4QVCA 2J06A 1N8RC 2D8JA 2H8HA 4QT7A 4ESRA 4KGXB 3FRNA 1K9MR 2VUBA 2L3RA 3ZBDA 2EPDA 4D8DA 3HRTA 3CBPA 2FRWA 4M77B 5I11A 2DVJA 3JAME 3CC7Q 3I55T 3M0RA 3L2RA 1TU0B 4N0AA 4PJMA 5A2QE 2MWOA 2RI2A 1VQ7T 3CCSA 5D6YA 5DM7R 5KCHA 1IGQA 4E7HA 2FVUA 1YNZA 2RQRA 2PVGB 1QQJA 1QCNA 2ZPBB 2KE9A 2KVQG 4M75F 1VQ6Q 1KC8R 1NJIC 4C8QF 1YJNQ 3MP1A 4OMNA 3EG0A 1WHHA 2CZ7B 4IKFA 4MZMA 3EFOB 2K3BA 3CCLT 3J81E 5GAOq 5EG2A 2CT4A 1ZBJA 1RL2A 2D0NA 5FRMA 2HSEB 3LGFA 2RHUA 5GANe 1Q81C 1RAGB 2LJ0A 4R0KA 3SEMA 2RI5A 5GAN5 3CCVT 1K4US 1Q95G 3MKDA 3M56A 2K9GA 2XMFA 1QW1A 2DETA 2K2VA 4V2SA 3CCQT 3QJYA 3JCMg 4M78D 5KE3A 3QWXX 2FHDA 3J80E 2DBMA 2MCNA 2WSCE 1WXUA 4BI8B 4JS4A 2KQWA 2K3XA 4HT8A 2E5KA 1WA7A 3ULRB 3FIFA 5GJWB 5KH6A 4F7UA 2EJFA 1K9MC 2JS2A 2RK1A 4PFPA 4B9WA 1AWJA 3L2WA 1PKSA 1D3BB 1RLQC 3Q1JA 4Z8AA 1TOVA 3FDRA 3CCRA 1BKBA 3JB9D 4N0AC 1SSHA 1YJ9A 2BE9B 4RUGA 2NUTB 2ZGWA 3CCJA 3CXCP 3OMCA 1NLOC 4M78B 3KXTA 4OVAA 3CCST 1TUGB 5KCOA 3QXEB 4F14A 3V7RA 1U5SA 3CMAT 1KC8C 2AT1B 5CQYA 2GTOA 2D0QB 2DILA 3OYDA 1KQSP 3VS1A 4ZGEB 4BI3A 4ME7A 4L59A 2GQVA 1CSKA 4A4HA 3CPFA 3MEVA 3I55Q 2FB7A 2RQTA 2DL5A 4NL3A 1Y57A 1OOTA 3R6NA 1ABOA 3C4SA 1FMKA 2RJCA 3RR6A 3UWNA 2LQNA 1VQ7Q 2O31A 1UFFA 3VS3A 3VU3C 1YN8A 5EC7A 4HT9A 3M53A 1WPYA 1XTDA 3JCMJ 2VB6A 1HJDA 1OU9A 2NUTA 5IXBA 5IXFA 2DO3A 4M75D 2CDTA 2HKQB 2EQUA 2KT1A 4C8QD 4ZNXA 4J6XA 5KYNA 1Q7YR 2L3PA 3CCLQ 2OX7A 1IHVA 2NLUA 4JPBW 4RG2A 1GL5A 3M54A 3QJ6A 4X9CA 1W70A 1WYXA 3M0QA 1VQ4A 2EGEA 1NE8A 1JRIA 4LDUA 5FU6B 3CCRT 3CCVQ 2CGHA 2YUQA 4DA4A 1M2VB 1YJ9T 2LT4A 1K8AR 3CCQQ 3P8BB 3JCMd 2C0IA 3QG1A 4PLIA 1YITA 3CPWP 2KK4A 3O8VA 4F7UE 2O2OA 5LJ5f 2OJ2A 4HCKA 2RJEA 5LJ3f 4M75B 4C8QB 2AZSA 2HZYA 2JMAA 4OB0B 3A8GB 3M0PA 4WCIA 2K4YA 2KRSA 3V7CA 1AEYA 2X4YA 4OF1A 3SDZA 2ED0A 4JJDA 4N4HA 1I81A 3CXCA 4LN2A 1SSFA 3H6ZA 1E6GA 3NTHA 2DIGA 3CCSQ 3EG1A 2PZ1A 1IRXA 2CP5A 2ENMA 2HBWA 3CMAQ 2QQRA 4FSSA 5GMKm 4XTZA 2ROTA 4KBMB 3X28B 1K0SA 4RTTA 2O4XB 4RTVA 4MDWA 3WVEB 1KQSA 2RPNA 3V7SA 4NL2A 3CCEA 2RQWA 1YI2A 4RCCA 2MI6A 1RI9A 1KSWA 3C12A 3QO3A 3RKYA 5CQXA 2QYZA 4IUQA 2QEXA 1C1AA 1AT1B 2LP5A 2J6FA 1G3TA 3EG3A 1K8AC 1O9SA 2C06A 5M9OA 5FU7B 4J8OA 3G1JA 1Y96A 2X4WA 1VYUA 2COWA 2LCLA 4RCBA 5LJ5h 2K5IA 4J9DA 2DM1A 4C0ZA 4KUDK 5LJ3h 5GAMj 5HY6A 3CEYA 2ZPEB 1Q86U 1N5ZA 1KFZA 5KYWB 3OS2A 2DZ9A 2CP0A 2HMAA 4OP0A 3BFMA 2X9HA 1QVPA 3H0FA 1MMAA 1RAFB 5I2MA 1AWXA 4PL6A 2HKNA 4ZN1A 3CCRQ 2EAYA 1QMCA 2LNVA 2CUDA 1YJ9Q 1PCXA 2PUOB 2P0QA 4M78G 2GFUA 2X3XD 2EYXA 3EH1A 5GAOp 5LJ3g 5CVIA 1M90R 1M4ZA 3EGXA 4XTXA 4D8KA 2VXEA 1KD1U 1M3AA 1KK7A 2W10A 1B34A 1I07A 1J3TA 2HEQA 2MK5A 1NPRA 1D0XA 3CCET 1YI2T 1X27A 1G8XA 1PG5B 5GMKh 2PVDB 5CKDA 2H3JA 3JB9G 4X34A 2ABLA 3CQTA 2QEXT 1VQ9A 1PHTA 3LX7A 2EIFA 2CS7A 2KI7A 1WXTA 2RA2A 3M5AA 4IURA 3GLXA 2HQEA 5GAOl 3VJPA 2NWMA 5D7UA 2RD1A 1IZ6A 5J3BA 4AFSC 1ZUYA 4C0GA 2H3EB 3EGUA 2SRCA 1QLYA 4C5IA 1EX4A 2DXTA 1R8OB 1GFCA 2YXYA 1QP2A 4DBQA 3PGGA 2AKKA 2KRMA 5GANj 2LT1A 4F7UF 3VS5A 4BACA 2PTKA 3VKIA 1WJQA 2DF6A 1S1NA 1WDXA 3NTKA 4FYXB 1YITQ 4FL6A 1M90C 3MJXA 4J7IA 3CCMA 2QQBA 1SF9A 4IUTA 1VQOA 2CZ1B 1S72A 4JZ4A 5KYYA 1W6XA 4LDXA 4M75G 4PJJA 2M0YA 2BE7D 4LD6A 1D1AA 2J6OA 3TEEA 2L3QA 3U23A 1VUBA 4LDYA 1D0ZA 2DEQA 3OYIA 2YT6A 4C92A 1I5OB 1C0MA 4Z89A 3MO8A 3FC3A 3L42A 1WX6A 3KBGA 5IHKA 2HL3A 1VQ9T 4EDUA 3L1AA 2K2MA 3M58A 1VQPA 3G6EA 2NYSA 2YRDA 1OULA 4PJLA 4Q5WA 1WI7A 1QVFA 5IH2A 1QWFA 3DLMA 2YWWA 4LD9K 1NBEB 2OAWA 4JRPA 2JW4A 2KDSA 2JM9A 4Y91A 5FW9A 1KJWA 2D8HA 1X75C 4CC4B 3CCEQ 1PRMC 1YI2Q 2VWFA 3H0HA 3OY9A 4EMHA 2MMPA 2QEXQ 2LTOA 1H641 4IUUA 4J9CA 1IHWA 1UG1A 2DIQA 1U8RA 2LZ6B 2E6NA 4XU2A 2PU9B 1OQKA 1D1CA 3R6OA 1GFDA 3GP8A 1XOVA 5I21A 4FT4A 3CCMT 1NEBA 3NGPA 3TSZA 1VQOT 1S72T 1HXDA 4BDZA 5A0GA 2ZPIB 5CAIA 2FZCB 4C92C 2BKDN 1GBQA 4LUEA 3VYGA 4Z88A 3TREA 2JOYA 3OYLA 1I4K1 4MMLA 1LPLA 3CCQA 4CRIA 3JRZA 2RF0A 5C6SA 1GCQC 3UATA 3JCMW 5FWBA 1M9SA 4DQ2A 1KQ2A 3JV3A 2KYBA 3DKMA 2DA9A 1M1KU 1VQPT 4PJOC 3A8HB 2P0KA 3G6ET 1AZGB 4ELZC 1M27C 3CCUA 4JJBA 2A36A 3O5ZA 1QCFA 4J5YA 4F17A 2FPFA 2O9VA 4C92E 4EIKA 3M0UA 2JN0A 4NS5A 2ZPFB 4FM4B 5IHIA 1Y71A 4M7AC 1O75A 3JB9I 1HK9A 1I8FA 1T0HA 5GAN4 2HDAA 3C95A 2EYQA 4FU6A 2KAFA 4RTUA 4F7UB 4LDWA 3V8KA 1VQ9Q 3JCMh 2C0TA 4EMKC 2M0OA 1X6BA 1G2BA 2E70A 4BE0A 3CMAA 4JJCA 2DTOA 1FMWA 3OW2S 4AG2C 3N5BB 2I2LA 3WVDB 4Z02A 4HCCA 2QTXA 1SKUB 1UECA 5KE2A 4ZGDB 1HYOA 2ZPHB 2HQHA 4RTXA 1AHJB 1X69A 4C92G 1BK2A 1K0XA 2YRCA 5GAN7 3H41A 3QDFA 5CKFA 5CIUA 4M7AE 2ZCFB 2BUDA 1WQWA 2ZPGB 1YWOA 4QVDA 2BZXA 1VA7A 1VQLA 1OX8A 1TWBA 3E9FA 1PWTA 1ARKA 2EKHA 1EIFA 8AT1B 1BI2A 3C94A 2K5FA 1AD5A 1WGSA 4C5GA 2MYSA 2QXFA 2HL5C 3FEOA 2K57A 5KYXA 1YCSB 2QI2A 3LWHA 2JXBA 2MOXA 4JUVA 2HNIA 1Q82U 2JMCA 2CH4W 4DBFA 4M7DA 1EFNA 3CCMQ 2CREA 2QQ9A 2MAMA 1VQOQ 2QAZA 1S72Q 2EFIA 4HKEA 3IQLA 3V8JA 3CCUT 1N8RU 1Z9QA 3RMQA 2EGCA 3I5RA 2ROLA 2E41A 1SG5A 3CBOA 4E7LA 1PSEA 2F1LA 2R58A 2JM8A 3HTRA 2CSQA 2DK3A 3M59A 2JTEA 2X3WD 2DTHA 2CH4A 5GANg 4EMGA 1BBZA 1E7OA 2D6FA 1K76A 2EKOA 3HPWA 1VQPQ 5HKCA 2AK5A 2XI9A 3I9QA 4OGEA 3G6EQ 2EW3A 1M2OA 3EAEA 4II1A 5GAMd 1RADB 3KUFA 4MDXA 2JJ9A 1H3HA 3OYGA 1NJIU 4OMFB 2Y4XA 4CC2A 5FLXE 1VIFA 3OQ5A 4BY6C 2QASA 1H3ZA 1PRLC 1NPPA 4Y28E 1BYMA 1Q86R 2WACA 2VYTA 3QYHB 4L5GA 3ER0A 1VQLT 2J05A 4E2FB 1SPKA 5CR2A 3I56T 1IB8A 2DMOA 3V8LA 1MNEA 1ZLMA 1MMNA 3CC4A 1ZHIA 3QPHA 1WXBA 2JT4A 1TG0A 4M7DC 2NUPB 2KBTA 1ZX6A 1I0CA 3DB3A 4PFOA 5L23A 3AHUA 1FYNA 1U1TA 3M4GA 3UF4A 2KY9A 4KULA 4M77C 2V1QA 1TUDA 2DRMA 3THKA 3L2UA 1K9MU 2QGGA 3PFSA 2BIVA 1R0CB 1W2BS 2F2VA 5AYFA 3CD6T 5CKEA 3DB4A 3PVLA 1NEGA 1YJWA 1VOMA 1A0NB 2RNAA 3A98A 1OX9A 3OYBA 1YHQA 2ED1A 2LX9A 1K9AA 4A53A 4DOVA 4ELYC 1BIBA 1VQNT 4JLIA 4M7DE 1JBMA 4QQGA 2OTJA 1K1ZA 2F5TX 2CZ6B 4M77E 1QKWA 1EZZB 1YFNA 3QYGB 3T9NA 1UB4A 4C92F 3URGA 2BTTA 3CCUQ 1UTIA 2NUPA 2K6DA 2OTLT 1N9RA 1WHLA 1Q86C 1QKXA 1Y96B 2YHTA 3JCMV 5J26A 2O01E 3VRYA 3QUIA 3JCMQ 1M8VA 5GMKi 4FW1A 2VKNA 1M8MA 5GANd 4F7UG 2CSIA 2RJFA 4C0DB 1UUEA 2QTVA 2L0AA 2DERA 1VQ5A 2O9SA 3CC4T 3META 4E7ZA 9ATCB 2HSPA 4WTOB 1YBYA 1Q7YC 1FXXA 2F69A 2FRYA 4M7AF 3JCMX 1XNIA 2VGNA 3VUBA 2CYZB 1K73U 1YJWT 3UA7A 3EGXB 1VQLQ 4OMMA 4PK4A 3I56Q 1YHQT 3PT9A 4TVRA 2E3HA 1WFWA 4X9DA 2XKOC 1M3BA 3H9NA 1NYGA 4GBQA 1B34B 2NUZA 4PKCC 4QVZA 2OTJT 1VYVA 2YUPA 5LJ5e 1SEMA 1WJRA 1ZBXA 4JDSA 1BU1A 5LJ3e 2YLCA 2LCSA 1OZ2A 3TVTA 2RQVA 4HXJA 1X6GA 1M1GA 4MZTA 3HHTB 1UEBA 2CP3A 3OYKA 2LNHB 4FW2A 4JLGA 4A4GA 3QDRB 3CD6Q 5GAN8 5I22A 2QG9B 4ZTFA 2Y90A 3OB9A 1B7TA 4AFQC 2A7YA 2KMTA 3CPWA 3RKXA 2KT8A 1GBRA 1VQNQ 4ZTJA 4E7KA 1BCMA 3E19A 3OBWA 1VQ5T 2IIMA 3TQ7P 1KQ1A 3EFSA 1HD3A 4C92D 5FU6C 4GLMA 1D0YA 2K3YA 1NYFA 1JQQA 2OTLQ 1RAIB 3SHWA 2E65A 2KGTA 2DX1A 5GMKe 4Y92A 1T3LA 3OYYA 2K79A 3JB9J 1U1SA 5KYYB 1G3SA 4C8QC 2DXBA 2E4HA 4BD3A 1K8AU 5GAN3 1U06A 2FZGB 4BE1A 3REAB 1ZQ1A 3BW1A 3CC4Q 1PD1A 1XJWB 3EH2A 5CKBA 2DXCA 4MMKA 2M1HA 4C92B 1PSFA 1X01A 2LQKA 3HFOA 1UHFA 1QVGS 4DEXA 3ZL7C 5CK9A 2AZVA 1M1KR 3G71A 1RAHB 3FJPA 2O88A 3GOXA 1HSQA 4LNPA 4AG1C 3CBMA 1YJWQ 3OW2P 4M7DF 3H0IA 1YHQQ 2YLBA 2EVRA 3RESA 3GIBA 4O5VA 3EGDA 1GCPA 4KT0E 3VYHB 2ATCB 1ZA1B 2OTJQ 3X24B 5GAMf 2ECZA 3RKWA 2M51A 4M7AB 1Y0MA 2EJ9A 4RTZA 1OV3A 1PNJA 5AT1B 5FU7C 4M4ZA 2DLPA 3GNGA 1BB9A 3E1SA 2HBPA 5J39A 4WF2A 1JJ2S 1V29B 2D9TA 4EMKB 2XDBA 2FPEA 3S3OA 2RJDA 3VRZA 4FYVB 5GAOr 1DJ7B 1SHFA 4J9BA 4A4FA 1GCQA 4KGVB 4YTLA 2PQWA 2EQIA 2D1XA 1WHMA 2LJ1A 1VQ5Q 4J6WA 4C0FA 3MP8A 4KGZB 2RHYA 2YRVA 4PJOA 2YDLA 4GY5A 5A0LA 4RG8A 2PNIA 2DBKA 4KH1B 1ABQA 1MGQA 5KYUA 2XDPA 2RHZA 3UT1A 3QWYA 3G71T 4JJNK 1PD0A 2V26A 4C5EA 2LC4A 5GMKl 4M7AA 3QBYA 2KXCA 1N8RR 5DLQE 1CKBA 3INZA 4J9IA 4LXCA 1MV0B 1ZSZA 2MPXC 3QZ5B 2G6FX 2I0NA 3HKSA 4EMKA 1TH7A 1E6HA 3SD4A 1KIKA 4J9EA 3OSSC 1OU8A 3CMEA 4A63B 2HD0A 4J9FA 5GAMh 2XU8A 4LE9A 4OGCA 3VUZA 2DPPB 1MHNA 4KH0B 2KROA 3I5SA 1GXIE 4BUGA 2B8AA 3NFCA 3TU4K 4A54A 2A28A 1T0JA 2QA4A 1MMGA 2X4JA 3M0SA 3OW2A 4FYYB 2FL7A 1IO6A 4OMLA 4M7DD 2DFUA 4A4KA 2DL3A 3NTIA 1IREB 1ZA2B 5GANf 2CP2A 1WHKA 4OB2B 5CCAA 2OAUA 3BDUA 2X51A 3EG9A 5GAMg 3MEAA 1W2BP 1D1BA 1UGPB 3SWNA 2COZA 4BY6B 4RMOA 4N4GA 5L8RE 2CUBA 1RAEB 2W0ZA 2P4TA 3M4YA 1OI1A 1TXQA 4E6RA 2LRQA 3C0CA 5KYXB 2X4XA 1D09B 3M9QA 2FPDA 2FZKB 2KYMA 5IN1A 4ORZA 2GQIA 1ZSZC 4M7DB 4OMQA 4B9XA 2EBPA 2KSSA 1R77A 2GCXA 2JTFA 3RBBB 2DD4A 2FYKA 4XAXB 3M0TA 3JCMe 1UJ0A 1KG1A 4PJOE 2XD0A 5GAN2 3VS6A 2VXFA 3ME9A 3OA6A 2VV5A 1RUWA 2L5QA 1SHGA 3CMET 2QQAA 3FLGA 3D7SB 1WJSA 3UPUA 1IXDA 1JU5C 3A8MB 1UGVA 3QKJA 2J6KA 2F2XA 3PVQA 3G71Q 1X2KA 4OMPA 2V8KA 2F2WA 2QA4T 4PLLA 3I56A 1R0BG 1MUZA 3OYMA 3HRUA 1OEBA 2FEIA 1M1FA 2DEUA 5DY9A 2PVOB 5GANh 2V8JA 4PJOG 2MIOA 1WHJA 4CI0C 4ZN3A 3PIOA 3SWNC 3ZFJA 2DL8A 3G7ZA 2M02A 3HP9A 4F16A 2L3SA 1FWZA 3BY7A 3LH5A 4IUPA 2RK2A 1KHCA 4M77A 3CD6A 4QQDA 2LCCA 5LJ5j 4M7AG 2EQMA 5LJ3j 1UGQB 2COYA 2K7AA 1LCKA 1WQ7A 1OZ3A 1UDLA 3X25B 1VQKA 1LNXA 1VQNA 2QQSA 3A5ZB 5IAYA 2A08A 3RDVA 4X1VA 3QIIA 1W2BA 2VGMA 1K73R 1G5VA 2M16A 2AKLA 1BIAA 3EFOA 1I5LA 1X43A 5LL6S 2BZYA 2LJ3A 3OYAA 3RIRA 4HCBA 1KHIA 2OTLA 2CT3A 3UDCA 3VS7A 2B86A 4E7SA 4XQ3A 3QHSA 2R5MA 3EHQA 1FMVA 4OMOA 4KUIA 1LOJA 4DOWA 1TUCA 2XK0A 1Q81U 3SB2A 1MMDA 4XU1A 2F5KA 2DJQA 2L89A 3ASKA 4J9HA 2RQUA 2RHIA 4F04B 5GMKj 3QSUA 4CC7A 3LGLA 2FG0A 2JUFA 3OYFA 2LQWA 4L6V5 4N4IA 1RACB 1OPLA 2RI3A 4MZPA 4CC3A 3JCMb 5GAOm 1WLPB 4UC4A 3P8DA 2HCKA 1NG2A 1GRIA 1D3BA 3M55A 2KEAA 2Z0WA 3CMEQ 1MNDA 2GBQA 2DZCA 3X20B 2DJZA 1ZSGA 1FX7A 4OB1B 2E12A 1KD1R 2V8IA 3J7AF 4PJNA 2YUOA 5CO7A 5D6XA 2DL7A 4M78A 2QA4Q 4OB3B 4HCZA 2SEMA 2DNUA 1G3YA 2E3IA 1VQKT 4DBRA 3NMZC 2L2PA 1K73C 1VYTA 4GLKA 5DLOA 1UHCA 5HCKA 5C0MA 1QVGP 2CP7A 1KC8U 2RMOA 3E9GA 1QCOA 1TTHB 2XIDA 4AFZC 3VS0A 3CCJT 3MPUB 3GBQA 2RM4A 5FROA 1SRLA 1ZUKA 2E1HA 4BB7A 1V1CA 3A1PA 4AMCA 1B07A 1VQMA 2J7IA 5I2SA 3MCAB 3HSBA 3RMSA 2JZ2A 1JB0E 2E10A 2R57A 1AZEA 2LMJA 3TCJA 4LDVA 1MV3A 4PJOF 4M7DG 3RNJA 1UGSB 2GGRA 2V1RA 1QWEA 2E6ZA 1ACMB 3M57A 1VQ8A 4M77G 2RN8A 2VVKA 4XK8E 3MEWA 3FJ5A 3TSWA 3F70A 4ZGJB 3REBB 4FT2A 3PMTA 2P84A 2RH2A 1JJ2P 3HFNA 4PNOA 4M78C 1KD1C 1M2VA 1G83A 1TS9A 3G4SA 8ATCB 1XQHA 1YP5A 1JXOA 2DAQA 3OYJA 2WSEE 2JS0A 1N27A 3E2UA 2RHXA 3OYCA 3JCMc 3PE0A 4M75A 4C8QA 4JRIA 1LVKA 2EQKA 4A4EA 1ZUUA 2OI3A 3RUXA 1VQ4T 3NHNA 3OMGA 3S3NA 1RI0A 2EYWA 2XHCA 1RLPC 2DVEA 2RB6A 1YIJA 4NOYA 4RKUE 1WHGA 1AWOA 2EYYA 2P0PA 4DEYA 3S6WA 1RABB 4M78E 1YITT 3CXCS 1PM3A 4EPCA 5FWCA 1Z9ZA 1Y7XA 2LVMA 1VQMT 2DYBA 2GFAA 3LYIA 2EWNA 1X6OA 2LQ8A 3OS0A 3VS4A 2QK0A 2ZAEA 3GF5A 4JZ3A 3KFVA 4XU3A 3JSCA 1SRMA 1VQKQ 3BE3A 1NZ9A 2MF2A 2RO0A 1QVGA 3CC2A 5CKHA 2O4XA 3OBYA 5ECAA 4DBHA 3GPLA 1JEGA 4R56A 1KQSS 1VQ8T 2IPOB 2G3RA 3WXMB 2IG0A 1H8KA 3A8LB 3CCJQ 1Q7YU 1PKTA 5FRNA 1RAAB 4P5NA 5LJ5g 3OS1A 2JNGA 3EGDB 3MP6A 4HVWA 3G4ST 1QVFP 3GNFB 3L2QA 4M75C 4HVUA 2BZ8A 2AHJB 2C0OA 4PJOD 2L8DA 4FSXA 4JS5A 2QDYB 3L2ZA 3CC7A 2AIRB 3OS5A 3OSVA 1VIEA 4FCYA 1W4SA 1BCOA 5KYWA 1M3CA 1WIEA 2LDMA
chains in the Genus database with same CATH topology
3SFMA 4OGCA 2K4YA 3HRSA 3VUZA 2DPPB 3V7CA 4BI4A 2X4YA 4OF1A 2DD5A 1MHNA 3SDZA 2E41A 4N4HA 3CBOA 1I81A 4E7LA 3CXCA 1P92A 1GXIE 3LWIA 4M7AD 4BE2A 1YIJT 1JJ2A 4BUGA 1PSEA 4JRKA 1SSFA 2B8AA 3H6ZA 3NFCA 3TU4K 4A54A 2DXUA 1OYXA 3NTHA 2R58A 2QA4A 3S3MA 2HQXA 3LH0A 1VQ6A 2X4JA 2XICA 2DIGA 3OW2A 2DK3A 3M59A 3LW5E 1YJNA 2DTHA 3JB9H 2FL7A 5GANg 4C0DC 3CPWS 1M5Q1 3BDLA 4IUVA 4M7DD 4EMGA 2EJGA 2DTIA 4A4KA 2D6FA 3NTIA 2QQRA 1IREB 2EKOA 2XG8D 4M75E 3HPWA 5GMKm 4XTZA 5HKCA 5GANf 4C8QE 2XI9A 4KBMB 4OGEA 2E5QA 3X28B 3PTAA 2O4XB 4PJOB 4MDWA 3WVEB 3EAEA 3PMIA 4II1A 5GAMd 1KQSA 4OB2B 3V7SA 4NL2A 3KUFA 4M77F 5CCAA 3QZ9B 2OAUA 3CCEA 3BDUA 1YI2A 4RCCA 5GAMg 3MEAA 3OYGA 1NJIU 2CKKA 4OMFB 2Y4XA 2MI6A 1UGPB 3SWNA 5FLXE 1VIFA 3C12A 3QO3A 4BY6B 3OQ5A 3CC2T 4XTYA 4RMOA 3RKYA 5CQXA 4BY6C 1H3ZA 4IUQA 2QEXA 1NPPA 4Y28E 4JRQA 4N4GA 1BYMA 5L8RE 2EQJA 5GAN6 3MEUA 5HK3A 2XDDA 2VC8A 1G3TA 1K8AC 2P4TA 3M4YA 2E64A 1OI1A 2WACA 2VYTA 1O9SA 2LRQA 3QYHB 2C06A 2A3LA 2X4XA 5M9OA 4L5GA 3ER0A 1VQLT 3M9QA 5FU7B 4J8OA 3L2VA 1Y96A 5CR2A 3FB9A 3I56T 5IN1A 2X35A 4BDYA 3V8LA 2X4WA 2LCLA 4RCBA 5LJ5h 2K5IA 1ZHIA 3CC4A 4O6JA 4M7DB 3QPHA 4C0ZA 4KUDK 5LJ3h 4B9XA 5GAMj 4M7DC 2KSSA 2GCXA 2JTFA 3DB3A 3CEYA 2ZPEB 5HY6A 4C8QG 1Q86U 2DD4A 2FYKA 4XAXB 5A0DA 3JCMe 1N9SA 3AHUA 1KG1A 3OS2A 2DZ9A 1U1TA 3M4GA 2MWPA 4PJOE 2KY9A 4KULA 2XD0A 2WSFE 2PUKB 4M77C 4OP0A 5GAN2 4PJOA 3BFMA 1LJOA 3CC7T 2VXFA 1QVPA 3ME9A 3L2UA 1K9MU 3OA6A 3PFSA 2VV5A 2L5QA 5I2MA 2BIVA 1W2BS 3CMET 3RERA 1Y07A 2QQAA 4PL6A 5AYFA 3FLGA 3CD6T 1WJSA 4QQ6A 3DB4A 5CKEA 4ZN1A 3JCMP 3OYHA 3UPUA 2EAYA 2LNVA 1YJWA 3PNWC 2GF7A 3ZEHA 3A8MB 1M1KC 4J83A 3PIPA 3QKJA 2PUOB 2R5AA 5HK0A 4E7JA 3OYBA 1UGRB 2P0QA 1QP3A 5LJ5d 1YHQA 2LX9A 2V8KA 5LJ3d 2JVVA 4M78G 2QA4T 4PLLA 3I56A 2GFUA 3P8HA 4A53A 4DOVA 4XTUA 3OYMA 4ELYC 5GAOp 3HRUA 1VQ6T 1BIBA 5LJ3g 1YJNT 1VQNT 4J6YA 4JLIA 5CVIA 4M7DE 1JBMA 1M4ZA 1M1FA 4QQGA 2OTJA 4XTXA 2Y4YA 5DY9A 2PVOB 2VXEA 4QW2A 1KD1U 1YCYA 5D6WA 5GANh 2F5TX 2V8JA 1WNLA 4PJOG 3SWNB 2CZ6B 4M77E 2CZ0B 3QYGB 3T9NA 4CI0C 4ZN3A 3PIOA 1UB4A 3SWNC 1B34A 3ZFJA 3I55A 3OYEA 3G7ZA 2ZZDA 3HP9A 4C92F 3URGA 1BI3A 1NPRA 3BY7A 1FWZA 3CCET 2M9UA 1YI2T 4IUPA 4XU0A 1N6AA 5IT9E 1M90U 1BI0A 2K5LA 2RK2A 1KHCA 5GMKh 2PVDB 1VQ7A 5CKDA 2JTMA 4M77A 2OTLT 3CD6A 1N9RA 1BI1A 2H3JA 4QQDA 2LCCA 3JB9G 5LJ5j 5GAMe 4X34A 1Q86C 4M7AG 1Y96B 2YHTA 2EQMA 3JCMV 2QEXT 4M78F 4E47A 5LJ3j 5J26A 1VQ9A 1UGQB 3H8ZA 2O01E 2EIFA 2CS7A 3LX7A 3JCMf 2RA2A 3M5AA 3QUIA 3JCMQ 4R55A 1M8VA 4IURA 1WQ7A 3GLXA 1OZ3A 2HQEA 4FIBA 3LLRA 5GMKi 2DKGA 4D6WA 3X25B 5GANd 4F7UG 2RJFA 4XTWA 1LNXA 4E7IA 1VQKA 4C0DB 1VQNA 2QQSA 5GAOl 3CCLA 3A5ZB 3VJPA 1VQ5A 3CC4T 5IAYA 3DLLA 5GAOn 3META 3MHXA 2RD1A 1IZ6A 4XTVA 5J3BA 3QIIA 1W2BA 1YBYA 2VGMA 3X26B 1QVFS 1G5VA 1Q7YC 4M77D 2M16A 4C0GA 1FXXA 3CCVA 1BIAA 2F69A 1I5LA 3VV0A 3JB9F 4C5IA 2IVWA 5LL6S 4M7AF 4C5HA 1G3WA 2DXTA 4J7FA 3JCMX 1XNIA 4HA8A 1R8OB 3OYAA 3A8OB 3HL8A 3RIRA 1QP2A 4HCBA 1KHIA 2OTLA 2VGNA 4VUBA 4ATOA 3UDCA 3VUBA 3PGGA 4XQ3A 3QHSA 2CYZB 1K73U 2R5MA 5GANj 2LT1A 4F7UF 1YJWT 4KUIA 1Q82C 1LOJA 3OYNA 2HAXA 4DOWA 4BACA 2XK0A 3VKIA 1Q81U 1WJQA 3EFRA 3NTKA 3SB2A 4QVCA 1YHQT 3PT9A 4FL6A 4TVRA 4X9DA 1M90C 1N8RC 2XKOC 2F5KA 4J7IA 4XU1A 2L89A 3CCMA 3ASKA 2QQBA 4IUTA 1B34B 2CZ1B 2RHIA 3FRNA 1VQOA 1S72A 2VUBA 2L3RA 4PKCC 4LDXA 4QVZA 5GMKj 3QSUA 2OTJT 4M75G 5LJ5e 3ZBDA 3LGLA 1WJRA 1ZBXA 2JUFA 4JDSA 5LJ3e 3OYFA 2YLCA 4L6V5 4N4IA 4MZPA 2RI3A 3HRTA 3CBPA 3JCMb 1OZ2A 4LD6A 5GAOm 4M77B 3TEEA 4UC4A 3P8DA 3JAME 1VUBA 1D3BA 1M1GA 3M55A 4MZTA 3HHTB 1UEBA 4LDYA 3OYKA 4MDXA 3I55T 2DEQA 3L2RA 4JLGA 4A4GA 3OYIA 3QDRB 4C92A 2DZCA 4N0AA 5A2QE 2MWOA 2RI2A 3MO8A 5GAN8 1VQ7T 3CCSA 5D6YA 4ZTFA 5DM7R 2Y90A 3OB9A 5KCHA 3FC3A 3L42A 3X20B 2DJZA 4E7HA 2FVUA 1FX7A 3KBGA 4OB1B 2E12A 2PVGB 1VQ9T 2V8IA 2A7YA 2KMTA 3J7AF 4EDUA 5CO7A 3CPWA 3L1AA 3RKXA 5D6XA 2ZPBB 3M58A 4M78A 1VQPA 4OB3B 2KVQG 4HCZA 3G6EA 4M75F 4Q5WA 1NJIC 4C8QF 3MP1A 4ZTJA 4E7KA 1QVFA 1G3YA 3DLMA 2CZ7B 4LD9K 1VQKT 4IKFA 3E19A 4MZMA 3OBWA 3CCLT 3J81E 5GAOq 5EG2A 1VQ5T 1K73C 4JRPA 4GLKA 1KQ1A 1RL2A 5DLOA 5FRMA 3EFSA 3LGFA 2RHUA 2KDSA 4Y91A 5GANe 5C0MA 4C92D 1Q81C 5FU6C 1KC8U 1X75C 3E9GA 2RI5A 5GAN5 3CCVT 2XIDA 2K3YA 3M56A 3OY9A 3CCJT 1QW1A 2RM4A 2K2VA 4V2SA 5FROA 2E65A 4EMHA 2MMPA 3QJYA 3JCMg 3CCQT 4M78D 2E1HA 2LTOA 4BB7A 5GMKe 5KE3A 1H641 4IUUA 3OYYA 2FHDA 3J80E 1VQMA 5I2SA 3MCAB 3HSBA 2WSCE 3JB9J 1U1SA 4BI8B 4JS4A 2KQWA 2DIQA 2JZ2A 2K3XA 3RMSA 2E6NA 1JB0E 1U8RA 2E10A 4HT8A 2R57A 4XU2A 2PU9B 1G3SA 3FIFA 4C8QC 5KH6A 2DXBA 4BD3A 1K8AU 5GAN3 4F7UA 2EJFA 1K9MC 3R6OA 2RK1A 3TCJA 4LDVA 3GP8A 1XOVA 5I21A 4B9WA 4PJOF 4FT4A 3L2WA 4M7DG 4BE1A 3CCMT 1ZQ1A 3BW1A 1D3BB 1UGSB 1VQOT 1S72T 3Q1JA 1HXDA 5CKBA 2E6ZA 4BDZA 5A0GA 2ZPIB 5CAIA 3M57A 1VQ8A 2DXCA 4M77G 4MMKA 2M1HA 4C92B 4XK8E 3MEWA 1PSFA 1X01A 3FDRA 3CCRA 1BKBA 3JB9D 4C92C 4N0AC 2LQKA 3F70A 4ZGJB 3HFOA 2BKDN 1YJ9A 3VYGA 1QVGS 5CK9A 3OYLA 2ZGWA 2JOYA 3TREA 3CCJA 4FT2A 3G71A 1I4K1 3PMTA 4MMLA 2RH2A 3OMCA 3FJPA 3CCQA 4M78B 3HFNA 4PNOA 4CRIA 3JRZA 3GOXA 4M78C 4OVAA 3KXTA 3CCST 5C6SA 1KD1C 3CBMA 5KCOA 3G4SA 3QXEB 3JCMW 3V7RA 1XQHA 4M7DF 1M9SA 2DAQA 4DQ2A 3CMAT 1KQ2A 1KC8C 3OYJA 2WSEE 3DKMA 5CQYA 1N27A 2YLBA 1M1KU 1VQPT 3RESA 4PJOC 3GIBA 3A8HB 2D0QB 4O5VA 2P0KA 4KT0E 3G6ET 3VYHB 4ELZC 2RHXA 3OYCA 3JCMc 3CCUA 4M75A 3X24B 4C8QA 3OYDA 4JRIA 2EQKA 4J5YA 4A4EA 5GAMf 3RUXA 1VQ4T 3OMGA 4ZGEB 4C92E 1RI0A 4BI3A 3S3NA 4ME7A 2XHCA 3RKWA 4L59A 2GQVA 4M7AB 2DVEA 4A4HA 2EJ9A 2RB6A 3CPFA 2JN0A 2ZPFB 3MEVA 4FM4B 2FB7A 4NOYA 1Y71A 4NS5A 4NL3A 1YIJA 2XDBA 4RKUE 4M7AC 1O75A 3C4SA 3JB9I 2RJCA 3UWNA 1HK9A 1I8FA 5GAN4 2P0PA 3C95A 2EYQA 4FU6A 3S6WA 5FU7C 4M78E 2KAFA 3GNGA 1YITT 3VU3C 3E1SA 2HBPA 5J39A 3CXCS 4HT9A 4F7UB 4WF2A 4EPCA 4LDWA 3M53A 1V29B 1WPYA 1XTDA 2D9TA 3JCMh 3V8KA 4EMKB 3JCMJ 1JJ2S 1Y7XA 2LVMA 1VQMT 4EMKC 2M0OA 2GFAA 2E70A 3LYIA 2EWNA 1X6OA 2DO3A 3CMAA 2RJDA 4M75D 2LQ8A 3OS0A 2DTOA 4BE0A 3S3OA 5GAOr 3OW2S 2EQUA 3GF5A 4C8QD 1DJ7B 3N5BB 4XU3A 4A4FA 4J6XA 2I2LA 3JSCA 4Z02A 3WVDB 4HCCA 2QTXA 1NZ9A 4YTLA 5KE2A 2PQWA 4ZGDB 4J6WA 2MF2A 2RO0A 2ZPHB 2NLUA 1QVGA 3CC2A 5CKHA 4C0FA 3MP8A 4RG2A 2RHYA 2YRVA 1AHJB 2O4XA 3M54A 3OBYA 3QJ6A 4X9CA 4C92G 4R56A 3GPLA 1VQ4A 5GAN7 1KQSS 1VQ8T 1NE8A 4GY5A 5CKFA 5CIUA 1JRIA 4LDUA 4RG8A 5FU6B 2G3RA 5A0LA 4M7AE 2ZCFB 3CCRT 2BUDA 3WXMB 2CGHA 2IG0A 1WQWA 2ZPGB 1MGQA 4DA4A 2XDPA 3A8LB 4QVDA 1YJ9T 1Q7YU 2LT4A 2RHZA 1VQLA 3E9FA 3UT1A 5FRNA 1EIFA 3P8BB 3JCMd 4P5NA 1BI2A 3C94A 5LJ5g 3OS1A 3QG1A 4PLIA 2K5FA 3G71T 4C5EA 2KK4A 4JJNK 1YITA 3O8VA 2JNGA 2LC4A 5GMKl 1WGSA 3QBYA 4C5GA 4M7AA 4F7UE 5DLQE 2QXFA 3MP6A 3FEOA 2K57A 5LJ5f 3INZA 2RJEA 3G4ST 5LJ3f 4M75B 3GNFB 2QI2A 3L2QA 3LWHA 4C8QB 4M75C 4JUVA 2HNIA 3QZ5B 2AHJB 1Q82U 4PJOD 2L8DA 4FSXA 3HKSA 4JS5A 4OB0B 4M7DA 2QDYB 3L2ZA 3CC7A 3OS5A 2QQ9A 2MAMA 3OSVA 1VIEA 4EMKA 3A8GB 1TH7A 1W4SA 2EFIA 3SD4A 4HKEA 3OSSC 3V8JA 3CCUT 1N8RU 3CMEA 2HD0A 3RMQA 5GAMh 2XU8A 2LDMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A53 A;  4M7D F;  4XTU A;  4DQ2 A;  5GAO p;  1KQ2 A;  2DEQ A;  1BIB A;  3V7C A;  5LJ3 g;  4J6Y A;  4JLI A;  4M7D E;  1JBM A;  2YLB A;  2E41 A;  4XTX A;  3RES A;  1I81 A;  3GIB A;  4C92 A;  2DZC A;  4N0A A;  5DY9 A;  2VXE A;  4PJO C;  1YCY A;  5GAN h;  5GAN 8;  4M7A D;  1WNL A;  4JRK A;  4PJO G;  3JCM c;  2Y90 A;  3SWN B;  4M75 A;  4M77 E;  2DXU A;  4A54 A;  2DJZ A;  3SWN C;  1B34 A;  4C8Q A;  4JRI A;  1M8V A;  4C92 F;  4J5Y A;  5GAM f;  3L1A A;  2DTH A;  3RKX A;  3RUX A;  3JB9 H;  4M78 A;  4C92 E;  5GAN g;  1M5Q 1;  3BY7 A;  3RKW A;  4XU0 A;  4M7A B;  4M75 F;  2DVE A;  4EMG A;  4M7D D;  2EJ9 A;  2RB6 A;  5GMK h;  2JN0 A;  2EJG A;  2DTI A;  2FB7 A;  4NOY A;  4M77 A;  4C8Q F;  4NL3 A;  4M7A C;  4M75 E;  1N9R A;  5GMK m;  3JB9 I;  4XTZ A;  5GAN f;  5LJ5 j;  5GAM e;  3JB9 G;  4C8Q E;  4M7A G;  1Y96 B;  2YHT A;  1HK9 A;  3JCM V;  1I8F A;  5GAN 4;  4PJO B;  4M78 F;  5LJ3 j;  3JCM f;  5GAO q;  5GAM d;  4M78 E;  3V7S A;  4NL2 A;  1KQ1 A;  3VU3 C;  4M77 F;  2RA2 A;  3EFS A;  3BDU A;  3QUI A;  4RCC A;  4WF2 A;  4F7U B;  3JCM Q;  4Y91 A;  5GAN e;  5GAM g;  3V8K A;  4C92 D;  1WPY A;  1WQ7 A;  4EMK B;  3JCM h;  5GMK i;  3JCM J;  3SWN A;  4HT9 A;  2DKG A;  3QO3 A;  4EMK C;  4XTY A;  3RKY A;  5GAN d;  2EWN A;  4F7U G;  4XTW A;  1LNX A;  4M75 D;  5GAN 5;  2DTO A;  5GAO r;  5GAO l;  4C8Q D;  2RM4 A;  4V2S A;  4XU3 A;  5GAO n;  4J6X A;  5GAN 6;  2I2L A;  2RD1 A;  2E65 A;  2VC8 A;  4EMH A;  2QTX A;  4XTV A;  3JCM g;  4M78 D;  2E64 A;  2E1H A;  5GMK e;  1H64 1;  4J6W A;  4M77 D;  3HSB A;  1Y96 A;  3JB9 J;  1U1S A;  3FB9 A;  4X9C A;  1BIA A;  4C92 G;  1I5L A;  3JB9 F;  4PJO A;  3V8L A;  4HT8 A;  5GAN 7;  2E10 A;  4M7A F;  4RCB A;  4XU2 A;  2DXT A;  5LJ5 h;  3JCM X;  4M7D B;  4C8Q C;  3FIF A;  4HA8 A;  1JRI A;  5LJ3 h;  5GAN 3;  3RIR A;  4F7U A;  5GAM j;  2EJF A;  4M7D C;  4M7A E;  4C8Q G;  2CGH A;  1WQW A;  5I21 A;  1MGQ A;  2FYK A;  4PJO F;  3JCM e;  4QVD A;  4M7D G;  1N9S A;  3BW1 A;  3PGG A;  3AHU A;  1D3B B;  2DZ9 A;  1U1T A;  4XQ3 A;  3M4G A;  4PJO E;  3QHS A;  1HXD A;  4M77 C;  3JCM d;  5LJ5 g;  4OP0 A;  5GAN 2;  5GAN j;  4F7U F;  5CAI A;  3BFM A;  1LOJ A;  5GMK l;  1LJO A;  4M77 G;  4MMK A;  4M7A A;  2VXF A;  4C92 B;  4F7U E;  1X01 A;  3EFR A;  2K57 A;  5LJ5 f;  3INZ A;  4N0A C;  3SB2 A;  4C92 C;  4QVC A;  3JB9 D;  3HFO A;  4X9D A;  5LJ3 f;  3RER A;  4M75 B;  4XU1 A;  1B34 B;  4M75 C;  4JUV A;  4C8Q B;  3JCM P;  2ZGW A;  2EAY A;  1I4K 1;  2HNI A;  4PJO D;  5GMK j;  4MML A;  3QSU A;  4M75 G;  4M7D A;  5LJ5 e;  3FJP A;  3L2Z A;  4M78 B;  3HFN A;  4EMK A;  4PNO A;  5LJ3 e;  1TH7 A;  2YLC A;  4M78 C;  5LJ5 d;  3JCM b;  5GAO m;  3V8J A;  4M77 B;  5LJ3 d;  4M78 G;  5GAM h;  1D3B A;  3JCM W;  3V7R A; 
#chains in the Genus database with same CATH topology
 3SFM A;  3AT1 B;  3HRS A;  4RTW A;  2P4R A;  4BI4 A;  2DD5 A;  1P92 A;  3LWI A;  4M7A D;  4BE2 A;  1YIJ T;  1JJ2 A;  4JRK A;  2DXU A;  1OYX A;  4IIO A;  2KR3 A;  2HQX A;  3S3M A;  4AFU C;  3LH0 A;  1VQ6 A;  2XIC A;  1UE9 A;  1YJN A;  3LW5 E;  3JB9 H;  4C0D C;  3CPW S;  1M5Q 1;  3BDL A;  4IUV A;  2EJG A;  2DTI A;  2XG8 D;  4M75 E;  2DRK A;  4HVV A;  4C8Q E;  2QDL A;  1V76 A;  2E5Q A;  3PTA A;  4PJO B;  3PMI A;  1AOJ A;  6AT1 B;  4M77 F;  3QZ9 B;  1UJY A;  2CKK A;  5KYU B;  2A0F B;  1VQ4 Q;  3CC2 T;  4XTY A;  2YUN A;  4JRQ A;  2KNB B;  2EQJ A;  5GJV B;  3MEU A;  5GAN 6;  5HK3 A;  2XDD A;  2VC8 A;  2E64 A;  2GNC A;  2A3L A;  2FO0 A;  3VS2 A;  3L2V A;  1ZSZ B;  2ESW A;  3FB9 A;  2X35 A;  4BDY A;  4B6M A;  1F1B B;  4O6J A;  1VQM Q;  2DE0 X;  4C8Q G;  5A0D A;  1N9S A;  3UA6 A;  2MWP A;  2WSF E;  2PUK B;  2DL4 A;  1C6V X;  1LJO A;  3CC7 T;  2GTJ A;  2VAS A;  3I35 A;  1VQ8 Q;  3RER A;  1Y07 A;  4J9G A;  1CKA A;  4QQ6 A;  3JCM P;  3OYH A;  3PNW C;  2GF7 A;  3ZEH A;  1M1K C;  4J83 A;  3PIP A;  2R5A A;  4E7J A;  1I1J A;  5HK0 A;  1UGR B;  1JO8 A;  1QP3 A;  5LJ5 d;  1Q82 R;  5LJ3 d;  2JVV A;  1VQ6 T;  3P8H A;  4XTU A;  1TSF A;  1YJN T;  1H92 A;  4J6Y A;  1W1F A;  3G4S Q;  1T3S A;  2Y4Y A;  4QW2 A;  3EG9 B;  1YCY A;  5D6W A;  1NLP C;  7AT1 B;  1WNL A;  3NPF A;  3SWN B;  2CZ0 B;  1AVZ C;  4IIM A;  2KXD A;  4FYW B;  2DYI A;  3I55 A;  3OYE A;  2ZZD A;  4LUD A;  1BI3 A;  2QGF B;  1WZO A;  2M9U A;  4XU0 A;  5IT9 E;  1N6A A;  1M90 U;  1PC0 A;  1BI0 A;  2K5L A;  1VQ7 A;  2JTM A;  1BI1 A;  2YSQ A;  5GAM e;  4PFZ A;  4M78 F;  4E47 A;  2KRN A;  1YIJ Q;  5IHN A;  3H8Z A;  3JCM f;  1NM7 A;  4R55 A;  1IGU A;  4FIB A;  3LLR A;  2DKG A;  4D6W A;  4E7I A;  4XTW A;  1JXM A;  4KRT A;  2EYZ A;  4ANJ A;  1NJI R;  3CCL A;  1AWW A;  3DLL A;  1U3O A;  5GAO n;  3MHX A;  4XTV A;  3EG2 A;  2A37 A;  2LX7 A;  4AT1 B;  2EGA A;  4QKU A;  3X26 B;  1QVF S;  1X2Q A;  4M77 D;  3CCV A;  3JB9 F;  3VV0 A;  2IVW A;  1Q81 R;  4C5H A;  1G3W A;  4J7F A;  4K11 A;  4HA8 A;  2CP6 A;  3CC2 Q;  3A8O B;  3HL8 A;  3EHR A;  4RTY A;  4VUB A;  4ATO A;  1OPK A;  1Q82 C;  3OYN A;  2HAX A;  1M30 A;  3EFR A;  1YWP A;  1B3Q A;  4QVC A;  2J06 A;  1N8R C;  2D8J A;  2H8H A;  4QT7 A;  4ESR A;  4KGX B;  3FRN A;  1K9M R;  2VUB A;  2L3R A;  3ZBD A;  2EPD A;  4D8D A;  3HRT A;  3CBP A;  2FRW A;  4M77 B;  5I11 A;  2DVJ A;  3JAM E;  3CC7 Q;  3I55 T;  3M0R A;  3L2R A;  1TU0 B;  4N0A A;  4PJM A;  5A2Q E;  2MWO A;  2RI2 A;  1VQ7 T;  3CCS A;  5D6Y A;  5DM7 R;  5KCH A;  1IGQ A;  4E7H A;  2FVU A;  1YNZ A;  2RQR A;  2PVG B;  1QQJ A;  1QCN A;  2ZPB B;  2KE9 A;  2KVQ G;  4M75 F;  1VQ6 Q;  1KC8 R;  1NJI C;  4C8Q F;  1YJN Q;  3MP1 A;  4OMN A;  3EG0 A;  1WHH A;  2CZ7 B;  4IKF A;  4MZM A;  3EFO B;  2K3B A;  3CCL T;  3J81 E;  5GAO q;  5EG2 A;  2CT4 A;  1ZBJ A;  1RL2 A;  2D0N A;  5FRM A;  2HSE B;  3LGF A;  2RHU A;  5GAN e;  1Q81 C;  1RAG B;  2LJ0 A;  4R0K A;  3SEM A;  2RI5 A;  5GAN 5;  3CCV T;  1K4U S;  1Q95 G;  3MKD A;  3M56 A;  2K9G A;  2XMF A;  1QW1 A;  2DET A;  2K2V A;  4V2S A;  3CCQ T;  3QJY A;  3JCM g;  4M78 D;  5KE3 A;  3QWX X;  2FHD A;  3J80 E;  2DBM A;  2MCN A;  2WSC E;  1WXU A;  4BI8 B;  4JS4 A;  2KQW A;  2K3X A;  4HT8 A;  2E5K A;  1WA7 A;  3ULR B;  3FIF A;  5GJW B;  5KH6 A;  4F7U A;  2EJF A;  1K9M C;  2JS2 A;  2RK1 A;  4PFP A;  4B9W A;  1AWJ A;  3L2W A;  1PKS A;  1D3B B;  1RLQ C;  3Q1J A;  4Z8A A;  1TOV A;  3FDR A;  3CCR A;  1BKB A;  3JB9 D;  4N0A C;  1SSH A;  1YJ9 A;  2BE9 B;  4RUG A;  2NUT B;  2ZGW A;  3CCJ A;  3CXC P;  3OMC A;  1NLO C;  4M78 B;  3KXT A;  4OVA A;  3CCS T;  1TUG B;  5KCO A;  3QXE B;  4F14 A;  3V7R A;  1U5S A;  3CMA T;  1KC8 C;  2AT1 B;  5CQY A;  2GTO A;  2D0Q B;  2DIL A;  3OYD A;  1KQS P;  3VS1 A;  4ZGE B;  4BI3 A;  4ME7 A;  4L59 A;  2GQV A;  1CSK A;  4A4H A;  3CPF A;  3MEV A;  3I55 Q;  2FB7 A;  2RQT A;  2DL5 A;  4NL3 A;  1Y57 A;  1OOT A;  3R6N A;  1ABO A;  3C4S A;  1FMK A;  2RJC A;  3RR6 A;  3UWN A;  2LQN A;  1VQ7 Q;  2O31 A;  1UFF A;  3VS3 A;  3VU3 C;  1YN8 A;  5EC7 A;  4HT9 A;  3M53 A;  1WPY A;  1XTD A;  3JCM J;  2VB6 A;  1HJD A;  1OU9 A;  2NUT A;  5IXB A;  5IXF A;  2DO3 A;  4M75 D;  2CDT A;  2HKQ B;  2EQU A;  2KT1 A;  4C8Q D;  4ZNX A;  4J6X A;  5KYN A;  1Q7Y R;  2L3P A;  3CCL Q;  2OX7 A;  1IHV A;  2NLU A;  4JPB W;  4RG2 A;  1GL5 A;  3M54 A;  3QJ6 A;  4X9C A;  1W70 A;  1WYX A;  3M0Q A;  1VQ4 A;  2EGE A;  1NE8 A;  1JRI A;  4LDU A;  5FU6 B;  3CCR T;  3CCV Q;  2CGH A;  2YUQ A;  4DA4 A;  1M2V B;  1YJ9 T;  2LT4 A;  1K8A R;  3CCQ Q;  3P8B B;  3JCM d;  2C0I A;  3QG1 A;  4PLI A;  1YIT A;  3CPW P;  2KK4 A;  3O8V A;  4F7U E;  2O2O A;  5LJ5 f;  2OJ2 A;  4HCK A;  2RJE A;  5LJ3 f;  4M75 B;  4C8Q B;  2AZS A;  2HZY A;  2JMA A;  4OB0 B;  3A8G B;  3M0P A;  4WCI A;  2K4Y A;  2KRS A;  3V7C A;  1AEY A;  2X4Y A;  4OF1 A;  3SDZ A;  2ED0 A;  4JJD A;  4N4H A;  1I81 A;  3CXC A;  4LN2 A;  1SSF A;  3H6Z A;  1E6G A;  3NTH A;  2DIG A;  3CCS Q;  3EG1 A;  2PZ1 A;  1IRX A;  2CP5 A;  2ENM A;  2HBW A;  3CMA Q;  2QQR A;  4FSS A;  5GMK m;  4XTZ A;  2ROT A;  4KBM B;  3X28 B;  1K0S A;  4RTT A;  2O4X B;  4RTV A;  4MDW A;  3WVE B;  1KQS A;  2RPN A;  3V7S A;  4NL2 A;  3CCE A;  2RQW A;  1YI2 A;  4RCC A;  2MI6 A;  1RI9 A;  1KSW A;  3C12 A;  3QO3 A;  3RKY A;  5CQX A;  2QYZ A;  4IUQ A;  2QEX A;  1C1A A;  1AT1 B;  2LP5 A;  2J6F A;  1G3T A;  3EG3 A;  1K8A C;  1O9S A;  2C06 A;  5M9O A;  5FU7 B;  4J8O A;  3G1J A;  1Y96 A;  2X4W A;  1VYU A;  2COW A;  2LCL A;  4RCB A;  5LJ5 h;  2K5I A;  4J9D A;  2DM1 A;  4C0Z A;  4KUD K;  5LJ3 h;  5GAM j;  5HY6 A;  3CEY A;  2ZPE B;  1Q86 U;  1N5Z A;  1KFZ A;  5KYW B;  3OS2 A;  2DZ9 A;  2CP0 A;  2HMA A;  4OP0 A;  3BFM A;  2X9H A;  1QVP A;  3H0F A;  1MMA A;  1RAF B;  5I2M A;  1AWX A;  4PL6 A;  2HKN A;  4ZN1 A;  3CCR Q;  2EAY A;  1QMC A;  2LNV A;  2CUD A;  1YJ9 Q;  1PCX A;  2PUO B;  2P0Q A;  4M78 G;  2GFU A;  2X3X D;  2EYX A;  3EH1 A;  5GAO p;  5LJ3 g;  5CVI A;  1M90 R;  1M4Z A;  3EGX A;  4XTX A;  4D8K A;  2VXE A;  1KD1 U;  1M3A A;  1KK7 A;  2W10 A;  1B34 A;  1I07 A;  1J3T A;  2HEQ A;  2MK5 A;  1NPR A;  1D0X A;  3CCE T;  1YI2 T;  1X27 A;  1G8X A;  1PG5 B;  5GMK h;  2PVD B;  5CKD A;  2H3J A;  3JB9 G;  4X34 A;  2ABL A;  3CQT A;  2QEX T;  1VQ9 A;  1PHT A;  3LX7 A;  2EIF A;  2CS7 A;  2KI7 A;  1WXT A;  2RA2 A;  3M5A A;  4IUR A;  3GLX A;  2HQE A;  5GAO l;  3VJP A;  2NWM A;  5D7U A;  2RD1 A;  1IZ6 A;  5J3B A;  4AFS C;  1ZUY A;  4C0G A;  2H3E B;  3EGU A;  2SRC A;  1QLY A;  4C5I A;  1EX4 A;  2DXT A;  1R8O B;  1GFC A;  2YXY A;  1QP2 A;  4DBQ A;  3PGG A;  2AKK A;  2KRM A;  5GAN j;  2LT1 A;  4F7U F;  3VS5 A;  4BAC A;  2PTK A;  3VKI A;  1WJQ A;  2DF6 A;  1S1N A;  1WDX A;  3NTK A;  4FYX B;  1YIT Q;  4FL6 A;  1M90 C;  3MJX A;  4J7I A;  3CCM A;  2QQB A;  1SF9 A;  4IUT A;  1VQO A;  2CZ1 B;  1S72 A;  4JZ4 A;  5KYY A;  1W6X A;  4LDX A;  4M75 G;  4PJJ A;  2M0Y A;  2BE7 D;  4LD6 A;  1D1A A;  2J6O A;  3TEE A;  2L3Q A;  3U23 A;  1VUB A;  4LDY A;  1D0Z A;  2DEQ A;  3OYI A;  2YT6 A;  4C92 A;  1I5O B;  1C0M A;  4Z89 A;  3MO8 A;  3FC3 A;  3L42 A;  1WX6 A;  3KBG A;  5IHK A;  2HL3 A;  1VQ9 T;  4EDU A;  3L1A A;  2K2M A;  3M58 A;  1VQP A;  3G6E A;  2NYS A;  2YRD A;  1OUL A;  4PJL A;  4Q5W A;  1WI7 A;  1QVF A;  5IH2 A;  1QWF A;  3DLM A;  2YWW A;  4LD9 K;  1NBE B;  2OAW A;  4JRP A;  2JW4 A;  2KDS A;  2JM9 A;  4Y91 A;  5FW9 A;  1KJW A;  2D8H A;  1X75 C;  4CC4 B;  3CCE Q;  1PRM C;  1YI2 Q;  2VWF A;  3H0H A;  3OY9 A;  4EMH A;  2MMP A;  2QEX Q;  2LTO A;  1H64 1;  4IUU A;  4J9C A;  1IHW A;  1UG1 A;  2DIQ A;  1U8R A;  2LZ6 B;  2E6N A;  4XU2 A;  2PU9 B;  1OQK A;  1D1C A;  3R6O A;  1GFD A;  3GP8 A;  1XOV A;  5I21 A;  4FT4 A;  3CCM T;  1NEB A;  3NGP A;  3TSZ A;  1VQO T;  1S72 T;  1HXD A;  4BDZ A;  5A0G A;  2ZPI B;  5CAI A;  2FZC B;  4C92 C;  2BKD N;  1GBQ A;  4LUE A;  3VYG A;  4Z88 A;  3TRE A;  2JOY A;  3OYL A;  1I4K 1;  4MML A;  1LPL A;  3CCQ A;  4CRI A;  3JRZ A;  2RF0 A;  5C6S A;  1GCQ C;  3UAT A;  3JCM W;  5FWB A;  1M9S A;  4DQ2 A;  1KQ2 A;  3JV3 A;  2KYB A;  3DKM A;  2DA9 A;  1M1K U;  1VQP T;  4PJO C;  3A8H B;  2P0K A;  3G6E T;  1AZG B;  4ELZ C;  1M27 C;  3CCU A;  4JJB A;  2A36 A;  3O5Z A;  1QCF A;  4J5Y A;  4F17 A;  2FPF A;  2O9V A;  4C92 E;  4EIK A;  3M0U A;  2JN0 A;  4NS5 A;  2ZPF B;  4FM4 B;  5IHI A;  1Y71 A;  4M7A C;  1O75 A;  3JB9 I;  1HK9 A;  1I8F A;  1T0H A;  5GAN 4;  2HDA A;  3C95 A;  2EYQ A;  4FU6 A;  2KAF A;  4RTU A;  4F7U B;  4LDW A;  3V8K A;  1VQ9 Q;  3JCM h;  2C0T A;  4EMK C;  2M0O A;  1X6B A;  1G2B A;  2E70 A;  4BE0 A;  3CMA A;  4JJC A;  2DTO A;  1FMW A;  3OW2 S;  4AG2 C;  3N5B B;  2I2L A;  3WVD B;  4Z02 A;  4HCC A;  2QTX A;  1SKU B;  1UEC A;  5KE2 A;  4ZGD B;  1HYO A;  2ZPH B;  2HQH A;  4RTX A;  1AHJ B;  1X69 A;  4C92 G;  1BK2 A;  1K0X A;  2YRC A;  5GAN 7;  3H41 A;  3QDF A;  5CKF A;  5CIU A;  4M7A E;  2ZCF B;  2BUD A;  1WQW A;  2ZPG B;  1YWO A;  4QVD A;  2BZX A;  1VA7 A;  1VQL A;  1OX8 A;  1TWB A;  3E9F A;  1PWT A;  1ARK A;  2EKH A;  1EIF A;  8AT1 B;  1BI2 A;  3C94 A;  2K5F A;  1AD5 A;  1WGS A;  4C5G A;  2MYS A;  2QXF A;  2HL5 C;  3FEO A;  2K57 A;  5KYX A;  1YCS B;  2QI2 A;  3LWH A;  2JXB A;  2MOX A;  4JUV A;  2HNI A;  1Q82 U;  2JMC A;  2CH4 W;  4DBF A;  4M7D A;  1EFN A;  3CCM Q;  2CRE A;  2QQ9 A;  2MAM A;  1VQO Q;  2QAZ A;  1S72 Q;  2EFI A;  4HKE A;  3IQL A;  3V8J A;  3CCU T;  1N8R U;  1Z9Q A;  3RMQ A;  2EGC A;  3I5R A;  2ROL A;  2E41 A;  1SG5 A;  3CBO A;  4E7L A;  1PSE A;  2F1L A;  2R58 A;  2JM8 A;  3HTR A;  2CSQ A;  2DK3 A;  3M59 A;  2JTE A;  2X3W D;  2DTH A;  2CH4 A;  5GAN g;  4EMG A;  1BBZ A;  1E7O A;  2D6F A;  1K76 A;  2EKO A;  3HPW A;  1VQP Q;  5HKC A;  2AK5 A;  2XI9 A;  3I9Q A;  4OGE A;  3G6E Q;  2EW3 A;  1M2O A;  3EAE A;  4II1 A;  5GAM d;  1RAD B;  3KUF A;  4MDX A;  2JJ9 A;  1H3H A;  3OYG A;  1NJI U;  4OMF B;  2Y4X A;  4CC2 A;  5FLX E;  1VIF A;  3OQ5 A;  4BY6 C;  2QAS A;  1H3Z A;  1PRL C;  1NPP A;  4Y28 E;  1BYM A;  1Q86 R;  2WAC A;  2VYT A;  3QYH B;  4L5G A;  3ER0 A;  1VQL T;  2J05 A;  4E2F B;  1SPK A;  5CR2 A;  3I56 T;  1IB8 A;  2DMO A;  3V8L A;  1MNE A;  1ZLM A;  1MMN A;  3CC4 A;  1ZHI A;  3QPH A;  1WXB A;  2JT4 A;  1TG0 A;  4M7D C;  2NUP B;  2KBT A;  1ZX6 A;  1I0C A;  3DB3 A;  4PFO A;  5L23 A;  3AHU A;  1FYN A;  1U1T A;  3M4G A;  3UF4 A;  2KY9 A;  4KUL A;  4M77 C;  2V1Q A;  1TUD A;  2DRM A;  3THK A;  3L2U A;  1K9M U;  2QGG A;  3PFS A;  2BIV A;  1R0C B;  1W2B S;  2F2V A;  5AYF A;  3CD6 T;  5CKE A;  3DB4 A;  3PVL A;  1NEG A;  1YJW A;  1VOM A;  1A0N B;  2RNA A;  3A98 A;  1OX9 A;  3OYB A;  1YHQ A;  2ED1 A;  2LX9 A;  1K9A A;  4A53 A;  4DOV A;  4ELY C;  1BIB A;  1VQN T;  4JLI A;  4M7D E;  1JBM A;  4QQG A;  2OTJ A;  1K1Z A;  2F5T X;  2CZ6 B;  4M77 E;  1QKW A;  1EZZ B;  1YFN A;  3QYG B;  3T9N A;  1UB4 A;  4C92 F;  3URG A;  2BTT A;  3CCU Q;  1UTI A;  2NUP A;  2K6D A;  2OTL T;  1N9R A;  1WHL A;  1Q86 C;  1QKX A;  1Y96 B;  2YHT A;  3JCM V;  5J26 A;  2O01 E;  3VRY A;  3QUI A;  3JCM Q;  1M8V A;  5GMK i;  4FW1 A;  2VKN A;  1M8M A;  5GAN d;  4F7U G;  2CSI A;  2RJF A;  4C0D B;  1UUE A;  2QTV A;  2L0A A;  2DER A;  1VQ5 A;  2O9S A;  3CC4 T;  3MET A;  4E7Z A;  9ATC B;  2HSP A;  4WTO B;  1YBY A;  1Q7Y C;  1FXX A;  2F69 A;  2FRY A;  4M7A F;  3JCM X;  1XNI A;  2VGN A;  3VUB A;  2CYZ B;  1K73 U;  1YJW T;  3UA7 A;  3EGX B;  1VQL Q;  4OMM A;  4PK4 A;  3I56 Q;  1YHQ T;  3PT9 A;  4TVR A;  2E3H A;  1WFW A;  4X9D A;  2XKO C;  1M3B A;  3H9N A;  1NYG A;  4GBQ A;  1B34 B;  2NUZ A;  4PKC C;  4QVZ A;  2OTJ T;  1VYV A;  2YUP A;  5LJ5 e;  1SEM A;  1WJR A;  1ZBX A;  4JDS A;  1BU1 A;  5LJ3 e;  2YLC A;  2LCS A;  1OZ2 A;  3TVT A;  2RQV A;  4HXJ A;  1X6G A;  1M1G A;  4MZT A;  3HHT B;  1UEB A;  2CP3 A;  3OYK A;  2LNH B;  4FW2 A;  4JLG A;  4A4G A;  3QDR B;  3CD6 Q;  5GAN 8;  5I22 A;  2QG9 B;  4ZTF A;  2Y90 A;  3OB9 A;  1B7T A;  4AFQ C;  2A7Y A;  2KMT A;  3CPW A;  3RKX A;  2KT8 A;  1GBR A;  1VQN Q;  4ZTJ A;  4E7K A;  1BCM A;  3E19 A;  3OBW A;  1VQ5 T;  2IIM A;  3TQ7 P;  1KQ1 A;  3EFS A;  1HD3 A;  4C92 D;  5FU6 C;  4GLM A;  1D0Y A;  2K3Y A;  1NYF A;  1JQQ A;  2OTL Q;  1RAI B;  3SHW A;  2E65 A;  2KGT A;  2DX1 A;  5GMK e;  4Y92 A;  1T3L A;  3OYY A;  2K79 A;  3JB9 J;  1U1S A;  5KYY B;  1G3S A;  4C8Q C;  2DXB A;  2E4H A;  4BD3 A;  1K8A U;  5GAN 3;  1U06 A;  2FZG B;  4BE1 A;  3REA B;  1ZQ1 A;  3BW1 A;  3CC4 Q;  1PD1 A;  1XJW B;  3EH2 A;  5CKB A;  2DXC A;  4MMK A;  2M1H A;  4C92 B;  1PSF A;  1X01 A;  2LQK A;  3HFO A;  1UHF A;  1QVG S;  4DEX A;  3ZL7 C;  5CK9 A;  2AZV A;  1M1K R;  3G71 A;  1RAH B;  3FJP A;  2O88 A;  3GOX A;  1HSQ A;  4LNP A;  4AG1 C;  3CBM A;  1YJW Q;  3OW2 P;  4M7D F;  3H0I A;  1YHQ Q;  2YLB A;  2EVR A;  3RES A;  3GIB A;  4O5V A;  3EGD A;  1GCP A;  4KT0 E;  3VYH B;  2ATC B;  1ZA1 B;  2OTJ Q;  3X24 B;  5GAM f;  2ECZ A;  3RKW A;  2M51 A;  4M7A B;  1Y0M A;  2EJ9 A;  4RTZ A;  1OV3 A;  1PNJ A;  5AT1 B;  5FU7 C;  4M4Z A;  2DLP A;  3GNG A;  1BB9 A;  3E1S A;  2HBP A;  5J39 A;  4WF2 A;  1JJ2 S;  1V29 B;  2D9T A;  4EMK B;  2XDB A;  2FPE A;  3S3O A;  2RJD A;  3VRZ A;  4FYV B;  5GAO r;  1DJ7 B;  1SHF A;  4J9B A;  4A4F A;  1GCQ A;  4KGV B;  4YTL A;  2PQW A;  2EQI A;  2D1X A;  1WHM A;  2LJ1 A;  1VQ5 Q;  4J6W A;  4C0F A;  3MP8 A;  4KGZ B;  2RHY A;  2YRV A;  4PJO A;  2YDL A;  4GY5 A;  5A0L A;  4RG8 A;  2PNI A;  2DBK A;  4KH1 B;  1ABQ A;  1MGQ A;  5KYU A;  2XDP A;  2RHZ A;  3UT1 A;  3QWY A;  3G71 T;  4JJN K;  1PD0 A;  2V26 A;  4C5E A;  2LC4 A;  5GMK l;  4M7A A;  3QBY A;  2KXC A;  1N8R R;  5DLQ E;  1CKB A;  3INZ A;  4J9I A;  4LXC A;  1MV0 B;  1ZSZ A;  2MPX C;  3QZ5 B;  2G6F X;  2I0N A;  3HKS A;  4EMK A;  1TH7 A;  1E6H A;  3SD4 A;  1KIK A;  4J9E A;  3OSS C;  1OU8 A;  3CME A;  4A63 B;  2HD0 A;  4J9F A;  5GAM h;  2XU8 A;  4LE9 A;  4OGC A;  3VUZ A;  2DPP B;  1MHN A;  4KH0 B;  2KRO A;  3I5S A;  1GXI E;  4BUG A;  2B8A A;  3NFC A;  3TU4 K;  4A54 A;  2A28 A;  1T0J A;  2QA4 A;  1MMG A;  2X4J A;  3M0S A;  3OW2 A;  4FYY B;  2FL7 A;  1IO6 A;  4OML A;  4M7D D;  2DFU A;  4A4K A;  2DL3 A;  3NTI A;  1IRE B;  1ZA2 B;  5GAN f;  2CP2 A;  1WHK A;  4OB2 B;  5CCA A;  2OAU A;  3BDU A;  2X51 A;  3EG9 A;  5GAM g;  3MEA A;  1W2B P;  1D1B A;  1UGP B;  3SWN A;  2COZ A;  4BY6 B;  4RMO A;  4N4G A;  5L8R E;  2CUB A;  1RAE B;  2W0Z A;  2P4T A;  3M4Y A;  1OI1 A;  1TXQ A;  4E6R A;  2LRQ A;  3C0C A;  5KYX B;  2X4X A;  1D09 B;  3M9Q A;  2FPD A;  2FZK B;  2KYM A;  5IN1 A;  4ORZ A;  2GQI A;  1ZSZ C;  4M7D B;  4OMQ A;  4B9X A;  2EBP A;  2KSS A;  1R77 A;  2GCX A;  2JTF A;  3RBB B;  2DD4 A;  2FYK A;  4XAX B;  3M0T A;  3JCM e;  1UJ0 A;  1KG1 A;  4PJO E;  2XD0 A;  5GAN 2;  3VS6 A;  2VXF A;  3ME9 A;  3OA6 A;  2VV5 A;  1RUW A;  2L5Q A;  1SHG A;  3CME T;  2QQA A;  3FLG A;  3D7S B;  1WJS A;  3UPU A;  1IXD A;  1JU5 C;  3A8M B;  1UGV A;  3QKJ A;  2J6K A;  2F2X A;  3PVQ A;  3G71 Q;  1X2K A;  4OMP A;  2V8K A;  2F2W A;  2QA4 T;  4PLL A;  3I56 A;  1R0B G;  1MUZ A;  3OYM A;  3HRU A;  1OEB A;  2FEI A;  1M1F A;  2DEU A;  5DY9 A;  2PVO B;  5GAN h;  2V8J A;  4PJO G;  2MIO A;  1WHJ A;  4CI0 C;  4ZN3 A;  3PIO A;  3SWN C;  3ZFJ A;  2DL8 A;  3G7Z A;  2M02 A;  3HP9 A;  4F16 A;  2L3S A;  1FWZ A;  3BY7 A;  3LH5 A;  4IUP A;  2RK2 A;  1KHC A;  4M77 A;  3CD6 A;  4QQD A;  2LCC A;  5LJ5 j;  4M7A G;  2EQM A;  5LJ3 j;  1UGQ B;  2COY A;  2K7A A;  1LCK A;  1WQ7 A;  1OZ3 A;  1UDL A;  3X25 B;  1VQK A;  1LNX A;  1VQN A;  2QQS A;  3A5Z B;  5IAY A;  2A08 A;  3RDV A;  4X1V A;  3QII A;  1W2B A;  2VGM A;  1K73 R;  1G5V A;  2M16 A;  2AKL A;  1BIA A;  3EFO A;  1I5L A;  1X43 A;  5LL6 S;  2BZY A;  2LJ3 A;  3OYA A;  3RIR A;  4HCB A;  1KHI A;  2OTL A;  2CT3 A;  3UDC A;  3VS7 A;  2B86 A;  4E7S A;  4XQ3 A;  3QHS A;  2R5M A;  3EHQ A;  1FMV A;  4OMO A;  4KUI A;  1LOJ A;  4DOW A;  1TUC A;  2XK0 A;  1Q81 U;  3SB2 A;  1MMD A;  4XU1 A;  2F5K A;  2DJQ A;  2L89 A;  3ASK A;  4J9H A;  2RQU A;  2RHI A;  4F04 B;  5GMK j;  3QSU A;  4CC7 A;  3LGL A;  2FG0 A;  2JUF A;  3OYF A;  2LQW A;  4L6V 5;  4N4I A;  1RAC B;  1OPL A;  2RI3 A;  4MZP A;  4CC3 A;  3JCM b;  5GAO m;  1WLP B;  4UC4 A;  3P8D A;  2HCK A;  1NG2 A;  1GRI A;  1D3B A;  3M55 A;  2KEA A;  2Z0W A;  3CME Q;  1MND A;  2GBQ A;  2DZC A;  3X20 B;  2DJZ A;  1ZSG A;  1FX7 A;  4OB1 B;  2E12 A;  1KD1 R;  2V8I A;  3J7A F;  4PJN A;  2YUO A;  5CO7 A;  5D6X A;  2DL7 A;  4M78 A;  2QA4 Q;  4OB3 B;  4HCZ A;  2SEM A;  2DNU A;  1G3Y A;  2E3I A;  1VQK T;  4DBR A;  3NMZ C;  2L2P A;  1K73 C;  1VYT A;  4GLK A;  5DLO A;  1UHC A;  5HCK A;  5C0M A;  1QVG P;  2CP7 A;  1KC8 U;  2RMO A;  3E9G A;  1QCO A;  1TTH B;  2XID A;  4AFZ C;  3VS0 A;  3CCJ T;  3MPU B;  3GBQ A;  2RM4 A;  5FRO A;  1SRL A;  1ZUK A;  2E1H A;  4BB7 A;  1V1C A;  3A1P A;  4AMC A;  1B07 A;  1VQM A;  2J7I A;  5I2S A;  3MCA B;  3HSB A;  3RMS A;  2JZ2 A;  1JB0 E;  2E10 A;  2R57 A;  1AZE A;  2LMJ A;  3TCJ A;  4LDV A;  1MV3 A;  4PJO F;  4M7D G;  3RNJ A;  1UGS B;  2GGR A;  2V1R A;  1QWE A;  2E6Z A;  1ACM B;  3M57 A;  1VQ8 A;  4M77 G;  2RN8 A;  2VVK A;  4XK8 E;  3MEW A;  3FJ5 A;  3TSW A;  3F70 A;  4ZGJ B;  3REB B;  4FT2 A;  3PMT A;  2P84 A;  2RH2 A;  1JJ2 P;  3HFN A;  4PNO A;  4M78 C;  1KD1 C;  1M2V A;  1G83 A;  1TS9 A;  3G4S A;  8ATC B;  1XQH A;  1YP5 A;  1JXO A;  2DAQ A;  3OYJ A;  2WSE E;  2JS0 A;  1N27 A;  3E2U A;  2RHX A;  3OYC A;  3JCM c;  3PE0 A;  4M75 A;  4C8Q A;  4JRI A;  1LVK A;  2EQK A;  4A4E A;  1ZUU A;  2OI3 A;  3RUX A;  1VQ4 T;  3NHN A;  3OMG A;  3S3N A;  1RI0 A;  2EYW A;  2XHC A;  1RLP C;  2DVE A;  2RB6 A;  1YIJ A;  4NOY A;  4RKU E;  1WHG A;  1AWO A;  2EYY A;  2P0P A;  4DEY A;  3S6W A;  1RAB B;  4M78 E;  1YIT T;  3CXC S;  1PM3 A;  4EPC A;  5FWC A;  1Z9Z A;  1Y7X A;  2LVM A;  1VQM T;  2DYB A;  2GFA A;  3LYI A;  2EWN A;  1X6O A;  2LQ8 A;  3OS0 A;  3VS4 A;  2QK0 A;  2ZAE A;  3GF5 A;  4JZ3 A;  3KFV A;  4XU3 A;  3JSC A;  1SRM A;  1VQK Q;  3BE3 A;  1NZ9 A;  2MF2 A;  2RO0 A;  1QVG A;  3CC2 A;  5CKH A;  2O4X A;  3OBY A;  5ECA A;  4DBH A;  3GPL A;  1JEG A;  4R56 A;  1KQS S;  1VQ8 T;  2IPO B;  2G3R A;  3WXM B;  2IG0 A;  1H8K A;  3A8L B;  3CCJ Q;  1Q7Y U;  1PKT A;  5FRN A;  1RAA B;  4P5N A;  5LJ5 g;  3OS1 A;  2JNG A;  3EGD B;  3MP6 A;  4HVW A;  3G4S T;  1QVF P;  3GNF B;  3L2Q A;  4M75 C;  4HVU A;  2BZ8 A;  2AHJ B;  2C0O A;  4PJO D;  2L8D A;  4FSX A;  4JS5 A;  2QDY B;  3L2Z A;  3CC7 A;  2AIR B;  3OS5 A;  3OSV A;  1VIE A;  4FCY A;  1W4S A;  1BCO A;  5KYW A;  1M3C A;  1WIE A;  2LDM A; 
#chains in the Genus database with same CATH homology
 3SFM A;  4OGC A;  2K4Y A;  3HRS A;  3VUZ A;  2DPP B;  3V7C A;  4BI4 A;  2X4Y A;  4OF1 A;  2DD5 A;  1MHN A;  3SDZ A;  2E41 A;  4N4H A;  3CBO A;  1I81 A;  4E7L A;  3CXC A;  1P92 A;  1GXI E;  3LWI A;  4M7A D;  4BE2 A;  1YIJ T;  1JJ2 A;  4BUG A;  1PSE A;  4JRK A;  1SSF A;  2B8A A;  3H6Z A;  3NFC A;  3TU4 K;  4A54 A;  2DXU A;  1OYX A;  3NTH A;  2R58 A;  2QA4 A;  3S3M A;  2HQX A;  3LH0 A;  1VQ6 A;  2X4J A;  2XIC A;  2DIG A;  3OW2 A;  2DK3 A;  3M59 A;  3LW5 E;  1YJN A;  2DTH A;  3JB9 H;  2FL7 A;  5GAN g;  4C0D C;  3CPW S;  1M5Q 1;  3BDL A;  4IUV A;  4M7D D;  4EMG A;  2EJG A;  2DTI A;  4A4K A;  2D6F A;  3NTI A;  2QQR A;  1IRE B;  2EKO A;  2XG8 D;  4M75 E;  3HPW A;  5GMK m;  4XTZ A;  5HKC A;  5GAN f;  4C8Q E;  2XI9 A;  4KBM B;  4OGE A;  2E5Q A;  3X28 B;  3PTA A;  2O4X B;  4PJO B;  4MDW A;  3WVE B;  3EAE A;  3PMI A;  4II1 A;  5GAM d;  1KQS A;  4OB2 B;  3V7S A;  4NL2 A;  3KUF A;  4M77 F;  5CCA A;  3QZ9 B;  2OAU A;  3CCE A;  3BDU A;  1YI2 A;  4RCC A;  5GAM g;  3MEA A;  3OYG A;  1NJI U;  2CKK A;  4OMF B;  2Y4X A;  2MI6 A;  1UGP B;  3SWN A;  5FLX E;  1VIF A;  3C12 A;  3QO3 A;  4BY6 B;  3OQ5 A;  3CC2 T;  4XTY A;  4RMO A;  3RKY A;  5CQX A;  4BY6 C;  1H3Z A;  4IUQ A;  2QEX A;  1NPP A;  4Y28 E;  4JRQ A;  4N4G A;  1BYM A;  5L8R E;  2EQJ A;  5GAN 6;  3MEU A;  5HK3 A;  2XDD A;  2VC8 A;  1G3T A;  1K8A C;  2P4T A;  3M4Y A;  2E64 A;  1OI1 A;  2WAC A;  2VYT A;  1O9S A;  2LRQ A;  3QYH B;  2C06 A;  2A3L A;  2X4X A;  5M9O A;  4L5G A;  3ER0 A;  1VQL T;  3M9Q A;  5FU7 B;  4J8O A;  3L2V A;  1Y96 A;  5CR2 A;  3FB9 A;  3I56 T;  5IN1 A;  2X35 A;  4BDY A;  3V8L A;  2X4W A;  2LCL A;  4RCB A;  5LJ5 h;  2K5I A;  1ZHI A;  3CC4 A;  4O6J A;  4M7D B;  3QPH A;  4C0Z A;  4KUD K;  5LJ3 h;  4B9X A;  5GAM j;  4M7D C;  2KSS A;  2GCX A;  2JTF A;  3DB3 A;  3CEY A;  2ZPE B;  5HY6 A;  4C8Q G;  1Q86 U;  2DD4 A;  2FYK A;  4XAX B;  5A0D A;  3JCM e;  1N9S A;  3AHU A;  1KG1 A;  3OS2 A;  2DZ9 A;  1U1T A;  3M4G A;  2MWP A;  4PJO E;  2KY9 A;  4KUL A;  2XD0 A;  2WSF E;  2PUK B;  4M77 C;  4OP0 A;  5GAN 2;  4PJO A;  3BFM A;  1LJO A;  3CC7 T;  2VXF A;  1QVP A;  3ME9 A;  3L2U A;  1K9M U;  3OA6 A;  3PFS A;  2VV5 A;  2L5Q A;  5I2M A;  2BIV A;  1W2B S;  3CME T;  3RER A;  1Y07 A;  2QQA A;  4PL6 A;  5AYF A;  3FLG A;  3CD6 T;  1WJS A;  4QQ6 A;  3DB4 A;  5CKE A;  4ZN1 A;  3JCM P;  3OYH A;  3UPU A;  2EAY A;  2LNV A;  1YJW A;  3PNW C;  2GF7 A;  3ZEH A;  3A8M B;  1M1K C;  4J83 A;  3PIP A;  3QKJ A;  2PUO B;  2R5A A;  5HK0 A;  4E7J A;  3OYB A;  1UGR B;  2P0Q A;  1QP3 A;  5LJ5 d;  1YHQ A;  2LX9 A;  2V8K A;  5LJ3 d;  2JVV A;  4M78 G;  2QA4 T;  4PLL A;  3I56 A;  2GFU A;  3P8H A;  4A53 A;  4DOV A;  4XTU A;  3OYM A;  4ELY C;  5GAO p;  3HRU A;  1VQ6 T;  1BIB A;  5LJ3 g;  1YJN T;  1VQN T;  4J6Y A;  4JLI A;  5CVI A;  4M7D E;  1JBM A;  1M4Z A;  1M1F A;  4QQG A;  2OTJ A;  4XTX A;  2Y4Y A;  5DY9 A;  2PVO B;  2VXE A;  4QW2 A;  1KD1 U;  1YCY A;  5D6W A;  5GAN h;  2F5T X;  2V8J A;  1WNL A;  4PJO G;  3SWN B;  2CZ6 B;  4M77 E;  2CZ0 B;  3QYG B;  3T9N A;  4CI0 C;  4ZN3 A;  3PIO A;  1UB4 A;  3SWN C;  1B34 A;  3ZFJ A;  3I55 A;  3OYE A;  3G7Z A;  2ZZD A;  3HP9 A;  4C92 F;  3URG A;  1BI3 A;  1NPR A;  3BY7 A;  1FWZ A;  3CCE T;  2M9U A;  1YI2 T;  4IUP A;  4XU0 A;  1N6A A;  5IT9 E;  1M90 U;  1BI0 A;  2K5L A;  2RK2 A;  1KHC A;  5GMK h;  2PVD B;  1VQ7 A;  5CKD A;  2JTM A;  4M77 A;  2OTL T;  3CD6 A;  1N9R A;  1BI1 A;  2H3J A;  4QQD A;  2LCC A;  3JB9 G;  5LJ5 j;  5GAM e;  4X34 A;  1Q86 C;  4M7A G;  1Y96 B;  2YHT A;  2EQM A;  3JCM V;  2QEX T;  4M78 F;  4E47 A;  5LJ3 j;  5J26 A;  1VQ9 A;  1UGQ B;  3H8Z A;  2O01 E;  2EIF A;  2CS7 A;  3LX7 A;  3JCM f;  2RA2 A;  3M5A A;  3QUI A;  3JCM Q;  4R55 A;  1M8V A;  4IUR A;  1WQ7 A;  3GLX A;  1OZ3 A;  2HQE A;  4FIB A;  3LLR A;  5GMK i;  2DKG A;  4D6W A;  3X25 B;  5GAN d;  4F7U G;  2RJF A;  4XTW A;  1LNX A;  4E7I A;  1VQK A;  4C0D B;  1VQN A;  2QQS A;  5GAO l;  3CCL A;  3A5Z B;  3VJP A;  1VQ5 A;  3CC4 T;  5IAY A;  3DLL A;  5GAO n;  3MET A;  3MHX A;  2RD1 A;  1IZ6 A;  4XTV A;  5J3B A;  3QII A;  1W2B A;  1YBY A;  2VGM A;  3X26 B;  1QVF S;  1G5V A;  1Q7Y C;  4M77 D;  2M16 A;  4C0G A;  1FXX A;  3CCV A;  1BIA A;  2F69 A;  1I5L A;  3VV0 A;  3JB9 F;  4C5I A;  2IVW A;  5LL6 S;  4M7A F;  4C5H A;  1G3W A;  2DXT A;  4J7F A;  3JCM X;  1XNI A;  4HA8 A;  1R8O B;  3OYA A;  3A8O B;  3HL8 A;  3RIR A;  1QP2 A;  4HCB A;  1KHI A;  2OTL A;  2VGN A;  4VUB A;  4ATO A;  3UDC A;  3VUB A;  3PGG A;  4XQ3 A;  3QHS A;  2CYZ B;  1K73 U;  2R5M A;  5GAN j;  2LT1 A;  4F7U F;  1YJW T;  4KUI A;  1Q82 C;  1LOJ A;  3OYN A;  2HAX A;  4DOW A;  4BAC A;  2XK0 A;  3VKI A;  1Q81 U;  1WJQ A;  3EFR A;  3NTK A;  3SB2 A;  4QVC A;  1YHQ T;  3PT9 A;  4FL6 A;  4TVR A;  4X9D A;  1M90 C;  1N8R C;  2XKO C;  2F5K A;  4J7I A;  4XU1 A;  2L89 A;  3CCM A;  3ASK A;  2QQB A;  4IUT A;  1B34 B;  2CZ1 B;  2RHI A;  3FRN A;  1VQO A;  1S72 A;  2VUB A;  2L3R A;  4PKC C;  4LDX A;  4QVZ A;  5GMK j;  3QSU A;  2OTJ T;  4M75 G;  5LJ5 e;  3ZBD A;  3LGL A;  1WJR A;  1ZBX A;  2JUF A;  4JDS A;  5LJ3 e;  3OYF A;  2YLC A;  4L6V 5;  4N4I A;  4MZP A;  2RI3 A;  3HRT A;  3CBP A;  3JCM b;  1OZ2 A;  4LD6 A;  5GAO m;  4M77 B;  3TEE A;  4UC4 A;  3P8D A;  3JAM E;  1VUB A;  1D3B A;  1M1G A;  3M55 A;  4MZT A;  3HHT B;  1UEB A;  4LDY A;  3OYK A;  4MDX A;  3I55 T;  2DEQ A;  3L2R A;  4JLG A;  4A4G A;  3OYI A;  3QDR B;  4C92 A;  2DZC A;  4N0A A;  5A2Q E;  2MWO A;  2RI2 A;  3MO8 A;  5GAN 8;  1VQ7 T;  3CCS A;  5D6Y A;  4ZTF A;  5DM7 R;  2Y90 A;  3OB9 A;  5KCH A;  3FC3 A;  3L42 A;  3X20 B;  2DJZ A;  4E7H A;  2FVU A;  1FX7 A;  3KBG A;  4OB1 B;  2E12 A;  2PVG B;  1VQ9 T;  2V8I A;  2A7Y A;  2KMT A;  3J7A F;  4EDU A;  5CO7 A;  3CPW A;  3L1A A;  3RKX A;  5D6X A;  2ZPB B;  3M58 A;  4M78 A;  1VQP A;  4OB3 B;  2KVQ G;  4HCZ A;  3G6E A;  4M75 F;  4Q5W A;  1NJI C;  4C8Q F;  3MP1 A;  4ZTJ A;  4E7K A;  1QVF A;  1G3Y A;  3DLM A;  2CZ7 B;  4LD9 K;  1VQK T;  4IKF A;  3E19 A;  4MZM A;  3OBW A;  3CCL T;  3J81 E;  5GAO q;  5EG2 A;  1VQ5 T;  1K73 C;  4JRP A;  4GLK A;  1KQ1 A;  1RL2 A;  5DLO A;  5FRM A;  3EFS A;  3LGF A;  2RHU A;  2KDS A;  4Y91 A;  5GAN e;  5C0M A;  4C92 D;  1Q81 C;  5FU6 C;  1KC8 U;  1X75 C;  3E9G A;  2RI5 A;  5GAN 5;  3CCV T;  2XID A;  2K3Y A;  3M56 A;  3OY9 A;  3CCJ T;  1QW1 A;  2RM4 A;  2K2V A;  4V2S A;  5FRO A;  2E65 A;  4EMH A;  2MMP A;  3QJY A;  3JCM g;  3CCQ T;  4M78 D;  2E1H A;  2LTO A;  4BB7 A;  5GMK e;  5KE3 A;  1H64 1;  4IUU A;  3OYY A;  2FHD A;  3J80 E;  1VQM A;  5I2S A;  3MCA B;  3HSB A;  2WSC E;  3JB9 J;  1U1S A;  4BI8 B;  4JS4 A;  2KQW A;  2DIQ A;  2JZ2 A;  2K3X A;  3RMS A;  2E6N A;  1JB0 E;  1U8R A;  2E10 A;  4HT8 A;  2R57 A;  4XU2 A;  2PU9 B;  1G3S A;  3FIF A;  4C8Q C;  5KH6 A;  2DXB A;  4BD3 A;  1K8A U;  5GAN 3;  4F7U A;  2EJF A;  1K9M C;  3R6O A;  2RK1 A;  3TCJ A;  4LDV A;  3GP8 A;  1XOV A;  5I21 A;  4B9W A;  4PJO F;  4FT4 A;  3L2W A;  4M7D G;  4BE1 A;  3CCM T;  1ZQ1 A;  3BW1 A;  1D3B B;  1UGS B;  1VQO T;  1S72 T;  3Q1J A;  1HXD A;  5CKB A;  2E6Z A;  4BDZ A;  5A0G A;  2ZPI B;  5CAI A;  3M57 A;  1VQ8 A;  2DXC A;  4M77 G;  4MMK A;  2M1H A;  4C92 B;  4XK8 E;  3MEW A;  1PSF A;  1X01 A;  3FDR A;  3CCR A;  1BKB A;  3JB9 D;  4C92 C;  4N0A C;  2LQK A;  3F70 A;  4ZGJ B;  3HFO A;  2BKD N;  1YJ9 A;  3VYG A;  1QVG S;  5CK9 A;  3OYL A;  2ZGW A;  2JOY A;  3TRE A;  3CCJ A;  4FT2 A;  3G71 A;  1I4K 1;  3PMT A;  4MML A;  2RH2 A;  3OMC A;  3FJP A;  3CCQ A;  4M78 B;  3HFN A;  4PNO A;  4CRI A;  3JRZ A;  3GOX A;  4M78 C;  4OVA A;  3KXT A;  3CCS T;  5C6S A;  1KD1 C;  3CBM A;  5KCO A;  3G4S A;  3QXE B;  3JCM W;  3V7R A;  1XQH A;  4M7D F;  1M9S A;  2DAQ A;  4DQ2 A;  3CMA T;  1KQ2 A;  1KC8 C;  3OYJ A;  2WSE E;  3DKM A;  5CQY A;  1N27 A;  2YLB A;  1M1K U;  1VQP T;  3RES A;  4PJO C;  3GIB A;  3A8H B;  2D0Q B;  4O5V A;  2P0K A;  4KT0 E;  3G6E T;  3VYH B;  4ELZ C;  2RHX A;  3OYC A;  3JCM c;  3CCU A;  4M75 A;  3X24 B;  4C8Q A;  3OYD A;  4JRI A;  2EQK A;  4J5Y A;  4A4E A;  5GAM f;  3RUX A;  1VQ4 T;  3OMG A;  4ZGE B;  4C92 E;  1RI0 A;  4BI3 A;  3S3N A;  4ME7 A;  2XHC A;  3RKW A;  4L59 A;  2GQV A;  4M7A B;  2DVE A;  4A4H A;  2EJ9 A;  2RB6 A;  3CPF A;  2JN0 A;  2ZPF B;  3MEV A;  4FM4 B;  2FB7 A;  4NOY A;  1Y71 A;  4NS5 A;  4NL3 A;  1YIJ A;  2XDB A;  4RKU E;  4M7A C;  1O75 A;  3C4S A;  3JB9 I;  2RJC A;  3UWN A;  1HK9 A;  1I8F A;  5GAN 4;  2P0P A;  3C95 A;  2EYQ A;  4FU6 A;  3S6W A;  5FU7 C;  4M78 E;  2KAF A;  3GNG A;  1YIT T;  3VU3 C;  3E1S A;  2HBP A;  5J39 A;  3CXC S;  4HT9 A;  4F7U B;  4WF2 A;  4EPC A;  4LDW A;  3M53 A;  1V29 B;  1WPY A;  1XTD A;  2D9T A;  3JCM h;  3V8K A;  4EMK B;  3JCM J;  1JJ2 S;  1Y7X A;  2LVM A;  1VQM T;  4EMK C;  2M0O A;  2GFA A;  2E70 A;  3LYI A;  2EWN A;  1X6O A;  2DO3 A;  3CMA A;  2RJD A;  4M75 D;  2LQ8 A;  3OS0 A;  2DTO A;  4BE0 A;  3S3O A;  5GAO r;  3OW2 S;  2EQU A;  3GF5 A;  4C8Q D;  1DJ7 B;  3N5B B;  4XU3 A;  4A4F A;  4J6X A;  2I2L A;  3JSC A;  4Z02 A;  3WVD B;  4HCC A;  2QTX A;  1NZ9 A;  4YTL A;  5KE2 A;  2PQW A;  4ZGD B;  4J6W A;  2MF2 A;  2RO0 A;  2ZPH B;  2NLU A;  1QVG A;  3CC2 A;  5CKH A;  4C0F A;  3MP8 A;  4RG2 A;  2RHY A;  2YRV A;  1AHJ B;  2O4X A;  3M54 A;  3OBY A;  3QJ6 A;  4X9C A;  4C92 G;  4R56 A;  3GPL A;  1VQ4 A;  5GAN 7;  1KQS S;  1VQ8 T;  1NE8 A;  4GY5 A;  5CKF A;  5CIU A;  1JRI A;  4LDU A;  4RG8 A;  5FU6 B;  2G3R A;  5A0L A;  4M7A E;  2ZCF B;  3CCR T;  2BUD A;  3WXM B;  2CGH A;  2IG0 A;  1WQW A;  2ZPG B;  1MGQ A;  4DA4 A;  2XDP A;  3A8L B;  4QVD A;  1YJ9 T;  1Q7Y U;  2LT4 A;  2RHZ A;  1VQL A;  3E9F A;  3UT1 A;  5FRN A;  1EIF A;  3P8B B;  3JCM d;  4P5N A;  1BI2 A;  3C94 A;  5LJ5 g;  3OS1 A;  3QG1 A;  4PLI A;  2K5F A;  3G71 T;  4C5E A;  2KK4 A;  4JJN K;  1YIT A;  3O8V A;  2JNG A;  2LC4 A;  5GMK l;  1WGS A;  3QBY A;  4C5G A;  4M7A A;  4F7U E;  5DLQ E;  2QXF A;  3MP6 A;  3FEO A;  2K57 A;  5LJ5 f;  3INZ A;  2RJE A;  3G4S T;  5LJ3 f;  4M75 B;  3GNF B;  2QI2 A;  3L2Q A;  3LWH A;  4C8Q B;  4M75 C;  4JUV A;  2HNI A;  3QZ5 B;  2AHJ B;  1Q82 U;  4PJO D;  2L8D A;  4FSX A;  3HKS A;  4JS5 A;  4OB0 B;  4M7D A;  2QDY B;  3L2Z A;  3CC7 A;  3OS5 A;  2QQ9 A;  2MAM A;  3OSV A;  1VIE A;  4EMK A;  3A8G B;  1TH7 A;  1W4S A;  2EFI A;  3SD4 A;  4HKE A;  3OSS C;  3V8J A;  3CCU T;  1N8R U;  3CME A;  2HD0 A;  3RMQ A;  5GAM h;  2XU8 A;  2LDM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...