4M75C

Crystal structure of lsm1-7 complex
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
76
structure length
70
Chain Sequence
PLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYQSESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Rna binding protein
molecule keywords U6 snRNA-associated Sm-like protein Lsm1
total genus 13
structure length 70
sequence length 76
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m75C00
3FB9A 4JLIA 2FB7A 4M7AA 4NOYA 4M77A 4C8QB 4M75E 3BFMA 4X9CA 1MGQA 4MMKA 3RESA 4PJOB 4XU3A 2DTOA 3EFSA 3JCMV 2YHTA 4XTXA 2DTIA 5GANd 5GMKj 3V7CA 4PJOG 4C92F 5GAOr 5LJ3e 1I8FA 3QO3A 4M78G 4F7UF 2CGHA 2YLCA 4M7DF 4M75C 5GAOp 1Y96B 5GAN3 1BIAA 4M7DG 2HNIA 4M77G 4M7AD 5GAOn 4MMLA 5GANj 4M78B 4A53A 5GMKl 1KQ2A 4JRKA 4PJOF 1LOJA 5GAOq 3HSBA 1WQWA 5LJ5f 5GAOl 2I2LA 3AHUA 2DTHA 4C8QF 2RM4A 4M75A 3SWNA 1WPYA 2EJ9A 4C8QE 1N9SA 2DVEA 4XTWA 5GANf 4M7AF 1D3BB 1BIBA 2E64A 3RIRA 4EMKA 5GAMe 5CAIA 4PJOE 5LJ3d 3SWNC 3JCMb 4V2SA 2DXUA 4C92D 3JCMQ 4JRIA 1B34B 1I4K1 4OP0A 1WQ7A 5LJ5d 2DZCA 5GAN2 4EMHA 3JCMP 3PGGA 5LJ3h 3JCMc 4M7DB 4J6YA 2K57A 4M7DC 3L1AA 1HXDA 1KQ1A 2RB6A 4M77C 4XTYA 3JB9F 4M7AC 4C92B 4F7UA 4HT9A 3INZA 3BW1A 4PNOA 4NL3A 5I21A 3JB9H 2FYKA 3FIFA 4C8QC 4Y91A 5GAN4 3HFOA 1I5LA 5LJ5h 4N0AA 3QUIA 4F7UG 4HT8A 2QTXA 3L2ZA 2E41A 2DEQA 5DY9A 3V7SA 1N9RA 4C8QA 4M7AE 3JCMe 5LJ5g 4PJOA 4XTVA 2EJGA 3SB2A 5GAMj 4J5YA 3RKWA 4PJOD 3V8JA 2DJZA 4XU2A 4C92C 5GAMh 1U1TA 5GMKe 3BY7A 5GMKi 5LJ5j 5GANg 4A54A 4NL2A 3QSUA 5LJ3f 2RA2A 4QVCA 5GANh 3JB9J 4M77D 2VC8A 3JB9D 1M5Q1 5GAMf 4M7AG 4F7UE 4M75D 5GAN5 4XTZA 5GAN6 4C8QG 5GAN8 1H641 4M78A 4C92E 1HK9A 4RCBA 5GAOm 5LJ3j 4M7AB 1I81A 4M77B 3V8LA 3JCMg 1LJOA 2DZ9A 4HA8A 4M75B 5LJ5e 4M77F 4EMGA 3SWNB 2Y90A 4J6WA 3RUXA 2RD1A 4XTUA 4N0AC 2EWNA 2EJFA 2DKGA 3QHSA 2JN0A 3JCMh 4EMKB 4C92G 4WF2A 3HFNA 3JCMX 2YLBA 4EMKC 4XQ3A 5GMKh 2E1HA 1LNXA 4M7DE 3JB9I 1Y96A 4M78D 2VXEA 4X9DA 3JCMJ 3JCMd 4J6XA 5GANe 2E65A 3EFRA 4DQ2A 4JUVA 4M78E 4XU1A 2EAYA 3VU3C 4C92A 5LJ3g 4M7DD 1JRIA 4QVDA 5GAMg 1U1SA 3GIBA 1X01A 3FJPA 3JCMW 4M77E 2VXFA 4M75F 5GAMd 5GMKm 1TH7A 3V8KA 1D3BA 4RCCA 3RERA 2DXTA 3JCMf 1YCYA 3V7RA 3M4GA 1JBMA 1B34A 4PJOC 5GAN7 4M78F 1WNLA 4M7DA 2ZGWA 4M78C 3JB9G 4XU0A 4M75G 1M8VA 3RKXA 4F7UB 4C8QD 3RKYA 2E10A 3BDUA
chains in the Genus database with same CATH superfamily
3LYIA 3FB9A 3OYBA 3C94A 1TSFA 1BI0A 1EZZB 3CPWA 1BCOA 3VRZA 5A0LA 2JM9A 2FZKB 1I07A 3OSSC 1OV3A 2CGHA 3CD6A 4DEXA 3CCQT 2X4XA 1QVGS 1G2BA 4BDZA 1JJ2P 2ZPHB 1WQWA 4KGVB 1WHMA 4M75A 4CC4B 2XIDA 3PVQA 2P0KA 4LE9A 4HCZA 2LCCA 3CCVA 2COWA 1KD1R 3RIRA 4JS5A 2M9UA 1VOMA 4JDSA 3SWNC 2RK2A 1WHKA 2PU9B 3HP9A 4BI3A 3META 4EMHA 2DL5A 3JCMc 3PTAA 2O01E 3M59A 4M77C 3OS2A 3G71Q 4J9EA 2KK4A 1N8RR 4UC4A 1Q95G 1I5LA 4OMNA 1ZHIA 2X35A 1WHLA 4CC3A 2A36A 2FL7A 1UGVA 2DBMA 4E47A 3HTRA 3CCLQ 5CR2A 2LTOA 2PNIA 1OQKA 1Y7XA 1G3TA 4FL6A 5KH6A 2XHCA 4RG8A 1BU1A 5GAN6 3E9GA 1Q81C 1K73C 4HA8A 3H0HA 4LD9K 3EGUA 3JCMh 5C6SA 4EMKC 4DBFA 4PK4A 5IHNA 3KFVA 4QQ6A 2LJ3A 3A8MB 1R0CB 3UA7A 3JCMd 3FRNA 2CDTA 2KSSA 2RHXA 1X01A 1D0YA 1D0ZA 4OMLA 5GAMd 2WSFE 2ESWA 3QWXX 1M30A 3M0QA 2RQWA 2KI7A 1YHQT 4A4GA 4M78F 4OGEA 3EGXB 3FEOA 4XU0A 4HCBA 4KRTA 1BBZA 2RQVA 1K8AR 3RESA 2DTOA 1Q7YR 2JTMA 2BE9B 2LC4A 3OYYA 4J9CA 3QBYA 5HCKA 3RDVA 5FROA 2HNIA 4MMLA 2AT1B 2A0FB 3C95A 1KQ2A 4D6WA 1RAIB 5CKFA 2D0QB 3OBWA 3H0FA 5GANf 3J81E 3O5ZA 4KUDK 2L3PA 2EFIA 2NUZA 2E6ZA 2ZZDA 4AFQC 2DETA 3VS2A 2KMTA 1PWTA 4HXJA 4M7DC 4HT9A 4F7UA 4PNOA 3CXCP 2A3LA 4C0DC 3QUIA 4F7UG 4HT8A 2D1XA 2QAZA 2DEQA 4Z8AA 5CVIA 5KYUA 2AKLA 3EHRA 2EYYA 1YHQQ 1NE8A 5LJ5j 1MMGA 5IN1A 4PFZA 2VUBA 5GAN5 1QCNA 1H641 4P5NA 1HK9A 3ZBDA 4KGZB 3OS0A 1FMWA 4EMGA 2EYWA 5FWBA 2EVRA 2PZ1A 2KGTA 1VQ4A 3CMAT 4O5VA 1M1KR 2DL8A 1UUEA 4KULA 1BKBA 2RHZA 2X3WD 2ZAEA 5J26A 3R6NA 1VQPA 2ECZA 1H3ZA 2K79A 2XDDA 3QJ6A 1GBRA 5M9OA 4RCCA 2ATCB 4BE1A 3BE3A 3G6EQ 1X6OA 3OS5A 3OYCA 4KGXB 6AT1B 2LCLA 1XTDA 2CSQA 2JW4A 1K1ZA 4X34A 1WA7A 2HQHA 2V8IA 3ME9A 3U23A 4ZN1A 1VQMA 3JCMV 1MV0B 4CC2A 2E70A 3S6WA 4E7HA 2LDMA 2G3RA 1ZUUA 1VIEA 1MMDA 4M78G 2CP3A 2QQBA 2JUFA 3C12A 3QZ5B 1Y71A 5CIUA 1QKWA 2GQIA 4M78B 1P92A 1PHTA 3CPFA 1X75C 2DTHA 4JJNK 2RM4A 3SD4A 1WPYA 5FU6C 4K11A 2JMCA 2OTLT 2JS2A 4V2SA 1XOVA 4LXCA 2EYQA 4OP0A 1NYFA 1RUWA 2RB6A 3HRTA 5DM7R 2F5KA 2OTLA 1HSQA 3P8DA 2V26A 3JCMe 2X51A 4JS4A 4PJOD 2LQNA 2QXFA 4XU2A 2YUQA 1GFCA 2E3IA 3G6ET 1MUZA 2SEMA 4GBQA 3VS5A 3AT1B 4EIKA 3OYGA 1UGRB 1QMCA 2JVVA 3TREA 1SHFA 2GFUA 4E7JA 3EGDA 1AVZC 4RTTA 5ECAA 2EWNA 3DKMA 1NJIU 1J3TA 4VUBA 4FM4B 2DE0X 3PT9A 1KG1A 4M78E 2ZPEB 2G6FX 3FDRA 3OYJA 1V1CA 1GL5A 1AZEA 3H0IA 3MEAA 2QQ9A 3M9QA 4J83A 5GMKm 2DL7A 2J6KA 2DXTA 4FT2A 5KYYA 2OTLQ 3HPWA 2ZPIB 3CCVQ 3H9NA 3VUBA 5KYNA 1X6BA 1RAEB 5D7UA 4JJBA 4FCYA 2DYIA 4ELZC 2O31A 3VS1A 9ATCB 4E6RA 2QGFB 3DB4A 3I9QA 3M57A 1E6HA 1Q7YC 1HD3A 1WXTA 3OY9A 3QWYA 1IREB 1QP2A 1X69A 1GCPA 3CCQA 2BZ8A 2EQUA 1VQ5Q 5CQXA 3TVTA 1VQ7Q 4M7DF 5GAOp 1LOJA 3LH0A 1YP5A 2I2LA 2EQIA 3MO8A 2NLUA 2YRCA 5EG2A 1LVKA 1AEYA 1CSKA 4J9BA 2LT4A 3OB9A 4C0ZA 1VQLA 1Z9ZA 1GRIA 4OB2B 5A0GA 1KQ1A 3G4SA 2NUPA 3BW1A 1WZOA 2L3QA 2JXBA 1QKXA 2BZYA 3V7SA 2M1HA 1KC8R 1O9SA 1NG2A 5KYYB 2O88A 1NLPC 1YHQA 4MZTA 4NL2A 3BDLA 1AWOA 4M7AG 4D8KA 3CC2T 5GAOm 4L59A 3VRYA 4RKUE 3UPUA 3EG0A 3QHSA 2AK5A 1T0HA 1N8RC 3OYNA 5L23A 2CT3A 2KVQG 4M7DE 4M78D 1SRLA 3Q1JA 2EBPA 2HD0A 2LNVA 4A4FA 3MKDA 1JRIA 2RO0A 2J05A 3M4YA 1RI0A 4BUGA 4RTWA 4M4ZA 3V8KA 3I55T 3WVEB 4OMQA 1UFFA 2E12A 5A2QE 1B34A 1WHGA 1M8MA 4Y92A 4PFPA 1QVFS 4C8QD 2LQKA 1YNZA 3RKYA 1T0JA 2FPEA 3OW2S 2HMAA 1YCSB 2LJ0A 3UA6A 2KT1A 4PJOB 1BK2A 1YIJQ 2Z0WA 2YHTA 4WCIA 3CBPA 2EKHA 3H6ZA 5AYFA 1M9SA 1ZSGA 2QQSA 4NS5A 4PJOG 1YN8A 4PKCC 2F1LA 2OTJA 1BIAA 2LQWA 1KFZA 2KYBA 4A53A 5GMKl 5GJWB 3HSBA 2DIQA 2DXBA 2FZGB 2RI3A 1KHIA 3QPHA 2X3XD 1BI2A 1UG1A 1D3BB 1Q81R 1WFWA 2R5AA 2XU8A 1YJ9T 5GAN2 2DZCA 2EW3A 4M7DB 2YRVA 3IQLA 3JB9F 3EG3A 2HQXA 3HRUA 1OU9A 2ROTA 1VQNT 2E41A 1RLPC 1N9RA 5I2SA 3I55Q 4J9DA 2YSQA 4AFZC 3V8JA 2DJZA 4C92C 1QQJA 3RBBB 2COYA 1VIFA 2CUBA 2RQTA 1D0XA 3JRZA 4F7UE 1ZBXA 3CPWS 3OQ5A 2DJQA 2LQ8A 2W0ZA 4RCBA 2J06A 4M7AB 1BI3A 1AD5A 1X27A 1V76A 1WHJA 4M77F 2DRMA 3G7ZA 4LUDA 3GP8A 3HKSA 2RI2A 1S1NA 2HEQA 2DD5A 3S3NA 4IUQA 3PMIA 2K9GA 3PMTA 1JU5C 1KD1C 2EYXA 3TSWA 2AZVA 4QVZA 5HKCA 2BUDA 1Y0MA 1D3BA 2JTEA 3A8GB 5KCOA 1QLYA 4IUVA 1NM7A 1KQSA 1SHGA 3KXTA 4AMCA 3VJPA 3VS3A 2E10A 2NWMA 2QQRA 1UGSB 4TVRA 4PFOA 3LWIA 2M16A 3M54A 3EGDB 3QG1A 3UT1A 5LJ3e 1CKAA 1ZSZC 1ZA1B 1SRMA 4M7AD 2RK1A 2LP5A 3SWNA 1NLOC 1KC8C 2LJ1A 4Y28E 3WXMB 4PJOE 3JCMb 1MNEA 2DXUA 2GBQA 1OEBA 4ZGEB 4J6YA 4J7FA 5CKBA 3CMEA 1JJ2A 1SG5A 4KT0E 3OYLA 2DM1A 1IHVA 3CXCS 1JXMA 2FG0A 1PCXA 1UEBA 4ORZA 5GAMh 3UWNA 7AT1B 4QKUA 4FYYB 2QYZA 2MI6A 5GAN8 2RQUA 2C0TA 4LD6A 4M77B 5KYXB 3JCMg 1HYOA 2KROA 1JXOA 1PSEA 1IB8A 3A8HB 1QW1A 1FWZA 2JN0A 4RTXA 2XG8D 1IRXA 4PL6A 3OMCA 3H8ZA 1UHFA 2BZXA 3JB9I 5I22A 3JAME 1TU0B 4DQ2A 4QVDA 1IXDA 2H3JA 1YBYA 2K5LA 3QDRB 1K9MC 1K73R 2DL3A 4RUGA 3DLMA 2MPXC 2E4HA 1TH7A 5CKEA 1SKUB 4IUTA 1JO8A 4IIMA 1TG0A 2C0IA 4C0GA 4ZNXA 1ZSZB 4BY6B 3CQTA 3PFSA 2GQVA 1C1AA 3CCSA 1VQ9A 1AOJA 1MGQA 5I2MA 2QDLA 1M2VB 1Y07A 4C5IA 3OYEA 5IHIA 1Y96B 3LGFA 3X24B 3GLXA 4L6V5 4PJOF 1W1FA 5KYXA 2WSCE 2DO3A 5GAOl 3M53A 4XAXB 3O8VA 4C8QE 2XKOC 2EQMA 2F2VA 2E6NA 2F5TX 5IT9E 1VQ7A 4J9GA 1NEBA 1B34B 1RAFB 2E5KA 2QA4T 2M02A 2VVKA 3INZA 3CC4Q 4IURA 4C8QC 4F04B 2CZ0B 3M0PA 1ZQ1A 5GJVB 2CP2A 3FC3A 4OGCA 4FSXA 5D6YA 1M2OA 1U1TA 2QEXT 1T3SA 2RA2A 3VYGA 3JB9J 4ESRA 2HQEA 2HAXA 2DPPB 3LGLA 2ZCFB 3A8LB 4OVAA 1LJOA 3QJYA 3ZFJA 1M2VA 1QVPA 2R58A 3CC7A 4C92G 1VYTA 2CREA 3OYAA 1ZUKA 2E1HA 2VXEA 1IZ6A 2E65A 3CCUQ 4M7DD 4XU1A 2BIVA 3X26B 1BYMA 2XK0A 4ZN3A 1YITA 2L3SA 1VUBA 3JCMf 4BI8B 1WNLA 4M75G 3L2UA 4OMMA 3CC4T 1M1KC 4MZMA 1UTIA 4RG2A 4F14A 2ABLA 4C8QB 2KXDA 3BFMA 1MNDA 3L42A 5CKHA 3TEEA 1D09B 3PIPA 1ZA2B 1YITT 3GF5A 1N6AA 2KRSA 2M0OA 1R77A 2RJFA 1M90C 2XDBA 2QEXQ 4YTLA 2YLCA 5GAN3 5L8RE 4M77G 2LCSA 1KHCA 3CC4A 2JS0A 1BB9A 5IAYA 2JJ9A 5IHKA 1VQ6A 3EAEA 4F17A 2DFUA 2YRDA 1UHCA 1M27C 2D6FA 3OYMA 4E7IA 4DBRA 2CP7A 2VB6A 3QYHB 5LJ5d 3PGGA 2QASA 3EH1A 4DEYA 2K5IA 3EG9A 3R6OA 3HFOA 1V29B 4QW2A 5CKDA 3CCST 4RTZA 2O9SA 2FZCB 4D8DA 4GLKA 2F2WA 4N4IA 4JJDA 3REAB 5IXBA 1AZGB 2FPDA 5GMKi 3OBYA 2IG0A 3N5BB 1AWXA 3RR6A 4C0DB 5KYWA 2MWOA 1YWPA 2I0NA 1M5Q1 4MDXA 2X4YA 2RN8A 1VQ8Q 2J6OA 4LDYA 1GXIE 1BI1A 4OF1A 4M75B 1K76A 1VQNA 2Y90A 2DMOA 4PJLA 2FVUA 1MHNA 2DBKA 1LNXA 2FRWA 3G71T 2DLPA 2KNBB 3PE0A 4XK8E 1UDLA 2ENMA 3J80E 1QVGP 1Q86R 1T3LA 2K2VA 1VQKA 1BCMA 3CCLT 1VA7A 4B9WA 5GAN7 3OYDA 2KEAA 1VYVA 3E1SA 1M8VA 2DF6A 3URGA 2DNUA 3BDUA 4FSSA 4ME7A 2X4JA 3CCSQ 3MHXA 1TXQA 1FX7A 4MMKA 4JPBW 1VQKT 1NPPA 1SF9A 1D1AA 3CMAA 2VKNA 3NTHA 1PM3A 3CXCA 1YJNT 2LT1A 1QP3A 2ED1A 3MJXA 4IIOA 2XD0A 1VQ8T 3VYHB 1Q7YU 1S72T 1GCQC 3OS1A 1W6XA 3HRSA 3X25B 4AFUC 4A4HA 4C92D 8ATCB 2IPOB 3CC7Q 3EGXA 8AT1B 4OMPA 1Q82C 3P8BB 2VWFA 4N0AA 4KUIA 3M58A 4JRPA 5LJ5g 2HL3A 1R8OB 1UJ0A 2EJGA 4LDVA 1X2QA 4GLMA 4LN2A 4QVCA 3CCJA 1WXUA 2WACA 2VC8A 1JJ2S 1NPRA 4M75D 2VGNA 1NJIC 2RHUA 4QQDA 3V8LA 4N4GA 1FYNA 3CCLA 1VQKQ 2SRCA 1OPKA 1WYXA 1VQOT 1VQLT 5FU7C 1G3SA 1YI2Q 2L3RA 4JUVA 4PLIA 1U1SA 3CBMA 1KSWA 1M3CA 1M1GA 2LX9A 1OX9A 1S72Q 1OULA 1PKSA 3P8HA 1YCYA 3NGPA 3QXEB 5KYUB 1JBMA 1UE9A 2DK3A 4N4HA 3JB9G 4FU6A 2NUPB 1PD0A 4HCCA 3L2WA 4FW1A 2KAFA 4II1A 1G3YA 1QWFA 2AIRB 3CMAQ 2NYSA 4JZ3A 1XJWB 3MP1A 2D8HA 1AHJB 5HK3A 1IHWA 2X4WA 4M75C 2COZA 3QIIA 3WVDB 4C5GA 5HY6A 4AG2C 1OOTA 3QYGB 1PNJA 3MCAB 3L2RA 1QWEA 3CMET 1NYGA 2EJ9A 1K8AC 3UF4A 1PC0A 4PJJA 1WHHA 3HL8A 3I56A 1VQOQ 2C0OA 3I5RA 2ZPFB 5LJ3h 3X20B 1VQLQ 1H8KA 1X2KA 4PJNA 1YI2T 2JZ2A 2FYKA 1U3OA 4Y91A 5IXFA 5IH2A 2DXCA 4C8QA 5A0DA 4XTVA 2OAUA 2AKKA 3G6EA 4J8OA 3QSUA 3T9NA 2A7YA 4A54A 3CPWP 3ZL7C 1TUDA 4IUUA 5DLQE 2DAQA 2QA4A 4XTZA 1EFNA 1VQ8A 4M78A 2RQRA 2YWWA 3F70A 1NBEB 2QDYB 4J6WA 2RHYA 1SSHA 2EJFA 5FRNA 1LCKA 3A1PA 4Z89A 4BY6C 1RAGB 2XDPA 1Q86U 1D1BA 3S3OA 2PVGB 3GIBA 3FJPA 4M77E 4OB3B 3M5AA 1B7TA 3TU4K 3CMEQ 2MF2A 3VUZA 1VQ9T 2R57A 5CQYA 2D8JA 1NEGA 3CD6T 3OYKA 3RNJA 4RTUA 4F7UB 4E2FB 2LRQA 3I35A 2CP5A 5FLXE 1M3AA 5I11A 2FB7A 1Q82U 2KBTA 4XU3A 4B9XA 1OI1A 1SEMA 1G8XA 1SPKA 1X43A 2PUKB 3VS7A 2D9TA 2DVJA 4LNPA 5CK9A 3G4ST 2JMAA 2VYTA 2C06A 2YXYA 2DIGA 3EHQA 3OYHA 3CCVT 2L5QA 5LJ3d 1XQHA 1SSFA 1WIEA 3QDFA 2ED0A 1IGQA 1PRMC 1I5OB 1YJWA 2FEIA 2DD4A 2QG9B 3EFOA 2P0QA 1YJ9A 1B3QA 1I0CA 4OB1B 3OW2A 5LJ5h 5FW9A 2DA9A 5AT1B 1KQSP 1K4US 4JZ4A 1VQ9Q 1W2BS 1NZ9A 2CH4A 1YJWQ 1VQ4Q 2FHDA 3CD6Q 2IIMA 2OJ2A 3JB9D 1WJSA 5CO7A 4C92E 2CZ7B 2EQJA 3UATA 3SFMA 2W10A 3NHNA 3TSZA 3KBGA 4N0AC 1RI9A 2EGEA 4RTYA 5KE2A 1AWJA 2P0PA 4X9DA 2KE9A 3EFRA 2JTFA 5GAMg 3G4SQ 2PQWA 1FMKA 3I55A 3NPFA 3L2QA 2VXFA 2K2MA 2CSIA 4HVVA 3FLGA 3CCJQ 4X1VA 4ZTJA 3CCRT 1FXXA 2AHJB 1UJYA 4CI0C 2K3BA 3M56A 3I5SA 3CC2Q 4FYVB 3CCRA 3VS6A 1WDXA 4NOYA 1W70A 2Y4XA 1X6GA 1OU8A 2OX7A 3CCMA 2DTIA 3V7CA 4B6MA 2JNGA 1YJWT 1VQ4T 3QO3A 2F2XA 3FJ5A 2M51A 5GANj 2L8DA 2CUDA 2ZPGB 1EX4A 5LJ5f 1G5VA 4C8QF 2LX7A 4KBMB 1YIJA 4M7AF 3CCMQ 1N5ZA 4BB7A 4EMKA 1K9AA 2JM8A 4JRIA 1I4K1 3A98A 1EIFA 1VQOA 2CP6A 2YUOA 4NL3A 2EKOA 3E9FA 1TWBA 2YT6A 5DY9A 1UGQB 1YIJT 3ULRB 2CYZB 1PRLC 2QI2A 4J5YA 1OX8A 1KC8U 1ZBJA 1NJIR 3CCJT 1KJWA 5LJ3f 5GANh 3CCRQ 3G71A 1U06A 3QKJA 1N8RU 2DEUA 2LNHB 4C8QG 1MV3A 1ZSZA 3MPUB 3M0RA 1GBQA 1K9MU 2DX1A 2DZ9A 5CCAA 2A08A 2H3EB 1KQSS 4E7ZA 3RUXA 3NMZC 4E7KA 4J9IA 3OYIA 2K3YA 2DKGA 3JCMX 3HFNA 1RLQC 2YLBA 1YJ9Q 3MEUA 3L2VA 1VQ5T 3ER0A 1Y96A 3JCMJ 1VQ7T 2R5MA 3QZ9B 4J6XA 2LZ6B 1R0BG 2RNAA 3VU3C 1VQPT 2K4YA 2OAWA 2XICA 4HKEA 2GTJA 3CCMT 1W4SA 2AZSA 2A28A 1WJRA 3V7RA 3DLLA 1GFDA 4AG1C 1HJDA 4M78C 2KR3A 3VKIA 1JB0E 3EG2A 1QCOA 2RH2A 1E7OA 5C0MA 3NTIA 2RPNA 3VS4A 3LH5A 4XTXA 5GANd 2CZ6B 5GMKj 5GAOr 1WGSA 2BE7D 4J9FA 3M0SA 2CP0A 3PNWC 4Z02A 2NUTA 1TUGB 1YI2A 3H41A 3RMSA 1K8AU 4HVUA 4AT1B 2K7AA 2V8KA 4J7IA 4XTWA 3HHTB 2CS7A 1RAHB 1BIBA 1I1JA 4MZPA 1XNIA 3C4SA 4CC7A 2HKNA 1GCQA 2K57A 1HXDA 5D6XA 1W2BP 2MWPA 3JV3A 1PD1A 2JT4A 1VQPQ 3NFCA 1DJ7B 2QTXA 3L2ZA 2K3XA 2V1QA 3PIOA 4PJMA 2E5QA 3SB2A 3I56Q 1WXBA 3RKWA 4AFSC 2VGMA 2QK0A 1TOVA 1YJNA 2YDLA 4WTOB 4PLLA 3CC2A 1VQMT 4FW2A 3MEVA 2P4TA 3C0CA 1QVFA 4IUPA 4EPCA 5EC7A 2EQKA 2FPFA 4XQ3A 4F16A 4CRIA 3EFOB 3RMQA 2A37A 2EAYA 2KXCA 1OYXA 2NUTB 4OMFB 5HK0A 5LJ3g 2PUOB 1ACMB 3UDCA 2EYZA 4BD3A 1D1CA 2D0NA 3M4GA 1RADB 1WI7A 1W2BA 4JLGA 4FYXB 3SHWA 2WSEE 4M7DA 2ZGWA 4FYWB 1KIKA 4J9HA 3RKXA 2LVMA 2PVOB 2RI5A 1ZX6A 2CKKA 1VQNQ 4M77A 3EH2A 2XMFA 4DBQA 4M75E 4X9CA 1F1BB 2HZYA 3MEWA 2IVWA 3LX7A 3THKA 3ZEHA 1ABOA 3I56T 3E19A 4C92F 1Q81U 2V8JA 2ROLA 2BKDN 4F7UF 4KH1B 1FMVA 4JJCA 4ANJA 2B8AA 1PG5B 5GAOq 3E2UA 5FRMA 1VQMQ 1RL2A 4QT7A 5GAMe 1A0NB 4DA4A 3JCMQ 3MP6A 4RMOA 3D7SB 3JCMP 3OA6A 2HKQB 1OPLA 3JB9H 5I21A 5GAN4 2MK5A 3CCUA 3M0UA 5FU7B 5GAMj 2GCXA 2KY9A 2ZPBB 3CBOA 3S3MA 5GAMf 1TTHB 3EG1A 3GNFB 1KD1U 1VQ6Q 2DYBA 1ARKA 1O75A 1WJQA 2XI9A 4DOWA 3REBB 4EMKB 4C5EA 1ZLMA 2BTTA 3M55A 5LL6S 4R0KA 3A8OB 4ELYC 3LWHA 5GMKh 2QA4Q 1U5SA 1MMAA 4C92A 2B86A 2HCKA 2GNCA 1QVGA 3TCJA 4BE2A 3LW5E 4BDYA 3JCMW 1B07A 1VYUA 1RAAB 4Q5WA 3RERA 4E7SA 2MYSA 2E3HA 2F69A 4LDWA 1M1FA 1OZ3A 2J6FA 4JRQA 2OTJT 4LDXA 4ZGDB 2HSEB 4BE0A 2O4XB 2FO0A 2MIOA 3G1JA 4JLIA 4RTVA 2L2PA 3GBQA 1Q82R 4E7LA 2PTKA 5J39A 3CCUT 1JEGA 1QVFP 3VV0A 2HL5C 2GGRA 1YFNA 3OSVA 4L5GA 1VQ6T 2L0AA 3AHUA 2RF0A 1N9SA 2MCNA 1M3BA 2EIFA 4HCKA 1ZUYA 2HBPA 1N27A 3L1AA 2HDAA 4M7AC 2MOXA 1WX6A 4C92B 4A4KA 1H92A 3FIFA 3OMGA 2KQWA 2O9VA 3M0TA 2DILA 4O6JA 4C0FA 4ATOA 4PJOA 2EPDA 2PVDB 5GANg 2FRYA 1TUCA 2OTJQ 2RJEA 1K0SA 2CH4W 2RJDA 4LDUA 2DERA 2O4XA 2KYMA 3CCEA 2RJCA 2HBWA 3PVLA 2MAMA 1C6VX 5LJ3j 1I81A 2YUNA 3SDZA 3JSCA 5LJ5e 4FT4A 5D6WA 4FIBA 2RD1A 3CEYA 2O2OA 1C0MA 2L89A 2Y4YA 3CCEQ 2P84A 4DOVA 3GPLA 2QQAA 1TS9A 1U8RA 1ABQA 2M0YA 1Q86C 4DBHA 3ASKA 3KUFA 3OW2P 2K6DA 3X28B 1KK7A 4PJOC 2KDSA 1QCFA 4LUEA 5KYWB 4Z88A 1M90U 4MDWA 2H8HA 1UGPB 1YWOA 1OZ2A 4M7AA 2HSPA 2X9HA 1M1KU 1Y57A 4R55A 3EFSA 1K9MR 4QQGA 2VV5A 5FWCA 1I8FA 1PKTA 4A4EA 5J3BA 4M7DG 2CT4A 5GAOn 4R56A 2CZ1B 1UB4A 4JRKA 2DL4A 1S72A 5FU6B 4BI4A 1RACB 4BACA 1H3HA 2DVEA 1G3WA 2RHIA 4A63B 1AT1B 4HVWA 2P4RA 2E64A 5CAIA 1K73U 2KRNA 2RMOA 4ZTFA 1WQ7A 2DRKA 2GTOA 3CCET 1UECA 4XTYA 2QTVA 1LPLA 3NTKA 5KE3A 1K0XA 4IKFA 1RABB 1MMNA 5KCHA 2V1RA 4KH0B 3SEMA 4ZGJB 1G83A 4M7AE 2YUPA 4GY5A 5GMKe 3BY7A 1M90R 2QGGA 1YJNQ 4M77D 1E6GA 3CCQQ 3GOXA 1VQ5A 4OB0B 2KRMA 2VASA 3A5ZB 2KT8A 3SWNB 1WLPB 4XTUA 1YITQ 2JOYA 2QEXA 1M4ZA 4WF2A 3OYFA 2EGCA 3CC7T 1AWWA 1IGUA 3TQ7P 3MP8A 5GANe 3J7AF 3LLRA 2K5FA 4M75F 4EDUA 1Z9QA 3GNGA 2OI3A 2MMPA 2J7IA 5DLOA 4C5HA 1IO6A 1JQQA 2GFAA 2GF7A 3VS0A 2EGAA 1PSFA 3DB3A 2LMJA 3EG9B 1CKBA 4OMOA
chains in the Genus database with same CATH topology
3LYIA 3FB9A 5C0MA 3OW2S 3OYBA 3NTIA 4ME7A 2X4JA 3C94A 3CPWA 1BI0A 3MHXA 1FX7A 4MMKA 4PJOB 1VQKT 1NPPA 5A0LA 2YHTA 4XTXA 3CBPA 3H6ZA 5GANd 2CZ6B 5AYFA 5GMKj 1M9SA 2QQSA 4NS5A 4PJOG 3CMAA 3OSSC 5GAOr 1WGSA 3NTHA 4PKCC 2CGHA 3PNWC 4Z02A 3CD6A 3CXCA 2OTJA 1BIAA 1YJNT 3CCQT 2LT1A 2X4XA 1QP3A 4A53A 5GMKl 1QVGS 1YI2A 2XD0A 4BDZA 3RMSA 1K8AU 2ZPHB 2DIQA 1WQWA 2DXBA 3VYHB 1VQ8T 3HSBA 4M75A 2RI3A 2V8KA 1KHIA 3QPHA 1S72T 1Q7YU 4J7IA 2XIDA 1BI2A 4XTWA 2CS7A 2P0KA 3HHTB 2LCCA 4HCZA 1D3BB 1BIBA 3RIRA 3X25B 3HRSA 2M9UA 3OS1A 4JS5A 4JDSA 3SWNC 2RK2A 4MZPA 4A4HA 2R5AA 1XNIA 2XU8A 3C4SA 2PU9B 4C92D 1YJ9T 3HP9A 4BI3A 3META 2DZCA 5GAN2 4EMHA 4M7DB 2YRVA 3JCMc 3PTAA 2O01E 3M59A 2K57A 1HXDA 4M77C 5D6XA 3OS2A 3JB9F 1Q82C 2KK4A 2MWPA 2HQXA 3HRUA 3P8BB 4UC4A 1I5LA 1VQNT 3NFCA 4N0AA 1DJ7B 4KUIA 2QTXA 3L2ZA 1ZHIA 3M58A 2K3XA 2E41A 2X35A 2FL7A 1N9RA 4JRPA 3PIOA 5I2SA 5LJ5g 4E47A 1R8OB 2E5QA 2EJGA 4LDVA 3SB2A 3RKWA 3V8JA 2DJZA 4C92C 2VGMA 2LTOA 5CR2A 1VIFA 4QVCA 1Y7XA 1YJNA 1G3TA 3CCJA 4FL6A 2WACA 5KH6A 2VC8A 3JRZA 2XHCA 1JJ2S 4F7UE 1ZBXA 1NPRA 4M75D 2VGNA 4RG8A 1NJIC 2RHUA 5GAN6 3CPWS 3OQ5A 2LQ8A 3E9GA 4RCBA 4PLLA 4QQDA 4M7AB 3CC2A 1VQMT 1Q81C 3V8LA 1BI3A 3MEVA 4N4GA 1K73C 2P4TA 4HA8A 4M77F 1QVFA 4IUPA 4EPCA 3CCLA 2EQKA 4LD9K 3G7ZA 3JCMh 5C6SA 3GP8A 3HKSA 4EMKC 4XQ3A 1VQOT 4QQ6A 3A8MB 2RI2A 4CRIA 1VQLT 5FU7C 1G3SA 2DD5A 3JCMd 3RMQA 2L3RA 3S3NA 4IUQA 3PMIA 3FRNA 4JUVA 3PMTA 2EAYA 4OMFB 1OYXA 5HK0A 5LJ3g 4PLIA 2KSSA 2PUOB 1KD1C 1U1SA 3CBMA 2RHXA 1X01A 3CCVA 1M1GA 2LX9A 4QVZA 3UDCA 5HKCA 4BD3A 2BUDA 5GAMd 2WSFE 1D3BA 3P8HA 1YCYA 3QXEB 3M4GA 3A8GB 5KCOA 1YHQT 4JLGA 1W2BA 1JBMA 4A4GA 4M78F 2DK3A 2WSEE 4N4HA 4OGEA 4M7DA 2ZGWA 3FEOA 3JB9G 4XU0A 4IUVA 4HCBA 4FU6A 3RKXA 4HCCA 2LVMA 3L2WA 1KQSA 2PVOB 2RI5A 3KXTA 3VJPA 2E10A 2CKKA 4M77A 2QQRA 1UGSB 4TVRA 4M75E 4X9CA 2KAFA 2M16A 4II1A 3LWIA 3RESA 3MEWA 2IVWA 3LX7A 1G3YA 2DTOA 3M54A 3ZEHA 3QG1A 2JTMA 2LC4A 3OYYA 3I56T 3E19A 3UT1A 4C92F 5LJ3e 3MP1A 2V8JA 1Q81U 2BKDN 1AHJB 5HK3A 3QBYA 4F7UF 2X4WA 4M75C 5FROA 2HNIA 3QIIA 2RK1A 3WVDB 4MMLA 5HY6A 4C5GA 3C95A 2B8AA 4M7AD 1KQ2A 4D6WA 3QYGB 5GAOq 5CKFA 5FRMA 2D0QB 3MCAB 3OBWA 1RL2A 3L2RA 3SWNA 3CMET 1K8AC 2EJ9A 5GANf 3J81E 1KC8C 4Y28E 4KUDK 5GAMe 3WXMB 4PJOE 2EFIA 2E6ZA 2ZZDA 3JCMb 4DA4A 3HL8A 2DXUA 3I56A 3JCMQ 3MP6A 4RMOA 3JCMP 2ZPFB 5LJ3h 3X20B 2KMTA 4ZGEB 4J6YA 4M7DC 4J7FA 3OA6A 1YI2T 4HT9A 4F7UA 2JZ2A 4PNOA 3JB9H 5I21A 2FYKA 5GAN4 5CKBA 4Y91A 2A3LA 4C0DC 3CCUA 3CMEA 3QUIA 2DXCA 4F7UG 4KT0E 1JJ2A 4HT8A 3OYLA 2DEQA 4C8QA 5A0DA 3CXCS 5CVIA 4XTVA 2OAUA 1UEBA 5FU7B 5GAMj 2GCXA 3G6EA 5GAMh 4J8OA 1NE8A 2KY9A 3UWNA 2ZPBB 3T9NA 2A7YA 4A54A 5IN1A 5LJ5j 3QSUA 4IUUA 3CBOA 5DLQE 2DAQA 2MI6A 3S3MA 5GAMf 2QA4A 2VUBA 5GAN5 4XTZA 5GAN8 1H641 1VQ8A 4M78A 4P5NA 1HK9A 3GNFB 3ZBDA 1KD1U 4LD6A 4M77B 3OS0A 3F70A 3JCMg 2QDYB 4EMGA 1O75A 1PSEA 4J6WA 3A8HB 1QW1A 1WJQA 2RHYA 2XI9A 4DOWA 1FWZA 2EJFA 4C5EA 2JN0A 4EMKB 1VQ4A 5FRNA 2XG8D 3CMAT 4O5VA 4PL6A 3M55A 5LL6S 4ELYC 3A8OB 3OMCA 3LWHA 3H8ZA 4KULA 1BKBA 5GMKh 3JB9I 2RHZA 5J26A 3JAME 4BY6C 1VQPA 2XDPA 4DQ2A 4C92A 1Q86U 3S3OA 2PVGB 1QVGA 3TCJA 4QVDA 3LW5E 4BE2A 3GIBA 2H3JA 1YBYA 4BDYA 2K5LA 3FJPA 3QDRB 1H3ZA 1K9MC 3JCMW 4M77E 4OB3B 2XDDA 3M5AA 3DLMA 3TU4K 3QJ6A 1TH7A 4Q5WA 2MF2A 5CKEA 4RCCA 4IUTA 3VUZA 5M9OA 1VQ9T 2R57A 3RERA 5CQYA 3CD6T 2F69A 4LDWA 1M1FA 1OZ3A 3OYKA 4JRQA 2OTJT 4BE1A 4LDXA 4ZGDB 1X6OA 4BE0A 3OS5A 3OYCA 4C0GA 2O4XB 4F7UB 2LRQA 2LCLA 1XTDA 5FLXE 4X34A 4JLIA 2FB7A 3PFSA 4BY6B 2GQVA 2V8IA 3ME9A 3CCSA 1Q82U 1VQ9A 1MGQA 4ZN1A 1VQMA 5I2MA 4XU3A 3JCMV 4B9XA 1OI1A 2E70A 3S6WA 4E7HA 2LDMA 1Y07A 2G3RA 4C5IA 4E7LA 1VIEA 3OYEA 4M78G 2QQBA 3C12A 1Y96B 2JUFA 3QZ5B 1Y71A 5J39A 2PUKB 3CCUT 5CIUA 3LGFA 3X24B 2D9TA 3GLXA 3VV0A 4L6V5 1P92A 4M78B 5CK9A 4PJOF 3G4ST 3CPFA 2WSCE 2VYTA 2DO3A 3OSVA 1X75C 3M53A 2DTHA 4L5GA 2RM4A 5GAOl 4JJNK 2C06A 1VQ6T 3SD4A 3AHUA 4XAXB 1WPYA 3O8VA 5FU6C 1N9SA 4C8QE 2XKOC 2DIGA 2OTLT 3OYHA 2EIFA 3CCVT 2L5QA 5LJ3d 1XQHA 1XOVA 2E6NA 1SSFA 2EQMA 2F5TX 5IT9E 4V2SA 2EYQA 1VQ7A 2HBPA 1B34B 4OP0A 1YJWA 2DD4A 1YJ9A 2P0QA 1N27A 2QA4T 3L1AA 2RB6A 3HRTA 4M7AC 4OB1B 3OW2A 4C92B 3INZA 4A4KA 5DM7R 3FIFA 3OMGA 4IURA 4C8QC 5LJ5h 2F5KA 2KQWA 4O6JA 2OTLA 2CZ0B 4C0FA 4ATOA 3P8DA 3JCMe 1ZQ1A 4PJOA 4JS4A 3FC3A 1W2BS 1NZ9A 2PVDB 4PJOD 4OGCA 4FSXA 2QXFA 4XU2A 5D6YA 5GANg 1U1TA 2FHDA 2QEXT 2RJEA 2RA2A 3VYGA 3JB9J 2RJDA 4LDUA 3G6ET 2O4XA 3JB9D 3CCEA 2HQEA 2RJCA 1WJSA 2HAXA 5CO7A 2DPPB 3LGLA 4C92E 2CZ7B 2MAMA 5LJ3j 2EQJA 1I81A 2ZCFB 3SDZA 3SFMA 3OYGA 1UGRB 3A8LB 4OVAA 1LJOA 3JSCA 2JVVA 4FT4A 5LJ5e 5D6WA 3TREA 3QJYA 2GFUA 4FIBA 3ZFJA 2RD1A 3KBGA 4E7JA 4N0AC 3CEYA 1QVPA 2EWNA 2R58A 3DKMA 1NJIU 3CC7A 4C92G 5KE2A 3OYAA 2L89A 2P0PA 4FM4B 2Y4YA 4VUBA 2E1HA 4DOVA 4X9DA 2VXEA 3PT9A 1KG1A 3GPLA 2QQAA 1IZ6A 2E65A 3EFRA 4M7DD 4M78E 4XU1A 2JTFA 2BIVA 1U8RA 2ZPEB 3FDRA 3X26B 3OYJA 5GAMg 2PQWA 1BYMA 1Q86C 3MEAA 2XK0A 4ZN3A 2QQ9A 3I55A 3L2QA 2VXFA 3M9QA 4J83A 1YITA 5GMKm 3ASKA 1VUBA 2DXTA 3JCMf 3KUFA 4FT2A 3X28B 3HPWA 2ZPIB 3VUBA 3FLGA 4BI8B 4ZTJA 4PJOC 2KDSA 1WNLA 3CCRT 1FXXA 2AHJB 4M75G 4CI0C 4ELZC 3M56A 1M90U 3CCRA 3L2UA 4MDWA 1M1KC 3CC4T 4MZMA 3DB4A 1UGPB 4RG2A 4M7AA 1OZ2A 4NOYA 3M57A 1Q7YC 4C8QB 3BFMA 1M1KU 4R55A 2Y4XA 3L42A 5CKHA 3TEEA 3PIPA 3EFSA 3OY9A 1YITT 1IREB 3GF5A 1N6AA 4QQGA 3CCMA 1QP2A 2DTIA 2M0OA 2VV5A 3V7CA 2RJFA 1I8FA 2JNGA 3CCQA 1M90C 1YJWT 2EQUA 1VQ4T 5CQXA 2XDBA 3QO3A 4YTLA 4A4EA 2YLCA 4M7DF 5GAOp 5GAN3 5J3BA 5L8RE 4M7DG 4M77G 5GAOn 5GANj 2L8DA 4R56A 2CZ1B 1UB4A 1KHCA 2ZPGB 4JRKA 1LOJA 3CC4A 3LH0A 5IAYA 2I2LA 3MO8A 5LJ5f 4C8QF 1S72A 1G5VA 2NLUA 5EG2A 5FU6B 1VQ6A 4KBMB 4BI4A 3EAEA 4BACA 1YIJA 4M7AF 2DVEA 1G3WA 2RHIA 2E64A 4BB7A 4EMKA 5CAIA 1K73U 3OYMA 2D6FA 4E7IA 2LT4A 3OB9A 4ZTFA 4JRIA 1I4K1 3QYHB 1WQ7A 1EIFA 4C0ZA 5LJ5d 1VQOA 1VQLA 3PGGA 3CCET 4OB2B 5A0GA 1KQ1A 4XTYA 3G4SA 2K5IA 3R6OA 3BW1A 3NTKA 5KE3A 4NL3A 2EKOA 1V29B 3E9FA 3HFOA 4QW2A 4IKFA 5CKDA 3CCST 5KCHA 5DY9A 4GLKA 3V7SA 2M1HA 1UGQB 4ZGJB 4M7AE 1YIJT 1O9SA 4N4IA 2CYZB 2QI2A 4GY5A 4J5YA 1KC8U 5GMKe 3BY7A 5GMKi 4MZTA 1YHQA 3OBYA 3BDLA 2IG0A 4NL2A 3N5BB 5LJ3f 4C0DB 3CCJT 5GANh 3G71A 2MWOA 4M77D 3QKJA 1M5Q1 4M7AG 1N8RU 1VQ5A 2X4YA 3GOXA 4MDXA 4OB0B 4C8QG 3CC2T 5GAOm 4LDYA 1GXIE 1BI1A 4OF1A 1K9MU 2DZ9A 4L59A 4M75B 3A5ZB 5CCAA 1KQSS 1VQNA 3SWNB 2Y90A 3RUXA 4E7KA 4RKUE 2FVUA 3UPUA 4XTUA 3OYIA 2K3YA 2JOYA 3QHSA 2QEXA 2DKGA 1M4ZA 3JCMX 4WF2A 3HFNA 3OYNA 2YLBA 3OYFA 1N8RC 3MEUA 3CC7T 1MHNA 3L2VA 1VQ5T 3ER0A 1LNXA 2KVQG 4M7DE 1Y96A 4M78D 3G71T 3JCMJ 1VQ7T 2R5MA 3MP8A 3QZ9B 4J6XA 5GANe 3Q1JA 2HD0A 2LNVA 4XK8E 3VU3C 4A4FA 1VQPT 3J7AF 1JRIA 2K4YA 2RO0A 3LLRA 3M4YA 1RI0A 2K5FA 3J80E 4BUGA 2K2VA 2XICA 4M75F 4EDUA 1VQKA 3V8KA 3I55T 3WVEB 4HKEA 3CCMT 1W4SA 3GNGA 3CCLT 1WJRA 3V7RA 2E12A 2MMPA 5A2QE 3DLLA 4B9WA 1B34A 5DLOA 5GAN7 4C5HA 2GFAA 3OYDA 2GF7A 3E1SA 4M78C 1PSFA 3DB3A 1M8VA 1QVFS 3VKIA 4C8QD 1JB0E 2LQKA 3URGA 3RKYA 2RH2A 3BDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB9 A;  4JLI A;  2FB7 A;  4M7A A;  4NOY A;  4M77 A;  4C8Q B;  4M75 E;  3BFM A;  4X9C A;  1MGQ A;  4MMK A;  3RES A;  4PJO B;  4XU3 A;  2DTO A;  3EFS A;  3JCM V;  2YHT A;  4XTX A;  2DTI A;  5GAN d;  5GMK j;  3V7C A;  4PJO G;  4C92 F;  5GAO r;  5LJ3 e;  1I8F A;  3QO3 A;  4M78 G;  4F7U F;  2CGH A;  2YLC A;  4M7D F;  4M75 C;  5GAO p;  1Y96 B;  5GAN 3;  1BIA A;  4M7D G;  2HNI A;  4M77 G;  4M7A D;  5GAO n;  4MML A;  5GAN j;  4M78 B;  4A53 A;  5GMK l;  1KQ2 A;  4JRK A;  4PJO F;  1LOJ A;  5GAO q;  3HSB A;  1WQW A;  5LJ5 f;  5GAO l;  2I2L A;  3AHU A;  2DTH A;  4C8Q F;  2RM4 A;  4M75 A;  3SWN A;  1WPY A;  2EJ9 A;  4C8Q E;  1N9S A;  2DVE A;  4XTW A;  5GAN f;  4M7A F;  1D3B B;  1BIB A;  2E64 A;  3RIR A;  4EMK A;  5GAM e;  5CAI A;  4PJO E;  5LJ3 d;  3SWN C;  3JCM b;  4V2S A;  2DXU A;  4C92 D;  3JCM Q;  4JRI A;  1B34 B;  1I4K 1;  4OP0 A;  1WQ7 A;  5LJ5 d;  2DZC A;  5GAN 2;  4EMH A;  3JCM P;  3PGG A;  5LJ3 h;  3JCM c;  4M7D B;  4J6Y A;  2K57 A;  4M7D C;  3L1A A;  1HXD A;  1KQ1 A;  2RB6 A;  4M77 C;  4XTY A;  3JB9 F;  4M7A C;  4C92 B;  4F7U A;  4HT9 A;  3INZ A;  3BW1 A;  4PNO A;  4NL3 A;  5I21 A;  3JB9 H;  2FYK A;  3FIF A;  4C8Q C;  4Y91 A;  5GAN 4;  3HFO A;  1I5L A;  5LJ5 h;  4N0A A;  3QUI A;  4F7U G;  4HT8 A;  2QTX A;  3L2Z A;  2E41 A;  2DEQ A;  5DY9 A;  3V7S A;  1N9R A;  4C8Q A;  4M7A E;  3JCM e;  5LJ5 g;  4PJO A;  4XTV A;  2EJG A;  3SB2 A;  5GAM j;  4J5Y A;  3RKW A;  4PJO D;  3V8J A;  2DJZ A;  4XU2 A;  4C92 C;  5GAM h;  1U1T A;  5GMK e;  3BY7 A;  5GMK i;  5LJ5 j;  5GAN g;  4A54 A;  4NL2 A;  3QSU A;  5LJ3 f;  2RA2 A;  4QVC A;  5GAN h;  3JB9 J;  4M77 D;  2VC8 A;  3JB9 D;  1M5Q 1;  5GAM f;  4M7A G;  4F7U E;  4M75 D;  5GAN 5;  4XTZ A;  5GAN 6;  4C8Q G;  5GAN 8;  1H64 1;  4M78 A;  4C92 E;  1HK9 A;  4RCB A;  5GAO m;  5LJ3 j;  4M7A B;  1I81 A;  4M77 B;  3V8L A;  3JCM g;  1LJO A;  2DZ9 A;  4HA8 A;  4M75 B;  5LJ5 e;  4M77 F;  4EMG A;  3SWN B;  2Y90 A;  4J6W A;  3RUX A;  2RD1 A;  4XTU A;  4N0A C;  2EWN A;  2EJF A;  2DKG A;  3QHS A;  2JN0 A;  3JCM h;  4EMK B;  4C92 G;  4WF2 A;  3HFN A;  3JCM X;  2YLB A;  4EMK C;  4XQ3 A;  5GMK h;  2E1H A;  1LNX A;  4M7D E;  3JB9 I;  1Y96 A;  4M78 D;  2VXE A;  4X9D A;  3JCM J;  3JCM d;  4J6X A;  5GAN e;  2E65 A;  3EFR A;  4DQ2 A;  4JUV A;  4M78 E;  4XU1 A;  2EAY A;  3VU3 C;  4C92 A;  5LJ3 g;  4M7D D;  1JRI A;  4QVD A;  5GAM g;  1U1S A;  3GIB A;  1X01 A;  3FJP A;  3JCM W;  4M77 E;  2VXF A;  4M75 F;  5GAM d;  5GMK m;  1TH7 A;  3V8K A;  1D3B A;  4RCC A;  3RER A;  2DXT A;  3JCM f;  1YCY A;  3V7R A;  3M4G A;  1JBM A;  1B34 A;  4PJO C;  5GAN 7;  4M78 F;  1WNL A;  4M7D A;  2ZGW A;  4M78 C;  3JB9 G;  4XU0 A;  4M75 G;  1M8V A;  3RKX A;  4F7U B;  4C8Q D;  3RKY A;  2E10 A;  3BDU A; 
#chains in the Genus database with same CATH topology
 3LYI A;  3FB9 A;  3OYB A;  3C94 A;  1TSF A;  1BI0 A;  1EZZ B;  3CPW A;  1BCO A;  3VRZ A;  5A0L A;  2JM9 A;  2FZK B;  1I07 A;  3OSS C;  1OV3 A;  2CGH A;  3CD6 A;  4DEX A;  3CCQ T;  2X4X A;  1QVG S;  1G2B A;  4BDZ A;  1JJ2 P;  2ZPH B;  1WQW A;  4KGV B;  1WHM A;  4M75 A;  4CC4 B;  2XID A;  3PVQ A;  2P0K A;  4LE9 A;  4HCZ A;  2LCC A;  3CCV A;  2COW A;  1KD1 R;  3RIR A;  4JS5 A;  2M9U A;  1VOM A;  4JDS A;  3SWN C;  2RK2 A;  1WHK A;  2PU9 B;  3HP9 A;  4BI3 A;  3MET A;  4EMH A;  2DL5 A;  3JCM c;  3PTA A;  2O01 E;  3M59 A;  4M77 C;  3OS2 A;  3G71 Q;  4J9E A;  2KK4 A;  1N8R R;  4UC4 A;  1Q95 G;  1I5L A;  4OMN A;  1ZHI A;  2X35 A;  1WHL A;  4CC3 A;  2A36 A;  2FL7 A;  1UGV A;  2DBM A;  4E47 A;  3HTR A;  3CCL Q;  5CR2 A;  2LTO A;  2PNI A;  1OQK A;  1Y7X A;  1G3T A;  4FL6 A;  5KH6 A;  2XHC A;  4RG8 A;  1BU1 A;  5GAN 6;  3E9G A;  1Q81 C;  1K73 C;  4HA8 A;  3H0H A;  4LD9 K;  3EGU A;  3JCM h;  5C6S A;  4EMK C;  4DBF A;  4PK4 A;  5IHN A;  3KFV A;  4QQ6 A;  2LJ3 A;  3A8M B;  1R0C B;  3UA7 A;  3JCM d;  3FRN A;  2CDT A;  2KSS A;  2RHX A;  1X01 A;  1D0Y A;  1D0Z A;  4OML A;  5GAM d;  2WSF E;  2ESW A;  3QWX X;  1M30 A;  3M0Q A;  2RQW A;  2KI7 A;  1YHQ T;  4A4G A;  4M78 F;  4OGE A;  3EGX B;  3FEO A;  4XU0 A;  4HCB A;  4KRT A;  1BBZ A;  2RQV A;  1K8A R;  3RES A;  2DTO A;  1Q7Y R;  2JTM A;  2BE9 B;  2LC4 A;  3OYY A;  4J9C A;  3QBY A;  5HCK A;  3RDV A;  5FRO A;  2HNI A;  4MML A;  2AT1 B;  2A0F B;  3C95 A;  1KQ2 A;  4D6W A;  1RAI B;  5CKF A;  2D0Q B;  3OBW A;  3H0F A;  5GAN f;  3J81 E;  3O5Z A;  4KUD K;  2L3P A;  2EFI A;  2NUZ A;  2E6Z A;  2ZZD A;  4AFQ C;  2DET A;  3VS2 A;  2KMT A;  1PWT A;  4HXJ A;  4M7D C;  4HT9 A;  4F7U A;  4PNO A;  3CXC P;  2A3L A;  4C0D C;  3QUI A;  4F7U G;  4HT8 A;  2D1X A;  2QAZ A;  2DEQ A;  4Z8A A;  5CVI A;  5KYU A;  2AKL A;  3EHR A;  2EYY A;  1YHQ Q;  1NE8 A;  5LJ5 j;  1MMG A;  5IN1 A;  4PFZ A;  2VUB A;  5GAN 5;  1QCN A;  1H64 1;  4P5N A;  1HK9 A;  3ZBD A;  4KGZ B;  3OS0 A;  1FMW A;  4EMG A;  2EYW A;  5FWB A;  2EVR A;  2PZ1 A;  2KGT A;  1VQ4 A;  3CMA T;  4O5V A;  1M1K R;  2DL8 A;  1UUE A;  4KUL A;  1BKB A;  2RHZ A;  2X3W D;  2ZAE A;  5J26 A;  3R6N A;  1VQP A;  2ECZ A;  1H3Z A;  2K79 A;  2XDD A;  3QJ6 A;  1GBR A;  5M9O A;  4RCC A;  2ATC B;  4BE1 A;  3BE3 A;  3G6E Q;  1X6O A;  3OS5 A;  3OYC A;  4KGX B;  6AT1 B;  2LCL A;  1XTD A;  2CSQ A;  2JW4 A;  1K1Z A;  4X34 A;  1WA7 A;  2HQH A;  2V8I A;  3ME9 A;  3U23 A;  4ZN1 A;  1VQM A;  3JCM V;  1MV0 B;  4CC2 A;  2E70 A;  3S6W A;  4E7H A;  2LDM A;  2G3R A;  1ZUU A;  1VIE A;  1MMD A;  4M78 G;  2CP3 A;  2QQB A;  2JUF A;  3C12 A;  3QZ5 B;  1Y71 A;  5CIU A;  1QKW A;  2GQI A;  4M78 B;  1P92 A;  1PHT A;  3CPF A;  1X75 C;  2DTH A;  4JJN K;  2RM4 A;  3SD4 A;  1WPY A;  5FU6 C;  4K11 A;  2JMC A;  2OTL T;  2JS2 A;  4V2S A;  1XOV A;  4LXC A;  2EYQ A;  4OP0 A;  1NYF A;  1RUW A;  2RB6 A;  3HRT A;  5DM7 R;  2F5K A;  2OTL A;  1HSQ A;  3P8D A;  2V26 A;  3JCM e;  2X51 A;  4JS4 A;  4PJO D;  2LQN A;  2QXF A;  4XU2 A;  2YUQ A;  1GFC A;  2E3I A;  3G6E T;  1MUZ A;  2SEM A;  4GBQ A;  3VS5 A;  3AT1 B;  4EIK A;  3OYG A;  1UGR B;  1QMC A;  2JVV A;  3TRE A;  1SHF A;  2GFU A;  4E7J A;  3EGD A;  1AVZ C;  4RTT A;  5ECA A;  2EWN A;  3DKM A;  1NJI U;  1J3T A;  4VUB A;  4FM4 B;  2DE0 X;  3PT9 A;  1KG1 A;  4M78 E;  2ZPE B;  2G6F X;  3FDR A;  3OYJ A;  1V1C A;  1GL5 A;  1AZE A;  3H0I A;  3MEA A;  2QQ9 A;  3M9Q A;  4J83 A;  5GMK m;  2DL7 A;  2J6K A;  2DXT A;  4FT2 A;  5KYY A;  2OTL Q;  3HPW A;  2ZPI B;  3CCV Q;  3H9N A;  3VUB A;  5KYN A;  1X6B A;  1RAE B;  5D7U A;  4JJB A;  4FCY A;  2DYI A;  4ELZ C;  2O31 A;  3VS1 A;  9ATC B;  4E6R A;  2QGF B;  3DB4 A;  3I9Q A;  3M57 A;  1E6H A;  1Q7Y C;  1HD3 A;  1WXT A;  3OY9 A;  3QWY A;  1IRE B;  1QP2 A;  1X69 A;  1GCP A;  3CCQ A;  2BZ8 A;  2EQU A;  1VQ5 Q;  5CQX A;  3TVT A;  1VQ7 Q;  4M7D F;  5GAO p;  1LOJ A;  3LH0 A;  1YP5 A;  2I2L A;  2EQI A;  3MO8 A;  2NLU A;  2YRC A;  5EG2 A;  1LVK A;  1AEY A;  1CSK A;  4J9B A;  2LT4 A;  3OB9 A;  4C0Z A;  1VQL A;  1Z9Z A;  1GRI A;  4OB2 B;  5A0G A;  1KQ1 A;  3G4S A;  2NUP A;  3BW1 A;  1WZO A;  2L3Q A;  2JXB A;  1QKX A;  2BZY A;  3V7S A;  2M1H A;  1KC8 R;  1O9S A;  1NG2 A;  5KYY B;  2O88 A;  1NLP C;  1YHQ A;  4MZT A;  4NL2 A;  3BDL A;  1AWO A;  4M7A G;  4D8K A;  3CC2 T;  5GAO m;  4L59 A;  3VRY A;  4RKU E;  3UPU A;  3EG0 A;  3QHS A;  2AK5 A;  1T0H A;  1N8R C;  3OYN A;  5L23 A;  2CT3 A;  2KVQ G;  4M7D E;  4M78 D;  1SRL A;  3Q1J A;  2EBP A;  2HD0 A;  2LNV A;  4A4F A;  3MKD A;  1JRI A;  2RO0 A;  2J05 A;  3M4Y A;  1RI0 A;  4BUG A;  4RTW A;  4M4Z A;  3V8K A;  3I55 T;  3WVE B;  4OMQ A;  1UFF A;  2E12 A;  5A2Q E;  1B34 A;  1WHG A;  1M8M A;  4Y92 A;  4PFP A;  1QVF S;  4C8Q D;  2LQK A;  1YNZ A;  3RKY A;  1T0J A;  2FPE A;  3OW2 S;  2HMA A;  1YCS B;  2LJ0 A;  3UA6 A;  2KT1 A;  4PJO B;  1BK2 A;  1YIJ Q;  2Z0W A;  2YHT A;  4WCI A;  3CBP A;  2EKH A;  3H6Z A;  5AYF A;  1M9S A;  1ZSG A;  2QQS A;  4NS5 A;  4PJO G;  1YN8 A;  4PKC C;  2F1L A;  2OTJ A;  1BIA A;  2LQW A;  1KFZ A;  2KYB A;  4A53 A;  5GMK l;  5GJW B;  3HSB A;  2DIQ A;  2DXB A;  2FZG B;  2RI3 A;  1KHI A;  3QPH A;  2X3X D;  1BI2 A;  1UG1 A;  1D3B B;  1Q81 R;  1WFW A;  2R5A A;  2XU8 A;  1YJ9 T;  5GAN 2;  2DZC A;  2EW3 A;  4M7D B;  2YRV A;  3IQL A;  3JB9 F;  3EG3 A;  2HQX A;  3HRU A;  1OU9 A;  2ROT A;  1VQN T;  2E41 A;  1RLP C;  1N9R A;  5I2S A;  3I55 Q;  4J9D A;  2YSQ A;  4AFZ C;  3V8J A;  2DJZ A;  4C92 C;  1QQJ A;  3RBB B;  2COY A;  1VIF A;  2CUB A;  2RQT A;  1D0X A;  3JRZ A;  4F7U E;  1ZBX A;  3CPW S;  3OQ5 A;  2DJQ A;  2LQ8 A;  2W0Z A;  4RCB A;  2J06 A;  4M7A B;  1BI3 A;  1AD5 A;  1X27 A;  1V76 A;  1WHJ A;  4M77 F;  2DRM A;  3G7Z A;  4LUD A;  3GP8 A;  3HKS A;  2RI2 A;  1S1N A;  2HEQ A;  2DD5 A;  3S3N A;  4IUQ A;  3PMI A;  2K9G A;  3PMT A;  1JU5 C;  1KD1 C;  2EYX A;  3TSW A;  2AZV A;  4QVZ A;  5HKC A;  2BUD A;  1Y0M A;  1D3B A;  2JTE A;  3A8G B;  5KCO A;  1QLY A;  4IUV A;  1NM7 A;  1KQS A;  1SHG A;  3KXT A;  4AMC A;  3VJP A;  3VS3 A;  2E10 A;  2NWM A;  2QQR A;  1UGS B;  4TVR A;  4PFO A;  3LWI A;  2M16 A;  3M54 A;  3EGD B;  3QG1 A;  3UT1 A;  5LJ3 e;  1CKA A;  1ZSZ C;  1ZA1 B;  1SRM A;  4M7A D;  2RK1 A;  2LP5 A;  3SWN A;  1NLO C;  1KC8 C;  2LJ1 A;  4Y28 E;  3WXM B;  4PJO E;  3JCM b;  1MNE A;  2DXU A;  2GBQ A;  1OEB A;  4ZGE B;  4J6Y A;  4J7F A;  5CKB A;  3CME A;  1JJ2 A;  1SG5 A;  4KT0 E;  3OYL A;  2DM1 A;  1IHV A;  3CXC S;  1JXM A;  2FG0 A;  1PCX A;  1UEB A;  4ORZ A;  5GAM h;  3UWN A;  7AT1 B;  4QKU A;  4FYY B;  2QYZ A;  2MI6 A;  5GAN 8;  2RQU A;  2C0T A;  4LD6 A;  4M77 B;  5KYX B;  3JCM g;  1HYO A;  2KRO A;  1JXO A;  1PSE A;  1IB8 A;  3A8H B;  1QW1 A;  1FWZ A;  2JN0 A;  4RTX A;  2XG8 D;  1IRX A;  4PL6 A;  3OMC A;  3H8Z A;  1UHF A;  2BZX A;  3JB9 I;  5I22 A;  3JAM E;  1TU0 B;  4DQ2 A;  4QVD A;  1IXD A;  2H3J A;  1YBY A;  2K5L A;  3QDR B;  1K9M C;  1K73 R;  2DL3 A;  4RUG A;  3DLM A;  2MPX C;  2E4H A;  1TH7 A;  5CKE A;  1SKU B;  4IUT A;  1JO8 A;  4IIM A;  1TG0 A;  2C0I A;  4C0G A;  4ZNX A;  1ZSZ B;  4BY6 B;  3CQT A;  3PFS A;  2GQV A;  1C1A A;  3CCS A;  1VQ9 A;  1AOJ A;  1MGQ A;  5I2M A;  2QDL A;  1M2V B;  1Y07 A;  4C5I A;  3OYE A;  5IHI A;  1Y96 B;  3LGF A;  3X24 B;  3GLX A;  4L6V 5;  4PJO F;  1W1F A;  5KYX A;  2WSC E;  2DO3 A;  5GAO l;  3M53 A;  4XAX B;  3O8V A;  4C8Q E;  2XKO C;  2EQM A;  2F2V A;  2E6N A;  2F5T X;  5IT9 E;  1VQ7 A;  4J9G A;  1NEB A;  1B34 B;  1RAF B;  2E5K A;  2QA4 T;  2M02 A;  2VVK A;  3INZ A;  3CC4 Q;  4IUR A;  4C8Q C;  4F04 B;  2CZ0 B;  3M0P A;  1ZQ1 A;  5GJV B;  2CP2 A;  3FC3 A;  4OGC A;  4FSX A;  5D6Y A;  1M2O A;  1U1T A;  2QEX T;  1T3S A;  2RA2 A;  3VYG A;  3JB9 J;  4ESR A;  2HQE A;  2HAX A;  2DPP B;  3LGL A;  2ZCF B;  3A8L B;  4OVA A;  1LJO A;  3QJY A;  3ZFJ A;  1M2V A;  1QVP A;  2R58 A;  3CC7 A;  4C92 G;  1VYT A;  2CRE A;  3OYA A;  1ZUK A;  2E1H A;  2VXE A;  1IZ6 A;  2E65 A;  3CCU Q;  4M7D D;  4XU1 A;  2BIV A;  3X26 B;  1BYM A;  2XK0 A;  4ZN3 A;  1YIT A;  2L3S A;  1VUB A;  3JCM f;  4BI8 B;  1WNL A;  4M75 G;  3L2U A;  4OMM A;  3CC4 T;  1M1K C;  4MZM A;  1UTI A;  4RG2 A;  4F14 A;  2ABL A;  4C8Q B;  2KXD A;  3BFM A;  1MND A;  3L42 A;  5CKH A;  3TEE A;  1D09 B;  3PIP A;  1ZA2 B;  1YIT T;  3GF5 A;  1N6A A;  2KRS A;  2M0O A;  1R77 A;  2RJF A;  1M90 C;  2XDB A;  2QEX Q;  4YTL A;  2YLC A;  5GAN 3;  5L8R E;  4M77 G;  2LCS A;  1KHC A;  3CC4 A;  2JS0 A;  1BB9 A;  5IAY A;  2JJ9 A;  5IHK A;  1VQ6 A;  3EAE A;  4F17 A;  2DFU A;  2YRD A;  1UHC A;  1M27 C;  2D6F A;  3OYM A;  4E7I A;  4DBR A;  2CP7 A;  2VB6 A;  3QYH B;  5LJ5 d;  3PGG A;  2QAS A;  3EH1 A;  4DEY A;  2K5I A;  3EG9 A;  3R6O A;  3HFO A;  1V29 B;  4QW2 A;  5CKD A;  3CCS T;  4RTZ A;  2O9S A;  2FZC B;  4D8D A;  4GLK A;  2F2W A;  4N4I A;  4JJD A;  3REA B;  5IXB A;  1AZG B;  2FPD A;  5GMK i;  3OBY A;  2IG0 A;  3N5B B;  1AWX A;  3RR6 A;  4C0D B;  5KYW A;  2MWO A;  1YWP A;  2I0N A;  1M5Q 1;  4MDX A;  2X4Y A;  2RN8 A;  1VQ8 Q;  2J6O A;  4LDY A;  1GXI E;  1BI1 A;  4OF1 A;  4M75 B;  1K76 A;  1VQN A;  2Y90 A;  2DMO A;  4PJL A;  2FVU A;  1MHN A;  2DBK A;  1LNX A;  2FRW A;  3G71 T;  2DLP A;  2KNB B;  3PE0 A;  4XK8 E;  1UDL A;  2ENM A;  3J80 E;  1QVG P;  1Q86 R;  1T3L A;  2K2V A;  1VQK A;  1BCM A;  3CCL T;  1VA7 A;  4B9W A;  5GAN 7;  3OYD A;  2KEA A;  1VYV A;  3E1S A;  1M8V A;  2DF6 A;  3URG A;  2DNU A;  3BDU A;  4FSS A;  4ME7 A;  2X4J A;  3CCS Q;  3MHX A;  1TXQ A;  1FX7 A;  4MMK A;  4JPB W;  1VQK T;  1NPP A;  1SF9 A;  1D1A A;  3CMA A;  2VKN A;  3NTH A;  1PM3 A;  3CXC A;  1YJN T;  2LT1 A;  1QP3 A;  2ED1 A;  3MJX A;  4IIO A;  2XD0 A;  1VQ8 T;  3VYH B;  1Q7Y U;  1S72 T;  1GCQ C;  3OS1 A;  1W6X A;  3HRS A;  3X25 B;  4AFU C;  4A4H A;  4C92 D;  8ATC B;  2IPO B;  3CC7 Q;  3EGX A;  8AT1 B;  4OMP A;  1Q82 C;  3P8B B;  2VWF A;  4N0A A;  4KUI A;  3M58 A;  4JRP A;  5LJ5 g;  2HL3 A;  1R8O B;  1UJ0 A;  2EJG A;  4LDV A;  1X2Q A;  4GLM A;  4LN2 A;  4QVC A;  3CCJ A;  1WXU A;  2WAC A;  2VC8 A;  1JJ2 S;  1NPR A;  4M75 D;  2VGN A;  1NJI C;  2RHU A;  4QQD A;  3V8L A;  4N4G A;  1FYN A;  3CCL A;  1VQK Q;  2SRC A;  1OPK A;  1WYX A;  1VQO T;  1VQL T;  5FU7 C;  1G3S A;  1YI2 Q;  2L3R A;  4JUV A;  4PLI A;  1U1S A;  3CBM A;  1KSW A;  1M3C A;  1M1G A;  2LX9 A;  1OX9 A;  1S72 Q;  1OUL A;  1PKS A;  3P8H A;  1YCY A;  3NGP A;  3QXE B;  5KYU B;  1JBM A;  1UE9 A;  2DK3 A;  4N4H A;  3JB9 G;  4FU6 A;  2NUP B;  1PD0 A;  4HCC A;  3L2W A;  4FW1 A;  2KAF A;  4II1 A;  1G3Y A;  1QWF A;  2AIR B;  3CMA Q;  2NYS A;  4JZ3 A;  1XJW B;  3MP1 A;  2D8H A;  1AHJ B;  5HK3 A;  1IHW A;  2X4W A;  4M75 C;  2COZ A;  3QII A;  3WVD B;  4C5G A;  5HY6 A;  4AG2 C;  1OOT A;  3QYG B;  1PNJ A;  3MCA B;  3L2R A;  1QWE A;  3CME T;  1NYG A;  2EJ9 A;  1K8A C;  3UF4 A;  1PC0 A;  4PJJ A;  1WHH A;  3HL8 A;  3I56 A;  1VQO Q;  2C0O A;  3I5R A;  2ZPF B;  5LJ3 h;  3X20 B;  1VQL Q;  1H8K A;  1X2K A;  4PJN A;  1YI2 T;  2JZ2 A;  2FYK A;  1U3O A;  4Y91 A;  5IXF A;  5IH2 A;  2DXC A;  4C8Q A;  5A0D A;  4XTV A;  2OAU A;  2AKK A;  3G6E A;  4J8O A;  3QSU A;  3T9N A;  2A7Y A;  4A54 A;  3CPW P;  3ZL7 C;  1TUD A;  4IUU A;  5DLQ E;  2DAQ A;  2QA4 A;  4XTZ A;  1EFN A;  1VQ8 A;  4M78 A;  2RQR A;  2YWW A;  3F70 A;  1NBE B;  2QDY B;  4J6W A;  2RHY A;  1SSH A;  2EJF A;  5FRN A;  1LCK A;  3A1P A;  4Z89 A;  4BY6 C;  1RAG B;  2XDP A;  1Q86 U;  1D1B A;  3S3O A;  2PVG B;  3GIB A;  3FJP A;  4M77 E;  4OB3 B;  3M5A A;  1B7T A;  3TU4 K;  3CME Q;  2MF2 A;  3VUZ A;  1VQ9 T;  2R57 A;  5CQY A;  2D8J A;  1NEG A;  3CD6 T;  3OYK A;  3RNJ A;  4RTU A;  4F7U B;  4E2F B;  2LRQ A;  3I35 A;  2CP5 A;  5FLX E;  1M3A A;  5I11 A;  2FB7 A;  1Q82 U;  2KBT A;  4XU3 A;  4B9X A;  1OI1 A;  1SEM A;  1G8X A;  1SPK A;  1X43 A;  2PUK B;  3VS7 A;  2D9T A;  2DVJ A;  4LNP A;  5CK9 A;  3G4S T;  2JMA A;  2VYT A;  2C06 A;  2YXY A;  2DIG A;  3EHQ A;  3OYH A;  3CCV T;  2L5Q A;  5LJ3 d;  1XQH A;  1SSF A;  1WIE A;  3QDF A;  2ED0 A;  1IGQ A;  1PRM C;  1I5O B;  1YJW A;  2FEI A;  2DD4 A;  2QG9 B;  3EFO A;  2P0Q A;  1YJ9 A;  1B3Q A;  1I0C A;  4OB1 B;  3OW2 A;  5LJ5 h;  5FW9 A;  2DA9 A;  5AT1 B;  1KQS P;  1K4U S;  4JZ4 A;  1VQ9 Q;  1W2B S;  1NZ9 A;  2CH4 A;  1YJW Q;  1VQ4 Q;  2FHD A;  3CD6 Q;  2IIM A;  2OJ2 A;  3JB9 D;  1WJS A;  5CO7 A;  4C92 E;  2CZ7 B;  2EQJ A;  3UAT A;  3SFM A;  2W10 A;  3NHN A;  3TSZ A;  3KBG A;  4N0A C;  1RI9 A;  2EGE A;  4RTY A;  5KE2 A;  1AWJ A;  2P0P A;  4X9D A;  2KE9 A;  3EFR A;  2JTF A;  5GAM g;  3G4S Q;  2PQW A;  1FMK A;  3I55 A;  3NPF A;  3L2Q A;  2VXF A;  2K2M A;  2CSI A;  4HVV A;  3FLG A;  3CCJ Q;  4X1V A;  4ZTJ A;  3CCR T;  1FXX A;  2AHJ B;  1UJY A;  4CI0 C;  2K3B A;  3M56 A;  3I5S A;  3CC2 Q;  4FYV B;  3CCR A;  3VS6 A;  1WDX A;  4NOY A;  1W70 A;  2Y4X A;  1X6G A;  1OU8 A;  2OX7 A;  3CCM A;  2DTI A;  3V7C A;  4B6M A;  2JNG A;  1YJW T;  1VQ4 T;  3QO3 A;  2F2X A;  3FJ5 A;  2M51 A;  5GAN j;  2L8D A;  2CUD A;  2ZPG B;  1EX4 A;  5LJ5 f;  1G5V A;  4C8Q F;  2LX7 A;  4KBM B;  1YIJ A;  4M7A F;  3CCM Q;  1N5Z A;  4BB7 A;  4EMK A;  1K9A A;  2JM8 A;  4JRI A;  1I4K 1;  3A98 A;  1EIF A;  1VQO A;  2CP6 A;  2YUO A;  4NL3 A;  2EKO A;  3E9F A;  1TWB A;  2YT6 A;  5DY9 A;  1UGQ B;  1YIJ T;  3ULR B;  2CYZ B;  1PRL C;  2QI2 A;  4J5Y A;  1OX8 A;  1KC8 U;  1ZBJ A;  1NJI R;  3CCJ T;  1KJW A;  5LJ3 f;  5GAN h;  3CCR Q;  3G71 A;  1U06 A;  3QKJ A;  1N8R U;  2DEU A;  2LNH B;  4C8Q G;  1MV3 A;  1ZSZ A;  3MPU B;  3M0R A;  1GBQ A;  1K9M U;  2DX1 A;  2DZ9 A;  5CCA A;  2A08 A;  2H3E B;  1KQS S;  4E7Z A;  3RUX A;  3NMZ C;  4E7K A;  4J9I A;  3OYI A;  2K3Y A;  2DKG A;  3JCM X;  3HFN A;  1RLQ C;  2YLB A;  1YJ9 Q;  3MEU A;  3L2V A;  1VQ5 T;  3ER0 A;  1Y96 A;  3JCM J;  1VQ7 T;  2R5M A;  3QZ9 B;  4J6X A;  2LZ6 B;  1R0B G;  2RNA A;  3VU3 C;  1VQP T;  2K4Y A;  2OAW A;  2XIC A;  4HKE A;  2GTJ A;  3CCM T;  1W4S A;  2AZS A;  2A28 A;  1WJR A;  3V7R A;  3DLL A;  1GFD A;  4AG1 C;  1HJD A;  4M78 C;  2KR3 A;  3VKI A;  1JB0 E;  3EG2 A;  1QCO A;  2RH2 A;  1E7O A;  5C0M A;  3NTI A;  2RPN A;  3VS4 A;  3LH5 A;  4XTX A;  5GAN d;  2CZ6 B;  5GMK j;  5GAO r;  1WGS A;  2BE7 D;  4J9F A;  3M0S A;  2CP0 A;  3PNW C;  4Z02 A;  2NUT A;  1TUG B;  1YI2 A;  3H41 A;  3RMS A;  1K8A U;  4HVU A;  4AT1 B;  2K7A A;  2V8K A;  4J7I A;  4XTW A;  3HHT B;  2CS7 A;  1RAH B;  1BIB A;  1I1J A;  4MZP A;  1XNI A;  3C4S A;  4CC7 A;  2HKN A;  1GCQ A;  2K57 A;  1HXD A;  5D6X A;  1W2B P;  2MWP A;  3JV3 A;  1PD1 A;  2JT4 A;  1VQP Q;  3NFC A;  1DJ7 B;  2QTX A;  3L2Z A;  2K3X A;  2V1Q A;  3PIO A;  4PJM A;  2E5Q A;  3SB2 A;  3I56 Q;  1WXB A;  3RKW A;  4AFS C;  2VGM A;  2QK0 A;  1TOV A;  1YJN A;  2YDL A;  4WTO B;  4PLL A;  3CC2 A;  1VQM T;  4FW2 A;  3MEV A;  2P4T A;  3C0C A;  1QVF A;  4IUP A;  4EPC A;  5EC7 A;  2EQK A;  2FPF A;  4XQ3 A;  4F16 A;  4CRI A;  3EFO B;  3RMQ A;  2A37 A;  2EAY A;  2KXC A;  1OYX A;  2NUT B;  4OMF B;  5HK0 A;  5LJ3 g;  2PUO B;  1ACM B;  3UDC A;  2EYZ A;  4BD3 A;  1D1C A;  2D0N A;  3M4G A;  1RAD B;  1WI7 A;  1W2B A;  4JLG A;  4FYX B;  3SHW A;  2WSE E;  4M7D A;  2ZGW A;  4FYW B;  1KIK A;  4J9H A;  3RKX A;  2LVM A;  2PVO B;  2RI5 A;  1ZX6 A;  2CKK A;  1VQN Q;  4M77 A;  3EH2 A;  2XMF A;  4DBQ A;  4M75 E;  4X9C A;  1F1B B;  2HZY A;  3MEW A;  2IVW A;  3LX7 A;  3THK A;  3ZEH A;  1ABO A;  3I56 T;  3E19 A;  4C92 F;  1Q81 U;  2V8J A;  2ROL A;  2BKD N;  4F7U F;  4KH1 B;  1FMV A;  4JJC A;  4ANJ A;  2B8A A;  1PG5 B;  5GAO q;  3E2U A;  5FRM A;  1VQM Q;  1RL2 A;  4QT7 A;  5GAM e;  1A0N B;  4DA4 A;  3JCM Q;  3MP6 A;  4RMO A;  3D7S B;  3JCM P;  3OA6 A;  2HKQ B;  1OPL A;  3JB9 H;  5I21 A;  5GAN 4;  2MK5 A;  3CCU A;  3M0U A;  5FU7 B;  5GAM j;  2GCX A;  2KY9 A;  2ZPB B;  3CBO A;  3S3M A;  5GAM f;  1TTH B;  3EG1 A;  3GNF B;  1KD1 U;  1VQ6 Q;  2DYB A;  1ARK A;  1O75 A;  1WJQ A;  2XI9 A;  4DOW A;  3REB B;  4EMK B;  4C5E A;  1ZLM A;  2BTT A;  3M55 A;  5LL6 S;  4R0K A;  3A8O B;  4ELY C;  3LWH A;  5GMK h;  2QA4 Q;  1U5S A;  1MMA A;  4C92 A;  2B86 A;  2HCK A;  2GNC A;  1QVG A;  3TCJ A;  4BE2 A;  3LW5 E;  4BDY A;  3JCM W;  1B07 A;  1VYU A;  1RAA B;  4Q5W A;  3RER A;  4E7S A;  2MYS A;  2E3H A;  2F69 A;  4LDW A;  1M1F A;  1OZ3 A;  2J6F A;  4JRQ A;  2OTJ T;  4LDX A;  4ZGD B;  2HSE B;  4BE0 A;  2O4X B;  2FO0 A;  2MIO A;  3G1J A;  4JLI A;  4RTV A;  2L2P A;  3GBQ A;  1Q82 R;  4E7L A;  2PTK A;  5J39 A;  3CCU T;  1JEG A;  1QVF P;  3VV0 A;  2HL5 C;  2GGR A;  1YFN A;  3OSV A;  4L5G A;  1VQ6 T;  2L0A A;  3AHU A;  2RF0 A;  1N9S A;  2MCN A;  1M3B A;  2EIF A;  4HCK A;  1ZUY A;  2HBP A;  1N27 A;  3L1A A;  2HDA A;  4M7A C;  2MOX A;  1WX6 A;  4C92 B;  4A4K A;  1H92 A;  3FIF A;  3OMG A;  2KQW A;  2O9V A;  3M0T A;  2DIL A;  4O6J A;  4C0F A;  4ATO A;  4PJO A;  2EPD A;  2PVD B;  5GAN g;  2FRY A;  1TUC A;  2OTJ Q;  2RJE A;  1K0S A;  2CH4 W;  2RJD A;  4LDU A;  2DER A;  2O4X A;  2KYM A;  3CCE A;  2RJC A;  2HBW A;  3PVL A;  2MAM A;  1C6V X;  5LJ3 j;  1I81 A;  2YUN A;  3SDZ A;  3JSC A;  5LJ5 e;  4FT4 A;  5D6W A;  4FIB A;  2RD1 A;  3CEY A;  2O2O A;  1C0M A;  2L89 A;  2Y4Y A;  3CCE Q;  2P84 A;  4DOV A;  3GPL A;  2QQA A;  1TS9 A;  1U8R A;  1ABQ A;  2M0Y A;  1Q86 C;  4DBH A;  3ASK A;  3KUF A;  3OW2 P;  2K6D A;  3X28 B;  1KK7 A;  4PJO C;  2KDS A;  1QCF A;  4LUE A;  5KYW B;  4Z88 A;  1M90 U;  4MDW A;  2H8H A;  1UGP B;  1YWO A;  1OZ2 A;  4M7A A;  2HSP A;  2X9H A;  1M1K U;  1Y57 A;  4R55 A;  3EFS A;  1K9M R;  4QQG A;  2VV5 A;  5FWC A;  1I8F A;  1PKT A;  4A4E A;  5J3B A;  4M7D G;  2CT4 A;  5GAO n;  4R56 A;  2CZ1 B;  1UB4 A;  4JRK A;  2DL4 A;  1S72 A;  5FU6 B;  4BI4 A;  1RAC B;  4BAC A;  1H3H A;  2DVE A;  1G3W A;  2RHI A;  4A63 B;  1AT1 B;  4HVW A;  2P4R A;  2E64 A;  5CAI A;  1K73 U;  2KRN A;  2RMO A;  4ZTF A;  1WQ7 A;  2DRK A;  2GTO A;  3CCE T;  1UEC A;  4XTY A;  2QTV A;  1LPL A;  3NTK A;  5KE3 A;  1K0X A;  4IKF A;  1RAB B;  1MMN A;  5KCH A;  2V1R A;  4KH0 B;  3SEM A;  4ZGJ B;  1G83 A;  4M7A E;  2YUP A;  4GY5 A;  5GMK e;  3BY7 A;  1M90 R;  2QGG A;  1YJN Q;  4M77 D;  1E6G A;  3CCQ Q;  3GOX A;  1VQ5 A;  4OB0 B;  2KRM A;  2VAS A;  3A5Z B;  2KT8 A;  3SWN B;  1WLP B;  4XTU A;  1YIT Q;  2JOY A;  2QEX A;  1M4Z A;  4WF2 A;  3OYF A;  2EGC A;  3CC7 T;  1AWW A;  1IGU A;  3TQ7 P;  3MP8 A;  5GAN e;  3J7A F;  3LLR A;  2K5F A;  4M75 F;  4EDU A;  1Z9Q A;  3GNG A;  2OI3 A;  2MMP A;  2J7I A;  5DLO A;  4C5H A;  1IO6 A;  1JQQ A;  2GFA A;  2GF7 A;  3VS0 A;  2EGA A;  1PSF A;  3DB3 A;  2LMJ A;  3EG9 B;  1CKB A;  4OMO A; 
#chains in the Genus database with same CATH homology
 3LYI A;  3FB9 A;  5C0M A;  3OW2 S;  3OYB A;  3NTI A;  4ME7 A;  2X4J A;  3C94 A;  3CPW A;  1BI0 A;  3MHX A;  1FX7 A;  4MMK A;  4PJO B;  1VQK T;  1NPP A;  5A0L A;  2YHT A;  4XTX A;  3CBP A;  3H6Z A;  5GAN d;  2CZ6 B;  5AYF A;  5GMK j;  1M9S A;  2QQS A;  4NS5 A;  4PJO G;  3CMA A;  3OSS C;  5GAO r;  1WGS A;  3NTH A;  4PKC C;  2CGH A;  3PNW C;  4Z02 A;  3CD6 A;  3CXC A;  2OTJ A;  1BIA A;  1YJN T;  3CCQ T;  2LT1 A;  2X4X A;  1QP3 A;  4A53 A;  5GMK l;  1QVG S;  1YI2 A;  2XD0 A;  4BDZ A;  3RMS A;  1K8A U;  2ZPH B;  2DIQ A;  1WQW A;  2DXB A;  3VYH B;  1VQ8 T;  3HSB A;  4M75 A;  2RI3 A;  2V8K A;  1KHI A;  3QPH A;  1S72 T;  1Q7Y U;  4J7I A;  2XID A;  1BI2 A;  4XTW A;  2CS7 A;  2P0K A;  3HHT B;  2LCC A;  4HCZ A;  1D3B B;  1BIB A;  3RIR A;  3X25 B;  3HRS A;  2M9U A;  3OS1 A;  4JS5 A;  4JDS A;  3SWN C;  2RK2 A;  4MZP A;  4A4H A;  2R5A A;  1XNI A;  2XU8 A;  3C4S A;  2PU9 B;  4C92 D;  1YJ9 T;  3HP9 A;  4BI3 A;  3MET A;  2DZC A;  5GAN 2;  4EMH A;  4M7D B;  2YRV A;  3JCM c;  3PTA A;  2O01 E;  3M59 A;  2K57 A;  1HXD A;  4M77 C;  5D6X A;  3OS2 A;  3JB9 F;  1Q82 C;  2KK4 A;  2MWP A;  2HQX A;  3HRU A;  3P8B B;  4UC4 A;  1I5L A;  1VQN T;  3NFC A;  4N0A A;  1DJ7 B;  4KUI A;  2QTX A;  3L2Z A;  1ZHI A;  3M58 A;  2K3X A;  2E41 A;  2X35 A;  2FL7 A;  1N9R A;  4JRP A;  3PIO A;  5I2S A;  5LJ5 g;  4E47 A;  1R8O B;  2E5Q A;  2EJG A;  4LDV A;  3SB2 A;  3RKW A;  3V8J A;  2DJZ A;  4C92 C;  2VGM A;  2LTO A;  5CR2 A;  1VIF A;  4QVC A;  1Y7X A;  1YJN A;  1G3T A;  3CCJ A;  4FL6 A;  2WAC A;  5KH6 A;  2VC8 A;  3JRZ A;  2XHC A;  1JJ2 S;  4F7U E;  1ZBX A;  1NPR A;  4M75 D;  2VGN A;  4RG8 A;  1NJI C;  2RHU A;  5GAN 6;  3CPW S;  3OQ5 A;  2LQ8 A;  3E9G A;  4RCB A;  4PLL A;  4QQD A;  4M7A B;  3CC2 A;  1VQM T;  1Q81 C;  3V8L A;  1BI3 A;  3MEV A;  4N4G A;  1K73 C;  2P4T A;  4HA8 A;  4M77 F;  1QVF A;  4IUP A;  4EPC A;  3CCL A;  2EQK A;  4LD9 K;  3G7Z A;  3JCM h;  5C6S A;  3GP8 A;  3HKS A;  4EMK C;  4XQ3 A;  1VQO T;  4QQ6 A;  3A8M B;  2RI2 A;  4CRI A;  1VQL T;  5FU7 C;  1G3S A;  2DD5 A;  3JCM d;  3RMQ A;  2L3R A;  3S3N A;  4IUQ A;  3PMI A;  3FRN A;  4JUV A;  3PMT A;  2EAY A;  4OMF B;  1OYX A;  5HK0 A;  5LJ3 g;  4PLI A;  2KSS A;  2PUO B;  1KD1 C;  1U1S A;  3CBM A;  2RHX A;  1X01 A;  3CCV A;  1M1G A;  2LX9 A;  4QVZ A;  3UDC A;  5HKC A;  4BD3 A;  2BUD A;  5GAM d;  2WSF E;  1D3B A;  3P8H A;  1YCY A;  3QXE B;  3M4G A;  3A8G B;  5KCO A;  1YHQ T;  4JLG A;  1W2B A;  1JBM A;  4A4G A;  4M78 F;  2DK3 A;  2WSE E;  4N4H A;  4OGE A;  4M7D A;  2ZGW A;  3FEO A;  3JB9 G;  4XU0 A;  4IUV A;  4HCB A;  4FU6 A;  3RKX A;  4HCC A;  2LVM A;  3L2W A;  1KQS A;  2PVO B;  2RI5 A;  3KXT A;  3VJP A;  2E10 A;  2CKK A;  4M77 A;  2QQR A;  1UGS B;  4TVR A;  4M75 E;  4X9C A;  2KAF A;  2M16 A;  4II1 A;  3LWI A;  3RES A;  3MEW A;  2IVW A;  3LX7 A;  1G3Y A;  2DTO A;  3M54 A;  3ZEH A;  3QG1 A;  2JTM A;  2LC4 A;  3OYY A;  3I56 T;  3E19 A;  3UT1 A;  4C92 F;  5LJ3 e;  3MP1 A;  2V8J A;  1Q81 U;  2BKD N;  1AHJ B;  5HK3 A;  3QBY A;  4F7U F;  2X4W A;  4M75 C;  5FRO A;  2HNI A;  3QII A;  2RK1 A;  3WVD B;  4MML A;  5HY6 A;  4C5G A;  3C95 A;  2B8A A;  4M7A D;  1KQ2 A;  4D6W A;  3QYG B;  5GAO q;  5CKF A;  5FRM A;  2D0Q B;  3MCA B;  3OBW A;  1RL2 A;  3L2R A;  3SWN A;  3CME T;  1K8A C;  2EJ9 A;  5GAN f;  3J81 E;  1KC8 C;  4Y28 E;  4KUD K;  5GAM e;  3WXM B;  4PJO E;  2EFI A;  2E6Z A;  2ZZD A;  3JCM b;  4DA4 A;  3HL8 A;  2DXU A;  3I56 A;  3JCM Q;  3MP6 A;  4RMO A;  3JCM P;  2ZPF B;  5LJ3 h;  3X20 B;  2KMT A;  4ZGE B;  4J6Y A;  4M7D C;  4J7F A;  3OA6 A;  1YI2 T;  4HT9 A;  4F7U A;  2JZ2 A;  4PNO A;  3JB9 H;  5I21 A;  2FYK A;  5GAN 4;  5CKB A;  4Y91 A;  2A3L A;  4C0D C;  3CCU A;  3CME A;  3QUI A;  2DXC A;  4F7U G;  4KT0 E;  1JJ2 A;  4HT8 A;  3OYL A;  2DEQ A;  4C8Q A;  5A0D A;  3CXC S;  5CVI A;  4XTV A;  2OAU A;  1UEB A;  5FU7 B;  5GAM j;  2GCX A;  3G6E A;  5GAM h;  4J8O A;  1NE8 A;  2KY9 A;  3UWN A;  2ZPB B;  3T9N A;  2A7Y A;  4A54 A;  5IN1 A;  5LJ5 j;  3QSU A;  4IUU A;  3CBO A;  5DLQ E;  2DAQ A;  2MI6 A;  3S3M A;  5GAM f;  2QA4 A;  2VUB A;  5GAN 5;  4XTZ A;  5GAN 8;  1H64 1;  1VQ8 A;  4M78 A;  4P5N A;  1HK9 A;  3GNF B;  3ZBD A;  1KD1 U;  4LD6 A;  4M77 B;  3OS0 A;  3F70 A;  3JCM g;  2QDY B;  4EMG A;  1O75 A;  1PSE A;  4J6W A;  3A8H B;  1QW1 A;  1WJQ A;  2RHY A;  2XI9 A;  4DOW A;  1FWZ A;  2EJF A;  4C5E A;  2JN0 A;  4EMK B;  1VQ4 A;  5FRN A;  2XG8 D;  3CMA T;  4O5V A;  4PL6 A;  3M55 A;  5LL6 S;  4ELY C;  3A8O B;  3OMC A;  3LWH A;  3H8Z A;  4KUL A;  1BKB A;  5GMK h;  3JB9 I;  2RHZ A;  5J26 A;  3JAM E;  4BY6 C;  1VQP A;  2XDP A;  4DQ2 A;  4C92 A;  1Q86 U;  3S3O A;  2PVG B;  1QVG A;  3TCJ A;  4QVD A;  3LW5 E;  4BE2 A;  3GIB A;  2H3J A;  1YBY A;  4BDY A;  2K5L A;  3FJP A;  3QDR B;  1H3Z A;  1K9M C;  3JCM W;  4M77 E;  4OB3 B;  2XDD A;  3M5A A;  3DLM A;  3TU4 K;  3QJ6 A;  1TH7 A;  4Q5W A;  2MF2 A;  5CKE A;  4RCC A;  4IUT A;  3VUZ A;  5M9O A;  1VQ9 T;  2R57 A;  3RER A;  5CQY A;  3CD6 T;  2F69 A;  4LDW A;  1M1F A;  1OZ3 A;  3OYK A;  4JRQ A;  2OTJ T;  4BE1 A;  4LDX A;  4ZGD B;  1X6O A;  4BE0 A;  3OS5 A;  3OYC A;  4C0G A;  2O4X B;  4F7U B;  2LRQ A;  2LCL A;  1XTD A;  5FLX E;  4X34 A;  4JLI A;  2FB7 A;  3PFS A;  4BY6 B;  2GQV A;  2V8I A;  3ME9 A;  3CCS A;  1Q82 U;  1VQ9 A;  1MGQ A;  4ZN1 A;  1VQM A;  5I2M A;  4XU3 A;  3JCM V;  4B9X A;  1OI1 A;  2E70 A;  3S6W A;  4E7H A;  2LDM A;  1Y07 A;  2G3R A;  4C5I A;  4E7L A;  1VIE A;  3OYE A;  4M78 G;  2QQB A;  3C12 A;  1Y96 B;  2JUF A;  3QZ5 B;  1Y71 A;  5J39 A;  2PUK B;  3CCU T;  5CIU A;  3LGF A;  3X24 B;  2D9T A;  3GLX A;  3VV0 A;  4L6V 5;  1P92 A;  4M78 B;  5CK9 A;  4PJO F;  3G4S T;  3CPF A;  2WSC E;  2VYT A;  2DO3 A;  3OSV A;  1X75 C;  3M53 A;  2DTH A;  4L5G A;  2RM4 A;  5GAO l;  4JJN K;  2C06 A;  1VQ6 T;  3SD4 A;  3AHU A;  4XAX B;  1WPY A;  3O8V A;  5FU6 C;  1N9S A;  4C8Q E;  2XKO C;  2DIG A;  2OTL T;  3OYH A;  2EIF A;  3CCV T;  2L5Q A;  5LJ3 d;  1XQH A;  1XOV A;  2E6N A;  1SSF A;  2EQM A;  2F5T X;  5IT9 E;  4V2S A;  2EYQ A;  1VQ7 A;  2HBP A;  1B34 B;  4OP0 A;  1YJW A;  2DD4 A;  1YJ9 A;  2P0Q A;  1N27 A;  2QA4 T;  3L1A A;  2RB6 A;  3HRT A;  4M7A C;  4OB1 B;  3OW2 A;  4C92 B;  3INZ A;  4A4K A;  5DM7 R;  3FIF A;  3OMG A;  4IUR A;  4C8Q C;  5LJ5 h;  2F5K A;  2KQW A;  4O6J A;  2OTL A;  2CZ0 B;  4C0F A;  4ATO A;  3P8D A;  3JCM e;  1ZQ1 A;  4PJO A;  4JS4 A;  3FC3 A;  1W2B S;  1NZ9 A;  2PVD B;  4PJO D;  4OGC A;  4FSX A;  2QXF A;  4XU2 A;  5D6Y A;  5GAN g;  1U1T A;  2FHD A;  2QEX T;  2RJE A;  2RA2 A;  3VYG A;  3JB9 J;  2RJD A;  4LDU A;  3G6E T;  2O4X A;  3JB9 D;  3CCE A;  2HQE A;  2RJC A;  1WJS A;  2HAX A;  5CO7 A;  2DPP B;  3LGL A;  4C92 E;  2CZ7 B;  2MAM A;  5LJ3 j;  2EQJ A;  1I81 A;  2ZCF B;  3SDZ A;  3SFM A;  3OYG A;  1UGR B;  3A8L B;  4OVA A;  1LJO A;  3JSC A;  2JVV A;  4FT4 A;  5LJ5 e;  5D6W A;  3TRE A;  3QJY A;  2GFU A;  4FIB A;  3ZFJ A;  2RD1 A;  3KBG A;  4E7J A;  4N0A C;  3CEY A;  1QVP A;  2EWN A;  2R58 A;  3DKM A;  1NJI U;  3CC7 A;  4C92 G;  5KE2 A;  3OYA A;  2L89 A;  2P0P A;  4FM4 B;  2Y4Y A;  4VUB A;  2E1H A;  4DOV A;  4X9D A;  2VXE A;  3PT9 A;  1KG1 A;  3GPL A;  2QQA A;  1IZ6 A;  2E65 A;  3EFR A;  4M7D D;  4M78 E;  4XU1 A;  2JTF A;  2BIV A;  1U8R A;  2ZPE B;  3FDR A;  3X26 B;  3OYJ A;  5GAM g;  2PQW A;  1BYM A;  1Q86 C;  3MEA A;  2XK0 A;  4ZN3 A;  2QQ9 A;  3I55 A;  3L2Q A;  2VXF A;  3M9Q A;  4J83 A;  1YIT A;  5GMK m;  3ASK A;  1VUB A;  2DXT A;  3JCM f;  3KUF A;  4FT2 A;  3X28 B;  3HPW A;  2ZPI B;  3VUB A;  3FLG A;  4BI8 B;  4ZTJ A;  4PJO C;  2KDS A;  1WNL A;  3CCR T;  1FXX A;  2AHJ B;  4M75 G;  4CI0 C;  4ELZ C;  3M56 A;  1M90 U;  3CCR A;  3L2U A;  4MDW A;  1M1K C;  3CC4 T;  4MZM A;  3DB4 A;  1UGP B;  4RG2 A;  4M7A A;  1OZ2 A;  4NOY A;  3M57 A;  1Q7Y C;  4C8Q B;  3BFM A;  1M1K U;  4R55 A;  2Y4X A;  3L42 A;  5CKH A;  3TEE A;  3PIP A;  3EFS A;  3OY9 A;  1YIT T;  1IRE B;  3GF5 A;  1N6A A;  4QQG A;  3CCM A;  1QP2 A;  2DTI A;  2M0O A;  2VV5 A;  3V7C A;  2RJF A;  1I8F A;  2JNG A;  3CCQ A;  1M90 C;  1YJW T;  2EQU A;  1VQ4 T;  5CQX A;  2XDB A;  3QO3 A;  4YTL A;  4A4E A;  2YLC A;  4M7D F;  5GAO p;  5GAN 3;  5J3B A;  5L8R E;  4M7D G;  4M77 G;  5GAO n;  5GAN j;  2L8D A;  4R56 A;  2CZ1 B;  1UB4 A;  1KHC A;  2ZPG B;  4JRK A;  1LOJ A;  3CC4 A;  3LH0 A;  5IAY A;  2I2L A;  3MO8 A;  5LJ5 f;  4C8Q F;  1S72 A;  1G5V A;  2NLU A;  5EG2 A;  5FU6 B;  1VQ6 A;  4KBM B;  4BI4 A;  3EAE A;  4BAC A;  1YIJ A;  4M7A F;  2DVE A;  1G3W A;  2RHI A;  2E64 A;  4BB7 A;  4EMK A;  5CAI A;  1K73 U;  3OYM A;  2D6F A;  4E7I A;  2LT4 A;  3OB9 A;  4ZTF A;  4JRI A;  1I4K 1;  3QYH B;  1WQ7 A;  1EIF A;  4C0Z A;  5LJ5 d;  1VQO A;  1VQL A;  3PGG A;  3CCE T;  4OB2 B;  5A0G A;  1KQ1 A;  4XTY A;  3G4S A;  2K5I A;  3R6O A;  3BW1 A;  3NTK A;  5KE3 A;  4NL3 A;  2EKO A;  1V29 B;  3E9F A;  3HFO A;  4QW2 A;  4IKF A;  5CKD A;  3CCS T;  5KCH A;  5DY9 A;  4GLK A;  3V7S A;  2M1H A;  1UGQ B;  4ZGJ B;  4M7A E;  1YIJ T;  1O9S A;  4N4I A;  2CYZ B;  2QI2 A;  4GY5 A;  4J5Y A;  1KC8 U;  5GMK e;  3BY7 A;  5GMK i;  4MZT A;  1YHQ A;  3OBY A;  3BDL A;  2IG0 A;  4NL2 A;  3N5B B;  5LJ3 f;  4C0D B;  3CCJ T;  5GAN h;  3G71 A;  2MWO A;  4M77 D;  3QKJ A;  1M5Q 1;  4M7A G;  1N8R U;  1VQ5 A;  2X4Y A;  3GOX A;  4MDX A;  4OB0 B;  4C8Q G;  3CC2 T;  5GAO m;  4LDY A;  1GXI E;  1BI1 A;  4OF1 A;  1K9M U;  2DZ9 A;  4L59 A;  4M75 B;  3A5Z B;  5CCA A;  1KQS S;  1VQN A;  3SWN B;  2Y90 A;  3RUX A;  4E7K A;  4RKU E;  2FVU A;  3UPU A;  4XTU A;  3OYI A;  2K3Y A;  2JOY A;  3QHS A;  2QEX A;  2DKG A;  1M4Z A;  3JCM X;  4WF2 A;  3HFN A;  3OYN A;  2YLB A;  3OYF A;  1N8R C;  3MEU A;  3CC7 T;  1MHN A;  3L2V A;  1VQ5 T;  3ER0 A;  1LNX A;  2KVQ G;  4M7D E;  1Y96 A;  4M78 D;  3G71 T;  3JCM J;  1VQ7 T;  2R5M A;  3MP8 A;  3QZ9 B;  4J6X A;  5GAN e;  3Q1J A;  2HD0 A;  2LNV A;  4XK8 E;  3VU3 C;  4A4F A;  1VQP T;  3J7A F;  1JRI A;  2K4Y A;  2RO0 A;  3LLR A;  3M4Y A;  1RI0 A;  2K5F A;  3J80 E;  4BUG A;  2K2V A;  2XIC A;  4M75 F;  4EDU A;  1VQK A;  3V8K A;  3I55 T;  3WVE B;  4HKE A;  3CCM T;  1W4S A;  3GNG A;  3CCL T;  1WJR A;  3V7R A;  2E12 A;  2MMP A;  5A2Q E;  3DLL A;  4B9W A;  1B34 A;  5DLO A;  5GAN 7;  4C5H A;  2GFA A;  3OYD A;  2GF7 A;  3E1S A;  4M78 C;  1PSF A;  3DB3 A;  1M8V A;  1QVF S;  3VKI A;  4C8Q D;  1JB0 E;  2LQK A;  3URG A;  3RKY A;  2RH2 A;  3BDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...