5CQYA

E. coli mazf mutant e24a in complex with maze residues 68-82 form ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
102
Chain Sequence
VSRYVPDMGDLIWVDFDPGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 22
structure length 102
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cqyA00
2C06A 1UB4A 2KMTA 4MZMA 4ELZC 3G7ZA 5CKBA 5CKFA 5HKCA 3JSCA 3NFCA 4MZPA 3TCJA 1X75C 5CKHA 5HK0A 3JRZA 5CCAA 5CR2A 4OF1A 4MDXA 1NE8A 3HPWA 2MF2A 5CQXA 4ELYC 5HK3A 5DLOA 5CKEA 4HKEA 5CQYA 5CO7A 5CKDA 2VUBA 1VUBA 1M1FA 4MZTA 4ME7A 4VUBA 5CK9A 3VUBA
chains in the Genus database with same CATH superfamily
2L5QA 3CMET 1MMNA 2EQIA 2EW3A 1RABB 1VQ6Q 4E7IA 3DB3A 2SRCA 5IN1A 1I5OB 3CPWA 3CCRQ 2DETA 2WSFE 2CP0A 1AWWA 2F2XA 2OTJQ 2DK3A 2KK4A 3PT9A 4L5GA 1GCQC 3M0TA 2JMCA 2L3RA 5A0LA 4QVDA 3D7SB 4N4IA 1M3CA 5CKDA 3QYHB 1M1KR 1U3OA 1WYXA 5FWCA 2E1HA 1VQPT 3CMEQ 2E12A 5LL6S 2DM1A 3LGLA 1Z9QA 2B8AA 1GFCA 2BKDN 1HK9A 4BE2A 2ZPGB 3P8HA 1SG5A 4JZ4A 1VQNA 2PNIA 3CD6A 1VQPQ 3VS6A 4ATOA 1ABQA 3OY9A 4M75G 1JO8A 4B9XA 2O88A 2DD4A 4XTWA 3HFOA 2B86A 3QHSA 4LUEA 1K9AA 3V7RA 3CCVT 2HQEA 2RNAA 2F5KA 1NPRA 2EFIA 3SWNB 1N9SA 2CUBA 4AG1C 4C92A 3OYDA 1WDXA 2DE0X 4QVCA 4OB3B 2DTHA 4M7AF 3PGGA 1VYTA 1VIFA 5GAN7 2ESWA 4AMCA 2LQ8A 3GNFB 5HCKA 4XU1A 1Q81U 1QKWA 3RDVA 1WZOA 3CCVQ 4ZGEB 3EHQA 2A36A 1WPYA 1QW1A 4JZ3A 2E70A 3CC2T 3E9GA 2NYSA 2DEQA 1T0JA 2EVRA 2F2WA 3QUIA 3RR6A 4BI8B 4RMOA 3EHRA 3E19A 1VQOA 3JCMQ 1YNZA 4MZTA 2HKQB 3CC2Q 4ZTFA 2OTLA 4KT0E 1DJ7B 2JOYA 2LT4A 2CYZB 3UF4A 3LLRA 3OBYA 5IHIA 3QBYA 4OB2B 2GGRA 4M77D 1ACMB 1RAFB 2X4XA 4E7HA 5AT1B 1TG0A 4EMKB 5LJ5f 4FW2A 2DEUA 3LW5E 3G71T 3G4ST 5LJ3d 2RHXA 5J3BA 1AEYA 1M27C 2F1LA 2QK0A 1IB8A 2ATCB 1OU9A 2D8JA 2DJQA 3SHWA 4OMFB 4ZGDB 2RF0A 1VQ6A 4IKFA 5GAOp 2ED0A 4BY6C 1ZA2B 1Y96B 4OMPA 3G71Q 1YCYA 3QPHA 2OTJA 2RK1A 3G4SQ 2L89A 3OSSC 1IREB 3TQ7P 1YBYA 3HKSA 3VYGA 2ZPIB 4X34A 3ZFJA 2A08A 2DA9A 3CCLA 3QKJA 3GNGA 5HKCA 3OS5A 3CMEA 2XG8D 1ZQ1A 1KQSS 3M4YA 4LNPA 2EGEA 3L2WA 1WJQA 1PM3A 1PKSA 4EPCA 1UJ0A 2VVKA 2YXYA 4JRPA 2O01E 3GPLA 1QLYA 3S3MA 1I4K1 1VQPA 1Q82C 4P5NA 1NM7A 4RCBA 4JJCA 2RQUA 4GLMA 4O6JA 1UGPB 5CQYA 4X1VA 3UA6A 2P0KA 5I2MA 3VKIA 1TSFA 3C12A 4D6WA 4RTYA 2P84A 2DYIA 3R6OA 1S1NA 2EYYA 4Z8AA 2RK2A 2JTEA 3JCMX 1D3BB 5KYXB 5KCOA 4M77F 2JZ2A 1SHGA 4BDYA 5KYWA 4LN2A 1Q81C 3RKWA 2GCXA 3OYYA 2RD1A 2EWNA 1WLPB 3EGXA 1S72Q 3JB9D 2K57A 4AFQC 4J7FA 4MZMA 2LJ1A 3SB2A 4C0GA 2K3BA 3CPWS 1BIAA 2D1XA 1VQ9T 4OB1B 4OMMA 1OU8A 4BD3A 3CC2A 3A1PA 1OX9A 2RA2A 1NBEB 3SFMA 1YJWT 1V1CA 4ZGJB 4J9GA 1Y57A 3ZBDA 2HSEB 2FPDA 4M7DE 3OYLA 4R56A 1UGRB 5GAMe 5GMKl 1I07A 4PFOA 1WIEA 1VQ9Q 2HCKA 8AT1B 2VC8A 3FB9A 3URGA 4LDWA 4RTVA 1RAIB 1M90U 2FB7A 3S3NA 1QVPA 3T9NA 3L2QA 1UHFA 2KROA 4KGXB 4M78E 3INZA 5IHNA 3HRTA 4IIOA 2MWPA 1QP2A 5D7UA 5GANg 4F17A 3J81E 1WXBA 5GANj 5D6XA 1KQSP 4JPBW 3H0HA 2X3WD 3EGDB 3FRNA 1VYVA 2DRKA 1X43A 2XIDA 4F7UF 1KJWA 3IQLA 3OYCA 5CR2A 1WHJA 5FLXE 4NL2A 2F69A 2DXBA 3BDLA 4PJMA 2X4WA 1KQ1A 4J6WA 4C92D 4RG8A 3OW2A 3A5ZB 1N27A 3M0PA 3QZ9B 2HEQA 5LJ3f 4DOVA 3CCEA 1XTDA 1R0CB 1ZSGA 4CC3A 1JU5C 1QWFA 2HBPA 3JCMf 1YIJA 2CS7A 4II1A 2BTTA 1BB9A 2O9VA 3JB9F 1VUBA 2VB6A 4PJOA 3H8ZA 2A7YA 2AT1B 4FCYA 4LD9K 3QG1A 4C0DC 3R6NA 1J3TA 2E41A 1ZUUA 1PG5B 4M7AE 4J9CA 1VQLA 2EYXA 1K0SA 1PD0A 2HBWA 3CPWP 1Y0MA 4E2FB 1SPKA 2CP3A 3CCMA 1X6BA 2DX1A 4J7IA 1H8KA 2GQVA 2XKOC 4DQ2A 3FJ5A 1S72A 2ZPEB 2DRMA 4FW1A 4CC4B 2I2LA 2M9UA 2XU8A 3HFNA 3HTRA 4ESRA 5DLOA 4RUGA 3VS5A 2DBKA 2E6NA 1EZZB 2KNBB 5A0GA 5GAN8 4HA8A 2KAFA 4RTZA 1NYFA 4E47A 2KRNA 1D1AA 3EG9B 3DLLA 4L6V5 2AZSA 5GANh 1T3LA 3A8MB 2DNUA 2GTJA 2QAZA 1B34A 2RJFA 3QZ5B 2DYBA 1NJIU 1VQ5T 4C92F 1KSWA 2EPDA 1PC0A 1AWXA 1QMCA 4FU6A 4DBFA 2E65A 2V1QA 1M90C 3RIRA 4WCIA 4XTVA 4A4HA 2E5QA 5KYYA 3KXTA 3GLXA 3VS4A 3CD6T 3EFOB 5GAMd 1VQ5Q 2KSSA 3RMSA 2COZA 2DL7A 5IXFA 2PU9B 3OQ5A 4M7DB 3X28B 3DLMA 4C8QE 3GIBA 1VOMA 2GFAA 1M8VA 1UB4A 2OI3A 3RKXA 3V8JA 1MNDA 1W70A 1WI7A 3JCMV 2FEIA 3CD6Q 1JXOA 1U06A 3RBBB 4PJOC 4M78B 4DEXA 3MPUB 3VS0A 3LGFA 3LWIA 1QVGS 1BYMA 2VWFA 4E7JA 4OGEA 4DBRA 3EG1A 2H8HA 1K8AC 4JJBA 2KMTA 2C0OA 1KC8U 1MMAA 3FEOA 2K5LA 1KD1R 2YRVA 2DZ9A 2BE9B 2DD5A 1OPLA 3NTIA 2XI9A 1PRLC 1VQOT 2K6DA 3SDZA 1Z9ZA 5CO7A 2RMOA 2KEAA 2FRYA 1QCNA 3TEEA 2FZGB 4DEYA 1OZ2A 2BZ8A 2RJCA 4A4GA 1TUGB 1GBQA 3M57A 3JB9J 2ROLA 2NWMA 1VQOQ 1UGSB 3EH1A 4IURA 1NLPC 4QT7A 1SSHA 2G6FX 2KVQG 1OX8A 4UC4A 5IT9E 5FWBA 1K1ZA 1GXIE 1IZ6A 1D3BA 4ELZC 3C4SA 4JJDA 2QA4T 2MAMA 4M7AB 5GAOr 4M77C 3M55A 1I8FA 1ZHIA 2JT4A 1CKBA 1AOJA 2HQXA 5CKHA 3F70A 3CCLT 1K73U 2PVOB 4M7DG 2QA4Q 3E1SA 3JAME 1NPPA 5GAOl 4AFZC 4CC7A 1NJIC 4C0ZA 2QG9B 1KHIA 3PVQA 1U1TA 2CZ1B 2OAUA 1RLQC 4AFSC 4M78G 3CCLQ 1VQ5A 2A28A 2CREA 3LH5A 3LX7A 2EBPA 4PL6A 3SD4A 4JJNK 3OS1A 3O8VA 3BW1A 2KYMA 4F7UE 1Q82U 3CXCA 4PJOD 1NEGA 1FWZA 4HT8A 3L2UA 1ZSZA 4M75F 4XTZA 3JCMP 5FU7B 1ZX6A 2RH2A 1M1KC 1M2VB 2RHYA 3HP9A 1VQ4A 1K0XA 2EYQA 2IPOB 2VGNA 1U8RA 2DL5A 2YHTA 4BB7A 2LCSA 1MUZA 4AFUC 4E7KA 1IGUA 1BKBA 1WHKA 4C5EA 1TUCA 4V2SA 1LVKA 1I0CA 5KYUB 5GANd 2DVJA 4C8QB 3META 1YJNT 2H3EB 5GAMf 3FIFA 2D8HA 3L2ZA 5GJVB 1KC8C 4PJNA 3RNJA 2CH4W 1KK7A 4PNOA 1N5ZA 1KIKA 1FMWA 2PVDB 2ZPBB 1VQKA 4XU0A 5HY6A 1XOVA 4XTXA 2VXFA 1M5Q1 4KH1B 2GBQA 3CCJT 2GTOA 2LX7A 2QDYB 1RACB 4M7AG 1YJNQ 4DBQA 4RCCA 3VJPA 1GFDA 2OJ2A 2QDLA 2YLCA 5CK9A 2PZ1A 1N9RA 1K76A 1M1GA 2K3YA 2FPEA 1X01A 4GY5A 4QQGA 2LTOA 1X69A 3CCJQ 5I22A 5C0MA 2KRMA 2QGGA 4QQ6A 3OW2P 2M0OA 2DTOA 2NUTA 2QTVA 2EYZA 3KBGA 1JQQA 2KY9A 4FSXA 3I55A 4D8KA 2E3IA 4PJOF 3A8GB 2QA4A 2AKKA 2JS0A 1HD3A 1FXXA 1G3SA 4C92E 2NUPA 2VGMA 1K73C 4XQ3A 1R0BG 4J9FA 5KE2A 2D9TA 3HRUA 3CPFA 1ZSZC 4XTYA 3CCET 5HK0A 2CZ0B 1G5VA 1Q95G 1YIJT 1TXQA 5LJ5g 1YFNA 1FYNA 2DXUA 1M1FA 1N8RR 5LJ5j 1UG1A 1YWOA 2A3LA 4C8QG 4C92C 2DXTA 2CKKA 3PVLA 3VV0A 2QQSA 5M9OA 3HL8A 3CCEQ 5IXBA 1NG2A 3OSVA 3REAB 1YIJQ 1VQLT 3X20B 1FX7A 2HL5C 2XD0A 1RI9A 3L2VA 4M7DA 2J6FA 3OYHA 1X2QA 4DBHA 5CQXA 2KXDA 1MMGA 3CCMT 1JEGA 2C06A 2KR3A 1S72T 2XK0A 3JCMJ 4F7UB 4QQDA 4O5VA 1VQLQ 2HL3A 2K9GA 4Z02A 2P0QA 1YN8A 3TSZA 1RUWA 1Q81R 1E6GA 2HQHA 4AG2C 1B7TA 2DPPB 2QQBA 4A63B 3CCMQ 3CCSA 1C0MA 5GAN5 5GMKj 1YJNA 1QVGA 1H3HA 2KRSA 2R58A 2LJ3A 1Q7YR 2YDLA 3M53A 5D6WA 2IVWA 4M75A 1OEBA 2M16A 4M77G 4XK8E 1YP5A 3OA6A 3NHNA 4ELYC 2DLPA 3MHXA 3CCJA 5FW9A 1AZEA 2LX9A 2FPFA 1SRLA 2V8IA 2J06A 1Y7XA 4HXJA 4LD6A 5CKBA 3CXCS 4F14A 1WA7A 4HVVA 2Z0WA 4M4ZA 3WVDB 4IIMA 4IUVA 4KH0B 3OS0A 1D1BA 3HPWA 2MCNA 4B6MA 2BZXA 2G3RA 2JTFA 4N4HA 2VUBA 1X27A 2E4HA 1PCXA 3UDCA 1CKAA 5A0DA 2NLUA 4VUBA 2LCLA 3UPUA 2X3XD 5LJ5h 3PIPA 4ZTJA 4BY6B 3VS2A 3THKA 1YITT 3RMQA 1VA7A 3UT1A 3V8LA 1NEBA 2FVUA 2BUDA 3PE0A 5CVIA 1UE9A 1UEBA 1WFWA 2M02A 4FYVB 2RHIA 1BCOA 3V8KA 4QW2A 1YITQ 2I0NA 2HAXA 1X2KA 4BE1A 1K8AU 1IRXA 2JW4A 1G8XA 2DJZA 1YJ9A 2R5AA 1C6VX 1QWEA 2LQNA 4F7UG 3QJYA 2JMAA 1UECA 3CC4A 3CCQQ 1Q86R 1YCSB 1VQ8A 2AIRB 2JM8A 2LCCA 3JCMb 5GMKh 1M4ZA 2IIMA 3JCMc 4HT9A 1UFFA 4JRIA 1WXUA 3S3OA 2CSIA 2EQUA 2YUPA 2O4XB 5KH6A 1VQMQ 2L2PA 1RAAB 3EFSA 1TWBA 4NS5A 4BI4A 2BE7D 3J80E 3VRYA 2CT4A 3JB9G 3C94A 4LUDA 4BI3A 3OMGA 4M75C 2EGAA 1IXDA 3SWNA 1UUEA 1QKXA 5LJ3g 3MP1A 4A4KA 5KCHA 2OX7A 4BE0A 2LT1A 1RADB 5LJ3j 1OULA 1BI0A 1K9MR 2PUKB 3JCMg 4RTXA 4C8QA 1B3QA 2CP5A 3H6ZA 4OB0B 3EG2A 3MP8A 2FRWA 3CXCP 4OMLA 3X25B 3ME9A 1VYUA 5GAN3 3VS3A 5FU6C 5GAOm 1W1FA 1B07A 5EC7A 4EMGA 2QEXA 4Q5WA 3CBOA 3TCJA 1WHHA 3M56A 4PLIA 2E6ZA 1LPLA 2COYA 2W0ZA 2PTKA 2LQKA 2A37A 1XNIA 1M30A 3A8LB 2HDAA 1F1BB 2LNVA 3M0UA 3PNWC 4PJOE 1UHCA 3WVEB 1PRMC 2J05A 4MZPA 3VRZA 3MCAB 3CBPA 2L3SA 1RAGB 1V29B 3VUZA 2FHDA 2RI5A 1NE8A 2KI7A 4BACA 1AZGB 4D8DA 2DKGA 4EMKA 2A0FB 2EJFA 1TH7A 1IHVA 3CEYA 4JS4A 1AT1B 2K3XA 3CC7Q 4CI0C 1R8OB 4C92G 4HCZA 3JV3A 1VQ4T 2HD0A 2MI6A 2VV5A 1M1KU 2KT1A 4M7DD 4OGCA 5GANe 3QDFA 2GF7A 2DFUA 2RQRA 1YITA 1ZLMA 1ZUKA 1WNLA 1BBZA 1Y96A 2E10A 2Y90A 5ECAA 1VQ4Q 2GQIA 3QJ6A 2YWWA 4J9HA 2LVMA 2QXFA 3ULRB 5DY9A 3CCQA 3OYKA 2MWOA 1VQKT 2M0YA 3NMZC 2DL4A 1CSKA 1PSEA 4GBQA 1FMKA 2KE9A 2X4JA 1QVFA 1M3BA 2EAYA 5LJ3h 2ZGWA 1PD1A 3OYBA 3EGUA 5J39A 4C0DB 1K4US 1VQMA 4NOYA 1GL5A 3SWNC 4J9IA 5KYWB 2EQMA 2F5TX 3JCMh 1PHTA 4ZN1A 1BCMA 4M75D 1X6OA 1VQKQ 3H9NA 3EGXB 3OYAA 4MMKA 4J9BA 4KUDK 2LC4A 1A0NB 1LNXA 1WJSA 2MIOA 3UWNA 4LDXA 2CH4A 4M77E 4OVAA 1KD1C 3AHUA 3AT1B 5LJ5d 2JS2A 3A98A 3BY7A 4EDUA 5DLQE 2QGFB 2V8KA 3I55T 3OYMA 5KYXA 4L59A 2RQWA 3C0CA 3VYHB 4BUGA 1SF9A 3PTAA 1SSFA 4BDZA 2R5MA 4DA4A 2WSCE 2GNCA 2DTIA 3G1JA 1P92A 4IUQA 2RB6A 2XDBA 2DBMA 3I55Q 1YHQA 4M7DF 3O5ZA 3QXEB 4PFZA 3CBMA 2QQ9A 2HNIA 4JLGA 1SEMA 2O9SA 4RTTA 4F16A 4EMKC 1XJWB 2EQJA 1NJIR 2DZCA 1MV0B 2RHZA 3RESA 3I5SA 2AZVA 2WACA 3FDRA 3MEWA 2PUOB 2ZAEA 4LDUA 2EGCA 3FJPA 1YWPA 1QQJA 5KYNA 4AT1B 1GCPA 1JJ2A 3CMAA 3CC7A 1VQ7A 1O9SA 4ZNXA 2YT6A 3ASKA 2LZ6B 3REBB 1ARKA 3KFVA 2BZYA 1QVGP 3V7CA 1OYXA 4J8OA 4JUVA 1R77A 2FL7A 1AD5A 3NTKA 4N0AA 5L23A 1SRMA 3G6EA 2MYSA 3V7SA 4PJOB 2MMPA 3CQTA 3EGDA 1N8RU 2E5KA 5GAN2 2H3JA 4F04B 5GMKi 3HRSA 4LDVA 1MV3A 2VKNA 2JN0A 2JTMA 5C6SA 3OB9A 2FYKA 1H3ZA 2LRQA 4X9CA 1O75A 1T3SA 3PMTA 1RAEB 3MKDA 2QASA 2ED1A 1NLOC 4A4EA 3CCST 5I21A 3EG3A 3OS2A 2KT8A 2RQTA 4PJLA 1KC8R 1JBMA 4E7SA 1G2BA 4KBMB 2MK5A 3NGPA 2EQKA 2V8JA 1H641 1M8MA 3VU3C 4C8QD 3KUFA 3ER0A 4IUTA 4E6RA 2COWA 2CZ7B 2Y4XA 5I2SA 1C1AA 4WTOB 1WHLA 3QWYA 2W10A 3CCSQ 1KQ2A 5GMKm 1D0ZA 1WHGA 2BIVA 1W2BA 5L8RE 1D0YA 3QSUA 2GFUA 8ATCB 1WQWA 2O4XA 3OYJA 4XTUA 3E2UA 2JM9A 2V1RA 1OPKA 4OMOA 3OYEA 3DKMA 1Q7YU 1HJDA 3A8OB 5I11A 4JRKA 2KGTA 4J5YA 3CCUA 4JS5A 5GAN6 5GAMg 2D6FA 1B34B 3GOXA 1V76A 3M0RA 2AHJB 2V26A 3P8DA 3RKYA 4Z89A 5GAMj 4HCBA 3M59A 3UA7A 3C95A 4EIKA 4IUPA 2X4YA 4KGZB 2HZYA 3LWHA 1EIFA 1TS9A 4M77B 4LE9A 1I81A 2DMOA 5KYYB 3I56T 1X6GA 1TOVA 3BE3A 3L42A 1WGSA 1HSQA 4EMHA 2EJ9A 3BDUA 3DB4A 3FLGA 2ENMA 2XMFA 1K73R 1G83A 5IHKA 2VYTA 3EG9A 4LDYA 3OYGA 2P4TA 1E7OA 3TREA 5CKFA 2DIQA 4FL6A 2RJEA 3I56Q 1OZ3A 2XICA 2X9HA 3OYIA 1QVFS 4PLLA 3QO3A 3HHTB 3FC3A 3JCMd 1YJ9T 4PJOG 7AT1B 4J83A 4N0AC 3CC4T 1H92A 3CCRA 1VQ8T 1UTIA 1JXMA 4R55A 4A53A 2DIGA 2EIFA 2YRCA 4MDWA 3VUBA 3RERA 4C8QF 4HCCA 1WHMA 4E7ZA 1Q82R 2ZZDA 9ATCB 3G7ZA 1YJ9Q 4PJJA 1QCOA 2RJDA 1ZA1B 3EFOA 2EKOA 2YUQA 1IO6A 3CC4Q 4XU3A 5D6YA 3TU4K 3EG0A 4FIBA 1VQ8Q 4OF1A 1IHWA 2RM4A 3P8BB 1PNJA 4NL3A 2ZCFB 3QYGB 3M4GA 2K7AA 2LJ0A 2L0AA 1N8RC 1U5SA 1Q86U 4JDSA 4FYXB 1RLPC 1GRIA 5GJWB 2DVEA 3QIIA 2C0IA 2FZKB 4M78A 1GBRA 2HKNA 1D09B 2L3QA 1UJYA 2QTXA 3VS1A 3X26B 2FO0A 1M2OA 4A4FA 1G3WA 1SKUB 5GAMh 1QCFA 2J6KA 3QWXX 1NZ9A 3M5AA 2XDDA 3UATA 4HVWA 3OMCA 1BI2A 2QEXT 2JVVA 3CCVA 1NYGA 4FT4A 1AWJA 5GAN4 1BK2A 1I5LA 1WXTA 1K9MU 1XQHA 1JJ2S 2L8DA 1HXDA 4PKCC 1PWTA 2QEXQ 4J6YA 4HCKA 2XDPA 3ZL7C 3PMIA 5GANf 1BIBA 2YUOA 3M0QA 1Q7YC 2K2VA 1EX4A 4FT2A 1FMVA 2RN8A 3GF5A 1MMDA 4OMNA 1PSFA 3JRZA 2DXCA 2QI2A 4QVZA 3E9FA 5HK3A 2YSQA 4JLIA 5IH2A 2M51A 2AKLA 2MOXA 1QVFP 2DL3A 2RI2A 4M7AA 1D0XA 4MMLA 1UGQB 3X24B 2YRDA 4J9DA 2EYWA 4C5IA 2ZPFB 3GBQA 1X75C 4CRIA 1YJWQ 3H0FA 2FG0A 3I56A 2JJ9A 4X9DA 2KQWA 2CSQA 1OV3A 4FM4B 1UDLA 3S6WA 2E3HA 1ZSZB 4ME7A 3CCQT 4KGVB 3JB9I 1IGQA 2DO3A 4LXCA 3G71A 2CT3A 2EKHA 3G4SA 1JRIA 4RG2A 4CC2A 4M7DC 2WSEE 1Y07A 4WF2A 4N4GA 1U1SA 3RUXA 4IUUA 5CCAA 2VASA 5A2QE 1BI3A 1VQMT 5CAIA 4M75E 4Y91A 4C92B 1W2BS 4JRQA 2SEMA 2Y4YA 4DOWA 2RHUA 4M78C 3LYIA 3M54A 5LJ5e 3MEVA 3LH0A 2IG0A 3JSCA 3MO8A 1JB0E 3NFCA 2RQVA 1WX6A 1YI2T 4KULA 1EFNA 1KD1U 1M9SA 1M2VA 5CKEA 2D0QB 3I35A 4R0KA 2R57A 1Q86C 3Q1JA 2X51A 4ZN3A 2CGHA 2JXBA 4QKUA 2KBTA 2CP6A 4OMQA 1YI2Q 1KHCA 2M1HA 3NPFA 2EJGA 3I5RA 3MJXA 5FRNA 3MEUA 3PFSA 3ZEHA 5KYUA 1PKTA 2PVGB 4RTWA 2YUNA 3VS7A 2MF2A 1JJ2P 1RI0A 4RKUE 1LJOA 2K4YA 3EFRA 3M9QA 3U23A 3JCMW 1WJRA 2LQWA 1YHQT 2KXCA 2NUTB 2XHCA 5GMKe 2X35A 4B9WA 1VIEA 1BI1A 5KE3A 1TTHB 2P4RA 2O2OA 1HYOA 2PQWA 2KDSA 3BFMA 1I1JA 1K9MC 3OBWA 1OI1A 1MGQA 3HSBA 1RAHB 3L1AA 3M58A 2JNGA 5GAOn 1YHQQ 4M7AC 1ZBXA 2J7IA 3GP8A 3MEAA 2LDMA 2YLBA 2OAWA 1SHFA 2NUPB 1UGVA 2P0PA 1M90R 3CMAT 2VXEA 3CC7T 1VQ7T 4RTUA 4Y28E 3WXMB 2CZ6B 1W6XA 1ABOA 1VQ9A 2QYZA 2ZPHB 2CUDA 2K79A 1G3TA 1D1CA 2DAQA 1AHJB 4HKEA 1YJWA 2KYBA 4FYYB 2CDTA 3G6ET 2RO0A 3CMAQ 3QDRB 4HVUA 4C0FA 4E7LA 3H41A 1VQ7Q 1TUDA 4M77A 4ORZA 5EG2A 1KG1A 3OYNA 1VQNT 2MPXC 1W2BP 4C5HA 4GLKA 3A8HB 4KRTA 4MDXA 1RL2A 5AYFA 4C5GA 1MHNA 3G6EQ 4M78D 1K8AR 1AWOA 4Y92A 4TVRA 1GCQA 2QQRA 5CIUA 2LNHB 5FU7C 1OOTA 3SEMA 1LOJA 1VQNQ 5FROA 5IAYA 3L2RA 3N5BB 3EH2A 2O31A 3OYFA 5GAOq 3J7AF 2DILA 2NUZA 5FRMA 4A54A 1W4SA 3M0SA 2AK5A 4KUIA 2DF6A 2HSPA 2J6OA 1KFZA 3MP6A 4FSSA 4C8QC 2CP2A 4Z88A 2CP7A 3CCUT 1AVZC 4M75B 1YI2A 6AT1B 1KQSA 2K5FA 1OQKA 1MNEA 1ZBJA 3PIOA 1T0HA 4XAXB 1WQ7A 2ABLA 3TVTA 2QQAA 4OP0A 4K11A 4YTLA 3H0IA 2OTLT 4F7UA 2LMJA 3CCUQ 2F2VA 1BU1A 2D0NA 2HMAA 4PK4A 1G3YA 2E64A 2DERA 1E6HA 1N6AA 5LJ3e 1LCKA 2K2MA 2C0TA 5FU6B 4M7AD 4PFPA 3NTHA 3JCMe 2JUFA 2OTLQ 3I9QA 5DM7R 1Y71A 3EAEA 2RI3A 2RPNA 1M3AA 4J6XA 3TSWA 1VQ6T 4FYWB 2FZCB 3JB9H 5J26A 4XU2A 4J9EA 2ECZA 1QP3A 3CCRT 1TU0B 2ROTA 2OTJT 1ZUYA 2LP5A 4M78F 2L3PA 2K5IA 3OW2S 4ANJA 2DL8A
chains in the Genus database with same CATH topology
4FU6A 2E65A 5LJ5h 1M90C 2L5QA 2P4TA 3RIRA 3TREA 3PIPA 3CMET 4ZTJA 4XTVA 4A4HA 2E5QA 5CKFA 2DIQA 3DB3A 2RJEA 4FL6A 3KXTA 4E7IA 1OZ3A 2XICA 4BY6B 3GLXA 3OYIA 5IN1A 4PLLA 1YITT 1QVFS 3QO3A 3HHTB 3FC3A 3JCMd 3RMQA 3CPWA 4PJOG 1YJ9T 3UT1A 3V8LA 4J83A 2WSFE 2FVUA 2BUDA 3CD6T 5CVIA 2DK3A 2KK4A 3PT9A 4N0AC 5GAMd 3CC4T 2KSSA 4L5GA 3CCRA 3RMSA 1UEBA 1VQ8T 2L3RA 5A0LA 4QVDA 4R55A 4N4IA 5CKDA 2PU9B 3OQ5A 3QYHB 3X28B 3DLMA 4A53A 4M7DB 2DIGA 2E1HA 4C8QE 1VQPT 2EIFA 3GIBA 4MDWA 3RERA 2E12A 2RHIA 5LL6S 3VUBA 4C8QF 4HCCA 2GFAA 3LGLA 1M8VA 1UB4A 2B8AA 2ZZDA 3RKXA 3V8JA 2BKDN 3V8KA 4QW2A 3G7ZA 2HAXA 1HK9A 4BE2A 2ZPGB 4BE1A 1K8AU 3JCMV 2RJDA 3P8HA 2EKOA 2DJZA 1YJ9A 4XU3A 2R5AA 5D6YA 4F7UG 3TU4K 4PJOC 4FIBA 3QJYA 4M78B 1VQNA 4OF1A 3CD6A 3LGFA 3LWIA 2RM4A 3P8BB 3CC4A 4ATOA 1QVGS 1BYMA 4NL3A 2ZCFB 3QYGB 4E7JA 3OY9A 4M75G 1VQ8A 3M4GA 4B9XA 4OGEA 2DD4A 2LCCA 1N8RC 3JCMb 4XTWA 5GMKh 1K8AC 3HFOA 1Q86U 1M4ZA 2KMTA 4JDSA 3QHSA 3JCMc 3V7RA 1KC8U 4JRIA 4HT9A 3CCVT 2HQEA 3S3OA 3FEOA 2EQUA 2K5LA 2F5KA 2DVEA 1NPRA 2EFIA 2O4XB 3SWNB 3QIIA 4M78A 5KH6A 2YRVA 2DZ9A 1N9SA 3OYDA 2DD5A 4C92A 4QVCA 4OB3B 2DTHA 3EFSA 2QTXA 3NTIA 4M7AF 3PGGA 1VIFA 5GAN7 2XI9A 5A0DA 2LQ8A 4NS5A 3GNFB 1VQOT 4XU1A 3X26B 4BI4A 3SDZA 3J80E 5CO7A 1Q81U 4A4FA 1G3WA 3JB9G 3C94A 4BI3A 3OMGA 4M75C 3TEEA 5GAMh 1NZ9A 1OZ2A 3M5AA 4ZGEB 2XDDA 3OMCA 1WPYA 2RJCA 3SWNA 1BI2A 1QW1A 4A4GA 2QEXT 2E70A 5LJ3g 2JVVA 3CC2T 3MP1A 4A4KA 3CCVA 1KD1C 3E9GA 4FT4A 5KCHA 3M57A 4BE0A 2LT1A 5LJ3j 5GAN4 3JB9J 1BI0A 2DEQA 2PUKB 1I5LA 3JCMg 1UGSB 4C8QA 4IURA 3QUIA 4BI8B 1K9MU 4RMOA 1XQHA 2KVQG 3E19A 1VQOA 3H6ZA 3JCMQ 4OB0B 4MZTA 4UC4A 5IT9E 3MP8A 1JJ2S 2L8DA 1HXDA 3X25B 4PKCC 1GXIE 3ME9A 1IZ6A 1D3BA 2XDPA 4J6YA 3PMIA 4ELZC 1BIBA 3C4SA 5GANf 5GAN3 4ZTFA 5FU6C 1Q7YC 4KT0E 2OTLA 2K2VA 5GAOm 4FT2A 4EMGA 1DJ7B 2JOYA 2LT4A 2QEXA 2QA4T 2MAMA 2CYZB 4Q5WA 3CBOA 3GF5A 4M7AB 3TCJA 3LLRA 1PSFA 3OBYA 3JRZA 5GAOr 3M56A 3QBYA 4OB2B 4PLIA 2E6ZA 2DXCA 2QI2A 4M77D 4QVZA 3E9FA 2X4XA 4E7HA 5HK3A 4M77C 2LQKA 4JLIA 4VUBA 3M55A 1XNIA 1I8FA 1ZHIA 3A8LB 2HQXA 4EMKB 5CKHA 5LJ5f 3LW5E 3G71T 3F70A 3CCLT 2LNVA 3G4ST 1K73U 2PVOB 4M7DG 5LJ3d 2RI2A 2RHXA 3PNWC 5J3BA 4PJOE 3WVEB 4M7AA 4MMLA 1UGQB 3X24B 3E1SA 4MZPA 3JAME 1NPPA 3MCAB 3CBPA 4C5IA 2ZPFB 1X75C 4OMFB 4CRIA 4ZGDB 5GAOl 1VQ6A 4IKFA 1V29B 3VUZA 5GAOp 4X9DA 3I56A 1NJIC 2FHDA 2RI5A 1NE8A 4BACA 4C0ZA 1KHIA 2DKGA 4BY6C 2OAUA 1U1TA 2CZ1B 2KQWA 4EMKA 2EJFA 1TH7A 4FM4B 3CEYA 4JS4A 4M78G 3S6WA 1Y96B 2K3XA 2OTJA 1YCYA 3QPHA 4CI0C 1R8OB 2RK1A 4ME7A 4HCZA 4C92G 1VQ5A 2L89A 3OSSC 1VQ4T 1IREB 3CCQT 2HD0A 2MI6A 1YBYA 3HKSA 3LX7A 4PL6A 3SD4A 3VYGA 2ZPIB 4X34A 3JB9I 2DO3A 2VV5A 3ZFJA 3OS1A 3G71A 4JJNK 1M1KU 3CCLA 4M7DD 3G4SA 3QKJA 1JRIA 3O8VA 3BW1A 3GNGA 4OGCA 3OS5A 4RG2A 5GANe 5HKCA 2WSEE 3CMEA 4M7DC 2XG8D 4F7UE 1Q82U 2GF7A 1Y07A 4WF2A 1ZQ1A 4N4GA 3CXCA 1U1SA 3RUXA 1KQSS 3M4YA 1YITA 4PJOD 4IUUA 3L2WA 1FWZA 1WJQA 5CCAA 1WNLA 5A2QE 1BI3A 3L2UA 1VQMT 5CAIA 4HT8A 4M75E 1Y96A 4Y91A 4C92B 4EPCA 1W2BS 4JRQA 2E10A 4M75F 4XTZA 3JCMP 5FU7B 2Y90A 4JRPA 2O01E 2RH2A 2Y4YA 3QJ6A 4DOWA 3GPLA 1M1KC 2RHYA 2RHUA 3S3MA 2LVMA 4M78C 3HP9A 1I4K1 2QXFA 3LYIA 3M54A 5LJ5e 3MEVA 5DY9A 3CCQA 1VQ4A 1VQPA 3LH0A 2EYQA 1Q82C 4P5NA 3OYKA 2MWOA 1VQKT 2VGNA 2IG0A 1U8RA 4RCBA 3JSCA 2YHTA 3MO8A 1JB0E 3NFCA 4BB7A 1PSEA 2X4JA 1YI2T 1QVFA 4E7KA 1BKBA 4C5EA 2EAYA 4V2SA 5LJ3h 4KULA 2ZGWA 3OYBA 1KD1U 4O6JA 5J39A 1M9SA 1UGPB 4C0DB 1VQMA 5GANd 4NOYA 2D0QB 5CKEA 5CQYA 3SWNC 4C8QB 2P0KA 2R57A 3META 2EQMA 2F5TX 5I2MA 3JCMh 4ZN1A 1YJNT 3Q1JA 5GAMf 1Q86C 3FIFA 3VKIA 3L2ZA 4M75D 2CGHA 4ZN3A 1X6OA 3C12A 1KC8C 4D6WA 3R6OA 3OYAA 4MMKA 4PNOA 4KUDK 2LC4A 2RK2A 2PVDB 1LNXA 1KHCA 1WJSA 2M1HA 2ZPBB 3JCMX 3UWNA 1VQKA 2EJGA 1D3BB 4LDXA 4XU0A 4M77E 5FRNA 4OVAA 5HY6A 3MEUA 1XOVA 3PFSA 4XTXA 5KCOA 2VXFA 4M77F 3ZEHA 3AHUA 2JZ2A 1M5Q1 2PVGB 5LJ5d 3CCJT 4BDYA 2QDYB 2MF2A 1Q81C 4M7AG 3RKWA 2GCXA 4RCCA 3VJPA 1RI0A 4RKUE 1LJOA 2K4YA 3EFRA 3M9QA 3OYYA 2YLCA 2RD1A 3JCMW 2EWNA 1WJRA 1YHQT 3BY7A 4EDUA 5CK9A 1N9RA 2XHCA 5DLQE 2K57A 2X35A 5GMKe 3JB9D 4B9WA 2V8KA 1M1GA 4J7FA 4MZMA 3I55T 2K3YA 3SB2A 3OYMA 4C0GA 3CPWS 1VIEA 1BI1A 5KE3A 1BIAA 4L59A 1VQ9T 4OB1B 3VYHB 1X01A 4GY5A 4BD3A 4BUGA 2PQWA 4QQGA 2LTOA 2KDSA 3BFMA 5C0MA 3CC2A 3PTAA 1SSFA 4BDZA 2R5MA 1K9MC 2RA2A 3OBWA 1OI1A 4DA4A 1MGQA 3HSBA 3L1AA 2WSCE 4QQ6A 3SFMA 3M58A 2JNGA 2M0OA 2DTIA 1YJWT 5GAOn 2DTOA 4ZGJB 1P92A 4IUQA 4M7AC 2RB6A 3ZBDA 1ZBXA 2XDBA 3GP8A 3MEAA 2LDMA 1H3ZA 2YLBA 4M7DE 3OYLA 4R56A 2P0PA 1UGRB 5GAMe 5GMKl 1YHQA 4M7DF 3QXEB 3CMAT 2VXEA 3CBMA 3CC7T 3KBGA 2QQ9A 2HNIA 1VQ7T 4JLGA 2KY9A 2VC8A 3FB9A 4FSXA 3URGA 4LDWA 3I55A 4Y28E 1M90U 2FB7A 3WXMB 4PJOF 2CZ6B 3A8GB 4EMKC 3S3NA 1VQ9A 1QVPA 3T9NA 2EQJA 2DZCA 2ZPHB 2RHZA 3RESA 3L2QA 2QA4A 1G3TA 2WACA 3FDRA 4M78E 3MEWA 2PUOB 1FXXA 4LDUA 1G3SA 4C92E 2DAQA 3INZA 1AHJB 4HKEA 3HRTA 3FJPA 1YJWA 2VGMA 2MWPA 1QP2A 1K73C 3G6ET 2RO0A 5GANg 4XQ3A 3QDRB 4C0FA 4E7LA 3J81E 4M77A 1JJ2A 5KE2A 5GANj 5D6XA 2D9TA 3CMAA 3HRUA 5EG2A 3CC7A 3CPFA 1KG1A 1VQ7A 1O9SA 3OYNA 3FRNA 4XTYA 3ASKA 3CCET 1VQNT 2XIDA 5HK0A 4F7UF 2CZ0B 4C5HA 1G5VA 4GLKA 3OYCA 3A8HB 5CR2A 5FLXE 4NL2A 1RL2A 5AYFA 4C5GA 1YIJT 4MDXA 3V7CA 2F69A 1MHNA 2DXBA 5LJ5g 3BDLA 1OYXA 4J8OA 2DXUA 4JUVA 2FL7A 1M1FA 4M78D 5LJ5j 3NTKA 2X4WA 1KQ1A 4J6WA 4N0AA 4C92D 4RG8A 3G6EA 3V7SA 4TVRA 2QQRA 2A3LA 3OW2A 4C8QG 4C92C 4PJOB 2MMPA 5CIUA 2DXTA 1N8RU 2CKKA 3VV0A 2H3JA 2QQSA 5FU7C 5M9OA 3HL8A 5GAN2 5GMKi 1LOJA 3A5ZB 3HRSA 5FROA 5IAYA 3L2RA 4LDVA 1N27A 3N5BB 2JN0A 2JTMA 3QZ9B 5C6SA 3OSVA 3OB9A 3OYFA 5LJ3f 2FYKA 4DOVA 5GAOq 3X20B 1FX7A 1XTDA 2LRQA 3CCEA 1VQLT 3J7AF 2XD0A 4X9CA 1O75A 3PMTA 3L2VA 4M7DA 5FRMA 4A54A 3OYHA 1W4SA 2HBPA 4A4EA 3JCMf 3CCST 1YIJA 5I21A 2CS7A 4II1A 3OS2A 3JB9F 1VUBA 4PJOA 3H8ZA 1JBMA 2A7YA 4KUIA 5CQXA 3UPUA 4KBMB 3CCMT 2C06A 2EQKA 2V8JA 1H641 3VU3C 4LD9K 3QG1A 4C0DC 4C8QD 3MP6A 3KUFA 1S72T 2XK0A 3ER0A 3JCMJ 4F7UB 4QQDA 4IUTA 4O5VA 4C8QC 2E41A 2CZ7B 2Y4XA 5I2SA 3CCUT 4Z02A 2P0QA 4M7AE 4M75B 1YI2A 1VQLA 1KQSA 2K5FA 1KQ2A 3PIOA 4XAXB 2DPPB 1WQ7A 2QQBA 5GMKm 3CCSA 5GAN5 2BIVA 1W2BA 5GMKj 5L8RE 2QQAA 4OP0A 1YJNA 2GFUA 4YTLA 1QVGA 2OTLT 3QSUA 4F7UA 2R58A 1WQWA 2O4XA 3CCMA 3OYJA 4XTUA 4J7IA 2GQVA 2XKOC 4DQ2A 1S72A 2ZPEB 3M53A 5D6WA 3OYEA 2IVWA 3DKMA 4M75A 1Q7YU 3A8OB 2M16A 4JRKA 1G3YA 2E64A 2I2LA 4J5YA 4M77G 3CCUA 4JS5A 1N6AA 5LJ3e 4XK8E 2M9UA 3OA6A 2XU8A 5GAN6 4ELYC 3HFNA 3MHXA 5DLOA 5GAMg 1B34B 3CCJA 3GOXA 2D6FA 5FU6B 4M7AD 2AHJB 3NTHA 3P8DA 3JCMe 2JUFA 2LX9A 2V8IA 3RKYA 5GAMj 1Y7XA 2E6NA 5A0GA 5GAN8 4HA8A 3M59A 2KAFA 4E47A 5DM7R 4HCBA 3C95A 4IUPA 2X4YA 3DLLA 1Y71A 4L6V5 4LD6A 5CKBA 3EAEA 2RI3A 3CXCS 5GANh 3LWHA 1EIFA 3WVDB 3A8MB 4M77B 1I81A 4J6XA 1VQ6T 3I56T 4IUVA 3JB9H 5J26A 3L42A 3OS0A 1WGSA 4XU2A 1B34A 2RJFA 4EMHA 1QP3A 3QZ5B 3CCRT 2EJ9A 3BDUA 3HPWA 3DB4A 2OTJT 2G3RA 3FLGA 1NJIU 1VQ5T 2JTFA 4M78F 4N4HA 2K5IA 2VUBA 4C92F 3OW2S 2VYTA 3UDCA 4LDYA 2NLUA 2LCLA 3OYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C06 A;  1UB4 A;  2KMT A;  4MZM A;  4ELZ C;  3G7Z A;  5CKB A;  5CKF A;  5HKC A;  3JSC A;  3NFC A;  4MZP A;  3TCJ A;  1X75 C;  5CKH A;  5HK0 A;  3JRZ A;  5CCA A;  5CR2 A;  4OF1 A;  4MDX A;  1NE8 A;  3HPW A;  2MF2 A;  5CQX A;  4ELY C;  5HK3 A;  5DLO A;  5CKE A;  4HKE A;  5CQY A;  5CO7 A;  5CKD A;  2VUB A;  1VUB A;  1M1F A;  4MZT A;  4ME7 A;  4VUB A;  5CK9 A;  3VUB A; 
#chains in the Genus database with same CATH topology
 2L5Q A;  3CME T;  1MMN A;  2EQI A;  2EW3 A;  1RAB B;  1VQ6 Q;  4E7I A;  3DB3 A;  2SRC A;  5IN1 A;  1I5O B;  3CPW A;  3CCR Q;  2DET A;  2WSF E;  2CP0 A;  1AWW A;  2F2X A;  2OTJ Q;  2DK3 A;  2KK4 A;  3PT9 A;  4L5G A;  1GCQ C;  3M0T A;  2JMC A;  2L3R A;  5A0L A;  4QVD A;  3D7S B;  4N4I A;  1M3C A;  5CKD A;  3QYH B;  1M1K R;  1U3O A;  1WYX A;  5FWC A;  2E1H A;  1VQP T;  3CME Q;  2E12 A;  5LL6 S;  2DM1 A;  3LGL A;  1Z9Q A;  2B8A A;  1GFC A;  2BKD N;  1HK9 A;  4BE2 A;  2ZPG B;  3P8H A;  1SG5 A;  4JZ4 A;  1VQN A;  2PNI A;  3CD6 A;  1VQP Q;  3VS6 A;  4ATO A;  1ABQ A;  3OY9 A;  4M75 G;  1JO8 A;  4B9X A;  2O88 A;  2DD4 A;  4XTW A;  3HFO A;  2B86 A;  3QHS A;  4LUE A;  1K9A A;  3V7R A;  3CCV T;  2HQE A;  2RNA A;  2F5K A;  1NPR A;  2EFI A;  3SWN B;  1N9S A;  2CUB A;  4AG1 C;  4C92 A;  3OYD A;  1WDX A;  2DE0 X;  4QVC A;  4OB3 B;  2DTH A;  4M7A F;  3PGG A;  1VYT A;  1VIF A;  5GAN 7;  2ESW A;  4AMC A;  2LQ8 A;  3GNF B;  5HCK A;  4XU1 A;  1Q81 U;  1QKW A;  3RDV A;  1WZO A;  3CCV Q;  4ZGE B;  3EHQ A;  2A36 A;  1WPY A;  1QW1 A;  4JZ3 A;  2E70 A;  3CC2 T;  3E9G A;  2NYS A;  2DEQ A;  1T0J A;  2EVR A;  2F2W A;  3QUI A;  3RR6 A;  4BI8 B;  4RMO A;  3EHR A;  3E19 A;  1VQO A;  3JCM Q;  1YNZ A;  4MZT A;  2HKQ B;  3CC2 Q;  4ZTF A;  2OTL A;  4KT0 E;  1DJ7 B;  2JOY A;  2LT4 A;  2CYZ B;  3UF4 A;  3LLR A;  3OBY A;  5IHI A;  3QBY A;  4OB2 B;  2GGR A;  4M77 D;  1ACM B;  1RAF B;  2X4X A;  4E7H A;  5AT1 B;  1TG0 A;  4EMK B;  5LJ5 f;  4FW2 A;  2DEU A;  3LW5 E;  3G71 T;  3G4S T;  5LJ3 d;  2RHX A;  5J3B A;  1AEY A;  1M27 C;  2F1L A;  2QK0 A;  1IB8 A;  2ATC B;  1OU9 A;  2D8J A;  2DJQ A;  3SHW A;  4OMF B;  4ZGD B;  2RF0 A;  1VQ6 A;  4IKF A;  5GAO p;  2ED0 A;  4BY6 C;  1ZA2 B;  1Y96 B;  4OMP A;  3G71 Q;  1YCY A;  3QPH A;  2OTJ A;  2RK1 A;  3G4S Q;  2L89 A;  3OSS C;  1IRE B;  3TQ7 P;  1YBY A;  3HKS A;  3VYG A;  2ZPI B;  4X34 A;  3ZFJ A;  2A08 A;  2DA9 A;  3CCL A;  3QKJ A;  3GNG A;  5HKC A;  3OS5 A;  3CME A;  2XG8 D;  1ZQ1 A;  1KQS S;  3M4Y A;  4LNP A;  2EGE A;  3L2W A;  1WJQ A;  1PM3 A;  1PKS A;  4EPC A;  1UJ0 A;  2VVK A;  2YXY A;  4JRP A;  2O01 E;  3GPL A;  1QLY A;  3S3M A;  1I4K 1;  1VQP A;  1Q82 C;  4P5N A;  1NM7 A;  4RCB A;  4JJC A;  2RQU A;  4GLM A;  4O6J A;  1UGP B;  5CQY A;  4X1V A;  3UA6 A;  2P0K A;  5I2M A;  3VKI A;  1TSF A;  3C12 A;  4D6W A;  4RTY A;  2P84 A;  2DYI A;  3R6O A;  1S1N A;  2EYY A;  4Z8A A;  2RK2 A;  2JTE A;  3JCM X;  1D3B B;  5KYX B;  5KCO A;  4M77 F;  2JZ2 A;  1SHG A;  4BDY A;  5KYW A;  4LN2 A;  1Q81 C;  3RKW A;  2GCX A;  3OYY A;  2RD1 A;  2EWN A;  1WLP B;  3EGX A;  1S72 Q;  3JB9 D;  2K57 A;  4AFQ C;  4J7F A;  4MZM A;  2LJ1 A;  3SB2 A;  4C0G A;  2K3B A;  3CPW S;  1BIA A;  2D1X A;  1VQ9 T;  4OB1 B;  4OMM A;  1OU8 A;  4BD3 A;  3CC2 A;  3A1P A;  1OX9 A;  2RA2 A;  1NBE B;  3SFM A;  1YJW T;  1V1C A;  4ZGJ B;  4J9G A;  1Y57 A;  3ZBD A;  2HSE B;  2FPD A;  4M7D E;  3OYL A;  4R56 A;  1UGR B;  5GAM e;  5GMK l;  1I07 A;  4PFO A;  1WIE A;  1VQ9 Q;  2HCK A;  8AT1 B;  2VC8 A;  3FB9 A;  3URG A;  4LDW A;  4RTV A;  1RAI B;  1M90 U;  2FB7 A;  3S3N A;  1QVP A;  3T9N A;  3L2Q A;  1UHF A;  2KRO A;  4KGX B;  4M78 E;  3INZ A;  5IHN A;  3HRT A;  4IIO A;  2MWP A;  1QP2 A;  5D7U A;  5GAN g;  4F17 A;  3J81 E;  1WXB A;  5GAN j;  5D6X A;  1KQS P;  4JPB W;  3H0H A;  2X3W D;  3EGD B;  3FRN A;  1VYV A;  2DRK A;  1X43 A;  2XID A;  4F7U F;  1KJW A;  3IQL A;  3OYC A;  5CR2 A;  1WHJ A;  5FLX E;  4NL2 A;  2F69 A;  2DXB A;  3BDL A;  4PJM A;  2X4W A;  1KQ1 A;  4J6W A;  4C92 D;  4RG8 A;  3OW2 A;  3A5Z B;  1N27 A;  3M0P A;  3QZ9 B;  2HEQ A;  5LJ3 f;  4DOV A;  3CCE A;  1XTD A;  1R0C B;  1ZSG A;  4CC3 A;  1JU5 C;  1QWF A;  2HBP A;  3JCM f;  1YIJ A;  2CS7 A;  4II1 A;  2BTT A;  1BB9 A;  2O9V A;  3JB9 F;  1VUB A;  2VB6 A;  4PJO A;  3H8Z A;  2A7Y A;  2AT1 B;  4FCY A;  4LD9 K;  3QG1 A;  4C0D C;  3R6N A;  1J3T A;  2E41 A;  1ZUU A;  1PG5 B;  4M7A E;  4J9C A;  1VQL A;  2EYX A;  1K0S A;  1PD0 A;  2HBW A;  3CPW P;  1Y0M A;  4E2F B;  1SPK A;  2CP3 A;  3CCM A;  1X6B A;  2DX1 A;  4J7I A;  1H8K A;  2GQV A;  2XKO C;  4DQ2 A;  3FJ5 A;  1S72 A;  2ZPE B;  2DRM A;  4FW1 A;  4CC4 B;  2I2L A;  2M9U A;  2XU8 A;  3HFN A;  3HTR A;  4ESR A;  5DLO A;  4RUG A;  3VS5 A;  2DBK A;  2E6N A;  1EZZ B;  2KNB B;  5A0G A;  5GAN 8;  4HA8 A;  2KAF A;  4RTZ A;  1NYF A;  4E47 A;  2KRN A;  1D1A A;  3EG9 B;  3DLL A;  4L6V 5;  2AZS A;  5GAN h;  1T3L A;  3A8M B;  2DNU A;  2GTJ A;  2QAZ A;  1B34 A;  2RJF A;  3QZ5 B;  2DYB A;  1NJI U;  1VQ5 T;  4C92 F;  1KSW A;  2EPD A;  1PC0 A;  1AWX A;  1QMC A;  4FU6 A;  4DBF A;  2E65 A;  2V1Q A;  1M90 C;  3RIR A;  4WCI A;  4XTV A;  4A4H A;  2E5Q A;  5KYY A;  3KXT A;  3GLX A;  3VS4 A;  3CD6 T;  3EFO B;  5GAM d;  1VQ5 Q;  2KSS A;  3RMS A;  2COZ A;  2DL7 A;  5IXF A;  2PU9 B;  3OQ5 A;  4M7D B;  3X28 B;  3DLM A;  4C8Q E;  3GIB A;  1VOM A;  2GFA A;  1M8V A;  1UB4 A;  2OI3 A;  3RKX A;  3V8J A;  1MND A;  1W70 A;  1WI7 A;  3JCM V;  2FEI A;  3CD6 Q;  1JXO A;  1U06 A;  3RBB B;  4PJO C;  4M78 B;  4DEX A;  3MPU B;  3VS0 A;  3LGF A;  3LWI A;  1QVG S;  1BYM A;  2VWF A;  4E7J A;  4OGE A;  4DBR A;  3EG1 A;  2H8H A;  1K8A C;  4JJB A;  2KMT A;  2C0O A;  1KC8 U;  1MMA A;  3FEO A;  2K5L A;  1KD1 R;  2YRV A;  2DZ9 A;  2BE9 B;  2DD5 A;  1OPL A;  3NTI A;  2XI9 A;  1PRL C;  1VQO T;  2K6D A;  3SDZ A;  1Z9Z A;  5CO7 A;  2RMO A;  2KEA A;  2FRY A;  1QCN A;  3TEE A;  2FZG B;  4DEY A;  1OZ2 A;  2BZ8 A;  2RJC A;  4A4G A;  1TUG B;  1GBQ A;  3M57 A;  3JB9 J;  2ROL A;  2NWM A;  1VQO Q;  1UGS B;  3EH1 A;  4IUR A;  1NLP C;  4QT7 A;  1SSH A;  2G6F X;  2KVQ G;  1OX8 A;  4UC4 A;  5IT9 E;  5FWB A;  1K1Z A;  1GXI E;  1IZ6 A;  1D3B A;  4ELZ C;  3C4S A;  4JJD A;  2QA4 T;  2MAM A;  4M7A B;  5GAO r;  4M77 C;  3M55 A;  1I8F A;  1ZHI A;  2JT4 A;  1CKB A;  1AOJ A;  2HQX A;  5CKH A;  3F70 A;  3CCL T;  1K73 U;  2PVO B;  4M7D G;  2QA4 Q;  3E1S A;  3JAM E;  1NPP A;  5GAO l;  4AFZ C;  4CC7 A;  1NJI C;  4C0Z A;  2QG9 B;  1KHI A;  3PVQ A;  1U1T A;  2CZ1 B;  2OAU A;  1RLQ C;  4AFS C;  4M78 G;  3CCL Q;  1VQ5 A;  2A28 A;  2CRE A;  3LH5 A;  3LX7 A;  2EBP A;  4PL6 A;  3SD4 A;  4JJN K;  3OS1 A;  3O8V A;  3BW1 A;  2KYM A;  4F7U E;  1Q82 U;  3CXC A;  4PJO D;  1NEG A;  1FWZ A;  4HT8 A;  3L2U A;  1ZSZ A;  4M75 F;  4XTZ A;  3JCM P;  5FU7 B;  1ZX6 A;  2RH2 A;  1M1K C;  1M2V B;  2RHY A;  3HP9 A;  1VQ4 A;  1K0X A;  2EYQ A;  2IPO B;  2VGN A;  1U8R A;  2DL5 A;  2YHT A;  4BB7 A;  2LCS A;  1MUZ A;  4AFU C;  4E7K A;  1IGU A;  1BKB A;  1WHK A;  4C5E A;  1TUC A;  4V2S A;  1LVK A;  1I0C A;  5KYU B;  5GAN d;  2DVJ A;  4C8Q B;  3MET A;  1YJN T;  2H3E B;  5GAM f;  3FIF A;  2D8H A;  3L2Z A;  5GJV B;  1KC8 C;  4PJN A;  3RNJ A;  2CH4 W;  1KK7 A;  4PNO A;  1N5Z A;  1KIK A;  1FMW A;  2PVD B;  2ZPB B;  1VQK A;  4XU0 A;  5HY6 A;  1XOV A;  4XTX A;  2VXF A;  1M5Q 1;  4KH1 B;  2GBQ A;  3CCJ T;  2GTO A;  2LX7 A;  2QDY B;  1RAC B;  4M7A G;  1YJN Q;  4DBQ A;  4RCC A;  3VJP A;  1GFD A;  2OJ2 A;  2QDL A;  2YLC A;  5CK9 A;  2PZ1 A;  1N9R A;  1K76 A;  1M1G A;  2K3Y A;  2FPE A;  1X01 A;  4GY5 A;  4QQG A;  2LTO A;  1X69 A;  3CCJ Q;  5I22 A;  5C0M A;  2KRM A;  2QGG A;  4QQ6 A;  3OW2 P;  2M0O A;  2DTO A;  2NUT A;  2QTV A;  2EYZ A;  3KBG A;  1JQQ A;  2KY9 A;  4FSX A;  3I55 A;  4D8K A;  2E3I A;  4PJO F;  3A8G B;  2QA4 A;  2AKK A;  2JS0 A;  1HD3 A;  1FXX A;  1G3S A;  4C92 E;  2NUP A;  2VGM A;  1K73 C;  4XQ3 A;  1R0B G;  4J9F A;  5KE2 A;  2D9T A;  3HRU A;  3CPF A;  1ZSZ C;  4XTY A;  3CCE T;  5HK0 A;  2CZ0 B;  1G5V A;  1Q95 G;  1YIJ T;  1TXQ A;  5LJ5 g;  1YFN A;  1FYN A;  2DXU A;  1M1F A;  1N8R R;  5LJ5 j;  1UG1 A;  1YWO A;  2A3L A;  4C8Q G;  4C92 C;  2DXT A;  2CKK A;  3PVL A;  3VV0 A;  2QQS A;  5M9O A;  3HL8 A;  3CCE Q;  5IXB A;  1NG2 A;  3OSV A;  3REA B;  1YIJ Q;  1VQL T;  3X20 B;  1FX7 A;  2HL5 C;  2XD0 A;  1RI9 A;  3L2V A;  4M7D A;  2J6F A;  3OYH A;  1X2Q A;  4DBH A;  5CQX A;  2KXD A;  1MMG A;  3CCM T;  1JEG A;  2C06 A;  2KR3 A;  1S72 T;  2XK0 A;  3JCM J;  4F7U B;  4QQD A;  4O5V A;  1VQL Q;  2HL3 A;  2K9G A;  4Z02 A;  2P0Q A;  1YN8 A;  3TSZ A;  1RUW A;  1Q81 R;  1E6G A;  2HQH A;  4AG2 C;  1B7T A;  2DPP B;  2QQB A;  4A63 B;  3CCM Q;  3CCS A;  1C0M A;  5GAN 5;  5GMK j;  1YJN A;  1QVG A;  1H3H A;  2KRS A;  2R58 A;  2LJ3 A;  1Q7Y R;  2YDL A;  3M53 A;  5D6W A;  2IVW A;  4M75 A;  1OEB A;  2M16 A;  4M77 G;  4XK8 E;  1YP5 A;  3OA6 A;  3NHN A;  4ELY C;  2DLP A;  3MHX A;  3CCJ A;  5FW9 A;  1AZE A;  2LX9 A;  2FPF A;  1SRL A;  2V8I A;  2J06 A;  1Y7X A;  4HXJ A;  4LD6 A;  5CKB A;  3CXC S;  4F14 A;  1WA7 A;  4HVV A;  2Z0W A;  4M4Z A;  3WVD B;  4IIM A;  4IUV A;  4KH0 B;  3OS0 A;  1D1B A;  3HPW A;  2MCN A;  4B6M A;  2BZX A;  2G3R A;  2JTF A;  4N4H A;  2VUB A;  1X27 A;  2E4H A;  1PCX A;  3UDC A;  1CKA A;  5A0D A;  2NLU A;  4VUB A;  2LCL A;  3UPU A;  2X3X D;  5LJ5 h;  3PIP A;  4ZTJ A;  4BY6 B;  3VS2 A;  3THK A;  1YIT T;  3RMQ A;  1VA7 A;  3UT1 A;  3V8L A;  1NEB A;  2FVU A;  2BUD A;  3PE0 A;  5CVI A;  1UE9 A;  1UEB A;  1WFW A;  2M02 A;  4FYV B;  2RHI A;  1BCO A;  3V8K A;  4QW2 A;  1YIT Q;  2I0N A;  2HAX A;  1X2K A;  4BE1 A;  1K8A U;  1IRX A;  2JW4 A;  1G8X A;  2DJZ A;  1YJ9 A;  2R5A A;  1C6V X;  1QWE A;  2LQN A;  4F7U G;  3QJY A;  2JMA A;  1UEC A;  3CC4 A;  3CCQ Q;  1Q86 R;  1YCS B;  1VQ8 A;  2AIR B;  2JM8 A;  2LCC A;  3JCM b;  5GMK h;  1M4Z A;  2IIM A;  3JCM c;  4HT9 A;  1UFF A;  4JRI A;  1WXU A;  3S3O A;  2CSI A;  2EQU A;  2YUP A;  2O4X B;  5KH6 A;  1VQM Q;  2L2P A;  1RAA B;  3EFS A;  1TWB A;  4NS5 A;  4BI4 A;  2BE7 D;  3J80 E;  3VRY A;  2CT4 A;  3JB9 G;  3C94 A;  4LUD A;  4BI3 A;  3OMG A;  4M75 C;  2EGA A;  1IXD A;  3SWN A;  1UUE A;  1QKX A;  5LJ3 g;  3MP1 A;  4A4K A;  5KCH A;  2OX7 A;  4BE0 A;  2LT1 A;  1RAD B;  5LJ3 j;  1OUL A;  1BI0 A;  1K9M R;  2PUK B;  3JCM g;  4RTX A;  4C8Q A;  1B3Q A;  2CP5 A;  3H6Z A;  4OB0 B;  3EG2 A;  3MP8 A;  2FRW A;  3CXC P;  4OML A;  3X25 B;  3ME9 A;  1VYU A;  5GAN 3;  3VS3 A;  5FU6 C;  5GAO m;  1W1F A;  1B07 A;  5EC7 A;  4EMG A;  2QEX A;  4Q5W A;  3CBO A;  3TCJ A;  1WHH A;  3M56 A;  4PLI A;  2E6Z A;  1LPL A;  2COY A;  2W0Z A;  2PTK A;  2LQK A;  2A37 A;  1XNI A;  1M30 A;  3A8L B;  2HDA A;  1F1B B;  2LNV A;  3M0U A;  3PNW C;  4PJO E;  1UHC A;  3WVE B;  1PRM C;  2J05 A;  4MZP A;  3VRZ A;  3MCA B;  3CBP A;  2L3S A;  1RAG B;  1V29 B;  3VUZ A;  2FHD A;  2RI5 A;  1NE8 A;  2KI7 A;  4BAC A;  1AZG B;  4D8D A;  2DKG A;  4EMK A;  2A0F B;  2EJF A;  1TH7 A;  1IHV A;  3CEY A;  4JS4 A;  1AT1 B;  2K3X A;  3CC7 Q;  4CI0 C;  1R8O B;  4C92 G;  4HCZ A;  3JV3 A;  1VQ4 T;  2HD0 A;  2MI6 A;  2VV5 A;  1M1K U;  2KT1 A;  4M7D D;  4OGC A;  5GAN e;  3QDF A;  2GF7 A;  2DFU A;  2RQR A;  1YIT A;  1ZLM A;  1ZUK A;  1WNL A;  1BBZ A;  1Y96 A;  2E10 A;  2Y90 A;  5ECA A;  1VQ4 Q;  2GQI A;  3QJ6 A;  2YWW A;  4J9H A;  2LVM A;  2QXF A;  3ULR B;  5DY9 A;  3CCQ A;  3OYK A;  2MWO A;  1VQK T;  2M0Y A;  3NMZ C;  2DL4 A;  1CSK A;  1PSE A;  4GBQ A;  1FMK A;  2KE9 A;  2X4J A;  1QVF A;  1M3B A;  2EAY A;  5LJ3 h;  2ZGW A;  1PD1 A;  3OYB A;  3EGU A;  5J39 A;  4C0D B;  1K4U S;  1VQM A;  4NOY A;  1GL5 A;  3SWN C;  4J9I A;  5KYW B;  2EQM A;  2F5T X;  3JCM h;  1PHT A;  4ZN1 A;  1BCM A;  4M75 D;  1X6O A;  1VQK Q;  3H9N A;  3EGX B;  3OYA A;  4MMK A;  4J9B A;  4KUD K;  2LC4 A;  1A0N B;  1LNX A;  1WJS A;  2MIO A;  3UWN A;  4LDX A;  2CH4 A;  4M77 E;  4OVA A;  1KD1 C;  3AHU A;  3AT1 B;  5LJ5 d;  2JS2 A;  3A98 A;  3BY7 A;  4EDU A;  5DLQ E;  2QGF B;  2V8K A;  3I55 T;  3OYM A;  5KYX A;  4L59 A;  2RQW A;  3C0C A;  3VYH B;  4BUG A;  1SF9 A;  3PTA A;  1SSF A;  4BDZ A;  2R5M A;  4DA4 A;  2WSC E;  2GNC A;  2DTI A;  3G1J A;  1P92 A;  4IUQ A;  2RB6 A;  2XDB A;  2DBM A;  3I55 Q;  1YHQ A;  4M7D F;  3O5Z A;  3QXE B;  4PFZ A;  3CBM A;  2QQ9 A;  2HNI A;  4JLG A;  1SEM A;  2O9S A;  4RTT A;  4F16 A;  4EMK C;  1XJW B;  2EQJ A;  1NJI R;  2DZC A;  1MV0 B;  2RHZ A;  3RES A;  3I5S A;  2AZV A;  2WAC A;  3FDR A;  3MEW A;  2PUO B;  2ZAE A;  4LDU A;  2EGC A;  3FJP A;  1YWP A;  1QQJ A;  5KYN A;  4AT1 B;  1GCP A;  1JJ2 A;  3CMA A;  3CC7 A;  1VQ7 A;  1O9S A;  4ZNX A;  2YT6 A;  3ASK A;  2LZ6 B;  3REB B;  1ARK A;  3KFV A;  2BZY A;  1QVG P;  3V7C A;  1OYX A;  4J8O A;  4JUV A;  1R77 A;  2FL7 A;  1AD5 A;  3NTK A;  4N0A A;  5L23 A;  1SRM A;  3G6E A;  2MYS A;  3V7S A;  4PJO B;  2MMP A;  3CQT A;  3EGD A;  1N8R U;  2E5K A;  5GAN 2;  2H3J A;  4F04 B;  5GMK i;  3HRS A;  4LDV A;  1MV3 A;  2VKN A;  2JN0 A;  2JTM A;  5C6S A;  3OB9 A;  2FYK A;  1H3Z A;  2LRQ A;  4X9C A;  1O75 A;  1T3S A;  3PMT A;  1RAE B;  3MKD A;  2QAS A;  2ED1 A;  1NLO C;  4A4E A;  3CCS T;  5I21 A;  3EG3 A;  3OS2 A;  2KT8 A;  2RQT A;  4PJL A;  1KC8 R;  1JBM A;  4E7S A;  1G2B A;  4KBM B;  2MK5 A;  3NGP A;  2EQK A;  2V8J A;  1H64 1;  1M8M A;  3VU3 C;  4C8Q D;  3KUF A;  3ER0 A;  4IUT A;  4E6R A;  2COW A;  2CZ7 B;  2Y4X A;  5I2S A;  1C1A A;  4WTO B;  1WHL A;  3QWY A;  2W10 A;  3CCS Q;  1KQ2 A;  5GMK m;  1D0Z A;  1WHG A;  2BIV A;  1W2B A;  5L8R E;  1D0Y A;  3QSU A;  2GFU A;  8ATC B;  1WQW A;  2O4X A;  3OYJ A;  4XTU A;  3E2U A;  2JM9 A;  2V1R A;  1OPK A;  4OMO A;  3OYE A;  3DKM A;  1Q7Y U;  1HJD A;  3A8O B;  5I11 A;  4JRK A;  2KGT A;  4J5Y A;  3CCU A;  4JS5 A;  5GAN 6;  5GAM g;  2D6F A;  1B34 B;  3GOX A;  1V76 A;  3M0R A;  2AHJ B;  2V26 A;  3P8D A;  3RKY A;  4Z89 A;  5GAM j;  4HCB A;  3M59 A;  3UA7 A;  3C95 A;  4EIK A;  4IUP A;  2X4Y A;  4KGZ B;  2HZY A;  3LWH A;  1EIF A;  1TS9 A;  4M77 B;  4LE9 A;  1I81 A;  2DMO A;  5KYY B;  3I56 T;  1X6G A;  1TOV A;  3BE3 A;  3L42 A;  1WGS A;  1HSQ A;  4EMH A;  2EJ9 A;  3BDU A;  3DB4 A;  3FLG A;  2ENM A;  2XMF A;  1K73 R;  1G83 A;  5IHK A;  2VYT A;  3EG9 A;  4LDY A;  3OYG A;  2P4T A;  1E7O A;  3TRE A;  5CKF A;  2DIQ A;  4FL6 A;  2RJE A;  3I56 Q;  1OZ3 A;  2XIC A;  2X9H A;  3OYI A;  1QVF S;  4PLL A;  3QO3 A;  3HHT B;  3FC3 A;  3JCM d;  1YJ9 T;  4PJO G;  7AT1 B;  4J83 A;  4N0A C;  3CC4 T;  1H92 A;  3CCR A;  1VQ8 T;  1UTI A;  1JXM A;  4R55 A;  4A53 A;  2DIG A;  2EIF A;  2YRC A;  4MDW A;  3VUB A;  3RER A;  4C8Q F;  4HCC A;  1WHM A;  4E7Z A;  1Q82 R;  2ZZD A;  9ATC B;  3G7Z A;  1YJ9 Q;  4PJJ A;  1QCO A;  2RJD A;  1ZA1 B;  3EFO A;  2EKO A;  2YUQ A;  1IO6 A;  3CC4 Q;  4XU3 A;  5D6Y A;  3TU4 K;  3EG0 A;  4FIB A;  1VQ8 Q;  4OF1 A;  1IHW A;  2RM4 A;  3P8B B;  1PNJ A;  4NL3 A;  2ZCF B;  3QYG B;  3M4G A;  2K7A A;  2LJ0 A;  2L0A A;  1N8R C;  1U5S A;  1Q86 U;  4JDS A;  4FYX B;  1RLP C;  1GRI A;  5GJW B;  2DVE A;  3QII A;  2C0I A;  2FZK B;  4M78 A;  1GBR A;  2HKN A;  1D09 B;  2L3Q A;  1UJY A;  2QTX A;  3VS1 A;  3X26 B;  2FO0 A;  1M2O A;  4A4F A;  1G3W A;  1SKU B;  5GAM h;  1QCF A;  2J6K A;  3QWX X;  1NZ9 A;  3M5A A;  2XDD A;  3UAT A;  4HVW A;  3OMC A;  1BI2 A;  2QEX T;  2JVV A;  3CCV A;  1NYG A;  4FT4 A;  1AWJ A;  5GAN 4;  1BK2 A;  1I5L A;  1WXT A;  1K9M U;  1XQH A;  1JJ2 S;  2L8D A;  1HXD A;  4PKC C;  1PWT A;  2QEX Q;  4J6Y A;  4HCK A;  2XDP A;  3ZL7 C;  3PMI A;  5GAN f;  1BIB A;  2YUO A;  3M0Q A;  1Q7Y C;  2K2V A;  1EX4 A;  4FT2 A;  1FMV A;  2RN8 A;  3GF5 A;  1MMD A;  4OMN A;  1PSF A;  3JRZ A;  2DXC A;  2QI2 A;  4QVZ A;  3E9F A;  5HK3 A;  2YSQ A;  4JLI A;  5IH2 A;  2M51 A;  2AKL A;  2MOX A;  1QVF P;  2DL3 A;  2RI2 A;  4M7A A;  1D0X A;  4MML A;  1UGQ B;  3X24 B;  2YRD A;  4J9D A;  2EYW A;  4C5I A;  2ZPF B;  3GBQ A;  1X75 C;  4CRI A;  1YJW Q;  3H0F A;  2FG0 A;  3I56 A;  2JJ9 A;  4X9D A;  2KQW A;  2CSQ A;  1OV3 A;  4FM4 B;  1UDL A;  3S6W A;  2E3H A;  1ZSZ B;  4ME7 A;  3CCQ T;  4KGV B;  3JB9 I;  1IGQ A;  2DO3 A;  4LXC A;  3G71 A;  2CT3 A;  2EKH A;  3G4S A;  1JRI A;  4RG2 A;  4CC2 A;  4M7D C;  2WSE E;  1Y07 A;  4WF2 A;  4N4G A;  1U1S A;  3RUX A;  4IUU A;  5CCA A;  2VAS A;  5A2Q E;  1BI3 A;  1VQM T;  5CAI A;  4M75 E;  4Y91 A;  4C92 B;  1W2B S;  4JRQ A;  2SEM A;  2Y4Y A;  4DOW A;  2RHU A;  4M78 C;  3LYI A;  3M54 A;  5LJ5 e;  3MEV A;  3LH0 A;  2IG0 A;  3JSC A;  3MO8 A;  1JB0 E;  3NFC A;  2RQV A;  1WX6 A;  1YI2 T;  4KUL A;  1EFN A;  1KD1 U;  1M9S A;  1M2V A;  5CKE A;  2D0Q B;  3I35 A;  4R0K A;  2R57 A;  1Q86 C;  3Q1J A;  2X51 A;  4ZN3 A;  2CGH A;  2JXB A;  4QKU A;  2KBT A;  2CP6 A;  4OMQ A;  1YI2 Q;  1KHC A;  2M1H A;  3NPF A;  2EJG A;  3I5R A;  3MJX A;  5FRN A;  3MEU A;  3PFS A;  3ZEH A;  5KYU A;  1PKT A;  2PVG B;  4RTW A;  2YUN A;  3VS7 A;  2MF2 A;  1JJ2 P;  1RI0 A;  4RKU E;  1LJO A;  2K4Y A;  3EFR A;  3M9Q A;  3U23 A;  3JCM W;  1WJR A;  2LQW A;  1YHQ T;  2KXC A;  2NUT B;  2XHC A;  5GMK e;  2X35 A;  4B9W A;  1VIE A;  1BI1 A;  5KE3 A;  1TTH B;  2P4R A;  2O2O A;  1HYO A;  2PQW A;  2KDS A;  3BFM A;  1I1J A;  1K9M C;  3OBW A;  1OI1 A;  1MGQ A;  3HSB A;  1RAH B;  3L1A A;  3M58 A;  2JNG A;  5GAO n;  1YHQ Q;  4M7A C;  1ZBX A;  2J7I A;  3GP8 A;  3MEA A;  2LDM A;  2YLB A;  2OAW A;  1SHF A;  2NUP B;  1UGV A;  2P0P A;  1M90 R;  3CMA T;  2VXE A;  3CC7 T;  1VQ7 T;  4RTU A;  4Y28 E;  3WXM B;  2CZ6 B;  1W6X A;  1ABO A;  1VQ9 A;  2QYZ A;  2ZPH B;  2CUD A;  2K79 A;  1G3T A;  1D1C A;  2DAQ A;  1AHJ B;  4HKE A;  1YJW A;  2KYB A;  4FYY B;  2CDT A;  3G6E T;  2RO0 A;  3CMA Q;  3QDR B;  4HVU A;  4C0F A;  4E7L A;  3H41 A;  1VQ7 Q;  1TUD A;  4M77 A;  4ORZ A;  5EG2 A;  1KG1 A;  3OYN A;  1VQN T;  2MPX C;  1W2B P;  4C5H A;  4GLK A;  3A8H B;  4KRT A;  4MDX A;  1RL2 A;  5AYF A;  4C5G A;  1MHN A;  3G6E Q;  4M78 D;  1K8A R;  1AWO A;  4Y92 A;  4TVR A;  1GCQ A;  2QQR A;  5CIU A;  2LNH B;  5FU7 C;  1OOT A;  3SEM A;  1LOJ A;  1VQN Q;  5FRO A;  5IAY A;  3L2R A;  3N5B B;  3EH2 A;  2O31 A;  3OYF A;  5GAO q;  3J7A F;  2DIL A;  2NUZ A;  5FRM A;  4A54 A;  1W4S A;  3M0S A;  2AK5 A;  4KUI A;  2DF6 A;  2HSP A;  2J6O A;  1KFZ A;  3MP6 A;  4FSS A;  4C8Q C;  2CP2 A;  4Z88 A;  2CP7 A;  3CCU T;  1AVZ C;  4M75 B;  1YI2 A;  6AT1 B;  1KQS A;  2K5F A;  1OQK A;  1MNE A;  1ZBJ A;  3PIO A;  1T0H A;  4XAX B;  1WQ7 A;  2ABL A;  3TVT A;  2QQA A;  4OP0 A;  4K11 A;  4YTL A;  3H0I A;  2OTL T;  4F7U A;  2LMJ A;  3CCU Q;  2F2V A;  1BU1 A;  2D0N A;  2HMA A;  4PK4 A;  1G3Y A;  2E64 A;  2DER A;  1E6H A;  1N6A A;  5LJ3 e;  1LCK A;  2K2M A;  2C0T A;  5FU6 B;  4M7A D;  4PFP A;  3NTH A;  3JCM e;  2JUF A;  2OTL Q;  3I9Q A;  5DM7 R;  1Y71 A;  3EAE A;  2RI3 A;  2RPN A;  1M3A A;  4J6X A;  3TSW A;  1VQ6 T;  4FYW B;  2FZC B;  3JB9 H;  5J26 A;  4XU2 A;  4J9E A;  2ECZ A;  1QP3 A;  3CCR T;  1TU0 B;  2ROT A;  2OTJ T;  1ZUY A;  2LP5 A;  4M78 F;  2L3P A;  2K5I A;  3OW2 S;  4ANJ A;  2DL8 A; 
#chains in the Genus database with same CATH homology
 4FU6 A;  2E65 A;  5LJ5 h;  1M90 C;  2L5Q A;  2P4T A;  3RIR A;  3TRE A;  3PIP A;  3CME T;  4ZTJ A;  4XTV A;  4A4H A;  2E5Q A;  5CKF A;  2DIQ A;  3DB3 A;  2RJE A;  4FL6 A;  3KXT A;  4E7I A;  1OZ3 A;  2XIC A;  4BY6 B;  3GLX A;  3OYI A;  5IN1 A;  4PLL A;  1YIT T;  1QVF S;  3QO3 A;  3HHT B;  3FC3 A;  3JCM d;  3RMQ A;  3CPW A;  4PJO G;  1YJ9 T;  3UT1 A;  3V8L A;  4J83 A;  2WSF E;  2FVU A;  2BUD A;  3CD6 T;  5CVI A;  2DK3 A;  2KK4 A;  3PT9 A;  4N0A C;  5GAM d;  3CC4 T;  2KSS A;  4L5G A;  3CCR A;  3RMS A;  1UEB A;  1VQ8 T;  2L3R A;  5A0L A;  4QVD A;  4R55 A;  4N4I A;  5CKD A;  2PU9 B;  3OQ5 A;  3QYH B;  3X28 B;  3DLM A;  4A53 A;  4M7D B;  2DIG A;  2E1H A;  4C8Q E;  1VQP T;  2EIF A;  3GIB A;  4MDW A;  3RER A;  2E12 A;  2RHI A;  5LL6 S;  3VUB A;  4C8Q F;  4HCC A;  2GFA A;  3LGL A;  1M8V A;  1UB4 A;  2B8A A;  2ZZD A;  3RKX A;  3V8J A;  2BKD N;  3V8K A;  4QW2 A;  3G7Z A;  2HAX A;  1HK9 A;  4BE2 A;  2ZPG B;  4BE1 A;  1K8A U;  3JCM V;  2RJD A;  3P8H A;  2EKO A;  2DJZ A;  1YJ9 A;  4XU3 A;  2R5A A;  5D6Y A;  4F7U G;  3TU4 K;  4PJO C;  4FIB A;  3QJY A;  4M78 B;  1VQN A;  4OF1 A;  3CD6 A;  3LGF A;  3LWI A;  2RM4 A;  3P8B B;  3CC4 A;  4ATO A;  1QVG S;  1BYM A;  4NL3 A;  2ZCF B;  3QYG B;  4E7J A;  3OY9 A;  4M75 G;  1VQ8 A;  3M4G A;  4B9X A;  4OGE A;  2DD4 A;  2LCC A;  1N8R C;  3JCM b;  4XTW A;  5GMK h;  1K8A C;  3HFO A;  1Q86 U;  1M4Z A;  2KMT A;  4JDS A;  3QHS A;  3JCM c;  3V7R A;  1KC8 U;  4JRI A;  4HT9 A;  3CCV T;  2HQE A;  3S3O A;  3FEO A;  2EQU A;  2K5L A;  2F5K A;  2DVE A;  1NPR A;  2EFI A;  2O4X B;  3SWN B;  3QII A;  4M78 A;  5KH6 A;  2YRV A;  2DZ9 A;  1N9S A;  3OYD A;  2DD5 A;  4C92 A;  4QVC A;  4OB3 B;  2DTH A;  3EFS A;  2QTX A;  3NTI A;  4M7A F;  3PGG A;  1VIF A;  5GAN 7;  2XI9 A;  5A0D A;  2LQ8 A;  4NS5 A;  3GNF B;  1VQO T;  4XU1 A;  3X26 B;  4BI4 A;  3SDZ A;  3J80 E;  5CO7 A;  1Q81 U;  4A4F A;  1G3W A;  3JB9 G;  3C94 A;  4BI3 A;  3OMG A;  4M75 C;  3TEE A;  5GAM h;  1NZ9 A;  1OZ2 A;  3M5A A;  4ZGE B;  2XDD A;  3OMC A;  1WPY A;  2RJC A;  3SWN A;  1BI2 A;  1QW1 A;  4A4G A;  2QEX T;  2E70 A;  5LJ3 g;  2JVV A;  3CC2 T;  3MP1 A;  4A4K A;  3CCV A;  1KD1 C;  3E9G A;  4FT4 A;  5KCH A;  3M57 A;  4BE0 A;  2LT1 A;  5LJ3 j;  5GAN 4;  3JB9 J;  1BI0 A;  2DEQ A;  2PUK B;  1I5L A;  3JCM g;  1UGS B;  4C8Q A;  4IUR A;  3QUI A;  4BI8 B;  1K9M U;  4RMO A;  1XQH A;  2KVQ G;  3E19 A;  1VQO A;  3H6Z A;  3JCM Q;  4OB0 B;  4MZT A;  4UC4 A;  5IT9 E;  3MP8 A;  1JJ2 S;  2L8D A;  1HXD A;  3X25 B;  4PKC C;  1GXI E;  3ME9 A;  1IZ6 A;  1D3B A;  2XDP A;  4J6Y A;  3PMI A;  4ELZ C;  1BIB A;  3C4S A;  5GAN f;  5GAN 3;  4ZTF A;  5FU6 C;  1Q7Y C;  4KT0 E;  2OTL A;  2K2V A;  5GAO m;  4FT2 A;  4EMG A;  1DJ7 B;  2JOY A;  2LT4 A;  2QEX A;  2QA4 T;  2MAM A;  2CYZ B;  4Q5W A;  3CBO A;  3GF5 A;  4M7A B;  3TCJ A;  3LLR A;  1PSF A;  3OBY A;  3JRZ A;  5GAO r;  3M56 A;  3QBY A;  4OB2 B;  4PLI A;  2E6Z A;  2DXC A;  2QI2 A;  4M77 D;  4QVZ A;  3E9F A;  2X4X A;  4E7H A;  5HK3 A;  4M77 C;  2LQK A;  4JLI A;  4VUB A;  3M55 A;  1XNI A;  1I8F A;  1ZHI A;  3A8L B;  2HQX A;  4EMK B;  5CKH A;  5LJ5 f;  3LW5 E;  3G71 T;  3F70 A;  3CCL T;  2LNV A;  3G4S T;  1K73 U;  2PVO B;  4M7D G;  5LJ3 d;  2RI2 A;  2RHX A;  3PNW C;  5J3B A;  4PJO E;  3WVE B;  4M7A A;  4MML A;  1UGQ B;  3X24 B;  3E1S A;  4MZP A;  3JAM E;  1NPP A;  3MCA B;  3CBP A;  4C5I A;  2ZPF B;  1X75 C;  4OMF B;  4CRI A;  4ZGD B;  5GAO l;  1VQ6 A;  4IKF A;  1V29 B;  3VUZ A;  5GAO p;  4X9D A;  3I56 A;  1NJI C;  2FHD A;  2RI5 A;  1NE8 A;  4BAC A;  4C0Z A;  1KHI A;  2DKG A;  4BY6 C;  2OAU A;  1U1T A;  2CZ1 B;  2KQW A;  4EMK A;  2EJF A;  1TH7 A;  4FM4 B;  3CEY A;  4JS4 A;  4M78 G;  3S6W A;  1Y96 B;  2K3X A;  2OTJ A;  1YCY A;  3QPH A;  4CI0 C;  1R8O B;  2RK1 A;  4ME7 A;  4HCZ A;  4C92 G;  1VQ5 A;  2L89 A;  3OSS C;  1VQ4 T;  1IRE B;  3CCQ T;  2HD0 A;  2MI6 A;  1YBY A;  3HKS A;  3LX7 A;  4PL6 A;  3SD4 A;  3VYG A;  2ZPI B;  4X34 A;  3JB9 I;  2DO3 A;  2VV5 A;  3ZFJ A;  3OS1 A;  3G71 A;  4JJN K;  1M1K U;  3CCL A;  4M7D D;  3G4S A;  3QKJ A;  1JRI A;  3O8V A;  3BW1 A;  3GNG A;  4OGC A;  3OS5 A;  4RG2 A;  5GAN e;  5HKC A;  2WSE E;  3CME A;  4M7D C;  2XG8 D;  4F7U E;  1Q82 U;  2GF7 A;  1Y07 A;  4WF2 A;  1ZQ1 A;  4N4G A;  3CXC A;  1U1S A;  3RUX A;  1KQS S;  3M4Y A;  1YIT A;  4PJO D;  4IUU A;  3L2W A;  1FWZ A;  1WJQ A;  5CCA A;  1WNL A;  5A2Q E;  1BI3 A;  3L2U A;  1VQM T;  5CAI A;  4HT8 A;  4M75 E;  1Y96 A;  4Y91 A;  4C92 B;  4EPC A;  1W2B S;  4JRQ A;  2E10 A;  4M75 F;  4XTZ A;  3JCM P;  5FU7 B;  2Y90 A;  4JRP A;  2O01 E;  2RH2 A;  2Y4Y A;  3QJ6 A;  4DOW A;  3GPL A;  1M1K C;  2RHY A;  2RHU A;  3S3M A;  2LVM A;  4M78 C;  3HP9 A;  1I4K 1;  2QXF A;  3LYI A;  3M54 A;  5LJ5 e;  3MEV A;  5DY9 A;  3CCQ A;  1VQ4 A;  1VQP A;  3LH0 A;  2EYQ A;  1Q82 C;  4P5N A;  3OYK A;  2MWO A;  1VQK T;  2VGN A;  2IG0 A;  1U8R A;  4RCB A;  3JSC A;  2YHT A;  3MO8 A;  1JB0 E;  3NFC A;  4BB7 A;  1PSE A;  2X4J A;  1YI2 T;  1QVF A;  4E7K A;  1BKB A;  4C5E A;  2EAY A;  4V2S A;  5LJ3 h;  4KUL A;  2ZGW A;  3OYB A;  1KD1 U;  4O6J A;  5J39 A;  1M9S A;  1UGP B;  4C0D B;  1VQM A;  5GAN d;  4NOY A;  2D0Q B;  5CKE A;  5CQY A;  3SWN C;  4C8Q B;  2P0K A;  2R57 A;  3MET A;  2EQM A;  2F5T X;  5I2M A;  3JCM h;  4ZN1 A;  1YJN T;  3Q1J A;  5GAM f;  1Q86 C;  3FIF A;  3VKI A;  3L2Z A;  4M75 D;  2CGH A;  4ZN3 A;  1X6O A;  3C12 A;  1KC8 C;  4D6W A;  3R6O A;  3OYA A;  4MMK A;  4PNO A;  4KUD K;  2LC4 A;  2RK2 A;  2PVD B;  1LNX A;  1KHC A;  1WJS A;  2M1H A;  2ZPB B;  3JCM X;  3UWN A;  1VQK A;  2EJG A;  1D3B B;  4LDX A;  4XU0 A;  4M77 E;  5FRN A;  4OVA A;  5HY6 A;  3MEU A;  1XOV A;  3PFS A;  4XTX A;  5KCO A;  2VXF A;  4M77 F;  3ZEH A;  3AHU A;  2JZ2 A;  1M5Q 1;  2PVG B;  5LJ5 d;  3CCJ T;  4BDY A;  2QDY B;  2MF2 A;  1Q81 C;  4M7A G;  3RKW A;  2GCX A;  4RCC A;  3VJP A;  1RI0 A;  4RKU E;  1LJO A;  2K4Y A;  3EFR A;  3M9Q A;  3OYY A;  2YLC A;  2RD1 A;  3JCM W;  2EWN A;  1WJR A;  1YHQ T;  3BY7 A;  4EDU A;  5CK9 A;  1N9R A;  2XHC A;  5DLQ E;  2K57 A;  2X35 A;  5GMK e;  3JB9 D;  4B9W A;  2V8K A;  1M1G A;  4J7F A;  4MZM A;  3I55 T;  2K3Y A;  3SB2 A;  3OYM A;  4C0G A;  3CPW S;  1VIE A;  1BI1 A;  5KE3 A;  1BIA A;  4L59 A;  1VQ9 T;  4OB1 B;  3VYH B;  1X01 A;  4GY5 A;  4BD3 A;  4BUG A;  2PQW A;  4QQG A;  2LTO A;  2KDS A;  3BFM A;  5C0M A;  3CC2 A;  3PTA A;  1SSF A;  4BDZ A;  2R5M A;  1K9M C;  2RA2 A;  3OBW A;  1OI1 A;  4DA4 A;  1MGQ A;  3HSB A;  3L1A A;  2WSC E;  4QQ6 A;  3SFM A;  3M58 A;  2JNG A;  2M0O A;  2DTI A;  1YJW T;  5GAO n;  2DTO A;  4ZGJ B;  1P92 A;  4IUQ A;  4M7A C;  2RB6 A;  3ZBD A;  1ZBX A;  2XDB A;  3GP8 A;  3MEA A;  2LDM A;  1H3Z A;  2YLB A;  4M7D E;  3OYL A;  4R56 A;  2P0P A;  1UGR B;  5GAM e;  5GMK l;  1YHQ A;  4M7D F;  3QXE B;  3CMA T;  2VXE A;  3CBM A;  3CC7 T;  3KBG A;  2QQ9 A;  2HNI A;  1VQ7 T;  4JLG A;  2KY9 A;  2VC8 A;  3FB9 A;  4FSX A;  3URG A;  4LDW A;  3I55 A;  4Y28 E;  1M90 U;  2FB7 A;  3WXM B;  4PJO F;  2CZ6 B;  3A8G B;  4EMK C;  3S3N A;  1VQ9 A;  1QVP A;  3T9N A;  2EQJ A;  2DZC A;  2ZPH B;  2RHZ A;  3RES A;  3L2Q A;  2QA4 A;  1G3T A;  2WAC A;  3FDR A;  4M78 E;  3MEW A;  2PUO B;  1FXX A;  4LDU A;  1G3S A;  4C92 E;  2DAQ A;  3INZ A;  1AHJ B;  4HKE A;  3HRT A;  3FJP A;  1YJW A;  2VGM A;  2MWP A;  1QP2 A;  1K73 C;  3G6E T;  2RO0 A;  5GAN g;  4XQ3 A;  3QDR B;  4C0F A;  4E7L A;  3J81 E;  4M77 A;  1JJ2 A;  5KE2 A;  5GAN j;  5D6X A;  2D9T A;  3CMA A;  3HRU A;  5EG2 A;  3CC7 A;  3CPF A;  1KG1 A;  1VQ7 A;  1O9S A;  3OYN A;  3FRN A;  4XTY A;  3ASK A;  3CCE T;  1VQN T;  2XID A;  5HK0 A;  4F7U F;  2CZ0 B;  4C5H A;  1G5V A;  4GLK A;  3OYC A;  3A8H B;  5CR2 A;  5FLX E;  4NL2 A;  1RL2 A;  5AYF A;  4C5G A;  1YIJ T;  4MDX A;  3V7C A;  2F69 A;  1MHN A;  2DXB A;  5LJ5 g;  3BDL A;  1OYX A;  4J8O A;  2DXU A;  4JUV A;  2FL7 A;  1M1F A;  4M78 D;  5LJ5 j;  3NTK A;  2X4W A;  1KQ1 A;  4J6W A;  4N0A A;  4C92 D;  4RG8 A;  3G6E A;  3V7S A;  4TVR A;  2QQR A;  2A3L A;  3OW2 A;  4C8Q G;  4C92 C;  4PJO B;  2MMP A;  5CIU A;  2DXT A;  1N8R U;  2CKK A;  3VV0 A;  2H3J A;  2QQS A;  5FU7 C;  5M9O A;  3HL8 A;  5GAN 2;  5GMK i;  1LOJ A;  3A5Z B;  3HRS A;  5FRO A;  5IAY A;  3L2R A;  4LDV A;  1N27 A;  3N5B B;  2JN0 A;  2JTM A;  3QZ9 B;  5C6S A;  3OSV A;  3OB9 A;  3OYF A;  5LJ3 f;  2FYK A;  4DOV A;  5GAO q;  3X20 B;  1FX7 A;  1XTD A;  2LRQ A;  3CCE A;  1VQL T;  3J7A F;  2XD0 A;  4X9C A;  1O75 A;  3PMT A;  3L2V A;  4M7D A;  5FRM A;  4A54 A;  3OYH A;  1W4S A;  2HBP A;  4A4E A;  3JCM f;  3CCS T;  1YIJ A;  5I21 A;  2CS7 A;  4II1 A;  3OS2 A;  3JB9 F;  1VUB A;  4PJO A;  3H8Z A;  1JBM A;  2A7Y A;  4KUI A;  5CQX A;  3UPU A;  4KBM B;  3CCM T;  2C06 A;  2EQK A;  2V8J A;  1H64 1;  3VU3 C;  4LD9 K;  3QG1 A;  4C0D C;  4C8Q D;  3MP6 A;  3KUF A;  1S72 T;  2XK0 A;  3ER0 A;  3JCM J;  4F7U B;  4QQD A;  4IUT A;  4O5V A;  4C8Q C;  2E41 A;  2CZ7 B;  2Y4X A;  5I2S A;  3CCU T;  4Z02 A;  2P0Q A;  4M7A E;  4M75 B;  1YI2 A;  1VQL A;  1KQS A;  2K5F A;  1KQ2 A;  3PIO A;  4XAX B;  2DPP B;  1WQ7 A;  2QQB A;  5GMK m;  3CCS A;  5GAN 5;  2BIV A;  1W2B A;  5GMK j;  5L8R E;  2QQA A;  4OP0 A;  1YJN A;  2GFU A;  4YTL A;  1QVG A;  2OTL T;  3QSU A;  4F7U A;  2R58 A;  1WQW A;  2O4X A;  3CCM A;  3OYJ A;  4XTU A;  4J7I A;  2GQV A;  2XKO C;  4DQ2 A;  1S72 A;  2ZPE B;  3M53 A;  5D6W A;  3OYE A;  2IVW A;  3DKM A;  4M75 A;  1Q7Y U;  3A8O B;  2M16 A;  4JRK A;  1G3Y A;  2E64 A;  2I2L A;  4J5Y A;  4M77 G;  3CCU A;  4JS5 A;  1N6A A;  5LJ3 e;  4XK8 E;  2M9U A;  3OA6 A;  2XU8 A;  5GAN 6;  4ELY C;  3HFN A;  3MHX A;  5DLO A;  5GAM g;  1B34 B;  3CCJ A;  3GOX A;  2D6F A;  5FU6 B;  4M7A D;  2AHJ B;  3NTH A;  3P8D A;  3JCM e;  2JUF A;  2LX9 A;  2V8I A;  3RKY A;  5GAM j;  1Y7X A;  2E6N A;  5A0G A;  5GAN 8;  4HA8 A;  3M59 A;  2KAF A;  4E47 A;  5DM7 R;  4HCB A;  3C95 A;  4IUP A;  2X4Y A;  3DLL A;  1Y71 A;  4L6V 5;  4LD6 A;  5CKB A;  3EAE A;  2RI3 A;  3CXC S;  5GAN h;  3LWH A;  1EIF A;  3WVD B;  3A8M B;  4M77 B;  1I81 A;  4J6X A;  1VQ6 T;  3I56 T;  4IUV A;  3JB9 H;  5J26 A;  3L42 A;  3OS0 A;  1WGS A;  4XU2 A;  1B34 A;  2RJF A;  4EMH A;  1QP3 A;  3QZ5 B;  3CCR T;  2EJ9 A;  3BDU A;  3HPW A;  3DB4 A;  2OTJ T;  2G3R A;  3FLG A;  1NJI U;  1VQ5 T;  2JTF A;  4M78 F;  4N4H A;  2K5I A;  2VUB A;  4C92 F;  3OW2 S;  2VYT A;  3UDC A;  4LDY A;  2NLU A;  2LCL A;  3OYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...