5CQYA

E. coli mazf mutant e24a in complex with maze residues 68-82 form ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
102
Chain Sequence
VSRYVPDMGDLIWVDFDPGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoribonuclease MazF
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
total genus 22
structure length 102
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cqyA00
4ELYC 5CKDA 4MDXA 3G7ZA 5CO7A 5CQXA 4MZTA 4ELZC 4MZPA 5HKCA 5CKBA 3NFCA 4ME7A 1NE8A 5CQYA 5CKFA 5HK3A 3JSCA 5DLOA 5CKEA 4OF1A 1VUBA 2KMTA 2MF2A 5CR2A 5CCAA 4VUBA 5CKHA 1X75C 4HKEA 3VUBA 5HK0A 4MZMA 5CK9A 2VUBA 3TCJA 3HPWA 1UB4A 3JRZA 2C06A 1M1FA
chains in the Genus database with same CATH superfamily
2E3IA 2JTEA 1K9MC 3CPFA 2EKOA 1YHQT 4QKUA 4M7AC 4RCCA 2RA2A 1UHFA 2QYZA 4J83A 4E2FB 2D6FA 3CCST 1R77A 3DLMA 3JB9G 2J06A 1G3YA 2E10A 1WXUA 3GLXA 4JZ3A 2A37A 2IVWA 2RB6A 1JU5C 4C5IA 2QEXA 1RUWA 1QWFA 3TVTA 3PE0A 1JO8A 3V7CA 3NTIA 5LJ3e 1C0MA 4L6V5 2V1QA 3CPWS 2CH4A 3TREA 1ZSZB 2CSQA 3G6ET 1QVGS 2L2PA 4E7SA 4AT1B 3CD6Q 3JCMg 1WLPB 1XNIA 3ZEHA 1YITQ 1VUBA 3JB9I 3MEAA 2DD4A 3ZBDA 1H92A 2RK1A 4Y91A 1S72T 1AHJB 2COWA 3OYLA 2B86A 4FT4A 2QQ9A 3O5ZA 1YCYA 2FPEA 3QYHB 4F14A 5KYWA 2K79A 4M78B 2K3YA 3CC4Q 3CD6T 2ZAEA 4LNPA 3LW5E 2RMOA 1YITT 1G83A 4NS5A 1UEBA 4HVWA 3SDZA 5GAOl 3FIFA 5I11A 4HT8A 3HFOA 1WDXA 4KRTA 3SEMA 5IN1A 2RK2A 5I22A 3M53A 1QW1A 2LNVA 2M0OA 1QVPA 3CC4T 1KQSP 1YI2Q 2EYZA 4EIKA 1Y71A 8AT1B 1K0SA 4LD9K 4OB1B 2E41A 2RF0A 3CBMA 3EG3A 4C8QB 3PMIA 2DTIA 2YXYA 4OMFB 3OS0A 3L2VA 4L59A 2MK5A 4PJOF 3JB9H 3CC2A 2C06A 1D1CA 1UDLA 3R6OA 4PNOA 2HMAA 2JS0A 2J6KA 2E64A 4MZPA 1I4K1 5GAOr 3PGGA 2KNBB 3RBBB 3J81E 2CP6A 3JCMX 2HZYA 1VA7A 4J9DA 3G71A 2OTLA 2E1HA 2RJEA 2DL3A 8ATCB 2FG0A 5AYFA 1X6GA 1UE9A 2EKHA 2RHIA 5HK3A 4WCIA 3H6ZA 2EJFA 2NUPA 1Q86R 2ED1A 1VQ6Q 3H0HA 1W6XA 3FDRA 1AOJA 5LJ5e 1JJ2S 1K9AA 2K5IA 1Q82C 1KQ1A 2DXTA 1HXDA 2GQVA 2WSCE 2DIQA 4KGZB 4CC7A 1PKTA 2CUDA 3SD4A 2J6FA 3QKJA 1Y96A 1PCXA 1VQ6T 1Q7YR 4C92C 1N8RR 4M7AF 1MV0B 2F5KA 3X26B 1PRMC 2XICA 1WHMA 1SG5A 4M4ZA 3NMZC 3VV0A 1MGQA 3WVDB 5GMKi 3ASKA 1D1AA 3Q1JA 4QT7A 1K76A 2KY9A 3ZFJA 2FPFA 4F7UF 1SKUB 2K6DA 5J26A 1ZHIA 2F1LA 2RJCA 3VS2A 4DQ2A 3I9QA 3JV3A 4A4HA 5LJ5g 2OI3A 2FYKA 3SWNB 2RJDA 5GAMf 2XU8A 2QEXQ 3N5BB 1GFDA 2ENMA 2NLUA 2D9TA 1FMVA 4QQ6A 5GAMd 3C4SA 1VQ5A 3LH5A 3MP8A 3QSUA 2QK0A 1UGPB 2O31A 3EAEA 1U5SA 1CSKA 3JCMf 1M1KR 1IGUA 3VYGA 2JNGA 3JCMd 1LCKA 1VQNA 4KUDK 4GBQA 3JB9D 1WFWA 4N4IA 1VQOA 1M27C 2JVVA 3UA6A 4BE2A 4ZNXA 2QI2A 3RDVA 3SWNC 2EFIA 3E2UA 1YJNA 2O88A 2QA4A 3HPWA 4QW2A 3F70A 4ELZC 2I0NA 2DXBA 4KGVB 1K4US 2EYXA 2P4TA 2LQWA 2DZCA 1NJIR 4O6JA 2EW3A 1UGVA 1OOTA 2JOYA 4D8KA 3KXTA 4PJOA 4RG8A 1M2VA 2E70A 1AWXA 3CEYA 1D09B 3VS7A 2CP0A 1W2BS 1BBZA 3UWNA 1ZUKA 2DAQA 4BACA 4ZTFA 2JN0A 5IAYA 2KYBA 1PG5B 2L89A 3CC2Q 4E7LA 2YUPA 3PIOA 4DEXA 4E7JA 2YLCA 4M77B 4J6WA 3HRTA 4M75B 1N6AA 2OJ2A 2OTJA 2KE9A 1I0CA 2DVJA 2Y90A 1D0XA 4V2SA 1Q81C 3EGUA 2CKKA 2YLBA 2EGAA 1ZA1B 2W10A 4E47A 3CC2T 1OX8A 2CP5A 3CCUA 3G71Q 1I81A 5C6SA 2OTLQ 2DPPB 4XTVA 1PC0A 3QDFA 3X25B 2LQ8A 2XDBA 1G3WA 4C92F 3C94A 4A63B 2VYTA 2DETA 1M90R 1SF9A 2JMCA 5GAN8 4B9XA 3A98A 1QVFA 4RTXA 3G71T 1OPKA 2FB7A 1OU8A 4HXJA 3NFCA 1YIJA 2FVUA 4M7AA 3M0QA 1JXMA 2LT1A 4JDSA 3JAME 5DLOA 2VXEA 3LGLA 2PQWA 1PD0A 4C5EA 5KYXB 2HBWA 1U06A 3VUBA 2D8JA 2PZ1A 2HD0A 1PM3A 1N27A 2MMPA 2XD0A 2EWNA 2KRNA 5FU7C 2LP5A 4F7UA 2PVGB 5GAOn 2LX9A 3LYIA 4CC2A 1RAIB 1ACMB 3OSSC 4JRKA 5AT1B 1E7OA 2VV5A 2LQNA 1X27A 1RLQC 3A8GB 4PL6A 2CS7A 1C6VX 4PK4A 1UG1A 1K9MU 1M1FA 3OA6A 3BE3A 5CVIA 4BUGA 2MI6A 4JJBA 1JEGA 2C0IA 1T3SA 2XG8D 4KGXB 2P0PA 3CCMA 5KYUA 3P8HA 4JRPA 1E6GA 2BZ8A 4XU1A 4TVRA 5KYNA 2PVDB 3MEWA 5IXFA 2R57A 2L5QA 1M8MA 2V1RA 5GMKm 4R0KA 1M1GA 1LOJA 1T0HA 2RHYA 5GMKe 3I56A 2YSQA 3NPFA 1B7TA 4A4KA 4DBRA 1VQ5Q 2RN8A 3BDLA 1D3BB 2HSEB 2KT8A 4OGCA 2JT4A 2L3PA 1YI2A 4FT2A 3FLGA 4XTXA 1ZQ1A 4M78A 1I8FA 2DYBA 2J6OA 3EGDB 2DRKA 1QVFP 1VQNQ 2JTMA 3DB3A 1RI0A 1RABB 1VQ5T 1NPRA 5CKDA 1WIEA 3CCVA 4Q5WA 4CC4B 4EMKB 1VQ8Q 1VQOQ 2XDDA 2Z0WA 4EMHA 5DY9A 3FJ5A 4KBMB 3V8KA 1YJNQ 2QA4Q 4AFSC 2LNHB 3S3OA 1YBYA 3VU3C 2J7IA 4IUUA 3V7SA 4FYVB 3MPUB 1VQKA 4FL6A 2ZPEB 4C8QA 1QCOA 4J9BA 1RAFB 2HKQB 2ZCFB 1IO6A 1YJNT 1ZSGA 2QA4T 3SFMA 3EGXB 1IHWA 2DL4A 2KMTA 4A4FA 2IPOB 1WXBA 4CC3A 2KI7A 1UGSB 1ZUUA 2HNIA 2DA9A 4LUDA 2K4YA 4OB3B 2WSFE 4BI8B 4NL2A 2BUDA 2OTJQ 2R5MA 2E3HA 5IHNA 2HBPA 2KBTA 6AT1B 4A54A 4M77D 4C92A 1OQKA 5FRNA 1MMDA 4PKCC 5GAMh 3GP8A 1H3ZA 3CCUQ 4FU6A 1QVGA 1TSFA 1KQ2A 1C1AA 1G3SA 2KRSA 1KQSA 1K8AR 4IKFA 2OTJT 1NLOC 1E6HA 2O4XB 1PWTA 3DLLA 4M77E 2GBQA 3HRUA 4JRIA 1TU0B 2LMJA 2ZZDA 1AWOA 3BY7A 3JCMh 2E5KA 3G1JA 2DXUA 3CCUT 2GFUA 2ESWA 2DK3A 1P92A 3M0RA 3FEOA 2RI3A 3RERA 1YWPA 1YIJQ 2E65A 1WA7A 1KSWA 1SRMA 2JMAA 3ME9A 4OVAA 1Q86U 1ZUYA 1RACB 1V1CA 3CCEA 4KH1B 3JCMV 2EJGA 5A0GA 3OYKA 1LNXA 2RHUA 1YIJT 3NHNA 4OMQA 1AT1B 2MAMA 4QQGA 3UPUA 3M55A 3E9GA 2C0TA 1R0CB 4E7KA 1Q7YU 4LXCA 3GIBA 2LJ0A 3FRNA 2RI2A 4ZN3A 5FW9A 3X24B 2E6ZA 4FIBA 3QWXX 2RH2A 2YUQA 2YUNA 4X9CA 3CCJA 4PFOA 2WSEE 4OMPA 3EG9A 2EAYA 1VQLA 3D7SB 1KK7A 1AWWA 5L23A 1RAHB 2J05A 4JJCA 4KH0B 3SWNA 3CCMQ 4IIOA 4RTVA 1SHFA 1RI9A 2NUZA 2EBPA 2X3WD 2MOXA 2CT4A 2KYMA 2RJFA 4JLGA 4LDUA 2V8IA 5GAN4 5GANe 3I56Q 3M0PA 1IHVA 1PNJA 2X9HA 3H0FA 1F1BB 4OP0A 3L42A 1HJDA 5IXBA 2A7YA 2E12A 1IREB 4D6WA 1QVGP 4FSSA 2KR3A 1ZSZC 4BD3A 4M7DG 4OB2B 4PJMA 4Y28E 1KD1R 3OSVA 4RG2A 3I56T 5LJ3g 1JBMA 1WQWA 1OYXA 1OEBA 2RD1A 2P84A 1KJWA 2JW4A 2ZPHB 2CP2A 4AFZC 2PVOB 4X34A 3CCVQ 4JS5A 5I2SA 1HSQA 1RADB 4BI4A 4M78C 1WHGA 1M1KU 1YI2T 3HSBA 4BB7A 1KD1C 2OAWA 1VQ7A 1NBEB 2F2VA 1MUZA 2B8AA 1WZOA 3EG0A 1R0BG 4M7DB 3OMCA 2NUTB 1BIBA 4RTUA 1G5VA 3L2QA 2HL5C 1XTDA 2K3XA 1WHHA 1K1ZA 2KDSA 2FZGB 5CKEA 1VQKQ 2G3RA 5A2QE 3LH0A 5GAOm 4Z02A 2PU9B 2DF6A 5GANg 4OMOA 2GNCA 2O2OA 1NJIU 1M30A 2V8JA 4C0ZA 2DX1A 4C8QC 2A3LA 5EC7A 2DTHA 1VQKT 3M0UA 4IIMA 4M77A 3RNJA 4M75A 3C95A 1B34A 5I21A 2EQKA 2DNUA 5GAOp 2ZPIB 2GFAA 4ZTJA 2P0QA 2XHCA 3OYEA 1OPLA 1Q81U 2K5LA 3FJPA 2JUFA 3NTKA 1NEBA 4E6RA 1GXIE 1BYMA 2QASA 1YJWA 5GAN2 5D6YA 3M59A 5LJ5h 1IZ6A 1JB0E 2ED0A 3PVQA 1Q86C 2K3BA 3CCQA 3MKDA 1OZ2A 1SEMA 3OYYA 3JCMc 2DKGA 3C12A 1U3OA 2E5QA 5FLXE 3H9NA 4JLIA 4PFZA 3OB9A 1Y0MA 1ABQA 4FYYB 4PJJA 2BZYA 2QDLA 1Q7YC 4BY6B 5KYXA 2L8DA 1N8RC 1JJ2P 1H3HA 2ZPBB 5I2MA 5GAN5 2V26A 4J8OA 1PKSA 1FMKA 4BE1A 2CSIA 2KXDA 3M57A 3CCEQ 5KCHA 2CP3A 3S6WA 3CMEA 5CQXA 5FU6B 2DE0X 1UJYA 2VGNA 2ATCB 2HAXA 3X20B 1SSHA 2MIOA 3JB9J 1RAEB 4LD6A 2RQTA 1W2BA 3CCET 3GNGA 2VB6A 4DBQA 2ABLA 1RLPC 1VYVA 4FYXB 1UTIA 2AKKA 4LDVA 3CCJQ 1AZGB 4Z89A 1BKBA 2QEXT 4OB0B 2EQJA 5GAMj 1JRIA 1VQLQ 1BK2A 3LX7A 2HL3A 1PSFA 2HSPA 1XQHA 5A0DA 3HP9A 3JB9F 3CXCA 1BIAA 3CCJT 1VQ8A 5FU6C 4WF2A 4QVDA 1IGQA 3A8MB 1VQLT 1X2KA 4IURA 1D3BA 2LJ1A 4M78F 1M1KC 2F2XA 2O9SA 4O5VA 3QZ9B 1YP5A 3ULRB 1TXQA 1GFCA 3P8DA 2AHJB 3EGDA 5J39A 3VUZA 1LJOA 1M4ZA 2QG9B 4EMKA 4NL3A 5LJ3f 1GBQA 3INZA 4ATOA 1NJIC 2EPDA 2L3QA 3PTAA 4E7IA 4LE9A 1U1TA 4RTWA 3OMGA 2XK0A 4C8QF 2CYZB 1WNLA 5LJ3d 1EX4A 1VQ7Q 1BI0A 5FWCA 2L0AA 4R55A 4RUGA 2FHDA 4MZMA 2M9UA 1PRLC 3DB4A 2MYSA 2RI5A 4M7DD 1TUDA 2LDMA 4J9CA 1KHIA 4GY5A 4MDXA 1MNDA 2DBKA 1BI1A 3CMAA 4E7HA 2V8KA 2HKNA 1VQ7T 2ZGWA 5IHIA 1RAGB 3RUXA 1W2BP 5GANf 4J5YA 3J7AF 3A8HB 2YDLA 4IUVA 3HTRA 1M2OA 1TUCA 4M7DE 4J9IA 3PMTA 2NUPB 3JCMb 5GANd 3LLRA 2LVMA 3EG1A 3OYAA 4RKUE 3HHTB 2R5AA 3OYIA 2OTLT 4FCYA 4XTWA 2DL7A 2KEAA 3GF5A 4M77C 4JJNK 4RTTA 4M75C 1HYOA 4J6YA 1YJWQ 1DJ7B 2P4RA 1Y96B 4B9WA 4RTZA 3CXCP 2VC8A 2O4XA 1M90C 2AK5A 1XOVA 1JQQA 2XMFA 2H3EB 4J7IA 3GBQA 3CCQQ 4AG2C 2VGMA 5FWBA 2JM8A 1UGQB 1W70A 2DJQA 2LQKA 3CCSA 1FYNA 3H8ZA 2XKOC 4HCZA 1YCSB 1EZZB 4JS4A 4PFPA 3RESA 5GJVB 4FW2A 3QIIA 4XAXB 3G6EA 2HQXA 2K2VA 1D1BA 4IUPA 5D6XA 2FRWA 3VS3A 3S3NA 1OI1A 4K11A 1T3LA 4QQDA 3EH1A 4X1VA 1G2BA 2RQUA 1S72A 3LWHA 3OW2A 3RR6A 2X35A 3CMEQ 2XI9A 2XDPA 3IQLA 3QBYA 4XTUA 5LJ5f 2KRMA 1ZSZA 3BFMA 4HVUA 1G3TA 3OS5A 5HY6A 1K73R 5LJ5d 5EG2A 2WACA 5CKBA 3I35A 4FW1A 3FC3A 2LTOA 3H41A 5GMKh 3CMET 3EHRA 5FROA 3M54A 5GAN7 4IUQA 1SPKA 4PJOG 2A28A 4KULA 4XTYA 1NZ9A 3CBPA 2A0FB 3RIRA 4C5GA 1IXDA 4JJDA 2CREA 3I5RA 5GAOq 2PTKA 2E6NA 4C0DB 5IHKA 2GCXA 1R8OB 5D6WA 2QXFA 1VIEA 4MDWA 2F5TX 4GLKA 4UC4A 4AFQC 4ZGJB 2OAUA 3H0IA 4J9EA 1X43A 1KC8R 2NYSA 4JPBW 1VQNT 3OYMA 2LCSA 4C5HA 2COYA 2LT4A 1BI2A 1VQ8T 1VQOT 3QHSA 2KXCA 1KIKA 4BDZA 3JCMJ 1GCQA 3MP1A 4OMMA 3M5AA 3RKXA 4DOVA 3G4SA 4X9DA 3TSWA 3QG1A 1GRIA 4QVZA 2EIFA 1KD1U 4HT9A 2VUBA 4XQ3A 2QAZA 4EMKC 3PT9A 1WI7A 2JJ9A 2QQSA 3GOXA 4ELYC 2DLPA 4FSXA 3QJ6A 2D0QB 1TOVA 2GF7A 3I55A 2FZKB 2BE9B 3OW2P 1AWJA 2EQUA 4M7AG 4M77F 2Y4XA 3UF4A 1UHCA 1ZLMA 4M75F 4AMCA 3CMAQ 1AZEA 3CPWA 1YFNA 2LX7A 3MJXA 1EFNA 1BI3A 2O9VA 4LDYA 1VQ9Q 5GAMe 2QGFB 1I1JA 3ZL7C 4F17A 2VASA 1QCFA 2LC4A 4F7UG 2RQWA 2LCLA 1Y7XA 4DBFA 4M7AB 2M1HA 5GAN3 4PJLA 1K8AC 2EQMA 1ABOA 2DZ9A 1TWBA 4D8DA 2YWWA 3VS6A 4DA4A 2X4XA 1A0NB 1M3CA 1B3QA 2EGCA 2KQWA 3CCLA 4DBHA 2FZCB 3FB9A 2SEMA 4Z88A 3OYFA 3LGFA 4F7UB 1WYXA 2F69A 3CCSQ 1WPYA 2VXFA 5GAN6 3JRZA 4KT0E 1ZX6A 1QP2A 4XK8E 4ORZA 1UECA 3QPHA 1ZA2B 5IH2A 1M5Q1 4Y92A 2AZVA 1N8RU 4XU2A 4PLIA 3BW1A 3UT1A 3G6EQ 5LJ3h 4N4HA 1AEYA 2K5FA 5GAMg 3QUIA 1WX6A 2JZ2A 2H3JA 4QVCA 4CI0C 5KYUB 3TEEA 1SRLA 1O75A 2QTXA 3OQ5A 1BB9A 2FEIA 1S72Q 2KROA 4M78G 3UA7A 3BDUA 1MV3A 3VRYA 4BDYA 1WHJA 1W1FA 1GL5A 1Y07A 3A8LB 1KQSS 5L8RE 4J9GA 5IT9E 3M0TA 1V76A 2JS2A 2DTOA 2QQRA 3OBYA 1VYUA 3CCMT 3O8VA 2GQIA 3CPWP 2GTJA 1FX7A 2L3SA 5GANh 2DILA 4OGEA 2EYWA 3UDCA 3KFVA 2AT1B 3QXEB 4OMNA 3L2WA 1MMNA 4C8QG 2PUKB 2K2MA 2M16A 1Q95G 1BCMA 2PNIA 1MMGA 1JJ2A 3L1AA 5J3BA 4VUBA 3URGA 2AIRB 2A36A 4JRQA 1OX9A 3SB2A 2H8HA 4J9FA 2CZ7B 2CH4W 1TS9A 1NEGA 2DIGA 1WHLA 1UJ0A 2DL8A 1N5ZA 2D0NA 3CCVT 3REBB 4EPCA 3OYBA 2MF2A 4C92G 4PJOD 4WTOB 5KYYB 2MWOA 1CKBA 2QQBA 5CIUA 3META 2AKLA 1SSFA 3G4SQ 2DM1A 5CQYA 2LZ6B 3VS1A 3WXMB 1VQ4A 2EGEA 4PJOE 3GNFB 1GCQC 1X2QA 2ECZA 4GLMA 2BIVA 2DYIA 4C92B 3MCAB 3I55Q 1W4SA 3EG2A 2X4YA 5GMKj 4M7DC 4KUIA 3G4ST 1Q82R 3V8LA 4N0AA 1O9SA 4N4GA 2HQEA 1BU1A 1OV3A 3PNWC 1AD5A 1NPPA 3EFOB 4JZ4A 5CR2A 2RNAA 3I55T 2A08A 2XIDA 3MO8A 2VKNA 1J3TA 4J9HA 3M56A 1MHNA 3QYGB 4C0GA 2L3RA 2K57A 2CUBA 5CO7A 3CBOA 3CC7A 3VS0A 4PLLA 3JCMW 1VQPA 3AHUA 4L5GA 4M7AD 1RL2A 1U1SA 5KCOA 2FRYA 3TSZA 1M90U 4BI3A 1H8KA 4YTLA 5HCKA 1QKWA 2I2LA 5KH6A 5C0MA 3ER0A 1OZ3A 7AT1B 5LL6S 3CCLQ 3L2UA 1FWZA 1FXXA 3A5ZB 2YRDA 3L2RA 2KT1A 4M7AE 2EYQA 4F16A 1I5LA 2FPDA 3KBGA 2C0OA 3JSCA 3GPLA 4EMGA 3EFSA 3CCRA 2BKDN 3CCLT 4PJNA 3OYNA 3THKA 3EG9B 2X51A 4BY6C 2D1XA 3RMQA 1Y57A 5M9OA 3E9FA 3UATA 5D7UA 4BE0A 4F7UE 1ZBXA 3E1SA 2MCNA 1K0XA 3JCMP 1GBRA 5KYWB 3CQTA 2MWPA 2QGGA 3PIPA 3VJPA 2DFUA 3VKIA 2GTOA 3OS1A 1NM7A 1WXTA 1WHKA 1B07A 4Z8AA 1VQMA 2RM4A 2DBMA 4RCBA 3REAB 2DVEA 3NGPA 4B6MA 4XTZA 2DEUA 3V8JA 1VIFA 3M58A 1OULA 1M3AA 3VS4A 4E7ZA 5KE3A 3VYHB 4C0FA 4J7FA 3OY9A 4HVVA 2COZA 1Z9ZA 3RKYA 3SHWA 4OMLA 2ZPFB 1M3BA 4HKEA 5CAIA 1NYGA 1K73U 4M78D 1KFZA 1LVKA 1M9SA 1UFFA 2DEQA 1YN8A 2QTVA 1PD1A 4M77G 4M75G 2DRMA 1S1NA 4M78E 4P5NA 3WVEB 1X75C 5A0LA 4XU0A 3PFSA 3A1PA 1Z9QA 1TUGB 1WJQA 2CGHA 5LJ3j 1QKXA 3EGXA 2DMOA 4M7DF 1Q81R 4C8QD 3MHXA 1YJ9A 1KC8U 5DM7R 2YT6A 1ARKA 3J80E 4ZGDB 4OF1A 1QQJA 1VQ9A 1B34B 2X3XD 4J6XA 4HCCA 4JUVA 3S3MA 4DEYA 3JCMQ 2X4WA 4C8QE 1VYTA 1VQ4Q 2SRCA 3QO3A 3CXCS 2IG0A 1TTHB 1VOMA 1PHTA 2DXCA 2QDYB 1I5OB 2DL5A 1XJWB 5GANj 1KG1A 3RKWA 3OYJA 5FU7B 1QWEA 4C92D 2YHTA 3E19A 1VQ4T 2CZ0B 3EH2A 4II1A 5CK9A 1TG0A 3TCJA 1YNZA 3HL8A 1YHQA 2MPXC 2JTFA 1D0ZA 3TU4K 4N0AC 1NE8A 2P0KA 2KSSA 2RHZA 3M4GA 4C92E 2ROLA 1QCNA 1X69A 1YJWT 5KE2A 5GMKl 5CCAA 3CC7Q 4R56A 2IIMA 1K8AU 1N9SA 1VQPQ 2YRCA 1AVZC 5GJWB 3CCQT 3OYCA 2LRQA 2W0ZA 1NG2A 1HD3A 2CZ1B 1JXOA 4ANJA 3M9QA 2BE7D 2CDTA 3EHQA 2RPNA 2YRVA 2NWMA 1CKAA 2QQAA 2RQRA 1M8VA 3CC7T 1MNEA 1VQPT 2CP7A 4EDUA 2M02A 2KK4A 4IUTA 3CD6A 3QZ5B 1HK9A 1G8XA 2HDAA 1YITA 1H641 2K9GA 2HEQA 3QDRB 3G7ZA 2DO3A 2OX7A 3CCRQ 1ZBJA 3M4YA 4LUEA 5HKCA 2CZ6B 5CKFA 1QVFS 3EFRA 2CT3A 3X28B 3QWYA 3DKMA 3CC4A 2KGTA 5LJ5j 3CCRT 2JM9A 3VRZA 1K73C 4AG1C 4XU3A 1VQMQ 2RO0A 1WGSA 3A8OB 5FRMA 4MMKA 2PUOB 1BCOA 2KAFA 3R6NA 2YUOA 4LDXA 4MMLA 4PJOB 2LCCA 2VWFA 1QMCA 1VQMT 3T9NA 4HA8A 1T0JA 1M2VB 3V7RA 3L2ZA 1TH7A 4HCKA 3RMSA 3U23A 1D0YA 2EJ9A 4RTYA 4CRIA 2DERA 1KC8C 1LPLA 3OYHA 3AT1B 2BTTA 3NTHA 3OW2S 4M7DA 1I07A 1UB4A 2EQIA 4RMOA 1EIFA 2RQVA 2Y4YA 4FM4B 2EYYA 2NUTA 4C0DC 2G6FX 1IB8A 2DJZA 1WJSA 4A4GA 2D8HA 2M0YA 2K7AA 4A4EA 3HKSA 4FYWB 3I5SA 3TQ7P 3OYDA 1GCPA 5KYYA 2ROTA 2R58A 1X6OA 3OBWA 2HQHA 4PJOC 5DLQE 4ESRA 5ECAA 1NLPC 3OYGA 1YJ9Q 4DOWA 2FO0A 3OS2A 4ZGEB 2F2WA 2EVRA 3MEVA 2JXBA 1OU9A 1VQ6A 1V29B 1PSEA 2E4HA 4AFUC 4MZTA 2ZPGB 4F04B 2FL7A 2RHXA 3M0SA 1QP3A 4M75D 2DD5A 1IRXA 1WJRA 4HCBA 3CMAT 1NYFA 1YWOA 1QLYA 1YJ9T 3VS5A 3MEUA 1UUEA 2X4JA 2KVQG 1X6BA 3P8BB 3PVLA 1VQ9T 1X01A 4A53A 1RAAB 1MMAA 1UGRB 4LDWA 3JCMe 3C0CA 1N9RA 2AZSA 3QJYA 4NOYA 3EFOA 4M75E 4ME7A 1FMWA 2O01E 1U8RA 9ATCB 1K9MR 2HCKA 3MP6A 1YHQQ 1KHCA 1Q82U 5CKHA 4ZN1A 2LJ3A 2VVKA 2M51A 1WQ7A 5HK0A 3HFNA 3HRSA 3LWIA 2GGRA 3KUFA 1SHGA 4LN2A 2BZXA
chains in the Genus database with same CATH topology
3INZA 3V8LA 4A4KA 1NJIC 4ATOA 1K9MC 4N0AA 3CPFA 2EKOA 3PTAA 4E7IA 1O9SA 1U1TA 1YHQT 4N4GA 3BDLA 4M7AC 2HQEA 3OMGA 2XK0A 4RCCA 4C8QF 1D3BB 2CYZB 1WNLA 5LJ3d 2RA2A 4J83A 3PNWC 2D6FA 4OGCA 3CCST 1YI2A 1NPPA 1BI0A 3DLMA 3FLGA 4FT2A 1ZQ1A 4XTXA 1G3YA 2E10A 5CR2A 2XIDA 4R55A 3MO8A 3JB9G 3GLXA 2IVWA 2FHDA 2RB6A 4M78A 4C5IA 1I8FA 2QEXA 4MZMA 2M9UA 3M56A 3V7CA 3DB4A 1MHNA 3NTIA 2RI5A 5LJ3e 3QYGB 4C0GA 4M7DD 2L3RA 2LDMA 2JTMA 2K57A 1RI0A 3DB3A 1KHIA 4L6V5 4GY5A 1NPRA 5CKDA 1VQ5T 5CO7A 3CBOA 3CCVA 4MDXA 3CC7A 3CPWS 1BI1A 4PLLA 3TREA 2V8KA 3CMAA 4Q5WA 3G6ET 4EMKB 4E7HA 3JCMW 1VQPA 1QVGS 2XDDA 1VQ7T 2ZGWA 4EMHA 3AHUA 4L5GA 5DY9A 3JCMg 4KBMB 4M7AD 1RL2A 3V8KA 1XNIA 1U1SA 3RUXA 3ZEHA 1VUBA 5GANf 4J5YA 5KCOA 3JB9I 3J7AF 3A8HB 3MEAA 3S3OA 2DD4A 3ZBDA 1M90U 4IUVA 4BI3A 1YBYA 2RK1A 4Y91A 3VU3C 4YTLA 4M7DE 1S72T 1AHJB 3OYLA 4IUUA 4FT4A 2I2LA 5KH6A 3PMTA 2QQ9A 5C0MA 1YCYA 3ER0A 1OZ3A 3JCMb 5LL6S 3V7SA 5GANd 1VQKA 3L2UA 1FWZA 1FXXA 3A5ZB 2ZPEB 3LLRA 4FL6A 3QYHB 2LVMA 3OYAA 4C8QA 3L2RA 4RKUE 3HHTB 2R5AA 4M78B 2K3YA 3CD6T 3OYIA 2OTLT 4M7AE 2ZCFB 2EYQA 1YJNT 3LW5E 4XTWA 1YITT 2QA4T 1I5LA 3GF5A 4NS5A 1UEBA 3SFMA 4M77C 4JJNK 3KBGA 3SDZA 3JSCA 5GAOl 3FIFA 3GPLA 4M75C 4EMGA 4HT8A 4XU0A 3HFOA 3EFSA 2KMTA 4J6YA 4A4FA 3CCRA 2BKDN 1DJ7B 5IN1A 1Y96B 2RK2A 4B9WA 3CCLT 2VC8A 2O4XA 1M90C 3M53A 1QW1A 2LNVA 2M0OA 1UGSB 1XOVA 1QVPA 2HNIA 3OYNA 3CC4T 4J7IA 4BY6C 3RMQA 2VGMA 5M9OA 2K4YA 3E9FA 4OB3B 4BE0A 1UGQB 4F7UE 2WSFE 1ZBXA 2LQKA 3E1SA 1Y71A 4NL2A 4BI8B 3CCSA 2BUDA 2R5MA 4LD9K 2HBPA 3JCMP 3H8ZA 4OB1B 2E41A 3CBMA 4A54A 4C8QB 2XKOC 4M77D 2MWPA 3PMIA 4C92A 3PIPA 3VJPA 4HCZA 5FRNA 2DTIA 4PKCC 4OMFB 3RESA 3VKIA 5GAMh 3OS1A 4JS4A 3GP8A 1H3ZA 3OS0A 3L2VA 4L59A 1VQMA 3QIIA 2RM4A 4FU6A 4XAXB 4PJOF 1QVGA 3G6EA 2HQXA 3JB9H 2K2VA 4RCBA 1KQ2A 3CC2A 2DVEA 1G3SA 4IUPA 5D6XA 2C06A 1KQSA 4IKFA 2OTJT 3R6OA 4PNOA 4XTZA 2O4XB 3V8JA 3S3NA 1OI1A 1VIFA 3DLLA 2E64A 4M77E 4MZPA 4QQDA 1I4K1 5GAOr 4JRIA 3HRUA 3PGGA 3J81E 3M58A 1S72A 2ZZDA 3BY7A 5KE3A 3LWHA 3OW2A 3JCMh 3JCMX 3VYHB 4C0FA 2DXUA 2X35A 4J7FA 3OY9A 2GFUA 3CCUT 2XI9A 2DK3A 2XDPA 3RKYA 1P92A 2ZPFB 3FEOA 4HKEA 2RI3A 3QBYA 5CAIA 3RERA 4XTUA 3G71A 1K73U 2OTLA 5LJ5f 2E65A 4M78D 2E1HA 3BFMA 1M9SA 1G3TA 3ME9A 2RJEA 3OS5A 4OVAA 5HY6A 2DEQA 1Q86U 5LJ5d 5EG2A 2WACA 5CKBA 5AYFA 3CCEA 2RHIA 3FC3A 3JCMV 2EJGA 2LTOA 5GMKh 5A0GA 3CMET 5HK3A 5FROA 3H6ZA 3OYKA 1LNXA 3M54A 4M77G 2EJFA 2RHUA 5GAN7 1YIJT 4M75G 4M78E 3WVEB 5A0LA 4P5NA 1X75C 3FDRA 5LJ5e 4IUQA 4PJOG 1JJ2S 2MAMA 2K5IA 3PFSA 4KULA 4QQGA 1KQ1A 2DXTA 1HXDA 2GQVA 2WSCE 3E9GA 3M55A 1NZ9A 3CBPA 1WJQA 2CGHA 2DIQA 4XTYA 3RIRA 4C5GA 5LJ3j 4E7KA 1Q7YU 5GAOq 3GIBA 3FRNA 4M7DF 2RI2A 3SD4A 4ZN3A 4C8QD 2E6NA 3MHXA 3X24B 2E6ZA 4FIBA 4C0DB 1YJ9A 3QKJA 3I55T 1Y96A 2GCXA 1R8OB 2RH2A 5D6WA 5DM7R 1KC8U 1VQ6T 2QXFA 4X9CA 1VIEA 4MDWA 4ZGDB 3J80E 4OF1A 2F5TX 4GLKA 4UC4A 4C92C 3CCJA 4M7AF 2F5KA 2WSEE 3X26B 4ZGJB 2OAUA 1VQ9A 2EAYA 2XICA 1VQLA 1B34B 4J6XA 4HCCA 1VQNT 3OYMA 3SWNA 4JUVA 3S3MA 3JCMQ 2X4WA 4C8QE 3VV0A 1MGQA 3QO3A 3WVDB 4C5HA 2LT4A 1BI2A 3CXCS 1Q82C 5GMKi 1VQOT 1VQ8T 3QHSA 2RJFA 4JLGA 4BDZA 2IG0A 3ASKA 4LDUA 3Q1JA 2V8IA 2DXCA 5GAN4 3JCMJ 2QDYB 5GANj 1KG1A 3RKWA 5GANe 2KY9A 3MP1A 5FU7B 3ZFJA 3OYJA 4F7UF 4C92D 5J26A 3UPUA 2YHTA 4OP0A 1ZHIA 3M5AA 3E19A 3L42A 3RKXA 4DOVA 3G4SA 1VQ4T 2CZ0B 2A7YA 4X9DA 2E12A 1IREB 3QG1A 4II1A 2EIFA 4QVZA 4D6WA 5CK9A 1KD1U 2RJCA 2VUBA 4HT9A 3TCJA 4XQ3A 4DQ2A 4BD3A 4EMKC 3PT9A 3HL8A 1YHQA 2JTFA 4A4HA 2QQSA 3GOXA 5LJ5g 4ELYC 4M7DG 4OB2B 4FSXA 3QJ6A 2FYKA 2D0QB 4Y28E 3TU4K 3SWNB 2RJDA 3OSVA 2GF7A 4RG2A 2XU8A 5GAMf 3I56T 4N0AC 1NE8A 2P0KA 2KSSA 1JBMA 2RHZA 3M4GA 4C92E 5LJ3g 3N5BB 3I55A 1YJWT 5KE2A 2EQUA 1WQWA 1OYXA 2D9TA 2NLUA 2RD1A 5GMKl 4M7AG 2ZPHB 4M77F 4QQ6A 5CCAA 2PVOB 2Y4XA 4X34A 5GAMd 4R56A 4JS5A 3C4SA 4M75F 5I2SA 1K8AU 1N9SA 1VQ5A 3MP8A 3CCQT 4BI4A 3CPWA 4M78C 3QSUA 1M1KU 1UGPB 3OYCA 2LRQA 1YI2T 3HSBA 4BB7A 1BI3A 3EAEA 1KD1C 1VQ7A 4LDYA 3JCMf 2CZ1B 2B8AA 5GAMe 3M9QA 4M7DB 3OMCA 2YRVA 2QQAA 1BIBA 1M8VA 1G5VA 3L2QA 2K3XA 1XTDA 2KDSA 3VYGA 3CC7T 2LC4A 1VQNA 5CKEA 2JNGA 4F7UG 2G3RA 3JCMd 4KUDK 2LCLA 1Y7XA 3JB9D 5A2QE 1VQPT 4M7AB 2M1HA 3LH0A 4EDUA 5GAN3 4N4IA 5GAOm 4Z02A 1VQOA 4BE2A 2JVVA 2KK4A 2PU9B 5GANg 2QI2A 4IUTA 3CD6A 3QZ5B 1K8AC 1HK9A 2EFIA 3SWNC 2EQMA 1YJNA 1NJIU 1YITA 2QA4A 2DZ9A 3HPWA 4QW2A 3F70A 1H641 2V8JA 3QDRB 4C0ZA 4DA4A 3G7ZA 2DO3A 2X4XA 3M4YA 4C8QC 2A3LA 4ELZC 2DTHA 2DXBA 5HKCA 1VQKT 2P4TA 4M77A 2DZCA 2CZ6B 2KQWA 4O6JA 5CKFA 3CCLA 4M75A 3C95A 1QVFS 3EFRA 1B34A 3FB9A 2EQKA 5I21A 3X28B 3OYFA 3LGFA 2JOYA 5GAOp 2ZPIB 2GFAA 3DKMA 2P0QA 4F7UB 3KXTA 4ZTJA 3CC4A 2XHCA 4PJOA 3OYEA 4RG8A 2F69A 5LJ5j 1WPYA 1Q81U 2K5LA 3FJPA 2JUFA 2E70A 3NTKA 2VXFA 5GAN6 3CEYA 3CCRT 1W2BS 3JRZA 3UWNA 4KT0E 1GXIE 1K73C 1QP2A 4XK8E 1BYMA 2DAQA 1YJWA 5GAN2 3QPHA 3M59A 5D6YA 4BACA 5LJ5h 4ZTFA 1M5Q1 2JN0A 1N8RU 1IZ6A 5IAYA 1JB0E 4XU2A 4XU3A 2RO0A 4PLIA 3BW1A 1Q86C 1WGSA 3UT1A 3A8OB 5LJ3h 2L89A 4N4HA 5FRMA 3CCQA 2K5FA 1OZ2A 5GAMg 4E7LA 4MMKA 3PIOA 2PUOB 4E7JA 3QUIA 3OYYA 2JZ2A 3JCMc 2DKGA 2H3JA 2YLCA 4M77B 2KAFA 4QVCA 3C12A 4CI0C 4J6WA 3HRTA 3TEEA 4M75B 1N6AA 4LDXA 2OTJA 2E5QA 4MMLA 1O75A 2QTXA 3OQ5A 2Y90A 5FLXE 4V2SA 4M78G 1Q81C 4PJOB 3BDUA 4JLIA 2LCCA 4BDYA 2CKKA 3OB9A 2YLBA 3T9NA 1VQMT 4HA8A 3V7RA 4E47A 3L2ZA 3CC2T 1TH7A 4BY6B 1Q7YC 3RMSA 3CCUA 2EJ9A 2L8DA 1Y07A 1I81A 3A8LB 5C6SA 1N8RC 1KQSS 2DPPB 2ZPBB 4XTVA 5I2MA 5L8RE 5GAN5 4CRIA 4J8OA 5IT9E 3X25B 1KC8C 2LQ8A 3OYHA 2QQRA 2DTOA 2XDBA 3OBYA 3CCMT 1G3WA 4C92F 3O8VA 3C94A 4BE1A 3NTHA 3M57A 3OW2S 1FX7A 5KCHA 4M7DA 2VYTA 5GANh 1UB4A 4OGEA 5GAN8 4RMOA 1EIFA 2Y4YA 4FM4B 4B9XA 4C0DC 3S6WA 3UDCA 1QVFA 2DJZA 3G71T 1WJSA 5CQXA 4A4GA 3CMEA 5FU6B 3QXEB 3L2WA 2FB7A 2VGNA 4A4EA 4C8QG 2PUKB 3NFCA 1YIJA 2FVUA 2HAXA 4M7AA 3X20B 3HKSA 2LT1A 3OYDA 2M16A 4JDSA 3JAME 5DLOA 2VXEA 3JB9J 3LGLA 1JJ2A 2PQWA 2R58A 4LD6A 1X6OA 4C5EA 1W2BA 3CCET 3OBWA 3L1AA 5J3BA 4VUBA 3GNGA 5DLQE 4PJOC 3URGA 3VUBA 3OYGA 4JRQA 2HD0A 3SB2A 1N27A 4DOWA 3OS2A 2MMPA 4ZGEB 2CZ7B 2XD0A 4LDVA 3MEVA 1VQ6A 1V29B 2DIGA 1BKBA 2QEXT 1PSEA 2EWNA 4OB0B 2EQJA 4MZTA 5GAMj 1JRIA 2ZPGB 2FL7A 5FU7C 4F7UA 2PVGB 3LX7A 5GAOn 2LX9A 3LYIA 2RHXA 3CCVT 1QP3A 4M75D 2DD5A 1WJRA 1PSFA 4EPCA 3CMAT 4HCBA 1XQHA 3OYBA 3OSSC 4JRKA 2MF2A 5A0DA 1YJ9T 3HP9A 4C92G 3MEUA 3JB9F 4PJOD 2VV5A 3CXCA 1BIAA 2X4JA 3CCJT 1VQ8A 2KVQG 5FU6C 4WF2A 3A8GB 2MWOA 3P8BB 4QVDA 4PL6A 1X01A 2QQBA 3A8MB 2CS7A 4A53A 1VQ9T 1VQLT 4IURA 1D3BA 4LDWA 1UGRB 1M1FA 4M78F 3JCMe 1M1KC 3OA6A 1K9MU 5CVIA 4O5VA 5CIUA 3QZ9B 4BUGA 1N9RA 3META 2MI6A 3QJYA 1SSFA 4NOYA 4M75E 4ME7A 2XG8D 5CQYA 3WXMB 2P0PA 2O01E 3CCMA 1U8RA 1VQ4A 4PJOE 3GNFB 3P8HA 4JRPA 3MP6A 3P8DA 2AHJB 4XU1A 1KHCA 4TVRA 5J39A 1Q82U 2PVDB 3MEWA 5CKHA 4ZN1A 2R57A 2L5QA 2BIVA 5GMKm 3VUZA 1LJOA 1WQ7A 1M4ZA 5HK0A 3HFNA 3HRSA 3MCAB 1M1GA 4C92B 1LOJA 1W4SA 4EMKA 3LWIA 2X4YA 2RHYA 5GMKj 3KUFA 4NL3A 4M7DC 4KUIA 5GMKe 3I56A 3G4ST 5LJ3f
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELY C;  5CKD A;  4MDX A;  3G7Z A;  5CO7 A;  5CQX A;  4MZT A;  4ELZ C;  4MZP A;  5HKC A;  5CKB A;  3NFC A;  4ME7 A;  1NE8 A;  5CQY A;  5CKF A;  5HK3 A;  3JSC A;  5DLO A;  5CKE A;  4OF1 A;  1VUB A;  2KMT A;  2MF2 A;  5CR2 A;  5CCA A;  4VUB A;  5CKH A;  1X75 C;  4HKE A;  3VUB A;  5HK0 A;  4MZM A;  5CK9 A;  2VUB A;  3TCJ A;  3HPW A;  1UB4 A;  3JRZ A;  2C06 A;  1M1F A; 
#chains in the Genus database with same CATH topology
 2E3I A;  2JTE A;  1K9M C;  3CPF A;  2EKO A;  1YHQ T;  4QKU A;  4M7A C;  4RCC A;  2RA2 A;  1UHF A;  2QYZ A;  4J83 A;  4E2F B;  2D6F A;  3CCS T;  1R77 A;  3DLM A;  3JB9 G;  2J06 A;  1G3Y A;  2E10 A;  1WXU A;  3GLX A;  4JZ3 A;  2A37 A;  2IVW A;  2RB6 A;  1JU5 C;  4C5I A;  2QEX A;  1RUW A;  1QWF A;  3TVT A;  3PE0 A;  1JO8 A;  3V7C A;  3NTI A;  5LJ3 e;  1C0M A;  4L6V 5;  2V1Q A;  3CPW S;  2CH4 A;  3TRE A;  1ZSZ B;  2CSQ A;  3G6E T;  1QVG S;  2L2P A;  4E7S A;  4AT1 B;  3CD6 Q;  3JCM g;  1WLP B;  1XNI A;  3ZEH A;  1YIT Q;  1VUB A;  3JB9 I;  3MEA A;  2DD4 A;  3ZBD A;  1H92 A;  2RK1 A;  4Y91 A;  1S72 T;  1AHJ B;  2COW A;  3OYL A;  2B86 A;  4FT4 A;  2QQ9 A;  3O5Z A;  1YCY A;  2FPE A;  3QYH B;  4F14 A;  5KYW A;  2K79 A;  4M78 B;  2K3Y A;  3CC4 Q;  3CD6 T;  2ZAE A;  4LNP A;  3LW5 E;  2RMO A;  1YIT T;  1G83 A;  4NS5 A;  1UEB A;  4HVW A;  3SDZ A;  5GAO l;  3FIF A;  5I11 A;  4HT8 A;  3HFO A;  1WDX A;  4KRT A;  3SEM A;  5IN1 A;  2RK2 A;  5I22 A;  3M53 A;  1QW1 A;  2LNV A;  2M0O A;  1QVP A;  3CC4 T;  1KQS P;  1YI2 Q;  2EYZ A;  4EIK A;  1Y71 A;  8AT1 B;  1K0S A;  4LD9 K;  4OB1 B;  2E41 A;  2RF0 A;  3CBM A;  3EG3 A;  4C8Q B;  3PMI A;  2DTI A;  2YXY A;  4OMF B;  3OS0 A;  3L2V A;  4L59 A;  2MK5 A;  4PJO F;  3JB9 H;  3CC2 A;  2C06 A;  1D1C A;  1UDL A;  3R6O A;  4PNO A;  2HMA A;  2JS0 A;  2J6K A;  2E64 A;  4MZP A;  1I4K 1;  5GAO r;  3PGG A;  2KNB B;  3RBB B;  3J81 E;  2CP6 A;  3JCM X;  2HZY A;  1VA7 A;  4J9D A;  3G71 A;  2OTL A;  2E1H A;  2RJE A;  2DL3 A;  8ATC B;  2FG0 A;  5AYF A;  1X6G A;  1UE9 A;  2EKH A;  2RHI A;  5HK3 A;  4WCI A;  3H6Z A;  2EJF A;  2NUP A;  1Q86 R;  2ED1 A;  1VQ6 Q;  3H0H A;  1W6X A;  3FDR A;  1AOJ A;  5LJ5 e;  1JJ2 S;  1K9A A;  2K5I A;  1Q82 C;  1KQ1 A;  2DXT A;  1HXD A;  2GQV A;  2WSC E;  2DIQ A;  4KGZ B;  4CC7 A;  1PKT A;  2CUD A;  3SD4 A;  2J6F A;  3QKJ A;  1Y96 A;  1PCX A;  1VQ6 T;  1Q7Y R;  4C92 C;  1N8R R;  4M7A F;  1MV0 B;  2F5K A;  3X26 B;  1PRM C;  2XIC A;  1WHM A;  1SG5 A;  4M4Z A;  3NMZ C;  3VV0 A;  1MGQ A;  3WVD B;  5GMK i;  3ASK A;  1D1A A;  3Q1J A;  4QT7 A;  1K76 A;  2KY9 A;  3ZFJ A;  2FPF A;  4F7U F;  1SKU B;  2K6D A;  5J26 A;  1ZHI A;  2F1L A;  2RJC A;  3VS2 A;  4DQ2 A;  3I9Q A;  3JV3 A;  4A4H A;  5LJ5 g;  2OI3 A;  2FYK A;  3SWN B;  2RJD A;  5GAM f;  2XU8 A;  2QEX Q;  3N5B B;  1GFD A;  2ENM A;  2NLU A;  2D9T A;  1FMV A;  4QQ6 A;  5GAM d;  3C4S A;  1VQ5 A;  3LH5 A;  3MP8 A;  3QSU A;  2QK0 A;  1UGP B;  2O31 A;  3EAE A;  1U5S A;  1CSK A;  3JCM f;  1M1K R;  1IGU A;  3VYG A;  2JNG A;  3JCM d;  1LCK A;  1VQN A;  4KUD K;  4GBQ A;  3JB9 D;  1WFW A;  4N4I A;  1VQO A;  1M27 C;  2JVV A;  3UA6 A;  4BE2 A;  4ZNX A;  2QI2 A;  3RDV A;  3SWN C;  2EFI A;  3E2U A;  1YJN A;  2O88 A;  2QA4 A;  3HPW A;  4QW2 A;  3F70 A;  4ELZ C;  2I0N A;  2DXB A;  4KGV B;  1K4U S;  2EYX A;  2P4T A;  2LQW A;  2DZC A;  1NJI R;  4O6J A;  2EW3 A;  1UGV A;  1OOT A;  2JOY A;  4D8K A;  3KXT A;  4PJO A;  4RG8 A;  1M2V A;  2E70 A;  1AWX A;  3CEY A;  1D09 B;  3VS7 A;  2CP0 A;  1W2B S;  1BBZ A;  3UWN A;  1ZUK A;  2DAQ A;  4BAC A;  4ZTF A;  2JN0 A;  5IAY A;  2KYB A;  1PG5 B;  2L89 A;  3CC2 Q;  4E7L A;  2YUP A;  3PIO A;  4DEX A;  4E7J A;  2YLC A;  4M77 B;  4J6W A;  3HRT A;  4M75 B;  1N6A A;  2OJ2 A;  2OTJ A;  2KE9 A;  1I0C A;  2DVJ A;  2Y90 A;  1D0X A;  4V2S A;  1Q81 C;  3EGU A;  2CKK A;  2YLB A;  2EGA A;  1ZA1 B;  2W10 A;  4E47 A;  3CC2 T;  1OX8 A;  2CP5 A;  3CCU A;  3G71 Q;  1I81 A;  5C6S A;  2OTL Q;  2DPP B;  4XTV A;  1PC0 A;  3QDF A;  3X25 B;  2LQ8 A;  2XDB A;  1G3W A;  4C92 F;  3C94 A;  4A63 B;  2VYT A;  2DET A;  1M90 R;  1SF9 A;  2JMC A;  5GAN 8;  4B9X A;  3A98 A;  1QVF A;  4RTX A;  3G71 T;  1OPK A;  2FB7 A;  1OU8 A;  4HXJ A;  3NFC A;  1YIJ A;  2FVU A;  4M7A A;  3M0Q A;  1JXM A;  2LT1 A;  4JDS A;  3JAM E;  5DLO A;  2VXE A;  3LGL A;  2PQW A;  1PD0 A;  4C5E A;  5KYX B;  2HBW A;  1U06 A;  3VUB A;  2D8J A;  2PZ1 A;  2HD0 A;  1PM3 A;  1N27 A;  2MMP A;  2XD0 A;  2EWN A;  2KRN A;  5FU7 C;  2LP5 A;  4F7U A;  2PVG B;  5GAO n;  2LX9 A;  3LYI A;  4CC2 A;  1RAI B;  1ACM B;  3OSS C;  4JRK A;  5AT1 B;  1E7O A;  2VV5 A;  2LQN A;  1X27 A;  1RLQ C;  3A8G B;  4PL6 A;  2CS7 A;  1C6V X;  4PK4 A;  1UG1 A;  1K9M U;  1M1F A;  3OA6 A;  3BE3 A;  5CVI A;  4BUG A;  2MI6 A;  4JJB A;  1JEG A;  2C0I A;  1T3S A;  2XG8 D;  4KGX B;  2P0P A;  3CCM A;  5KYU A;  3P8H A;  4JRP A;  1E6G A;  2BZ8 A;  4XU1 A;  4TVR A;  5KYN A;  2PVD B;  3MEW A;  5IXF A;  2R57 A;  2L5Q A;  1M8M A;  2V1R A;  5GMK m;  4R0K A;  1M1G A;  1LOJ A;  1T0H A;  2RHY A;  5GMK e;  3I56 A;  2YSQ A;  3NPF A;  1B7T A;  4A4K A;  4DBR A;  1VQ5 Q;  2RN8 A;  3BDL A;  1D3B B;  2HSE B;  2KT8 A;  4OGC A;  2JT4 A;  2L3P A;  1YI2 A;  4FT2 A;  3FLG A;  4XTX A;  1ZQ1 A;  4M78 A;  1I8F A;  2DYB A;  2J6O A;  3EGD B;  2DRK A;  1QVF P;  1VQN Q;  2JTM A;  3DB3 A;  1RI0 A;  1RAB B;  1VQ5 T;  1NPR A;  5CKD A;  1WIE A;  3CCV A;  4Q5W A;  4CC4 B;  4EMK B;  1VQ8 Q;  1VQO Q;  2XDD A;  2Z0W A;  4EMH A;  5DY9 A;  3FJ5 A;  4KBM B;  3V8K A;  1YJN Q;  2QA4 Q;  4AFS C;  2LNH B;  3S3O A;  1YBY A;  3VU3 C;  2J7I A;  4IUU A;  3V7S A;  4FYV B;  3MPU B;  1VQK A;  4FL6 A;  2ZPE B;  4C8Q A;  1QCO A;  4J9B A;  1RAF B;  2HKQ B;  2ZCF B;  1IO6 A;  1YJN T;  1ZSG A;  2QA4 T;  3SFM A;  3EGX B;  1IHW A;  2DL4 A;  2KMT A;  4A4F A;  2IPO B;  1WXB A;  4CC3 A;  2KI7 A;  1UGS B;  1ZUU A;  2HNI A;  2DA9 A;  4LUD A;  2K4Y A;  4OB3 B;  2WSF E;  4BI8 B;  4NL2 A;  2BUD A;  2OTJ Q;  2R5M A;  2E3H A;  5IHN A;  2HBP A;  2KBT A;  6AT1 B;  4A54 A;  4M77 D;  4C92 A;  1OQK A;  5FRN A;  1MMD A;  4PKC C;  5GAM h;  3GP8 A;  1H3Z A;  3CCU Q;  4FU6 A;  1QVG A;  1TSF A;  1KQ2 A;  1C1A A;  1G3S A;  2KRS A;  1KQS A;  1K8A R;  4IKF A;  2OTJ T;  1NLO C;  1E6H A;  2O4X B;  1PWT A;  3DLL A;  4M77 E;  2GBQ A;  3HRU A;  4JRI A;  1TU0 B;  2LMJ A;  2ZZD A;  1AWO A;  3BY7 A;  3JCM h;  2E5K A;  3G1J A;  2DXU A;  3CCU T;  2GFU A;  2ESW A;  2DK3 A;  1P92 A;  3M0R A;  3FEO A;  2RI3 A;  3RER A;  1YWP A;  1YIJ Q;  2E65 A;  1WA7 A;  1KSW A;  1SRM A;  2JMA A;  3ME9 A;  4OVA A;  1Q86 U;  1ZUY A;  1RAC B;  1V1C A;  3CCE A;  4KH1 B;  3JCM V;  2EJG A;  5A0G A;  3OYK A;  1LNX A;  2RHU A;  1YIJ T;  3NHN A;  4OMQ A;  1AT1 B;  2MAM A;  4QQG A;  3UPU A;  3M55 A;  3E9G A;  2C0T A;  1R0C B;  4E7K A;  1Q7Y U;  4LXC A;  3GIB A;  2LJ0 A;  3FRN A;  2RI2 A;  4ZN3 A;  5FW9 A;  3X24 B;  2E6Z A;  4FIB A;  3QWX X;  2RH2 A;  2YUQ A;  2YUN A;  4X9C A;  3CCJ A;  4PFO A;  2WSE E;  4OMP A;  3EG9 A;  2EAY A;  1VQL A;  3D7S B;  1KK7 A;  1AWW A;  5L23 A;  1RAH B;  2J05 A;  4JJC A;  4KH0 B;  3SWN A;  3CCM Q;  4IIO A;  4RTV A;  1SHF A;  1RI9 A;  2NUZ A;  2EBP A;  2X3W D;  2MOX A;  2CT4 A;  2KYM A;  2RJF A;  4JLG A;  4LDU A;  2V8I A;  5GAN 4;  5GAN e;  3I56 Q;  3M0P A;  1IHV A;  1PNJ A;  2X9H A;  3H0F A;  1F1B B;  4OP0 A;  3L42 A;  1HJD A;  5IXB A;  2A7Y A;  2E12 A;  1IRE B;  4D6W A;  1QVG P;  4FSS A;  2KR3 A;  1ZSZ C;  4BD3 A;  4M7D G;  4OB2 B;  4PJM A;  4Y28 E;  1KD1 R;  3OSV A;  4RG2 A;  3I56 T;  5LJ3 g;  1JBM A;  1WQW A;  1OYX A;  1OEB A;  2RD1 A;  2P84 A;  1KJW A;  2JW4 A;  2ZPH B;  2CP2 A;  4AFZ C;  2PVO B;  4X34 A;  3CCV Q;  4JS5 A;  5I2S A;  1HSQ A;  1RAD B;  4BI4 A;  4M78 C;  1WHG A;  1M1K U;  1YI2 T;  3HSB A;  4BB7 A;  1KD1 C;  2OAW A;  1VQ7 A;  1NBE B;  2F2V A;  1MUZ A;  2B8A A;  1WZO A;  3EG0 A;  1R0B G;  4M7D B;  3OMC A;  2NUT B;  1BIB A;  4RTU A;  1G5V A;  3L2Q A;  2HL5 C;  1XTD A;  2K3X A;  1WHH A;  1K1Z A;  2KDS A;  2FZG B;  5CKE A;  1VQK Q;  2G3R A;  5A2Q E;  3LH0 A;  5GAO m;  4Z02 A;  2PU9 B;  2DF6 A;  5GAN g;  4OMO A;  2GNC A;  2O2O A;  1NJI U;  1M30 A;  2V8J A;  4C0Z A;  2DX1 A;  4C8Q C;  2A3L A;  5EC7 A;  2DTH A;  1VQK T;  3M0U A;  4IIM A;  4M77 A;  3RNJ A;  4M75 A;  3C95 A;  1B34 A;  5I21 A;  2EQK A;  2DNU A;  5GAO p;  2ZPI B;  2GFA A;  4ZTJ A;  2P0Q A;  2XHC A;  3OYE A;  1OPL A;  1Q81 U;  2K5L A;  3FJP A;  2JUF A;  3NTK A;  1NEB A;  4E6R A;  1GXI E;  1BYM A;  2QAS A;  1YJW A;  5GAN 2;  5D6Y A;  3M59 A;  5LJ5 h;  1IZ6 A;  1JB0 E;  2ED0 A;  3PVQ A;  1Q86 C;  2K3B A;  3CCQ A;  3MKD A;  1OZ2 A;  1SEM A;  3OYY A;  3JCM c;  2DKG A;  3C12 A;  1U3O A;  2E5Q A;  5FLX E;  3H9N A;  4JLI A;  4PFZ A;  3OB9 A;  1Y0M A;  1ABQ A;  4FYY B;  4PJJ A;  2BZY A;  2QDL A;  1Q7Y C;  4BY6 B;  5KYX A;  2L8D A;  1N8R C;  1JJ2 P;  1H3H A;  2ZPB B;  5I2M A;  5GAN 5;  2V26 A;  4J8O A;  1PKS A;  1FMK A;  4BE1 A;  2CSI A;  2KXD A;  3M57 A;  3CCE Q;  5KCH A;  2CP3 A;  3S6W A;  3CME A;  5CQX A;  5FU6 B;  2DE0 X;  1UJY A;  2VGN A;  2ATC B;  2HAX A;  3X20 B;  1SSH A;  2MIO A;  3JB9 J;  1RAE B;  4LD6 A;  2RQT A;  1W2B A;  3CCE T;  3GNG A;  2VB6 A;  4DBQ A;  2ABL A;  1RLP C;  1VYV A;  4FYX B;  1UTI A;  2AKK A;  4LDV A;  3CCJ Q;  1AZG B;  4Z89 A;  1BKB A;  2QEX T;  4OB0 B;  2EQJ A;  5GAM j;  1JRI A;  1VQL Q;  1BK2 A;  3LX7 A;  2HL3 A;  1PSF A;  2HSP A;  1XQH A;  5A0D A;  3HP9 A;  3JB9 F;  3CXC A;  1BIA A;  3CCJ T;  1VQ8 A;  5FU6 C;  4WF2 A;  4QVD A;  1IGQ A;  3A8M B;  1VQL T;  1X2K A;  4IUR A;  1D3B A;  2LJ1 A;  4M78 F;  1M1K C;  2F2X A;  2O9S A;  4O5V A;  3QZ9 B;  1YP5 A;  3ULR B;  1TXQ A;  1GFC A;  3P8D A;  2AHJ B;  3EGD A;  5J39 A;  3VUZ A;  1LJO A;  1M4Z A;  2QG9 B;  4EMK A;  4NL3 A;  5LJ3 f;  1GBQ A;  3INZ A;  4ATO A;  1NJI C;  2EPD A;  2L3Q A;  3PTA A;  4E7I A;  4LE9 A;  1U1T A;  4RTW A;  3OMG A;  2XK0 A;  4C8Q F;  2CYZ B;  1WNL A;  5LJ3 d;  1EX4 A;  1VQ7 Q;  1BI0 A;  5FWC A;  2L0A A;  4R55 A;  4RUG A;  2FHD A;  4MZM A;  2M9U A;  1PRL C;  3DB4 A;  2MYS A;  2RI5 A;  4M7D D;  1TUD A;  2LDM A;  4J9C A;  1KHI A;  4GY5 A;  4MDX A;  1MND A;  2DBK A;  1BI1 A;  3CMA A;  4E7H A;  2V8K A;  2HKN A;  1VQ7 T;  2ZGW A;  5IHI A;  1RAG B;  3RUX A;  1W2B P;  5GAN f;  4J5Y A;  3J7A F;  3A8H B;  2YDL A;  4IUV A;  3HTR A;  1M2O A;  1TUC A;  4M7D E;  4J9I A;  3PMT A;  2NUP B;  3JCM b;  5GAN d;  3LLR A;  2LVM A;  3EG1 A;  3OYA A;  4RKU E;  3HHT B;  2R5A A;  3OYI A;  2OTL T;  4FCY A;  4XTW A;  2DL7 A;  2KEA A;  3GF5 A;  4M77 C;  4JJN K;  4RTT A;  4M75 C;  1HYO A;  4J6Y A;  1YJW Q;  1DJ7 B;  2P4R A;  1Y96 B;  4B9W A;  4RTZ A;  3CXC P;  2VC8 A;  2O4X A;  1M90 C;  2AK5 A;  1XOV A;  1JQQ A;  2XMF A;  2H3E B;  4J7I A;  3GBQ A;  3CCQ Q;  4AG2 C;  2VGM A;  5FWB A;  2JM8 A;  1UGQ B;  1W70 A;  2DJQ A;  2LQK A;  3CCS A;  1FYN A;  3H8Z A;  2XKO C;  4HCZ A;  1YCS B;  1EZZ B;  4JS4 A;  4PFP A;  3RES A;  5GJV B;  4FW2 A;  3QII A;  4XAX B;  3G6E A;  2HQX A;  2K2V A;  1D1B A;  4IUP A;  5D6X A;  2FRW A;  3VS3 A;  3S3N A;  1OI1 A;  4K11 A;  1T3L A;  4QQD A;  3EH1 A;  4X1V A;  1G2B A;  2RQU A;  1S72 A;  3LWH A;  3OW2 A;  3RR6 A;  2X35 A;  3CME Q;  2XI9 A;  2XDP A;  3IQL A;  3QBY A;  4XTU A;  5LJ5 f;  2KRM A;  1ZSZ A;  3BFM A;  4HVU A;  1G3T A;  3OS5 A;  5HY6 A;  1K73 R;  5LJ5 d;  5EG2 A;  2WAC A;  5CKB A;  3I35 A;  4FW1 A;  3FC3 A;  2LTO A;  3H41 A;  5GMK h;  3CME T;  3EHR A;  5FRO A;  3M54 A;  5GAN 7;  4IUQ A;  1SPK A;  4PJO G;  2A28 A;  4KUL A;  4XTY A;  1NZ9 A;  3CBP A;  2A0F B;  3RIR A;  4C5G A;  1IXD A;  4JJD A;  2CRE A;  3I5R A;  5GAO q;  2PTK A;  2E6N A;  4C0D B;  5IHK A;  2GCX A;  1R8O B;  5D6W A;  2QXF A;  1VIE A;  4MDW A;  2F5T X;  4GLK A;  4UC4 A;  4AFQ C;  4ZGJ B;  2OAU A;  3H0I A;  4J9E A;  1X43 A;  1KC8 R;  2NYS A;  4JPB W;  1VQN T;  3OYM A;  2LCS A;  4C5H A;  2COY A;  2LT4 A;  1BI2 A;  1VQ8 T;  1VQO T;  3QHS A;  2KXC A;  1KIK A;  4BDZ A;  3JCM J;  1GCQ A;  3MP1 A;  4OMM A;  3M5A A;  3RKX A;  4DOV A;  3G4S A;  4X9D A;  3TSW A;  3QG1 A;  1GRI A;  4QVZ A;  2EIF A;  1KD1 U;  4HT9 A;  2VUB A;  4XQ3 A;  2QAZ A;  4EMK C;  3PT9 A;  1WI7 A;  2JJ9 A;  2QQS A;  3GOX A;  4ELY C;  2DLP A;  4FSX A;  3QJ6 A;  2D0Q B;  1TOV A;  2GF7 A;  3I55 A;  2FZK B;  2BE9 B;  3OW2 P;  1AWJ A;  2EQU A;  4M7A G;  4M77 F;  2Y4X A;  3UF4 A;  1UHC A;  1ZLM A;  4M75 F;  4AMC A;  3CMA Q;  1AZE A;  3CPW A;  1YFN A;  2LX7 A;  3MJX A;  1EFN A;  1BI3 A;  2O9V A;  4LDY A;  1VQ9 Q;  5GAM e;  2QGF B;  1I1J A;  3ZL7 C;  4F17 A;  2VAS A;  1QCF A;  2LC4 A;  4F7U G;  2RQW A;  2LCL A;  1Y7X A;  4DBF A;  4M7A B;  2M1H A;  5GAN 3;  4PJL A;  1K8A C;  2EQM A;  1ABO A;  2DZ9 A;  1TWB A;  4D8D A;  2YWW A;  3VS6 A;  4DA4 A;  2X4X A;  1A0N B;  1M3C A;  1B3Q A;  2EGC A;  2KQW A;  3CCL A;  4DBH A;  2FZC B;  3FB9 A;  2SEM A;  4Z88 A;  3OYF A;  3LGF A;  4F7U B;  1WYX A;  2F69 A;  3CCS Q;  1WPY A;  2VXF A;  5GAN 6;  3JRZ A;  4KT0 E;  1ZX6 A;  1QP2 A;  4XK8 E;  4ORZ A;  1UEC A;  3QPH A;  1ZA2 B;  5IH2 A;  1M5Q 1;  4Y92 A;  2AZV A;  1N8R U;  4XU2 A;  4PLI A;  3BW1 A;  3UT1 A;  3G6E Q;  5LJ3 h;  4N4H A;  1AEY A;  2K5F A;  5GAM g;  3QUI A;  1WX6 A;  2JZ2 A;  2H3J A;  4QVC A;  4CI0 C;  5KYU B;  3TEE A;  1SRL A;  1O75 A;  2QTX A;  3OQ5 A;  1BB9 A;  2FEI A;  1S72 Q;  2KRO A;  4M78 G;  3UA7 A;  3BDU A;  1MV3 A;  3VRY A;  4BDY A;  1WHJ A;  1W1F A;  1GL5 A;  1Y07 A;  3A8L B;  1KQS S;  5L8R E;  4J9G A;  5IT9 E;  3M0T A;  1V76 A;  2JS2 A;  2DTO A;  2QQR A;  3OBY A;  1VYU A;  3CCM T;  3O8V A;  2GQI A;  3CPW P;  2GTJ A;  1FX7 A;  2L3S A;  5GAN h;  2DIL A;  4OGE A;  2EYW A;  3UDC A;  3KFV A;  2AT1 B;  3QXE B;  4OMN A;  3L2W A;  1MMN A;  4C8Q G;  2PUK B;  2K2M A;  2M16 A;  1Q95 G;  1BCM A;  2PNI A;  1MMG A;  1JJ2 A;  3L1A A;  5J3B A;  4VUB A;  3URG A;  2AIR B;  2A36 A;  4JRQ A;  1OX9 A;  3SB2 A;  2H8H A;  4J9F A;  2CZ7 B;  2CH4 W;  1TS9 A;  1NEG A;  2DIG A;  1WHL A;  1UJ0 A;  2DL8 A;  1N5Z A;  2D0N A;  3CCV T;  3REB B;  4EPC A;  3OYB A;  2MF2 A;  4C92 G;  4PJO D;  4WTO B;  5KYY B;  2MWO A;  1CKB A;  2QQB A;  5CIU A;  3MET A;  2AKL A;  1SSF A;  3G4S Q;  2DM1 A;  5CQY A;  2LZ6 B;  3VS1 A;  3WXM B;  1VQ4 A;  2EGE A;  4PJO E;  3GNF B;  1GCQ C;  1X2Q A;  2ECZ A;  4GLM A;  2BIV A;  2DYI A;  4C92 B;  3MCA B;  3I55 Q;  1W4S A;  3EG2 A;  2X4Y A;  5GMK j;  4M7D C;  4KUI A;  3G4S T;  1Q82 R;  3V8L A;  4N0A A;  1O9S A;  4N4G A;  2HQE A;  1BU1 A;  1OV3 A;  3PNW C;  1AD5 A;  1NPP A;  3EFO B;  4JZ4 A;  5CR2 A;  2RNA A;  3I55 T;  2A08 A;  2XID A;  3MO8 A;  2VKN A;  1J3T A;  4J9H A;  3M56 A;  1MHN A;  3QYG B;  4C0G A;  2L3R A;  2K57 A;  2CUB A;  5CO7 A;  3CBO A;  3CC7 A;  3VS0 A;  4PLL A;  3JCM W;  1VQP A;  3AHU A;  4L5G A;  4M7A D;  1RL2 A;  1U1S A;  5KCO A;  2FRY A;  3TSZ A;  1M90 U;  4BI3 A;  1H8K A;  4YTL A;  5HCK A;  1QKW A;  2I2L A;  5KH6 A;  5C0M A;  3ER0 A;  1OZ3 A;  7AT1 B;  5LL6 S;  3CCL Q;  3L2U A;  1FWZ A;  1FXX A;  3A5Z B;  2YRD A;  3L2R A;  2KT1 A;  4M7A E;  2EYQ A;  4F16 A;  1I5L A;  2FPD A;  3KBG A;  2C0O A;  3JSC A;  3GPL A;  4EMG A;  3EFS A;  3CCR A;  2BKD N;  3CCL T;  4PJN A;  3OYN A;  3THK A;  3EG9 B;  2X51 A;  4BY6 C;  2D1X A;  3RMQ A;  1Y57 A;  5M9O A;  3E9F A;  3UAT A;  5D7U A;  4BE0 A;  4F7U E;  1ZBX A;  3E1S A;  2MCN A;  1K0X A;  3JCM P;  1GBR A;  5KYW B;  3CQT A;  2MWP A;  2QGG A;  3PIP A;  3VJP A;  2DFU A;  3VKI A;  2GTO A;  3OS1 A;  1NM7 A;  1WXT A;  1WHK A;  1B07 A;  4Z8A A;  1VQM A;  2RM4 A;  2DBM A;  4RCB A;  3REA B;  2DVE A;  3NGP A;  4B6M A;  4XTZ A;  2DEU A;  3V8J A;  1VIF A;  3M58 A;  1OUL A;  1M3A A;  3VS4 A;  4E7Z A;  5KE3 A;  3VYH B;  4C0F A;  4J7F A;  3OY9 A;  4HVV A;  2COZ A;  1Z9Z A;  3RKY A;  3SHW A;  4OML A;  2ZPF B;  1M3B A;  4HKE A;  5CAI A;  1NYG A;  1K73 U;  4M78 D;  1KFZ A;  1LVK A;  1M9S A;  1UFF A;  2DEQ A;  1YN8 A;  2QTV A;  1PD1 A;  4M77 G;  4M75 G;  2DRM A;  1S1N A;  4M78 E;  4P5N A;  3WVE B;  1X75 C;  5A0L A;  4XU0 A;  3PFS A;  3A1P A;  1Z9Q A;  1TUG B;  1WJQ A;  2CGH A;  5LJ3 j;  1QKX A;  3EGX A;  2DMO A;  4M7D F;  1Q81 R;  4C8Q D;  3MHX A;  1YJ9 A;  1KC8 U;  5DM7 R;  2YT6 A;  1ARK A;  3J80 E;  4ZGD B;  4OF1 A;  1QQJ A;  1VQ9 A;  1B34 B;  2X3X D;  4J6X A;  4HCC A;  4JUV A;  3S3M A;  4DEY A;  3JCM Q;  2X4W A;  4C8Q E;  1VYT A;  1VQ4 Q;  2SRC A;  3QO3 A;  3CXC S;  2IG0 A;  1TTH B;  1VOM A;  1PHT A;  2DXC A;  2QDY B;  1I5O B;  2DL5 A;  1XJW B;  5GAN j;  1KG1 A;  3RKW A;  3OYJ A;  5FU7 B;  1QWE A;  4C92 D;  2YHT A;  3E19 A;  1VQ4 T;  2CZ0 B;  3EH2 A;  4II1 A;  5CK9 A;  1TG0 A;  3TCJ A;  1YNZ A;  3HL8 A;  1YHQ A;  2MPX C;  2JTF A;  1D0Z A;  3TU4 K;  4N0A C;  1NE8 A;  2P0K A;  2KSS A;  2RHZ A;  3M4G A;  4C92 E;  2ROL A;  1QCN A;  1X69 A;  1YJW T;  5KE2 A;  5GMK l;  5CCA A;  3CC7 Q;  4R56 A;  2IIM A;  1K8A U;  1N9S A;  1VQP Q;  2YRC A;  1AVZ C;  5GJW B;  3CCQ T;  3OYC A;  2LRQ A;  2W0Z A;  1NG2 A;  1HD3 A;  2CZ1 B;  1JXO A;  4ANJ A;  3M9Q A;  2BE7 D;  2CDT A;  3EHQ A;  2RPN A;  2YRV A;  2NWM A;  1CKA A;  2QQA A;  2RQR A;  1M8V A;  3CC7 T;  1MNE A;  1VQP T;  2CP7 A;  4EDU A;  2M02 A;  2KK4 A;  4IUT A;  3CD6 A;  3QZ5 B;  1HK9 A;  1G8X A;  2HDA A;  1YIT A;  1H64 1;  2K9G A;  2HEQ A;  3QDR B;  3G7Z A;  2DO3 A;  2OX7 A;  3CCR Q;  1ZBJ A;  3M4Y A;  4LUE A;  5HKC A;  2CZ6 B;  5CKF A;  1QVF S;  3EFR A;  2CT3 A;  3X28 B;  3QWY A;  3DKM A;  3CC4 A;  2KGT A;  5LJ5 j;  3CCR T;  2JM9 A;  3VRZ A;  1K73 C;  4AG1 C;  4XU3 A;  1VQM Q;  2RO0 A;  1WGS A;  3A8O B;  5FRM A;  4MMK A;  2PUO B;  1BCO A;  2KAF A;  3R6N A;  2YUO A;  4LDX A;  4MML A;  4PJO B;  2LCC A;  2VWF A;  1QMC A;  1VQM T;  3T9N A;  4HA8 A;  1T0J A;  1M2V B;  3V7R A;  3L2Z A;  1TH7 A;  4HCK A;  3RMS A;  3U23 A;  1D0Y A;  2EJ9 A;  4RTY A;  4CRI A;  2DER A;  1KC8 C;  1LPL A;  3OYH A;  3AT1 B;  2BTT A;  3NTH A;  3OW2 S;  4M7D A;  1I07 A;  1UB4 A;  2EQI A;  4RMO A;  1EIF A;  2RQV A;  2Y4Y A;  4FM4 B;  2EYY A;  2NUT A;  4C0D C;  2G6F X;  1IB8 A;  2DJZ A;  1WJS A;  4A4G A;  2D8H A;  2M0Y A;  2K7A A;  4A4E A;  3HKS A;  4FYW B;  3I5S A;  3TQ7 P;  3OYD A;  1GCP A;  5KYY A;  2ROT A;  2R58 A;  1X6O A;  3OBW A;  2HQH A;  4PJO C;  5DLQ E;  4ESR A;  5ECA A;  1NLP C;  3OYG A;  1YJ9 Q;  4DOW A;  2FO0 A;  3OS2 A;  4ZGE B;  2F2W A;  2EVR A;  3MEV A;  2JXB A;  1OU9 A;  1VQ6 A;  1V29 B;  1PSE A;  2E4H A;  4AFU C;  4MZT A;  2ZPG B;  4F04 B;  2FL7 A;  2RHX A;  3M0S A;  1QP3 A;  4M75 D;  2DD5 A;  1IRX A;  1WJR A;  4HCB A;  3CMA T;  1NYF A;  1YWO A;  1QLY A;  1YJ9 T;  3VS5 A;  3MEU A;  1UUE A;  2X4J A;  2KVQ G;  1X6B A;  3P8B B;  3PVL A;  1VQ9 T;  1X01 A;  4A53 A;  1RAA B;  1MMA A;  1UGR B;  4LDW A;  3JCM e;  3C0C A;  1N9R A;  2AZS A;  3QJY A;  4NOY A;  3EFO A;  4M75 E;  4ME7 A;  1FMW A;  2O01 E;  1U8R A;  9ATC B;  1K9M R;  2HCK A;  3MP6 A;  1YHQ Q;  1KHC A;  1Q82 U;  5CKH A;  4ZN1 A;  2LJ3 A;  2VVK A;  2M51 A;  1WQ7 A;  5HK0 A;  3HFN A;  3HRS A;  3LWI A;  2GGR A;  3KUF A;  1SHG A;  4LN2 A;  2BZX A; 
#chains in the Genus database with same CATH homology
 3INZ A;  3V8L A;  4A4K A;  1NJI C;  4ATO A;  1K9M C;  4N0A A;  3CPF A;  2EKO A;  3PTA A;  4E7I A;  1O9S A;  1U1T A;  1YHQ T;  4N4G A;  3BDL A;  4M7A C;  2HQE A;  3OMG A;  2XK0 A;  4RCC A;  4C8Q F;  1D3B B;  2CYZ B;  1WNL A;  5LJ3 d;  2RA2 A;  4J83 A;  3PNW C;  2D6F A;  4OGC A;  3CCS T;  1YI2 A;  1NPP A;  1BI0 A;  3DLM A;  3FLG A;  4FT2 A;  1ZQ1 A;  4XTX A;  1G3Y A;  2E10 A;  5CR2 A;  2XID A;  4R55 A;  3MO8 A;  3JB9 G;  3GLX A;  2IVW A;  2FHD A;  2RB6 A;  4M78 A;  4C5I A;  1I8F A;  2QEX A;  4MZM A;  2M9U A;  3M56 A;  3V7C A;  3DB4 A;  1MHN A;  3NTI A;  2RI5 A;  5LJ3 e;  3QYG B;  4C0G A;  4M7D D;  2L3R A;  2LDM A;  2JTM A;  2K57 A;  1RI0 A;  3DB3 A;  1KHI A;  4L6V 5;  4GY5 A;  1NPR A;  5CKD A;  1VQ5 T;  5CO7 A;  3CBO A;  3CCV A;  4MDX A;  3CC7 A;  3CPW S;  1BI1 A;  4PLL A;  3TRE A;  2V8K A;  3CMA A;  4Q5W A;  3G6E T;  4EMK B;  4E7H A;  3JCM W;  1VQP A;  1QVG S;  2XDD A;  1VQ7 T;  2ZGW A;  4EMH A;  3AHU A;  4L5G A;  5DY9 A;  3JCM g;  4KBM B;  4M7A D;  1RL2 A;  3V8K A;  1XNI A;  1U1S A;  3RUX A;  3ZEH A;  1VUB A;  5GAN f;  4J5Y A;  5KCO A;  3JB9 I;  3J7A F;  3A8H B;  3MEA A;  3S3O A;  2DD4 A;  3ZBD A;  1M90 U;  4IUV A;  4BI3 A;  1YBY A;  2RK1 A;  4Y91 A;  3VU3 C;  4YTL A;  4M7D E;  1S72 T;  1AHJ B;  3OYL A;  4IUU A;  4FT4 A;  2I2L A;  5KH6 A;  3PMT A;  2QQ9 A;  5C0M A;  1YCY A;  3ER0 A;  1OZ3 A;  3JCM b;  5LL6 S;  3V7S A;  5GAN d;  1VQK A;  3L2U A;  1FWZ A;  1FXX A;  3A5Z B;  2ZPE B;  3LLR A;  4FL6 A;  3QYH B;  2LVM A;  3OYA A;  4C8Q A;  3L2R A;  4RKU E;  3HHT B;  2R5A A;  4M78 B;  2K3Y A;  3CD6 T;  3OYI A;  2OTL T;  4M7A E;  2ZCF B;  2EYQ A;  1YJN T;  3LW5 E;  4XTW A;  1YIT T;  2QA4 T;  1I5L A;  3GF5 A;  4NS5 A;  1UEB A;  3SFM A;  4M77 C;  4JJN K;  3KBG A;  3SDZ A;  3JSC A;  5GAO l;  3FIF A;  3GPL A;  4M75 C;  4EMG A;  4HT8 A;  4XU0 A;  3HFO A;  3EFS A;  2KMT A;  4J6Y A;  4A4F A;  3CCR A;  2BKD N;  1DJ7 B;  5IN1 A;  1Y96 B;  2RK2 A;  4B9W A;  3CCL T;  2VC8 A;  2O4X A;  1M90 C;  3M53 A;  1QW1 A;  2LNV A;  2M0O A;  1UGS B;  1XOV A;  1QVP A;  2HNI A;  3OYN A;  3CC4 T;  4J7I A;  4BY6 C;  3RMQ A;  2VGM A;  5M9O A;  2K4Y A;  3E9F A;  4OB3 B;  4BE0 A;  1UGQ B;  4F7U E;  2WSF E;  1ZBX A;  2LQK A;  3E1S A;  1Y71 A;  4NL2 A;  4BI8 B;  3CCS A;  2BUD A;  2R5M A;  4LD9 K;  2HBP A;  3JCM P;  3H8Z A;  4OB1 B;  2E41 A;  3CBM A;  4A54 A;  4C8Q B;  2XKO C;  4M77 D;  2MWP A;  3PMI A;  4C92 A;  3PIP A;  3VJP A;  4HCZ A;  5FRN A;  2DTI A;  4PKC C;  4OMF B;  3RES A;  3VKI A;  5GAM h;  3OS1 A;  4JS4 A;  3GP8 A;  1H3Z A;  3OS0 A;  3L2V A;  4L59 A;  1VQM A;  3QII A;  2RM4 A;  4FU6 A;  4XAX B;  4PJO F;  1QVG A;  3G6E A;  2HQX A;  3JB9 H;  2K2V A;  4RCB A;  1KQ2 A;  3CC2 A;  2DVE A;  1G3S A;  4IUP A;  5D6X A;  2C06 A;  1KQS A;  4IKF A;  2OTJ T;  3R6O A;  4PNO A;  4XTZ A;  2O4X B;  3V8J A;  3S3N A;  1OI1 A;  1VIF A;  3DLL A;  2E64 A;  4M77 E;  4MZP A;  4QQD A;  1I4K 1;  5GAO r;  4JRI A;  3HRU A;  3PGG A;  3J81 E;  3M58 A;  1S72 A;  2ZZD A;  3BY7 A;  5KE3 A;  3LWH A;  3OW2 A;  3JCM h;  3JCM X;  3VYH B;  4C0F A;  2DXU A;  2X35 A;  4J7F A;  3OY9 A;  2GFU A;  3CCU T;  2XI9 A;  2DK3 A;  2XDP A;  3RKY A;  1P92 A;  2ZPF B;  3FEO A;  4HKE A;  2RI3 A;  3QBY A;  5CAI A;  3RER A;  4XTU A;  3G71 A;  1K73 U;  2OTL A;  5LJ5 f;  2E65 A;  4M78 D;  2E1H A;  3BFM A;  1M9S A;  1G3T A;  3ME9 A;  2RJE A;  3OS5 A;  4OVA A;  5HY6 A;  2DEQ A;  1Q86 U;  5LJ5 d;  5EG2 A;  2WAC A;  5CKB A;  5AYF A;  3CCE A;  2RHI A;  3FC3 A;  3JCM V;  2EJG A;  2LTO A;  5GMK h;  5A0G A;  3CME T;  5HK3 A;  5FRO A;  3H6Z A;  3OYK A;  1LNX A;  3M54 A;  4M77 G;  2EJF A;  2RHU A;  5GAN 7;  1YIJ T;  4M75 G;  4M78 E;  3WVE B;  5A0L A;  4P5N A;  1X75 C;  3FDR A;  5LJ5 e;  4IUQ A;  4PJO G;  1JJ2 S;  2MAM A;  2K5I A;  3PFS A;  4KUL A;  4QQG A;  1KQ1 A;  2DXT A;  1HXD A;  2GQV A;  2WSC E;  3E9G A;  3M55 A;  1NZ9 A;  3CBP A;  1WJQ A;  2CGH A;  2DIQ A;  4XTY A;  3RIR A;  4C5G A;  5LJ3 j;  4E7K A;  1Q7Y U;  5GAO q;  3GIB A;  3FRN A;  4M7D F;  2RI2 A;  3SD4 A;  4ZN3 A;  4C8Q D;  2E6N A;  3MHX A;  3X24 B;  2E6Z A;  4FIB A;  4C0D B;  1YJ9 A;  3QKJ A;  3I55 T;  1Y96 A;  2GCX A;  1R8O B;  2RH2 A;  5D6W A;  5DM7 R;  1KC8 U;  1VQ6 T;  2QXF A;  4X9C A;  1VIE A;  4MDW A;  4ZGD B;  3J80 E;  4OF1 A;  2F5T X;  4GLK A;  4UC4 A;  4C92 C;  3CCJ A;  4M7A F;  2F5K A;  2WSE E;  3X26 B;  4ZGJ B;  2OAU A;  1VQ9 A;  2EAY A;  2XIC A;  1VQL A;  1B34 B;  4J6X A;  4HCC A;  1VQN T;  3OYM A;  3SWN A;  4JUV A;  3S3M A;  3JCM Q;  2X4W A;  4C8Q E;  3VV0 A;  1MGQ A;  3QO3 A;  3WVD B;  4C5H A;  2LT4 A;  1BI2 A;  3CXC S;  1Q82 C;  5GMK i;  1VQO T;  1VQ8 T;  3QHS A;  2RJF A;  4JLG A;  4BDZ A;  2IG0 A;  3ASK A;  4LDU A;  3Q1J A;  2V8I A;  2DXC A;  5GAN 4;  3JCM J;  2QDY B;  5GAN j;  1KG1 A;  3RKW A;  5GAN e;  2KY9 A;  3MP1 A;  5FU7 B;  3ZFJ A;  3OYJ A;  4F7U F;  4C92 D;  5J26 A;  3UPU A;  2YHT A;  4OP0 A;  1ZHI A;  3M5A A;  3E19 A;  3L42 A;  3RKX A;  4DOV A;  3G4S A;  1VQ4 T;  2CZ0 B;  2A7Y A;  4X9D A;  2E12 A;  1IRE B;  3QG1 A;  4II1 A;  2EIF A;  4QVZ A;  4D6W A;  5CK9 A;  1KD1 U;  2RJC A;  2VUB A;  4HT9 A;  3TCJ A;  4XQ3 A;  4DQ2 A;  4BD3 A;  4EMK C;  3PT9 A;  3HL8 A;  1YHQ A;  2JTF A;  4A4H A;  2QQS A;  3GOX A;  5LJ5 g;  4ELY C;  4M7D G;  4OB2 B;  4FSX A;  3QJ6 A;  2FYK A;  2D0Q B;  4Y28 E;  3TU4 K;  3SWN B;  2RJD A;  3OSV A;  2GF7 A;  4RG2 A;  2XU8 A;  5GAM f;  3I56 T;  4N0A C;  1NE8 A;  2P0K A;  2KSS A;  1JBM A;  2RHZ A;  3M4G A;  4C92 E;  5LJ3 g;  3N5B B;  3I55 A;  1YJW T;  5KE2 A;  2EQU A;  1WQW A;  1OYX A;  2D9T A;  2NLU A;  2RD1 A;  5GMK l;  4M7A G;  2ZPH B;  4M77 F;  4QQ6 A;  5CCA A;  2PVO B;  2Y4X A;  4X34 A;  5GAM d;  4R56 A;  4JS5 A;  3C4S A;  4M75 F;  5I2S A;  1K8A U;  1N9S A;  1VQ5 A;  3MP8 A;  3CCQ T;  4BI4 A;  3CPW A;  4M78 C;  3QSU A;  1M1K U;  1UGP B;  3OYC A;  2LRQ A;  1YI2 T;  3HSB A;  4BB7 A;  1BI3 A;  3EAE A;  1KD1 C;  1VQ7 A;  4LDY A;  3JCM f;  2CZ1 B;  2B8A A;  5GAM e;  3M9Q A;  4M7D B;  3OMC A;  2YRV A;  2QQA A;  1BIB A;  1M8V A;  1G5V A;  3L2Q A;  2K3X A;  1XTD A;  2KDS A;  3VYG A;  3CC7 T;  2LC4 A;  1VQN A;  5CKE A;  2JNG A;  4F7U G;  2G3R A;  3JCM d;  4KUD K;  2LCL A;  1Y7X A;  3JB9 D;  5A2Q E;  1VQP T;  4M7A B;  2M1H A;  3LH0 A;  4EDU A;  5GAN 3;  4N4I A;  5GAO m;  4Z02 A;  1VQO A;  4BE2 A;  2JVV A;  2KK4 A;  2PU9 B;  5GAN g;  2QI2 A;  4IUT A;  3CD6 A;  3QZ5 B;  1K8A C;  1HK9 A;  2EFI A;  3SWN C;  2EQM A;  1YJN A;  1NJI U;  1YIT A;  2QA4 A;  2DZ9 A;  3HPW A;  4QW2 A;  3F70 A;  1H64 1;  2V8J A;  3QDR B;  4C0Z A;  4DA4 A;  3G7Z A;  2DO3 A;  2X4X A;  3M4Y A;  4C8Q C;  2A3L A;  4ELZ C;  2DTH A;  2DXB A;  5HKC A;  1VQK T;  2P4T A;  4M77 A;  2DZC A;  2CZ6 B;  2KQW A;  4O6J A;  5CKF A;  3CCL A;  4M75 A;  3C95 A;  1QVF S;  3EFR A;  1B34 A;  3FB9 A;  2EQK A;  5I21 A;  3X28 B;  3OYF A;  3LGF A;  2JOY A;  5GAO p;  2ZPI B;  2GFA A;  3DKM A;  2P0Q A;  4F7U B;  3KXT A;  4ZTJ A;  3CC4 A;  2XHC A;  4PJO A;  3OYE A;  4RG8 A;  2F69 A;  5LJ5 j;  1WPY A;  1Q81 U;  2K5L A;  3FJP A;  2JUF A;  2E70 A;  3NTK A;  2VXF A;  5GAN 6;  3CEY A;  3CCR T;  1W2B S;  3JRZ A;  3UWN A;  4KT0 E;  1GXI E;  1K73 C;  1QP2 A;  4XK8 E;  1BYM A;  2DAQ A;  1YJW A;  5GAN 2;  3QPH A;  3M59 A;  5D6Y A;  4BAC A;  5LJ5 h;  4ZTF A;  1M5Q 1;  2JN0 A;  1N8R U;  1IZ6 A;  5IAY A;  1JB0 E;  4XU2 A;  4XU3 A;  2RO0 A;  4PLI A;  3BW1 A;  1Q86 C;  1WGS A;  3UT1 A;  3A8O B;  5LJ3 h;  2L89 A;  4N4H A;  5FRM A;  3CCQ A;  2K5F A;  1OZ2 A;  5GAM g;  4E7L A;  4MMK A;  3PIO A;  2PUO B;  4E7J A;  3QUI A;  3OYY A;  2JZ2 A;  3JCM c;  2DKG A;  2H3J A;  2YLC A;  4M77 B;  2KAF A;  4QVC A;  3C12 A;  4CI0 C;  4J6W A;  3HRT A;  3TEE A;  4M75 B;  1N6A A;  4LDX A;  2OTJ A;  2E5Q A;  4MML A;  1O75 A;  2QTX A;  3OQ5 A;  2Y90 A;  5FLX E;  4V2S A;  4M78 G;  1Q81 C;  4PJO B;  3BDU A;  4JLI A;  2LCC A;  4BDY A;  2CKK A;  3OB9 A;  2YLB A;  3T9N A;  1VQM T;  4HA8 A;  3V7R A;  4E47 A;  3L2Z A;  3CC2 T;  1TH7 A;  4BY6 B;  1Q7Y C;  3RMS A;  3CCU A;  2EJ9 A;  2L8D A;  1Y07 A;  1I81 A;  3A8L B;  5C6S A;  1N8R C;  1KQS S;  2DPP B;  2ZPB B;  4XTV A;  5I2M A;  5L8R E;  5GAN 5;  4CRI A;  4J8O A;  5IT9 E;  3X25 B;  1KC8 C;  2LQ8 A;  3OYH A;  2QQR A;  2DTO A;  2XDB A;  3OBY A;  3CCM T;  1G3W A;  4C92 F;  3O8V A;  3C94 A;  4BE1 A;  3NTH A;  3M57 A;  3OW2 S;  1FX7 A;  5KCH A;  4M7D A;  2VYT A;  5GAN h;  1UB4 A;  4OGE A;  5GAN 8;  4RMO A;  1EIF A;  2Y4Y A;  4FM4 B;  4B9X A;  4C0D C;  3S6W A;  3UDC A;  1QVF A;  2DJZ A;  3G71 T;  1WJS A;  5CQX A;  4A4G A;  3CME A;  5FU6 B;  3QXE B;  3L2W A;  2FB7 A;  2VGN A;  4A4E A;  4C8Q G;  2PUK B;  3NFC A;  1YIJ A;  2FVU A;  2HAX A;  4M7A A;  3X20 B;  3HKS A;  2LT1 A;  3OYD A;  2M16 A;  4JDS A;  3JAM E;  5DLO A;  2VXE A;  3JB9 J;  3LGL A;  1JJ2 A;  2PQW A;  2R58 A;  4LD6 A;  1X6O A;  4C5E A;  1W2B A;  3CCE T;  3OBW A;  3L1A A;  5J3B A;  4VUB A;  3GNG A;  5DLQ E;  4PJO C;  3URG A;  3VUB A;  3OYG A;  4JRQ A;  2HD0 A;  3SB2 A;  1N27 A;  4DOW A;  3OS2 A;  2MMP A;  4ZGE B;  2CZ7 B;  2XD0 A;  4LDV A;  3MEV A;  1VQ6 A;  1V29 B;  2DIG A;  1BKB A;  2QEX T;  1PSE A;  2EWN A;  4OB0 B;  2EQJ A;  4MZT A;  5GAM j;  1JRI A;  2ZPG B;  2FL7 A;  5FU7 C;  4F7U A;  2PVG B;  3LX7 A;  5GAO n;  2LX9 A;  3LYI A;  2RHX A;  3CCV T;  1QP3 A;  4M75 D;  2DD5 A;  1WJR A;  1PSF A;  4EPC A;  3CMA T;  4HCB A;  1XQH A;  3OYB A;  3OSS C;  4JRK A;  2MF2 A;  5A0D A;  1YJ9 T;  3HP9 A;  4C92 G;  3MEU A;  3JB9 F;  4PJO D;  2VV5 A;  3CXC A;  1BIA A;  2X4J A;  3CCJ T;  1VQ8 A;  2KVQ G;  5FU6 C;  4WF2 A;  3A8G B;  2MWO A;  3P8B B;  4QVD A;  4PL6 A;  1X01 A;  2QQB A;  3A8M B;  2CS7 A;  4A53 A;  1VQ9 T;  1VQL T;  4IUR A;  1D3B A;  4LDW A;  1UGR B;  1M1F A;  4M78 F;  3JCM e;  1M1K C;  3OA6 A;  1K9M U;  5CVI A;  4O5V A;  5CIU A;  3QZ9 B;  4BUG A;  1N9R A;  3MET A;  2MI6 A;  3QJY A;  1SSF A;  4NOY A;  4M75 E;  4ME7 A;  2XG8 D;  5CQY A;  3WXM B;  2P0P A;  2O01 E;  3CCM A;  1U8R A;  1VQ4 A;  4PJO E;  3GNF B;  3P8H A;  4JRP A;  3MP6 A;  3P8D A;  2AHJ B;  4XU1 A;  1KHC A;  4TVR A;  5J39 A;  1Q82 U;  2PVD B;  3MEW A;  5CKH A;  4ZN1 A;  2R57 A;  2L5Q A;  2BIV A;  5GMK m;  3VUZ A;  1LJO A;  1WQ7 A;  1M4Z A;  5HK0 A;  3HFN A;  3HRS A;  3MCA B;  1M1G A;  4C92 B;  1LOJ A;  1W4S A;  4EMK A;  3LWI A;  2X4Y A;  2RHY A;  5GMK j;  3KUF A;  4NL3 A;  4M7D C;  4KUI A;  5GMK e;  3I56 A;  3G4S T;  5LJ3 f; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...