5CQYA

E. coli mazf mutant e24a in complex with maze residues 68-82 form ii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
111
structure length
102
Chain Sequence
VSRYVPDMGDLIWVDFDPGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQEGVALADQVKSIAWRARGATKKGTVAPEELQLIKAKINVLIGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Recognition and Activity Regulation of the Escherichia coli mRNA Endonuclease MazF.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Hydrolase
molecule keywords Endoribonuclease MazF
total genus 22
structure length 102
sequence length 111
chains with identical sequence B
ec nomenclature ec 3.1.27.-:
pdb deposition date 2015-07-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02452 PemK_toxin PemK-like, MazF-like toxin of type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 5cqyA00
5CQXA 3VUBA 4MZMA 3JRZA 3TCJA 2VUBA 5CR2A 5CKDA 4HKEA 5CO7A 1NE8A 5HK0A 4MDXA 4MZPA 3NFCA 5CKBA 2MF2A 4MZTA 5HKCA 5DLOA 1UB4A 2KMTA 4ME7A 1M1FA 5CK9A 4VUBA 5CCAA 5CKFA 4OF1A 3JSCA 5CKEA 4ELZC 5CKHA 3HPWA 5HK3A 2C06A 1VUBA 3G7ZA 4ELYC 5CQYA 1X75C
chains in the Genus database with same CATH superfamily
3E2UA 3PIPA 1QKXA 4XTWA 2P4TA 3CCST 2LJ1A 1EFNA 4XTXA 1VQ9T 3CD6A 3NFCA 1VQLQ 3CC7Q 4IUTA 3UDCA 1VIEA 3AT1B 3NPFA 3JCMe 3UPUA 2WACA 2D9TA 4B6MA 2A36A 1SF9A 3HFOA 1U1SA 1U1TA 1X2QA 2DTOA 4DEXA 2EFIA 2JT4A 1PSFA 2F69A 1JO8A 3KXTA 5GMKh 4JPBW 2XI9A 4JRQA 4BDZA 3SWNA 4N0AA 1G2BA 5FWCA 4M78C 3E19A 3EHRA 2L3RA 1Q86C 4BUGA 1HJDA 1M90C 5LJ3f 4M75B 1YWPA 2FHDA 1GFCA 3QDFA 4E6RA 3VS5A 4OGEA 3X20B 3DKMA 3C12A 3JRZA 2CKKA 2Z0WA 2L2PA 1K73R 2ZPFB 2V8JA 4D8KA 4E47A 4RG2A 4V2SA 1GCQC 2O9SA 3CCSQ 2RHYA 4PKCC 3MP8A 2BZ8A 3SB2A 2AZSA 2XDBA 5KYXA 3EH1A 4KBMB 2RI5A 2RQTA 3OS1A 3TEEA 4XU3A 2VVKA 1T0JA 4DBFA 5LJ3j 3EFRA 4FL6A 4J9IA 4QQ6A 3BW1A 1VQMA 2ZPEB 4J9DA 5KYYB 2RK1A 3LLRA 4A4GA 4C0ZA 3EG2A 2VGMA 5AYFA 2D8JA 3FEOA 4PJOD 1RI9A 2MF2A 1VOMA 2JJ9A 3I35A 1UB4A 4AG1C 1Y0MA 3M0UA 1A0NB 4DA4A 1PRMC 3I9QA 3OYFA 4ZGDB 3L2WA 3LWIA 2XU8A 4RUGA 3MP6A 4PJOE 1TH7A 1YP5A 3J80E 2RO0A 1KD1R 4M77D 2CH4W 3O8VA 5GJWB 2KGTA 1UHCA 3JB9J 4EMKC 4DEYA 1YWOA 2GTJA 5KYNA 2F1LA 1PHTA 2LP5A 4F04B 2EKHA 1SEMA 1T3LA 1EZZB 2DL5A 2E3IA 1G3WA 2M51A 5DLQE 1ZUUA 3PTAA 1YHQQ 2EIFA 2VUBA 3LX7A 5CKDA 1BIBA 1YCYA 3OMCA 1OPKA 4C92E 4M7AG 1N5ZA 3MO8A 1BK2A 1QKWA 2CSQA 1UHFA 2F5KA 2DMOA 3CPWS 2RHUA 4RTUA 4C8QF 4ZGEB 1M3CA 2WSCE 3CC2A 4M75G 3CMEQ 3O5ZA 2X3WD 4CI0C 4MMKA 2KXDA 5GAMh 2HL5C 2LNHB 1V76A 2KT1A 3OYYA 2VC8A 1MMAA 5D6WA 3HTRA 4O6JA 1M1FA 3SHWA 2JVVA 3A8OB 2FPEA 3QYHB 2CH4A 1NBEB 3H0HA 2LTOA 2QGFB 4EMKA 4C92D 2OTLT 1WA7A 1K8AU 1YN8A 1D1AA 1ARKA 2DJZA 2E5KA 3OY9A 1WX6A 3SD4A 1AZGB 1N27A 2K79A 4OB2B 5IXBA 1VQLA 3CPWP 2OTJT 2DIGA 1Y57A 2YHTA 3NTHA 1VQ9A 4FT4A 1K8AR 2K2VA 4E7JA 3CCSA 2PVOB 3A8HB 2KRMA 4KGZB 4HVUA 3NGPA 4OMLA 4AFSC 5FLXE 1K9MR 2EQMA 3MPUB 3QBYA 3S3OA 1U5SA 1JJ2P 2CP6A 4B9XA 2W10A 4C5EA 2D0NA 4E7KA 4RTVA 3CQTA 1JQQA 5CKFA 1ZHIA 4FYXB 2A28A 3A8GB 1Q7YR 1WYXA 1GL5A 4FSXA 4OMQA 4LE9A 1O75A 2DXBA 1PD0A 8ATCB 4F7UG 3M4GA 1VYUA 5D6XA 2NYSA 4B9WA 3L42A 3SWNC 3KFVA 3OYCA 1VQMQ 2KROA 1RACB 1X43A 3SDZA 3M57A 3JCMV 4OB0B 4CC7A 5L23A 5J26A 3VS7A 1K9MC 3M55A 1M90R 2K3YA 3H0IA 3QHSA 3HKSA 5C6SA 3GNFB 2LJ3A 1VQ8T 2M0OA 4RCCA 1NYGA 1R0CB 2O01E 4JZ4A 5LJ3g 4PL6A 4BY6B 4JJDA 1ZSZC 2VYTA 2P84A 1FMWA 4FYWB 1JB0E 5LJ5f 1SRMA 4M77E 1AWWA 2RD1A 3I56T 1WHGA 4J6XA 5IN1A 5GANg 4HCCA 4AFZC 1NLPC 1IHVA 1TU0B 3R6OA 2CP3A 2RA2A 1NLOC 1UGRB 1FWZA 3C95A 1D0YA 5KYYA 2X9HA 2MWOA 2A0FB 2EBPA 3JB9F 1OI1A 5GJVB 1NG2A 2M16A 3X24B 1DJ7B 1Q81R 2DJQA 2KRSA 2CP0A 2DO3A 5FW9A 3M0TA 2GTOA 4FW1A 2XK0A 3ULRB 4C92B 2VKNA 4M7AE 2J05A 3CC4Q 4C92G 1QQJA 2EJ9A 4JRKA 4PK4A 3RMSA 2LMJA 2HD0A 2X4XA 4JLGA 4FW2A 1OX8A 2E1HA 1QVGS 5KYXB 3WVDB 1I4K1 1AT1B 1UFFA 3QWYA 3OYLA 2NWMA 1KSWA 2DBKA 2DE0X 1X6BA 3OYJA 1N8RR 2R5MA 1WJRA 1NE8A 1BCMA 3GIBA 1B7TA 3CCLQ 4EDUA 5FRNA 2RJEA 4KH1B 1M3AA 5D7UA 1M1GA 3Q1JA 2KYBA 4ZGJB 4ELZC 4M78G 3ASKA 2J7IA 4D6WA 2QDLA 2ZGWA 1YIJA 1Q82C 3G6EQ 1IRXA 4A4FA 4PNOA 4KGVB 5HCKA 1OULA 4MZMA 2COZA 2CZ7B 1MMGA 3CC2Q 2ROLA 2PQWA 1QP3A 3CD6T 4QVCA 2COWA 1RADB 1ABQA 3LWHA 1R77A 3WVEB 3CBOA 3N5BB 4M7AD 3EAEA 2DL7A 1J3TA 4IIMA 1W70A 1G3TA 4O5VA 2EWNA 5FWBA 2QA4T 2XHCA 5A0GA 4XTZA 3HSBA 1PC0A 2V1RA 2HKQB 3A1PA 2QI2A 2V8IA 2DL3A 1IZ6A 1K76A 3HHTB 4M78B 1NJIU 2HBWA 5CAIA 1FX7A 3TREA 3JCMX 6AT1B 1YFNA 1Z9ZA 3PMIA 1I1JA 5GANf 4E7IA 2LQKA 4NS5A 1QWEA 3L2QA 1TOVA 4JRPA 5CQYA 1VQ9Q 2J06A 5GAOp 2KYMA 1G5VA 5KE2A 1O9SA 2HZYA 5LJ5h 3U23A 1YJNT 3CCQA 2SEMA 5CCAA 2JW4A 3MEUA 1CKAA 4C8QB 3VRYA 2RI3A 4PJOG 2DX1A 2K57A 2RJFA 1MGQA 4FU6A 1ZBXA 4JS5A 4C5GA 2DBMA 3I56Q 2AIRB 2RF0A 2RK2A 5FU6B 2ZPGB 3V8KA 3H8ZA 2MMPA 3RERA 3FJPA 2YSQA 1RAAB 2L8DA 1UJ0A 1AOJA 1QLYA 2E70A 2EYZA 1MV3A 5GANj 1YJNQ 4PJJA 2E3HA 1VQ8Q 3INZA 5ECAA 2KK4A 2VWFA 1SKUB 3PVQA 3PMTA 4EMHA 4M77G 1VQ5A 4HKEA 2FRWA 2ABLA 2CSIA 5GMKi 2MI6A 1XQHA 2GFUA 3R6NA 4WTOB 4M7AC 4M7DB 1WJSA 3C0CA 1KQ1A 1KQSA 2E65A 3LW5E 1R0BG 2QEXA 4Q5WA 2DERA 2DD4A 1UTIA 2HSEB 2RH2A 2P0QA 1HK9A 2YWWA 1VQ4T 5I22A 3FB9A 2RMOA 3TVTA 4KULA 4PJNA 3V7SA 5C0MA 2ZPBB 3M59A 4PFZA 5GAMe 2PU9B 1CKBA 1D3BA 2K9GA 3QJYA 1NJIR 4HVVA 3JB9I 2LCSA 3CCJT 3CCRQ 4M7AB 4M7DC 1OOTA 5GAN4 3JCMd 1VUBA 4Z89A 5EG2A 4A4HA 4RCBA 2JZ2A 1M30A 4R56A 1JRIA 2CP7A 4JJCA 1G3SA 4BDYA 2PNIA 3UT1A 3CCLT 3C4SA 1S1NA 3CC4A 1W1FA 1T3SA 4M78D 1H8KA 5CVIA 3PFSA 1U06A 2YLBA 3G1JA 4FM4B 1E6GA 4YTLA 2P0PA 3HPWA 4K11A 1VYTA 2FL7A 3EFOB 3QXEB 4ZNXA 1NEBA 4RG8A 1IGUA 4TVRA 1TUCA 4PJLA 3CC7T 5HKCA 1X2KA 2FRYA 2LNVA 3P8BB 2F5TX 4XQ3A 3CXCS 1ZLMA 4J9HA 3M9QA 2VB6A 4IUVA 4M75A 1LJOA 1SPKA 1YIJQ 1AWJA 1RAFB 3CEYA 3G6EA 4XU2A 2GCXA 1X27A 1KC8C 4J6YA 2LRQA 1WQ7A 3CBMA 1GRIA 1OZ3A 4QT7A 4BD3A 2JTEA 1I5OB 5DY9A 5IHKA 2YRCA 3DLMA 3CCRT 1SG5A 4C92A 1NZ9A 2O31A 4RTXA 3RNJA 1ZQ1A 4OMPA 1H3ZA 1KHIA 4M75E 4DBQA 2E64A 4HCZA 1W4SA 1MMNA 3E9FA 1C1AA 1WPYA 2KEAA 3A8LB 2ENMA 1MNEA 2L0AA 2EAYA 1OYXA 1JXOA 3KBGA 2O4XB 3M53A 4FYVB 4F7UF 2NUPB 1U3OA 3OS5A 4F16A 4DBRA 2EQKA 1KD1C 1MMDA 3QDRB 3SWNB 4HT8A 2PVGB 4BI3A 1Q95G 3JB9H 3OYMA 1Q82R 1JBMA 2JNGA 3M0SA 4NOYA 2D8HA 3L2VA 1UJYA 3QPHA 1RAEB 3EGXA 4M77A 4OGCA 4AG2C 3CCQQ 2JTMA 5LJ5d 2QASA 2WSEE 1VQNQ 2E10A 2K4YA 1C0MA 4M7DG 1WHJA 1TXQA 2ED1A 4ORZA 5GAN7 1WJQA 4BI8B 2J6KA 2MCNA 4FCYA 3JB9G 1LOJA 2YUNA 3VV0A 1UGSB 2DM1A 2KBTA 2QDYB 4C92C 1TG0A 3JCMg 1NM7A 5L8RE 3CCUA 2JN0A 5CKEA 2QTVA 3DB3A 1Z9QA 2LC4A 4MMLA 2ESWA 2K5LA 2PUKB 4ELYC 1YJNA 2AK5A 2RHIA 1M1KR 1H3HA 1FXXA 2QTXA 1B34B 2YRDA 3M54A 3JCMW 1YJ9T 3L2UA 2G3RA 1VQOA 2K2MA 3VS1A 3CCEA 3H6ZA 4ZN1A 5GANh 1KK7A 1OU8A 2LCCA 3RR6A 2DEUA 2LX9A 2FZGB 1JEGA 1HXDA 3OBYA 3M4YA 4AFQC 2JS0A 3A5ZB 3RMQA 1QVGP 4IUUA 2CZ0B 5GAN8 1VQPA 2HQXA 4HVWA 4M7AF 1D09B 3OSSC 4DOWA 1VQ6A 1K0SA 2FEIA 4VUBA 1M8MA 1CSKA 4C8QC 2GNCA 1WHHA 4M75C 2L3PA 2A37A 2YUQA 4LDYA 1VQNT 1PWTA 4L5GA 4KUDK 4PJOB 4R0KA 4ESRA 4N4HA 1YJ9A 2PUOB 1YNZA 3UA7A 1SHFA 1BKBA 1BU1A 2CYZB 2JM8A 1QCNA 3QIIA 3EG9B 2DF6A 1KJWA 4MDWA 1AWXA 2JS2A 4N0AC 3QG1A 4M78A 2R5AA 2DD5A 4QQGA 2EYQA 3RUXA 5CQXA 3ER0A 4IIOA 3L2RA 7AT1B 4IURA 2DXTA 3GNGA 2EQUA 3A8MB 1QVFP 4JS4A 4BE2A 1TS9A 3EGXB 1RI0A 4OP0A 3UWNA 3OYKA 2ED0A 1I5LA 1I07A 1IREB 1X75C 1M5Q1 4A54A 4AT1B 4QVDA 2LQNA 4M78E 5HK0A 5GANd 1HSQA 2L89A 2DRMA 3LYIA 3H0FA 2QQRA 4A4EA 2AZVA 3UF4A 2QA4A 3HFNA 2FG0A 3GBQA 4PJOA 1BI2A 1IB8A 3M0PA 2O4XA 3UA6A 2ZAEA 2QQ9A 3FDRA 5GMKe 3S3NA 1OQKA 3HP9A 1VQNA 1VIFA 1Y71A 2QG9B 2DA9A 1UG1A 4KRTA 3OYEA 4LXCA 4PLIA 2KE9A 2OTJA 1PD1A 5DM7R 5CIUA 5FRMA 1PKSA 2EGCA 2I0NA 1Q81C 1N9SA 2C0IA 5KYWA 3BDUA 4XU0A 2LT1A 2VV5A 4DQ2A 1K8AC 1VQKA 1B07A 4LDWA 1EX4A 3CMAQ 1K4US 4OMOA 2RJCA 1XTDA 3JSCA 4J9GA 2J6OA 1NPPA 1E7OA 1ZSGA 3V8LA 1KC8R 1P92A 1TUGB 3CCEQ 4C8QG 3RIRA 4LDUA 2DAQA 2BUDA 4ZTJA 1VQ7Q 2DL8A 2QQBA 3HRSA 4D8DA 1Q7YC 3CMAT 2RHXA 4FSSA 2Y90A 3CCUT 3VS3A 2DL4A 3WXMB 1BYMA 4RTZA 3CBPA 2LCLA 3JAME 2YDLA 5LJ5e 2LZ6B 1YHQA 2O2OA 3OS2A 4LUDA 4ANJA 1M1KC 2P4RA 1WHKA 2X3XD 2D1XA 3BDLA 3CCLA 2MWPA 1T0HA 1X01A 3EGDA 3GOXA 1YJ9Q 1X6OA 4E7ZA 1KD1U 5IH2A 3OYBA 3CD6Q 1IGQA 5KYUA 2B86A 3CC7A 4OF1A 2GQVA 4Y92A 2F2WA 3REBB 2J6FA 1QWFA 1K73U 2DNUA 2YXYA 2XD0A 1LPLA 3TQ7P 4J7IA 4DOVA 4PLLA 2CDTA 5GAMj 4C8QE 1I81A 5KYWB 1C6VX 2X35A 1D1BA 3NTKA 3BY7A 1VQPQ 1AWOA 3MEWA 5GAN2 4KUIA 1M90U 1B3QA 1V29B 2FZCB 1VQ6Q 2IG0A 1K9AA 2OAWA 2AT1B 3I55A 2PVDB 4C0FA 3BFMA 1UEBA 2HAXA 3P8DA 2AKKA 2BKDN 5LL6S 2CP2A 2CZ6B 3TSWA 3JCMc 4BI4A 2YLCA 1VYVA 2LX7A 2XIDA 1WZOA 1OV3A 2QXFA 5GAN5 4II1A 1WHLA 2QQAA 2ZZDA 1XNIA 2X4YA 1WIEA 2Y4YA 3VJPA 1GBQA 2QAZA 2L3QA 3CCVQ 4JLIA 4AMCA 3MEVA 4LUEA 1UUEA 3VS6A 1BBZA 3TCJA 1E6HA 1YHQT 2JM9A 3CPFA 3OYDA 3V8JA 2JOYA 2EVRA 2MK5A 4M77B 1GCQA 2RM4A 5GAN3 5KCHA 2JTFA 2HQHA 1WXBA 1RAIB 2DVJA 2RPNA 2BZYA 3CCJA 1VQ5T 2VGNA 2E6NA 2QGGA 3VS0A 5CO7A 1H641 3KUFA 4A53A 4HA8A 3VUZA 2KMTA 1YITQ 3I55T 1M9SA 1GXIE 1BI3A 1VQKT 2QEXT 1ZSZA 3D7SB 1TWBA 3T9NA 1K9MU 4OB3B 4JUVA 1SHGA 4HCKA 3RBBB 5I11A 2HEQA 3J7AF 4C5HA 8AT1B 2FVUA 5I2MA 4EMGA 2DETA 4XTVA 2DKGA 4LD9K 4J6WA 1N9RA 1WXTA 2HSPA 4X34A 5J39A 1IHWA 3H41A 4C0GA 4QQDA 1VQ7A 1ACMB 1NYFA 1VQMT 1Q86U 2QEXQ 2IVWA 2OTJQ 2X4JA 4L6V5 3EGDB 2D0QB 1PCXA 4X9CA 2K3XA 3OW2S 4EMKB 2R57A 2GQIA 3PGGA 3JCMb 4F14A 4M77C 3MP1A 2DK3A 4XU1A 5CR2A 2MOXA 4RKUE 1M2VB 3HL8A 4UC4A 3C94A 5J3BA 1VQKQ 4F7UE 1NJIC 1OZ2A 3DB4A 1N8RC 5LJ5j 1D0XA 3QJ6A 2LJ0A 5I21A 3CCQT 2CZ1B 4Z88A 2V26A 4M7DA 2YT6A 5FU7B 2PZ1A 3PNWC 2RQWA 2DLPA 4JJBA 3A98A 1W2BS 3CMEA 4RTWA 4M75D 2KRNA 1QVPA 5I2SA 3CCET 1ZA1B 3PE0A 1OU9A 3CPWA 5LJ3h 3G4ST 3PT9A 3QSUA 2CP5A 2HCKA 5HK3A 2QYZA 3FIFA 1UDLA 2SRCA 4R55A 1LNXA 2EKOA 3JV3A 4JJNK 1WFWA 1JJ2S 3I55Q 5GAOq 4BE0A 3G71A 2XDPA 2K5IA 2BE7D 3J81E 5KCOA 4EPCA 1KQSP 1F1BB 4C8QA 2LQ8A 3EG9A 4J9CA 4J9EA 4BE1A 1ZA2B 4M7DE 4E7SA 3S6WA 1YJWT 2EGEA 3CCVA 5HY6A 2OI3A 5GAOr 4OMNA 1BI1A 1JJ2A 1MUZA 3NMZC 4J9BA 1ZUYA 2EYWA 5GMKl 1VQ6T 1YIJT 3JCMQ 1ZUKA 3QO3A 4Z8AA 2EJFA 5M9OA 1QVFS 4WF2A 3I5RA 2COYA 2YUOA 3JCMP 4E7LA 2RQUA 1ZBJA 1Y96A 3GF5A 2KT8A 1UGVA 4MDXA 4L59A 2M0YA 1KFZA 1Y96B 2DXCA 4OVAA 4C92F 2HBPA 1M1KU 1G3YA 5GMKm 4AFUC 2DTIA 1S72Q 2E4HA 4E7HA 2V1QA 2IPOB 1PRLC 2OX7A 2A7YA 2KSSA 2MPXC 2NLUA 3E1SA 5LJ3d 3OA6A 2V8KA 3OQ5A 2ECZA 1K73C 3ZL7C 2GFAA 2ZPIB 1M2VA 4N4GA 1FMKA 3QZ9B 2KXCA 2RNAA 4GLMA 3G71T 1KG1A 2JMAA 3PVLA 3G6ET 1M27C 1Y07A 4Y91A 3P8HA 3CCJQ 2NUTB 2A3LA 2EQIA 1HYOA 2JMCA 2LDMA 3S3MA 1NPRA 2QQSA 3G4SA 2E41A 3CCUQ 2DVEA 1RLQC 3OBWA 2F2VA 5GAOl 1WQWA 5GAOn 3CMET 2M1HA 2CGHA 1VQ5Q 3M58A 4KGXB 4KH0B 4M78F 1M2OA 4PFOA 4X1VA 2XMFA 1BCOA 1GCPA 1YCSB 2LT4A 4QW2A 3IQLA 1UGPB 1RUWA 2OAUA 2BTTA 3OSVA 3RKXA 1M3BA 2BIVA 3CCVT 3ZFJA 2A08A 1VQOT 2K7AA 1WDXA 1PM3A 3VYGA 4ATOA 1FYNA 1YBYA 4GLKA 2HMAA 4RTTA 3CCRA 1QVFA 5AT1B 1R8OB 3E9GA 4MZTA 2RJDA 2Y4XA 2KQWA 3G71Q 3OB9A 1QP2A 3HRUA 1U8RA 2L5QA 3RDVA 1PSEA 4NL3A 3X28B 3JB9D 4GBQA 4XAXB 1OEBA 1D0ZA 3OS0A 2AHJB 3SFMA 3MKDA 4M7DD 1WI7A 2BZXA 3QZ5B 1PNJA 1QMCA 5CKBA 4JRIA 3H9NA 2DIQA 2O88A 2R58A 3TU4K 4FT2A 4A63B 2W0ZA 5IXFA 2G6FX 2M9UA 4C0DB 1RL2A 1IO6A 4FYYB 1WXUA 3EG3A 2RQRA 5FU6C 1VQ7T 5IT9E 3RKYA 3URGA 1QVGA 3CCMT 3M0QA 4J9FA 4ZN3A 3FJ5A 4XTUA 4HCBA 3JCMh 4ME7A 3DLLA 5A0DA 4J7FA 5KH6A 4ZTFA 4QKUA 5IHIA 1X69A 2RB6A 3EH2A 4PJOF 1AHJB 2KNBB 1S72A 2OJ2A 2X4WA 4C8QD 2KDSA 4LDVA 1K1ZA 1N8RU 2QA4Q 1JXMA 1KC8U 2MYSA 1NEGA 1I0CA 1ABOA 1KHCA 2IIMA 1RAGB 1TTHB 4XTYA 3CC2T 1XOVA 4IUQA 4P5NA 3X26B 1MNDA 4M75F 3SEMA 1TUDA 4DBHA 4PFPA 3THKA 1S72T 2VXFA 2YUPA 1SSFA 1AVZC 5KYUB 2FB7A 2E12A 2MAMA 2X51A 1W6XA 2DYIA 2KI7A 3F70A 4LN2A 1X6GA 2E6ZA 2VXEA 3JCMf 3G4SQ 2L3SA 4CC4B 3CCMA 2OTLQ 1AZEA 2NUPA 3EGUA 2PTKA 3MEAA 2LVMA 1B34A 2C0TA 1YI2Q 2CREA 3GP8A 2ROTA 1QCOA 2RN8A 3CMAA 1WNLA 4LDXA 4WCIA 3VYHB 2EJGA 2XG8D 3I5SA 5CK9A 2H3EB 3OYAA 4M77F 1JU5C 1YJWQ 4NL2A 5LJ3e 2FPDA 5CKHA 2NUZA 1AD5A 2DXUA 2HQEA 3OW2P 1LCKA 4RMOA 3CC4T 4CC3A 1GFDA 4J8OA 2CUDA 3NHNA 3ZEHA 2EPDA 5A0LA 4EIKA 4M7AA 1M4ZA 4LNPA 3V7RA 5FU7C 1UE9A 2DZ9A 2DRKA 3BE3A 3VS4A 3QYGB 2KVQG 1TSFA 3OYIA 1RAHB 1D3BB 1RLPC 2M02A 3LH0A 4N4IA 2KAFA 2QK0A 4OMMA 2B8AA 2DYBA 3G7ZA 4JDSA 3OYHA 3V7CA 1Y7XA 2EGAA 1BIAA 3REAB 2ZCFB 1OPLA 1VQOQ 5GAMd 1QCFA 4J5YA 4F7UB 5EC7A 3HRTA 5GAMg 2JXBA 4FIBA 2JUFA 1VQ4A 3NTIA 1Q86R 3CXCP 3M56A 2DTHA 1PG5B 3FC3A 1VA7A 4E2FB 1UGQB 1LVKA 1SRLA 3MJXA 1IXDA 1KQ2A 1V1CA 1K0XA 1WHMA 1WLPB 1WGSA 2DPPB 2VASA 4OMFB 4Z02A 3OYNA 3EHQA 1W2BA 3X25B 1MV0B 4XK8E 2XDDA 4BACA 4C5IA 4J83A 1SSHA 1EIFA 1Q81U 2KY9A 1KQSS 3L2ZA 2NUTA 1QW1A 3L1AA 4RTYA 2RHZA 2RI2A 3FLGA 2C0OA 2FO0A 4JZ3A 3MCAB 2RQVA 1HD3A 2HL3A 1BI0A 1ZSZB 1Q82U 3CXCA 4CRIA 1RABB 2F2XA 2GBQA 2GGRA 3OMGA 2HKNA 5A2QE 4BB7A 2CT3A 2C06A 2I2LA 4IKFA 3VS2A 3UATA 4F7UA 1PKTA 3EFSA 3VUBA 3ME9A 5IAYA 3EFOA 4X9DA 3PIOA 3VRZA 5DLOA 3AHUA 3ZBDA 9ATCB 5GAN6 2K3BA 2ZPHB 3RESA 5IHNA 2WSFE 2YRVA 3MHXA 3M5AA 5FROA 4PJOC 1KIKA 1W2BP 4LD6A 3OYGA 2DILA 3OW2A 3M0RA 1YITA 2DEQA 3JCMJ 1YI2A 2EYYA 2EYXA 5LJ5g 2FZKB 2BE9B 2MIOA 2K5FA 3QWXX 1YJWA 5GMKj 3QKJA 1G8XA 2CS7A 4GY5A 4QVZA 2EQJA 3I56A 3EG0A 1OX9A 4HT9A 1FMVA 5GAMf 5KE3A 2O9VA 2FPFA 1VQLT 2FYKA 4M4ZA 2GF7A 4OB1B 4IUPA 3TSZA 2LQWA 1YITT 2CT4A 1N6AA 1BB9A 4KT0E 3GLXA 3CCMQ 2OTLA 2HNIA 1VQ8A 4BY6C 3META 2K6DA 2H8HA 2H3JA 5GAOm 3LGFA 1ZX6A 1I8FA 1D1CA 3VKIA 3GPLA 3FRNA 2HDAA 3LH5A 1XJWB 2XKOC 4F17A 1M8VA 2EW3A 2D6FA 1AEYA 4Y28E 2P0KA 4A4KA 1GBRA 2CUBA 1VQ4Q 1G83A 3EG1A 4M7DF 2DZCA 3LGLA 3RKWA 1YI2T 1H92A 4PJMA 2ATCB 1VQPT 3VU3C 1Q7YU 4MZPA 5D6YA 1UECA 4C0DC 4CC2A 2DFUA 2AKLA 3QUIA 4HXJA 2E5QA 5GANe 1MHNA 2XICA 2KR3A
chains in the Genus database with same CATH topology
3PIPA 2XHCA 4XTWA 3FDRA 2P4TA 4M78F 5GMKe 5A0GA 3CCST 3S3NA 3HP9A 1VQNA 1VIFA 1Y71A 4XTZA 3HSBA 4XTXA 1VQ9T 3CD6A 3OYEA 3NFCA 2QI2A 2V8IA 4PLIA 1IZ6A 4M78B 3HHTB 1NJIU 2OTJA 4IUTA 3UDCA 5CAIA 5DM7R 1FX7A 2LT4A 5CIUA 3TREA 3JCMX 1VIEA 4QW2A 5FRMA 1UGPB 3JCMe 2OAUA 3PMIA 3UPUA 2WACA 1Q81C 5GANf 2D9TA 3OSVA 4E7IA 2LQKA 3HFOA 3RKXA 1U1SA 1U1TA 2BIVA 4NS5A 1N9SA 3L2QA 3ZFJA 3CCVT 2DTOA 4JRPA 5CQYA 1VQOT 3BDUA 5GAOp 2EFIA 1PSFA 2F69A 4XU0A 2LT1A 3VYGA 2VV5A 4ATOA 4DQ2A 3KXTA 1YBYA 4GLKA 5GMKh 1K8AC 5KE2A 1VQKA 1G5VA 3CCRA 1QVFA 1O9SA 1R8OB 3E9GA 2XI9A 4LDWA 2RJDA 2Y4XA 4MZTA 5LJ5h 4JRQA 4BDZA 3SWNA 2KQWA 4N0AA 1YJNT 2RJCA 4M78C 3CCQA 1XTDA 3E19A 5CCAA 2L3RA 3MEUA 3OB9A 4BUGA 1QP2A 3HRUA 3JSCA 4C8QB 1Q86C 1M90C 2RI3A 4PJOG 1NPPA 1U8RA 2K57A 2L5QA 1PSEA 2RJFA 5LJ3f 4NL3A 3V8LA 1P92A 1MGQA 4FU6A 4M75B 4C8QG 2FHDA 3RIRA 4LDUA 2DAQA 3X28B 3JB9D 1ZBXA 2BUDA 4JS5A 4ZTJA 4C5GA 4OGEA 3X20B 3DKMA 2RK2A 3C12A 3V8KA 5FU6B 2QQBA 2ZPGB 3HRSA 3H8ZA 3JRZA 4XAXB 3OS0A 2AHJB 2MMPA 3SFMA 1Q7YC 3CMAT 2CKKA 4M7DD 3QZ5B 2RHXA 3RERA 3FJPA 5CKBA 2ZPFB 2L8DA 2Y90A 3CCUT 2V8JA 4JRIA 2DIQA 3WXMB 4E47A 1BYMA 2E70A 2R58A 4RG2A 4V2SA 3TU4K 3CBPA 2LCLA 3JAME 5GANj 4FT2A 5LJ5e 2RHYA 4PKCC 3MP8A 3OS2A 1YHQA 2M9UA 3INZA 1M1KC 4C0DB 2KK4A 1RL2A 4EMHA 3PMTA 3SB2A 3BDLA 3CCLA 4M77G 1VQ5A 5FU6C 4HKEA 1VQ7T 2XDBA 5IT9E 3RKYA 3URGA 5GMKi 4KBMB 1QVGA 2RI5A 3CCMT 2MI6A 1XQHA 2MWPA 1X01A 2GFUA 4ZN3A 3OS1A 3TEEA 3GOXA 4XTUA 4HCBA 4XU3A 4ME7A 3JCMh 1X6OA 3DLLA 5A0DA 1KD1U 4J7FA 4M7AC 1WJSA 3OYBA 4M7DB 1KQ1A 1KQSA 3CC7A 4OF1A 5KH6A 4ZTFA 2GQVA 5LJ3j 2E65A 3LW5E 2QEXA 3EFRA 4Q5WA 4FL6A 1K73U 2XD0A 2DD4A 2RH2A 2RB6A 2P0QA 4J7IA 4QQ6A 1HK9A 1VQ4T 3BW1A 1VQMA 4PJOF 2ZPEB 1AHJB 1S72A 2RK1A 4DOVA 3FB9A 4PLLA 3LLRA 4A4GA 4C0ZA 5GAMj 2X4WA 4C8QE 2VGMA 1I81A 4KULA 5AYFA 3V7SA 2KDSA 3FEOA 4C8QD 5C0MA 2ZPBB 4LDVA 3M59A 2X35A 1N8RU 5GAMe 2PU9B 4PJOD 1KC8U 3NTKA 1D3BA 2MF2A 3BY7A 1UB4A 1KHCA 3QJYA 3MEWA 4XTYA 5GAN2 4DA4A 3CC2T 1XOVA 4IUQA 4KUIA 4P5NA 3JB9I 1M90U 3X26B 1V29B 3CCJT 4M75F 3OYFA 4M7AB 4ZGDB 4M7DC 3L2WA 5GAN4 3LWIA 2IG0A 2XU8A 3JCMd 3MP6A 4PJOE 1VUBA 3I55A 5EG2A 1TH7A 2PVDB 4A4HA 4C0FA 3BFMA 3J80E 1S72T 2VXFA 1UEBA 2RO0A 4RCBA 2HAXA 4M77D 3P8DA 3O8VA 1SSFA 2BKDN 2JZ2A 4R56A 1JRIA 5LL6S 3JB9J 2CZ6B 1G3SA 2FB7A 4EMKC 2E12A 3JCMc 4BI4A 2YLCA 4BDYA 3UT1A 3CCLT 2MAMA 3C4SA 3CC4A 2XIDA 4M78D 2QXFA 3F70A 5CVIA 5GAN5 3PFSA 2E6ZA 2VXEA 4II1A 2QQAA 2YLBA 2ZZDA 1XNIA 3JCMf 3CCMA 2X4YA 2Y4YA 4FM4B 3VJPA 4YTLA 1G3WA 2P0PA 3HPWA 4JLIA 3MEVA 5DLQE 3MEAA 2LVMA 3PTAA 2FL7A 1B34A 3GP8A 3QXEB 3TCJA 2EIFA 2VUBA 3LX7A 5CKDA 4RG8A 1BIBA 3CMAA 3CPFA 1YHQT 1YCYA 3OMCA 3OYDA 4TVRA 3V8JA 4C92E 2JOYA 1WNLA 4M77B 3CC7T 4M7AG 4LDXA 3VYHB 5HKCA 2RM4A 3MO8A 2EJGA 5GAN3 5KCHA 2JTFA 2LNVA 2XG8D 3P8BB 5CK9A 3OYAA 2F5KA 4M77F 2F5TX 4XQ3A 3CXCS 3CPWS 2RHUA 4NL2A 5LJ3e 5CKHA 4C8QF 4ZGEB 3CCJA 1VQ5T 2VGNA 3M9QA 2DXUA 2E6NA 2WSCE 4IUVA 2HQEA 4M75G 3CC2A 4M75A 1LJOA 4CI0C 4MMKA 4RMOA 3CC4T 5GAMh 3CEYA 3G6EA 4XU2A 4J8OA 2GCXA 3OYYA 2VC8A 3ZEHA 5CO7A 1H641 3KUFA 1KC8C 4J6YA 5D6WA 5A0LA 2LRQA 4M7AA 4A53A 1M4ZA 4HA8A 3VUZA 1WQ7A 3CBMA 3V7RA 1OZ3A 2KMTA 5FU7C 2DZ9A 1M1FA 4O6JA 4BD3A 2JVVA 3A8OB 3QYGB 2KVQG 5DY9A 3OYIA 1M9SA 3I55T 3DLMA 3QYHB 1GXIE 1BI3A 3CCRT 1D3BB 1VQKT 4C92A 2QEXT 1NZ9A 3LH0A 4N4IA 3T9NA 1K9MU 2LTOA 2KAFA 1ZQ1A 1H3ZA 4OB3B 4JUVA 2B8AA 3G7ZA 4JDSA 1KHIA 4EMKA 3OYHA 3V7CA 1Y7XA 3J7AF 4C5HA 4M75E 4C92D 2FVUA 5I2MA 1BIAA 4EMGA 4XTVA 2DKGA 2E64A 2ZCFB 4J6WA 4HCZA 1W4SA 1N9RA 4X34A 2OTLT 5J39A 4LD9K 4C0GA 1K8AU 3E9FA 5GAMd 2DJZA 4QQDA 1VQ7A 3OY9A 1WPYA 4J5YA 4F7UB 3HRTA 3SD4A 3A8LB 5GAMg 1N27A 4FIBA 4OB2B 2JUFA 1VQMT 1VQ4A 3NTIA 1Q86U 1VQLA 2EAYA 1OYXA 2IVWA 2OTJT 3M56A 2X4JA 2DIGA 2DTHA 2O4XB 2YHTA 3KBGA 3M53A 4L6V5 3NTHA 2D0QB 4X9CA 4F7UF 2K3XA 3OS5A 3OW2S 4EMKB 1VQ9A 4FT4A 3FC3A 2R57A 1UGQB 2K2VA 3PGGA 3JCMb 2EQKA 4E7JA 3CCSA 1KD1C 4M77C 3MP1A 2PVOB 3A8HB 3QDRB 2DK3A 3SWNB 1KQ2A 4HT8A 4XU1A 2PVGB 5CR2A 1VQ8T 5FLXE 4BI3A 2EQMA 3QBYA 1WGSA 3S3OA 3JB9H 2DPPB 4RKUE 3OYMA 1JBMA 2JNGA 3HL8A 4OMFB 4NOYA 4UC4A 4B9XA 4C5EA 3C94A 4Z02A 3OYNA 3L2VA 5J3BA 4E7KA 4F7UE 1NJIC 1W2BA 3X25B 1OZ2A 1ZHIA 3QPHA 3DB4A 5CKFA 4XK8E 1N8RC 4M77A 2XDDA 4OGCA 4BACA 3A8GB 2JTMA 4C5IA 5LJ5j 4J83A 5LJ5d 1EIFA 1Q81U 2WSEE 4FSXA 2KY9A 3QJ6A 5I21A 2E10A 2K4YA 3CCQT 1KQSS 2CZ1B 3L2ZA 1O75A 1QW1A 2DXBA 3L1AA 4M7DA 4M7DG 2RHZA 3M4GA 2RI2A 4F7UG 3FLGA 5D6XA 5FU7B 5GAN7 3PNWC 1WJQA 4BI8B 4B9WA 3L42A 1W2BS 3SWNC 3OYCA 3MCAB 3JB9G 1LOJA 3VV0A 3CMEA 1UGSB 4M75D 1QVPA 2QDYB 5I2SA 1BI0A 1Q82U 4C92C 3CCET 3SDZA 3M57A 3JCMV 4OB0B 3JCMg 5L8RE 3CXCA 3CPWA 5LJ3h 3CCUA 4CRIA 3G4ST 3PT9A 3QSUA 2JN0A 5J26A 3OMGA 5CKEA 1K9MC 3M55A 5A2QE 2K3YA 3DB3A 4BB7A 5HK3A 2LC4A 2C06A 2I2LA 4MMLA 4IKFA 3QHSA 3FIFA 2K5LA 2PUKB 4ELYC 3HKSA 1YJNA 5C6SA 3GNFB 4F7UA 2RHIA 4R55A 1LNXA 2EKOA 3EFSA 3VUBA 2M0OA 1FXXA 4JJNK 2QTXA 3ME9A 4RCCA 5IAYA 1JJ2S 1B34B 4X9DA 3PIOA 3M54A 5GAOq 4BE0A 3G71A 2O01E 3JCMW 1YJ9T 2XDPA 3L2UA 5LJ3g 5DLOA 3AHUA 4PL6A 2G3RA 3ZBDA 4BY6B 1VQOA 5GAN6 2K5IA 2VYTA 2ZPHB 3CCEA 3H6ZA 3RESA 4ZN1A 5GANh 3J81E 5KCOA 1JB0E 2WSFE 2LCCA 2YRVA 3MHXA 4EPCA 5LJ5f 4M77E 3M5AA 2RD1A 3I56T 4J6XA 5IN1A 5FROA 5GANg 4HCCA 2LX9A 4PJOC 4C8QA 2LQ8A 1HXDA 4BE1A 3OBYA 3M4YA 3R6OA 4LD6A 4M7DE 3A5ZB 3RMQA 3S6WA 1YJWT 4IUUA 2RA2A 2CZ0B 3OYGA 3CCVA 5HY6A 5GAN8 1UGRB 3OW2A 1FWZA 5GAOr 1VQPA 1BI1A 3C95A 1JJ2A 1YITA 2HQXA 4M7AF 3OSSC 2DEQA 3JCMJ 2MWOA 1YI2A 4DOWA 1VQ6A 3JB9F 1OI1A 4VUBA 5GMKl 5LJ5g 4C8QC 1VQ6T 1YIJT 3JCMQ 2M16A 3X24B 3QO3A 2EJFA 5M9OA 1DJ7B 4M75C 1QVFS 4WF2A 2K5FA 2DO3A 4LDYA 1VQNT 4L5GA 1YJWA 3JCMP 5GMKj 4KUDK 2XK0A 4E7LA 4PJOB 3QKJA 2CS7A 4C92B 4N4HA 1Y96A 3GF5A 4GY5A 4QVZA 1YJ9A 2EQJA 2PUOB 3I56A 4M7AE 1BKBA 4C92G 4HT9A 4MDXA 5GAMf 2EJ9A 4L59A 4JRKA 5KE3A 2CYZB 1Y96B 2DXCA 4OVAA 3QIIA 4C92F 2HBPA 3RMSA 1VQLT 2FYKA 4MDWA 1G3YA 1M1KU 2GF7A 4OB1B 4IUPA 5GMKm 2HD0A 2X4XA 2DTIA 4N0AC 3QG1A 1YITT 4JLGA 4M78A 2R5AA 2E1HA 1N6AA 2DD5A 4QQGA 4KT0E 3GLXA 1QVGS 4E7HA 2EYQA 2OTLA 3WVDB 3RUXA 2HNIA 1I4K1 3OYLA 1VQ8A 5CQXA 4BY6C 3META 3ER0A 2A7YA 2KSSA 3OYJA 2NLUA 2R5MA 3E1SA 2H3JA 1WJRA 5LJ3d 5GAOm 1NE8A 3LGFA 3OA6A 1I8FA 3VKIA 3L2RA 2V8KA 3GPLA 3GIBA 3OQ5A 3FRNA 4IURA 1K73C 2XKOC 4EDUA 2RJEA 5FRNA 1M8VA 2GFAA 2ZPIB 2DXTA 3GNGA 4N4GA 2EQUA 3A8MB 2D6FA 1M1GA 4JS4A 3QZ9B 3Q1JA 4BE2A 4Y28E 2P0KA 4A4KA 4ZGJB 4ELZC 4M78G 3G71T 3ASKA 4D6WA 1KG1A 1RI0A 2ZGWA 4OP0A 3UWNA 3OYKA 1YIJA 1Q82C 4A4FA 3G6ET 4M7DF 1I5LA 2DZCA 4PNOA 1IREB 1Y07A 1X75C 1M5Q1 3LGLA 3RKWA 4Y91A 3P8HA 4MZMA 4A54A 1YI2T 2CZ7B 2A3LA 2PQWA 1QP3A 4QVDA 3CD6T 4M78E 4QVCA 5HK0A 5GANd 1VQPT 2LDMA 3VU3C 2L89A 3S3MA 4MZPA 1Q7YU 1NPRA 3LYIA 5D6YA 2QQSA 2QQRA 2E41A 4A4EA 4C0DC 3G4SA 3LWHA 2DVEA 3WVEB 3CBOA 3QUIA 2QA4A 3HFNA 3N5BB 3OBWA 4M7AD 5GAOl 3EAEA 4PJOA 1BI2A 1WQWA 2E5QA 5GANe 5GAOn 3CMET 2M1HA 2O4XA 2CGHA 1MHNA 1G3TA 3M58A 2EWNA 4O5VA 2XICA 2QA4T 2QQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CQX A;  3VUB A;  4MZM A;  3JRZ A;  3TCJ A;  2VUB A;  5CR2 A;  5CKD A;  4HKE A;  5CO7 A;  1NE8 A;  5HK0 A;  4MDX A;  4MZP A;  3NFC A;  5CKB A;  2MF2 A;  4MZT A;  5HKC A;  5DLO A;  1UB4 A;  2KMT A;  4ME7 A;  1M1F A;  5CK9 A;  4VUB A;  5CCA A;  5CKF A;  4OF1 A;  3JSC A;  5CKE A;  4ELZ C;  5CKH A;  3HPW A;  5HK3 A;  2C06 A;  1VUB A;  3G7Z A;  4ELY C;  5CQY A;  1X75 C; 
#chains in the Genus database with same CATH topology
 3E2U A;  3PIP A;  1QKX A;  4XTW A;  2P4T A;  3CCS T;  2LJ1 A;  1EFN A;  4XTX A;  1VQ9 T;  3CD6 A;  3NFC A;  1VQL Q;  3CC7 Q;  4IUT A;  3UDC A;  1VIE A;  3AT1 B;  3NPF A;  3JCM e;  3UPU A;  2WAC A;  2D9T A;  4B6M A;  2A36 A;  1SF9 A;  3HFO A;  1U1S A;  1U1T A;  1X2Q A;  2DTO A;  4DEX A;  2EFI A;  2JT4 A;  1PSF A;  2F69 A;  1JO8 A;  3KXT A;  5GMK h;  4JPB W;  2XI9 A;  4JRQ A;  4BDZ A;  3SWN A;  4N0A A;  1G2B A;  5FWC A;  4M78 C;  3E19 A;  3EHR A;  2L3R A;  1Q86 C;  4BUG A;  1HJD A;  1M90 C;  5LJ3 f;  4M75 B;  1YWP A;  2FHD A;  1GFC A;  3QDF A;  4E6R A;  3VS5 A;  4OGE A;  3X20 B;  3DKM A;  3C12 A;  3JRZ A;  2CKK A;  2Z0W A;  2L2P A;  1K73 R;  2ZPF B;  2V8J A;  4D8K A;  4E47 A;  4RG2 A;  4V2S A;  1GCQ C;  2O9S A;  3CCS Q;  2RHY A;  4PKC C;  3MP8 A;  2BZ8 A;  3SB2 A;  2AZS A;  2XDB A;  5KYX A;  3EH1 A;  4KBM B;  2RI5 A;  2RQT A;  3OS1 A;  3TEE A;  4XU3 A;  2VVK A;  1T0J A;  4DBF A;  5LJ3 j;  3EFR A;  4FL6 A;  4J9I A;  4QQ6 A;  3BW1 A;  1VQM A;  2ZPE B;  4J9D A;  5KYY B;  2RK1 A;  3LLR A;  4A4G A;  4C0Z A;  3EG2 A;  2VGM A;  5AYF A;  2D8J A;  3FEO A;  4PJO D;  1RI9 A;  2MF2 A;  1VOM A;  2JJ9 A;  3I35 A;  1UB4 A;  4AG1 C;  1Y0M A;  3M0U A;  1A0N B;  4DA4 A;  1PRM C;  3I9Q A;  3OYF A;  4ZGD B;  3L2W A;  3LWI A;  2XU8 A;  4RUG A;  3MP6 A;  4PJO E;  1TH7 A;  1YP5 A;  3J80 E;  2RO0 A;  1KD1 R;  4M77 D;  2CH4 W;  3O8V A;  5GJW B;  2KGT A;  1UHC A;  3JB9 J;  4EMK C;  4DEY A;  1YWO A;  2GTJ A;  5KYN A;  2F1L A;  1PHT A;  2LP5 A;  4F04 B;  2EKH A;  1SEM A;  1T3L A;  1EZZ B;  2DL5 A;  2E3I A;  1G3W A;  2M51 A;  5DLQ E;  1ZUU A;  3PTA A;  1YHQ Q;  2EIF A;  2VUB A;  3LX7 A;  5CKD A;  1BIB A;  1YCY A;  3OMC A;  1OPK A;  4C92 E;  4M7A G;  1N5Z A;  3MO8 A;  1BK2 A;  1QKW A;  2CSQ A;  1UHF A;  2F5K A;  2DMO A;  3CPW S;  2RHU A;  4RTU A;  4C8Q F;  4ZGE B;  1M3C A;  2WSC E;  3CC2 A;  4M75 G;  3CME Q;  3O5Z A;  2X3W D;  4CI0 C;  4MMK A;  2KXD A;  5GAM h;  2HL5 C;  2LNH B;  1V76 A;  2KT1 A;  3OYY A;  2VC8 A;  1MMA A;  5D6W A;  3HTR A;  4O6J A;  1M1F A;  3SHW A;  2JVV A;  3A8O B;  2FPE A;  3QYH B;  2CH4 A;  1NBE B;  3H0H A;  2LTO A;  2QGF B;  4EMK A;  4C92 D;  2OTL T;  1WA7 A;  1K8A U;  1YN8 A;  1D1A A;  1ARK A;  2DJZ A;  2E5K A;  3OY9 A;  1WX6 A;  3SD4 A;  1AZG B;  1N27 A;  2K79 A;  4OB2 B;  5IXB A;  1VQL A;  3CPW P;  2OTJ T;  2DIG A;  1Y57 A;  2YHT A;  3NTH A;  1VQ9 A;  4FT4 A;  1K8A R;  2K2V A;  4E7J A;  3CCS A;  2PVO B;  3A8H B;  2KRM A;  4KGZ B;  4HVU A;  3NGP A;  4OML A;  4AFS C;  5FLX E;  1K9M R;  2EQM A;  3MPU B;  3QBY A;  3S3O A;  1U5S A;  1JJ2 P;  2CP6 A;  4B9X A;  2W10 A;  4C5E A;  2D0N A;  4E7K A;  4RTV A;  3CQT A;  1JQQ A;  5CKF A;  1ZHI A;  4FYX B;  2A28 A;  3A8G B;  1Q7Y R;  1WYX A;  1GL5 A;  4FSX A;  4OMQ A;  4LE9 A;  1O75 A;  2DXB A;  1PD0 A;  8ATC B;  4F7U G;  3M4G A;  1VYU A;  5D6X A;  2NYS A;  4B9W A;  3L42 A;  3SWN C;  3KFV A;  3OYC A;  1VQM Q;  2KRO A;  1RAC B;  1X43 A;  3SDZ A;  3M57 A;  3JCM V;  4OB0 B;  4CC7 A;  5L23 A;  5J26 A;  3VS7 A;  1K9M C;  3M55 A;  1M90 R;  2K3Y A;  3H0I A;  3QHS A;  3HKS A;  5C6S A;  3GNF B;  2LJ3 A;  1VQ8 T;  2M0O A;  4RCC A;  1NYG A;  1R0C B;  2O01 E;  4JZ4 A;  5LJ3 g;  4PL6 A;  4BY6 B;  4JJD A;  1ZSZ C;  2VYT A;  2P84 A;  1FMW A;  4FYW B;  1JB0 E;  5LJ5 f;  1SRM A;  4M77 E;  1AWW A;  2RD1 A;  3I56 T;  1WHG A;  4J6X A;  5IN1 A;  5GAN g;  4HCC A;  4AFZ C;  1NLP C;  1IHV A;  1TU0 B;  3R6O A;  2CP3 A;  2RA2 A;  1NLO C;  1UGR B;  1FWZ A;  3C95 A;  1D0Y A;  5KYY A;  2X9H A;  2MWO A;  2A0F B;  2EBP A;  3JB9 F;  1OI1 A;  5GJV B;  1NG2 A;  2M16 A;  3X24 B;  1DJ7 B;  1Q81 R;  2DJQ A;  2KRS A;  2CP0 A;  2DO3 A;  5FW9 A;  3M0T A;  2GTO A;  4FW1 A;  2XK0 A;  3ULR B;  4C92 B;  2VKN A;  4M7A E;  2J05 A;  3CC4 Q;  4C92 G;  1QQJ A;  2EJ9 A;  4JRK A;  4PK4 A;  3RMS A;  2LMJ A;  2HD0 A;  2X4X A;  4JLG A;  4FW2 A;  1OX8 A;  2E1H A;  1QVG S;  5KYX B;  3WVD B;  1I4K 1;  1AT1 B;  1UFF A;  3QWY A;  3OYL A;  2NWM A;  1KSW A;  2DBK A;  2DE0 X;  1X6B A;  3OYJ A;  1N8R R;  2R5M A;  1WJR A;  1NE8 A;  1BCM A;  3GIB A;  1B7T A;  3CCL Q;  4EDU A;  5FRN A;  2RJE A;  4KH1 B;  1M3A A;  5D7U A;  1M1G A;  3Q1J A;  2KYB A;  4ZGJ B;  4ELZ C;  4M78 G;  3ASK A;  2J7I A;  4D6W A;  2QDL A;  2ZGW A;  1YIJ A;  1Q82 C;  3G6E Q;  1IRX A;  4A4F A;  4PNO A;  4KGV B;  5HCK A;  1OUL A;  4MZM A;  2COZ A;  2CZ7 B;  1MMG A;  3CC2 Q;  2ROL A;  2PQW A;  1QP3 A;  3CD6 T;  4QVC A;  2COW A;  1RAD B;  1ABQ A;  3LWH A;  1R77 A;  3WVE B;  3CBO A;  3N5B B;  4M7A D;  3EAE A;  2DL7 A;  1J3T A;  4IIM A;  1W70 A;  1G3T A;  4O5V A;  2EWN A;  5FWB A;  2QA4 T;  2XHC A;  5A0G A;  4XTZ A;  3HSB A;  1PC0 A;  2V1R A;  2HKQ B;  3A1P A;  2QI2 A;  2V8I A;  2DL3 A;  1IZ6 A;  1K76 A;  3HHT B;  4M78 B;  1NJI U;  2HBW A;  5CAI A;  1FX7 A;  3TRE A;  3JCM X;  6AT1 B;  1YFN A;  1Z9Z A;  3PMI A;  1I1J A;  5GAN f;  4E7I A;  2LQK A;  4NS5 A;  1QWE A;  3L2Q A;  1TOV A;  4JRP A;  5CQY A;  1VQ9 Q;  2J06 A;  5GAO p;  2KYM A;  1G5V A;  5KE2 A;  1O9S A;  2HZY A;  5LJ5 h;  3U23 A;  1YJN T;  3CCQ A;  2SEM A;  5CCA A;  2JW4 A;  3MEU A;  1CKA A;  4C8Q B;  3VRY A;  2RI3 A;  4PJO G;  2DX1 A;  2K57 A;  2RJF A;  1MGQ A;  4FU6 A;  1ZBX A;  4JS5 A;  4C5G A;  2DBM A;  3I56 Q;  2AIR B;  2RF0 A;  2RK2 A;  5FU6 B;  2ZPG B;  3V8K A;  3H8Z A;  2MMP A;  3RER A;  3FJP A;  2YSQ A;  1RAA B;  2L8D A;  1UJ0 A;  1AOJ A;  1QLY A;  2E70 A;  2EYZ A;  1MV3 A;  5GAN j;  1YJN Q;  4PJJ A;  2E3H A;  1VQ8 Q;  3INZ A;  5ECA A;  2KK4 A;  2VWF A;  1SKU B;  3PVQ A;  3PMT A;  4EMH A;  4M77 G;  1VQ5 A;  4HKE A;  2FRW A;  2ABL A;  2CSI A;  5GMK i;  2MI6 A;  1XQH A;  2GFU A;  3R6N A;  4WTO B;  4M7A C;  4M7D B;  1WJS A;  3C0C A;  1KQ1 A;  1KQS A;  2E65 A;  3LW5 E;  1R0B G;  2QEX A;  4Q5W A;  2DER A;  2DD4 A;  1UTI A;  2HSE B;  2RH2 A;  2P0Q A;  1HK9 A;  2YWW A;  1VQ4 T;  5I22 A;  3FB9 A;  2RMO A;  3TVT A;  4KUL A;  4PJN A;  3V7S A;  5C0M A;  2ZPB B;  3M59 A;  4PFZ A;  5GAM e;  2PU9 B;  1CKB A;  1D3B A;  2K9G A;  3QJY A;  1NJI R;  4HVV A;  3JB9 I;  2LCS A;  3CCJ T;  3CCR Q;  4M7A B;  4M7D C;  1OOT A;  5GAN 4;  3JCM d;  1VUB A;  4Z89 A;  5EG2 A;  4A4H A;  4RCB A;  2JZ2 A;  1M30 A;  4R56 A;  1JRI A;  2CP7 A;  4JJC A;  1G3S A;  4BDY A;  2PNI A;  3UT1 A;  3CCL T;  3C4S A;  1S1N A;  3CC4 A;  1W1F A;  1T3S A;  4M78 D;  1H8K A;  5CVI A;  3PFS A;  1U06 A;  2YLB A;  3G1J A;  4FM4 B;  1E6G A;  4YTL A;  2P0P A;  3HPW A;  4K11 A;  1VYT A;  2FL7 A;  3EFO B;  3QXE B;  4ZNX A;  1NEB A;  4RG8 A;  1IGU A;  4TVR A;  1TUC A;  4PJL A;  3CC7 T;  5HKC A;  1X2K A;  2FRY A;  2LNV A;  3P8B B;  2F5T X;  4XQ3 A;  3CXC S;  1ZLM A;  4J9H A;  3M9Q A;  2VB6 A;  4IUV A;  4M75 A;  1LJO A;  1SPK A;  1YIJ Q;  1AWJ A;  1RAF B;  3CEY A;  3G6E A;  4XU2 A;  2GCX A;  1X27 A;  1KC8 C;  4J6Y A;  2LRQ A;  1WQ7 A;  3CBM A;  1GRI A;  1OZ3 A;  4QT7 A;  4BD3 A;  2JTE A;  1I5O B;  5DY9 A;  5IHK A;  2YRC A;  3DLM A;  3CCR T;  1SG5 A;  4C92 A;  1NZ9 A;  2O31 A;  4RTX A;  3RNJ A;  1ZQ1 A;  4OMP A;  1H3Z A;  1KHI A;  4M75 E;  4DBQ A;  2E64 A;  4HCZ A;  1W4S A;  1MMN A;  3E9F A;  1C1A A;  1WPY A;  2KEA A;  3A8L B;  2ENM A;  1MNE A;  2L0A A;  2EAY A;  1OYX A;  1JXO A;  3KBG A;  2O4X B;  3M53 A;  4FYV B;  4F7U F;  2NUP B;  1U3O A;  3OS5 A;  4F16 A;  4DBR A;  2EQK A;  1KD1 C;  1MMD A;  3QDR B;  3SWN B;  4HT8 A;  2PVG B;  4BI3 A;  1Q95 G;  3JB9 H;  3OYM A;  1Q82 R;  1JBM A;  2JNG A;  3M0S A;  4NOY A;  2D8H A;  3L2V A;  1UJY A;  3QPH A;  1RAE B;  3EGX A;  4M77 A;  4OGC A;  4AG2 C;  3CCQ Q;  2JTM A;  5LJ5 d;  2QAS A;  2WSE E;  1VQN Q;  2E10 A;  2K4Y A;  1C0M A;  4M7D G;  1WHJ A;  1TXQ A;  2ED1 A;  4ORZ A;  5GAN 7;  1WJQ A;  4BI8 B;  2J6K A;  2MCN A;  4FCY A;  3JB9 G;  1LOJ A;  2YUN A;  3VV0 A;  1UGS B;  2DM1 A;  2KBT A;  2QDY B;  4C92 C;  1TG0 A;  3JCM g;  1NM7 A;  5L8R E;  3CCU A;  2JN0 A;  5CKE A;  2QTV A;  3DB3 A;  1Z9Q A;  2LC4 A;  4MML A;  2ESW A;  2K5L A;  2PUK B;  4ELY C;  1YJN A;  2AK5 A;  2RHI A;  1M1K R;  1H3H A;  1FXX A;  2QTX A;  1B34 B;  2YRD A;  3M54 A;  3JCM W;  1YJ9 T;  3L2U A;  2G3R A;  1VQO A;  2K2M A;  3VS1 A;  3CCE A;  3H6Z A;  4ZN1 A;  5GAN h;  1KK7 A;  1OU8 A;  2LCC A;  3RR6 A;  2DEU A;  2LX9 A;  2FZG B;  1JEG A;  1HXD A;  3OBY A;  3M4Y A;  4AFQ C;  2JS0 A;  3A5Z B;  3RMQ A;  1QVG P;  4IUU A;  2CZ0 B;  5GAN 8;  1VQP A;  2HQX A;  4HVW A;  4M7A F;  1D09 B;  3OSS C;  4DOW A;  1VQ6 A;  1K0S A;  2FEI A;  4VUB A;  1M8M A;  1CSK A;  4C8Q C;  2GNC A;  1WHH A;  4M75 C;  2L3P A;  2A37 A;  2YUQ A;  4LDY A;  1VQN T;  1PWT A;  4L5G A;  4KUD K;  4PJO B;  4R0K A;  4ESR A;  4N4H A;  1YJ9 A;  2PUO B;  1YNZ A;  3UA7 A;  1SHF A;  1BKB A;  1BU1 A;  2CYZ B;  2JM8 A;  1QCN A;  3QII A;  3EG9 B;  2DF6 A;  1KJW A;  4MDW A;  1AWX A;  2JS2 A;  4N0A C;  3QG1 A;  4M78 A;  2R5A A;  2DD5 A;  4QQG A;  2EYQ A;  3RUX A;  5CQX A;  3ER0 A;  4IIO A;  3L2R A;  7AT1 B;  4IUR A;  2DXT A;  3GNG A;  2EQU A;  3A8M B;  1QVF P;  4JS4 A;  4BE2 A;  1TS9 A;  3EGX B;  1RI0 A;  4OP0 A;  3UWN A;  3OYK A;  2ED0 A;  1I5L A;  1I07 A;  1IRE B;  1X75 C;  1M5Q 1;  4A54 A;  4AT1 B;  4QVD A;  2LQN A;  4M78 E;  5HK0 A;  5GAN d;  1HSQ A;  2L89 A;  2DRM A;  3LYI A;  3H0F A;  2QQR A;  4A4E A;  2AZV A;  3UF4 A;  2QA4 A;  3HFN A;  2FG0 A;  3GBQ A;  4PJO A;  1BI2 A;  1IB8 A;  3M0P A;  2O4X A;  3UA6 A;  2ZAE A;  2QQ9 A;  3FDR A;  5GMK e;  3S3N A;  1OQK A;  3HP9 A;  1VQN A;  1VIF A;  1Y71 A;  2QG9 B;  2DA9 A;  1UG1 A;  4KRT A;  3OYE A;  4LXC A;  4PLI A;  2KE9 A;  2OTJ A;  1PD1 A;  5DM7 R;  5CIU A;  5FRM A;  1PKS A;  2EGC A;  2I0N A;  1Q81 C;  1N9S A;  2C0I A;  5KYW A;  3BDU A;  4XU0 A;  2LT1 A;  2VV5 A;  4DQ2 A;  1K8A C;  1VQK A;  1B07 A;  4LDW A;  1EX4 A;  3CMA Q;  1K4U S;  4OMO A;  2RJC A;  1XTD A;  3JSC A;  4J9G A;  2J6O A;  1NPP A;  1E7O A;  1ZSG A;  3V8L A;  1KC8 R;  1P92 A;  1TUG B;  3CCE Q;  4C8Q G;  3RIR A;  4LDU A;  2DAQ A;  2BUD A;  4ZTJ A;  1VQ7 Q;  2DL8 A;  2QQB A;  3HRS A;  4D8D A;  1Q7Y C;  3CMA T;  2RHX A;  4FSS A;  2Y90 A;  3CCU T;  3VS3 A;  2DL4 A;  3WXM B;  1BYM A;  4RTZ A;  3CBP A;  2LCL A;  3JAM E;  2YDL A;  5LJ5 e;  2LZ6 B;  1YHQ A;  2O2O A;  3OS2 A;  4LUD A;  4ANJ A;  1M1K C;  2P4R A;  1WHK A;  2X3X D;  2D1X A;  3BDL A;  3CCL A;  2MWP A;  1T0H A;  1X01 A;  3EGD A;  3GOX A;  1YJ9 Q;  1X6O A;  4E7Z A;  1KD1 U;  5IH2 A;  3OYB A;  3CD6 Q;  1IGQ A;  5KYU A;  2B86 A;  3CC7 A;  4OF1 A;  2GQV A;  4Y92 A;  2F2W A;  3REB B;  2J6F A;  1QWF A;  1K73 U;  2DNU A;  2YXY A;  2XD0 A;  1LPL A;  3TQ7 P;  4J7I A;  4DOV A;  4PLL A;  2CDT A;  5GAM j;  4C8Q E;  1I81 A;  5KYW B;  1C6V X;  2X35 A;  1D1B A;  3NTK A;  3BY7 A;  1VQP Q;  1AWO A;  3MEW A;  5GAN 2;  4KUI A;  1M90 U;  1B3Q A;  1V29 B;  2FZC B;  1VQ6 Q;  2IG0 A;  1K9A A;  2OAW A;  2AT1 B;  3I55 A;  2PVD B;  4C0F A;  3BFM A;  1UEB A;  2HAX A;  3P8D A;  2AKK A;  2BKD N;  5LL6 S;  2CP2 A;  2CZ6 B;  3TSW A;  3JCM c;  4BI4 A;  2YLC A;  1VYV A;  2LX7 A;  2XID A;  1WZO A;  1OV3 A;  2QXF A;  5GAN 5;  4II1 A;  1WHL A;  2QQA A;  2ZZD A;  1XNI A;  2X4Y A;  1WIE A;  2Y4Y A;  3VJP A;  1GBQ A;  2QAZ A;  2L3Q A;  3CCV Q;  4JLI A;  4AMC A;  3MEV A;  4LUE A;  1UUE A;  3VS6 A;  1BBZ A;  3TCJ A;  1E6H A;  1YHQ T;  2JM9 A;  3CPF A;  3OYD A;  3V8J A;  2JOY A;  2EVR A;  2MK5 A;  4M77 B;  1GCQ A;  2RM4 A;  5GAN 3;  5KCH A;  2JTF A;  2HQH A;  1WXB A;  1RAI B;  2DVJ A;  2RPN A;  2BZY A;  3CCJ A;  1VQ5 T;  2VGN A;  2E6N A;  2QGG A;  3VS0 A;  5CO7 A;  1H64 1;  3KUF A;  4A53 A;  4HA8 A;  3VUZ A;  2KMT A;  1YIT Q;  3I55 T;  1M9S A;  1GXI E;  1BI3 A;  1VQK T;  2QEX T;  1ZSZ A;  3D7S B;  1TWB A;  3T9N A;  1K9M U;  4OB3 B;  4JUV A;  1SHG A;  4HCK A;  3RBB B;  5I11 A;  2HEQ A;  3J7A F;  4C5H A;  8AT1 B;  2FVU A;  5I2M A;  4EMG A;  2DET A;  4XTV A;  2DKG A;  4LD9 K;  4J6W A;  1N9R A;  1WXT A;  2HSP A;  4X34 A;  5J39 A;  1IHW A;  3H41 A;  4C0G A;  4QQD A;  1VQ7 A;  1ACM B;  1NYF A;  1VQM T;  1Q86 U;  2QEX Q;  2IVW A;  2OTJ Q;  2X4J A;  4L6V 5;  3EGD B;  2D0Q B;  1PCX A;  4X9C A;  2K3X A;  3OW2 S;  4EMK B;  2R57 A;  2GQI A;  3PGG A;  3JCM b;  4F14 A;  4M77 C;  3MP1 A;  2DK3 A;  4XU1 A;  5CR2 A;  2MOX A;  4RKU E;  1M2V B;  3HL8 A;  4UC4 A;  3C94 A;  5J3B A;  1VQK Q;  4F7U E;  1NJI C;  1OZ2 A;  3DB4 A;  1N8R C;  5LJ5 j;  1D0X A;  3QJ6 A;  2LJ0 A;  5I21 A;  3CCQ T;  2CZ1 B;  4Z88 A;  2V26 A;  4M7D A;  2YT6 A;  5FU7 B;  2PZ1 A;  3PNW C;  2RQW A;  2DLP A;  4JJB A;  3A98 A;  1W2B S;  3CME A;  4RTW A;  4M75 D;  2KRN A;  1QVP A;  5I2S A;  3CCE T;  1ZA1 B;  3PE0 A;  1OU9 A;  3CPW A;  5LJ3 h;  3G4S T;  3PT9 A;  3QSU A;  2CP5 A;  2HCK A;  5HK3 A;  2QYZ A;  3FIF A;  1UDL A;  2SRC A;  4R55 A;  1LNX A;  2EKO A;  3JV3 A;  4JJN K;  1WFW A;  1JJ2 S;  3I55 Q;  5GAO q;  4BE0 A;  3G71 A;  2XDP A;  2K5I A;  2BE7 D;  3J81 E;  5KCO A;  4EPC A;  1KQS P;  1F1B B;  4C8Q A;  2LQ8 A;  3EG9 A;  4J9C A;  4J9E A;  4BE1 A;  1ZA2 B;  4M7D E;  4E7S A;  3S6W A;  1YJW T;  2EGE A;  3CCV A;  5HY6 A;  2OI3 A;  5GAO r;  4OMN A;  1BI1 A;  1JJ2 A;  1MUZ A;  3NMZ C;  4J9B A;  1ZUY A;  2EYW A;  5GMK l;  1VQ6 T;  1YIJ T;  3JCM Q;  1ZUK A;  3QO3 A;  4Z8A A;  2EJF A;  5M9O A;  1QVF S;  4WF2 A;  3I5R A;  2COY A;  2YUO A;  3JCM P;  4E7L A;  2RQU A;  1ZBJ A;  1Y96 A;  3GF5 A;  2KT8 A;  1UGV A;  4MDX A;  4L59 A;  2M0Y A;  1KFZ A;  1Y96 B;  2DXC A;  4OVA A;  4C92 F;  2HBP A;  1M1K U;  1G3Y A;  5GMK m;  4AFU C;  2DTI A;  1S72 Q;  2E4H A;  4E7H A;  2V1Q A;  2IPO B;  1PRL C;  2OX7 A;  2A7Y A;  2KSS A;  2MPX C;  2NLU A;  3E1S A;  5LJ3 d;  3OA6 A;  2V8K A;  3OQ5 A;  2ECZ A;  1K73 C;  3ZL7 C;  2GFA A;  2ZPI B;  1M2V A;  4N4G A;  1FMK A;  3QZ9 B;  2KXC A;  2RNA A;  4GLM A;  3G71 T;  1KG1 A;  2JMA A;  3PVL A;  3G6E T;  1M27 C;  1Y07 A;  4Y91 A;  3P8H A;  3CCJ Q;  2NUT B;  2A3L A;  2EQI A;  1HYO A;  2JMC A;  2LDM A;  3S3M A;  1NPR A;  2QQS A;  3G4S A;  2E41 A;  3CCU Q;  2DVE A;  1RLQ C;  3OBW A;  2F2V A;  5GAO l;  1WQW A;  5GAO n;  3CME T;  2M1H A;  2CGH A;  1VQ5 Q;  3M58 A;  4KGX B;  4KH0 B;  4M78 F;  1M2O A;  4PFO A;  4X1V A;  2XMF A;  1BCO A;  1GCP A;  1YCS B;  2LT4 A;  4QW2 A;  3IQL A;  1UGP B;  1RUW A;  2OAU A;  2BTT A;  3OSV A;  3RKX A;  1M3B A;  2BIV A;  3CCV T;  3ZFJ A;  2A08 A;  1VQO T;  2K7A A;  1WDX A;  1PM3 A;  3VYG A;  4ATO A;  1FYN A;  1YBY A;  4GLK A;  2HMA A;  4RTT A;  3CCR A;  1QVF A;  5AT1 B;  1R8O B;  3E9G A;  4MZT A;  2RJD A;  2Y4X A;  2KQW A;  3G71 Q;  3OB9 A;  1QP2 A;  3HRU A;  1U8R A;  2L5Q A;  3RDV A;  1PSE A;  4NL3 A;  3X28 B;  3JB9 D;  4GBQ A;  4XAX B;  1OEB A;  1D0Z A;  3OS0 A;  2AHJ B;  3SFM A;  3MKD A;  4M7D D;  1WI7 A;  2BZX A;  3QZ5 B;  1PNJ A;  1QMC A;  5CKB A;  4JRI A;  3H9N A;  2DIQ A;  2O88 A;  2R58 A;  3TU4 K;  4FT2 A;  4A63 B;  2W0Z A;  5IXF A;  2G6F X;  2M9U A;  4C0D B;  1RL2 A;  1IO6 A;  4FYY B;  1WXU A;  3EG3 A;  2RQR A;  5FU6 C;  1VQ7 T;  5IT9 E;  3RKY A;  3URG A;  1QVG A;  3CCM T;  3M0Q A;  4J9F A;  4ZN3 A;  3FJ5 A;  4XTU A;  4HCB A;  3JCM h;  4ME7 A;  3DLL A;  5A0D A;  4J7F A;  5KH6 A;  4ZTF A;  4QKU A;  5IHI A;  1X69 A;  2RB6 A;  3EH2 A;  4PJO F;  1AHJ B;  2KNB B;  1S72 A;  2OJ2 A;  2X4W A;  4C8Q D;  2KDS A;  4LDV A;  1K1Z A;  1N8R U;  2QA4 Q;  1JXM A;  1KC8 U;  2MYS A;  1NEG A;  1I0C A;  1ABO A;  1KHC A;  2IIM A;  1RAG B;  1TTH B;  4XTY A;  3CC2 T;  1XOV A;  4IUQ A;  4P5N A;  3X26 B;  1MND A;  4M75 F;  3SEM A;  1TUD A;  4DBH A;  4PFP A;  3THK A;  1S72 T;  2VXF A;  2YUP A;  1SSF A;  1AVZ C;  5KYU B;  2FB7 A;  2E12 A;  2MAM A;  2X51 A;  1W6X A;  2DYI A;  2KI7 A;  3F70 A;  4LN2 A;  1X6G A;  2E6Z A;  2VXE A;  3JCM f;  3G4S Q;  2L3S A;  4CC4 B;  3CCM A;  2OTL Q;  1AZE A;  2NUP A;  3EGU A;  2PTK A;  3MEA A;  2LVM A;  1B34 A;  2C0T A;  1YI2 Q;  2CRE A;  3GP8 A;  2ROT A;  1QCO A;  2RN8 A;  3CMA A;  1WNL A;  4LDX A;  4WCI A;  3VYH B;  2EJG A;  2XG8 D;  3I5S A;  5CK9 A;  2H3E B;  3OYA A;  4M77 F;  1JU5 C;  1YJW Q;  4NL2 A;  5LJ3 e;  2FPD A;  5CKH A;  2NUZ A;  1AD5 A;  2DXU A;  2HQE A;  3OW2 P;  1LCK A;  4RMO A;  3CC4 T;  4CC3 A;  1GFD A;  4J8O A;  2CUD A;  3NHN A;  3ZEH A;  2EPD A;  5A0L A;  4EIK A;  4M7A A;  1M4Z A;  4LNP A;  3V7R A;  5FU7 C;  1UE9 A;  2DZ9 A;  2DRK A;  3BE3 A;  3VS4 A;  3QYG B;  2KVQ G;  1TSF A;  3OYI A;  1RAH B;  1D3B B;  1RLP C;  2M02 A;  3LH0 A;  4N4I A;  2KAF A;  2QK0 A;  4OMM A;  2B8A A;  2DYB A;  3G7Z A;  4JDS A;  3OYH A;  3V7C A;  1Y7X A;  2EGA A;  1BIA A;  3REA B;  2ZCF B;  1OPL A;  1VQO Q;  5GAM d;  1QCF A;  4J5Y A;  4F7U B;  5EC7 A;  3HRT A;  5GAM g;  2JXB A;  4FIB A;  2JUF A;  1VQ4 A;  3NTI A;  1Q86 R;  3CXC P;  3M56 A;  2DTH A;  1PG5 B;  3FC3 A;  1VA7 A;  4E2F B;  1UGQ B;  1LVK A;  1SRL A;  3MJX A;  1IXD A;  1KQ2 A;  1V1C A;  1K0X A;  1WHM A;  1WLP B;  1WGS A;  2DPP B;  2VAS A;  4OMF B;  4Z02 A;  3OYN A;  3EHQ A;  1W2B A;  3X25 B;  1MV0 B;  4XK8 E;  2XDD A;  4BAC A;  4C5I A;  4J83 A;  1SSH A;  1EIF A;  1Q81 U;  2KY9 A;  1KQS S;  3L2Z A;  2NUT A;  1QW1 A;  3L1A A;  4RTY A;  2RHZ A;  2RI2 A;  3FLG A;  2C0O A;  2FO0 A;  4JZ3 A;  3MCA B;  2RQV A;  1HD3 A;  2HL3 A;  1BI0 A;  1ZSZ B;  1Q82 U;  3CXC A;  4CRI A;  1RAB B;  2F2X A;  2GBQ A;  2GGR A;  3OMG A;  2HKN A;  5A2Q E;  4BB7 A;  2CT3 A;  2C06 A;  2I2L A;  4IKF A;  3VS2 A;  3UAT A;  4F7U A;  1PKT A;  3EFS A;  3VUB A;  3ME9 A;  5IAY A;  3EFO A;  4X9D A;  3PIO A;  3VRZ A;  5DLO A;  3AHU A;  3ZBD A;  9ATC B;  5GAN 6;  2K3B A;  2ZPH B;  3RES A;  5IHN A;  2WSF E;  2YRV A;  3MHX A;  3M5A A;  5FRO A;  4PJO C;  1KIK A;  1W2B P;  4LD6 A;  3OYG A;  2DIL A;  3OW2 A;  3M0R A;  1YIT A;  2DEQ A;  3JCM J;  1YI2 A;  2EYY A;  2EYX A;  5LJ5 g;  2FZK B;  2BE9 B;  2MIO A;  2K5F A;  3QWX X;  1YJW A;  5GMK j;  3QKJ A;  1G8X A;  2CS7 A;  4GY5 A;  4QVZ A;  2EQJ A;  3I56 A;  3EG0 A;  1OX9 A;  4HT9 A;  1FMV A;  5GAM f;  5KE3 A;  2O9V A;  2FPF A;  1VQL T;  2FYK A;  4M4Z A;  2GF7 A;  4OB1 B;  4IUP A;  3TSZ A;  2LQW A;  1YIT T;  2CT4 A;  1N6A A;  1BB9 A;  4KT0 E;  3GLX A;  3CCM Q;  2OTL A;  2HNI A;  1VQ8 A;  4BY6 C;  3MET A;  2K6D A;  2H8H A;  2H3J A;  5GAO m;  3LGF A;  1ZX6 A;  1I8F A;  1D1C A;  3VKI A;  3GPL A;  3FRN A;  2HDA A;  3LH5 A;  1XJW B;  2XKO C;  4F17 A;  1M8V A;  2EW3 A;  2D6F A;  1AEY A;  4Y28 E;  2P0K A;  4A4K A;  1GBR A;  2CUB A;  1VQ4 Q;  1G83 A;  3EG1 A;  4M7D F;  2DZC A;  3LGL A;  3RKW A;  1YI2 T;  1H92 A;  4PJM A;  2ATC B;  1VQP T;  3VU3 C;  1Q7Y U;  4MZP A;  5D6Y A;  1UEC A;  4C0D C;  4CC2 A;  2DFU A;  2AKL A;  3QUI A;  4HXJ A;  2E5Q A;  5GAN e;  1MHN A;  2XIC A;  2KR3 A; 
#chains in the Genus database with same CATH homology
 3PIP A;  2XHC A;  4XTW A;  3FDR A;  2P4T A;  4M78 F;  5GMK e;  5A0G A;  3CCS T;  3S3N A;  3HP9 A;  1VQN A;  1VIF A;  1Y71 A;  4XTZ A;  3HSB A;  4XTX A;  1VQ9 T;  3CD6 A;  3OYE A;  3NFC A;  2QI2 A;  2V8I A;  4PLI A;  1IZ6 A;  4M78 B;  3HHT B;  1NJI U;  2OTJ A;  4IUT A;  3UDC A;  5CAI A;  5DM7 R;  1FX7 A;  2LT4 A;  5CIU A;  3TRE A;  3JCM X;  1VIE A;  4QW2 A;  5FRM A;  1UGP B;  3JCM e;  2OAU A;  3PMI A;  3UPU A;  2WAC A;  1Q81 C;  5GAN f;  2D9T A;  3OSV A;  4E7I A;  2LQK A;  3HFO A;  3RKX A;  1U1S A;  1U1T A;  2BIV A;  4NS5 A;  1N9S A;  3L2Q A;  3ZFJ A;  3CCV T;  2DTO A;  4JRP A;  5CQY A;  1VQO T;  3BDU A;  5GAO p;  2EFI A;  1PSF A;  2F69 A;  4XU0 A;  2LT1 A;  3VYG A;  2VV5 A;  4ATO A;  4DQ2 A;  3KXT A;  1YBY A;  4GLK A;  5GMK h;  1K8A C;  5KE2 A;  1VQK A;  1G5V A;  3CCR A;  1QVF A;  1O9S A;  1R8O B;  3E9G A;  2XI9 A;  4LDW A;  2RJD A;  2Y4X A;  4MZT A;  5LJ5 h;  4JRQ A;  4BDZ A;  3SWN A;  2KQW A;  4N0A A;  1YJN T;  2RJC A;  4M78 C;  3CCQ A;  1XTD A;  3E19 A;  5CCA A;  2L3R A;  3MEU A;  3OB9 A;  4BUG A;  1QP2 A;  3HRU A;  3JSC A;  4C8Q B;  1Q86 C;  1M90 C;  2RI3 A;  4PJO G;  1NPP A;  1U8R A;  2K57 A;  2L5Q A;  1PSE A;  2RJF A;  5LJ3 f;  4NL3 A;  3V8L A;  1P92 A;  1MGQ A;  4FU6 A;  4M75 B;  4C8Q G;  2FHD A;  3RIR A;  4LDU A;  2DAQ A;  3X28 B;  3JB9 D;  1ZBX A;  2BUD A;  4JS5 A;  4ZTJ A;  4C5G A;  4OGE A;  3X20 B;  3DKM A;  2RK2 A;  3C12 A;  3V8K A;  5FU6 B;  2QQB A;  2ZPG B;  3HRS A;  3H8Z A;  3JRZ A;  4XAX B;  3OS0 A;  2AHJ B;  2MMP A;  3SFM A;  1Q7Y C;  3CMA T;  2CKK A;  4M7D D;  3QZ5 B;  2RHX A;  3RER A;  3FJP A;  5CKB A;  2ZPF B;  2L8D A;  2Y90 A;  3CCU T;  2V8J A;  4JRI A;  2DIQ A;  3WXM B;  4E47 A;  1BYM A;  2E70 A;  2R58 A;  4RG2 A;  4V2S A;  3TU4 K;  3CBP A;  2LCL A;  3JAM E;  5GAN j;  4FT2 A;  5LJ5 e;  2RHY A;  4PKC C;  3MP8 A;  3OS2 A;  1YHQ A;  2M9U A;  3INZ A;  1M1K C;  4C0D B;  2KK4 A;  1RL2 A;  4EMH A;  3PMT A;  3SB2 A;  3BDL A;  3CCL A;  4M77 G;  1VQ5 A;  5FU6 C;  4HKE A;  1VQ7 T;  2XDB A;  5IT9 E;  3RKY A;  3URG A;  5GMK i;  4KBM B;  1QVG A;  2RI5 A;  3CCM T;  2MI6 A;  1XQH A;  2MWP A;  1X01 A;  2GFU A;  4ZN3 A;  3OS1 A;  3TEE A;  3GOX A;  4XTU A;  4HCB A;  4XU3 A;  4ME7 A;  3JCM h;  1X6O A;  3DLL A;  5A0D A;  1KD1 U;  4J7F A;  4M7A C;  1WJS A;  3OYB A;  4M7D B;  1KQ1 A;  1KQS A;  3CC7 A;  4OF1 A;  5KH6 A;  4ZTF A;  2GQV A;  5LJ3 j;  2E65 A;  3LW5 E;  2QEX A;  3EFR A;  4Q5W A;  4FL6 A;  1K73 U;  2XD0 A;  2DD4 A;  2RH2 A;  2RB6 A;  2P0Q A;  4J7I A;  4QQ6 A;  1HK9 A;  1VQ4 T;  3BW1 A;  1VQM A;  4PJO F;  2ZPE B;  1AHJ B;  1S72 A;  2RK1 A;  4DOV A;  3FB9 A;  4PLL A;  3LLR A;  4A4G A;  4C0Z A;  5GAM j;  2X4W A;  4C8Q E;  2VGM A;  1I81 A;  4KUL A;  5AYF A;  3V7S A;  2KDS A;  3FEO A;  4C8Q D;  5C0M A;  2ZPB B;  4LDV A;  3M59 A;  2X35 A;  1N8R U;  5GAM e;  2PU9 B;  4PJO D;  1KC8 U;  3NTK A;  1D3B A;  2MF2 A;  3BY7 A;  1UB4 A;  1KHC A;  3QJY A;  3MEW A;  4XTY A;  5GAN 2;  4DA4 A;  3CC2 T;  1XOV A;  4IUQ A;  4KUI A;  4P5N A;  3JB9 I;  1M90 U;  3X26 B;  1V29 B;  3CCJ T;  4M75 F;  3OYF A;  4M7A B;  4ZGD B;  4M7D C;  3L2W A;  5GAN 4;  3LWI A;  2IG0 A;  2XU8 A;  3JCM d;  3MP6 A;  4PJO E;  1VUB A;  3I55 A;  5EG2 A;  1TH7 A;  2PVD B;  4A4H A;  4C0F A;  3BFM A;  3J80 E;  1S72 T;  2VXF A;  1UEB A;  2RO0 A;  4RCB A;  2HAX A;  4M77 D;  3P8D A;  3O8V A;  1SSF A;  2BKD N;  2JZ2 A;  4R56 A;  1JRI A;  5LL6 S;  3JB9 J;  2CZ6 B;  1G3S A;  2FB7 A;  4EMK C;  2E12 A;  3JCM c;  4BI4 A;  2YLC A;  4BDY A;  3UT1 A;  3CCL T;  2MAM A;  3C4S A;  3CC4 A;  2XID A;  4M78 D;  2QXF A;  3F70 A;  5CVI A;  5GAN 5;  3PFS A;  2E6Z A;  2VXE A;  4II1 A;  2QQA A;  2YLB A;  2ZZD A;  1XNI A;  3JCM f;  3CCM A;  2X4Y A;  2Y4Y A;  4FM4 B;  3VJP A;  4YTL A;  1G3W A;  2P0P A;  3HPW A;  4JLI A;  3MEV A;  5DLQ E;  3MEA A;  2LVM A;  3PTA A;  2FL7 A;  1B34 A;  3GP8 A;  3QXE B;  3TCJ A;  2EIF A;  2VUB A;  3LX7 A;  5CKD A;  4RG8 A;  1BIB A;  3CMA A;  3CPF A;  1YHQ T;  1YCY A;  3OMC A;  3OYD A;  4TVR A;  3V8J A;  4C92 E;  2JOY A;  1WNL A;  4M77 B;  3CC7 T;  4M7A G;  4LDX A;  3VYH B;  5HKC A;  2RM4 A;  3MO8 A;  2EJG A;  5GAN 3;  5KCH A;  2JTF A;  2LNV A;  2XG8 D;  3P8B B;  5CK9 A;  3OYA A;  2F5K A;  4M77 F;  2F5T X;  4XQ3 A;  3CXC S;  3CPW S;  2RHU A;  4NL2 A;  5LJ3 e;  5CKH A;  4C8Q F;  4ZGE B;  3CCJ A;  1VQ5 T;  2VGN A;  3M9Q A;  2DXU A;  2E6N A;  2WSC E;  4IUV A;  2HQE A;  4M75 G;  3CC2 A;  4M75 A;  1LJO A;  4CI0 C;  4MMK A;  4RMO A;  3CC4 T;  5GAM h;  3CEY A;  3G6E A;  4XU2 A;  4J8O A;  2GCX A;  3OYY A;  2VC8 A;  3ZEH A;  5CO7 A;  1H64 1;  3KUF A;  1KC8 C;  4J6Y A;  5D6W A;  5A0L A;  2LRQ A;  4M7A A;  4A53 A;  1M4Z A;  4HA8 A;  3VUZ A;  1WQ7 A;  3CBM A;  3V7R A;  1OZ3 A;  2KMT A;  5FU7 C;  2DZ9 A;  1M1F A;  4O6J A;  4BD3 A;  2JVV A;  3A8O B;  3QYG B;  2KVQ G;  5DY9 A;  3OYI A;  1M9S A;  3I55 T;  3DLM A;  3QYH B;  1GXI E;  1BI3 A;  3CCR T;  1D3B B;  1VQK T;  4C92 A;  2QEX T;  1NZ9 A;  3LH0 A;  4N4I A;  3T9N A;  1K9M U;  2LTO A;  2KAF A;  1ZQ1 A;  1H3Z A;  4OB3 B;  4JUV A;  2B8A A;  3G7Z A;  4JDS A;  1KHI A;  4EMK A;  3OYH A;  3V7C A;  1Y7X A;  3J7A F;  4C5H A;  4M75 E;  4C92 D;  2FVU A;  5I2M A;  1BIA A;  4EMG A;  4XTV A;  2DKG A;  2E64 A;  2ZCF B;  4J6W A;  4HCZ A;  1W4S A;  1N9R A;  4X34 A;  2OTL T;  5J39 A;  4LD9 K;  4C0G A;  1K8A U;  3E9F A;  5GAM d;  2DJZ A;  4QQD A;  1VQ7 A;  3OY9 A;  1WPY A;  4J5Y A;  4F7U B;  3HRT A;  3SD4 A;  3A8L B;  5GAM g;  1N27 A;  4FIB A;  4OB2 B;  2JUF A;  1VQM T;  1VQ4 A;  3NTI A;  1Q86 U;  1VQL A;  2EAY A;  1OYX A;  2IVW A;  2OTJ T;  3M56 A;  2X4J A;  2DIG A;  2DTH A;  2O4X B;  2YHT A;  3KBG A;  3M53 A;  4L6V 5;  3NTH A;  2D0Q B;  4X9C A;  4F7U F;  2K3X A;  3OS5 A;  3OW2 S;  4EMK B;  1VQ9 A;  4FT4 A;  3FC3 A;  2R57 A;  1UGQ B;  2K2V A;  3PGG A;  3JCM b;  2EQK A;  4E7J A;  3CCS A;  1KD1 C;  4M77 C;  3MP1 A;  2PVO B;  3A8H B;  3QDR B;  2DK3 A;  3SWN B;  1KQ2 A;  4HT8 A;  4XU1 A;  2PVG B;  5CR2 A;  1VQ8 T;  5FLX E;  4BI3 A;  2EQM A;  3QBY A;  1WGS A;  3S3O A;  3JB9 H;  2DPP B;  4RKU E;  3OYM A;  1JBM A;  2JNG A;  3HL8 A;  4OMF B;  4NOY A;  4UC4 A;  4B9X A;  4C5E A;  3C94 A;  4Z02 A;  3OYN A;  3L2V A;  5J3B A;  4E7K A;  4F7U E;  1NJI C;  1W2B A;  3X25 B;  1OZ2 A;  1ZHI A;  3QPH A;  3DB4 A;  5CKF A;  4XK8 E;  1N8R C;  4M77 A;  2XDD A;  4OGC A;  4BAC A;  3A8G B;  2JTM A;  4C5I A;  5LJ5 j;  4J83 A;  5LJ5 d;  1EIF A;  1Q81 U;  2WSE E;  4FSX A;  2KY9 A;  3QJ6 A;  5I21 A;  2E10 A;  2K4Y A;  3CCQ T;  1KQS S;  2CZ1 B;  3L2Z A;  1O75 A;  1QW1 A;  2DXB A;  3L1A A;  4M7D A;  4M7D G;  2RHZ A;  3M4G A;  2RI2 A;  4F7U G;  3FLG A;  5D6X A;  5FU7 B;  5GAN 7;  3PNW C;  1WJQ A;  4BI8 B;  4B9W A;  3L42 A;  1W2B S;  3SWN C;  3OYC A;  3MCA B;  3JB9 G;  1LOJ A;  3VV0 A;  3CME A;  1UGS B;  4M75 D;  1QVP A;  2QDY B;  5I2S A;  1BI0 A;  1Q82 U;  4C92 C;  3CCE T;  3SDZ A;  3M57 A;  3JCM V;  4OB0 B;  3JCM g;  5L8R E;  3CXC A;  3CPW A;  5LJ3 h;  3CCU A;  4CRI A;  3G4S T;  3PT9 A;  3QSU A;  2JN0 A;  5J26 A;  3OMG A;  5CKE A;  1K9M C;  3M55 A;  5A2Q E;  2K3Y A;  3DB3 A;  4BB7 A;  5HK3 A;  2LC4 A;  2C06 A;  2I2L A;  4MML A;  4IKF A;  3QHS A;  3FIF A;  2K5L A;  2PUK B;  4ELY C;  3HKS A;  1YJN A;  5C6S A;  3GNF B;  4F7U A;  2RHI A;  4R55 A;  1LNX A;  2EKO A;  3EFS A;  3VUB A;  2M0O A;  1FXX A;  4JJN K;  2QTX A;  3ME9 A;  4RCC A;  5IAY A;  1JJ2 S;  1B34 B;  4X9D A;  3PIO A;  3M54 A;  5GAO q;  4BE0 A;  3G71 A;  2O01 E;  3JCM W;  1YJ9 T;  2XDP A;  3L2U A;  5LJ3 g;  5DLO A;  3AHU A;  4PL6 A;  2G3R A;  3ZBD A;  4BY6 B;  1VQO A;  5GAN 6;  2K5I A;  2VYT A;  2ZPH B;  3CCE A;  3H6Z A;  3RES A;  4ZN1 A;  5GAN h;  3J81 E;  5KCO A;  1JB0 E;  2WSF E;  2LCC A;  2YRV A;  3MHX A;  4EPC A;  5LJ5 f;  4M77 E;  3M5A A;  2RD1 A;  3I56 T;  4J6X A;  5IN1 A;  5FRO A;  5GAN g;  4HCC A;  2LX9 A;  4PJO C;  4C8Q A;  2LQ8 A;  1HXD A;  4BE1 A;  3OBY A;  3M4Y A;  3R6O A;  4LD6 A;  4M7D E;  3A5Z B;  3RMQ A;  3S6W A;  1YJW T;  4IUU A;  2RA2 A;  2CZ0 B;  3OYG A;  3CCV A;  5HY6 A;  5GAN 8;  1UGR B;  3OW2 A;  1FWZ A;  5GAO r;  1VQP A;  1BI1 A;  3C95 A;  1JJ2 A;  1YIT A;  2HQX A;  4M7A F;  3OSS C;  2DEQ A;  3JCM J;  2MWO A;  1YI2 A;  4DOW A;  1VQ6 A;  3JB9 F;  1OI1 A;  4VUB A;  5GMK l;  5LJ5 g;  4C8Q C;  1VQ6 T;  1YIJ T;  3JCM Q;  2M16 A;  3X24 B;  3QO3 A;  2EJF A;  5M9O A;  1DJ7 B;  4M75 C;  1QVF S;  4WF2 A;  2K5F A;  2DO3 A;  4LDY A;  1VQN T;  4L5G A;  1YJW A;  3JCM P;  5GMK j;  4KUD K;  2XK0 A;  4E7L A;  4PJO B;  3QKJ A;  2CS7 A;  4C92 B;  4N4H A;  1Y96 A;  3GF5 A;  4GY5 A;  4QVZ A;  1YJ9 A;  2EQJ A;  2PUO B;  3I56 A;  4M7A E;  1BKB A;  4C92 G;  4HT9 A;  4MDX A;  5GAM f;  2EJ9 A;  4L59 A;  4JRK A;  5KE3 A;  2CYZ B;  1Y96 B;  2DXC A;  4OVA A;  3QII A;  4C92 F;  2HBP A;  3RMS A;  1VQL T;  2FYK A;  4MDW A;  1G3Y A;  1M1K U;  2GF7 A;  4OB1 B;  4IUP A;  5GMK m;  2HD0 A;  2X4X A;  2DTI A;  4N0A C;  3QG1 A;  1YIT T;  4JLG A;  4M78 A;  2R5A A;  2E1H A;  1N6A A;  2DD5 A;  4QQG A;  4KT0 E;  3GLX A;  1QVG S;  4E7H A;  2EYQ A;  2OTL A;  3WVD B;  3RUX A;  2HNI A;  1I4K 1;  3OYL A;  1VQ8 A;  5CQX A;  4BY6 C;  3MET A;  3ER0 A;  2A7Y A;  2KSS A;  3OYJ A;  2NLU A;  2R5M A;  3E1S A;  2H3J A;  1WJR A;  5LJ3 d;  5GAO m;  1NE8 A;  3LGF A;  3OA6 A;  1I8F A;  3VKI A;  3L2R A;  2V8K A;  3GPL A;  3GIB A;  3OQ5 A;  3FRN A;  4IUR A;  1K73 C;  2XKO C;  4EDU A;  2RJE A;  5FRN A;  1M8V A;  2GFA A;  2ZPI B;  2DXT A;  3GNG A;  4N4G A;  2EQU A;  3A8M B;  2D6F A;  1M1G A;  4JS4 A;  3QZ9 B;  3Q1J A;  4BE2 A;  4Y28 E;  2P0K A;  4A4K A;  4ZGJ B;  4ELZ C;  4M78 G;  3G71 T;  3ASK A;  4D6W A;  1KG1 A;  1RI0 A;  2ZGW A;  4OP0 A;  3UWN A;  3OYK A;  1YIJ A;  1Q82 C;  4A4F A;  3G6E T;  4M7D F;  1I5L A;  2DZC A;  4PNO A;  1IRE B;  1Y07 A;  1X75 C;  1M5Q 1;  3LGL A;  3RKW A;  4Y91 A;  3P8H A;  4MZM A;  4A54 A;  1YI2 T;  2CZ7 B;  2A3L A;  2PQW A;  1QP3 A;  4QVD A;  3CD6 T;  4M78 E;  4QVC A;  5HK0 A;  5GAN d;  1VQP T;  2LDM A;  3VU3 C;  2L89 A;  3S3M A;  4MZP A;  1Q7Y U;  1NPR A;  3LYI A;  5D6Y A;  2QQS A;  2QQR A;  2E41 A;  4A4E A;  4C0D C;  3G4S A;  3LWH A;  2DVE A;  3WVE B;  3CBO A;  3QUI A;  2QA4 A;  3HFN A;  3N5B B;  3OBW A;  4M7A D;  5GAO l;  3EAE A;  4PJO A;  1BI2 A;  1WQW A;  2E5Q A;  5GAN e;  5GAO n;  3CME T;  2M1H A;  2O4X A;  2CGH A;  1MHN A;  1G3T A;  3M58 A;  2EWN A;  4O5V A;  2XIC A;  2QA4 T;  2QQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...