2GNCA

Crystal structure of srgap1 sh3 domain in the slit-robo signaling pathway
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
PEFAIAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLIT-ROBO Rho GTPase-activating protein 1
publication title Structural Basis of Robo Proline-rich Motif Recognition by the srGAP1 Src Homology 3 Domain in the Slit-Robo Signaling Pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gncA00
2EKHA 3M0SA 2BZ8A 2GTOA 1WXUA 2PZ1A 1JU5C 1K1ZA 2CUBA 2LJ0A 2YSQA 2J6FA 2C0IA 2LZ6B 1G83A 2EYXA 1QWFA 2ESWA 4RUGA 2VWFA 1CKAA 1BK2A 2KRMA 1X2QA 1WFWA 3GBQA 2ECZA 1AWWA 1GFDA 1ZUKA 2RQUA 2DYBA 1NEBA 2KXCA 4A63B 5I22A 1KJWA 2KRNA 1ABOA 2RN8A 1HSQA 1OV3A 2CSIA 1M3CA 1NG2A 3EG3A 2C0TA 2JMCA 1UHFA 4OMMA 4HXJA 4J9FA 1SSHA 4ESRA 1UECA 5GJVB 2FPDA 3VRYA 2F2VA 1NYFA 2KROA 2EGCA 1EFNA 2VVKA 3M0TA 2RQTA 4J9BA 3NMZC 1WLPB 1NEGA 2XMFA 1TG0A 1E6HA 1AWXA 2MIOA 2DE0X 1UJYA 1PKTA 2YT6A 1FYNA 2KE9A 4LE9A 3H0IA 1UHCA 2L3PA 2K7AA 1GRIA 1UJ0A 2EYYA 2LX7A 2ROLA 4RTYA 1I07A 4J9GA 2DBKA 3SEMA 4JPBW 1YWPA 1UE9A 2NUZA 1K9AA 2KT8A 1T3LA 3VS2A 2NWMA 3QWXX 4ORZA 5L23A 2BTTA 4Z8AA 2KR3A 4CC4B 3M0PA 5IHKA 2CH4A 2LP5A 2ENMA 1Y57A 1QWEA 2FRYA 3PVQA 2AZVA 3EG2A 3U23A 2O31A 3EHRA 2RNAA 3EGUA 1OOTA 3H41A 2P4RA 4DEYA 5I11A 2KYBA 1WXTA 2JTEA 1N5ZA 1X2KA 2CDTA 1SEMA 2HDAA 2DX1A 3TVTA 4Z89A 2FPEA 2H8HA 3ZL7C 2DL5A 3VS4A 2D0NA 1X6GA 1XOVA 2GBQA 3VS1A 2D1XA 4J9HA 2SEMA 4D8KA 1M8MA 4CC3A 1PRMC 2HEQA 1MV0B 3UF4A 4F17A 1NYGA 1UUEA 1UFFA 1PRLC 2AZSA 1WXBA 4HVUA 4OMQA 1ZBJA 5IXFA 2O9VA 4JZ4A 2L3QA 2OI3A 5FWCA 2MOXA 5GJWB 2YUQA 1YN8A 2JW4A 2D8JA 5HCKA 1BB9A 1OPLA 1T3SA 4GBQA 2PNIA 2DL8A 1ARKA 2LNHB 1WA7A 2J06A 4J9DA 1PWTA 4LN2A 2HSPA 2RPNA 3VS5A 1I0CA 4LUDA 2DILA 5FWBA 3UA6A 1BU1A 2ED0A 2BZXA 1UG1A 4D8DA 1QKXA 4RTZA 1ZLMA 1X6BA 1X27A 1GFCA 1K76A 1VYVA 4OMNA 1Z9ZA 2KT1A 1AZGB 1M30A 1RUWA 1TUCA 2LCSA 1ZSGA 1AEYA 2RMOA 1WDXA 5IHNA 4J9IA 1K4US 1YP5A 2HBWA 1OEBA 1GCPA 1U3OA 2DRKA 2J6OA 4AFUC 1RLQC 2RQVA 2K2MA 4F14A 2CT3A 3NHNA 2FPFA 3C0CA 2M51A 4J9EA 2A37A 4JJBA 4DEXA 1W70A 2JXBA 2DM1A 3THKA 1YCSB 1ZUUA 1U06A 2OJ2A 5FW9A 2L0AA 3M0UA 3H0HA 2JM8A 2AKLA 2CT4A 2X3WD 3O5ZA 2DF6A 4LUEA 2YUOA 1AOJA 1CSKA 2W10A 2O88A 2RQWA 1H92A 3PE0A 2L3SA 3TSWA 2DVJA 3EG0A 3VS3A 1E7OA 1W1FA 3I5RA 1BBZA 1ZX6A 1Z9QA 2EYZA 4HCKA 1SHGA 4JZ3A 1YWOA 2G6FX 2ED1A 4IIOA 4J9CA 2K6DA 2FEIA 3M0QA 4OMOA 4HVWA 2KGTA 4OMPA 1GL5A 1RLPC 2ROTA 3R6NA 4CC7A 4AFQC 2J05A 2O9SA 4F16A 2D8HA 2VKNA 1AVZC 2JS2A 1PKSA 1WYXA 2V1RA 2FO0A 2I0NA 2J6KA 4K11A 1T0HA 1WIEA 2KXDA 1GCQC 1S1NA 4FSSA 1GCQA 3I9QA 1NLOC 1FMKA 1SPKA 2EQIA 4RTVA 1SRMA 1CKBA 3JV3A 4WCIA 2EVRA 1AZEA 2LQWA 1HJDA 1VYTA 1SHFA 1T0JA 5IHIA 1UTIA 2O2OA 2J7IA 2KYMA 2B86A 2W0ZA 1GBRA 2KRSA 3RBBB 2EW3A 5ECAA 4HVVA 5IXBA 2SRCA 4X1VA 2E5KA 4Y92A 2GGRA 3UATA 1IO6A 2M0YA 2K79A 1JXOA 2EGAA 4AG1C 3NGPA 2A36A 1KSWA 1JQQA 2GQIA 2C0OA 4RTUA 1E6GA 1J3TA 3VS6A 1MUZA 3SHWA 3REAB 2DLPA 4IIMA 3NPFA 1PNJA 2FG0A 2K3BA 4QT7A 2EGEA 2RF0A 2CREA 1M27C 2YUPA 1K0SA 2EBPA 2JT4A 2DL3A 4KRTA 2YDLA 1M3AA 1WI7A 1WX6A 2V1QA 2IIMA 3QWYA 4E6RA 4AFSC 1LCKA 2F2XA 1H3HA 4EIKA 4RTTA 3VS0A 2CSQA 2DL7A 1B3QA 2A08A 1VYUA 1QCFA 1NLPC 2KNBB 3A98A 2DL4A 2L2PA 3FJ5A 1GBQA 2CUDA 2KBTA 3LH5A 5IH2A 2DMOA 1G2BA 2LQNA 3PVLA 1UDLA 2DNUA 3EHQA 4R0KA 2HCKA 3UA7A 1RI9A 1AWJA 2X3XD 1UGVA 4LNPA 2ABLA 1M3BA 4JJDA 2JMAA 2YUNA 1U5SA 5EC7A 2QDLA 1JEGA 4GLMA 1Y0MA 2DJQA 2EYWA 2FRWA 1HD3A 2AKKA 2DRMA 3M0RA 1JXMA 3VRZA 4AFZC 1AWOA 1ABQA 1X69A 1JO8A 2LMJA 3TSZA 1AD5A 2BZYA 4RTXA 3IQLA 2F2WA 3EG1A 3VS7A 1V1CA 1MV3A 1TUDA 4OMLA 2MCNA 1QLYA 1NM7A 2K9GA 1YNZA 3KFVA 1K0XA 1VA7A 2AK5A 1KFZA 1QKWA 3CQTA 2JM9A 1B07A 3I35A 2LJ1A 4Z88A 1H8KA 2CH4W 1OPKA 2KEAA 1ZUYA 2DBMA 4M4ZA 2RQRA 2GTJA 3I5SA 4JJCA 4RTWA 2PTKA 1KIKA 1I1JA 3REBB 3ULRB 1PHTA 2A28A 1SRLA 2OAWA 4CC2A 3RNJA 1A0NB 2LJ3A 4AG2C 3H0FA 2DA9A 1W6XA 2GNCA 4ZNXA 1X43A 2JS0A 2EPDA
chains in the Genus database with same CATH superfamily
1YJNA 3L2UA 2GTOA 1U1SA 1WXUA 1JU5C 2J6FA 2C0IA 1RL2A 5GAMf 3JCMc 2EYXA 2MYSA 3JCMg 1W2BA 2DD4A 3GOXA 1OZ2A 1GFDA 4M75F 3CC2A 1OYXA 2RQUA 4RG8A 5L8RE 2QQBA 4ZGEB 3GNGA 2RI2A 1YITA 4ZGJB 5I22A 8ATCB 1HSQA 1VQ5A 1NG2A 4BB7A 3OMCA 3V7SA 4HXJA 4C8QD 1SSHA 4ESRA 1FMWA 4J7IA 4F7UA 2HQXA 1UECA 1K73R 3I55Q 3VRYA 2YRCA 4XAXB 2EGCA 2EFIA 3M4YA 5FU6C 1OX9A 3M0TA 3NMZC 1NEGA 1JJ2A 2CZ7B 2XMFA 2HQHA 1E6HA 1AWXA 1D1AA 2DE0X 1PKTA 1FYNA 3CCSQ 4RCBA 3H0IA 1UHCA 1YBYA 2K7AA 2QXFA 2ZPIB 2XI9A 2V8IA 5GANd 1HXDA 2MF2A 1I07A 3CCVA 2DBKA 4C8QG 4J6WA 2NUZA 1YI2A 4ORZA 1KC8R 2CP5A 4Z8AA 4CC4B 3OBWA 3M0PA 2RHZA 1K9MC 2ENMA 2COZA 1M1FA 4JLIA 1VQPT 3PVQA 3LGLA 1YI2Q 2AZVA 3U23A 5A0DA 3ZBDA 3PNWC 1R0CB 4HCCA 2K4YA 4KGXB 5I11A 2JTEA 2EQKA 1G3YA 3CCQA 3TVTA 3V8KA 4Z89A 2FPEA 2H8HA 4XTWA 3ZL7C 4OGEA 2E65A 2YRDA 4PL6A 3VS1A 4LDXA 4J9HA 3QHSA 1M8MA 3S6WA 2HEQA 1K8AR 3KBGA 4XK8E 3QKJA 4C5EA 4OGCA 2VGMA 2FZGB 2VYTA 2AZSA 3OYJA 2GFAA 2GQVA 3RKXA 2M0OA 2K2VA 3CPWS 1FMVA 4UC4A 1MMDA 1Y96A 5GAN3 4M7DE 5GMKe 3CCEA 1VQ6A 3QPHA 4KUIA 5J3BA 2PNIA 2DL8A 5D6XA 1YHQA 2EQMA 5KYWA 3CCUQ 2A7YA 1DJ7B 3CBMA 3VS5A 1I0CA 2DILA 2ED0A 1Q7YU 1X01A 1I4K1 3EGDA 1UG1A 2ZPGB 3ME9A 2GCXA 5I2SA 4C0ZA 1K9MU 2DAQA 5AYFA 1X27A 4M75E 4NS5A 2KT1A 2LQ8A 4PFOA 4E7ZA 4FM4B 4TVRA 3G71A 2LCSA 2CZ0B 3A8MB 5GAN4 1C1AA 2LT1A 2ZPFB 3OBYA 1N9RA 1U3OA 2OX7A 5FROA 3OS2A 3CMAT 3QJ6A 4FYWB 1Q81U 1QVFS 3QBYA 4X9DA 4JJBA 4X34A 4BDYA 3HHTB 5GMKm 1W70A 2BIVA 1ZUUA 3PIOA 3FEOA 4EMGA 4B9XA 3S3NA 2HZYA 2RK2A 1YJWQ 4C0GA 2X3WD 2DF6A 2FL7A 1ZSZC 4M7AB 1ZSZA 1OI1A 3EAEA 2CP7A 2W10A 3QIIA 5GANh 2E5QA 2F1LA 1H92A 4C92B 4LXCA 2DZ9A 2DIQA 3OYNA 3CCMT 3TSWA 5D6YA 3VS3A 3MP1A 1E7OA 2QG9B 3H9NA 4XU2A 3JCMX 1VUBA 2G6FX 2M1HA 2ED1A 1EX4A 4IIOA 1YJ9Q 4J9CA 3QYHB 2K6DA 2LDMA 2CYZB 1BCMA 2ZPEB 2ROTA 3VJPA 1M4ZA 3LYIA 2O9SA 4F16A 4GY5A 1PKSA 1WYXA 5GAMg 3X28B 2F69A 2M16A 2J6KA 4K11A 4ANJA 2RM4A 1WIEA 1S1NA 4XTUA 4FSSA 3QDRB 1OZ3A 1FMKA 1SPKA 3CCRQ 1CKBA 2EVRA 1AZEA 1VYTA 2HD0A 2EQJA 4XQ3A 1KK7A 4BDZA 4P5NA 1NE8A 1M2VA 3OYBA 1XJWB 2CGHA 1GBRA 4ZTJA 2EW3A 3QYGB 5CQYA 5IXBA 4BE2A 4X1VA 1LJOA 1M1KC 2I2LA 2WSFE 3VU3C 4F7UG 3OYKA 3SFMA 1KSWA 1JQQA 1PSFA 4C92F 3MEVA 1J3TA 1TS9A 2PU9B 1MUZA 1M1GA 4JLGA 4ZN1A 1IRXA 1VIFA 3HTRA 3PGGA 1KD1C 3BW1A 2D6FA 3OS5A 3CXCP 4IURA 2CREA 5GAN6 1VQLA 2OTJT 1K0SA 4FU6A 5KYYA 2JT4A 1M3AA 3A8OB 3DLLA 2YLBA 2V1QA 3L2ZA 1K73C 4C8QB 8AT1B 2DEQA 4PKCC 4AFSC 4PJOA 1LCKA 4BI8B 2KY9A 3VYGA 4PFZA 1Y71A 4EIKA 4EMHA 4RTTA 3VS0A 4RMOA 3CXCA 1NPPA 2QEXA 4DOVA 2E64A 2HKQB 2KNBB 3AT1B 2QA4Q 2DL4A 2L2PA 1GBQA 5CAIA 1G2BA 3I56Q 2VUBA 1K9MR 3TEEA 5KE3A 1D3BA 3UA7A 1UGPB 1UGVA 4LNPA 4A4HA 3CC4T 4JJDA 3BDLA 2JMAA 4C0DB 3TU4K 3H6ZA 5GMKl 1JEGA 2QQ9A 2DRMA 1VQOQ 5KYXB 5KCOA 3VRZA 1AWOA 2LMJA 2VC8A 1Q81R 3HRTA 2BZYA 3IQLA 3GNFB 4OMLA 2MCNA 4BY6B 2X4JA 1QLYA 1NM7A 2X9HA 1YNZA 3BY7A 3KFVA 5DLOA 1U1TA 1K0XA 1O9SA 1KFZA 3CQTA 1KD1U 1B07A 3OYFA 2LJ1A 5GMKh 1H8KA 2XU8A 2E4HA 2CH4W 1ZUYA 2R5MA 2D0QB 1VQ9A 5GAOq 3M59A 2DXCA 4JJCA 4O6JA 2Z0WA 1KIKA 3H8ZA 3REBB 1PHTA 4CC2A 3CCJT 1XQHA 4RCCA 2GNCA 3E9GA 1X43A 4ZNXA 4X9CA 4JRPA 3FIFA 2EPDA 1PC0A 4RG2A 1LVKA 1TSFA 2PZ1A 2LJ0A 2LZ6B 3ZFJA 2IPOB 1G83A 1G3SA 4E7SA 1IXDA 2LCCA 2ESWA 4YTLA 2VWFA 1CKAA 5I2MA 3CMEA 1D1BA 1TOVA 3JCMP 1W2BS 5GANj 1VQMT 1X2QA 4A53A 1WFWA 3GBQA 1AWWA 2DYBA 7AT1B 1KJWA 4C92E 4OB0B 1XNIA 2RN8A 2CSIA 1NBEB 3OW2P 1VQNA 1VQ7A 3BE3A 4JRKA 2ZCFB 1YIJQ 1NYFA 2X4YA 1UEBA 2DKGA 2E3IA 4A4EA 4F04B 2DZCA 1N6AA 1JJ2S 3OYMA 1TG0A 4D6WA 3JCMQ 1EZZB 1S72Q 1MNEA 1RAIB 2KE9A 1VQ4A 2R57A 2L3PA 1UJ0A 2EYYA 3QZ5B 2LX7A 3PMTA 1KQSA 3SEMA 3FC3A 3M58A 1VQ4Q 3LWIA 5HK0A 4IKFA 2LNVA 3QWXX 5L23A 4J8OA 3G4SA 2BTTA 4XTYA 2A3LA 2KR3A 2NYSA 1NZ9A 2A0FB 2CH4A 3CC7A 1OOTA 3H41A 1QVGA 2P4RA 4M78E 2OTLQ 1WXTA 3FB9A 5FU7C 1SEMA 3QXEB 5GANe 2H3EB 3CCLT 2DX1A 2K5IA 4QVZA 2DL5A 2H3JA 3VS4A 1X6GA 2GBQA 4JRQA 3G6EA 1JBMA 1RI0A 1VQKT 4CC3A 4A4KA 2ZGWA 4FT2A 4M7DC 3GPLA 4M7DA 1WQ7A 4J6XA 1M1KR 1KHIA 1QW1A 5CK9A 2CZ6B 3WVEB 3CD6Q 2AIRB 5CVIA 4BD3A 3QJYA 4OMQA 5FU6B 4JZ4A 1EIFA 4IUVA 2OI3A 5FWCA 2MOXA 3JCMJ 2D8JA 5HCKA 6AT1B 1C0MA 4M75A 2QASA 1B7TA 1WA7A 2LNHB 5LJ5g 4R55A 1KD1R 1BYMA 1PWTA 1OU8A 3I55A 2XIDA 2PUOB 2IVWA 1BU1A 3VUZA 1YJNT 4D8DA 4QVDA 1QKXA 4RTZA 2KMTA 2WSCE 3EGXA 1M2OA 4PLIA 4E7KA 3M55A 2EJFA 4J83A 1GFCA 1SSFA 2WSEE 1K76A 1VYVA 2K5FA 2RHYA 1AZGB 4FW1A 1RUWA 1AHJB 3LH0A 5LJ3h 1ZSGA 3CCSA 4NL2A 1WDXA 2EJ9A 3JB9D 1K4US 2RHXA 3CC2T 2RJFA 2J6OA 4AFUC 1YITT 5GMKj 2RQVA 2K2MA 4F14A 4ZGDB 2BE9B 2L8DA 4N0AA 2FZCB 2FPFA 2HQEA 3C0CA 1G8XA 1VQ5T 2A37A 3HKSA 4A4GA 4M77E 5C0MA 5CKEA 2EQUA 4OMFB 2XDBA 2QTVA 3SWNC 3M0UA 3SWNA 3H0HA 2JM8A 2CT4A 1Q7YC 4LUEA 1UGSB 2DO3A 3LGFA 1AOJA 1CSKA 2HL3A 2RQWA 3JB9G 4BE1A 4J7FA 2L3SA 2CP2A 2DVJA 3EG0A 2L89A 1VQPQ 2K5LA 1W1FA 3I5RA 2EYZA 2RJCA 3N5BB 4NOYA 3CCVT 2KVQG 1G5VA 4N4GA 5M9OA 2QYZA 2F5KA 2LQKA 3JB9H 3M0QA 2FEIA 5KYWB 1YI2T 3V8LA 4OMPA 3TREA 1Q81C 1WGSA 1H641 1RLPC 1GL5A 3R6NA 2RI5A 3NFCA 4PJLA 4L5GA 2KSSA 5HK3A 4EMKC 2V26A 4EMKA 1BKBA 1WJRA 2V1RA 3EGDB 1IZ6A 1T0HA 1D0YA 2BUDA 1G3TA 1NLOC 4RTVA 3JV3A 5FLXE 4JUVA 4A54A 5GAN7 1SHFA 1T0JA 2E3HA 3CCUA 1UTIA 3CCQT 3M4GA 1ZA1B 2KRSA 1WNLA 2X35A 4Y92A 4OB3B 3MCAB 2NUPA 5AT1B 1IO6A 2EYQA 3JCMV 2K79A 2GQIA 2DTOA 2C0OA 4FYVB 4RTUA 1E6GA 3SHWA 1RAAB 4E2FB 4ZN3A 1ZSZB 3QUIA 3NPFA 2FG0A 2K3BA 2E12A 3RR6A 3CCET 1VQ6T 1IGQA 1YHQT 3BDUA 2RJEA 4BACA 4ZTFA 2EBPA 5GAOp 3OYEA 2PUKB 4A4FA 3OA6A 3CMAQ 3QWYA 1YJWA 1M9SA 4LDYA 2HAXA 2ATCB 2F2XA 1H3HA 4M7DD 4AMCA 5IT9E 1PG5B 3CXCS 2QQSA 3G71T 2A08A 1QCFA 1NLPC 1HK9A 3A98A 2X4XA 2YRVA 2DNUA 3EHQA 2NUTA 2HCKA 3UDCA 1YJ9A 2ZPBB 5GANf 1YFNA 1RI9A 1AWJA 3MKDA 2XD0A 1BI0A 1M3BA 3P8HA 1M2VB 4M75D 1OU9A 4KH1B 2QDLA 5HKCA 4GLMA 1Y0MA 2LCLA 3CCMQ 2DJQA 1HD3A 3M0RA 1LNXA 5GAN5 4QW2A 1JO8A 4M7DG 4KULA 1TUGB 4N4IA 3MPUB 4DBFA 2F2WA 3CCRA 3VS7A 2KDSA 2JN0A 1TUDA 1RAFB 1M90U 2RJDA 1X75C 2DETA 1M5Q1 3EFOB 1QKWA 2JM9A 2COWA 4JS5A 1MGQA 2KEAA 2DBMA 4Z02A 2RQRA 1WHJA 2DEUA 2FHDA 3PIPA 2P84A 4QQDA 2DXBA 4M75G 3OY9A 2DXUA 2E1HA 5CKHA 2DJZA 2DIGA 1I1JA 1D0XA 3QDFA 4DOWA 1Q82U 4JRIA 1SRLA 2DPPB 2OAWA 3DKMA 4Y28E 1TXQA 4MMKA 1P92A 4MDXA 2EKHA 1RAGB 2BZ8A 4M7AF 3HRUA 3DLMA 5KYNA 1SG5A 2CUBA 4PJJA 3M54A 5CCAA 1IB8A 3G7ZA 9ATCB 3PT9A 2IG0A 4WTOB 4IUUA 1QWFA 3T9NA 2EKOA 1KQ2A 1NJIC 5C6SA 1HYOA 1ZUKA 4BI4A 1D3BB 1JB0E 3OYCA 1NEBA 2KXCA 1KQ1A 5FRMA 3SB2A 1OV3A 2BE7D 2OTJQ 3EG3A 2C0TA 4OMMA 2E10A 5KE2A 4J9FA 1N8RC 1QVFP 3LX7A 3KUFA 2KQWA 5GJVB 2FPDA 2QA4A 1B34A 5CKBA 2KROA 4EPCA 4PJOC 4PJNA 5GAMe 3I56A 2QQRA 2VVKA 2RQTA 3QZ9B 5HY6A 4IUTA 2YWWA 3Q1JA 3JCMh 2CZ1B 1Q7YR 3JCMW 1LOJA 3UWNA 1VQLT 5LJ3e 1VQ8A 1I8FA 1OULA 3A8LB 1WHGA 1GRIA 3D7SB 1VQOA 2JTFA 3GF5A 4MZMA 2YLCA 3RIRA 1KQSS 3HRSA 3F70A 4JPBW 1BIBA 5GAN2 1VQ8Q 3CC4Q 2KT8A 4M78C 4M78A 2NWMA 4HA8A 2EAYA 2XDDA 1VIEA 2PVDB 2QEXT 4DBQA 3NTIA 3V8JA 2ZPHB 1MNDA 3L2QA 2PQWA 3EG2A 2O4XA 3EHRA 1KG1A 1NJIU 4DEYA 1QVGS 2JTMA 3MO8A 1N5ZA 2CDTA 4LD9K 5KYUA 3TQ7P 2HDAA 3HP9A 3VKIA 1XOVA 4C8QF 2COYA 3OSVA 1N8RU 3M9QA 4KT0E 1PRMC 1MV0B 1UGQB 2AT1B 2FYKA 3VUBA 3CCJQ 3OMGA 4F17A 1NYGA 1PRLC 5KCHA 1ZBJA 2O9VA 3P8BB 4GLKA 3OSSC 5GAMd 4OVAA 2YUQA 1VQ9T 2MMPA 4XTXA 1MHNA 5GAOl 4M7AE 4FW2A 4LN2A 1VQMQ 5A0GA 3MP6A 3DB3A 5LJ3d 2BKDN 2RPNA 1YIJA 5FWBA 1N27A 3ER0A 2BZXA 2R58A 1BI3A 1ZLMA 1X6BA 3JB9I 1MMGA 1C6VX 1Q82R 2DTHA 1Z9ZA 2ZZDA 1S72A 3QG1A 1PD0A 1PSEA 1TUCA 3OS0A 4M77C 2MK5A 4M77A 3RKWA 3CMET 5GANg 2HBPA 2VB6A 1AEYA 1IGUA 2RMOA 5D6WA 5J39A 1OEBA 1JRIA 1BI1A 1KC8U 2G3RA 2FB7A 3OW2A 2CT3A 4FYYB 5FU7B 1UB4A 4J9EA 2Y4XA 3QO3A 4DEXA 3OYIA 2KAFA 1VQNT 2JXBA 3THKA 1YCSB 4J5YA 1VQ7T 3X26B 3L42A 2V8JA 2L0AA 2FZKB 1D1CA 1X6OA 4M7DB 2HNIA 4JS4A 2PVOB 3O5ZA 3O8VA 1RADB 3PFSA 2HL5C 2OTLA 2O88A 3J81E 2DXTA 3UT1A 4KUDK 1VQ4T 3EH2A 4PNOA 3RMSA 1IHWA 4HCKA 1SHGA 4FCYA 2Y4YA 3NTKA 4E7IA 3HSBA 2ZAEA 3JRZA 1MMNA 1R77A 2LTOA 3CCLQ 4CC7A 4AFQC 3R6OA 2KI7A 2VKNA 3G4ST 1AVZC 1QCNA 2DTIA 2JS2A 3CD6A 1XTDA 3M53A 2RK1A 2P0KA 2I0NA 4C5GA 4IUQA 3EGXB 1VQKQ 2KXDA 4F7UB 3I9QA 4KBMB 4PJOD 3CC7T 2EQIA 1SRMA 4WCIA 1N9SA 4C8QE 3HL8A 5IHIA 4DA4A 3RKYA 3JAME 2J7IA 2KYMA 4ATOA 2W0ZA 1R8OB 5ECAA 4RKUE 2SRCA 4LDWA 3G6ET 4M75C 2CP6A 1NJIR 2E5KA 2RA2A 1RABB 3CBOA 3UATA 5CKFA 4ELYC 5KH6A 2A36A 2MWPA 4M78D 5GAMh 3OYDA 3RERA 1WQWA 4ME7A 2XHCA 4PJOG 3SWNB 4C5HA 3VS6A 5D7UA 1N8RR 3RUXA 1YJNQ 2EJGA 3G1JA 5LJ3f 5GAOr 2EGEA 1JJ2P 1M27C 2XK0A 5DM7R 4ELZC 2X51A 4FIBA 4N0AC 3CC2Q 2DL3A 3I55T 2YDLA 1YITQ 3MJXA 2DERA 2HSEB 4F7UF 1WI7A 3EG9A 3CEYA 2QAZA 4M78G 1QP3A 3FLGA 3BFMA 1VQ5Q 2XKOC 3C12A 5I21A 4EDUA 2LT4A 2CSQA 3OYYA 5A2QE 4EMKB 2DL7A 1B3QA 1WPYA 1QCOA 3ASKA 3CCST 3L2VA 1O75A 3HFNA 2LC4A 1VQPA 3FJ5A 2QGGA 3LH5A 5IH2A 3PVLA 1FX7A 1UDLA 3OYGA 2EIFA 4R0KA 4BUGA 5IN1A 3M5AA 5DY9A 2QGFB 2ABLA 3JCMe 2YUNA 1U5SA 2E6NA 2Y90A 1Y96B 4R56A 2EYWA 2FRWA 5LJ5e 2AKKA 4AFZC 1BCOA 5A0LA 1ABQA 1X69A 2NUPB 4E7HA 2CKKA 2QK0A 4E47A 2P4TA 1NPRA 3CCVQ 4RTXA 1FWZA 3EG1A 1V1CA 1MV3A 2JNGA 1AT1B 1MMAA 1IREB 2XICA 2AK5A 4XTVA 5GAOn 4M77D 3NTHA 1LPLA 3I35A 3C94A 2FVUA 4FSXA 5DLQE 2CP3A 4HKEA 4XU1A 1WHKA 4V2SA 2PTKA 2RI3A 3ULRB 4MZTA 4J6YA 2A28A 3CCQQ 1W4SA 3E1SA 3LLRA 3H0FA 2DA9A 4Y91A 1WHHA 2QTXA 2MWOA 3M0SA 5CR2A 4HCZA 3OS1A 3S3MA 1K1ZA 2YSQA 1Y07A 4M77G 1WHLA 3FDRA 4XU0A 4RUGA 1Q86C 1M90C 1BK2A 4PLLA 3MHXA 2KRMA 3CCUT 2KK4A 1WJSA 1PD1A 1OX8A 2ECZA 2NUTB 4FT4A 1V76A 4A63B 3CMAA 2KRNA 3X24B 1ABOA 4CI0C 1ZQ1A 2HMAA 2R5AA 3CCEQ 1VQ6Q 1M3CA 2JMCA 4OB2B 1UHFA 1YHQQ 1ZHIA 3JCMd 1Q82C 2EWNA 1GXIE 4QQ6A 2F2VA 4WF2A 5LJ5d 1EFNA 1BI2A 3QSUA 2X4WA 4J9BA 1WLPB 2B8AA 2D9TA 3EFRA 2VGNA 2MIOA 1UJYA 3G71Q 1KHCA 4F7UE 2YT6A 4HT8A 4LE9A 1I5LA 3CCMA 1QQJA 2K57A 1Q95G 5EG2A 2ROLA 4RTYA 1ACMB 4J9GA 1YJWT 3TCJA 1YWPA 2LRQA 1UE9A 4FYXB 1K9AA 2F5TX 1T3LA 3VS2A 3VV0A 2LX9A 5IHKA 4LDVA 5GAMj 4C5IA 2LP5A 1Y57A 1QWEA 2FRYA 3LWHA 2P0QA 2MI6A 1Q86U 2O31A 3ZEHA 2RNAA 3EGUA 1TTHB 1YJ9T 2M9UA 2WACA 3RDVA 4QVCA 2KYBA 5LJ3j 1X2KA 2GF7A 2OAUA 4IUPA 3LW5E 2NLUA 2D0NA 3OYAA 4OF1A 5CO7A 5CKDA 2D1XA 4LD6A 2SEMA 4L59A 2CP0A 4D8KA 3CPWP 2JVVA 4MDWA 1QVPA 3S3OA 3RESA 3JSCA 5GAOm 4KGVB 5KYYB 3CCRT 4M7AC 3UF4A 4M7AA 1B34B 1TWBA 1UUEA 1UFFA 3E19A 5CIUA 4PJOB 5LL6S 5LJ3g 4PJMA 4C92C 1WXBA 4HVUA 4C92A 5IXFA 3DB4A 2L3QA 5FRNA 5GJWB 3CPWA 1YN8A 2JW4A 3X20B 1QMCA 3KXTA 1WZOA 1BB9A 4OP0A 3GP8A 1ZBXA 5GAN8 1OPLA 1T3SA 4GBQA 4VUBA 2OTJA 1ARKA 1I81A 2J06A 4HCBA 4J9DA 4MZPA 4E7JA 2HSPA 2K3YA 4LUDA 3UA6A 4KH0B 5CQXA 3URGA 4M78B 3PMIA 3EFOA 2E41A 2K3XA 4OMNA 4DQ2A 1M30A 3C4SA 3WVDB 3L2WA 2RHIA 1H3ZA 3MEUA 4N4HA 4L6V5 5IHNA 4J9IA 1YP5A 2HBWA 2O4XB 1GCPA 2M02A 2DRKA 3FJPA 1RLQC 2DK3A 3JCMf 3OW2S 5KYUB 4LDUA 3NHNA 1QVFA 5LJ5h 3CC4A 2M51A 5LJ5f 4XTZA 1VQLQ 3OB9A 4XU3A 4Q5WA 4PK4A 2DM1A 2XDPA 4PJOF 3PTAA 3A1PA 1U06A 1WJQA 3AHUA 4QQGA 2QA4T 2OJ2A 5FW9A 1TH7A 3I56T 2QQAA 2AKLA 3SDZA 1FXXA 2JUFA 2VXEA 2GFUA 2L5QA 2YUOA 3HPWA 2V8KA 3M56A 2QEXQ 3PE0A 1VQ8T 1VQOT 1BBZA 2XG8D 1ZX6A 1M1KU 3MP8A 1Z9QA 4KGZB 2RD1A 4JZ3A 1YWOA 2O01E 4BE0A 4M78F 2JZ2A 1KC8C 2DYIA 1SKUB 4C8QC 2RO0A 4HVWA 4OMOA 2KGTA 4C8QA 1V29B 3GIBA 3HFOA 4BI3A 1BIAA 2J05A 3CCJA 3WXMB 2JJ9A 2D8HA 1RACB 5IAYA 1YCYA 3A5ZB 2FO0A 1GCQC 1GCQA 3MEAA 3JB9F 1ZA2B 3FRNA 2LQWA 1HJDA 4M77B 3INZA 1PCXA 2E6ZA 3RMQA 2O2OA 4C0DC 1VQMA 1QP2A 2B86A 3RBBB 3L1AA 1Q86R 1K73U 1M90R 4HVVA 1K8AC 1PM3A 2YHTA 1U8RA 1VOMA 5KYXA 1VQ9Q 2GGRA 2M0YA 1JXOA 2EGAA 4AG1C 3NGPA 4NL3A 4BY6C 2CS7A 5J26A 4AT1B 1G3WA 4PFPA 2E70A 2MAMA 1WHMA 4DBHA 3X25B 2DFUA 3REAB 2YXYA 2DLPA 3CBPA 3EH1A 2RH2A 4IIMA 1Y7XA 1PNJA 4QT7A 2QDYB 1I5OB 2RF0A 4O5VA 3CMEQ 2YUPA 2DD5A 1RAHB 3OQ5A 4E7LA 3EFSA 1YIJT 4KRTA 1D09B 4QKUA 3SD4A 1WX6A 4E6RA 2IIMA 3E9FA 1R0BG 3C95A 2VXFA 4JDSA 1TU0B 1D0ZA 1KQSP 3CPFA 4M77F 3VYHB 1S72T 2PVGB 1VQNQ 2AHJB 1VYUA 4M7AD 1VQ7Q 2KBTA 2CUDA 1F1BB 2DMOA 2LQNA 3V7RA 4C92D 1OQKA 3UPUA 2RB6A 3OYLA 3A8HB 2HKNA 4PJOE 1UGRB 3E2UA 4B6MA 2X3XD 3P8DA 1RAEB 3META 1K8AU 3JB9J 3CCLA 1QVGP 5EC7A 4JJNK 4M75B 4MMLA 1JXMA 2DVEA 2RHUA 3M57A 4C0FA 3MEWA 2JOYA 1VQKA 3TSZA 1AD5A 4M7AG 4DBRA 4HT9A 2K9GA 5GMKi 4B9WA 2OTLT 2L3RA 3G4SQ 3A8GB 1VA7A 4II1A 2VASA 4C92G 1M8VA 2LVMA 3J7AF 2VV5A 2MPXC 4Z88A 3L2RA 1OPKA 2P0PA 4M4ZA 3JCMb 3CC7Q 1IHVA 2GTJA 3I5SA 2C06A 2QI2A 3V7CA 4OB1B 4RTWA 4CRIA 3GLXA 3J80E 5LJ5j 1W2BP 3RNJA 1A0NB 2LJ3A 4AG2C 4FL6A 1SF9A 1W6XA 3OYHA 3CD6T 4M7DF 2JS0A 3EG9B 3G6EQ
chains in the Genus database with same CATH topology
2EKHA 3M0SA 2BZ8A 2GTOA 1WXUA 2PZ1A 1JU5C 1K1ZA 2CUBA 2LJ0A 2YSQA 2J6FA 2C0IA 2LZ6B 1G83A 2EYXA 1QWFA 2ESWA 4RUGA 2VWFA 1CKAA 1BK2A 2KRMA 1X2QA 1WFWA 3GBQA 2ECZA 1AWWA 1GFDA 1ZUKA 2RQUA 2DYBA 1NEBA 2KXCA 4A63B 5I22A 1KJWA 2KRNA 1ABOA 2RN8A 1HSQA 1OV3A 2CSIA 1M3CA 1NG2A 3EG3A 2C0TA 2JMCA 1UHFA 4OMMA 4HXJA 4J9FA 1SSHA 4ESRA 1UECA 5GJVB 2FPDA 3VRYA 2F2VA 1NYFA 2KROA 2EGCA 1EFNA 2VVKA 3M0TA 2RQTA 4J9BA 3NMZC 1WLPB 1NEGA 2XMFA 1TG0A 1E6HA 1AWXA 2MIOA 2DE0X 1UJYA 1PKTA 2YT6A 1FYNA 2KE9A 4LE9A 3H0IA 1UHCA 2L3PA 2K7AA 1GRIA 1UJ0A 2EYYA 2LX7A 2ROLA 4RTYA 1I07A 4J9GA 2DBKA 3SEMA 4JPBW 1YWPA 1UE9A 2NUZA 1K9AA 2KT8A 1T3LA 3VS2A 2NWMA 3QWXX 4ORZA 5L23A 2BTTA 4Z8AA 2KR3A 4CC4B 3M0PA 5IHKA 2CH4A 2LP5A 2ENMA 1Y57A 1QWEA 2FRYA 3PVQA 2AZVA 3EG2A 3U23A 2O31A 3EHRA 2RNAA 3EGUA 1OOTA 3H41A 2P4RA 4DEYA 5I11A 2KYBA 1WXTA 2JTEA 1N5ZA 1X2KA 2CDTA 1SEMA 2HDAA 2DX1A 3TVTA 4Z89A 2FPEA 2H8HA 3ZL7C 2DL5A 3VS4A 2D0NA 1X6GA 1XOVA 2GBQA 3VS1A 2D1XA 4J9HA 2SEMA 4D8KA 1M8MA 4CC3A 1PRMC 2HEQA 1MV0B 3UF4A 4F17A 1NYGA 1UUEA 1UFFA 1PRLC 2AZSA 1WXBA 4HVUA 4OMQA 1ZBJA 5IXFA 2O9VA 4JZ4A 2L3QA 2OI3A 5FWCA 2MOXA 5GJWB 2YUQA 1YN8A 2JW4A 2D8JA 5HCKA 1BB9A 1OPLA 1T3SA 4GBQA 2PNIA 2DL8A 1ARKA 2LNHB 1WA7A 2J06A 4J9DA 1PWTA 4LN2A 2HSPA 2RPNA 3VS5A 1I0CA 4LUDA 2DILA 5FWBA 3UA6A 1BU1A 2ED0A 2BZXA 1UG1A 4D8DA 1QKXA 4RTZA 1ZLMA 1X6BA 1X27A 1GFCA 1K76A 1VYVA 4OMNA 1Z9ZA 2KT1A 1AZGB 1M30A 1RUWA 1TUCA 2LCSA 1ZSGA 1AEYA 2RMOA 1WDXA 5IHNA 4J9IA 1K4US 1YP5A 2HBWA 1OEBA 1GCPA 1U3OA 2DRKA 2J6OA 4AFUC 1RLQC 2RQVA 2K2MA 4F14A 2CT3A 3NHNA 2FPFA 3C0CA 2M51A 4J9EA 2A37A 4JJBA 4DEXA 1W70A 2JXBA 2DM1A 3THKA 1YCSB 1ZUUA 1U06A 2OJ2A 5FW9A 2L0AA 3M0UA 3H0HA 2JM8A 2AKLA 2CT4A 2X3WD 3O5ZA 2DF6A 4LUEA 2YUOA 1AOJA 1CSKA 2W10A 2O88A 2RQWA 1H92A 3PE0A 2L3SA 3TSWA 2DVJA 3EG0A 3VS3A 1E7OA 1W1FA 3I5RA 1BBZA 1ZX6A 1Z9QA 2EYZA 4HCKA 1SHGA 4JZ3A 1YWOA 2G6FX 2ED1A 4IIOA 4J9CA 2K6DA 2FEIA 3M0QA 4OMOA 4HVWA 2KGTA 4OMPA 1GL5A 1RLPC 2ROTA 3R6NA 4CC7A 4AFQC 2J05A 2O9SA 4F16A 2D8HA 2VKNA 1AVZC 2JS2A 1PKSA 1WYXA 2V1RA 2FO0A 2I0NA 2J6KA 4K11A 1T0HA 1WIEA 2KXDA 1GCQC 1S1NA 4FSSA 1GCQA 3I9QA 1NLOC 1FMKA 1SPKA 2EQIA 4RTVA 1SRMA 1CKBA 3JV3A 4WCIA 2EVRA 1AZEA 2LQWA 1HJDA 1VYTA 1SHFA 1T0JA 5IHIA 1UTIA 2O2OA 2J7IA 2KYMA 2B86A 2W0ZA 1GBRA 2KRSA 3RBBB 2EW3A 5ECAA 4HVVA 5IXBA 2SRCA 4X1VA 2E5KA 4Y92A 2GGRA 3UATA 1IO6A 2M0YA 2K79A 1JXOA 2EGAA 4AG1C 3NGPA 2A36A 1KSWA 1JQQA 2GQIA 2C0OA 4RTUA 1E6GA 1J3TA 3VS6A 1MUZA 3SHWA 3REAB 2DLPA 4IIMA 3NPFA 1PNJA 2FG0A 2K3BA 4QT7A 2EGEA 2RF0A 2CREA 1M27C 2YUPA 1K0SA 2EBPA 2JT4A 2DL3A 4KRTA 2YDLA 1M3AA 1WI7A 1WX6A 2V1QA 2IIMA 3QWYA 4E6RA 4AFSC 1LCKA 2F2XA 1H3HA 4EIKA 4RTTA 3VS0A 2CSQA 2DL7A 1B3QA 2A08A 1VYUA 1QCFA 1NLPC 2KNBB 3A98A 2DL4A 2L2PA 3FJ5A 1GBQA 2CUDA 2KBTA 3LH5A 5IH2A 2DMOA 1G2BA 2LQNA 3PVLA 1UDLA 2DNUA 3EHQA 4R0KA 2HCKA 3UA7A 1RI9A 1AWJA 2X3XD 1UGVA 4LNPA 2ABLA 1M3BA 4JJDA 2JMAA 2YUNA 1U5SA 5EC7A 2QDLA 1JEGA 4GLMA 1Y0MA 2DJQA 2EYWA 2FRWA 1HD3A 2AKKA 2DRMA 3M0RA 1JXMA 3VRZA 4AFZC 1AWOA 1ABQA 1X69A 1JO8A 2LMJA 3TSZA 1AD5A 2BZYA 4RTXA 3IQLA 2F2WA 3EG1A 3VS7A 1V1CA 1MV3A 1TUDA 4OMLA 2MCNA 1QLYA 1NM7A 2K9GA 1YNZA 3KFVA 1K0XA 1VA7A 2AK5A 1KFZA 1QKWA 3CQTA 2JM9A 1B07A 3I35A 2LJ1A 4Z88A 1H8KA 2CH4W 1OPKA 2KEAA 1ZUYA 2DBMA 4M4ZA 2RQRA 2GTJA 3I5SA 4JJCA 4RTWA 2PTKA 1KIKA 1I1JA 3REBB 3ULRB 1PHTA 2A28A 1SRLA 2OAWA 4CC2A 3RNJA 1A0NB 2LJ3A 4AG2C 3H0FA 2DA9A 1W6XA 2GNCA 4ZNXA 1X43A 2JS0A 2EPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKH A;  3M0S A;  2BZ8 A;  2GTO A;  1WXU A;  2PZ1 A;  1JU5 C;  1K1Z A;  2CUB A;  2LJ0 A;  2YSQ A;  2J6F A;  2C0I A;  2LZ6 B;  1G83 A;  2EYX A;  1QWF A;  2ESW A;  4RUG A;  2VWF A;  1CKA A;  1BK2 A;  2KRM A;  1X2Q A;  1WFW A;  3GBQ A;  2ECZ A;  1AWW A;  1GFD A;  1ZUK A;  2RQU A;  2DYB A;  1NEB A;  2KXC A;  4A63 B;  5I22 A;  1KJW A;  2KRN A;  1ABO A;  2RN8 A;  1HSQ A;  1OV3 A;  2CSI A;  1M3C A;  1NG2 A;  3EG3 A;  2C0T A;  2JMC A;  1UHF A;  4OMM A;  4HXJ A;  4J9F A;  1SSH A;  4ESR A;  1UEC A;  5GJV B;  2FPD A;  3VRY A;  2F2V A;  1NYF A;  2KRO A;  2EGC A;  1EFN A;  2VVK A;  3M0T A;  2RQT A;  4J9B A;  3NMZ C;  1WLP B;  1NEG A;  2XMF A;  1TG0 A;  1E6H A;  1AWX A;  2MIO A;  2DE0 X;  1UJY A;  1PKT A;  2YT6 A;  1FYN A;  2KE9 A;  4LE9 A;  3H0I A;  1UHC A;  2L3P A;  2K7A A;  1GRI A;  1UJ0 A;  2EYY A;  2LX7 A;  2ROL A;  4RTY A;  1I07 A;  4J9G A;  2DBK A;  3SEM A;  4JPB W;  1YWP A;  1UE9 A;  2NUZ A;  1K9A A;  2KT8 A;  1T3L A;  3VS2 A;  2NWM A;  3QWX X;  4ORZ A;  5L23 A;  2BTT A;  4Z8A A;  2KR3 A;  4CC4 B;  3M0P A;  5IHK A;  2CH4 A;  2LP5 A;  2ENM A;  1Y57 A;  1QWE A;  2FRY A;  3PVQ A;  2AZV A;  3EG2 A;  3U23 A;  2O31 A;  3EHR A;  2RNA A;  3EGU A;  1OOT A;  3H41 A;  2P4R A;  4DEY A;  5I11 A;  2KYB A;  1WXT A;  2JTE A;  1N5Z A;  1X2K A;  2CDT A;  1SEM A;  2HDA A;  2DX1 A;  3TVT A;  4Z89 A;  2FPE A;  2H8H A;  3ZL7 C;  2DL5 A;  3VS4 A;  2D0N A;  1X6G A;  1XOV A;  2GBQ A;  3VS1 A;  2D1X A;  4J9H A;  2SEM A;  4D8K A;  1M8M A;  4CC3 A;  1PRM C;  2HEQ A;  1MV0 B;  3UF4 A;  4F17 A;  1NYG A;  1UUE A;  1UFF A;  1PRL C;  2AZS A;  1WXB A;  4HVU A;  4OMQ A;  1ZBJ A;  5IXF A;  2O9V A;  4JZ4 A;  2L3Q A;  2OI3 A;  5FWC A;  2MOX A;  5GJW B;  2YUQ A;  1YN8 A;  2JW4 A;  2D8J A;  5HCK A;  1BB9 A;  1OPL A;  1T3S A;  4GBQ A;  2PNI A;  2DL8 A;  1ARK A;  2LNH B;  1WA7 A;  2J06 A;  4J9D A;  1PWT A;  4LN2 A;  2HSP A;  2RPN A;  3VS5 A;  1I0C A;  4LUD A;  2DIL A;  5FWB A;  3UA6 A;  1BU1 A;  2ED0 A;  2BZX A;  1UG1 A;  4D8D A;  1QKX A;  4RTZ A;  1ZLM A;  1X6B A;  1X27 A;  1GFC A;  1K76 A;  1VYV A;  4OMN A;  1Z9Z A;  2KT1 A;  1AZG B;  1M30 A;  1RUW A;  1TUC A;  2LCS A;  1ZSG A;  1AEY A;  2RMO A;  1WDX A;  5IHN A;  4J9I A;  1K4U S;  1YP5 A;  2HBW A;  1OEB A;  1GCP A;  1U3O A;  2DRK A;  2J6O A;  4AFU C;  1RLQ C;  2RQV A;  2K2M A;  4F14 A;  2CT3 A;  3NHN A;  2FPF A;  3C0C A;  2M51 A;  4J9E A;  2A37 A;  4JJB A;  4DEX A;  1W70 A;  2JXB A;  2DM1 A;  3THK A;  1YCS B;  1ZUU A;  1U06 A;  2OJ2 A;  5FW9 A;  2L0A A;  3M0U A;  3H0H A;  2JM8 A;  2AKL A;  2CT4 A;  2X3W D;  3O5Z A;  2DF6 A;  4LUE A;  2YUO A;  1AOJ A;  1CSK A;  2W10 A;  2O88 A;  2RQW A;  1H92 A;  3PE0 A;  2L3S A;  3TSW A;  2DVJ A;  3EG0 A;  3VS3 A;  1E7O A;  1W1F A;  3I5R A;  1BBZ A;  1ZX6 A;  1Z9Q A;  2EYZ A;  4HCK A;  1SHG A;  4JZ3 A;  1YWO A;  2G6F X;  2ED1 A;  4IIO A;  4J9C A;  2K6D A;  2FEI A;  3M0Q A;  4OMO A;  4HVW A;  2KGT A;  4OMP A;  1GL5 A;  1RLP C;  2ROT A;  3R6N A;  4CC7 A;  4AFQ C;  2J05 A;  2O9S A;  4F16 A;  2D8H A;  2VKN A;  1AVZ C;  2JS2 A;  1PKS A;  1WYX A;  2V1R A;  2FO0 A;  2I0N A;  2J6K A;  4K11 A;  1T0H A;  1WIE A;  2KXD A;  1GCQ C;  1S1N A;  4FSS A;  1GCQ A;  3I9Q A;  1NLO C;  1FMK A;  1SPK A;  2EQI A;  4RTV A;  1SRM A;  1CKB A;  3JV3 A;  4WCI A;  2EVR A;  1AZE A;  2LQW A;  1HJD A;  1VYT A;  1SHF A;  1T0J A;  5IHI A;  1UTI A;  2O2O A;  2J7I A;  2KYM A;  2B86 A;  2W0Z A;  1GBR A;  2KRS A;  3RBB B;  2EW3 A;  5ECA A;  4HVV A;  5IXB A;  2SRC A;  4X1V A;  2E5K A;  4Y92 A;  2GGR A;  3UAT A;  1IO6 A;  2M0Y A;  2K79 A;  1JXO A;  2EGA A;  4AG1 C;  3NGP A;  2A36 A;  1KSW A;  1JQQ A;  2GQI A;  2C0O A;  4RTU A;  1E6G A;  1J3T A;  3VS6 A;  1MUZ A;  3SHW A;  3REA B;  2DLP A;  4IIM A;  3NPF A;  1PNJ A;  2FG0 A;  2K3B A;  4QT7 A;  2EGE A;  2RF0 A;  2CRE A;  1M27 C;  2YUP A;  1K0S A;  2EBP A;  2JT4 A;  2DL3 A;  4KRT A;  2YDL A;  1M3A A;  1WI7 A;  1WX6 A;  2V1Q A;  2IIM A;  3QWY A;  4E6R A;  4AFS C;  1LCK A;  2F2X A;  1H3H A;  4EIK A;  4RTT A;  3VS0 A;  2CSQ A;  2DL7 A;  1B3Q A;  2A08 A;  1VYU A;  1QCF A;  1NLP C;  2KNB B;  3A98 A;  2DL4 A;  2L2P A;  3FJ5 A;  1GBQ A;  2CUD A;  2KBT A;  3LH5 A;  5IH2 A;  2DMO A;  1G2B A;  2LQN A;  3PVL A;  1UDL A;  2DNU A;  3EHQ A;  4R0K A;  2HCK A;  3UA7 A;  1RI9 A;  1AWJ A;  2X3X D;  1UGV A;  4LNP A;  2ABL A;  1M3B A;  4JJD A;  2JMA A;  2YUN A;  1U5S A;  5EC7 A;  2QDL A;  1JEG A;  4GLM A;  1Y0M A;  2DJQ A;  2EYW A;  2FRW A;  1HD3 A;  2AKK A;  2DRM A;  3M0R A;  1JXM A;  3VRZ A;  4AFZ C;  1AWO A;  1ABQ A;  1X69 A;  1JO8 A;  2LMJ A;  3TSZ A;  1AD5 A;  2BZY A;  4RTX A;  3IQL A;  2F2W A;  3EG1 A;  3VS7 A;  1V1C A;  1MV3 A;  1TUD A;  4OML A;  2MCN A;  1QLY A;  1NM7 A;  2K9G A;  1YNZ A;  3KFV A;  1K0X A;  1VA7 A;  2AK5 A;  1KFZ A;  1QKW A;  3CQT A;  2JM9 A;  1B07 A;  3I35 A;  2LJ1 A;  4Z88 A;  1H8K A;  2CH4 W;  1OPK A;  2KEA A;  1ZUY A;  2DBM A;  4M4Z A;  2RQR A;  2GTJ A;  3I5S A;  4JJC A;  4RTW A;  2PTK A;  1KIK A;  1I1J A;  3REB B;  3ULR B;  1PHT A;  2A28 A;  1SRL A;  2OAW A;  4CC2 A;  3RNJ A;  1A0N B;  2LJ3 A;  4AG2 C;  3H0F A;  2DA9 A;  1W6X A;  2GNC A;  4ZNX A;  1X43 A;  2JS0 A;  2EPD A; 
#chains in the Genus database with same CATH topology
 1YJN A;  3L2U A;  2GTO A;  1U1S A;  1WXU A;  1JU5 C;  2J6F A;  2C0I A;  1RL2 A;  5GAM f;  3JCM c;  2EYX A;  2MYS A;  3JCM g;  1W2B A;  2DD4 A;  3GOX A;  1OZ2 A;  1GFD A;  4M75 F;  3CC2 A;  1OYX A;  2RQU A;  4RG8 A;  5L8R E;  2QQB A;  4ZGE B;  3GNG A;  2RI2 A;  1YIT A;  4ZGJ B;  5I22 A;  8ATC B;  1HSQ A;  1VQ5 A;  1NG2 A;  4BB7 A;  3OMC A;  3V7S A;  4HXJ A;  4C8Q D;  1SSH A;  4ESR A;  1FMW A;  4J7I A;  4F7U A;  2HQX A;  1UEC A;  1K73 R;  3I55 Q;  3VRY A;  2YRC A;  4XAX B;  2EGC A;  2EFI A;  3M4Y A;  5FU6 C;  1OX9 A;  3M0T A;  3NMZ C;  1NEG A;  1JJ2 A;  2CZ7 B;  2XMF A;  2HQH A;  1E6H A;  1AWX A;  1D1A A;  2DE0 X;  1PKT A;  1FYN A;  3CCS Q;  4RCB A;  3H0I A;  1UHC A;  1YBY A;  2K7A A;  2QXF A;  2ZPI B;  2XI9 A;  2V8I A;  5GAN d;  1HXD A;  2MF2 A;  1I07 A;  3CCV A;  2DBK A;  4C8Q G;  4J6W A;  2NUZ A;  1YI2 A;  4ORZ A;  1KC8 R;  2CP5 A;  4Z8A A;  4CC4 B;  3OBW A;  3M0P A;  2RHZ A;  1K9M C;  2ENM A;  2COZ A;  1M1F A;  4JLI A;  1VQP T;  3PVQ A;  3LGL A;  1YI2 Q;  2AZV A;  3U23 A;  5A0D A;  3ZBD A;  3PNW C;  1R0C B;  4HCC A;  2K4Y A;  4KGX B;  5I11 A;  2JTE A;  2EQK A;  1G3Y A;  3CCQ A;  3TVT A;  3V8K A;  4Z89 A;  2FPE A;  2H8H A;  4XTW A;  3ZL7 C;  4OGE A;  2E65 A;  2YRD A;  4PL6 A;  3VS1 A;  4LDX A;  4J9H A;  3QHS A;  1M8M A;  3S6W A;  2HEQ A;  1K8A R;  3KBG A;  4XK8 E;  3QKJ A;  4C5E A;  4OGC A;  2VGM A;  2FZG B;  2VYT A;  2AZS A;  3OYJ A;  2GFA A;  2GQV A;  3RKX A;  2M0O A;  2K2V A;  3CPW S;  1FMV A;  4UC4 A;  1MMD A;  1Y96 A;  5GAN 3;  4M7D E;  5GMK e;  3CCE A;  1VQ6 A;  3QPH A;  4KUI A;  5J3B A;  2PNI A;  2DL8 A;  5D6X A;  1YHQ A;  2EQM A;  5KYW A;  3CCU Q;  2A7Y A;  1DJ7 B;  3CBM A;  3VS5 A;  1I0C A;  2DIL A;  2ED0 A;  1Q7Y U;  1X01 A;  1I4K 1;  3EGD A;  1UG1 A;  2ZPG B;  3ME9 A;  2GCX A;  5I2S A;  4C0Z A;  1K9M U;  2DAQ A;  5AYF A;  1X27 A;  4M75 E;  4NS5 A;  2KT1 A;  2LQ8 A;  4PFO A;  4E7Z A;  4FM4 B;  4TVR A;  3G71 A;  2LCS A;  2CZ0 B;  3A8M B;  5GAN 4;  1C1A A;  2LT1 A;  2ZPF B;  3OBY A;  1N9R A;  1U3O A;  2OX7 A;  5FRO A;  3OS2 A;  3CMA T;  3QJ6 A;  4FYW B;  1Q81 U;  1QVF S;  3QBY A;  4X9D A;  4JJB A;  4X34 A;  4BDY A;  3HHT B;  5GMK m;  1W70 A;  2BIV A;  1ZUU A;  3PIO A;  3FEO A;  4EMG A;  4B9X A;  3S3N A;  2HZY A;  2RK2 A;  1YJW Q;  4C0G A;  2X3W D;  2DF6 A;  2FL7 A;  1ZSZ C;  4M7A B;  1ZSZ A;  1OI1 A;  3EAE A;  2CP7 A;  2W10 A;  3QII A;  5GAN h;  2E5Q A;  2F1L A;  1H92 A;  4C92 B;  4LXC A;  2DZ9 A;  2DIQ A;  3OYN A;  3CCM T;  3TSW A;  5D6Y A;  3VS3 A;  3MP1 A;  1E7O A;  2QG9 B;  3H9N A;  4XU2 A;  3JCM X;  1VUB A;  2G6F X;  2M1H A;  2ED1 A;  1EX4 A;  4IIO A;  1YJ9 Q;  4J9C A;  3QYH B;  2K6D A;  2LDM A;  2CYZ B;  1BCM A;  2ZPE B;  2ROT A;  3VJP A;  1M4Z A;  3LYI A;  2O9S A;  4F16 A;  4GY5 A;  1PKS A;  1WYX A;  5GAM g;  3X28 B;  2F69 A;  2M16 A;  2J6K A;  4K11 A;  4ANJ A;  2RM4 A;  1WIE A;  1S1N A;  4XTU A;  4FSS A;  3QDR B;  1OZ3 A;  1FMK A;  1SPK A;  3CCR Q;  1CKB A;  2EVR A;  1AZE A;  1VYT A;  2HD0 A;  2EQJ A;  4XQ3 A;  1KK7 A;  4BDZ A;  4P5N A;  1NE8 A;  1M2V A;  3OYB A;  1XJW B;  2CGH A;  1GBR A;  4ZTJ A;  2EW3 A;  3QYG B;  5CQY A;  5IXB A;  4BE2 A;  4X1V A;  1LJO A;  1M1K C;  2I2L A;  2WSF E;  3VU3 C;  4F7U G;  3OYK A;  3SFM A;  1KSW A;  1JQQ A;  1PSF A;  4C92 F;  3MEV A;  1J3T A;  1TS9 A;  2PU9 B;  1MUZ A;  1M1G A;  4JLG A;  4ZN1 A;  1IRX A;  1VIF A;  3HTR A;  3PGG A;  1KD1 C;  3BW1 A;  2D6F A;  3OS5 A;  3CXC P;  4IUR A;  2CRE A;  5GAN 6;  1VQL A;  2OTJ T;  1K0S A;  4FU6 A;  5KYY A;  2JT4 A;  1M3A A;  3A8O B;  3DLL A;  2YLB A;  2V1Q A;  3L2Z A;  1K73 C;  4C8Q B;  8AT1 B;  2DEQ A;  4PKC C;  4AFS C;  4PJO A;  1LCK A;  4BI8 B;  2KY9 A;  3VYG A;  4PFZ A;  1Y71 A;  4EIK A;  4EMH A;  4RTT A;  3VS0 A;  4RMO A;  3CXC A;  1NPP A;  2QEX A;  4DOV A;  2E64 A;  2HKQ B;  2KNB B;  3AT1 B;  2QA4 Q;  2DL4 A;  2L2P A;  1GBQ A;  5CAI A;  1G2B A;  3I56 Q;  2VUB A;  1K9M R;  3TEE A;  5KE3 A;  1D3B A;  3UA7 A;  1UGP B;  1UGV A;  4LNP A;  4A4H A;  3CC4 T;  4JJD A;  3BDL A;  2JMA A;  4C0D B;  3TU4 K;  3H6Z A;  5GMK l;  1JEG A;  2QQ9 A;  2DRM A;  1VQO Q;  5KYX B;  5KCO A;  3VRZ A;  1AWO A;  2LMJ A;  2VC8 A;  1Q81 R;  3HRT A;  2BZY A;  3IQL A;  3GNF B;  4OML A;  2MCN A;  4BY6 B;  2X4J A;  1QLY A;  1NM7 A;  2X9H A;  1YNZ A;  3BY7 A;  3KFV A;  5DLO A;  1U1T A;  1K0X A;  1O9S A;  1KFZ A;  3CQT A;  1KD1 U;  1B07 A;  3OYF A;  2LJ1 A;  5GMK h;  1H8K A;  2XU8 A;  2E4H A;  2CH4 W;  1ZUY A;  2R5M A;  2D0Q B;  1VQ9 A;  5GAO q;  3M59 A;  2DXC A;  4JJC A;  4O6J A;  2Z0W A;  1KIK A;  3H8Z A;  3REB B;  1PHT A;  4CC2 A;  3CCJ T;  1XQH A;  4RCC A;  2GNC A;  3E9G A;  1X43 A;  4ZNX A;  4X9C A;  4JRP A;  3FIF A;  2EPD A;  1PC0 A;  4RG2 A;  1LVK A;  1TSF A;  2PZ1 A;  2LJ0 A;  2LZ6 B;  3ZFJ A;  2IPO B;  1G83 A;  1G3S A;  4E7S A;  1IXD A;  2LCC A;  2ESW A;  4YTL A;  2VWF A;  1CKA A;  5I2M A;  3CME A;  1D1B A;  1TOV A;  3JCM P;  1W2B S;  5GAN j;  1VQM T;  1X2Q A;  4A53 A;  1WFW A;  3GBQ A;  1AWW A;  2DYB A;  7AT1 B;  1KJW A;  4C92 E;  4OB0 B;  1XNI A;  2RN8 A;  2CSI A;  1NBE B;  3OW2 P;  1VQN A;  1VQ7 A;  3BE3 A;  4JRK A;  2ZCF B;  1YIJ Q;  1NYF A;  2X4Y A;  1UEB A;  2DKG A;  2E3I A;  4A4E A;  4F04 B;  2DZC A;  1N6A A;  1JJ2 S;  3OYM A;  1TG0 A;  4D6W A;  3JCM Q;  1EZZ B;  1S72 Q;  1MNE A;  1RAI B;  2KE9 A;  1VQ4 A;  2R57 A;  2L3P A;  1UJ0 A;  2EYY A;  3QZ5 B;  2LX7 A;  3PMT A;  1KQS A;  3SEM A;  3FC3 A;  3M58 A;  1VQ4 Q;  3LWI A;  5HK0 A;  4IKF A;  2LNV A;  3QWX X;  5L23 A;  4J8O A;  3G4S A;  2BTT A;  4XTY A;  2A3L A;  2KR3 A;  2NYS A;  1NZ9 A;  2A0F B;  2CH4 A;  3CC7 A;  1OOT A;  3H41 A;  1QVG A;  2P4R A;  4M78 E;  2OTL Q;  1WXT A;  3FB9 A;  5FU7 C;  1SEM A;  3QXE B;  5GAN e;  2H3E B;  3CCL T;  2DX1 A;  2K5I A;  4QVZ A;  2DL5 A;  2H3J A;  3VS4 A;  1X6G A;  2GBQ A;  4JRQ A;  3G6E A;  1JBM A;  1RI0 A;  1VQK T;  4CC3 A;  4A4K A;  2ZGW A;  4FT2 A;  4M7D C;  3GPL A;  4M7D A;  1WQ7 A;  4J6X A;  1M1K R;  1KHI A;  1QW1 A;  5CK9 A;  2CZ6 B;  3WVE B;  3CD6 Q;  2AIR B;  5CVI A;  4BD3 A;  3QJY A;  4OMQ A;  5FU6 B;  4JZ4 A;  1EIF A;  4IUV A;  2OI3 A;  5FWC A;  2MOX A;  3JCM J;  2D8J A;  5HCK A;  6AT1 B;  1C0M A;  4M75 A;  2QAS A;  1B7T A;  1WA7 A;  2LNH B;  5LJ5 g;  4R55 A;  1KD1 R;  1BYM A;  1PWT A;  1OU8 A;  3I55 A;  2XID A;  2PUO B;  2IVW A;  1BU1 A;  3VUZ A;  1YJN T;  4D8D A;  4QVD A;  1QKX A;  4RTZ A;  2KMT A;  2WSC E;  3EGX A;  1M2O A;  4PLI A;  4E7K A;  3M55 A;  2EJF A;  4J83 A;  1GFC A;  1SSF A;  2WSE E;  1K76 A;  1VYV A;  2K5F A;  2RHY A;  1AZG B;  4FW1 A;  1RUW A;  1AHJ B;  3LH0 A;  5LJ3 h;  1ZSG A;  3CCS A;  4NL2 A;  1WDX A;  2EJ9 A;  3JB9 D;  1K4U S;  2RHX A;  3CC2 T;  2RJF A;  2J6O A;  4AFU C;  1YIT T;  5GMK j;  2RQV A;  2K2M A;  4F14 A;  4ZGD B;  2BE9 B;  2L8D A;  4N0A A;  2FZC B;  2FPF A;  2HQE A;  3C0C A;  1G8X A;  1VQ5 T;  2A37 A;  3HKS A;  4A4G A;  4M77 E;  5C0M A;  5CKE A;  2EQU A;  4OMF B;  2XDB A;  2QTV A;  3SWN C;  3M0U A;  3SWN A;  3H0H A;  2JM8 A;  2CT4 A;  1Q7Y C;  4LUE A;  1UGS B;  2DO3 A;  3LGF A;  1AOJ A;  1CSK A;  2HL3 A;  2RQW A;  3JB9 G;  4BE1 A;  4J7F A;  2L3S A;  2CP2 A;  2DVJ A;  3EG0 A;  2L89 A;  1VQP Q;  2K5L A;  1W1F A;  3I5R A;  2EYZ A;  2RJC A;  3N5B B;  4NOY A;  3CCV T;  2KVQ G;  1G5V A;  4N4G A;  5M9O A;  2QYZ A;  2F5K A;  2LQK A;  3JB9 H;  3M0Q A;  2FEI A;  5KYW B;  1YI2 T;  3V8L A;  4OMP A;  3TRE A;  1Q81 C;  1WGS A;  1H64 1;  1RLP C;  1GL5 A;  3R6N A;  2RI5 A;  3NFC A;  4PJL A;  4L5G A;  2KSS A;  5HK3 A;  4EMK C;  2V26 A;  4EMK A;  1BKB A;  1WJR A;  2V1R A;  3EGD B;  1IZ6 A;  1T0H A;  1D0Y A;  2BUD A;  1G3T A;  1NLO C;  4RTV A;  3JV3 A;  5FLX E;  4JUV A;  4A54 A;  5GAN 7;  1SHF A;  1T0J A;  2E3H A;  3CCU A;  1UTI A;  3CCQ T;  3M4G A;  1ZA1 B;  2KRS A;  1WNL A;  2X35 A;  4Y92 A;  4OB3 B;  3MCA B;  2NUP A;  5AT1 B;  1IO6 A;  2EYQ A;  3JCM V;  2K79 A;  2GQI A;  2DTO A;  2C0O A;  4FYV B;  4RTU A;  1E6G A;  3SHW A;  1RAA B;  4E2F B;  4ZN3 A;  1ZSZ B;  3QUI A;  3NPF A;  2FG0 A;  2K3B A;  2E12 A;  3RR6 A;  3CCE T;  1VQ6 T;  1IGQ A;  1YHQ T;  3BDU A;  2RJE A;  4BAC A;  4ZTF A;  2EBP A;  5GAO p;  3OYE A;  2PUK B;  4A4F A;  3OA6 A;  3CMA Q;  3QWY A;  1YJW A;  1M9S A;  4LDY A;  2HAX A;  2ATC B;  2F2X A;  1H3H A;  4M7D D;  4AMC A;  5IT9 E;  1PG5 B;  3CXC S;  2QQS A;  3G71 T;  2A08 A;  1QCF A;  1NLP C;  1HK9 A;  3A98 A;  2X4X A;  2YRV A;  2DNU A;  3EHQ A;  2NUT A;  2HCK A;  3UDC A;  1YJ9 A;  2ZPB B;  5GAN f;  1YFN A;  1RI9 A;  1AWJ A;  3MKD A;  2XD0 A;  1BI0 A;  1M3B A;  3P8H A;  1M2V B;  4M75 D;  1OU9 A;  4KH1 B;  2QDL A;  5HKC A;  4GLM A;  1Y0M A;  2LCL A;  3CCM Q;  2DJQ A;  1HD3 A;  3M0R A;  1LNX A;  5GAN 5;  4QW2 A;  1JO8 A;  4M7D G;  4KUL A;  1TUG B;  4N4I A;  3MPU B;  4DBF A;  2F2W A;  3CCR A;  3VS7 A;  2KDS A;  2JN0 A;  1TUD A;  1RAF B;  1M90 U;  2RJD A;  1X75 C;  2DET A;  1M5Q 1;  3EFO B;  1QKW A;  2JM9 A;  2COW A;  4JS5 A;  1MGQ A;  2KEA A;  2DBM A;  4Z02 A;  2RQR A;  1WHJ A;  2DEU A;  2FHD A;  3PIP A;  2P84 A;  4QQD A;  2DXB A;  4M75 G;  3OY9 A;  2DXU A;  2E1H A;  5CKH A;  2DJZ A;  2DIG A;  1I1J A;  1D0X A;  3QDF A;  4DOW A;  1Q82 U;  4JRI A;  1SRL A;  2DPP B;  2OAW A;  3DKM A;  4Y28 E;  1TXQ A;  4MMK A;  1P92 A;  4MDX A;  2EKH A;  1RAG B;  2BZ8 A;  4M7A F;  3HRU A;  3DLM A;  5KYN A;  1SG5 A;  2CUB A;  4PJJ A;  3M54 A;  5CCA A;  1IB8 A;  3G7Z A;  9ATC B;  3PT9 A;  2IG0 A;  4WTO B;  4IUU A;  1QWF A;  3T9N A;  2EKO A;  1KQ2 A;  1NJI C;  5C6S A;  1HYO A;  1ZUK A;  4BI4 A;  1D3B B;  1JB0 E;  3OYC A;  1NEB A;  2KXC A;  1KQ1 A;  5FRM A;  3SB2 A;  1OV3 A;  2BE7 D;  2OTJ Q;  3EG3 A;  2C0T A;  4OMM A;  2E10 A;  5KE2 A;  4J9F A;  1N8R C;  1QVF P;  3LX7 A;  3KUF A;  2KQW A;  5GJV B;  2FPD A;  2QA4 A;  1B34 A;  5CKB A;  2KRO A;  4EPC A;  4PJO C;  4PJN A;  5GAM e;  3I56 A;  2QQR A;  2VVK A;  2RQT A;  3QZ9 B;  5HY6 A;  4IUT A;  2YWW A;  3Q1J A;  3JCM h;  2CZ1 B;  1Q7Y R;  3JCM W;  1LOJ A;  3UWN A;  1VQL T;  5LJ3 e;  1VQ8 A;  1I8F A;  1OUL A;  3A8L B;  1WHG A;  1GRI A;  3D7S B;  1VQO A;  2JTF A;  3GF5 A;  4MZM A;  2YLC A;  3RIR A;  1KQS S;  3HRS A;  3F70 A;  4JPB W;  1BIB A;  5GAN 2;  1VQ8 Q;  3CC4 Q;  2KT8 A;  4M78 C;  4M78 A;  2NWM A;  4HA8 A;  2EAY A;  2XDD A;  1VIE A;  2PVD B;  2QEX T;  4DBQ A;  3NTI A;  3V8J A;  2ZPH B;  1MND A;  3L2Q A;  2PQW A;  3EG2 A;  2O4X A;  3EHR A;  1KG1 A;  1NJI U;  4DEY A;  1QVG S;  2JTM A;  3MO8 A;  1N5Z A;  2CDT A;  4LD9 K;  5KYU A;  3TQ7 P;  2HDA A;  3HP9 A;  3VKI A;  1XOV A;  4C8Q F;  2COY A;  3OSV A;  1N8R U;  3M9Q A;  4KT0 E;  1PRM C;  1MV0 B;  1UGQ B;  2AT1 B;  2FYK A;  3VUB A;  3CCJ Q;  3OMG A;  4F17 A;  1NYG A;  1PRL C;  5KCH A;  1ZBJ A;  2O9V A;  3P8B B;  4GLK A;  3OSS C;  5GAM d;  4OVA A;  2YUQ A;  1VQ9 T;  2MMP A;  4XTX A;  1MHN A;  5GAO l;  4M7A E;  4FW2 A;  4LN2 A;  1VQM Q;  5A0G A;  3MP6 A;  3DB3 A;  5LJ3 d;  2BKD N;  2RPN A;  1YIJ A;  5FWB A;  1N27 A;  3ER0 A;  2BZX A;  2R58 A;  1BI3 A;  1ZLM A;  1X6B A;  3JB9 I;  1MMG A;  1C6V X;  1Q82 R;  2DTH A;  1Z9Z A;  2ZZD A;  1S72 A;  3QG1 A;  1PD0 A;  1PSE A;  1TUC A;  3OS0 A;  4M77 C;  2MK5 A;  4M77 A;  3RKW A;  3CME T;  5GAN g;  2HBP A;  2VB6 A;  1AEY A;  1IGU A;  2RMO A;  5D6W A;  5J39 A;  1OEB A;  1JRI A;  1BI1 A;  1KC8 U;  2G3R A;  2FB7 A;  3OW2 A;  2CT3 A;  4FYY B;  5FU7 B;  1UB4 A;  4J9E A;  2Y4X A;  3QO3 A;  4DEX A;  3OYI A;  2KAF A;  1VQN T;  2JXB A;  3THK A;  1YCS B;  4J5Y A;  1VQ7 T;  3X26 B;  3L42 A;  2V8J A;  2L0A A;  2FZK B;  1D1C A;  1X6O A;  4M7D B;  2HNI A;  4JS4 A;  2PVO B;  3O5Z A;  3O8V A;  1RAD B;  3PFS A;  2HL5 C;  2OTL A;  2O88 A;  3J81 E;  2DXT A;  3UT1 A;  4KUD K;  1VQ4 T;  3EH2 A;  4PNO A;  3RMS A;  1IHW A;  4HCK A;  1SHG A;  4FCY A;  2Y4Y A;  3NTK A;  4E7I A;  3HSB A;  2ZAE A;  3JRZ A;  1MMN A;  1R77 A;  2LTO A;  3CCL Q;  4CC7 A;  4AFQ C;  3R6O A;  2KI7 A;  2VKN A;  3G4S T;  1AVZ C;  1QCN A;  2DTI A;  2JS2 A;  3CD6 A;  1XTD A;  3M53 A;  2RK1 A;  2P0K A;  2I0N A;  4C5G A;  4IUQ A;  3EGX B;  1VQK Q;  2KXD A;  4F7U B;  3I9Q A;  4KBM B;  4PJO D;  3CC7 T;  2EQI A;  1SRM A;  4WCI A;  1N9S A;  4C8Q E;  3HL8 A;  5IHI A;  4DA4 A;  3RKY A;  3JAM E;  2J7I A;  2KYM A;  4ATO A;  2W0Z A;  1R8O B;  5ECA A;  4RKU E;  2SRC A;  4LDW A;  3G6E T;  4M75 C;  2CP6 A;  1NJI R;  2E5K A;  2RA2 A;  1RAB B;  3CBO A;  3UAT A;  5CKF A;  4ELY C;  5KH6 A;  2A36 A;  2MWP A;  4M78 D;  5GAM h;  3OYD A;  3RER A;  1WQW A;  4ME7 A;  2XHC A;  4PJO G;  3SWN B;  4C5H A;  3VS6 A;  5D7U A;  1N8R R;  3RUX A;  1YJN Q;  2EJG A;  3G1J A;  5LJ3 f;  5GAO r;  2EGE A;  1JJ2 P;  1M27 C;  2XK0 A;  5DM7 R;  4ELZ C;  2X51 A;  4FIB A;  4N0A C;  3CC2 Q;  2DL3 A;  3I55 T;  2YDL A;  1YIT Q;  3MJX A;  2DER A;  2HSE B;  4F7U F;  1WI7 A;  3EG9 A;  3CEY A;  2QAZ A;  4M78 G;  1QP3 A;  3FLG A;  3BFM A;  1VQ5 Q;  2XKO C;  3C12 A;  5I21 A;  4EDU A;  2LT4 A;  2CSQ A;  3OYY A;  5A2Q E;  4EMK B;  2DL7 A;  1B3Q A;  1WPY A;  1QCO A;  3ASK A;  3CCS T;  3L2V A;  1O75 A;  3HFN A;  2LC4 A;  1VQP A;  3FJ5 A;  2QGG A;  3LH5 A;  5IH2 A;  3PVL A;  1FX7 A;  1UDL A;  3OYG A;  2EIF A;  4R0K A;  4BUG A;  5IN1 A;  3M5A A;  5DY9 A;  2QGF B;  2ABL A;  3JCM e;  2YUN A;  1U5S A;  2E6N A;  2Y90 A;  1Y96 B;  4R56 A;  2EYW A;  2FRW A;  5LJ5 e;  2AKK A;  4AFZ C;  1BCO A;  5A0L A;  1ABQ A;  1X69 A;  2NUP B;  4E7H A;  2CKK A;  2QK0 A;  4E47 A;  2P4T A;  1NPR A;  3CCV Q;  4RTX A;  1FWZ A;  3EG1 A;  1V1C A;  1MV3 A;  2JNG A;  1AT1 B;  1MMA A;  1IRE B;  2XIC A;  2AK5 A;  4XTV A;  5GAO n;  4M77 D;  3NTH A;  1LPL A;  3I35 A;  3C94 A;  2FVU A;  4FSX A;  5DLQ E;  2CP3 A;  4HKE A;  4XU1 A;  1WHK A;  4V2S A;  2PTK A;  2RI3 A;  3ULR B;  4MZT A;  4J6Y A;  2A28 A;  3CCQ Q;  1W4S A;  3E1S A;  3LLR A;  3H0F A;  2DA9 A;  4Y91 A;  1WHH A;  2QTX A;  2MWO A;  3M0S A;  5CR2 A;  4HCZ A;  3OS1 A;  3S3M A;  1K1Z A;  2YSQ A;  1Y07 A;  4M77 G;  1WHL A;  3FDR A;  4XU0 A;  4RUG A;  1Q86 C;  1M90 C;  1BK2 A;  4PLL A;  3MHX A;  2KRM A;  3CCU T;  2KK4 A;  1WJS A;  1PD1 A;  1OX8 A;  2ECZ A;  2NUT B;  4FT4 A;  1V76 A;  4A63 B;  3CMA A;  2KRN A;  3X24 B;  1ABO A;  4CI0 C;  1ZQ1 A;  2HMA A;  2R5A A;  3CCE Q;  1VQ6 Q;  1M3C A;  2JMC A;  4OB2 B;  1UHF A;  1YHQ Q;  1ZHI A;  3JCM d;  1Q82 C;  2EWN A;  1GXI E;  4QQ6 A;  2F2V A;  4WF2 A;  5LJ5 d;  1EFN A;  1BI2 A;  3QSU A;  2X4W A;  4J9B A;  1WLP B;  2B8A A;  2D9T A;  3EFR A;  2VGN A;  2MIO A;  1UJY A;  3G71 Q;  1KHC A;  4F7U E;  2YT6 A;  4HT8 A;  4LE9 A;  1I5L A;  3CCM A;  1QQJ A;  2K57 A;  1Q95 G;  5EG2 A;  2ROL A;  4RTY A;  1ACM B;  4J9G A;  1YJW T;  3TCJ A;  1YWP A;  2LRQ A;  1UE9 A;  4FYX B;  1K9A A;  2F5T X;  1T3L A;  3VS2 A;  3VV0 A;  2LX9 A;  5IHK A;  4LDV A;  5GAM j;  4C5I A;  2LP5 A;  1Y57 A;  1QWE A;  2FRY A;  3LWH A;  2P0Q A;  2MI6 A;  1Q86 U;  2O31 A;  3ZEH A;  2RNA A;  3EGU A;  1TTH B;  1YJ9 T;  2M9U A;  2WAC A;  3RDV A;  4QVC A;  2KYB A;  5LJ3 j;  1X2K A;  2GF7 A;  2OAU A;  4IUP A;  3LW5 E;  2NLU A;  2D0N A;  3OYA A;  4OF1 A;  5CO7 A;  5CKD A;  2D1X A;  4LD6 A;  2SEM A;  4L59 A;  2CP0 A;  4D8K A;  3CPW P;  2JVV A;  4MDW A;  1QVP A;  3S3O A;  3RES A;  3JSC A;  5GAO m;  4KGV B;  5KYY B;  3CCR T;  4M7A C;  3UF4 A;  4M7A A;  1B34 B;  1TWB A;  1UUE A;  1UFF A;  3E19 A;  5CIU A;  4PJO B;  5LL6 S;  5LJ3 g;  4PJM A;  4C92 C;  1WXB A;  4HVU A;  4C92 A;  5IXF A;  3DB4 A;  2L3Q A;  5FRN A;  5GJW B;  3CPW A;  1YN8 A;  2JW4 A;  3X20 B;  1QMC A;  3KXT A;  1WZO A;  1BB9 A;  4OP0 A;  3GP8 A;  1ZBX A;  5GAN 8;  1OPL A;  1T3S A;  4GBQ A;  4VUB A;  2OTJ A;  1ARK A;  1I81 A;  2J06 A;  4HCB A;  4J9D A;  4MZP A;  4E7J A;  2HSP A;  2K3Y A;  4LUD A;  3UA6 A;  4KH0 B;  5CQX A;  3URG A;  4M78 B;  3PMI A;  3EFO A;  2E41 A;  2K3X A;  4OMN A;  4DQ2 A;  1M30 A;  3C4S A;  3WVD B;  3L2W A;  2RHI A;  1H3Z A;  3MEU A;  4N4H A;  4L6V 5;  5IHN A;  4J9I A;  1YP5 A;  2HBW A;  2O4X B;  1GCP A;  2M02 A;  2DRK A;  3FJP A;  1RLQ C;  2DK3 A;  3JCM f;  3OW2 S;  5KYU B;  4LDU A;  3NHN A;  1QVF A;  5LJ5 h;  3CC4 A;  2M51 A;  5LJ5 f;  4XTZ A;  1VQL Q;  3OB9 A;  4XU3 A;  4Q5W A;  4PK4 A;  2DM1 A;  2XDP A;  4PJO F;  3PTA A;  3A1P A;  1U06 A;  1WJQ A;  3AHU A;  4QQG A;  2QA4 T;  2OJ2 A;  5FW9 A;  1TH7 A;  3I56 T;  2QQA A;  2AKL A;  3SDZ A;  1FXX A;  2JUF A;  2VXE A;  2GFU A;  2L5Q A;  2YUO A;  3HPW A;  2V8K A;  3M56 A;  2QEX Q;  3PE0 A;  1VQ8 T;  1VQO T;  1BBZ A;  2XG8 D;  1ZX6 A;  1M1K U;  3MP8 A;  1Z9Q A;  4KGZ B;  2RD1 A;  4JZ3 A;  1YWO A;  2O01 E;  4BE0 A;  4M78 F;  2JZ2 A;  1KC8 C;  2DYI A;  1SKU B;  4C8Q C;  2RO0 A;  4HVW A;  4OMO A;  2KGT A;  4C8Q A;  1V29 B;  3GIB A;  3HFO A;  4BI3 A;  1BIA A;  2J05 A;  3CCJ A;  3WXM B;  2JJ9 A;  2D8H A;  1RAC B;  5IAY A;  1YCY A;  3A5Z B;  2FO0 A;  1GCQ C;  1GCQ A;  3MEA A;  3JB9 F;  1ZA2 B;  3FRN A;  2LQW A;  1HJD A;  4M77 B;  3INZ A;  1PCX A;  2E6Z A;  3RMQ A;  2O2O A;  4C0D C;  1VQM A;  1QP2 A;  2B86 A;  3RBB B;  3L1A A;  1Q86 R;  1K73 U;  1M90 R;  4HVV A;  1K8A C;  1PM3 A;  2YHT A;  1U8R A;  1VOM A;  5KYX A;  1VQ9 Q;  2GGR A;  2M0Y A;  1JXO A;  2EGA A;  4AG1 C;  3NGP A;  4NL3 A;  4BY6 C;  2CS7 A;  5J26 A;  4AT1 B;  1G3W A;  4PFP A;  2E70 A;  2MAM A;  1WHM A;  4DBH A;  3X25 B;  2DFU A;  3REA B;  2YXY A;  2DLP A;  3CBP A;  3EH1 A;  2RH2 A;  4IIM A;  1Y7X A;  1PNJ A;  4QT7 A;  2QDY B;  1I5O B;  2RF0 A;  4O5V A;  3CME Q;  2YUP A;  2DD5 A;  1RAH B;  3OQ5 A;  4E7L A;  3EFS A;  1YIJ T;  4KRT A;  1D09 B;  4QKU A;  3SD4 A;  1WX6 A;  4E6R A;  2IIM A;  3E9F A;  1R0B G;  3C95 A;  2VXF A;  4JDS A;  1TU0 B;  1D0Z A;  1KQS P;  3CPF A;  4M77 F;  3VYH B;  1S72 T;  2PVG B;  1VQN Q;  2AHJ B;  1VYU A;  4M7A D;  1VQ7 Q;  2KBT A;  2CUD A;  1F1B B;  2DMO A;  2LQN A;  3V7R A;  4C92 D;  1OQK A;  3UPU A;  2RB6 A;  3OYL A;  3A8H B;  2HKN A;  4PJO E;  1UGR B;  3E2U A;  4B6M A;  2X3X D;  3P8D A;  1RAE B;  3MET A;  1K8A U;  3JB9 J;  3CCL A;  1QVG P;  5EC7 A;  4JJN K;  4M75 B;  4MML A;  1JXM A;  2DVE A;  2RHU A;  3M57 A;  4C0F A;  3MEW A;  2JOY A;  1VQK A;  3TSZ A;  1AD5 A;  4M7A G;  4DBR A;  4HT9 A;  2K9G A;  5GMK i;  4B9W A;  2OTL T;  2L3R A;  3G4S Q;  3A8G B;  1VA7 A;  4II1 A;  2VAS A;  4C92 G;  1M8V A;  2LVM A;  3J7A F;  2VV5 A;  2MPX C;  4Z88 A;  3L2R A;  1OPK A;  2P0P A;  4M4Z A;  3JCM b;  3CC7 Q;  1IHV A;  2GTJ A;  3I5S A;  2C06 A;  2QI2 A;  3V7C A;  4OB1 B;  4RTW A;  4CRI A;  3GLX A;  3J80 E;  5LJ5 j;  1W2B P;  3RNJ A;  1A0N B;  2LJ3 A;  4AG2 C;  4FL6 A;  1SF9 A;  1W6X A;  3OYH A;  3CD6 T;  4M7D F;  2JS0 A;  3EG9 B;  3G6E Q; 
#chains in the Genus database with same CATH homology
 2EKH A;  3M0S A;  2BZ8 A;  2GTO A;  1WXU A;  2PZ1 A;  1JU5 C;  1K1Z A;  2CUB A;  2LJ0 A;  2YSQ A;  2J6F A;  2C0I A;  2LZ6 B;  1G83 A;  2EYX A;  1QWF A;  2ESW A;  4RUG A;  2VWF A;  1CKA A;  1BK2 A;  2KRM A;  1X2Q A;  1WFW A;  3GBQ A;  2ECZ A;  1AWW A;  1GFD A;  1ZUK A;  2RQU A;  2DYB A;  1NEB A;  2KXC A;  4A63 B;  5I22 A;  1KJW A;  2KRN A;  1ABO A;  2RN8 A;  1HSQ A;  1OV3 A;  2CSI A;  1M3C A;  1NG2 A;  3EG3 A;  2C0T A;  2JMC A;  1UHF A;  4OMM A;  4HXJ A;  4J9F A;  1SSH A;  4ESR A;  1UEC A;  5GJV B;  2FPD A;  3VRY A;  2F2V A;  1NYF A;  2KRO A;  2EGC A;  1EFN A;  2VVK A;  3M0T A;  2RQT A;  4J9B A;  3NMZ C;  1WLP B;  1NEG A;  2XMF A;  1TG0 A;  1E6H A;  1AWX A;  2MIO A;  2DE0 X;  1UJY A;  1PKT A;  2YT6 A;  1FYN A;  2KE9 A;  4LE9 A;  3H0I A;  1UHC A;  2L3P A;  2K7A A;  1GRI A;  1UJ0 A;  2EYY A;  2LX7 A;  2ROL A;  4RTY A;  1I07 A;  4J9G A;  2DBK A;  3SEM A;  4JPB W;  1YWP A;  1UE9 A;  2NUZ A;  1K9A A;  2KT8 A;  1T3L A;  3VS2 A;  2NWM A;  3QWX X;  4ORZ A;  5L23 A;  2BTT A;  4Z8A A;  2KR3 A;  4CC4 B;  3M0P A;  5IHK A;  2CH4 A;  2LP5 A;  2ENM A;  1Y57 A;  1QWE A;  2FRY A;  3PVQ A;  2AZV A;  3EG2 A;  3U23 A;  2O31 A;  3EHR A;  2RNA A;  3EGU A;  1OOT A;  3H41 A;  2P4R A;  4DEY A;  5I11 A;  2KYB A;  1WXT A;  2JTE A;  1N5Z A;  1X2K A;  2CDT A;  1SEM A;  2HDA A;  2DX1 A;  3TVT A;  4Z89 A;  2FPE A;  2H8H A;  3ZL7 C;  2DL5 A;  3VS4 A;  2D0N A;  1X6G A;  1XOV A;  2GBQ A;  3VS1 A;  2D1X A;  4J9H A;  2SEM A;  4D8K A;  1M8M A;  4CC3 A;  1PRM C;  2HEQ A;  1MV0 B;  3UF4 A;  4F17 A;  1NYG A;  1UUE A;  1UFF A;  1PRL C;  2AZS A;  1WXB A;  4HVU A;  4OMQ A;  1ZBJ A;  5IXF A;  2O9V A;  4JZ4 A;  2L3Q A;  2OI3 A;  5FWC A;  2MOX A;  5GJW B;  2YUQ A;  1YN8 A;  2JW4 A;  2D8J A;  5HCK A;  1BB9 A;  1OPL A;  1T3S A;  4GBQ A;  2PNI A;  2DL8 A;  1ARK A;  2LNH B;  1WA7 A;  2J06 A;  4J9D A;  1PWT A;  4LN2 A;  2HSP A;  2RPN A;  3VS5 A;  1I0C A;  4LUD A;  2DIL A;  5FWB A;  3UA6 A;  1BU1 A;  2ED0 A;  2BZX A;  1UG1 A;  4D8D A;  1QKX A;  4RTZ A;  1ZLM A;  1X6B A;  1X27 A;  1GFC A;  1K76 A;  1VYV A;  4OMN A;  1Z9Z A;  2KT1 A;  1AZG B;  1M30 A;  1RUW A;  1TUC A;  2LCS A;  1ZSG A;  1AEY A;  2RMO A;  1WDX A;  5IHN A;  4J9I A;  1K4U S;  1YP5 A;  2HBW A;  1OEB A;  1GCP A;  1U3O A;  2DRK A;  2J6O A;  4AFU C;  1RLQ C;  2RQV A;  2K2M A;  4F14 A;  2CT3 A;  3NHN A;  2FPF A;  3C0C A;  2M51 A;  4J9E A;  2A37 A;  4JJB A;  4DEX A;  1W70 A;  2JXB A;  2DM1 A;  3THK A;  1YCS B;  1ZUU A;  1U06 A;  2OJ2 A;  5FW9 A;  2L0A A;  3M0U A;  3H0H A;  2JM8 A;  2AKL A;  2CT4 A;  2X3W D;  3O5Z A;  2DF6 A;  4LUE A;  2YUO A;  1AOJ A;  1CSK A;  2W10 A;  2O88 A;  2RQW A;  1H92 A;  3PE0 A;  2L3S A;  3TSW A;  2DVJ A;  3EG0 A;  3VS3 A;  1E7O A;  1W1F A;  3I5R A;  1BBZ A;  1ZX6 A;  1Z9Q A;  2EYZ A;  4HCK A;  1SHG A;  4JZ3 A;  1YWO A;  2G6F X;  2ED1 A;  4IIO A;  4J9C A;  2K6D A;  2FEI A;  3M0Q A;  4OMO A;  4HVW A;  2KGT A;  4OMP A;  1GL5 A;  1RLP C;  2ROT A;  3R6N A;  4CC7 A;  4AFQ C;  2J05 A;  2O9S A;  4F16 A;  2D8H A;  2VKN A;  1AVZ C;  2JS2 A;  1PKS A;  1WYX A;  2V1R A;  2FO0 A;  2I0N A;  2J6K A;  4K11 A;  1T0H A;  1WIE A;  2KXD A;  1GCQ C;  1S1N A;  4FSS A;  1GCQ A;  3I9Q A;  1NLO C;  1FMK A;  1SPK A;  2EQI A;  4RTV A;  1SRM A;  1CKB A;  3JV3 A;  4WCI A;  2EVR A;  1AZE A;  2LQW A;  1HJD A;  1VYT A;  1SHF A;  1T0J A;  5IHI A;  1UTI A;  2O2O A;  2J7I A;  2KYM A;  2B86 A;  2W0Z A;  1GBR A;  2KRS A;  3RBB B;  2EW3 A;  5ECA A;  4HVV A;  5IXB A;  2SRC A;  4X1V A;  2E5K A;  4Y92 A;  2GGR A;  3UAT A;  1IO6 A;  2M0Y A;  2K79 A;  1JXO A;  2EGA A;  4AG1 C;  3NGP A;  2A36 A;  1KSW A;  1JQQ A;  2GQI A;  2C0O A;  4RTU A;  1E6G A;  1J3T A;  3VS6 A;  1MUZ A;  3SHW A;  3REA B;  2DLP A;  4IIM A;  3NPF A;  1PNJ A;  2FG0 A;  2K3B A;  4QT7 A;  2EGE A;  2RF0 A;  2CRE A;  1M27 C;  2YUP A;  1K0S A;  2EBP A;  2JT4 A;  2DL3 A;  4KRT A;  2YDL A;  1M3A A;  1WI7 A;  1WX6 A;  2V1Q A;  2IIM A;  3QWY A;  4E6R A;  4AFS C;  1LCK A;  2F2X A;  1H3H A;  4EIK A;  4RTT A;  3VS0 A;  2CSQ A;  2DL7 A;  1B3Q A;  2A08 A;  1VYU A;  1QCF A;  1NLP C;  2KNB B;  3A98 A;  2DL4 A;  2L2P A;  3FJ5 A;  1GBQ A;  2CUD A;  2KBT A;  3LH5 A;  5IH2 A;  2DMO A;  1G2B A;  2LQN A;  3PVL A;  1UDL A;  2DNU A;  3EHQ A;  4R0K A;  2HCK A;  3UA7 A;  1RI9 A;  1AWJ A;  2X3X D;  1UGV A;  4LNP A;  2ABL A;  1M3B A;  4JJD A;  2JMA A;  2YUN A;  1U5S A;  5EC7 A;  2QDL A;  1JEG A;  4GLM A;  1Y0M A;  2DJQ A;  2EYW A;  2FRW A;  1HD3 A;  2AKK A;  2DRM A;  3M0R A;  1JXM A;  3VRZ A;  4AFZ C;  1AWO A;  1ABQ A;  1X69 A;  1JO8 A;  2LMJ A;  3TSZ A;  1AD5 A;  2BZY A;  4RTX A;  3IQL A;  2F2W A;  3EG1 A;  3VS7 A;  1V1C A;  1MV3 A;  1TUD A;  4OML A;  2MCN A;  1QLY A;  1NM7 A;  2K9G A;  1YNZ A;  3KFV A;  1K0X A;  1VA7 A;  2AK5 A;  1KFZ A;  1QKW A;  3CQT A;  2JM9 A;  1B07 A;  3I35 A;  2LJ1 A;  4Z88 A;  1H8K A;  2CH4 W;  1OPK A;  2KEA A;  1ZUY A;  2DBM A;  4M4Z A;  2RQR A;  2GTJ A;  3I5S A;  4JJC A;  4RTW A;  2PTK A;  1KIK A;  1I1J A;  3REB B;  3ULR B;  1PHT A;  2A28 A;  1SRL A;  2OAW A;  4CC2 A;  3RNJ A;  1A0N B;  2LJ3 A;  4AG2 C;  3H0F A;  2DA9 A;  1W6X A;  2GNC A;  4ZNX A;  1X43 A;  2JS0 A;  2EPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...