2GNCA

Crystal structure of srgap1 sh3 domain in the slit-robo signaling pathway
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
b'PEFAIAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SLIT-ROBO Rho GTPase-activating protein 1
publication title Structural Basis of Robo Proline-rich Motif Recognition by the srGAP1 Src Homology 3 Domain in the Slit-Robo Signaling Pathway
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gncA00
2LJ1A 4A63B 2K3BA 4HVWA 5HCKA 2L3SA 2O2OA 2FPFA 1Y0MA 2PZ1A 2KXCA 2K2MA 4RTUA 2P4RA 2FG0A 2LX7A 1JEGA 2KBTA 2ENMA 3EG3A 2LNHB 1HD3A 1ZUUA 1BU1A 3GBQA 1ABQA 3REBB 5L23A 2KGTA 2DL7A 4RUGA 3QWYA 4IIMA 1ZUYA 2HDAA 1Y57A 4J9IA 1X6GA 2EGEA 5GJVB 3VS0A 1M3BA 5IH2A 3M0QA 1PHTA 5FWCA 3UA7A 2DNUA 2KE9A 3H0HA 1YNZA 2O88A 2EW3A 2EVRA 3PE0A 4J9BA 4Z89A 3REAB 4J9GA 1AZEA 4CC4B 2GNCA 1X2QA 2JT4A 1PRLC 3VS2A 2CT3A 1M30A 1NYGA 1PKSA 2F2VA 2EGAA 2RF0A 3VS3A 3RBBB 1Z9ZA 3EGUA 3I5RA 2DL8A 4F16A 2EYWA 1I0CA 1LCKA 2LCSA 2DYBA 2CREA 2EPDA 4R0KA 2HEQA 4WCIA 1NEBA 1YWOA 1SEMA 2GQIA 2O31A 2DE0X 2MIOA 2F2WA 2YT6A 1W6XA 1CSKA 2A08A 2F2XA 2GTOA 3TSZA 1H8KA 3SEMA 2GGRA 4D8KA 2AK5A 4AG2C 4OMMA 2KRMA 1UUEA 2YDLA 2EGCA 5FWBA 2KRSA 2AKKA 2J6KA 2CSQA 2BZXA 1XOVA 1Z9QA 1KJWA 1TUCA 1G2BA 1WXTA 1QWEA 2OJ2A 1X6BA 1YP5A 2FEIA 2ROLA 1HJDA 4AFZC 2KYMA 1TG0A 2E5KA 1RLQC 5IHKA 1JU5C 1YN8A 2JW4A 2C0TA 2YUOA 1SRMA 2DM1A 3QWXX 1AWJA 1UHCA 3M0SA 4F17A 1FMKA 3VRZA 1M3CA 2AKLA 3VS7A 3H0FA 2JM8A 3VS6A 2BZ8A 2CH4A 3EG2A 2CSIA 1FYNA 3VS1A 2BTTA 2DA9A 1A0NB 1UE9A 2RQVA 2LMJA 4Y92A 3U23A 3NHNA 2ED0A 4J9CA 3VS5A 1NLPC 2A37A 1U5SA 2DVJA 2H8HA 1J3TA 1UFFA 4AFUC 2RMOA 2VWFA 4GBQA 1UTIA 2EQIA 1AVZC 2O9VA 1HSQA 2VKNA 4OMQA 1AOJA 2KXDA 4CC3A 1PRMC 2YSQA 1T0HA 1BB9A 1E6HA 2LZ6B 1UJYA 2RQUA 3UA6A 1JQQA 1PWTA 1ZX6A 2AZSA 1GCQC 2VVKA 1KIKA 2D0NA 1OPLA 2C0OA 1QCFA 1NM7A 4JJCA 2PTKA 2ED1A 4OMLA 3VRYA 1JXMA 4HXJA 1IO6A 2DL3A 1CKBA 5GJWB 1X69A 1YWPA 4EIKA 2KT1A 4KRTA 4ORZA 1SPKA 1B3QA 3SHWA 2L3PA 1GCPA 2DF6A 1EFNA 1ZLMA 2B86A 1AWOA 4LUDA 3NPFA 1GRIA 2DILA 3LH5A 3R6NA 4RTYA 4J9FA 1PNJA 4X1VA 2M51A 2J7IA 1K0SA 1K76A 1NLOC 2EYYA 2W10A 2M0YA 3VS4A 5IHIA 1W1FA 1RI9A 2JMCA 3ZL7C 1KFZA 2MCNA 4FSSA 2RPNA 4RTTA 2D1XA 1ZUKA 1SHFA 3M0UA 2JMAA 2LP5A 1E7OA 2PNIA 4AG1C 2YUQA 3NGPA 4LUEA 2NWMA 2FRYA 2KR3A 2K9GA 4F14A 4OMPA 2QDLA 1WYXA 2IIMA 1VA7A 2CT4A 1QLYA 5IXFA 2A36A 2OI3A 3O5ZA 2L3QA 1NYFA 3M0TA 1GBQA 2W0ZA 4JZ4A 1GFDA 2LQNA 4E6RA 4D8DA 2FRWA 4M4ZA 2X3XD 2KEAA 2DL5A 2DRKA 1OV3A 2V1QA 1MUZA 2EYZA 1GBRA 2LQWA 2KROA 2CUBA 4HVUA 5ECAA 4AFSC 2RQWA 1T0JA 1W70A 1M8MA 2KRNA 2ABLA 2CH4W 2LJ3A 3IQLA 3TVTA 4JZ3A 1CKAA 1I1JA 2DBMA 4HCKA 4RTVA 4LE9A 2ROTA 1U3OA 5I22A 3NMZC 1G83A 4RTWA 2ECZA 1GL5A 1M3AA 2FO0A 3H0IA 4DEYA 4OMOA 1ARKA 4J9DA 2AZVA 2A28A 1H3HA 1UECA 2HBWA 2C0IA 2RQTA 4LNPA 1UG1A 1UDLA 2RNAA 4ZNXA 2NUZA 2O9SA 1GCQA 2EYXA 2CUDA 2KYBA 3I35A 2DX1A 2OAWA 2FPDA 1AWXA 1X2KA 2X3WD 1MV0B 1QKWA 2MOXA 1AD5A 3H41A 2K79A 3PVLA 1YCSB 3JV3A 4CC2A 1VYUA 3UATA 1WDXA 3M0RA 2ESWA 3TSWA 2JM9A 1GFCA 2YUPA 4J9HA 1UHFA 4LN2A 1N5ZA 1SSHA 4JPBW 1T3SA 1VYTA 2K6DA 1H92A 1K9AA 1NG2A 2DL4A 3ULRB 4GLMA 1K0XA 1WLPB 1OEBA 3C0CA 1AWWA 5FW9A 1AEYA 2L0AA 1WX6A 1E6GA 2GBQA 1OOTA 2JS0A 2BZYA 2YUNA 1BBZA 2D8JA 2J06A 5I11A 2SRCA 1WXUA 2DBKA 2LJ0A 3RNJA 1QWFA 1OPKA 4QT7A 3EG1A 4OMNA 3I5SA 1BK2A 2XMFA 2JTEA 4Z8AA 1T3LA 2SEMA 1RLPC 4RTXA 3EHQA 3THKA 2D8HA 3M0PA 1M27C 2JXBA 1ZSGA 2KNBB 2HCKA 2DRMA 1WXBA 2J05A 4RTZA 2RQRA 2L2PA 1K4US 1JO8A 2EBPA 2DMOA 2RN8A 2HSPA 3EHRA 1U06A 2KT8A 2K7AA 3KFVA 4K11A 2EKHA 1WIEA 5IHNA 3CQTA 1TUDA 1SRLA 1UJ0A 4JJDA 1SHGA 1V1CA 1WI7A 1PKTA 2JS2A 1X43A 2G6FX 3UF4A 1AZGB 1NEGA 1MV3A 1S1NA 1JXOA 2J6OA 3EG0A 2J6FA 1B07A 2CDTA 1I07A 3I9QA 1X27A 1UGVA 3PVQA 2V1RA 1WFWA 2FPEA 4CC7A 3FJ5A 4J9EA 4ESRA 1KSWA 1ZBJA 4AFQC 1VYVA 1WA7A 1K1ZA 4IIOA 1RUWA 1ABOA 5EC7A 5IXBA 2GTJA 3A98A 4Z88A 4DEXA 2DJQA 4HVVA 2DLPA 2I0NA 1QKXA 4JJBA
chains in the Genus database with same CATH superfamily
2MK5A 1W2BS 2LJ1A 4BD3A 1AHJB 2LRQA 4J5YA 2HQEA 5CO7A 2LX7A 2RI3A 2EQKA 4KUDK 4BI4A 1NPRA 2HKNA 3V8JA 1K9MC 1Q82R 1UGPB 2E3IA 2JNGA 2E5QA 3GBQA 5L23A 1QVGA 4RUGA 2KVQG 4IIMA 3CCJT 4E7IA 3QIIA 3JCMf 2JTMA 2AHJB 1OI1A 5GANg 1X6GA 1M3BA 3M0QA 3MP8A 2KE9A 1TH7A 1YNZA 3H0HA 1YJNA 3QJ6A 1YITA 2EVRA 2P0PA 4J9BA 4J9GA 1YHQQ 1X2QA 3H9NA 2RD1A 1NYGA 1X01A 3I56Q 5LJ5h 1PKSA 2F2VA 1FXXA 2RF0A 3VS3A 3RBBB 4MMLA 1VQ5Q 3EGUA 1I4K1 1KHIA 2E10A 2EYWA 4N4HA 4C0ZA 2YRDA 4BY6C 2CREA 4R0KA 5LJ3h 2KK4A 2DIQA 2HEQA 2NUPB 2DZ9A 1M1KR 3EFOB 3M55A 2JZ2A 1YWOA 1TOVA 2DE0X 2MIOA 2R57A 4O6JA 2WSFE 1RAEB 5GANd 1S72T 2F2XA 3RKYA 2DTOA 4M78B 4BE1A 1WQWA 3BDUA 1VQ7T 5FWBA 1UUEA 4XTUA 1BYMA 7AT1B 1KJWA 1TUCA 1G2BA 1PCXA 5FROA 3QUIA 3GIBA 2BE7D 1HJDA 4OMFB 2E5KA 2NUPA 5GAN6 4IUTA 3V7SA 3EFOA 3X28B 4PJLA 1HYOA 4V2SA 2DM1A 3QWXX 1UHCA 3NTHA 1M1FA 2E70A 3C94A 3PMTA 2RHUA 2A7YA 2PQWA 1K73C 1M3CA 2YHTA 2AKLA 2LX9A 4M78A 2JM8A 3CMET 2CH4A 3SD4A 1R77A 3VS1A 4MZPA 1A0NB 1UE9A 1OZ2A 4Y92A 3U23A 2JJ9A 4C5EA 1IRXA 4QVDA 2QQAA 1M9SA 3FB9A 4II1A 1U5SA 2QASA 2DVJA 5GAN8 1J3TA 1VQOT 2QI2A 4NL3A 2FB7A 2VWFA 1UTIA 1JJ2S 4M77E 1AOJA 4OF1A 3L2RA 2YSQA 5KE2A 1T0HA 1YI2T 1C0MA 1E6HA 2VGNA 1KIKA 2D0NA 4BI8B 2C0OA 4M7DG 1NM7A 4BY6B 2PTKA 2NYSA 4LDUA 4IUUA 2DL3A 5GJWB 3PIOA 1XNIA 4EIKA 3JCMb 5GAOp 2BKDN 5I21A 2CYZB 2L8DA 2L3PA 2D0QB 5KH6A 1AWOA 2DILA 1KK7A 2RM4A 3R6NA 3KBGA 2M51A 2PU9B 2ZCFB 2X4WA 1K0SA 1NLOC 2DD5A 1BI3A 2W10A 3VS4A 3VV0A 3JCMW 3QSUA 3JCMV 1P92A 3FLGA 4FSSA 3EGXB 3CD6A 1G3SA 3HPWA 1UGQB 1S72Q 3X24B 1PD1A 2ZGWA 2KR3A 2K9GA 3OA6A 1K73U 2IIMA 1RABB 1YFNA 1M90C 3CBMA 1RAIB 1MNDA 1BCOA 1PSFA 2A36A 2OI3A 3VYGA 4QVZA 4KGVB 3M0TA 2HKQB 2RI2A 3EGXA 2FRWA 3HRTA 4KT0E 4PJOE 2DRKA 1VQMA 1WJQA 8ATCB 2LCCA 4XU1A 2V1QA 2ZPGB 2LQWA 3CCRT 1T0JA 2LJ3A 3CPWP 1CKAA 2BUDA 4RTVA 2ROTA 1VUBA 3NMZC 3CCLQ 1ZQ1A 4RTWA 1GL5A 4JRKA 2H3JA 1VQ4A 1VQOQ 3QDFA 2X4XA 3VUZA 1RI0A 1ARKA 4J9DA 2XI9A 2CZ7B 1DJ7B 3G6ET 3EGDB 1SSFA 1YI2Q 2G3RA 2HBWA 1W2BA 2BE9B 1YIJT 4QQ6A 1NJIR 3G4ST 2RNAA 4C8QG 3LH0A 2O9SA 2CUDA 2DK3A 2KYBA 3I35A 3RMQA 2OAUA 2OAWA 1H3ZA 1UB4A 1LOJA 3E1SA 1MV0B 3N5BB 3CC2A 3A8GB 2MOXA 3H41A 5AYFA 1JRIA 2XKOC 1C1AA 1WDXA 3M0RA 3DB4A 4RG8A 2R5AA 4ZGEB 3OSVA 2V8KA 1RAGB 1UHFA 3EGDA 4E7JA 3MEAA 4J6WA 1WHKA 3RERA 4C92B 1NG2A 1K0XA 2EWNA 2ZAEA 1Q7YR 5A2QE 2QTVA 1M90U 4Q5WA 5FW9A 4PFOA 4M7DD 2GBQA 2FZKB 4VUBA 3LYIA 2JS0A 2MWPA 1VOMA 1QVFP 1VQ9T 3A8LB 3PTAA 1QWFA 1OPKA 3HFNA 5GAMe 3V7CA 3G71Q 5CQXA 3JSCA 3HKSA 4M7AG 1HXDA 2KMTA 3F70A 3I5SA 5CAIA 3P8HA 3CXCS 2COWA 5GMKe 3TQ7P 4C8QC 4JLIA 4RTXA 2QA4T 4LDWA 4M75D 1MHNA 3CCUA 3OS1A 3CPWA 4JJNK 2JOYA 2PUKB 5LJ5g 2RQRA 4JS5A 3CCMA 1JO8A 4DBRA 1M90R 2DMOA 3BDLA 2E41A 1YJ9Q 3KFVA 2EIFA 2EKHA 2COYA 2E4HA 4M7DE 1TUDA 5LJ3g 2COZA 2K57A 1KC8C 3OYFA 3OYGA 1WJRA 4D6WA 1KG1A 3G6EQ 1Q86C 3CCVA 1MMGA 3EH1A 3M4GA 2KY9A 2QAZA 1YIJQ 2V1RA 3HTRA 2FPEA 5J26A 1W4SA 5GANj 6AT1B 3FJ5A 4J9EA 4OB1B 1D0XA 4J6YA 3CC7A 5C0MA 4AFQC 1VYVA 1YJWT 4F7UE 3DKMA 2GTJA 1Y96B 4DEXA 3PGGA 3LW5E 1JJ2A 2DJQA 4HVVA 4M75E 4FW1A 3KUFA 3JCMe 2X9HA 2RH2A 4J8OA 4DOWA 4A63B 4M7AC 2K3BA 1Q82C 4KH0B 2DPPB 2L3SA 2O2OA 2FPFA 1Y0MA 2PZ1A 2K2MA 3DB3A 4EMKC 5KCOA 2FZGB 2KBTA 5GMKl 2HL5C 2ENMA 3EG3A 4OB2B 2LNHB 3M59A 2DEQA 1FMWA 1HD3A 2PVDB 4AMCA 1XQHA 1ABQA 3CCJA 4C8QD 3QWYA 3CEYA 1BCMA 2K5IA 3PFSA 2EGEA 5GJVB 4FYWB 3TEEA 4M7DF 1TXQA 1VQ9Q 3FJPA 2O4XB 3I55Q 3UT1A 3KXTA 3RUXA 2DNUA 1VQ6Q 3CCET 5CIUA 4M78G 1XJWB 2VGMA 3OS2A 4XAXB 1BKBA 1AZEA 4CC4B 3BFMA 2GF7A 2GNCA 1M1KC 1PRLC 3VS2A 3A5ZB 2CP3A 3JCMQ 2X51A 1KC8U 2P0QA 2QA4Q 2LNVA 3URGA 5LL6S 1I0CA 1LCKA 3I56T 2EPDA 1Q86U 1WHGA 4WCIA 1NEBA 1O9SA 3OSSC 1VQ5T 1D0YA 4M75F 4BE0A 2GQIA 1VQPT 2O4XA 4FYXB 2ATCB 2KQWA 5GAOm 2A08A 4C8QE 2GTOA 2EQJA 3OW2P 3SEMA 4D8KA 4ZN3A 2AK5A 2PVGB 4AG2C 2GQVA 1VQ7A 2EGCA 2KRSA 3CC4Q 2AKKA 2J6KA 2OTJA 1G3TA 2M1HA 2X4YA 4JLGA 1G3WA 5FLXE 1Y07A 4HCZA 3WVEB 1Q82U 4N4IA 4AFZC 4PFZA 2DERA 1TG0A 5IHKA 1G3YA 1M4ZA 1YN8A 3C95A 4FSXA 2CS7A 2HL3A 1RAFB 1SRMA 3CPFA 1AWJA 3M0SA 3CCQT 5CQYA 1FMKA 3NFCA 4FYYB 3VRZA 3VS7A 3LGLA 3S6WA 3VS6A 3CMEA 1Q86R 1RACB 3CMAT 3EG2A 4M78C 2GFUA 1Y7XA 2YLCA 3JAME 2RQVA 4M7AA 2EAYA 2DXBA 3NHNA 1QCNA 4FM4B 1WZOA 2DAQA 2H8HA 2XDDA 4EMKA 5GAMh 3X20B 2RMOA 2QXFA 2DD4A 5GAN5 2JVVA 2QQBA 2ZPBB 2O9VA 1HSQA 2VKNA 2I2LA 1QQJA 1VQ8T 2FL7A 5GMKh 4A4EA 1BB9A 1ZHIA 2VASA 1M1KU 3OYCA 2AZSA 3TREA 1Q81R 1VQLT 3OQ5A 4L59A 4E7ZA 1OPLA 3RR6A 1QCFA 3X25B 3OYIA 4J83A 4C8QF 3QPHA 2EQMA 1IO6A 1EZZB 1X69A 2LVMA 3OYHA 1YWPA 3CCEQ 2KT1A 4DOVA 4ORZA 1B3QA 2M9UA 1ZLMA 1G5VA 4ZTJA 3NPFA 3LH5A 2QK0A 1F1BB 3D7SB 4QQDA 2J7IA 1YCYA 2LDMA 1K76A 2M0YA 2HQHA 2RHZA 5IHIA 1RI9A 5CKFA 2VB6A 1KFZA 1UGRB 4E7SA 2FVUA 4PFPA 1VQPQ 1ZUKA 2CP0A 2V8IA 1WHHA 3M54A 3CCST 2HNIA 8AT1B 4N0AC 3CXCA 2YUQA 1TWBA 1RL2A 2NWMA 3OYJA 5CK9A 4JRQA 1B34B 2EJGA 3JCMh 1TU0B 4M78D 1OX8A 2CT4A 2X35A 3AT1B 2JTFA 2YRCA 3FDRA 3CPWS 3G7ZA 1GBQA 4B6MA 4JZ4A 1R0CB 1GFDA 2LQNA 4D8DA 1OQKA 4OGEA 2AIRB 2EJ9A 2OTLT 1N6AA 3QZ9B 3CCQQ 1NPPA 4JDSA 3JCMP 3ZEHA 2EYZA 1WGSA 3CCRA 2KROA 4HVUA 3OYAA 3C4SA 2RQWA 1W70A 4M77B 2CH4W 3CMAQ 3TVTA 4JZ3A 1B34A 2EJFA 4X9DA 4HCKA 4E7LA 2IVWA 2K5LA 4LE9A 3LWIA 4A54A 1RAHB 2DFUA 1VQKQ 1KD1U 1G83A 1M3AA 3GF5A 3H0IA 1NJIC 4DEYA 2QEXA 4XTXA 5A0GA 3HL8A 1IXDA 1VQNA 4EMGA 4ZN1A 1OU8A 3CCLT 2Z0WA 4N4GA 1VQ8Q 5HK3A 4LDVA 1BIBA 1WPYA 4C92G 2C0IA 3QXEB 3G4SA 1VQLQ 1UG1A 1UDLA 4M77A 4GLKA 4PLLA 2RK2A 2EYXA 3HRUA 2RK1A 1IREB 4JRPA 1K8AC 2DX1A 3CBPA 4TVRA 4NS5A 2QGFB 5CKDA 2XG8D 1AD5A 3PVLA 1YCSB 3JV3A 4CC2A 1Q7YC 2ESWA 4ELYC 3FC3A 3TSWA 4FW2A 3UWNA 2JM9A 4MZTA 3A8MB 4LN2A 1N5ZA 3MP1A 1QP3A 2A0FB 1M8VA 1KD1R 1SKUB 1QVFS 2YXYA 1WLPB 3BY7A 3S3MA 3ME9A 1AWWA 5LJ5j 3CCSQ 2E65A 2BZYA 2CP6A 4N0AA 1D1CA 1QCOA 5LJ3j 4MMKA 2YUNA 4PJOB 2J06A 2SRCA 1WXUA 2DBKA 3L2UA 2LJ0A 1KQSP 4J7FA 1I81A 3EG1A 5KYWB 4M78F 4C92C 2XMFA 4DBQA 1T3LA 4E7KA 3G71T 4XQ3A 2OTLQ 2ZPHB 3EHQA 3EFRA 1NJIU 3WXMB 3THKA 3M0PA 5CKBA 2BIVA 4KULA 1M27C 3LLRA 3QYGB 4MDWA 2KNBB 4RTZA 3JRZA 1MGQA 4PJOA 2RN8A 2XICA 2HD0A 2KT8A 2K7AA 5GANf 3OYEA 5KYNA 1WIEA 5IHNA 5FRNA 3CQTA 1SRLA 1K8AU 1YJ9T 1SHGA 4A4HA 4HA8A 1X43A 2LT1A 3UF4A 1NEGA 2LTOA 1MV3A 2J6OA 1Q7YU 2HMAA 1B07A 2CDTA 1I07A 3I9QA 5D6YA 1D0ZA 1U1SA 4BE2A 4CC7A 2DKGA 1ZBXA 4ESRA 5I2MA 3HHTB 3LX7A 3O8VA 4QKUA 1YJWA 4IIOA 5EC7A 3A98A 2DTIA 5A0LA 3M58A 1GCPA 2I0NA 3L2ZA 2Y4XA 3RKXA 1N8RU 3M9QA 5HCKA 1ZSZC 2ZPEB 3OBYA 4PNOA 4ELZC 2P4RA 5D6WA 1H641 1JEGA 2M0OA 5I2SA 1K8AR 5GMKm 5KYUB 1I8FA 4PJJA 4C92D 2IG0A 2RHYA 3BW1A 2KDSA 3L42A 3Q1JA 4NL2A 3REBB 2KGTA 2DL7A 1ZA2B 5C6SA 5GAMg 1ZUYA 1Y57A 2LCLA 2HBPA 1PD0A 1KQ1A 2DXUA 3VS0A 2LC4A 4OP0A 1YJNQ 2JN0A 3MCAB 2CZ0B 1YITQ 4JUVA 1PHTA 5FWCA 5GAN4 4KH1B 2Y4YA 3UA7A 3DLLA 2F1LA 4FL6A 4BB7A 2KSSA 1LPLA 3SDZA 3PE0A 2M02A 3VKIA 3I55T 5KYUA 2C06A 1N8RR 2RJDA 4RG2A 4A53A 4C92A 3P8BB 1M30A 1I5OB 1VQ6T 3GNFB 2FZCB 3OW2S 1YHQA 3J7AF 3RMSA 3TCJA 4BUGA 4F16A 3I56A 1R0BG 1C6VX 3CD6T 2DYBA 1V29B 1VQ5A 3JB9J 3JCMX 1FMVA 3E2UA 1SEMA 3OYYA 1YBYA 4QQGA 2F2WA 1W6XA 3SFMA 5J3BA 4L5GA 3OS5A 2Y90A 1H8KA 2K3XA 2R5MA 3VJPA 4OVAA 4QW2A 9ATCB 4E2FB 2YDLA 4F7UB 2CSQA 1XOVA 1ZSZB 4HT8A 1WXTA 1QWEA 2OJ2A 1YP5A 3CC4T 5IN1A 2EKOA 3JCMg 1RLQC 2GCXA 2R58A 4RMOA 4XU3A 2C0TA 4F17A 5GMKi 3H0FA 5DLOA 4KGZB 1EIFA 2CSIA 4F7UA 2BTTA 4GY5A 2LMJA 1ZSZA 5LJ5d 1ACMB 2ED0A 2DTHA 4J9CA 2A37A 1Q81C 2NUTB 5GAOr 4AFUC 5DM7R 3OB9A 4GBQA 2EQIA 1AVZC 5LJ3d 3JB9I 3GLXA 5CVIA 4CC3A 4FYVB 3OYNA 2ZZDA 2QYZA 1WNLA 2LZ6B 1UJYA 3UA6A 1JQQA 1PWTA 1IHVA 3CC2T 2D9TA 4WTOB 2F5KA 4NOYA 4KGXB 2ED1A 1Y96A 3VRYA 1QVFA 2MI6A 1GXIE 3ASKA 4ZGDB 2WSEE 3ZFJA 2NUTA 1IGQA 4IUVA 2V26A 2DF6A 3UPUA 2B86A 3PMIA 5IAYA 4LUDA 3SB2A 2PUOB 4RTYA 4XU2A 1BI2A 1KHCA 1IHWA 2V8JA 1WHLA 2EYYA 2MF2A 3CD6Q 2L89A 4EDUA 3MO8A 2MCNA 2RPNA 3V8LA 1QVGP 2DO3A 4PJMA 1SHFA 3M0UA 4Y28E 4CI0C 3QHSA 2LP5A 1E7OA 4AG1C 4ME7A 3MPUB 3NGPA 3FEOA 4LUEA 4M77G 2FRYA 2CP7A 3L2VA 4WF2A 1S72A 3C12A 4OMPA 2QDLA 1WYXA 3MP6A 4EPCA 1U8RA 2RHIA 4XTVA 4DQ2A 1QLYA 5D7UA 4LXCA 3HP9A 2LQKA 4IUQA 5IXFA 5FRMA 1D1BA 1NE8A 4PL6A 3UDCA 2L3QA 1NYFA 3M57A 4M7AD 1VQMQ 4A4KA 3CCUT 2X3XD 3JB9H 1Q81U 2DL5A 2EFIA 4HT9A 1GBRA 1MUZA 4DA4A 5IT9E 4JS4A 4C0DB 2KRNA 1QP2A 2ABLA 3HRSA 3H8ZA 3IQLA 2XDBA 3QKJA 1I1JA 1TUGB 1VQ4Q 4LDXA 1U3OA 5I22A 1XTDA 4L6V5 2K2VA 3LGFA 2E12A 2ECZA 2DETA 5HK0A 3META 4XK8E 1RAAB 2CP5A 4OMOA 3CCLA 4C5HA 2A3LA 1VQKT 2AZVA 2IPOB 1H3HA 1VQOA 1UECA 2DXTA 3T9NA 3CC7T 1WJSA 3CC2Q 3G1JA 4M7AE 1YI2A 4M77C 3QZ5B 4B9WA 2FPDA 1AWXA 1X2KA 2X3WD 1KD1C 2HZYA 3MKDA 3M53A 3PNWC 5LJ5f 4AT1B 1VYUA 3UATA 2CKKA 3RKWA 3WVDB 4PJOG 2YUPA 4OB3B 1MMDA 1SSHA 4JPBW 1T3SA 5LJ3f 3OS0A 2K6DA 3P8DA 1K9AA 4FCYA 3C0CA 4C5GA 1KQSS 1AEYA 2E3HA 4FT4A 3GOXA 1WX6A 2ZPFB 2GFAA 1OZ3A 5KYXB 2XDPA 1WHJA 1OYXA 1OU9A 3BE3A 3OW2A 1VIEA 1MMNA 2D8JA 3X26B 2JUFA 3RNJA 2X4JA 2HAXA 4E7HA 1UEBA 5GANe 1G8XA 2QQSA 1M2VB 2MMPA 3A8OB 4OMNA 1LNXA 2EYQA 2VXEA 3G71A 1LJOA 3CCUQ 1RLPC 1BI0A 3MEUA 4M7AF 3CCMQ 5KYXA 1O75A 5GAOl 1IZ6A 2DRMA 1WXBA 4KUIA 3OMCA 2L2PA 1K4US 1SG5A 2NLUA 3EHRA 1U1TA 4K11A 4BDYA 4PJOC 4M77D 4HCCA 4KBMB 5HY6A 3E9GA 3JB9G 2P0KA 5HKCA 3CCVQ 1M2VA 1YJ9A 2OTJT 3AHUA 1V1CA 1PKTA 2JS2A 4HKEA 2MPXC 1AZGB 1ZA1B 1IB8A 1S1NA 2J6FA 3CC7Q 3G6EA 1X27A 2XHCA 3INZA 4FT2A 3OBWA 5GAMj 5GAN7 4M78E 1RADB 1AT1B 1YIJA 1ZBJA 1K9MU 5D6XA 1WA7A 4Y91A 5KE3A 1RUWA 3TU4K 1ABOA 4B9XA 5GMKj 2VXFA 4Z88A 2B8AA 1QKXA 5EG2A 2QDYB 5FU6C 4HVWA 3M5AA 2KXCA 3CBOA 4RTUA 2K5FA 2FG0A 2DXCA 4C0FA 2MAMA 3CCJQ 4IURA 2XK0A 1ZUUA 2P4TA 1BU1A 3RESA 1W2BP 4X9CA 2K4YA 2F5TX 2PVOB 2HDAA 2HQXA 4J9IA 2RJFA 3HFOA 1N8RC 5IH2A 1D1AA 1K9MR 2O88A 2EW3A 1YJNT 1YITT 4Z89A 4PJOD 1QMCA 1VQ9A 3REAB 1TSFA 2P84A 4E47A 3I55A 1TS9A 3NTIA 3RDVA 1V76A 2JT4A 2CT3A 1VQ6A 4F7UG 3S3OA 4BACA 2HSEB 2EGAA 4M75G 4OB0B 2H3EB 3QDRB 1Z9ZA 3I5RA 2DYIA 2DL8A 2LCSA 5GAOq 2QA4A 1FX7A 3EAEA 3MHXA 1B7TA 1M5Q1 2O31A 2YT6A 2LT4A 2YLBA 1CSKA 2RHXA 1VQ7Q 4UC4A 4LDYA 3TSZA 2EQUA 2O01E 1OULA 2GGRA 2VUBA 2DEUA 2OTJQ 2QTXA 2DZCA 4M77F 2QG9B 4OMMA 2KRMA 5FU6B 5GAN3 5A0DA 3EH2A 3OMGA 2BZXA 3M56A 1Z9QA 3EG9B 1NZ9A 5KYWA 2DJZA 3CC4A 1X6BA 2FEIA 2ROLA 4CRIA 4M7DC 1Y71A 2KYMA 3V7RA 3FIFA 3M4YA 1JU5C 2JW4A 1KQ2A 3JCMJ 2YUOA 3HSBA 2RB6A 3CMEQ 4OGCA 1BI1A 5J39A 1HK9A 3VU3C 1N9RA 2BZ8A 1FYNA 2DA9A 5DLQE 2QEXT 2WACA 4DBHA 3JB9D 2WSCE 3EG9A 1VQNT 1K73R 1N27A 2QQ9A 3VS5A 1NLPC 4M75C 2M16A 1UFFA 2D6FA 5GANh 4Z02A 4OMQA 2KXDA 1PRMC 2CZ1B 4P5NA 2RQUA 1ZX6A 1IGUA 1GCQC 2CP2A 2CZ6B 2VVKA 4YTLA 4DBFA 2MWOA 3MEWA 4JJCA 4ATOA 2MYSA 3MJXA 4OMLA 3VYHB 2L3RA 1JXMA 4HXJA 1JJ2P 1R8OB 1X6OA 3PT9A 1CKBA 2VV5A 4MDXA 2KAFA 3OYLA 2XIDA 4JRIA 4KRTA 1KQSA 1QVGS 1QVPA 1SPKA 4R56A 3SHWA 3JCMc 2DVEA 4LD9K 1EFNA 2L5QA 3CCEA 1WHMA 4PJOF 1GRIA 4J9FA 1PNJA 4X1VA 5KCHA 4PK4A 5FU7C 4RCCA 2VC8A 3H6ZA 1W1FA 1WQ7A 4M7DB 2JMCA 3ZL7C 1D09B 4RTTA 2D1XA 4PKCC 3ER0A 4X34A 3SWNC 1MMAA 2JMAA 2XU8A 2PNIA 3A1PA 1OX9A 3ZBDA 4C0GA 3OYKA 1VQPA 4C92E 4J7IA 1QW1A 4PLIA 1NBEB 5GAMd 5GAOn 1M1GA 2E6NA 2RA2A 4F14A 4XTZA 4ZTFA 1VA7A 4IKFA 5L8RE 3PIPA 5KYYB 3A8HB 1TTHB 4IUPA 3DLMA 3O5ZA 2W0ZA 4M75B 1PC0A 1BIAA 4M7DA 4E6RA 3CCRQ 4M4ZA 2KEAA 1OV3A 1VQMT 2CUBA 5ECAA 4AFSC 1M8MA 3CCQA 3OYDA 2RI5A 3S3NA 4C5IA 2DBMA 2VYTA 2QEXQ 4MZMA 3CMAA 2KI7A 1VQNQ 1M2OA 5KYYA 2FO0A 5CKHA 4ZGJB 5LJ5e 1VQ4T 3JB9F 4M75A 1UGSB 1VQKA 4EMHA 2A28A 2LQ8A 3G4SQ 4FIBA 1SF9A 3QG1A 2E1HA 4O5VA 5LJ3e 1PSEA 2RQTA 5FU7B 4LNPA 1VQ8A 2XD0A 4ZNXA 1I5LA 2NUZA 1GCQA 3QJYA 3V8KA 4C0DC 1VIFA 4C92F 3JCMd 1VQLA 1PM3A 3SWNB 1QKWA 5GAN2 3QYHB 4A4GA 2K79A 3J80E 5CKEA 4A4FA 1FWZA 1GFCA 4J9HA 4XU0A 3VUBA 1PG5B 5AT1B 2RO0A 3E9FA 1VYTA 3L1AA 3RIRA 1H92A 4PJNA 4XTYA 2DL4A 3ULRB 3R6OA 4GLMA 3L2WA 4C8QB 1OEBA 2DIGA 5CR2A 4F04B 2E64A 1Q95G 2L0AA 3SWNA 3QBYA 1E6GA 4BI3A 1OOTA 2CGHA 2ZPIB 3CCSA 2K3YA 1BBZA 1LVKA 5I11A 4QT7A 5M9OA 1D3BB 4RKUE 1N9SA 1YHQT 4C8QA 1BK2A 4LD6A 2OX7A 2JTEA 4Z8AA 2SEMA 3GNGA 3NTKA 4F7UF 2AT1B 2QQRA 2QGGA 2D8HA 2JXBA 1ZSGA 2OTLA 2HCKA 3OY9A 2J05A 3LWHA 2EBPA 3CCMT 4HCBA 3J81E 4QVCA 2HSPA 3OYMA 4FU6A 2RJEA 3FRNA 5GAMf 3L2QA 3CXCP 1U06A 4BDZA 4R55A 1JB0E 1D3BA 1MNEA 4M7AB 3QO3A 4XTWA 1UJ0A 1EX4A 4JJDA 4ANJA 5CCAA 2YWWA 4J6XA 1WI7A 3GP8A 4RCBA 5DY9A 4EMKB 1JBMA 2G6FX 3E19A 3CCVT 1JXOA 3EG0A 3MEVA 3EFSA 2FYKA 1YJWQ 1UGVA 2YRVA 3PVQA 1KC8R 1WFWA 2E6ZA 2F69A 1KSWA 3GPLA 1K1ZA 2RJCA 5IXBA 2FHDA 1X75C 2DLPA 3OYBA 4JJBA
chains in the Genus database with same CATH topology
2LJ1A 4A63B 2K3BA 4HVWA 5HCKA 2L3SA 2O2OA 2FPFA 1Y0MA 2PZ1A 2KXCA 2K2MA 4RTUA 2P4RA 2FG0A 2LX7A 1JEGA 2KBTA 2ENMA 3EG3A 2LNHB 1HD3A 1ZUUA 1BU1A 3GBQA 1ABQA 3REBB 5L23A 2KGTA 2DL7A 4RUGA 3QWYA 4IIMA 1ZUYA 2HDAA 1Y57A 4J9IA 1X6GA 2EGEA 5GJVB 3VS0A 1M3BA 5IH2A 3M0QA 1PHTA 5FWCA 3UA7A 2DNUA 2KE9A 3H0HA 1YNZA 2O88A 2EW3A 2EVRA 3PE0A 4J9BA 4Z89A 3REAB 4J9GA 1AZEA 4CC4B 2GNCA 1X2QA 2JT4A 1PRLC 3VS2A 2CT3A 1M30A 1NYGA 1PKSA 2F2VA 2EGAA 2RF0A 3VS3A 3RBBB 1Z9ZA 3EGUA 3I5RA 2DL8A 4F16A 2EYWA 1I0CA 1LCKA 2LCSA 2DYBA 2CREA 2EPDA 4R0KA 2HEQA 4WCIA 1NEBA 1YWOA 1SEMA 2GQIA 2O31A 2DE0X 2MIOA 2F2WA 2YT6A 1W6XA 1CSKA 2A08A 2F2XA 2GTOA 3TSZA 1H8KA 3SEMA 2GGRA 4D8KA 2AK5A 4AG2C 4OMMA 2KRMA 1UUEA 2YDLA 2EGCA 5FWBA 2KRSA 2AKKA 2J6KA 2CSQA 2BZXA 1XOVA 1Z9QA 1KJWA 1TUCA 1G2BA 1WXTA 1QWEA 2OJ2A 1X6BA 1YP5A 2FEIA 2ROLA 1HJDA 4AFZC 2KYMA 1TG0A 2E5KA 1RLQC 5IHKA 1JU5C 1YN8A 2JW4A 2C0TA 2YUOA 1SRMA 2DM1A 3QWXX 1AWJA 1UHCA 3M0SA 4F17A 1FMKA 3VRZA 1M3CA 2AKLA 3VS7A 3H0FA 2JM8A 3VS6A 2BZ8A 2CH4A 3EG2A 2CSIA 1FYNA 3VS1A 2BTTA 2DA9A 1A0NB 1UE9A 2RQVA 2LMJA 4Y92A 3U23A 3NHNA 2ED0A 4J9CA 3VS5A 1NLPC 2A37A 1U5SA 2DVJA 2H8HA 1J3TA 1UFFA 4AFUC 2RMOA 2VWFA 4GBQA 1UTIA 2EQIA 1AVZC 2O9VA 1HSQA 2VKNA 4OMQA 1AOJA 2KXDA 4CC3A 1PRMC 2YSQA 1T0HA 1BB9A 1E6HA 2LZ6B 1UJYA 2RQUA 3UA6A 1JQQA 1PWTA 1ZX6A 2AZSA 1GCQC 2VVKA 1KIKA 2D0NA 1OPLA 2C0OA 1QCFA 1NM7A 4JJCA 2PTKA 2ED1A 4OMLA 3VRYA 1JXMA 4HXJA 1IO6A 2DL3A 1CKBA 5GJWB 1X69A 1YWPA 4EIKA 2KT1A 4KRTA 4ORZA 1SPKA 1B3QA 3SHWA 2L3PA 1GCPA 2DF6A 1EFNA 1ZLMA 2B86A 1AWOA 4LUDA 3NPFA 1GRIA 2DILA 3LH5A 3R6NA 4RTYA 4J9FA 1PNJA 4X1VA 2M51A 2J7IA 1K0SA 1K76A 1NLOC 2EYYA 2W10A 2M0YA 3VS4A 5IHIA 1W1FA 1RI9A 2JMCA 3ZL7C 1KFZA 2MCNA 4FSSA 2RPNA 4RTTA 2D1XA 1ZUKA 1SHFA 3M0UA 2JMAA 2LP5A 1E7OA 2PNIA 4AG1C 2YUQA 3NGPA 4LUEA 2NWMA 2FRYA 2KR3A 2K9GA 4F14A 4OMPA 2QDLA 1WYXA 2IIMA 1VA7A 2CT4A 1QLYA 5IXFA 2A36A 2OI3A 3O5ZA 2L3QA 1NYFA 3M0TA 1GBQA 2W0ZA 4JZ4A 1GFDA 2LQNA 4E6RA 4D8DA 2FRWA 4M4ZA 2X3XD 2KEAA 2DL5A 2DRKA 1OV3A 2V1QA 1MUZA 2EYZA 1GBRA 2LQWA 2KROA 2CUBA 4HVUA 5ECAA 4AFSC 2RQWA 1T0JA 1W70A 1M8MA 2KRNA 2ABLA 2CH4W 2LJ3A 3IQLA 3TVTA 4JZ3A 1CKAA 1I1JA 2DBMA 4HCKA 4RTVA 4LE9A 2ROTA 1U3OA 5I22A 3NMZC 1G83A 4RTWA 2ECZA 1GL5A 1M3AA 2FO0A 3H0IA 4DEYA 4OMOA 1ARKA 4J9DA 2AZVA 2A28A 1H3HA 1UECA 2HBWA 2C0IA 2RQTA 4LNPA 1UG1A 1UDLA 2RNAA 4ZNXA 2NUZA 2O9SA 1GCQA 2EYXA 2CUDA 2KYBA 3I35A 2DX1A 2OAWA 2FPDA 1AWXA 1X2KA 2X3WD 1MV0B 1QKWA 2MOXA 1AD5A 3H41A 2K79A 3PVLA 1YCSB 3JV3A 4CC2A 1VYUA 3UATA 1WDXA 3M0RA 2ESWA 3TSWA 2JM9A 1GFCA 2YUPA 4J9HA 1UHFA 4LN2A 1N5ZA 1SSHA 4JPBW 1T3SA 1VYTA 2K6DA 1H92A 1K9AA 1NG2A 2DL4A 3ULRB 4GLMA 1K0XA 1WLPB 1OEBA 3C0CA 1AWWA 5FW9A 1AEYA 2L0AA 1WX6A 1E6GA 2GBQA 1OOTA 2JS0A 2BZYA 2YUNA 1BBZA 2D8JA 2J06A 5I11A 2SRCA 1WXUA 2DBKA 2LJ0A 3RNJA 1QWFA 1OPKA 4QT7A 3EG1A 4OMNA 3I5SA 1BK2A 2XMFA 2JTEA 4Z8AA 1T3LA 2SEMA 1RLPC 4RTXA 3EHQA 3THKA 2D8HA 3M0PA 1M27C 2JXBA 1ZSGA 2KNBB 2HCKA 2DRMA 1WXBA 2J05A 4RTZA 2RQRA 2L2PA 1K4US 1JO8A 2EBPA 2DMOA 2RN8A 2HSPA 3EHRA 1U06A 2KT8A 2K7AA 3KFVA 4K11A 2EKHA 1WIEA 5IHNA 3CQTA 1TUDA 1SRLA 1UJ0A 4JJDA 1SHGA 1V1CA 1WI7A 1PKTA 2JS2A 1X43A 2G6FX 3UF4A 1AZGB 1NEGA 1MV3A 1S1NA 1JXOA 2J6OA 3EG0A 2J6FA 1B07A 2CDTA 1I07A 3I9QA 1X27A 1UGVA 3PVQA 2V1RA 1WFWA 2FPEA 4CC7A 3FJ5A 4J9EA 4ESRA 1KSWA 1ZBJA 4AFQC 1VYVA 1WA7A 1K1ZA 4IIOA 1RUWA 1ABOA 5EC7A 5IXBA 2GTJA 3A98A 4Z88A 4DEXA 2DJQA 4HVVA 2DLPA 2I0NA 1QKXA 4JJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ1 A;  4A63 B;  2K3B A;  4HVW A;  5HCK A;  2L3S A;  2O2O A;  2FPF A;  1Y0M A;  2PZ1 A;  2KXC A;  2K2M A;  4RTU A;  2P4R A;  2FG0 A;  2LX7 A;  1JEG A;  2KBT A;  2ENM A;  3EG3 A;  2LNH B;  1HD3 A;  1ZUU A;  1BU1 A;  3GBQ A;  1ABQ A;  3REB B;  5L23 A;  2KGT A;  2DL7 A;  4RUG A;  3QWY A;  4IIM A;  1ZUY A;  2HDA A;  1Y57 A;  4J9I A;  1X6G A;  2EGE A;  5GJV B;  3VS0 A;  1M3B A;  5IH2 A;  3M0Q A;  1PHT A;  5FWC A;  3UA7 A;  2DNU A;  2KE9 A;  3H0H A;  1YNZ A;  2O88 A;  2EW3 A;  2EVR A;  3PE0 A;  4J9B A;  4Z89 A;  3REA B;  4J9G A;  1AZE A;  4CC4 B;  2GNC A;  1X2Q A;  2JT4 A;  1PRL C;  3VS2 A;  2CT3 A;  1M30 A;  1NYG A;  1PKS A;  2F2V A;  2EGA A;  2RF0 A;  3VS3 A;  3RBB B;  1Z9Z A;  3EGU A;  3I5R A;  2DL8 A;  4F16 A;  2EYW A;  1I0C A;  1LCK A;  2LCS A;  2DYB A;  2CRE A;  2EPD A;  4R0K A;  2HEQ A;  4WCI A;  1NEB A;  1YWO A;  1SEM A;  2GQI A;  2O31 A;  2DE0 X;  2MIO A;  2F2W A;  2YT6 A;  1W6X A;  1CSK A;  2A08 A;  2F2X A;  2GTO A;  3TSZ A;  1H8K A;  3SEM A;  2GGR A;  4D8K A;  2AK5 A;  4AG2 C;  4OMM A;  2KRM A;  1UUE A;  2YDL A;  2EGC A;  5FWB A;  2KRS A;  2AKK A;  2J6K A;  2CSQ A;  2BZX A;  1XOV A;  1Z9Q A;  1KJW A;  1TUC A;  1G2B A;  1WXT A;  1QWE A;  2OJ2 A;  1X6B A;  1YP5 A;  2FEI A;  2ROL A;  1HJD A;  4AFZ C;  2KYM A;  1TG0 A;  2E5K A;  1RLQ C;  5IHK A;  1JU5 C;  1YN8 A;  2JW4 A;  2C0T A;  2YUO A;  1SRM A;  2DM1 A;  3QWX X;  1AWJ A;  1UHC A;  3M0S A;  4F17 A;  1FMK A;  3VRZ A;  1M3C A;  2AKL A;  3VS7 A;  3H0F A;  2JM8 A;  3VS6 A;  2BZ8 A;  2CH4 A;  3EG2 A;  2CSI A;  1FYN A;  3VS1 A;  2BTT A;  2DA9 A;  1A0N B;  1UE9 A;  2RQV A;  2LMJ A;  4Y92 A;  3U23 A;  3NHN A;  2ED0 A;  4J9C A;  3VS5 A;  1NLP C;  2A37 A;  1U5S A;  2DVJ A;  2H8H A;  1J3T A;  1UFF A;  4AFU C;  2RMO A;  2VWF A;  4GBQ A;  1UTI A;  2EQI A;  1AVZ C;  2O9V A;  1HSQ A;  2VKN A;  4OMQ A;  1AOJ A;  2KXD A;  4CC3 A;  1PRM C;  2YSQ A;  1T0H A;  1BB9 A;  1E6H A;  2LZ6 B;  1UJY A;  2RQU A;  3UA6 A;  1JQQ A;  1PWT A;  1ZX6 A;  2AZS A;  1GCQ C;  2VVK A;  1KIK A;  2D0N A;  1OPL A;  2C0O A;  1QCF A;  1NM7 A;  4JJC A;  2PTK A;  2ED1 A;  4OML A;  3VRY A;  1JXM A;  4HXJ A;  1IO6 A;  2DL3 A;  1CKB A;  5GJW B;  1X69 A;  1YWP A;  4EIK A;  2KT1 A;  4KRT A;  4ORZ A;  1SPK A;  1B3Q A;  3SHW A;  2L3P A;  1GCP A;  2DF6 A;  1EFN A;  1ZLM A;  2B86 A;  1AWO A;  4LUD A;  3NPF A;  1GRI A;  2DIL A;  3LH5 A;  3R6N A;  4RTY A;  4J9F A;  1PNJ A;  4X1V A;  2M51 A;  2J7I A;  1K0S A;  1K76 A;  1NLO C;  2EYY A;  2W10 A;  2M0Y A;  3VS4 A;  5IHI A;  1W1F A;  1RI9 A;  2JMC A;  3ZL7 C;  1KFZ A;  2MCN A;  4FSS A;  2RPN A;  4RTT A;  2D1X A;  1ZUK A;  1SHF A;  3M0U A;  2JMA A;  2LP5 A;  1E7O A;  2PNI A;  4AG1 C;  2YUQ A;  3NGP A;  4LUE A;  2NWM A;  2FRY A;  2KR3 A;  2K9G A;  4F14 A;  4OMP A;  2QDL A;  1WYX A;  2IIM A;  1VA7 A;  2CT4 A;  1QLY A;  5IXF A;  2A36 A;  2OI3 A;  3O5Z A;  2L3Q A;  1NYF A;  3M0T A;  1GBQ A;  2W0Z A;  4JZ4 A;  1GFD A;  2LQN A;  4E6R A;  4D8D A;  2FRW A;  4M4Z A;  2X3X D;  2KEA A;  2DL5 A;  2DRK A;  1OV3 A;  2V1Q A;  1MUZ A;  2EYZ A;  1GBR A;  2LQW A;  2KRO A;  2CUB A;  4HVU A;  5ECA A;  4AFS C;  2RQW A;  1T0J A;  1W70 A;  1M8M A;  2KRN A;  2ABL A;  2CH4 W;  2LJ3 A;  3IQL A;  3TVT A;  4JZ3 A;  1CKA A;  1I1J A;  2DBM A;  4HCK A;  4RTV A;  4LE9 A;  2ROT A;  1U3O A;  5I22 A;  3NMZ C;  1G83 A;  4RTW A;  2ECZ A;  1GL5 A;  1M3A A;  2FO0 A;  3H0I A;  4DEY A;  4OMO A;  1ARK A;  4J9D A;  2AZV A;  2A28 A;  1H3H A;  1UEC A;  2HBW A;  2C0I A;  2RQT A;  4LNP A;  1UG1 A;  1UDL A;  2RNA A;  4ZNX A;  2NUZ A;  2O9S A;  1GCQ A;  2EYX A;  2CUD A;  2KYB A;  3I35 A;  2DX1 A;  2OAW A;  2FPD A;  1AWX A;  1X2K A;  2X3W D;  1MV0 B;  1QKW A;  2MOX A;  1AD5 A;  3H41 A;  2K79 A;  3PVL A;  1YCS B;  3JV3 A;  4CC2 A;  1VYU A;  3UAT A;  1WDX A;  3M0R A;  2ESW A;  3TSW A;  2JM9 A;  1GFC A;  2YUP A;  4J9H A;  1UHF A;  4LN2 A;  1N5Z A;  1SSH A;  4JPB W;  1T3S A;  1VYT A;  2K6D A;  1H92 A;  1K9A A;  1NG2 A;  2DL4 A;  3ULR B;  4GLM A;  1K0X A;  1WLP B;  1OEB A;  3C0C A;  1AWW A;  5FW9 A;  1AEY A;  2L0A A;  1WX6 A;  1E6G A;  2GBQ A;  1OOT A;  2JS0 A;  2BZY A;  2YUN A;  1BBZ A;  2D8J A;  2J06 A;  5I11 A;  2SRC A;  1WXU A;  2DBK A;  2LJ0 A;  3RNJ A;  1QWF A;  1OPK A;  4QT7 A;  3EG1 A;  4OMN A;  3I5S A;  1BK2 A;  2XMF A;  2JTE A;  4Z8A A;  1T3L A;  2SEM A;  1RLP C;  4RTX A;  3EHQ A;  3THK A;  2D8H A;  3M0P A;  1M27 C;  2JXB A;  1ZSG A;  2KNB B;  2HCK A;  2DRM A;  1WXB A;  2J05 A;  4RTZ A;  2RQR A;  2L2P A;  1K4U S;  1JO8 A;  2EBP A;  2DMO A;  2RN8 A;  2HSP A;  3EHR A;  1U06 A;  2KT8 A;  2K7A A;  3KFV A;  4K11 A;  2EKH A;  1WIE A;  5IHN A;  3CQT A;  1TUD A;  1SRL A;  1UJ0 A;  4JJD A;  1SHG A;  1V1C A;  1WI7 A;  1PKT A;  2JS2 A;  1X43 A;  2G6F X;  3UF4 A;  1AZG B;  1NEG A;  1MV3 A;  1S1N A;  1JXO A;  2J6O A;  3EG0 A;  2J6F A;  1B07 A;  2CDT A;  1I07 A;  3I9Q A;  1X27 A;  1UGV A;  3PVQ A;  2V1R A;  1WFW A;  2FPE A;  4CC7 A;  3FJ5 A;  4J9E A;  4ESR A;  1KSW A;  1ZBJ A;  4AFQ C;  1VYV A;  1WA7 A;  1K1Z A;  4IIO A;  1RUW A;  1ABO A;  5EC7 A;  5IXB A;  2GTJ A;  3A98 A;  4Z88 A;  4DEX A;  2DJQ A;  4HVV A;  2DLP A;  2I0N A;  1QKX A;  4JJB A; 
#chains in the Genus database with same CATH topology
 2MK5 A;  1W2B S;  2LJ1 A;  4BD3 A;  1AHJ B;  2LRQ A;  4J5Y A;  2HQE A;  5CO7 A;  2LX7 A;  2RI3 A;  2EQK A;  4KUD K;  4BI4 A;  1NPR A;  2HKN A;  3V8J A;  1K9M C;  1Q82 R;  1UGP B;  2E3I A;  2JNG A;  2E5Q A;  3GBQ A;  5L23 A;  1QVG A;  4RUG A;  2KVQ G;  4IIM A;  3CCJ T;  4E7I A;  3QII A;  3JCM f;  2JTM A;  2AHJ B;  1OI1 A;  5GAN g;  1X6G A;  1M3B A;  3M0Q A;  3MP8 A;  2KE9 A;  1TH7 A;  1YNZ A;  3H0H A;  1YJN A;  3QJ6 A;  1YIT A;  2EVR A;  2P0P A;  4J9B A;  4J9G A;  1YHQ Q;  1X2Q A;  3H9N A;  2RD1 A;  1NYG A;  1X01 A;  3I56 Q;  5LJ5 h;  1PKS A;  2F2V A;  1FXX A;  2RF0 A;  3VS3 A;  3RBB B;  4MML A;  1VQ5 Q;  3EGU A;  1I4K 1;  1KHI A;  2E10 A;  2EYW A;  4N4H A;  4C0Z A;  2YRD A;  4BY6 C;  2CRE A;  4R0K A;  5LJ3 h;  2KK4 A;  2DIQ A;  2HEQ A;  2NUP B;  2DZ9 A;  1M1K R;  3EFO B;  3M55 A;  2JZ2 A;  1YWO A;  1TOV A;  2DE0 X;  2MIO A;  2R57 A;  4O6J A;  2WSF E;  1RAE B;  5GAN d;  1S72 T;  2F2X A;  3RKY A;  2DTO A;  4M78 B;  4BE1 A;  1WQW A;  3BDU A;  1VQ7 T;  5FWB A;  1UUE A;  4XTU A;  1BYM A;  7AT1 B;  1KJW A;  1TUC A;  1G2B A;  1PCX A;  5FRO A;  3QUI A;  3GIB A;  2BE7 D;  1HJD A;  4OMF B;  2E5K A;  2NUP A;  5GAN 6;  4IUT A;  3V7S A;  3EFO A;  3X28 B;  4PJL A;  1HYO A;  4V2S A;  2DM1 A;  3QWX X;  1UHC A;  3NTH A;  1M1F A;  2E70 A;  3C94 A;  3PMT A;  2RHU A;  2A7Y A;  2PQW A;  1K73 C;  1M3C A;  2YHT A;  2AKL A;  2LX9 A;  4M78 A;  2JM8 A;  3CME T;  2CH4 A;  3SD4 A;  1R77 A;  3VS1 A;  4MZP A;  1A0N B;  1UE9 A;  1OZ2 A;  4Y92 A;  3U23 A;  2JJ9 A;  4C5E A;  1IRX A;  4QVD A;  2QQA A;  1M9S A;  3FB9 A;  4II1 A;  1U5S A;  2QAS A;  2DVJ A;  5GAN 8;  1J3T A;  1VQO T;  2QI2 A;  4NL3 A;  2FB7 A;  2VWF A;  1UTI A;  1JJ2 S;  4M77 E;  1AOJ A;  4OF1 A;  3L2R A;  2YSQ A;  5KE2 A;  1T0H A;  1YI2 T;  1C0M A;  1E6H A;  2VGN A;  1KIK A;  2D0N A;  4BI8 B;  2C0O A;  4M7D G;  1NM7 A;  4BY6 B;  2PTK A;  2NYS A;  4LDU A;  4IUU A;  2DL3 A;  5GJW B;  3PIO A;  1XNI A;  4EIK A;  3JCM b;  5GAO p;  2BKD N;  5I21 A;  2CYZ B;  2L8D A;  2L3P A;  2D0Q B;  5KH6 A;  1AWO A;  2DIL A;  1KK7 A;  2RM4 A;  3R6N A;  3KBG A;  2M51 A;  2PU9 B;  2ZCF B;  2X4W A;  1K0S A;  1NLO C;  2DD5 A;  1BI3 A;  2W10 A;  3VS4 A;  3VV0 A;  3JCM W;  3QSU A;  3JCM V;  1P92 A;  3FLG A;  4FSS A;  3EGX B;  3CD6 A;  1G3S A;  3HPW A;  1UGQ B;  1S72 Q;  3X24 B;  1PD1 A;  2ZGW A;  2KR3 A;  2K9G A;  3OA6 A;  1K73 U;  2IIM A;  1RAB B;  1YFN A;  1M90 C;  3CBM A;  1RAI B;  1MND A;  1BCO A;  1PSF A;  2A36 A;  2OI3 A;  3VYG A;  4QVZ A;  4KGV B;  3M0T A;  2HKQ B;  2RI2 A;  3EGX A;  2FRW A;  3HRT A;  4KT0 E;  4PJO E;  2DRK A;  1VQM A;  1WJQ A;  8ATC B;  2LCC A;  4XU1 A;  2V1Q A;  2ZPG B;  2LQW A;  3CCR T;  1T0J A;  2LJ3 A;  3CPW P;  1CKA A;  2BUD A;  4RTV A;  2ROT A;  1VUB A;  3NMZ C;  3CCL Q;  1ZQ1 A;  4RTW A;  1GL5 A;  4JRK A;  2H3J A;  1VQ4 A;  1VQO Q;  3QDF A;  2X4X A;  3VUZ A;  1RI0 A;  1ARK A;  4J9D A;  2XI9 A;  2CZ7 B;  1DJ7 B;  3G6E T;  3EGD B;  1SSF A;  1YI2 Q;  2G3R A;  2HBW A;  1W2B A;  2BE9 B;  1YIJ T;  4QQ6 A;  1NJI R;  3G4S T;  2RNA A;  4C8Q G;  3LH0 A;  2O9S A;  2CUD A;  2DK3 A;  2KYB A;  3I35 A;  3RMQ A;  2OAU A;  2OAW A;  1H3Z A;  1UB4 A;  1LOJ A;  3E1S A;  1MV0 B;  3N5B B;  3CC2 A;  3A8G B;  2MOX A;  3H41 A;  5AYF A;  1JRI A;  2XKO C;  1C1A A;  1WDX A;  3M0R A;  3DB4 A;  4RG8 A;  2R5A A;  4ZGE B;  3OSV A;  2V8K A;  1RAG B;  1UHF A;  3EGD A;  4E7J A;  3MEA A;  4J6W A;  1WHK A;  3RER A;  4C92 B;  1NG2 A;  1K0X A;  2EWN A;  2ZAE A;  1Q7Y R;  5A2Q E;  2QTV A;  1M90 U;  4Q5W A;  5FW9 A;  4PFO A;  4M7D D;  2GBQ A;  2FZK B;  4VUB A;  3LYI A;  2JS0 A;  2MWP A;  1VOM A;  1QVF P;  1VQ9 T;  3A8L B;  3PTA A;  1QWF A;  1OPK A;  3HFN A;  5GAM e;  3V7C A;  3G71 Q;  5CQX A;  3JSC A;  3HKS A;  4M7A G;  1HXD A;  2KMT A;  3F70 A;  3I5S A;  5CAI A;  3P8H A;  3CXC S;  2COW A;  5GMK e;  3TQ7 P;  4C8Q C;  4JLI A;  4RTX A;  2QA4 T;  4LDW A;  4M75 D;  1MHN A;  3CCU A;  3OS1 A;  3CPW A;  4JJN K;  2JOY A;  2PUK B;  5LJ5 g;  2RQR A;  4JS5 A;  3CCM A;  1JO8 A;  4DBR A;  1M90 R;  2DMO A;  3BDL A;  2E41 A;  1YJ9 Q;  3KFV A;  2EIF A;  2EKH A;  2COY A;  2E4H A;  4M7D E;  1TUD A;  5LJ3 g;  2COZ A;  2K57 A;  1KC8 C;  3OYF A;  3OYG A;  1WJR A;  4D6W A;  1KG1 A;  3G6E Q;  1Q86 C;  3CCV A;  1MMG A;  3EH1 A;  3M4G A;  2KY9 A;  2QAZ A;  1YIJ Q;  2V1R A;  3HTR A;  2FPE A;  5J26 A;  1W4S A;  5GAN j;  6AT1 B;  3FJ5 A;  4J9E A;  4OB1 B;  1D0X A;  4J6Y A;  3CC7 A;  5C0M A;  4AFQ C;  1VYV A;  1YJW T;  4F7U E;  3DKM A;  2GTJ A;  1Y96 B;  4DEX A;  3PGG A;  3LW5 E;  1JJ2 A;  2DJQ A;  4HVV A;  4M75 E;  4FW1 A;  3KUF A;  3JCM e;  2X9H A;  2RH2 A;  4J8O A;  4DOW A;  4A63 B;  4M7A C;  2K3B A;  1Q82 C;  4KH0 B;  2DPP B;  2L3S A;  2O2O A;  2FPF A;  1Y0M A;  2PZ1 A;  2K2M A;  3DB3 A;  4EMK C;  5KCO A;  2FZG B;  2KBT A;  5GMK l;  2HL5 C;  2ENM A;  3EG3 A;  4OB2 B;  2LNH B;  3M59 A;  2DEQ A;  1FMW A;  1HD3 A;  2PVD B;  4AMC A;  1XQH A;  1ABQ A;  3CCJ A;  4C8Q D;  3QWY A;  3CEY A;  1BCM A;  2K5I A;  3PFS A;  2EGE A;  5GJV B;  4FYW B;  3TEE A;  4M7D F;  1TXQ A;  1VQ9 Q;  3FJP A;  2O4X B;  3I55 Q;  3UT1 A;  3KXT A;  3RUX A;  2DNU A;  1VQ6 Q;  3CCE T;  5CIU A;  4M78 G;  1XJW B;  2VGM A;  3OS2 A;  4XAX B;  1BKB A;  1AZE A;  4CC4 B;  3BFM A;  2GF7 A;  2GNC A;  1M1K C;  1PRL C;  3VS2 A;  3A5Z B;  2CP3 A;  3JCM Q;  2X51 A;  1KC8 U;  2P0Q A;  2QA4 Q;  2LNV A;  3URG A;  5LL6 S;  1I0C A;  1LCK A;  3I56 T;  2EPD A;  1Q86 U;  1WHG A;  4WCI A;  1NEB A;  1O9S A;  3OSS C;  1VQ5 T;  1D0Y A;  4M75 F;  4BE0 A;  2GQI A;  1VQP T;  2O4X A;  4FYX B;  2ATC B;  2KQW A;  5GAO m;  2A08 A;  4C8Q E;  2GTO A;  2EQJ A;  3OW2 P;  3SEM A;  4D8K A;  4ZN3 A;  2AK5 A;  2PVG B;  4AG2 C;  2GQV A;  1VQ7 A;  2EGC A;  2KRS A;  3CC4 Q;  2AKK A;  2J6K A;  2OTJ A;  1G3T A;  2M1H A;  2X4Y A;  4JLG A;  1G3W A;  5FLX E;  1Y07 A;  4HCZ A;  3WVE B;  1Q82 U;  4N4I A;  4AFZ C;  4PFZ A;  2DER A;  1TG0 A;  5IHK A;  1G3Y A;  1M4Z A;  1YN8 A;  3C95 A;  4FSX A;  2CS7 A;  2HL3 A;  1RAF B;  1SRM A;  3CPF A;  1AWJ A;  3M0S A;  3CCQ T;  5CQY A;  1FMK A;  3NFC A;  4FYY B;  3VRZ A;  3VS7 A;  3LGL A;  3S6W A;  3VS6 A;  3CME A;  1Q86 R;  1RAC B;  3CMA T;  3EG2 A;  4M78 C;  2GFU A;  1Y7X A;  2YLC A;  3JAM E;  2RQV A;  4M7A A;  2EAY A;  2DXB A;  3NHN A;  1QCN A;  4FM4 B;  1WZO A;  2DAQ A;  2H8H A;  2XDD A;  4EMK A;  5GAM h;  3X20 B;  2RMO A;  2QXF A;  2DD4 A;  5GAN 5;  2JVV A;  2QQB A;  2ZPB B;  2O9V A;  1HSQ A;  2VKN A;  2I2L A;  1QQJ A;  1VQ8 T;  2FL7 A;  5GMK h;  4A4E A;  1BB9 A;  1ZHI A;  2VAS A;  1M1K U;  3OYC A;  2AZS A;  3TRE A;  1Q81 R;  1VQL T;  3OQ5 A;  4L59 A;  4E7Z A;  1OPL A;  3RR6 A;  1QCF A;  3X25 B;  3OYI A;  4J83 A;  4C8Q F;  3QPH A;  2EQM A;  1IO6 A;  1EZZ B;  1X69 A;  2LVM A;  3OYH A;  1YWP A;  3CCE Q;  2KT1 A;  4DOV A;  4ORZ A;  1B3Q A;  2M9U A;  1ZLM A;  1G5V A;  4ZTJ A;  3NPF A;  3LH5 A;  2QK0 A;  1F1B B;  3D7S B;  4QQD A;  2J7I A;  1YCY A;  2LDM A;  1K76 A;  2M0Y A;  2HQH A;  2RHZ A;  5IHI A;  1RI9 A;  5CKF A;  2VB6 A;  1KFZ A;  1UGR B;  4E7S A;  2FVU A;  4PFP A;  1VQP Q;  1ZUK A;  2CP0 A;  2V8I A;  1WHH A;  3M54 A;  3CCS T;  2HNI A;  8AT1 B;  4N0A C;  3CXC A;  2YUQ A;  1TWB A;  1RL2 A;  2NWM A;  3OYJ A;  5CK9 A;  4JRQ A;  1B34 B;  2EJG A;  3JCM h;  1TU0 B;  4M78 D;  1OX8 A;  2CT4 A;  2X35 A;  3AT1 B;  2JTF A;  2YRC A;  3FDR A;  3CPW S;  3G7Z A;  1GBQ A;  4B6M A;  4JZ4 A;  1R0C B;  1GFD A;  2LQN A;  4D8D A;  1OQK A;  4OGE A;  2AIR B;  2EJ9 A;  2OTL T;  1N6A A;  3QZ9 B;  3CCQ Q;  1NPP A;  4JDS A;  3JCM P;  3ZEH A;  2EYZ A;  1WGS A;  3CCR A;  2KRO A;  4HVU A;  3OYA A;  3C4S A;  2RQW A;  1W70 A;  4M77 B;  2CH4 W;  3CMA Q;  3TVT A;  4JZ3 A;  1B34 A;  2EJF A;  4X9D A;  4HCK A;  4E7L A;  2IVW A;  2K5L A;  4LE9 A;  3LWI A;  4A54 A;  1RAH B;  2DFU A;  1VQK Q;  1KD1 U;  1G83 A;  1M3A A;  3GF5 A;  3H0I A;  1NJI C;  4DEY A;  2QEX A;  4XTX A;  5A0G A;  3HL8 A;  1IXD A;  1VQN A;  4EMG A;  4ZN1 A;  1OU8 A;  3CCL T;  2Z0W A;  4N4G A;  1VQ8 Q;  5HK3 A;  4LDV A;  1BIB A;  1WPY A;  4C92 G;  2C0I A;  3QXE B;  3G4S A;  1VQL Q;  1UG1 A;  1UDL A;  4M77 A;  4GLK A;  4PLL A;  2RK2 A;  2EYX A;  3HRU A;  2RK1 A;  1IRE B;  4JRP A;  1K8A C;  2DX1 A;  3CBP A;  4TVR A;  4NS5 A;  2QGF B;  5CKD A;  2XG8 D;  1AD5 A;  3PVL A;  1YCS B;  3JV3 A;  4CC2 A;  1Q7Y C;  2ESW A;  4ELY C;  3FC3 A;  3TSW A;  4FW2 A;  3UWN A;  2JM9 A;  4MZT A;  3A8M B;  4LN2 A;  1N5Z A;  3MP1 A;  1QP3 A;  2A0F B;  1M8V A;  1KD1 R;  1SKU B;  1QVF S;  2YXY A;  1WLP B;  3BY7 A;  3S3M A;  3ME9 A;  1AWW A;  5LJ5 j;  3CCS Q;  2E65 A;  2BZY A;  2CP6 A;  4N0A A;  1D1C A;  1QCO A;  5LJ3 j;  4MMK A;  2YUN A;  4PJO B;  2J06 A;  2SRC A;  1WXU A;  2DBK A;  3L2U A;  2LJ0 A;  1KQS P;  4J7F A;  1I81 A;  3EG1 A;  5KYW B;  4M78 F;  4C92 C;  2XMF A;  4DBQ A;  1T3L A;  4E7K A;  3G71 T;  4XQ3 A;  2OTL Q;  2ZPH B;  3EHQ A;  3EFR A;  1NJI U;  3WXM B;  3THK A;  3M0P A;  5CKB A;  2BIV A;  4KUL A;  1M27 C;  3LLR A;  3QYG B;  4MDW A;  2KNB B;  4RTZ A;  3JRZ A;  1MGQ A;  4PJO A;  2RN8 A;  2XIC A;  2HD0 A;  2KT8 A;  2K7A A;  5GAN f;  3OYE A;  5KYN A;  1WIE A;  5IHN A;  5FRN A;  3CQT A;  1SRL A;  1K8A U;  1YJ9 T;  1SHG A;  4A4H A;  4HA8 A;  1X43 A;  2LT1 A;  3UF4 A;  1NEG A;  2LTO A;  1MV3 A;  2J6O A;  1Q7Y U;  2HMA A;  1B07 A;  2CDT A;  1I07 A;  3I9Q A;  5D6Y A;  1D0Z A;  1U1S A;  4BE2 A;  4CC7 A;  2DKG A;  1ZBX A;  4ESR A;  5I2M A;  3HHT B;  3LX7 A;  3O8V A;  4QKU A;  1YJW A;  4IIO A;  5EC7 A;  3A98 A;  2DTI A;  5A0L A;  3M58 A;  1GCP A;  2I0N A;  3L2Z A;  2Y4X A;  3RKX A;  1N8R U;  3M9Q A;  5HCK A;  1ZSZ C;  2ZPE B;  3OBY A;  4PNO A;  4ELZ C;  2P4R A;  5D6W A;  1H64 1;  1JEG A;  2M0O A;  5I2S A;  1K8A R;  5GMK m;  5KYU B;  1I8F A;  4PJJ A;  4C92 D;  2IG0 A;  2RHY A;  3BW1 A;  2KDS A;  3L42 A;  3Q1J A;  4NL2 A;  3REB B;  2KGT A;  2DL7 A;  1ZA2 B;  5C6S A;  5GAM g;  1ZUY A;  1Y57 A;  2LCL A;  2HBP A;  1PD0 A;  1KQ1 A;  2DXU A;  3VS0 A;  2LC4 A;  4OP0 A;  1YJN Q;  2JN0 A;  3MCA B;  2CZ0 B;  1YIT Q;  4JUV A;  1PHT A;  5FWC A;  5GAN 4;  4KH1 B;  2Y4Y A;  3UA7 A;  3DLL A;  2F1L A;  4FL6 A;  4BB7 A;  2KSS A;  1LPL A;  3SDZ A;  3PE0 A;  2M02 A;  3VKI A;  3I55 T;  5KYU A;  2C06 A;  1N8R R;  2RJD A;  4RG2 A;  4A53 A;  4C92 A;  3P8B B;  1M30 A;  1I5O B;  1VQ6 T;  3GNF B;  2FZC B;  3OW2 S;  1YHQ A;  3J7A F;  3RMS A;  3TCJ A;  4BUG A;  4F16 A;  3I56 A;  1R0B G;  1C6V X;  3CD6 T;  2DYB A;  1V29 B;  1VQ5 A;  3JB9 J;  3JCM X;  1FMV A;  3E2U A;  1SEM A;  3OYY A;  1YBY A;  4QQG A;  2F2W A;  1W6X A;  3SFM A;  5J3B A;  4L5G A;  3OS5 A;  2Y90 A;  1H8K A;  2K3X A;  2R5M A;  3VJP A;  4OVA A;  4QW2 A;  9ATC B;  4E2F B;  2YDL A;  4F7U B;  2CSQ A;  1XOV A;  1ZSZ B;  4HT8 A;  1WXT A;  1QWE A;  2OJ2 A;  1YP5 A;  3CC4 T;  5IN1 A;  2EKO A;  3JCM g;  1RLQ C;  2GCX A;  2R58 A;  4RMO A;  4XU3 A;  2C0T A;  4F17 A;  5GMK i;  3H0F A;  5DLO A;  4KGZ B;  1EIF A;  2CSI A;  4F7U A;  2BTT A;  4GY5 A;  2LMJ A;  1ZSZ A;  5LJ5 d;  1ACM B;  2ED0 A;  2DTH A;  4J9C A;  2A37 A;  1Q81 C;  2NUT B;  5GAO r;  4AFU C;  5DM7 R;  3OB9 A;  4GBQ A;  2EQI A;  1AVZ C;  5LJ3 d;  3JB9 I;  3GLX A;  5CVI A;  4CC3 A;  4FYV B;  3OYN A;  2ZZD A;  2QYZ A;  1WNL A;  2LZ6 B;  1UJY A;  3UA6 A;  1JQQ A;  1PWT A;  1IHV A;  3CC2 T;  2D9T A;  4WTO B;  2F5K A;  4NOY A;  4KGX B;  2ED1 A;  1Y96 A;  3VRY A;  1QVF A;  2MI6 A;  1GXI E;  3ASK A;  4ZGD B;  2WSE E;  3ZFJ A;  2NUT A;  1IGQ A;  4IUV A;  2V26 A;  2DF6 A;  3UPU A;  2B86 A;  3PMI A;  5IAY A;  4LUD A;  3SB2 A;  2PUO B;  4RTY A;  4XU2 A;  1BI2 A;  1KHC A;  1IHW A;  2V8J A;  1WHL A;  2EYY A;  2MF2 A;  3CD6 Q;  2L89 A;  4EDU A;  3MO8 A;  2MCN A;  2RPN A;  3V8L A;  1QVG P;  2DO3 A;  4PJM A;  1SHF A;  3M0U A;  4Y28 E;  4CI0 C;  3QHS A;  2LP5 A;  1E7O A;  4AG1 C;  4ME7 A;  3MPU B;  3NGP A;  3FEO A;  4LUE A;  4M77 G;  2FRY A;  2CP7 A;  3L2V A;  4WF2 A;  1S72 A;  3C12 A;  4OMP A;  2QDL A;  1WYX A;  3MP6 A;  4EPC A;  1U8R A;  2RHI A;  4XTV A;  4DQ2 A;  1QLY A;  5D7U A;  4LXC A;  3HP9 A;  2LQK A;  4IUQ A;  5IXF A;  5FRM A;  1D1B A;  1NE8 A;  4PL6 A;  3UDC A;  2L3Q A;  1NYF A;  3M57 A;  4M7A D;  1VQM Q;  4A4K A;  3CCU T;  2X3X D;  3JB9 H;  1Q81 U;  2DL5 A;  2EFI A;  4HT9 A;  1GBR A;  1MUZ A;  4DA4 A;  5IT9 E;  4JS4 A;  4C0D B;  2KRN A;  1QP2 A;  2ABL A;  3HRS A;  3H8Z A;  3IQL A;  2XDB A;  3QKJ A;  1I1J A;  1TUG B;  1VQ4 Q;  4LDX A;  1U3O A;  5I22 A;  1XTD A;  4L6V 5;  2K2V A;  3LGF A;  2E12 A;  2ECZ A;  2DET A;  5HK0 A;  3MET A;  4XK8 E;  1RAA B;  2CP5 A;  4OMO A;  3CCL A;  4C5H A;  2A3L A;  1VQK T;  2AZV A;  2IPO B;  1H3H A;  1VQO A;  1UEC A;  2DXT A;  3T9N A;  3CC7 T;  1WJS A;  3CC2 Q;  3G1J A;  4M7A E;  1YI2 A;  4M77 C;  3QZ5 B;  4B9W A;  2FPD A;  1AWX A;  1X2K A;  2X3W D;  1KD1 C;  2HZY A;  3MKD A;  3M53 A;  3PNW C;  5LJ5 f;  4AT1 B;  1VYU A;  3UAT A;  2CKK A;  3RKW A;  3WVD B;  4PJO G;  2YUP A;  4OB3 B;  1MMD A;  1SSH A;  4JPB W;  1T3S A;  5LJ3 f;  3OS0 A;  2K6D A;  3P8D A;  1K9A A;  4FCY A;  3C0C A;  4C5G A;  1KQS S;  1AEY A;  2E3H A;  4FT4 A;  3GOX A;  1WX6 A;  2ZPF B;  2GFA A;  1OZ3 A;  5KYX B;  2XDP A;  1WHJ A;  1OYX A;  1OU9 A;  3BE3 A;  3OW2 A;  1VIE A;  1MMN A;  2D8J A;  3X26 B;  2JUF A;  3RNJ A;  2X4J A;  2HAX A;  4E7H A;  1UEB A;  5GAN e;  1G8X A;  2QQS A;  1M2V B;  2MMP A;  3A8O B;  4OMN A;  1LNX A;  2EYQ A;  2VXE A;  3G71 A;  1LJO A;  3CCU Q;  1RLP C;  1BI0 A;  3MEU A;  4M7A F;  3CCM Q;  5KYX A;  1O75 A;  5GAO l;  1IZ6 A;  2DRM A;  1WXB A;  4KUI A;  3OMC A;  2L2P A;  1K4U S;  1SG5 A;  2NLU A;  3EHR A;  1U1T A;  4K11 A;  4BDY A;  4PJO C;  4M77 D;  4HCC A;  4KBM B;  5HY6 A;  3E9G A;  3JB9 G;  2P0K A;  5HKC A;  3CCV Q;  1M2V A;  1YJ9 A;  2OTJ T;  3AHU A;  1V1C A;  1PKT A;  2JS2 A;  4HKE A;  2MPX C;  1AZG B;  1ZA1 B;  1IB8 A;  1S1N A;  2J6F A;  3CC7 Q;  3G6E A;  1X27 A;  2XHC A;  3INZ A;  4FT2 A;  3OBW A;  5GAM j;  5GAN 7;  4M78 E;  1RAD B;  1AT1 B;  1YIJ A;  1ZBJ A;  1K9M U;  5D6X A;  1WA7 A;  4Y91 A;  5KE3 A;  1RUW A;  3TU4 K;  1ABO A;  4B9X A;  5GMK j;  2VXF A;  4Z88 A;  2B8A A;  1QKX A;  5EG2 A;  2QDY B;  5FU6 C;  4HVW A;  3M5A A;  2KXC A;  3CBO A;  4RTU A;  2K5F A;  2FG0 A;  2DXC A;  4C0F A;  2MAM A;  3CCJ Q;  4IUR A;  2XK0 A;  1ZUU A;  2P4T A;  1BU1 A;  3RES A;  1W2B P;  4X9C A;  2K4Y A;  2F5T X;  2PVO B;  2HDA A;  2HQX A;  4J9I A;  2RJF A;  3HFO A;  1N8R C;  5IH2 A;  1D1A A;  1K9M R;  2O88 A;  2EW3 A;  1YJN T;  1YIT T;  4Z89 A;  4PJO D;  1QMC A;  1VQ9 A;  3REA B;  1TSF A;  2P84 A;  4E47 A;  3I55 A;  1TS9 A;  3NTI A;  3RDV A;  1V76 A;  2JT4 A;  2CT3 A;  1VQ6 A;  4F7U G;  3S3O A;  4BAC A;  2HSE B;  2EGA A;  4M75 G;  4OB0 B;  2H3E B;  3QDR B;  1Z9Z A;  3I5R A;  2DYI A;  2DL8 A;  2LCS A;  5GAO q;  2QA4 A;  1FX7 A;  3EAE A;  3MHX A;  1B7T A;  1M5Q 1;  2O31 A;  2YT6 A;  2LT4 A;  2YLB A;  1CSK A;  2RHX A;  1VQ7 Q;  4UC4 A;  4LDY A;  3TSZ A;  2EQU A;  2O01 E;  1OUL A;  2GGR A;  2VUB A;  2DEU A;  2OTJ Q;  2QTX A;  2DZC A;  4M77 F;  2QG9 B;  4OMM A;  2KRM A;  5FU6 B;  5GAN 3;  5A0D A;  3EH2 A;  3OMG A;  2BZX A;  3M56 A;  1Z9Q A;  3EG9 B;  1NZ9 A;  5KYW A;  2DJZ A;  3CC4 A;  1X6B A;  2FEI A;  2ROL A;  4CRI A;  4M7D C;  1Y71 A;  2KYM A;  3V7R A;  3FIF A;  3M4Y A;  1JU5 C;  2JW4 A;  1KQ2 A;  3JCM J;  2YUO A;  3HSB A;  2RB6 A;  3CME Q;  4OGC A;  1BI1 A;  5J39 A;  1HK9 A;  3VU3 C;  1N9R A;  2BZ8 A;  1FYN A;  2DA9 A;  5DLQ E;  2QEX T;  2WAC A;  4DBH A;  3JB9 D;  2WSC E;  3EG9 A;  1VQN T;  1K73 R;  1N27 A;  2QQ9 A;  3VS5 A;  1NLP C;  4M75 C;  2M16 A;  1UFF A;  2D6F A;  5GAN h;  4Z02 A;  4OMQ A;  2KXD A;  1PRM C;  2CZ1 B;  4P5N A;  2RQU A;  1ZX6 A;  1IGU A;  1GCQ C;  2CP2 A;  2CZ6 B;  2VVK A;  4YTL A;  4DBF A;  2MWO A;  3MEW A;  4JJC A;  4ATO A;  2MYS A;  3MJX A;  4OML A;  3VYH B;  2L3R A;  1JXM A;  4HXJ A;  1JJ2 P;  1R8O B;  1X6O A;  3PT9 A;  1CKB A;  2VV5 A;  4MDX A;  2KAF A;  3OYL A;  2XID A;  4JRI A;  4KRT A;  1KQS A;  1QVG S;  1QVP A;  1SPK A;  4R56 A;  3SHW A;  3JCM c;  2DVE A;  4LD9 K;  1EFN A;  2L5Q A;  3CCE A;  1WHM A;  4PJO F;  1GRI A;  4J9F A;  1PNJ A;  4X1V A;  5KCH A;  4PK4 A;  5FU7 C;  4RCC A;  2VC8 A;  3H6Z A;  1W1F A;  1WQ7 A;  4M7D B;  2JMC A;  3ZL7 C;  1D09 B;  4RTT A;  2D1X A;  4PKC C;  3ER0 A;  4X34 A;  3SWN C;  1MMA A;  2JMA A;  2XU8 A;  2PNI A;  3A1P A;  1OX9 A;  3ZBD A;  4C0G A;  3OYK A;  1VQP A;  4C92 E;  4J7I A;  1QW1 A;  4PLI A;  1NBE B;  5GAM d;  5GAO n;  1M1G A;  2E6N A;  2RA2 A;  4F14 A;  4XTZ A;  4ZTF A;  1VA7 A;  4IKF A;  5L8R E;  3PIP A;  5KYY B;  3A8H B;  1TTH B;  4IUP A;  3DLM A;  3O5Z A;  2W0Z A;  4M75 B;  1PC0 A;  1BIA A;  4M7D A;  4E6R A;  3CCR Q;  4M4Z A;  2KEA A;  1OV3 A;  1VQM T;  2CUB A;  5ECA A;  4AFS C;  1M8M A;  3CCQ A;  3OYD A;  2RI5 A;  3S3N A;  4C5I A;  2DBM A;  2VYT A;  2QEX Q;  4MZM A;  3CMA A;  2KI7 A;  1VQN Q;  1M2O A;  5KYY A;  2FO0 A;  5CKH A;  4ZGJ B;  5LJ5 e;  1VQ4 T;  3JB9 F;  4M75 A;  1UGS B;  1VQK A;  4EMH A;  2A28 A;  2LQ8 A;  3G4S Q;  4FIB A;  1SF9 A;  3QG1 A;  2E1H A;  4O5V A;  5LJ3 e;  1PSE A;  2RQT A;  5FU7 B;  4LNP A;  1VQ8 A;  2XD0 A;  4ZNX A;  1I5L A;  2NUZ A;  1GCQ A;  3QJY A;  3V8K A;  4C0D C;  1VIF A;  4C92 F;  3JCM d;  1VQL A;  1PM3 A;  3SWN B;  1QKW A;  5GAN 2;  3QYH B;  4A4G A;  2K79 A;  3J80 E;  5CKE A;  4A4F A;  1FWZ A;  1GFC A;  4J9H A;  4XU0 A;  3VUB A;  1PG5 B;  5AT1 B;  2RO0 A;  3E9F A;  1VYT A;  3L1A A;  3RIR A;  1H92 A;  4PJN A;  4XTY A;  2DL4 A;  3ULR B;  3R6O A;  4GLM A;  3L2W A;  4C8Q B;  1OEB A;  2DIG A;  5CR2 A;  4F04 B;  2E64 A;  1Q95 G;  2L0A A;  3SWN A;  3QBY A;  1E6G A;  4BI3 A;  1OOT A;  2CGH A;  2ZPI B;  3CCS A;  2K3Y A;  1BBZ A;  1LVK A;  5I11 A;  4QT7 A;  5M9O A;  1D3B B;  4RKU E;  1N9S A;  1YHQ T;  4C8Q A;  1BK2 A;  4LD6 A;  2OX7 A;  2JTE A;  4Z8A A;  2SEM A;  3GNG A;  3NTK A;  4F7U F;  2AT1 B;  2QQR A;  2QGG A;  2D8H A;  2JXB A;  1ZSG A;  2OTL A;  2HCK A;  3OY9 A;  2J05 A;  3LWH A;  2EBP A;  3CCM T;  4HCB A;  3J81 E;  4QVC A;  2HSP A;  3OYM A;  4FU6 A;  2RJE A;  3FRN A;  5GAM f;  3L2Q A;  3CXC P;  1U06 A;  4BDZ A;  4R55 A;  1JB0 E;  1D3B A;  1MNE A;  4M7A B;  3QO3 A;  4XTW A;  1UJ0 A;  1EX4 A;  4JJD A;  4ANJ A;  5CCA A;  2YWW A;  4J6X A;  1WI7 A;  3GP8 A;  4RCB A;  5DY9 A;  4EMK B;  1JBM A;  2G6F X;  3E19 A;  3CCV T;  1JXO A;  3EG0 A;  3MEV A;  3EFS A;  2FYK A;  1YJW Q;  1UGV A;  2YRV A;  3PVQ A;  1KC8 R;  1WFW A;  2E6Z A;  2F69 A;  1KSW A;  3GPL A;  1K1Z A;  2RJC A;  5IXB A;  2FHD A;  1X75 C;  2DLP A;  3OYB A;  4JJB A; 
#chains in the Genus database with same CATH homology
 2LJ1 A;  4A63 B;  2K3B A;  4HVW A;  5HCK A;  2L3S A;  2O2O A;  2FPF A;  1Y0M A;  2PZ1 A;  2KXC A;  2K2M A;  4RTU A;  2P4R A;  2FG0 A;  2LX7 A;  1JEG A;  2KBT A;  2ENM A;  3EG3 A;  2LNH B;  1HD3 A;  1ZUU A;  1BU1 A;  3GBQ A;  1ABQ A;  3REB B;  5L23 A;  2KGT A;  2DL7 A;  4RUG A;  3QWY A;  4IIM A;  1ZUY A;  2HDA A;  1Y57 A;  4J9I A;  1X6G A;  2EGE A;  5GJV B;  3VS0 A;  1M3B A;  5IH2 A;  3M0Q A;  1PHT A;  5FWC A;  3UA7 A;  2DNU A;  2KE9 A;  3H0H A;  1YNZ A;  2O88 A;  2EW3 A;  2EVR A;  3PE0 A;  4J9B A;  4Z89 A;  3REA B;  4J9G A;  1AZE A;  4CC4 B;  2GNC A;  1X2Q A;  2JT4 A;  1PRL C;  3VS2 A;  2CT3 A;  1M30 A;  1NYG A;  1PKS A;  2F2V A;  2EGA A;  2RF0 A;  3VS3 A;  3RBB B;  1Z9Z A;  3EGU A;  3I5R A;  2DL8 A;  4F16 A;  2EYW A;  1I0C A;  1LCK A;  2LCS A;  2DYB A;  2CRE A;  2EPD A;  4R0K A;  2HEQ A;  4WCI A;  1NEB A;  1YWO A;  1SEM A;  2GQI A;  2O31 A;  2DE0 X;  2MIO A;  2F2W A;  2YT6 A;  1W6X A;  1CSK A;  2A08 A;  2F2X A;  2GTO A;  3TSZ A;  1H8K A;  3SEM A;  2GGR A;  4D8K A;  2AK5 A;  4AG2 C;  4OMM A;  2KRM A;  1UUE A;  2YDL A;  2EGC A;  5FWB A;  2KRS A;  2AKK A;  2J6K A;  2CSQ A;  2BZX A;  1XOV A;  1Z9Q A;  1KJW A;  1TUC A;  1G2B A;  1WXT A;  1QWE A;  2OJ2 A;  1X6B A;  1YP5 A;  2FEI A;  2ROL A;  1HJD A;  4AFZ C;  2KYM A;  1TG0 A;  2E5K A;  1RLQ C;  5IHK A;  1JU5 C;  1YN8 A;  2JW4 A;  2C0T A;  2YUO A;  1SRM A;  2DM1 A;  3QWX X;  1AWJ A;  1UHC A;  3M0S A;  4F17 A;  1FMK A;  3VRZ A;  1M3C A;  2AKL A;  3VS7 A;  3H0F A;  2JM8 A;  3VS6 A;  2BZ8 A;  2CH4 A;  3EG2 A;  2CSI A;  1FYN A;  3VS1 A;  2BTT A;  2DA9 A;  1A0N B;  1UE9 A;  2RQV A;  2LMJ A;  4Y92 A;  3U23 A;  3NHN A;  2ED0 A;  4J9C A;  3VS5 A;  1NLP C;  2A37 A;  1U5S A;  2DVJ A;  2H8H A;  1J3T A;  1UFF A;  4AFU C;  2RMO A;  2VWF A;  4GBQ A;  1UTI A;  2EQI A;  1AVZ C;  2O9V A;  1HSQ A;  2VKN A;  4OMQ A;  1AOJ A;  2KXD A;  4CC3 A;  1PRM C;  2YSQ A;  1T0H A;  1BB9 A;  1E6H A;  2LZ6 B;  1UJY A;  2RQU A;  3UA6 A;  1JQQ A;  1PWT A;  1ZX6 A;  2AZS A;  1GCQ C;  2VVK A;  1KIK A;  2D0N A;  1OPL A;  2C0O A;  1QCF A;  1NM7 A;  4JJC A;  2PTK A;  2ED1 A;  4OML A;  3VRY A;  1JXM A;  4HXJ A;  1IO6 A;  2DL3 A;  1CKB A;  5GJW B;  1X69 A;  1YWP A;  4EIK A;  2KT1 A;  4KRT A;  4ORZ A;  1SPK A;  1B3Q A;  3SHW A;  2L3P A;  1GCP A;  2DF6 A;  1EFN A;  1ZLM A;  2B86 A;  1AWO A;  4LUD A;  3NPF A;  1GRI A;  2DIL A;  3LH5 A;  3R6N A;  4RTY A;  4J9F A;  1PNJ A;  4X1V A;  2M51 A;  2J7I A;  1K0S A;  1K76 A;  1NLO C;  2EYY A;  2W10 A;  2M0Y A;  3VS4 A;  5IHI A;  1W1F A;  1RI9 A;  2JMC A;  3ZL7 C;  1KFZ A;  2MCN A;  4FSS A;  2RPN A;  4RTT A;  2D1X A;  1ZUK A;  1SHF A;  3M0U A;  2JMA A;  2LP5 A;  1E7O A;  2PNI A;  4AG1 C;  2YUQ A;  3NGP A;  4LUE A;  2NWM A;  2FRY A;  2KR3 A;  2K9G A;  4F14 A;  4OMP A;  2QDL A;  1WYX A;  2IIM A;  1VA7 A;  2CT4 A;  1QLY A;  5IXF A;  2A36 A;  2OI3 A;  3O5Z A;  2L3Q A;  1NYF A;  3M0T A;  1GBQ A;  2W0Z A;  4JZ4 A;  1GFD A;  2LQN A;  4E6R A;  4D8D A;  2FRW A;  4M4Z A;  2X3X D;  2KEA A;  2DL5 A;  2DRK A;  1OV3 A;  2V1Q A;  1MUZ A;  2EYZ A;  1GBR A;  2LQW A;  2KRO A;  2CUB A;  4HVU A;  5ECA A;  4AFS C;  2RQW A;  1T0J A;  1W70 A;  1M8M A;  2KRN A;  2ABL A;  2CH4 W;  2LJ3 A;  3IQL A;  3TVT A;  4JZ3 A;  1CKA A;  1I1J A;  2DBM A;  4HCK A;  4RTV A;  4LE9 A;  2ROT A;  1U3O A;  5I22 A;  3NMZ C;  1G83 A;  4RTW A;  2ECZ A;  1GL5 A;  1M3A A;  2FO0 A;  3H0I A;  4DEY A;  4OMO A;  1ARK A;  4J9D A;  2AZV A;  2A28 A;  1H3H A;  1UEC A;  2HBW A;  2C0I A;  2RQT A;  4LNP A;  1UG1 A;  1UDL A;  2RNA A;  4ZNX A;  2NUZ A;  2O9S A;  1GCQ A;  2EYX A;  2CUD A;  2KYB A;  3I35 A;  2DX1 A;  2OAW A;  2FPD A;  1AWX A;  1X2K A;  2X3W D;  1MV0 B;  1QKW A;  2MOX A;  1AD5 A;  3H41 A;  2K79 A;  3PVL A;  1YCS B;  3JV3 A;  4CC2 A;  1VYU A;  3UAT A;  1WDX A;  3M0R A;  2ESW A;  3TSW A;  2JM9 A;  1GFC A;  2YUP A;  4J9H A;  1UHF A;  4LN2 A;  1N5Z A;  1SSH A;  4JPB W;  1T3S A;  1VYT A;  2K6D A;  1H92 A;  1K9A A;  1NG2 A;  2DL4 A;  3ULR B;  4GLM A;  1K0X A;  1WLP B;  1OEB A;  3C0C A;  1AWW A;  5FW9 A;  1AEY A;  2L0A A;  1WX6 A;  1E6G A;  2GBQ A;  1OOT A;  2JS0 A;  2BZY A;  2YUN A;  1BBZ A;  2D8J A;  2J06 A;  5I11 A;  2SRC A;  1WXU A;  2DBK A;  2LJ0 A;  3RNJ A;  1QWF A;  1OPK A;  4QT7 A;  3EG1 A;  4OMN A;  3I5S A;  1BK2 A;  2XMF A;  2JTE A;  4Z8A A;  1T3L A;  2SEM A;  1RLP C;  4RTX A;  3EHQ A;  3THK A;  2D8H A;  3M0P A;  1M27 C;  2JXB A;  1ZSG A;  2KNB B;  2HCK A;  2DRM A;  1WXB A;  2J05 A;  4RTZ A;  2RQR A;  2L2P A;  1K4U S;  1JO8 A;  2EBP A;  2DMO A;  2RN8 A;  2HSP A;  3EHR A;  1U06 A;  2KT8 A;  2K7A A;  3KFV A;  4K11 A;  2EKH A;  1WIE A;  5IHN A;  3CQT A;  1TUD A;  1SRL A;  1UJ0 A;  4JJD A;  1SHG A;  1V1C A;  1WI7 A;  1PKT A;  2JS2 A;  1X43 A;  2G6F X;  3UF4 A;  1AZG B;  1NEG A;  1MV3 A;  1S1N A;  1JXO A;  2J6O A;  3EG0 A;  2J6F A;  1B07 A;  2CDT A;  1I07 A;  3I9Q A;  1X27 A;  1UGV A;  3PVQ A;  2V1R A;  1WFW A;  2FPE A;  4CC7 A;  3FJ5 A;  4J9E A;  4ESR A;  1KSW A;  1ZBJ A;  4AFQ C;  1VYV A;  1WA7 A;  1K1Z A;  4IIO A;  1RUW A;  1ABO A;  5EC7 A;  5IXB A;  2GTJ A;  3A98 A;  4Z88 A;  4DEX A;  2DJQ A;  4HVV A;  2DLP A;  2I0N A;  1QKX A;  4JJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...