2GNCA

Crystal structure of srgap1 sh3 domain in the slit-robo signaling pathway
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
55
structure length
55
Chain Sequence
PEFAIAKFDYVGRSARELSFKKGASLLLYHRASEDWWEGRHNGIDGLVPHQYIVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords SLIT-ROBO Rho GTPase-activating protein 1
publication title Structural Basis of Robo Proline-rich Motif Recognition by the srGAP1 Src Homology 3 Domain in the Slit-Robo Signaling Pathway
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2gncA00
1YNZA 2CUDA 3UA7A 3UF4A 2L0AA 5IHIA 1NEGA 1WFWA 2DMOA 1V1CA 2FPDA 2J7IA 2D8HA 4AG1C 1HJDA 2FG0A 2PZ1A 1ZUKA 2RMOA 2CUBA 1T0HA 1KIKA 1WXUA 3LH5A 2C0OA 2FEIA 1UDLA 2H8HA 4F14A 2PTKA 4AFSC 1NLPC 2ESWA 2EQIA 1X6GA 3H0FA 4CC7A 2F2WA 1QLYA 5EC7A 2GGRA 1WDXA 4RTUA 2YUNA 4AFQC 3KFVA 3REAB 4OMQA 1HD3A 1K76A 4HXJA 2BZYA 4F17A 1JO8A 3VS3A 2J6KA 5IH2A 1WX6A 1QKWA 2MCNA 1NYFA 2LZ6B 1K1ZA 3TSWA 1PWTA 3QWYA 5L23A 2DA9A 1S1NA 1B3QA 4HVVA 2ENMA 4J9CA 2KT1A 1GBQA 3C0CA 1M3AA 4DEXA 3NPFA 3VS2A 3SHWA 2BTTA 2BZXA 2J05A 4OMLA 3TSZA 2D8JA 4OMOA 1JU5C 4J9IA 2FRYA 1VYVA 2JT4A 2K2MA 3VS0A 1K4US 2DL4A 3VS6A 1U3OA 1UG1A 3UATA 1VYTA 2AKKA 1CSKA 2KRNA 1X6BA 2RQVA 1OV3A 3EG2A 1AD5A 4J9EA 4IIMA 1K0SA 5ECAA 2EYWA 2CH4A 2FRWA 2KR3A 4JJBA 1IO6A 1SHFA 2LP5A 1RLPC 1UJYA 2KROA 2DX1A 3PE0A 2B86A 2DRKA 2LCSA 1K0XA 2RQUA 1M3CA 2EPDA 4AFUC 2LQNA 4LN2A 2DVJA 2ROTA 1PRLC 1ZUYA 2L3SA 4J9DA 1OPLA 4OMPA 4RTYA 2KYBA 4JPBW 2KGTA 2RQRA 2CT4A 3QWXX 3PVLA 5GJWB 2AZSA 1QWEA 1WI7A 2JS0A 4Y92A 1H8KA 2K79A 2MIOA 1TUDA 2DLPA 3VS4A 1Y0MA 1AWXA 3R6NA 2DJQA 4GLMA 2GTJA 1GCPA 2AK5A 3CQTA 4LUEA 3UA6A 1G2BA 1U06A 1VYUA 1FMKA 1BBZA 1OPKA 2A08A 3M0PA 1ZUUA 2YUOA 1M3BA 4RTWA 1UGVA 1PKSA 3I35A 3M0TA 3ULRB 1QCFA 1AVZC 2VVKA 1Z9QA 4HVWA 2HBWA 3EHQA 2JM9A 1A0NB 1AWOA 2DRMA 2RN8A 2KT8A 2DM1A 2FPEA 2HDAA 1GFDA 3U23A 3VRZA 1WIEA 4K11A 2YT6A 2JTEA 4D8DA 1W70A 4RTZA 2I0NA 1UUEA 2IIMA 1ZSGA 1RLQC 1B07A 5IXFA 1LCKA 1TG0A 2DBMA 1N5ZA 2ED0A 2KE9A 2RPNA 1I0CA 2DF6A 1ABOA 2LJ1A 3H0HA 2PNIA 2EW3A 2A28A 5FW9A 1AOJA 2KEAA 3NMZC 2HCKA 3JV3A 1JXOA 1W6XA 3I5RA 2EKHA 2YUPA 4RUGA 2OI3A 2JW4A 3REBB 1U5SA 2G6FX 1BU1A 2DL3A 4FSSA 4LNPA 1X69A 4M4ZA 1SPKA 2EVRA 2QDLA 4E6RA 2DNUA 1SSHA 2W10A 3I9QA 2VWFA 3NHNA 4ESRA 1Z9ZA 2KRMA 2O9SA 1AZGB 2KXCA 3NGPA 3FJ5A 2JXBA 1M27C 1MV3A 1VA7A 1CKBA 1WA7A 2KRSA 1W1FA 2EYZA 4LUDA 1YWPA 1EFNA 2DL8A 2V1QA 1WYXA 1K9AA 4CC2A 3M0SA 2VKNA 2A36A 2DBKA 4Z8AA 1YCSB 1GL5A 2ROLA 2LNHB 1UHFA 2X3WD 3I5SA 1BK2A 4Z88A 1YWOA 1QWFA 2EBPA 4WCIA 2RQTA 4RTVA 1AWJA 4AG2C 3VS1A 2CT3A 2JMAA 2CSQA 3A98A 2RNAA 4LE9A 2K6DA 1PHTA 1X27A 3O5ZA 4HVUA 1E6GA 2EGEA 5I11A 1GBRA 2LX7A 3THKA 4QT7A 2D1XA 1RI9A 1AZEA 1GCQA 1TUCA 2J6FA 1X43A 3EG0A 4JJCA 2D0NA 2GQIA 2YSQA 4KRTA 1ARKA 1GCQC 1JEGA 1JQQA 1RUWA 3RNJA 1YN8A 1I07A 3ZL7C 1OOTA 5GJVB 5FWCA 2OJ2A 2RF0A 2M51A 2YDLA 1E6HA 1QKXA 4J9GA 2EGAA 2LQWA 1XOVA 2O31A 2J6OA 2X3XD 1WXTA 4Z89A 1UFFA 1T3LA 2GNCA 2L2PA 1ZX6A 2BZ8A 3PVQA 2AZVA 2EGCA 4J9BA 1MV0B 1NM7A 1YP5A 1UTIA 4EIKA 2W0ZA 3EGUA 3EHRA 2L3QA 4J9HA 2JS2A 1H3HA 2CDTA 2EYYA 4GBQA 1OEBA 1UJ0A 4AFZC 1X2KA 2O88A 1KSWA 1E7OA 1JXMA 2CH4W 2CSIA 4OMNA 1GRIA 4ORZA 2LJ0A 1WXBA 3RBBB 5IHKA 2O9VA 2ECZA 2JMCA 2KBTA 4D8KA 3TVTA 1ZBJA 2DILA 1SRMA 4DEYA 2J06A 2DYBA 1PNJA 4J9FA 1FYNA 4JZ3A 3H0IA 2CREA 2E5KA 1NYGA 1AEYA 1UE9A 1NEBA 2XMFA 5IXBA 4JJDA 2O2OA 2F2XA 5HCKA 2NWMA 4CC3A 2JM8A 2SRCA 2SEMA 2FPFA 1T0JA 1J3TA 3VS5A 3M0RA 2F2VA 1NG2A 2DL5A 2DL7A 2AKLA 1GFCA 3EG3A 4RTTA 1I1JA 1UHCA 1MUZA 2L3PA 2DE0X 1ABQA 1T3SA 2KXDA 2YUQA 2ABLA 3M0QA 1G83A 2MOXA 1ZLMA 1M30A 4A63B 3M0UA 2LMJA 1WLPB 2P4RA 1UECA 1KFZA 1NLOC 5IHNA 2NUZA 2OAWA 1PRMC 2EYXA 2FO0A 3GBQA 4CC4B 4X1VA 2V1RA 2C0IA 2C0TA 4JZ4A 3EG1A 1PKTA 2GTOA 4RTXA 1SRLA 1BB9A 2A37A 2HEQA 5FWBA 2LJ3A 2K3BA 4HCKA 1H92A 2ED1A 1SHGA 3H41A 3SEMA 4IIOA 4R0KA 4ZNXA 1M8MA 2RQWA 2M0YA 1Y57A 2KNBB 1CKAA 2K9GA 2KYMA 4OMMA 3VS7A 1X2QA 3VRYA 2HSPA 4F16A 1HSQA 1AWWA 1KJWA 1SEMA 2K7AA 3IQLA 2GBQA 5I22A
chains in the Genus database with same CATH superfamily
3A8LB 4A54A 2ZPHB 5LJ5f 2RA2A 1K9MC 3ZEHA 2Z0WA 5IHIA 2HZYA 4WTOB 1WJQA 1X75C 3MP6A 1Q86U 3I55A 1PD1A 3A8MB 2PZ1A 4LDUA 1W2BA 1ZUKA 4JLIA 1WXUA 3QBYA 4KH1B 3H9NA 3PFSA 1UDLA 2CGHA 2K3YA 1YJ9T 2RJEA 4C92B 2EQIA 1X6GA 3H0FA 2IG0A 2JNGA 2HKNA 3KFVA 1K73R 1VOMA 4OMQA 1K76A 3JB9J 2BZYA 2PVOB 3VS3A 1S72T 1VQ6T 2LQKA 3SWNA 3I56A 1QKWA 2MCNA 3GLXA 3SWNC 4ELYC 2DA9A 3CCVQ 1RAIB 2KY9A 1YCYA 3DB3A 3JCMV 3C0CA 3S3OA 2OTLA 3UDCA 3GOXA 4DEXA 3SHWA 2J05A 1GXIE 4OMLA 2VXEA 3G4ST 1JU5C 1VUBA 1ZQ1A 2MWOA 2FRYA 1VYVA 4C92E 5GMKl 3PIPA 1QVFP 2CYZB 1VQLT 3ZBDA 1YJWQ 3M53A 2QTVA 4C8QB 3GIBA 2AKKA 1CSKA 4J6WA 1X6BA 3A8HB 2RQVA 3EG2A 3CD6A 3CPFA 4J9EA 5CK9A 4GY5A 1KD1C 1K0SA 2WSCE 2CH4A 2GQVA 4JJBA 3GNGA 1IO6A 5LJ5e 5GAOn 3CCUT 5FU7C 3CEYA 2KROA 2NLUA 2DXUA 3PE0A 2DRKA 3V8LA 2LCSA 4MDXA 1K0XA 2VGMA 5J26A 4MMLA 4M7DD 2E3IA 1ZUYA 3S3NA 4JS5A 4J9DA 1OPLA 4OMPA 4C5IA 2KYBA 3QWXX 3X25B 5LJ5d 3CCSA 4LD6A 4C92C 3OYDA 1YITA 2JN0A 2YLCA 2E41A 3DKMA 1Y0MA 5J39A 3R6NA 3PMTA 1YJNA 5FRMA 2DJQA 1VQ9T 9ATCB 4PFPA 1WHLA 1U06A 1FMKA 1BBZA 5GAN8 2A08A 2COYA 3L2VA 2VUBA 1ZUUA 4RTWA 4M75D 4VUBA 2LDMA 3LGLA 4GLKA 4JJNK 2JM9A 4DOVA 1AWOA 3LX7A 4DBHA 3CCQA 2RK2A 3AHUA 1IREB 2DM1A 2FPEA 2DVEA 2XD0A 3VRZA 1BIAA 1MMGA 2LTOA 3HHTB 1W70A 4M7AA 2D6FA 3BFMA 4OF1A 1UGQB 4PJJA 2I0NA 2P0PA 4OP0A 2IIMA 1ZSGA 1KQSP 1BKBA 1RAFB 1VQNA 3HFOA 5FU6B 3LWIA 4BY6B 3M9QA 4DQ2A 1K9MU 4UC4A 2EW3A 5FW9A 4O5VA 3SFMA 2KEAA 4NS5A 2JUFA 3NMZC 4LD9K 1W6XA 2EKHA 2HSEB 1C1AA 2G6FX 1LJOA 2PUKB 1SPKA 3G1JA 3CPWP 2COZA 2RHXA 2R5MA 1I5LA 2DNUA 1WHKA 3D7SB 2DTIA 2XU8A 1KD1R 3NHNA 3HTRA 3S3MA 1B7TA 1AZGB 2KXCA 3WVEB 3EGDA 3FJ5A 2JXBA 1IB8A 1M27C 1K8AC 1WA7A 1W1FA 4LUDA 4A4FA 2HD0A 3VJPA 5GAN5 3F70A 4Z8AA 1GL5A 4M77B 3OSSC 1UHFA 1VQPA 2RB6A 5CAIA 1FWZA 4J6YA 2AIRB 4BE2A 1XJWB 4Z88A 1YJ9Q 1YWOA 2RQTA 3M54A 5DY9A 1N9RA 2RNAA 2RJFA 2HBPA 3EFOA 4LE9A 2K6DA 1X27A 4HVUA 2HL3A 2EGEA 1GBRA 1H3ZA 3THKA 2YRDA 1IHWA 2MYSA 3QJYA 1RI9A 7AT1B 3EG0A 3OYBA 2J6FA 1KD1U 1S72Q 1VQ6Q 2QI2A 3MO8A 3CMAT 1ZHIA 2DJZA 3ZL7C 1OOTA 5GJVB 4M77E 2M16A 5GMKj 3NFCA 2RF0A 2HQEA 4XTYA 4PFZA 5GAMg 4J9GA 3QZ9B 3OYLA 2QQAA 2L8DA 1VIEA 2EYQA 4BB7A 2DYIA 2QQBA 3G4SQ 5GAMf 2QQ9A 4FT2A 4IURA 2L2PA 3QG1A 3PVQA 2BZ8A 2AZVA 1VQLQ 2EGCA 1WHMA 3JAME 3PMIA 1NM7A 4LDXA 2CP0A 1WHJA 2W0ZA 4AT1B 3RESA 2L3QA 4OGEA 1VQ5T 1M2VB 4E7IA 2IVWA 3CCVA 1KG1A 1TXQA 1OEBA 1TOVA 2GFAA 3J81E 1QW1A 3OYHA 2O88A 1E7OA 2RI3A 2AHJB 4IUPA 3QKJA 2XIDA 2CSIA 2LJ0A 1D3BA 4M77C 3V7SA 5IHKA 3L2ZA 5CKFA 2JMCA 3OW2P 1YI2T 1WJSA 3JCMJ 1YJWA 4D8KA 2DKGA 1SRMA 1LPLA 5KYXA 2DYBA 4J9FA 1FYNA 3M56A 4JZ3A 2BUDA 3PGGA 4XU2A 2DETA 1K8AR 1RAAB 3VYGA 2CREA 2E12A 1AEYA 1UE9A 2LVMA 4QVZA 1TTHB 5D6YA 1VQ9Q 3PTAA 3A5ZB 1KHIA 5LJ5h 3A8GB 1HK9A 2F69A 2QG9B 3M0RA 2F2VA 1LNXA 2DL5A 4IUQA 1ZSZB 1GFCA 4RTTA 2ZPGB 4N4GA 1ABQA 2DE0X 2GF7A 2KXDA 2YUQA 4PJOB 2ABLA 3J80E 1JJ2P 3LH0A 5GAMe 1ZLMA 4J83A 1NJIC 3MP1A 5IHNA 2K4YA 3LGFA 2EJ9A 2V1RA 2C0IA 3CCET 3CCLT 1B34A 4MZPA 3M58A 5J3BA 1O9SA 3RIRA 1M2OA 1XQHA 3EG1A 1PKTA 4JZ4A 3V7CA 4J7IA 1SRLA 3BE3A 4OMFB 2HEQA 3EFRA 4V2SA 3G7ZA 5GAMd 1LOJA 1SKUB 3P8BB 1VQKT 1H92A 4X34A 2X35A 4ZNXA 2CP7A 4X9CA 2IPOB 3G6EQ 2M0YA 2XICA 2K9GA 1FMWA 4OMMA 1AHJB 2DFUA 2O4XB 1N6AA 4NL3A 4PJOE 4ZGEB 2ZZDA 1KJWA 2KMTA 1SEMA 2K7AA 4BI3A 5KE3A 3LLRA 2L0AA 1IHVA 2MWPA 3JCMP 1RABB 1I8FA 1N8RC 2LCCA 2VASA 1N27A 2E6ZA 3FLGA 1HJDA 5L8RE 2EQMA 3RR6A 3LH5A 2P4TA 2C0OA 4HCCA 2H8HA 4F14A 5CCAA 1WZOA 3EG9A 2ESWA 4O6JA 3VU3C 2MK5A 2E64A 2F5KA 2DIGA 3QYGB 1QCOA 5DM7R 2F2WA 3QUIA 1FXXA 2YUNA 1VQMT 3CC7T 3JCMb 4HXJA 1WJRA 4F17A 5IH2A 2J6KA 3HP9A 1WX6A 4OB0B 3VYHB 1NYFA 1K73C 1K1ZA 4C92F 3LWHA 2QEXQ 3CC2T 1S1NA 1B3QA 2LCLA 4MZMA 2RD1A 3VUZA 4C92G 1I5OB 1GBQA 4KUIA 2R58A 1C6VX 2MMPA 3NPFA 2BTTA 2X9HA 1Y7XA 2YLBA 2D8JA 4OMOA 3QO3A 2JT4A 2K2MA 1UB4A 1Y71A 1K4US 2DL4A 1UG1A 1V29B 1YJ9A 3EH2A 4B6MA 4E7SA 1NJIR 1OV3A 3LYIA 1ACMB 2X4JA 2F5TX 5KYWA 3JB9D 5GAN6 2KR3A 3ASKA 2DXBA 1SF9A 4N4HA 4FSXA 1UJYA 2E10A 2O01E 2KQWA 2FB7A 1WQWA 4PJLA 4AFUC 2LQNA 2OX7A 1S72A 1VQ6A 3PT9A 2ROTA 1X6OA 1VQ5Q 3JCMW 4JRIA 3QDFA 3CCRT 2QAZA 3PVLA 2HKQB 3X20B 4C0GA 1UEBA 2AZSA 5C0MA 3E2UA 1QWEA 4M7AD 3NTHA 2QASA 1H8KA 1WHHA 2MIOA 1TUDA 3G4SA 1YIJT 3VS4A 2CZ6B 4AMCA 1VQLA 1YI2Q 2DEUA 1N8RR 2GTJA 4F7UB 1GCPA 2AK5A 1WPYA 3CQTA 3UA6A 5GAN2 1M5Q1 2V8KA 3JCMc 2DTHA 1PKSA 2MAMA 3RMSA 3I35A 1QCFA 1Q95G 1W2BP 5A0LA 2VVKA 1Z9QA 2D9TA 2K3XA 2DRMA 4ZN1A 2RN8A 2K5IA 3FB9A 2HDAA 1GFDA 4K11A 3AT1B 2JTEA 3UPUA 5CKBA 5LJ3h 2E3HA 4EMKB 1WGSA 1Y96A 2LNVA 4F7UE 1BCOA 1N5ZA 3OS0A 2ED0A 4A4KA 2K5FA 1MMDA 3H0HA 3TQ7P 2A28A 1G3YA 1AOJA 1VQ9A 2HCKA 4KH0B 3CCEQ 3CCLQ 4R55A 3CXCS 2DK3A 2MF2A 4LNPA 1BU1A 1O75A 1NE8A 2QDLA 1VQKQ 1SSHA 2EKOA 4ATOA 4BE0A 1BIBA 2VWFA 1KQ1A 4BD3A 2PUOB 4M78B 2O9SA 2FZGB 2A3LA 4ZGDB 3OYIA 5KYUB 3OA6A 4C0ZA 5GAMh 3R6OA 5GAOq 1YWPA 1K73U 2DL8A 3HL8A 1WYXA 3S6WA 1K9AA 2QK0A 1W4SA 1YCSB 1JBMA 3OYAA 1QCNA 2PVDB 2CP6A 1MHNA 2XKOC 2LQ8A 1BK2A 4HT8A 4NOYA 1R0BG 4RTVA 3G6EA 2DXCA 3I55T 3VS1A 2JMAA 4C92A 3A98A 3QJ6A 2QA4T 1BI1A 5I11A 4C8QE 1ZBXA 4M78E 2DEQA 1VQMQ 4M77F 4QT7A 4QVCA 3CC7Q 1YFNA 2AT1B 2R5AA 1AZEA 2BE7D 1R8OB 4M77G 2GQIA 2YSQA 5I21A 5GANj 3GF5A 2DIQA 3OBWA 2M51A 4L5GA 2EGAA 3N5BB 2LQWA 1XOVA 2O31A 4XTWA 2X3XD 1MNEA 1WXTA 2CZ7B 1HXDA 2RK1A 4TVRA 1M8VA 1T3LA 2GNCA 3V8KA 3OYJA 2MI6A 3ER0A 3MEUA 1MMNA 3EH1A 1MV0B 4N0AA 4FCYA 2CS7A 4E7JA 3BW1A 4C8QA 4CRIA 3EGUA 3EHRA 1QVFS 4N0AC 4C8QC 4J9HA 4HCBA 4M78C 1R77A 2QEXA 5M9OA 4MMKA 2CDTA 4AFZC 1YHQT 4Y91A 3GP8A 1VQ4T 3MHXA 2DPPB 2CH4W 3O8VA 4ORZA 1SSFA 2KAFA 3FRNA 2O9VA 5C6SA 2CZ1B 2ECZA 2RO0A 3TREA 3M57A 2YWWA 3TVTA 1ZBJA 2DILA 4DEYA 2NUPB 2J06A 3JSCA 1M90C 1NYGA 2VB6A 4M7DB 1FMVA 3CCMT 2FL7A 1V76A 1VQOT 4JJDA 1D1CA 2O2OA 1TWBA 2M1HA 1KC8C 4CC3A 5LJ3g 2PVGB 1VQ5A 2SRCA 3PIOA 2DZ9A 4PLLA 5LJ3f 3DB4A 1NPPA 2NYSA 5FRNA 2L3PA 3TU4K 4C0DB 1T3SA 2COWA 5EG2A 3M0UA 4FYXB 2LMJA 1U8RA 2P4RA 1UECA 4OB3B 3GBQA 2RHYA 4CC4B 4X1VA 3Q1JA 1YI2A 4M7DE 2QXFA 4DBFA 4M75B 3OY9A 3OYMA 2GTOA 1BB9A 5A2QE 2A37A 1RAEB 2XDBA 5FWBA 3FIFA 3SEMA 4IIOA 4R0KA 1KQSS 5FU6C 4BY6C 1VQ7T 1Y57A 1CKAA 3FC3A 4FYWB 3VRYA 1MMAA 2V26A 3MEAA 1X01A 3L2WA 5KE2A 1BI0A 3IQLA 5I22A 2CUDA 3UA7A 4XTVA 2KVQG 1UGSB 2ZPBB 1WFWA 2DD5A 1V1CA 1ZA1B 2FPDA 8ATCB 2D8HA 4AG1C 4M75E 4IUTA 1KIKA 4M7DC 3G71T 3CCUQ 8AT1B 3OYGA 3CCEA 1NLPC 3CCLA 3QPHA 1RAGB 2M02A 2RHIA 2EJGA 2HAXA 3E1SA 4C5EA 3P8DA 3OYKA 4CC7A 4A4HA 5LJ3e 4M77A 5EC7A 4ELZC 1EX4A 1VQKA 1QVPA 1P92A 4AFQC 1OYXA 3OMGA 3RMQA 1IGQA 2X4WA 1M90R 2K2VA 1M1GA 1VQPT 1OU9A 3M59A 2OTJT 5KYYB 2QA4Q 4C5HA 1PWTA 2R57A 2A7YA 2ENMA 2QYZA 4ZTFA 5LJ3d 1KC8R 4LDVA 1M3AA 1WQ7A 4M75C 3TSZA 1TU0B 4XTUA 4PJMA 4J9IA 1M4ZA 4XTXA 3VS0A 1M9SA 3VS6A 4E7KA 3UATA 1VYTA 1D0XA 1RADB 2KRNA 3CMET 1KQ2A 3OYCA 2E70A 1AD5A 2WSFE 4JRKA 3EAEA 3EGXB 1OQKA 2EFIA 5ECAA 2EYWA 2LP5A 4QQ6A 1VQMA 3OBYA 3CC7A 4BUGA 2DX1A 1D1BA 3QDRB 1Y07A 1M3CA 2DZCA 2E4HA 2EPDA 1KK7A 3HRTA 2DVJA 1M90U 4P5NA 3T9NA 2ATCB 4JS4A 1Q81C 2QDYB 1QVGA 4JPBW 2RQRA 2Y4YA 1K8AU 2CT4A 1M2VA 1RI0A 1YHQQ 2YRVA 3P8HA 1VQ4Q 1EIFA 2K79A 4DBRA 4KUDK 4JUVA 2DLPA 2XI9A 1AWXA 1PC0A 3MCAB 1QP3A 2RJCA 4LUEA 1G2BA 5LL6S 1G3SA 1VYUA 3INZA 2RM4A 3OW2S 3CCMQ 2P0QA 1YJWT 1EZZB 1M3BA 3OYFA 3VKIA 1HYOA 4R56A 3M0TA 5I2MA 1VQ8T 1AVZC 2HBWA 3MEWA 3M55A 2KT8A 4RCBA 4MDWA 4F7UF 2L3RA 5FROA 4E47A 3U23A 5GMKe 2YT6A 4F7UG 5D6XA 3CC4T 2KI7A 1UUEA 1ZSZA 3TEEA 1IRXA 4DOWA 1PSFA 1RLQC 1B07A 5GMKm 5IXFA 1LCKA 1ZSZC 5CO7A 4PJOA 2DBMA 3OMCA 4PJNA 4PK4A 2DF6A 5AT1B 4PJOC 2PNIA 2RI5A 3HPWA 1QVGS 3JV3A 1JJ2S 1JXOA 4KBMB 3I5RA 2JTMA 4RUGA 1WHGA 2NUTB 3REBB 2WACA 4FSSA 4M4ZA 1X69A 2EVRA 3CMAQ 4RG2A 5HY6A 2LT1A 4C92D 5LJ5j 2XDPA 4E7LA 1VQ7Q 2LRQA 2ZGWA 3MPUB 4ESRA 4IUUA 5HKCA 3CBOA 2KSSA 3NGPA 4FW1A 2LT4A 1IXDA 4HA8A 2O4XA 3OS1A 1MV3A 1VA7A 4OB1B 1CKBA 2X4YA 2KRSA 2EYZA 3NTIA 2XK0A 2CP5A 1Q81R 4FW2A 3KXTA 2V1QA 2CKKA 3CCJT 4CC2A 2A36A 1UGPB 2DO3A 4BI8B 1PG5B 4C8QF 3URGA 2X3WD 1OULA 4M78F 3G71Q 2BKDN 2EBPA 4C8QG 1BYMA 4M78G 3CXCA 3E9GA 2CT3A 2X51A 3L42A 2CSQA 5D7UA 3JRZA 3C4SA 1PHTA 3O5ZA 3M4GA 4N4IA 4C8QD 2Y90A 3HFNA 4ANJA 5CQYA 1GCQA 1X43A 4B9WA 3E19A 5HK0A 4E2FB 4KRTA 4D6WA 4EPCA 1GCQC 2OTJQ 2GCXA 1PCXA 1RUWA 2GFUA 3RNJA 1I07A 5CKDA 1NJIU 1RL2A 3H6ZA 3EFSA 5FWCA 2JJ9A 3QXEB 2OJ2A 3CCUA 2RHUA 1E6HA 1VIFA 3RKXA 3ME9A 2QGGA 2NUTA 5FU7B 1Q7YC 1UFFA 3UWNA 3OS5A 2ZPIB 5GAOl 4PFOA 1ZX6A 2K57A 2XDDA 4XAXB 1YP5A 1OX9A 1D0ZA 3M4YA 3L2RA 3CMEQ 2L89A 3QIIA 2BIVA 2QA4A 2Y4XA 1NBEB 2EYYA 3FEOA 1TSFA 1UJ0A 3BDUA 2ZPEB 5A0DA 1X2KA 3RDVA 5FLXE 1N8RU 3WVDB 1XTDA 5HK3A 3QYHB 1G3TA 5GAOr 2VXFA 2JVVA 4J6XA 4DA4A 1D0YA 2H3EB 5A0GA 3OQ5A 3M5AA 3RERA 2RI2A 1PNJA 3H8ZA 5CKHA 4EMHA 4RG8A 2DD4A 1TH7A 3H0IA 4XK8E 2E5KA 2FVUA 1NEBA 1I81A 1QVFA 2F2XA 4F7UA 4B9XA 5HCKA 3VUBA 1Q82C 2JM8A 2RH2A 4M7AB 2SEMA 1AT1B 1T0JA 4C0FA 1J3TA 2AKLA 1YBYA 3EG3A 1VQ8Q 4M7DF 1WNLA 1I1JA 1UHCA 1MUZA 4ZN3A 1YHQA 1RAHB 5KCOA 1VQ4A 2MOXA 4M7DG 5CR2A 4A63B 1BI3A 4HKEA 1KFZA 2V8JA 3E9FA 3OS2A 2OAWA 1PRMC 2EYXA 1W2BS 1DJ7B 4IKFA 2HQXA 4LXCA 3CC4Q 2C0TA 4KULA 3GPLA 2EQUA 3SB2A 4BACA 4FL6A 3V8JA 4EMKA 4E7HA 4EMKC 2LJ3A 2K3BA 4KGXB 3CCMA 2CP3A 3GNFB 2ED1A 3H41A 3CC2Q 4M7AE 4F04B 1VQOA 2RQWA 4LDWA 4M77D 1D1AA 1Q7YR 2KYMA 3EGDB 3I56T 1K9MR 4J7FA 2HSPA 4F16A 1G5VA 2A0FB 4M75F 1HSQA 5IXBA 2GBQA 1YNZA 4M75G 3UF4A 2D0QB 1NZ9A 2OTLT 1G3WA 1M1FA 2DAQA 5KH6A 3JCMg 5GMKh 2PQWA 2HNIA 3UT1A 1NEGA 2V8IA 2DMOA 4KGZB 4BDZA 2J7IA 2E5QA 2FG0A 4M78A 3JCMf 2RMOA 2CUBA 5LJ3j 1T0HA 5CKEA 1JB0E 4XU1A 2FEIA 5KYUA 3BDLA 2PTKA 4AFSC 5D6WA 3C95A 5IT9E 3CCJQ 3EFOB 4PLIA 2VGNA 4JRQA 3CD6T 4FIBA 4C5GA 2X4XA 3CMAA 1QLYA 2GGRA 2EAYA 1WDXA 2JOYA 4RTUA 3JCMQ 1KQSA 5IN1A 2EQJA 4M7AC 3REAB 3MJXA 3CCRQ 1HD3A 5CQXA 1VQ7A 1JO8A 1Q7YU 3A8OB 3PNWC 5GAN4 2LZ6B 4II1A 3TSWA 3QWYA 5L23A 2YHTA 4HVVA 4BE1A 1YIJQ 4J9CA 4QQDA 3G6ET 2KT1A 5GANg 4FYVB 1QP2A 5GAOp 3CCST 2ZAEA 1Q82R 3CPWA 3VS2A 2BZXA 2QGFB 5I2SA 5GANf 1YITT 4A53A 5GAMj 4L6V5 4PNOA 2G3RA 1TS9A 5GMKi 3JB9I 1YJNT 3G71A 3QSUA 1U3OA 3A1PA 1G8XA 1RACB 3C12A 4IIMA 4BDYA 2FRWA 1BCMA 2EWNA 1SHFA 1RLPC 2H3JA 2B86A 2RQUA 3FJPA 4LN2A 2VV5A 4OGCA 3CCQT 1PRLC 2OTJA 3JCMe 2L3SA 1D3BB 4RTYA 1D09B 2KGTA 4PJOF 5KYXB 1M1KC 5GJWB 5GAN3 4QW2A 1WI7A 1Q82U 4PJOG 3L1AA 2HMAA 2JS0A 2QEXT 1SG5A 4Y92A 4RCCA 2VYTA 3QHSA 1VQNT 4OB2B 4JRPA 2FZKB 4PKCC 3JCMd 2BE9B 3ZFJA 3NTKA 4PJOD 3OYEA 4GLMA 5CIUA 3L2UA 3V7RA 3CMEA 3KUFA 2NUPA 4A4EA 1OPKA 1U1SA 1FX7A 3M0PA 3VV0A 3CPWS 2YUOA 1UGVA 4M7DA 4FU6A 5KCHA 3ULRB 1H641 3MP8A 4HVWA 5GANe 5GAN7 2DERA 3EHQA 1A0NB 4Q5WA 4PL6A 5KYNA 1WIEA 4ZGJB 4D8DA 1B34B 4RTZA 2WSEE 4L59A 3HRSA 1OU8A 2P84A 4QKUA 1TG0A 3I55Q 5GANd 3HRUA 2KE9A 2RPNA 1I0CA 3X28B 4C0DC 1ABOA 2XG8D 2LJ1A 4E7ZA 3DLLA 3HKSA 2RHZA 3OYYA 4ZTJA 2ZCFB 1N9SA 1I4K1 4HT9A 2YUPA 2OI3A 2JW4A 2KK4A 4M75A 3OW2A 1U5SA 2DL3A 2EIFA 2VC8A 4E6RA 2DTOA 2JTFA 3RUXA 2W10A 4LDYA 1VQ8A 3I9QA 3I56Q 1Z9ZA 1MGQA 2KRMA 4YTLA 4QVDA 3RKWA 2EQKA 3EG9B 4J8OA 3CC4A 2B8AA 1IGUA 2OTLQ 1ZA2B 4FYYB 1EFNA 3JCMX 3M0SA 2VKNA 2DBKA 3CBPA 2L5QA 1OZ2A 4XU0A 2ROLA 2LNHB 2YXYA 4NL2A 1M1KR 3MKDA 3TCJA 2I2LA 3BY7A 3DLMA 3RKYA 1U1TA 1LVKA 5CVIA 1JJ2A 3CC2A 1QVGP 3I5SA 3C94A 1QWFA 4WCIA 2XHCA 1AWJA 3OSVA 4IUVA 4AG2C 3HSBA 3KBGA 2EJFA 3CD6Q 1KC8U 1QMCA 2MPXC 1E6GA 1Q86C 3CCVT 4X9DA 2LX7A 4RKUE 1R0CB 2D1XA 2FHDA 1TUCA 1QQJA 4KGVB 4JJCA 5GAOm 2F1LA 2D0NA 1NPRA 1ARKA 1BI2A 1JEGA 1JQQA 1YN8A 5KYYA 4EMGA 4MZTA 1PD0A 2E6NA 3CCSQ 2YDLA 1QKXA 1VQOQ 5KYWB 3CCJA 2J6OA 3MEVA 4J5YA 2YRCA 1YITQ 2M9UA 4Z89A 2LX9A 1M1KU 1YJNQ 4XQ3A 3OB9A 2DXTA 3CBMA 4J9BA 2HL5C 3CCRA 2K5LA 1XNIA 1UTIA 4EDUA 1TUGB 3X24B 4JDSA 4EIKA 2JS2A 3WXMB 2CP2A 1H3HA 3EGXA 1YIJA 3META 2LC4A 2C06A 4GBQA 1KHCA 3J7AF 1KSWA 1JXMA 1PSEA 2OAUA 3CCQQ 4OMNA 1GRIA 1WXBA 3L2QA 3RBBB 2JZ2A 2CZ0B 2E1HA 1OX8A 4KT0E 4Y28E 1MNDA 1C0MA 2KBTA 4WF2A 2QTXA 2FZCB 1VQNQ 1OZ3A 4FT4A 2XMFA 5DLOA 4JLGA 2QQRA 3SDZA 5IAYA 1IZ6A 2NWMA 4CI0C 1JRIA 3JB9F 2ZPFB 2E65A 6AT1B 2FPFA 2QQSA 3JB9G 3VS5A 4DBQA 1NG2A 4ME7A 3JCMh 2DL7A 2M0OA 1PM3A 1Y96B 3FDRA 3QZ5B 4XTZA 3M0QA 1G83A 3SWNB 1Q86R 1M30A 1WLPB 2RJDA 1NLOC 3CXCP 2NUZA 3OYNA 5AYFA 2FYKA 3JB9H 2FO0A 2HQHA 4M7AF 4M78D 4QQGA 4Z02A 4RTXA 4M7AG 2PU9B 2P0KA 5DLQE 4BI4A 1VQPQ 4XU3A 4HCKA 3X26B 1OI1A 1SHGA 3LW5E 2KDSA 4OVAA 4HCZA 1M8MA 2KNBB 3VS7A 1X2QA 5LJ5g 1UGRB 1Q81U 1F1BB 4FM4B 4RMOA 5GANh 4A4GA 1AWWA 3SD4A
chains in the Genus database with same CATH topology
1YNZA 2CUDA 3UA7A 3UF4A 2L0AA 5IHIA 1NEGA 1WFWA 2DMOA 1V1CA 2FPDA 2J7IA 2D8HA 4AG1C 1HJDA 2FG0A 2PZ1A 1ZUKA 2RMOA 2CUBA 1T0HA 1KIKA 1WXUA 3LH5A 2C0OA 2FEIA 1UDLA 2H8HA 4F14A 2PTKA 4AFSC 1NLPC 2ESWA 2EQIA 1X6GA 3H0FA 4CC7A 2F2WA 1QLYA 5EC7A 2GGRA 1WDXA 4RTUA 2YUNA 4AFQC 3KFVA 3REAB 4OMQA 1HD3A 1K76A 4HXJA 2BZYA 4F17A 1JO8A 3VS3A 2J6KA 5IH2A 1WX6A 1QKWA 2MCNA 1NYFA 2LZ6B 1K1ZA 3TSWA 1PWTA 3QWYA 5L23A 2DA9A 1S1NA 1B3QA 4HVVA 2ENMA 4J9CA 2KT1A 1GBQA 3C0CA 1M3AA 4DEXA 3NPFA 3VS2A 3SHWA 2BTTA 2BZXA 2J05A 4OMLA 3TSZA 2D8JA 4OMOA 1JU5C 4J9IA 2FRYA 1VYVA 2JT4A 2K2MA 3VS0A 1K4US 2DL4A 3VS6A 1U3OA 1UG1A 3UATA 1VYTA 2AKKA 1CSKA 2KRNA 1X6BA 2RQVA 1OV3A 3EG2A 1AD5A 4J9EA 4IIMA 1K0SA 5ECAA 2EYWA 2CH4A 2FRWA 2KR3A 4JJBA 1IO6A 1SHFA 2LP5A 1RLPC 1UJYA 2KROA 2DX1A 3PE0A 2B86A 2DRKA 2LCSA 1K0XA 2RQUA 1M3CA 2EPDA 4AFUC 2LQNA 4LN2A 2DVJA 2ROTA 1PRLC 1ZUYA 2L3SA 4J9DA 1OPLA 4OMPA 4RTYA 2KYBA 4JPBW 2KGTA 2RQRA 2CT4A 3QWXX 3PVLA 5GJWB 2AZSA 1QWEA 1WI7A 2JS0A 4Y92A 1H8KA 2K79A 2MIOA 1TUDA 2DLPA 3VS4A 1Y0MA 1AWXA 3R6NA 2DJQA 4GLMA 2GTJA 1GCPA 2AK5A 3CQTA 4LUEA 3UA6A 1G2BA 1U06A 1VYUA 1FMKA 1BBZA 1OPKA 2A08A 3M0PA 1ZUUA 2YUOA 1M3BA 4RTWA 1UGVA 1PKSA 3I35A 3M0TA 3ULRB 1QCFA 1AVZC 2VVKA 1Z9QA 4HVWA 2HBWA 3EHQA 2JM9A 1A0NB 1AWOA 2DRMA 2RN8A 2KT8A 2DM1A 2FPEA 2HDAA 1GFDA 3U23A 3VRZA 1WIEA 4K11A 2YT6A 2JTEA 4D8DA 1W70A 4RTZA 2I0NA 1UUEA 2IIMA 1ZSGA 1RLQC 1B07A 5IXFA 1LCKA 1TG0A 2DBMA 1N5ZA 2ED0A 2KE9A 2RPNA 1I0CA 2DF6A 1ABOA 2LJ1A 3H0HA 2PNIA 2EW3A 2A28A 5FW9A 1AOJA 2KEAA 3NMZC 2HCKA 3JV3A 1JXOA 1W6XA 3I5RA 2EKHA 2YUPA 4RUGA 2OI3A 2JW4A 3REBB 1U5SA 2G6FX 1BU1A 2DL3A 4FSSA 4LNPA 1X69A 4M4ZA 1SPKA 2EVRA 2QDLA 4E6RA 2DNUA 1SSHA 2W10A 3I9QA 2VWFA 3NHNA 4ESRA 1Z9ZA 2KRMA 2O9SA 1AZGB 2KXCA 3NGPA 3FJ5A 2JXBA 1M27C 1MV3A 1VA7A 1CKBA 1WA7A 2KRSA 1W1FA 2EYZA 4LUDA 1YWPA 1EFNA 2DL8A 2V1QA 1WYXA 1K9AA 4CC2A 3M0SA 2VKNA 2A36A 2DBKA 4Z8AA 1YCSB 1GL5A 2ROLA 2LNHB 1UHFA 2X3WD 3I5SA 1BK2A 4Z88A 1YWOA 1QWFA 2EBPA 4WCIA 2RQTA 4RTVA 1AWJA 4AG2C 3VS1A 2CT3A 2JMAA 2CSQA 3A98A 2RNAA 4LE9A 2K6DA 1PHTA 1X27A 3O5ZA 4HVUA 1E6GA 2EGEA 5I11A 1GBRA 2LX7A 3THKA 4QT7A 2D1XA 1RI9A 1AZEA 1GCQA 1TUCA 2J6FA 1X43A 3EG0A 4JJCA 2D0NA 2GQIA 2YSQA 4KRTA 1ARKA 1GCQC 1JEGA 1JQQA 1RUWA 3RNJA 1YN8A 1I07A 3ZL7C 1OOTA 5GJVB 5FWCA 2OJ2A 2RF0A 2M51A 2YDLA 1E6HA 1QKXA 4J9GA 2EGAA 2LQWA 1XOVA 2O31A 2J6OA 2X3XD 1WXTA 4Z89A 1UFFA 1T3LA 2GNCA 2L2PA 1ZX6A 2BZ8A 3PVQA 2AZVA 2EGCA 4J9BA 1MV0B 1NM7A 1YP5A 1UTIA 4EIKA 2W0ZA 3EGUA 3EHRA 2L3QA 4J9HA 2JS2A 1H3HA 2CDTA 2EYYA 4GBQA 1OEBA 1UJ0A 4AFZC 1X2KA 2O88A 1KSWA 1E7OA 1JXMA 2CH4W 2CSIA 4OMNA 1GRIA 4ORZA 2LJ0A 1WXBA 3RBBB 5IHKA 2O9VA 2ECZA 2JMCA 2KBTA 4D8KA 3TVTA 1ZBJA 2DILA 1SRMA 4DEYA 2J06A 2DYBA 1PNJA 4J9FA 1FYNA 4JZ3A 3H0IA 2CREA 2E5KA 1NYGA 1AEYA 1UE9A 1NEBA 2XMFA 5IXBA 4JJDA 2O2OA 2F2XA 5HCKA 2NWMA 4CC3A 2JM8A 2SRCA 2SEMA 2FPFA 1T0JA 1J3TA 3VS5A 3M0RA 2F2VA 1NG2A 2DL5A 2DL7A 2AKLA 1GFCA 3EG3A 4RTTA 1I1JA 1UHCA 1MUZA 2L3PA 2DE0X 1ABQA 1T3SA 2KXDA 2YUQA 2ABLA 3M0QA 1G83A 2MOXA 1ZLMA 1M30A 4A63B 3M0UA 2LMJA 1WLPB 2P4RA 1UECA 1KFZA 1NLOC 5IHNA 2NUZA 2OAWA 1PRMC 2EYXA 2FO0A 3GBQA 4CC4B 4X1VA 2V1RA 2C0IA 2C0TA 4JZ4A 3EG1A 1PKTA 2GTOA 4RTXA 1SRLA 1BB9A 2A37A 2HEQA 5FWBA 2LJ3A 2K3BA 4HCKA 1H92A 2ED1A 1SHGA 3H41A 3SEMA 4IIOA 4R0KA 4ZNXA 1M8MA 2RQWA 2M0YA 1Y57A 2KNBB 1CKAA 2K9GA 2KYMA 4OMMA 3VS7A 1X2QA 3VRYA 2HSPA 4F16A 1HSQA 1AWWA 1KJWA 1SEMA 2K7AA 3IQLA 2GBQA 5I22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YNZ A;  2CUD A;  3UA7 A;  3UF4 A;  2L0A A;  5IHI A;  1NEG A;  1WFW A;  2DMO A;  1V1C A;  2FPD A;  2J7I A;  2D8H A;  4AG1 C;  1HJD A;  2FG0 A;  2PZ1 A;  1ZUK A;  2RMO A;  2CUB A;  1T0H A;  1KIK A;  1WXU A;  3LH5 A;  2C0O A;  2FEI A;  1UDL A;  2H8H A;  4F14 A;  2PTK A;  4AFS C;  1NLP C;  2ESW A;  2EQI A;  1X6G A;  3H0F A;  4CC7 A;  2F2W A;  1QLY A;  5EC7 A;  2GGR A;  1WDX A;  4RTU A;  2YUN A;  4AFQ C;  3KFV A;  3REA B;  4OMQ A;  1HD3 A;  1K76 A;  4HXJ A;  2BZY A;  4F17 A;  1JO8 A;  3VS3 A;  2J6K A;  5IH2 A;  1WX6 A;  1QKW A;  2MCN A;  1NYF A;  2LZ6 B;  1K1Z A;  3TSW A;  1PWT A;  3QWY A;  5L23 A;  2DA9 A;  1S1N A;  1B3Q A;  4HVV A;  2ENM A;  4J9C A;  2KT1 A;  1GBQ A;  3C0C A;  1M3A A;  4DEX A;  3NPF A;  3VS2 A;  3SHW A;  2BTT A;  2BZX A;  2J05 A;  4OML A;  3TSZ A;  2D8J A;  4OMO A;  1JU5 C;  4J9I A;  2FRY A;  1VYV A;  2JT4 A;  2K2M A;  3VS0 A;  1K4U S;  2DL4 A;  3VS6 A;  1U3O A;  1UG1 A;  3UAT A;  1VYT A;  2AKK A;  1CSK A;  2KRN A;  1X6B A;  2RQV A;  1OV3 A;  3EG2 A;  1AD5 A;  4J9E A;  4IIM A;  1K0S A;  5ECA A;  2EYW A;  2CH4 A;  2FRW A;  2KR3 A;  4JJB A;  1IO6 A;  1SHF A;  2LP5 A;  1RLP C;  1UJY A;  2KRO A;  2DX1 A;  3PE0 A;  2B86 A;  2DRK A;  2LCS A;  1K0X A;  2RQU A;  1M3C A;  2EPD A;  4AFU C;  2LQN A;  4LN2 A;  2DVJ A;  2ROT A;  1PRL C;  1ZUY A;  2L3S A;  4J9D A;  1OPL A;  4OMP A;  4RTY A;  2KYB A;  4JPB W;  2KGT A;  2RQR A;  2CT4 A;  3QWX X;  3PVL A;  5GJW B;  2AZS A;  1QWE A;  1WI7 A;  2JS0 A;  4Y92 A;  1H8K A;  2K79 A;  2MIO A;  1TUD A;  2DLP A;  3VS4 A;  1Y0M A;  1AWX A;  3R6N A;  2DJQ A;  4GLM A;  2GTJ A;  1GCP A;  2AK5 A;  3CQT A;  4LUE A;  3UA6 A;  1G2B A;  1U06 A;  1VYU A;  1FMK A;  1BBZ A;  1OPK A;  2A08 A;  3M0P A;  1ZUU A;  2YUO A;  1M3B A;  4RTW A;  1UGV A;  1PKS A;  3I35 A;  3M0T A;  3ULR B;  1QCF A;  1AVZ C;  2VVK A;  1Z9Q A;  4HVW A;  2HBW A;  3EHQ A;  2JM9 A;  1A0N B;  1AWO A;  2DRM A;  2RN8 A;  2KT8 A;  2DM1 A;  2FPE A;  2HDA A;  1GFD A;  3U23 A;  3VRZ A;  1WIE A;  4K11 A;  2YT6 A;  2JTE A;  4D8D A;  1W70 A;  4RTZ A;  2I0N A;  1UUE A;  2IIM A;  1ZSG A;  1RLQ C;  1B07 A;  5IXF A;  1LCK A;  1TG0 A;  2DBM A;  1N5Z A;  2ED0 A;  2KE9 A;  2RPN A;  1I0C A;  2DF6 A;  1ABO A;  2LJ1 A;  3H0H A;  2PNI A;  2EW3 A;  2A28 A;  5FW9 A;  1AOJ A;  2KEA A;  3NMZ C;  2HCK A;  3JV3 A;  1JXO A;  1W6X A;  3I5R A;  2EKH A;  2YUP A;  4RUG A;  2OI3 A;  2JW4 A;  3REB B;  1U5S A;  2G6F X;  1BU1 A;  2DL3 A;  4FSS A;  4LNP A;  1X69 A;  4M4Z A;  1SPK A;  2EVR A;  2QDL A;  4E6R A;  2DNU A;  1SSH A;  2W10 A;  3I9Q A;  2VWF A;  3NHN A;  4ESR A;  1Z9Z A;  2KRM A;  2O9S A;  1AZG B;  2KXC A;  3NGP A;  3FJ5 A;  2JXB A;  1M27 C;  1MV3 A;  1VA7 A;  1CKB A;  1WA7 A;  2KRS A;  1W1F A;  2EYZ A;  4LUD A;  1YWP A;  1EFN A;  2DL8 A;  2V1Q A;  1WYX A;  1K9A A;  4CC2 A;  3M0S A;  2VKN A;  2A36 A;  2DBK A;  4Z8A A;  1YCS B;  1GL5 A;  2ROL A;  2LNH B;  1UHF A;  2X3W D;  3I5S A;  1BK2 A;  4Z88 A;  1YWO A;  1QWF A;  2EBP A;  4WCI A;  2RQT A;  4RTV A;  1AWJ A;  4AG2 C;  3VS1 A;  2CT3 A;  2JMA A;  2CSQ A;  3A98 A;  2RNA A;  4LE9 A;  2K6D A;  1PHT A;  1X27 A;  3O5Z A;  4HVU A;  1E6G A;  2EGE A;  5I11 A;  1GBR A;  2LX7 A;  3THK A;  4QT7 A;  2D1X A;  1RI9 A;  1AZE A;  1GCQ A;  1TUC A;  2J6F A;  1X43 A;  3EG0 A;  4JJC A;  2D0N A;  2GQI A;  2YSQ A;  4KRT A;  1ARK A;  1GCQ C;  1JEG A;  1JQQ A;  1RUW A;  3RNJ A;  1YN8 A;  1I07 A;  3ZL7 C;  1OOT A;  5GJV B;  5FWC A;  2OJ2 A;  2RF0 A;  2M51 A;  2YDL A;  1E6H A;  1QKX A;  4J9G A;  2EGA A;  2LQW A;  1XOV A;  2O31 A;  2J6O A;  2X3X D;  1WXT A;  4Z89 A;  1UFF A;  1T3L A;  2GNC A;  2L2P A;  1ZX6 A;  2BZ8 A;  3PVQ A;  2AZV A;  2EGC A;  4J9B A;  1MV0 B;  1NM7 A;  1YP5 A;  1UTI A;  4EIK A;  2W0Z A;  3EGU A;  3EHR A;  2L3Q A;  4J9H A;  2JS2 A;  1H3H A;  2CDT A;  2EYY A;  4GBQ A;  1OEB A;  1UJ0 A;  4AFZ C;  1X2K A;  2O88 A;  1KSW A;  1E7O A;  1JXM A;  2CH4 W;  2CSI A;  4OMN A;  1GRI A;  4ORZ A;  2LJ0 A;  1WXB A;  3RBB B;  5IHK A;  2O9V A;  2ECZ A;  2JMC A;  2KBT A;  4D8K A;  3TVT A;  1ZBJ A;  2DIL A;  1SRM A;  4DEY A;  2J06 A;  2DYB A;  1PNJ A;  4J9F A;  1FYN A;  4JZ3 A;  3H0I A;  2CRE A;  2E5K A;  1NYG A;  1AEY A;  1UE9 A;  1NEB A;  2XMF A;  5IXB A;  4JJD A;  2O2O A;  2F2X A;  5HCK A;  2NWM A;  4CC3 A;  2JM8 A;  2SRC A;  2SEM A;  2FPF A;  1T0J A;  1J3T A;  3VS5 A;  3M0R A;  2F2V A;  1NG2 A;  2DL5 A;  2DL7 A;  2AKL A;  1GFC A;  3EG3 A;  4RTT A;  1I1J A;  1UHC A;  1MUZ A;  2L3P A;  2DE0 X;  1ABQ A;  1T3S A;  2KXD A;  2YUQ A;  2ABL A;  3M0Q A;  1G83 A;  2MOX A;  1ZLM A;  1M30 A;  4A63 B;  3M0U A;  2LMJ A;  1WLP B;  2P4R A;  1UEC A;  1KFZ A;  1NLO C;  5IHN A;  2NUZ A;  2OAW A;  1PRM C;  2EYX A;  2FO0 A;  3GBQ A;  4CC4 B;  4X1V A;  2V1R A;  2C0I A;  2C0T A;  4JZ4 A;  3EG1 A;  1PKT A;  2GTO A;  4RTX A;  1SRL A;  1BB9 A;  2A37 A;  2HEQ A;  5FWB A;  2LJ3 A;  2K3B A;  4HCK A;  1H92 A;  2ED1 A;  1SHG A;  3H41 A;  3SEM A;  4IIO A;  4R0K A;  4ZNX A;  1M8M A;  2RQW A;  2M0Y A;  1Y57 A;  2KNB B;  1CKA A;  2K9G A;  2KYM A;  4OMM A;  3VS7 A;  1X2Q A;  3VRY A;  2HSP A;  4F16 A;  1HSQ A;  1AWW A;  1KJW A;  1SEM A;  2K7A A;  3IQL A;  2GBQ A;  5I22 A; 
#chains in the Genus database with same CATH topology
 3A8L B;  4A54 A;  2ZPH B;  5LJ5 f;  2RA2 A;  1K9M C;  3ZEH A;  2Z0W A;  5IHI A;  2HZY A;  4WTO B;  1WJQ A;  1X75 C;  3MP6 A;  1Q86 U;  3I55 A;  1PD1 A;  3A8M B;  2PZ1 A;  4LDU A;  1W2B A;  1ZUK A;  4JLI A;  1WXU A;  3QBY A;  4KH1 B;  3H9N A;  3PFS A;  1UDL A;  2CGH A;  2K3Y A;  1YJ9 T;  2RJE A;  4C92 B;  2EQI A;  1X6G A;  3H0F A;  2IG0 A;  2JNG A;  2HKN A;  3KFV A;  1K73 R;  1VOM A;  4OMQ A;  1K76 A;  3JB9 J;  2BZY A;  2PVO B;  3VS3 A;  1S72 T;  1VQ6 T;  2LQK A;  3SWN A;  3I56 A;  1QKW A;  2MCN A;  3GLX A;  3SWN C;  4ELY C;  2DA9 A;  3CCV Q;  1RAI B;  2KY9 A;  1YCY A;  3DB3 A;  3JCM V;  3C0C A;  3S3O A;  2OTL A;  3UDC A;  3GOX A;  4DEX A;  3SHW A;  2J05 A;  1GXI E;  4OML A;  2VXE A;  3G4S T;  1JU5 C;  1VUB A;  1ZQ1 A;  2MWO A;  2FRY A;  1VYV A;  4C92 E;  5GMK l;  3PIP A;  1QVF P;  2CYZ B;  1VQL T;  3ZBD A;  1YJW Q;  3M53 A;  2QTV A;  4C8Q B;  3GIB A;  2AKK A;  1CSK A;  4J6W A;  1X6B A;  3A8H B;  2RQV A;  3EG2 A;  3CD6 A;  3CPF A;  4J9E A;  5CK9 A;  4GY5 A;  1KD1 C;  1K0S A;  2WSC E;  2CH4 A;  2GQV A;  4JJB A;  3GNG A;  1IO6 A;  5LJ5 e;  5GAO n;  3CCU T;  5FU7 C;  3CEY A;  2KRO A;  2NLU A;  2DXU A;  3PE0 A;  2DRK A;  3V8L A;  2LCS A;  4MDX A;  1K0X A;  2VGM A;  5J26 A;  4MML A;  4M7D D;  2E3I A;  1ZUY A;  3S3N A;  4JS5 A;  4J9D A;  1OPL A;  4OMP A;  4C5I A;  2KYB A;  3QWX X;  3X25 B;  5LJ5 d;  3CCS A;  4LD6 A;  4C92 C;  3OYD A;  1YIT A;  2JN0 A;  2YLC A;  2E41 A;  3DKM A;  1Y0M A;  5J39 A;  3R6N A;  3PMT A;  1YJN A;  5FRM A;  2DJQ A;  1VQ9 T;  9ATC B;  4PFP A;  1WHL A;  1U06 A;  1FMK A;  1BBZ A;  5GAN 8;  2A08 A;  2COY A;  3L2V A;  2VUB A;  1ZUU A;  4RTW A;  4M75 D;  4VUB A;  2LDM A;  3LGL A;  4GLK A;  4JJN K;  2JM9 A;  4DOV A;  1AWO A;  3LX7 A;  4DBH A;  3CCQ A;  2RK2 A;  3AHU A;  1IRE B;  2DM1 A;  2FPE A;  2DVE A;  2XD0 A;  3VRZ A;  1BIA A;  1MMG A;  2LTO A;  3HHT B;  1W70 A;  4M7A A;  2D6F A;  3BFM A;  4OF1 A;  1UGQ B;  4PJJ A;  2I0N A;  2P0P A;  4OP0 A;  2IIM A;  1ZSG A;  1KQS P;  1BKB A;  1RAF B;  1VQN A;  3HFO A;  5FU6 B;  3LWI A;  4BY6 B;  3M9Q A;  4DQ2 A;  1K9M U;  4UC4 A;  2EW3 A;  5FW9 A;  4O5V A;  3SFM A;  2KEA A;  4NS5 A;  2JUF A;  3NMZ C;  4LD9 K;  1W6X A;  2EKH A;  2HSE B;  1C1A A;  2G6F X;  1LJO A;  2PUK B;  1SPK A;  3G1J A;  3CPW P;  2COZ A;  2RHX A;  2R5M A;  1I5L A;  2DNU A;  1WHK A;  3D7S B;  2DTI A;  2XU8 A;  1KD1 R;  3NHN A;  3HTR A;  3S3M A;  1B7T A;  1AZG B;  2KXC A;  3WVE B;  3EGD A;  3FJ5 A;  2JXB A;  1IB8 A;  1M27 C;  1K8A C;  1WA7 A;  1W1F A;  4LUD A;  4A4F A;  2HD0 A;  3VJP A;  5GAN 5;  3F70 A;  4Z8A A;  1GL5 A;  4M77 B;  3OSS C;  1UHF A;  1VQP A;  2RB6 A;  5CAI A;  1FWZ A;  4J6Y A;  2AIR B;  4BE2 A;  1XJW B;  4Z88 A;  1YJ9 Q;  1YWO A;  2RQT A;  3M54 A;  5DY9 A;  1N9R A;  2RNA A;  2RJF A;  2HBP A;  3EFO A;  4LE9 A;  2K6D A;  1X27 A;  4HVU A;  2HL3 A;  2EGE A;  1GBR A;  1H3Z A;  3THK A;  2YRD A;  1IHW A;  2MYS A;  3QJY A;  1RI9 A;  7AT1 B;  3EG0 A;  3OYB A;  2J6F A;  1KD1 U;  1S72 Q;  1VQ6 Q;  2QI2 A;  3MO8 A;  3CMA T;  1ZHI A;  2DJZ A;  3ZL7 C;  1OOT A;  5GJV B;  4M77 E;  2M16 A;  5GMK j;  3NFC A;  2RF0 A;  2HQE A;  4XTY A;  4PFZ A;  5GAM g;  4J9G A;  3QZ9 B;  3OYL A;  2QQA A;  2L8D A;  1VIE A;  2EYQ A;  4BB7 A;  2DYI A;  2QQB A;  3G4S Q;  5GAM f;  2QQ9 A;  4FT2 A;  4IUR A;  2L2P A;  3QG1 A;  3PVQ A;  2BZ8 A;  2AZV A;  1VQL Q;  2EGC A;  1WHM A;  3JAM E;  3PMI A;  1NM7 A;  4LDX A;  2CP0 A;  1WHJ A;  2W0Z A;  4AT1 B;  3RES A;  2L3Q A;  4OGE A;  1VQ5 T;  1M2V B;  4E7I A;  2IVW A;  3CCV A;  1KG1 A;  1TXQ A;  1OEB A;  1TOV A;  2GFA A;  3J81 E;  1QW1 A;  3OYH A;  2O88 A;  1E7O A;  2RI3 A;  2AHJ B;  4IUP A;  3QKJ A;  2XID A;  2CSI A;  2LJ0 A;  1D3B A;  4M77 C;  3V7S A;  5IHK A;  3L2Z A;  5CKF A;  2JMC A;  3OW2 P;  1YI2 T;  1WJS A;  3JCM J;  1YJW A;  4D8K A;  2DKG A;  1SRM A;  1LPL A;  5KYX A;  2DYB A;  4J9F A;  1FYN A;  3M56 A;  4JZ3 A;  2BUD A;  3PGG A;  4XU2 A;  2DET A;  1K8A R;  1RAA B;  3VYG A;  2CRE A;  2E12 A;  1AEY A;  1UE9 A;  2LVM A;  4QVZ A;  1TTH B;  5D6Y A;  1VQ9 Q;  3PTA A;  3A5Z B;  1KHI A;  5LJ5 h;  3A8G B;  1HK9 A;  2F69 A;  2QG9 B;  3M0R A;  2F2V A;  1LNX A;  2DL5 A;  4IUQ A;  1ZSZ B;  1GFC A;  4RTT A;  2ZPG B;  4N4G A;  1ABQ A;  2DE0 X;  2GF7 A;  2KXD A;  2YUQ A;  4PJO B;  2ABL A;  3J80 E;  1JJ2 P;  3LH0 A;  5GAM e;  1ZLM A;  4J83 A;  1NJI C;  3MP1 A;  5IHN A;  2K4Y A;  3LGF A;  2EJ9 A;  2V1R A;  2C0I A;  3CCE T;  3CCL T;  1B34 A;  4MZP A;  3M58 A;  5J3B A;  1O9S A;  3RIR A;  1M2O A;  1XQH A;  3EG1 A;  1PKT A;  4JZ4 A;  3V7C A;  4J7I A;  1SRL A;  3BE3 A;  4OMF B;  2HEQ A;  3EFR A;  4V2S A;  3G7Z A;  5GAM d;  1LOJ A;  1SKU B;  3P8B B;  1VQK T;  1H92 A;  4X34 A;  2X35 A;  4ZNX A;  2CP7 A;  4X9C A;  2IPO B;  3G6E Q;  2M0Y A;  2XIC A;  2K9G A;  1FMW A;  4OMM A;  1AHJ B;  2DFU A;  2O4X B;  1N6A A;  4NL3 A;  4PJO E;  4ZGE B;  2ZZD A;  1KJW A;  2KMT A;  1SEM A;  2K7A A;  4BI3 A;  5KE3 A;  3LLR A;  2L0A A;  1IHV A;  2MWP A;  3JCM P;  1RAB B;  1I8F A;  1N8R C;  2LCC A;  2VAS A;  1N27 A;  2E6Z A;  3FLG A;  1HJD A;  5L8R E;  2EQM A;  3RR6 A;  3LH5 A;  2P4T A;  2C0O A;  4HCC A;  2H8H A;  4F14 A;  5CCA A;  1WZO A;  3EG9 A;  2ESW A;  4O6J A;  3VU3 C;  2MK5 A;  2E64 A;  2F5K A;  2DIG A;  3QYG B;  1QCO A;  5DM7 R;  2F2W A;  3QUI A;  1FXX A;  2YUN A;  1VQM T;  3CC7 T;  3JCM b;  4HXJ A;  1WJR A;  4F17 A;  5IH2 A;  2J6K A;  3HP9 A;  1WX6 A;  4OB0 B;  3VYH B;  1NYF A;  1K73 C;  1K1Z A;  4C92 F;  3LWH A;  2QEX Q;  3CC2 T;  1S1N A;  1B3Q A;  2LCL A;  4MZM A;  2RD1 A;  3VUZ A;  4C92 G;  1I5O B;  1GBQ A;  4KUI A;  2R58 A;  1C6V X;  2MMP A;  3NPF A;  2BTT A;  2X9H A;  1Y7X A;  2YLB A;  2D8J A;  4OMO A;  3QO3 A;  2JT4 A;  2K2M A;  1UB4 A;  1Y71 A;  1K4U S;  2DL4 A;  1UG1 A;  1V29 B;  1YJ9 A;  3EH2 A;  4B6M A;  4E7S A;  1NJI R;  1OV3 A;  3LYI A;  1ACM B;  2X4J A;  2F5T X;  5KYW A;  3JB9 D;  5GAN 6;  2KR3 A;  3ASK A;  2DXB A;  1SF9 A;  4N4H A;  4FSX A;  1UJY A;  2E10 A;  2O01 E;  2KQW A;  2FB7 A;  1WQW A;  4PJL A;  4AFU C;  2LQN A;  2OX7 A;  1S72 A;  1VQ6 A;  3PT9 A;  2ROT A;  1X6O A;  1VQ5 Q;  3JCM W;  4JRI A;  3QDF A;  3CCR T;  2QAZ A;  3PVL A;  2HKQ B;  3X20 B;  4C0G A;  1UEB A;  2AZS A;  5C0M A;  3E2U A;  1QWE A;  4M7A D;  3NTH A;  2QAS A;  1H8K A;  1WHH A;  2MIO A;  1TUD A;  3G4S A;  1YIJ T;  3VS4 A;  2CZ6 B;  4AMC A;  1VQL A;  1YI2 Q;  2DEU A;  1N8R R;  2GTJ A;  4F7U B;  1GCP A;  2AK5 A;  1WPY A;  3CQT A;  3UA6 A;  5GAN 2;  1M5Q 1;  2V8K A;  3JCM c;  2DTH A;  1PKS A;  2MAM A;  3RMS A;  3I35 A;  1QCF A;  1Q95 G;  1W2B P;  5A0L A;  2VVK A;  1Z9Q A;  2D9T A;  2K3X A;  2DRM A;  4ZN1 A;  2RN8 A;  2K5I A;  3FB9 A;  2HDA A;  1GFD A;  4K11 A;  3AT1 B;  2JTE A;  3UPU A;  5CKB A;  5LJ3 h;  2E3H A;  4EMK B;  1WGS A;  1Y96 A;  2LNV A;  4F7U E;  1BCO A;  1N5Z A;  3OS0 A;  2ED0 A;  4A4K A;  2K5F A;  1MMD A;  3H0H A;  3TQ7 P;  2A28 A;  1G3Y A;  1AOJ A;  1VQ9 A;  2HCK A;  4KH0 B;  3CCE Q;  3CCL Q;  4R55 A;  3CXC S;  2DK3 A;  2MF2 A;  4LNP A;  1BU1 A;  1O75 A;  1NE8 A;  2QDL A;  1VQK Q;  1SSH A;  2EKO A;  4ATO A;  4BE0 A;  1BIB A;  2VWF A;  1KQ1 A;  4BD3 A;  2PUO B;  4M78 B;  2O9S A;  2FZG B;  2A3L A;  4ZGD B;  3OYI A;  5KYU B;  3OA6 A;  4C0Z A;  5GAM h;  3R6O A;  5GAO q;  1YWP A;  1K73 U;  2DL8 A;  3HL8 A;  1WYX A;  3S6W A;  1K9A A;  2QK0 A;  1W4S A;  1YCS B;  1JBM A;  3OYA A;  1QCN A;  2PVD B;  2CP6 A;  1MHN A;  2XKO C;  2LQ8 A;  1BK2 A;  4HT8 A;  4NOY A;  1R0B G;  4RTV A;  3G6E A;  2DXC A;  3I55 T;  3VS1 A;  2JMA A;  4C92 A;  3A98 A;  3QJ6 A;  2QA4 T;  1BI1 A;  5I11 A;  4C8Q E;  1ZBX A;  4M78 E;  2DEQ A;  1VQM Q;  4M77 F;  4QT7 A;  4QVC A;  3CC7 Q;  1YFN A;  2AT1 B;  2R5A A;  1AZE A;  2BE7 D;  1R8O B;  4M77 G;  2GQI A;  2YSQ A;  5I21 A;  5GAN j;  3GF5 A;  2DIQ A;  3OBW A;  2M51 A;  4L5G A;  2EGA A;  3N5B B;  2LQW A;  1XOV A;  2O31 A;  4XTW A;  2X3X D;  1MNE A;  1WXT A;  2CZ7 B;  1HXD A;  2RK1 A;  4TVR A;  1M8V A;  1T3L A;  2GNC A;  3V8K A;  3OYJ A;  2MI6 A;  3ER0 A;  3MEU A;  1MMN A;  3EH1 A;  1MV0 B;  4N0A A;  4FCY A;  2CS7 A;  4E7J A;  3BW1 A;  4C8Q A;  4CRI A;  3EGU A;  3EHR A;  1QVF S;  4N0A C;  4C8Q C;  4J9H A;  4HCB A;  4M78 C;  1R77 A;  2QEX A;  5M9O A;  4MMK A;  2CDT A;  4AFZ C;  1YHQ T;  4Y91 A;  3GP8 A;  1VQ4 T;  3MHX A;  2DPP B;  2CH4 W;  3O8V A;  4ORZ A;  1SSF A;  2KAF A;  3FRN A;  2O9V A;  5C6S A;  2CZ1 B;  2ECZ A;  2RO0 A;  3TRE A;  3M57 A;  2YWW A;  3TVT A;  1ZBJ A;  2DIL A;  4DEY A;  2NUP B;  2J06 A;  3JSC A;  1M90 C;  1NYG A;  2VB6 A;  4M7D B;  1FMV A;  3CCM T;  2FL7 A;  1V76 A;  1VQO T;  4JJD A;  1D1C A;  2O2O A;  1TWB A;  2M1H A;  1KC8 C;  4CC3 A;  5LJ3 g;  2PVG B;  1VQ5 A;  2SRC A;  3PIO A;  2DZ9 A;  4PLL A;  5LJ3 f;  3DB4 A;  1NPP A;  2NYS A;  5FRN A;  2L3P A;  3TU4 K;  4C0D B;  1T3S A;  2COW A;  5EG2 A;  3M0U A;  4FYX B;  2LMJ A;  1U8R A;  2P4R A;  1UEC A;  4OB3 B;  3GBQ A;  2RHY A;  4CC4 B;  4X1V A;  3Q1J A;  1YI2 A;  4M7D E;  2QXF A;  4DBF A;  4M75 B;  3OY9 A;  3OYM A;  2GTO A;  1BB9 A;  5A2Q E;  2A37 A;  1RAE B;  2XDB A;  5FWB A;  3FIF A;  3SEM A;  4IIO A;  4R0K A;  1KQS S;  5FU6 C;  4BY6 C;  1VQ7 T;  1Y57 A;  1CKA A;  3FC3 A;  4FYW B;  3VRY A;  1MMA A;  2V26 A;  3MEA A;  1X01 A;  3L2W A;  5KE2 A;  1BI0 A;  3IQL A;  5I22 A;  2CUD A;  3UA7 A;  4XTV A;  2KVQ G;  1UGS B;  2ZPB B;  1WFW A;  2DD5 A;  1V1C A;  1ZA1 B;  2FPD A;  8ATC B;  2D8H A;  4AG1 C;  4M75 E;  4IUT A;  1KIK A;  4M7D C;  3G71 T;  3CCU Q;  8AT1 B;  3OYG A;  3CCE A;  1NLP C;  3CCL A;  3QPH A;  1RAG B;  2M02 A;  2RHI A;  2EJG A;  2HAX A;  3E1S A;  4C5E A;  3P8D A;  3OYK A;  4CC7 A;  4A4H A;  5LJ3 e;  4M77 A;  5EC7 A;  4ELZ C;  1EX4 A;  1VQK A;  1QVP A;  1P92 A;  4AFQ C;  1OYX A;  3OMG A;  3RMQ A;  1IGQ A;  2X4W A;  1M90 R;  2K2V A;  1M1G A;  1VQP T;  1OU9 A;  3M59 A;  2OTJ T;  5KYY B;  2QA4 Q;  4C5H A;  1PWT A;  2R57 A;  2A7Y A;  2ENM A;  2QYZ A;  4ZTF A;  5LJ3 d;  1KC8 R;  4LDV A;  1M3A A;  1WQ7 A;  4M75 C;  3TSZ A;  1TU0 B;  4XTU A;  4PJM A;  4J9I A;  1M4Z A;  4XTX A;  3VS0 A;  1M9S A;  3VS6 A;  4E7K A;  3UAT A;  1VYT A;  1D0X A;  1RAD B;  2KRN A;  3CME T;  1KQ2 A;  3OYC A;  2E70 A;  1AD5 A;  2WSF E;  4JRK A;  3EAE A;  3EGX B;  1OQK A;  2EFI A;  5ECA A;  2EYW A;  2LP5 A;  4QQ6 A;  1VQM A;  3OBY A;  3CC7 A;  4BUG A;  2DX1 A;  1D1B A;  3QDR B;  1Y07 A;  1M3C A;  2DZC A;  2E4H A;  2EPD A;  1KK7 A;  3HRT A;  2DVJ A;  1M90 U;  4P5N A;  3T9N A;  2ATC B;  4JS4 A;  1Q81 C;  2QDY B;  1QVG A;  4JPB W;  2RQR A;  2Y4Y A;  1K8A U;  2CT4 A;  1M2V A;  1RI0 A;  1YHQ Q;  2YRV A;  3P8H A;  1VQ4 Q;  1EIF A;  2K79 A;  4DBR A;  4KUD K;  4JUV A;  2DLP A;  2XI9 A;  1AWX A;  1PC0 A;  3MCA B;  1QP3 A;  2RJC A;  4LUE A;  1G2B A;  5LL6 S;  1G3S A;  1VYU A;  3INZ A;  2RM4 A;  3OW2 S;  3CCM Q;  2P0Q A;  1YJW T;  1EZZ B;  1M3B A;  3OYF A;  3VKI A;  1HYO A;  4R56 A;  3M0T A;  5I2M A;  1VQ8 T;  1AVZ C;  2HBW A;  3MEW A;  3M55 A;  2KT8 A;  4RCB A;  4MDW A;  4F7U F;  2L3R A;  5FRO A;  4E47 A;  3U23 A;  5GMK e;  2YT6 A;  4F7U G;  5D6X A;  3CC4 T;  2KI7 A;  1UUE A;  1ZSZ A;  3TEE A;  1IRX A;  4DOW A;  1PSF A;  1RLQ C;  1B07 A;  5GMK m;  5IXF A;  1LCK A;  1ZSZ C;  5CO7 A;  4PJO A;  2DBM A;  3OMC A;  4PJN A;  4PK4 A;  2DF6 A;  5AT1 B;  4PJO C;  2PNI A;  2RI5 A;  3HPW A;  1QVG S;  3JV3 A;  1JJ2 S;  1JXO A;  4KBM B;  3I5R A;  2JTM A;  4RUG A;  1WHG A;  2NUT B;  3REB B;  2WAC A;  4FSS A;  4M4Z A;  1X69 A;  2EVR A;  3CMA Q;  4RG2 A;  5HY6 A;  2LT1 A;  4C92 D;  5LJ5 j;  2XDP A;  4E7L A;  1VQ7 Q;  2LRQ A;  2ZGW A;  3MPU B;  4ESR A;  4IUU A;  5HKC A;  3CBO A;  2KSS A;  3NGP A;  4FW1 A;  2LT4 A;  1IXD A;  4HA8 A;  2O4X A;  3OS1 A;  1MV3 A;  1VA7 A;  4OB1 B;  1CKB A;  2X4Y A;  2KRS A;  2EYZ A;  3NTI A;  2XK0 A;  2CP5 A;  1Q81 R;  4FW2 A;  3KXT A;  2V1Q A;  2CKK A;  3CCJ T;  4CC2 A;  2A36 A;  1UGP B;  2DO3 A;  4BI8 B;  1PG5 B;  4C8Q F;  3URG A;  2X3W D;  1OUL A;  4M78 F;  3G71 Q;  2BKD N;  2EBP A;  4C8Q G;  1BYM A;  4M78 G;  3CXC A;  3E9G A;  2CT3 A;  2X51 A;  3L42 A;  2CSQ A;  5D7U A;  3JRZ A;  3C4S A;  1PHT A;  3O5Z A;  3M4G A;  4N4I A;  4C8Q D;  2Y90 A;  3HFN A;  4ANJ A;  5CQY A;  1GCQ A;  1X43 A;  4B9W A;  3E19 A;  5HK0 A;  4E2F B;  4KRT A;  4D6W A;  4EPC A;  1GCQ C;  2OTJ Q;  2GCX A;  1PCX A;  1RUW A;  2GFU A;  3RNJ A;  1I07 A;  5CKD A;  1NJI U;  1RL2 A;  3H6Z A;  3EFS A;  5FWC A;  2JJ9 A;  3QXE B;  2OJ2 A;  3CCU A;  2RHU A;  1E6H A;  1VIF A;  3RKX A;  3ME9 A;  2QGG A;  2NUT A;  5FU7 B;  1Q7Y C;  1UFF A;  3UWN A;  3OS5 A;  2ZPI B;  5GAO l;  4PFO A;  1ZX6 A;  2K57 A;  2XDD A;  4XAX B;  1YP5 A;  1OX9 A;  1D0Z A;  3M4Y A;  3L2R A;  3CME Q;  2L89 A;  3QII A;  2BIV A;  2QA4 A;  2Y4X A;  1NBE B;  2EYY A;  3FEO A;  1TSF A;  1UJ0 A;  3BDU A;  2ZPE B;  5A0D A;  1X2K A;  3RDV A;  5FLX E;  1N8R U;  3WVD B;  1XTD A;  5HK3 A;  3QYH B;  1G3T A;  5GAO r;  2VXF A;  2JVV A;  4J6X A;  4DA4 A;  1D0Y A;  2H3E B;  5A0G A;  3OQ5 A;  3M5A A;  3RER A;  2RI2 A;  1PNJ A;  3H8Z A;  5CKH A;  4EMH A;  4RG8 A;  2DD4 A;  1TH7 A;  3H0I A;  4XK8 E;  2E5K A;  2FVU A;  1NEB A;  1I81 A;  1QVF A;  2F2X A;  4F7U A;  4B9X A;  5HCK A;  3VUB A;  1Q82 C;  2JM8 A;  2RH2 A;  4M7A B;  2SEM A;  1AT1 B;  1T0J A;  4C0F A;  1J3T A;  2AKL A;  1YBY A;  3EG3 A;  1VQ8 Q;  4M7D F;  1WNL A;  1I1J A;  1UHC A;  1MUZ A;  4ZN3 A;  1YHQ A;  1RAH B;  5KCO A;  1VQ4 A;  2MOX A;  4M7D G;  5CR2 A;  4A63 B;  1BI3 A;  4HKE A;  1KFZ A;  2V8J A;  3E9F A;  3OS2 A;  2OAW A;  1PRM C;  2EYX A;  1W2B S;  1DJ7 B;  4IKF A;  2HQX A;  4LXC A;  3CC4 Q;  2C0T A;  4KUL A;  3GPL A;  2EQU A;  3SB2 A;  4BAC A;  4FL6 A;  3V8J A;  4EMK A;  4E7H A;  4EMK C;  2LJ3 A;  2K3B A;  4KGX B;  3CCM A;  2CP3 A;  3GNF B;  2ED1 A;  3H41 A;  3CC2 Q;  4M7A E;  4F04 B;  1VQO A;  2RQW A;  4LDW A;  4M77 D;  1D1A A;  1Q7Y R;  2KYM A;  3EGD B;  3I56 T;  1K9M R;  4J7F A;  2HSP A;  4F16 A;  1G5V A;  2A0F B;  4M75 F;  1HSQ A;  5IXB A;  2GBQ A;  1YNZ A;  4M75 G;  3UF4 A;  2D0Q B;  1NZ9 A;  2OTL T;  1G3W A;  1M1F A;  2DAQ A;  5KH6 A;  3JCM g;  5GMK h;  2PQW A;  2HNI A;  3UT1 A;  1NEG A;  2V8I A;  2DMO A;  4KGZ B;  4BDZ A;  2J7I A;  2E5Q A;  2FG0 A;  4M78 A;  3JCM f;  2RMO A;  2CUB A;  5LJ3 j;  1T0H A;  5CKE A;  1JB0 E;  4XU1 A;  2FEI A;  5KYU A;  3BDL A;  2PTK A;  4AFS C;  5D6W A;  3C95 A;  5IT9 E;  3CCJ Q;  3EFO B;  4PLI A;  2VGN A;  4JRQ A;  3CD6 T;  4FIB A;  4C5G A;  2X4X A;  3CMA A;  1QLY A;  2GGR A;  2EAY A;  1WDX A;  2JOY A;  4RTU A;  3JCM Q;  1KQS A;  5IN1 A;  2EQJ A;  4M7A C;  3REA B;  3MJX A;  3CCR Q;  1HD3 A;  5CQX A;  1VQ7 A;  1JO8 A;  1Q7Y U;  3A8O B;  3PNW C;  5GAN 4;  2LZ6 B;  4II1 A;  3TSW A;  3QWY A;  5L23 A;  2YHT A;  4HVV A;  4BE1 A;  1YIJ Q;  4J9C A;  4QQD A;  3G6E T;  2KT1 A;  5GAN g;  4FYV B;  1QP2 A;  5GAO p;  3CCS T;  2ZAE A;  1Q82 R;  3CPW A;  3VS2 A;  2BZX A;  2QGF B;  5I2S A;  5GAN f;  1YIT T;  4A53 A;  5GAM j;  4L6V 5;  4PNO A;  2G3R A;  1TS9 A;  5GMK i;  3JB9 I;  1YJN T;  3G71 A;  3QSU A;  1U3O A;  3A1P A;  1G8X A;  1RAC B;  3C12 A;  4IIM A;  4BDY A;  2FRW A;  1BCM A;  2EWN A;  1SHF A;  1RLP C;  2H3J A;  2B86 A;  2RQU A;  3FJP A;  4LN2 A;  2VV5 A;  4OGC A;  3CCQ T;  1PRL C;  2OTJ A;  3JCM e;  2L3S A;  1D3B B;  4RTY A;  1D09 B;  2KGT A;  4PJO F;  5KYX B;  1M1K C;  5GJW B;  5GAN 3;  4QW2 A;  1WI7 A;  1Q82 U;  4PJO G;  3L1A A;  2HMA A;  2JS0 A;  2QEX T;  1SG5 A;  4Y92 A;  4RCC A;  2VYT A;  3QHS A;  1VQN T;  4OB2 B;  4JRP A;  2FZK B;  4PKC C;  3JCM d;  2BE9 B;  3ZFJ A;  3NTK A;  4PJO D;  3OYE A;  4GLM A;  5CIU A;  3L2U A;  3V7R A;  3CME A;  3KUF A;  2NUP A;  4A4E A;  1OPK A;  1U1S A;  1FX7 A;  3M0P A;  3VV0 A;  3CPW S;  2YUO A;  1UGV A;  4M7D A;  4FU6 A;  5KCH A;  3ULR B;  1H64 1;  3MP8 A;  4HVW A;  5GAN e;  5GAN 7;  2DER A;  3EHQ A;  1A0N B;  4Q5W A;  4PL6 A;  5KYN A;  1WIE A;  4ZGJ B;  4D8D A;  1B34 B;  4RTZ A;  2WSE E;  4L59 A;  3HRS A;  1OU8 A;  2P84 A;  4QKU A;  1TG0 A;  3I55 Q;  5GAN d;  3HRU A;  2KE9 A;  2RPN A;  1I0C A;  3X28 B;  4C0D C;  1ABO A;  2XG8 D;  2LJ1 A;  4E7Z A;  3DLL A;  3HKS A;  2RHZ A;  3OYY A;  4ZTJ A;  2ZCF B;  1N9S A;  1I4K 1;  4HT9 A;  2YUP A;  2OI3 A;  2JW4 A;  2KK4 A;  4M75 A;  3OW2 A;  1U5S A;  2DL3 A;  2EIF A;  2VC8 A;  4E6R A;  2DTO A;  2JTF A;  3RUX A;  2W10 A;  4LDY A;  1VQ8 A;  3I9Q A;  3I56 Q;  1Z9Z A;  1MGQ A;  2KRM A;  4YTL A;  4QVD A;  3RKW A;  2EQK A;  3EG9 B;  4J8O A;  3CC4 A;  2B8A A;  1IGU A;  2OTL Q;  1ZA2 B;  4FYY B;  1EFN A;  3JCM X;  3M0S A;  2VKN A;  2DBK A;  3CBP A;  2L5Q A;  1OZ2 A;  4XU0 A;  2ROL A;  2LNH B;  2YXY A;  4NL2 A;  1M1K R;  3MKD A;  3TCJ A;  2I2L A;  3BY7 A;  3DLM A;  3RKY A;  1U1T A;  1LVK A;  5CVI A;  1JJ2 A;  3CC2 A;  1QVG P;  3I5S A;  3C94 A;  1QWF A;  4WCI A;  2XHC A;  1AWJ A;  3OSV A;  4IUV A;  4AG2 C;  3HSB A;  3KBG A;  2EJF A;  3CD6 Q;  1KC8 U;  1QMC A;  2MPX C;  1E6G A;  1Q86 C;  3CCV T;  4X9D A;  2LX7 A;  4RKU E;  1R0C B;  2D1X A;  2FHD A;  1TUC A;  1QQJ A;  4KGV B;  4JJC A;  5GAO m;  2F1L A;  2D0N A;  1NPR A;  1ARK A;  1BI2 A;  1JEG A;  1JQQ A;  1YN8 A;  5KYY A;  4EMG A;  4MZT A;  1PD0 A;  2E6N A;  3CCS Q;  2YDL A;  1QKX A;  1VQO Q;  5KYW B;  3CCJ A;  2J6O A;  3MEV A;  4J5Y A;  2YRC A;  1YIT Q;  2M9U A;  4Z89 A;  2LX9 A;  1M1K U;  1YJN Q;  4XQ3 A;  3OB9 A;  2DXT A;  3CBM A;  4J9B A;  2HL5 C;  3CCR A;  2K5L A;  1XNI A;  1UTI A;  4EDU A;  1TUG B;  3X24 B;  4JDS A;  4EIK A;  2JS2 A;  3WXM B;  2CP2 A;  1H3H A;  3EGX A;  1YIJ A;  3MET A;  2LC4 A;  2C06 A;  4GBQ A;  1KHC A;  3J7A F;  1KSW A;  1JXM A;  1PSE A;  2OAU A;  3CCQ Q;  4OMN A;  1GRI A;  1WXB A;  3L2Q A;  3RBB B;  2JZ2 A;  2CZ0 B;  2E1H A;  1OX8 A;  4KT0 E;  4Y28 E;  1MND A;  1C0M A;  2KBT A;  4WF2 A;  2QTX A;  2FZC B;  1VQN Q;  1OZ3 A;  4FT4 A;  2XMF A;  5DLO A;  4JLG A;  2QQR A;  3SDZ A;  5IAY A;  1IZ6 A;  2NWM A;  4CI0 C;  1JRI A;  3JB9 F;  2ZPF B;  2E65 A;  6AT1 B;  2FPF A;  2QQS A;  3JB9 G;  3VS5 A;  4DBQ A;  1NG2 A;  4ME7 A;  3JCM h;  2DL7 A;  2M0O A;  1PM3 A;  1Y96 B;  3FDR A;  3QZ5 B;  4XTZ A;  3M0Q A;  1G83 A;  3SWN B;  1Q86 R;  1M30 A;  1WLP B;  2RJD A;  1NLO C;  3CXC P;  2NUZ A;  3OYN A;  5AYF A;  2FYK A;  3JB9 H;  2FO0 A;  2HQH A;  4M7A F;  4M78 D;  4QQG A;  4Z02 A;  4RTX A;  4M7A G;  2PU9 B;  2P0K A;  5DLQ E;  4BI4 A;  1VQP Q;  4XU3 A;  4HCK A;  3X26 B;  1OI1 A;  1SHG A;  3LW5 E;  2KDS A;  4OVA A;  4HCZ A;  1M8M A;  2KNB B;  3VS7 A;  1X2Q A;  5LJ5 g;  1UGR B;  1Q81 U;  1F1B B;  4FM4 B;  4RMO A;  5GAN h;  4A4G A;  1AWW A;  3SD4 A; 
#chains in the Genus database with same CATH homology
 1YNZ A;  2CUD A;  3UA7 A;  3UF4 A;  2L0A A;  5IHI A;  1NEG A;  1WFW A;  2DMO A;  1V1C A;  2FPD A;  2J7I A;  2D8H A;  4AG1 C;  1HJD A;  2FG0 A;  2PZ1 A;  1ZUK A;  2RMO A;  2CUB A;  1T0H A;  1KIK A;  1WXU A;  3LH5 A;  2C0O A;  2FEI A;  1UDL A;  2H8H A;  4F14 A;  2PTK A;  4AFS C;  1NLP C;  2ESW A;  2EQI A;  1X6G A;  3H0F A;  4CC7 A;  2F2W A;  1QLY A;  5EC7 A;  2GGR A;  1WDX A;  4RTU A;  2YUN A;  4AFQ C;  3KFV A;  3REA B;  4OMQ A;  1HD3 A;  1K76 A;  4HXJ A;  2BZY A;  4F17 A;  1JO8 A;  3VS3 A;  2J6K A;  5IH2 A;  1WX6 A;  1QKW A;  2MCN A;  1NYF A;  2LZ6 B;  1K1Z A;  3TSW A;  1PWT A;  3QWY A;  5L23 A;  2DA9 A;  1S1N A;  1B3Q A;  4HVV A;  2ENM A;  4J9C A;  2KT1 A;  1GBQ A;  3C0C A;  1M3A A;  4DEX A;  3NPF A;  3VS2 A;  3SHW A;  2BTT A;  2BZX A;  2J05 A;  4OML A;  3TSZ A;  2D8J A;  4OMO A;  1JU5 C;  4J9I A;  2FRY A;  1VYV A;  2JT4 A;  2K2M A;  3VS0 A;  1K4U S;  2DL4 A;  3VS6 A;  1U3O A;  1UG1 A;  3UAT A;  1VYT A;  2AKK A;  1CSK A;  2KRN A;  1X6B A;  2RQV A;  1OV3 A;  3EG2 A;  1AD5 A;  4J9E A;  4IIM A;  1K0S A;  5ECA A;  2EYW A;  2CH4 A;  2FRW A;  2KR3 A;  4JJB A;  1IO6 A;  1SHF A;  2LP5 A;  1RLP C;  1UJY A;  2KRO A;  2DX1 A;  3PE0 A;  2B86 A;  2DRK A;  2LCS A;  1K0X A;  2RQU A;  1M3C A;  2EPD A;  4AFU C;  2LQN A;  4LN2 A;  2DVJ A;  2ROT A;  1PRL C;  1ZUY A;  2L3S A;  4J9D A;  1OPL A;  4OMP A;  4RTY A;  2KYB A;  4JPB W;  2KGT A;  2RQR A;  2CT4 A;  3QWX X;  3PVL A;  5GJW B;  2AZS A;  1QWE A;  1WI7 A;  2JS0 A;  4Y92 A;  1H8K A;  2K79 A;  2MIO A;  1TUD A;  2DLP A;  3VS4 A;  1Y0M A;  1AWX A;  3R6N A;  2DJQ A;  4GLM A;  2GTJ A;  1GCP A;  2AK5 A;  3CQT A;  4LUE A;  3UA6 A;  1G2B A;  1U06 A;  1VYU A;  1FMK A;  1BBZ A;  1OPK A;  2A08 A;  3M0P A;  1ZUU A;  2YUO A;  1M3B A;  4RTW A;  1UGV A;  1PKS A;  3I35 A;  3M0T A;  3ULR B;  1QCF A;  1AVZ C;  2VVK A;  1Z9Q A;  4HVW A;  2HBW A;  3EHQ A;  2JM9 A;  1A0N B;  1AWO A;  2DRM A;  2RN8 A;  2KT8 A;  2DM1 A;  2FPE A;  2HDA A;  1GFD A;  3U23 A;  3VRZ A;  1WIE A;  4K11 A;  2YT6 A;  2JTE A;  4D8D A;  1W70 A;  4RTZ A;  2I0N A;  1UUE A;  2IIM A;  1ZSG A;  1RLQ C;  1B07 A;  5IXF A;  1LCK A;  1TG0 A;  2DBM A;  1N5Z A;  2ED0 A;  2KE9 A;  2RPN A;  1I0C A;  2DF6 A;  1ABO A;  2LJ1 A;  3H0H A;  2PNI A;  2EW3 A;  2A28 A;  5FW9 A;  1AOJ A;  2KEA A;  3NMZ C;  2HCK A;  3JV3 A;  1JXO A;  1W6X A;  3I5R A;  2EKH A;  2YUP A;  4RUG A;  2OI3 A;  2JW4 A;  3REB B;  1U5S A;  2G6F X;  1BU1 A;  2DL3 A;  4FSS A;  4LNP A;  1X69 A;  4M4Z A;  1SPK A;  2EVR A;  2QDL A;  4E6R A;  2DNU A;  1SSH A;  2W10 A;  3I9Q A;  2VWF A;  3NHN A;  4ESR A;  1Z9Z A;  2KRM A;  2O9S A;  1AZG B;  2KXC A;  3NGP A;  3FJ5 A;  2JXB A;  1M27 C;  1MV3 A;  1VA7 A;  1CKB A;  1WA7 A;  2KRS A;  1W1F A;  2EYZ A;  4LUD A;  1YWP A;  1EFN A;  2DL8 A;  2V1Q A;  1WYX A;  1K9A A;  4CC2 A;  3M0S A;  2VKN A;  2A36 A;  2DBK A;  4Z8A A;  1YCS B;  1GL5 A;  2ROL A;  2LNH B;  1UHF A;  2X3W D;  3I5S A;  1BK2 A;  4Z88 A;  1YWO A;  1QWF A;  2EBP A;  4WCI A;  2RQT A;  4RTV A;  1AWJ A;  4AG2 C;  3VS1 A;  2CT3 A;  2JMA A;  2CSQ A;  3A98 A;  2RNA A;  4LE9 A;  2K6D A;  1PHT A;  1X27 A;  3O5Z A;  4HVU A;  1E6G A;  2EGE A;  5I11 A;  1GBR A;  2LX7 A;  3THK A;  4QT7 A;  2D1X A;  1RI9 A;  1AZE A;  1GCQ A;  1TUC A;  2J6F A;  1X43 A;  3EG0 A;  4JJC A;  2D0N A;  2GQI A;  2YSQ A;  4KRT A;  1ARK A;  1GCQ C;  1JEG A;  1JQQ A;  1RUW A;  3RNJ A;  1YN8 A;  1I07 A;  3ZL7 C;  1OOT A;  5GJV B;  5FWC A;  2OJ2 A;  2RF0 A;  2M51 A;  2YDL A;  1E6H A;  1QKX A;  4J9G A;  2EGA A;  2LQW A;  1XOV A;  2O31 A;  2J6O A;  2X3X D;  1WXT A;  4Z89 A;  1UFF A;  1T3L A;  2GNC A;  2L2P A;  1ZX6 A;  2BZ8 A;  3PVQ A;  2AZV A;  2EGC A;  4J9B A;  1MV0 B;  1NM7 A;  1YP5 A;  1UTI A;  4EIK A;  2W0Z A;  3EGU A;  3EHR A;  2L3Q A;  4J9H A;  2JS2 A;  1H3H A;  2CDT A;  2EYY A;  4GBQ A;  1OEB A;  1UJ0 A;  4AFZ C;  1X2K A;  2O88 A;  1KSW A;  1E7O A;  1JXM A;  2CH4 W;  2CSI A;  4OMN A;  1GRI A;  4ORZ A;  2LJ0 A;  1WXB A;  3RBB B;  5IHK A;  2O9V A;  2ECZ A;  2JMC A;  2KBT A;  4D8K A;  3TVT A;  1ZBJ A;  2DIL A;  1SRM A;  4DEY A;  2J06 A;  2DYB A;  1PNJ A;  4J9F A;  1FYN A;  4JZ3 A;  3H0I A;  2CRE A;  2E5K A;  1NYG A;  1AEY A;  1UE9 A;  1NEB A;  2XMF A;  5IXB A;  4JJD A;  2O2O A;  2F2X A;  5HCK A;  2NWM A;  4CC3 A;  2JM8 A;  2SRC A;  2SEM A;  2FPF A;  1T0J A;  1J3T A;  3VS5 A;  3M0R A;  2F2V A;  1NG2 A;  2DL5 A;  2DL7 A;  2AKL A;  1GFC A;  3EG3 A;  4RTT A;  1I1J A;  1UHC A;  1MUZ A;  2L3P A;  2DE0 X;  1ABQ A;  1T3S A;  2KXD A;  2YUQ A;  2ABL A;  3M0Q A;  1G83 A;  2MOX A;  1ZLM A;  1M30 A;  4A63 B;  3M0U A;  2LMJ A;  1WLP B;  2P4R A;  1UEC A;  1KFZ A;  1NLO C;  5IHN A;  2NUZ A;  2OAW A;  1PRM C;  2EYX A;  2FO0 A;  3GBQ A;  4CC4 B;  4X1V A;  2V1R A;  2C0I A;  2C0T A;  4JZ4 A;  3EG1 A;  1PKT A;  2GTO A;  4RTX A;  1SRL A;  1BB9 A;  2A37 A;  2HEQ A;  5FWB A;  2LJ3 A;  2K3B A;  4HCK A;  1H92 A;  2ED1 A;  1SHG A;  3H41 A;  3SEM A;  4IIO A;  4R0K A;  4ZNX A;  1M8M A;  2RQW A;  2M0Y A;  1Y57 A;  2KNB B;  1CKA A;  2K9G A;  2KYM A;  4OMM A;  3VS7 A;  1X2Q A;  3VRY A;  2HSP A;  4F16 A;  1HSQ A;  1AWW A;  1KJW A;  1SEM A;  2K7A A;  3IQL A;  2GBQ A;  5I22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...