1SRLA

1h and 15n assignments and secondary structure of the src sh3 domain
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
56
structure length
56
Chain Sequence
b'TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRC TYROSINE KINASE SH3 DOMAIN
molecule tags Phosphotransferase
source organism Gallus gallus
publication title 1H and 15N assignments and secondary structure of the Src SH3 domain.
pubmed doi rcsb
total genus 3
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1srlA00
1ZUYA 2O9VA 4D8DA 2MIOA 4F16A 1ZX6A 2CH4W 3SHWA 2J6OA 2BZ8A 1M30A 2W10A 2RN8A 3H0IA 4GLMA 5IXBA 3EG0A 4J9CA 1YNZA 2RQVA 5I22A 3RBBB 1YWPA 2K79A 2FO0A 3UA6A 1PNJA 4Z8AA 3VS2A 1GRIA 1AEYA 2VVKA 2DYBA 2V1QA 2LX7A 3M0SA 4HVVA 1YWOA 4LN2A 2LJ1A 4ESRA 2DM1A 2JS2A 2PTKA 3EHRA 2ABLA 3H0HA 2BZYA 2CSIA 2K6DA 2F2VA 1CKBA 4J9FA 3UA7A 4A63B 3A98A 4ORZA 1U5SA 2AK5A 2JT4A 1B3QA 1M3CA 2ED1A 4HCKA 1ARKA 2OAWA 2A36A 3M0PA 2O2OA 2DILA 1CKAA 2A08A 2J7IA 4CC3A 2DNUA 4WCIA 2CT4A 1NEBA 1UTIA 2DL8A 5GJVB 3TVTA 2EYXA 2LQNA 1UE9A 1QWEA 1YCSB 1KIKA 1FYNA 4J9BA 2ECZA 2EGAA 2ROLA 3H0FA 5EC7A 1H8KA 2HBWA 2K3BA 4HXJA 2B86A 1VYUA 4AG1C 2KYBA 1OV3A 2DRKA 2NUZA 2DVJA 2X3XD 3M0TA 3UF4A 2DL4A 4AFZC 2CH4A 1WXUA 2PZ1A 2QDLA 2KT8A 2E5KA 1QWFA 3ZL7C 1G2BA 2CREA 2FPDA 2JM9A 2DBMA 1JU5C 2MCNA 4CC7A 1AVZC 1TUDA 1UJ0A 4Y92A 1E7OA 2D0NA 2KROA 2RNAA 2J6FA 3PE0A 3NHNA 2GBQA 1T0HA 1W1FA 1JXOA 3QWXX 1WXTA 2H8HA 1AWXA 5I11A 4HVUA 2EKHA 3EG2A 1X69A 2YT6A 2L2PA 2IIMA 1T0JA 1UDLA 2EW3A 1AWOA 4J9EA 5GJWB 1WLPB 1NEGA 2JMAA 4J9GA 1AZEA 2YSQA 2FRWA 1WX6A 3QWYA 1Y0MA 5FW9A 1M8MA 4X1VA 1IO6A 2DJQA 1GCPA 1UFFA 1UHFA 2L0AA 2DE0X 1S1NA 2EBPA 2CSQA 3I5SA 1K76A 2V1RA 2ROTA 2DL5A 2K7AA 1I07A 5FWCA 5IHIA 1RUWA 1NYFA 1PRLC 2KEAA 1SHFA 2EYZA 3EHQA 2EQIA 1WA7A 3SEMA 1GBRA 4JJBA 3TSWA 2CUDA 2JMCA 2YUOA 1FMKA 2KRSA 1BU1A 2HDAA 1SEMA 4EIKA 1N5ZA 4LUEA 4IIOA 1G83A 4DEYA 3EG1A 2W0ZA 2O31A 4HVWA 3VS5A 1X2QA 4RTUA 2DMOA 1UGVA 1I1JA 2NWMA 4RTXA 2JTEA 2K2MA 1PKTA 2KT1A 1SSHA 5IHNA 1PRMC 1TUCA 1PWTA 2YUQA 1T3SA 2RQWA 1X2KA 3PVQA 2EGEA 4OMOA 2YUPA 1JEGA 4OMNA 3PVLA 2BZXA 2DLPA 2AZSA 2AKKA 2DF6A 2D8HA 3EG3A 2G6FX 1AWWA 4J9DA 2DBKA 2FPEA 1J3TA 1X27A 2DA9A 2LJ3A 1K0SA 1SHGA 2FG0A 2AZVA 5HCKA 3VS7A 4LE9A 2RQRA 1ZUUA 1Z9ZA 1NG2A 3R6NA 1PKSA 4F17A 4E6RA 2EGCA 1SRMA 4JZ4A 1H92A 3VRZA 1ZSGA 2ENMA 2L3PA 1E6GA 2RF0A 2KXDA 2LCSA 2OI3A 1GFCA 1UHCA 1W70A 2FPFA 2M51A 4AG2C 1WXBA 3M0QA 4RTWA 2LZ6B 4F14A 1EFNA 1QKXA 5L23A 3U23A 2CT3A 1HJDA 3NMZC 2SRCA 4OMMA 2KE9A 2CUBA 1GBQA 1JQQA 1VA7A 2C0OA 2HEQA 2LNHB 2HSPA 3NPFA 4OMPA 2EPDA 3EGUA 1AOJA 1JXMA 2JXBA 4RTYA 4JZ3A 4CC2A 2KRNA 3I5RA 1KSWA 3GBQA 1OOTA 2J05A 1ZBJA 1ABQA 2C0IA 2LJ0A 2J6KA 1AD5A 1TG0A 4R0KA 2JW4A 2KBTA 2GTJA 2JM8A 3LH5A 3NGPA 3UATA 2DX1A 1BBZA 2ESWA 4RTZA 3M0RA 2VKNA 1UG1A 4Z88A 2RQTA 2F2XA 2BTTA 1WIEA 1U3OA 1ZLMA 2A28A 2K9GA 2YDLA 2KYMA 3VS3A 1K9AA 1VYTA 2EVRA 5IXFA 1X6BA 2CDTA 1H3HA 4IIMA 1K1ZA 3TSZA 1UUEA 3VRYA 1YN8A 2GQIA 1K0XA 4M4ZA 4AFUC 2D1XA 4FSSA 3RNJA 4KRTA 1X43A 4RUGA 4QT7A 2FRYA 1OPLA 2ED0A 2GTOA 2O88A 1Z9QA 1SPKA 1WFWA 4J9HA 1KFZA 1Y57A 4JJCA 1GFDA 1OPKA 4J9IA 3VS0A 4AFQC 2C0TA 3I9QA 1QCFA 1NM7A 2DL3A 2LP5A 1JO8A 1X6GA 2KR3A 3VS4A 2DRMA 2PNIA 1AZGB 1ZUKA 1RI9A 1YP5A 2I0NA 4ZNXA 1U06A 2RQUA 2HCKA 2DL7A 2RMOA 5IHKA 2MOXA 2SEMA 1BB9A 1UECA 2YUNA 1WI7A 1M27C 2D8JA 1VYVA 1MV0B 3KFVA 1KJWA 2KRMA 2L3QA 2AKLA 1PHTA 4DEXA 4RTVA 3THKA 2M0YA 3FJ5A 4D8KA 1QKWA 1T3LA 4CC4B 3H41A 4OMQA 2XMFA 1MV3A 2LQWA 3I35A 2J06A 2VWFA 3VS1A 3REBB 2A37A 1LCKA 2GGRA 3VS6A 1HD3A 1CSKA 1B07A 2O9SA 2L3SA 3REAB 2EYWA 1ABOA 1NYGA 3C0CA 4JJDA 4LNPA 3O5ZA 2KGTA 1RLQC 1RLPC 4Z89A 4AFSC 3M0UA 4GBQA 5FWBA 3IQLA 1WDXA 1M3BA 2X3WD 3ULRB 1QLYA 2OJ2A 5IH2A 1K4US 1MUZA 1WYXA 2P4RA 4OMLA 1A0NB 1E6HA 1M3AA 1XOVA 2FEIA 2F2WA 1SRLA 4LUDA 1HSQA 2KXCA 1NLOC 1OEBA 2LMJA 1NLPC 2KNBB 1AWJA 4JPBW 2RPNA 1GCQA 5ECAA 2GNCA 4RTTA 2JS0A 1GCQC 1V1CA 2EYYA 3JV3A 1I0CA 1BK2A 3CQTA 1UJYA 1GL5A 1W6XA 4K11A
chains in the Genus database with same CATH superfamily
4ZN1A 2DYIA 3CC7T 3ZBDA 5GAMe 4J8OA 3SD4A 5GAOl 2LQ8A 1BYMA 2BZ8A 4M7DE 2RN8A 3H0IA 4GLMA 5IXBA 5GAOq 4JRPA 1WHMA 3LGLA 4LDYA 1PNJA 4FT4A 1AEYA 2V1QA 3JB9F 3R6OA 5GAN3 3MEAA 5CKHA 1MMDA 2JS2A 1W2BS 2X9HA 5CKBA 3L1AA 4QVZA 2CSIA 2FZGB 3DLLA 4X34A 3QO3A 1Q82U 4LXCA 5KYUB 3A98A 1ZBXA 3M58A 3CD6T 2MI6A 1B3QA 2ED1A 4HCKA 5GAN7 1ZA2B 2OAWA 2E1HA 3LWIA 1CKAA 2A08A 2J7IA 4PJOC 1UTIA 1YIJA 3OYNA 1WHGA 3OYLA 2DL8A 1YCSB 4KGZB 3X26B 1KIKA 4M75A 1U1SA 5I2MA 2ROLA 1N27A 3H0FA 5EC7A 3OYBA 5CR2A 4B6MA 2HBWA 4HXJA 1I4K1 1VQOQ 2PVDB 1Q7YC 1VYUA 3OS1A 1OV3A 2VB6A 1M1GA 2QDYB 3JCMf 4C92D 2XDPA 1UGQB 4FYXB 4DOWA 2AHJB 4JLIA 2JVVA 1OU8A 2D0QB 2COZA 5GAOp 4FU6A 2E41A 2Z0WA 3L2UA 1MMNA 2CREA 2DBMA 4PJOD 5C0MA 2QXFA 1UJ0A 3L2QA 2D0NA 4F7UE 4PFOA 1BI1A 1JXOA 2RHXA 4OB2B 1VQ9A 2H8HA 2IVWA 1K73U 1OZ3A 4EMKA 3X25B 3JCMP 1D09B 2IIMA 2QTVA 3OYJA 1UDLA 2HKNA 3T9NA 2QG9B 2YLCA 1WLPB 2P0PA 1NEGA 1G3YA 1AZEA 1QQJA 4FW2A 3QSUA 3H6ZA 4J5YA 2DZCA 4M7AE 1Y0MA 3FJPA 3G71A 1IO6A 5GMKl 4OF1A 4N4GA 3G4ST 4MZTA 2CSQA 3H9NA 3I5SA 5KYNA 3OA6A 1I07A 4BDZA 1W2BA 2F69A 3OYEA 1SHFA 3HFOA 2D6FA 2R5MA 1GBRA 1VUBA 2PUKB 3MEUA 1BI2A 4FT2A 3MEWA 4M78E 1FMKA 2KRSA 3OS0A 1BU1A 4PJOE 1VQKQ 4DEYA 1G83A 3JB9H 3UPUA 1RAHB 1ZHIA 4EMKB 3I56A 1VQ8Q 4XTVA 5HK0A 1HXDA 1X2QA 5DY9A 2DMOA 4C0ZA 1UGVA 1I1JA 2YXYA 4M78G 2K2MA 2RHIA 1PRMC 3I56Q 2YUQA 4A4KA 5CCAA 3JRZA 2DD4A 4OMNA 2DLPA 2CGHA 2AKKA 3OYIA 2QA4T 3JB9I 2KSSA 2DPPB 3EGXB 3MP1A 2KI7A 2WSCE 2JTMA 3OW2P 3JCMc 1J3TA 3SWNC 4M75F 1WJSA 3C94A 3WXMB 5KYYB 3CCUA 3QJYA 3VU3C 3CCQT 4M7DC 2PVGB 2QK0A 1ZUUA 4F17A 4IKFA 1FMVA 4M7AG 4Y28E 3JCMh 3S6WA 1H92A 4OB1B 1V76A 5GAMh 5GANd 2ENMA 4YTLA 2RF0A 1RAEB 4KULA 1FWZA 2LCSA 1G3WA 2OI3A 2FPFA 1BIAA 3CMEA 3M0QA 5D6XA 4RTWA 1JJ2P 3JCMg 2FHDA 1Q82C 2DVEA 3KBGA 3CCJT 1EFNA 1VQNT 3CCLT 5LJ3g 2XK0A 3PTAA 1HJDA 2COWA 2SRCA 1ZSZA 2E3HA 3CBMA 1K8AR 1M1KU 3CC4T 2C0OA 4IUVA 4OMPA 2VYTA 4RTYA 1YCYA 3GF5A 4CC2A 1FX7A 1MNEA 1VQ6T 5LJ3h 1F1BB 1KSWA 1KQSA 1VIFA 5DM7R 1YJWA 2C0IA 3OYAA 2DD5A 2HKQB 2KDSA 2BIVA 2EAYA 3FB9A 4R0KA 3CCLA 4BE2A 3MCAB 1M2VA 3UWNA 2RD1A 3LLRA 1Y71A 4LD6A 4FSXA 4DBRA 1QVFP 2ESWA 4RTZA 2VKNA 4M75B 2RQTA 2F2XA 1WIEA 2G3RA 1U3OA 1ZLMA 2K9GA 2FVUA 2YDLA 1VYTA 3TEEA 2LVMA 3JSCA 1KQ1A 1X6BA 2CDTA 5IN1A 5LJ5d 4JRKA 2XD0A 2BE9B 3TSZA 3CMAQ 2RI2A 3X24B 2ATCB 4B9WA 4KRTA 4RUGA 2NUTA 1VQKA 2ED0A 4RKUE 1D3BA 1Y57A 4C0GA 1VQ5A 3A8MB 1QVPA 4UC4A 2V8KA 2DL3A 1YHQQ 4RCCA 4F7UA 3VS4A 2DRMA 4L59A 1LVKA 2CP2A 1AZGB 4OP0A 3P8BB 1WHHA 2MOXA 5CQXA 3VKIA 2YUNA 4E7KA 1M27C 1VYVA 2EJFA 3CBOA 1ACMB 2M0YA 3FC3A 3FJ5A 4D8KA 2LDMA 1QKWA 3P8HA 4OMQA 1VQMT 1WQWA 6AT1B 1TWBA 1M90U 1MV3A 1X75C 2LQWA 4PJMA 1YITT 4J6YA 3VS1A 2A37A 2GGRA 1HD3A 5IAYA 2O9SA 2V26A 1NYGA 2K2VA 3QIIA 2LTOA 4C8QF 3O5ZA 3I55A 3FDRA 4GY5A 3G71Q 3ULRB 2XICA 2OJ2A 4OMLA 4V2SA 4KT0E 2FEIA 1SRLA 4QQ6A 1IHVA 4JPBW 2RPNA 1NJIR 2GNCA 2JS0A 2DKGA 4QQGA 4LDWA 2EYYA 2EIFA 2KK4A 3JV3A 5C6SA 3CC2Q 4M7DG 3CCSA 1GL5A 3WVDB 1WGSA 3INZA 2DO3A 3EFOA 3I56T 3SHWA 4EPCA 1QP3A 4C92G 2OAUA 1JB0E 2Y4XA 4C5IA 3S3OA 1UGRB 2YWWA 2CKKA 2MF2A 3HRUA 2KAFA 2IG0A 3EG9B 4BI4A 3CCJA 4KUIA 1YNZA 2FZCB 2HL3A 1KD1U 2RQVA 4M75E 3RBBB 5I22A 2K79A 1IREB 5D7UA 3UA6A 3VS2A 1GRIA 2VVKA 3OYKA 3DB4A 4RG8A 2LX7A 3CCST 4IURA 1YWOA 4LN2A 2QQRA 3PMTA 3CXCP 2QQSA 1RAIB 2BZYA 3C4SA 4HA8A 2FB7A 4M7AB 1G8XA 3CEYA 1CKBA 4QQDA 4A63B 4AT1B 1U5SA 1C1AA 2B8AA 5CIUA 3EG9A 2LRQA 4PLLA 4BI3A 5CQYA 5FRNA 2QYZA 2LT4A 2A36A 2DILA 5KYWA 4WCIA 2ZGWA 4PJJA 5KYXB 4ATOA 5GJVB 1Y07A 2MYSA 1FYNA 1SG5A 3UT1A 4JRQA 4M75C 4WTOB 2K57A 4O6JA 1H8KA 1VQ6Q 3CC4A 1B34A 4AG1C 1VIEA 1S72A 1N6AA 2ZPEB 2DVJA 2X3XD 1RAFB 1KD1C 4OGEA 2QDLA 2KT8A 3M54A 4C8QD 1WZOA 2JM9A 4DBQA 1C6VX 3E1SA 1WPYA 3CMEQ 2JJ9A 2DTIA 1I5LA 2J6FA 2OTLA 2GBQA 5GAMf 2OTJA 3RMSA 4C92F 1WXTA 5I11A 3CMAT 2L2PA 2VC8A 3P8DA 1M1FA 1UB4A 2EW3A 1AWOA 4MDXA 3G6ET 4WF2A 3JB9G 1MMAA 2LNVA 4N0AC 2YSQA 4ANJA 2F5TX 2CP6A 1O75A 2M02A 1K9MR 3HRTA 3HSBA 2XDBA 2L0AA 3OYYA 3CCEA 2DE0X 5I21A 1M2VB 1UGPB 4A4HA 1YJ9A 1Q7YR 2ROTA 2V8JA 1QVFS 2K7AA 1C0MA 4MZPA 5FWCA 4GLKA 2MK5A 4JUVA 5FU6C 3J80E 4PJLA 2ZAEA 3M56A 2RK2A 1UGSB 3JCMb 3I55T 2FYKA 4A4FA 3OY9A 1O9SA 2EQIA 4XTZA 1N8RU 2R57A 2JMCA 4OMFB 2HAXA 4PFZA 2HDAA 3GNFB 1SEMA 3C95A 4N4IA 1YJ9T 4LUEA 1VQMQ 2DTHA 1I81A 3JCMJ 5CKEA 1YITQ 1M8VA 4EMKC 4M77D 2W0ZA 2O31A 3H8ZA 1Q81R 2NWMA 4RTXA 3QZ9B 4HKEA 1PKTA 2KT1A 2RJCA 5IHNA 4BY6C 2XIDA 3EH1A 3V8KA 2O4XB 1YHQA 1T3SA 1X2KA 5CVIA 1RADB 2XI9A 5GANf 2K5IA 2AT1B 2VV5A 3PVLA 4FM4B 3A8HB 2AZSA 4ZGDB 5A0LA 2DF6A 4XTWA 3NTKA 2G6FX 1AWWA 2O4XA 4J9DA 4F7UB 2KVQG 1X27A 1SHGA 3TQ7P 1NPPA 4CRIA 1OULA 4J6XA 5HCKA 3VS7A 2E65A 5GANe 5GMKj 4E6RA 3CC2A 1ZSGA 1QCOA 1E6GA 4E7JA 2KXDA 2RO0A 5CAIA 2XDDA 2DXUA 5CK9A 3ER0A 1OI1A 1UHCA 4AG2C 3QPHA 2KMTA 1MMGA 2YRDA 4XTYA 1VQ7Q 2NUPB 1NPRA 1U1TA 5KE2A 1IXDA 2CYZB 3NMZC 2CP7A 2HSPA 3M59A 2EPDA 2JXBA 1GXIE 1YJWT 2KRNA 3A1PA 1OOTA 1BI3A 2FZKB 2J05A 5LJ5f 5GAOn 1ZBJA 4M78A 1NBEB 2LJ0A 2BUDA 2QQAA 2J6KA 2JZ2A 1AD5A 1I8FA 5A2QE 2DERA 2JW4A 2KBTA 1TXQA 2GTJA 4C8QE 3QYGB 3LH5A 3OSSC 1ZQ1A 3V7RA 2DX1A 3CPWP 1YBYA 2DXBA 4Z88A 5FRMA 2MWOA 5EG2A 4II1A 2QEXT 4FCYA 2KYMA 1Q95G 4E7IA 3GP8A 1K9AA 1JBMA 3SB2A 4JLGA 3AHUA 3WVEB 2PU9B 1UUEA 4NS5A 2GQIA 4M4ZA 2MMPA 2R58A 4KUDK 2C06A 1OX9A 4QT7A 3QZ5B 4Q5WA 1OPLA 2DK3A 1SPKA 1WFWA 4J9HA 1JJ2S 1OPKA 3OB9A 1PD1A 2C0TA 1QCFA 1TTHB 1NM7A 5GMKm 5KE3A 5M9OA 4ZTJA 2VGMA 3GLXA 5CO7A 2P4TA 3G4SA 2I0NA 1Q7YU 1U06A 2DL7A 2GF7A 1LPLA 1BB9A 1UECA 5KYYA 2D8JA 1MV0B 3M4GA 2KRMA 4X9DA 2EQUA 4NL2A 1PCXA 2LQKA 4DEXA 4FYWB 5D6WA 3SWNB 3GPLA 1Q81U 4CC4B 3H41A 3MP6A 3I35A 2J06A 2LC4A 4C5HA 1LCKA 5HK3A 3VS6A 3Q1JA 2L3SA 1RAGB 1H3ZA 2EYWA 4C92E 3C0CA 4QVDA 3O8VA 1MHNA 2KGTA 1RLQC 4Z89A 2P0QA 5A0DA 4GBQA 5HKCA 1KHCA 2X3WD 1G3SA 4ME7A 1VQOT 1MUZA 4P5NA 3NFCA 3KUFA 2RH2A 1M3AA 1XOVA 1YJ9Q 1HSQA 1Q81C 2A3LA 2XKOC 3PT9A 4RTTA 1GCQC 2QASA 3C12A 3QJ6A 1BK2A 1R8OB 3RIRA 5KCOA 3J81E 4FL6A 4M77F 1W6XA 4FW1A 1X6OA 2XHCA 1ZUYA 2O9VA 4D8DA 4F16A 4FYYB 2HMAA 2ZPGB 2CH4W 2J6OA 3SDZA 4B9XA 1M90C 2W10A 2RK1A 1VQPT 3EG0A 1K73R 4A53A 2MPXC 3UDCA 4M7AC 2FO0A 3FIFA 5FU7C 1TS9A 2DYBA 2EJGA 4F7UG 4KBMB 2L8DA 3LW5E 3M0SA 5J39A 2COYA 4HVVA 2L5QA 2LJ1A 3RDVA 4ESRA 2DM1A 2WACA 1DJ7B 3H0HA 1I5OB 1LNXA 2PVOB 1W4SA 4MMLA 2X4XA 3HFNA 2K6DA 4J7FA 5GAN6 3OSVA 3QYHB 4J6WA 1KK7A 3UA7A 3G4SQ 3OMGA 4ORZA 3VYHB 1M2OA 1YI2Q 1M3CA 1VQ7T 3M0PA 2O2OA 4CC3A 2DNUA 1NEBA 3SFMA 1X01A 3TVTA 1VQ9T 2EYXA 1QWEA 3OW2S 4J9BA 2IPOB 3MP8A 3L2RA 1KQSS 2K3BA 5FROA 3BE3A 1KHIA 3HTRA 3MHXA 5CKFA 3OW2A 5LL6S 2DAQA 5LJ5j 2HQHA 3M0TA 3ZFJA 1YJNT 2DL4A 4AFZC 3V7SA 3M57A 3JCMQ 3LGFA 2P84A 1QWFA 4C8QA 1G2BA 2GFAA 5GAN8 1PM3A 4AMCA 2HQEA 1JU5C 2MCNA 1XQHA 4CC7A 1AVZC 1RI0A 3G7ZA 1E7OA 2KROA 2RNAA 3NHNA 1T0HA 4PJNA 5GMKh 4BB7A 4IUUA 1HYOA 2YLBA 4HVUA 4DBFA 1W2BP 3EG2A 4LD9K 1IHWA 1X69A 2YT6A 5DLQE 1T0JA 5J26A 1AHJB 5GAMg 2E6NA 1OZ2A 3GIBA 4J9EA 2JMAA 4C0DC 1QW1A 4J9GA 4M7DF 2P0KA 3BDUA 2FRWA 1WX6A 3QWYA 5FW9A 2QGFB 3RKYA 1M8MA 4X1VA 2JUFA 3EFSA 2DJQA 2RHUA 4OGCA 1GCPA 1UFFA 1UHFA 3VYGA 1TU0B 4F7UF 2V1RA 2HL5C 1RL2A 2RA2A 3E2UA 2CS7A 5IHIA 1RUWA 1NYFA 1PRLC 3M9QA 1VQNQ 2KEAA 4NL3A 3ASKA 2K3YA 3EHQA 1KD1R 2GQVA 4JJBA 4ZN3A 3CC4Q 1QVFA 3TSWA 3EGDB 1VQ5T 4M78B 4QKUA 3RERA 3OYFA 4XAXB 1ZA1B 3EGXA 1LJOA 2BE7D 1VOMA 3QKJA 2ZPFB 4EIKA 4X9CA 2CZ1B 3M4YA 3BFMA 1WJQA 1S72T 4HVWA 4M75D 4HT9A 4ZGEB 2ZPBB 4DBHA 3HP9A 1TUCA 4PLIA 4OMOA 4N0AA 3EGDA 3PIPA 1OU9A 3OBWA 4Z02A 1R0CB 2BZXA 1Q86C 2EFIA 1XTDA 3BW1A 4HCBA 4M77B 1K9MC 2FPEA 1EIFA 2XU8A 2RJFA 2QAZA 2DA9A 1Y96B 2DTOA 2DXCA 2LJ3A 5I2SA 1N8RC 2AZVA 3CMAA 4LE9A 4ELZC 1V29B 1NG2A 2HBPA 1UEBA 4PJOB 1D1AA 4JZ4A 8AT1B 1TOVA 3CCMA 3VRZA 1KG1A 2L3PA 2VXFA 2E64A 1K73C 3OMCA 1SSFA 1VQPQ 1YHQT 3CCVQ 1VQ7A 4BE1A 1W70A 2LZ6B 2CP5A 2X4WA 3NTHA 5FU7B 1FXXA 3S3NA 2QGGA 1IRXA 2K5FA 2DIQA 4PJOG 1RABB 3TREA 3U23A 2CT3A 4RG2A 1P92A 4JS4A 2KE9A 2CUBA 1GBQA 1VA7A 5GAN2 2LNHB 3CCMT 3RUXA 4M7DD 3NPFA 3OYHA 3EGUA 1AOJA 1JXMA 1QVGA 1H641 4PK4A 3OYMA 1VQKT 4M75G 2A0FB 1WHLA 2DIGA 1YI2T 1ABQA 4J7IA 2RI5A 3F70A 3CXCS 2K4YA 3ZEHA 3BY7A 1VQ8T 7AT1B 2JM8A 3BDLA 3UATA 1D3BB 4JJNK 2JNGA 5LJ3e 1BBZA 4PFPA 1VQ9Q 4PJOF 3M0RA 4BD3A 1D0XA 4A4EA 3QUIA 3G71T 3MO8A 2KY9A 1VQNA 4XU1A 2EVRA 2CZ6B 1VQ4A 1OX8A 1H3HA 4IIMA 1K1ZA 1YFNA 5GAN4 3VRYA 3MJXA 1OQKA 1YN8A 3META 2E70A 3CC2T 2D1XA 4M78C 4CI0C 4FSSA 1QVGP 3L2ZA 1RAAB 4EMHA 2FRYA 2M1HA 2GTOA 2L3RA 1Z9QA 1KFZA 4DOVA 4JJCA 4EDUA 4C5EA 4MMKA 4AFQC 2M0OA 1VQ4T 5KYUA 1JO8A 1JJ2A 1X6GA 2KR3A 4HCCA 2YHTA 4XQ3A 2PNIA 3HKSA 1PD0A 5FU6B 1RI9A 3CCJQ 1BI0A 3LYIA 2RQUA 2HCKA 3MEVA 3CCLQ 3CCSQ 2PUOB 1U8RA 4OB3B 4OB0B 3HHTB 1WQ7A 3KFVA 1WHKA 5LJ5e 2H3EB 1VQPA 5DLOA 1PHTA 8ATCB 1B34B 2E4HA 3RKXA 1KQ2A 3HRSA 4E7ZA 2OTLT 3OYGA 1T3LA 1MGQA 5GAOr 2E5QA 3TCJA 3L2VA 3V8JA 5LJ5g 1RACB 4XU0A 2VWFA 5CKDA 3MPUB 3CC7A 1CSKA 1B07A 4C92A 1SF9A 3REAB 4KGVB 4JDSA 4IUQA 4VUBA 3RESA 3X20B 5KYWB 3JB9D 1FMWA 4C8QB 4LNPA 4M7DB 1RLPC 2X35A 2JN0A 1G3TA 5LJ5h 4AFSC 4A4GA 1VQ5Q 3CCRQ 3OQ5A 1M3BA 3M5AA 2LCCA 1QLYA 5KCHA 1IGQA 2EQKA 2P4RA 1VQLQ 1E6HA 4C92B 4JS5A 2JOYA 2XG8D 2KXCA 2LMJA 2KNBB 1AWJA 2E6ZA 1S72Q 4LDXA 2MAMA 1I0CA 4E2FB 3X28B 3JCMX 3DLMA 1UJYA 4K11A 1VQMA 2MIOA 2CZ0B 1XNIA 1ZX6A 5LJ3d 2GCXA 1M30A 4OVAA 4M7AA 3JB9J 4J9CA 1TUGB 4A54A 1BIBA 3DB3A 4XTXA 3OYDA 1YWPA 4M77G 4R55A 4Z8AA 3FLGA 2E3IA 5GANg 4QW2A 1KC8R 3D7SB 3PNWC 4LDVA 2PTKA 4BE0A 3EHRA 2ABLA 3E9GA 4M7DA 1PSEA 3E19A 2F2VA 3FRNA 4C0FA 2OTJQ 5GAMd 4J9FA 5GANh 3MKDA 5HY6A 4M77E 3CCVT 3CPFA 3M53A 4XU2A 2AK5A 5KH6A 2JT4A 1ARKA 3V7CA 2CT4A 4FIBA 3JAME 3I55Q 4C0DB 2VGNA 3EH2A 2LQNA 1JRIA 1UE9A 2M16A 3CCMQ 1N9RA 2ECZA 3VUZA 2EGAA 3L2WA 3A5ZB 4DQ2A 3QG1A 3EAEA 2HQXA 2B86A 3CCEQ 1M90R 3EFRA 4DA4A 2KYBA 2DRKA 3QHSA 2PQWA 2NUZA 2LT1A 3TU4K 3QDRB 3UF4A 2E12A 2CH4A 1WXUA 3JCMe 4F04B 1KQSP 2PZ1A 4XK8E 2E5KA 1R77A 1IB8A 3ZL7C 4D6WA 2FPDA 3M55A 1NZ9A 3PGGA 1TUDA 2DZ9A 4E47A 3RR6A 4Y92A 4RMOA 5L8RE 4L5GA 3PE0A 3CCUQ 4PKCC 3LX7A 1W1FA 3DKMA 1YIJQ 5FLXE 3QWXX 1OYXA 1AWXA 2EKHA 1D0YA 4O5VA 1BKBA 3SWNA 2NLUA 2L89A 2QQBA 3L42A 5GJWB 1VQLA 3LH0A 3S3MA 4QVCA 2MWPA 2VUBA 1R0BG 1SKUB 2V8IA 4PL6A 1IGUA 4Y91A 4PNOA 2VASA 2HNIA 1VQ4Q 2X51A 4KH1B 1S1NA 2DEQA 2EBPA 4LDUA 1K76A 2HD0A 1ZSZB 2DL5A 2DFUA 1Y96A 2EYZA 2EQMA 1WA7A 3SEMA 3CXCA 2K3XA 2CUDA 2RB6A 1VQ6A 3HL8A 4BUGA 2YUOA 3VJPA 3KXTA 1YJWQ 2HSEB 2R5AA 3JCMW 4C92C 1QVGS 2OTLQ 4HT8A 1EZZB 2WSEE 1N5ZA 1Q82R 3CCQA 4IIOA 1XJWB 9ATCB 2D9TA 3EG1A 3FEOA 2ZPHB 3GOXA 3VS5A 2YRVA 4RTUA 3CCVA 2NUTB 2FL7A 1K8AC 2RJEA 2JTEA 3EFOB 1SSHA 3CC7Q 1PWTA 2RQWA 3PVQA 2EGEA 4KGXB 4L6V5 4BI8B 3OYCA 3CCRT 4PJOA 2YUPA 2QEXQ 2LX9A 4C8QG 3CMET 1JEGA 4IUPA 3QXEB 2F1LA 2D8HA 3EG3A 4BY6B 1VQLT 4MDWA 2DBKA 1KC8U 4RCBA 2RI3A 5IT9E 1K0SA 3RKWA 2FG0A 3OBYA 2RQRA 2BKDN 1D0ZA 5GMKe 1Z9ZA 4JRIA 5GANj 3R6NA 1PKSA 2EGCA 1SRMA 1Q86U 4M7AD 3G6EQ 2WSFE 2KQWA 2X4JA 1M1KC 3G1JA 1BCMA 5KYXA 1VQOA 3G6EA 1GFCA 2M51A 3CD6Q 2OX7A 1WXBA 1Y7XA 3V8LA 4F14A 2QQ9A 1KC8C 2VXEA 3VUBA 1QKXA 5L23A 2DXTA 4E7LA 2RM4A 4OMMA 4N4HA 1JQQA 1QP2A 3OS5A 2HEQA 3A8OB 4XU3A 1N9SA 4NOYA 1HK9A 1PC0A 1PG5B 2EKOA 4M7AF 2I2LA 5GAOm 4JZ3A 1YI2A 2EWNA 1TSFA 3I5RA 2OTJT 3RMQA 3GBQA 3A8LB 1YITA 5AT1B 2F5KA 1Q86R 2E10A 5A0GA 5GAN5 1EX4A 1NE8A 2DEUA 4MZMA 5D6YA 1M5Q1 1TG0A 1IZ6A 4KH0B 3PIOA 2ZPIB 4FYVB 3QDFA 3PFSA 2DETA 1N8RR 3NGPA 4M77C 2CZ7B 1AT1B 4ZTFA 1WNLA 1UG1A 3LWHA 2BTTA 2QI2A 4E7HA 1NJIU 2AIRB 2A28A 2O01E 3J7AF 3VS3A 4EMGA 2M9UA 3CCET 4J83A 3AT1B 4C8QC 5IXFA 2ZCFB 2LCLA 2A7YA 3N5BB 1WHJA 2ZZDA 3JCMd 1K0XA 3GNGA 4BDYA 4AFUC 4M78F 3RNJA 4IUTA 1M9SA 1X43A 5J3BA 2O88A 1VQ8A 1QMCA 2NUPA 1GFDA 4J9IA 1PSFA 3VS0A 3I9QA 1M4ZA 1ZSZC 3E9FA 1WJRA 2RJDA 2LP5A 3CCUT 4ZGJB 1LOJA 1YIJT 1NJIC 2EQJA 3QBYA 2GFUA 2H3JA 2JTFA 1QCNA 3CCRA 1ZUKA 1K9MU 1YP5A 5GAMj 2CP0A 4ZNXA 4TVRA 2NYSA 2QEXA 3NTIA 2RMOA 5IHKA 4ELYC 1B7TA 2SEMA 1WI7A 4E7SA 1KJWA 3PMIA 2Y90A 2L3QA 2AKLA 2DJZA 1D1BA 4RTVA 5AYFA 1TH7A 3THKA 2Y4YA 2EJ9A 1MNDA 4HCZA 3ME9A 2HZYA 2RHYA 2XMFA 2YRCA 3CPWS 2X4YA 1D1CA 3REBB 3CBPA 4BACA 4M78D 5LJ3j 4XTUA 1ABOA 3CPWA 4JJDA 3JCMV 2QA4A 2CP3A 2RHZA 3URGA 3CD6A 4C5GA 1G5VA 4M77A 3M0UA 5FWBA 3IQLA 1WDXA 2EYQA 2K5LA 5LJ3f 1K8AU 1M1KR 2QA4Q 5IH2A 1YJNA 3OS2A 1K4US 1WYXA 1A0NB 2F2WA 4LUDA 1NLOC 1OEBA 1NLPC 5GMKi 5ECAA 1GCQA 3VV0A 1YJNQ 1V1CA 3CCQQ 3HPWA 1BCOA 3A8GB 4R56A 3CQTA 2QTXA
chains in the Genus database with same CATH topology
1ZUYA 2O9VA 4D8DA 2MIOA 4F16A 1ZX6A 2CH4W 3SHWA 2J6OA 2BZ8A 1M30A 2W10A 2RN8A 3H0IA 4GLMA 5IXBA 3EG0A 4J9CA 1YNZA 2RQVA 5I22A 3RBBB 1YWPA 2K79A 2FO0A 3UA6A 1PNJA 4Z8AA 3VS2A 1GRIA 1AEYA 2VVKA 2DYBA 2V1QA 2LX7A 3M0SA 4HVVA 1YWOA 4LN2A 2LJ1A 4ESRA 2DM1A 2JS2A 2PTKA 3EHRA 2ABLA 3H0HA 2BZYA 2CSIA 2K6DA 2F2VA 1CKBA 4J9FA 3UA7A 4A63B 3A98A 4ORZA 1U5SA 2AK5A 2JT4A 1B3QA 1M3CA 2ED1A 4HCKA 1ARKA 2OAWA 2A36A 3M0PA 2O2OA 2DILA 1CKAA 2A08A 2J7IA 4CC3A 2DNUA 4WCIA 2CT4A 1NEBA 1UTIA 2DL8A 5GJVB 3TVTA 2EYXA 2LQNA 1UE9A 1QWEA 1YCSB 1KIKA 1FYNA 4J9BA 2ECZA 2EGAA 2ROLA 3H0FA 5EC7A 1H8KA 2HBWA 2K3BA 4HXJA 2B86A 1VYUA 4AG1C 2KYBA 1OV3A 2DRKA 2NUZA 2DVJA 2X3XD 3M0TA 3UF4A 2DL4A 4AFZC 2CH4A 1WXUA 2PZ1A 2QDLA 2KT8A 2E5KA 1QWFA 3ZL7C 1G2BA 2CREA 2FPDA 2JM9A 2DBMA 1JU5C 2MCNA 4CC7A 1AVZC 1TUDA 1UJ0A 4Y92A 1E7OA 2D0NA 2KROA 2RNAA 2J6FA 3PE0A 3NHNA 2GBQA 1T0HA 1W1FA 1JXOA 3QWXX 1WXTA 2H8HA 1AWXA 5I11A 4HVUA 2EKHA 3EG2A 1X69A 2YT6A 2L2PA 2IIMA 1T0JA 1UDLA 2EW3A 1AWOA 4J9EA 5GJWB 1WLPB 1NEGA 2JMAA 4J9GA 1AZEA 2YSQA 2FRWA 1WX6A 3QWYA 1Y0MA 5FW9A 1M8MA 4X1VA 1IO6A 2DJQA 1GCPA 1UFFA 1UHFA 2L0AA 2DE0X 1S1NA 2EBPA 2CSQA 3I5SA 1K76A 2V1RA 2ROTA 2DL5A 2K7AA 1I07A 5FWCA 5IHIA 1RUWA 1NYFA 1PRLC 2KEAA 1SHFA 2EYZA 3EHQA 2EQIA 1WA7A 3SEMA 1GBRA 4JJBA 3TSWA 2CUDA 2JMCA 2YUOA 1FMKA 2KRSA 1BU1A 2HDAA 1SEMA 4EIKA 1N5ZA 4LUEA 4IIOA 1G83A 4DEYA 3EG1A 2W0ZA 2O31A 4HVWA 3VS5A 1X2QA 4RTUA 2DMOA 1UGVA 1I1JA 2NWMA 4RTXA 2JTEA 2K2MA 1PKTA 2KT1A 1SSHA 5IHNA 1PRMC 1TUCA 1PWTA 2YUQA 1T3SA 2RQWA 1X2KA 3PVQA 2EGEA 4OMOA 2YUPA 1JEGA 4OMNA 3PVLA 2BZXA 2DLPA 2AZSA 2AKKA 2DF6A 2D8HA 3EG3A 2G6FX 1AWWA 4J9DA 2DBKA 2FPEA 1J3TA 1X27A 2DA9A 2LJ3A 1K0SA 1SHGA 2FG0A 2AZVA 5HCKA 3VS7A 4LE9A 2RQRA 1ZUUA 1Z9ZA 1NG2A 3R6NA 1PKSA 4F17A 4E6RA 2EGCA 1SRMA 4JZ4A 1H92A 3VRZA 1ZSGA 2ENMA 2L3PA 1E6GA 2RF0A 2KXDA 2LCSA 2OI3A 1GFCA 1UHCA 1W70A 2FPFA 2M51A 4AG2C 1WXBA 3M0QA 4RTWA 2LZ6B 4F14A 1EFNA 1QKXA 5L23A 3U23A 2CT3A 1HJDA 3NMZC 2SRCA 4OMMA 2KE9A 2CUBA 1GBQA 1JQQA 1VA7A 2C0OA 2HEQA 2LNHB 2HSPA 3NPFA 4OMPA 2EPDA 3EGUA 1AOJA 1JXMA 2JXBA 4RTYA 4JZ3A 4CC2A 2KRNA 3I5RA 1KSWA 3GBQA 1OOTA 2J05A 1ZBJA 1ABQA 2C0IA 2LJ0A 2J6KA 1AD5A 1TG0A 4R0KA 2JW4A 2KBTA 2GTJA 2JM8A 3LH5A 3NGPA 3UATA 2DX1A 1BBZA 2ESWA 4RTZA 3M0RA 2VKNA 1UG1A 4Z88A 2RQTA 2F2XA 2BTTA 1WIEA 1U3OA 1ZLMA 2A28A 2K9GA 2YDLA 2KYMA 3VS3A 1K9AA 1VYTA 2EVRA 5IXFA 1X6BA 2CDTA 1H3HA 4IIMA 1K1ZA 3TSZA 1UUEA 3VRYA 1YN8A 2GQIA 1K0XA 4M4ZA 4AFUC 2D1XA 4FSSA 3RNJA 4KRTA 1X43A 4RUGA 4QT7A 2FRYA 1OPLA 2ED0A 2GTOA 2O88A 1Z9QA 1SPKA 1WFWA 4J9HA 1KFZA 1Y57A 4JJCA 1GFDA 1OPKA 4J9IA 3VS0A 4AFQC 2C0TA 3I9QA 1QCFA 1NM7A 2DL3A 2LP5A 1JO8A 1X6GA 2KR3A 3VS4A 2DRMA 2PNIA 1AZGB 1ZUKA 1RI9A 1YP5A 2I0NA 4ZNXA 1U06A 2RQUA 2HCKA 2DL7A 2RMOA 5IHKA 2MOXA 2SEMA 1BB9A 1UECA 2YUNA 1WI7A 1M27C 2D8JA 1VYVA 1MV0B 3KFVA 1KJWA 2KRMA 2L3QA 2AKLA 1PHTA 4DEXA 4RTVA 3THKA 2M0YA 3FJ5A 4D8KA 1QKWA 1T3LA 4CC4B 3H41A 4OMQA 2XMFA 1MV3A 2LQWA 3I35A 2J06A 2VWFA 3VS1A 3REBB 2A37A 1LCKA 2GGRA 3VS6A 1HD3A 1CSKA 1B07A 2O9SA 2L3SA 3REAB 2EYWA 1ABOA 1NYGA 3C0CA 4JJDA 4LNPA 3O5ZA 2KGTA 1RLQC 1RLPC 4Z89A 4AFSC 3M0UA 4GBQA 5FWBA 3IQLA 1WDXA 1M3BA 2X3WD 3ULRB 1QLYA 2OJ2A 5IH2A 1K4US 1MUZA 1WYXA 2P4RA 4OMLA 1A0NB 1E6HA 1M3AA 1XOVA 2FEIA 2F2WA 1SRLA 4LUDA 1HSQA 2KXCA 1NLOC 1OEBA 2LMJA 1NLPC 2KNBB 1AWJA 4JPBW 2RPNA 1GCQA 5ECAA 2GNCA 4RTTA 2JS0A 1GCQC 1V1CA 2EYYA 3JV3A 1I0CA 1BK2A 3CQTA 1UJYA 1GL5A 1W6XA 4K11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZUY A;  2O9V A;  4D8D A;  2MIO A;  4F16 A;  1ZX6 A;  2CH4 W;  3SHW A;  2J6O A;  2BZ8 A;  1M30 A;  2W10 A;  2RN8 A;  3H0I A;  4GLM A;  5IXB A;  3EG0 A;  4J9C A;  1YNZ A;  2RQV A;  5I22 A;  3RBB B;  1YWP A;  2K79 A;  2FO0 A;  3UA6 A;  1PNJ A;  4Z8A A;  3VS2 A;  1GRI A;  1AEY A;  2VVK A;  2DYB A;  2V1Q A;  2LX7 A;  3M0S A;  4HVV A;  1YWO A;  4LN2 A;  2LJ1 A;  4ESR A;  2DM1 A;  2JS2 A;  2PTK A;  3EHR A;  2ABL A;  3H0H A;  2BZY A;  2CSI A;  2K6D A;  2F2V A;  1CKB A;  4J9F A;  3UA7 A;  4A63 B;  3A98 A;  4ORZ A;  1U5S A;  2AK5 A;  2JT4 A;  1B3Q A;  1M3C A;  2ED1 A;  4HCK A;  1ARK A;  2OAW A;  2A36 A;  3M0P A;  2O2O A;  2DIL A;  1CKA A;  2A08 A;  2J7I A;  4CC3 A;  2DNU A;  4WCI A;  2CT4 A;  1NEB A;  1UTI A;  2DL8 A;  5GJV B;  3TVT A;  2EYX A;  2LQN A;  1UE9 A;  1QWE A;  1YCS B;  1KIK A;  1FYN A;  4J9B A;  2ECZ A;  2EGA A;  2ROL A;  3H0F A;  5EC7 A;  1H8K A;  2HBW A;  2K3B A;  4HXJ A;  2B86 A;  1VYU A;  4AG1 C;  2KYB A;  1OV3 A;  2DRK A;  2NUZ A;  2DVJ A;  2X3X D;  3M0T A;  3UF4 A;  2DL4 A;  4AFZ C;  2CH4 A;  1WXU A;  2PZ1 A;  2QDL A;  2KT8 A;  2E5K A;  1QWF A;  3ZL7 C;  1G2B A;  2CRE A;  2FPD A;  2JM9 A;  2DBM A;  1JU5 C;  2MCN A;  4CC7 A;  1AVZ C;  1TUD A;  1UJ0 A;  4Y92 A;  1E7O A;  2D0N A;  2KRO A;  2RNA A;  2J6F A;  3PE0 A;  3NHN A;  2GBQ A;  1T0H A;  1W1F A;  1JXO A;  3QWX X;  1WXT A;  2H8H A;  1AWX A;  5I11 A;  4HVU A;  2EKH A;  3EG2 A;  1X69 A;  2YT6 A;  2L2P A;  2IIM A;  1T0J A;  1UDL A;  2EW3 A;  1AWO A;  4J9E A;  5GJW B;  1WLP B;  1NEG A;  2JMA A;  4J9G A;  1AZE A;  2YSQ A;  2FRW A;  1WX6 A;  3QWY A;  1Y0M A;  5FW9 A;  1M8M A;  4X1V A;  1IO6 A;  2DJQ A;  1GCP A;  1UFF A;  1UHF A;  2L0A A;  2DE0 X;  1S1N A;  2EBP A;  2CSQ A;  3I5S A;  1K76 A;  2V1R A;  2ROT A;  2DL5 A;  2K7A A;  1I07 A;  5FWC A;  5IHI A;  1RUW A;  1NYF A;  1PRL C;  2KEA A;  1SHF A;  2EYZ A;  3EHQ A;  2EQI A;  1WA7 A;  3SEM A;  1GBR A;  4JJB A;  3TSW A;  2CUD A;  2JMC A;  2YUO A;  1FMK A;  2KRS A;  1BU1 A;  2HDA A;  1SEM A;  4EIK A;  1N5Z A;  4LUE A;  4IIO A;  1G83 A;  4DEY A;  3EG1 A;  2W0Z A;  2O31 A;  4HVW A;  3VS5 A;  1X2Q A;  4RTU A;  2DMO A;  1UGV A;  1I1J A;  2NWM A;  4RTX A;  2JTE A;  2K2M A;  1PKT A;  2KT1 A;  1SSH A;  5IHN A;  1PRM C;  1TUC A;  1PWT A;  2YUQ A;  1T3S A;  2RQW A;  1X2K A;  3PVQ A;  2EGE A;  4OMO A;  2YUP A;  1JEG A;  4OMN A;  3PVL A;  2BZX A;  2DLP A;  2AZS A;  2AKK A;  2DF6 A;  2D8H A;  3EG3 A;  2G6F X;  1AWW A;  4J9D A;  2DBK A;  2FPE A;  1J3T A;  1X27 A;  2DA9 A;  2LJ3 A;  1K0S A;  1SHG A;  2FG0 A;  2AZV A;  5HCK A;  3VS7 A;  4LE9 A;  2RQR A;  1ZUU A;  1Z9Z A;  1NG2 A;  3R6N A;  1PKS A;  4F17 A;  4E6R A;  2EGC A;  1SRM A;  4JZ4 A;  1H92 A;  3VRZ A;  1ZSG A;  2ENM A;  2L3P A;  1E6G A;  2RF0 A;  2KXD A;  2LCS A;  2OI3 A;  1GFC A;  1UHC A;  1W70 A;  2FPF A;  2M51 A;  4AG2 C;  1WXB A;  3M0Q A;  4RTW A;  2LZ6 B;  4F14 A;  1EFN A;  1QKX A;  5L23 A;  3U23 A;  2CT3 A;  1HJD A;  3NMZ C;  2SRC A;  4OMM A;  2KE9 A;  2CUB A;  1GBQ A;  1JQQ A;  1VA7 A;  2C0O A;  2HEQ A;  2LNH B;  2HSP A;  3NPF A;  4OMP A;  2EPD A;  3EGU A;  1AOJ A;  1JXM A;  2JXB A;  4RTY A;  4JZ3 A;  4CC2 A;  2KRN A;  3I5R A;  1KSW A;  3GBQ A;  1OOT A;  2J05 A;  1ZBJ A;  1ABQ A;  2C0I A;  2LJ0 A;  2J6K A;  1AD5 A;  1TG0 A;  4R0K A;  2JW4 A;  2KBT A;  2GTJ A;  2JM8 A;  3LH5 A;  3NGP A;  3UAT A;  2DX1 A;  1BBZ A;  2ESW A;  4RTZ A;  3M0R A;  2VKN A;  1UG1 A;  4Z88 A;  2RQT A;  2F2X A;  2BTT A;  1WIE A;  1U3O A;  1ZLM A;  2A28 A;  2K9G A;  2YDL A;  2KYM A;  3VS3 A;  1K9A A;  1VYT A;  2EVR A;  5IXF A;  1X6B A;  2CDT A;  1H3H A;  4IIM A;  1K1Z A;  3TSZ A;  1UUE A;  3VRY A;  1YN8 A;  2GQI A;  1K0X A;  4M4Z A;  4AFU C;  2D1X A;  4FSS A;  3RNJ A;  4KRT A;  1X43 A;  4RUG A;  4QT7 A;  2FRY A;  1OPL A;  2ED0 A;  2GTO A;  2O88 A;  1Z9Q A;  1SPK A;  1WFW A;  4J9H A;  1KFZ A;  1Y57 A;  4JJC A;  1GFD A;  1OPK A;  4J9I A;  3VS0 A;  4AFQ C;  2C0T A;  3I9Q A;  1QCF A;  1NM7 A;  2DL3 A;  2LP5 A;  1JO8 A;  1X6G A;  2KR3 A;  3VS4 A;  2DRM A;  2PNI A;  1AZG B;  1ZUK A;  1RI9 A;  1YP5 A;  2I0N A;  4ZNX A;  1U06 A;  2RQU A;  2HCK A;  2DL7 A;  2RMO A;  5IHK A;  2MOX A;  2SEM A;  1BB9 A;  1UEC A;  2YUN A;  1WI7 A;  1M27 C;  2D8J A;  1VYV A;  1MV0 B;  3KFV A;  1KJW A;  2KRM A;  2L3Q A;  2AKL A;  1PHT A;  4DEX A;  4RTV A;  3THK A;  2M0Y A;  3FJ5 A;  4D8K A;  1QKW A;  1T3L A;  4CC4 B;  3H41 A;  4OMQ A;  2XMF A;  1MV3 A;  2LQW A;  3I35 A;  2J06 A;  2VWF A;  3VS1 A;  3REB B;  2A37 A;  1LCK A;  2GGR A;  3VS6 A;  1HD3 A;  1CSK A;  1B07 A;  2O9S A;  2L3S A;  3REA B;  2EYW A;  1ABO A;  1NYG A;  3C0C A;  4JJD A;  4LNP A;  3O5Z A;  2KGT A;  1RLQ C;  1RLP C;  4Z89 A;  4AFS C;  3M0U A;  4GBQ A;  5FWB A;  3IQL A;  1WDX A;  1M3B A;  2X3W D;  3ULR B;  1QLY A;  2OJ2 A;  5IH2 A;  1K4U S;  1MUZ A;  1WYX A;  2P4R A;  4OML A;  1A0N B;  1E6H A;  1M3A A;  1XOV A;  2FEI A;  2F2W A;  1SRL A;  4LUD A;  1HSQ A;  2KXC A;  1NLO C;  1OEB A;  2LMJ A;  1NLP C;  2KNB B;  1AWJ A;  4JPB W;  2RPN A;  1GCQ A;  5ECA A;  2GNC A;  4RTT A;  2JS0 A;  1GCQ C;  1V1C A;  2EYY A;  3JV3 A;  1I0C A;  1BK2 A;  3CQT A;  1UJY A;  1GL5 A;  1W6X A;  4K11 A; 
#chains in the Genus database with same CATH topology
 4ZN1 A;  2DYI A;  3CC7 T;  3ZBD A;  5GAM e;  4J8O A;  3SD4 A;  5GAO l;  2LQ8 A;  1BYM A;  2BZ8 A;  4M7D E;  2RN8 A;  3H0I A;  4GLM A;  5IXB A;  5GAO q;  4JRP A;  1WHM A;  3LGL A;  4LDY A;  1PNJ A;  4FT4 A;  1AEY A;  2V1Q A;  3JB9 F;  3R6O A;  5GAN 3;  3MEA A;  5CKH A;  1MMD A;  2JS2 A;  1W2B S;  2X9H A;  5CKB A;  3L1A A;  4QVZ A;  2CSI A;  2FZG B;  3DLL A;  4X34 A;  3QO3 A;  1Q82 U;  4LXC A;  5KYU B;  3A98 A;  1ZBX A;  3M58 A;  3CD6 T;  2MI6 A;  1B3Q A;  2ED1 A;  4HCK A;  5GAN 7;  1ZA2 B;  2OAW A;  2E1H A;  3LWI A;  1CKA A;  2A08 A;  2J7I A;  4PJO C;  1UTI A;  1YIJ A;  3OYN A;  1WHG A;  3OYL A;  2DL8 A;  1YCS B;  4KGZ B;  3X26 B;  1KIK A;  4M75 A;  1U1S A;  5I2M A;  2ROL A;  1N27 A;  3H0F A;  5EC7 A;  3OYB A;  5CR2 A;  4B6M A;  2HBW A;  4HXJ A;  1I4K 1;  1VQO Q;  2PVD B;  1Q7Y C;  1VYU A;  3OS1 A;  1OV3 A;  2VB6 A;  1M1G A;  2QDY B;  3JCM f;  4C92 D;  2XDP A;  1UGQ B;  4FYX B;  4DOW A;  2AHJ B;  4JLI A;  2JVV A;  1OU8 A;  2D0Q B;  2COZ A;  5GAO p;  4FU6 A;  2E41 A;  2Z0W A;  3L2U A;  1MMN A;  2CRE A;  2DBM A;  4PJO D;  5C0M A;  2QXF A;  1UJ0 A;  3L2Q A;  2D0N A;  4F7U E;  4PFO A;  1BI1 A;  1JXO A;  2RHX A;  4OB2 B;  1VQ9 A;  2H8H A;  2IVW A;  1K73 U;  1OZ3 A;  4EMK A;  3X25 B;  3JCM P;  1D09 B;  2IIM A;  2QTV A;  3OYJ A;  1UDL A;  2HKN A;  3T9N A;  2QG9 B;  2YLC A;  1WLP B;  2P0P A;  1NEG A;  1G3Y A;  1AZE A;  1QQJ A;  4FW2 A;  3QSU A;  3H6Z A;  4J5Y A;  2DZC A;  4M7A E;  1Y0M A;  3FJP A;  3G71 A;  1IO6 A;  5GMK l;  4OF1 A;  4N4G A;  3G4S T;  4MZT A;  2CSQ A;  3H9N A;  3I5S A;  5KYN A;  3OA6 A;  1I07 A;  4BDZ A;  1W2B A;  2F69 A;  3OYE A;  1SHF A;  3HFO A;  2D6F A;  2R5M A;  1GBR A;  1VUB A;  2PUK B;  3MEU A;  1BI2 A;  4FT2 A;  3MEW A;  4M78 E;  1FMK A;  2KRS A;  3OS0 A;  1BU1 A;  4PJO E;  1VQK Q;  4DEY A;  1G83 A;  3JB9 H;  3UPU A;  1RAH B;  1ZHI A;  4EMK B;  3I56 A;  1VQ8 Q;  4XTV A;  5HK0 A;  1HXD A;  1X2Q A;  5DY9 A;  2DMO A;  4C0Z A;  1UGV A;  1I1J A;  2YXY A;  4M78 G;  2K2M A;  2RHI A;  1PRM C;  3I56 Q;  2YUQ A;  4A4K A;  5CCA A;  3JRZ A;  2DD4 A;  4OMN A;  2DLP A;  2CGH A;  2AKK A;  3OYI A;  2QA4 T;  3JB9 I;  2KSS A;  2DPP B;  3EGX B;  3MP1 A;  2KI7 A;  2WSC E;  2JTM A;  3OW2 P;  3JCM c;  1J3T A;  3SWN C;  4M75 F;  1WJS A;  3C94 A;  3WXM B;  5KYY B;  3CCU A;  3QJY A;  3VU3 C;  3CCQ T;  4M7D C;  2PVG B;  2QK0 A;  1ZUU A;  4F17 A;  4IKF A;  1FMV A;  4M7A G;  4Y28 E;  3JCM h;  3S6W A;  1H92 A;  4OB1 B;  1V76 A;  5GAM h;  5GAN d;  2ENM A;  4YTL A;  2RF0 A;  1RAE B;  4KUL A;  1FWZ A;  2LCS A;  1G3W A;  2OI3 A;  2FPF A;  1BIA A;  3CME A;  3M0Q A;  5D6X A;  4RTW A;  1JJ2 P;  3JCM g;  2FHD A;  1Q82 C;  2DVE A;  3KBG A;  3CCJ T;  1EFN A;  1VQN T;  3CCL T;  5LJ3 g;  2XK0 A;  3PTA A;  1HJD A;  2COW A;  2SRC A;  1ZSZ A;  2E3H A;  3CBM A;  1K8A R;  1M1K U;  3CC4 T;  2C0O A;  4IUV A;  4OMP A;  2VYT A;  4RTY A;  1YCY A;  3GF5 A;  4CC2 A;  1FX7 A;  1MNE A;  1VQ6 T;  5LJ3 h;  1F1B B;  1KSW A;  1KQS A;  1VIF A;  5DM7 R;  1YJW A;  2C0I A;  3OYA A;  2DD5 A;  2HKQ B;  2KDS A;  2BIV A;  2EAY A;  3FB9 A;  4R0K A;  3CCL A;  4BE2 A;  3MCA B;  1M2V A;  3UWN A;  2RD1 A;  3LLR A;  1Y71 A;  4LD6 A;  4FSX A;  4DBR A;  1QVF P;  2ESW A;  4RTZ A;  2VKN A;  4M75 B;  2RQT A;  2F2X A;  1WIE A;  2G3R A;  1U3O A;  1ZLM A;  2K9G A;  2FVU A;  2YDL A;  1VYT A;  3TEE A;  2LVM A;  3JSC A;  1KQ1 A;  1X6B A;  2CDT A;  5IN1 A;  5LJ5 d;  4JRK A;  2XD0 A;  2BE9 B;  3TSZ A;  3CMA Q;  2RI2 A;  3X24 B;  2ATC B;  4B9W A;  4KRT A;  4RUG A;  2NUT A;  1VQK A;  2ED0 A;  4RKU E;  1D3B A;  1Y57 A;  4C0G A;  1VQ5 A;  3A8M B;  1QVP A;  4UC4 A;  2V8K A;  2DL3 A;  1YHQ Q;  4RCC A;  4F7U A;  3VS4 A;  2DRM A;  4L59 A;  1LVK A;  2CP2 A;  1AZG B;  4OP0 A;  3P8B B;  1WHH A;  2MOX A;  5CQX A;  3VKI A;  2YUN A;  4E7K A;  1M27 C;  1VYV A;  2EJF A;  3CBO A;  1ACM B;  2M0Y A;  3FC3 A;  3FJ5 A;  4D8K A;  2LDM A;  1QKW A;  3P8H A;  4OMQ A;  1VQM T;  1WQW A;  6AT1 B;  1TWB A;  1M90 U;  1MV3 A;  1X75 C;  2LQW A;  4PJM A;  1YIT T;  4J6Y A;  3VS1 A;  2A37 A;  2GGR A;  1HD3 A;  5IAY A;  2O9S A;  2V26 A;  1NYG A;  2K2V A;  3QII A;  2LTO A;  4C8Q F;  3O5Z A;  3I55 A;  3FDR A;  4GY5 A;  3G71 Q;  3ULR B;  2XIC A;  2OJ2 A;  4OML A;  4V2S A;  4KT0 E;  2FEI A;  1SRL A;  4QQ6 A;  1IHV A;  4JPB W;  2RPN A;  1NJI R;  2GNC A;  2JS0 A;  2DKG A;  4QQG A;  4LDW A;  2EYY A;  2EIF A;  2KK4 A;  3JV3 A;  5C6S A;  3CC2 Q;  4M7D G;  3CCS A;  1GL5 A;  3WVD B;  1WGS A;  3INZ A;  2DO3 A;  3EFO A;  3I56 T;  3SHW A;  4EPC A;  1QP3 A;  4C92 G;  2OAU A;  1JB0 E;  2Y4X A;  4C5I A;  3S3O A;  1UGR B;  2YWW A;  2CKK A;  2MF2 A;  3HRU A;  2KAF A;  2IG0 A;  3EG9 B;  4BI4 A;  3CCJ A;  4KUI A;  1YNZ A;  2FZC B;  2HL3 A;  1KD1 U;  2RQV A;  4M75 E;  3RBB B;  5I22 A;  2K79 A;  1IRE B;  5D7U A;  3UA6 A;  3VS2 A;  1GRI A;  2VVK A;  3OYK A;  3DB4 A;  4RG8 A;  2LX7 A;  3CCS T;  4IUR A;  1YWO A;  4LN2 A;  2QQR A;  3PMT A;  3CXC P;  2QQS A;  1RAI B;  2BZY A;  3C4S A;  4HA8 A;  2FB7 A;  4M7A B;  1G8X A;  3CEY A;  1CKB A;  4QQD A;  4A63 B;  4AT1 B;  1U5S A;  1C1A A;  2B8A A;  5CIU A;  3EG9 A;  2LRQ A;  4PLL A;  4BI3 A;  5CQY A;  5FRN A;  2QYZ A;  2LT4 A;  2A36 A;  2DIL A;  5KYW A;  4WCI A;  2ZGW A;  4PJJ A;  5KYX B;  4ATO A;  5GJV B;  1Y07 A;  2MYS A;  1FYN A;  1SG5 A;  3UT1 A;  4JRQ A;  4M75 C;  4WTO B;  2K57 A;  4O6J A;  1H8K A;  1VQ6 Q;  3CC4 A;  1B34 A;  4AG1 C;  1VIE A;  1S72 A;  1N6A A;  2ZPE B;  2DVJ A;  2X3X D;  1RAF B;  1KD1 C;  4OGE A;  2QDL A;  2KT8 A;  3M54 A;  4C8Q D;  1WZO A;  2JM9 A;  4DBQ A;  1C6V X;  3E1S A;  1WPY A;  3CME Q;  2JJ9 A;  2DTI A;  1I5L A;  2J6F A;  2OTL A;  2GBQ A;  5GAM f;  2OTJ A;  3RMS A;  4C92 F;  1WXT A;  5I11 A;  3CMA T;  2L2P A;  2VC8 A;  3P8D A;  1M1F A;  1UB4 A;  2EW3 A;  1AWO A;  4MDX A;  3G6E T;  4WF2 A;  3JB9 G;  1MMA A;  2LNV A;  4N0A C;  2YSQ A;  4ANJ A;  2F5T X;  2CP6 A;  1O75 A;  2M02 A;  1K9M R;  3HRT A;  3HSB A;  2XDB A;  2L0A A;  3OYY A;  3CCE A;  2DE0 X;  5I21 A;  1M2V B;  1UGP B;  4A4H A;  1YJ9 A;  1Q7Y R;  2ROT A;  2V8J A;  1QVF S;  2K7A A;  1C0M A;  4MZP A;  5FWC A;  4GLK A;  2MK5 A;  4JUV A;  5FU6 C;  3J80 E;  4PJL A;  2ZAE A;  3M56 A;  2RK2 A;  1UGS B;  3JCM b;  3I55 T;  2FYK A;  4A4F A;  3OY9 A;  1O9S A;  2EQI A;  4XTZ A;  1N8R U;  2R57 A;  2JMC A;  4OMF B;  2HAX A;  4PFZ A;  2HDA A;  3GNF B;  1SEM A;  3C95 A;  4N4I A;  1YJ9 T;  4LUE A;  1VQM Q;  2DTH A;  1I81 A;  3JCM J;  5CKE A;  1YIT Q;  1M8V A;  4EMK C;  4M77 D;  2W0Z A;  2O31 A;  3H8Z A;  1Q81 R;  2NWM A;  4RTX A;  3QZ9 B;  4HKE A;  1PKT A;  2KT1 A;  2RJC A;  5IHN A;  4BY6 C;  2XID A;  3EH1 A;  3V8K A;  2O4X B;  1YHQ A;  1T3S A;  1X2K A;  5CVI A;  1RAD B;  2XI9 A;  5GAN f;  2K5I A;  2AT1 B;  2VV5 A;  3PVL A;  4FM4 B;  3A8H B;  2AZS A;  4ZGD B;  5A0L A;  2DF6 A;  4XTW A;  3NTK A;  2G6F X;  1AWW A;  2O4X A;  4J9D A;  4F7U B;  2KVQ G;  1X27 A;  1SHG A;  3TQ7 P;  1NPP A;  4CRI A;  1OUL A;  4J6X A;  5HCK A;  3VS7 A;  2E65 A;  5GAN e;  5GMK j;  4E6R A;  3CC2 A;  1ZSG A;  1QCO A;  1E6G A;  4E7J A;  2KXD A;  2RO0 A;  5CAI A;  2XDD A;  2DXU A;  5CK9 A;  3ER0 A;  1OI1 A;  1UHC A;  4AG2 C;  3QPH A;  2KMT A;  1MMG A;  2YRD A;  4XTY A;  1VQ7 Q;  2NUP B;  1NPR A;  1U1T A;  5KE2 A;  1IXD A;  2CYZ B;  3NMZ C;  2CP7 A;  2HSP A;  3M59 A;  2EPD A;  2JXB A;  1GXI E;  1YJW T;  2KRN A;  3A1P A;  1OOT A;  1BI3 A;  2FZK B;  2J05 A;  5LJ5 f;  5GAO n;  1ZBJ A;  4M78 A;  1NBE B;  2LJ0 A;  2BUD A;  2QQA A;  2J6K A;  2JZ2 A;  1AD5 A;  1I8F A;  5A2Q E;  2DER A;  2JW4 A;  2KBT A;  1TXQ A;  2GTJ A;  4C8Q E;  3QYG B;  3LH5 A;  3OSS C;  1ZQ1 A;  3V7R A;  2DX1 A;  3CPW P;  1YBY A;  2DXB A;  4Z88 A;  5FRM A;  2MWO A;  5EG2 A;  4II1 A;  2QEX T;  4FCY A;  2KYM A;  1Q95 G;  4E7I A;  3GP8 A;  1K9A A;  1JBM A;  3SB2 A;  4JLG A;  3AHU A;  3WVE B;  2PU9 B;  1UUE A;  4NS5 A;  2GQI A;  4M4Z A;  2MMP A;  2R58 A;  4KUD K;  2C06 A;  1OX9 A;  4QT7 A;  3QZ5 B;  4Q5W A;  1OPL A;  2DK3 A;  1SPK A;  1WFW A;  4J9H A;  1JJ2 S;  1OPK A;  3OB9 A;  1PD1 A;  2C0T A;  1QCF A;  1TTH B;  1NM7 A;  5GMK m;  5KE3 A;  5M9O A;  4ZTJ A;  2VGM A;  3GLX A;  5CO7 A;  2P4T A;  3G4S A;  2I0N A;  1Q7Y U;  1U06 A;  2DL7 A;  2GF7 A;  1LPL A;  1BB9 A;  1UEC A;  5KYY A;  2D8J A;  1MV0 B;  3M4G A;  2KRM A;  4X9D A;  2EQU A;  4NL2 A;  1PCX A;  2LQK A;  4DEX A;  4FYW B;  5D6W A;  3SWN B;  3GPL A;  1Q81 U;  4CC4 B;  3H41 A;  3MP6 A;  3I35 A;  2J06 A;  2LC4 A;  4C5H A;  1LCK A;  5HK3 A;  3VS6 A;  3Q1J A;  2L3S A;  1RAG B;  1H3Z A;  2EYW A;  4C92 E;  3C0C A;  4QVD A;  3O8V A;  1MHN A;  2KGT A;  1RLQ C;  4Z89 A;  2P0Q A;  5A0D A;  4GBQ A;  5HKC A;  1KHC A;  2X3W D;  1G3S A;  4ME7 A;  1VQO T;  1MUZ A;  4P5N A;  3NFC A;  3KUF A;  2RH2 A;  1M3A A;  1XOV A;  1YJ9 Q;  1HSQ A;  1Q81 C;  2A3L A;  2XKO C;  3PT9 A;  4RTT A;  1GCQ C;  2QAS A;  3C12 A;  3QJ6 A;  1BK2 A;  1R8O B;  3RIR A;  5KCO A;  3J81 E;  4FL6 A;  4M77 F;  1W6X A;  4FW1 A;  1X6O A;  2XHC A;  1ZUY A;  2O9V A;  4D8D A;  4F16 A;  4FYY B;  2HMA A;  2ZPG B;  2CH4 W;  2J6O A;  3SDZ A;  4B9X A;  1M90 C;  2W10 A;  2RK1 A;  1VQP T;  3EG0 A;  1K73 R;  4A53 A;  2MPX C;  3UDC A;  4M7A C;  2FO0 A;  3FIF A;  5FU7 C;  1TS9 A;  2DYB A;  2EJG A;  4F7U G;  4KBM B;  2L8D A;  3LW5 E;  3M0S A;  5J39 A;  2COY A;  4HVV A;  2L5Q A;  2LJ1 A;  3RDV A;  4ESR A;  2DM1 A;  2WAC A;  1DJ7 B;  3H0H A;  1I5O B;  1LNX A;  2PVO B;  1W4S A;  4MML A;  2X4X A;  3HFN A;  2K6D A;  4J7F A;  5GAN 6;  3OSV A;  3QYH B;  4J6W A;  1KK7 A;  3UA7 A;  3G4S Q;  3OMG A;  4ORZ A;  3VYH B;  1M2O A;  1YI2 Q;  1M3C A;  1VQ7 T;  3M0P A;  2O2O A;  4CC3 A;  2DNU A;  1NEB A;  3SFM A;  1X01 A;  3TVT A;  1VQ9 T;  2EYX A;  1QWE A;  3OW2 S;  4J9B A;  2IPO B;  3MP8 A;  3L2R A;  1KQS S;  2K3B A;  5FRO A;  3BE3 A;  1KHI A;  3HTR A;  3MHX A;  5CKF A;  3OW2 A;  5LL6 S;  2DAQ A;  5LJ5 j;  2HQH A;  3M0T A;  3ZFJ A;  1YJN T;  2DL4 A;  4AFZ C;  3V7S A;  3M57 A;  3JCM Q;  3LGF A;  2P84 A;  1QWF A;  4C8Q A;  1G2B A;  2GFA A;  5GAN 8;  1PM3 A;  4AMC A;  2HQE A;  1JU5 C;  2MCN A;  1XQH A;  4CC7 A;  1AVZ C;  1RI0 A;  3G7Z A;  1E7O A;  2KRO A;  2RNA A;  3NHN A;  1T0H A;  4PJN A;  5GMK h;  4BB7 A;  4IUU A;  1HYO A;  2YLB A;  4HVU A;  4DBF A;  1W2B P;  3EG2 A;  4LD9 K;  1IHW A;  1X69 A;  2YT6 A;  5DLQ E;  1T0J A;  5J26 A;  1AHJ B;  5GAM g;  2E6N A;  1OZ2 A;  3GIB A;  4J9E A;  2JMA A;  4C0D C;  1QW1 A;  4J9G A;  4M7D F;  2P0K A;  3BDU A;  2FRW A;  1WX6 A;  3QWY A;  5FW9 A;  2QGF B;  3RKY A;  1M8M A;  4X1V A;  2JUF A;  3EFS A;  2DJQ A;  2RHU A;  4OGC A;  1GCP A;  1UFF A;  1UHF A;  3VYG A;  1TU0 B;  4F7U F;  2V1R A;  2HL5 C;  1RL2 A;  2RA2 A;  3E2U A;  2CS7 A;  5IHI A;  1RUW A;  1NYF A;  1PRL C;  3M9Q A;  1VQN Q;  2KEA A;  4NL3 A;  3ASK A;  2K3Y A;  3EHQ A;  1KD1 R;  2GQV A;  4JJB A;  4ZN3 A;  3CC4 Q;  1QVF A;  3TSW A;  3EGD B;  1VQ5 T;  4M78 B;  4QKU A;  3RER A;  3OYF A;  4XAX B;  1ZA1 B;  3EGX A;  1LJO A;  2BE7 D;  1VOM A;  3QKJ A;  2ZPF B;  4EIK A;  4X9C A;  2CZ1 B;  3M4Y A;  3BFM A;  1WJQ A;  1S72 T;  4HVW A;  4M75 D;  4HT9 A;  4ZGE B;  2ZPB B;  4DBH A;  3HP9 A;  1TUC A;  4PLI A;  4OMO A;  4N0A A;  3EGD A;  3PIP A;  1OU9 A;  3OBW A;  4Z02 A;  1R0C B;  2BZX A;  1Q86 C;  2EFI A;  1XTD A;  3BW1 A;  4HCB A;  4M77 B;  1K9M C;  2FPE A;  1EIF A;  2XU8 A;  2RJF A;  2QAZ A;  2DA9 A;  1Y96 B;  2DTO A;  2DXC A;  2LJ3 A;  5I2S A;  1N8R C;  2AZV A;  3CMA A;  4LE9 A;  4ELZ C;  1V29 B;  1NG2 A;  2HBP A;  1UEB A;  4PJO B;  1D1A A;  4JZ4 A;  8AT1 B;  1TOV A;  3CCM A;  3VRZ A;  1KG1 A;  2L3P A;  2VXF A;  2E64 A;  1K73 C;  3OMC A;  1SSF A;  1VQP Q;  1YHQ T;  3CCV Q;  1VQ7 A;  4BE1 A;  1W70 A;  2LZ6 B;  2CP5 A;  2X4W A;  3NTH A;  5FU7 B;  1FXX A;  3S3N A;  2QGG A;  1IRX A;  2K5F A;  2DIQ A;  4PJO G;  1RAB B;  3TRE A;  3U23 A;  2CT3 A;  4RG2 A;  1P92 A;  4JS4 A;  2KE9 A;  2CUB A;  1GBQ A;  1VA7 A;  5GAN 2;  2LNH B;  3CCM T;  3RUX A;  4M7D D;  3NPF A;  3OYH A;  3EGU A;  1AOJ A;  1JXM A;  1QVG A;  1H64 1;  4PK4 A;  3OYM A;  1VQK T;  4M75 G;  2A0F B;  1WHL A;  2DIG A;  1YI2 T;  1ABQ A;  4J7I A;  2RI5 A;  3F70 A;  3CXC S;  2K4Y A;  3ZEH A;  3BY7 A;  1VQ8 T;  7AT1 B;  2JM8 A;  3BDL A;  3UAT A;  1D3B B;  4JJN K;  2JNG A;  5LJ3 e;  1BBZ A;  4PFP A;  1VQ9 Q;  4PJO F;  3M0R A;  4BD3 A;  1D0X A;  4A4E A;  3QUI A;  3G71 T;  3MO8 A;  2KY9 A;  1VQN A;  4XU1 A;  2EVR A;  2CZ6 B;  1VQ4 A;  1OX8 A;  1H3H A;  4IIM A;  1K1Z A;  1YFN A;  5GAN 4;  3VRY A;  3MJX A;  1OQK A;  1YN8 A;  3MET A;  2E70 A;  3CC2 T;  2D1X A;  4M78 C;  4CI0 C;  4FSS A;  1QVG P;  3L2Z A;  1RAA B;  4EMH A;  2FRY A;  2M1H A;  2GTO A;  2L3R A;  1Z9Q A;  1KFZ A;  4DOV A;  4JJC A;  4EDU A;  4C5E A;  4MMK A;  4AFQ C;  2M0O A;  1VQ4 T;  5KYU A;  1JO8 A;  1JJ2 A;  1X6G A;  2KR3 A;  4HCC A;  2YHT A;  4XQ3 A;  2PNI A;  3HKS A;  1PD0 A;  5FU6 B;  1RI9 A;  3CCJ Q;  1BI0 A;  3LYI A;  2RQU A;  2HCK A;  3MEV A;  3CCL Q;  3CCS Q;  2PUO B;  1U8R A;  4OB3 B;  4OB0 B;  3HHT B;  1WQ7 A;  3KFV A;  1WHK A;  5LJ5 e;  2H3E B;  1VQP A;  5DLO A;  1PHT A;  8ATC B;  1B34 B;  2E4H A;  3RKX A;  1KQ2 A;  3HRS A;  4E7Z A;  2OTL T;  3OYG A;  1T3L A;  1MGQ A;  5GAO r;  2E5Q A;  3TCJ A;  3L2V A;  3V8J A;  5LJ5 g;  1RAC B;  4XU0 A;  2VWF A;  5CKD A;  3MPU B;  3CC7 A;  1CSK A;  1B07 A;  4C92 A;  1SF9 A;  3REA B;  4KGV B;  4JDS A;  4IUQ A;  4VUB A;  3RES A;  3X20 B;  5KYW B;  3JB9 D;  1FMW A;  4C8Q B;  4LNP A;  4M7D B;  1RLP C;  2X35 A;  2JN0 A;  1G3T A;  5LJ5 h;  4AFS C;  4A4G A;  1VQ5 Q;  3CCR Q;  3OQ5 A;  1M3B A;  3M5A A;  2LCC A;  1QLY A;  5KCH A;  1IGQ A;  2EQK A;  2P4R A;  1VQL Q;  1E6H A;  4C92 B;  4JS5 A;  2JOY A;  2XG8 D;  2KXC A;  2LMJ A;  2KNB B;  1AWJ A;  2E6Z A;  1S72 Q;  4LDX A;  2MAM A;  1I0C A;  4E2F B;  3X28 B;  3JCM X;  3DLM A;  1UJY A;  4K11 A;  1VQM A;  2MIO A;  2CZ0 B;  1XNI A;  1ZX6 A;  5LJ3 d;  2GCX A;  1M30 A;  4OVA A;  4M7A A;  3JB9 J;  4J9C A;  1TUG B;  4A54 A;  1BIB A;  3DB3 A;  4XTX A;  3OYD A;  1YWP A;  4M77 G;  4R55 A;  4Z8A A;  3FLG A;  2E3I A;  5GAN g;  4QW2 A;  1KC8 R;  3D7S B;  3PNW C;  4LDV A;  2PTK A;  4BE0 A;  3EHR A;  2ABL A;  3E9G A;  4M7D A;  1PSE A;  3E19 A;  2F2V A;  3FRN A;  4C0F A;  2OTJ Q;  5GAM d;  4J9F A;  5GAN h;  3MKD A;  5HY6 A;  4M77 E;  3CCV T;  3CPF A;  3M53 A;  4XU2 A;  2AK5 A;  5KH6 A;  2JT4 A;  1ARK A;  3V7C A;  2CT4 A;  4FIB A;  3JAM E;  3I55 Q;  4C0D B;  2VGN A;  3EH2 A;  2LQN A;  1JRI A;  1UE9 A;  2M16 A;  3CCM Q;  1N9R A;  2ECZ A;  3VUZ A;  2EGA A;  3L2W A;  3A5Z B;  4DQ2 A;  3QG1 A;  3EAE A;  2HQX A;  2B86 A;  3CCE Q;  1M90 R;  3EFR A;  4DA4 A;  2KYB A;  2DRK A;  3QHS A;  2PQW A;  2NUZ A;  2LT1 A;  3TU4 K;  3QDR B;  3UF4 A;  2E12 A;  2CH4 A;  1WXU A;  3JCM e;  4F04 B;  1KQS P;  2PZ1 A;  4XK8 E;  2E5K A;  1R77 A;  1IB8 A;  3ZL7 C;  4D6W A;  2FPD A;  3M55 A;  1NZ9 A;  3PGG A;  1TUD A;  2DZ9 A;  4E47 A;  3RR6 A;  4Y92 A;  4RMO A;  5L8R E;  4L5G A;  3PE0 A;  3CCU Q;  4PKC C;  3LX7 A;  1W1F A;  3DKM A;  1YIJ Q;  5FLX E;  3QWX X;  1OYX A;  1AWX A;  2EKH A;  1D0Y A;  4O5V A;  1BKB A;  3SWN A;  2NLU A;  2L89 A;  2QQB A;  3L42 A;  5GJW B;  1VQL A;  3LH0 A;  3S3M A;  4QVC A;  2MWP A;  2VUB A;  1R0B G;  1SKU B;  2V8I A;  4PL6 A;  1IGU A;  4Y91 A;  4PNO A;  2VAS A;  2HNI A;  1VQ4 Q;  2X51 A;  4KH1 B;  1S1N A;  2DEQ A;  2EBP A;  4LDU A;  1K76 A;  2HD0 A;  1ZSZ B;  2DL5 A;  2DFU A;  1Y96 A;  2EYZ A;  2EQM A;  1WA7 A;  3SEM A;  3CXC A;  2K3X A;  2CUD A;  2RB6 A;  1VQ6 A;  3HL8 A;  4BUG A;  2YUO A;  3VJP A;  3KXT A;  1YJW Q;  2HSE B;  2R5A A;  3JCM W;  4C92 C;  1QVG S;  2OTL Q;  4HT8 A;  1EZZ B;  2WSE E;  1N5Z A;  1Q82 R;  3CCQ A;  4IIO A;  1XJW B;  9ATC B;  2D9T A;  3EG1 A;  3FEO A;  2ZPH B;  3GOX A;  3VS5 A;  2YRV A;  4RTU A;  3CCV A;  2NUT B;  2FL7 A;  1K8A C;  2RJE A;  2JTE A;  3EFO B;  1SSH A;  3CC7 Q;  1PWT A;  2RQW A;  3PVQ A;  2EGE A;  4KGX B;  4L6V 5;  4BI8 B;  3OYC A;  3CCR T;  4PJO A;  2YUP A;  2QEX Q;  2LX9 A;  4C8Q G;  3CME T;  1JEG A;  4IUP A;  3QXE B;  2F1L A;  2D8H A;  3EG3 A;  4BY6 B;  1VQL T;  4MDW A;  2DBK A;  1KC8 U;  4RCB A;  2RI3 A;  5IT9 E;  1K0S A;  3RKW A;  2FG0 A;  3OBY A;  2RQR A;  2BKD N;  1D0Z A;  5GMK e;  1Z9Z A;  4JRI A;  5GAN j;  3R6N A;  1PKS A;  2EGC A;  1SRM A;  1Q86 U;  4M7A D;  3G6E Q;  2WSF E;  2KQW A;  2X4J A;  1M1K C;  3G1J A;  1BCM A;  5KYX A;  1VQO A;  3G6E A;  1GFC A;  2M51 A;  3CD6 Q;  2OX7 A;  1WXB A;  1Y7X A;  3V8L A;  4F14 A;  2QQ9 A;  1KC8 C;  2VXE A;  3VUB A;  1QKX A;  5L23 A;  2DXT A;  4E7L A;  2RM4 A;  4OMM A;  4N4H A;  1JQQ A;  1QP2 A;  3OS5 A;  2HEQ A;  3A8O B;  4XU3 A;  1N9S A;  4NOY A;  1HK9 A;  1PC0 A;  1PG5 B;  2EKO A;  4M7A F;  2I2L A;  5GAO m;  4JZ3 A;  1YI2 A;  2EWN A;  1TSF A;  3I5R A;  2OTJ T;  3RMQ A;  3GBQ A;  3A8L B;  1YIT A;  5AT1 B;  2F5K A;  1Q86 R;  2E10 A;  5A0G A;  5GAN 5;  1EX4 A;  1NE8 A;  2DEU A;  4MZM A;  5D6Y A;  1M5Q 1;  1TG0 A;  1IZ6 A;  4KH0 B;  3PIO A;  2ZPI B;  4FYV B;  3QDF A;  3PFS A;  2DET A;  1N8R R;  3NGP A;  4M77 C;  2CZ7 B;  1AT1 B;  4ZTF A;  1WNL A;  1UG1 A;  3LWH A;  2BTT A;  2QI2 A;  4E7H A;  1NJI U;  2AIR B;  2A28 A;  2O01 E;  3J7A F;  3VS3 A;  4EMG A;  2M9U A;  3CCE T;  4J83 A;  3AT1 B;  4C8Q C;  5IXF A;  2ZCF B;  2LCL A;  2A7Y A;  3N5B B;  1WHJ A;  2ZZD A;  3JCM d;  1K0X A;  3GNG A;  4BDY A;  4AFU C;  4M78 F;  3RNJ A;  4IUT A;  1M9S A;  1X43 A;  5J3B A;  2O88 A;  1VQ8 A;  1QMC A;  2NUP A;  1GFD A;  4J9I A;  1PSF A;  3VS0 A;  3I9Q A;  1M4Z A;  1ZSZ C;  3E9F A;  1WJR A;  2RJD A;  2LP5 A;  3CCU T;  4ZGJ B;  1LOJ A;  1YIJ T;  1NJI C;  2EQJ A;  3QBY A;  2GFU A;  2H3J A;  2JTF A;  1QCN A;  3CCR A;  1ZUK A;  1K9M U;  1YP5 A;  5GAM j;  2CP0 A;  4ZNX A;  4TVR A;  2NYS A;  2QEX A;  3NTI A;  2RMO A;  5IHK A;  4ELY C;  1B7T A;  2SEM A;  1WI7 A;  4E7S A;  1KJW A;  3PMI A;  2Y90 A;  2L3Q A;  2AKL A;  2DJZ A;  1D1B A;  4RTV A;  5AYF A;  1TH7 A;  3THK A;  2Y4Y A;  2EJ9 A;  1MND A;  4HCZ A;  3ME9 A;  2HZY A;  2RHY A;  2XMF A;  2YRC A;  3CPW S;  2X4Y A;  1D1C A;  3REB B;  3CBP A;  4BAC A;  4M78 D;  5LJ3 j;  4XTU A;  1ABO A;  3CPW A;  4JJD A;  3JCM V;  2QA4 A;  2CP3 A;  2RHZ A;  3URG A;  3CD6 A;  4C5G A;  1G5V A;  4M77 A;  3M0U A;  5FWB A;  3IQL A;  1WDX A;  2EYQ A;  2K5L A;  5LJ3 f;  1K8A U;  1M1K R;  2QA4 Q;  5IH2 A;  1YJN A;  3OS2 A;  1K4U S;  1WYX A;  1A0N B;  2F2W A;  4LUD A;  1NLO C;  1OEB A;  1NLP C;  5GMK i;  5ECA A;  1GCQ A;  3VV0 A;  1YJN Q;  1V1C A;  3CCQ Q;  3HPW A;  1BCO A;  3A8G B;  4R56 A;  3CQT A;  2QTX A; 
#chains in the Genus database with same CATH homology
 1ZUY A;  2O9V A;  4D8D A;  2MIO A;  4F16 A;  1ZX6 A;  2CH4 W;  3SHW A;  2J6O A;  2BZ8 A;  1M30 A;  2W10 A;  2RN8 A;  3H0I A;  4GLM A;  5IXB A;  3EG0 A;  4J9C A;  1YNZ A;  2RQV A;  5I22 A;  3RBB B;  1YWP A;  2K79 A;  2FO0 A;  3UA6 A;  1PNJ A;  4Z8A A;  3VS2 A;  1GRI A;  1AEY A;  2VVK A;  2DYB A;  2V1Q A;  2LX7 A;  3M0S A;  4HVV A;  1YWO A;  4LN2 A;  2LJ1 A;  4ESR A;  2DM1 A;  2JS2 A;  2PTK A;  3EHR A;  2ABL A;  3H0H A;  2BZY A;  2CSI A;  2K6D A;  2F2V A;  1CKB A;  4J9F A;  3UA7 A;  4A63 B;  3A98 A;  4ORZ A;  1U5S A;  2AK5 A;  2JT4 A;  1B3Q A;  1M3C A;  2ED1 A;  4HCK A;  1ARK A;  2OAW A;  2A36 A;  3M0P A;  2O2O A;  2DIL A;  1CKA A;  2A08 A;  2J7I A;  4CC3 A;  2DNU A;  4WCI A;  2CT4 A;  1NEB A;  1UTI A;  2DL8 A;  5GJV B;  3TVT A;  2EYX A;  2LQN A;  1UE9 A;  1QWE A;  1YCS B;  1KIK A;  1FYN A;  4J9B A;  2ECZ A;  2EGA A;  2ROL A;  3H0F A;  5EC7 A;  1H8K A;  2HBW A;  2K3B A;  4HXJ A;  2B86 A;  1VYU A;  4AG1 C;  2KYB A;  1OV3 A;  2DRK A;  2NUZ A;  2DVJ A;  2X3X D;  3M0T A;  3UF4 A;  2DL4 A;  4AFZ C;  2CH4 A;  1WXU A;  2PZ1 A;  2QDL A;  2KT8 A;  2E5K A;  1QWF A;  3ZL7 C;  1G2B A;  2CRE A;  2FPD A;  2JM9 A;  2DBM A;  1JU5 C;  2MCN A;  4CC7 A;  1AVZ C;  1TUD A;  1UJ0 A;  4Y92 A;  1E7O A;  2D0N A;  2KRO A;  2RNA A;  2J6F A;  3PE0 A;  3NHN A;  2GBQ A;  1T0H A;  1W1F A;  1JXO A;  3QWX X;  1WXT A;  2H8H A;  1AWX A;  5I11 A;  4HVU A;  2EKH A;  3EG2 A;  1X69 A;  2YT6 A;  2L2P A;  2IIM A;  1T0J A;  1UDL A;  2EW3 A;  1AWO A;  4J9E A;  5GJW B;  1WLP B;  1NEG A;  2JMA A;  4J9G A;  1AZE A;  2YSQ A;  2FRW A;  1WX6 A;  3QWY A;  1Y0M A;  5FW9 A;  1M8M A;  4X1V A;  1IO6 A;  2DJQ A;  1GCP A;  1UFF A;  1UHF A;  2L0A A;  2DE0 X;  1S1N A;  2EBP A;  2CSQ A;  3I5S A;  1K76 A;  2V1R A;  2ROT A;  2DL5 A;  2K7A A;  1I07 A;  5FWC A;  5IHI A;  1RUW A;  1NYF A;  1PRL C;  2KEA A;  1SHF A;  2EYZ A;  3EHQ A;  2EQI A;  1WA7 A;  3SEM A;  1GBR A;  4JJB A;  3TSW A;  2CUD A;  2JMC A;  2YUO A;  1FMK A;  2KRS A;  1BU1 A;  2HDA A;  1SEM A;  4EIK A;  1N5Z A;  4LUE A;  4IIO A;  1G83 A;  4DEY A;  3EG1 A;  2W0Z A;  2O31 A;  4HVW A;  3VS5 A;  1X2Q A;  4RTU A;  2DMO A;  1UGV A;  1I1J A;  2NWM A;  4RTX A;  2JTE A;  2K2M A;  1PKT A;  2KT1 A;  1SSH A;  5IHN A;  1PRM C;  1TUC A;  1PWT A;  2YUQ A;  1T3S A;  2RQW A;  1X2K A;  3PVQ A;  2EGE A;  4OMO A;  2YUP A;  1JEG A;  4OMN A;  3PVL A;  2BZX A;  2DLP A;  2AZS A;  2AKK A;  2DF6 A;  2D8H A;  3EG3 A;  2G6F X;  1AWW A;  4J9D A;  2DBK A;  2FPE A;  1J3T A;  1X27 A;  2DA9 A;  2LJ3 A;  1K0S A;  1SHG A;  2FG0 A;  2AZV A;  5HCK A;  3VS7 A;  4LE9 A;  2RQR A;  1ZUU A;  1Z9Z A;  1NG2 A;  3R6N A;  1PKS A;  4F17 A;  4E6R A;  2EGC A;  1SRM A;  4JZ4 A;  1H92 A;  3VRZ A;  1ZSG A;  2ENM A;  2L3P A;  1E6G A;  2RF0 A;  2KXD A;  2LCS A;  2OI3 A;  1GFC A;  1UHC A;  1W70 A;  2FPF A;  2M51 A;  4AG2 C;  1WXB A;  3M0Q A;  4RTW A;  2LZ6 B;  4F14 A;  1EFN A;  1QKX A;  5L23 A;  3U23 A;  2CT3 A;  1HJD A;  3NMZ C;  2SRC A;  4OMM A;  2KE9 A;  2CUB A;  1GBQ A;  1JQQ A;  1VA7 A;  2C0O A;  2HEQ A;  2LNH B;  2HSP A;  3NPF A;  4OMP A;  2EPD A;  3EGU A;  1AOJ A;  1JXM A;  2JXB A;  4RTY A;  4JZ3 A;  4CC2 A;  2KRN A;  3I5R A;  1KSW A;  3GBQ A;  1OOT A;  2J05 A;  1ZBJ A;  1ABQ A;  2C0I A;  2LJ0 A;  2J6K A;  1AD5 A;  1TG0 A;  4R0K A;  2JW4 A;  2KBT A;  2GTJ A;  2JM8 A;  3LH5 A;  3NGP A;  3UAT A;  2DX1 A;  1BBZ A;  2ESW A;  4RTZ A;  3M0R A;  2VKN A;  1UG1 A;  4Z88 A;  2RQT A;  2F2X A;  2BTT A;  1WIE A;  1U3O A;  1ZLM A;  2A28 A;  2K9G A;  2YDL A;  2KYM A;  3VS3 A;  1K9A A;  1VYT A;  2EVR A;  5IXF A;  1X6B A;  2CDT A;  1H3H A;  4IIM A;  1K1Z A;  3TSZ A;  1UUE A;  3VRY A;  1YN8 A;  2GQI A;  1K0X A;  4M4Z A;  4AFU C;  2D1X A;  4FSS A;  3RNJ A;  4KRT A;  1X43 A;  4RUG A;  4QT7 A;  2FRY A;  1OPL A;  2ED0 A;  2GTO A;  2O88 A;  1Z9Q A;  1SPK A;  1WFW A;  4J9H A;  1KFZ A;  1Y57 A;  4JJC A;  1GFD A;  1OPK A;  4J9I A;  3VS0 A;  4AFQ C;  2C0T A;  3I9Q A;  1QCF A;  1NM7 A;  2DL3 A;  2LP5 A;  1JO8 A;  1X6G A;  2KR3 A;  3VS4 A;  2DRM A;  2PNI A;  1AZG B;  1ZUK A;  1RI9 A;  1YP5 A;  2I0N A;  4ZNX A;  1U06 A;  2RQU A;  2HCK A;  2DL7 A;  2RMO A;  5IHK A;  2MOX A;  2SEM A;  1BB9 A;  1UEC A;  2YUN A;  1WI7 A;  1M27 C;  2D8J A;  1VYV A;  1MV0 B;  3KFV A;  1KJW A;  2KRM A;  2L3Q A;  2AKL A;  1PHT A;  4DEX A;  4RTV A;  3THK A;  2M0Y A;  3FJ5 A;  4D8K A;  1QKW A;  1T3L A;  4CC4 B;  3H41 A;  4OMQ A;  2XMF A;  1MV3 A;  2LQW A;  3I35 A;  2J06 A;  2VWF A;  3VS1 A;  3REB B;  2A37 A;  1LCK A;  2GGR A;  3VS6 A;  1HD3 A;  1CSK A;  1B07 A;  2O9S A;  2L3S A;  3REA B;  2EYW A;  1ABO A;  1NYG A;  3C0C A;  4JJD A;  4LNP A;  3O5Z A;  2KGT A;  1RLQ C;  1RLP C;  4Z89 A;  4AFS C;  3M0U A;  4GBQ A;  5FWB A;  3IQL A;  1WDX A;  1M3B A;  2X3W D;  3ULR B;  1QLY A;  2OJ2 A;  5IH2 A;  1K4U S;  1MUZ A;  1WYX A;  2P4R A;  4OML A;  1A0N B;  1E6H A;  1M3A A;  1XOV A;  2FEI A;  2F2W A;  1SRL A;  4LUD A;  1HSQ A;  2KXC A;  1NLO C;  1OEB A;  2LMJ A;  1NLP C;  2KNB B;  1AWJ A;  4JPB W;  2RPN A;  1GCQ A;  5ECA A;  2GNC A;  4RTT A;  2JS0 A;  1GCQ C;  1V1C A;  2EYY A;  3JV3 A;  1I0C A;  1BK2 A;  3CQT A;  1UJY A;  1GL5 A;  1W6X A;  4K11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...