1SRLA

1h and 15n assignments and secondary structure of the src sh3 domain
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
56
structure length
56
Chain Sequence
TFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLTTGQTGYIPSNYVAPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SRC TYROSINE KINASE SH3 DOMAIN
publication title 1H and 15N assignments and secondary structure of the Src SH3 domain.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Phosphotransferase
total genus 3
structure length 56
sequence length 56
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 1994-03-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 1srlA00
2LP5A 2CREA 4HVWA 1HD3A 2DL3A 2DJQA 2EYYA 1IO6A 2GQIA 3R6NA 3C0CA 4AG2C 2KXCA 4OMMA 1UFFA 2DILA 2J7IA 2CT3A 3THKA 4LUEA 5GJVB 4CC4B 2YUNA 4JZ3A 2J6KA 4LN2A 4J9HA 2NUZA 2ESWA 3PVLA 2KYMA 1G2BA 1RLQC 2J6FA 3VS1A 3VS4A 1VA7A 1W1FA 2JMCA 2BZXA 5L23A 1H3HA 2VKNA 2CSIA 4OMNA 1QWEA 2KXDA 3EG3A 1QKWA 4AFSC 2SRCA 1AWXA 1OOTA 1M27C 2JM8A 4D8DA 1K9AA 3VRYA 2LQNA 3EG2A 2C0OA 2K7AA 1JO8A 1W6XA 1WLPB 1K0XA 4J9GA 1GFDA 1E6GA 5IHNA 2EYZA 2LQWA 2BZYA 4IIMA 1K1ZA 2LJ1A 1GCQC 2YUOA 2JM9A 1GL5A 2LCSA 1NEBA 1UTIA 1ZBJA 2GGRA 2ROLA 2RQTA 1PRLC 2JW4A 2BTTA 4CC2A 5IHKA 2HBWA 1W70A 1UHFA 1B3QA 1X2KA 2J06A 1EFNA 1BU1A 2X3WD 1K76A 5HCKA 1NYGA 2YUQA 4GBQA 2MOXA 2W0ZA 2CDTA 1G83A 1X6GA 2DL8A 2KYBA 1GFCA 2DA9A 2F2XA 2HCKA 2D0NA 3EG1A 3O5ZA 4J9DA 1XOVA 1JQQA 1Y57A 1H8KA 1U5SA 1OV3A 1MV3A 2AZSA 4OMQA 2HSPA 1H92A 3NGPA 1AZGB 1KFZA 2DRMA 1ZUKA 2CH4W 1M8MA 1WDXA 3U23A 2ECZA 3M0SA 1NLPC 1ABOA 1JU5C 1HSQA 2KROA 3EG0A 1M3BA 1PNJA 2EGEA 2EVRA 2LZ6B 4D8KA 4OMLA 5I11A 2C0TA 2DL7A 4RUGA 4JJDA 1UJ0A 1UG1A 2L3PA 1YCSB 2EYXA 2LJ3A 2RF0A 1PRMC 2DL5A 4J9EA 3VS2A 2GNCA 3M0RA 4J9FA 4AG1C 4M4ZA 2L2PA 2KRNA 1PKTA 1YWPA 1VYTA 2F2VA 1BBZA 2DF6A 5FW9A 4JJCA 1TUDA 3TVTA 1AWOA 1PWTA 1FYNA 1WIEA 1UDLA 2KR3A 1PHTA 3I9QA 1RI9A 1SHFA 4Y92A 3EGUA 2RQRA 4ZNXA 1X2QA 5IH2A 1S1NA 2KRMA 4F17A 2KBTA 2GBQA 3UATA 2AKKA 2C0IA 4HCKA 1J3TA 1Z9ZA 1M30A 1ZSGA 4HVVA 2DBKA 4JZ4A 1YWOA 3QWYA 2EBPA 1UECA 1TUCA 3M0PA 3RNJA 1MV0B 5FWBA 2SEMA 2DNUA 2FEIA 3TSWA 2BZ8A 3VS3A 4RTXA 1UJYA 2OJ2A 2D8JA 4E6RA 1X27A 1SRLA 1I1JA 2L3SA 2I0NA 1PKSA 1Z9QA 2ED0A 2JMAA 4OMOA 3GBQA 2K6DA 1YNZA 2JS2A 4AFUC 4EIKA 2FPFA 3VS7A 1HJDA 2ENMA 1M3AA 1X43A 2L0AA 2AKLA 3FJ5A 1MUZA 4QT7A 2NWMA 4DEXA 2H8HA 2FG0A 2B86A 1OPLA 3M0UA 1RUWA 1VYVA 3REAB 2DE0X 2P4RA 3H41A 1RLPC 2JXBA 2ABLA 1WFWA 4F14A 1GCPA 1SRMA 1N5ZA 1U06A 1NM7A 1WXTA 4JPBW 3H0IA 2LX7A 3VS0A 2AK5A 2KRSA 1ZX6A 3REBB 1AWWA 5IHIA 2RNAA 1X69A 1ZLMA 2EQIA 1T3LA 2FPDA 2HEQA 4OMPA 2A36A 2L3QA 1AEYA 4LUDA 2JTEA 3ULRB 4HXJA 5EC7A 2V1RA 2YDLA 2DMOA 2J05A 2QDLA 1V1CA 4K11A 1CKAA 2O31A 3NMZC 2HDAA 1UUEA 2KT1A 2DX1A 4RTYA 4X1VA 2RPNA 2VWFA 4F16A 1B07A 2MIOA 1FMKA 4LE9A 4AFZC 1NG2A 3QWXX 2M51A 1ABQA 2F2WA 5ECAA 3I5RA 1UGVA 3UF4A 2ROTA 2RQWA 2D8HA 1WYXA 1BB9A 2JT4A 4IIOA 2GTJA 3VS6A 2DLPA 2MCNA 1KJWA 1UHCA 2J6OA 1NYFA 2ED1A 2E5KA 2EYWA 5IXFA 1JXMA 2K79A 3VS5A 3I35A 2KE9A 3LH5A 3TSZA 1CSKA 1AWJA 1SSHA 2FPEA 3KFVA 1QLYA 3A98A 4KRTA 2KGTA 2RQVA 3SHWA 2OAWA 2CUBA 4WCIA 2IIMA 2K9GA 1YN8A 4LNPA 4GLMA 2LJ0A 4Z88A 4JJBA 1T0HA 2YUPA 2A08A 2FRWA 2DRKA 1T3SA 1I07A 2FO0A 1GCQA 2FRYA 1AZEA 2W10A 4ORZA 1Y0MA 1SEMA 1K0SA 2PZ1A 2LNHB 2DBMA 2O9SA 4RTUA 4Z8AA 2JS0A 1QCFA 1QWFA 2K3BA 4CC7A 1I0CA 2XMFA 1X6BA 1LCKA 1K4US 2KNBB 1OEBA 2DM1A 1KIKA 2RQUA 5IXBA 3IQLA 1NEGA 5I22A 1AD5A 3SEMA 4J9CA 3UA7A 2K2MA 2EGAA 4J9BA 2YT6A 1KSWA 1WA7A 1GBQA 1ZUYA 2X3XD 2DL4A 2DYBA 1QKXA 1WXBA 2M0YA 1WXUA 3CQTA 3PE0A 2DVJA 2A37A 1VYUA 1JEGA 1ZUUA 2EPDA 1TG0A 3JV3A 4J9IA 1E7OA 4DEYA 2KT8A 2VVKA 2LMJA 1JXOA 4R0KA 3H0HA 2O9VA 1U3OA 2YSQA 3NPFA 2OI3A 3H0FA 3NHNA 4RTTA 2G6FX 2CH4A 3EHRA 2RN8A 3ZL7C 4Z89A 2AZVA 4RTVA 3UA6A 3RBBB 1AVZC 4RTZA 4AFQC 5GJWB 3M0TA 1WX6A 1SPKA 3PVQA 3VRZA 1SHGA 2RMOA 1CKBA 4RTWA 3EHQA 2CUDA 1NLOC 2CT4A 2PNIA 1OPKA 1AOJA 2EGCA 2A28A 2O2OA 1T0JA 4HVUA 1GBRA 2CSQA 1E6HA 2KEAA 1GRIA 2V1QA 3I5SA 3M0QA 2EW3A 1A0NB 1YP5A 1M3CA 4ESRA 2D1XA 4A63B 2GTOA 1BK2A 1ARKA 1UE9A 5FWCA 4CC3A 2EKHA 4FSSA 1WI7A 2PTKA 2O88A
chains in the Genus database with same CATH superfamily
5KYUA 5FRMA 5FU7C 3META 2DJQA 2EYYA 3EH2A 4KUIA 3R6NA 3C0CA 1VQ8A 3HRSA 2DILA 2J7IA 1BIAA 5HK3A 3S6WA 5GAOm 2X51A 3LYIA 4PJOB 3OS1A 1VQ6T 2CZ0B 1D1AA 2J6KA 5CKHA 3JB9J 2R5AA 2ZPEB 5GANf 2QQBA 3VS4A 1U8RA 1R0CB 3Q1JA 3G71T 4O5VA 3BDLA 4C8QF 1WZOA 4M7AC 5GAMj 2F5TX 1B34B 2KXDA 1QKWA 3CC2T 4O6JA 2M1HA 2QTVA 4EMKC 4OB3B 2M9UA 1W2BA 1M27C 2LQNA 3EG2A 3BY7A 3ME9A 2RK1A 3OYIA 4LDVA 2CP7A 1VQPT 4M75A 1WLPB 5D6YA 3MP1A 1GFDA 1E6GA 3CCVT 2EYZA 2BZYA 3WVEB 1GCQC 4XU2A 3BDUA 2JM9A 1GL5A 2ZPGB 1KD1U 2Y4YA 2QDYB 2RI5A 3CBMA 1ZBJA 1QP3A 2ROLA 5GMKe 2JW4A 4CC2A 1B3QA 3CMAQ 3OBWA 4RCBA 2YRVA 2QGGA 5HCKA 2FVUA 2DVEA 4WF2A 4UC4A 2CDTA 1G83A 1X6GA 2AHJB 2DL8A 1VQ6A 1QVGA 4M7DG 2DA9A 2F2XA 4DBRA 5GAOq 1R8OB 5CKDA 3DKMA 4C92D 1ZA2B 4Q5WA 3OYDA 4M75D 1IRXA 3G71A 4M75E 1MV3A 1JJ2A 1BYMA 5AT1B 3NTIA 2HSPA 5A0LA 3CC2A 1M8MA 1H3ZA 2HQEA 4PK4A 3M0SA 1UGRB 1FMVA 3CCMT 5D6XA 2NYSA 4XU1A 1M3BA 3SWNC 4R55A 4JUVA 4PJJA 2EGEA 1M9SA 2ATCB 3S3MA 1VQPA 2YLBA 1Q86C 2DYIA 4LD6A 2RF0A 1PRMC 4P5NA 3OY9A 4J9EA 1OU9A 1PG5B 3VS2A 3X26B 3JB9D 3M0RA 4J9FA 4M4ZA 2QA4T 1D1CA 1PKTA 4OP0A 1QVPA 1D09B 4JJCA 1OULA 5GMKh 3CCSA 3TVTA 3CCQQ 1QVFA 1VQ4T 4B9WA 4JRPA 2KDSA 1PHTA 3I9QA 3VJPA 3GNGA 1NJIR 2RQRA 3L2WA 3HFOA 2KRMA 4ME7A 1GXIE 5LJ3j 3M4GA 4J7IA 1ZBXA 4HCKA 2C0IA 1NBEB 1ZSGA 4JZ4A 3H9NA 1UECA 3KXTA 4PJOF 5FWBA 5GANd 2SEMA 3C94A 2YWWA 1R0BG 4PFPA 1NPPA 5IT9E 5AYFA 5KCOA 4ZN3A 2NUPA 2A0FB 2CZ7B 5KYYB 5GAN2 5D6WA 4E2FB 3VV0A 4II1A 2YXYA 1M2OA 2HQXA 2JMAA 5C0MA 1OYXA 2K6DA 3CEYA 1YNZA 5CAIA 3CXCA 4F7UB 2QQSA 3SB2A 1HJDA 1K8AU 1RL2A 4QT7A 4DEXA 4MDXA 3JCMV 1RAGB 2RJCA 5FU6C 4C92C 1LNXA 2DE0X 2XI9A 3OYEA 4M75C 2HKNA 1RLPC 3QZ9B 2ABLA 1WFWA 4F14A 1N5ZA 1U06A 4J6WA 1NJIU 3JB9H 3LLRA 1VQ4A 3ASKA 2AK5A 3G1JA 1DJ7B 1ZX6A 3OS0A 1YJ9Q 4N4GA 1VQ9Q 3REBB 2LRQA 1YJWQ 2RNAA 1ZLMA 2A36A 1KC8R 2CP2A 3M55A 1EX4A 3A8HB 5EC7A 2DMOA 3L2RA 1V1CA 4DBQA 1CKAA 2O31A 1RAAB 3A8OB 2DPPB 4RTYA 3DB3A 4XTXA 1ZHIA 2VWFA 3MEAA 3I56T 3HFNA 1FMKA 3A8GB 3MCAB 2MMPA 3VYHB 3J81E 3A5ZB 1W2BS 5J3BA 4R56A 1OX9A 1PSFA 2E65A 2JT4A 4IIOA 3D7SB 2GTJA 1PD1A 2WSFE 4M78D 1KJWA 4FW2A 1M1GA 2QGFB 4C92F 2OTLQ 2K79A 3VS5A 1K73R 1WHLA 1M90R 3LH5A 4PJOG 3TSZA 3OMCA 1VQ7T 2QYZA 2E3IA 1LVKA 5GAMh 2GCXA 3LH0A 2XD0A 4KRTA 1VQOQ 3R6OA 2D6FA 1LOJA 4M7DA 4XU3A 4Z88A 1T0HA 4ATOA 2Y4XA 4E7HA 2DRKA 3C4SA 3E2UA 4HCCA 2COWA 3L2VA 2FRYA 1KC8U 1Y0MA 1SEMA 3EGXB 2DBMA 4OF1A 2LVMA 4FL6A 3CCSQ 4RTUA 1FXXA 3CMEQ 1QWFA 2XMFA 4OGEA 1K4US 4JRIA 1I81A 2DTHA 1TH7A 4WTOB 1K9MU 5I22A 2RHIA 1JJ2S 3X25B 3I56A 4C0DC 2EGAA 4QVZA 1IREB 2QQAA 2K4YA 1GBQA 3OBYA 4JJNK 2NUTB 3OYFA 4N4HA 4C8QA 3PE0A 2GF7A 2ZPIB 1W2BP 2DVJA 1VYUA 3FB9A 1JEGA 4M7DD 4M7DE 1E7OA 2E4HA 4ZGJB 2KT8A 1JXOA 1VQ7A 2VV5A 1YCYA 2RA2A 2YSQA 3GIBA 3NPFA 1VQMA 2O4XB 3QIIA 4DOVA 3M58A 4RTTA 2G6FX 3V8KA 2CH4A 3F70A 4CI0C 4FT2A 1QVFS 3LGFA 4KGZB 3CMAT 4M77B 3SDZA 2RMOA 3FC3A 2DKGA 1CKBA 4FYYB 2RH2A 4C92G 2EGCA 4KUDK 4CRIA 3M54A 2KEAA 2A3LA 2R5MA 3OSVA 2V1QA 1Y7XA 1JB0E 3OYLA 4RKUE 2XIDA 4C8QE 4A63B 3HRTA 1ZA1B 1ARKA 2IPOB 2CKKA 3EFSA 1V76A 1UE9A 2XK0A 1YI2A 4BI3A 4FYXB 1AHJB 2HKQB 2EWNA 4C0FA 2KY9A 3LW5E 1PC0A 4EMKA 2X4WA 5CKEA 2PVGB 1JJ2P 1KQSA 2LP5A 2V8IA 4HVWA 1HD3A 1KHIA 9ATCB 1M2VA 1IO6A 1Y96B 2F1LA 1M1KU 1RI0A 4XTUA 2HMAA 2BE9B 5GANg 4EPCA 2E6NA 2NUZA 3WVDB 2DFUA 1WHGA 1VA7A 1W1FA 2JMCA 2BZXA 4X9CA 2DXBA 2FYKA 3J80E 2CSIA 3E9GA 3E19A 1K73C 1M90C 3CMAA 3CCQT 4M78F 1AWXA 3FLGA 1F1BB 1IB8A 1EIFA 4BDZA 2JM8A 4D8DA 1QVFP 3VRYA 4FCYA 3JB9I 2K7AA 1W6XA 3RUXA 1K0XA 4M7DC 5IHNA 4IIMA 3QO3A 4OGCA 2MF2A 4QW2A 3ZEHA 3DLMA 1Q82U 2DXUA 1UTIA 2RQTA 4RG8A 1TSFA 2HBWA 3OB9A 1W70A 2LDMA 4E7IA 3QUIA 2DK3A 1D3BA 2J06A 1EFNA 3QYGB 4XTZA 3AHUA 1G8XA 2QK0A 2BKDN 4L6V5 3SWNA 1IGUA 4BY6B 1G3TA 2E64A 4PFZA 2ZZDA 3X20B 2KYBA 5GMKi 2DXCA 2D0NA 2DAQA 1S72Q 4JRKA 2M02A 3CXCP 3RKYA 2HQHA 4J9DA 4C5EA 5CKFA 2QTXA 1Y57A 2CP5A 4KH0B 1U5SA 1OV3A 1Q81C 1MMNA 2DRMA 4Z02A 1P92A 1ZUKA 2CH4W 2KAFA 1WDXA 3U23A 3CCQA 5GMKl 4HT8A 2ECZA 1N9SA 1NLPC 1HSQA 5DLQE 1KQ2A 1TWBA 2KROA 3FRNA 1YJ9T 1R77A 1OQKA 1O9SA 4HCBA 2EVRA 5I11A 4OMLA 1YJWT 4M77F 4RUGA 5A0DA 4PJOD 1UG1A 4V2SA 1YCSB 3CC4Q 3TU4K 1G5VA 3MP8A 3EGDB 1BIBA 4AG1C 4C5HA 1N6AA 2L2PA 3RIRA 2KRNA 1YWPA 1VYTA 2DF6A 1ZSZB 4M78G 3A1PA 1PWTA 4FYVB 4EMGA 2O01E 3JAME 1EZZB 3CCJQ 1RI9A 4C0ZA 1M5Q1 2EQMA 1YI2Q 1M4ZA 4XTVA 3PMIA 3G6EQ 4ZTFA 4XTYA 1J3TA 2RI3A 2OTLT 2FZCB 1NZ9A 2HNIA 1MV0B 1Q7YR 1IXDA 4X9DA 4C92A 2FEIA 3QDRB 4LDWA 3VS3A 3JSCA 3GLXA 4RTXA 2MYSA 2RI2A 1VQOT 1UJYA 2LX9A 2D8JA 1YFNA 4XU0A 1X27A 1VQNQ 4J5YA 1Y07A 5LJ5d 1Z9QA 1YJ9A 5KE3A 1YJNQ 1VQ9A 4C5IA 4OMOA 1YJWA 1YBYA 4Y28E 3CCST 3CMET 5KYNA 3MPUB 5J26A 4A53A 2FPFA 3LX7A 2ZPBB 1JBMA 3OS2A 1YITQ 3M0UA 2XICA 1WHHA 3RKWA 2RHUA 1SRMA 4JPBW 1NM7A 1KQSS 1SG5A 3H0IA 5KYUB 3VS0A 2FZGB 3NTKA 2KRSA 3V8JA 2LT1A 5GAN3 4M77G 4ELZC 4C92E 5IHIA 1WGSA 4OMPA 1D0XA 1XQHA 2JTEA 4AT1B 1Q7YU 1G3YA 4E7JA 3MEWA 4HXJA 4PJOC 2V1RA 3LGLA 2OTLA 2QDLA 3QBYA 1D0YA 2B8AA 3CPFA 1LPLA 2K5FA 1B07A 2MIOA 2VB6A 1VQOA 2QQRA 2PUKB 4LE9A 5M9OA 3QDFA 1NG2A 3QWXX 2M51A 2QASA 4BE0A 1ABQA 5ECAA 3JCMc 5DM7R 3FEOA 2ROTA 2RQWA 2HL5C 5FU6B 1BB9A 4MMLA 1K8AR 2H3EB 3VS6A 1N9RA 3JCMg 2AT1B 2ED1A 3CMEA 5IXFA 1JXMA 2DETA 3I35A 2KE9A 1ZQ1A 2LQKA 1IZ6A 1I8FA 2K5LA 4XAXB 4OB1B 3V7SA 2DD4A 3PTAA 1QLYA 3SHWA 1KD1C 2OAWA 2IIMA 5LJ5j 4JJBA 4FW1A 2YUPA 2FRWA 1T3SA 2FO0A 2W10A 4ORZA 1KQSP 2LNHB 2QEXQ 2O9SA 4CC7A 1QCFA 3CBOA 1I0CA 3OSSC 1WPYA 3JCMJ 1KQ1A 1X6BA 2F5KA 4ZGEB 3L2UA 1OEBA 2DM1A 3T9NA 1KIKA 2DJZA 3TEEA 3IQLA 2PVDB 1NEGA 2AIRB 1B7TA 1HK9A 1O75A 2YT6A 4DOWA 2RO0A 1KSWA 5GAMe 2DEQA 3QHSA 1JRIA 1ZUYA 4VUBA 5KE2A 2OTJQ 3ZFJA 2EFIA 5FRNA 2P0KA 3CQTA 3A8MB 1IGQA 1VIFA 4M78A 1TG0A 3JV3A 4EDUA 5CCAA 3VU3C 2VVKA 1VQLQ 2O9VA 3E9FA 5FLXE 4FYWB 2OI3A 2IG0A 4RG2A 2VXFA 8ATCB 2RN8A 3EGXA 2LC4A 4RTVA 2EKOA 3UA6A 1G3WA 3TCJA 4AFQC 3M0TA 4JLIA 1SPKA 3PNWC 3PVQA 1W4SA 3VRZA 4FU6A 3CD6Q 1NLOC 2CT4A 2H3JA 2O2OA 1T0JA 1GBRA 1K9MR 3I5SA 4ZGDB 1QQJA 3RESA 1LJOA 2EQKA 2D1XA 1S72T 2DXTA 2JVVA 3GP8A 2LTOA 4M78E 2V26A 5GANj 4CC3A 3V7RA 4L59A 1WI7A 1BI3A 2F69A 1ACMB 1KHCA 1VQMT 3OYAA 3OYKA 2DL3A 3LWIA 2COYA 3L42A 5A2QE 3EFOB 3EFRA 2GQIA 4AG2C 1KK7A 2CT3A 3THKA 4BE1A 3QJ6A 1BI1A 5GJVB 4CC4B 2YUNA 2XG8D 5KYXA 4JZ3A 1IHWA 5C6SA 4J9HA 1N8RR 5GAN8 3CC4T 4GY5A 5KH6A 3M59A 4M77A 1K8AC 2GFAA 3QZ5B 4HCZA 2EQJA 3CCLQ 1WJQA 5L23A 1H3HA 2VKNA 1QVGS 2EJGA 4OMNA 3CCVQ 1QWEA 2NLUA 3EG3A 1QMCA 5LJ5g 2SRCA 4F04B 1C0MA 3OYNA 1X75C 3OYJA 2KVQG 1NJIC 3VUZA 3CCJT 2C0OA 1YI2T 5D7UA 2KK4A 3G6ET 3BE3A 5LJ3e 2LQWA 1K1ZA 2XDDA 3S3OA 2YUOA 3INZA 1S72A 4FT4A 3MEVA 5GAMf 1NEBA 2GGRA 1Y96A 2ZPHB 5IHKA 2LQ8A 2XDBA 4MZPA 2XHCA 1M1KR 4D6WA 4NL2A 4BUGA 1BU1A 4M77D 3MEUA 1MMDA 4M77E 1K76A 3OYYA 4PJMA 5FROA 1VQNT 3QKJA 4F7UF 3PIOA 4BI8B 1NYGA 5L8RE 2ZPFB 4GBQA 1YJNT 2HBPA 1N8RU 3NFCA 3RMQA 1GFCA 4HKEA 3CCUQ 1QCOA 2XKOC 3CC4A 2VXEA 3O5ZA 3CCMQ 4TVRA 4DBHA 5EG2A 1JQQA 2FL7A 1YITT 1U1TA 4M78C 2AZSA 3OYGA 4FSXA 3NTHA 1H92A 3OYHA 1VQ5Q 1KFZA 4GLKA 5CVIA 3M56A 4J7FA 1ABOA 1QVGP 2BE7D 2QA4Q 3EG0A 3CCJA 2DERA 1V29B 3HRUA 1UGQB 4D8KA 2LZ6B 1Q82R 1KC8C 2C0TA 3G6EA 2X4XA 1RABB 3JCMQ 3ER0A 2EYXA 2KMTA 5LJ3h 3BFMA 4E47A 2DL5A 1PSEA 3CC7Q 2F2VA 3OA6A 1BBZA 1K9MC 1C6VX 3V7CA 4MMKA 3CXCS 2RJEA 4FM4B 3H8ZA 1YIJQ 2KR3A 4C8QB 1VQNA 4Y92A 3EGUA 4BDYA 3EG9B 4OB2B 5IH2A 1YJNA 2X35A 1S1NA 4F17A 2HL3A 2KBTA 4YTLA 2GBQA 5KYWB 3OMGA 3UATA 2E5QA 4HVVA 2DBKA 1HYOA 2JNGA 3JRZA 5I2MA 1YWOA 4NS5A 3QWYA 4N4IA 1TUCA 2YRDA 3RNJA 3EAEA 2L3RA 4BACA 5GMKj 3TSWA 2BZ8A 5HKCA 1YITA 3CPWA 6AT1B 3LWHA 4QVDA 1G3SA 2MK5A 4E7KA 3UPUA 4BD3A 3CCRQ 1BKBA 4E6RA 3S3NA 4JS5A 3J7AF 3PGGA 4F7UG 1SRLA 5FU7B 1M1FA 4M77C 1I1JA 3EGDA 1PKSA 3C12A 5LJ3f 5GAN7 4QQDA 1VQKQ 2QEXT 3GBQA 2ZGWA 2P4TA 5GAOl 3I55Q 2JS2A 1SKUB 1ZSZA 4EIKA 4LDUA 4PJOA 3VS7A 2K5IA 4KGVB 5LL6S 4E7SA 1M3AA 2ENMA 2AKLA 1MUZA 2NWMA 3BW1A 2H8HA 2FG0A 5GAMd 2B86A 1OPLA 4M7AB 3H41A 2P4RA 3CCEQ 3JCMX 1PD0A 2QAZA 4A4EA 2JXBA 4EMKB 1B34A 1RAIB 2E1HA 1UGSB 2DTOA 2FZKB 2LX7A 1M2VB 2OTJT 3E1SA 1AWWA 3DB4A 4J6YA 1X69A 2G3RA 3FDRA 2EQIA 3HKSA 2X9HA 1NE8A 1H641 2L3QA 1VUBA 1M1KC 3TQ7P 1OU8A 2YDLA 5GANh 1YHQQ 2HDAA 1UUEA 1VQ9T 2DX1A 1SF9A 4PNOA 2RPNA 3VUBA 4F16A 1TS9A 4EMHA 4PJOE 4AFZC 3G4SQ 3MP6A 2HSEB 5CKBA 4B6MA 2D0QB 2F2WA 5J39A 1XNIA 2D8HA 1D1BA 2MCNA 3CD6T 2QEXA 2DZCA 1UHCA 1NYFA 1VOMA 2HZYA 2E5KA 2EYWA 1PM3A 4Y91A 2DD5A 1CSKA 2CGHA 1RAEB 1AWJA 2RJFA 1SSHA 4DQ2A 2FPEA 2P84A 1Q82C 2YRCA 3HL8A 2K9GA 1YN8A 4LNPA 1D3BB 2MWOA 1OZ3A 3P8HA 2RM4A 3H6ZA 5IAYA 3MKDA 4BE2A 4LD9K 3SWNB 1K0SA 2OTJA 2JTFA 1MMAA 1Q86U 1RAHB 4BY6C 4OVAA 2K3BA 2LCCA 3FJPA 1AT1B 1LCKA 3N5BB 1FMWA 1QW1A 1WNLA 1XJWB 2WSEE 2P0QA 2RQUA 1VQLA 5IXBA 1TOVA 4J9CA 1BCMA 3UA7A 2M16A 3CCLT 4OMFB 3SD4A 2E6ZA 3M5AA 1VIEA 4B9XA 5GMKm 2DL4A 2DYBA 1WXBA 4HA8A 4PLLA 5LJ3d 2DTIA 2K57A 2A37A 3CD6A 3HHTB 2E12A 1MMGA 4DEYA 5CK9A 2LMJA 2RD1A 3H0HA 4R0KA 1WHJA 1U3OA 1MNDA 4QQ6A 4J6XA 5I21A 3JCMb 3H0FA 3NHNA 3HP9A 2Y90A 3EHRA 4Z89A 2AZVA 3RBBB 1AVZC 1WJSA 1ZSZC 3EH1A 4RTZA 2DIGA 1X01A 4M7AF 5GAN4 1WX6A 5KYYA 2QG9B 3GPLA 4RTWA 3EHQA 2PNIA 3L2ZA 1OPKA 1AOJA 4HVUA 4X34A 1TXQA 5CQXA 1GRIA 3M0QA 1RAFB 4F7UA 1YP5A 1OZ2A 2DIQA 3CCUT 3V8LA 2GTOA 4C92B 1BK2A 2K2VA 3CPWS 4M75B 3CCLA 3UT1A 2EKHA 4FSSA 2JOYA 2Z0WA 2PTKA 3OS5A 4NL3A 3CCVA 1VQ5T 2BUDA 2CREA 3PFSA 4IUPA 4C8QG 3JCMe 2R57A 2KXCA 4OMMA 1UFFA 1I5LA 4LUEA 2JUFA 2JZ2A 4LN2A 4IUTA 2ESWA 3PVLA 4N0AC 2GQVA 1PCXA 2KYMA 1G2BA 3RR6A 1RLQC 5HY6A 2J6FA 3O8VA 4E7ZA 3VS1A 2LNVA 3CC7T 2HD0A 3MO8A 2YHTA 4C5GA 3QYHB 1WQ7A 2RHZA 1QP2A 4FIBA 3OYBA 5CQYA 2KI7A 4AFSC 4F7UE 1OOTA 4A4GA 1YIJT 2E10A 1K9AA 1WHKA 4IUVA 1Y71A 2IVWA 1VQ8Q 4A4HA 3RDVA 1JO8A 1MHNA 2COZA 2CZ6B 4KBMB 3TREA 4J9GA 1WQWA 5GAMg 2E70A 5IN1A 2LJ1A 2L89A 4PJLA 1Q7YC 3CCUA 4PJNA 2FHDA 2LCSA 3CCMA 3L2QA 2PVOB 3EFOA 3HTRA 1PRLC 2RK2A 2BTTA 4M7AG 3UDCA 3AT1B 1UHFA 3OYCA 1XTDA 1X2KA 4QQGA 3CPWP 3CCRT 4JLGA 1UB4A 1VQ5A 2X3WD 4OB0B 4ANJA 1FX7A 2QA4A 4LDXA 3M57A 3PT9A 2YUQA 1VQKT 2MOXA 2W0ZA 3JCMh 2P0PA 2D9TA 1TU0B 3I55T 3OW2A 1NPRA 3RKXA 2HCKA 2PUOB 3EG1A 4KH1B 2PU9B 4A4KA 4LXCA 2R58A 1XOVA 1TTHB 3CC7A 1H8KA 4C0DB 5CR2A 4DA4A 5CO7A 4JDSA 4J8OA 3CCET 7AT1B 4MZMA 4OMQA 3NGPA 1AZGB 3GF5A 4PKCC 2EJ9A 2VGNA 2NUTA 1JU5C 1YIJA 3HPWA 2QQ9A 2DO3A 2VGMA 5GAN5 1PNJA 1KG1A 2EIFA 2DL7A 4JJDA 4E7LA 1VQ6Q 1UJ0A 2NUPB 4IUQA 5GAN6 2L3PA 5KCHA 2LJ3A 2GNCA 3PMTA 2O4XA 1YHQT 3OYMA 3G71Q 3FIFA 2CZ1B 5A0GA 5FW9A 3CC2Q 1TUDA 1AWOA 1FYNA 2RHXA 3CCRA 3G4ST 4IKFA 3JCMf 3UWNA 4M75F 1WIEA 1D0ZA 2MAMA 1UDLA 4KULA 4ZTJA 2L5QA 3G7ZA 4BB7A 1SHFA 4ELYC 4ZNXA 1VQPQ 1X2QA 4M78B 1VQKA 4AMCA 2GFUA 2AKKA 3I55A 1Z9ZA 1M30A 3MJXA 5GAOr 2EBPA 3M0PA 2XDPA 3M4YA 2X4JA 2DNUA 1QCNA 3CCEA 2ZCFB 2A7YA 4PL6A 3JB9F 5LJ5e 2BIVA 2OJ2A 4L5GA 4A4FA 2KSSA 5LJ3g 3QPHA 1FWZA 3VKIA 2VYTA 2L3SA 2I0NA 2ED0A 5I2SA 2MI6A 3QXEB 2QXFA 5DY9A 5DLOA 4AFUC 2JTMA 1Q95G 2CS7A 3ZBDA 4XQ3A 1X43A 2L0AA 1BI0A 3FJ5A 1HXDA 4A54A 1WHMA 4J83A 1YHQA 1MGQA 4JS4A 3QJYA 1RUWA 1VYVA 1K73U 3REAB 1M90U 3L1AA 2LCLA 3EG9A 2V8KA 1Q81R 5KYWA 1GCPA 2RJDA 4QVCA 1WXTA 1BI2A 2YLCA 3G4SA 2VC8A 2VASA 3P8DA 3M9QA 3GOXA 2EJFA 1T3LA 2FPDA 2HEQA 4M7DB 1AEYA 1SSFA 4LUDA 5KYXB 3ULRB 3P8BB 4PFOA 2J05A 2JJ9A 2I2LA 1UGPB 4K11A 3A8LB 4KT0E 3NMZC 2KT1A 4X1VA 3JCMW 1WJRA 2PQWA 1IHVA 4M75G 3WXMB 3KBGA 1VQ4Q 2LT4A 3RMSA 5LJ5h 3I5RA 4C8QD 1UGVA 2JN0A 3UF4A 2EYQA 2M0OA 1WYXA 2DLPA 4M7AA 3M53A 2J6OA 5GAOp 2E41A 3HSBA 4C0GA 2CP0A 1OI1A 5HK0A 4HT9A 1Q81U 3KFVA 3A98A 2FB7A 2KGTA 2RQVA 1I5OB 3JB9G 2C06A 3X28B 2CUBA 4WCIA 4KGXB 4GLMA 5GANe 2LJ0A 2EAYA 2OAUA 4BI4A 2A08A 2V8JA 3JCMd 2X4YA 3RERA 1I07A 2HAXA 1GCQA 1RADB 1X6OA 1AZEA 3DLLA 5GAOn 2PZ1A 3URGA 2RHYA 2DEUA 4Z8AA 2JS0A 2WSCE 4LDYA 3OW2S 1N8RC 2MPXC 2KNBB 2CYZB 1BCOA 1I4K1 4MZTA 4QKUA 5LJ5f 1UEBA 1AD5A 3CBPA 4M7AD 1OX8A 3SEMA 4ZN1A 4M7AE 2K2MA 4J9BA 1RACB 2CP6A 2KQWA 1WA7A 3KUFA 4XTWA 1C1AA 4NOYA 2X3XD 1QKXA 3MHXA 2M0YA 2VUBA 3QG1A 1WXUA 2K3XA 4XK8E 3X24B 2WACA 1VQ8T 1ZUUA 2EPDA 3SFMA 4J9IA 3GNFB 2QI2A 2OX7A 1N27A 3I56Q 4DBFA 2XU8A 3ZL7C 2E3HA 1M8VA 4IUUA 2RB6A 8AT1B 1Q86R 2L8DA 5GJWB 2ZAEA 2EQUA 1TUGB 1VQLT 4JRQA 3PIPA 1SHGA 2K3YA 3QSUA 4C8QC 2CUDA 4RCCA 4PLIA 2A28A 3VYGA 1MNEA 2CSQA 1E6HA 1VQ7Q 3C95A 2EW3A 1A0NB 1VQMQ 5CIUA 1M3CA 4N0AA 2CP3A 4ESRA 4M7DF 3OW2P 3JCMP 2MWPA 2DZ9A 4MDWA 1KD1R 5FWCA 4RMOA 4IURA 1U1SA 3OQ5A 2O88A
chains in the Genus database with same CATH topology
2LP5A 2CREA 4HVWA 1HD3A 2DL3A 2DJQA 2EYYA 1IO6A 2GQIA 3R6NA 3C0CA 4AG2C 2KXCA 4OMMA 1UFFA 2DILA 2J7IA 2CT3A 3THKA 4LUEA 5GJVB 4CC4B 2YUNA 4JZ3A 2J6KA 4LN2A 4J9HA 2NUZA 2ESWA 3PVLA 2KYMA 1G2BA 1RLQC 2J6FA 3VS1A 3VS4A 1VA7A 1W1FA 2JMCA 2BZXA 5L23A 1H3HA 2VKNA 2CSIA 4OMNA 1QWEA 2KXDA 3EG3A 1QKWA 4AFSC 2SRCA 1AWXA 1OOTA 1M27C 2JM8A 4D8DA 1K9AA 3VRYA 2LQNA 3EG2A 2C0OA 2K7AA 1JO8A 1W6XA 1WLPB 1K0XA 4J9GA 1GFDA 1E6GA 5IHNA 2EYZA 2LQWA 2BZYA 4IIMA 1K1ZA 2LJ1A 1GCQC 2YUOA 2JM9A 1GL5A 2LCSA 1NEBA 1UTIA 1ZBJA 2GGRA 2ROLA 2RQTA 1PRLC 2JW4A 2BTTA 4CC2A 5IHKA 2HBWA 1W70A 1UHFA 1B3QA 1X2KA 2J06A 1EFNA 1BU1A 2X3WD 1K76A 5HCKA 1NYGA 2YUQA 4GBQA 2MOXA 2W0ZA 2CDTA 1G83A 1X6GA 2DL8A 2KYBA 1GFCA 2DA9A 2F2XA 2HCKA 2D0NA 3EG1A 3O5ZA 4J9DA 1XOVA 1JQQA 1Y57A 1H8KA 1U5SA 1OV3A 1MV3A 2AZSA 4OMQA 2HSPA 1H92A 3NGPA 1AZGB 1KFZA 2DRMA 1ZUKA 2CH4W 1M8MA 1WDXA 3U23A 2ECZA 3M0SA 1NLPC 1ABOA 1JU5C 1HSQA 2KROA 3EG0A 1M3BA 1PNJA 2EGEA 2EVRA 2LZ6B 4D8KA 4OMLA 5I11A 2C0TA 2DL7A 4RUGA 4JJDA 1UJ0A 1UG1A 2L3PA 1YCSB 2EYXA 2LJ3A 2RF0A 1PRMC 2DL5A 4J9EA 3VS2A 2GNCA 3M0RA 4J9FA 4AG1C 4M4ZA 2L2PA 2KRNA 1PKTA 1YWPA 1VYTA 2F2VA 1BBZA 2DF6A 5FW9A 4JJCA 1TUDA 3TVTA 1AWOA 1PWTA 1FYNA 1WIEA 1UDLA 2KR3A 1PHTA 3I9QA 1RI9A 1SHFA 4Y92A 3EGUA 2RQRA 4ZNXA 1X2QA 5IH2A 1S1NA 2KRMA 4F17A 2KBTA 2GBQA 3UATA 2AKKA 2C0IA 4HCKA 1J3TA 1Z9ZA 1M30A 1ZSGA 4HVVA 2DBKA 4JZ4A 1YWOA 3QWYA 2EBPA 1UECA 1TUCA 3M0PA 3RNJA 1MV0B 5FWBA 2SEMA 2DNUA 2FEIA 3TSWA 2BZ8A 3VS3A 4RTXA 1UJYA 2OJ2A 2D8JA 4E6RA 1X27A 1SRLA 1I1JA 2L3SA 2I0NA 1PKSA 1Z9QA 2ED0A 2JMAA 4OMOA 3GBQA 2K6DA 1YNZA 2JS2A 4AFUC 4EIKA 2FPFA 3VS7A 1HJDA 2ENMA 1M3AA 1X43A 2L0AA 2AKLA 3FJ5A 1MUZA 4QT7A 2NWMA 4DEXA 2H8HA 2FG0A 2B86A 1OPLA 3M0UA 1RUWA 1VYVA 3REAB 2DE0X 2P4RA 3H41A 1RLPC 2JXBA 2ABLA 1WFWA 4F14A 1GCPA 1SRMA 1N5ZA 1U06A 1NM7A 1WXTA 4JPBW 3H0IA 2LX7A 3VS0A 2AK5A 2KRSA 1ZX6A 3REBB 1AWWA 5IHIA 2RNAA 1X69A 1ZLMA 2EQIA 1T3LA 2FPDA 2HEQA 4OMPA 2A36A 2L3QA 1AEYA 4LUDA 2JTEA 3ULRB 4HXJA 5EC7A 2V1RA 2YDLA 2DMOA 2J05A 2QDLA 1V1CA 4K11A 1CKAA 2O31A 3NMZC 2HDAA 1UUEA 2KT1A 2DX1A 4RTYA 4X1VA 2RPNA 2VWFA 4F16A 1B07A 2MIOA 1FMKA 4LE9A 4AFZC 1NG2A 3QWXX 2M51A 1ABQA 2F2WA 5ECAA 3I5RA 1UGVA 3UF4A 2ROTA 2RQWA 2D8HA 1WYXA 1BB9A 2JT4A 4IIOA 2GTJA 3VS6A 2DLPA 2MCNA 1KJWA 1UHCA 2J6OA 1NYFA 2ED1A 2E5KA 2EYWA 5IXFA 1JXMA 2K79A 3VS5A 3I35A 2KE9A 3LH5A 3TSZA 1CSKA 1AWJA 1SSHA 2FPEA 3KFVA 1QLYA 3A98A 4KRTA 2KGTA 2RQVA 3SHWA 2OAWA 2CUBA 4WCIA 2IIMA 2K9GA 1YN8A 4LNPA 4GLMA 2LJ0A 4Z88A 4JJBA 1T0HA 2YUPA 2A08A 2FRWA 2DRKA 1T3SA 1I07A 2FO0A 1GCQA 2FRYA 1AZEA 2W10A 4ORZA 1Y0MA 1SEMA 1K0SA 2PZ1A 2LNHB 2DBMA 2O9SA 4RTUA 4Z8AA 2JS0A 1QCFA 1QWFA 2K3BA 4CC7A 1I0CA 2XMFA 1X6BA 1LCKA 1K4US 2KNBB 1OEBA 2DM1A 1KIKA 2RQUA 5IXBA 3IQLA 1NEGA 5I22A 1AD5A 3SEMA 4J9CA 3UA7A 2K2MA 2EGAA 4J9BA 2YT6A 1KSWA 1WA7A 1GBQA 1ZUYA 2X3XD 2DL4A 2DYBA 1QKXA 1WXBA 2M0YA 1WXUA 3CQTA 3PE0A 2DVJA 2A37A 1VYUA 1JEGA 1ZUUA 2EPDA 1TG0A 3JV3A 4J9IA 1E7OA 4DEYA 2KT8A 2VVKA 2LMJA 1JXOA 4R0KA 3H0HA 2O9VA 1U3OA 2YSQA 3NPFA 2OI3A 3H0FA 3NHNA 4RTTA 2G6FX 2CH4A 3EHRA 2RN8A 3ZL7C 4Z89A 2AZVA 4RTVA 3UA6A 3RBBB 1AVZC 4RTZA 4AFQC 5GJWB 3M0TA 1WX6A 1SPKA 3PVQA 3VRZA 1SHGA 2RMOA 1CKBA 4RTWA 3EHQA 2CUDA 1NLOC 2CT4A 2PNIA 1OPKA 1AOJA 2EGCA 2A28A 2O2OA 1T0JA 4HVUA 1GBRA 2CSQA 1E6HA 2KEAA 1GRIA 2V1QA 3I5SA 3M0QA 2EW3A 1A0NB 1YP5A 1M3CA 4ESRA 2D1XA 4A63B 2GTOA 1BK2A 1ARKA 1UE9A 5FWCA 4CC3A 2EKHA 4FSSA 1WI7A 2PTKA 2O88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LP5 A;  2CRE A;  4HVW A;  1HD3 A;  2DL3 A;  2DJQ A;  2EYY A;  1IO6 A;  2GQI A;  3R6N A;  3C0C A;  4AG2 C;  2KXC A;  4OMM A;  1UFF A;  2DIL A;  2J7I A;  2CT3 A;  3THK A;  4LUE A;  5GJV B;  4CC4 B;  2YUN A;  4JZ3 A;  2J6K A;  4LN2 A;  4J9H A;  2NUZ A;  2ESW A;  3PVL A;  2KYM A;  1G2B A;  1RLQ C;  2J6F A;  3VS1 A;  3VS4 A;  1VA7 A;  1W1F A;  2JMC A;  2BZX A;  5L23 A;  1H3H A;  2VKN A;  2CSI A;  4OMN A;  1QWE A;  2KXD A;  3EG3 A;  1QKW A;  4AFS C;  2SRC A;  1AWX A;  1OOT A;  1M27 C;  2JM8 A;  4D8D A;  1K9A A;  3VRY A;  2LQN A;  3EG2 A;  2C0O A;  2K7A A;  1JO8 A;  1W6X A;  1WLP B;  1K0X A;  4J9G A;  1GFD A;  1E6G A;  5IHN A;  2EYZ A;  2LQW A;  2BZY A;  4IIM A;  1K1Z A;  2LJ1 A;  1GCQ C;  2YUO A;  2JM9 A;  1GL5 A;  2LCS A;  1NEB A;  1UTI A;  1ZBJ A;  2GGR A;  2ROL A;  2RQT A;  1PRL C;  2JW4 A;  2BTT A;  4CC2 A;  5IHK A;  2HBW A;  1W70 A;  1UHF A;  1B3Q A;  1X2K A;  2J06 A;  1EFN A;  1BU1 A;  2X3W D;  1K76 A;  5HCK A;  1NYG A;  2YUQ A;  4GBQ A;  2MOX A;  2W0Z A;  2CDT A;  1G83 A;  1X6G A;  2DL8 A;  2KYB A;  1GFC A;  2DA9 A;  2F2X A;  2HCK A;  2D0N A;  3EG1 A;  3O5Z A;  4J9D A;  1XOV A;  1JQQ A;  1Y57 A;  1H8K A;  1U5S A;  1OV3 A;  1MV3 A;  2AZS A;  4OMQ A;  2HSP A;  1H92 A;  3NGP A;  1AZG B;  1KFZ A;  2DRM A;  1ZUK A;  2CH4 W;  1M8M A;  1WDX A;  3U23 A;  2ECZ A;  3M0S A;  1NLP C;  1ABO A;  1JU5 C;  1HSQ A;  2KRO A;  3EG0 A;  1M3B A;  1PNJ A;  2EGE A;  2EVR A;  2LZ6 B;  4D8K A;  4OML A;  5I11 A;  2C0T A;  2DL7 A;  4RUG A;  4JJD A;  1UJ0 A;  1UG1 A;  2L3P A;  1YCS B;  2EYX A;  2LJ3 A;  2RF0 A;  1PRM C;  2DL5 A;  4J9E A;  3VS2 A;  2GNC A;  3M0R A;  4J9F A;  4AG1 C;  4M4Z A;  2L2P A;  2KRN A;  1PKT A;  1YWP A;  1VYT A;  2F2V A;  1BBZ A;  2DF6 A;  5FW9 A;  4JJC A;  1TUD A;  3TVT A;  1AWO A;  1PWT A;  1FYN A;  1WIE A;  1UDL A;  2KR3 A;  1PHT A;  3I9Q A;  1RI9 A;  1SHF A;  4Y92 A;  3EGU A;  2RQR A;  4ZNX A;  1X2Q A;  5IH2 A;  1S1N A;  2KRM A;  4F17 A;  2KBT A;  2GBQ A;  3UAT A;  2AKK A;  2C0I A;  4HCK A;  1J3T A;  1Z9Z A;  1M30 A;  1ZSG A;  4HVV A;  2DBK A;  4JZ4 A;  1YWO A;  3QWY A;  2EBP A;  1UEC A;  1TUC A;  3M0P A;  3RNJ A;  1MV0 B;  5FWB A;  2SEM A;  2DNU A;  2FEI A;  3TSW A;  2BZ8 A;  3VS3 A;  4RTX A;  1UJY A;  2OJ2 A;  2D8J A;  4E6R A;  1X27 A;  1SRL A;  1I1J A;  2L3S A;  2I0N A;  1PKS A;  1Z9Q A;  2ED0 A;  2JMA A;  4OMO A;  3GBQ A;  2K6D A;  1YNZ A;  2JS2 A;  4AFU C;  4EIK A;  2FPF A;  3VS7 A;  1HJD A;  2ENM A;  1M3A A;  1X43 A;  2L0A A;  2AKL A;  3FJ5 A;  1MUZ A;  4QT7 A;  2NWM A;  4DEX A;  2H8H A;  2FG0 A;  2B86 A;  1OPL A;  3M0U A;  1RUW A;  1VYV A;  3REA B;  2DE0 X;  2P4R A;  3H41 A;  1RLP C;  2JXB A;  2ABL A;  1WFW A;  4F14 A;  1GCP A;  1SRM A;  1N5Z A;  1U06 A;  1NM7 A;  1WXT A;  4JPB W;  3H0I A;  2LX7 A;  3VS0 A;  2AK5 A;  2KRS A;  1ZX6 A;  3REB B;  1AWW A;  5IHI A;  2RNA A;  1X69 A;  1ZLM A;  2EQI A;  1T3L A;  2FPD A;  2HEQ A;  4OMP A;  2A36 A;  2L3Q A;  1AEY A;  4LUD A;  2JTE A;  3ULR B;  4HXJ A;  5EC7 A;  2V1R A;  2YDL A;  2DMO A;  2J05 A;  2QDL A;  1V1C A;  4K11 A;  1CKA A;  2O31 A;  3NMZ C;  2HDA A;  1UUE A;  2KT1 A;  2DX1 A;  4RTY A;  4X1V A;  2RPN A;  2VWF A;  4F16 A;  1B07 A;  2MIO A;  1FMK A;  4LE9 A;  4AFZ C;  1NG2 A;  3QWX X;  2M51 A;  1ABQ A;  2F2W A;  5ECA A;  3I5R A;  1UGV A;  3UF4 A;  2ROT A;  2RQW A;  2D8H A;  1WYX A;  1BB9 A;  2JT4 A;  4IIO A;  2GTJ A;  3VS6 A;  2DLP A;  2MCN A;  1KJW A;  1UHC A;  2J6O A;  1NYF A;  2ED1 A;  2E5K A;  2EYW A;  5IXF A;  1JXM A;  2K79 A;  3VS5 A;  3I35 A;  2KE9 A;  3LH5 A;  3TSZ A;  1CSK A;  1AWJ A;  1SSH A;  2FPE A;  3KFV A;  1QLY A;  3A98 A;  4KRT A;  2KGT A;  2RQV A;  3SHW A;  2OAW A;  2CUB A;  4WCI A;  2IIM A;  2K9G A;  1YN8 A;  4LNP A;  4GLM A;  2LJ0 A;  4Z88 A;  4JJB A;  1T0H A;  2YUP A;  2A08 A;  2FRW A;  2DRK A;  1T3S A;  1I07 A;  2FO0 A;  1GCQ A;  2FRY A;  1AZE A;  2W10 A;  4ORZ A;  1Y0M A;  1SEM A;  1K0S A;  2PZ1 A;  2LNH B;  2DBM A;  2O9S A;  4RTU A;  4Z8A A;  2JS0 A;  1QCF A;  1QWF A;  2K3B A;  4CC7 A;  1I0C A;  2XMF A;  1X6B A;  1LCK A;  1K4U S;  2KNB B;  1OEB A;  2DM1 A;  1KIK A;  2RQU A;  5IXB A;  3IQL A;  1NEG A;  5I22 A;  1AD5 A;  3SEM A;  4J9C A;  3UA7 A;  2K2M A;  2EGA A;  4J9B A;  2YT6 A;  1KSW A;  1WA7 A;  1GBQ A;  1ZUY A;  2X3X D;  2DL4 A;  2DYB A;  1QKX A;  1WXB A;  2M0Y A;  1WXU A;  3CQT A;  3PE0 A;  2DVJ A;  2A37 A;  1VYU A;  1JEG A;  1ZUU A;  2EPD A;  1TG0 A;  3JV3 A;  4J9I A;  1E7O A;  4DEY A;  2KT8 A;  2VVK A;  2LMJ A;  1JXO A;  4R0K A;  3H0H A;  2O9V A;  1U3O A;  2YSQ A;  3NPF A;  2OI3 A;  3H0F A;  3NHN A;  4RTT A;  2G6F X;  2CH4 A;  3EHR A;  2RN8 A;  3ZL7 C;  4Z89 A;  2AZV A;  4RTV A;  3UA6 A;  3RBB B;  1AVZ C;  4RTZ A;  4AFQ C;  5GJW B;  3M0T A;  1WX6 A;  1SPK A;  3PVQ A;  3VRZ A;  1SHG A;  2RMO A;  1CKB A;  4RTW A;  3EHQ A;  2CUD A;  1NLO C;  2CT4 A;  2PNI A;  1OPK A;  1AOJ A;  2EGC A;  2A28 A;  2O2O A;  1T0J A;  4HVU A;  1GBR A;  2CSQ A;  1E6H A;  2KEA A;  1GRI A;  2V1Q A;  3I5S A;  3M0Q A;  2EW3 A;  1A0N B;  1YP5 A;  1M3C A;  4ESR A;  2D1X A;  4A63 B;  2GTO A;  1BK2 A;  1ARK A;  1UE9 A;  5FWC A;  4CC3 A;  2EKH A;  4FSS A;  1WI7 A;  2PTK A;  2O88 A; 
#chains in the Genus database with same CATH topology
 5KYU A;  5FRM A;  5FU7 C;  3MET A;  2DJQ A;  2EYY A;  3EH2 A;  4KUI A;  3R6N A;  3C0C A;  1VQ8 A;  3HRS A;  2DIL A;  2J7I A;  1BIA A;  5HK3 A;  3S6W A;  5GAO m;  2X51 A;  3LYI A;  4PJO B;  3OS1 A;  1VQ6 T;  2CZ0 B;  1D1A A;  2J6K A;  5CKH A;  3JB9 J;  2R5A A;  2ZPE B;  5GAN f;  2QQB A;  3VS4 A;  1U8R A;  1R0C B;  3Q1J A;  3G71 T;  4O5V A;  3BDL A;  4C8Q F;  1WZO A;  4M7A C;  5GAM j;  2F5T X;  1B34 B;  2KXD A;  1QKW A;  3CC2 T;  4O6J A;  2M1H A;  2QTV A;  4EMK C;  4OB3 B;  2M9U A;  1W2B A;  1M27 C;  2LQN A;  3EG2 A;  3BY7 A;  3ME9 A;  2RK1 A;  3OYI A;  4LDV A;  2CP7 A;  1VQP T;  4M75 A;  1WLP B;  5D6Y A;  3MP1 A;  1GFD A;  1E6G A;  3CCV T;  2EYZ A;  2BZY A;  3WVE B;  1GCQ C;  4XU2 A;  3BDU A;  2JM9 A;  1GL5 A;  2ZPG B;  1KD1 U;  2Y4Y A;  2QDY B;  2RI5 A;  3CBM A;  1ZBJ A;  1QP3 A;  2ROL A;  5GMK e;  2JW4 A;  4CC2 A;  1B3Q A;  3CMA Q;  3OBW A;  4RCB A;  2YRV A;  2QGG A;  5HCK A;  2FVU A;  2DVE A;  4WF2 A;  4UC4 A;  2CDT A;  1G83 A;  1X6G A;  2AHJ B;  2DL8 A;  1VQ6 A;  1QVG A;  4M7D G;  2DA9 A;  2F2X A;  4DBR A;  5GAO q;  1R8O B;  5CKD A;  3DKM A;  4C92 D;  1ZA2 B;  4Q5W A;  3OYD A;  4M75 D;  1IRX A;  3G71 A;  4M75 E;  1MV3 A;  1JJ2 A;  1BYM A;  5AT1 B;  3NTI A;  2HSP A;  5A0L A;  3CC2 A;  1M8M A;  1H3Z A;  2HQE A;  4PK4 A;  3M0S A;  1UGR B;  1FMV A;  3CCM T;  5D6X A;  2NYS A;  4XU1 A;  1M3B A;  3SWN C;  4R55 A;  4JUV A;  4PJJ A;  2EGE A;  1M9S A;  2ATC B;  3S3M A;  1VQP A;  2YLB A;  1Q86 C;  2DYI A;  4LD6 A;  2RF0 A;  1PRM C;  4P5N A;  3OY9 A;  4J9E A;  1OU9 A;  1PG5 B;  3VS2 A;  3X26 B;  3JB9 D;  3M0R A;  4J9F A;  4M4Z A;  2QA4 T;  1D1C A;  1PKT A;  4OP0 A;  1QVP A;  1D09 B;  4JJC A;  1OUL A;  5GMK h;  3CCS A;  3TVT A;  3CCQ Q;  1QVF A;  1VQ4 T;  4B9W A;  4JRP A;  2KDS A;  1PHT A;  3I9Q A;  3VJP A;  3GNG A;  1NJI R;  2RQR A;  3L2W A;  3HFO A;  2KRM A;  4ME7 A;  1GXI E;  5LJ3 j;  3M4G A;  4J7I A;  1ZBX A;  4HCK A;  2C0I A;  1NBE B;  1ZSG A;  4JZ4 A;  3H9N A;  1UEC A;  3KXT A;  4PJO F;  5FWB A;  5GAN d;  2SEM A;  3C94 A;  2YWW A;  1R0B G;  4PFP A;  1NPP A;  5IT9 E;  5AYF A;  5KCO A;  4ZN3 A;  2NUP A;  2A0F B;  2CZ7 B;  5KYY B;  5GAN 2;  5D6W A;  4E2F B;  3VV0 A;  4II1 A;  2YXY A;  1M2O A;  2HQX A;  2JMA A;  5C0M A;  1OYX A;  2K6D A;  3CEY A;  1YNZ A;  5CAI A;  3CXC A;  4F7U B;  2QQS A;  3SB2 A;  1HJD A;  1K8A U;  1RL2 A;  4QT7 A;  4DEX A;  4MDX A;  3JCM V;  1RAG B;  2RJC A;  5FU6 C;  4C92 C;  1LNX A;  2DE0 X;  2XI9 A;  3OYE A;  4M75 C;  2HKN A;  1RLP C;  3QZ9 B;  2ABL A;  1WFW A;  4F14 A;  1N5Z A;  1U06 A;  4J6W A;  1NJI U;  3JB9 H;  3LLR A;  1VQ4 A;  3ASK A;  2AK5 A;  3G1J A;  1DJ7 B;  1ZX6 A;  3OS0 A;  1YJ9 Q;  4N4G A;  1VQ9 Q;  3REB B;  2LRQ A;  1YJW Q;  2RNA A;  1ZLM A;  2A36 A;  1KC8 R;  2CP2 A;  3M55 A;  1EX4 A;  3A8H B;  5EC7 A;  2DMO A;  3L2R A;  1V1C A;  4DBQ A;  1CKA A;  2O31 A;  1RAA B;  3A8O B;  2DPP B;  4RTY A;  3DB3 A;  4XTX A;  1ZHI A;  2VWF A;  3MEA A;  3I56 T;  3HFN A;  1FMK A;  3A8G B;  3MCA B;  2MMP A;  3VYH B;  3J81 E;  3A5Z B;  1W2B S;  5J3B A;  4R56 A;  1OX9 A;  1PSF A;  2E65 A;  2JT4 A;  4IIO A;  3D7S B;  2GTJ A;  1PD1 A;  2WSF E;  4M78 D;  1KJW A;  4FW2 A;  1M1G A;  2QGF B;  4C92 F;  2OTL Q;  2K79 A;  3VS5 A;  1K73 R;  1WHL A;  1M90 R;  3LH5 A;  4PJO G;  3TSZ A;  3OMC A;  1VQ7 T;  2QYZ A;  2E3I A;  1LVK A;  5GAM h;  2GCX A;  3LH0 A;  2XD0 A;  4KRT A;  1VQO Q;  3R6O A;  2D6F A;  1LOJ A;  4M7D A;  4XU3 A;  4Z88 A;  1T0H A;  4ATO A;  2Y4X A;  4E7H A;  2DRK A;  3C4S A;  3E2U A;  4HCC A;  2COW A;  3L2V A;  2FRY A;  1KC8 U;  1Y0M A;  1SEM A;  3EGX B;  2DBM A;  4OF1 A;  2LVM A;  4FL6 A;  3CCS Q;  4RTU A;  1FXX A;  3CME Q;  1QWF A;  2XMF A;  4OGE A;  1K4U S;  4JRI A;  1I81 A;  2DTH A;  1TH7 A;  4WTO B;  1K9M U;  5I22 A;  2RHI A;  1JJ2 S;  3X25 B;  3I56 A;  4C0D C;  2EGA A;  4QVZ A;  1IRE B;  2QQA A;  2K4Y A;  1GBQ A;  3OBY A;  4JJN K;  2NUT B;  3OYF A;  4N4H A;  4C8Q A;  3PE0 A;  2GF7 A;  2ZPI B;  1W2B P;  2DVJ A;  1VYU A;  3FB9 A;  1JEG A;  4M7D D;  4M7D E;  1E7O A;  2E4H A;  4ZGJ B;  2KT8 A;  1JXO A;  1VQ7 A;  2VV5 A;  1YCY A;  2RA2 A;  2YSQ A;  3GIB A;  3NPF A;  1VQM A;  2O4X B;  3QII A;  4DOV A;  3M58 A;  4RTT A;  2G6F X;  3V8K A;  2CH4 A;  3F70 A;  4CI0 C;  4FT2 A;  1QVF S;  3LGF A;  4KGZ B;  3CMA T;  4M77 B;  3SDZ A;  2RMO A;  3FC3 A;  2DKG A;  1CKB A;  4FYY B;  2RH2 A;  4C92 G;  2EGC A;  4KUD K;  4CRI A;  3M54 A;  2KEA A;  2A3L A;  2R5M A;  3OSV A;  2V1Q A;  1Y7X A;  1JB0 E;  3OYL A;  4RKU E;  2XID A;  4C8Q E;  4A63 B;  3HRT A;  1ZA1 B;  1ARK A;  2IPO B;  2CKK A;  3EFS A;  1V76 A;  1UE9 A;  2XK0 A;  1YI2 A;  4BI3 A;  4FYX B;  1AHJ B;  2HKQ B;  2EWN A;  4C0F A;  2KY9 A;  3LW5 E;  1PC0 A;  4EMK A;  2X4W A;  5CKE A;  2PVG B;  1JJ2 P;  1KQS A;  2LP5 A;  2V8I A;  4HVW A;  1HD3 A;  1KHI A;  9ATC B;  1M2V A;  1IO6 A;  1Y96 B;  2F1L A;  1M1K U;  1RI0 A;  4XTU A;  2HMA A;  2BE9 B;  5GAN g;  4EPC A;  2E6N A;  2NUZ A;  3WVD B;  2DFU A;  1WHG A;  1VA7 A;  1W1F A;  2JMC A;  2BZX A;  4X9C A;  2DXB A;  2FYK A;  3J80 E;  2CSI A;  3E9G A;  3E19 A;  1K73 C;  1M90 C;  3CMA A;  3CCQ T;  4M78 F;  1AWX A;  3FLG A;  1F1B B;  1IB8 A;  1EIF A;  4BDZ A;  2JM8 A;  4D8D A;  1QVF P;  3VRY A;  4FCY A;  3JB9 I;  2K7A A;  1W6X A;  3RUX A;  1K0X A;  4M7D C;  5IHN A;  4IIM A;  3QO3 A;  4OGC A;  2MF2 A;  4QW2 A;  3ZEH A;  3DLM A;  1Q82 U;  2DXU A;  1UTI A;  2RQT A;  4RG8 A;  1TSF A;  2HBW A;  3OB9 A;  1W70 A;  2LDM A;  4E7I A;  3QUI A;  2DK3 A;  1D3B A;  2J06 A;  1EFN A;  3QYG B;  4XTZ A;  3AHU A;  1G8X A;  2QK0 A;  2BKD N;  4L6V 5;  3SWN A;  1IGU A;  4BY6 B;  1G3T A;  2E64 A;  4PFZ A;  2ZZD A;  3X20 B;  2KYB A;  5GMK i;  2DXC A;  2D0N A;  2DAQ A;  1S72 Q;  4JRK A;  2M02 A;  3CXC P;  3RKY A;  2HQH A;  4J9D A;  4C5E A;  5CKF A;  2QTX A;  1Y57 A;  2CP5 A;  4KH0 B;  1U5S A;  1OV3 A;  1Q81 C;  1MMN A;  2DRM A;  4Z02 A;  1P92 A;  1ZUK A;  2CH4 W;  2KAF A;  1WDX A;  3U23 A;  3CCQ A;  5GMK l;  4HT8 A;  2ECZ A;  1N9S A;  1NLP C;  1HSQ A;  5DLQ E;  1KQ2 A;  1TWB A;  2KRO A;  3FRN A;  1YJ9 T;  1R77 A;  1OQK A;  1O9S A;  4HCB A;  2EVR A;  5I11 A;  4OML A;  1YJW T;  4M77 F;  4RUG A;  5A0D A;  4PJO D;  1UG1 A;  4V2S A;  1YCS B;  3CC4 Q;  3TU4 K;  1G5V A;  3MP8 A;  3EGD B;  1BIB A;  4AG1 C;  4C5H A;  1N6A A;  2L2P A;  3RIR A;  2KRN A;  1YWP A;  1VYT A;  2DF6 A;  1ZSZ B;  4M78 G;  3A1P A;  1PWT A;  4FYV B;  4EMG A;  2O01 E;  3JAM E;  1EZZ B;  3CCJ Q;  1RI9 A;  4C0Z A;  1M5Q 1;  2EQM A;  1YI2 Q;  1M4Z A;  4XTV A;  3PMI A;  3G6E Q;  4ZTF A;  4XTY A;  1J3T A;  2RI3 A;  2OTL T;  2FZC B;  1NZ9 A;  2HNI A;  1MV0 B;  1Q7Y R;  1IXD A;  4X9D A;  4C92 A;  2FEI A;  3QDR B;  4LDW A;  3VS3 A;  3JSC A;  3GLX A;  4RTX A;  2MYS A;  2RI2 A;  1VQO T;  1UJY A;  2LX9 A;  2D8J A;  1YFN A;  4XU0 A;  1X27 A;  1VQN Q;  4J5Y A;  1Y07 A;  5LJ5 d;  1Z9Q A;  1YJ9 A;  5KE3 A;  1YJN Q;  1VQ9 A;  4C5I A;  4OMO A;  1YJW A;  1YBY A;  4Y28 E;  3CCS T;  3CME T;  5KYN A;  3MPU B;  5J26 A;  4A53 A;  2FPF A;  3LX7 A;  2ZPB B;  1JBM A;  3OS2 A;  1YIT Q;  3M0U A;  2XIC A;  1WHH A;  3RKW A;  2RHU A;  1SRM A;  4JPB W;  1NM7 A;  1KQS S;  1SG5 A;  3H0I A;  5KYU B;  3VS0 A;  2FZG B;  3NTK A;  2KRS A;  3V8J A;  2LT1 A;  5GAN 3;  4M77 G;  4ELZ C;  4C92 E;  5IHI A;  1WGS A;  4OMP A;  1D0X A;  1XQH A;  2JTE A;  4AT1 B;  1Q7Y U;  1G3Y A;  4E7J A;  3MEW A;  4HXJ A;  4PJO C;  2V1R A;  3LGL A;  2OTL A;  2QDL A;  3QBY A;  1D0Y A;  2B8A A;  3CPF A;  1LPL A;  2K5F A;  1B07 A;  2MIO A;  2VB6 A;  1VQO A;  2QQR A;  2PUK B;  4LE9 A;  5M9O A;  3QDF A;  1NG2 A;  3QWX X;  2M51 A;  2QAS A;  4BE0 A;  1ABQ A;  5ECA A;  3JCM c;  5DM7 R;  3FEO A;  2ROT A;  2RQW A;  2HL5 C;  5FU6 B;  1BB9 A;  4MML A;  1K8A R;  2H3E B;  3VS6 A;  1N9R A;  3JCM g;  2AT1 B;  2ED1 A;  3CME A;  5IXF A;  1JXM A;  2DET A;  3I35 A;  2KE9 A;  1ZQ1 A;  2LQK A;  1IZ6 A;  1I8F A;  2K5L A;  4XAX B;  4OB1 B;  3V7S A;  2DD4 A;  3PTA A;  1QLY A;  3SHW A;  1KD1 C;  2OAW A;  2IIM A;  5LJ5 j;  4JJB A;  4FW1 A;  2YUP A;  2FRW A;  1T3S A;  2FO0 A;  2W10 A;  4ORZ A;  1KQS P;  2LNH B;  2QEX Q;  2O9S A;  4CC7 A;  1QCF A;  3CBO A;  1I0C A;  3OSS C;  1WPY A;  3JCM J;  1KQ1 A;  1X6B A;  2F5K A;  4ZGE B;  3L2U A;  1OEB A;  2DM1 A;  3T9N A;  1KIK A;  2DJZ A;  3TEE A;  3IQL A;  2PVD B;  1NEG A;  2AIR B;  1B7T A;  1HK9 A;  1O75 A;  2YT6 A;  4DOW A;  2RO0 A;  1KSW A;  5GAM e;  2DEQ A;  3QHS A;  1JRI A;  1ZUY A;  4VUB A;  5KE2 A;  2OTJ Q;  3ZFJ A;  2EFI A;  5FRN A;  2P0K A;  3CQT A;  3A8M B;  1IGQ A;  1VIF A;  4M78 A;  1TG0 A;  3JV3 A;  4EDU A;  5CCA A;  3VU3 C;  2VVK A;  1VQL Q;  2O9V A;  3E9F A;  5FLX E;  4FYW B;  2OI3 A;  2IG0 A;  4RG2 A;  2VXF A;  8ATC B;  2RN8 A;  3EGX A;  2LC4 A;  4RTV A;  2EKO A;  3UA6 A;  1G3W A;  3TCJ A;  4AFQ C;  3M0T A;  4JLI A;  1SPK A;  3PNW C;  3PVQ A;  1W4S A;  3VRZ A;  4FU6 A;  3CD6 Q;  1NLO C;  2CT4 A;  2H3J A;  2O2O A;  1T0J A;  1GBR A;  1K9M R;  3I5S A;  4ZGD B;  1QQJ A;  3RES A;  1LJO A;  2EQK A;  2D1X A;  1S72 T;  2DXT A;  2JVV A;  3GP8 A;  2LTO A;  4M78 E;  2V26 A;  5GAN j;  4CC3 A;  3V7R A;  4L59 A;  1WI7 A;  1BI3 A;  2F69 A;  1ACM B;  1KHC A;  1VQM T;  3OYA A;  3OYK A;  2DL3 A;  3LWI A;  2COY A;  3L42 A;  5A2Q E;  3EFO B;  3EFR A;  2GQI A;  4AG2 C;  1KK7 A;  2CT3 A;  3THK A;  4BE1 A;  3QJ6 A;  1BI1 A;  5GJV B;  4CC4 B;  2YUN A;  2XG8 D;  5KYX A;  4JZ3 A;  1IHW A;  5C6S A;  4J9H A;  1N8R R;  5GAN 8;  3CC4 T;  4GY5 A;  5KH6 A;  3M59 A;  4M77 A;  1K8A C;  2GFA A;  3QZ5 B;  4HCZ A;  2EQJ A;  3CCL Q;  1WJQ A;  5L23 A;  1H3H A;  2VKN A;  1QVG S;  2EJG A;  4OMN A;  3CCV Q;  1QWE A;  2NLU A;  3EG3 A;  1QMC A;  5LJ5 g;  2SRC A;  4F04 B;  1C0M A;  3OYN A;  1X75 C;  3OYJ A;  2KVQ G;  1NJI C;  3VUZ A;  3CCJ T;  2C0O A;  1YI2 T;  5D7U A;  2KK4 A;  3G6E T;  3BE3 A;  5LJ3 e;  2LQW A;  1K1Z A;  2XDD A;  3S3O A;  2YUO A;  3INZ A;  1S72 A;  4FT4 A;  3MEV A;  5GAM f;  1NEB A;  2GGR A;  1Y96 A;  2ZPH B;  5IHK A;  2LQ8 A;  2XDB A;  4MZP A;  2XHC A;  1M1K R;  4D6W A;  4NL2 A;  4BUG A;  1BU1 A;  4M77 D;  3MEU A;  1MMD A;  4M77 E;  1K76 A;  3OYY A;  4PJM A;  5FRO A;  1VQN T;  3QKJ A;  4F7U F;  3PIO A;  4BI8 B;  1NYG A;  5L8R E;  2ZPF B;  4GBQ A;  1YJN T;  2HBP A;  1N8R U;  3NFC A;  3RMQ A;  1GFC A;  4HKE A;  3CCU Q;  1QCO A;  2XKO C;  3CC4 A;  2VXE A;  3O5Z A;  3CCM Q;  4TVR A;  4DBH A;  5EG2 A;  1JQQ A;  2FL7 A;  1YIT T;  1U1T A;  4M78 C;  2AZS A;  3OYG A;  4FSX A;  3NTH A;  1H92 A;  3OYH A;  1VQ5 Q;  1KFZ A;  4GLK A;  5CVI A;  3M56 A;  4J7F A;  1ABO A;  1QVG P;  2BE7 D;  2QA4 Q;  3EG0 A;  3CCJ A;  2DER A;  1V29 B;  3HRU A;  1UGQ B;  4D8K A;  2LZ6 B;  1Q82 R;  1KC8 C;  2C0T A;  3G6E A;  2X4X A;  1RAB B;  3JCM Q;  3ER0 A;  2EYX A;  2KMT A;  5LJ3 h;  3BFM A;  4E47 A;  2DL5 A;  1PSE A;  3CC7 Q;  2F2V A;  3OA6 A;  1BBZ A;  1K9M C;  1C6V X;  3V7C A;  4MMK A;  3CXC S;  2RJE A;  4FM4 B;  3H8Z A;  1YIJ Q;  2KR3 A;  4C8Q B;  1VQN A;  4Y92 A;  3EGU A;  4BDY A;  3EG9 B;  4OB2 B;  5IH2 A;  1YJN A;  2X35 A;  1S1N A;  4F17 A;  2HL3 A;  2KBT A;  4YTL A;  2GBQ A;  5KYW B;  3OMG A;  3UAT A;  2E5Q A;  4HVV A;  2DBK A;  1HYO A;  2JNG A;  3JRZ A;  5I2M A;  1YWO A;  4NS5 A;  3QWY A;  4N4I A;  1TUC A;  2YRD A;  3RNJ A;  3EAE A;  2L3R A;  4BAC A;  5GMK j;  3TSW A;  2BZ8 A;  5HKC A;  1YIT A;  3CPW A;  6AT1 B;  3LWH A;  4QVD A;  1G3S A;  2MK5 A;  4E7K A;  3UPU A;  4BD3 A;  3CCR Q;  1BKB A;  4E6R A;  3S3N A;  4JS5 A;  3J7A F;  3PGG A;  4F7U G;  1SRL A;  5FU7 B;  1M1F A;  4M77 C;  1I1J A;  3EGD A;  1PKS A;  3C12 A;  5LJ3 f;  5GAN 7;  4QQD A;  1VQK Q;  2QEX T;  3GBQ A;  2ZGW A;  2P4T A;  5GAO l;  3I55 Q;  2JS2 A;  1SKU B;  1ZSZ A;  4EIK A;  4LDU A;  4PJO A;  3VS7 A;  2K5I A;  4KGV B;  5LL6 S;  4E7S A;  1M3A A;  2ENM A;  2AKL A;  1MUZ A;  2NWM A;  3BW1 A;  2H8H A;  2FG0 A;  5GAM d;  2B86 A;  1OPL A;  4M7A B;  3H41 A;  2P4R A;  3CCE Q;  3JCM X;  1PD0 A;  2QAZ A;  4A4E A;  2JXB A;  4EMK B;  1B34 A;  1RAI B;  2E1H A;  1UGS B;  2DTO A;  2FZK B;  2LX7 A;  1M2V B;  2OTJ T;  3E1S A;  1AWW A;  3DB4 A;  4J6Y A;  1X69 A;  2G3R A;  3FDR A;  2EQI A;  3HKS A;  2X9H A;  1NE8 A;  1H64 1;  2L3Q A;  1VUB A;  1M1K C;  3TQ7 P;  1OU8 A;  2YDL A;  5GAN h;  1YHQ Q;  2HDA A;  1UUE A;  1VQ9 T;  2DX1 A;  1SF9 A;  4PNO A;  2RPN A;  3VUB A;  4F16 A;  1TS9 A;  4EMH A;  4PJO E;  4AFZ C;  3G4S Q;  3MP6 A;  2HSE B;  5CKB A;  4B6M A;  2D0Q B;  2F2W A;  5J39 A;  1XNI A;  2D8H A;  1D1B A;  2MCN A;  3CD6 T;  2QEX A;  2DZC A;  1UHC A;  1NYF A;  1VOM A;  2HZY A;  2E5K A;  2EYW A;  1PM3 A;  4Y91 A;  2DD5 A;  1CSK A;  2CGH A;  1RAE B;  1AWJ A;  2RJF A;  1SSH A;  4DQ2 A;  2FPE A;  2P84 A;  1Q82 C;  2YRC A;  3HL8 A;  2K9G A;  1YN8 A;  4LNP A;  1D3B B;  2MWO A;  1OZ3 A;  3P8H A;  2RM4 A;  3H6Z A;  5IAY A;  3MKD A;  4BE2 A;  4LD9 K;  3SWN B;  1K0S A;  2OTJ A;  2JTF A;  1MMA A;  1Q86 U;  1RAH B;  4BY6 C;  4OVA A;  2K3B A;  2LCC A;  3FJP A;  1AT1 B;  1LCK A;  3N5B B;  1FMW A;  1QW1 A;  1WNL A;  1XJW B;  2WSE E;  2P0Q A;  2RQU A;  1VQL A;  5IXB A;  1TOV A;  4J9C A;  1BCM A;  3UA7 A;  2M16 A;  3CCL T;  4OMF B;  3SD4 A;  2E6Z A;  3M5A A;  1VIE A;  4B9X A;  5GMK m;  2DL4 A;  2DYB A;  1WXB A;  4HA8 A;  4PLL A;  5LJ3 d;  2DTI A;  2K57 A;  2A37 A;  3CD6 A;  3HHT B;  2E12 A;  1MMG A;  4DEY A;  5CK9 A;  2LMJ A;  2RD1 A;  3H0H A;  4R0K A;  1WHJ A;  1U3O A;  1MND A;  4QQ6 A;  4J6X A;  5I21 A;  3JCM b;  3H0F A;  3NHN A;  3HP9 A;  2Y90 A;  3EHR A;  4Z89 A;  2AZV A;  3RBB B;  1AVZ C;  1WJS A;  1ZSZ C;  3EH1 A;  4RTZ A;  2DIG A;  1X01 A;  4M7A F;  5GAN 4;  1WX6 A;  5KYY A;  2QG9 B;  3GPL A;  4RTW A;  3EHQ A;  2PNI A;  3L2Z A;  1OPK A;  1AOJ A;  4HVU A;  4X34 A;  1TXQ A;  5CQX A;  1GRI A;  3M0Q A;  1RAF B;  4F7U A;  1YP5 A;  1OZ2 A;  2DIQ A;  3CCU T;  3V8L A;  2GTO A;  4C92 B;  1BK2 A;  2K2V A;  3CPW S;  4M75 B;  3CCL A;  3UT1 A;  2EKH A;  4FSS A;  2JOY A;  2Z0W A;  2PTK A;  3OS5 A;  4NL3 A;  3CCV A;  1VQ5 T;  2BUD A;  2CRE A;  3PFS A;  4IUP A;  4C8Q G;  3JCM e;  2R57 A;  2KXC A;  4OMM A;  1UFF A;  1I5L A;  4LUE A;  2JUF A;  2JZ2 A;  4LN2 A;  4IUT A;  2ESW A;  3PVL A;  4N0A C;  2GQV A;  1PCX A;  2KYM A;  1G2B A;  3RR6 A;  1RLQ C;  5HY6 A;  2J6F A;  3O8V A;  4E7Z A;  3VS1 A;  2LNV A;  3CC7 T;  2HD0 A;  3MO8 A;  2YHT A;  4C5G A;  3QYH B;  1WQ7 A;  2RHZ A;  1QP2 A;  4FIB A;  3OYB A;  5CQY A;  2KI7 A;  4AFS C;  4F7U E;  1OOT A;  4A4G A;  1YIJ T;  2E10 A;  1K9A A;  1WHK A;  4IUV A;  1Y71 A;  2IVW A;  1VQ8 Q;  4A4H A;  3RDV A;  1JO8 A;  1MHN A;  2COZ A;  2CZ6 B;  4KBM B;  3TRE A;  4J9G A;  1WQW A;  5GAM g;  2E70 A;  5IN1 A;  2LJ1 A;  2L89 A;  4PJL A;  1Q7Y C;  3CCU A;  4PJN A;  2FHD A;  2LCS A;  3CCM A;  3L2Q A;  2PVO B;  3EFO A;  3HTR A;  1PRL C;  2RK2 A;  2BTT A;  4M7A G;  3UDC A;  3AT1 B;  1UHF A;  3OYC A;  1XTD A;  1X2K A;  4QQG A;  3CPW P;  3CCR T;  4JLG A;  1UB4 A;  1VQ5 A;  2X3W D;  4OB0 B;  4ANJ A;  1FX7 A;  2QA4 A;  4LDX A;  3M57 A;  3PT9 A;  2YUQ A;  1VQK T;  2MOX A;  2W0Z A;  3JCM h;  2P0P A;  2D9T A;  1TU0 B;  3I55 T;  3OW2 A;  1NPR A;  3RKX A;  2HCK A;  2PUO B;  3EG1 A;  4KH1 B;  2PU9 B;  4A4K A;  4LXC A;  2R58 A;  1XOV A;  1TTH B;  3CC7 A;  1H8K A;  4C0D B;  5CR2 A;  4DA4 A;  5CO7 A;  4JDS A;  4J8O A;  3CCE T;  7AT1 B;  4MZM A;  4OMQ A;  3NGP A;  1AZG B;  3GF5 A;  4PKC C;  2EJ9 A;  2VGN A;  2NUT A;  1JU5 C;  1YIJ A;  3HPW A;  2QQ9 A;  2DO3 A;  2VGM A;  5GAN 5;  1PNJ A;  1KG1 A;  2EIF A;  2DL7 A;  4JJD A;  4E7L A;  1VQ6 Q;  1UJ0 A;  2NUP B;  4IUQ A;  5GAN 6;  2L3P A;  5KCH A;  2LJ3 A;  2GNC A;  3PMT A;  2O4X A;  1YHQ T;  3OYM A;  3G71 Q;  3FIF A;  2CZ1 B;  5A0G A;  5FW9 A;  3CC2 Q;  1TUD A;  1AWO A;  1FYN A;  2RHX A;  3CCR A;  3G4S T;  4IKF A;  3JCM f;  3UWN A;  4M75 F;  1WIE A;  1D0Z A;  2MAM A;  1UDL A;  4KUL A;  4ZTJ A;  2L5Q A;  3G7Z A;  4BB7 A;  1SHF A;  4ELY C;  4ZNX A;  1VQP Q;  1X2Q A;  4M78 B;  1VQK A;  4AMC A;  2GFU A;  2AKK A;  3I55 A;  1Z9Z A;  1M30 A;  3MJX A;  5GAO r;  2EBP A;  3M0P A;  2XDP A;  3M4Y A;  2X4J A;  2DNU A;  1QCN A;  3CCE A;  2ZCF B;  2A7Y A;  4PL6 A;  3JB9 F;  5LJ5 e;  2BIV A;  2OJ2 A;  4L5G A;  4A4F A;  2KSS A;  5LJ3 g;  3QPH A;  1FWZ A;  3VKI A;  2VYT A;  2L3S A;  2I0N A;  2ED0 A;  5I2S A;  2MI6 A;  3QXE B;  2QXF A;  5DY9 A;  5DLO A;  4AFU C;  2JTM A;  1Q95 G;  2CS7 A;  3ZBD A;  4XQ3 A;  1X43 A;  2L0A A;  1BI0 A;  3FJ5 A;  1HXD A;  4A54 A;  1WHM A;  4J83 A;  1YHQ A;  1MGQ A;  4JS4 A;  3QJY A;  1RUW A;  1VYV A;  1K73 U;  3REA B;  1M90 U;  3L1A A;  2LCL A;  3EG9 A;  2V8K A;  1Q81 R;  5KYW A;  1GCP A;  2RJD A;  4QVC A;  1WXT A;  1BI2 A;  2YLC A;  3G4S A;  2VC8 A;  2VAS A;  3P8D A;  3M9Q A;  3GOX A;  2EJF A;  1T3L A;  2FPD A;  2HEQ A;  4M7D B;  1AEY A;  1SSF A;  4LUD A;  5KYX B;  3ULR B;  3P8B B;  4PFO A;  2J05 A;  2JJ9 A;  2I2L A;  1UGP B;  4K11 A;  3A8L B;  4KT0 E;  3NMZ C;  2KT1 A;  4X1V A;  3JCM W;  1WJR A;  2PQW A;  1IHV A;  4M75 G;  3WXM B;  3KBG A;  1VQ4 Q;  2LT4 A;  3RMS A;  5LJ5 h;  3I5R A;  4C8Q D;  1UGV A;  2JN0 A;  3UF4 A;  2EYQ A;  2M0O A;  1WYX A;  2DLP A;  4M7A A;  3M53 A;  2J6O A;  5GAO p;  2E41 A;  3HSB A;  4C0G A;  2CP0 A;  1OI1 A;  5HK0 A;  4HT9 A;  1Q81 U;  3KFV A;  3A98 A;  2FB7 A;  2KGT A;  2RQV A;  1I5O B;  3JB9 G;  2C06 A;  3X28 B;  2CUB A;  4WCI A;  4KGX B;  4GLM A;  5GAN e;  2LJ0 A;  2EAY A;  2OAU A;  4BI4 A;  2A08 A;  2V8J A;  3JCM d;  2X4Y A;  3RER A;  1I07 A;  2HAX A;  1GCQ A;  1RAD B;  1X6O A;  1AZE A;  3DLL A;  5GAO n;  2PZ1 A;  3URG A;  2RHY A;  2DEU A;  4Z8A A;  2JS0 A;  2WSC E;  4LDY A;  3OW2 S;  1N8R C;  2MPX C;  2KNB B;  2CYZ B;  1BCO A;  1I4K 1;  4MZT A;  4QKU A;  5LJ5 f;  1UEB A;  1AD5 A;  3CBP A;  4M7A D;  1OX8 A;  3SEM A;  4ZN1 A;  4M7A E;  2K2M A;  4J9B A;  1RAC B;  2CP6 A;  2KQW A;  1WA7 A;  3KUF A;  4XTW A;  1C1A A;  4NOY A;  2X3X D;  1QKX A;  3MHX A;  2M0Y A;  2VUB A;  3QG1 A;  1WXU A;  2K3X A;  4XK8 E;  3X24 B;  2WAC A;  1VQ8 T;  1ZUU A;  2EPD A;  3SFM A;  4J9I A;  3GNF B;  2QI2 A;  2OX7 A;  1N27 A;  3I56 Q;  4DBF A;  2XU8 A;  3ZL7 C;  2E3H A;  1M8V A;  4IUU A;  2RB6 A;  8AT1 B;  1Q86 R;  2L8D A;  5GJW B;  2ZAE A;  2EQU A;  1TUG B;  1VQL T;  4JRQ A;  3PIP A;  1SHG A;  2K3Y A;  3QSU A;  4C8Q C;  2CUD A;  4RCC A;  4PLI A;  2A28 A;  3VYG A;  1MNE A;  2CSQ A;  1E6H A;  1VQ7 Q;  3C95 A;  2EW3 A;  1A0N B;  1VQM Q;  5CIU A;  1M3C A;  4N0A A;  2CP3 A;  4ESR A;  4M7D F;  3OW2 P;  3JCM P;  2MWP A;  2DZ9 A;  4MDW A;  1KD1 R;  5FWC A;  4RMO A;  4IUR A;  1U1S A;  3OQ5 A;  2O88 A; 
#chains in the Genus database with same CATH homology
 2LP5 A;  2CRE A;  4HVW A;  1HD3 A;  2DL3 A;  2DJQ A;  2EYY A;  1IO6 A;  2GQI A;  3R6N A;  3C0C A;  4AG2 C;  2KXC A;  4OMM A;  1UFF A;  2DIL A;  2J7I A;  2CT3 A;  3THK A;  4LUE A;  5GJV B;  4CC4 B;  2YUN A;  4JZ3 A;  2J6K A;  4LN2 A;  4J9H A;  2NUZ A;  2ESW A;  3PVL A;  2KYM A;  1G2B A;  1RLQ C;  2J6F A;  3VS1 A;  3VS4 A;  1VA7 A;  1W1F A;  2JMC A;  2BZX A;  5L23 A;  1H3H A;  2VKN A;  2CSI A;  4OMN A;  1QWE A;  2KXD A;  3EG3 A;  1QKW A;  4AFS C;  2SRC A;  1AWX A;  1OOT A;  1M27 C;  2JM8 A;  4D8D A;  1K9A A;  3VRY A;  2LQN A;  3EG2 A;  2C0O A;  2K7A A;  1JO8 A;  1W6X A;  1WLP B;  1K0X A;  4J9G A;  1GFD A;  1E6G A;  5IHN A;  2EYZ A;  2LQW A;  2BZY A;  4IIM A;  1K1Z A;  2LJ1 A;  1GCQ C;  2YUO A;  2JM9 A;  1GL5 A;  2LCS A;  1NEB A;  1UTI A;  1ZBJ A;  2GGR A;  2ROL A;  2RQT A;  1PRL C;  2JW4 A;  2BTT A;  4CC2 A;  5IHK A;  2HBW A;  1W70 A;  1UHF A;  1B3Q A;  1X2K A;  2J06 A;  1EFN A;  1BU1 A;  2X3W D;  1K76 A;  5HCK A;  1NYG A;  2YUQ A;  4GBQ A;  2MOX A;  2W0Z A;  2CDT A;  1G83 A;  1X6G A;  2DL8 A;  2KYB A;  1GFC A;  2DA9 A;  2F2X A;  2HCK A;  2D0N A;  3EG1 A;  3O5Z A;  4J9D A;  1XOV A;  1JQQ A;  1Y57 A;  1H8K A;  1U5S A;  1OV3 A;  1MV3 A;  2AZS A;  4OMQ A;  2HSP A;  1H92 A;  3NGP A;  1AZG B;  1KFZ A;  2DRM A;  1ZUK A;  2CH4 W;  1M8M A;  1WDX A;  3U23 A;  2ECZ A;  3M0S A;  1NLP C;  1ABO A;  1JU5 C;  1HSQ A;  2KRO A;  3EG0 A;  1M3B A;  1PNJ A;  2EGE A;  2EVR A;  2LZ6 B;  4D8K A;  4OML A;  5I11 A;  2C0T A;  2DL7 A;  4RUG A;  4JJD A;  1UJ0 A;  1UG1 A;  2L3P A;  1YCS B;  2EYX A;  2LJ3 A;  2RF0 A;  1PRM C;  2DL5 A;  4J9E A;  3VS2 A;  2GNC A;  3M0R A;  4J9F A;  4AG1 C;  4M4Z A;  2L2P A;  2KRN A;  1PKT A;  1YWP A;  1VYT A;  2F2V A;  1BBZ A;  2DF6 A;  5FW9 A;  4JJC A;  1TUD A;  3TVT A;  1AWO A;  1PWT A;  1FYN A;  1WIE A;  1UDL A;  2KR3 A;  1PHT A;  3I9Q A;  1RI9 A;  1SHF A;  4Y92 A;  3EGU A;  2RQR A;  4ZNX A;  1X2Q A;  5IH2 A;  1S1N A;  2KRM A;  4F17 A;  2KBT A;  2GBQ A;  3UAT A;  2AKK A;  2C0I A;  4HCK A;  1J3T A;  1Z9Z A;  1M30 A;  1ZSG A;  4HVV A;  2DBK A;  4JZ4 A;  1YWO A;  3QWY A;  2EBP A;  1UEC A;  1TUC A;  3M0P A;  3RNJ A;  1MV0 B;  5FWB A;  2SEM A;  2DNU A;  2FEI A;  3TSW A;  2BZ8 A;  3VS3 A;  4RTX A;  1UJY A;  2OJ2 A;  2D8J A;  4E6R A;  1X27 A;  1SRL A;  1I1J A;  2L3S A;  2I0N A;  1PKS A;  1Z9Q A;  2ED0 A;  2JMA A;  4OMO A;  3GBQ A;  2K6D A;  1YNZ A;  2JS2 A;  4AFU C;  4EIK A;  2FPF A;  3VS7 A;  1HJD A;  2ENM A;  1M3A A;  1X43 A;  2L0A A;  2AKL A;  3FJ5 A;  1MUZ A;  4QT7 A;  2NWM A;  4DEX A;  2H8H A;  2FG0 A;  2B86 A;  1OPL A;  3M0U A;  1RUW A;  1VYV A;  3REA B;  2DE0 X;  2P4R A;  3H41 A;  1RLP C;  2JXB A;  2ABL A;  1WFW A;  4F14 A;  1GCP A;  1SRM A;  1N5Z A;  1U06 A;  1NM7 A;  1WXT A;  4JPB W;  3H0I A;  2LX7 A;  3VS0 A;  2AK5 A;  2KRS A;  1ZX6 A;  3REB B;  1AWW A;  5IHI A;  2RNA A;  1X69 A;  1ZLM A;  2EQI A;  1T3L A;  2FPD A;  2HEQ A;  4OMP A;  2A36 A;  2L3Q A;  1AEY A;  4LUD A;  2JTE A;  3ULR B;  4HXJ A;  5EC7 A;  2V1R A;  2YDL A;  2DMO A;  2J05 A;  2QDL A;  1V1C A;  4K11 A;  1CKA A;  2O31 A;  3NMZ C;  2HDA A;  1UUE A;  2KT1 A;  2DX1 A;  4RTY A;  4X1V A;  2RPN A;  2VWF A;  4F16 A;  1B07 A;  2MIO A;  1FMK A;  4LE9 A;  4AFZ C;  1NG2 A;  3QWX X;  2M51 A;  1ABQ A;  2F2W A;  5ECA A;  3I5R A;  1UGV A;  3UF4 A;  2ROT A;  2RQW A;  2D8H A;  1WYX A;  1BB9 A;  2JT4 A;  4IIO A;  2GTJ A;  3VS6 A;  2DLP A;  2MCN A;  1KJW A;  1UHC A;  2J6O A;  1NYF A;  2ED1 A;  2E5K A;  2EYW A;  5IXF A;  1JXM A;  2K79 A;  3VS5 A;  3I35 A;  2KE9 A;  3LH5 A;  3TSZ A;  1CSK A;  1AWJ A;  1SSH A;  2FPE A;  3KFV A;  1QLY A;  3A98 A;  4KRT A;  2KGT A;  2RQV A;  3SHW A;  2OAW A;  2CUB A;  4WCI A;  2IIM A;  2K9G A;  1YN8 A;  4LNP A;  4GLM A;  2LJ0 A;  4Z88 A;  4JJB A;  1T0H A;  2YUP A;  2A08 A;  2FRW A;  2DRK A;  1T3S A;  1I07 A;  2FO0 A;  1GCQ A;  2FRY A;  1AZE A;  2W10 A;  4ORZ A;  1Y0M A;  1SEM A;  1K0S A;  2PZ1 A;  2LNH B;  2DBM A;  2O9S A;  4RTU A;  4Z8A A;  2JS0 A;  1QCF A;  1QWF A;  2K3B A;  4CC7 A;  1I0C A;  2XMF A;  1X6B A;  1LCK A;  1K4U S;  2KNB B;  1OEB A;  2DM1 A;  1KIK A;  2RQU A;  5IXB A;  3IQL A;  1NEG A;  5I22 A;  1AD5 A;  3SEM A;  4J9C A;  3UA7 A;  2K2M A;  2EGA A;  4J9B A;  2YT6 A;  1KSW A;  1WA7 A;  1GBQ A;  1ZUY A;  2X3X D;  2DL4 A;  2DYB A;  1QKX A;  1WXB A;  2M0Y A;  1WXU A;  3CQT A;  3PE0 A;  2DVJ A;  2A37 A;  1VYU A;  1JEG A;  1ZUU A;  2EPD A;  1TG0 A;  3JV3 A;  4J9I A;  1E7O A;  4DEY A;  2KT8 A;  2VVK A;  2LMJ A;  1JXO A;  4R0K A;  3H0H A;  2O9V A;  1U3O A;  2YSQ A;  3NPF A;  2OI3 A;  3H0F A;  3NHN A;  4RTT A;  2G6F X;  2CH4 A;  3EHR A;  2RN8 A;  3ZL7 C;  4Z89 A;  2AZV A;  4RTV A;  3UA6 A;  3RBB B;  1AVZ C;  4RTZ A;  4AFQ C;  5GJW B;  3M0T A;  1WX6 A;  1SPK A;  3PVQ A;  3VRZ A;  1SHG A;  2RMO A;  1CKB A;  4RTW A;  3EHQ A;  2CUD A;  1NLO C;  2CT4 A;  2PNI A;  1OPK A;  1AOJ A;  2EGC A;  2A28 A;  2O2O A;  1T0J A;  4HVU A;  1GBR A;  2CSQ A;  1E6H A;  2KEA A;  1GRI A;  2V1Q A;  3I5S A;  3M0Q A;  2EW3 A;  1A0N B;  1YP5 A;  1M3C A;  4ESR A;  2D1X A;  4A63 B;  2GTO A;  1BK2 A;  1ARK A;  1UE9 A;  5FWC A;  4CC3 A;  2EKH A;  4FSS A;  1WI7 A;  2PTK A;  2O88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...