1M1KR

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1m1kR00
3CCMQ 1VQPQ 1YITQ 2QA4Q 3CCVQ 3CC7Q 1VQKQ 1W2BP 1M90R 3CCEQ 1S72Q 1KQSP 3CC4Q 1YJ9Q 3CPWP 1VQNQ 1KC8R 3CCJQ 1YJNQ 3CCUQ 1VQ9Q 3G4SQ 1Q7YR 2OTJQ 1M1KR 3CCLQ 1YI2Q 3CMAQ 1K73R 1JJ2P 1Q86R 1NJIR 1YJWQ 1KD1R 1VQ5Q 1YHQQ 1VQ6Q 1VQOQ 3G6EQ 1Q81R 3G71Q 1VQ7Q 1VQLQ 3CD6Q 1QVGP 2QEXQ 3CCQQ 3I55Q 3CXCP 3OW2P 1YIJQ 3CCRQ 1QVFP 2OTLQ 1VQ4Q 1VQ8Q 3I56Q 1Q82R 3CCSQ 1N8RR 1K8AR 1K9MR 1VQMQ 3CC2Q 3CMEQ
chains in the Genus database with same CATH superfamily
5CCAA 5KYXA 2C0TA 4LNPA 1QCOA 3RKWA 2QG9B 2HL3A 1KQSS 1QVFA 3NTKA 3CCLQ 1JEGA 5CAIA 5LJ3e 2EFIA 4EMGA 2E5QA 2QQAA 4XK8E 3MO8A 2BZ8A 3RKXA 4HXJA 4EIKA 1Q82R 1YI2A 1AT1B 3VRYA 1X6GA 2AIRB 3NHNA 3OYGA 5DY9A 2V8KA 1AVZC 1QWFA 4M77D 1SPKA 1UHFA 2HQHA 1BIAA 1PRLC 2O88A 1QMCA 5I2SA 2O01E 4AG1C 2CREA 2CGHA 2QASA 1XOVA 1RAHB 2XD0A 1RAFB 2PQWA 2DKGA 2EPDA 2LDMA 2CP0A 5GAMf 1QVFP 3CCEA 3I56Q 2RHUA 1YWPA 2CZ0B 2XU8A 2DL3A 2JT4A 2DEUA 3CCLT 2LQNA 2E5KA 1WQ7A 3QWYA 4M78G 4M75D 3HTRA 2DL7A 2Z0WA 1N8RU 3C95A 5GANj 4M7DD 2BE7D 1X75C 2KR3A 3QWXX 2QGGA 4IUVA 1VQ5T 4ZGEB 3MEAA 2X9HA 1ZHIA 1AZEA 1PKTA 2ECZA 1EX4A 3CCQT 1UFFA 2C0OA 3DKMA 1RACB 2KI7A 3FDRA 3CC4Q 2FHDA 2KY9A 4AG2C 2MYSA 4PJOE 4M77E 4M75G 3CC4T 1QCFA 1I5OB 3VV0A 4J6WA 1OI1A 3OQ5A 2YWWA 3MKDA 2CYZB 3SHWA 2EYYA 4C0ZA 5GAN4 5LJ3d 4M77C 4QQDA 2ZPBB 2COZA 1H3ZA 1PM3A 2VC8A 2LT1A 4ZGJB 2EQMA 3X24B 1SEMA 4A4HA 1SKUB 4MZPA 4C0DB 4RKUE 3CC4A 2DTHA 4DA4A 2CZ6B 4ZN1A 3L2WA 3M53A 2KXCA 3JCMe 1G2BA 3JCMc 2LCCA 2F1LA 5J3BA 4ZNXA 2M1HA 3QJ6A 1M2VB 3LH0A 1GBRA 2VB6A 4M75A 1M1GA 1ACMB 3QBYA 2E10A 4J83A 4MMLA 1OX8A 4PJOC 1MMDA 5FW9A 1Y96B 2DEQA 3QO3A 2A36A 1ZLMA 3BDUA 1MV0B 3FEOA 2K3BA 4FYXB 2HEQA 1YJNA 3UA6A 3HRUA 4AFUC 5FU7C 1AWWA 4KGZB 1Q81R 4OMOA 4EMKA 3CD6T 1HJDA 2FYKA 1KSWA 1YP5A 3EG3A 3CMEQ 3CC2Q 3VS5A 2DJQA 2KK4A 4PJNA 1K4US 5FRMA 4PJOD 2H3EB 5FU6C 5CKFA 8ATCB 2CS7A 3VS2A 2LNVA 2PTKA 3CCJA 3OYCA 5GAMe 3BDLA 4UC4A 3JCMX 2GBQA 2JW4A 1MNEA 4A4GA 4CC2A 1VA7A 1NEGA 2BUDA 1WDXA 5GJWB 1GFDA 2QEXT 2QQRA 4XTVA 4C8QD 2P84A 1H92A 4HKEA 2XI9A 1NPRA 1KJWA 2EW3A 1V1CA 4GY5A 4PJMA 1V76A 2JTMA 1M2OA 3CPFA 1B34A 3VS3A 4HCZA 4LN2A 4HCCA 5CKBA 1HXDA 3I9QA 1IGQA 1OULA 3UT1A 1YJ9Q 2X4WA 3VJPA 2W0ZA 2YT6A 1OU8A 4PK4A 1YJ9T 5LJ5j 3MEWA 1W2BS 2X4XA 1PHTA 1SF9A 2DMOA 4J9DA 5D6YA 1VQMT 3EHQA 3DB4A 3C4SA 4M78A 4PJLA 4KGXB 5GAOn 1E7OA 3TVTA 5LJ5f 1GCPA 1D0XA 3CCEQ 8AT1B 2B8AA 4LUDA 4F17A 2OI3A 4F7UF 5FU7B 2RB6A 2FEIA 1YJ9A 2ROTA 3TQ7P 2X35A 3JCMf 3AHUA 2CP7A 2QQBA 3LX7A 3RUXA 2HSEB 1K0XA 1R8OB 4OMQA 1KQ2A 2BZXA 1M90R 4Z8AA 4AFZC 1QVPA 1WNLA 4XU2A 3FB9A 3OA6A 1VQ8T 5GANh 1VQ6Q 3EG0A 4FIBA 4Z89A 2K7AA 5M9OA 3VS1A 1PD1A 4KBMB 1RAIB 4R0KA 1K9MR 2E12A 1BI1A 1FMKA 4BI3A 3ZFJA 1O9SA 3DLMA 1IRXA 4JS5A 1GFCA 4C0DC 1M90C 1ZX6A 2GCXA 3A5ZB 2OAWA 3OYEA 4VUBA 3I55A 2YUNA 1RABB 1VQ8A 2JUFA 5AT1B 5GAOp 2OTJT 3G1JA 4ZN3A 3WVEB 3GBQA 1ARKA 2RF0A 1QP3A 1F1BB 1QKXA 2J6FA 2AHJB 1ZUYA 4M78D 1TH7A 2L3RA 3A8MB 4C0FA 1UB4A 4M7DG 1U8RA 4PL6A 4LXCA 1MMAA 4E47A 4C92D 1YIJT 3UF4A 2EIFA 4F7UB 3G6EA 2JVVA 2DM1A 2EGCA 3NMZC 2VV5A 5D6WA 5KYXB 1PKSA 3NGPA 1X01A 3CCST 1HYOA 2M51A 5HK3A 2YDLA 2KGTA 4M7DB 2QTVA 3N5BB 1WYXA 2L2PA 2AZSA 3PFSA 2GFAA 4F7UG 3FIFA 4LUEA 4LD6A 1VQ7Q 2FZCB 4X1VA 2CP5A 3JSCA 3M55A 2HDAA 4C8QB 2CUDA 4C92C 5CQYA 1WHMA 3EFOB 2FRWA 2FB7A 1SHFA 4ANJA 1RAEB 1D1BA 2B86A 1BB9A 2CZ7B 3MEVA 3V8LA 1YJNQ 1SG5A 3M5AA 1AWJA 1D3BA 2L8DA 3SD4A 4D6WA 3L2ZA 2RQWA 2RJCA 4XTYA 4IUQA 3VS6A 1W70A 4J6YA 2ZPFB 4C8QA 4M78B 3LGLA 4TVRA 2XDDA 4PJOA 1PC0A 3CMEA 2OTLT 2LQ8A 5GAN7 1JJ2A 4EMHA 3PVQA 1T0HA 3GNFB 1WJRA 1UUEA 4JUVA 3LLRA 1D1CA 2VGMA 2BTTA 2LQKA 2ED0A 3A98A 2F5TX 1W1FA 3EAEA 2X51A 2OX7A 3J80E 2MWOA 1RLQC 5DM7R 4N4GA 1LVKA 4CC3A 2JS0A 1VQKQ 1EZZB 5LJ3j 3FRNA 4RTWA 5GAN2 5A0DA 1KG1A 1WA7A 2CSIA 2EKOA 2H8HA 5KYWB 3I56T 1PSEA 1B34B 2LMJA 2CKKA 4BE1A 1QVGP 3MJXA 2PVGB 5IT9E 1YHQT 3J81E 2EYXA 3CCVA 2MK5A 2RHZA 1M3BA 3M0QA 2V26A 3OS5A 1VYUA 4IUTA 3QKJA 4M7DC 5FROA 4MDXA 3CMAQ 3KXTA 5HY6A 2PNIA 1QQJA 1OEBA 4KULA 3CXCP 2DVJA 5C0MA 3AT1B 5GMKe 2EYZA 5CR2A 2DBMA 2XKOC 1UDLA 3OYKA 3VU3C 3PGGA 5LJ3h 1NG2A 2FZKB 1RAGB 4B9XA 4OMMA 2CP6A 4LD9K 1MNDA 5A2QE 1NLOC 1YHQQ 1G5VA 2HQEA 5CKDA 2J6KA 1UGRB 2ED1A 2DTIA 2O2OA 2ZAEA 4II1A 1KHCA 2K3XA 1VQ6A 1GL5A 1WHKA 4JPBW 4RTUA 4RTYA 1BI3A 3QZ9B 3CPWP 2V1RA 4E7ZA 3CCMA 2W10A 5L8RE 1M1KU 1OV3A 2G6FX 4HA8A 4C5IA 4MMKA 1NZ9A 3EG1A 3CCRQ 2P4RA 1ZSZB 4XU3A 1QKWA 1VQPT 2XDPA 3INZA 1PSFA 2A7YA 3G4SA 3RDVA 4PFOA 4OMNA 1IHWA 2EKHA 2E3IA 1FX7A 1U1TA 2X4YA 2Y4XA 1UECA 2EJ9A 3I55Q 2R5AA 3GF5A 2K57A 3H9NA 4BUGA 5EG2A 1HD3A 3OYFA 2M0YA 1KC8R 2RMOA 2JZ2A 2NUTB 1VQ9Q 4M7AD 1VQ5A 2DIGA 3H8ZA 1B7TA 2P0KA 2CT4A 3CCQA 5GANe 3KFVA 3G71Q 5J26A 2DXBA 2YHTA 4B9WA 3SWNC 5I2MA 4WTOB 4P5NA 2RPNA 4AT1B 3TCJA 4OMPA 4J9CA 2DF6A 2DA9A 2LQWA 1FMWA 2Y4YA 2E4HA 3JCMh 3QJYA 1RI0A 1QLYA 1WZOA 5GANd 1IXDA 3BW1A 2COWA 1Q7YU 5GAN6 1YNZA 1K76A 4JJCA 3H0HA 3MP8A 1SSHA 1KIKA 4E7SA 4R56A 3VS4A 1Q81C 5CKEA 2YRCA 4BY6C 2RA2A 4J5YA 4QVZA 3PE0A 2MPXC 2HD0A 1EFNA 2R5MA 2FZGB 3P8DA 5LJ5e 2JS2A 2K5IA 2VVKA 4JRIA 4M4ZA 2PVDB 2DYBA 3T9NA 3UDCA 2DFUA 1AHJB 2P4TA 1LJOA 4NS5A 1TXQA 1BU1A 4PLIA 4CI0C 3PTAA 2AZVA 1KQ1A 3M0TA 3QYHB 3EGDA 2V8JA 2HL5C 2DYIA 1VYVA 4A4FA 3JCMW 3X28B 5I11A 3OSSC 4J8OA 2RK2A 4FCYA 3CCUQ 3M59A 2HAXA 2QAZA 3X20B 2R57A 1MHNA 2E65A 3PMTA 1I5LA 1PG5B 3GLXA 1JRIA 4FT2A 4C8QF 1FWZA 1RLPC 1W2BP 3CC2T 1U06A 2DD4A 1K9AA 1ZSGA 3OB9A 1TWBA 2MOXA 3HKSA 1R77A 3MCAB 1TSFA 3LH5A 2XMFA 1G8XA 2LZ6B 4K11A 3HFNA 4O5VA 4LDXA 3CCJT 2X3WD 5FU6B 4M78F 1VQKA 5GMKi 4A53A 2MI6A 4F14A 2JJ9A 3HRSA 3VRZA 4LDVA 4BE2A 1D0ZA 1UGSB 3JCMQ 1YWOA 1W2BA 2QEXA 1TUCA 2QA4A 1VQLQ 1W6XA 4ATOA 4J9EA 3OMCA 2RM4A 3OYIA 3S3OA 1QVGS 1RADB 2K5FA 2BE9B 4OB1B 4O6JA 3DLLA 1UJ0A 3QXEB 1UG1A 1ZBJA 1IB8A 2LRQA 1Z9QA 4NL3A 1B3QA 2FPFA 2CP2A 2FPDA 2D8HA 5LL6S 1M30A 2HBPA 3FJ5A 3SB2A 3L2VA 4BDYA 2DVEA 2LCLA 4JJBA 1FXXA 3EFOA 2FO0A 1VQMQ 3L1AA 2EYQA 1UHCA 1K9MC 2FRYA 2DLPA 4FW2A 2ZCFB 3CMAT 3QG1A 2QQ9A 1YCSB 2DIQA 1WHLA 3MP6A 2LJ3A 4M7AA 2HMAA 3VYGA 1GCQC 1IHVA 2GF7A 2K79A 3FLGA 1MMNA 3TSWA 3P8BB 3PIOA 1NLPC 1GBQA 2CH4W 4ELYC 2CP3A 3E2UA 4M77G 5KE2A 2C06A 2XIDA 3PMIA 5D6XA 2QTXA 3ZEHA 3QUIA 2KYBA 2E70A 1VQ7T 2DAQA 4DOWA 2KYMA 4M7AF 2EGEA 1I0CA 1WHJA 1I07A 4DBHA 2L3PA 4EMKC 3URGA 2E3HA 2D9TA 4PKCC 1IGUA 4ORZA 4NOYA 3EG2A 2CH4A 1UGPB 1D0YA 3QPHA 1R0BG 2ZGWA 2RQVA 3EHRA 2EGAA 1AWOA 1C0MA 1VQ5Q 2RJDA 3NPFA 4FL6A 3JCMP 4C5EA 5GAMd 2NYSA 3MEUA 4XU1A 1Q81U 4BDZA 5GAOr 4DEYA 1OZ2A 1JB0E 3UATA 2V8IA 2X4JA 2YRVA 4KH1B 2SRCA 3VKIA 2OTJA 4ELZC 3ZL7C 3G6EQ 1YITA 1KK7A 2EQIA 2EAYA 1YIJQ 3OW2P 3C12A 2JMAA 2AK5A 1WXTA 1X43A 1YN8A 3ER0A 2RHXA 4IUPA 2EVRA 2XG8D 3RESA 1VQLA 4GLMA 1YFNA 1BBZA 4JRKA 4M75E 4FM4B 2YLBA 1M9SA 2NUPA 1NPPA 2O31A 5KYWA 1Q86R 2FVUA 4IKFA 5ECAA 3UWNA 4QQGA 4RUGA 4A54A 2GNCA 1U3OA 1X2KA 4M7AB 1BI0A 5LJ3f 1FMVA 2E64A 1QVGA 2RQUA 1Q95G 2PVOB 2JMCA 2RH2A 3OYMA 5GMKh 5KE3A 1KQSA 1VQOQ 1ZSZC 1Q86C 1M8MA 4PJJA 1TU0B 3WXMB 4PLLA 1KD1U 5D7UA 2JM9A 3RKYA 1LPLA 3CD6A 4QVDA 3FC3A 1S72T 4Z88A 2LC4A 3J7AF 5GAMg 4RCBA 1M27C 4XQ3A 4N4HA 1K8AU 1NYFA 3CXCS 1UTIA 4LE9A 2MWPA 4C92B 1JXMA 2O4XA 1H3HA 2J05A 5A0GA 4JZ4A 2DX1A 5FWCA 2OJ2A 4OB2B 1I4K1 3QDRB 2SEMA 3ME9A 4YTLA 1VQOA 1GXIE 2I0NA 2E6NA 1I8FA 1YBYA 3CEYA 4N4IA 1KD1C 3TSZA 3NTIA 4C92G 4LDUA 2DK3A 1VQ4T 3H41A 3OYYA 1K73R 4M78E 3S3NA 2L89A 4F7UA 4DBFA 1YI2T 1K0SA 2DPPB 4E7KA 2A3LA 1ZA1B 1ABOA 1IREB 3E9FA 2QEXQ 1AWXA 3M56A 2KVQG 3H0IA 2R58A 4E7IA 2DO3A 2RD1A 2MMPA 5IXBA 1VYTA 4QQ6A 4RG2A 4R55A 2YUQA 1RL2A 1OOTA 3CXCA 4N0AC 3V7RA 3L42A 5GAMj 5GMKj 1KD1R 2CZ1B 3JCMg 2BKDN 3O5ZA 1KFZA 4M7AE 1UE9A 2JN0A 3HRTA 1VQ4A 2DD5A 3CCLA 2DL5A 3RMSA 1AOJA 1K8AR 2VGNA 3HPWA 1YITQ 2LJ1A 1XTDA 3GOXA 4AFQC 4E7JA 2J7IA 4OMLA 4IIMA 1VQNA 3OS0A 1MGQA 2AKLA 1JJ2S 1WXUA 2BIVA 3QDFA 1Y07A 2ESWA 1M3AA 2HNIA 1M2VA 2PUOB 3EFRA 4N0AA 3OMGA 5FLXE 5J39A 2YRDA 2DETA 4HCKA 1GCQA 2LTOA 1HSQA 3H0FA 2GGRA 2RHYA 4M78C 3OYJA 1CKBA 3I5RA 1X27A 3HL8A 3EH1A 4F7UE 1PRMC 1KC8C 3GNGA 3VUBA 3V7CA 3OYAA 3OYNA 5KYYB 2RI2A 2DE0X 3MPUB 4RTTA 1ZUUA 2RHIA 2VKNA 3CCMT 5FWBA 3JV3A 1OX9A 3JB9F 4OF1A 2VXFA 4KUDK 2M9UA 3L2RA 1U5SA 3MP1A 2L3QA 4RTVA 3SFMA 4M75C 3ASKA 1VQPA 3QHSA 3CCRA 3JB9I 3JCMd 5CK9A 2F5KA 3HHTB 3EGDB 1JU5C 1P92A 5DLQE 5IH2A 2RJFA 2EQUA 2D8JA 4LDYA 5CIUA 4J6XA 3NFCA 2ATCB 2ZZDA 1BIBA 2LJ0A 3JCMV 1X2QA 2KBTA 1SRLA 4FSSA 4KUIA 1BYMA 3E1SA 2EYWA 2KEAA 3IQLA 3OS1A 2A37A 5LJ5g 1GRIA 9ATCB 3NTHA 1AD5A 4M75F 1UJYA 4CRIA 4F16A 3THKA 2K2VA 1J3TA 3RBBB 2K9GA 5DLOA 2EQJA 2RQRA 1H641 4C8QG 4HT8A 3M57A 1Y57A 1G3YA 3RR6A 2DNUA 4JJNK 6AT1B 3VS0A 2MIOA 1VQ9T 2NWMA 1S72Q 1XJWB 3C94A 4XTZA 5LJ5h 3CC2A 1Q7YR 4J7IA 3UA7A 5GAMh 2XICA 1DJ7B 1OYXA 1OPLA 3CPWS 4OVAA 1ZSZA 1FYNA 2I2LA 4D8KA 4XAXB 5IHKA 5CVIA 4IURA 4BY6B 5EC7A 2JM8A 5LJ5d 1JO8A 3VYHB 4BI8B 1JXOA 2E6ZA 4A4EA 1VQ9A 2ZPGB 2WSCE 4Q5WA 5IHIA 1OU9A 1NJIR 3SWNA 1N27A 3JRZA 3OBWA 1Q7YC 2PZ1A 3EGUA 3I5SA 2D1XA 1W4SA 1UEBA 2VWFA 4HVUA 4WCIA 2QA4T 2DZ9A 1N9RA 2K2MA 1OPKA 1BKBA 1VQPQ 1VIEA 2L5QA 4M77A 4HT9A 2KE9A 4BD3A 2HBWA 1KQSP 4QW2A 4LDWA 1QP2A 3M4YA 2K5LA 2JOYA 4RG8A 2JXBA 3LWIA 3PIPA 3OY9A 2LX7A 3M58A 1NYGA 2ROLA 2RK1A 1XNIA 3I56A 2QDLA 3CCUT 1M90U 2E1HA 2LT4A 2GTOA 1WLPB 1YHQA 4C5GA 2YSQA 4OB3B 3KBGA 2HKNA 1TUGB 4OGEA 2J06A 5LJ3g 3RERA 4J9BA 4PFPA 4Y92A 3O8VA 5KCOA 1N8RC 3OBYA 2KT8A 3GPLA 2AT1B 1JQQA 3OYDA 2QK0A 2A08A 1PNJA 2RNAA 4F04B 2QYZA 2GQIA 1VQNQ 2NUPB 3CQTA 3CCUA 3JB9G 2DBKA 5FRNA 1WXBA 4DOVA 2RI5A 4KRTA 1ABQA 1KHIA 4M7DE 4EPCA 4DBRA 3M4GA 3F70A 1VQ4Q 3A8OB 2NUZA 2MAMA 4FYWB 2CSQA 3EGXA 2YXYA 4E2FB 4C8QE 5KCHA 4JJDA 2ZPIB 4FYVB 1WHHA 3TEEA 2RO0A 3A8HB 2QQSA 3UPUA 3VS7A 2NUTA 1VQ6T 3BY7A 1ZQ1A 3DB3A 2K3YA 4BI4A 1Z9ZA 4DEXA 5HK0A 1T3LA 3CCET 5GAOl 3QIIA 4OP0A 5GAN8 1TS9A 2BZYA 2YUOA 3V8JA 4C92A 5GAOm 3M0SA 5KYYA 1A0NB 1G83A 2KAFA 2NLUA 2QGFB 2HSPA 3CMAA 4E7LA 4PJOB 5GANg 5GAOq 2DXCA 1WX6A 2QDYB 3L2QA 3SDZA 4ESRA 2KMTA 1QWEA 3R6NA 2RJEA 1WPYA 4JLGA 4E7HA 1K1ZA 4M7DF 1NEBA 4Y91A 3P8HA 2XDBA 2JNGA 2O4XB 5KYUB 5GMKl 3HFOA 2OTLQ 1G3SA 4JS4A 2YLCA 2KRMA 4BE0A 1JBMA 4MZMA 2CDTA 1O75A 1VUBA 4M7DA 2YUPA 3JAME 1N6AA 1YJNT 1RUWA 2WACA 2KRSA 1M1KC 4ME7A 3CCSQ 4C0GA 3KUFA 2FPEA 1RAAB 3Q1JA 3CCMQ 1MUZA 2KSSA 2AKKA 2COYA 4J7FA 1M5Q1 5GAN5 1KC8U 2OTJQ 3X25B 2HCKA 1Y7XA 3CC7A 4JZ3A 1WQWA 1VIFA 3CMET 1BK2A 1M1KR 2FL7A 3E19A 3EFSA 3JCMb 2EJGA 3MHXA 4MZTA 3VUZA 1OQKA 1QW1A 2GTJA 2EBPA 2RN8A 2HZYA 4OGCA 1YITT 1S72A 1NM7A 4KH0B 4L59A 3OYHA 3RMQA 5IN1A 1CSKA 2HQXA 3QZ5B 4C8QC 2F69A 1OZ3A 2KROA 3CC7T 1UGVA 3REBB 2F2XA 3M0RA 3RIRA 2Y90A 2D0QB 4WF2A 3X26B 2EQKA 3CC7Q 1M3CA 4JLIA 3ZBDA 4E6RA 1M8VA 3REAB 1T0JA 2GFUA 2LVMA 2M02A 4XTUA 2JTEA 4J9IA 2KNBB 2O9VA 4NL2A 3JB9J 3M0UA 2DRMA 4DQ2A 1D3BB 3CCVT 2PUKB 1U1SA 3OYLA 4RTXA 1N5ZA 4KT0E 1K73C 4M75B 2WSFE 3G7ZA 5KYUA 3WVDB 3CPWA 2QI2A 5GMKm 1AZGB 2VASA 2MCNA 2EWNA 4CC7A 3OSVA 4M77B 3I35A 4JRQA 1ZUKA 3QSUA 1H8KA 4JDSA 4FW1A 4X9DA 4B6MA 2X3XD 4HVWA 4J9HA 3E9GA 3CBMA 1VOMA 3BE3A 4C5HA 4M7AC 4PFZA 1LNXA 1IZ6A 2L3SA 1VQ8Q 4OMFB 1G3WA 1K8AC 1LOJA 1UGQB 2QXFA 1AEYA 3U23A 1VQNT 2KT1A 5KYNA 4A63B 2P0PA 4RCCA 2A28A 1VQKT 4ZGDB 3EG9A 2DERA 3GIBA 2EJFA 4L5GA 1Q86U 1VQOT 4IUUA 2M16A 4QVCA 1XQHA 2E41A 3ULRB 1C1AA 2MF2A 5C6SA 3V8KA 1Y96A 5HKCA 2DXTA 1YJWA 1Q82U 4C92F 1K73U 1WI7A 1VQMA 4X34A 1WFWA 2OAUA 1M4ZA 2F2WA 3EG9B 3G4ST 4KGVB 2O9SA 3HSBA 1SSFA 2WSEE 3I55T 4ZTFA 2LX9A 1D09B 4OB0B 4D8DA 4HCBA 5L23A 5CQXA 2H3JA 3CBPA 4M77F 1YJWT 1PD0A 1EIFA 1MV3A 3PVLA 1Y71A 2IPOB 4EMKB 2P0QA 5IXFA 4PNOA 1YCYA 2IIMA 4FYYB 4DBQA 3S6WA 2G3RA 3CCRT 1SHGA 3CD6Q 1G3TA 2A0FB 3EH2A 4EDUA 3G6ET 1NBEB 1E6HA 2ENMA 5GJVB 1N9SA 2VUBA 2K4YA 3JB9D 1TUDA 3PNWC 3L2UA 5CKHA 3A8LB 3G4SQ 4GBQA 1IO6A 1X69A 3OW2A 1TOVA 1PWTA 4HVVA 2DTOA 5IAYA 3A1PA 2L0AA 1VQ7A 4X9CA 2D6FA 3V7SA 2HKQB 4BB7A 1R0CB 1LCKA 3EGXB 2VXEA 1RI9A 1Y0MA 2GQVA 3LYIA 4XTWA 3JB9H 1T3SA 3M54A 2DZCA 2PU9B 1PCXA 4M7AG 1V29B 3D7SB 1C6VX 4AFSC 4RTZA 4BACA 4Z02A 5AYFA 1X6OA 3C0CA 1X6BA 3LW5E 1BI2A 3CBOA 2FG0A 3QYGB 4QKUA 3G71A 1HK9A 3S3MA 2CT3A 4PJOG 7AT1B 1YIJA 1NE8A 4J9GA 4JRPA 4PJOF 3OYBA 2V1QA 1YI2Q 5GAN3 2ZPHB 3RNJA 1YJWQ 1I81A 1WJSA 1WGSA 4CC4B 2K6DA 1NJIU 5I21A 2DILA 3SWNB 3LWHA 2J6OA 5IHNA 4GLKA 2M0OA 3CCSA 1CKAA 1E6GA 2KQWA 2QA4Q 1ZBXA 3HP9A 2F2VA 4FT4A 1BCOA 1TG0A 4FU6A 3G71T 2D0NA 1MMGA 4MDWA 4C92E 3OS2A 1K9MU 2C0IA 1VQLT 4L6V5 3A8GB 4IIOA 3GP8A 1JJ2P 4Y28E 1QCNA 3META 2DXUA 1M1FA 4AMCA 1NJIC 4J9FA 4QT7A 1BCMA 2DRKA 1S1NA 2RI3A 1WJQA 1QVFS 3CCJQ 3OW2S 5CO7A 4RMOA 5HCKA 2RQTA 2LNHB 5KH6A 1ZA2B 2VYTA 2IG0A 1TTHB 3SEMA 2KXDA 2ZPEB 2DL8A 4A4KA 3JCMJ 3TREA 2OTLA 2DL4A 2KDSA 3H6ZA 4FSXA 1WHGA 3CCVQ 2JTFA 2IVWA 4XTXA 3M9QA 4XU0A 3TU4K 3FJPA 1WIEA 3LGFA 2XK0A 5GANf 2LCSA 2XHCA 2DJZA 3R6OA 2CUBA 1I1JA 4V2SA 3BFMA 1D1AA 3M0PA 5A0LA 1Q82C 4ZTJA 2KRNA 3CCQQ 2LP5A 5I22A 1N8RR 3PT9A 1B07A 1SRMA 2ABLA
chains in the Genus database with same CATH topology
3CCMQ 1VQPQ 1YITQ 2QA4Q 3CCVQ 3CC7Q 1VQKQ 1W2BP 1M90R 3CCEQ 1S72Q 1KQSP 3CC4Q 1YJ9Q 3CPWP 1VQNQ 1KC8R 3CCJQ 1YJNQ 3CCUQ 1VQ9Q 3G4SQ 1Q7YR 2OTJQ 1M1KR 3CCLQ 1YI2Q 3CMAQ 1K73R 1JJ2P 1Q86R 1NJIR 1YJWQ 1KD1R 1VQ5Q 1YHQQ 1VQ6Q 1VQOQ 3G6EQ 1Q81R 3G71Q 1VQ7Q 1VQLQ 3CD6Q 1QVGP 2QEXQ 3CCQQ 3I55Q 3CXCP 3OW2P 1YIJQ 3CCRQ 1QVFP 2OTLQ 1VQ4Q 1VQ8Q 3I56Q 1Q82R 3CCSQ 1N8RR 1K8AR 1K9MR 1VQMQ 3CC2Q 3CMEQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCM Q;  1VQP Q;  1YIT Q;  2QA4 Q;  3CCV Q;  3CC7 Q;  1VQK Q;  1W2B P;  1M90 R;  3CCE Q;  1S72 Q;  1KQS P;  3CC4 Q;  1YJ9 Q;  3CPW P;  1VQN Q;  1KC8 R;  3CCJ Q;  1YJN Q;  3CCU Q;  1VQ9 Q;  3G4S Q;  1Q7Y R;  2OTJ Q;  1M1K R;  3CCL Q;  1YI2 Q;  3CMA Q;  1K73 R;  1JJ2 P;  1Q86 R;  1NJI R;  1YJW Q;  1KD1 R;  1VQ5 Q;  1YHQ Q;  1VQ6 Q;  1VQO Q;  3G6E Q;  1Q81 R;  3G71 Q;  1VQ7 Q;  1VQL Q;  3CD6 Q;  1QVG P;  2QEX Q;  3CCQ Q;  3I55 Q;  3CXC P;  3OW2 P;  1YIJ Q;  3CCR Q;  1QVF P;  2OTL Q;  1VQ4 Q;  1VQ8 Q;  3I56 Q;  1Q82 R;  3CCS Q;  1N8R R;  1K8A R;  1K9M R;  1VQM Q;  3CC2 Q;  3CME Q; 
#chains in the Genus database with same CATH topology
 5CCA A;  5KYX A;  2C0T A;  4LNP A;  1QCO A;  3RKW A;  2QG9 B;  2HL3 A;  1KQS S;  1QVF A;  3NTK A;  3CCL Q;  1JEG A;  5CAI A;  5LJ3 e;  2EFI A;  4EMG A;  2E5Q A;  2QQA A;  4XK8 E;  3MO8 A;  2BZ8 A;  3RKX A;  4HXJ A;  4EIK A;  1Q82 R;  1YI2 A;  1AT1 B;  3VRY A;  1X6G A;  2AIR B;  3NHN A;  3OYG A;  5DY9 A;  2V8K A;  1AVZ C;  1QWF A;  4M77 D;  1SPK A;  1UHF A;  2HQH A;  1BIA A;  1PRL C;  2O88 A;  1QMC A;  5I2S A;  2O01 E;  4AG1 C;  2CRE A;  2CGH A;  2QAS A;  1XOV A;  1RAH B;  2XD0 A;  1RAF B;  2PQW A;  2DKG A;  2EPD A;  2LDM A;  2CP0 A;  5GAM f;  1QVF P;  3CCE A;  3I56 Q;  2RHU A;  1YWP A;  2CZ0 B;  2XU8 A;  2DL3 A;  2JT4 A;  2DEU A;  3CCL T;  2LQN A;  2E5K A;  1WQ7 A;  3QWY A;  4M78 G;  4M75 D;  3HTR A;  2DL7 A;  2Z0W A;  1N8R U;  3C95 A;  5GAN j;  4M7D D;  2BE7 D;  1X75 C;  2KR3 A;  3QWX X;  2QGG A;  4IUV A;  1VQ5 T;  4ZGE B;  3MEA A;  2X9H A;  1ZHI A;  1AZE A;  1PKT A;  2ECZ A;  1EX4 A;  3CCQ T;  1UFF A;  2C0O A;  3DKM A;  1RAC B;  2KI7 A;  3FDR A;  3CC4 Q;  2FHD A;  2KY9 A;  4AG2 C;  2MYS A;  4PJO E;  4M77 E;  4M75 G;  3CC4 T;  1QCF A;  1I5O B;  3VV0 A;  4J6W A;  1OI1 A;  3OQ5 A;  2YWW A;  3MKD A;  2CYZ B;  3SHW A;  2EYY A;  4C0Z A;  5GAN 4;  5LJ3 d;  4M77 C;  4QQD A;  2ZPB B;  2COZ A;  1H3Z A;  1PM3 A;  2VC8 A;  2LT1 A;  4ZGJ B;  2EQM A;  3X24 B;  1SEM A;  4A4H A;  1SKU B;  4MZP A;  4C0D B;  4RKU E;  3CC4 A;  2DTH A;  4DA4 A;  2CZ6 B;  4ZN1 A;  3L2W A;  3M53 A;  2KXC A;  3JCM e;  1G2B A;  3JCM c;  2LCC A;  2F1L A;  5J3B A;  4ZNX A;  2M1H A;  3QJ6 A;  1M2V B;  3LH0 A;  1GBR A;  2VB6 A;  4M75 A;  1M1G A;  1ACM B;  3QBY A;  2E10 A;  4J83 A;  4MML A;  1OX8 A;  4PJO C;  1MMD A;  5FW9 A;  1Y96 B;  2DEQ A;  3QO3 A;  2A36 A;  1ZLM A;  3BDU A;  1MV0 B;  3FEO A;  2K3B A;  4FYX B;  2HEQ A;  1YJN A;  3UA6 A;  3HRU A;  4AFU C;  5FU7 C;  1AWW A;  4KGZ B;  1Q81 R;  4OMO A;  4EMK A;  3CD6 T;  1HJD A;  2FYK A;  1KSW A;  1YP5 A;  3EG3 A;  3CME Q;  3CC2 Q;  3VS5 A;  2DJQ A;  2KK4 A;  4PJN A;  1K4U S;  5FRM A;  4PJO D;  2H3E B;  5FU6 C;  5CKF A;  8ATC B;  2CS7 A;  3VS2 A;  2LNV A;  2PTK A;  3CCJ A;  3OYC A;  5GAM e;  3BDL A;  4UC4 A;  3JCM X;  2GBQ A;  2JW4 A;  1MNE A;  4A4G A;  4CC2 A;  1VA7 A;  1NEG A;  2BUD A;  1WDX A;  5GJW B;  1GFD A;  2QEX T;  2QQR A;  4XTV A;  4C8Q D;  2P84 A;  1H92 A;  4HKE A;  2XI9 A;  1NPR A;  1KJW A;  2EW3 A;  1V1C A;  4GY5 A;  4PJM A;  1V76 A;  2JTM A;  1M2O A;  3CPF A;  1B34 A;  3VS3 A;  4HCZ A;  4LN2 A;  4HCC A;  5CKB A;  1HXD A;  3I9Q A;  1IGQ A;  1OUL A;  3UT1 A;  1YJ9 Q;  2X4W A;  3VJP A;  2W0Z A;  2YT6 A;  1OU8 A;  4PK4 A;  1YJ9 T;  5LJ5 j;  3MEW A;  1W2B S;  2X4X A;  1PHT A;  1SF9 A;  2DMO A;  4J9D A;  5D6Y A;  1VQM T;  3EHQ A;  3DB4 A;  3C4S A;  4M78 A;  4PJL A;  4KGX B;  5GAO n;  1E7O A;  3TVT A;  5LJ5 f;  1GCP A;  1D0X A;  3CCE Q;  8AT1 B;  2B8A A;  4LUD A;  4F17 A;  2OI3 A;  4F7U F;  5FU7 B;  2RB6 A;  2FEI A;  1YJ9 A;  2ROT A;  3TQ7 P;  2X35 A;  3JCM f;  3AHU A;  2CP7 A;  2QQB A;  3LX7 A;  3RUX A;  2HSE B;  1K0X A;  1R8O B;  4OMQ A;  1KQ2 A;  2BZX A;  1M90 R;  4Z8A A;  4AFZ C;  1QVP A;  1WNL A;  4XU2 A;  3FB9 A;  3OA6 A;  1VQ8 T;  5GAN h;  1VQ6 Q;  3EG0 A;  4FIB A;  4Z89 A;  2K7A A;  5M9O A;  3VS1 A;  1PD1 A;  4KBM B;  1RAI B;  4R0K A;  1K9M R;  2E12 A;  1BI1 A;  1FMK A;  4BI3 A;  3ZFJ A;  1O9S A;  3DLM A;  1IRX A;  4JS5 A;  1GFC A;  4C0D C;  1M90 C;  1ZX6 A;  2GCX A;  3A5Z B;  2OAW A;  3OYE A;  4VUB A;  3I55 A;  2YUN A;  1RAB B;  1VQ8 A;  2JUF A;  5AT1 B;  5GAO p;  2OTJ T;  3G1J A;  4ZN3 A;  3WVE B;  3GBQ A;  1ARK A;  2RF0 A;  1QP3 A;  1F1B B;  1QKX A;  2J6F A;  2AHJ B;  1ZUY A;  4M78 D;  1TH7 A;  2L3R A;  3A8M B;  4C0F A;  1UB4 A;  4M7D G;  1U8R A;  4PL6 A;  4LXC A;  1MMA A;  4E47 A;  4C92 D;  1YIJ T;  3UF4 A;  2EIF A;  4F7U B;  3G6E A;  2JVV A;  2DM1 A;  2EGC A;  3NMZ C;  2VV5 A;  5D6W A;  5KYX B;  1PKS A;  3NGP A;  1X01 A;  3CCS T;  1HYO A;  2M51 A;  5HK3 A;  2YDL A;  2KGT A;  4M7D B;  2QTV A;  3N5B B;  1WYX A;  2L2P A;  2AZS A;  3PFS A;  2GFA A;  4F7U G;  3FIF A;  4LUE A;  4LD6 A;  1VQ7 Q;  2FZC B;  4X1V A;  2CP5 A;  3JSC A;  3M55 A;  2HDA A;  4C8Q B;  2CUD A;  4C92 C;  5CQY A;  1WHM A;  3EFO B;  2FRW A;  2FB7 A;  1SHF A;  4ANJ A;  1RAE B;  1D1B A;  2B86 A;  1BB9 A;  2CZ7 B;  3MEV A;  3V8L A;  1YJN Q;  1SG5 A;  3M5A A;  1AWJ A;  1D3B A;  2L8D A;  3SD4 A;  4D6W A;  3L2Z A;  2RQW A;  2RJC A;  4XTY A;  4IUQ A;  3VS6 A;  1W70 A;  4J6Y A;  2ZPF B;  4C8Q A;  4M78 B;  3LGL A;  4TVR A;  2XDD A;  4PJO A;  1PC0 A;  3CME A;  2OTL T;  2LQ8 A;  5GAN 7;  1JJ2 A;  4EMH A;  3PVQ A;  1T0H A;  3GNF B;  1WJR A;  1UUE A;  4JUV A;  3LLR A;  1D1C A;  2VGM A;  2BTT A;  2LQK A;  2ED0 A;  3A98 A;  2F5T X;  1W1F A;  3EAE A;  2X51 A;  2OX7 A;  3J80 E;  2MWO A;  1RLQ C;  5DM7 R;  4N4G A;  1LVK A;  4CC3 A;  2JS0 A;  1VQK Q;  1EZZ B;  5LJ3 j;  3FRN A;  4RTW A;  5GAN 2;  5A0D A;  1KG1 A;  1WA7 A;  2CSI A;  2EKO A;  2H8H A;  5KYW B;  3I56 T;  1PSE A;  1B34 B;  2LMJ A;  2CKK A;  4BE1 A;  1QVG P;  3MJX A;  2PVG B;  5IT9 E;  1YHQ T;  3J81 E;  2EYX A;  3CCV A;  2MK5 A;  2RHZ A;  1M3B A;  3M0Q A;  2V26 A;  3OS5 A;  1VYU A;  4IUT A;  3QKJ A;  4M7D C;  5FRO A;  4MDX A;  3CMA Q;  3KXT A;  5HY6 A;  2PNI A;  1QQJ A;  1OEB A;  4KUL A;  3CXC P;  2DVJ A;  5C0M A;  3AT1 B;  5GMK e;  2EYZ A;  5CR2 A;  2DBM A;  2XKO C;  1UDL A;  3OYK A;  3VU3 C;  3PGG A;  5LJ3 h;  1NG2 A;  2FZK B;  1RAG B;  4B9X A;  4OMM A;  2CP6 A;  4LD9 K;  1MND A;  5A2Q E;  1NLO C;  1YHQ Q;  1G5V A;  2HQE A;  5CKD A;  2J6K A;  1UGR B;  2ED1 A;  2DTI A;  2O2O A;  2ZAE A;  4II1 A;  1KHC A;  2K3X A;  1VQ6 A;  1GL5 A;  1WHK A;  4JPB W;  4RTU A;  4RTY A;  1BI3 A;  3QZ9 B;  3CPW P;  2V1R A;  4E7Z A;  3CCM A;  2W10 A;  5L8R E;  1M1K U;  1OV3 A;  2G6F X;  4HA8 A;  4C5I A;  4MMK A;  1NZ9 A;  3EG1 A;  3CCR Q;  2P4R A;  1ZSZ B;  4XU3 A;  1QKW A;  1VQP T;  2XDP A;  3INZ A;  1PSF A;  2A7Y A;  3G4S A;  3RDV A;  4PFO A;  4OMN A;  1IHW A;  2EKH A;  2E3I A;  1FX7 A;  1U1T A;  2X4Y A;  2Y4X A;  1UEC A;  2EJ9 A;  3I55 Q;  2R5A A;  3GF5 A;  2K57 A;  3H9N A;  4BUG A;  5EG2 A;  1HD3 A;  3OYF A;  2M0Y A;  1KC8 R;  2RMO A;  2JZ2 A;  2NUT B;  1VQ9 Q;  4M7A D;  1VQ5 A;  2DIG A;  3H8Z A;  1B7T A;  2P0K A;  2CT4 A;  3CCQ A;  5GAN e;  3KFV A;  3G71 Q;  5J26 A;  2DXB A;  2YHT A;  4B9W A;  3SWN C;  5I2M A;  4WTO B;  4P5N A;  2RPN A;  4AT1 B;  3TCJ A;  4OMP A;  4J9C A;  2DF6 A;  2DA9 A;  2LQW A;  1FMW A;  2Y4Y A;  2E4H A;  3JCM h;  3QJY A;  1RI0 A;  1QLY A;  1WZO A;  5GAN d;  1IXD A;  3BW1 A;  2COW A;  1Q7Y U;  5GAN 6;  1YNZ A;  1K76 A;  4JJC A;  3H0H A;  3MP8 A;  1SSH A;  1KIK A;  4E7S A;  4R56 A;  3VS4 A;  1Q81 C;  5CKE A;  2YRC A;  4BY6 C;  2RA2 A;  4J5Y A;  4QVZ A;  3PE0 A;  2MPX C;  2HD0 A;  1EFN A;  2R5M A;  2FZG B;  3P8D A;  5LJ5 e;  2JS2 A;  2K5I A;  2VVK A;  4JRI A;  4M4Z A;  2PVD B;  2DYB A;  3T9N A;  3UDC A;  2DFU A;  1AHJ B;  2P4T A;  1LJO A;  4NS5 A;  1TXQ A;  1BU1 A;  4PLI A;  4CI0 C;  3PTA A;  2AZV A;  1KQ1 A;  3M0T A;  3QYH B;  3EGD A;  2V8J A;  2HL5 C;  2DYI A;  1VYV A;  4A4F A;  3JCM W;  3X28 B;  5I11 A;  3OSS C;  4J8O A;  2RK2 A;  4FCY A;  3CCU Q;  3M59 A;  2HAX A;  2QAZ A;  3X20 B;  2R57 A;  1MHN A;  2E65 A;  3PMT A;  1I5L A;  1PG5 B;  3GLX A;  1JRI A;  4FT2 A;  4C8Q F;  1FWZ A;  1RLP C;  1W2B P;  3CC2 T;  1U06 A;  2DD4 A;  1K9A A;  1ZSG A;  3OB9 A;  1TWB A;  2MOX A;  3HKS A;  1R77 A;  3MCA B;  1TSF A;  3LH5 A;  2XMF A;  1G8X A;  2LZ6 B;  4K11 A;  3HFN A;  4O5V A;  4LDX A;  3CCJ T;  2X3W D;  5FU6 B;  4M78 F;  1VQK A;  5GMK i;  4A53 A;  2MI6 A;  4F14 A;  2JJ9 A;  3HRS A;  3VRZ A;  4LDV A;  4BE2 A;  1D0Z A;  1UGS B;  3JCM Q;  1YWO A;  1W2B A;  2QEX A;  1TUC A;  2QA4 A;  1VQL Q;  1W6X A;  4ATO A;  4J9E A;  3OMC A;  2RM4 A;  3OYI A;  3S3O A;  1QVG S;  1RAD B;  2K5F A;  2BE9 B;  4OB1 B;  4O6J A;  3DLL A;  1UJ0 A;  3QXE B;  1UG1 A;  1ZBJ A;  1IB8 A;  2LRQ A;  1Z9Q A;  4NL3 A;  1B3Q A;  2FPF A;  2CP2 A;  2FPD A;  2D8H A;  5LL6 S;  1M30 A;  2HBP A;  3FJ5 A;  3SB2 A;  3L2V A;  4BDY A;  2DVE A;  2LCL A;  4JJB A;  1FXX A;  3EFO A;  2FO0 A;  1VQM Q;  3L1A A;  2EYQ A;  1UHC A;  1K9M C;  2FRY A;  2DLP A;  4FW2 A;  2ZCF B;  3CMA T;  3QG1 A;  2QQ9 A;  1YCS B;  2DIQ A;  1WHL A;  3MP6 A;  2LJ3 A;  4M7A A;  2HMA A;  3VYG A;  1GCQ C;  1IHV A;  2GF7 A;  2K79 A;  3FLG A;  1MMN A;  3TSW A;  3P8B B;  3PIO A;  1NLP C;  1GBQ A;  2CH4 W;  4ELY C;  2CP3 A;  3E2U A;  4M77 G;  5KE2 A;  2C06 A;  2XID A;  3PMI A;  5D6X A;  2QTX A;  3ZEH A;  3QUI A;  2KYB A;  2E70 A;  1VQ7 T;  2DAQ A;  4DOW A;  2KYM A;  4M7A F;  2EGE A;  1I0C A;  1WHJ A;  1I07 A;  4DBH A;  2L3P A;  4EMK C;  3URG A;  2E3H A;  2D9T A;  4PKC C;  1IGU A;  4ORZ A;  4NOY A;  3EG2 A;  2CH4 A;  1UGP B;  1D0Y A;  3QPH A;  1R0B G;  2ZGW A;  2RQV A;  3EHR A;  2EGA A;  1AWO A;  1C0M A;  1VQ5 Q;  2RJD A;  3NPF A;  4FL6 A;  3JCM P;  4C5E A;  5GAM d;  2NYS A;  3MEU A;  4XU1 A;  1Q81 U;  4BDZ A;  5GAO r;  4DEY A;  1OZ2 A;  1JB0 E;  3UAT A;  2V8I A;  2X4J A;  2YRV A;  4KH1 B;  2SRC A;  3VKI A;  2OTJ A;  4ELZ C;  3ZL7 C;  3G6E Q;  1YIT A;  1KK7 A;  2EQI A;  2EAY A;  1YIJ Q;  3OW2 P;  3C12 A;  2JMA A;  2AK5 A;  1WXT A;  1X43 A;  1YN8 A;  3ER0 A;  2RHX A;  4IUP A;  2EVR A;  2XG8 D;  3RES A;  1VQL A;  4GLM A;  1YFN A;  1BBZ A;  4JRK A;  4M75 E;  4FM4 B;  2YLB A;  1M9S A;  2NUP A;  1NPP A;  2O31 A;  5KYW A;  1Q86 R;  2FVU A;  4IKF A;  5ECA A;  3UWN A;  4QQG A;  4RUG A;  4A54 A;  2GNC A;  1U3O A;  1X2K A;  4M7A B;  1BI0 A;  5LJ3 f;  1FMV A;  2E64 A;  1QVG A;  2RQU A;  1Q95 G;  2PVO B;  2JMC A;  2RH2 A;  3OYM A;  5GMK h;  5KE3 A;  1KQS A;  1VQO Q;  1ZSZ C;  1Q86 C;  1M8M A;  4PJJ A;  1TU0 B;  3WXM B;  4PLL A;  1KD1 U;  5D7U A;  2JM9 A;  3RKY A;  1LPL A;  3CD6 A;  4QVD A;  3FC3 A;  1S72 T;  4Z88 A;  2LC4 A;  3J7A F;  5GAM g;  4RCB A;  1M27 C;  4XQ3 A;  4N4H A;  1K8A U;  1NYF A;  3CXC S;  1UTI A;  4LE9 A;  2MWP A;  4C92 B;  1JXM A;  2O4X A;  1H3H A;  2J05 A;  5A0G A;  4JZ4 A;  2DX1 A;  5FWC A;  2OJ2 A;  4OB2 B;  1I4K 1;  3QDR B;  2SEM A;  3ME9 A;  4YTL A;  1VQO A;  1GXI E;  2I0N A;  2E6N A;  1I8F A;  1YBY A;  3CEY A;  4N4I A;  1KD1 C;  3TSZ A;  3NTI A;  4C92 G;  4LDU A;  2DK3 A;  1VQ4 T;  3H41 A;  3OYY A;  1K73 R;  4M78 E;  3S3N A;  2L89 A;  4F7U A;  4DBF A;  1YI2 T;  1K0S A;  2DPP B;  4E7K A;  2A3L A;  1ZA1 B;  1ABO A;  1IRE B;  3E9F A;  2QEX Q;  1AWX A;  3M56 A;  2KVQ G;  3H0I A;  2R58 A;  4E7I A;  2DO3 A;  2RD1 A;  2MMP A;  5IXB A;  1VYT A;  4QQ6 A;  4RG2 A;  4R55 A;  2YUQ A;  1RL2 A;  1OOT A;  3CXC A;  4N0A C;  3V7R A;  3L42 A;  5GAM j;  5GMK j;  1KD1 R;  2CZ1 B;  3JCM g;  2BKD N;  3O5Z A;  1KFZ A;  4M7A E;  1UE9 A;  2JN0 A;  3HRT A;  1VQ4 A;  2DD5 A;  3CCL A;  2DL5 A;  3RMS A;  1AOJ A;  1K8A R;  2VGN A;  3HPW A;  1YIT Q;  2LJ1 A;  1XTD A;  3GOX A;  4AFQ C;  4E7J A;  2J7I A;  4OML A;  4IIM A;  1VQN A;  3OS0 A;  1MGQ A;  2AKL A;  1JJ2 S;  1WXU A;  2BIV A;  3QDF A;  1Y07 A;  2ESW A;  1M3A A;  2HNI A;  1M2V A;  2PUO B;  3EFR A;  4N0A A;  3OMG A;  5FLX E;  5J39 A;  2YRD A;  2DET A;  4HCK A;  1GCQ A;  2LTO A;  1HSQ A;  3H0F A;  2GGR A;  2RHY A;  4M78 C;  3OYJ A;  1CKB A;  3I5R A;  1X27 A;  3HL8 A;  3EH1 A;  4F7U E;  1PRM C;  1KC8 C;  3GNG A;  3VUB A;  3V7C A;  3OYA A;  3OYN A;  5KYY B;  2RI2 A;  2DE0 X;  3MPU B;  4RTT A;  1ZUU A;  2RHI A;  2VKN A;  3CCM T;  5FWB A;  3JV3 A;  1OX9 A;  3JB9 F;  4OF1 A;  2VXF A;  4KUD K;  2M9U A;  3L2R A;  1U5S A;  3MP1 A;  2L3Q A;  4RTV A;  3SFM A;  4M75 C;  3ASK A;  1VQP A;  3QHS A;  3CCR A;  3JB9 I;  3JCM d;  5CK9 A;  2F5K A;  3HHT B;  3EGD B;  1JU5 C;  1P92 A;  5DLQ E;  5IH2 A;  2RJF A;  2EQU A;  2D8J A;  4LDY A;  5CIU A;  4J6X A;  3NFC A;  2ATC B;  2ZZD A;  1BIB A;  2LJ0 A;  3JCM V;  1X2Q A;  2KBT A;  1SRL A;  4FSS A;  4KUI A;  1BYM A;  3E1S A;  2EYW A;  2KEA A;  3IQL A;  3OS1 A;  2A37 A;  5LJ5 g;  1GRI A;  9ATC B;  3NTH A;  1AD5 A;  4M75 F;  1UJY A;  4CRI A;  4F16 A;  3THK A;  2K2V A;  1J3T A;  3RBB B;  2K9G A;  5DLO A;  2EQJ A;  2RQR A;  1H64 1;  4C8Q G;  4HT8 A;  3M57 A;  1Y57 A;  1G3Y A;  3RR6 A;  2DNU A;  4JJN K;  6AT1 B;  3VS0 A;  2MIO A;  1VQ9 T;  2NWM A;  1S72 Q;  1XJW B;  3C94 A;  4XTZ A;  5LJ5 h;  3CC2 A;  1Q7Y R;  4J7I A;  3UA7 A;  5GAM h;  2XIC A;  1DJ7 B;  1OYX A;  1OPL A;  3CPW S;  4OVA A;  1ZSZ A;  1FYN A;  2I2L A;  4D8K A;  4XAX B;  5IHK A;  5CVI A;  4IUR A;  4BY6 B;  5EC7 A;  2JM8 A;  5LJ5 d;  1JO8 A;  3VYH B;  4BI8 B;  1JXO A;  2E6Z A;  4A4E A;  1VQ9 A;  2ZPG B;  2WSC E;  4Q5W A;  5IHI A;  1OU9 A;  1NJI R;  3SWN A;  1N27 A;  3JRZ A;  3OBW A;  1Q7Y C;  2PZ1 A;  3EGU A;  3I5S A;  2D1X A;  1W4S A;  1UEB A;  2VWF A;  4HVU A;  4WCI A;  2QA4 T;  2DZ9 A;  1N9R A;  2K2M A;  1OPK A;  1BKB A;  1VQP Q;  1VIE A;  2L5Q A;  4M77 A;  4HT9 A;  2KE9 A;  4BD3 A;  2HBW A;  1KQS P;  4QW2 A;  4LDW A;  1QP2 A;  3M4Y A;  2K5L A;  2JOY A;  4RG8 A;  2JXB A;  3LWI A;  3PIP A;  3OY9 A;  2LX7 A;  3M58 A;  1NYG A;  2ROL A;  2RK1 A;  1XNI A;  3I56 A;  2QDL A;  3CCU T;  1M90 U;  2E1H A;  2LT4 A;  2GTO A;  1WLP B;  1YHQ A;  4C5G A;  2YSQ A;  4OB3 B;  3KBG A;  2HKN A;  1TUG B;  4OGE A;  2J06 A;  5LJ3 g;  3RER A;  4J9B A;  4PFP A;  4Y92 A;  3O8V A;  5KCO A;  1N8R C;  3OBY A;  2KT8 A;  3GPL A;  2AT1 B;  1JQQ A;  3OYD A;  2QK0 A;  2A08 A;  1PNJ A;  2RNA A;  4F04 B;  2QYZ A;  2GQI A;  1VQN Q;  2NUP B;  3CQT A;  3CCU A;  3JB9 G;  2DBK A;  5FRN A;  1WXB A;  4DOV A;  2RI5 A;  4KRT A;  1ABQ A;  1KHI A;  4M7D E;  4EPC A;  4DBR A;  3M4G A;  3F70 A;  1VQ4 Q;  3A8O B;  2NUZ A;  2MAM A;  4FYW B;  2CSQ A;  3EGX A;  2YXY A;  4E2F B;  4C8Q E;  5KCH A;  4JJD A;  2ZPI B;  4FYV B;  1WHH A;  3TEE A;  2RO0 A;  3A8H B;  2QQS A;  3UPU A;  3VS7 A;  2NUT A;  1VQ6 T;  3BY7 A;  1ZQ1 A;  3DB3 A;  2K3Y A;  4BI4 A;  1Z9Z A;  4DEX A;  5HK0 A;  1T3L A;  3CCE T;  5GAO l;  3QII A;  4OP0 A;  5GAN 8;  1TS9 A;  2BZY A;  2YUO A;  3V8J A;  4C92 A;  5GAO m;  3M0S A;  5KYY A;  1A0N B;  1G83 A;  2KAF A;  2NLU A;  2QGF B;  2HSP A;  3CMA A;  4E7L A;  4PJO B;  5GAN g;  5GAO q;  2DXC A;  1WX6 A;  2QDY B;  3L2Q A;  3SDZ A;  4ESR A;  2KMT A;  1QWE A;  3R6N A;  2RJE A;  1WPY A;  4JLG A;  4E7H A;  1K1Z A;  4M7D F;  1NEB A;  4Y91 A;  3P8H A;  2XDB A;  2JNG A;  2O4X B;  5KYU B;  5GMK l;  3HFO A;  2OTL Q;  1G3S A;  4JS4 A;  2YLC A;  2KRM A;  4BE0 A;  1JBM A;  4MZM A;  2CDT A;  1O75 A;  1VUB A;  4M7D A;  2YUP A;  3JAM E;  1N6A A;  1YJN T;  1RUW A;  2WAC A;  2KRS A;  1M1K C;  4ME7 A;  3CCS Q;  4C0G A;  3KUF A;  2FPE A;  1RAA B;  3Q1J A;  3CCM Q;  1MUZ A;  2KSS A;  2AKK A;  2COY A;  4J7F A;  1M5Q 1;  5GAN 5;  1KC8 U;  2OTJ Q;  3X25 B;  2HCK A;  1Y7X A;  3CC7 A;  4JZ3 A;  1WQW A;  1VIF A;  3CME T;  1BK2 A;  1M1K R;  2FL7 A;  3E19 A;  3EFS A;  3JCM b;  2EJG A;  3MHX A;  4MZT A;  3VUZ A;  1OQK A;  1QW1 A;  2GTJ A;  2EBP A;  2RN8 A;  2HZY A;  4OGC A;  1YIT T;  1S72 A;  1NM7 A;  4KH0 B;  4L59 A;  3OYH A;  3RMQ A;  5IN1 A;  1CSK A;  2HQX A;  3QZ5 B;  4C8Q C;  2F69 A;  1OZ3 A;  2KRO A;  3CC7 T;  1UGV A;  3REB B;  2F2X A;  3M0R A;  3RIR A;  2Y90 A;  2D0Q B;  4WF2 A;  3X26 B;  2EQK A;  3CC7 Q;  1M3C A;  4JLI A;  3ZBD A;  4E6R A;  1M8V A;  3REA B;  1T0J A;  2GFU A;  2LVM A;  2M02 A;  4XTU A;  2JTE A;  4J9I A;  2KNB B;  2O9V A;  4NL2 A;  3JB9 J;  3M0U A;  2DRM A;  4DQ2 A;  1D3B B;  3CCV T;  2PUK B;  1U1S A;  3OYL A;  4RTX A;  1N5Z A;  4KT0 E;  1K73 C;  4M75 B;  2WSF E;  3G7Z A;  5KYU A;  3WVD B;  3CPW A;  2QI2 A;  5GMK m;  1AZG B;  2VAS A;  2MCN A;  2EWN A;  4CC7 A;  3OSV A;  4M77 B;  3I35 A;  4JRQ A;  1ZUK A;  3QSU A;  1H8K A;  4JDS A;  4FW1 A;  4X9D A;  4B6M A;  2X3X D;  4HVW A;  4J9H A;  3E9G A;  3CBM A;  1VOM A;  3BE3 A;  4C5H A;  4M7A C;  4PFZ A;  1LNX A;  1IZ6 A;  2L3S A;  1VQ8 Q;  4OMF B;  1G3W A;  1K8A C;  1LOJ A;  1UGQ B;  2QXF A;  1AEY A;  3U23 A;  1VQN T;  2KT1 A;  5KYN A;  4A63 B;  2P0P A;  4RCC A;  2A28 A;  1VQK T;  4ZGD B;  3EG9 A;  2DER A;  3GIB A;  2EJF A;  4L5G A;  1Q86 U;  1VQO T;  4IUU A;  2M16 A;  4QVC A;  1XQH A;  2E41 A;  3ULR B;  1C1A A;  2MF2 A;  5C6S A;  3V8K A;  1Y96 A;  5HKC A;  2DXT A;  1YJW A;  1Q82 U;  4C92 F;  1K73 U;  1WI7 A;  1VQM A;  4X34 A;  1WFW A;  2OAU A;  1M4Z A;  2F2W A;  3EG9 B;  3G4S T;  4KGV B;  2O9S A;  3HSB A;  1SSF A;  2WSE E;  3I55 T;  4ZTF A;  2LX9 A;  1D09 B;  4OB0 B;  4D8D A;  4HCB A;  5L23 A;  5CQX A;  2H3J A;  3CBP A;  4M77 F;  1YJW T;  1PD0 A;  1EIF A;  1MV3 A;  3PVL A;  1Y71 A;  2IPO B;  4EMK B;  2P0Q A;  5IXF A;  4PNO A;  1YCY A;  2IIM A;  4FYY B;  4DBQ A;  3S6W A;  2G3R A;  3CCR T;  1SHG A;  3CD6 Q;  1G3T A;  2A0F B;  3EH2 A;  4EDU A;  3G6E T;  1NBE B;  1E6H A;  2ENM A;  5GJV B;  1N9S A;  2VUB A;  2K4Y A;  3JB9 D;  1TUD A;  3PNW C;  3L2U A;  5CKH A;  3A8L B;  3G4S Q;  4GBQ A;  1IO6 A;  1X69 A;  3OW2 A;  1TOV A;  1PWT A;  4HVV A;  2DTO A;  5IAY A;  3A1P A;  2L0A A;  1VQ7 A;  4X9C A;  2D6F A;  3V7S A;  2HKQ B;  4BB7 A;  1R0C B;  1LCK A;  3EGX B;  2VXE A;  1RI9 A;  1Y0M A;  2GQV A;  3LYI A;  4XTW A;  3JB9 H;  1T3S A;  3M54 A;  2DZC A;  2PU9 B;  1PCX A;  4M7A G;  1V29 B;  3D7S B;  1C6V X;  4AFS C;  4RTZ A;  4BAC A;  4Z02 A;  5AYF A;  1X6O A;  3C0C A;  1X6B A;  3LW5 E;  1BI2 A;  3CBO A;  2FG0 A;  3QYG B;  4QKU A;  3G71 A;  1HK9 A;  3S3M A;  2CT3 A;  4PJO G;  7AT1 B;  1YIJ A;  1NE8 A;  4J9G A;  4JRP A;  4PJO F;  3OYB A;  2V1Q A;  1YI2 Q;  5GAN 3;  2ZPH B;  3RNJ A;  1YJW Q;  1I81 A;  1WJS A;  1WGS A;  4CC4 B;  2K6D A;  1NJI U;  5I21 A;  2DIL A;  3SWN B;  3LWH A;  2J6O A;  5IHN A;  4GLK A;  2M0O A;  3CCS A;  1CKA A;  1E6G A;  2KQW A;  2QA4 Q;  1ZBX A;  3HP9 A;  2F2V A;  4FT4 A;  1BCO A;  1TG0 A;  4FU6 A;  3G71 T;  2D0N A;  1MMG A;  4MDW A;  4C92 E;  3OS2 A;  1K9M U;  2C0I A;  1VQL T;  4L6V 5;  3A8G B;  4IIO A;  3GP8 A;  1JJ2 P;  4Y28 E;  1QCN A;  3MET A;  2DXU A;  1M1F A;  4AMC A;  1NJI C;  4J9F A;  4QT7 A;  1BCM A;  2DRK A;  1S1N A;  2RI3 A;  1WJQ A;  1QVF S;  3CCJ Q;  3OW2 S;  5CO7 A;  4RMO A;  5HCK A;  2RQT A;  2LNH B;  5KH6 A;  1ZA2 B;  2VYT A;  2IG0 A;  1TTH B;  3SEM A;  2KXD A;  2ZPE B;  2DL8 A;  4A4K A;  3JCM J;  3TRE A;  2OTL A;  2DL4 A;  2KDS A;  3H6Z A;  4FSX A;  1WHG A;  3CCV Q;  2JTF A;  2IVW A;  4XTX A;  3M9Q A;  4XU0 A;  3TU4 K;  3FJP A;  1WIE A;  3LGF A;  2XK0 A;  5GAN f;  2LCS A;  2XHC A;  2DJZ A;  3R6O A;  2CUB A;  1I1J A;  4V2S A;  3BFM A;  1D1A A;  3M0P A;  5A0L A;  1Q82 C;  4ZTJ A;  2KRN A;  3CCQ Q;  2LP5 A;  5I22 A;  1N8R R;  3PT9 A;  1B07 A;  1SRM A;  2ABL A; 
#chains in the Genus database with same CATH homology
 3CCM Q;  1VQP Q;  1YIT Q;  2QA4 Q;  3CCV Q;  3CC7 Q;  1VQK Q;  1W2B P;  1M90 R;  3CCE Q;  1S72 Q;  1KQS P;  3CC4 Q;  1YJ9 Q;  3CPW P;  1VQN Q;  1KC8 R;  3CCJ Q;  1YJN Q;  3CCU Q;  1VQ9 Q;  3G4S Q;  1Q7Y R;  2OTJ Q;  1M1K R;  3CCL Q;  1YI2 Q;  3CMA Q;  1K73 R;  1JJ2 P;  1Q86 R;  1NJI R;  1YJW Q;  1KD1 R;  1VQ5 Q;  1YHQ Q;  1VQ6 Q;  1VQO Q;  3G6E Q;  1Q81 R;  3G71 Q;  1VQ7 Q;  1VQL Q;  3CD6 Q;  1QVG P;  2QEX Q;  3CCQ Q;  3I55 Q;  3CXC P;  3OW2 P;  1YIJ Q;  3CCR Q;  1QVF P;  2OTL Q;  1VQ4 Q;  1VQ8 Q;  3I56 Q;  1Q82 R;  3CCS Q;  1N8R R;  1K8A R;  1K9M R;  1VQM Q;  3CC2 Q;  3CME Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...