1M1KR

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
b'PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1m1kR00
3G6EQ 3G71Q 1YIJQ 1N8RR 3CCUQ 1NJIR 1W2BP 1VQ5Q 1VQ9Q 3CCRQ 1VQNQ 1Q81R 1VQKQ 3I56Q 1VQPQ 3CCLQ 1YITQ 1KC8R 1K9MR 1YJ9Q 3CD6Q 1YHQQ 1VQMQ 1VQ4Q 3CXCP 1M90R 3G4SQ 1S72Q 3CC7Q 3CCSQ 3CCQQ 3CCVQ 3CMAQ 2QA4Q 1Q82R 1Q86R 1VQLQ 1YJNQ 3OW2P 3CPWP 1QVFP 1QVGP 1VQ6Q 3CCMQ 1YI2Q 1VQOQ 1K73R 1KQSP 1JJ2P 1VQ7Q 2OTLQ 1Q7YR 3CCJQ 3I55Q 1KD1R 2OTJQ 3CMEQ 1YJWQ 1M1KR 3CC4Q 3CCEQ 1K8AR 3CC2Q 1VQ8Q 2QEXQ
chains in the Genus database with same CATH superfamily
3GPLA 2FG0A 2VGNA 2LJ1A 2KEAA 5I2SA 2DTIA 1MMDA 1X2QA 9ATCB 1UE9A 3CBOA 1G8XA 5GAN5 1NBEB 4PJMA 2EQUA 3ER0A 1QMCA 2YRCA 1LOJA 5EC7A 5J39A 3TSZA 2F1LA 2MYSA 3MEWA 3VS5A 4LDYA 2QGFB 1Q82U 2DYBA 4FYVB 2FZGB 4J9EA 1MGQA 2QTXA 4M75F 5GAOp 1PRMC 4PJLA 4RTYA 3CC7T 3G4ST 3G7ZA 5CKFA 3HTRA 4PLLA 2O88A 2DD4A 1FMKA 2JS0A 4C5IA 5CIUA 5GAMd 4KBMB 2CT3A 2LCLA 1M8MA 1N8RR 4KGZB 5KCOA 4RTXA 4ZGDB 4JS5A 2LJ0A 1DJ7B 3OYCA 1YHQT 4RG8A 2RI5A 5FU7C 1K4US 4BD3A 1JJ2P 4CI0C 3CMAA 4LDWA 2QEXQ 4F7UE 2QQRA 2NUZA 2XMFA 4F04B 2VXEA 1M3AA 2VVKA 4BB7A 1ARKA 4A53A 4M77E 3PIOA 1N5ZA 2DF6A 4ZTJA 5GAN4 1GFDA 3ASKA 2IG0A 1QWFA 5FWBA 4LD9K 1ZQ1A 2PVDB 3CPWS 1M3BA 2HQXA 2VUBA 2KQWA 4N4HA 4FYXB 2B86A 2EPDA 4KH1B 3RESA 3A8OB 2HNIA 3M0SA 2AIRB 2LX7A 2C0IA 1NE8A 1VQNA 1QQJA 3EAEA 1VQPA 2JTEA 3JCMX 4J6XA 2YUQA 3L2VA 3VUZA 1OQKA 2F5KA 2VGMA 4LUDA 4M78A 1WXUA 1VQLA 3PT9A 2LQNA 2L3QA 3VJPA 3C95A 4IUVA 3WXMB 3M58A 1TUDA 4NS5A 4L5GA 2P4TA 2JXBA 4A4EA 3I35A 1G3SA 1KK7A 2E4HA 2FHDA 4J6WA 2EBPA 1IGUA 2CZ1B 2MMPA 1X43A 1EX4A 2HMAA 3CMAT 1YFNA 3NHNA 4EMGA 5GAOm 3JAME 2EYQA 1M4ZA 3CCMT 2LDMA 4PJOF 2L8DA 2JJ9A 1Q95G 1AWWA 2VXFA 3OB9A 3G71Q 4B9WA 1IREB 4RKUE 5IHKA 4II1A 4OMPA 2MWPA 2QQSA 2EQKA 3MEUA 5CQXA 1KD1C 1MV3A 2NWMA 4OB0B 1WXTA 4BI3A 2DEUA 1GBRA 4QT7A 1G3WA 4ZNXA 4C5HA 5HCKA 1GRIA 4RUGA 3KXTA 2FB7A 3PMIA 1QVGS 2OTJA 1X27A 4EPCA 1QKXA 2EKOA 2KDSA 2DXCA 1VQNT 2PNIA 1VQPT 4UC4A 2QYZA 3L2ZA 8ATCB 2RQWA 3CEYA 1KQ1A 1RACB 1ZSZB 2RQUA 5GANg 2MPXC 4MDWA 2Y4YA 4AFZC 5I21A 4O5VA 2YHTA 4QW2A 1YCSB 4FU6A 1EIFA 2J6KA 2O9VA 2QQAA 2CZ0B 5IXFA 2CS7A 2AHJB 4FYWB 3VS1A 1VQKA 4KRTA 3I56A 4C8QG 4M78C 1D1BA 1N8RU 5EG2A 5D6YA 5LJ5e 5GAOq 1OPKA 4FW1A 2A7YA 4O6JA 2EFIA 3OS5A 4RG2A 1B34A 3OYLA 4LNPA 2JM9A 2LP5A 4GBQA 1T0HA 1YIJA 4MZMA 3RKWA 4FT2A 1AZEA 2ZPFB 3LH5A 4AG2C 4JS4A 5FRMA 1MMGA 4OMQA 1JB0E 3M0PA 3C4SA 2JT4A 1M8VA 2B8AA 4OVAA 2K79A 4X9CA 4F14A 3CXCS 2RH2A 1BKBA 1OYXA 4Y91A 1VQ6A 2OTJT 3CC4Q 1M5Q1 5GMKj 5GAOl 1PSFA 2KRSA 4P5NA 4NL3A 4NOYA 3CC2A 3NPFA 1Y07A 4M7DG 2XHCA 1OX9A 1AD5A 4RTUA 2CT4A 3QSUA 5GAMe 4E7SA 3MO8A 3CD6A 3QZ9B 2OI3A 2WSFE 5GMKh 1QVGP 1I81A 2FPDA 1D3BA 2EYZA 3H6ZA 2ROTA 1RAHB 1K8AR 5FU7B 1RABB 3DKMA 3M0RA 1QCNA 1Q82C 3QHSA 1ACMB 1VYUA 2ED1A 1VQKT 4BUGA 3M0TA 3I56T 2K4YA 3V7CA 5J26A 2KYBA 2OAUA 2VWFA 4AFQC 3M0QA 4X9DA 5LJ3f 3OS1A 2YRVA 5A0LA 1KQSA 2L0AA 3VKIA 1X01A 3R6OA 4FSSA 4E7HA 4LDXA 4X34A 5GMKm 2MI6A 4KULA 2RN8A 3JSCA 4DA4A 1TTHB 2COZA 1KHIA 3UF4A 1FXXA 2FYKA 3OYKA 1AHJB 1NZ9A 3CCUA 2EYYA 1ZA2B 2E5QA 2DJZA 1M2VA 3M4YA 3LWIA 3OYAA 2P0PA 3QDRB 3SD4A 4CC7A 1VQ6T 4Z89A 2D8HA 2HKNA 2L5QA 3RBBB 2EAYA 1M1KR 4PL6A 4BE1A 3P8DA 3CC2T 2YDLA 2KT8A 1NYGA 4J9HA 2J06A 2DX1A 2XDBA 3QIIA 4RTTA 2RB6A 4JRQA 1RAFB 2FEIA 1ZBXA 1ZBJA 4C8QA 5GAOn 3MHXA 2DL4A 1OU9A 3FB9A 3KBGA 3CD6T 4R56A 4JUVA 2GQIA 2DA9A 3EH2A 2BUDA 2P0KA 2RA2A 2AT1B 2FVUA 1RI0A 1RAGB 2FO0A 2EQJA 4C92G 3CCEQ 2CH4W 4RCBA 4RTZA 3SHWA 2JS2A 4FL6A 3PE0A 1G2BA 1F1BB 2X35A 1U1TA 1G83A 3V7SA 3X25B 1W4SA 1YNZA 3BE3A 5GAN2 1TXQA 4HVWA 5CKEA 3RMQA 5C0MA 4WTOB 2ZZDA 3NMZC 1PNJA 7AT1B 2RQRA 2LX9A 2RI2A 2DMOA 3RIRA 2E12A 2R5AA 2WSEE 3E1SA 4VUBA 1K9AA 2DM1A 3J80E 3MCAB 4M77F 1IGQA 1X75C 4QVDA 3CCUT 2RI3A 3MP8A 3H9NA 4J9DA 4C8QD 1YJ9Q 2K3XA 5D7UA 4M7DE 4IURA 4BACA 3EG0A 1VQOQ 4XU0A 4PJOA 5GAOr 4IIOA 2DIQA 3EHRA 3UWNA 5KH6A 2HBWA 2GCXA 2RF0A 3FC3A 2XKOC 2NLUA 4A4HA 4XTXA 5IH2A 2QEXA 1VUBA 2DIGA 2ZPIB 3EGDA 1D1CA 3HRTA 2DVEA 3S6WA 3CCVQ 2E3IA 2QAZA 1VIFA 2ZGWA 1K76A 3L42A 2DL3A 4M78B 4WF2A 2GGRA 1YIJQ 1PKSA 4C8QC 2EGAA 3CCRQ 1IB8A 1IO6A 4JDSA 4EDUA 4M7DD 4E7KA 3JV3A 5CO7A 1K8AU 4N0AC 3LW5E 2DRMA 3OY9A 1PSEA 3JCMd 2PVOB 2P84A 1A0NB 4KH0B 5GAN7 1TOVA 3OBWA 4FCYA 1UEBA 4J9GA 3LGFA 2AZSA 2K3YA 1OEBA 1KHCA 3OYFA 2KROA 2QQ9A 3OBYA 5GAMg 2WACA 1RAEB 3INZA 5CR2A 1WJQA 4C92A 1N8RC 2O9SA 1WHLA 2NUPA 4IUPA 5HK0A 4XU1A 1GL5A 1RI9A 4M7DC 1KG1A 4C92E 2QEXT 2CSIA 4OGCA 2GTOA 2LC4A 3M5AA 4M7AF 3EG2A 3G71A 3MP6A 5A0DA 1O9SA 1K9MR 3JCMV 3L2QA 1W2BS 1M1KU 1VQMQ 2L3PA 3KUFA 2XDPA 3R6NA 1WLPB 1UB4A 2OTLQ 4Z88A 1VQ7Q 3CCJQ 2DBKA 1Z9ZA 3M54A 1VQ8Q 1UGRB 2XG8D 1XTDA 1KQ2A 4Z02A 4PNOA 2RHUA 2A3LA 1JEGA 1T0JA 4PFZA 1YN8A 3RKXA 1MUZA 3FJ5A 5GANe 3WVEB 1UECA 3HSBA 2RJFA 1R0CB 2KMTA 2XICA 3HPWA 4OB3B 4C92D 2HKQB 2CP5A 1NM7A 3QBYA 1UGVA 3HKSA 5DLQE 1AEYA 1B34B 1I4K1 4ELZC 3EHQA 5DLOA 1XOVA 1TH7A 2CZ7B 2DZCA 2RMOA 5LJ3j 2GFUA 2ENMA 2CYZB 2DO3A 4C5GA 3L2WA 1U3OA 2DILA 2K5IA 3G71T 5KCHA 4BI4A 1NEBA 2ZPHB 5LJ3h 3PMTA 4QKUA 3LGLA 4C92C 3CCSQ 2X9HA 2BTTA 3U23A 3AHUA 4YTLA 3IQLA 2FPFA 2V8KA 2W0ZA 2RK1A 1D3BB 5LJ5j 1OV3A 4GY5A 2F5TX 2CP3A 4E7LA 1B07A 1ABOA 1WHMA 3CC4A 1W2BP 1C0MA 5LJ5h 2E41A 3GNFB 2D1XA 2HSEB 3F70A 1RLPC 4MMLA 3VUBA 3CMEQ 4ANJA 3X20B 3HFNA 4RMOA 1RL2A 2SEMA 2A28A 2HAXA 1NJIR 1BCOA 2NYSA 2EKHA 2GF7A 2NUTA 4EMHA 1D0ZA 1JXMA 1M2VB 5GAMj 2BKDN 3PGGA 5CKDA 1SEMA 1WHKA 2DNUA 2BZ8A 2G3RA 4JRKA 4PK4A 1RLQC 4PJNA 3VYHB 1N6AA 4OP0A 1PWTA 3NTHA 3V8LA 1H3ZA 1BK2A 5GAMh 3A5ZB 2RO0A 4C8QB 1S72Q 1WNLA 1WZOA 3CPFA 1YJNQ 3OW2A 1QLYA 1OOTA 2KXCA 1LJOA 4EMKA 4Z8AA 1K9MU 2EYWA 1MMNA 3VRZA 3CC4T 4B9XA 4M78E 2F2VA 4ELYC 2RPNA 2X4YA 3JCMe 4A63B 4HT8A 2COWA 2QTVA 4ME7A 1JRIA 2PVGB 2DETA 1V1CA 5KYUA 5IHNA 4FW2A 2E1HA 1MNEA 3P8HA 1Q7YR 3I55Q 1RAAB 2VC8A 5CK9A 2K5LA 1N9SA 3RERA 2QDLA 2EGCA 4DBFA 3CCEA 1PC0A 2J6FA 4V2SA 1FMVA 4M7DB 4ZGJB 3C0CA 2HZYA 3E9GA 1HYOA 5L23A 1K8AC 4M75G 2DD5A 2CP7A 2ZAEA 3NFCA 1JXOA 4M78D 1TS9A 2JNGA 4QVZA 1QVFS 4PJOB 2JM8A 3BDLA 4C0DB 4IUQA 1P92A 5GJVB 1EFNA 2VYTA 2E64A 1C1AA 1RADB 5CKHA 4IIMA 1I1JA 2LCSA 1I5LA 4XTWA 3H41A 5LL6S 3EGDB 1YJ9A 4BE0A 3EG3A 3CPWP 4E47A 1VQLT 1JJ2A 1VYVA 4HA8A 1H641 2X51A 1VQOA 2HSPA 2FZKB 3SEMA 2KXDA 1AWJA 1SRMA 4M7AA 3M59A 3MEVA 3WVDB 5FRNA 1GXIE 2QDYB 1OULA 3FJPA 4LDUA 1M1KC 3EFRA 1D1AA 1G3TA 3HHTB 3CCVA 2GNCA 1ZLMA 3D7SB 2ESWA 3VRYA 3ZL7C 4ZGEB 3FDRA 3CCET 1CKBA 2BIVA 1U5SA 2F69A 2YUPA 4GLMA 3BW1A 3CCRA 4IUUA 3JRZA 1UG1A 2QK0A 1NJIU 2CP2A 4ZN3A 1K73R 2H8HA 3S3OA 4C92B 1BIBA 4OGEA 2RHYA 2NUPB 5DY9A 3C12A 1CKAA 2LCCA 1LNXA 3RKYA 2DVJA 2ECZA 3H0HA 4DEXA 3QO3A 2JUFA 2K2MA 1YJ9T 2X3XD 1GCPA 3I9QA 2GQVA 4MZPA 2EJFA 1WJSA 2GFAA 1VQOT 4PJOG 2L89A 4DBQA 1OI1A 1M1FA 4ATOA 3NTKA 3TQ7P 2LQWA 4ZN1A 1TSFA 1KC8R 3CQTA 4M75A 2D0QB 2KT1A 3UATA 3OMCA 2M02A 2J05A 3CCVT 1W1FA 1VQMA 4J8OA 2VB6A 2JMCA 3CCMQ 3RR6A 1WA7A 3X26B 1Y7XA 1SSHA 4N4GA 3GP8A 2OTLA 1VQ7A 3FRNA 1YI2Q 3CCJA 3C94A 3G6EQ 2E3HA 1SKUB 3PNWC 1YIJT 3OMGA 1VQ8A 2VKNA 3CCRT 4QQ6A 2ABLA 2HQHA 1Q7YU 1MHNA 5D6WA 3I5RA 3MJXA 3QJ6A 4KGXB 4JZ3A 2BZXA 4KGVB 3VS7A 2V1QA 5LJ5f 2ZPBB 1OZ3A 2D9TA 2I0NA 2COYA 2KAFA 3ULRB 3GIBA 1M2OA 1AWXA 3JCMg 2L3SA 4FIBA 1ZUUA 4M75D 3CXCP 1WXBA 4JJCA 2R58A 2WSCE 3OSVA 1V29B 4C8QE 3A98A 5GANj 3UDCA 5AYFA 3OS2A 2PTKA 4KUIA 3OYIA 3P8BB 5CKBA 2DAQA 1PD1A 3M55A 3X24B 2ED0A 1QWEA 3JB9F 4LXCA 4XTUA 2CUDA 4XU2A 1X6GA 5GANh 2V8JA 1B7TA 1VQ4Q 1AOJA 1IHWA 1VQMT 4LE9A 5GAMf 2DKGA 1Z9QA 3MEAA 2IIMA 1KIKA 2PZ1A 2LVMA 3CCSA 1D0XA 4F7UF 2OTLT 1VQ7T 1XNIA 3CCJT 2J6OA 1WX6A 1K9MC 2LQKA 1VQ8T 1ABQA 5KYYA 1SRLA 4M75C 2DL7A 3M53A 3LYIA 2YSQA 2JVVA 1UHCA 1KSWA 2LMJA 1M90R 1R77A 3CCQQ 3M0UA 2P0QA 2K3BA 1I07A 4PJJA 4TVRA 2NUTB 1QVGA 3OYBA 2LT1A 1X2KA 3PFSA 1YJWQ 1ZHIA 1W70A 3CMEA 4PJOE 4HCBA 1K73U 2E5KA 2LQ8A 5GMKl 3CCLQ 3QZ5B 4HCCA 3QUIA 1YP5A 1RUWA 2K9GA 4RCCA 2YXYA 2ATCB 2RQVA 2Y4XA 3JCMb 5M9OA 1NLPC 1GCQA 2O4XA 4QVCA 1ZA1B 2Y90A 5FW9A 3GLXA 1J3TA 4J9IA 5C6SA 4J5YA 3CCST 5KYUB 5FU6C 1M1GA 3JCMW 2LNHB 1S72A 3L2RA 1YWPA 1YJNA 3OW2S 3QWXX 1QCFA 5ECAA 4PJOD 3MP1A 1KC8U 2XI9A 2FL7A 1QCOA 1UDLA 2K6DA 3RUXA 4J9CA 4CRIA 3EG1A 3GF5A 2MF2A 4BDYA 3QPHA 4DOWA 4MZTA 3HL8A 2DEQA 2OAWA 1YITA 1Q86R 5KYNA 4HT9A 2Z0WA 2DXBA 1YWOA 2MIOA 1SSFA 2ZPGB 2EJGA 3CMET 3THKA 4A4GA 3I55A 2QXFA 2H3JA 1Y96A 2KNBB 2CGHA 4JPBW 1VA7A 4JRPA 3JB9G 1MV0B 2DE0X 2LJ3A 2LNVA 1IHVA 1PRLC 5GJWB 4R55A 3X28B 4BI8B 2M1HA 3JCMJ 4PJOC 1HD3A 4C0DC 3JCMP 5I11A 3HRSA 1NJIC 1KFZA 3N5BB 5HKCA 4JJNK 3JCMh 1VOMA 1H92A 2EYXA 5HY6A 1N27A 4J6YA 2XDDA 4M77G 2QGGA 4A4FA 4PKCC 4AFSC 2JN0A 5FLXE 4PLIA 3A8GB 1S72T 5D6XA 1YJNT 3OSSC 1SG5A 2O01E 3REAB 4ZTFA 4HCKA 2RHIA 4CC3A 1GCQC 5LJ3d 1JJ2S 2CH4A 1YCYA 5A0GA 2R57A 4FT4A 5FROA 1Q81R 2JZ2A 3VU3C 2AK5A 4CC4B 4ESRA 1OZ2A 3L1AA 1BYMA 1NEGA 2DXUA 2I2LA 4Y28E 2D8JA 3JB9H 4X1VA 3REBB 2DJQA 3I55T 1U06A 2RQTA 3J7AF 1M90U 2O2OA 4JJBA 3ZBDA 5LJ5d 1VQ5Q 2EIFA 2H3EB 3M9QA 1QW1A 4R0KA 3UA7A 3ME9A 1LCKA 2CUBA 2IVWA 1M9SA 4D8KA 1S1NA 1G5VA 5KE2A 2LT4A 1BU1A 1Q7YC 1AZGB 3BFMA 2CREA 3QYGB 2DZ9A 5CQYA 1T3LA 1W6XA 4FSXA 1V76A 1WGSA 1E7OA 4E7ZA 5CCAA 1OU8A 1HXDA 4XTYA 3GNGA 5GAN6 2JTFA 2XIDA 1JQQA 3FLGA 3EFSA 1R8OB 2XU8A 3ZEHA 5KYWA 2RJCA 4HCZA 2E6ZA 1JU5C 2MWOA 2X4WA 2QA4Q 4M75B 4XQ3A 4KT0E 1SPKA 2DYIA 4OB2B 4OF1A 2YT6A 2YWWA 4FM4B 4QQDA 3VV0A 1I0CA 3DB3A 4JJDA 1VIEA 2JMAA 2RJDA 2AZVA 3MPUB 1WPYA 1BCMA 2DL8A 1TUGB 4M7AG 1WYXA 2QQBA 3FIFA 4LUEA 3E2UA 5GANf 4F7UA 4J7IA 2CP0A 4E7JA 2BE9B 4XU3A 3CCMA 2QASA 2HDAA 1KQSS 1ZSGA 4M77A 1Q86U 4Y92A 3NTIA 2AKKA 3I5SA 1YI2A 3G6EA 2K5FA 1UGSB 4E6RA 2X4XA 4C8QF 5KE3A 2HBPA 3URGA 3E9FA 1HJDA 3QKJA 3PIPA 3VS0A 1Y0MA 3AT1B 1U8RA 1ZUYA 4DBRA 2QG9B 4LDVA 2C0OA 5FU6B 3TU4K 1WJRA 3H8ZA 4BY6C 1VQ9Q 2XK0A 3JB9D 1PD0A 3OYYA 2KRNA 1YITQ 1K73C 3HFOA 2A0FB 1XJWB 1QKWA 2A08A 5GAN3 2C06A 4GLKA 2CDTA 2EJ9A 3LWHA 1MMAA 1IXDA 1H3HA 2KI7A 3A8MB 3H0FA 3TEEA 5DM7R 2BE7D 3QG1A 4K11A 3VS6A 2RNAA 2KYMA 2JW4A 2LRQA 5KYXA 4M77D 3OYDA 4M7DF 5KYYB 2V26A 4XTVA 2GTJA 1WDXA 1UTIA 1NG2A 3O8VA 2IPOB 4J7FA 2LZ6B 1VQ4A 1Q81U 2O31A 3CBPA 2A37A 3EGXA 4XAXB 3O5ZA 4WCIA 1KC8C 3EFOA 1NYFA 4D6WA 3QWYA 1YI2T 3PVQA 3G6ET 2FRWA 2DK3A 2PU9B 2LTOA 5J3BA 1W2BA 1BIAA 1UHFA 1N9RA 1D0YA 1M30A 2XD0A 3CC7Q 3G4SQ 2C0TA 2HQEA 1KQSP 2HCKA 2E65A 2EWNA 3CCQA 2F2WA 4L6V5 4OB1B 3VS4A 4M77C 2KE9A 3EG9A 2M0OA 2V8IA 1YJWA 2DL5A 2O4XB 2K57A 2DBMA 3M57A 4HKEA 3RNJA 1YHQQ 5LJ3e 4M7AE 2FZCB 3CCLA 1WQWA 4EMKC 4MDXA 1TWBA 2KK4A 1WHJA 2YLBA 3KFVA 2OX7A 1I8FA 4LD6A 1WI7A 4JLGA 2ZCFB 2EGEA 3TREA 4XTZA 3JCMf 4E7IA 4A54A 2JOYA 8AT1B 4J9FA 1D09B 3SWNA 3OYGA 4IUTA 2M16A 1PM3A 2RD1A 3OYMA 1VQ4T 2L2PA 5IN1A 3TVTA 3OYJA 1CSKA 1NPRA 4C92F 2VASA 3VS3A 3MKDA 2YLCA 2PUKB 3PVLA 1UFFA 2ZPEB 4M7AD 1FX7A 5CAIA 1AVZC 1OX8A 1Y96B 1H8KA 3E19A 1T3SA 1YBYA 3TCJA 5IAYA 3CCQT 1QVFP 1WHGA 1PHTA 3L2UA 2MCNA 2E6NA 1YJWT 1XQHA 3EGUA 4RTVA 2E70A 3V8KA 1M90C 4RTWA 5IXBA 3RMSA 5AT1B 3OYEA 3CCLT 3G1JA 3H0IA 4E2FB 3JCMQ 3CMAQ 4NL2A 3M56A 5CVIA 1ZUKA 5I22A 4M75E 5L8RE 2YUOA 1KD1R 5IT9E 3QDFA 3Q1JA 4M7AC 1QP3A 4B6MA 5A2QE 1BI1A 3SFMA 2DFUA 2EQIA 1BI2A 1Y57A 4M4ZA 3OYNA 1PCXA 1SHGA 4OMNA 4A4KA 1WIEA 3CPWA 1TG0A 3V7RA 1X6BA 4C5EA 2QI2A 1FYNA 2OJ2A 3BY7A 5GANd 1VQNQ 1ZX6A 3SWNC 1VQPQ 3A1PA 4PFOA 2RM4A 2X3WD 4OMLA 3BDUA 1BI0A 4BY6B 1I5OB 3PTAA 2M9UA 1HK9A 2FPEA 1WQ7A 1VQLQ 4MMKA 1GBQA 2J7IA 5I2MA 4PFPA 3SB2A 2EW3A 2E10A 4AT1B 1E6HA 3J81E 3M4GA 1BI3A 4F17A 1O75A 1Q86C 2W10A 1NPPA 1VQ5A 2AKLA 1UJYA 3DLLA 2X4JA 4CC2A 5KYWB 1AWOA 4N0AA 1MNDA 2YRDA 5HK3A 1SF9A 5GMKi 2RK2A 3QJYA 4DEYA 1HSQA 2KBTA 6AT1B 3V8JA 1JO8A 4F16A 4C0GA 3LLRA 3UA6A 2EVRA 4DBHA 4LN2A 4OMFB 1B3QA 2DTOA 3UPUA 3A8HB 4DQ2A 2M0YA 2A36A 2ROLA 2DERA 1QVFA 3HP9A 2QA4A 3JCMc 4F7UB 2OTJQ 1RAIB 2KRMA 1UGPB 1K0XA 4N4IA 4M7DA 5FWCA 3ZFJA 1WFWA 1OPLA 1IRXA 2HD0A 4M77B 3GOXA 2MOXA 2L3RA 2VV5A 3CBMA 3HRUA 2JTMA 2K7AA 3A8LB 5LJ3g 1Q82R 1IZ6A 4AFUC 3OS0A 2BZYA 4HVVA 3S3NA 1Q81C 4M78F 4J9BA 2HL5C 2DTHA 3DB4A 4EMKB 1EZZB 2V1RA 4HXJA 1C6VX 1QVPA 4AG1C 1VQ5T 1VQKQ 3I56Q 4C0FA 3OA6A 1G3YA 1ZSZA 3NGPA 3SDZA 2K2VA 2EQMA 2RHZA 3DLMA 4D8DA 2CSQA 3FEOA 5LJ5g 1U1SA 5GMKe 1QP2A 2GBQA 3OQ5A 1UUEA 2HL3A 2YUNA 5KYXB 1UGQB 2M51A 3LX7A 4JZ4A 1KD1U 1VQ9A 4L59A 3META 3T9NA 4IKFA 1KJWA 3CXCA 1NLOC 2QA4T 2KVQG 1VQ6Q 1M3CA 1PG5B 2HEQA 2P4RA 2DLPA 4QQGA 3OYHA 3EGXB 3CC2Q 2CP6A 2DXTA 1LPLA 4C0ZA 5GAN8 4HVUA 1GFCA 3EFOB 4JLIA 3CD6Q 1BBZA 1VYTA 1WHHA 1UJ0A 4J83A 1LVKA 2CZ6B 3TSWA 2RHXA 3VS2A 2D6FA 4F7UG 4ORZA 1K1ZA 3JB9I 1K0SA 3JB9J 3QXEB 2RJEA 4BDZA 2G6FX 3UT1A 4OMMA 3EG9B 3VYGA 2MAMA 2SRCA 4DOVA 4M7AB 1X6OA 2DPPB 1BB9A 1FWZA 3QYHB 4AMCA 4OMOA 1Y71A 2KR3A 3CC7A 3G4SA 1PKTA 4XK8E 4FYYB 1X69A 2DRKA 3LH0A 2F2XA 1R0BG 3EH1A 2CKKA 3RDVA 2KY9A 4BE2A 1FMWA 3CCUQ 4JRIA 1TUCA 2D0NA 2KGTA 1ZSZC 1VQ9T 2MK5A 3GBQA 5IHIA 1YITT 4Q5WA 2FRYA 2KSSA 2PQWA 3SWNB 2PUOB 3OW2P 4EIKA 1YHQA 3S3MA 1JBMA 4KUDK 1AT1B 1E6GA 1M27C 1SHFA 4M78G 1TU0B 2R5MA
chains in the Genus database with same CATH topology
3G6EQ 3G71Q 1YIJQ 1N8RR 3CCUQ 1NJIR 1W2BP 1VQ5Q 1VQ9Q 3CCRQ 1VQNQ 1Q81R 1VQKQ 3I56Q 1VQPQ 3CCLQ 1YITQ 1KC8R 1K9MR 1YJ9Q 3CD6Q 1YHQQ 1VQMQ 1VQ4Q 3CXCP 1M90R 3G4SQ 1S72Q 3CC7Q 3CCSQ 3CCQQ 3CCVQ 3CMAQ 2QA4Q 1Q82R 1Q86R 1VQLQ 1YJNQ 3OW2P 3CPWP 1QVFP 1QVGP 1VQ6Q 3CCMQ 1YI2Q 1VQOQ 1K73R 1KQSP 1JJ2P 1VQ7Q 2OTLQ 1Q7YR 3CCJQ 3I55Q 1KD1R 2OTJQ 3CMEQ 1YJWQ 1M1KR 3CC4Q 3CCEQ 1K8AR 3CC2Q 1VQ8Q 2QEXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  3G71 Q;  1YIJ Q;  1N8R R;  3CCU Q;  1NJI R;  1W2B P;  1VQ5 Q;  1VQ9 Q;  3CCR Q;  1VQN Q;  1Q81 R;  1VQK Q;  3I56 Q;  1VQP Q;  3CCL Q;  1YIT Q;  1KC8 R;  1K9M R;  1YJ9 Q;  3CD6 Q;  1YHQ Q;  1VQM Q;  1VQ4 Q;  3CXC P;  1M90 R;  3G4S Q;  1S72 Q;  3CC7 Q;  3CCS Q;  3CCQ Q;  3CCV Q;  3CMA Q;  2QA4 Q;  1Q82 R;  1Q86 R;  1VQL Q;  1YJN Q;  3OW2 P;  3CPW P;  1QVF P;  1QVG P;  1VQ6 Q;  3CCM Q;  1YI2 Q;  1VQO Q;  1K73 R;  1KQS P;  1JJ2 P;  1VQ7 Q;  2OTL Q;  1Q7Y R;  3CCJ Q;  3I55 Q;  1KD1 R;  2OTJ Q;  3CME Q;  1YJW Q;  1M1K R;  3CC4 Q;  3CCE Q;  1K8A R;  3CC2 Q;  1VQ8 Q;  2QEX Q; 
#chains in the Genus database with same CATH topology
 3GPL A;  2FG0 A;  2VGN A;  2LJ1 A;  2KEA A;  5I2S A;  2DTI A;  1MMD A;  1X2Q A;  9ATC B;  1UE9 A;  3CBO A;  1G8X A;  5GAN 5;  1NBE B;  4PJM A;  2EQU A;  3ER0 A;  1QMC A;  2YRC A;  1LOJ A;  5EC7 A;  5J39 A;  3TSZ A;  2F1L A;  2MYS A;  3MEW A;  3VS5 A;  4LDY A;  2QGF B;  1Q82 U;  2DYB A;  4FYV B;  2FZG B;  4J9E A;  1MGQ A;  2QTX A;  4M75 F;  5GAO p;  1PRM C;  4PJL A;  4RTY A;  3CC7 T;  3G4S T;  3G7Z A;  5CKF A;  3HTR A;  4PLL A;  2O88 A;  2DD4 A;  1FMK A;  2JS0 A;  4C5I A;  5CIU A;  5GAM d;  4KBM B;  2CT3 A;  2LCL A;  1M8M A;  1N8R R;  4KGZ B;  5KCO A;  4RTX A;  4ZGD B;  4JS5 A;  2LJ0 A;  1DJ7 B;  3OYC A;  1YHQ T;  4RG8 A;  2RI5 A;  5FU7 C;  1K4U S;  4BD3 A;  1JJ2 P;  4CI0 C;  3CMA A;  4LDW A;  2QEX Q;  4F7U E;  2QQR A;  2NUZ A;  2XMF A;  4F04 B;  2VXE A;  1M3A A;  2VVK A;  4BB7 A;  1ARK A;  4A53 A;  4M77 E;  3PIO A;  1N5Z A;  2DF6 A;  4ZTJ A;  5GAN 4;  1GFD A;  3ASK A;  2IG0 A;  1QWF A;  5FWB A;  4LD9 K;  1ZQ1 A;  2PVD B;  3CPW S;  1M3B A;  2HQX A;  2VUB A;  2KQW A;  4N4H A;  4FYX B;  2B86 A;  2EPD A;  4KH1 B;  3RES A;  3A8O B;  2HNI A;  3M0S A;  2AIR B;  2LX7 A;  2C0I A;  1NE8 A;  1VQN A;  1QQJ A;  3EAE A;  1VQP A;  2JTE A;  3JCM X;  4J6X A;  2YUQ A;  3L2V A;  3VUZ A;  1OQK A;  2F5K A;  2VGM A;  4LUD A;  4M78 A;  1WXU A;  1VQL A;  3PT9 A;  2LQN A;  2L3Q A;  3VJP A;  3C95 A;  4IUV A;  3WXM B;  3M58 A;  1TUD A;  4NS5 A;  4L5G A;  2P4T A;  2JXB A;  4A4E A;  3I35 A;  1G3S A;  1KK7 A;  2E4H A;  2FHD A;  4J6W A;  2EBP A;  1IGU A;  2CZ1 B;  2MMP A;  1X43 A;  1EX4 A;  2HMA A;  3CMA T;  1YFN A;  3NHN A;  4EMG A;  5GAO m;  3JAM E;  2EYQ A;  1M4Z A;  3CCM T;  2LDM A;  4PJO F;  2L8D A;  2JJ9 A;  1Q95 G;  1AWW A;  2VXF A;  3OB9 A;  3G71 Q;  4B9W A;  1IRE B;  4RKU E;  5IHK A;  4II1 A;  4OMP A;  2MWP A;  2QQS A;  2EQK A;  3MEU A;  5CQX A;  1KD1 C;  1MV3 A;  2NWM A;  4OB0 B;  1WXT A;  4BI3 A;  2DEU A;  1GBR A;  4QT7 A;  1G3W A;  4ZNX A;  4C5H A;  5HCK A;  1GRI A;  4RUG A;  3KXT A;  2FB7 A;  3PMI A;  1QVG S;  2OTJ A;  1X27 A;  4EPC A;  1QKX A;  2EKO A;  2KDS A;  2DXC A;  1VQN T;  2PNI A;  1VQP T;  4UC4 A;  2QYZ A;  3L2Z A;  8ATC B;  2RQW A;  3CEY A;  1KQ1 A;  1RAC B;  1ZSZ B;  2RQU A;  5GAN g;  2MPX C;  4MDW A;  2Y4Y A;  4AFZ C;  5I21 A;  4O5V A;  2YHT A;  4QW2 A;  1YCS B;  4FU6 A;  1EIF A;  2J6K A;  2O9V A;  2QQA A;  2CZ0 B;  5IXF A;  2CS7 A;  2AHJ B;  4FYW B;  3VS1 A;  1VQK A;  4KRT A;  3I56 A;  4C8Q G;  4M78 C;  1D1B A;  1N8R U;  5EG2 A;  5D6Y A;  5LJ5 e;  5GAO q;  1OPK A;  4FW1 A;  2A7Y A;  4O6J A;  2EFI A;  3OS5 A;  4RG2 A;  1B34 A;  3OYL A;  4LNP A;  2JM9 A;  2LP5 A;  4GBQ A;  1T0H A;  1YIJ A;  4MZM A;  3RKW A;  4FT2 A;  1AZE A;  2ZPF B;  3LH5 A;  4AG2 C;  4JS4 A;  5FRM A;  1MMG A;  4OMQ A;  1JB0 E;  3M0P A;  3C4S A;  2JT4 A;  1M8V A;  2B8A A;  4OVA A;  2K79 A;  4X9C A;  4F14 A;  3CXC S;  2RH2 A;  1BKB A;  1OYX A;  4Y91 A;  1VQ6 A;  2OTJ T;  3CC4 Q;  1M5Q 1;  5GMK j;  5GAO l;  1PSF A;  2KRS A;  4P5N A;  4NL3 A;  4NOY A;  3CC2 A;  3NPF A;  1Y07 A;  4M7D G;  2XHC A;  1OX9 A;  1AD5 A;  4RTU A;  2CT4 A;  3QSU A;  5GAM e;  4E7S A;  3MO8 A;  3CD6 A;  3QZ9 B;  2OI3 A;  2WSF E;  5GMK h;  1QVG P;  1I81 A;  2FPD A;  1D3B A;  2EYZ A;  3H6Z A;  2ROT A;  1RAH B;  1K8A R;  5FU7 B;  1RAB B;  3DKM A;  3M0R A;  1QCN A;  1Q82 C;  3QHS A;  1ACM B;  1VYU A;  2ED1 A;  1VQK T;  4BUG A;  3M0T A;  3I56 T;  2K4Y A;  3V7C A;  5J26 A;  2KYB A;  2OAU A;  2VWF A;  4AFQ C;  3M0Q A;  4X9D A;  5LJ3 f;  3OS1 A;  2YRV A;  5A0L A;  1KQS A;  2L0A A;  3VKI A;  1X01 A;  3R6O A;  4FSS A;  4E7H A;  4LDX A;  4X34 A;  5GMK m;  2MI6 A;  4KUL A;  2RN8 A;  3JSC A;  4DA4 A;  1TTH B;  2COZ A;  1KHI A;  3UF4 A;  1FXX A;  2FYK A;  3OYK A;  1AHJ B;  1NZ9 A;  3CCU A;  2EYY A;  1ZA2 B;  2E5Q A;  2DJZ A;  1M2V A;  3M4Y A;  3LWI A;  3OYA A;  2P0P A;  3QDR B;  3SD4 A;  4CC7 A;  1VQ6 T;  4Z89 A;  2D8H A;  2HKN A;  2L5Q A;  3RBB B;  2EAY A;  1M1K R;  4PL6 A;  4BE1 A;  3P8D A;  3CC2 T;  2YDL A;  2KT8 A;  1NYG A;  4J9H A;  2J06 A;  2DX1 A;  2XDB A;  3QII A;  4RTT A;  2RB6 A;  4JRQ A;  1RAF B;  2FEI A;  1ZBX A;  1ZBJ A;  4C8Q A;  5GAO n;  3MHX A;  2DL4 A;  1OU9 A;  3FB9 A;  3KBG A;  3CD6 T;  4R56 A;  4JUV A;  2GQI A;  2DA9 A;  3EH2 A;  2BUD A;  2P0K A;  2RA2 A;  2AT1 B;  2FVU A;  1RI0 A;  1RAG B;  2FO0 A;  2EQJ A;  4C92 G;  3CCE Q;  2CH4 W;  4RCB A;  4RTZ A;  3SHW A;  2JS2 A;  4FL6 A;  3PE0 A;  1G2B A;  1F1B B;  2X35 A;  1U1T A;  1G83 A;  3V7S A;  3X25 B;  1W4S A;  1YNZ A;  3BE3 A;  5GAN 2;  1TXQ A;  4HVW A;  5CKE A;  3RMQ A;  5C0M A;  4WTO B;  2ZZD A;  3NMZ C;  1PNJ A;  7AT1 B;  2RQR A;  2LX9 A;  2RI2 A;  2DMO A;  3RIR A;  2E12 A;  2R5A A;  2WSE E;  3E1S A;  4VUB A;  1K9A A;  2DM1 A;  3J80 E;  3MCA B;  4M77 F;  1IGQ A;  1X75 C;  4QVD A;  3CCU T;  2RI3 A;  3MP8 A;  3H9N A;  4J9D A;  4C8Q D;  1YJ9 Q;  2K3X A;  5D7U A;  4M7D E;  4IUR A;  4BAC A;  3EG0 A;  1VQO Q;  4XU0 A;  4PJO A;  5GAO r;  4IIO A;  2DIQ A;  3EHR A;  3UWN A;  5KH6 A;  2HBW A;  2GCX A;  2RF0 A;  3FC3 A;  2XKO C;  2NLU A;  4A4H A;  4XTX A;  5IH2 A;  2QEX A;  1VUB A;  2DIG A;  2ZPI B;  3EGD A;  1D1C A;  3HRT A;  2DVE A;  3S6W A;  3CCV Q;  2E3I A;  2QAZ A;  1VIF A;  2ZGW A;  1K76 A;  3L42 A;  2DL3 A;  4M78 B;  4WF2 A;  2GGR A;  1YIJ Q;  1PKS A;  4C8Q C;  2EGA A;  3CCR Q;  1IB8 A;  1IO6 A;  4JDS A;  4EDU A;  4M7D D;  4E7K A;  3JV3 A;  5CO7 A;  1K8A U;  4N0A C;  3LW5 E;  2DRM A;  3OY9 A;  1PSE A;  3JCM d;  2PVO B;  2P84 A;  1A0N B;  4KH0 B;  5GAN 7;  1TOV A;  3OBW A;  4FCY A;  1UEB A;  4J9G A;  3LGF A;  2AZS A;  2K3Y A;  1OEB A;  1KHC A;  3OYF A;  2KRO A;  2QQ9 A;  3OBY A;  5GAM g;  2WAC A;  1RAE B;  3INZ A;  5CR2 A;  1WJQ A;  4C92 A;  1N8R C;  2O9S A;  1WHL A;  2NUP A;  4IUP A;  5HK0 A;  4XU1 A;  1GL5 A;  1RI9 A;  4M7D C;  1KG1 A;  4C92 E;  2QEX T;  2CSI A;  4OGC A;  2GTO A;  2LC4 A;  3M5A A;  4M7A F;  3EG2 A;  3G71 A;  3MP6 A;  5A0D A;  1O9S A;  1K9M R;  3JCM V;  3L2Q A;  1W2B S;  1M1K U;  1VQM Q;  2L3P A;  3KUF A;  2XDP A;  3R6N A;  1WLP B;  1UB4 A;  2OTL Q;  4Z88 A;  1VQ7 Q;  3CCJ Q;  2DBK A;  1Z9Z A;  3M54 A;  1VQ8 Q;  1UGR B;  2XG8 D;  1XTD A;  1KQ2 A;  4Z02 A;  4PNO A;  2RHU A;  2A3L A;  1JEG A;  1T0J A;  4PFZ A;  1YN8 A;  3RKX A;  1MUZ A;  3FJ5 A;  5GAN e;  3WVE B;  1UEC A;  3HSB A;  2RJF A;  1R0C B;  2KMT A;  2XIC A;  3HPW A;  4OB3 B;  4C92 D;  2HKQ B;  2CP5 A;  1NM7 A;  3QBY A;  1UGV A;  3HKS A;  5DLQ E;  1AEY A;  1B34 B;  1I4K 1;  4ELZ C;  3EHQ A;  5DLO A;  1XOV A;  1TH7 A;  2CZ7 B;  2DZC A;  2RMO A;  5LJ3 j;  2GFU A;  2ENM A;  2CYZ B;  2DO3 A;  4C5G A;  3L2W A;  1U3O A;  2DIL A;  2K5I A;  3G71 T;  5KCH A;  4BI4 A;  1NEB A;  2ZPH B;  5LJ3 h;  3PMT A;  4QKU A;  3LGL A;  4C92 C;  3CCS Q;  2X9H A;  2BTT A;  3U23 A;  3AHU A;  4YTL A;  3IQL A;  2FPF A;  2V8K A;  2W0Z A;  2RK1 A;  1D3B B;  5LJ5 j;  1OV3 A;  4GY5 A;  2F5T X;  2CP3 A;  4E7L A;  1B07 A;  1ABO A;  1WHM A;  3CC4 A;  1W2B P;  1C0M A;  5LJ5 h;  2E41 A;  3GNF B;  2D1X A;  2HSE B;  3F70 A;  1RLP C;  4MML A;  3VUB A;  3CME Q;  4ANJ A;  3X20 B;  3HFN A;  4RMO A;  1RL2 A;  2SEM A;  2A28 A;  2HAX A;  1NJI R;  1BCO A;  2NYS A;  2EKH A;  2GF7 A;  2NUT A;  4EMH A;  1D0Z A;  1JXM A;  1M2V B;  5GAM j;  2BKD N;  3PGG A;  5CKD A;  1SEM A;  1WHK A;  2DNU A;  2BZ8 A;  2G3R A;  4JRK A;  4PK4 A;  1RLQ C;  4PJN A;  3VYH B;  1N6A A;  4OP0 A;  1PWT A;  3NTH A;  3V8L A;  1H3Z A;  1BK2 A;  5GAM h;  3A5Z B;  2RO0 A;  4C8Q B;  1S72 Q;  1WNL A;  1WZO A;  3CPF A;  1YJN Q;  3OW2 A;  1QLY A;  1OOT A;  2KXC A;  1LJO A;  4EMK A;  4Z8A A;  1K9M U;  2EYW A;  1MMN A;  3VRZ A;  3CC4 T;  4B9X A;  4M78 E;  2F2V A;  4ELY C;  2RPN A;  2X4Y A;  3JCM e;  4A63 B;  4HT8 A;  2COW A;  2QTV A;  4ME7 A;  1JRI A;  2PVG B;  2DET A;  1V1C A;  5KYU A;  5IHN A;  4FW2 A;  2E1H A;  1MNE A;  3P8H A;  1Q7Y R;  3I55 Q;  1RAA B;  2VC8 A;  5CK9 A;  2K5L A;  1N9S A;  3RER A;  2QDL A;  2EGC A;  4DBF A;  3CCE A;  1PC0 A;  2J6F A;  4V2S A;  1FMV A;  4M7D B;  4ZGJ B;  3C0C A;  2HZY A;  3E9G A;  1HYO A;  5L23 A;  1K8A C;  4M75 G;  2DD5 A;  2CP7 A;  2ZAE A;  3NFC A;  1JXO A;  4M78 D;  1TS9 A;  2JNG A;  4QVZ A;  1QVF S;  4PJO B;  2JM8 A;  3BDL A;  4C0D B;  4IUQ A;  1P92 A;  5GJV B;  1EFN A;  2VYT A;  2E64 A;  1C1A A;  1RAD B;  5CKH A;  4IIM A;  1I1J A;  2LCS A;  1I5L A;  4XTW A;  3H41 A;  5LL6 S;  3EGD B;  1YJ9 A;  4BE0 A;  3EG3 A;  3CPW P;  4E47 A;  1VQL T;  1JJ2 A;  1VYV A;  4HA8 A;  1H64 1;  2X51 A;  1VQO A;  2HSP A;  2FZK B;  3SEM A;  2KXD A;  1AWJ A;  1SRM A;  4M7A A;  3M59 A;  3MEV A;  3WVD B;  5FRN A;  1GXI E;  2QDY B;  1OUL A;  3FJP A;  4LDU A;  1M1K C;  3EFR A;  1D1A A;  1G3T A;  3HHT B;  3CCV A;  2GNC A;  1ZLM A;  3D7S B;  2ESW A;  3VRY A;  3ZL7 C;  4ZGE B;  3FDR A;  3CCE T;  1CKB A;  2BIV A;  1U5S A;  2F69 A;  2YUP A;  4GLM A;  3BW1 A;  3CCR A;  4IUU A;  3JRZ A;  1UG1 A;  2QK0 A;  1NJI U;  2CP2 A;  4ZN3 A;  1K73 R;  2H8H A;  3S3O A;  4C92 B;  1BIB A;  4OGE A;  2RHY A;  2NUP B;  5DY9 A;  3C12 A;  1CKA A;  2LCC A;  1LNX A;  3RKY A;  2DVJ A;  2ECZ A;  3H0H A;  4DEX A;  3QO3 A;  2JUF A;  2K2M A;  1YJ9 T;  2X3X D;  1GCP A;  3I9Q A;  2GQV A;  4MZP A;  2EJF A;  1WJS A;  2GFA A;  1VQO T;  4PJO G;  2L89 A;  4DBQ A;  1OI1 A;  1M1F A;  4ATO A;  3NTK A;  3TQ7 P;  2LQW A;  4ZN1 A;  1TSF A;  1KC8 R;  3CQT A;  4M75 A;  2D0Q B;  2KT1 A;  3UAT A;  3OMC A;  2M02 A;  2J05 A;  3CCV T;  1W1F A;  1VQM A;  4J8O A;  2VB6 A;  2JMC A;  3CCM Q;  3RR6 A;  1WA7 A;  3X26 B;  1Y7X A;  1SSH A;  4N4G A;  3GP8 A;  2OTL A;  1VQ7 A;  3FRN A;  1YI2 Q;  3CCJ A;  3C94 A;  3G6E Q;  2E3H A;  1SKU B;  3PNW C;  1YIJ T;  3OMG A;  1VQ8 A;  2VKN A;  3CCR T;  4QQ6 A;  2ABL A;  2HQH A;  1Q7Y U;  1MHN A;  5D6W A;  3I5R A;  3MJX A;  3QJ6 A;  4KGX B;  4JZ3 A;  2BZX A;  4KGV B;  3VS7 A;  2V1Q A;  5LJ5 f;  2ZPB B;  1OZ3 A;  2D9T A;  2I0N A;  2COY A;  2KAF A;  3ULR B;  3GIB A;  1M2O A;  1AWX A;  3JCM g;  2L3S A;  4FIB A;  1ZUU A;  4M75 D;  3CXC P;  1WXB A;  4JJC A;  2R58 A;  2WSC E;  3OSV A;  1V29 B;  4C8Q E;  3A98 A;  5GAN j;  3UDC A;  5AYF A;  3OS2 A;  2PTK A;  4KUI A;  3OYI A;  3P8B B;  5CKB A;  2DAQ A;  1PD1 A;  3M55 A;  3X24 B;  2ED0 A;  1QWE A;  3JB9 F;  4LXC A;  4XTU A;  2CUD A;  4XU2 A;  1X6G A;  5GAN h;  2V8J A;  1B7T A;  1VQ4 Q;  1AOJ A;  1IHW A;  1VQM T;  4LE9 A;  5GAM f;  2DKG A;  1Z9Q A;  3MEA A;  2IIM A;  1KIK A;  2PZ1 A;  2LVM A;  3CCS A;  1D0X A;  4F7U F;  2OTL T;  1VQ7 T;  1XNI A;  3CCJ T;  2J6O A;  1WX6 A;  1K9M C;  2LQK A;  1VQ8 T;  1ABQ A;  5KYY A;  1SRL A;  4M75 C;  2DL7 A;  3M53 A;  3LYI A;  2YSQ A;  2JVV A;  1UHC A;  1KSW A;  2LMJ A;  1M90 R;  1R77 A;  3CCQ Q;  3M0U A;  2P0Q A;  2K3B A;  1I07 A;  4PJJ A;  4TVR A;  2NUT B;  1QVG A;  3OYB A;  2LT1 A;  1X2K A;  3PFS A;  1YJW Q;  1ZHI A;  1W70 A;  3CME A;  4PJO E;  4HCB A;  1K73 U;  2E5K A;  2LQ8 A;  5GMK l;  3CCL Q;  3QZ5 B;  4HCC A;  3QUI A;  1YP5 A;  1RUW A;  2K9G A;  4RCC A;  2YXY A;  2ATC B;  2RQV A;  2Y4X A;  3JCM b;  5M9O A;  1NLP C;  1GCQ A;  2O4X A;  4QVC A;  1ZA1 B;  2Y90 A;  5FW9 A;  3GLX A;  1J3T A;  4J9I A;  5C6S A;  4J5Y A;  3CCS T;  5KYU B;  5FU6 C;  1M1G A;  3JCM W;  2LNH B;  1S72 A;  3L2R A;  1YWP A;  1YJN A;  3OW2 S;  3QWX X;  1QCF A;  5ECA A;  4PJO D;  3MP1 A;  1KC8 U;  2XI9 A;  2FL7 A;  1QCO A;  1UDL A;  2K6D A;  3RUX A;  4J9C A;  4CRI A;  3EG1 A;  3GF5 A;  2MF2 A;  4BDY A;  3QPH A;  4DOW A;  4MZT A;  3HL8 A;  2DEQ A;  2OAW A;  1YIT A;  1Q86 R;  5KYN A;  4HT9 A;  2Z0W A;  2DXB A;  1YWO A;  2MIO A;  1SSF A;  2ZPG B;  2EJG A;  3CME T;  3THK A;  4A4G A;  3I55 A;  2QXF A;  2H3J A;  1Y96 A;  2KNB B;  2CGH A;  4JPB W;  1VA7 A;  4JRP A;  3JB9 G;  1MV0 B;  2DE0 X;  2LJ3 A;  2LNV A;  1IHV A;  1PRL C;  5GJW B;  4R55 A;  3X28 B;  4BI8 B;  2M1H A;  3JCM J;  4PJO C;  1HD3 A;  4C0D C;  3JCM P;  5I11 A;  3HRS A;  1NJI C;  1KFZ A;  3N5B B;  5HKC A;  4JJN K;  3JCM h;  1VOM A;  1H92 A;  2EYX A;  5HY6 A;  1N27 A;  4J6Y A;  2XDD A;  4M77 G;  2QGG A;  4A4F A;  4PKC C;  4AFS C;  2JN0 A;  5FLX E;  4PLI A;  3A8G B;  1S72 T;  5D6X A;  1YJN T;  3OSS C;  1SG5 A;  2O01 E;  3REA B;  4ZTF A;  4HCK A;  2RHI A;  4CC3 A;  1GCQ C;  5LJ3 d;  1JJ2 S;  2CH4 A;  1YCY A;  5A0G A;  2R57 A;  4FT4 A;  5FRO A;  1Q81 R;  2JZ2 A;  3VU3 C;  2AK5 A;  4CC4 B;  4ESR A;  1OZ2 A;  3L1A A;  1BYM A;  1NEG A;  2DXU A;  2I2L A;  4Y28 E;  2D8J A;  3JB9 H;  4X1V A;  3REB B;  2DJQ A;  3I55 T;  1U06 A;  2RQT A;  3J7A F;  1M90 U;  2O2O A;  4JJB A;  3ZBD A;  5LJ5 d;  1VQ5 Q;  2EIF A;  2H3E B;  3M9Q A;  1QW1 A;  4R0K A;  3UA7 A;  3ME9 A;  1LCK A;  2CUB A;  2IVW A;  1M9S A;  4D8K A;  1S1N A;  1G5V A;  5KE2 A;  2LT4 A;  1BU1 A;  1Q7Y C;  1AZG B;  3BFM A;  2CRE A;  3QYG B;  2DZ9 A;  5CQY A;  1T3L A;  1W6X A;  4FSX A;  1V76 A;  1WGS A;  1E7O A;  4E7Z A;  5CCA A;  1OU8 A;  1HXD A;  4XTY A;  3GNG A;  5GAN 6;  2JTF A;  2XID A;  1JQQ A;  3FLG A;  3EFS A;  1R8O B;  2XU8 A;  3ZEH A;  5KYW A;  2RJC A;  4HCZ A;  2E6Z A;  1JU5 C;  2MWO A;  2X4W A;  2QA4 Q;  4M75 B;  4XQ3 A;  4KT0 E;  1SPK A;  2DYI A;  4OB2 B;  4OF1 A;  2YT6 A;  2YWW A;  4FM4 B;  4QQD A;  3VV0 A;  1I0C A;  3DB3 A;  4JJD A;  1VIE A;  2JMA A;  2RJD A;  2AZV A;  3MPU B;  1WPY A;  1BCM A;  2DL8 A;  1TUG B;  4M7A G;  1WYX A;  2QQB A;  3FIF A;  4LUE A;  3E2U A;  5GAN f;  4F7U A;  4J7I A;  2CP0 A;  4E7J A;  2BE9 B;  4XU3 A;  3CCM A;  2QAS A;  2HDA A;  1KQS S;  1ZSG A;  4M77 A;  1Q86 U;  4Y92 A;  3NTI A;  2AKK A;  3I5S A;  1YI2 A;  3G6E A;  2K5F A;  1UGS B;  4E6R A;  2X4X A;  4C8Q F;  5KE3 A;  2HBP A;  3URG A;  3E9F A;  1HJD A;  3QKJ A;  3PIP A;  3VS0 A;  1Y0M A;  3AT1 B;  1U8R A;  1ZUY A;  4DBR A;  2QG9 B;  4LDV A;  2C0O A;  5FU6 B;  3TU4 K;  1WJR A;  3H8Z A;  4BY6 C;  1VQ9 Q;  2XK0 A;  3JB9 D;  1PD0 A;  3OYY A;  2KRN A;  1YIT Q;  1K73 C;  3HFO A;  2A0F B;  1XJW B;  1QKW A;  2A08 A;  5GAN 3;  2C06 A;  4GLK A;  2CDT A;  2EJ9 A;  3LWH A;  1MMA A;  1IXD A;  1H3H A;  2KI7 A;  3A8M B;  3H0F A;  3TEE A;  5DM7 R;  2BE7 D;  3QG1 A;  4K11 A;  3VS6 A;  2RNA A;  2KYM A;  2JW4 A;  2LRQ A;  5KYX A;  4M77 D;  3OYD A;  4M7D F;  5KYY B;  2V26 A;  4XTV A;  2GTJ A;  1WDX A;  1UTI A;  1NG2 A;  3O8V A;  2IPO B;  4J7F A;  2LZ6 B;  1VQ4 A;  1Q81 U;  2O31 A;  3CBP A;  2A37 A;  3EGX A;  4XAX B;  3O5Z A;  4WCI A;  1KC8 C;  3EFO A;  1NYF A;  4D6W A;  3QWY A;  1YI2 T;  3PVQ A;  3G6E T;  2FRW A;  2DK3 A;  2PU9 B;  2LTO A;  5J3B A;  1W2B A;  1BIA A;  1UHF A;  1N9R A;  1D0Y A;  1M30 A;  2XD0 A;  3CC7 Q;  3G4S Q;  2C0T A;  2HQE A;  1KQS P;  2HCK A;  2E65 A;  2EWN A;  3CCQ A;  2F2W A;  4L6V 5;  4OB1 B;  3VS4 A;  4M77 C;  2KE9 A;  3EG9 A;  2M0O A;  2V8I A;  1YJW A;  2DL5 A;  2O4X B;  2K57 A;  2DBM A;  3M57 A;  4HKE A;  3RNJ A;  1YHQ Q;  5LJ3 e;  4M7A E;  2FZC B;  3CCL A;  1WQW A;  4EMK C;  4MDX A;  1TWB A;  2KK4 A;  1WHJ A;  2YLB A;  3KFV A;  2OX7 A;  1I8F A;  4LD6 A;  1WI7 A;  4JLG A;  2ZCF B;  2EGE A;  3TRE A;  4XTZ A;  3JCM f;  4E7I A;  4A54 A;  2JOY A;  8AT1 B;  4J9F A;  1D09 B;  3SWN A;  3OYG A;  4IUT A;  2M16 A;  1PM3 A;  2RD1 A;  3OYM A;  1VQ4 T;  2L2P A;  5IN1 A;  3TVT A;  3OYJ A;  1CSK A;  1NPR A;  4C92 F;  2VAS A;  3VS3 A;  3MKD A;  2YLC A;  2PUK B;  3PVL A;  1UFF A;  2ZPE B;  4M7A D;  1FX7 A;  5CAI A;  1AVZ C;  1OX8 A;  1Y96 B;  1H8K A;  3E19 A;  1T3S A;  1YBY A;  3TCJ A;  5IAY A;  3CCQ T;  1QVF P;  1WHG A;  1PHT A;  3L2U A;  2MCN A;  2E6N A;  1YJW T;  1XQH A;  3EGU A;  4RTV A;  2E70 A;  3V8K A;  1M90 C;  4RTW A;  5IXB A;  3RMS A;  5AT1 B;  3OYE A;  3CCL T;  3G1J A;  3H0I A;  4E2F B;  3JCM Q;  3CMA Q;  4NL2 A;  3M56 A;  5CVI A;  1ZUK A;  5I22 A;  4M75 E;  5L8R E;  2YUO A;  1KD1 R;  5IT9 E;  3QDF A;  3Q1J A;  4M7A C;  1QP3 A;  4B6M A;  5A2Q E;  1BI1 A;  3SFM A;  2DFU A;  2EQI A;  1BI2 A;  1Y57 A;  4M4Z A;  3OYN A;  1PCX A;  1SHG A;  4OMN A;  4A4K A;  1WIE A;  3CPW A;  1TG0 A;  3V7R A;  1X6B A;  4C5E A;  2QI2 A;  1FYN A;  2OJ2 A;  3BY7 A;  5GAN d;  1VQN Q;  1ZX6 A;  3SWN C;  1VQP Q;  3A1P A;  4PFO A;  2RM4 A;  2X3W D;  4OML A;  3BDU A;  1BI0 A;  4BY6 B;  1I5O B;  3PTA A;  2M9U A;  1HK9 A;  2FPE A;  1WQ7 A;  1VQL Q;  4MMK A;  1GBQ A;  2J7I A;  5I2M A;  4PFP A;  3SB2 A;  2EW3 A;  2E10 A;  4AT1 B;  1E6H A;  3J81 E;  3M4G A;  1BI3 A;  4F17 A;  1O75 A;  1Q86 C;  2W10 A;  1NPP A;  1VQ5 A;  2AKL A;  1UJY A;  3DLL A;  2X4J A;  4CC2 A;  5KYW B;  1AWO A;  4N0A A;  1MND A;  2YRD A;  5HK3 A;  1SF9 A;  5GMK i;  2RK2 A;  3QJY A;  4DEY A;  1HSQ A;  2KBT A;  6AT1 B;  3V8J A;  1JO8 A;  4F16 A;  4C0G A;  3LLR A;  3UA6 A;  2EVR A;  4DBH A;  4LN2 A;  4OMF B;  1B3Q A;  2DTO A;  3UPU A;  3A8H B;  4DQ2 A;  2M0Y A;  2A36 A;  2ROL A;  2DER A;  1QVF A;  3HP9 A;  2QA4 A;  3JCM c;  4F7U B;  2OTJ Q;  1RAI B;  2KRM A;  1UGP B;  1K0X A;  4N4I A;  4M7D A;  5FWC A;  3ZFJ A;  1WFW A;  1OPL A;  1IRX A;  2HD0 A;  4M77 B;  3GOX A;  2MOX A;  2L3R A;  2VV5 A;  3CBM A;  3HRU A;  2JTM A;  2K7A A;  3A8L B;  5LJ3 g;  1Q82 R;  1IZ6 A;  4AFU C;  3OS0 A;  2BZY A;  4HVV A;  3S3N A;  1Q81 C;  4M78 F;  4J9B A;  2HL5 C;  2DTH A;  3DB4 A;  4EMK B;  1EZZ B;  2V1R A;  4HXJ A;  1C6V X;  1QVP A;  4AG1 C;  1VQ5 T;  1VQK Q;  3I56 Q;  4C0F A;  3OA6 A;  1G3Y A;  1ZSZ A;  3NGP A;  3SDZ A;  2K2V A;  2EQM A;  2RHZ A;  3DLM A;  4D8D A;  2CSQ A;  3FEO A;  5LJ5 g;  1U1S A;  5GMK e;  1QP2 A;  2GBQ A;  3OQ5 A;  1UUE A;  2HL3 A;  2YUN A;  5KYX B;  1UGQ B;  2M51 A;  3LX7 A;  4JZ4 A;  1KD1 U;  1VQ9 A;  4L59 A;  3MET A;  3T9N A;  4IKF A;  1KJW A;  3CXC A;  1NLO C;  2QA4 T;  2KVQ G;  1VQ6 Q;  1M3C A;  1PG5 B;  2HEQ A;  2P4R A;  2DLP A;  4QQG A;  3OYH A;  3EGX B;  3CC2 Q;  2CP6 A;  2DXT A;  1LPL A;  4C0Z A;  5GAN 8;  4HVU A;  1GFC A;  3EFO B;  4JLI A;  3CD6 Q;  1BBZ A;  1VYT A;  1WHH A;  1UJ0 A;  4J83 A;  1LVK A;  2CZ6 B;  3TSW A;  2RHX A;  3VS2 A;  2D6F A;  4F7U G;  4ORZ A;  1K1Z A;  3JB9 I;  1K0S A;  3JB9 J;  3QXE B;  2RJE A;  4BDZ A;  2G6F X;  3UT1 A;  4OMM A;  3EG9 B;  3VYG A;  2MAM A;  2SRC A;  4DOV A;  4M7A B;  1X6O A;  2DPP B;  1BB9 A;  1FWZ A;  3QYH B;  4AMC A;  4OMO A;  1Y71 A;  2KR3 A;  3CC7 A;  3G4S A;  1PKT A;  4XK8 E;  4FYY B;  1X69 A;  2DRK A;  3LH0 A;  2F2X A;  1R0B G;  3EH1 A;  2CKK A;  3RDV A;  2KY9 A;  4BE2 A;  1FMW A;  3CCU Q;  4JRI A;  1TUC A;  2D0N A;  2KGT A;  1ZSZ C;  1VQ9 T;  2MK5 A;  3GBQ A;  5IHI A;  1YIT T;  4Q5W A;  2FRY A;  2KSS A;  2PQW A;  3SWN B;  2PUO B;  3OW2 P;  4EIK A;  1YHQ A;  3S3M A;  1JBM A;  4KUD K;  1AT1 B;  1E6G A;  1M27 C;  1SHF A;  4M78 G;  1TU0 B;  2R5M A; 
#chains in the Genus database with same CATH homology
 3G6E Q;  3G71 Q;  1YIJ Q;  1N8R R;  3CCU Q;  1NJI R;  1W2B P;  1VQ5 Q;  1VQ9 Q;  3CCR Q;  1VQN Q;  1Q81 R;  1VQK Q;  3I56 Q;  1VQP Q;  3CCL Q;  1YIT Q;  1KC8 R;  1K9M R;  1YJ9 Q;  3CD6 Q;  1YHQ Q;  1VQM Q;  1VQ4 Q;  3CXC P;  1M90 R;  3G4S Q;  1S72 Q;  3CC7 Q;  3CCS Q;  3CCQ Q;  3CCV Q;  3CMA Q;  2QA4 Q;  1Q82 R;  1Q86 R;  1VQL Q;  1YJN Q;  3OW2 P;  3CPW P;  1QVF P;  1QVG P;  1VQ6 Q;  3CCM Q;  1YI2 Q;  1VQO Q;  1K73 R;  1KQS P;  1JJ2 P;  1VQ7 Q;  2OTL Q;  1Q7Y R;  3CCJ Q;  3I55 Q;  1KD1 R;  2OTJ Q;  3CME Q;  1YJW Q;  1M1K R;  3CC4 Q;  3CCE Q;  1K8A R;  3CC2 Q;  1VQ8 Q;  2QEX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...