1M1KR

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1m1kR00
3I55Q 3CCMQ 3CMAQ 3CC4Q 1VQ8Q 1VQOQ 3G6EQ 1YITQ 3CCSQ 1N8RR 1VQ6Q 3CC2Q 1YJ9Q 1JJ2P 1KQSP 3CMEQ 3CCJQ 3CCLQ 2OTLQ 3CD6Q 3CC7Q 1Q7YR 1QVFP 1Q82R 1YI2Q 1KD1R 3G71Q 1VQ9Q 1VQMQ 1W2BP 1K9MR 1M1KR 1YIJQ 1VQ7Q 2QEXQ 2QA4Q 1YHQQ 1VQ4Q 1M90R 3CCQQ 3OW2P 1YJNQ 1VQNQ 1YJWQ 1Q81R 1Q86R 1K8AR 1VQLQ 3CXCP 1VQPQ 3I56Q 1KC8R 3CCVQ 1K73R 3CCEQ 1VQ5Q 1S72Q 2OTJQ 3CPWP 3G4SQ 3CCUQ 1NJIR 1VQKQ 3CCRQ 1QVGP
chains in the Genus database with same CATH superfamily
1VYVA 3VS4A 2ZPEB 1U3OA 1PD1A 5IHNA 4PLLA 3HP9A 2HEQA 2NUTB 2O01E 1OZ3A 4C0DC 1VQ6A 4LN2A 2RJDA 2W10A 3LYIA 4EPCA 2DL7A 2LVMA 1UTIA 1WHKA 2M9UA 4OMNA 1NBEB 2ED1A 2LCLA 4M77B 1YFNA 5GANj 4J5YA 5A0GA 1PHTA 2FL7A 2WACA 1X6OA 3M59A 3L42A 2ZPHB 3NTIA 1OPKA 2CT3A 1E7OA 3DB3A 5LJ3d 1RACB 3A8OB 2PVDB 3OMGA 2EGEA 3J81E 3DB4A 1VQ9T 3C94A 1SSFA 2NLUA 1YJWT 2J06A 3QKJA 5GJWB 4FT2A 4QVZA 2HZYA 1YWOA 2BZYA 3I35A 4OMQA 2F2XA 3MO8A 4KGXB 1NE8A 3UATA 5KYWA 1WYXA 2ENMA 2YUPA 2V8IA 2K2VA 3JCMb 1K0SA 2YLCA 4FYYB 1BK2A 1ACMB 2ECZA 2P4TA 3REBB 2IPOB 1AOJA 4M78C 1TUGB 1OYXA 2A08A 3HFOA 2COWA 3OYEA 1IZ6A 1U1TA 1M30A 3JSCA 2DJQA 3UA7A 3MPUB 4F7UG 4ZTJA 2JM8A 2P0KA 4ANJA 3CMAA 1WJSA 2KRNA 4E47A 2FO0A 2MMPA 1VQ7T 1VQ7Q 3V8KA 2K2MA 1K73U 1B34A 1M1GA 2KYBA 4XU3A 4C92A 4JS4A 1BI2A 2VYTA 5LJ5d 4AG1C 3OQ5A 4Q5WA 1LVKA 3UDCA 1VOMA 5GAN8 1KQ1A 1TWBA 4A4GA 1HK9A 2E4HA 3JB9J 4XU1A 1K76A 1N6AA 3OA6A 4Y92A 4FM4B 1PCXA 4ZNXA 2D0NA 4ZN1A 4CI0C 2E5QA 3CQTA 4AFQC 4PL6A 2HCKA 1JXOA 1Y07A 1WI7A 3L1AA 4BDZA 1YHQA 3C0CA 5FROA 3G4SQ 4DEXA 2RPNA 3WVEB 1BI0A 4Z8AA 5IXBA 2EBPA 2CP2A 2L3SA 2LX9A 4F17A 4ZGDB 4XAXB 4IIOA 1EFNA 1Y96B 1UGRB 2EYXA 4PFZA 4JJNK 2G6FX 3P8HA 4C0ZA 2V1RA 3CMEA 2K5LA 4J6XA 3I5SA 4GY5A 3S3OA 4HKEA 2O88A 1BIBA 1VQKT 2EYYA 3CCMQ 3KFVA 1MUZA 2RHXA 4OMLA 4FYVB 4M75F 1OQKA 2RI5A 4OMOA 1OU8A 2RI2A 1WIEA 4A53A 1N9SA 4FCYA 1WHGA 3CCJA 2EAYA 2QA4T 3CCQT 1K1ZA 1W6XA 1NEGA 4JRKA 2RD1A 1YCYA 3HRSA 2DXCA 3CCRQ 2DL3A 1CKAA 2NYSA 5CCAA 1FYNA 2EGAA 2KK4A 2E65A 5IH2A 1VQ6T 1VQ6Q 4AFSC 1OZ2A 1KQSP 4CC2A 1I1JA 2RHYA 3RKYA 2L89A 1OPLA 1UUEA 2DO3A 3E9FA 2KQWA 4M78A 4PJOD 3PT9A 4E2FB 5J39A 2D0QB 1HJDA 1AVZC 1H641 4PJNA 1Q95G 4DA4A 4II1A 3CCUA 3M55A 4A4FA 3UPUA 2RQWA 5EG2A 4PJOE 1IHVA 1JB0E 5CQXA 9ATCB 4HT9A 2RMOA 2CGHA 2E41A 4IURA 3BW1A 1XOVA 2JOYA 3QHSA 4DBFA 1Z9ZA 1G5VA 4MZPA 2DYIA 3V7CA 1WQWA 4E6RA 1D0XA 4IUVA 1G2BA 3O5ZA 3SFMA 1WDXA 4OMMA 3VS1A 1VA7A 1RAGB 5C0MA 1T0HA 4LE9A 1T3LA 3OYBA 4OGEA 2FG0A 3L2ZA 2JS2A 5GMKm 2EW3A 3VUBA 2AKKA 1AT1B 3CMAQ 3VUZA 4JRIA 2ATCB 3UA6A 1UFFA 1Q86U 4M77C 1SRMA 1Q86C 5GAOn 1YJ9A 5IN1A 2V8JA 4BB7A 3ASKA 3EAEA 4E7ZA 2F2WA 2SEMA 1KQSA 4M7DA 1T3SA 3EG0A 1ZQ1A 3QYGB 2C06A 3GNFB 1QCOA 5D6XA 1H3ZA 1D1CA 4C92D 1D09B 2GTJA 1LJOA 2ED0A 4XTZA 1YHQT 1Q86R 2BZXA 1X6GA 4JJCA 1CSKA 2JUFA 4PFOA 2LNHB 3UWNA 5GANf 4J9BA 4C92E 3FDRA 4PK4A 1VIFA 4JZ3A 5DLOA 2X51A 3CMET 3VU3C 4TVRA 4J9DA 2PUKB 2LMJA 4NS5A 4DBHA 3VV0A 3REAB 2M51A 2O9VA 2QQBA 3OY9A 4AT1B 3INZA 2KXCA 2QEXA 3A5ZB 4AMCA 5GAN6 2HL3A 3OS0A 2MI6A 2DPPB 1NPPA 3L2VA 2DIQA 1TSFA 4RCCA 3MP1A 3CCJT 3VS0A 3QJ6A 3CCJQ 4ZTFA 4LUDA 3NTHA 2VB6A 1TOVA 1PM3A 5D7UA 3HHTB 2KXDA 2YUNA 4UC4A 1BU1A 3VRYA 1W1FA 2DL8A 2EJFA 1TS9A 5LJ3j 2FPEA 4EMKB 2ABLA 1TU0B 3OYMA 2HMAA 2NUTA 4RG8A 2EQKA 2P84A 2K3YA 4M75B 3CCUQ 2MWOA 3RKXA 1VQLA 1ARKA 4M77A 2YWWA 5GAN3 1NPRA 1KD1C 3G6ET 1PRMC 1QKWA 5GMKl 2L0AA 4XTYA 4LD9K 4XTWA 2K79A 4M78D 3META 4CC3A 4Z02A 2F2VA 2D8JA 3MEWA 4AG2C 1ZA2B 2X3WD 2PZ1A 1NEBA 1WJQA 2F5TX 4HVVA 3NMZC 4M75G 3EFRA 3I56A 1M1KU 4RTYA 2CSIA 1AZGB 3TREA 2IIMA 4J9IA 1M1KC 4F7UA 1HD3A 1KC8U 2ZGWA 1E6GA 2X4WA 1QLYA 4RG2A 1KC8C 1KHIA 3AT1B 4C8QE 4JLIA 2Y90A 2JW4A 3ME9A 2LQ8A 1YJNA 2H3JA 4E7SA 1I07A 2KEAA 3FB9A 4C0GA 4LDXA 5IHKA 2E64A 4EMHA 2BUDA 2E1HA 2F69A 1YJ9T 1YP5A 1CKBA 2DXTA 2KDSA 3EH1A 1M1KR 1PKSA 3BFMA 5J3BA 3BDLA 1KC8R 1VQ4A 4QW2A 1V1CA 3N5BB 3QZ5B 2H3EB 4F04B 4XK8E 2LT4A 4C0FA 1G3SA 4HCCA 1MV0B 1UEBA 1JEGA 2PNIA 2AK5A 2IG0A 1AHJB 3CCSA 2DRMA 2CZ6B 2CT4A 2CP7A 3FJ5A 1QVGA 3EG9B 2DD4A 5GAN7 3L2WA 3OYGA 4DEYA 4M7DD 2MIOA 1YIJA 4CC4B 1S1NA 3VRZA 3OYLA 4DBRA 2GFAA 4A4KA 5GAOm 1QVFA 2RI3A 1NYFA 2FB7A 3V7SA 3CCEA 2QQ9A 3CCVA 4ELZC 3G4SA 3O8VA 1X43A 1NYGA 5HCKA 1AZEA 1OU9A 3M58A 4M7DE 3SWNB 2QEXQ 4X34A 2X9HA 1Y96A 4RTXA 1GFDA 2EFIA 3DLLA 1WXBA 1RLQC 4BE0A 1VQ5Q 4M7AE 3R6NA 1SEMA 4PJOF 5CAIA 2BE7D 4N0AC 3JV3A 4PKCC 1TXQA 4EIKA 3CXCA 2EQUA 3CD6Q 1D3BA 4JJDA 4RTZA 1XNIA 4BACA 2XKOC 1X01A 2GNCA 2K3XA 1Z9QA 3M9QA 1JRIA 1JQQA 5CKFA 5IHIA 1GBQA 2XMFA 2LTOA 1VQPA 3C95A 1X6BA 2RM4A 3LH5A 1QCFA 3CCRA 4RUGA 1JO8A 2OAWA 2DILA 4HXJA 4J83A 2COYA 1SHFA 2FPDA 3RR6A 4E7IA 2ESWA 1RAAB 1MMGA 2CYZB 1VQLT 1VQLQ 1I8FA 4EDUA 5CKEA 2LQWA 2HQXA 3JCMe 4J7FA 1IB8A 1MGQA 1RI0A 2RHUA 3VS7A 2RHZA 3CC2Q 2FHDA 2DE0X 3PFSA 1WZOA 2V8KA 3PMTA 1JJ2S 4O6JA 2RO0A 3I56T 3I56Q 2EQJA 2LP5A 2E6ZA 4M77D 1EX4A 4OB3B 2VUBA 1HYOA 2DJZA 5KYUB 3MEAA 3VJPA 4F7UB 4EMGA 4QKUA 5HKCA 4A63B 4FL6A 2YT6A 3CEYA 2LX7A 1YJNT 1YJNQ 3CC7A 3PVLA 1U06A 3LWIA 4C92F 3MKDA 1F1BB 4PJLA 3QYHB 1SRLA 4EMKC 5FU7C 2YDLA 4N4HA 2OX7A 4VUBA 1I81A 2I2LA 1RL2A 2E5KA 4B6MA 3JB9I 2ROTA 2DBMA 5GAMe 1PNJA 5GAOl 4J6YA 1ZSGA 1YI2Q 2LQKA 4M75C 5LL6S 1SPKA 1VQ4T 2EYZA 1VQ4Q 4E7JA 3URGA 1QP3A 2LQNA 3JCMf 4CC7A 2VC8A 3H0HA 3QUIA 5FWCA 4N0AA 4N4GA 5M9OA 5HK0A 1H3HA 1V29B 2VV5A 3S3MA 2MYSA 1VQOQ 3CCST 3CCSQ 2F1LA 2XICA 1NZ9A 1D1BA 1AWXA 2CREA 1OI1A 4XQ3A 1YIJT 1YIJQ 3H41A 5LJ3f 1MMDA 2KYMA 2RH2A 2EVRA 4HCBA 2YUOA 4MZMA 2XDPA 2C0TA 4J9EA 3CCVQ 3CCEQ 1UGVA 3G4ST 4ATOA 1PWTA 3EH2A 3JB9D 3THKA 2LJ3A 3M4YA 2QDYB 3RIRA 4FYXB 3DLMA 1UHCA 2EKHA 3A8LB 2DTOA 1J3TA 2ROLA 2R58A 1R0CB 3OBYA 4BUGA 1I4K1 6AT1B 4ZN3A 1AEYA 2VGNA 2DBKA 3HPWA 2A7YA 4OB0B 2K3BA 2LC4A 1WHMA 2DIGA 3CCMT 4R0KA 2GF7A 1YN8A 3X25B 5GAMf 1D3BB 1OOTA 4OMPA 5C6SA 1I5LA 1QVGS 2DA9A 1RABB 3S6WA 2FRWA 4BI8B 2DMOA 2JS0A 2B8AA 2HQHA 1QWEA 2C0OA 2A0FB 1M3AA 1QVFS 1M9SA 2XHCA 2DM1A 1VQPT 1VQPQ 2PU9B 2FZCB 1JBMA 3MHXA 2RJFA 5I2SA 2KT1A 1ZBXA 1Y71A 5GMKe 3CCRT 1VQ8Q 2XIDA 3TU4K 4L5GA 2DZ9A 1KHCA 3EGXA 1YNZA 2CSQA 1X27A 4C8QF 2DRKA 3OBWA 3OYHA 2R5MA 8ATCB 3OYCA 4QQGA 4JJBA 4M4ZA 4F16A 4EMKA 4JDSA 2CZ0B 4D8KA 1O9SA 2X4YA 1GCQC 3A8GB 4LDUA 4R56A 3M54A 3SWNC 4XU2A 3CXCS 4M75A 2DTIA 2RF0A 4DOWA 2E70A 2YHTA 2JNGA 3G71Q 1QW1A 1UJ0A 1LOJA 3JRZA 3QBYA 3TSZA 3I9QA 2DL4A 2CDTA 3GBQA 4X1VA 2MF2A 3ZBDA 4BD3A 1UB4A 4PJOG 1ABOA 2E3IA 4BI3A 5GAOq 2RN8A 3JCMc 1OX9A 3BY7A 3QXEB 2JZ2A 1ZBJA 1Q7YU 3IQLA 2IVWA 1FX7A 2DZCA 2P0PA 1IO6A 1KFZA 3I5RA 1Q7YC 5GANe 3CC7T 3CC7Q 1QP2A 2QGGA 1TG0A 1N9RA 2D6FA 4RTVA 2FRYA 2X3XD 4L6V5 2GBQA 5DY9A 1ZX6A 1KG1A 2RNAA 2GTOA 3SB2A 4M7DF 3S3NA 1VIEA 3VS6A 3CMAT 2XG8D 3LGLA 2WSCE 4BI4A 1JJ2P 3QWXX 1K8AU 1Q7YR 3QJYA 1TTHB 1OV3A 3ZL7C 3EFOA 1SHGA 1UGPB 2B86A 4JS5A 1K8AC 4M7AF 1IGQA 3MP8A 1GRIA 4HVWA 3OS2A 3PMIA 4WCIA 1BBZA 2C0IA 3LH0A 3NFCA 2M0YA 4FSXA 4RTTA 1E6HA 2XDDA 2EJGA 4IUTA 4D6WA 5IT9E 1O75A 3QG1A 3HL8A 5D6WA 3VYGA 2CH4W 1K8AR 1IHWA 3NPFA 1X69A 1SKUB 3EG9A 1ZLMA 4LD6A 3G7ZA 3H6ZA 3VS2A 5A0LA 2KNBB 4FSSA 2NUPA 3GF5A 2JT4A 2MOXA 3JAME 2HBPA 1MV3A 3X28B 1UGQB 3OYJA 3DKMA 2NWMA 4L59A 2KRSA 2CH4A 1GCQA 2PQWA 4WF2A 4C92G 1UDLA 4GLKA 5HY6A 4FT4A 4OGCA 5KYYB 2X4JA 3SWNA 1VQMA 4XTVA 1WGSA 2XDBA 3HKSA 2L2PA 2PUOB 1VQ5A 2GQVA 1MNDA 1WHLA 3QDRB 1Q81U 2YRCA 1GFCA 3JCMg 2BTTA 1M90C 2DTHA 2KI7A 1Q81C 2J6OA 2LCCA 2AZSA 2GQIA 2DNUA 3GLXA 4Y28E 4MMLA 3C12A 3CD6A 1ABQA 3EG3A 4LDWA 2EJ9A 1PG5B 3LWHA 3CBOA 3OSSC 5GAOp 1JJ2A 1VUBA 3NTKA 3M57A 3EGXB 1M27C 2YSQA 1AWJA 3BE3A 1GCPA 3H0FA 4JZ4A 1QKXA 3OS5A 2WSFE 4O5VA 5FU7B 2AHJB 3GNGA 5CVIA 1Q81R 4BE2A 2P4RA 2KSSA 4NOYA 2KAFA 5A0DA 2EWNA 3CCUT 4OVAA 1QVGP 1KD1U 2EKOA 5A2QE 4E7HA 3V8JA 3RKWA 4LUEA 2CP5A 4XU0A 1QVFP 1MHNA 2RK2A 3L2QA 3KBGA 2DL5A 2KR3A 3CC2A 2Y4XA 3JCMh 5GAMg 4J9FA 3M0RA 1BB9A 1WJRA 5KCHA 4M75D 1VQNA 1WPYA 3LGFA 3RBBB 1RUWA 2CKKA 1K4US 5KYUA 3OYIA 4M78E 4J6WA 3GPLA 1NG2A 2QASA 4A4HA 3VYHB 3Q1JA 1KD1R 1WHJA 3MCAB 3E9GA 4M78G 2L3PA 2RQUA 2WSEE 5IAYA 1VQ9A 3CXCP 1UHFA 1FWZA 2HL5C 2RA2A 5LJ5j 4OB1B 2L3RA 1YJWA 2OJ2A 4C5GA 2DXUA 3OYKA 3QDFA 4C8QG 4PJOC 2K9GA 3EFOB 2DLPA 2PTKA 1KSWA 1H92A 1M3CA 1UJYA 1YI2A 1Y0MA 2GGRA 2K5IA 4ME7A 2RJEA 3JCMJ 5KE2A 3QO3A 2QXFA 2K4YA 5GAMh 5FLXE 2EQMA 4PNOA 3ZFJA 1G3WA 1M2OA 2DAQA 2VGMA 5KYXA 2BZ8A 2R5AA 4QQDA 2FZKB 1VQOA 3HRTA 3PGGA 2X35A 1SSHA 1NM7A 3A8HB 3TVTA 3LLRA 2HKQB 2NUPB 1M3BA 3CC4Q 3MJXA 2RQRA 3BDUA 2CP3A 4M7AB 1R8OB 3ULRB 2RB6A 4ORZA 1ZSZC 1KQ2A 2E12A 1VQMQ 1D0YA 2QQRA 2QEXT 2DYBA 3GIBA 2JN0A 1NLOC 1ZUKA 4M7DG 2LZ6B 1VQ5T 1I5OB 1K0XA 4J9GA 2OAUA 4PFPA 1LNXA 1TUDA 4IUPA 4YTLA 4DBQA 4M7AG 1X2QA 1WXTA 3CD6T 4LDYA 4FIBA 1HXDA 3V8LA 3CPWA 4ZGJB 3CCLA 1QVPA 2FVUA 2YRDA 2EYQA 3JCMX 4OP0A 1JU5C 2OTJQ 3M0TA 1LCKA 2HD0A 2LDMA 2XK0A 1K9MU 3OYNA 3E19A 4OF1A 5CK9A 3TCJA 2J6KA 1VQKA 4XTXA 1K9MC 1BI1A 2K57A 5CIUA 1OULA 4MMKA 1VQ8A 1IRXA 5DM7R 1TH7A 1V76A 5GANg 5GMKh 1W2BS 4LXCA 4PJOA 3M0UA 4OMFB 2VKNA 4KULA 5I11A 2Y4YA 3C4SA 1AWOA 3U23A 3RESA 1UGSB 4D8DA 3CC2T 1AD5A 2QQAA 3PVQA 5L23A 1XTDA 1K9MR 2ZCFB 4HVUA 3JCMd 1VQNT 1VQNQ 5LJ3e 3G71A 2A28A 2HSEB 2LJ0A 1QQJA 3RERA 3H0IA 1C6VX 4DQ2A 2RJCA 2KMTA 4Z88A 3SDZA 2DEQA 3OMCA 4KT0E 3OW2A 3H8ZA 3LX7A 1VQ9Q 1FMVA 1M8MA 5CO7A 4M77E 1YJWQ 2QGFB 1OEBA 1N8RU 1ZUYA 1GL5A 4M77G 1N8RC 1U1SA 3NGPA 5GANh 3QSUA 1ZSZA 1BI3A 1WXUA 4J8OA 2YRVA 1NLPC 1WA7A 2OTLA 5KH6A 1MMAA 4E7LA 4FYWB 1YI2T 3FC3A 4RCBA 2K6DA 2O4XA 2JTMA 8AT1B 3OYAA 4QQ6A 3M0SA 3VS3A 2OI3A 4F7UE 5GAMd 3VS5A 5J26A 4MDWA 5KYXB 3SD4A 2E3HA 1MMNA 1N8RR 5LJ5e 1VQOT 2HNIA 1AWWA 1I0CA 1IREB 3JCMV 2FEIA 3I55A 2FZGB 5CKBA 2K5FA 1Y57A 4C8QC 2DD5A 2AKLA 3FRNA 4KUDK 3EHRA 5GJVB 1KJWA 1K73C 2MWPA 1D1AA 3PE0A 4ESRA 5GAOr 1PSFA 1MNEA 3CCVT 3CCET 2CZ7B 1QCNA 1LPLA 2RHIA 2SRCA 2RQVA 1YWPA 2JMCA 3P8DA 1N27A 2LT1A 3P8BB 2DVEA 1KIKA 1ZUUA 4BY6B 1G8XA 1WX6A 1A0NB 3TQ7P 5CQYA 2FYKA 5EC7A 3T9NA 4KH0B 1K73R 5KYYA 3J7AF 2QI2A 5L8RE 4JRQA 3M0PA 2QTVA 3A1PA 1WNLA 2AZVA 3JB9G 4KH1B 2J6FA 1YCSB 2EGCA 3CCLQ 3CCLT 4P5NA 4BDYA 5CKHA 2YLBA 1M5Q1 1SG5A 1C0MA 1UG1A 5FWBA 2L8DA 2JM9A 2KRMA 1QMCA 1X2KA 4M78F 1JXMA 1VQKQ 2HAXA 5LJ5f 5HK3A 2PVGB 1VQ8T 3SHWA 4M7DC 3JCMP 3QWYA 1YITA 1RAIB 1EIFA 2QA4Q 2QG9B 3CCQQ 4M7AC 2R57A 4PJOB 2PVOB 1H8KA 3OS1A 3AHUA 2J05A 3GP8A 2RK1A 3PTAA 2XI9A 4J9HA 1W4SA 2V1QA 2CS7A 2DFUA 3HSBA 1G3YA 3CPWS 4HCKA 1GXIE 2Z0WA 5KCOA 2KROA 3G71T 3OYFA 1B3QA 2HSPA 3TSWA 4MDXA 3QZ9B 3X24B 2M02A 3HFNA 2JMAA 1R0BG 1M2VA 3PNWC 4HCZA 3FJPA 5CR2A 4B9WA 4ZGEB 4LDVA 1GBRA 2A3LA 4QT7A 2DEUA 4C8QA 4GLMA 2CUDA 2A36A 2J7IA 2VXFA 3G6EA 1XJWB 2EPDA 1W2BP 1BYMA 1RI9A 3CBPA 3TEEA 3CPFA 2A37A 5ECAA 2QYZA 3ER0A 1N5ZA 3WXMB 2ZPIB 1UECA 1M4ZA 3EG2A 5GANd 1ZSZB 2OTLT 2OTLQ 5KYWB 2MK5A 4C5HA 5FU6C 3D7SB 3JCMW 3M4GA 1S72A 2X4XA 2DERA 2CZ1B 2O4XB 5GAN4 4FU6A 4HT8A 4PLIA 4NL3A 4V2SA 1M1FA 2EIFA 2W0ZA 2QAZA 2ZPFB 4C5EA 2FPFA 2VWFA 3FEOA 2VASA 4B9XA 2KBTA 3RNJA 3OW2S 5GMKi 3I55T 3I55Q 2DF6A 2YUQA 3RMQA 3R6OA 4BE1A 1B34B 5KYNA 4JRPA 1IXDA 4C92B 3EG1A 1D0ZA 4IKFA 2D8HA 4HA8A 2ZPBB 1K9AA 3OYDA 1W70A 2GCXA 4MZTA 3KXTA 2JVVA 3PIOA 3UT1A 4FW2A 2ZPGB 2DXBA 4E7KA 4IUUA 2O9SA 4M7AA 3SEMA 4DOVA 3CC4A 2BKDN 1BIAA 2LJ1A 1YHQQ 4KBMB 1RLPC 1U8RA 1WFWA 2DK3A 2KT8A 1FMKA 2G3RA 3E2UA 1UE9A 1BCMA 1Q82U 4C0DB 5CKDA 3KUFA 4PJJA 1W2BA 3EGDA 2V26A 2L3QA 3L2RA 1Q82C 1M90U 4J7IA 3CMEQ 4PJMA 1RAHB 1ZHIA 2BE9B 4AFUC 1NJIU 4CRIA 3A8MB 4AFZC 1NJIC 4C5IA 1T0JA 1FXXA 5AYFA 2O31A 2ZZDA 4WTOB 3V7RA 5LJ3g 2LRQA 1YITT 5GAN2 1YITQ 4LNPA 2P0QA 4J9CA 4M77F 2OTJA 3X20B 1P92A 5I21A 1Q82R 2M0OA 1M90R 2LCSA 4KUIA 1ZA1B 3OB9A 2E10A 4RMOA 3J80E 1C1AA 1NJIR 1R77A 2HBWA 2MAMA 4JUVA 4BY6C 2M1HA 2CUBA 1PC0A 2HDAA 1YBYA 1PSEA 1X75C 2EQIA 3HTRA 3RMSA 2GFUA 4F7UF 1TUCA 4M78B 3JB9H 4GBQA 3LW5E 2LNVA 3FLGA 3F70A 5FRMA 1M2VB 4KRTA 3X26B 4KGVB 1SF9A 3WVDB 5IXFA 3OYYA 1XQHA 4C8QB 3G6EQ 2KE9A 1U5SA 3QIIA 1FMWA 2JJ9A 4K11A 3HRUA 3FIFA 2DVJA 5LJ3h 4A54A 2QQSA 4QVDA 3M56A 2NUZA 5LJ5g 3CBMA 2O2OA 2CP6A 4M75E 3L2UA 2H8HA 2JXBA 1S72T 1S72Q 3CPWP 5GAMj 4C8QD 2M16A 2EYWA 3G1JA 4N4IA 1RADB 1G3TA 4R55A 4Z89A 1HSQA 2QDLA 3JB9F 4QVCA 2MCNA 2E6NA 5DLQE 5FW9A 4A4EA 3PIPA 3JCMQ 3QPHA 3RDVA 1WQ7A 4Y91A 1RAEB 2QTXA 1B07A 3H9NA 1VYUA 2KGTA 2D1XA 3UF4A 2XU8A 3MEUA 2RQTA 3EHQA 1YJ9Q 2HQEA 2F5KA 2BIVA 2KY9A 4IUQA 1PRLC 1Y7XA 3RUXA 2COZA 2VXEA 2K7AA 2AT1B 4ELYC 2AIRB 1BKBA 5GAN5 2I0NA 1PKTA 4M7DB 1VQ7A 5LJ5h 2KVQG 2MPXC 1EZZB 4KGZB 3OSVA 3CC4T 4NL2A 2D9TA 2DETA 7AT1B 1WLPB 4JLGA 1VYTA 1RAFB 3M0QA 1VQMT 2YXYA 5FRNA 2ZAEA 2JTFA 3OW2P 3EFSA 1OX8A 1WHHA 4RTUA 3EGDB 4X9CA 4JPBW 3E1SA 1G83A 4FW1A 4M7AD 5I22A 1PD0A 3VKIA 5I2MA 1QWFA 2JTEA 2HKNA 1DJ7B 4F14A 2QK0A 3GOXA 5D6YA 1KQSS 3ZEHA 4OB2B 5GMKj 2XD0A 1KK7A 3MP6A 3MEVA 5KE3A 4C92C 1B7TA 2OTJT 3M5AA 3M53A 3A98A 2CP0A 5AT1B 2DX1A 4XTUA 2VVKA 4IIMA 1BCOA 3EGUA 3CCMA 4X9DA 5FU6B 4RTWA 3NHNA 1IGUA 2QA4A 2L5QA 2DKGA 4RKUE 3CCQA 1M8VA
chains in the Genus database with same CATH topology
3I55Q 3CCMQ 3CMAQ 3CC4Q 1VQ8Q 1VQOQ 3G6EQ 1YITQ 3CCSQ 1N8RR 1VQ6Q 3CC2Q 1YJ9Q 1JJ2P 1KQSP 3CMEQ 3CCJQ 3CCLQ 2OTLQ 3CD6Q 3CC7Q 1Q7YR 1QVFP 1Q82R 1YI2Q 1KD1R 3G71Q 1VQ9Q 1VQMQ 1W2BP 1K9MR 1M1KR 1YIJQ 1VQ7Q 2QEXQ 2QA4Q 1YHQQ 1VQ4Q 1M90R 3CCQQ 3OW2P 1YJNQ 1VQNQ 1YJWQ 1Q81R 1Q86R 1K8AR 1VQLQ 3CXCP 1VQPQ 3I56Q 1KC8R 3CCVQ 1K73R 3CCEQ 1VQ5Q 1S72Q 2OTJQ 3CPWP 3G4SQ 3CCUQ 1NJIR 1VQKQ 3CCRQ 1QVGP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I55 Q;  3CCM Q;  3CMA Q;  3CC4 Q;  1VQ8 Q;  1VQO Q;  3G6E Q;  1YIT Q;  3CCS Q;  1N8R R;  1VQ6 Q;  3CC2 Q;  1YJ9 Q;  1JJ2 P;  1KQS P;  3CME Q;  3CCJ Q;  3CCL Q;  2OTL Q;  3CD6 Q;  3CC7 Q;  1Q7Y R;  1QVF P;  1Q82 R;  1YI2 Q;  1KD1 R;  3G71 Q;  1VQ9 Q;  1VQM Q;  1W2B P;  1K9M R;  1M1K R;  1YIJ Q;  1VQ7 Q;  2QEX Q;  2QA4 Q;  1YHQ Q;  1VQ4 Q;  1M90 R;  3CCQ Q;  3OW2 P;  1YJN Q;  1VQN Q;  1YJW Q;  1Q81 R;  1Q86 R;  1K8A R;  1VQL Q;  3CXC P;  1VQP Q;  3I56 Q;  1KC8 R;  3CCV Q;  1K73 R;  3CCE Q;  1VQ5 Q;  1S72 Q;  2OTJ Q;  3CPW P;  3G4S Q;  3CCU Q;  1NJI R;  1VQK Q;  3CCR Q;  1QVG P; 
#chains in the Genus database with same CATH topology
 1VYV A;  3VS4 A;  2ZPE B;  1U3O A;  1PD1 A;  5IHN A;  4PLL A;  3HP9 A;  2HEQ A;  2NUT B;  2O01 E;  1OZ3 A;  4C0D C;  1VQ6 A;  4LN2 A;  2RJD A;  2W10 A;  3LYI A;  4EPC A;  2DL7 A;  2LVM A;  1UTI A;  1WHK A;  2M9U A;  4OMN A;  1NBE B;  2ED1 A;  2LCL A;  4M77 B;  1YFN A;  5GAN j;  4J5Y A;  5A0G A;  1PHT A;  2FL7 A;  2WAC A;  1X6O A;  3M59 A;  3L42 A;  2ZPH B;  3NTI A;  1OPK A;  2CT3 A;  1E7O A;  3DB3 A;  5LJ3 d;  1RAC B;  3A8O B;  2PVD B;  3OMG A;  2EGE A;  3J81 E;  3DB4 A;  1VQ9 T;  3C94 A;  1SSF A;  2NLU A;  1YJW T;  2J06 A;  3QKJ A;  5GJW B;  4FT2 A;  4QVZ A;  2HZY A;  1YWO A;  2BZY A;  3I35 A;  4OMQ A;  2F2X A;  3MO8 A;  4KGX B;  1NE8 A;  3UAT A;  5KYW A;  1WYX A;  2ENM A;  2YUP A;  2V8I A;  2K2V A;  3JCM b;  1K0S A;  2YLC A;  4FYY B;  1BK2 A;  1ACM B;  2ECZ A;  2P4T A;  3REB B;  2IPO B;  1AOJ A;  4M78 C;  1TUG B;  1OYX A;  2A08 A;  3HFO A;  2COW A;  3OYE A;  1IZ6 A;  1U1T A;  1M30 A;  3JSC A;  2DJQ A;  3UA7 A;  3MPU B;  4F7U G;  4ZTJ A;  2JM8 A;  2P0K A;  4ANJ A;  3CMA A;  1WJS A;  2KRN A;  4E47 A;  2FO0 A;  2MMP A;  1VQ7 T;  1VQ7 Q;  3V8K A;  2K2M A;  1K73 U;  1B34 A;  1M1G A;  2KYB A;  4XU3 A;  4C92 A;  4JS4 A;  1BI2 A;  2VYT A;  5LJ5 d;  4AG1 C;  3OQ5 A;  4Q5W A;  1LVK A;  3UDC A;  1VOM A;  5GAN 8;  1KQ1 A;  1TWB A;  4A4G A;  1HK9 A;  2E4H A;  3JB9 J;  4XU1 A;  1K76 A;  1N6A A;  3OA6 A;  4Y92 A;  4FM4 B;  1PCX A;  4ZNX A;  2D0N A;  4ZN1 A;  4CI0 C;  2E5Q A;  3CQT A;  4AFQ C;  4PL6 A;  2HCK A;  1JXO A;  1Y07 A;  1WI7 A;  3L1A A;  4BDZ A;  1YHQ A;  3C0C A;  5FRO A;  3G4S Q;  4DEX A;  2RPN A;  3WVE B;  1BI0 A;  4Z8A A;  5IXB A;  2EBP A;  2CP2 A;  2L3S A;  2LX9 A;  4F17 A;  4ZGD B;  4XAX B;  4IIO A;  1EFN A;  1Y96 B;  1UGR B;  2EYX A;  4PFZ A;  4JJN K;  2G6F X;  3P8H A;  4C0Z A;  2V1R A;  3CME A;  2K5L A;  4J6X A;  3I5S A;  4GY5 A;  3S3O A;  4HKE A;  2O88 A;  1BIB A;  1VQK T;  2EYY A;  3CCM Q;  3KFV A;  1MUZ A;  2RHX A;  4OML A;  4FYV B;  4M75 F;  1OQK A;  2RI5 A;  4OMO A;  1OU8 A;  2RI2 A;  1WIE A;  4A53 A;  1N9S A;  4FCY A;  1WHG A;  3CCJ A;  2EAY A;  2QA4 T;  3CCQ T;  1K1Z A;  1W6X A;  1NEG A;  4JRK A;  2RD1 A;  1YCY A;  3HRS A;  2DXC A;  3CCR Q;  2DL3 A;  1CKA A;  2NYS A;  5CCA A;  1FYN A;  2EGA A;  2KK4 A;  2E65 A;  5IH2 A;  1VQ6 T;  1VQ6 Q;  4AFS C;  1OZ2 A;  1KQS P;  4CC2 A;  1I1J A;  2RHY A;  3RKY A;  2L89 A;  1OPL A;  1UUE A;  2DO3 A;  3E9F A;  2KQW A;  4M78 A;  4PJO D;  3PT9 A;  4E2F B;  5J39 A;  2D0Q B;  1HJD A;  1AVZ C;  1H64 1;  4PJN A;  1Q95 G;  4DA4 A;  4II1 A;  3CCU A;  3M55 A;  4A4F A;  3UPU A;  2RQW A;  5EG2 A;  4PJO E;  1IHV A;  1JB0 E;  5CQX A;  9ATC B;  4HT9 A;  2RMO A;  2CGH A;  2E41 A;  4IUR A;  3BW1 A;  1XOV A;  2JOY A;  3QHS A;  4DBF A;  1Z9Z A;  1G5V A;  4MZP A;  2DYI A;  3V7C A;  1WQW A;  4E6R A;  1D0X A;  4IUV A;  1G2B A;  3O5Z A;  3SFM A;  1WDX A;  4OMM A;  3VS1 A;  1VA7 A;  1RAG B;  5C0M A;  1T0H A;  4LE9 A;  1T3L A;  3OYB A;  4OGE A;  2FG0 A;  3L2Z A;  2JS2 A;  5GMK m;  2EW3 A;  3VUB A;  2AKK A;  1AT1 B;  3CMA Q;  3VUZ A;  4JRI A;  2ATC B;  3UA6 A;  1UFF A;  1Q86 U;  4M77 C;  1SRM A;  1Q86 C;  5GAO n;  1YJ9 A;  5IN1 A;  2V8J A;  4BB7 A;  3ASK A;  3EAE A;  4E7Z A;  2F2W A;  2SEM A;  1KQS A;  4M7D A;  1T3S A;  3EG0 A;  1ZQ1 A;  3QYG B;  2C06 A;  3GNF B;  1QCO A;  5D6X A;  1H3Z A;  1D1C A;  4C92 D;  1D09 B;  2GTJ A;  1LJO A;  2ED0 A;  4XTZ A;  1YHQ T;  1Q86 R;  2BZX A;  1X6G A;  4JJC A;  1CSK A;  2JUF A;  4PFO A;  2LNH B;  3UWN A;  5GAN f;  4J9B A;  4C92 E;  3FDR A;  4PK4 A;  1VIF A;  4JZ3 A;  5DLO A;  2X51 A;  3CME T;  3VU3 C;  4TVR A;  4J9D A;  2PUK B;  2LMJ A;  4NS5 A;  4DBH A;  3VV0 A;  3REA B;  2M51 A;  2O9V A;  2QQB A;  3OY9 A;  4AT1 B;  3INZ A;  2KXC A;  2QEX A;  3A5Z B;  4AMC A;  5GAN 6;  2HL3 A;  3OS0 A;  2MI6 A;  2DPP B;  1NPP A;  3L2V A;  2DIQ A;  1TSF A;  4RCC A;  3MP1 A;  3CCJ T;  3VS0 A;  3QJ6 A;  3CCJ Q;  4ZTF A;  4LUD A;  3NTH A;  2VB6 A;  1TOV A;  1PM3 A;  5D7U A;  3HHT B;  2KXD A;  2YUN A;  4UC4 A;  1BU1 A;  3VRY A;  1W1F A;  2DL8 A;  2EJF A;  1TS9 A;  5LJ3 j;  2FPE A;  4EMK B;  2ABL A;  1TU0 B;  3OYM A;  2HMA A;  2NUT A;  4RG8 A;  2EQK A;  2P84 A;  2K3Y A;  4M75 B;  3CCU Q;  2MWO A;  3RKX A;  1VQL A;  1ARK A;  4M77 A;  2YWW A;  5GAN 3;  1NPR A;  1KD1 C;  3G6E T;  1PRM C;  1QKW A;  5GMK l;  2L0A A;  4XTY A;  4LD9 K;  4XTW A;  2K79 A;  4M78 D;  3MET A;  4CC3 A;  4Z02 A;  2F2V A;  2D8J A;  3MEW A;  4AG2 C;  1ZA2 B;  2X3W D;  2PZ1 A;  1NEB A;  1WJQ A;  2F5T X;  4HVV A;  3NMZ C;  4M75 G;  3EFR A;  3I56 A;  1M1K U;  4RTY A;  2CSI A;  1AZG B;  3TRE A;  2IIM A;  4J9I A;  1M1K C;  4F7U A;  1HD3 A;  1KC8 U;  2ZGW A;  1E6G A;  2X4W A;  1QLY A;  4RG2 A;  1KC8 C;  1KHI A;  3AT1 B;  4C8Q E;  4JLI A;  2Y90 A;  2JW4 A;  3ME9 A;  2LQ8 A;  1YJN A;  2H3J A;  4E7S A;  1I07 A;  2KEA A;  3FB9 A;  4C0G A;  4LDX A;  5IHK A;  2E64 A;  4EMH A;  2BUD A;  2E1H A;  2F69 A;  1YJ9 T;  1YP5 A;  1CKB A;  2DXT A;  2KDS A;  3EH1 A;  1M1K R;  1PKS A;  3BFM A;  5J3B A;  3BDL A;  1KC8 R;  1VQ4 A;  4QW2 A;  1V1C A;  3N5B B;  3QZ5 B;  2H3E B;  4F04 B;  4XK8 E;  2LT4 A;  4C0F A;  1G3S A;  4HCC A;  1MV0 B;  1UEB A;  1JEG A;  2PNI A;  2AK5 A;  2IG0 A;  1AHJ B;  3CCS A;  2DRM A;  2CZ6 B;  2CT4 A;  2CP7 A;  3FJ5 A;  1QVG A;  3EG9 B;  2DD4 A;  5GAN 7;  3L2W A;  3OYG A;  4DEY A;  4M7D D;  2MIO A;  1YIJ A;  4CC4 B;  1S1N A;  3VRZ A;  3OYL A;  4DBR A;  2GFA A;  4A4K A;  5GAO m;  1QVF A;  2RI3 A;  1NYF A;  2FB7 A;  3V7S A;  3CCE A;  2QQ9 A;  3CCV A;  4ELZ C;  3G4S A;  3O8V A;  1X43 A;  1NYG A;  5HCK A;  1AZE A;  1OU9 A;  3M58 A;  4M7D E;  3SWN B;  2QEX Q;  4X34 A;  2X9H A;  1Y96 A;  4RTX A;  1GFD A;  2EFI A;  3DLL A;  1WXB A;  1RLQ C;  4BE0 A;  1VQ5 Q;  4M7A E;  3R6N A;  1SEM A;  4PJO F;  5CAI A;  2BE7 D;  4N0A C;  3JV3 A;  4PKC C;  1TXQ A;  4EIK A;  3CXC A;  2EQU A;  3CD6 Q;  1D3B A;  4JJD A;  4RTZ A;  1XNI A;  4BAC A;  2XKO C;  1X01 A;  2GNC A;  2K3X A;  1Z9Q A;  3M9Q A;  1JRI A;  1JQQ A;  5CKF A;  5IHI A;  1GBQ A;  2XMF A;  2LTO A;  1VQP A;  3C95 A;  1X6B A;  2RM4 A;  3LH5 A;  1QCF A;  3CCR A;  4RUG A;  1JO8 A;  2OAW A;  2DIL A;  4HXJ A;  4J83 A;  2COY A;  1SHF A;  2FPD A;  3RR6 A;  4E7I A;  2ESW A;  1RAA B;  1MMG A;  2CYZ B;  1VQL T;  1VQL Q;  1I8F A;  4EDU A;  5CKE A;  2LQW A;  2HQX A;  3JCM e;  4J7F A;  1IB8 A;  1MGQ A;  1RI0 A;  2RHU A;  3VS7 A;  2RHZ A;  3CC2 Q;  2FHD A;  2DE0 X;  3PFS A;  1WZO A;  2V8K A;  3PMT A;  1JJ2 S;  4O6J A;  2RO0 A;  3I56 T;  3I56 Q;  2EQJ A;  2LP5 A;  2E6Z A;  4M77 D;  1EX4 A;  4OB3 B;  2VUB A;  1HYO A;  2DJZ A;  5KYU B;  3MEA A;  3VJP A;  4F7U B;  4EMG A;  4QKU A;  5HKC A;  4A63 B;  4FL6 A;  2YT6 A;  3CEY A;  2LX7 A;  1YJN T;  1YJN Q;  3CC7 A;  3PVL A;  1U06 A;  3LWI A;  4C92 F;  3MKD A;  1F1B B;  4PJL A;  3QYH B;  1SRL A;  4EMK C;  5FU7 C;  2YDL A;  4N4H A;  2OX7 A;  4VUB A;  1I81 A;  2I2L A;  1RL2 A;  2E5K A;  4B6M A;  3JB9 I;  2ROT A;  2DBM A;  5GAM e;  1PNJ A;  5GAO l;  4J6Y A;  1ZSG A;  1YI2 Q;  2LQK A;  4M75 C;  5LL6 S;  1SPK A;  1VQ4 T;  2EYZ A;  1VQ4 Q;  4E7J A;  3URG A;  1QP3 A;  2LQN A;  3JCM f;  4CC7 A;  2VC8 A;  3H0H A;  3QUI A;  5FWC A;  4N0A A;  4N4G A;  5M9O A;  5HK0 A;  1H3H A;  1V29 B;  2VV5 A;  3S3M A;  2MYS A;  1VQO Q;  3CCS T;  3CCS Q;  2F1L A;  2XIC A;  1NZ9 A;  1D1B A;  1AWX A;  2CRE A;  1OI1 A;  4XQ3 A;  1YIJ T;  1YIJ Q;  3H41 A;  5LJ3 f;  1MMD A;  2KYM A;  2RH2 A;  2EVR A;  4HCB A;  2YUO A;  4MZM A;  2XDP A;  2C0T A;  4J9E A;  3CCV Q;  3CCE Q;  1UGV A;  3G4S T;  4ATO A;  1PWT A;  3EH2 A;  3JB9 D;  3THK A;  2LJ3 A;  3M4Y A;  2QDY B;  3RIR A;  4FYX B;  3DLM A;  1UHC A;  2EKH A;  3A8L B;  2DTO A;  1J3T A;  2ROL A;  2R58 A;  1R0C B;  3OBY A;  4BUG A;  1I4K 1;  6AT1 B;  4ZN3 A;  1AEY A;  2VGN A;  2DBK A;  3HPW A;  2A7Y A;  4OB0 B;  2K3B A;  2LC4 A;  1WHM A;  2DIG A;  3CCM T;  4R0K A;  2GF7 A;  1YN8 A;  3X25 B;  5GAM f;  1D3B B;  1OOT A;  4OMP A;  5C6S A;  1I5L A;  1QVG S;  2DA9 A;  1RAB B;  3S6W A;  2FRW A;  4BI8 B;  2DMO A;  2JS0 A;  2B8A A;  2HQH A;  1QWE A;  2C0O A;  2A0F B;  1M3A A;  1QVF S;  1M9S A;  2XHC A;  2DM1 A;  1VQP T;  1VQP Q;  2PU9 B;  2FZC B;  1JBM A;  3MHX A;  2RJF A;  5I2S A;  2KT1 A;  1ZBX A;  1Y71 A;  5GMK e;  3CCR T;  1VQ8 Q;  2XID A;  3TU4 K;  4L5G A;  2DZ9 A;  1KHC A;  3EGX A;  1YNZ A;  2CSQ A;  1X27 A;  4C8Q F;  2DRK A;  3OBW A;  3OYH A;  2R5M A;  8ATC B;  3OYC A;  4QQG A;  4JJB A;  4M4Z A;  4F16 A;  4EMK A;  4JDS A;  2CZ0 B;  4D8K A;  1O9S A;  2X4Y A;  1GCQ C;  3A8G B;  4LDU A;  4R56 A;  3M54 A;  3SWN C;  4XU2 A;  3CXC S;  4M75 A;  2DTI A;  2RF0 A;  4DOW A;  2E70 A;  2YHT A;  2JNG A;  3G71 Q;  1QW1 A;  1UJ0 A;  1LOJ A;  3JRZ A;  3QBY A;  3TSZ A;  3I9Q A;  2DL4 A;  2CDT A;  3GBQ A;  4X1V A;  2MF2 A;  3ZBD A;  4BD3 A;  1UB4 A;  4PJO G;  1ABO A;  2E3I A;  4BI3 A;  5GAO q;  2RN8 A;  3JCM c;  1OX9 A;  3BY7 A;  3QXE B;  2JZ2 A;  1ZBJ A;  1Q7Y U;  3IQL A;  2IVW A;  1FX7 A;  2DZC A;  2P0P A;  1IO6 A;  1KFZ A;  3I5R A;  1Q7Y C;  5GAN e;  3CC7 T;  3CC7 Q;  1QP2 A;  2QGG A;  1TG0 A;  1N9R A;  2D6F A;  4RTV A;  2FRY A;  2X3X D;  4L6V 5;  2GBQ A;  5DY9 A;  1ZX6 A;  1KG1 A;  2RNA A;  2GTO A;  3SB2 A;  4M7D F;  3S3N A;  1VIE A;  3VS6 A;  3CMA T;  2XG8 D;  3LGL A;  2WSC E;  4BI4 A;  1JJ2 P;  3QWX X;  1K8A U;  1Q7Y R;  3QJY A;  1TTH B;  1OV3 A;  3ZL7 C;  3EFO A;  1SHG A;  1UGP B;  2B86 A;  4JS5 A;  1K8A C;  4M7A F;  1IGQ A;  3MP8 A;  1GRI A;  4HVW A;  3OS2 A;  3PMI A;  4WCI A;  1BBZ A;  2C0I A;  3LH0 A;  3NFC A;  2M0Y A;  4FSX A;  4RTT A;  1E6H A;  2XDD A;  2EJG A;  4IUT A;  4D6W A;  5IT9 E;  1O75 A;  3QG1 A;  3HL8 A;  5D6W A;  3VYG A;  2CH4 W;  1K8A R;  1IHW A;  3NPF A;  1X69 A;  1SKU B;  3EG9 A;  1ZLM A;  4LD6 A;  3G7Z A;  3H6Z A;  3VS2 A;  5A0L A;  2KNB B;  4FSS A;  2NUP A;  3GF5 A;  2JT4 A;  2MOX A;  3JAM E;  2HBP A;  1MV3 A;  3X28 B;  1UGQ B;  3OYJ A;  3DKM A;  2NWM A;  4L59 A;  2KRS A;  2CH4 A;  1GCQ A;  2PQW A;  4WF2 A;  4C92 G;  1UDL A;  4GLK A;  5HY6 A;  4FT4 A;  4OGC A;  5KYY B;  2X4J A;  3SWN A;  1VQM A;  4XTV A;  1WGS A;  2XDB A;  3HKS A;  2L2P A;  2PUO B;  1VQ5 A;  2GQV A;  1MND A;  1WHL A;  3QDR B;  1Q81 U;  2YRC A;  1GFC A;  3JCM g;  2BTT A;  1M90 C;  2DTH A;  2KI7 A;  1Q81 C;  2J6O A;  2LCC A;  2AZS A;  2GQI A;  2DNU A;  3GLX A;  4Y28 E;  4MML A;  3C12 A;  3CD6 A;  1ABQ A;  3EG3 A;  4LDW A;  2EJ9 A;  1PG5 B;  3LWH A;  3CBO A;  3OSS C;  5GAO p;  1JJ2 A;  1VUB A;  3NTK A;  3M57 A;  3EGX B;  1M27 C;  2YSQ A;  1AWJ A;  3BE3 A;  1GCP A;  3H0F A;  4JZ4 A;  1QKX A;  3OS5 A;  2WSF E;  4O5V A;  5FU7 B;  2AHJ B;  3GNG A;  5CVI A;  1Q81 R;  4BE2 A;  2P4R A;  2KSS A;  4NOY A;  2KAF A;  5A0D A;  2EWN A;  3CCU T;  4OVA A;  1QVG P;  1KD1 U;  2EKO A;  5A2Q E;  4E7H A;  3V8J A;  3RKW A;  4LUE A;  2CP5 A;  4XU0 A;  1QVF P;  1MHN A;  2RK2 A;  3L2Q A;  3KBG A;  2DL5 A;  2KR3 A;  3CC2 A;  2Y4X A;  3JCM h;  5GAM g;  4J9F A;  3M0R A;  1BB9 A;  1WJR A;  5KCH A;  4M75 D;  1VQN A;  1WPY A;  3LGF A;  3RBB B;  1RUW A;  2CKK A;  1K4U S;  5KYU A;  3OYI A;  4M78 E;  4J6W A;  3GPL A;  1NG2 A;  2QAS A;  4A4H A;  3VYH B;  3Q1J A;  1KD1 R;  1WHJ A;  3MCA B;  3E9G A;  4M78 G;  2L3P A;  2RQU A;  2WSE E;  5IAY A;  1VQ9 A;  3CXC P;  1UHF A;  1FWZ A;  2HL5 C;  2RA2 A;  5LJ5 j;  4OB1 B;  2L3R A;  1YJW A;  2OJ2 A;  4C5G A;  2DXU A;  3OYK A;  3QDF A;  4C8Q G;  4PJO C;  2K9G A;  3EFO B;  2DLP A;  2PTK A;  1KSW A;  1H92 A;  1M3C A;  1UJY A;  1YI2 A;  1Y0M A;  2GGR A;  2K5I A;  4ME7 A;  2RJE A;  3JCM J;  5KE2 A;  3QO3 A;  2QXF A;  2K4Y A;  5GAM h;  5FLX E;  2EQM A;  4PNO A;  3ZFJ A;  1G3W A;  1M2O A;  2DAQ A;  2VGM A;  5KYX A;  2BZ8 A;  2R5A A;  4QQD A;  2FZK B;  1VQO A;  3HRT A;  3PGG A;  2X35 A;  1SSH A;  1NM7 A;  3A8H B;  3TVT A;  3LLR A;  2HKQ B;  2NUP B;  1M3B A;  3CC4 Q;  3MJX A;  2RQR A;  3BDU A;  2CP3 A;  4M7A B;  1R8O B;  3ULR B;  2RB6 A;  4ORZ A;  1ZSZ C;  1KQ2 A;  2E12 A;  1VQM Q;  1D0Y A;  2QQR A;  2QEX T;  2DYB A;  3GIB A;  2JN0 A;  1NLO C;  1ZUK A;  4M7D G;  2LZ6 B;  1VQ5 T;  1I5O B;  1K0X A;  4J9G A;  2OAU A;  4PFP A;  1LNX A;  1TUD A;  4IUP A;  4YTL A;  4DBQ A;  4M7A G;  1X2Q A;  1WXT A;  3CD6 T;  4LDY A;  4FIB A;  1HXD A;  3V8L A;  3CPW A;  4ZGJ B;  3CCL A;  1QVP A;  2FVU A;  2YRD A;  2EYQ A;  3JCM X;  4OP0 A;  1JU5 C;  2OTJ Q;  3M0T A;  1LCK A;  2HD0 A;  2LDM A;  2XK0 A;  1K9M U;  3OYN A;  3E19 A;  4OF1 A;  5CK9 A;  3TCJ A;  2J6K A;  1VQK A;  4XTX A;  1K9M C;  1BI1 A;  2K57 A;  5CIU A;  1OUL A;  4MMK A;  1VQ8 A;  1IRX A;  5DM7 R;  1TH7 A;  1V76 A;  5GAN g;  5GMK h;  1W2B S;  4LXC A;  4PJO A;  3M0U A;  4OMF B;  2VKN A;  4KUL A;  5I11 A;  2Y4Y A;  3C4S A;  1AWO A;  3U23 A;  3RES A;  1UGS B;  4D8D A;  3CC2 T;  1AD5 A;  2QQA A;  3PVQ A;  5L23 A;  1XTD A;  1K9M R;  2ZCF B;  4HVU A;  3JCM d;  1VQN T;  1VQN Q;  5LJ3 e;  3G71 A;  2A28 A;  2HSE B;  2LJ0 A;  1QQJ A;  3RER A;  3H0I A;  1C6V X;  4DQ2 A;  2RJC A;  2KMT A;  4Z88 A;  3SDZ A;  2DEQ A;  3OMC A;  4KT0 E;  3OW2 A;  3H8Z A;  3LX7 A;  1VQ9 Q;  1FMV A;  1M8M A;  5CO7 A;  4M77 E;  1YJW Q;  2QGF B;  1OEB A;  1N8R U;  1ZUY A;  1GL5 A;  4M77 G;  1N8R C;  1U1S A;  3NGP A;  5GAN h;  3QSU A;  1ZSZ A;  1BI3 A;  1WXU A;  4J8O A;  2YRV A;  1NLP C;  1WA7 A;  2OTL A;  5KH6 A;  1MMA A;  4E7L A;  4FYW B;  1YI2 T;  3FC3 A;  4RCB A;  2K6D A;  2O4X A;  2JTM A;  8AT1 B;  3OYA A;  4QQ6 A;  3M0S A;  3VS3 A;  2OI3 A;  4F7U E;  5GAM d;  3VS5 A;  5J26 A;  4MDW A;  5KYX B;  3SD4 A;  2E3H A;  1MMN A;  1N8R R;  5LJ5 e;  1VQO T;  2HNI A;  1AWW A;  1I0C A;  1IRE B;  3JCM V;  2FEI A;  3I55 A;  2FZG B;  5CKB A;  2K5F A;  1Y57 A;  4C8Q C;  2DD5 A;  2AKL A;  3FRN A;  4KUD K;  3EHR A;  5GJV B;  1KJW A;  1K73 C;  2MWP A;  1D1A A;  3PE0 A;  4ESR A;  5GAO r;  1PSF A;  1MNE A;  3CCV T;  3CCE T;  2CZ7 B;  1QCN A;  1LPL A;  2RHI A;  2SRC A;  2RQV A;  1YWP A;  2JMC A;  3P8D A;  1N27 A;  2LT1 A;  3P8B B;  2DVE A;  1KIK A;  1ZUU A;  4BY6 B;  1G8X A;  1WX6 A;  1A0N B;  3TQ7 P;  5CQY A;  2FYK A;  5EC7 A;  3T9N A;  4KH0 B;  1K73 R;  5KYY A;  3J7A F;  2QI2 A;  5L8R E;  4JRQ A;  3M0P A;  2QTV A;  3A1P A;  1WNL A;  2AZV A;  3JB9 G;  4KH1 B;  2J6F A;  1YCS B;  2EGC A;  3CCL Q;  3CCL T;  4P5N A;  4BDY A;  5CKH A;  2YLB A;  1M5Q 1;  1SG5 A;  1C0M A;  1UG1 A;  5FWB A;  2L8D A;  2JM9 A;  2KRM A;  1QMC A;  1X2K A;  4M78 F;  1JXM A;  1VQK Q;  2HAX A;  5LJ5 f;  5HK3 A;  2PVG B;  1VQ8 T;  3SHW A;  4M7D C;  3JCM P;  3QWY A;  1YIT A;  1RAI B;  1EIF A;  2QA4 Q;  2QG9 B;  3CCQ Q;  4M7A C;  2R57 A;  4PJO B;  2PVO B;  1H8K A;  3OS1 A;  3AHU A;  2J05 A;  3GP8 A;  2RK1 A;  3PTA A;  2XI9 A;  4J9H A;  1W4S A;  2V1Q A;  2CS7 A;  2DFU A;  3HSB A;  1G3Y A;  3CPW S;  4HCK A;  1GXI E;  2Z0W A;  5KCO A;  2KRO A;  3G71 T;  3OYF A;  1B3Q A;  2HSP A;  3TSW A;  4MDX A;  3QZ9 B;  3X24 B;  2M02 A;  3HFN A;  2JMA A;  1R0B G;  1M2V A;  3PNW C;  4HCZ A;  3FJP A;  5CR2 A;  4B9W A;  4ZGE B;  4LDV A;  1GBR A;  2A3L A;  4QT7 A;  2DEU A;  4C8Q A;  4GLM A;  2CUD A;  2A36 A;  2J7I A;  2VXF A;  3G6E A;  1XJW B;  2EPD A;  1W2B P;  1BYM A;  1RI9 A;  3CBP A;  3TEE A;  3CPF A;  2A37 A;  5ECA A;  2QYZ A;  3ER0 A;  1N5Z A;  3WXM B;  2ZPI B;  1UEC A;  1M4Z A;  3EG2 A;  5GAN d;  1ZSZ B;  2OTL T;  2OTL Q;  5KYW B;  2MK5 A;  4C5H A;  5FU6 C;  3D7S B;  3JCM W;  3M4G A;  1S72 A;  2X4X A;  2DER A;  2CZ1 B;  2O4X B;  5GAN 4;  4FU6 A;  4HT8 A;  4PLI A;  4NL3 A;  4V2S A;  1M1F A;  2EIF A;  2W0Z A;  2QAZ A;  2ZPF B;  4C5E A;  2FPF A;  2VWF A;  3FEO A;  2VAS A;  4B9X A;  2KBT A;  3RNJ A;  3OW2 S;  5GMK i;  3I55 T;  3I55 Q;  2DF6 A;  2YUQ A;  3RMQ A;  3R6O A;  4BE1 A;  1B34 B;  5KYN A;  4JRP A;  1IXD A;  4C92 B;  3EG1 A;  1D0Z A;  4IKF A;  2D8H A;  4HA8 A;  2ZPB B;  1K9A A;  3OYD A;  1W70 A;  2GCX A;  4MZT A;  3KXT A;  2JVV A;  3PIO A;  3UT1 A;  4FW2 A;  2ZPG B;  2DXB A;  4E7K A;  4IUU A;  2O9S A;  4M7A A;  3SEM A;  4DOV A;  3CC4 A;  2BKD N;  1BIA A;  2LJ1 A;  1YHQ Q;  4KBM B;  1RLP C;  1U8R A;  1WFW A;  2DK3 A;  2KT8 A;  1FMK A;  2G3R A;  3E2U A;  1UE9 A;  1BCM A;  1Q82 U;  4C0D B;  5CKD A;  3KUF A;  4PJJ A;  1W2B A;  3EGD A;  2V26 A;  2L3Q A;  3L2R A;  1Q82 C;  1M90 U;  4J7I A;  3CME Q;  4PJM A;  1RAH B;  1ZHI A;  2BE9 B;  4AFU C;  1NJI U;  4CRI A;  3A8M B;  4AFZ C;  1NJI C;  4C5I A;  1T0J A;  1FXX A;  5AYF A;  2O31 A;  2ZZD A;  4WTO B;  3V7R A;  5LJ3 g;  2LRQ A;  1YIT T;  5GAN 2;  1YIT Q;  4LNP A;  2P0Q A;  4J9C A;  4M77 F;  2OTJ A;  3X20 B;  1P92 A;  5I21 A;  1Q82 R;  2M0O A;  1M90 R;  2LCS A;  4KUI A;  1ZA1 B;  3OB9 A;  2E10 A;  4RMO A;  3J80 E;  1C1A A;  1NJI R;  1R77 A;  2HBW A;  2MAM A;  4JUV A;  4BY6 C;  2M1H A;  2CUB A;  1PC0 A;  2HDA A;  1YBY A;  1PSE A;  1X75 C;  2EQI A;  3HTR A;  3RMS A;  2GFU A;  4F7U F;  1TUC A;  4M78 B;  3JB9 H;  4GBQ A;  3LW5 E;  2LNV A;  3FLG A;  3F70 A;  5FRM A;  1M2V B;  4KRT A;  3X26 B;  4KGV B;  1SF9 A;  3WVD B;  5IXF A;  3OYY A;  1XQH A;  4C8Q B;  3G6E Q;  2KE9 A;  1U5S A;  3QII A;  1FMW A;  2JJ9 A;  4K11 A;  3HRU A;  3FIF A;  2DVJ A;  5LJ3 h;  4A54 A;  2QQS A;  4QVD A;  3M56 A;  2NUZ A;  5LJ5 g;  3CBM A;  2O2O A;  2CP6 A;  4M75 E;  3L2U A;  2H8H A;  2JXB A;  1S72 T;  1S72 Q;  3CPW P;  5GAM j;  4C8Q D;  2M16 A;  2EYW A;  3G1J A;  4N4I A;  1RAD B;  1G3T A;  4R55 A;  4Z89 A;  1HSQ A;  2QDL A;  3JB9 F;  4QVC A;  2MCN A;  2E6N A;  5DLQ E;  5FW9 A;  4A4E A;  3PIP A;  3JCM Q;  3QPH A;  3RDV A;  1WQ7 A;  4Y91 A;  1RAE B;  2QTX A;  1B07 A;  3H9N A;  1VYU A;  2KGT A;  2D1X A;  3UF4 A;  2XU8 A;  3MEU A;  2RQT A;  3EHQ A;  1YJ9 Q;  2HQE A;  2F5K A;  2BIV A;  2KY9 A;  4IUQ A;  1PRL C;  1Y7X A;  3RUX A;  2COZ A;  2VXE A;  2K7A A;  2AT1 B;  4ELY C;  2AIR B;  1BKB A;  5GAN 5;  2I0N A;  1PKT A;  4M7D B;  1VQ7 A;  5LJ5 h;  2KVQ G;  2MPX C;  1EZZ B;  4KGZ B;  3OSV A;  3CC4 T;  4NL2 A;  2D9T A;  2DET A;  7AT1 B;  1WLP B;  4JLG A;  1VYT A;  1RAF B;  3M0Q A;  1VQM T;  2YXY A;  5FRN A;  2ZAE A;  2JTF A;  3OW2 P;  3EFS A;  1OX8 A;  1WHH A;  4RTU A;  3EGD B;  4X9C A;  4JPB W;  3E1S A;  1G83 A;  4FW1 A;  4M7A D;  5I22 A;  1PD0 A;  3VKI A;  5I2M A;  1QWF A;  2JTE A;  2HKN A;  1DJ7 B;  4F14 A;  2QK0 A;  3GOX A;  5D6Y A;  1KQS S;  3ZEH A;  4OB2 B;  5GMK j;  2XD0 A;  1KK7 A;  3MP6 A;  3MEV A;  5KE3 A;  4C92 C;  1B7T A;  2OTJ T;  3M5A A;  3M53 A;  3A98 A;  2CP0 A;  5AT1 B;  2DX1 A;  4XTU A;  2VVK A;  4IIM A;  1BCO A;  3EGU A;  3CCM A;  4X9D A;  5FU6 B;  4RTW A;  3NHN A;  1IGU A;  2QA4 A;  2L5Q A;  2DKG A;  4RKU E;  3CCQ A;  1M8V A; 
#chains in the Genus database with same CATH homology
 3I55 Q;  3CCM Q;  3CMA Q;  3CC4 Q;  1VQ8 Q;  1VQO Q;  3G6E Q;  1YIT Q;  3CCS Q;  1N8R R;  1VQ6 Q;  3CC2 Q;  1YJ9 Q;  1JJ2 P;  1KQS P;  3CME Q;  3CCJ Q;  3CCL Q;  2OTL Q;  3CD6 Q;  3CC7 Q;  1Q7Y R;  1QVF P;  1Q82 R;  1YI2 Q;  1KD1 R;  3G71 Q;  1VQ9 Q;  1VQM Q;  1W2B P;  1K9M R;  1M1K R;  1YIJ Q;  1VQ7 Q;  2QEX Q;  2QA4 Q;  1YHQ Q;  1VQ4 Q;  1M90 R;  3CCQ Q;  3OW2 P;  1YJN Q;  1VQN Q;  1YJW Q;  1Q81 R;  1Q86 R;  1K8A R;  1VQL Q;  3CXC P;  1VQP Q;  3I56 Q;  1KC8 R;  3CCV Q;  1K73 R;  3CCE Q;  1VQ5 Q;  1S72 Q;  2OTJ Q;  3CPW P;  3G4S Q;  3CCU Q;  1NJI R;  1VQK Q;  3CCR Q;  1QVG P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...