1M1KR

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 23S RRNA
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1m1kR00
2OTJQ 3CCLQ 1VQ8Q 3CCJQ 3G6EQ 3CPWP 1VQOQ 3I55Q 3CCUQ 1YIJQ 1Q81R 2OTLQ 1VQMQ 3I56Q 2QEXQ 1VQ5Q 1QVGP 1VQPQ 1Q86R 3CC2Q 1S72Q 1YHQQ 3CD6Q 1K73R 1YJNQ 3G71Q 1Q7YR 3CC7Q 3CMEQ 1VQ7Q 1QVFP 1NJIR 1VQLQ 1M1KR 1YJ9Q 1VQNQ 3CMAQ 1KQSP 1VQKQ 3CCRQ 1Q82R 1N8RR 1M90R 3CC4Q 1VQ6Q 3CCQQ 3CXCP 1VQ9Q 3OW2P 3CCSQ 3G4SQ 3CCMQ 1YI2Q 1KC8R 1K9MR 2QA4Q 1YITQ 1KD1R 1YJWQ 3CCVQ 1W2BP 1VQ4Q 3CCEQ 1K8AR 1JJ2P
chains in the Genus database with same CATH superfamily
4HVVA 3G7ZA 4DBHA 1FX7A 4QT7A 3I56A 4RTWA 1EFNA 1X2KA 2L3PA 5ECAA 2MPXC 1PKSA 3CCMT 1XOVA 3E9GA 3OW2P 4ZTFA 5IHNA 1UGSB 3VS6A 1OYXA 3OYLA 1WJQA 3RMSA 4EMKB 3Q1JA 2M16A 1Q86R 3X20B 3LX7A 2HKNA 1JQQA 4LNPA 2DVJA 4PJMA 1PCXA 5KYUA 4M77D 2LVMA 2YT6A 4XTZA 4NOYA 3RBBB 1YCSB 4M7AE 2EYZA 4OGEA 2OTJQ 3QZ9B 4E7HA 4LUEA 3X25B 3S3OA 3CEYA 2QTXA 2DTHA 4C8QB 2RPNA 4ESRA 3DB4A 3OS2A 3EHQA 2KNBB 4PJOE 2WSCE 3VU3C 1WFWA 3M0PA 2X3WD 3TSWA 2EAYA 4M7AG 3LWIA 2LZ6B 4QVCA 2JZ2A 2QG9B 3CCET 4IKFA 3TCJA 2NUPA 4ME7A 3CCEQ 3CCLT 4LE9A 1Y71A 1WJSA 4PK4A 3I56T 3V8LA 2E64A 2J7IA 1NEBA 3GPLA 1QVFA 1O75A 1X6GA 4PFPA 2V26A 3JB9D 1QCNA 1YHQA 3KUFA 2DL7A 3JCMd 3RR6A 1JJ2A 3E2UA 3JRZA 1TU0B 3OW2S 3SWNB 2F2WA 3SHWA 5IAYA 1ABOA 3C94A 2PTKA 1KHCA 2WACA 3OYBA 1YNZA 3CCRA 3H0HA 1Q82C 5GJVB 2COZA 4PJNA 1TUCA 2DM1A 2EYXA 1YBYA 4PJOF 1UJYA 1ZSZB 4LUDA 3CMET 4DBQA 1I81A 1K73U 3KFVA 2QQRA 2QGFB 1VQMQ 5CKHA 2V1RA 1D1BA 3F70A 4F7UE 3TU4K 1I1JA 3LH5A 4FYYB 4LD6A 1ZA1B 3O5ZA 3EHRA 4MDXA 4E7KA 1G83A 3MHXA 1JRIA 5D6XA 2K2MA 2OTLT 1SSFA 3PVQA 2XDPA 1WLPB 3EFOA 3MEVA 5GANj 5FW9A 3UT1A 4ATOA 1UHFA 2X4WA 5A2QE 1N8RU 1VQ5Q 4RG8A 2LJ0A 1X69A 4R55A 2LQKA 5DLQE 5KCOA 1D0YA 4M75D 3EGXB 3PVLA 3CD6A 1VQ7T 3GNFB 1YN8A 1KJWA 4KH1B 4ANJA 2RJCA 1KQSS 4IURA 2E6ZA 5CK9A 1KD1R 1V29B 1VA7A 1D0ZA 4MDWA 3CCVT 1GFDA 2LNHB 2K3XA 3MO8A 2ESWA 4C92D 4PJOB 2MK5A 2LX7A 2OI3A 2YRVA 2D8HA 5FU6C 3CCQQ 1QWEA 2GTJA 1H8KA 2DXUA 1LVKA 5GMKj 2MMPA 2ZPBB 5GAN4 1NPRA 1UFFA 3H41A 4OMFB 1VQ9T 1OX9A 4CC7A 3I55Q 3JB9J 5CQYA 2RHXA 1QVGP 2Y4YA 3HP9A 2HQXA 4QQ6A 1TWBA 4NL2A 1GXIE 3BE3A 1K9MU 3L2ZA 1M1KU 5KYXA 3OYNA 3OYKA 2OTLA 2EYQA 1VUBA 1G8XA 1RADB 1DJ7B 1ZUKA 3L1AA 2KGTA 3META 3BFMA 4J9HA 4PNOA 2LNVA 1N5ZA 4FT2A 5FWBA 1X6OA 1IGQA 1WIEA 1M1GA 4PL6A 4ZN3A 5IXFA 4FT4A 4PLIA 2CH4W 1IREB 2DRMA 2KSSA 1VQ6A 2EQMA 2A08A 4B6MA 2XD0A 3MP8A 3G71A 4DEXA 1WXTA 4D6WA 1KSWA 4O5VA 1SSHA 1VQMT 1Q7YR 4M77A 4KGZB 2BZXA 3OYFA 2JVVA 2RM4A 2F5TX 1Y96B 3H6ZA 2GQVA 2PQWA 4AFQC 2IPOB 1RAFB 1IHWA 1M2OA 3ZEHA 1WJRA 3N5BB 4Y91A 1I5OB 3QJ6A 2F69A 2YUNA 2E5QA 2CP6A 5GANe 1FMKA 1IO6A 1XQHA 4L6V5 1VQLA 2EJGA 3JCMQ 4Q5WA 1PWTA 1SG5A 5DY9A 1S72A 2CKKA 3VS5A 2YLBA 2DEUA 1VQ8Q 2CP7A 4UC4A 4BY6B 2AZVA 4BACA 4WF2A 1NPPA 3X28B 1CKAA 3UA7A 4AFSC 2KE9A 4C8QE 1B34A 1NJIC 4M7DA 2E1HA 2IG0A 2RI3A 2YDLA 1I4K1 2GQIA 2PU9B 3LLRA 2DVEA 2XI9A 1XNIA 1UG1A 3U23A 1VQOQ 1BU1A 3MEWA 4Z88A 2HSPA 2EGAA 3INZA 1BKBA 2BE7D 3EG9A 2EBPA 4HKEA 3CD6T 1RUWA 3EG2A 4A4EA 2VV5A 1KG1A 1VQ4T 1MNEA 2JT4A 2L5QA 5I22A 3G6ET 4XK8E 4FU6A 2GNCA 2DD4A 3TVTA 3T9NA 2RI5A 4PLLA 4TVRA 2EIFA 2L0AA 4CRIA 3M56A 3A5ZB 4HCZA 1TH7A 2ZCFB 1XJWB 4OMLA 3M4YA 4BE0A 2BIVA 4BE2A 1HK9A 2KT8A 4XTUA 1YP5A 3NFCA 1KQSA 3M0TA 4C0DB 3JCMP 2K2VA 3LGFA 4J9CA 4GY5A 3MKDA 2DETA 3JCMb 1YJ9A 3EG1A 1WHMA 1KD1U 3VS3A 2JTEA 1OZ3A 3G71T 4ZNXA 1N8RC 2YXYA 1GFCA 3UATA 1JBMA 4NS5A 4M7DF 4A63B 1YJ9Q 3GNGA 3RKWA 3HKSA 4RTYA 3VJPA 2HL5C 3QKJA 3RMQA 1UEBA 2XDBA 4J9GA 1AWWA 2Z0WA 3A8GB 2E65A 2DTIA 1MUZA 1U06A 3FEOA 5GAN8 1ZBXA 1T0HA 3RUXA 4OMPA 3QHSA 2CT3A 2YUPA 1VQKA 1XTDA 2DYIA 2ZPFB 1W1FA 1YJNA 3C95A 5LJ3j 5LJ5j 3J80E 1GBQA 4RTTA 2HNIA 2QEXA 5GAN5 3MEAA 4RTZA 5GAMd 2HQEA 3L2VA 3M58A 4IUTA 2EJ9A 3EFSA 2CGHA 3J7AF 2CP0A 3HFOA 1JU5C 3JV3A 2X4XA 4HT8A 1WQWA 1CKBA 5KH6A 1PM3A 4HCBA 1M9SA 1QKXA 2RHYA 4B9WA 2P0KA 2LCSA 3EAEA 3SB2A 1YFNA 1UGVA 2MYSA 2CZ1B 3RESA 4KRTA 3CCLA 1YJWQ 3OBYA 3CXCA 2E70A 2QXFA 3JCMV 2DFUA 1Y7XA 4OB1B 3C0CA 4JDSA 2KT1A 2M0YA 2JW4A 1AWJA 2X9HA 1NG2A 2CH4A 1YJWA 7AT1B 1PRLC 1AVZC 4M7AA 1Y57A 2RJFA 5I2MA 2QDYB 2DKGA 2HD0A 4M7AD 3HL8A 1AZEA 1M2VA 4AFZC 2DA9A 3QPHA 1TSFA 1UGPB 1KFZA 1BCMA 4F14A 3H0IA 1WI7A 4QW2A 3CC4T 2AZSA 1D3BB 2CT4A 5FRMA 2FPFA 3GP8A 1KQ1A 2K79A 4RTXA 2DBKA 5KYWB 5LL6S 3NTKA 3GBQA 2LJ3A 4C92A 3OW2A 1VYVA 1K73C 2EQKA 4JJCA 2CUBA 1K1ZA 1SKUB 4FCYA 3I5SA 3FIFA 4CI0C 1UTIA 3LWHA 2LCLA 3CXCS 2RQWA 3L2WA 3M53A 3G71Q 3JB9H 1R0CB 4PKCC 2ZPIB 1WPYA 1Z9ZA 2DXBA 4A53A 1QVGS 1VQ6Q 2KXDA 3PFSA 1S72T 1KC8R 4C5IA 2RO0A 3WXMB 2QYZA 3PGGA 2IVWA 2LX9A 5GMKe 2ROLA 4CC2A 5IHIA 2GF7A 2M9UA 4FW1A 1K8AC 4XU1A 4FSXA 2K9GA 3A98A 2D1XA 2NWMA 2R5MA 1ACMB 2CP5A 4N4GA 2XKOC 4M7DC 1PKTA 9ATCB 5LJ3e 5LJ5e 2O31A 5FWCA 3CMAT 2XMFA 4PJOD 3VYGA 3UA6A 3NMZC 2E3HA 1MGQA 4KH0B 3CC2T 3CC4A 3L2QA 2DERA 2NLUA 1AHJB 2DL8A 2XG8D 4ZGDB 2VC8A 2AIRB 2YRCA 3CCQA 3CBPA 2EPDA 2D6FA 1QLYA 2LC4A 1VQOT 1G5VA 5D6YA 3CCUQ 2DNUA 2FHDA 3QUIA 1WXUA 2FG0A 3P8DA 2JMCA 1O9SA 2COWA 4Z89A 2QEXT 1YITT 5IT9E 3GF5A 4WTOB 2H3EB 2RH2A 1M8VA 2I2LA 3SEMA 4AG2C 1QP3A 1EZZB 2GGRA 5D7UA 1UB4A 4JRPA 2JMAA 2DO3A 4LDVA 3ZBDA 4E47A 2HDAA 4C8QF 1PSEA 2VUBA 3VS1A 5KYWA 5GJWB 1VQ8A 3REBB 4C92B 4HA8A 3JB9I 2QA4T 5L23A 2PNIA 2A37A 2DAQA 5D6WA 1P92A 5IN1A 2JS0A 4ELYC 1W2BP 4EMKC 2HAXA 2BTTA 3ASKA 4M75A 2O4XA 2X3XD 3G1JA 1VQMA 3VV0A 3PNWC 2MIOA 3VYHB 3EFRA 2DPPB 2RA2A 1Q82R 3HRSA 1H3HA 2EGCA 5J26A 2RQRA 1ZA2B 3QG1A 5GAN3 1VQ9Q 1LOJA 1RL2A 1GL5A 1BB9A 1B7TA 1ABQA 1LNXA 2DL3A 5IHKA 3CCVA 3EG0A 2QI2A 1SRMA 3LGLA 5CKBA 4PJOC 1OV3A 2CYZB 2RN8A 2EKOA 1RLQC 4X9CA 1NYFA 4BUGA 3EGXA 2L89A 3CC4Q 3OYYA 2D0NA 2DX1A 4DQ2A 2HKQB 1OULA 3OYGA 1V1CA 2RQUA 1U5SA 3HPWA 3VRZA 3S3MA 4JJDA 1FWZA 4JUVA 1RI0A 3TEEA 5CKDA 5DLOA 3PT9A 4M77E 1B34B 2FPEA 1GBRA 4HCCA 4XAXB 3UWNA 4M78G 1VQNT 2IIMA 2PVDB 3CQTA 1YWPA 1LPLA 2SRCA 4M4ZA 1C6VX 3EGUA 4J5YA 5A0LA 1K9MC 5HKCA 2JN0A 1MNDA 2X4JA 4QVDA 2I0NA 2EYYA 3BW1A 4K11A 3HRTA 2CZ6B 3GLXA 4C8QD 2ZAEA 4M78E 4BD3A 3NTHA 2BE9B 5GANd 5CCAA 1X75C 1HD3A 3HTRA 1WHGA 5IXBA 1U1TA 3L2UA 3OQ5A 4XTVA 1RAIB 2P0QA 2HBWA 1FMVA 2JTFA 5KYNA 3CCVQ 1CSKA 3OYMA 4RTUA 2LRQA 2LQNA 4XTXA 3EGDB 2RI2A 1VQ9A 4L5GA 1ZSZA 4DOVA 4N4HA 4PFOA 3M57A 1BYMA 1SHFA 1NBEB 1TG0A 1Y0MA 1OI1A 4D8KA 2E5KA 5C0MA 2EW3A 3URGA 2QTVA 3HSBA 5GAOq 2YLCA 4N0AC 3LW5E 2RHUA 2KYBA 3DKMA 4JS4A 1BI0A 4J7FA 1GCQC 3CPWA 2K3BA 3I56Q 2CS7A 2BKDN 2D0QB 3MJXA 1VQLT 3PIPA 2DZ9A 2MWOA 2JOYA 1UHCA 2JNGA 3VRYA 1K4US 3OSSC 1T3LA 4EMGA 1FYNA 1OPLA 1U8RA 4XU3A 2EQJA 3A8HB 4LDYA 2M51A 3OYJA 3CCJT 1AWOA 2P84A 4OB0B 2PUOB 4C8QC 4MMLA 1VQ8T 4AMCA 5CKEA 1M1FA 1W2BS 2MOXA 3QSUA 4J8OA 3VS0A 2HEQA 4A4FA 2DE0X 2L3RA 4M7AC 2MAMA 2A0FB 3CCUA 3M4GA 3MP1A 2K7AA 1MMNA 1Q82U 2DK3A 4LD9K 3CPWP 5CKFA 4XU0A 4Z02A 2P4RA 4J83A 2HBPA 2V1QA 1YJNQ 5HK0A 1Z9QA 1KC8C 1VQKQ 1QWFA 1S1NA 3E19A 4XTWA 2QQ9A 1RLPC 5LJ3d 5LJ5d 5KE3A 4QQGA 3QO3A 1RAHB 3MCAB 2KEAA 1WHKA 4N0AA 1GCPA 4DOWA 1WQ7A 4JLGA 1ZLMA 2RF0A 1EX4A 1SRLA 2JTMA 3JCMJ 1QVFS 1D1CA 2H3JA 2H8HA 1WDXA 2F5KA 2PZ1A 3EH1A 2DXTA 1K9AA 1WHHA 3JSCA 2RNAA 4GBQA 1W70A 1M4ZA 5J39A 1RAAB 3L2RA 2MF2A 1BK2A 3VKIA 2OTJA 3VUZA 1YHQT 2FO0A 2DL5A 4OB2B 2OX7A 1I8FA 2KI7A 2E6NA 1WYXA 1Q95G 4DBFA 1T3SA 1X6BA 1WA7A 1F1BB 5GAMf 4EIKA 3H0FA 4OB3B 4C0FA 2OAUA 2MWPA 3CCRT 3JCMg 4F16A 1JEGA 4BDZA 4F7UB 1K73R 2YWWA 2DXCA 3REAB 1RAEB 1IZ6A 1IXDA 2R57A 2VXFA 4M78B 3M5AA 1PHTA 4J9IA 4OMQA 3AT1B 3OMCA 1MHNA 2XDDA 4DBRA 3P8BB 1H92A 3JB9F 3KXTA 4QQDA 3QXEB 3OYDA 4MZMA 1A0NB 4IUVA 3SDZA 2KXCA 4BE1A 1N8RR 3OYEA 1HSQA 1I5LA 1ZQ1A 4PFZA 1X43A 3SD4A 2DF6A 3AHUA 2C06A 1KC8U 3C12A 3CMAA 4J9DA 3CCLQ 2FB7A 4KUDK 4PJLA 2D8JA 4RCCA 2FRYA 1FMWA 2J6KA 1M3BA 4RMOA 3CC2A 4JLIA 3FC3A 1JJ2S 2FZKB 1D09B 1QVFP 1YJWT 1VQLQ 4BB7A 3BY7A 1HYOA 3H8ZA 1YJNT 2ENMA 2PUKB 5GAMh 1PD0A 2QQBA 4ELZC 2P4TA 4AT1B 1N27A 3I55T 4VUBA 2WSEE 2JUFA 4MZTA 3DB3A 1HXDA 1Q86C 5L8RE 3DLLA 2QEXQ 3ME9A 1QCFA 2COYA 1BBZA 1X2QA 2O9VA 1VQPT 2RHZA 3I9QA 3QYHB 1YCYA 2L3QA 5GMKh 4II1A 1QP2A 4J6YA 2X4YA 5GAOr 2V8JA 3CPWS 1LCKA 1MV3A 1M2VB 4X1VA 1QVPA 2K4YA 3O8VA 1B07A 2HSEB 2DYBA 1UJ0A 4HVUA 2KDSA 2RD1A 4F7UG 3MEUA 1VIFA 1D3BA 1E6HA 3I35A 4MZPA 4JJBA 2KMTA 3OSVA 4E7LA 4E7ZA 3M0UA 3FJPA 3IQLA 2MI6A 3V7RA 2OTLQ 2M1HA 1VIEA 2ABLA 2VKNA 2EVRA 3UDCA 1OZ2A 2KROA 2NYSA 1OEBA 1UGRB 4YTLA 3S6WA 8AT1B 5GAOm 2JXBA 1YI2Q 2DEQA 3I55A 3H9NA 1AT1B 1BI1A 4DEYA 2ED0A 1JJ2P 4E2FB 4JRKA 2KBTA 1M1KC 1HJDA 4M7DG 4C0DC 3QJYA 5EC7A 1C0MA 2OTJT 2Y4XA 4BDYA 5A0GA 2K5LA 4OMOA 2L8DA 1D0XA 2O2OA 1V76A 4OVAA 2NUZA 1E6GA 2HZYA 3CCQT 1G3WA 2K5FA 3TREA 3MP6A 2FZGB 3OA6A 4C8QA 4A4KA 3S3NA 1VQOA 4F04B 1N6AA 2V8IA 2VASA 4M75E 4M7DE 4C8QG 4HCKA 3NTIA 4A54A 2R58A 1WHLA 4RKUE 1M30A 2ZGWA 2LQ8A 3QBYA 1J3TA 2FPDA 4C92F 4M77G 1YITA 4NL3A 2JJ9A 2F1LA 2KAFA 1U3OA 2M02A 3CCMQ 2KY9A 1AEYA 4BI3A 1NJIU 3GOXA 4C5GA 4FYVB 4QKUA 4RTVA 3P8HA 1K8AR 1ARKA 2AHJB 1RI9A 3OMGA 3QWYA 1NLPC 1YIJT 4PJJA 1S72Q 3OS0A 4Y92A 2ECZA 3M0RA 2CZ7B 4IUPA 3V7CA 3PMIA 3M0QA 3LYIA 1VQPA 3X26B 2L3SA 3JAME 2QA4A 2J6OA 3KBGA 5KYYB 1IB8A 3G4SA 4X9DA 2DD5A 1PSFA 1K76A 3PTAA 3L42A 3WVDB 2E4HA 5GMKi 2K5IA 3EGDA 4GLKA 2Y90A 8ATCB 1Q81U 1UGQB 1NJIR 1VQ4A 1PC0A 2A7YA 1K8AU 1Q81C 1LJOA 3E1SA 2HQHA 2EQUA 4KGVB 4OP0A 1TUDA 4IIMA 5GANh 4JRQA 2O4XB 2EQIA 4BI8B 2LT4A 3UPUA 2C0OA 1K0SA 1NYGA 1I07A 3CCST 4J9EA 5CAIA 3EFOB 3A1PA 3CCSQ 2W0ZA 4OMNA 1PRMC 1R0BG 1TOVA 3M55A 4XTYA 2CSQA 4M75F 1MV0B 1U1SA 1VYTA 3QZ5B 4JZ4A 1YIJQ 3JCMX 4OF1A 3ZFJA 2CUDA 2VXEA 2QQAA 4LDXA 3CMEQ 3CPFA 4M7DD 1PD1A 3ZL7C 2O88A 4M75C 4E7IA 5GAMj 2X35A 3CBOA 1WNLA 1PG5B 4C0ZA 3LH0A 4F17A 2NUPB 3M9QA 3RERA 2X51A 3NHNA 2E41A 3UF4A 2OAWA 3RKYA 3PIOA 4IUQA 4XU2A 1M90U 3E9FA 2AT1B 1TUGB 2KR3A 1RABB 4FYWB 5J3BA 4M78C 1M3AA 2O9SA 2EYWA 4M78F 4FL6A 1M3CA 2J05A 3JCMe 1QCOA 4EDUA 4KUIA 2O01E 1ZHIA 3RKXA 2JS2A 3VS2A 3CCJQ 3QWXX 2ROTA 1M27C 2LDMA 2KRMA 1AWXA 1YIJA 4RCBA 5KYXB 4C5EA 1ZSZC 3CD6Q 1QVGA 2EGEA 3V8KA 2J06A 2LJ1A 5CR2A 1VQ5A 2HCKA 1Q7YU 1OU9A 1K9MR 2QASA 2WSFE 2VGNA 4FYXB 4AG1C 2NUTB 2LP5A 4JPBW 4XQ3A 5GAMg 3QYGB 1FXXA 5GAOn 1JXOA 2FYKA 1I0CA 4M75B 2G6FX 4BI4A 1VQ7A 3A8LB 5CQXA 1QKWA 5LJ3h 5LJ5h 3OS5A 2E12A 2K6DA 1WX6A 4ZTJA 2A28A 2BZ8A 5HY6A 5FRNA 1GRIA 4OMMA 3OYHA 2CREA 2MCNA 2KQWA 3JCMf 2ZZDA 4QVZA 2RQTA 4J9BA 1OOTA 5FU7B 1T0JA 1KHIA 2YUQA 3VUBA 3THKA 3CCRQ 5KYUB 4M78A 3G4ST 5HK3A 2DBMA 5EG2A 3G4SQ 2AK5A 2YSQA 2DLPA 1R77A 1ZBJA 1VQPQ 4M77F 3RIRA 5GMKm 4C92C 4PJOG 1QMCA 2EWNA 3V7SA 1YHQQ 4PJOA 1SF9A 1H641 3OYCA 1BI3A 4IIOA 2VGMA 4EMHA 5FU6B 2R5AA 2DL4A 2PVOB 3NGPA 1SHGA 2CP2A 2C0IA 4HT9A 5GAMe 3CCEA 2HMAA 4R0KA 2F2XA 3QIIA 4Y28E 2VYTA 2A36A 2ZPGB 2RMOA 1JXMA 2RB6A 3CC7T 3CCJA 1NE8A 2LT1A 1G3YA 2RHIA 3PE0A 1JO8A 2XK0A 1VQ6T 2RK1A 3CCUT 2EFIA 2JM9A 5GAN2 1NM7A 4J6XA 2LTOA 5CO7A 2KK4A 3QDRB 4F7UF 4FSSA 1OX8A 1KK7A 4FM4B 1VOMA 1M90R 4LDWA 4JRIA 6AT1B 2VB6A 2NUTA 2ATCB 2ED1A 2CP3A 3FB9A 2VVKA 3M59A 3I5RA 2XU8A 2LQWA 3SFMA 1BI2A 4V2SA 3CMEA 2DIGA 5I11A 2G3RA 2V8KA 2DTOA 1E7OA 4M77B 2M0OA 1RAGB 1W4SA 1OPKA 1AD5A 1VQNQ 4E6RA 3TQ7P 2E10A 2FL7A 2KRNA 2QAZA 2DJQA 4FW2A 2YUOA 3CCSA 5I21A 1ZSGA 4KULA 3FJ5A 1C1AA 4A4GA 1W6XA 2DRKA 2L2PA 1OU8A 4AFUC 1KD1C 2AKKA 4JZ3A 4LXCA 4ORZA 4O6JA 1MMDA 1Q7YC 1N9RA 3X24B 2KYMA 2QQSA 3JB9G 1GCQA 4LN2A 3EH2A 1VQ5T 2LCCA 1X27A 4A4HA 1B3QA 5GAN6 2RQVA 4ZGJB 3OYAA 1VQ4Q 3HHTB 4C0GA 2HL3A 3G6EQ 4D8DA 3V8JA 1TXQA 2GFUA 4J7IA 1QW1A 4P5NA 1M1KR 2QDLA 5AYFA 2BZYA 5IH2A 3RNJA 4MMKA 4OGCA 2DJZA 1D1AA 2QA4Q 1AZGB 5GAN7 3FDRA 1Q86U 2GCXA 2FRWA 2F2VA 4E7SA 3CC2Q 4M75G 3WVEB 3EG9B 3CC7Q 2AKLA 1JB0E 1BIAA 2XICA 1BIBA 1IHVA 3BDLA 3OY9A 3CCMA 1EIFA 4J9FA 1YJ9T 1YITQ 2PVGB 3TSZA 2XHCA 3OBWA 1PNJA 1K0XA 2GBQA 5DM7R 3BDUA 2OJ2A 1KQ2A 4C5HA 2EKHA 2JM8A 1UE9A 4KGXB 1VQNA 4M7AB 1M5Q1 5GANf 3ULRB 2BUDA 5KYYA 2EJFA 4X34A 3QDFA 2VWFA 1UUEA 2A3LA 2K3YA 2CDTA 1MMGA 1WZOA 1G3TA 4HXJA 1WXBA 5FROA 5LJ3f 5LJ5f 4N4IA 5GAOp 1UDLA 2CSIA 1VQKT 5CIUA 1N9SA 1Y07A 3PMTA 2FVUA 2E3IA 2RK2A 1KQSP 1Y96A 3ER0A 1IGUA 3FLGA 4F7UA 4ZN1A 1H3ZA 1YI2A 3D7SB 1AOJA 3JCMc 5A0DA 4JJNK 2SEMA 5KE2A 2FZCB 1Q81R 2QGGA 4IUUA 4M78D 5GAOl 5FU7C 1IRXA 2DILA 2QK0A 1WHJA 2GFAA 4EMKA 4JS5A 2KVQG 3FRNA 1G2BA 3A8MB 4FIBA 2DMOA 4J6WA 2RJEA 5GANg 2W10A 4WCIA 4E7JA 4B9XA 4C92G 2GTOA 1WGSA 5HCKA 1TTHB 3M54A 3JCMW 5AT1B 1NZ9A 4HVWA 5C6SA 2C0TA 2ZPHB 4KT0E 5CVIA 1SPKA 5FLXE 3R6OA 1SEMA 1NLOC 4M77C 5LJ5g 2LMJA 5LJ3g 5GMKl 4KBMB 4M7DB 2P0PA 5KCHA 3CC7A 1YWOA 2FEIA 4C92E 3NPFA 3OS1A 1KIKA 1QQJA 4CC4B 3OB9A 4BY6C 4LDUA 2DZCA 3HRUA 4R56A 3CBMA 4M7AF 3JCMh 1OQKA 3R6NA 1RACB 1TS9A 2K57A 1M90C 1W2BA 3M0SA 1BCOA 3VS7A 3SWNC 1UECA 3C4SA 1ZUYA 2CZ0B 4Z8AA 2XIDA 3J81E 1YI2T 1MMAA 3CXCP 4DA4A 4ZGEB 3RDVA 1NEGA 3G6EA 3GIBA 3VS4A 4GLMA 4EPCA 2ZPEB 3MPUB 1R8OB 2RJDA 4RG2A 3SWNA 4L59A 3OYIA 3EG3A 1VQ7Q 3CMAQ 2DIQA 2YRDA 1M8MA 1ZX6A 2KRSA 1ZUUA 3HFNA 3DLMA 5I2SA 4CC3A 1G3SA 4RUGA 1VYUA 5M9OA 2J6FA 1X01A 2B86A 3A8OB 2B8AA 2YHTA 2D9TA
chains in the Genus database with same CATH topology
2OTJQ 3CCLQ 1VQ8Q 3CCJQ 3G6EQ 3CPWP 1VQOQ 3I55Q 3CCUQ 1YIJQ 1Q81R 2OTLQ 1VQMQ 3I56Q 2QEXQ 1VQ5Q 1QVGP 1VQPQ 1Q86R 3CC2Q 1S72Q 1YHQQ 3CD6Q 1K73R 1YJNQ 3G71Q 1Q7YR 3CC7Q 3CMEQ 1VQ7Q 1QVFP 1NJIR 1VQLQ 1M1KR 1YJ9Q 1VQNQ 3CMAQ 1KQSP 1VQKQ 3CCRQ 1Q82R 1N8RR 1M90R 3CC4Q 1VQ6Q 3CCQQ 3CXCP 1VQ9Q 3OW2P 3CCSQ 3G4SQ 3CCMQ 1YI2Q 1KC8R 1K9MR 2QA4Q 1YITQ 1KD1R 1YJWQ 3CCVQ 1W2BP 1VQ4Q 3CCEQ 1K8AR 1JJ2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OTJ Q;  3CCL Q;  1VQ8 Q;  3CCJ Q;  3G6E Q;  3CPW P;  1VQO Q;  3I55 Q;  3CCU Q;  1YIJ Q;  1Q81 R;  2OTL Q;  1VQM Q;  3I56 Q;  2QEX Q;  1VQ5 Q;  1QVG P;  1VQP Q;  1Q86 R;  3CC2 Q;  1S72 Q;  1YHQ Q;  3CD6 Q;  1K73 R;  1YJN Q;  3G71 Q;  1Q7Y R;  3CC7 Q;  3CME Q;  1VQ7 Q;  1QVF P;  1NJI R;  1VQL Q;  1M1K R;  1YJ9 Q;  1VQN Q;  3CMA Q;  1KQS P;  1VQK Q;  3CCR Q;  1Q82 R;  1N8R R;  1M90 R;  3CC4 Q;  1VQ6 Q;  3CCQ Q;  3CXC P;  1VQ9 Q;  3OW2 P;  3CCS Q;  3G4S Q;  3CCM Q;  1YI2 Q;  1KC8 R;  1K9M R;  2QA4 Q;  1YIT Q;  1KD1 R;  1YJW Q;  3CCV Q;  1W2B P;  1VQ4 Q;  3CCE Q;  1K8A R;  1JJ2 P; 
#chains in the Genus database with same CATH topology
 4HVV A;  3G7Z A;  4DBH A;  1FX7 A;  4QT7 A;  3I56 A;  4RTW A;  1EFN A;  1X2K A;  2L3P A;  5ECA A;  2MPX C;  1PKS A;  3CCM T;  1XOV A;  3E9G A;  3OW2 P;  4ZTF A;  5IHN A;  1UGS B;  3VS6 A;  1OYX A;  3OYL A;  1WJQ A;  3RMS A;  4EMK B;  3Q1J A;  2M16 A;  1Q86 R;  3X20 B;  3LX7 A;  2HKN A;  1JQQ A;  4LNP A;  2DVJ A;  4PJM A;  1PCX A;  5KYU A;  4M77 D;  2LVM A;  2YT6 A;  4XTZ A;  4NOY A;  3RBB B;  1YCS B;  4M7A E;  2EYZ A;  4OGE A;  2OTJ Q;  3QZ9 B;  4E7H A;  4LUE A;  3X25 B;  3S3O A;  3CEY A;  2QTX A;  2DTH A;  4C8Q B;  2RPN A;  4ESR A;  3DB4 A;  3OS2 A;  3EHQ A;  2KNB B;  4PJO E;  2WSC E;  3VU3 C;  1WFW A;  3M0P A;  2X3W D;  3TSW A;  2EAY A;  4M7A G;  3LWI A;  2LZ6 B;  4QVC A;  2JZ2 A;  2QG9 B;  3CCE T;  4IKF A;  3TCJ A;  2NUP A;  4ME7 A;  3CCE Q;  3CCL T;  4LE9 A;  1Y71 A;  1WJS A;  4PK4 A;  3I56 T;  3V8L A;  2E64 A;  2J7I A;  1NEB A;  3GPL A;  1QVF A;  1O75 A;  1X6G A;  4PFP A;  2V26 A;  3JB9 D;  1QCN A;  1YHQ A;  3KUF A;  2DL7 A;  3JCM d;  3RR6 A;  1JJ2 A;  3E2U A;  3JRZ A;  1TU0 B;  3OW2 S;  3SWN B;  2F2W A;  3SHW A;  5IAY A;  1ABO A;  3C94 A;  2PTK A;  1KHC A;  2WAC A;  3OYB A;  1YNZ A;  3CCR A;  3H0H A;  1Q82 C;  5GJV B;  2COZ A;  4PJN A;  1TUC A;  2DM1 A;  2EYX A;  1YBY A;  4PJO F;  1UJY A;  1ZSZ B;  4LUD A;  3CME T;  4DBQ A;  1I81 A;  1K73 U;  3KFV A;  2QQR A;  2QGF B;  1VQM Q;  5CKH A;  2V1R A;  1D1B A;  3F70 A;  4F7U E;  3TU4 K;  1I1J A;  3LH5 A;  4FYY B;  4LD6 A;  1ZA1 B;  3O5Z A;  3EHR A;  4MDX A;  4E7K A;  1G83 A;  3MHX A;  1JRI A;  5D6X A;  2K2M A;  2OTL T;  1SSF A;  3PVQ A;  2XDP A;  1WLP B;  3EFO A;  3MEV A;  5GAN j;  5FW9 A;  3UT1 A;  4ATO A;  1UHF A;  2X4W A;  5A2Q E;  1N8R U;  1VQ5 Q;  4RG8 A;  2LJ0 A;  1X69 A;  4R55 A;  2LQK A;  5DLQ E;  5KCO A;  1D0Y A;  4M75 D;  3EGX B;  3PVL A;  3CD6 A;  1VQ7 T;  3GNF B;  1YN8 A;  1KJW A;  4KH1 B;  4ANJ A;  2RJC A;  1KQS S;  4IUR A;  2E6Z A;  5CK9 A;  1KD1 R;  1V29 B;  1VA7 A;  1D0Z A;  4MDW A;  3CCV T;  1GFD A;  2LNH B;  2K3X A;  3MO8 A;  2ESW A;  4C92 D;  4PJO B;  2MK5 A;  2LX7 A;  2OI3 A;  2YRV A;  2D8H A;  5FU6 C;  3CCQ Q;  1QWE A;  2GTJ A;  1H8K A;  2DXU A;  1LVK A;  5GMK j;  2MMP A;  2ZPB B;  5GAN 4;  1NPR A;  1UFF A;  3H41 A;  4OMF B;  1VQ9 T;  1OX9 A;  4CC7 A;  3I55 Q;  3JB9 J;  5CQY A;  2RHX A;  1QVG P;  2Y4Y A;  3HP9 A;  2HQX A;  4QQ6 A;  1TWB A;  4NL2 A;  1GXI E;  3BE3 A;  1K9M U;  3L2Z A;  1M1K U;  5KYX A;  3OYN A;  3OYK A;  2OTL A;  2EYQ A;  1VUB A;  1G8X A;  1RAD B;  1DJ7 B;  1ZUK A;  3L1A A;  2KGT A;  3MET A;  3BFM A;  4J9H A;  4PNO A;  2LNV A;  1N5Z A;  4FT2 A;  5FWB A;  1X6O A;  1IGQ A;  1WIE A;  1M1G A;  4PL6 A;  4ZN3 A;  5IXF A;  4FT4 A;  4PLI A;  2CH4 W;  1IRE B;  2DRM A;  2KSS A;  1VQ6 A;  2EQM A;  2A08 A;  4B6M A;  2XD0 A;  3MP8 A;  3G71 A;  4DEX A;  1WXT A;  4D6W A;  1KSW A;  4O5V A;  1SSH A;  1VQM T;  1Q7Y R;  4M77 A;  4KGZ B;  2BZX A;  3OYF A;  2JVV A;  2RM4 A;  2F5T X;  1Y96 B;  3H6Z A;  2GQV A;  2PQW A;  4AFQ C;  2IPO B;  1RAF B;  1IHW A;  1M2O A;  3ZEH A;  1WJR A;  3N5B B;  4Y91 A;  1I5O B;  3QJ6 A;  2F69 A;  2YUN A;  2E5Q A;  2CP6 A;  5GAN e;  1FMK A;  1IO6 A;  1XQH A;  4L6V 5;  1VQL A;  2EJG A;  3JCM Q;  4Q5W A;  1PWT A;  1SG5 A;  5DY9 A;  1S72 A;  2CKK A;  3VS5 A;  2YLB A;  2DEU A;  1VQ8 Q;  2CP7 A;  4UC4 A;  4BY6 B;  2AZV A;  4BAC A;  4WF2 A;  1NPP A;  3X28 B;  1CKA A;  3UA7 A;  4AFS C;  2KE9 A;  4C8Q E;  1B34 A;  1NJI C;  4M7D A;  2E1H A;  2IG0 A;  2RI3 A;  2YDL A;  1I4K 1;  2GQI A;  2PU9 B;  3LLR A;  2DVE A;  2XI9 A;  1XNI A;  1UG1 A;  3U23 A;  1VQO Q;  1BU1 A;  3MEW A;  4Z88 A;  2HSP A;  2EGA A;  3INZ A;  1BKB A;  2BE7 D;  3EG9 A;  2EBP A;  4HKE A;  3CD6 T;  1RUW A;  3EG2 A;  4A4E A;  2VV5 A;  1KG1 A;  1VQ4 T;  1MNE A;  2JT4 A;  2L5Q A;  5I22 A;  3G6E T;  4XK8 E;  4FU6 A;  2GNC A;  2DD4 A;  3TVT A;  3T9N A;  2RI5 A;  4PLL A;  4TVR A;  2EIF A;  2L0A A;  4CRI A;  3M56 A;  3A5Z B;  4HCZ A;  1TH7 A;  2ZCF B;  1XJW B;  4OML A;  3M4Y A;  4BE0 A;  2BIV A;  4BE2 A;  1HK9 A;  2KT8 A;  4XTU A;  1YP5 A;  3NFC A;  1KQS A;  3M0T A;  4C0D B;  3JCM P;  2K2V A;  3LGF A;  4J9C A;  4GY5 A;  3MKD A;  2DET A;  3JCM b;  1YJ9 A;  3EG1 A;  1WHM A;  1KD1 U;  3VS3 A;  2JTE A;  1OZ3 A;  3G71 T;  4ZNX A;  1N8R C;  2YXY A;  1GFC A;  3UAT A;  1JBM A;  4NS5 A;  4M7D F;  4A63 B;  1YJ9 Q;  3GNG A;  3RKW A;  3HKS A;  4RTY A;  3VJP A;  2HL5 C;  3QKJ A;  3RMQ A;  1UEB A;  2XDB A;  4J9G A;  1AWW A;  2Z0W A;  3A8G B;  2E65 A;  2DTI A;  1MUZ A;  1U06 A;  3FEO A;  5GAN 8;  1ZBX A;  1T0H A;  3RUX A;  4OMP A;  3QHS A;  2CT3 A;  2YUP A;  1VQK A;  1XTD A;  2DYI A;  2ZPF B;  1W1F A;  1YJN A;  3C95 A;  5LJ3 j;  5LJ5 j;  3J80 E;  1GBQ A;  4RTT A;  2HNI A;  2QEX A;  5GAN 5;  3MEA A;  4RTZ A;  5GAM d;  2HQE A;  3L2V A;  3M58 A;  4IUT A;  2EJ9 A;  3EFS A;  2CGH A;  3J7A F;  2CP0 A;  3HFO A;  1JU5 C;  3JV3 A;  2X4X A;  4HT8 A;  1WQW A;  1CKB A;  5KH6 A;  1PM3 A;  4HCB A;  1M9S A;  1QKX A;  2RHY A;  4B9W A;  2P0K A;  2LCS A;  3EAE A;  3SB2 A;  1YFN A;  1UGV A;  2MYS A;  2CZ1 B;  3RES A;  4KRT A;  3CCL A;  1YJW Q;  3OBY A;  3CXC A;  2E70 A;  2QXF A;  3JCM V;  2DFU A;  1Y7X A;  4OB1 B;  3C0C A;  4JDS A;  2KT1 A;  2M0Y A;  2JW4 A;  1AWJ A;  2X9H A;  1NG2 A;  2CH4 A;  1YJW A;  7AT1 B;  1PRL C;  1AVZ C;  4M7A A;  1Y57 A;  2RJF A;  5I2M A;  2QDY B;  2DKG A;  2HD0 A;  4M7A D;  3HL8 A;  1AZE A;  1M2V A;  4AFZ C;  2DA9 A;  3QPH A;  1TSF A;  1UGP B;  1KFZ A;  1BCM A;  4F14 A;  3H0I A;  1WI7 A;  4QW2 A;  3CC4 T;  2AZS A;  1D3B B;  2CT4 A;  5FRM A;  2FPF A;  3GP8 A;  1KQ1 A;  2K79 A;  4RTX A;  2DBK A;  5KYW B;  5LL6 S;  3NTK A;  3GBQ A;  2LJ3 A;  4C92 A;  3OW2 A;  1VYV A;  1K73 C;  2EQK A;  4JJC A;  2CUB A;  1K1Z A;  1SKU B;  4FCY A;  3I5S A;  3FIF A;  4CI0 C;  1UTI A;  3LWH A;  2LCL A;  3CXC S;  2RQW A;  3L2W A;  3M53 A;  3G71 Q;  3JB9 H;  1R0C B;  4PKC C;  2ZPI B;  1WPY A;  1Z9Z A;  2DXB A;  4A53 A;  1QVG S;  1VQ6 Q;  2KXD A;  3PFS A;  1S72 T;  1KC8 R;  4C5I A;  2RO0 A;  3WXM B;  2QYZ A;  3PGG A;  2IVW A;  2LX9 A;  5GMK e;  2ROL A;  4CC2 A;  5IHI A;  2GF7 A;  2M9U A;  4FW1 A;  1K8A C;  4XU1 A;  4FSX A;  2K9G A;  3A98 A;  2D1X A;  2NWM A;  2R5M A;  1ACM B;  2CP5 A;  4N4G A;  2XKO C;  4M7D C;  1PKT A;  9ATC B;  5LJ3 e;  5LJ5 e;  2O31 A;  5FWC A;  3CMA T;  2XMF A;  4PJO D;  3VYG A;  3UA6 A;  3NMZ C;  2E3H A;  1MGQ A;  4KH0 B;  3CC2 T;  3CC4 A;  3L2Q A;  2DER A;  2NLU A;  1AHJ B;  2DL8 A;  2XG8 D;  4ZGD B;  2VC8 A;  2AIR B;  2YRC A;  3CCQ A;  3CBP A;  2EPD A;  2D6F A;  1QLY A;  2LC4 A;  1VQO T;  1G5V A;  5D6Y A;  3CCU Q;  2DNU A;  2FHD A;  3QUI A;  1WXU A;  2FG0 A;  3P8D A;  2JMC A;  1O9S A;  2COW A;  4Z89 A;  2QEX T;  1YIT T;  5IT9 E;  3GF5 A;  4WTO B;  2H3E B;  2RH2 A;  1M8V A;  2I2L A;  3SEM A;  4AG2 C;  1QP3 A;  1EZZ B;  2GGR A;  5D7U A;  1UB4 A;  4JRP A;  2JMA A;  2DO3 A;  4LDV A;  3ZBD A;  4E47 A;  2HDA A;  4C8Q F;  1PSE A;  2VUB A;  3VS1 A;  5KYW A;  5GJW B;  1VQ8 A;  3REB B;  4C92 B;  4HA8 A;  3JB9 I;  2QA4 T;  5L23 A;  2PNI A;  2A37 A;  2DAQ A;  5D6W A;  1P92 A;  5IN1 A;  2JS0 A;  4ELY C;  1W2B P;  4EMK C;  2HAX A;  2BTT A;  3ASK A;  4M75 A;  2O4X A;  2X3X D;  3G1J A;  1VQM A;  3VV0 A;  3PNW C;  2MIO A;  3VYH B;  3EFR A;  2DPP B;  2RA2 A;  1Q82 R;  3HRS A;  1H3H A;  2EGC A;  5J26 A;  2RQR A;  1ZA2 B;  3QG1 A;  5GAN 3;  1VQ9 Q;  1LOJ A;  1RL2 A;  1GL5 A;  1BB9 A;  1B7T A;  1ABQ A;  1LNX A;  2DL3 A;  5IHK A;  3CCV A;  3EG0 A;  2QI2 A;  1SRM A;  3LGL A;  5CKB A;  4PJO C;  1OV3 A;  2CYZ B;  2RN8 A;  2EKO A;  1RLQ C;  4X9C A;  1NYF A;  4BUG A;  3EGX A;  2L89 A;  3CC4 Q;  3OYY A;  2D0N A;  2DX1 A;  4DQ2 A;  2HKQ B;  1OUL A;  3OYG A;  1V1C A;  2RQU A;  1U5S A;  3HPW A;  3VRZ A;  3S3M A;  4JJD A;  1FWZ A;  4JUV A;  1RI0 A;  3TEE A;  5CKD A;  5DLO A;  3PT9 A;  4M77 E;  1B34 B;  2FPE A;  1GBR A;  4HCC A;  4XAX B;  3UWN A;  4M78 G;  1VQN T;  2IIM A;  2PVD B;  3CQT A;  1YWP A;  1LPL A;  2SRC A;  4M4Z A;  1C6V X;  3EGU A;  4J5Y A;  5A0L A;  1K9M C;  5HKC A;  2JN0 A;  1MND A;  2X4J A;  4QVD A;  2I0N A;  2EYY A;  3BW1 A;  4K11 A;  3HRT A;  2CZ6 B;  3GLX A;  4C8Q D;  2ZAE A;  4M78 E;  4BD3 A;  3NTH A;  2BE9 B;  5GAN d;  5CCA A;  1X75 C;  1HD3 A;  3HTR A;  1WHG A;  5IXB A;  1U1T A;  3L2U A;  3OQ5 A;  4XTV A;  1RAI B;  2P0Q A;  2HBW A;  1FMV A;  2JTF A;  5KYN A;  3CCV Q;  1CSK A;  3OYM A;  4RTU A;  2LRQ A;  2LQN A;  4XTX A;  3EGD B;  2RI2 A;  1VQ9 A;  4L5G A;  1ZSZ A;  4DOV A;  4N4H A;  4PFO A;  3M57 A;  1BYM A;  1SHF A;  1NBE B;  1TG0 A;  1Y0M A;  1OI1 A;  4D8K A;  2E5K A;  5C0M A;  2EW3 A;  3URG A;  2QTV A;  3HSB A;  5GAO q;  2YLC A;  4N0A C;  3LW5 E;  2RHU A;  2KYB A;  3DKM A;  4JS4 A;  1BI0 A;  4J7F A;  1GCQ C;  3CPW A;  2K3B A;  3I56 Q;  2CS7 A;  2BKD N;  2D0Q B;  3MJX A;  1VQL T;  3PIP A;  2DZ9 A;  2MWO A;  2JOY A;  1UHC A;  2JNG A;  3VRY A;  1K4U S;  3OSS C;  1T3L A;  4EMG A;  1FYN A;  1OPL A;  1U8R A;  4XU3 A;  2EQJ A;  3A8H B;  4LDY A;  2M51 A;  3OYJ A;  3CCJ T;  1AWO A;  2P84 A;  4OB0 B;  2PUO B;  4C8Q C;  4MML A;  1VQ8 T;  4AMC A;  5CKE A;  1M1F A;  1W2B S;  2MOX A;  3QSU A;  4J8O A;  3VS0 A;  2HEQ A;  4A4F A;  2DE0 X;  2L3R A;  4M7A C;  2MAM A;  2A0F B;  3CCU A;  3M4G A;  3MP1 A;  2K7A A;  1MMN A;  1Q82 U;  2DK3 A;  4LD9 K;  3CPW P;  5CKF A;  4XU0 A;  4Z02 A;  2P4R A;  4J83 A;  2HBP A;  2V1Q A;  1YJN Q;  5HK0 A;  1Z9Q A;  1KC8 C;  1VQK Q;  1QWF A;  1S1N A;  3E19 A;  4XTW A;  2QQ9 A;  1RLP C;  5LJ3 d;  5LJ5 d;  5KE3 A;  4QQG A;  3QO3 A;  1RAH B;  3MCA B;  2KEA A;  1WHK A;  4N0A A;  1GCP A;  4DOW A;  1WQ7 A;  4JLG A;  1ZLM A;  2RF0 A;  1EX4 A;  1SRL A;  2JTM A;  3JCM J;  1QVF S;  1D1C A;  2H3J A;  2H8H A;  1WDX A;  2F5K A;  2PZ1 A;  3EH1 A;  2DXT A;  1K9A A;  1WHH A;  3JSC A;  2RNA A;  4GBQ A;  1W70 A;  1M4Z A;  5J39 A;  1RAA B;  3L2R A;  2MF2 A;  1BK2 A;  3VKI A;  2OTJ A;  3VUZ A;  1YHQ T;  2FO0 A;  2DL5 A;  4OB2 B;  2OX7 A;  1I8F A;  2KI7 A;  2E6N A;  1WYX A;  1Q95 G;  4DBF A;  1T3S A;  1X6B A;  1WA7 A;  1F1B B;  5GAM f;  4EIK A;  3H0F A;  4OB3 B;  4C0F A;  2OAU A;  2MWP A;  3CCR T;  3JCM g;  4F16 A;  1JEG A;  4BDZ A;  4F7U B;  1K73 R;  2YWW A;  2DXC A;  3REA B;  1RAE B;  1IZ6 A;  1IXD A;  2R57 A;  2VXF A;  4M78 B;  3M5A A;  1PHT A;  4J9I A;  4OMQ A;  3AT1 B;  3OMC A;  1MHN A;  2XDD A;  4DBR A;  3P8B B;  1H92 A;  3JB9 F;  3KXT A;  4QQD A;  3QXE B;  3OYD A;  4MZM A;  1A0N B;  4IUV A;  3SDZ A;  2KXC A;  4BE1 A;  1N8R R;  3OYE A;  1HSQ A;  1I5L A;  1ZQ1 A;  4PFZ A;  1X43 A;  3SD4 A;  2DF6 A;  3AHU A;  2C06 A;  1KC8 U;  3C12 A;  3CMA A;  4J9D A;  3CCL Q;  2FB7 A;  4KUD K;  4PJL A;  2D8J A;  4RCC A;  2FRY A;  1FMW A;  2J6K A;  1M3B A;  4RMO A;  3CC2 A;  4JLI A;  3FC3 A;  1JJ2 S;  2FZK B;  1D09 B;  1QVF P;  1YJW T;  1VQL Q;  4BB7 A;  3BY7 A;  1HYO A;  3H8Z A;  1YJN T;  2ENM A;  2PUK B;  5GAM h;  1PD0 A;  2QQB A;  4ELZ C;  2P4T A;  4AT1 B;  1N27 A;  3I55 T;  4VUB A;  2WSE E;  2JUF A;  4MZT A;  3DB3 A;  1HXD A;  1Q86 C;  5L8R E;  3DLL A;  2QEX Q;  3ME9 A;  1QCF A;  2COY A;  1BBZ A;  1X2Q A;  2O9V A;  1VQP T;  2RHZ A;  3I9Q A;  3QYH B;  1YCY A;  2L3Q A;  5GMK h;  4II1 A;  1QP2 A;  4J6Y A;  2X4Y A;  5GAO r;  2V8J A;  3CPW S;  1LCK A;  1MV3 A;  1M2V B;  4X1V A;  1QVP A;  2K4Y A;  3O8V A;  1B07 A;  2HSE B;  2DYB A;  1UJ0 A;  4HVU A;  2KDS A;  2RD1 A;  4F7U G;  3MEU A;  1VIF A;  1D3B A;  1E6H A;  3I35 A;  4MZP A;  4JJB A;  2KMT A;  3OSV A;  4E7L A;  4E7Z A;  3M0U A;  3FJP A;  3IQL A;  2MI6 A;  3V7R A;  2OTL Q;  2M1H A;  1VIE A;  2ABL A;  2VKN A;  2EVR A;  3UDC A;  1OZ2 A;  2KRO A;  2NYS A;  1OEB A;  1UGR B;  4YTL A;  3S6W A;  8AT1 B;  5GAO m;  2JXB A;  1YI2 Q;  2DEQ A;  3I55 A;  3H9N A;  1AT1 B;  1BI1 A;  4DEY A;  2ED0 A;  1JJ2 P;  4E2F B;  4JRK A;  2KBT A;  1M1K C;  1HJD A;  4M7D G;  4C0D C;  3QJY A;  5EC7 A;  1C0M A;  2OTJ T;  2Y4X A;  4BDY A;  5A0G A;  2K5L A;  4OMO A;  2L8D A;  1D0X A;  2O2O A;  1V76 A;  4OVA A;  2NUZ A;  1E6G A;  2HZY A;  3CCQ T;  1G3W A;  2K5F A;  3TRE A;  3MP6 A;  2FZG B;  3OA6 A;  4C8Q A;  4A4K A;  3S3N A;  1VQO A;  4F04 B;  1N6A A;  2V8I A;  2VAS A;  4M75 E;  4M7D E;  4C8Q G;  4HCK A;  3NTI A;  4A54 A;  2R58 A;  1WHL A;  4RKU E;  1M30 A;  2ZGW A;  2LQ8 A;  3QBY A;  1J3T A;  2FPD A;  4C92 F;  4M77 G;  1YIT A;  4NL3 A;  2JJ9 A;  2F1L A;  2KAF A;  1U3O A;  2M02 A;  3CCM Q;  2KY9 A;  1AEY A;  4BI3 A;  1NJI U;  3GOX A;  4C5G A;  4FYV B;  4QKU A;  4RTV A;  3P8H A;  1K8A R;  1ARK A;  2AHJ B;  1RI9 A;  3OMG A;  3QWY A;  1NLP C;  1YIJ T;  4PJJ A;  1S72 Q;  3OS0 A;  4Y92 A;  2ECZ A;  3M0R A;  2CZ7 B;  4IUP A;  3V7C A;  3PMI A;  3M0Q A;  3LYI A;  1VQP A;  3X26 B;  2L3S A;  3JAM E;  2QA4 A;  2J6O A;  3KBG A;  5KYY B;  1IB8 A;  3G4S A;  4X9D A;  2DD5 A;  1PSF A;  1K76 A;  3PTA A;  3L42 A;  3WVD B;  2E4H A;  5GMK i;  2K5I A;  3EGD A;  4GLK A;  2Y90 A;  8ATC B;  1Q81 U;  1UGQ B;  1NJI R;  1VQ4 A;  1PC0 A;  2A7Y A;  1K8A U;  1Q81 C;  1LJO A;  3E1S A;  2HQH A;  2EQU A;  4KGV B;  4OP0 A;  1TUD A;  4IIM A;  5GAN h;  4JRQ A;  2O4X B;  2EQI A;  4BI8 B;  2LT4 A;  3UPU A;  2C0O A;  1K0S A;  1NYG A;  1I07 A;  3CCS T;  4J9E A;  5CAI A;  3EFO B;  3A1P A;  3CCS Q;  2W0Z A;  4OMN A;  1PRM C;  1R0B G;  1TOV A;  3M55 A;  4XTY A;  2CSQ A;  4M75 F;  1MV0 B;  1U1S A;  1VYT A;  3QZ5 B;  4JZ4 A;  1YIJ Q;  3JCM X;  4OF1 A;  3ZFJ A;  2CUD A;  2VXE A;  2QQA A;  4LDX A;  3CME Q;  3CPF A;  4M7D D;  1PD1 A;  3ZL7 C;  2O88 A;  4M75 C;  4E7I A;  5GAM j;  2X35 A;  3CBO A;  1WNL A;  1PG5 B;  4C0Z A;  3LH0 A;  4F17 A;  2NUP B;  3M9Q A;  3RER A;  2X51 A;  3NHN A;  2E41 A;  3UF4 A;  2OAW A;  3RKY A;  3PIO A;  4IUQ A;  4XU2 A;  1M90 U;  3E9F A;  2AT1 B;  1TUG B;  2KR3 A;  1RAB B;  4FYW B;  5J3B A;  4M78 C;  1M3A A;  2O9S A;  2EYW A;  4M78 F;  4FL6 A;  1M3C A;  2J05 A;  3JCM e;  1QCO A;  4EDU A;  4KUI A;  2O01 E;  1ZHI A;  3RKX A;  2JS2 A;  3VS2 A;  3CCJ Q;  3QWX X;  2ROT A;  1M27 C;  2LDM A;  2KRM A;  1AWX A;  1YIJ A;  4RCB A;  5KYX B;  4C5E A;  1ZSZ C;  3CD6 Q;  1QVG A;  2EGE A;  3V8K A;  2J06 A;  2LJ1 A;  5CR2 A;  1VQ5 A;  2HCK A;  1Q7Y U;  1OU9 A;  1K9M R;  2QAS A;  2WSF E;  2VGN A;  4FYX B;  4AG1 C;  2NUT B;  2LP5 A;  4JPB W;  4XQ3 A;  5GAM g;  3QYG B;  1FXX A;  5GAO n;  1JXO A;  2FYK A;  1I0C A;  4M75 B;  2G6F X;  4BI4 A;  1VQ7 A;  3A8L B;  5CQX A;  1QKW A;  5LJ3 h;  5LJ5 h;  3OS5 A;  2E12 A;  2K6D A;  1WX6 A;  4ZTJ A;  2A28 A;  2BZ8 A;  5HY6 A;  5FRN A;  1GRI A;  4OMM A;  3OYH A;  2CRE A;  2MCN A;  2KQW A;  3JCM f;  2ZZD A;  4QVZ A;  2RQT A;  4J9B A;  1OOT A;  5FU7 B;  1T0J A;  1KHI A;  2YUQ A;  3VUB A;  3THK A;  3CCR Q;  5KYU B;  4M78 A;  3G4S T;  5HK3 A;  2DBM A;  5EG2 A;  3G4S Q;  2AK5 A;  2YSQ A;  2DLP A;  1R77 A;  1ZBJ A;  1VQP Q;  4M77 F;  3RIR A;  5GMK m;  4C92 C;  4PJO G;  1QMC A;  2EWN A;  3V7S A;  1YHQ Q;  4PJO A;  1SF9 A;  1H64 1;  3OYC A;  1BI3 A;  4IIO A;  2VGM A;  4EMH A;  5FU6 B;  2R5A A;  2DL4 A;  2PVO B;  3NGP A;  1SHG A;  2CP2 A;  2C0I A;  4HT9 A;  5GAM e;  3CCE A;  2HMA A;  4R0K A;  2F2X A;  3QII A;  4Y28 E;  2VYT A;  2A36 A;  2ZPG B;  2RMO A;  1JXM A;  2RB6 A;  3CC7 T;  3CCJ A;  1NE8 A;  2LT1 A;  1G3Y A;  2RHI A;  3PE0 A;  1JO8 A;  2XK0 A;  1VQ6 T;  2RK1 A;  3CCU T;  2EFI A;  2JM9 A;  5GAN 2;  1NM7 A;  4J6X A;  2LTO A;  5CO7 A;  2KK4 A;  3QDR B;  4F7U F;  4FSS A;  1OX8 A;  1KK7 A;  4FM4 B;  1VOM A;  1M90 R;  4LDW A;  4JRI A;  6AT1 B;  2VB6 A;  2NUT A;  2ATC B;  2ED1 A;  2CP3 A;  3FB9 A;  2VVK A;  3M59 A;  3I5R A;  2XU8 A;  2LQW A;  3SFM A;  1BI2 A;  4V2S A;  3CME A;  2DIG A;  5I11 A;  2G3R A;  2V8K A;  2DTO A;  1E7O A;  4M77 B;  2M0O A;  1RAG B;  1W4S A;  1OPK A;  1AD5 A;  1VQN Q;  4E6R A;  3TQ7 P;  2E10 A;  2FL7 A;  2KRN A;  2QAZ A;  2DJQ A;  4FW2 A;  2YUO A;  3CCS A;  5I21 A;  1ZSG A;  4KUL A;  3FJ5 A;  1C1A A;  4A4G A;  1W6X A;  2DRK A;  2L2P A;  1OU8 A;  4AFU C;  1KD1 C;  2AKK A;  4JZ3 A;  4LXC A;  4ORZ A;  4O6J A;  1MMD A;  1Q7Y C;  1N9R A;  3X24 B;  2KYM A;  2QQS A;  3JB9 G;  1GCQ A;  4LN2 A;  3EH2 A;  1VQ5 T;  2LCC A;  1X27 A;  4A4H A;  1B3Q A;  5GAN 6;  2RQV A;  4ZGJ B;  3OYA A;  1VQ4 Q;  3HHT B;  4C0G A;  2HL3 A;  3G6E Q;  4D8D A;  3V8J A;  1TXQ A;  2GFU A;  4J7I A;  1QW1 A;  4P5N A;  1M1K R;  2QDL A;  5AYF A;  2BZY A;  5IH2 A;  3RNJ A;  4MMK A;  4OGC A;  2DJZ A;  1D1A A;  2QA4 Q;  1AZG B;  5GAN 7;  3FDR A;  1Q86 U;  2GCX A;  2FRW A;  2F2V A;  4E7S A;  3CC2 Q;  4M75 G;  3WVE B;  3EG9 B;  3CC7 Q;  2AKL A;  1JB0 E;  1BIA A;  2XIC A;  1BIB A;  1IHV A;  3BDL A;  3OY9 A;  3CCM A;  1EIF A;  4J9F A;  1YJ9 T;  1YIT Q;  2PVG B;  3TSZ A;  2XHC A;  3OBW A;  1PNJ A;  1K0X A;  2GBQ A;  5DM7 R;  3BDU A;  2OJ2 A;  1KQ2 A;  4C5H A;  2EKH A;  2JM8 A;  1UE9 A;  4KGX B;  1VQN A;  4M7A B;  1M5Q 1;  5GAN f;  3ULR B;  2BUD A;  5KYY A;  2EJF A;  4X34 A;  3QDF A;  2VWF A;  1UUE A;  2A3L A;  2K3Y A;  2CDT A;  1MMG A;  1WZO A;  1G3T A;  4HXJ A;  1WXB A;  5FRO A;  5LJ3 f;  5LJ5 f;  4N4I A;  5GAO p;  1UDL A;  2CSI A;  1VQK T;  5CIU A;  1N9S A;  1Y07 A;  3PMT A;  2FVU A;  2E3I A;  2RK2 A;  1KQS P;  1Y96 A;  3ER0 A;  1IGU A;  3FLG A;  4F7U A;  4ZN1 A;  1H3Z A;  1YI2 A;  3D7S B;  1AOJ A;  3JCM c;  5A0D A;  4JJN K;  2SEM A;  5KE2 A;  2FZC B;  1Q81 R;  2QGG A;  4IUU A;  4M78 D;  5GAO l;  5FU7 C;  1IRX A;  2DIL A;  2QK0 A;  1WHJ A;  2GFA A;  4EMK A;  4JS5 A;  2KVQ G;  3FRN A;  1G2B A;  3A8M B;  4FIB A;  2DMO A;  4J6W A;  2RJE A;  5GAN g;  2W10 A;  4WCI A;  4E7J A;  4B9X A;  4C92 G;  2GTO A;  1WGS A;  5HCK A;  1TTH B;  3M54 A;  3JCM W;  5AT1 B;  1NZ9 A;  4HVW A;  5C6S A;  2C0T A;  2ZPH B;  4KT0 E;  5CVI A;  1SPK A;  5FLX E;  3R6O A;  1SEM A;  1NLO C;  4M77 C;  5LJ5 g;  2LMJ A;  5LJ3 g;  5GMK l;  4KBM B;  4M7D B;  2P0P A;  5KCH A;  3CC7 A;  1YWO A;  2FEI A;  4C92 E;  3NPF A;  3OS1 A;  1KIK A;  1QQJ A;  4CC4 B;  3OB9 A;  4BY6 C;  4LDU A;  2DZC A;  3HRU A;  4R56 A;  3CBM A;  4M7A F;  3JCM h;  1OQK A;  3R6N A;  1RAC B;  1TS9 A;  2K57 A;  1M90 C;  1W2B A;  3M0S A;  1BCO A;  3VS7 A;  3SWN C;  1UEC A;  3C4S A;  1ZUY A;  2CZ0 B;  4Z8A A;  2XID A;  3J81 E;  1YI2 T;  1MMA A;  3CXC P;  4DA4 A;  4ZGE B;  3RDV A;  1NEG A;  3G6E A;  3GIB A;  3VS4 A;  4GLM A;  4EPC A;  2ZPE B;  3MPU B;  1R8O B;  2RJD A;  4RG2 A;  3SWN A;  4L59 A;  3OYI A;  3EG3 A;  1VQ7 Q;  3CMA Q;  2DIQ A;  2YRD A;  1M8M A;  1ZX6 A;  2KRS A;  1ZUU A;  3HFN A;  3DLM A;  5I2S A;  4CC3 A;  1G3S A;  4RUG A;  1VYU A;  5M9O A;  2J6F A;  1X01 A;  2B86 A;  3A8O B;  2B8A A;  2YHT A;  2D9T A; 
#chains in the Genus database with same CATH homology
 2OTJ Q;  3CCL Q;  1VQ8 Q;  3CCJ Q;  3G6E Q;  3CPW P;  1VQO Q;  3I55 Q;  3CCU Q;  1YIJ Q;  1Q81 R;  2OTL Q;  1VQM Q;  3I56 Q;  2QEX Q;  1VQ5 Q;  1QVG P;  1VQP Q;  1Q86 R;  3CC2 Q;  1S72 Q;  1YHQ Q;  3CD6 Q;  1K73 R;  1YJN Q;  3G71 Q;  1Q7Y R;  3CC7 Q;  3CME Q;  1VQ7 Q;  1QVF P;  1NJI R;  1VQL Q;  1M1K R;  1YJ9 Q;  1VQN Q;  3CMA Q;  1KQS P;  1VQK Q;  3CCR Q;  1Q82 R;  1N8R R;  1M90 R;  3CC4 Q;  1VQ6 Q;  3CCQ Q;  3CXC P;  1VQ9 Q;  3OW2 P;  3CCS Q;  3G4S Q;  3CCM Q;  1YI2 Q;  1KC8 R;  1K9M R;  2QA4 Q;  1YIT Q;  1KD1 R;  1YJW Q;  3CCV Q;  1W2B P;  1VQ4 Q;  3CCE Q;  1K8A R;  1JJ2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...