1M1KR

Co-crystal structure of azithromycin bound to the 50s ribosomal subunit of haloarcula marismortui
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
95
structure length
95
Chain Sequence
PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGKEKTIIVTAAHLRRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 23S RRNA
publication title The structures of four macrolide antibiotics bound to the large ribosomal subunit.
pubmed doi rcsb
molecule tags Ribosome
total genus 18
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2002-06-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.70 Mainly Beta Roll SH3 type barrels. Ribosomal protein L21 1m1kR00
3G6EQ 1YIJQ 3CCVQ 3G4SQ 1VQKQ 3CMEQ 3CCSQ 1QVFP 2OTJQ 1VQLQ 1VQ7Q 3I55Q 2QA4Q 3CC4Q 3CC2Q 1VQ6Q 1K9MR 3CCUQ 1KC8R 3CMAQ 3OW2P 3CCRQ 1VQMQ 1YITQ 1YJWQ 3CCQQ 1KD1R 1VQ4Q 3G71Q 1NJIR 1Q7YR 1YJNQ 3CCEQ 3CC7Q 1JJ2P 1YJ9Q 1VQOQ 3CCLQ 1S72Q 1VQPQ 1YI2Q 1M90R 1Q82R 1W2BP 1QVGP 1VQ5Q 1VQ9Q 2QEXQ 1Q86R 3CPWP 3CXCP 1N8RR 1YHQQ 3CCJQ 1Q81R 1VQ8Q 1K73R 3CCMQ 3CD6Q 1KQSP 1M1KR 2OTLQ 1K8AR 3I56Q 1VQNQ
chains in the Genus database with same CATH superfamily
5CQXA 4AFUC 4EMHA 3JRZA 5I22A 2RM4A 2FHDA 4P5NA 4XAXB 1M1FA 1PCXA 1QLYA 2RHZA 3EFRA 3OQ5A 5A0GA 1YJNA 2L3SA 3QHSA 3RUXA 2VV5A 3BDUA 2V8IA 2VB6A 4M78E 2RHYA 3MEVA 1IO6A 2DTHA 4HCCA 2X3WD 2YHTA 2LT1A 4FIBA 4M77E 4MDXA 1UUEA 1IHWA 2M0OA 1ZBJA 5GAOm 2EVRA 1YFNA 2LRQA 4C8QG 1K0SA 2M9UA 4X1VA 2YWWA 3V8LA 2COZA 1W2BP 3NTHA 3MP1A 2FYKA 5LJ3j 2JMAA 2JVVA 4ATOA 3WVEB 2XK0A 2M16A 1UDLA 4XU2A 2Y4XA 2YUQA 3JCMf 4IUVA 2JMCA 1FWZA 4QVDA 2IVWA 1B07A 4M75A 3THKA 2R58A 4NOYA 4RTWA 1H3HA 3META 3VS5A 3TREA 2E3HA 3G1JA 1VQ5T 1W4SA 5I21A 2JT4A 5LJ5e 2DEUA 2CYZB 5LL6S 4F7UF 1M1KU 3CMAQ 4NS5A 3OBYA 1BKBA 4ZTFA 4FYVB 3SD4A 3QXEB 3M56A 3OMGA 1CKBA 3M0PA 3CCLQ 1GFDA 1CKAA 2ABLA 1VQ5A 2DL4A 2EYYA 4HKEA 3ULRB 1ZUKA 4FT4A 4CC4B 1QKXA 4M7AC 1WNLA 2EGEA 2RQRA 3CMEQ 3TCJA 1Y71A 2GCXA 4XU0A 3CPWS 2MCNA 2PTKA 2HL3A 2E5KA 1OQKA 3FJPA 1AZEA 3EAEA 2QG9B 4QQ6A 4QW2A 5KYXB 3LGFA 5DLOA 3LH5A 1PC0A 4FM4B 1VQ9Q 1U1TA 2EKHA 2GQIA 1M2VA 2GF7A 3CCJQ 3CD6Q 1JO8A 1NEGA 3GLXA 5I2MA 2OTJQ 1KIKA 1QQJA 2BZ8A 2YT6A 3QYGB 4RCCA 1K4US 1BU1A 5I11A 2JW4A 3BY7A 3M58A 1G3TA 2DVEA 3VS4A 4XK8E 2DPPB 4ZNXA 1GFCA 2FEIA 2PUOB 4HCBA 5LJ5d 1YHQQ 2EYWA 1WZOA 1YP5A 2OTLA 4RUGA 7AT1B 2H3JA 3PT9A 1MHNA 4C5HA 3EG0A 1VUBA 1VQKT 3CCST 1TUDA 4EMKA 3P8HA 4C8QE 2C0IA 2NUTB 5KYWB 5GAOl 2LVMA 1ZLMA 1N8RR 2VKNA 1M4ZA 2ENMA 4PJJA 1HD3A 4M7AF 1SPKA 5DY9A 3E1SA 3H0FA 3QKJA 3M4YA 3TU4K 1VQ8T 1VQKA 3CCSA 4ELYC 3CCRQ 1M30A 1OZ3A 4JS5A 2Y90A 4N4IA 2VASA 2HBWA 2CZ6B 2BZXA 4BE1A 3JSCA 2PVDB 3CC7T 2J06A 4GBQA 4LDUA 3T9NA 4BI8B 1VQ8A 3EGXA 4J5YA 3O8VA 2ZPHB 1G3YA 2DL5A 4B9WA 1E6GA 1W2BS 4OMPA 3S3NA 4QQGA 3LX7A 4N4HA 1YITT 4BE0A 1RLQC 2MAMA 1G3WA 1KHIA 2EIFA 2QQ9A 2JTEA 4Q5WA 2GFUA 5IXFA 3ZL7C 1YIJT 1YITA 5FWCA 4LDXA 5CKDA 4PJOE 3VRZA 2RJDA 2FZKB 2MWPA 3P8DA 3VUZA 1U3OA 2BTTA 4IKFA 5CCAA 2BKDN 1P92A 1WQ7A 2EGCA 4J6XA 4PKCC 2K3BA 1YIJA 4FSXA 1WJRA 1VQNT 1ZQ1A 4ANJA 2QGGA 2PUKB 2DEQA 2O31A 2DD5A 2V1RA 4WF2A 1N6AA 3X26B 2V26A 3C12A 3QZ9B 4OB1B 2YUOA 2HEQA 4JZ3A 1YI2T 3M9QA 1PG5B 4OMQA 2ESWA 3SHWA 1WHJA 2DXTA 1VQNA 4KGVB 3J80E 2YRCA 1ZX6A 3OA6A 2E3IA 2FZCB 4M7DE 3PNWC 1VQPQ 2VVKA 2HAXA 3H41A 1YI2A 4PK4A 3A8OB 4DEYA 2HZYA 4BACA 1SSFA 4PFPA 3RKXA 2I2LA 2OTLQ 2KNBB 4JPBW 4RTVA 4E7IA 2KE9A 2CDTA 1HSQA 5KYUA 3O5ZA 3ZEHA 3CCEQ 1QVGA 2HD0A 1OX9A 2QA4T 1MMDA 2CZ1B 1AWOA 1WYXA 3JB9D 2X3XD 1M1GA 1UFFA 2V8KA 4M4ZA 2KBTA 3HL8A 2MIOA 2EFIA 1ZSGA 1OU9A 3EG9A 3OS5A 3BFMA 1U8RA 1VQ6Q 1SG5A 2QA4A 1YBYA 5GAOq 4FCYA 2KSSA 2MYSA 2D1XA 4BE2A 3HKSA 2RO0A 2CP3A 2EWNA 2ZZDA 2KK4A 4M7AA 5GMKi 2RH2A 2GNCA 3OSSC 5GAN4 2P4TA 2LTOA 3A8GB 2A37A 1VQ7Q 2XDPA 3CEYA 1JRIA 4C92G 4C5EA 4DBFA 2DRKA 3V8JA 1WQWA 2D8HA 2WSEE 1D0ZA 1KQSS 1OULA 3JAME 2CSQA 2LQKA 3L2WA 2L5QA 3VV0A 1RAFB 2E10A 3QO3A 2JM9A 4C92C 1UHFA 3UA7A 2XIDA 1SHFA 5KYNA 2EPDA 3REBB 5I2SA 1PD1A 3SEMA 2XICA 2DBKA 5GANg 4JDSA 5HCKA 3SWNC 4BDYA 1PRMC 1Z9QA 2EAYA 4F14A 4FT2A 2RN8A 2BE7D 3OYLA 1BIBA 3JCMb 3QZ5B 2RA2A 2LJ1A 3FIFA 1PSFA 2A3LA 4XTZA 3AHUA 5GAMg 1KSWA 2AZSA 1Q86U 3EFSA 2K2VA 2RI3A 4F04B 2ROLA 1E6HA 1X6GA 2K6DA 1VYUA 5FU7B 1FXXA 2KAFA 3QWXX 1JJ2P 1I8FA 1G8XA 1BCOA 3HTRA 3DKMA 1QVFS 2RJFA 2K5LA 4XTUA 2DF6A 3C0CA 5KH6A 5CR2A 4MDWA 3KXTA 4ZGDB 3MKDA 1R77A 1VIFA 4ZN3A 3EH1A 1M2OA 1Q81C 1K76A 5L8RE 2V1QA 2KYBA 3SFMA 4BY6C 4LNPA 3MP8A 4M78C 2QQAA 3LGLA 1H92A 1AWXA 2LDMA 2OJ2A 4M77C 3RNJA 1RLPC 1YNZA 1EX4A 1YI2Q 1S72A 1VA7A 3CMAT 4C92F 4C0ZA 1TS9A 2RK1A 3PMIA 3CCLT 1LJOA 2AZVA 3C4SA 1Q95G 4JJBA 3OYMA 4MZPA 2C0TA 4OMLA 1LCKA 3JCMJ 3CMAA 3CMET 3BW1A 2XD0A 1K9MC 3OB9A 3CCLA 3E9GA 2FVUA 2QDLA 4AFZC 3R6OA 1VQ9T 4DOWA 2NUPB 1G2BA 2NUZA 3CCJT 5GAMd 3CD6T 3CMEA 5KE3A 3P8BB 1PHTA 1VQMA 2D9TA 2LCLA 5KCHA 3CC2T 4PLIA 2Z0WA 1MMAA 1X6BA 2F2VA 1PSEA 1M5Q1 2RJCA 1VQ9A 3I5SA 3PFSA 4JJDA 1D1CA 3EG2A 3CCJA 3CD6A 1YHQT 4M78F 2NWMA 4ZTJA 2CZ0B 1QKWA 2QDYB 3CCUQ 3BDLA 4LDYA 3CC2A 3PTAA 2QXFA 4M77F 1SSHA 1AEYA 1UHCA 3JB9I 1OEBA 2KROA 2EGAA 3QYHB 1NPRA 4OB2B 4J6WA 5CVIA 1YHQA 2QYZA 2K3XA 3DLLA 5GAOp 1Q81U 4WCIA 1XTDA 2RQVA 2CP2A 2W10A 2RHUA 3TSWA 3RR6A 3VS3A 3CCRT 1JU5C 3I9QA 4LD9K 4OGEA 3I56Q 3MEUA 2QI2A 2QGFB 5GAN3 1W6XA 5IH2A 2F69A 3VYHB 2DKGA 3TEEA 3EG3A 1QVPA 3VS0A 2KI7A 3CCRA 4JUVA 1C6VX 5IAYA 4CI0C 1K9MU 3CCQT 2L3PA 4HT8A 2VGMA 2DETA 5FW9A 1Y96A 1X43A 4QQDA 4C8QC 1OOTA 3S3OA 1JJ2S 2PU9B 4PJOB 3M0QA 3PVLA 2KMTA 4E7SA 1B34B 3L2QA 2COWA 2COYA 1QWFA 1XQHA 4O6JA 3UF4A 1TG0A 1BK2A 1TSFA 3CCQA 1HJDA 1RADB 1S72Q 5LJ5g 1Q82R 3OYCA 2C0OA 1TWBA 5LJ3e 3HHTB 4DBRA 2BE9B 1NPPA 2JTFA 4E6RA 1KQ2A 3CBMA 2DIGA 3TVTA 4E2FB 5HK3A 2KRSA 4PJNA 2X4JA 2LT4A 2L2PA 4E47A 2LC4A 1YJ9Q 1V76A 5KYYB 4FL6A 4PFOA 2H3EB 4C92A 4BD3A 1ZUYA 1D09B 2JXBA 3OYAA 1NLPC 2X51A 1BB9A 1TUCA 2RJEA 4BUGA 4M7DB 2EQKA 1PKTA 1FMWA 1T0HA 1BI1A 4A54A 1VQMQ 3SWNA 4PJOG 2O4XB 2HNIA 3EFOA 2O2OA 5C6SA 1KC8C 3JCMV 3M55A 4HCKA 3J7AF 3VS1A 3M54A 2ROTA 4C8QF 2ZPFB 1VIEA 2BUDA 1WJSA 1Y7XA 1VQPT 2CZ7B 2OAWA 4E7ZA 4AG1C 1RUWA 3S6WA 1PNJA 4ELZC 4D6WA 1RL2A 2OTLT 4LDVA 3CC2Q 3OYGA 1I5OB 4HXJA 2HQHA 3UATA 4IURA 2DXUA 2E1HA 1V1CA 1YCSB 2HQEA 4J8OA 5LJ3d 2KT1A 1VQPA 4XU1A 3CCET 1I81A 3JCMQ 4JZ4A 1Q82C 2YUNA 5CKFA 4A4KA 2O01E 1GBRA 4M75D 2MOXA 4M78A 1RAHB 4RTTA 2YUPA 4M77A 1SF9A 2AK5A 4LXCA 2L3RA 4M7DG 1BCMA 1WXTA 2F2WA 3CCEA 2JS0A 1VQ6T 1GRIA 4JRIA 4PJLA 3UDCA 3VYGA 1M8MA 2EQUA 3UPUA 2CSIA 3QIIA 4R0KA 1TUGB 2FPEA 1VQ6A 4IUQA 2FPFA 3ZBDA 1VQ7T 4JJCA 2F2XA 3NFCA 2DD4A 4J83A 4IIOA 4QVZA 1KFZA 1H641 3ME9A 4PJOF 2HBPA 3V7SA 4C0FA 1KQSP 3LWIA 2A08A 4FU6A 3OY9A 4RMOA 4A53A 3CCMT 4FYXB 4PLLA 1C1AA 5HKCA 5FWBA 3CC4Q 1VQ7A 3S3MA 1IRXA 1X6OA 3EGDB 4E7JA 3CCQQ 2DX1A 3D7SB 4GY5A 3C95A 2SRCA 4XTVA 2EQJA 1KC8U 1NJIC 1KQ1A 1Q86R 3GPLA 4RTUA 1I0CA 1D3BA 1ZSZB 3CCMA 1OPLA 3MPUB 4BI4A 1HXDA 3GOXA 2YXYA 3JCMe 4LUEA 4X9DA 2ECZA 2VC8A 2GFAA 4XQ3A 2JUFA 3HRTA 2LZ6B 1KK7A 2D0QB 2XDDA 1JB0E 1YN8A 3M59A 3HFOA 4J9HA 1AZGB 1K1ZA 1KHCA 1PWTA 1O9SA 5GANf 4M7DF 4J9BA 4Z89A 1Q82U 1H3ZA 1QW1A 1K73C 3REAB 1QVFP 3G4SA 1K8AC 3ER0A 1QMCA 4A4GA 1MV0B 3OYHA 3PIPA 2HKNA 1X2QA 4F7UA 1NEBA 1SRLA 2O9VA 2EJGA 1NZ9A 5GAMf 2X4XA 4ZN1A 2LCSA 3CXCA 1UGRB 1VQOQ 1Y57A 1QVGP 1UG1A 5CK9A 3FEOA 2DM1A 1M27C 1BI0A 1PD0A 2C06A 3CCVQ 4K11A 2DTOA 1IREB 2M0YA 5D6XA 4E7LA 4GLKA 2CH4W 2RHXA 3MO8A 4Z8AA 4M75B 2J6KA 2BZYA 5GJVB 1ZSZC 2EW3A 1GXIE 5L23A 3OS2A 3QBYA 4C8QA 3JCMd 2D0NA 1WI7A 2ATCB 2P4RA 4D8DA 5GMKl 1Q86C 2E6ZA 3VS7A 1MMGA 1SRMA 3PVQA 1N27A 1BI2A 2XDBA 1UTIA 5FU6B 3U23A 1WHKA 1IZ6A 2NLUA 4LN2A 4Y92A 1FX7A 9ATCB 2LNHB 2LQNA 2JS2A 2G3RA 1H8KA 1NJIU 1X27A 1UJ0A 1D1BA 1DJ7B 3KBGA 3OYIA 2P0KA 2FL7A 4A4HA 4N0AC 3VJPA 1IB8A 3QG1A 1V29B 1LOJA 5D7UA 4IUPA 5J3BA 2DZCA 1UJYA 3QPHA 3CCUT 1OX8A 1Q81R 1AT1B 4EIKA 4KH1B 1M2VB 3QJ6A 4M75G 2KDSA 1WLPB 1IXDA 1WHHA 2QTVA 2XU8A 3OYKA 1K73U 1K8AU 1NYGA 4FYWB 4MMKA 1Y07A 3UA6A 3CCUA 3G71Q 1GCPA 3A8MB 3A98A 2L8DA 2X35A 2VWFA 3CCMQ 3OYDA 3QDFA 2DAQA 1OV3A 2RQWA 3LLRA 5IT9E 3OW2A 2KYMA 4NL3A 3CXCS 3I56T 1K9MR 1ZHIA 2YRVA 4HVVA 1VQ4Q 3KUFA 1WIEA 3A8LB 3NTIA 3UWNA 1UGSB 5EC7A 4BI3A 3HSBA 4EMKB 4AMCA 5EG2A 4RG2A 1TH7A 5GANj 2K4YA 2D8JA 2F5TX 4II1A 2KXDA 3NHNA 1K0XA 2R5AA 4IIMA 4BDZA 2RHIA 3I56A 3G4SQ 3M0UA 1JXMA 1W70A 2YRDA 5GMKj 2O88A 4QT7A 4KGXB 3A1PA 5GAMj 3IQLA 4XTWA 2CUBA 1MNEA 1LPLA 2JTMA 1ZBXA 2EJFA 2ZPEB 4KUIA 3GIBA 4C0DB 1I1JA 1NLOC 1UEBA 1S72T 1M3AA 4ME7A 4JRKA 3SDZA 4VUBA 4RTYA 1Y0MA 3EGXB 4XTXA 1QVGS 1UGPB 5KYXA 4DQ2A 3X28B 2W0ZA 5GAN8 4J9FA 2ZGWA 3QSUA 3FJ5A 1J3TA 1QCFA 2E12A 2RQUA 2LX7A 2VGNA 1QCNA 1SKUB 4M7AD 1NYFA 3TSZA 1BIAA 2LMJA 2AHJB 1YJ9T 3GNFB 1N5ZA 3OYYA 4FYYB 5FROA 4B9XA 2FZGB 2O9SA 5LJ5f 1D0XA 1U5SA 1GBQA 5M9OA 1JBMA 1B7TA 3PE0A 3X20B 1ABOA 2AT1B 4KBMB 1N9SA 1TTHB 3EHRA 4HCZA 2DMOA 2L0AA 4LE9A 1YJ9A 2PVGB 3LWHA 1Z9ZA 2DRMA 3FDRA 5D6YA 1VQMT 4RKUE 5DLQE 3SB2A 1PM3A 5J26A 5CIUA 1FMVA 3L2ZA 3FB9A 4M75E 4C5GA 2J6FA 2RK2A 2CREA 2G6FX 2JOYA 5FU7C 4PNOA 1N9RA 2A28A 3E2UA 3OBWA 3JV3A 1YJWQ 4DBQA 2KY9A 2NUTA 4A63B 5KYWA 2JZ2A 2XMFA 2VUBA 1HYOA 1ABQA 3ASKA 4OB3B 1T0JA 2X9HA 2E41A 2QEXQ 4WTOB 1ZA2B 3GP8A 4A4FA 3OW2S 3PMTA 3DB3A 4J9EA 3HRSA 3I55Q 1NM7A 3V7RA 1OU8A 3CBPA 1I5LA 2K7AA 5IXBA 1Q7YR 3JB9G 4KULA 1UE9A 2E65A 2MPXC 2PNIA 3X25B 4KH0B 3R6NA 3NPFA 4L59A 2CT3A 4Z88A 1UGVA 2J7IA 2LJ3A 3OYJA 3QUIA 4LUDA 1VYTA 1TXQA 5KYUB 3A5ZB 1G83A 1XJWB 3CPWA 3VKIA 3FRNA 2YLCA 1BBZA 5CO7A 5A2QE 1G5VA 1MNDA 2P84A 1QWEA 2F1LA 4EDUA 5GJWB 5A0DA 4RCBA 4KRTA 1R0CB 4QVCA 1KC8R 1WA7A 3EG9B 2ZPIB 2MWOA 2EQIA 5GAN6 1RAEB 1D1AA 2M51A 1F1BB 3OS0A 3CC4T 4AG2C 5A0LA 5CKBA 2CP0A 2RB6A 1UGQB 2NYSA 3LH0A 2K2MA 4OGCA 3RIRA 2H8HA 4N0AA 2PVOB 2P0QA 3JB9H 4M7AB 3VU3C 1GCQC 1QP3A 3M4GA 2MK5A 3M57A 3CC4A 1AWWA 5LJ3g 3QWYA 4PJMA 4TVRA 1Q7YC 4N4GA 1RAGB 4Z02A 3M0TA 2ZCFB 3PIOA 2PQWA 3JB9F 4HA8A 2QAZA 4CC2A 5LJ5j 2RF0A 2QTXA 2DIQA 3EG1A 3M53A 3N5BB 4RG8A 5GANh 4E7HA 4OP0A 4JLGA 4X9CA 3MCAB 4EMGA 1SHGA 4OVAA 2F5KA 2L3QA 3L2VA 2X4YA 3E19A 5KE2A 1WXUA 2E5QA 3JCMX 1OI1A 4OMFB 5GMKh 4RTZA 3CPFA 4ORZA 1RABB 3VUBA 3MP6A 1VQOT 2K5IA 1YCYA 4O5VA 5GAMh 4PFZA 1KJWA 2ZPBB 4OMOA 2FRYA 3BE3A 1MUZA 4J6YA 1AD5A 2EBPA 3G6ET 2L89A 3CCVT 2VYTA 1W2BA 4M7AG 5HY6A 1ZA1B 1M8VA 5IHNA 1M90R 1VQOA 3ZFJA 2DZ9A 4IUTA 1T3LA 4OB0B 1WJQA 1XOVA 5CAIA 1JXOA 2LX9A 5CKEA 4PJOC 3H0HA 1SEMA 3INZA 3HPWA 3G6EA 2DVJA 1LNXA 3EGUA 3CCVA 4FW2A 3E9FA 3RDVA 1NJIR 2LQ8A 4YTLA 2QQBA 8AT1B 3EH2A 1WGSA 4AT1B 1M3BA 2D6FA 4V2SA 1UECA 2QQRA 1WHLA 2CGHA 2EJ9A 2KXCA 4F7UE 5AYFA 2OX7A 4FW1A 2DYIA 1AWJA 2K5FA 1RAAB 1NG2A 2HSEB 6AT1B 2DBMA 4DEXA 2EKOA 5GMKm 1Q7YU 2DILA 1K73R 3NTKA 1K8AR 3UT1A 1RACB 4NL2A 2AIRB 4M7DC 4J9DA 3I5RA 2QK0A 2HDAA 5GAN5 2EYZA 4AFSC 3H6ZA 1BI3A 3CQTA 1X01A 1K9AA 1YJNQ 1EZZB 3JB9J 4C92D 2DL3A 5CQYA 4HVWA 2EQMA 3G71T 8ATCB 1M90C 2CP5A 5KCOA 2AKKA 4RTXA 4OMMA 3HFNA 2DL8A 1U06A 1KD1R 4XTYA 4CRIA 5GAOr 2XKOC 2LP5A 3G71A 2WSFE 1MV3A 1VQ4T 4JRQA 2PZ1A 2IG0A 2JNGA 3CXCP 3JCMg 2B8AA 2JJ9A 2YSQA 2KRMA 4L6V5 2RI2A 2K3YA 5FRNA 1C0MA 2CUDA 2VXFA 4FSSA 5C0MA 1QCOA 3L42A 4Y91A 1U1SA 1IGQA 4C5IA 2RMOA 2DE0X 2SEMA 3G4ST 1VQ4A 3H0IA 2J6OA 1MGQA 3CC7A 1FYNA 1PRLC 4JS4A 4M7AE 3RERA 3OYNA 3V8KA 1FMKA 2LQWA 3C94A 2BIVA 4M78D 1WPYA 1IHVA 1WX6A 4HT9A 3M0RA 5AT1B 2MF2A 2FPDA 2OAUA 4M77D 2GTOA 3OYFA 3L2UA 3MEAA 3JCMc 4CC7A 3L1AA 5IN1A 2JM8A 2CT4A 3VS2A 4BB7A 1KQSA 4ESRA 1VQ5Q 4J9CA 2ED0A 1JQQA 1AVZC 3RBBB 2GGRA 2NUPA 1GL5A 3PGGA 2B86A 4JLIA 1N8RC 3G6EQ 4DOVA 1Y96B 3H8ZA 3RKWA 1R8OB 4AFQC 2DLPA 1OZ2A 5LJ3h 5FLXE 1JEGA 2HSPA 3NGPA 2YDLA 3L2RA 2R57A 5LJ5h 4KT0E 4F17A 1KD1C 1HK9A 2CS7A 3HRUA 1E7OA 1WDXA 1R0BG 4JRPA 4R55A 2V8JA 1I4K1 2FRWA 3HP9A 4A4EA 5HK0A 2OI3A 4J7FA 1M90U 1GCQA 2RD1A 2R5MA 1AHJB 2A36A 1VQLT 2DL7A 2K57A 2FO0A 2HMAA 2VXEA 4QKUA 3LW5E 3DLMA 3GNGA 1YJWT 5GAN7 4B6MA 2XG8D 1G3SA 4OMNA 1QVFA 1TU0B 4C92B 2DA9A 2QEXT 1BYMA 3I35A 5GAOn 1PKSA 1D0YA 1X75C 2A0FB 2LCCA 1VQLA 4HVUA 2KR3A 3OW2P 3OYEA 2ZPGB 3FC3A 1YJWA 3I55T 2FG0A 2KVQG 3TQ7P 3SWNB 2P0PA 4XU3A 2QASA 3DB4A 3J81E 1WFWA 3EFOB 1WHGA 4F16A 2QEXA 3EHQA 2RI5A 1EIFA 2DYBA 1VQKQ 3MEWA 3CCSQ 3I55A 2DXBA 2Y4YA 5J39A 4M75C 1OYXA 2E6NA 1ACMB 1IGUA 4KUDK 1AOJA 2WACA 2CH4A 2DTIA 1NE8A 1VQ8Q 5DM7R 2JN0A 4PJOA 3MJXA 1O75A 1B34A 1UB4A 3H9NA 3X24B 2GBQA 1N8RU 4ZGJB 1YWOA 4DBHA 4J9IA 2IIMA 1W1FA 5FU6C 3RMQA 1WXBA 5CKHA 2A7YA 4BY6B 1OPKA 4M78B 2AKLA 2ZAEA 2K9GA 3CC7Q 2CP7A 3RMSA 3V7CA 1RI9A 4C8QD 4M77B 1T3SA 4CC3A 2DFUA 4L5GA 1KD1U 2LJ0A 2M1HA 4LD6A 4JJNK 2CKKA 4PL6A 2RPNA 3A8HB 1QP2A 2I0NA 2DXCA 2E70A 1MMNA 2EYQA 2K79A 1YITQ 1TOVA 2KT8A 2X4WA 4EPCA 5KYYA 4D8KA 1ARKA 2LNVA 2ED1A 1S1NA 3AT1B 5GAN2 4KGZB 4ZGEB 2QQSA 5GANe 3M5AA 2CP6A 5ECAA 3VS6A 4M7DA 1YIJQ 2GTJA 2MI6A 5GMKe 2HCKA 2O4XA 5IHIA 1VYVA 4M75F 4R56A 5GAMe 2RQTA 3CBOA 2M02A 3MHXA 3WXMB 1YWPA 3OS1A 2KEAA 3LYIA 3WVDB 3QJYA 3JCMh 4M78G 3OSVA 4E7KA 2J05A 5LJ3f 1M1KR 2KGTA 2GQVA 4M77G 2DNUA 3GBQA 1VQNQ 1D3BB 1EFNA 2KQWA 2E4HA 1X69A 2KRNA 1B3QA 1X2KA 5IHKA 2YLBA 4Y28E 1LVKA 4J9GA 2HKQB 4UC4A 4EMKC 3JCMW 2XHCA 4PJOD 1VOMA 2DJZA 3RESA 4GLMA 2EYXA 3VRYA 4DA4A 4IUUA 3OMCA 2DJQA 3G7ZA 4C0GA 1VQLQ 1M9SA 3JCMP 1ZUUA 2HQXA 2FB7A 1JJ2A 3Q1JA 4OF1A 1I07A 5GANd 1RI0A 4F7UB 4LDWA 4C0DC 3CPWP 1M3CA 2IPOB 2WSCE 3URGA 1WHMA 2QA4Q 2MMPA 4C92E 2E64A 2OTJT 3F70A 2DO3A 4MZMA 5D6WA 4M7DD 3KFVA 3GF5A 1KG1A 2HL5C 1CSKA 1RAIB 3NMZC 1A0NB 4C8QB 2DK3A 3EGDA 2OTJA 1M1KC 2XI9A 5FRMA 1NBEB 4MZTA 3OYBA 1XNIA 4X34A 3FLGA 2RNAA 4J7IA 3M0SA 4MMLA 1ZSZA 2DERA 1YJNT 3RKYA 4F7UG 3QDRB
chains in the Genus database with same CATH topology
3G6EQ 1YIJQ 3CCVQ 3G4SQ 1VQKQ 3CMEQ 3CCSQ 1QVFP 2OTJQ 1VQLQ 1VQ7Q 3I55Q 2QA4Q 3CC4Q 3CC2Q 1VQ6Q 1K9MR 3CCUQ 1KC8R 3CMAQ 3OW2P 3CCRQ 1VQMQ 1YITQ 1YJWQ 3CCQQ 1KD1R 1VQ4Q 3G71Q 1NJIR 1Q7YR 1YJNQ 3CCEQ 3CC7Q 1JJ2P 1YJ9Q 1VQOQ 3CCLQ 1S72Q 1VQPQ 1YI2Q 1M90R 1Q82R 1W2BP 1QVGP 1VQ5Q 1VQ9Q 2QEXQ 1Q86R 3CPWP 3CXCP 1N8RR 1YHQQ 3CCJQ 1Q81R 1VQ8Q 1K73R 3CCMQ 3CD6Q 1KQSP 1M1KR 2OTLQ 1K8AR 3I56Q 1VQNQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G6E Q;  1YIJ Q;  3CCV Q;  3G4S Q;  1VQK Q;  3CME Q;  3CCS Q;  1QVF P;  2OTJ Q;  1VQL Q;  1VQ7 Q;  3I55 Q;  2QA4 Q;  3CC4 Q;  3CC2 Q;  1VQ6 Q;  1K9M R;  3CCU Q;  1KC8 R;  3CMA Q;  3OW2 P;  3CCR Q;  1VQM Q;  1YIT Q;  1YJW Q;  3CCQ Q;  1KD1 R;  1VQ4 Q;  3G71 Q;  1NJI R;  1Q7Y R;  1YJN Q;  3CCE Q;  3CC7 Q;  1JJ2 P;  1YJ9 Q;  1VQO Q;  3CCL Q;  1S72 Q;  1VQP Q;  1YI2 Q;  1M90 R;  1Q82 R;  1W2B P;  1QVG P;  1VQ5 Q;  1VQ9 Q;  2QEX Q;  1Q86 R;  3CPW P;  3CXC P;  1N8R R;  1YHQ Q;  3CCJ Q;  1Q81 R;  1VQ8 Q;  1K73 R;  3CCM Q;  3CD6 Q;  1KQS P;  1M1K R;  2OTL Q;  1K8A R;  3I56 Q;  1VQN Q; 
#chains in the Genus database with same CATH topology
 5CQX A;  4AFU C;  4EMH A;  3JRZ A;  5I22 A;  2RM4 A;  2FHD A;  4P5N A;  4XAX B;  1M1F A;  1PCX A;  1QLY A;  2RHZ A;  3EFR A;  3OQ5 A;  5A0G A;  1YJN A;  2L3S A;  3QHS A;  3RUX A;  2VV5 A;  3BDU A;  2V8I A;  2VB6 A;  4M78 E;  2RHY A;  3MEV A;  1IO6 A;  2DTH A;  4HCC A;  2X3W D;  2YHT A;  2LT1 A;  4FIB A;  4M77 E;  4MDX A;  1UUE A;  1IHW A;  2M0O A;  1ZBJ A;  5GAO m;  2EVR A;  1YFN A;  2LRQ A;  4C8Q G;  1K0S A;  2M9U A;  4X1V A;  2YWW A;  3V8L A;  2COZ A;  1W2B P;  3NTH A;  3MP1 A;  2FYK A;  5LJ3 j;  2JMA A;  2JVV A;  4ATO A;  3WVE B;  2XK0 A;  2M16 A;  1UDL A;  4XU2 A;  2Y4X A;  2YUQ A;  3JCM f;  4IUV A;  2JMC A;  1FWZ A;  4QVD A;  2IVW A;  1B07 A;  4M75 A;  3THK A;  2R58 A;  4NOY A;  4RTW A;  1H3H A;  3MET A;  3VS5 A;  3TRE A;  2E3H A;  3G1J A;  1VQ5 T;  1W4S A;  5I21 A;  2JT4 A;  5LJ5 e;  2DEU A;  2CYZ B;  5LL6 S;  4F7U F;  1M1K U;  3CMA Q;  4NS5 A;  3OBY A;  1BKB A;  4ZTF A;  4FYV B;  3SD4 A;  3QXE B;  3M56 A;  3OMG A;  1CKB A;  3M0P A;  3CCL Q;  1GFD A;  1CKA A;  2ABL A;  1VQ5 A;  2DL4 A;  2EYY A;  4HKE A;  3ULR B;  1ZUK A;  4FT4 A;  4CC4 B;  1QKX A;  4M7A C;  1WNL A;  2EGE A;  2RQR A;  3CME Q;  3TCJ A;  1Y71 A;  2GCX A;  4XU0 A;  3CPW S;  2MCN A;  2PTK A;  2HL3 A;  2E5K A;  1OQK A;  3FJP A;  1AZE A;  3EAE A;  2QG9 B;  4QQ6 A;  4QW2 A;  5KYX B;  3LGF A;  5DLO A;  3LH5 A;  1PC0 A;  4FM4 B;  1VQ9 Q;  1U1T A;  2EKH A;  2GQI A;  1M2V A;  2GF7 A;  3CCJ Q;  3CD6 Q;  1JO8 A;  1NEG A;  3GLX A;  5I2M A;  2OTJ Q;  1KIK A;  1QQJ A;  2BZ8 A;  2YT6 A;  3QYG B;  4RCC A;  1K4U S;  1BU1 A;  5I11 A;  2JW4 A;  3BY7 A;  3M58 A;  1G3T A;  2DVE A;  3VS4 A;  4XK8 E;  2DPP B;  4ZNX A;  1GFC A;  2FEI A;  2PUO B;  4HCB A;  5LJ5 d;  1YHQ Q;  2EYW A;  1WZO A;  1YP5 A;  2OTL A;  4RUG A;  7AT1 B;  2H3J A;  3PT9 A;  1MHN A;  4C5H A;  3EG0 A;  1VUB A;  1VQK T;  3CCS T;  1TUD A;  4EMK A;  3P8H A;  4C8Q E;  2C0I A;  2NUT B;  5KYW B;  5GAO l;  2LVM A;  1ZLM A;  1N8R R;  2VKN A;  1M4Z A;  2ENM A;  4PJJ A;  1HD3 A;  4M7A F;  1SPK A;  5DY9 A;  3E1S A;  3H0F A;  3QKJ A;  3M4Y A;  3TU4 K;  1VQ8 T;  1VQK A;  3CCS A;  4ELY C;  3CCR Q;  1M30 A;  1OZ3 A;  4JS5 A;  2Y90 A;  4N4I A;  2VAS A;  2HBW A;  2CZ6 B;  2BZX A;  4BE1 A;  3JSC A;  2PVD B;  3CC7 T;  2J06 A;  4GBQ A;  4LDU A;  3T9N A;  4BI8 B;  1VQ8 A;  3EGX A;  4J5Y A;  3O8V A;  2ZPH B;  1G3Y A;  2DL5 A;  4B9W A;  1E6G A;  1W2B S;  4OMP A;  3S3N A;  4QQG A;  3LX7 A;  4N4H A;  1YIT T;  4BE0 A;  1RLQ C;  2MAM A;  1G3W A;  1KHI A;  2EIF A;  2QQ9 A;  2JTE A;  4Q5W A;  2GFU A;  5IXF A;  3ZL7 C;  1YIJ T;  1YIT A;  5FWC A;  4LDX A;  5CKD A;  4PJO E;  3VRZ A;  2RJD A;  2FZK B;  2MWP A;  3P8D A;  3VUZ A;  1U3O A;  2BTT A;  4IKF A;  5CCA A;  2BKD N;  1P92 A;  1WQ7 A;  2EGC A;  4J6X A;  4PKC C;  2K3B A;  1YIJ A;  4FSX A;  1WJR A;  1VQN T;  1ZQ1 A;  4ANJ A;  2QGG A;  2PUK B;  2DEQ A;  2O31 A;  2DD5 A;  2V1R A;  4WF2 A;  1N6A A;  3X26 B;  2V26 A;  3C12 A;  3QZ9 B;  4OB1 B;  2YUO A;  2HEQ A;  4JZ3 A;  1YI2 T;  3M9Q A;  1PG5 B;  4OMQ A;  2ESW A;  3SHW A;  1WHJ A;  2DXT A;  1VQN A;  4KGV B;  3J80 E;  2YRC A;  1ZX6 A;  3OA6 A;  2E3I A;  2FZC B;  4M7D E;  3PNW C;  1VQP Q;  2VVK A;  2HAX A;  3H41 A;  1YI2 A;  4PK4 A;  3A8O B;  4DEY A;  2HZY A;  4BAC A;  1SSF A;  4PFP A;  3RKX A;  2I2L A;  2OTL Q;  2KNB B;  4JPB W;  4RTV A;  4E7I A;  2KE9 A;  2CDT A;  1HSQ A;  5KYU A;  3O5Z A;  3ZEH A;  3CCE Q;  1QVG A;  2HD0 A;  1OX9 A;  2QA4 T;  1MMD A;  2CZ1 B;  1AWO A;  1WYX A;  3JB9 D;  2X3X D;  1M1G A;  1UFF A;  2V8K A;  4M4Z A;  2KBT A;  3HL8 A;  2MIO A;  2EFI A;  1ZSG A;  1OU9 A;  3EG9 A;  3OS5 A;  3BFM A;  1U8R A;  1VQ6 Q;  1SG5 A;  2QA4 A;  1YBY A;  5GAO q;  4FCY A;  2KSS A;  2MYS A;  2D1X A;  4BE2 A;  3HKS A;  2RO0 A;  2CP3 A;  2EWN A;  2ZZD A;  2KK4 A;  4M7A A;  5GMK i;  2RH2 A;  2GNC A;  3OSS C;  5GAN 4;  2P4T A;  2LTO A;  3A8G B;  2A37 A;  1VQ7 Q;  2XDP A;  3CEY A;  1JRI A;  4C92 G;  4C5E A;  4DBF A;  2DRK A;  3V8J A;  1WQW A;  2D8H A;  2WSE E;  1D0Z A;  1KQS S;  1OUL A;  3JAM E;  2CSQ A;  2LQK A;  3L2W A;  2L5Q A;  3VV0 A;  1RAF B;  2E10 A;  3QO3 A;  2JM9 A;  4C92 C;  1UHF A;  3UA7 A;  2XID A;  1SHF A;  5KYN A;  2EPD A;  3REB B;  5I2S A;  1PD1 A;  3SEM A;  2XIC A;  2DBK A;  5GAN g;  4JDS A;  5HCK A;  3SWN C;  4BDY A;  1PRM C;  1Z9Q A;  2EAY A;  4F14 A;  4FT2 A;  2RN8 A;  2BE7 D;  3OYL A;  1BIB A;  3JCM b;  3QZ5 B;  2RA2 A;  2LJ1 A;  3FIF A;  1PSF A;  2A3L A;  4XTZ A;  3AHU A;  5GAM g;  1KSW A;  2AZS A;  1Q86 U;  3EFS A;  2K2V A;  2RI3 A;  4F04 B;  2ROL A;  1E6H A;  1X6G A;  2K6D A;  1VYU A;  5FU7 B;  1FXX A;  2KAF A;  3QWX X;  1JJ2 P;  1I8F A;  1G8X A;  1BCO A;  3HTR A;  3DKM A;  1QVF S;  2RJF A;  2K5L A;  4XTU A;  2DF6 A;  3C0C A;  5KH6 A;  5CR2 A;  4MDW A;  3KXT A;  4ZGD B;  3MKD A;  1R77 A;  1VIF A;  4ZN3 A;  3EH1 A;  1M2O A;  1Q81 C;  1K76 A;  5L8R E;  2V1Q A;  2KYB A;  3SFM A;  4BY6 C;  4LNP A;  3MP8 A;  4M78 C;  2QQA A;  3LGL A;  1H92 A;  1AWX A;  2LDM A;  2OJ2 A;  4M77 C;  3RNJ A;  1RLP C;  1YNZ A;  1EX4 A;  1YI2 Q;  1S72 A;  1VA7 A;  3CMA T;  4C92 F;  4C0Z A;  1TS9 A;  2RK1 A;  3PMI A;  3CCL T;  1LJO A;  2AZV A;  3C4S A;  1Q95 G;  4JJB A;  3OYM A;  4MZP A;  2C0T A;  4OML A;  1LCK A;  3JCM J;  3CMA A;  3CME T;  3BW1 A;  2XD0 A;  1K9M C;  3OB9 A;  3CCL A;  3E9G A;  2FVU A;  2QDL A;  4AFZ C;  3R6O A;  1VQ9 T;  4DOW A;  2NUP B;  1G2B A;  2NUZ A;  3CCJ T;  5GAM d;  3CD6 T;  3CME A;  5KE3 A;  3P8B B;  1PHT A;  1VQM A;  2D9T A;  2LCL A;  5KCH A;  3CC2 T;  4PLI A;  2Z0W A;  1MMA A;  1X6B A;  2F2V A;  1PSE A;  1M5Q 1;  2RJC A;  1VQ9 A;  3I5S A;  3PFS A;  4JJD A;  1D1C A;  3EG2 A;  3CCJ A;  3CD6 A;  1YHQ T;  4M78 F;  2NWM A;  4ZTJ A;  2CZ0 B;  1QKW A;  2QDY B;  3CCU Q;  3BDL A;  4LDY A;  3CC2 A;  3PTA A;  2QXF A;  4M77 F;  1SSH A;  1AEY A;  1UHC A;  3JB9 I;  1OEB A;  2KRO A;  2EGA A;  3QYH B;  1NPR A;  4OB2 B;  4J6W A;  5CVI A;  1YHQ A;  2QYZ A;  2K3X A;  3DLL A;  5GAO p;  1Q81 U;  4WCI A;  1XTD A;  2RQV A;  2CP2 A;  2W10 A;  2RHU A;  3TSW A;  3RR6 A;  3VS3 A;  3CCR T;  1JU5 C;  3I9Q A;  4LD9 K;  4OGE A;  3I56 Q;  3MEU A;  2QI2 A;  2QGF B;  5GAN 3;  1W6X A;  5IH2 A;  2F69 A;  3VYH B;  2DKG A;  3TEE A;  3EG3 A;  1QVP A;  3VS0 A;  2KI7 A;  3CCR A;  4JUV A;  1C6V X;  5IAY A;  4CI0 C;  1K9M U;  3CCQ T;  2L3P A;  4HT8 A;  2VGM A;  2DET A;  5FW9 A;  1Y96 A;  1X43 A;  4QQD A;  4C8Q C;  1OOT A;  3S3O A;  1JJ2 S;  2PU9 B;  4PJO B;  3M0Q A;  3PVL A;  2KMT A;  4E7S A;  1B34 B;  3L2Q A;  2COW A;  2COY A;  1QWF A;  1XQH A;  4O6J A;  3UF4 A;  1TG0 A;  1BK2 A;  1TSF A;  3CCQ A;  1HJD A;  1RAD B;  1S72 Q;  5LJ5 g;  1Q82 R;  3OYC A;  2C0O A;  1TWB A;  5LJ3 e;  3HHT B;  4DBR A;  2BE9 B;  1NPP A;  2JTF A;  4E6R A;  1KQ2 A;  3CBM A;  2DIG A;  3TVT A;  4E2F B;  5HK3 A;  2KRS A;  4PJN A;  2X4J A;  2LT4 A;  2L2P A;  4E47 A;  2LC4 A;  1YJ9 Q;  1V76 A;  5KYY B;  4FL6 A;  4PFO A;  2H3E B;  4C92 A;  4BD3 A;  1ZUY A;  1D09 B;  2JXB A;  3OYA A;  1NLP C;  2X51 A;  1BB9 A;  1TUC A;  2RJE A;  4BUG A;  4M7D B;  2EQK A;  1PKT A;  1FMW A;  1T0H A;  1BI1 A;  4A54 A;  1VQM Q;  3SWN A;  4PJO G;  2O4X B;  2HNI A;  3EFO A;  2O2O A;  5C6S A;  1KC8 C;  3JCM V;  3M55 A;  4HCK A;  3J7A F;  3VS1 A;  3M54 A;  2ROT A;  4C8Q F;  2ZPF B;  1VIE A;  2BUD A;  1WJS A;  1Y7X A;  1VQP T;  2CZ7 B;  2OAW A;  4E7Z A;  4AG1 C;  1RUW A;  3S6W A;  1PNJ A;  4ELZ C;  4D6W A;  1RL2 A;  2OTL T;  4LDV A;  3CC2 Q;  3OYG A;  1I5O B;  4HXJ A;  2HQH A;  3UAT A;  4IUR A;  2DXU A;  2E1H A;  1V1C A;  1YCS B;  2HQE A;  4J8O A;  5LJ3 d;  2KT1 A;  1VQP A;  4XU1 A;  3CCE T;  1I81 A;  3JCM Q;  4JZ4 A;  1Q82 C;  2YUN A;  5CKF A;  4A4K A;  2O01 E;  1GBR A;  4M75 D;  2MOX A;  4M78 A;  1RAH B;  4RTT A;  2YUP A;  4M77 A;  1SF9 A;  2AK5 A;  4LXC A;  2L3R A;  4M7D G;  1BCM A;  1WXT A;  2F2W A;  3CCE A;  2JS0 A;  1VQ6 T;  1GRI A;  4JRI A;  4PJL A;  3UDC A;  3VYG A;  1M8M A;  2EQU A;  3UPU A;  2CSI A;  3QII A;  4R0K A;  1TUG B;  2FPE A;  1VQ6 A;  4IUQ A;  2FPF A;  3ZBD A;  1VQ7 T;  4JJC A;  2F2X A;  3NFC A;  2DD4 A;  4J83 A;  4IIO A;  4QVZ A;  1KFZ A;  1H64 1;  3ME9 A;  4PJO F;  2HBP A;  3V7S A;  4C0F A;  1KQS P;  3LWI A;  2A08 A;  4FU6 A;  3OY9 A;  4RMO A;  4A53 A;  3CCM T;  4FYX B;  4PLL A;  1C1A A;  5HKC A;  5FWB A;  3CC4 Q;  1VQ7 A;  3S3M A;  1IRX A;  1X6O A;  3EGD B;  4E7J A;  3CCQ Q;  2DX1 A;  3D7S B;  4GY5 A;  3C95 A;  2SRC A;  4XTV A;  2EQJ A;  1KC8 U;  1NJI C;  1KQ1 A;  1Q86 R;  3GPL A;  4RTU A;  1I0C A;  1D3B A;  1ZSZ B;  3CCM A;  1OPL A;  3MPU B;  4BI4 A;  1HXD A;  3GOX A;  2YXY A;  3JCM e;  4LUE A;  4X9D A;  2ECZ A;  2VC8 A;  2GFA A;  4XQ3 A;  2JUF A;  3HRT A;  2LZ6 B;  1KK7 A;  2D0Q B;  2XDD A;  1JB0 E;  1YN8 A;  3M59 A;  3HFO A;  4J9H A;  1AZG B;  1K1Z A;  1KHC A;  1PWT A;  1O9S A;  5GAN f;  4M7D F;  4J9B A;  4Z89 A;  1Q82 U;  1H3Z A;  1QW1 A;  1K73 C;  3REA B;  1QVF P;  3G4S A;  1K8A C;  3ER0 A;  1QMC A;  4A4G A;  1MV0 B;  3OYH A;  3PIP A;  2HKN A;  1X2Q A;  4F7U A;  1NEB A;  1SRL A;  2O9V A;  2EJG A;  1NZ9 A;  5GAM f;  2X4X A;  4ZN1 A;  2LCS A;  3CXC A;  1UGR B;  1VQO Q;  1Y57 A;  1QVG P;  1UG1 A;  5CK9 A;  3FEO A;  2DM1 A;  1M27 C;  1BI0 A;  1PD0 A;  2C06 A;  3CCV Q;  4K11 A;  2DTO A;  1IRE B;  2M0Y A;  5D6X A;  4E7L A;  4GLK A;  2CH4 W;  2RHX A;  3MO8 A;  4Z8A A;  4M75 B;  2J6K A;  2BZY A;  5GJV B;  1ZSZ C;  2EW3 A;  1GXI E;  5L23 A;  3OS2 A;  3QBY A;  4C8Q A;  3JCM d;  2D0N A;  1WI7 A;  2ATC B;  2P4R A;  4D8D A;  5GMK l;  1Q86 C;  2E6Z A;  3VS7 A;  1MMG A;  1SRM A;  3PVQ A;  1N27 A;  1BI2 A;  2XDB A;  1UTI A;  5FU6 B;  3U23 A;  1WHK A;  1IZ6 A;  2NLU A;  4LN2 A;  4Y92 A;  1FX7 A;  9ATC B;  2LNH B;  2LQN A;  2JS2 A;  2G3R A;  1H8K A;  1NJI U;  1X27 A;  1UJ0 A;  1D1B A;  1DJ7 B;  3KBG A;  3OYI A;  2P0K A;  2FL7 A;  4A4H A;  4N0A C;  3VJP A;  1IB8 A;  3QG1 A;  1V29 B;  1LOJ A;  5D7U A;  4IUP A;  5J3B A;  2DZC A;  1UJY A;  3QPH A;  3CCU T;  1OX8 A;  1Q81 R;  1AT1 B;  4EIK A;  4KH1 B;  1M2V B;  3QJ6 A;  4M75 G;  2KDS A;  1WLP B;  1IXD A;  1WHH A;  2QTV A;  2XU8 A;  3OYK A;  1K73 U;  1K8A U;  1NYG A;  4FYW B;  4MMK A;  1Y07 A;  3UA6 A;  3CCU A;  3G71 Q;  1GCP A;  3A8M B;  3A98 A;  2L8D A;  2X35 A;  2VWF A;  3CCM Q;  3OYD A;  3QDF A;  2DAQ A;  1OV3 A;  2RQW A;  3LLR A;  5IT9 E;  3OW2 A;  2KYM A;  4NL3 A;  3CXC S;  3I56 T;  1K9M R;  1ZHI A;  2YRV A;  4HVV A;  1VQ4 Q;  3KUF A;  1WIE A;  3A8L B;  3NTI A;  3UWN A;  1UGS B;  5EC7 A;  4BI3 A;  3HSB A;  4EMK B;  4AMC A;  5EG2 A;  4RG2 A;  1TH7 A;  5GAN j;  2K4Y A;  2D8J A;  2F5T X;  4II1 A;  2KXD A;  3NHN A;  1K0X A;  2R5A A;  4IIM A;  4BDZ A;  2RHI A;  3I56 A;  3G4S Q;  3M0U A;  1JXM A;  1W70 A;  2YRD A;  5GMK j;  2O88 A;  4QT7 A;  4KGX B;  3A1P A;  5GAM j;  3IQL A;  4XTW A;  2CUB A;  1MNE A;  1LPL A;  2JTM A;  1ZBX A;  2EJF A;  2ZPE B;  4KUI A;  3GIB A;  4C0D B;  1I1J A;  1NLO C;  1UEB A;  1S72 T;  1M3A A;  4ME7 A;  4JRK A;  3SDZ A;  4VUB A;  4RTY A;  1Y0M A;  3EGX B;  4XTX A;  1QVG S;  1UGP B;  5KYX A;  4DQ2 A;  3X28 B;  2W0Z A;  5GAN 8;  4J9F A;  2ZGW A;  3QSU A;  3FJ5 A;  1J3T A;  1QCF A;  2E12 A;  2RQU A;  2LX7 A;  2VGN A;  1QCN A;  1SKU B;  4M7A D;  1NYF A;  3TSZ A;  1BIA A;  2LMJ A;  2AHJ B;  1YJ9 T;  3GNF B;  1N5Z A;  3OYY A;  4FYY B;  5FRO A;  4B9X A;  2FZG B;  2O9S A;  5LJ5 f;  1D0X A;  1U5S A;  1GBQ A;  5M9O A;  1JBM A;  1B7T A;  3PE0 A;  3X20 B;  1ABO A;  2AT1 B;  4KBM B;  1N9S A;  1TTH B;  3EHR A;  4HCZ A;  2DMO A;  2L0A A;  4LE9 A;  1YJ9 A;  2PVG B;  3LWH A;  1Z9Z A;  2DRM A;  3FDR A;  5D6Y A;  1VQM T;  4RKU E;  5DLQ E;  3SB2 A;  1PM3 A;  5J26 A;  5CIU A;  1FMV A;  3L2Z A;  3FB9 A;  4M75 E;  4C5G A;  2J6F A;  2RK2 A;  2CRE A;  2G6F X;  2JOY A;  5FU7 C;  4PNO A;  1N9R A;  2A28 A;  3E2U A;  3OBW A;  3JV3 A;  1YJW Q;  4DBQ A;  2KY9 A;  2NUT A;  4A63 B;  5KYW A;  2JZ2 A;  2XMF A;  2VUB A;  1HYO A;  1ABQ A;  3ASK A;  4OB3 B;  1T0J A;  2X9H A;  2E41 A;  2QEX Q;  4WTO B;  1ZA2 B;  3GP8 A;  4A4F A;  3OW2 S;  3PMT A;  3DB3 A;  4J9E A;  3HRS A;  3I55 Q;  1NM7 A;  3V7R A;  1OU8 A;  3CBP A;  1I5L A;  2K7A A;  5IXB A;  1Q7Y R;  3JB9 G;  4KUL A;  1UE9 A;  2E65 A;  2MPX C;  2PNI A;  3X25 B;  4KH0 B;  3R6N A;  3NPF A;  4L59 A;  2CT3 A;  4Z88 A;  1UGV A;  2J7I A;  2LJ3 A;  3OYJ A;  3QUI A;  4LUD A;  1VYT A;  1TXQ A;  5KYU B;  3A5Z B;  1G83 A;  1XJW B;  3CPW A;  3VKI A;  3FRN A;  2YLC A;  1BBZ A;  5CO7 A;  5A2Q E;  1G5V A;  1MND A;  2P84 A;  1QWE A;  2F1L A;  4EDU A;  5GJW B;  5A0D A;  4RCB A;  4KRT A;  1R0C B;  4QVC A;  1KC8 R;  1WA7 A;  3EG9 B;  2ZPI B;  2MWO A;  2EQI A;  5GAN 6;  1RAE B;  1D1A A;  2M51 A;  1F1B B;  3OS0 A;  3CC4 T;  4AG2 C;  5A0L A;  5CKB A;  2CP0 A;  2RB6 A;  1UGQ B;  2NYS A;  3LH0 A;  2K2M A;  4OGC A;  3RIR A;  2H8H A;  4N0A A;  2PVO B;  2P0Q A;  3JB9 H;  4M7A B;  3VU3 C;  1GCQ C;  1QP3 A;  3M4G A;  2MK5 A;  3M57 A;  3CC4 A;  1AWW A;  5LJ3 g;  3QWY A;  4PJM A;  4TVR A;  1Q7Y C;  4N4G A;  1RAG B;  4Z02 A;  3M0T A;  2ZCF B;  3PIO A;  2PQW A;  3JB9 F;  4HA8 A;  2QAZ A;  4CC2 A;  5LJ5 j;  2RF0 A;  2QTX A;  2DIQ A;  3EG1 A;  3M53 A;  3N5B B;  4RG8 A;  5GAN h;  4E7H A;  4OP0 A;  4JLG A;  4X9C A;  3MCA B;  4EMG A;  1SHG A;  4OVA A;  2F5K A;  2L3Q A;  3L2V A;  2X4Y A;  3E19 A;  5KE2 A;  1WXU A;  2E5Q A;  3JCM X;  1OI1 A;  4OMF B;  5GMK h;  4RTZ A;  3CPF A;  4ORZ A;  1RAB B;  3VUB A;  3MP6 A;  1VQO T;  2K5I A;  1YCY A;  4O5V A;  5GAM h;  4PFZ A;  1KJW A;  2ZPB B;  4OMO A;  2FRY A;  3BE3 A;  1MUZ A;  4J6Y A;  1AD5 A;  2EBP A;  3G6E T;  2L89 A;  3CCV T;  2VYT A;  1W2B A;  4M7A G;  5HY6 A;  1ZA1 B;  1M8V A;  5IHN A;  1M90 R;  1VQO A;  3ZFJ A;  2DZ9 A;  4IUT A;  1T3L A;  4OB0 B;  1WJQ A;  1XOV A;  5CAI A;  1JXO A;  2LX9 A;  5CKE A;  4PJO C;  3H0H A;  1SEM A;  3INZ A;  3HPW A;  3G6E A;  2DVJ A;  1LNX A;  3EGU A;  3CCV A;  4FW2 A;  3E9F A;  3RDV A;  1NJI R;  2LQ8 A;  4YTL A;  2QQB A;  8AT1 B;  3EH2 A;  1WGS A;  4AT1 B;  1M3B A;  2D6F A;  4V2S A;  1UEC A;  2QQR A;  1WHL A;  2CGH A;  2EJ9 A;  2KXC A;  4F7U E;  5AYF A;  2OX7 A;  4FW1 A;  2DYI A;  1AWJ A;  2K5F A;  1RAA B;  1NG2 A;  2HSE B;  6AT1 B;  2DBM A;  4DEX A;  2EKO A;  5GMK m;  1Q7Y U;  2DIL A;  1K73 R;  3NTK A;  1K8A R;  3UT1 A;  1RAC B;  4NL2 A;  2AIR B;  4M7D C;  4J9D A;  3I5R A;  2QK0 A;  2HDA A;  5GAN 5;  2EYZ A;  4AFS C;  3H6Z A;  1BI3 A;  3CQT A;  1X01 A;  1K9A A;  1YJN Q;  1EZZ B;  3JB9 J;  4C92 D;  2DL3 A;  5CQY A;  4HVW A;  2EQM A;  3G71 T;  8ATC B;  1M90 C;  2CP5 A;  5KCO A;  2AKK A;  4RTX A;  4OMM A;  3HFN A;  2DL8 A;  1U06 A;  1KD1 R;  4XTY A;  4CRI A;  5GAO r;  2XKO C;  2LP5 A;  3G71 A;  2WSF E;  1MV3 A;  1VQ4 T;  4JRQ A;  2PZ1 A;  2IG0 A;  2JNG A;  3CXC P;  3JCM g;  2B8A A;  2JJ9 A;  2YSQ A;  2KRM A;  4L6V 5;  2RI2 A;  2K3Y A;  5FRN A;  1C0M A;  2CUD A;  2VXF A;  4FSS A;  5C0M A;  1QCO A;  3L42 A;  4Y91 A;  1U1S A;  1IGQ A;  4C5I A;  2RMO A;  2DE0 X;  2SEM A;  3G4S T;  1VQ4 A;  3H0I A;  2J6O A;  1MGQ A;  3CC7 A;  1FYN A;  1PRL C;  4JS4 A;  4M7A E;  3RER A;  3OYN A;  3V8K A;  1FMK A;  2LQW A;  3C94 A;  2BIV A;  4M78 D;  1WPY A;  1IHV A;  1WX6 A;  4HT9 A;  3M0R A;  5AT1 B;  2MF2 A;  2FPD A;  2OAU A;  4M77 D;  2GTO A;  3OYF A;  3L2U A;  3MEA A;  3JCM c;  4CC7 A;  3L1A A;  5IN1 A;  2JM8 A;  2CT4 A;  3VS2 A;  4BB7 A;  1KQS A;  4ESR A;  1VQ5 Q;  4J9C A;  2ED0 A;  1JQQ A;  1AVZ C;  3RBB B;  2GGR A;  2NUP A;  1GL5 A;  3PGG A;  2B86 A;  4JLI A;  1N8R C;  3G6E Q;  4DOV A;  1Y96 B;  3H8Z A;  3RKW A;  1R8O B;  4AFQ C;  2DLP A;  1OZ2 A;  5LJ3 h;  5FLX E;  1JEG A;  2HSP A;  3NGP A;  2YDL A;  3L2R A;  2R57 A;  5LJ5 h;  4KT0 E;  4F17 A;  1KD1 C;  1HK9 A;  2CS7 A;  3HRU A;  1E7O A;  1WDX A;  1R0B G;  4JRP A;  4R55 A;  2V8J A;  1I4K 1;  2FRW A;  3HP9 A;  4A4E A;  5HK0 A;  2OI3 A;  4J7F A;  1M90 U;  1GCQ A;  2RD1 A;  2R5M A;  1AHJ B;  2A36 A;  1VQL T;  2DL7 A;  2K57 A;  2FO0 A;  2HMA A;  2VXE A;  4QKU A;  3LW5 E;  3DLM A;  3GNG A;  1YJW T;  5GAN 7;  4B6M A;  2XG8 D;  1G3S A;  4OMN A;  1QVF A;  1TU0 B;  4C92 B;  2DA9 A;  2QEX T;  1BYM A;  3I35 A;  5GAO n;  1PKS A;  1D0Y A;  1X75 C;  2A0F B;  2LCC A;  1VQL A;  4HVU A;  2KR3 A;  3OW2 P;  3OYE A;  2ZPG B;  3FC3 A;  1YJW A;  3I55 T;  2FG0 A;  2KVQ G;  3TQ7 P;  3SWN B;  2P0P A;  4XU3 A;  2QAS A;  3DB4 A;  3J81 E;  1WFW A;  3EFO B;  1WHG A;  4F16 A;  2QEX A;  3EHQ A;  2RI5 A;  1EIF A;  2DYB A;  1VQK Q;  3MEW A;  3CCS Q;  3I55 A;  2DXB A;  2Y4Y A;  5J39 A;  4M75 C;  1OYX A;  2E6N A;  1ACM B;  1IGU A;  4KUD K;  1AOJ A;  2WAC A;  2CH4 A;  2DTI A;  1NE8 A;  1VQ8 Q;  5DM7 R;  2JN0 A;  4PJO A;  3MJX A;  1O75 A;  1B34 A;  1UB4 A;  3H9N A;  3X24 B;  2GBQ A;  1N8R U;  4ZGJ B;  1YWO A;  4DBH A;  4J9I A;  2IIM A;  1W1F A;  5FU6 C;  3RMQ A;  1WXB A;  5CKH A;  2A7Y A;  4BY6 B;  1OPK A;  4M78 B;  2AKL A;  2ZAE A;  2K9G A;  3CC7 Q;  2CP7 A;  3RMS A;  3V7C A;  1RI9 A;  4C8Q D;  4M77 B;  1T3S A;  4CC3 A;  2DFU A;  4L5G A;  1KD1 U;  2LJ0 A;  2M1H A;  4LD6 A;  4JJN K;  2CKK A;  4PL6 A;  2RPN A;  3A8H B;  1QP2 A;  2I0N A;  2DXC A;  2E70 A;  1MMN A;  2EYQ A;  2K79 A;  1YIT Q;  1TOV A;  2KT8 A;  2X4W A;  4EPC A;  5KYY A;  4D8K A;  1ARK A;  2LNV A;  2ED1 A;  1S1N A;  3AT1 B;  5GAN 2;  4KGZ B;  4ZGE B;  2QQS A;  5GAN e;  3M5A A;  2CP6 A;  5ECA A;  3VS6 A;  4M7D A;  1YIJ Q;  2GTJ A;  2MI6 A;  5GMK e;  2HCK A;  2O4X A;  5IHI A;  1VYV A;  4M75 F;  4R56 A;  5GAM e;  2RQT A;  3CBO A;  2M02 A;  3MHX A;  3WXM B;  1YWP A;  3OS1 A;  2KEA A;  3LYI A;  3WVD B;  3QJY A;  3JCM h;  4M78 G;  3OSV A;  4E7K A;  2J05 A;  5LJ3 f;  1M1K R;  2KGT A;  2GQV A;  4M77 G;  2DNU A;  3GBQ A;  1VQN Q;  1D3B B;  1EFN A;  2KQW A;  2E4H A;  1X69 A;  2KRN A;  1B3Q A;  1X2K A;  5IHK A;  2YLB A;  4Y28 E;  1LVK A;  4J9G A;  2HKQ B;  4UC4 A;  4EMK C;  3JCM W;  2XHC A;  4PJO D;  1VOM A;  2DJZ A;  3RES A;  4GLM A;  2EYX A;  3VRY A;  4DA4 A;  4IUU A;  3OMC A;  2DJQ A;  3G7Z A;  4C0G A;  1VQL Q;  1M9S A;  3JCM P;  1ZUU A;  2HQX A;  2FB7 A;  1JJ2 A;  3Q1J A;  4OF1 A;  1I07 A;  5GAN d;  1RI0 A;  4F7U B;  4LDW A;  4C0D C;  3CPW P;  1M3C A;  2IPO B;  2WSC E;  3URG A;  1WHM A;  2QA4 Q;  2MMP A;  4C92 E;  2E64 A;  2OTJ T;  3F70 A;  2DO3 A;  4MZM A;  5D6W A;  4M7D D;  3KFV A;  3GF5 A;  1KG1 A;  2HL5 C;  1CSK A;  1RAI B;  3NMZ C;  1A0N B;  4C8Q B;  2DK3 A;  3EGD A;  2OTJ A;  1M1K C;  2XI9 A;  5FRM A;  1NBE B;  4MZT A;  3OYB A;  1XNI A;  4X34 A;  3FLG A;  2RNA A;  4J7I A;  3M0S A;  4MML A;  1ZSZ A;  2DER A;  1YJN T;  3RKY A;  4F7U G;  3QDR B; 
#chains in the Genus database with same CATH homology
 3G6E Q;  1YIJ Q;  3CCV Q;  3G4S Q;  1VQK Q;  3CME Q;  3CCS Q;  1QVF P;  2OTJ Q;  1VQL Q;  1VQ7 Q;  3I55 Q;  2QA4 Q;  3CC4 Q;  3CC2 Q;  1VQ6 Q;  1K9M R;  3CCU Q;  1KC8 R;  3CMA Q;  3OW2 P;  3CCR Q;  1VQM Q;  1YIT Q;  1YJW Q;  3CCQ Q;  1KD1 R;  1VQ4 Q;  3G71 Q;  1NJI R;  1Q7Y R;  1YJN Q;  3CCE Q;  3CC7 Q;  1JJ2 P;  1YJ9 Q;  1VQO Q;  3CCL Q;  1S72 Q;  1VQP Q;  1YI2 Q;  1M90 R;  1Q82 R;  1W2B P;  1QVG P;  1VQ5 Q;  1VQ9 Q;  2QEX Q;  1Q86 R;  3CPW P;  3CXC P;  1N8R R;  1YHQ Q;  3CCJ Q;  1Q81 R;  1VQ8 Q;  1K73 R;  3CCM Q;  3CD6 Q;  1KQS P;  1M1K R;  2OTL Q;  1K8A R;  3I56 Q;  1VQN Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...