2RQWA

Solution structure of bem1p sh3ci domain complexed with ste20p-prr peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
105
structure length
105
Chain Sequence
GSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud emergence protein 1
publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 7
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqwA01
1TG0A 4CC7A 2O9VA 2ED1A 5ECAA 1CKBA 3O5ZA 3EG2A 4FSSA 3TVTA 3ZL7C 1I0CA 2MIOA 4LN2A 3I35A 2F2VA 1UHCA 2LMJA 1WDXA 2DL7A 1OOTA 4AG1C 2CUDA 2EYYA 4RUGA 2KNBB 3TSZA 2ENMA 2BTTA 2JM8A 2LP5A 3RBBB 2MCNA 1J3TA 1X69A 1WFWA 1SHFA 1WIEA 1SSHA 1X2QA 5GJWB 1ABQA 4ZNXA 2AZVA 1T0JA 1JU5C 1AD5A 1YP5A 2K79A 2YUPA 2DA9A 1UDLA 2RNAA 2EYXA 2CSQA 5IHIA 1RI9A 1AWJA 3CQTA 3VS3A 3EG3A 1WXBA 1E6GA 1RLQC 5IHNA 3I9QA 2D8HA 1XOVA 1KIKA 1EFNA 3M0QA 4JJCA 2OAWA 3SHWA 2EPDA 4J9GA 3EHQA 1PWTA 1ZUUA 1I1JA 1FYNA 1AWWA 1T3LA 2C0IA 2EBPA 2GBQA 1QWEA 2JXBA 2ECZA 4EIKA 1QKXA 4JJDA 2YUOA 2JM9A 2KRMA 1W6XA 2L3PA 2NUZA 5HCKA 1RUWA 2CT4A 4RTZA 2FO0A 4Y92A 3NMZC 4J9DA 2KE9A 1GFCA 2O2OA 2O9SA 3M0RA 1X6BA 3M0TA 2EVRA 4IIMA 4OMMA 2E5KA 2ED0A 2BZXA 2ROTA 2X3XD 2FG0A 2LX7A 4AFUC 2CH4W 4HVVA 1AZGB 3VS0A 3JV3A 2DMOA 3VS2A 1MUZA 2KROA 2JTEA 2CH4A 1U06A 1HJDA 2V1QA 2C0OA 2A37A 3H0IA 1WA7A 1YNZA 1OV3A 2RMOA 4OMQA 4RTXA 3KFVA 1H8KA 3ULRB 1JO8A 2ESWA 2M51A 1KJWA 4CC3A 1K9AA 2FRWA 4D8KA 1AEYA 2KXCA 2LNHB 2XMFA 3VS1A 2RPNA 1PNJA 2JT4A 5L23A 2RN8A 5IH2A 3H0HA 2CREA 2KBTA 1WLPB 2GTOA 4HVWA 4OMOA 1UE9A 3VRZA 1T0HA 2RQTA 2J06A 2KXDA 4K11A 2RF0A 1ABOA 2DLPA 3REAB 2DNUA 2GQIA 2LQNA 1GCQA 1M3AA 2F2WA 1GL5A 2MOXA 2CUBA 2L2PA 2KYMA 2AK5A 1QLYA 1KSWA 1AVZC 4Z88A 1K1ZA 4J9CA 2JMAA 2NWMA 1B07A 4OMPA 1IO6A 3EG0A 1ZUYA 3GBQA 2FPFA 1M3CA 3R6NA 2LJ1A 2EKHA 1NM7A 2FRYA 1SRMA 1GFDA 3IQLA 4JPBW 1HD3A 4DEXA 1CKAA 2HCKA 1NLPC 1S1NA 2JS0A 2C0TA 2K7AA 1Y0MA 3VS6A 1PKSA 2DVJA 1UJYA 2D1XA 1ZX6A 2A08A 4RTYA 4M4ZA 4E6RA 1KFZA 4JJBA 1U5SA 1M8MA 1Y57A 3I5RA 1I07A 4X1VA 2EYZA 1K0SA 1Z9QA 1AZEA 1YN8A 1UFFA 1ZUKA 4J9BA 3EG1A 1GBQA 2A36A 4LNPA 3VS5A 1JEGA 1SPKA 2L3SA 5IHKA 3QWYA 3M0UA 4LUDA 1AWXA 3THKA 2HSPA 1YWOA 1W70A 2BZYA 1HSQA 1VA7A 1VYUA 2KYBA 1FMKA 2PTKA 2RQVA 2A28A 1H92A 3PE0A 2LQWA 3C0CA 4LUEA 4AFSC 1SHGA 1AWOA 4GBQA 2F2XA 1NLOC 1WXUA 2GTJA 2LJ3A 4AFQC 3SEMA 4HXJA 2YT6A 2KR3A 2J7IA 2L3QA 5EC7A 1M27C 1YWPA 2KRNA 1JQQA 1GBRA 2EGAA 1JXOA 1PRLC 4IIOA 2K2MA 2K6DA 3EGUA 4WCIA 4Z8AA 3RNJA 1NYFA 2W10A 1JXMA 2ROLA 1ZLMA 4CC2A 2DL5A 1GCQC 3A98A 1UG1A 2QDLA 2DILA 1WXTA 2FPEA 3M0PA 2DL4A 4LE9A 3U23A 3VS4A 1BB9A 1K0XA 2DL8A 5FW9A 1VYVA 2X3WD 2KT1A 1ZBJA 1MV0B 4F14A 2LCSA 2PZ1A 4R0KA 1G83A 1UUEA 1X6GA 3H0FA 1ZSGA 3REBB 5FWCA 2YDLA 2YSQA 1M30A 2LJ0A 1X27A 2EYWA 1RLPC 4OMLA 2DJQA 2KEAA 2G6FX 2RQRA 4OMNA 5FWBA 3TSWA 1B3QA 1W1FA 2J6KA 3UA7A 2DM1A 2EW3A 2DYBA 2HBWA 2B86A 1AOJA 3PVQA 2AKLA 3VS7A 2ABLA 2DRKA 2VKNA 2KRSA 3I5SA 1M3BA 1E6HA 2HDAA 1UGVA 1GCPA 2DL3A 1YCSB 4QT7A 1BK2A 4KRTA 1TUDA 4Z89A 3H41A 1VYTA 2DF6A 2VVKA 4D8DA 2AZSA 2KGTA 1K76A 2OJ2A 3NGPA 3PVLA 2YUNA 2H8HA 2IIMA 1BBZA 1SRLA 1PHTA 1Z9ZA 3NHNA 4HVUA 1OPLA 1PKTA 2K9GA 2RQWA 2OI3A 2BZ8A 2SRCA 1UHFA 2W0ZA 3EHRA 2DRMA 1UJ0A 4AG2C 1QCFA 2CT3A 2D0NA 1ARKA 1MV3A 1NG2A 2J6FA 2O88A 1SEMA 4F17A 2VWFA 1H3HA 2K3BA 2PNIA 4GLMA 2M0YA 1WX6A 2CDTA 3UATA 2JMCA 2L0AA 1K4US 1A0NB 1NYGA 1LCKA 4J9HA 1X43A 2J6OA 1OPKA 5I22A 3LH5A 2LZ6B 1OEBA 5GJVB 1BU1A 2SEMA 2GGRA 4ORZA 2GNCA 2EGEA 1NEGA 2J05A 1CSKA 2FEIA 1PRMC 1WI7A 2KT8A 4HCKA 4J9FA 4RTTA 4RTUA 1WYXA 1G2BA 2CSIA 4RTVA 2O31A 2EGCA 2DBMA 4A63B 1QWFA 2I0NA 3VRYA 1UTIA 4J9IA 1T3SA 2DX1A 4JZ4A 3UF4A 1UECA 5IXFA 2HEQA 5I11A 4ESRA 1NEBA 1E7OA 2FPDA 2DBKA 1V1CA 4AFZC 2JW4A 3FJ5A 1QKWA 4DEYA 3QWXX 2AKKA 4CC4B 2P4RA 2V1RA 1GRIA 1N5ZA 2EQIA 2DE0X 4RTWA 3UA6A 4F16A 2D8JA 2JS2A 5IXBA 1U3OA 3NPFA 2RQUA 1X2KA 3M0SA 1TUCA 4J9EA 4JZ3A 2YUQA
chains in the Genus database with same CATH superfamily
1R0BG 4A53A 2F2VA 2CP7A 1UHCA 3ME9A 1DJ7B 3QDFA 3OYMA 4HT8A 3AT1B 1C1AA 4MMKA 4HKEA 3TSZA 2CP3A 2JM8A 4IUTA 4QVDA 2MCNA 3OYCA 1KQSS 1SHFA 1SSHA 1ABQA 3MP8A 4ZNXA 1T0JA 2QEXA 2CSQA 4BACA 1RI9A 5LJ3g 2RH2A 1EX4A 2DAQA 1WXBA 1RLQC 3OBWA 1LPLA 2KQWA 2AT1B 1SKUB 2LTOA 5HY6A 4ZGEB 3JAME 4PKCC 2DD4A 2EJFA 2EPDA 1PWTA 5LL6S 1AWWA 3MHXA 3OYIA 1MMAA 1ZSZC 2C0IA 3E9GA 4Q5WA 2X51A 3CC7Q 4PFZA 2YRCA 2ECZA 1S72A 1R8OB 4M78G 2L3PA 2CT4A 2LX9A 4E47A 3SD4A 3CCRA 2O01E 3NMZC 4J9DA 1VIEA 4X9DA 1OZ2A 1GFCA 1SF9A 5J3BA 2EQKA 4JS4A 3BFMA 2DK3A 4IIMA 2EVRA 4JS5A 3P8HA 1OZ3A 4M75E 1ZHIA 2XDPA 3V8LA 1MMGA 2CS7A 3MPUB 2A7YA 2LX7A 1OU8A 1GXIE 4MZMA 4FYYB 2ZPHB 2QA4A 2OTJT 4OMQA 3KFVA 1TU0B 4XTUA 1VQMQ 3CC2Q 2K5LA 4NOYA 4D8KA 2KXCA 2LNHB 3VS1A 3HRSA 1H641 4ZN3A 1I8FA 1PNJA 1VQ9A 1XTDA 2K4YA 1KC8C 2DXTA 2CREA 1SG5A 1Y96B 2KBTA 3C4SA 1WLPB 3CPWA 1AHJB 1UE9A 1YJWT 3R6OA 2P0KA 1YITA 2J06A 2QEXQ 4K11A 3LWHA 3HSBA 1AT1B 4L5GA 2DNUA 4M7AB 3JCMb 4M77A 2LQNA 3A8MB 2RJDA 3CC4T 2F2WA 2FZCB 3HFNA 3OYKA 2L2PA 4PJOD 2KYMA 3WVDB 2RI3A 1KSWA 3CCVA 3JCMh 4M7DD 1BIAA 4WTOB 5GAN6 1P92A 1B07A 3FEOA 3EG0A 4EMKC 3QYHB 3G4SQ 1S72Q 2EKHA 5KH6A 1SRMA 1Q82U 1GFDA 4BI3A 3IQLA 4M7DG 5LJ3j 3CCRQ 1UB4A 2JS0A 2OAUA 2AIRB 3VYGA 1FMVA 4PLLA 3V8JA 4PFPA 1KQSP 1ZX6A 2DXUA 2LQKA 3QKJA 2A08A 3PGGA 4M4ZA 4RTYA 1KFZA 3EFSA 1M8MA 3CMEA 3LX7A 1I07A 2LQ8A 1JB0E 4QVCA 2EYZA 3X25B 5DY9A 4C92A 1K0SA 7AT1B 3OYGA 2QA4Q 2XDDA 1NZ9A 1YN8A 1UFFA 2VV5A 3EFOA 4E7KA 4A4EA 4E2FB 1KC8U 4C8QE 4VUBA 1W2BS 1SPKA 2L3SA 4RG8A 3OQ5A 1AWXA 2M02A 2HSPA 1YWOA 1Y07A 3LYIA 3TQ7P 1VYUA 2QK0A 2GFAA 4FYVB 2KYBA 2EJ9A 2QGFB 2A28A 1IXDA 1HXDA 1VQ5A 1SHGA 1YITQ 5A2QE 1AWOA 4GBQA 1Y71A 1RL2A 2E6NA 1K73R 1VUBA 3HHTB 1NLOC 1WXUA 2X35A 1K9MR 1N8RR 3OYBA 1M5Q1 2YT6A 3H8ZA 3VUBA 5J26A 1YJNA 2J7IA 4DOWA 2L3QA 1KQ2A 1YWPA 2FHDA 4IIOA 3RIRA 5GANe 1YJ9A 3CCVQ 1KHCA 4WCIA 4DBQA 4Z8AA 2VC8A 2B8AA 4OB3B 3ZBDA 2CP0A 5C0MA 2ROLA 2PUOB 1YCYA 2QDLA 3I55T 3U23A 2DL4A 3VS4A 2DL8A 5KE2A 3BW1A 2KDSA 2KT1A 4JJNK 2YWWA 3QO3A 2PZ1A 4R0KA 2EJGA 1Q81C 3QG1A 4XTVA 1ZSGA 5KYXA 3REBB 1G3WA 2E12A 5I2SA 2YDLA 1R77A 2E3IA 3HTRA 5DLOA 2LVMA 2DJQA 3M55A 2G6FX 4OMNA 3CCSA 1B3QA 1M2OA 3OBYA 3RMQA 2OX7A 2GQVA 2HBWA 3META 5CQXA 1KQSA 2DEUA 3PVQA 2PUKB 2ABLA 2DRKA 4EMKA 5GAOl 3I5SA 1E6HA 4M78B 1GCPA 4OB1B 4IKFA 2DL3A 2PVGB 2PVOB 4V2SA 1TUDA 3H41A 4D8DA 2AZSA 3PVLA 5GAOm 4HCCA 2XHCA 4OGCA 1VQ7A 4HVUA 5GAMe 2E3HA 4PJOE 3A8OB 1D09B 2BZ8A 3EHRA 2L3RA 3C94A 2CT3A 2D0NA 2HNIA 2CZ7B 2EQJA 2X4WA 1MV3A 4J83A 1JJ2S 2XK0A 2COWA 4XTZA 2ZAEA 4F17A 2VWFA 4XU3A 4M75A 2CDTA 1YJNQ 1IHWA 3UATA 1A0NB 4J9HA 1X43A 1OPKA 4KGXB 3CEYA 3LH5A 4M78C 1X6OA 2F69A 2D0QB 4ORZA 5IAYA 3T9NA 2LDMA 3CCQT 1PRMC 1VQ8A 1Q81U 1HYOA 2RHIA 4JRPA 1BI3A 2KT8A 3LGFA 1VQKA 2JJ9A 1G2BA 3OYDA 4BY6B 1SSFA 4X9CA 1UTIA 4J9IA 4F04B 2DX1A 3CCUQ 4OB2B 1Q7YC 2HEQA 5I11A 1KHIA 4ESRA 1NJIR 1E7OA 5CKDA 1Q95G 4A4FA 2RD1A 4IUQA 4D6WA 4CC4B 1Q86R 2V1RA 1GRIA 1N5ZA 1VQ4A 2DE0X 1VQNQ 2VGMA 2RA2A 3QPHA 2JS2A 1QCNA 4JRKA 2KY9A 4M75F 4M7AD 3M0SA 1TUCA 1RAGB 4J9EA 3M53A 2RK1A 2O9VA 2AHJB 3O5ZA 3FDRA 3EG2A 3TVTA 2EQUA 2MIOA 3OYHA 3I35A 2RHUA 3G6EA 1RAIB 4M7AG 2CUDA 3CCLT 5KYNA 1YIJQ 4ATOA 2OTLA 2ENMA 2BTTA 3M58A 1TH7A 1M4ZA 3RKWA 3VV0A 1VQ7Q 4O6JA 2D9TA 1VQ6A 1YP5A 2K79A 1YHQQ 2NUTA 2DZCA 3CQTA 2EQMA 4MZTA 3CCMT 3CCEQ 5IHNA 1V29B 3OS1A 3CD6T 4GY5A 3I9QA 1PG5B 2CZ0B 2RHXA 4JRQA 1WHLA 1Y7XA 4TVRA 3M0QA 3ZFJA 2OAWA 1OX8A 3SWNA 4J9GA 2K3XA 1WHGA 4M7DC 1UGSB 1T3LA 2EBPA 4XU0A 4KBMB 5HK0A 2V8IA 1RI0A 1QWEA 2EAYA 5LJ3e 1VQ8Q 1QKXA 3RERA 4XTYA 4QQ6A 1Q7YU 2NUZA 3QJYA 4C8QA 3CMAA 4RTZA 3MEAA 2QQRA 5EG2A 3QIIA 2FO0A 3S3OA 2IVWA 4R55A 3OYYA 1YBYA 2VYTA 3OYJA 1BI2A 2CP2A 2O2OA 1K8AR 3M0RA 3KUFA 4PFOA 2ED0A 1W2BA 1OI1A 2FG0A 2CH4W 1BCOA 1UGRB 3G7ZA 4HVVA 2WSCE 3EGDB 3UPUA 2NUPA 3VS2A 2KROA 3CXCP 2CH4A 5CAIA 1O75A 4FT2A 1U06A 4B6MA 2V1QA 1MGQA 1YNZA 5I2MA 4FT4A 1VQ4Q 1OV3A 4JUVA 2RMOA 1JJ2P 5GANh 1G3TA 4M77B 1H8KA 2MAMA 2ESWA 4IUUA 2MYSA 2K5FA 1PD0A 1WHJA 4CC3A 8ATCB 3QYGB 1K9AA 2FRWA 4AT1B 1AEYA 2XMFA 3HRTA 2MWOA 1I5LA 4QVZA 5GANd 1XQHA 2X4JA 2PVDB 2P0PA 5GAN8 3X26B 3HPWA 2E10A 2OTLQ 4N0AC 3VRZA 5FRNA 2K3YA 2HBPA 4E7JA 2RQTA 2KXDA 1MNDA 2RF0A 3NTIA 1M90C 1ABOA 4X34A 2D6FA 1M3AA 3M54A 4DBFA 4CRIA 2CYZB 2MOXA 1GL5A 2OTJA 5GAN5 4BE1A 2AK5A 1M1FA 3O8VA 4PLIA 2K57A 1D1BA 1AVZC 4MDXA 2NWMA 4A4KA 1OYXA 1MMDA 5CQYA 3EFRA 5FLXE 3OA6A 1M1KR 2Z0WA 1ZUYA 3GBQA 2FPFA 2E41A 3EFOB 1M3CA 5GAMj 1M8VA 3EH1A 3HL8A 1NM7A 2FRYA 1BI0A 3N5BB 2DTIA 1HD3A 1N9RA 2EIFA 2HQEA 3CMAQ 4C0DB 1RADB 4RKUE 1KK7A 1O9SA 5GAMh 3JCMc 2C0TA 1YJWA 4M78D 1D1AA 4KT0E 1PKSA 4RG2A 4M7AE 2D1XA 1VQPT 5CIUA 3S3NA 3CC7T 4F7UA 3RR6A 3CC4A 2HZYA 3L2RA 4JJBA 2JN0A 2COYA 4PJJA 3I56A 5KYYB 5GAMd 5GAOq 4PJOA 1Z9QA 4PJNA 4LNPA 2LT1A 4AMCA 1Q82C 4C0DC 4LUDA 4PL6A 4L6V5 1W70A 3P8DA 5D6YA 1JJ2A 2P84A 2BZYA 4FU6A 1M90U 4XU1A 1FMKA 2E70A 4QQGA 4JDSA 2M0OA 5CVIA 2LQWA 3L2VA 1VQMT 3CC2T 3H6ZA 2VGNA 2ZPBB 1VOMA 3FB9A 2GTJA 2LNVA 4HXJA 4F7UF 2KSSA 2KR3A 2OTJQ 2HSEB 3RDVA 2R5MA 2M9UA 1JQQA 2QAZA 3A8LB 1VQLA 4NS5A 4XU2A 5GAN4 1PRLC 2K2MA 2K6DA 1TWBA 4KULA 2QEXT 1OU9A 4OMFB 3S3MA 2ZPEB 1ZLMA 4DBRA 2DL5A 2V8KA 3QZ9B 5IN1A 1GCQC 2QQAA 1YI2A 3A98A 2CP6A 5DLQE 2QGGA 4C5EA 2DILA 2FPEA 4FYXB 4LE9A 3VKIA 3KXTA 1IZ6A 3BDLA 1TS9A 1ZBJA 4BDZA 3ASKA 3AHUA 4P5NA 3QDRB 3G4ST 1U8RA 1X27A 2EYWA 1RLPC 5GAN2 2X9HA 1QVGP 3I56Q 1QW1A 2RQRA 2JUFA 4C5GA 1WPYA 3OMGA 2CKKA 2DM1A 2EW3A 2DYBA 4M7AC 3A8HB 2PQWA 4PJMA 5GAN7 2FYKA 3QJ6A 5KYWA 5LJ3h 2VKNA 1I4K1 4M75B 1NBEB 2QTVA 3FLGA 3L2UA 2DD5A 1M3BA 3HFOA 1TSFA 3I55A 1YCSB 4M77F 2XI9A 1BK2A 4MZPA 2MMPA 4KRTA 1G8XA 2L8DA 2MWPA 1VYTA 4BI4A 2KVQG 1D0XA 2LT4A 2OJ2A 3NGPA 2H8HA 2IIMA 2XIDA 1SRLA 5LJ3d 1PHTA 1WQ7A 1Z9ZA 5CKBA 4LDYA 1OPLA 5KCOA 1ZSZA 3L2ZA 2O4XB 2RQWA 2BE7D 4AG2C 2HQHA 1PSFA 4N4GA 2J6FA 2O88A 4C0GA 2HL5C 4GLMA 1VQ9Q 2M0YA 1JBMA 3UT1A 2L0AA 1K4US 2F1LA 1LCKA 5CO7A 1VQLQ 2JZ2A 2LZ6B 6AT1B 2YHTA 1WZOA 5GJVB 4UC4A 3OYEA 1B7TA 2H3EB 2HMAA 2SEMA 2GNCA 2EGEA 3INZA 4M78E 2J05A 3PMIA 2EFIA 5M9OA 1VIFA 4M77D 5GANf 3CCJA 4RTTA 4RTUA 1YI2Q 2CSIA 2EGCA 2DBMA 1XNIA 4C92F 3OY9A 5KE3A 2I0NA 2I2LA 4JRIA 4E7HA 3VRYA 3HRUA 4M77G 3CCVT 1T3SA 4BE2A 1WJSA 5IXFA 5CR2A 5KCHA 1NEBA 1N6AA 4AFZC 2JW4A 2GF7A 4DA4A 2LC4A 4DEYA 2A3LA 2COZA 4MMLA 4FW1A 1ZA2B 3UA6A 4OGEA 2JOYA 2DETA 3NPFA 1KD1C 3Q1JA 3JCMP 2YUQA 1D0ZA 5FU6B 5A0DA 1TG0A 4CC7A 5ECAA 4FSSA 2E5QA 3V7RA 4ZGDB 3SWNB 1WDXA 1LVKA 2Y4YA 1OOTA 3CMEQ 3I55Q 3EG9A 2LRQA 2NYSA 2EYYA 4RUGA 2RJEA 1FX7A 3OW2P 2LP5A 1RAHB 1WFWA 3QHSA 1WIEA 1X2QA 2L89A 5GJWB 4C8QB 2E6ZA 3MCAB 3BY7A 1JU5C 1AD5A 1Y96A 2YUPA 1D3BA 1AWJA 4C92G 2RI2A 1KG1A 3VS3A 3EG3A 2CZ1B 1E6GA 5GAMf 3CBPA 1KIKA 1XOVA 1EFNA 2QDYB 4M7AA 5A0LA 5KYUB 5LJ5g 3SHWA 1U1TA 3V8KA 3EHQA 1WHHA 1VQ5Q 4EMHA 3CXCS 2GBQA 4M7DE 4EPCA 3EAEA 4KGVB 3CCJQ 4JJDA 2KI7A 3CCLA 2LCCA 2KRMA 3JSCA 4C5IA 1WJQA 4FIBA 3DB3A 1YJNT 2LCLA 1WNLA 2O9SA 4OMMA 5L8RE 1YJ9Q 2BZXA 4PJLA 2K5IA 4IUPA 3TCJA 4AFUC 1KD1U 3TEEA 3GIBA 2DERA 2F5KA 2DMOA 3NFCA 3CD6A 3HP9A 3X20B 1HJDA 3H0IA 1WA7A 3JB9J 4FW2A 4LD9K 1U1SA 3RKYA 3JB9F 3G71A 3ULRB 1JO8A 1RAAB 1KC8R 2M51A 2QQ9A 3CCUT 3M5AA 2FZGB 1RABB 2DEQA 5GMKj 4LDXA 4FM4B 2RPNA 2DKGA 3LLRA 2JT4A 3EH2A 3H0HA 1JRIA 1VQNT 3CCSQ 2P0QA 2GTOA 5GMKi 4HVWA 1LJOA 4OMOA 1T0HA 3X28B 2HAXA 3BE3A 3REAB 1I81A 3OYAA 1RAEB 4KH0B 3QSUA 4BY6C 5I21A 1BIBA 3J7AF 1C0MA 1YIJT 1VQOA 1FMWA 3OYNA 2DPPB 4HCBA 3L2QA 4F7UB 4EDUA 1G3SA 4JLGA 4Z88A 1K1ZA 4C0FA 1YHQT 4WF2A 1IRXA 4OMPA 1TTHB 1IO6A 2ZCFB 2QASA 3R6NA 4A54A 4XAXB 3CCET 1B34A 4JPBW 4E7ZA 2HCKA 4M75D 1NLPC 1S1NA 5LJ3f 4E7SA 2K7AA 2GFUA 3CBOA 1Y0MA 3VS6A 2DVJA 1UJYA 5LJ5j 3MO8A 3RKXA 3PFSA 4E6RA 4M75G 1U5SA 1Y57A 3SB2A 3A5ZB 4QQDA 1VQKQ 1QMCA 1AZEA 4JLIA 3G71Q 5FU7B 4J9BA 3RUXA 1TOVA 1GBQA 3PMTA 3FC3A 2XDBA 5C6SA 5IHKA 2WSEE 1FXXA 3M0UA 3X24B 1OX9A 5LJ5d 2JTFA 1QVPA 4ZTFA 3CPFA 4XTWA 2PTKA 2RQVA 4M78A 3OS0A 3H9NA 4CI0C 2NLUA 1H92A 3PE0A 3C0CA 2E64A 1VQPA 4AFSC 4BUGA 2ZPFB 3CC7A 3MJXA 1LNXA 1M2VA 2DTHA 2DJZA 2MI6A 3GPLA 1XJWB 3M4YA 3G6EQ 3RESA 3UDCA 3GLXA 1IGQA 1OULA 3C12A 3MEWA 4XTXA 1G3YA 5EC7A 3GNFB 4C8QF 1VQOQ 1M1GA 2KRNA 3RMSA 2RB6A 2EGAA 2MF2A 1K73C 3EGUA 3BDUA 1N8RC 1K9MC 3CBMA 1ZBXA 4GLKA 4PNOA 3M9QA 1NYFA 4R56A 1VQ6Q 3E19A 4B9XA 3MP6A 4CC2A 1Q81R 1QVGS 4M77C 3PIPA 4N4HA 1D0YA 1WQWA 3TU4K 3OSSC 3M0PA 1K0XA 3ER0A 4FL6A 1VYVA 4ELYC 2X3WD 4O5VA 1QVFP 1M9SA 1VQMA 3CC2A 3CPWP 1G83A 1UUEA 1X6GA 4IUVA 3H0FA 3JCMg 4J6XA 4C92B 3J81E 3TREA 4OF1A 2YSQA 1BYMA 2LJ0A 1EIFA 4KGZB 1QCOA 1ZSZB 4OMLA 2KEAA 5FWBA 4C8QD 3CMAT 1X75C 3UA7A 1AOJA 3GF5A 3A8GB 4OB0B 3VUZA 2HQXA 2DIGA 2AKLA 3VS7A 4QKUA 3A1PA 1IHVA 2KRSA 4E7IA 4C8QG 4BI8B 2G3RA 4QT7A 4QW2A 5CKFA 4Z89A 2DF6A 3S6WA 2VVKA 4C92C 2KGTA 4FCYA 2YUNA 2BE9B 2M16A 1BBZA 4A4GA 4M7DA 4BB7A 5GAOn 5DM7R 3HKSA 1VQPQ 2OI3A 2SRCA 2W0ZA 2DIQA 1UJ0A 3CXCA 3G4SA 1K73U 1QCFA 2BIVA 2IG0A 1K9MU 2CP5A 1N8RU 1BCMA 1SEMA 2PNIA 3E1SA 5CK9A 1WX6A 3FRNA 3UWNA 5CCAA 2JMCA 3P8BB 1OEBA 3URGA 3PIOA 2ZZDA 3VU3C 2GGRA 1YFNA 1NEGA 1CSKA 2R58A 3QXEB 5AT1B 4OVAA 1Q7YR 1WYXA 4RTVA 5KYXB 2DVEA 4A63B 1QWFA 2ZPIB 4PJOF 5GMKl 3FIFA 9ATCB 2RI5A 2DXBA 2YLBA 3EG9B 4M7DF 2P4TA 3M56A 4ZTJA 2FL7A 5D6XA 4RCCA 2QG9B 3LW5E 1V1CA 1IB8A 1QKWA 1D1CA 4BDYA 1WJRA 1PD1A 5GMKm 3J80E 2HKQB 2P4RA 1QVFA 3OW2S 4RTWA 3EGDA 3M59A 4F16A 4EMKB 5IXBA 1U3OA 1D3BB 4N0AA 3EGXA 1QP2A 2RQUA 1X2KA 2FB7A 1YJWQ 1NJIC 4A4HA 5GMKe 3VYHB 3OS5A 2ED1A 1CKBA 3ZL7C 1I0CA 1Q86C 4LN2A 2LMJA 3CC4Q 2DL7A 4AG1C 1N9SA 1S72T 3WVEB 2RJFA 3I56T 4NL2A 2A0FB 2KNBB 2YXYA 3CCRT 2BUDA 3RBBB 1J3TA 1X69A 1WHMA 5GAN3 4F7UG 2AZVA 4ANJA 3GNGA 2R5AA 3OB9A 3GP8A 2DA9A 1UDLA 2RNAA 3MEUA 2EYXA 5IHIA 2ZPGB 4PJOG 2C06A 2FZKB 2QQSA 4C0ZA 2D8HA 4DOVA 3JCMd 2WSFE 4FYWB 3MEVA 4JJCA 2QYZA 4ZGJB 1H3ZA 3F70A 2L5QA 2QA4T 1F1BB 3QZ5B 1ZUUA 4Z02A 1FYNA 1I1JA 2GCXA 4NL3A 1I5OB 5LJ5f 3E2UA 2JXBA 1PC0A 2ZGWA 4XK8E 4EIKA 1NPRA 2YUOA 2JM9A 1IGUA 2DFUA 1W6XA 5HCKA 1RUWA 1FWZA 1ZA1B 4YTLA 1VQ9T 4Y92A 2ATCB 2KE9A 4M75C 2DTOA 5LJ5e 3JB9H 2VXFA 4L59A 1VQLT 1X6BA 3M0TA 2V8JA 2E5KA 2ROTA 2X3XD 2WACA 1YITT 1OQKA 1PCXA 1AZGB 4Y28E 3VS0A 1NJIU 3JV3A 1WGSA 1MUZA 1MHNA 2JTEA 1IREB 1ZQ1A 4J5YA 4RMOA 1K8AC 1YI2T 2C0OA 5HK3A 3MKDA 1Q86U 2A37A 4RTXA 3PTAA 2BKDN 2RJCA 5KYYA 3WXMB 5CKHA 1KJWA 4DQ2A 3SDZA 4ZN1A 2IPOB 1TXQA 2Y4XA 1M90R 3JCMX 5L23A 2RN8A 4OP0A 5IH2A 2NUTB 1MNEA 2YLCA 3M4GA 4LDVA 1B34B 2K2VA 4XQ3A 1X01A 2DXCA 2JNGA 3CCQA 2DLPA 2GQIA 1GCQA 4ME7A 1QVGA 5J39A 1N27A 2E1HA 4BE0A 3JB9I 3CMET 2V26A 2CUBA 4C92D 2H3JA 4II1A 2QTXA 1QLYA 2Y90A 5FRMA 1EZZB 4HT9A 2DYIA 3CCUA 4J9CA 3E9FA 2JMAA 1V76A 3OMCA 1PSEA 1UEBA 3FJPA 5D7UA 2XD0A 2LJ1A 3OS2A 1VQNA 5FU6C 4DEXA 1R0CB 1ACMB 1CKAA 2XU8A 2XG8D 2NUPB 2QI2A 1K8AU 3GOXA 2F5TX 1M1KC 3SWNC 3QBYA 2PU9B 4IURA 3V7CA 1QP3A 2RO0A 1VQ5T 1PM3A 2QQBA 3I5RA 1WHKA 4J6WA 3CCJT 4J7FA 4X1VA 4FSXA 1YIJA 4HA8A 1Q82R 4F7UE 1M2VB 4C8QC 3MP1A 5GAOp 2JVVA 2MPXC 4LXCA 1ZUKA 4E7LA 3EG1A 2A36A 3LGLA 1YHQA 3VS5A 1YJ9T 1JEGA 4B9WA 4Y91A 2CGHA 3QWYA 3THKA 3G1JA 3CCEA 3CCMA 2EKOA 1C6VX 5CKEA 1HSQA 1VA7A 2KAFA 3OSVA 4PK4A 5GAOr 5FROA 5GANg 2HL3A 4M7AF 4LUEA 2E65A 3QUIA 2MK5A 3CCQQ 1W2BP 2F2XA 5A0GA 3D7SB 3KBGA 4AFQC 2LJ3A 1HK9A 3SEMA 2O4XA 2XKOC 5IT9E 4LDUA 3JCMW 3NTKA 1QVFS 2YRDA 5HKCA 2KMTA 1M27C 2KK4A 3LH0A 5GMKh 3CCST 1GBRA 3CPWS 1JXOA 2EWNA 1UGQB 3PT9A 3RNJA 2XICA 2FVUA 2EYQA 2W10A 3OYLA 1M1KU 3VJPA 1JXMA 2HD0A 3DB4A 4J8OA 3DKMA 4N4IA 1UG1A 3OW2A 1WXTA 2RHZA 3C95A 1BB9A 3JB9D 4M77E 5FW9A 2RHYA 4J6YA 3DLLA 1NPPA 4F14A 3L42A 1MV0B 2LCSA 1RACB 2CZ6B 1VQ7T 1BI1A 4PJOB 5FWCA 2VB6A 2X4YA 3JB9G 2VASA 1M30A 4M7DB 2YRVA 3JCMf 3CCLQ 3TSWA 1W1FA 2J6KA 3JCMJ 2RM4A 2B86A 5GAMg 2M1HA 4C5HA 1G5VA 3JCMe 3JCMV 4HCZA 3M57A 3L1AA 2VUBA 2HDAA 1UGVA 3CCMQ 3CD6Q 3ZEHA 1VQ8T 1TUGB 3LWIA 1BKBA 5LJ5h 1VQKT 1K76A 4PJOC 1MMNA 4DBHA 2X4XA 3G71T 3NHNA 1PKTA 4C92E 4J7IA 2K9GA 1UHFA 2DRMA 3SFMA 1QQJA 2E4HA 2HKNA 1ARKA 4KUDK 1NG2A 4EMGA 1H3HA 2K3BA 3DLMA 1VQ4T 1NYGA 2DO3A 3JCMQ 2J6OA 1W4SA 5I22A 2DZ9A 2R57A 5D6WA 4LD6A 1BU1A 8AT1B 3V7SA 1UGPB 1RAFB 5KYUA 5GANj 2FEIA 3EGXB 3NTHA 3L2WA 1WI7A 4J9FA 4HCKA 5FU7C 1KQ1A 3G6ET 2VXEA 2O31A 2RK2A 1VQOT 4RCBA 2OTLT 4BD3A 1NE8A 3OYFA 4KH1B 4JZ4A 3UF4A 1LOJA 1UECA 1KD1R 1VQ6T 3JRZA 2FPDA 4MDWA 2DBKA 3FJ5A 4KUIA 3QWXX 2AKKA 3PNWC 4LDWA 5AYFA 2EQIA 5KYWB 2D8JA 4ELZC 2JTMA 4JZ3A 2QXFA 4M78F
chains in the Genus database with same CATH topology
1TG0A 4CC7A 2O9VA 2ED1A 5ECAA 1CKBA 3O5ZA 3EG2A 4FSSA 3TVTA 3ZL7C 1I0CA 2MIOA 4LN2A 3I35A 2F2VA 1UHCA 2LMJA 1WDXA 2DL7A 1OOTA 4AG1C 2CUDA 2EYYA 4RUGA 2KNBB 3TSZA 2ENMA 2BTTA 2JM8A 2LP5A 3RBBB 2MCNA 1J3TA 1X69A 1WFWA 1SHFA 1WIEA 1SSHA 1X2QA 5GJWB 1ABQA 4ZNXA 2AZVA 1T0JA 1JU5C 1AD5A 1YP5A 2K79A 2YUPA 2DA9A 1UDLA 2RNAA 2EYXA 2CSQA 5IHIA 1RI9A 1AWJA 3CQTA 3VS3A 3EG3A 1WXBA 1E6GA 1RLQC 5IHNA 3I9QA 2D8HA 1XOVA 1KIKA 1EFNA 3M0QA 4JJCA 2OAWA 3SHWA 2EPDA 4J9GA 3EHQA 1PWTA 1ZUUA 1I1JA 1FYNA 1AWWA 1T3LA 2C0IA 2EBPA 2GBQA 1QWEA 2JXBA 2ECZA 4EIKA 1QKXA 4JJDA 2YUOA 2JM9A 2KRMA 1W6XA 2L3PA 2NUZA 5HCKA 1RUWA 2CT4A 4RTZA 2FO0A 4Y92A 3NMZC 4J9DA 2KE9A 1GFCA 2O2OA 2O9SA 3M0RA 1X6BA 3M0TA 2EVRA 4IIMA 4OMMA 2E5KA 2ED0A 2BZXA 2ROTA 2X3XD 2FG0A 2LX7A 4AFUC 2CH4W 4HVVA 1AZGB 3VS0A 3JV3A 2DMOA 3VS2A 1MUZA 2KROA 2JTEA 2CH4A 1U06A 1HJDA 2V1QA 2C0OA 2A37A 3H0IA 1WA7A 1YNZA 1OV3A 2RMOA 4OMQA 4RTXA 3KFVA 1H8KA 3ULRB 1JO8A 2ESWA 2M51A 1KJWA 4CC3A 1K9AA 2FRWA 4D8KA 1AEYA 2KXCA 2LNHB 2XMFA 3VS1A 2RPNA 1PNJA 2JT4A 5L23A 2RN8A 5IH2A 3H0HA 2CREA 2KBTA 1WLPB 2GTOA 4HVWA 4OMOA 1UE9A 3VRZA 1T0HA 2RQTA 2J06A 2KXDA 4K11A 2RF0A 1ABOA 2DLPA 3REAB 2DNUA 2GQIA 2LQNA 1GCQA 1M3AA 2F2WA 1GL5A 2MOXA 2CUBA 2L2PA 2KYMA 2AK5A 1QLYA 1KSWA 1AVZC 4Z88A 1K1ZA 4J9CA 2JMAA 2NWMA 1B07A 4OMPA 1IO6A 3EG0A 1ZUYA 3GBQA 2FPFA 1M3CA 3R6NA 2LJ1A 2EKHA 1NM7A 2FRYA 1SRMA 1GFDA 3IQLA 4JPBW 1HD3A 4DEXA 1CKAA 2HCKA 1NLPC 1S1NA 2JS0A 2C0TA 2K7AA 1Y0MA 3VS6A 1PKSA 2DVJA 1UJYA 2D1XA 1ZX6A 2A08A 4RTYA 4M4ZA 4E6RA 1KFZA 4JJBA 1U5SA 1M8MA 1Y57A 3I5RA 1I07A 4X1VA 2EYZA 1K0SA 1Z9QA 1AZEA 1YN8A 1UFFA 1ZUKA 4J9BA 3EG1A 1GBQA 2A36A 4LNPA 3VS5A 1JEGA 1SPKA 2L3SA 5IHKA 3QWYA 3M0UA 4LUDA 1AWXA 3THKA 2HSPA 1YWOA 1W70A 2BZYA 1HSQA 1VA7A 1VYUA 2KYBA 1FMKA 2PTKA 2RQVA 2A28A 1H92A 3PE0A 2LQWA 3C0CA 4LUEA 4AFSC 1SHGA 1AWOA 4GBQA 2F2XA 1NLOC 1WXUA 2GTJA 2LJ3A 4AFQC 3SEMA 4HXJA 2YT6A 2KR3A 2J7IA 2L3QA 5EC7A 1M27C 1YWPA 2KRNA 1JQQA 1GBRA 2EGAA 1JXOA 1PRLC 4IIOA 2K2MA 2K6DA 3EGUA 4WCIA 4Z8AA 3RNJA 1NYFA 2W10A 1JXMA 2ROLA 1ZLMA 4CC2A 2DL5A 1GCQC 3A98A 1UG1A 2QDLA 2DILA 1WXTA 2FPEA 3M0PA 2DL4A 4LE9A 3U23A 3VS4A 1BB9A 1K0XA 2DL8A 5FW9A 1VYVA 2X3WD 2KT1A 1ZBJA 1MV0B 4F14A 2LCSA 2PZ1A 4R0KA 1G83A 1UUEA 1X6GA 3H0FA 1ZSGA 3REBB 5FWCA 2YDLA 2YSQA 1M30A 2LJ0A 1X27A 2EYWA 1RLPC 4OMLA 2DJQA 2KEAA 2G6FX 2RQRA 4OMNA 5FWBA 3TSWA 1B3QA 1W1FA 2J6KA 3UA7A 2DM1A 2EW3A 2DYBA 2HBWA 2B86A 1AOJA 3PVQA 2AKLA 3VS7A 2ABLA 2DRKA 2VKNA 2KRSA 3I5SA 1M3BA 1E6HA 2HDAA 1UGVA 1GCPA 2DL3A 1YCSB 4QT7A 1BK2A 4KRTA 1TUDA 4Z89A 3H41A 1VYTA 2DF6A 2VVKA 4D8DA 2AZSA 2KGTA 1K76A 2OJ2A 3NGPA 3PVLA 2YUNA 2H8HA 2IIMA 1BBZA 1SRLA 1PHTA 1Z9ZA 3NHNA 4HVUA 1OPLA 1PKTA 2K9GA 2RQWA 2OI3A 2BZ8A 2SRCA 1UHFA 2W0ZA 3EHRA 2DRMA 1UJ0A 4AG2C 1QCFA 2CT3A 2D0NA 1ARKA 1MV3A 1NG2A 2J6FA 2O88A 1SEMA 4F17A 2VWFA 1H3HA 2K3BA 2PNIA 4GLMA 2M0YA 1WX6A 2CDTA 3UATA 2JMCA 2L0AA 1K4US 1A0NB 1NYGA 1LCKA 4J9HA 1X43A 2J6OA 1OPKA 5I22A 3LH5A 2LZ6B 1OEBA 5GJVB 1BU1A 2SEMA 2GGRA 4ORZA 2GNCA 2EGEA 1NEGA 2J05A 1CSKA 2FEIA 1PRMC 1WI7A 2KT8A 4HCKA 4J9FA 4RTTA 4RTUA 1WYXA 1G2BA 2CSIA 4RTVA 2O31A 2EGCA 2DBMA 4A63B 1QWFA 2I0NA 3VRYA 1UTIA 4J9IA 1T3SA 2DX1A 4JZ4A 3UF4A 1UECA 5IXFA 2HEQA 5I11A 4ESRA 1NEBA 1E7OA 2FPDA 2DBKA 1V1CA 4AFZC 2JW4A 3FJ5A 1QKWA 4DEYA 3QWXX 2AKKA 4CC4B 2P4RA 2V1RA 1GRIA 1N5ZA 2EQIA 2DE0X 4RTWA 3UA6A 4F16A 2D8JA 2JS2A 5IXBA 1U3OA 3NPFA 2RQUA 1X2KA 3M0SA 1TUCA 4J9EA 4JZ3A 2YUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TG0 A;  4CC7 A;  2O9V A;  2ED1 A;  5ECA A;  1CKB A;  3O5Z A;  3EG2 A;  4FSS A;  3TVT A;  3ZL7 C;  1I0C A;  2MIO A;  4LN2 A;  3I35 A;  2F2V A;  1UHC A;  2LMJ A;  1WDX A;  2DL7 A;  1OOT A;  4AG1 C;  2CUD A;  2EYY A;  4RUG A;  2KNB B;  3TSZ A;  2ENM A;  2BTT A;  2JM8 A;  2LP5 A;  3RBB B;  2MCN A;  1J3T A;  1X69 A;  1WFW A;  1SHF A;  1WIE A;  1SSH A;  1X2Q A;  5GJW B;  1ABQ A;  4ZNX A;  2AZV A;  1T0J A;  1JU5 C;  1AD5 A;  1YP5 A;  2K79 A;  2YUP A;  2DA9 A;  1UDL A;  2RNA A;  2EYX A;  2CSQ A;  5IHI A;  1RI9 A;  1AWJ A;  3CQT A;  3VS3 A;  3EG3 A;  1WXB A;  1E6G A;  1RLQ C;  5IHN A;  3I9Q A;  2D8H A;  1XOV A;  1KIK A;  1EFN A;  3M0Q A;  4JJC A;  2OAW A;  3SHW A;  2EPD A;  4J9G A;  3EHQ A;  1PWT A;  1ZUU A;  1I1J A;  1FYN A;  1AWW A;  1T3L A;  2C0I A;  2EBP A;  2GBQ A;  1QWE A;  2JXB A;  2ECZ A;  4EIK A;  1QKX A;  4JJD A;  2YUO A;  2JM9 A;  2KRM A;  1W6X A;  2L3P A;  2NUZ A;  5HCK A;  1RUW A;  2CT4 A;  4RTZ A;  2FO0 A;  4Y92 A;  3NMZ C;  4J9D A;  2KE9 A;  1GFC A;  2O2O A;  2O9S A;  3M0R A;  1X6B A;  3M0T A;  2EVR A;  4IIM A;  4OMM A;  2E5K A;  2ED0 A;  2BZX A;  2ROT A;  2X3X D;  2FG0 A;  2LX7 A;  4AFU C;  2CH4 W;  4HVV A;  1AZG B;  3VS0 A;  3JV3 A;  2DMO A;  3VS2 A;  1MUZ A;  2KRO A;  2JTE A;  2CH4 A;  1U06 A;  1HJD A;  2V1Q A;  2C0O A;  2A37 A;  3H0I A;  1WA7 A;  1YNZ A;  1OV3 A;  2RMO A;  4OMQ A;  4RTX A;  3KFV A;  1H8K A;  3ULR B;  1JO8 A;  2ESW A;  2M51 A;  1KJW A;  4CC3 A;  1K9A A;  2FRW A;  4D8K A;  1AEY A;  2KXC A;  2LNH B;  2XMF A;  3VS1 A;  2RPN A;  1PNJ A;  2JT4 A;  5L23 A;  2RN8 A;  5IH2 A;  3H0H A;  2CRE A;  2KBT A;  1WLP B;  2GTO A;  4HVW A;  4OMO A;  1UE9 A;  3VRZ A;  1T0H A;  2RQT A;  2J06 A;  2KXD A;  4K11 A;  2RF0 A;  1ABO A;  2DLP A;  3REA B;  2DNU A;  2GQI A;  2LQN A;  1GCQ A;  1M3A A;  2F2W A;  1GL5 A;  2MOX A;  2CUB A;  2L2P A;  2KYM A;  2AK5 A;  1QLY A;  1KSW A;  1AVZ C;  4Z88 A;  1K1Z A;  4J9C A;  2JMA A;  2NWM A;  1B07 A;  4OMP A;  1IO6 A;  3EG0 A;  1ZUY A;  3GBQ A;  2FPF A;  1M3C A;  3R6N A;  2LJ1 A;  2EKH A;  1NM7 A;  2FRY A;  1SRM A;  1GFD A;  3IQL A;  4JPB W;  1HD3 A;  4DEX A;  1CKA A;  2HCK A;  1NLP C;  1S1N A;  2JS0 A;  2C0T A;  2K7A A;  1Y0M A;  3VS6 A;  1PKS A;  2DVJ A;  1UJY A;  2D1X A;  1ZX6 A;  2A08 A;  4RTY A;  4M4Z A;  4E6R A;  1KFZ A;  4JJB A;  1U5S A;  1M8M A;  1Y57 A;  3I5R A;  1I07 A;  4X1V A;  2EYZ A;  1K0S A;  1Z9Q A;  1AZE A;  1YN8 A;  1UFF A;  1ZUK A;  4J9B A;  3EG1 A;  1GBQ A;  2A36 A;  4LNP A;  3VS5 A;  1JEG A;  1SPK A;  2L3S A;  5IHK A;  3QWY A;  3M0U A;  4LUD A;  1AWX A;  3THK A;  2HSP A;  1YWO A;  1W70 A;  2BZY A;  1HSQ A;  1VA7 A;  1VYU A;  2KYB A;  1FMK A;  2PTK A;  2RQV A;  2A28 A;  1H92 A;  3PE0 A;  2LQW A;  3C0C A;  4LUE A;  4AFS C;  1SHG A;  1AWO A;  4GBQ A;  2F2X A;  1NLO C;  1WXU A;  2GTJ A;  2LJ3 A;  4AFQ C;  3SEM A;  4HXJ A;  2YT6 A;  2KR3 A;  2J7I A;  2L3Q A;  5EC7 A;  1M27 C;  1YWP A;  2KRN A;  1JQQ A;  1GBR A;  2EGA A;  1JXO A;  1PRL C;  4IIO A;  2K2M A;  2K6D A;  3EGU A;  4WCI A;  4Z8A A;  3RNJ A;  1NYF A;  2W10 A;  1JXM A;  2ROL A;  1ZLM A;  4CC2 A;  2DL5 A;  1GCQ C;  3A98 A;  1UG1 A;  2QDL A;  2DIL A;  1WXT A;  2FPE A;  3M0P A;  2DL4 A;  4LE9 A;  3U23 A;  3VS4 A;  1BB9 A;  1K0X A;  2DL8 A;  5FW9 A;  1VYV A;  2X3W D;  2KT1 A;  1ZBJ A;  1MV0 B;  4F14 A;  2LCS A;  2PZ1 A;  4R0K A;  1G83 A;  1UUE A;  1X6G A;  3H0F A;  1ZSG A;  3REB B;  5FWC A;  2YDL A;  2YSQ A;  1M30 A;  2LJ0 A;  1X27 A;  2EYW A;  1RLP C;  4OML A;  2DJQ A;  2KEA A;  2G6F X;  2RQR A;  4OMN A;  5FWB A;  3TSW A;  1B3Q A;  1W1F A;  2J6K A;  3UA7 A;  2DM1 A;  2EW3 A;  2DYB A;  2HBW A;  2B86 A;  1AOJ A;  3PVQ A;  2AKL A;  3VS7 A;  2ABL A;  2DRK A;  2VKN A;  2KRS A;  3I5S A;  1M3B A;  1E6H A;  2HDA A;  1UGV A;  1GCP A;  2DL3 A;  1YCS B;  4QT7 A;  1BK2 A;  4KRT A;  1TUD A;  4Z89 A;  3H41 A;  1VYT A;  2DF6 A;  2VVK A;  4D8D A;  2AZS A;  2KGT A;  1K76 A;  2OJ2 A;  3NGP A;  3PVL A;  2YUN A;  2H8H A;  2IIM A;  1BBZ A;  1SRL A;  1PHT A;  1Z9Z A;  3NHN A;  4HVU A;  1OPL A;  1PKT A;  2K9G A;  2RQW A;  2OI3 A;  2BZ8 A;  2SRC A;  1UHF A;  2W0Z A;  3EHR A;  2DRM A;  1UJ0 A;  4AG2 C;  1QCF A;  2CT3 A;  2D0N A;  1ARK A;  1MV3 A;  1NG2 A;  2J6F A;  2O88 A;  1SEM A;  4F17 A;  2VWF A;  1H3H A;  2K3B A;  2PNI A;  4GLM A;  2M0Y A;  1WX6 A;  2CDT A;  3UAT A;  2JMC A;  2L0A A;  1K4U S;  1A0N B;  1NYG A;  1LCK A;  4J9H A;  1X43 A;  2J6O A;  1OPK A;  5I22 A;  3LH5 A;  2LZ6 B;  1OEB A;  5GJV B;  1BU1 A;  2SEM A;  2GGR A;  4ORZ A;  2GNC A;  2EGE A;  1NEG A;  2J05 A;  1CSK A;  2FEI A;  1PRM C;  1WI7 A;  2KT8 A;  4HCK A;  4J9F A;  4RTT A;  4RTU A;  1WYX A;  1G2B A;  2CSI A;  4RTV A;  2O31 A;  2EGC A;  2DBM A;  4A63 B;  1QWF A;  2I0N A;  3VRY A;  1UTI A;  4J9I A;  1T3S A;  2DX1 A;  4JZ4 A;  3UF4 A;  1UEC A;  5IXF A;  2HEQ A;  5I11 A;  4ESR A;  1NEB A;  1E7O A;  2FPD A;  2DBK A;  1V1C A;  4AFZ C;  2JW4 A;  3FJ5 A;  1QKW A;  4DEY A;  3QWX X;  2AKK A;  4CC4 B;  2P4R A;  2V1R A;  1GRI A;  1N5Z A;  2EQI A;  2DE0 X;  4RTW A;  3UA6 A;  4F16 A;  2D8J A;  2JS2 A;  5IXB A;  1U3O A;  3NPF A;  2RQU A;  1X2K A;  3M0S A;  1TUC A;  4J9E A;  4JZ3 A;  2YUQ A; 
#chains in the Genus database with same CATH topology
 1R0B G;  4A53 A;  2F2V A;  2CP7 A;  1UHC A;  3ME9 A;  1DJ7 B;  3QDF A;  3OYM A;  4HT8 A;  3AT1 B;  1C1A A;  4MMK A;  4HKE A;  3TSZ A;  2CP3 A;  2JM8 A;  4IUT A;  4QVD A;  2MCN A;  3OYC A;  1KQS S;  1SHF A;  1SSH A;  1ABQ A;  3MP8 A;  4ZNX A;  1T0J A;  2QEX A;  2CSQ A;  4BAC A;  1RI9 A;  5LJ3 g;  2RH2 A;  1EX4 A;  2DAQ A;  1WXB A;  1RLQ C;  3OBW A;  1LPL A;  2KQW A;  2AT1 B;  1SKU B;  2LTO A;  5HY6 A;  4ZGE B;  3JAM E;  4PKC C;  2DD4 A;  2EJF A;  2EPD A;  1PWT A;  5LL6 S;  1AWW A;  3MHX A;  3OYI A;  1MMA A;  1ZSZ C;  2C0I A;  3E9G A;  4Q5W A;  2X51 A;  3CC7 Q;  4PFZ A;  2YRC A;  2ECZ A;  1S72 A;  1R8O B;  4M78 G;  2L3P A;  2CT4 A;  2LX9 A;  4E47 A;  3SD4 A;  3CCR A;  2O01 E;  3NMZ C;  4J9D A;  1VIE A;  4X9D A;  1OZ2 A;  1GFC A;  1SF9 A;  5J3B A;  2EQK A;  4JS4 A;  3BFM A;  2DK3 A;  4IIM A;  2EVR A;  4JS5 A;  3P8H A;  1OZ3 A;  4M75 E;  1ZHI A;  2XDP A;  3V8L A;  1MMG A;  2CS7 A;  3MPU B;  2A7Y A;  2LX7 A;  1OU8 A;  1GXI E;  4MZM A;  4FYY B;  2ZPH B;  2QA4 A;  2OTJ T;  4OMQ A;  3KFV A;  1TU0 B;  4XTU A;  1VQM Q;  3CC2 Q;  2K5L A;  4NOY A;  4D8K A;  2KXC A;  2LNH B;  3VS1 A;  3HRS A;  1H64 1;  4ZN3 A;  1I8F A;  1PNJ A;  1VQ9 A;  1XTD A;  2K4Y A;  1KC8 C;  2DXT A;  2CRE A;  1SG5 A;  1Y96 B;  2KBT A;  3C4S A;  1WLP B;  3CPW A;  1AHJ B;  1UE9 A;  1YJW T;  3R6O A;  2P0K A;  1YIT A;  2J06 A;  2QEX Q;  4K11 A;  3LWH A;  3HSB A;  1AT1 B;  4L5G A;  2DNU A;  4M7A B;  3JCM b;  4M77 A;  2LQN A;  3A8M B;  2RJD A;  3CC4 T;  2F2W A;  2FZC B;  3HFN A;  3OYK A;  2L2P A;  4PJO D;  2KYM A;  3WVD B;  2RI3 A;  1KSW A;  3CCV A;  3JCM h;  4M7D D;  1BIA A;  4WTO B;  5GAN 6;  1P92 A;  1B07 A;  3FEO A;  3EG0 A;  4EMK C;  3QYH B;  3G4S Q;  1S72 Q;  2EKH A;  5KH6 A;  1SRM A;  1Q82 U;  1GFD A;  4BI3 A;  3IQL A;  4M7D G;  5LJ3 j;  3CCR Q;  1UB4 A;  2JS0 A;  2OAU A;  2AIR B;  3VYG A;  1FMV A;  4PLL A;  3V8J A;  4PFP A;  1KQS P;  1ZX6 A;  2DXU A;  2LQK A;  3QKJ A;  2A08 A;  3PGG A;  4M4Z A;  4RTY A;  1KFZ A;  3EFS A;  1M8M A;  3CME A;  3LX7 A;  1I07 A;  2LQ8 A;  1JB0 E;  4QVC A;  2EYZ A;  3X25 B;  5DY9 A;  4C92 A;  1K0S A;  7AT1 B;  3OYG A;  2QA4 Q;  2XDD A;  1NZ9 A;  1YN8 A;  1UFF A;  2VV5 A;  3EFO A;  4E7K A;  4A4E A;  4E2F B;  1KC8 U;  4C8Q E;  4VUB A;  1W2B S;  1SPK A;  2L3S A;  4RG8 A;  3OQ5 A;  1AWX A;  2M02 A;  2HSP A;  1YWO A;  1Y07 A;  3LYI A;  3TQ7 P;  1VYU A;  2QK0 A;  2GFA A;  4FYV B;  2KYB A;  2EJ9 A;  2QGF B;  2A28 A;  1IXD A;  1HXD A;  1VQ5 A;  1SHG A;  1YIT Q;  5A2Q E;  1AWO A;  4GBQ A;  1Y71 A;  1RL2 A;  2E6N A;  1K73 R;  1VUB A;  3HHT B;  1NLO C;  1WXU A;  2X35 A;  1K9M R;  1N8R R;  3OYB A;  1M5Q 1;  2YT6 A;  3H8Z A;  3VUB A;  5J26 A;  1YJN A;  2J7I A;  4DOW A;  2L3Q A;  1KQ2 A;  1YWP A;  2FHD A;  4IIO A;  3RIR A;  5GAN e;  1YJ9 A;  3CCV Q;  1KHC A;  4WCI A;  4DBQ A;  4Z8A A;  2VC8 A;  2B8A A;  4OB3 B;  3ZBD A;  2CP0 A;  5C0M A;  2ROL A;  2PUO B;  1YCY A;  2QDL A;  3I55 T;  3U23 A;  2DL4 A;  3VS4 A;  2DL8 A;  5KE2 A;  3BW1 A;  2KDS A;  2KT1 A;  4JJN K;  2YWW A;  3QO3 A;  2PZ1 A;  4R0K A;  2EJG A;  1Q81 C;  3QG1 A;  4XTV A;  1ZSG A;  5KYX A;  3REB B;  1G3W A;  2E12 A;  5I2S A;  2YDL A;  1R77 A;  2E3I A;  3HTR A;  5DLO A;  2LVM A;  2DJQ A;  3M55 A;  2G6F X;  4OMN A;  3CCS A;  1B3Q A;  1M2O A;  3OBY A;  3RMQ A;  2OX7 A;  2GQV A;  2HBW A;  3MET A;  5CQX A;  1KQS A;  2DEU A;  3PVQ A;  2PUK B;  2ABL A;  2DRK A;  4EMK A;  5GAO l;  3I5S A;  1E6H A;  4M78 B;  1GCP A;  4OB1 B;  4IKF A;  2DL3 A;  2PVG B;  2PVO B;  4V2S A;  1TUD A;  3H41 A;  4D8D A;  2AZS A;  3PVL A;  5GAO m;  4HCC A;  2XHC A;  4OGC A;  1VQ7 A;  4HVU A;  5GAM e;  2E3H A;  4PJO E;  3A8O B;  1D09 B;  2BZ8 A;  3EHR A;  2L3R A;  3C94 A;  2CT3 A;  2D0N A;  2HNI A;  2CZ7 B;  2EQJ A;  2X4W A;  1MV3 A;  4J83 A;  1JJ2 S;  2XK0 A;  2COW A;  4XTZ A;  2ZAE A;  4F17 A;  2VWF A;  4XU3 A;  4M75 A;  2CDT A;  1YJN Q;  1IHW A;  3UAT A;  1A0N B;  4J9H A;  1X43 A;  1OPK A;  4KGX B;  3CEY A;  3LH5 A;  4M78 C;  1X6O A;  2F69 A;  2D0Q B;  4ORZ A;  5IAY A;  3T9N A;  2LDM A;  3CCQ T;  1PRM C;  1VQ8 A;  1Q81 U;  1HYO A;  2RHI A;  4JRP A;  1BI3 A;  2KT8 A;  3LGF A;  1VQK A;  2JJ9 A;  1G2B A;  3OYD A;  4BY6 B;  1SSF A;  4X9C A;  1UTI A;  4J9I A;  4F04 B;  2DX1 A;  3CCU Q;  4OB2 B;  1Q7Y C;  2HEQ A;  5I11 A;  1KHI A;  4ESR A;  1NJI R;  1E7O A;  5CKD A;  1Q95 G;  4A4F A;  2RD1 A;  4IUQ A;  4D6W A;  4CC4 B;  1Q86 R;  2V1R A;  1GRI A;  1N5Z A;  1VQ4 A;  2DE0 X;  1VQN Q;  2VGM A;  2RA2 A;  3QPH A;  2JS2 A;  1QCN A;  4JRK A;  2KY9 A;  4M75 F;  4M7A D;  3M0S A;  1TUC A;  1RAG B;  4J9E A;  3M53 A;  2RK1 A;  2O9V A;  2AHJ B;  3O5Z A;  3FDR A;  3EG2 A;  3TVT A;  2EQU A;  2MIO A;  3OYH A;  3I35 A;  2RHU A;  3G6E A;  1RAI B;  4M7A G;  2CUD A;  3CCL T;  5KYN A;  1YIJ Q;  4ATO A;  2OTL A;  2ENM A;  2BTT A;  3M58 A;  1TH7 A;  1M4Z A;  3RKW A;  3VV0 A;  1VQ7 Q;  4O6J A;  2D9T A;  1VQ6 A;  1YP5 A;  2K79 A;  1YHQ Q;  2NUT A;  2DZC A;  3CQT A;  2EQM A;  4MZT A;  3CCM T;  3CCE Q;  5IHN A;  1V29 B;  3OS1 A;  3CD6 T;  4GY5 A;  3I9Q A;  1PG5 B;  2CZ0 B;  2RHX A;  4JRQ A;  1WHL A;  1Y7X A;  4TVR A;  3M0Q A;  3ZFJ A;  2OAW A;  1OX8 A;  3SWN A;  4J9G A;  2K3X A;  1WHG A;  4M7D C;  1UGS B;  1T3L A;  2EBP A;  4XU0 A;  4KBM B;  5HK0 A;  2V8I A;  1RI0 A;  1QWE A;  2EAY A;  5LJ3 e;  1VQ8 Q;  1QKX A;  3RER A;  4XTY A;  4QQ6 A;  1Q7Y U;  2NUZ A;  3QJY A;  4C8Q A;  3CMA A;  4RTZ A;  3MEA A;  2QQR A;  5EG2 A;  3QII A;  2FO0 A;  3S3O A;  2IVW A;  4R55 A;  3OYY A;  1YBY A;  2VYT A;  3OYJ A;  1BI2 A;  2CP2 A;  2O2O A;  1K8A R;  3M0R A;  3KUF A;  4PFO A;  2ED0 A;  1W2B A;  1OI1 A;  2FG0 A;  2CH4 W;  1BCO A;  1UGR B;  3G7Z A;  4HVV A;  2WSC E;  3EGD B;  3UPU A;  2NUP A;  3VS2 A;  2KRO A;  3CXC P;  2CH4 A;  5CAI A;  1O75 A;  4FT2 A;  1U06 A;  4B6M A;  2V1Q A;  1MGQ A;  1YNZ A;  5I2M A;  4FT4 A;  1VQ4 Q;  1OV3 A;  4JUV A;  2RMO A;  1JJ2 P;  5GAN h;  1G3T A;  4M77 B;  1H8K A;  2MAM A;  2ESW A;  4IUU A;  2MYS A;  2K5F A;  1PD0 A;  1WHJ A;  4CC3 A;  8ATC B;  3QYG B;  1K9A A;  2FRW A;  4AT1 B;  1AEY A;  2XMF A;  3HRT A;  2MWO A;  1I5L A;  4QVZ A;  5GAN d;  1XQH A;  2X4J A;  2PVD B;  2P0P A;  5GAN 8;  3X26 B;  3HPW A;  2E10 A;  2OTL Q;  4N0A C;  3VRZ A;  5FRN A;  2K3Y A;  2HBP A;  4E7J A;  2RQT A;  2KXD A;  1MND A;  2RF0 A;  3NTI A;  1M90 C;  1ABO A;  4X34 A;  2D6F A;  1M3A A;  3M54 A;  4DBF A;  4CRI A;  2CYZ B;  2MOX A;  1GL5 A;  2OTJ A;  5GAN 5;  4BE1 A;  2AK5 A;  1M1F A;  3O8V A;  4PLI A;  2K57 A;  1D1B A;  1AVZ C;  4MDX A;  2NWM A;  4A4K A;  1OYX A;  1MMD A;  5CQY A;  3EFR A;  5FLX E;  3OA6 A;  1M1K R;  2Z0W A;  1ZUY A;  3GBQ A;  2FPF A;  2E41 A;  3EFO B;  1M3C A;  5GAM j;  1M8V A;  3EH1 A;  3HL8 A;  1NM7 A;  2FRY A;  1BI0 A;  3N5B B;  2DTI A;  1HD3 A;  1N9R A;  2EIF A;  2HQE A;  3CMA Q;  4C0D B;  1RAD B;  4RKU E;  1KK7 A;  1O9S A;  5GAM h;  3JCM c;  2C0T A;  1YJW A;  4M78 D;  1D1A A;  4KT0 E;  1PKS A;  4RG2 A;  4M7A E;  2D1X A;  1VQP T;  5CIU A;  3S3N A;  3CC7 T;  4F7U A;  3RR6 A;  3CC4 A;  2HZY A;  3L2R A;  4JJB A;  2JN0 A;  2COY A;  4PJJ A;  3I56 A;  5KYY B;  5GAM d;  5GAO q;  4PJO A;  1Z9Q A;  4PJN A;  4LNP A;  2LT1 A;  4AMC A;  1Q82 C;  4C0D C;  4LUD A;  4PL6 A;  4L6V 5;  1W70 A;  3P8D A;  5D6Y A;  1JJ2 A;  2P84 A;  2BZY A;  4FU6 A;  1M90 U;  4XU1 A;  1FMK A;  2E70 A;  4QQG A;  4JDS A;  2M0O A;  5CVI A;  2LQW A;  3L2V A;  1VQM T;  3CC2 T;  3H6Z A;  2VGN A;  2ZPB B;  1VOM A;  3FB9 A;  2GTJ A;  2LNV A;  4HXJ A;  4F7U F;  2KSS A;  2KR3 A;  2OTJ Q;  2HSE B;  3RDV A;  2R5M A;  2M9U A;  1JQQ A;  2QAZ A;  3A8L B;  1VQL A;  4NS5 A;  4XU2 A;  5GAN 4;  1PRL C;  2K2M A;  2K6D A;  1TWB A;  4KUL A;  2QEX T;  1OU9 A;  4OMF B;  3S3M A;  2ZPE B;  1ZLM A;  4DBR A;  2DL5 A;  2V8K A;  3QZ9 B;  5IN1 A;  1GCQ C;  2QQA A;  1YI2 A;  3A98 A;  2CP6 A;  5DLQ E;  2QGG A;  4C5E A;  2DIL A;  2FPE A;  4FYX B;  4LE9 A;  3VKI A;  3KXT A;  1IZ6 A;  3BDL A;  1TS9 A;  1ZBJ A;  4BDZ A;  3ASK A;  3AHU A;  4P5N A;  3QDR B;  3G4S T;  1U8R A;  1X27 A;  2EYW A;  1RLP C;  5GAN 2;  2X9H A;  1QVG P;  3I56 Q;  1QW1 A;  2RQR A;  2JUF A;  4C5G A;  1WPY A;  3OMG A;  2CKK A;  2DM1 A;  2EW3 A;  2DYB A;  4M7A C;  3A8H B;  2PQW A;  4PJM A;  5GAN 7;  2FYK A;  3QJ6 A;  5KYW A;  5LJ3 h;  2VKN A;  1I4K 1;  4M75 B;  1NBE B;  2QTV A;  3FLG A;  3L2U A;  2DD5 A;  1M3B A;  3HFO A;  1TSF A;  3I55 A;  1YCS B;  4M77 F;  2XI9 A;  1BK2 A;  4MZP A;  2MMP A;  4KRT A;  1G8X A;  2L8D A;  2MWP A;  1VYT A;  4BI4 A;  2KVQ G;  1D0X A;  2LT4 A;  2OJ2 A;  3NGP A;  2H8H A;  2IIM A;  2XID A;  1SRL A;  5LJ3 d;  1PHT A;  1WQ7 A;  1Z9Z A;  5CKB A;  4LDY A;  1OPL A;  5KCO A;  1ZSZ A;  3L2Z A;  2O4X B;  2RQW A;  2BE7 D;  4AG2 C;  2HQH A;  1PSF A;  4N4G A;  2J6F A;  2O88 A;  4C0G A;  2HL5 C;  4GLM A;  1VQ9 Q;  2M0Y A;  1JBM A;  3UT1 A;  2L0A A;  1K4U S;  2F1L A;  1LCK A;  5CO7 A;  1VQL Q;  2JZ2 A;  2LZ6 B;  6AT1 B;  2YHT A;  1WZO A;  5GJV B;  4UC4 A;  3OYE A;  1B7T A;  2H3E B;  2HMA A;  2SEM A;  2GNC A;  2EGE A;  3INZ A;  4M78 E;  2J05 A;  3PMI A;  2EFI A;  5M9O A;  1VIF A;  4M77 D;  5GAN f;  3CCJ A;  4RTT A;  4RTU A;  1YI2 Q;  2CSI A;  2EGC A;  2DBM A;  1XNI A;  4C92 F;  3OY9 A;  5KE3 A;  2I0N A;  2I2L A;  4JRI A;  4E7H A;  3VRY A;  3HRU A;  4M77 G;  3CCV T;  1T3S A;  4BE2 A;  1WJS A;  5IXF A;  5CR2 A;  5KCH A;  1NEB A;  1N6A A;  4AFZ C;  2JW4 A;  2GF7 A;  4DA4 A;  2LC4 A;  4DEY A;  2A3L A;  2COZ A;  4MML A;  4FW1 A;  1ZA2 B;  3UA6 A;  4OGE A;  2JOY A;  2DET A;  3NPF A;  1KD1 C;  3Q1J A;  3JCM P;  2YUQ A;  1D0Z A;  5FU6 B;  5A0D A;  1TG0 A;  4CC7 A;  5ECA A;  4FSS A;  2E5Q A;  3V7R A;  4ZGD B;  3SWN B;  1WDX A;  1LVK A;  2Y4Y A;  1OOT A;  3CME Q;  3I55 Q;  3EG9 A;  2LRQ A;  2NYS A;  2EYY A;  4RUG A;  2RJE A;  1FX7 A;  3OW2 P;  2LP5 A;  1RAH B;  1WFW A;  3QHS A;  1WIE A;  1X2Q A;  2L89 A;  5GJW B;  4C8Q B;  2E6Z A;  3MCA B;  3BY7 A;  1JU5 C;  1AD5 A;  1Y96 A;  2YUP A;  1D3B A;  1AWJ A;  4C92 G;  2RI2 A;  1KG1 A;  3VS3 A;  3EG3 A;  2CZ1 B;  1E6G A;  5GAM f;  3CBP A;  1KIK A;  1XOV A;  1EFN A;  2QDY B;  4M7A A;  5A0L A;  5KYU B;  5LJ5 g;  3SHW A;  1U1T A;  3V8K A;  3EHQ A;  1WHH A;  1VQ5 Q;  4EMH A;  3CXC S;  2GBQ A;  4M7D E;  4EPC A;  3EAE A;  4KGV B;  3CCJ Q;  4JJD A;  2KI7 A;  3CCL A;  2LCC A;  2KRM A;  3JSC A;  4C5I A;  1WJQ A;  4FIB A;  3DB3 A;  1YJN T;  2LCL A;  1WNL A;  2O9S A;  4OMM A;  5L8R E;  1YJ9 Q;  2BZX A;  4PJL A;  2K5I A;  4IUP A;  3TCJ A;  4AFU C;  1KD1 U;  3TEE A;  3GIB A;  2DER A;  2F5K A;  2DMO A;  3NFC A;  3CD6 A;  3HP9 A;  3X20 B;  1HJD A;  3H0I A;  1WA7 A;  3JB9 J;  4FW2 A;  4LD9 K;  1U1S A;  3RKY A;  3JB9 F;  3G71 A;  3ULR B;  1JO8 A;  1RAA B;  1KC8 R;  2M51 A;  2QQ9 A;  3CCU T;  3M5A A;  2FZG B;  1RAB B;  2DEQ A;  5GMK j;  4LDX A;  4FM4 B;  2RPN A;  2DKG A;  3LLR A;  2JT4 A;  3EH2 A;  3H0H A;  1JRI A;  1VQN T;  3CCS Q;  2P0Q A;  2GTO A;  5GMK i;  4HVW A;  1LJO A;  4OMO A;  1T0H A;  3X28 B;  2HAX A;  3BE3 A;  3REA B;  1I81 A;  3OYA A;  1RAE B;  4KH0 B;  3QSU A;  4BY6 C;  5I21 A;  1BIB A;  3J7A F;  1C0M A;  1YIJ T;  1VQO A;  1FMW A;  3OYN A;  2DPP B;  4HCB A;  3L2Q A;  4F7U B;  4EDU A;  1G3S A;  4JLG A;  4Z88 A;  1K1Z A;  4C0F A;  1YHQ T;  4WF2 A;  1IRX A;  4OMP A;  1TTH B;  1IO6 A;  2ZCF B;  2QAS A;  3R6N A;  4A54 A;  4XAX B;  3CCE T;  1B34 A;  4JPB W;  4E7Z A;  2HCK A;  4M75 D;  1NLP C;  1S1N A;  5LJ3 f;  4E7S A;  2K7A A;  2GFU A;  3CBO A;  1Y0M A;  3VS6 A;  2DVJ A;  1UJY A;  5LJ5 j;  3MO8 A;  3RKX A;  3PFS A;  4E6R A;  4M75 G;  1U5S A;  1Y57 A;  3SB2 A;  3A5Z B;  4QQD A;  1VQK Q;  1QMC A;  1AZE A;  4JLI A;  3G71 Q;  5FU7 B;  4J9B A;  3RUX A;  1TOV A;  1GBQ A;  3PMT A;  3FC3 A;  2XDB A;  5C6S A;  5IHK A;  2WSE E;  1FXX A;  3M0U A;  3X24 B;  1OX9 A;  5LJ5 d;  2JTF A;  1QVP A;  4ZTF A;  3CPF A;  4XTW A;  2PTK A;  2RQV A;  4M78 A;  3OS0 A;  3H9N A;  4CI0 C;  2NLU A;  1H92 A;  3PE0 A;  3C0C A;  2E64 A;  1VQP A;  4AFS C;  4BUG A;  2ZPF B;  3CC7 A;  3MJX A;  1LNX A;  1M2V A;  2DTH A;  2DJZ A;  2MI6 A;  3GPL A;  1XJW B;  3M4Y A;  3G6E Q;  3RES A;  3UDC A;  3GLX A;  1IGQ A;  1OUL A;  3C12 A;  3MEW A;  4XTX A;  1G3Y A;  5EC7 A;  3GNF B;  4C8Q F;  1VQO Q;  1M1G A;  2KRN A;  3RMS A;  2RB6 A;  2EGA A;  2MF2 A;  1K73 C;  3EGU A;  3BDU A;  1N8R C;  1K9M C;  3CBM A;  1ZBX A;  4GLK A;  4PNO A;  3M9Q A;  1NYF A;  4R56 A;  1VQ6 Q;  3E19 A;  4B9X A;  3MP6 A;  4CC2 A;  1Q81 R;  1QVG S;  4M77 C;  3PIP A;  4N4H A;  1D0Y A;  1WQW A;  3TU4 K;  3OSS C;  3M0P A;  1K0X A;  3ER0 A;  4FL6 A;  1VYV A;  4ELY C;  2X3W D;  4O5V A;  1QVF P;  1M9S A;  1VQM A;  3CC2 A;  3CPW P;  1G83 A;  1UUE A;  1X6G A;  4IUV A;  3H0F A;  3JCM g;  4J6X A;  4C92 B;  3J81 E;  3TRE A;  4OF1 A;  2YSQ A;  1BYM A;  2LJ0 A;  1EIF A;  4KGZ B;  1QCO A;  1ZSZ B;  4OML A;  2KEA A;  5FWB A;  4C8Q D;  3CMA T;  1X75 C;  3UA7 A;  1AOJ A;  3GF5 A;  3A8G B;  4OB0 B;  3VUZ A;  2HQX A;  2DIG A;  2AKL A;  3VS7 A;  4QKU A;  3A1P A;  1IHV A;  2KRS A;  4E7I A;  4C8Q G;  4BI8 B;  2G3R A;  4QT7 A;  4QW2 A;  5CKF A;  4Z89 A;  2DF6 A;  3S6W A;  2VVK A;  4C92 C;  2KGT A;  4FCY A;  2YUN A;  2BE9 B;  2M16 A;  1BBZ A;  4A4G A;  4M7D A;  4BB7 A;  5GAO n;  5DM7 R;  3HKS A;  1VQP Q;  2OI3 A;  2SRC A;  2W0Z A;  2DIQ A;  1UJ0 A;  3CXC A;  3G4S A;  1K73 U;  1QCF A;  2BIV A;  2IG0 A;  1K9M U;  2CP5 A;  1N8R U;  1BCM A;  1SEM A;  2PNI A;  3E1S A;  5CK9 A;  1WX6 A;  3FRN A;  3UWN A;  5CCA A;  2JMC A;  3P8B B;  1OEB A;  3URG A;  3PIO A;  2ZZD A;  3VU3 C;  2GGR A;  1YFN A;  1NEG A;  1CSK A;  2R58 A;  3QXE B;  5AT1 B;  4OVA A;  1Q7Y R;  1WYX A;  4RTV A;  5KYX B;  2DVE A;  4A63 B;  1QWF A;  2ZPI B;  4PJO F;  5GMK l;  3FIF A;  9ATC B;  2RI5 A;  2DXB A;  2YLB A;  3EG9 B;  4M7D F;  2P4T A;  3M56 A;  4ZTJ A;  2FL7 A;  5D6X A;  4RCC A;  2QG9 B;  3LW5 E;  1V1C A;  1IB8 A;  1QKW A;  1D1C A;  4BDY A;  1WJR A;  1PD1 A;  5GMK m;  3J80 E;  2HKQ B;  2P4R A;  1QVF A;  3OW2 S;  4RTW A;  3EGD A;  3M59 A;  4F16 A;  4EMK B;  5IXB A;  1U3O A;  1D3B B;  4N0A A;  3EGX A;  1QP2 A;  2RQU A;  1X2K A;  2FB7 A;  1YJW Q;  1NJI C;  4A4H A;  5GMK e;  3VYH B;  3OS5 A;  2ED1 A;  1CKB A;  3ZL7 C;  1I0C A;  1Q86 C;  4LN2 A;  2LMJ A;  3CC4 Q;  2DL7 A;  4AG1 C;  1N9S A;  1S72 T;  3WVE B;  2RJF A;  3I56 T;  4NL2 A;  2A0F B;  2KNB B;  2YXY A;  3CCR T;  2BUD A;  3RBB B;  1J3T A;  1X69 A;  1WHM A;  5GAN 3;  4F7U G;  2AZV A;  4ANJ A;  3GNG A;  2R5A A;  3OB9 A;  3GP8 A;  2DA9 A;  1UDL A;  2RNA A;  3MEU A;  2EYX A;  5IHI A;  2ZPG B;  4PJO G;  2C06 A;  2FZK B;  2QQS A;  4C0Z A;  2D8H A;  4DOV A;  3JCM d;  2WSF E;  4FYW B;  3MEV A;  4JJC A;  2QYZ A;  4ZGJ B;  1H3Z A;  3F70 A;  2L5Q A;  2QA4 T;  1F1B B;  3QZ5 B;  1ZUU A;  4Z02 A;  1FYN A;  1I1J A;  2GCX A;  4NL3 A;  1I5O B;  5LJ5 f;  3E2U A;  2JXB A;  1PC0 A;  2ZGW A;  4XK8 E;  4EIK A;  1NPR A;  2YUO A;  2JM9 A;  1IGU A;  2DFU A;  1W6X A;  5HCK A;  1RUW A;  1FWZ A;  1ZA1 B;  4YTL A;  1VQ9 T;  4Y92 A;  2ATC B;  2KE9 A;  4M75 C;  2DTO A;  5LJ5 e;  3JB9 H;  2VXF A;  4L59 A;  1VQL T;  1X6B A;  3M0T A;  2V8J A;  2E5K A;  2ROT A;  2X3X D;  2WAC A;  1YIT T;  1OQK A;  1PCX A;  1AZG B;  4Y28 E;  3VS0 A;  1NJI U;  3JV3 A;  1WGS A;  1MUZ A;  1MHN A;  2JTE A;  1IRE B;  1ZQ1 A;  4J5Y A;  4RMO A;  1K8A C;  1YI2 T;  2C0O A;  5HK3 A;  3MKD A;  1Q86 U;  2A37 A;  4RTX A;  3PTA A;  2BKD N;  2RJC A;  5KYY A;  3WXM B;  5CKH A;  1KJW A;  4DQ2 A;  3SDZ A;  4ZN1 A;  2IPO B;  1TXQ A;  2Y4X A;  1M90 R;  3JCM X;  5L23 A;  2RN8 A;  4OP0 A;  5IH2 A;  2NUT B;  1MNE A;  2YLC A;  3M4G A;  4LDV A;  1B34 B;  2K2V A;  4XQ3 A;  1X01 A;  2DXC A;  2JNG A;  3CCQ A;  2DLP A;  2GQI A;  1GCQ A;  4ME7 A;  1QVG A;  5J39 A;  1N27 A;  2E1H A;  4BE0 A;  3JB9 I;  3CME T;  2V26 A;  2CUB A;  4C92 D;  2H3J A;  4II1 A;  2QTX A;  1QLY A;  2Y90 A;  5FRM A;  1EZZ B;  4HT9 A;  2DYI A;  3CCU A;  4J9C A;  3E9F A;  2JMA A;  1V76 A;  3OMC A;  1PSE A;  1UEB A;  3FJP A;  5D7U A;  2XD0 A;  2LJ1 A;  3OS2 A;  1VQN A;  5FU6 C;  4DEX A;  1R0C B;  1ACM B;  1CKA A;  2XU8 A;  2XG8 D;  2NUP B;  2QI2 A;  1K8A U;  3GOX A;  2F5T X;  1M1K C;  3SWN C;  3QBY A;  2PU9 B;  4IUR A;  3V7C A;  1QP3 A;  2RO0 A;  1VQ5 T;  1PM3 A;  2QQB A;  3I5R A;  1WHK A;  4J6W A;  3CCJ T;  4J7F A;  4X1V A;  4FSX A;  1YIJ A;  4HA8 A;  1Q82 R;  4F7U E;  1M2V B;  4C8Q C;  3MP1 A;  5GAO p;  2JVV A;  2MPX C;  4LXC A;  1ZUK A;  4E7L A;  3EG1 A;  2A36 A;  3LGL A;  1YHQ A;  3VS5 A;  1YJ9 T;  1JEG A;  4B9W A;  4Y91 A;  2CGH A;  3QWY A;  3THK A;  3G1J A;  3CCE A;  3CCM A;  2EKO A;  1C6V X;  5CKE A;  1HSQ A;  1VA7 A;  2KAF A;  3OSV A;  4PK4 A;  5GAO r;  5FRO A;  5GAN g;  2HL3 A;  4M7A F;  4LUE A;  2E65 A;  3QUI A;  2MK5 A;  3CCQ Q;  1W2B P;  2F2X A;  5A0G A;  3D7S B;  3KBG A;  4AFQ C;  2LJ3 A;  1HK9 A;  3SEM A;  2O4X A;  2XKO C;  5IT9 E;  4LDU A;  3JCM W;  3NTK A;  1QVF S;  2YRD A;  5HKC A;  2KMT A;  1M27 C;  2KK4 A;  3LH0 A;  5GMK h;  3CCS T;  1GBR A;  3CPW S;  1JXO A;  2EWN A;  1UGQ B;  3PT9 A;  3RNJ A;  2XIC A;  2FVU A;  2EYQ A;  2W10 A;  3OYL A;  1M1K U;  3VJP A;  1JXM A;  2HD0 A;  3DB4 A;  4J8O A;  3DKM A;  4N4I A;  1UG1 A;  3OW2 A;  1WXT A;  2RHZ A;  3C95 A;  1BB9 A;  3JB9 D;  4M77 E;  5FW9 A;  2RHY A;  4J6Y A;  3DLL A;  1NPP A;  4F14 A;  3L42 A;  1MV0 B;  2LCS A;  1RAC B;  2CZ6 B;  1VQ7 T;  1BI1 A;  4PJO B;  5FWC A;  2VB6 A;  2X4Y A;  3JB9 G;  2VAS A;  1M30 A;  4M7D B;  2YRV A;  3JCM f;  3CCL Q;  3TSW A;  1W1F A;  2J6K A;  3JCM J;  2RM4 A;  2B86 A;  5GAM g;  2M1H A;  4C5H A;  1G5V A;  3JCM e;  3JCM V;  4HCZ A;  3M57 A;  3L1A A;  2VUB A;  2HDA A;  1UGV A;  3CCM Q;  3CD6 Q;  3ZEH A;  1VQ8 T;  1TUG B;  3LWI A;  1BKB A;  5LJ5 h;  1VQK T;  1K76 A;  4PJO C;  1MMN A;  4DBH A;  2X4X A;  3G71 T;  3NHN A;  1PKT A;  4C92 E;  4J7I A;  2K9G A;  1UHF A;  2DRM A;  3SFM A;  1QQJ A;  2E4H A;  2HKN A;  1ARK A;  4KUD K;  1NG2 A;  4EMG A;  1H3H A;  2K3B A;  3DLM A;  1VQ4 T;  1NYG A;  2DO3 A;  3JCM Q;  2J6O A;  1W4S A;  5I22 A;  2DZ9 A;  2R57 A;  5D6W A;  4LD6 A;  1BU1 A;  8AT1 B;  3V7S A;  1UGP B;  1RAF B;  5KYU A;  5GAN j;  2FEI A;  3EGX B;  3NTH A;  3L2W A;  1WI7 A;  4J9F A;  4HCK A;  5FU7 C;  1KQ1 A;  3G6E T;  2VXE A;  2O31 A;  2RK2 A;  1VQO T;  4RCB A;  2OTL T;  4BD3 A;  1NE8 A;  3OYF A;  4KH1 B;  4JZ4 A;  3UF4 A;  1LOJ A;  1UEC A;  1KD1 R;  1VQ6 T;  3JRZ A;  2FPD A;  4MDW A;  2DBK A;  3FJ5 A;  4KUI A;  3QWX X;  2AKK A;  3PNW C;  4LDW A;  5AYF A;  2EQI A;  5KYW B;  2D8J A;  4ELZ C;  2JTM A;  4JZ3 A;  2QXF A;  4M78 F; 
#chains in the Genus database with same CATH homology
 1TG0 A;  4CC7 A;  2O9V A;  2ED1 A;  5ECA A;  1CKB A;  3O5Z A;  3EG2 A;  4FSS A;  3TVT A;  3ZL7 C;  1I0C A;  2MIO A;  4LN2 A;  3I35 A;  2F2V A;  1UHC A;  2LMJ A;  1WDX A;  2DL7 A;  1OOT A;  4AG1 C;  2CUD A;  2EYY A;  4RUG A;  2KNB B;  3TSZ A;  2ENM A;  2BTT A;  2JM8 A;  2LP5 A;  3RBB B;  2MCN A;  1J3T A;  1X69 A;  1WFW A;  1SHF A;  1WIE A;  1SSH A;  1X2Q A;  5GJW B;  1ABQ A;  4ZNX A;  2AZV A;  1T0J A;  1JU5 C;  1AD5 A;  1YP5 A;  2K79 A;  2YUP A;  2DA9 A;  1UDL A;  2RNA A;  2EYX A;  2CSQ A;  5IHI A;  1RI9 A;  1AWJ A;  3CQT A;  3VS3 A;  3EG3 A;  1WXB A;  1E6G A;  1RLQ C;  5IHN A;  3I9Q A;  2D8H A;  1XOV A;  1KIK A;  1EFN A;  3M0Q A;  4JJC A;  2OAW A;  3SHW A;  2EPD A;  4J9G A;  3EHQ A;  1PWT A;  1ZUU A;  1I1J A;  1FYN A;  1AWW A;  1T3L A;  2C0I A;  2EBP A;  2GBQ A;  1QWE A;  2JXB A;  2ECZ A;  4EIK A;  1QKX A;  4JJD A;  2YUO A;  2JM9 A;  2KRM A;  1W6X A;  2L3P A;  2NUZ A;  5HCK A;  1RUW A;  2CT4 A;  4RTZ A;  2FO0 A;  4Y92 A;  3NMZ C;  4J9D A;  2KE9 A;  1GFC A;  2O2O A;  2O9S A;  3M0R A;  1X6B A;  3M0T A;  2EVR A;  4IIM A;  4OMM A;  2E5K A;  2ED0 A;  2BZX A;  2ROT A;  2X3X D;  2FG0 A;  2LX7 A;  4AFU C;  2CH4 W;  4HVV A;  1AZG B;  3VS0 A;  3JV3 A;  2DMO A;  3VS2 A;  1MUZ A;  2KRO A;  2JTE A;  2CH4 A;  1U06 A;  1HJD A;  2V1Q A;  2C0O A;  2A37 A;  3H0I A;  1WA7 A;  1YNZ A;  1OV3 A;  2RMO A;  4OMQ A;  4RTX A;  3KFV A;  1H8K A;  3ULR B;  1JO8 A;  2ESW A;  2M51 A;  1KJW A;  4CC3 A;  1K9A A;  2FRW A;  4D8K A;  1AEY A;  2KXC A;  2LNH B;  2XMF A;  3VS1 A;  2RPN A;  1PNJ A;  2JT4 A;  5L23 A;  2RN8 A;  5IH2 A;  3H0H A;  2CRE A;  2KBT A;  1WLP B;  2GTO A;  4HVW A;  4OMO A;  1UE9 A;  3VRZ A;  1T0H A;  2RQT A;  2J06 A;  2KXD A;  4K11 A;  2RF0 A;  1ABO A;  2DLP A;  3REA B;  2DNU A;  2GQI A;  2LQN A;  1GCQ A;  1M3A A;  2F2W A;  1GL5 A;  2MOX A;  2CUB A;  2L2P A;  2KYM A;  2AK5 A;  1QLY A;  1KSW A;  1AVZ C;  4Z88 A;  1K1Z A;  4J9C A;  2JMA A;  2NWM A;  1B07 A;  4OMP A;  1IO6 A;  3EG0 A;  1ZUY A;  3GBQ A;  2FPF A;  1M3C A;  3R6N A;  2LJ1 A;  2EKH A;  1NM7 A;  2FRY A;  1SRM A;  1GFD A;  3IQL A;  4JPB W;  1HD3 A;  4DEX A;  1CKA A;  2HCK A;  1NLP C;  1S1N A;  2JS0 A;  2C0T A;  2K7A A;  1Y0M A;  3VS6 A;  1PKS A;  2DVJ A;  1UJY A;  2D1X A;  1ZX6 A;  2A08 A;  4RTY A;  4M4Z A;  4E6R A;  1KFZ A;  4JJB A;  1U5S A;  1M8M A;  1Y57 A;  3I5R A;  1I07 A;  4X1V A;  2EYZ A;  1K0S A;  1Z9Q A;  1AZE A;  1YN8 A;  1UFF A;  1ZUK A;  4J9B A;  3EG1 A;  1GBQ A;  2A36 A;  4LNP A;  3VS5 A;  1JEG A;  1SPK A;  2L3S A;  5IHK A;  3QWY A;  3M0U A;  4LUD A;  1AWX A;  3THK A;  2HSP A;  1YWO A;  1W70 A;  2BZY A;  1HSQ A;  1VA7 A;  1VYU A;  2KYB A;  1FMK A;  2PTK A;  2RQV A;  2A28 A;  1H92 A;  3PE0 A;  2LQW A;  3C0C A;  4LUE A;  4AFS C;  1SHG A;  1AWO A;  4GBQ A;  2F2X A;  1NLO C;  1WXU A;  2GTJ A;  2LJ3 A;  4AFQ C;  3SEM A;  4HXJ A;  2YT6 A;  2KR3 A;  2J7I A;  2L3Q A;  5EC7 A;  1M27 C;  1YWP A;  2KRN A;  1JQQ A;  1GBR A;  2EGA A;  1JXO A;  1PRL C;  4IIO A;  2K2M A;  2K6D A;  3EGU A;  4WCI A;  4Z8A A;  3RNJ A;  1NYF A;  2W10 A;  1JXM A;  2ROL A;  1ZLM A;  4CC2 A;  2DL5 A;  1GCQ C;  3A98 A;  1UG1 A;  2QDL A;  2DIL A;  1WXT A;  2FPE A;  3M0P A;  2DL4 A;  4LE9 A;  3U23 A;  3VS4 A;  1BB9 A;  1K0X A;  2DL8 A;  5FW9 A;  1VYV A;  2X3W D;  2KT1 A;  1ZBJ A;  1MV0 B;  4F14 A;  2LCS A;  2PZ1 A;  4R0K A;  1G83 A;  1UUE A;  1X6G A;  3H0F A;  1ZSG A;  3REB B;  5FWC A;  2YDL A;  2YSQ A;  1M30 A;  2LJ0 A;  1X27 A;  2EYW A;  1RLP C;  4OML A;  2DJQ A;  2KEA A;  2G6F X;  2RQR A;  4OMN A;  5FWB A;  3TSW A;  1B3Q A;  1W1F A;  2J6K A;  3UA7 A;  2DM1 A;  2EW3 A;  2DYB A;  2HBW A;  2B86 A;  1AOJ A;  3PVQ A;  2AKL A;  3VS7 A;  2ABL A;  2DRK A;  2VKN A;  2KRS A;  3I5S A;  1M3B A;  1E6H A;  2HDA A;  1UGV A;  1GCP A;  2DL3 A;  1YCS B;  4QT7 A;  1BK2 A;  4KRT A;  1TUD A;  4Z89 A;  3H41 A;  1VYT A;  2DF6 A;  2VVK A;  4D8D A;  2AZS A;  2KGT A;  1K76 A;  2OJ2 A;  3NGP A;  3PVL A;  2YUN A;  2H8H A;  2IIM A;  1BBZ A;  1SRL A;  1PHT A;  1Z9Z A;  3NHN A;  4HVU A;  1OPL A;  1PKT A;  2K9G A;  2RQW A;  2OI3 A;  2BZ8 A;  2SRC A;  1UHF A;  2W0Z A;  3EHR A;  2DRM A;  1UJ0 A;  4AG2 C;  1QCF A;  2CT3 A;  2D0N A;  1ARK A;  1MV3 A;  1NG2 A;  2J6F A;  2O88 A;  1SEM A;  4F17 A;  2VWF A;  1H3H A;  2K3B A;  2PNI A;  4GLM A;  2M0Y A;  1WX6 A;  2CDT A;  3UAT A;  2JMC A;  2L0A A;  1K4U S;  1A0N B;  1NYG A;  1LCK A;  4J9H A;  1X43 A;  2J6O A;  1OPK A;  5I22 A;  3LH5 A;  2LZ6 B;  1OEB A;  5GJV B;  1BU1 A;  2SEM A;  2GGR A;  4ORZ A;  2GNC A;  2EGE A;  1NEG A;  2J05 A;  1CSK A;  2FEI A;  1PRM C;  1WI7 A;  2KT8 A;  4HCK A;  4J9F A;  4RTT A;  4RTU A;  1WYX A;  1G2B A;  2CSI A;  4RTV A;  2O31 A;  2EGC A;  2DBM A;  4A63 B;  1QWF A;  2I0N A;  3VRY A;  1UTI A;  4J9I A;  1T3S A;  2DX1 A;  4JZ4 A;  3UF4 A;  1UEC A;  5IXF A;  2HEQ A;  5I11 A;  4ESR A;  1NEB A;  1E7O A;  2FPD A;  2DBK A;  1V1C A;  4AFZ C;  2JW4 A;  3FJ5 A;  1QKW A;  4DEY A;  3QWX X;  2AKK A;  4CC4 B;  2P4R A;  2V1R A;  1GRI A;  1N5Z A;  2EQI A;  2DE0 X;  4RTW A;  3UA6 A;  4F16 A;  2D8J A;  2JS2 A;  5IXB A;  1U3O A;  3NPF A;  2RQU A;  1X2K A;  3M0S A;  1TUC A;  4J9E A;  4JZ3 A;  2YUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...