2RQWA

Solution structure of bem1p sh3ci domain complexed with ste20p-prr peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
105
structure length
105
Chain Sequence
b'GSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Bud emergence protein 1
publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Signaling protein
total genus 7
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqwA01
2C0IA 1K9AA 4RUGA 1VYUA 2NUZA 1U5SA 2EGAA 4IIMA 1J3TA 3M0RA 5FWBA 2ESWA 4X1VA 4E6RA 3VS1A 3VRYA 3FJ5A 1PHTA 3UA7A 3VRZA 2CT4A 1K0SA 1UE9A 2L3PA 4HXJA 2BZYA 2CSIA 1A0NB 5I11A 2EPDA 1X2KA 2B86A 3VS6A 2CUBA 2X3XD 2CDTA 1BB9A 1AVZC 1ZSGA 2VVKA 1K76A 1K1ZA 2YT6A 1WX6A 2DA9A 3EGUA 5GJWB 4GBQA 1QCFA 2CH4A 1OV3A 1RLQC 2AZSA 2D8HA 1NG2A 4Z8AA 2DL5A 2JM9A 3GBQA 1UDLA 1SRMA 3NPFA 4OMNA 1M3AA 3A98A 3VS5A 3I9QA 1NYFA 1UTIA 4J9HA 1AWWA 2HDAA 2W10A 4LUEA 3EG2A 2DBMA 2EYWA 4ZNXA 2C0TA 1ARKA 1T0HA 1OPKA 2DNUA 2AKKA 1SEMA 2ENMA 2HCKA 2K3BA 3VS3A 1AD5A 1AOJA 4OMPA 1SHFA 2EQIA 3M0UA 3PE0A 2DBKA 1W70A 1OEBA 2K2MA 4R0KA 2KXCA 2LJ1A 3VS4A 4Z89A 1UHCA 1UFFA 3M0QA 3TSZA 2HEQA 3C0CA 1ZLMA 3I5RA 2A08A 2RF0A 3NGPA 1X2QA 1ZBJA 2LJ3A 1VA7A 2GTJA 2EYYA 4CC7A 2EGCA 1JU5C 2M51A 1JQQA 2KROA 1HSQA 1HJDA 1SPKA 2O88A 4ESRA 4JZ4A 2FPDA 2H8HA 1GCQC 2LJ0A 1TUCA 2DYBA 3QWYA 3H41A 2LCSA 3M0PA 2RQWA 4LN2A 2J06A 2LP5A 4RTYA 4HVVA 1WXBA 1ABQA 4Y92A 4AFQC 2DM1A 1RLPC 2L2PA 2RQRA 5IHKA 1FYNA 1QKWA 1X69A 2VKNA 3NHNA 1WXUA 4F16A 3VS0A 2GTOA 4RTZA 2G6FX 1S1NA 2A28A 1QWEA 3PVQA 1ZX6A 3SEMA 2RN8A 2FO0A 3UA6A 1FMKA 1TUDA 2JT4A 2D1XA 1WDXA 2HSPA 3U23A 1NM7A 4IIOA 2MCNA 4JJCA 1B07A 1T0JA 3UF4A 1G83A 3REAB 2KR3A 2K7AA 2PZ1A 2LMJA 2YUQA 2LNHB 4M4ZA 4K11A 2XMFA 1ZUUA 2F2VA 1M27C 2LZ6B 2DMOA 4EIKA 2YDLA 2ECZA 2OI3A 1GCPA 1JXOA 2V1QA 4F17A 5L23A 1PNJA 2JMAA 2OAWA 2O31A 2W0ZA 3H0IA 2IIMA 2L0AA 1K4US 2KYBA 2P4RA 1GBRA 1GL5A 1KIKA 1AWOA 1CSKA 4OMQA 2K79A 2LQNA 5IH2A 1UHFA 2JMCA 2KE9A 1KJWA 1WIEA 1QWFA 1V1CA 3VS7A 1I1JA 1MUZA 2FEIA 3QWXX 2I0NA 2QDLA 2NWMA 3UATA 5IXBA 4Z88A 3THKA 2KRNA 2V1RA 3H0FA 3LH5A 4J9FA 3TVTA 4LNPA 1NYGA 4AG2C 2K6DA 4D8DA 1YWPA 2DLPA 2DRKA 1OPLA 2O2OA 1JXMA 2KT8A 5HCKA 2JM8A 1IO6A 2VWFA 2DF6A 2DRMA 2HBWA 2EYXA 4KRTA 3EG1A 5IHIA 2SEMA 1MV3A 1ABOA 1H92A 1RI9A 1X6BA 2ED1A 1Z9ZA 4J9DA 4RTUA 1Y0MA 3O5ZA 2DL3A 1ZUKA 2O9VA 4RTWA 2YSQA 2BTTA 1YNZA 2JTEA 3M0SA 1G2BA 2ROLA 5I22A 2KEAA 1OOTA 4DEXA 4OMLA 4JZ3A 2ABLA 2JW4A 1NLOC 2DX1A 5IHNA 3EHRA 2GBQA 4CC4B 3ULRB 4J9CA 4QT7A 1JO8A 2KXDA 2F2XA 2DILA 2E5KA 2ROTA 4A63B 1H3HA 1WFWA 1X6GA 2D0NA 1WA7A 1K0XA 1YP5A 1WXTA 1ZUYA 3JV3A 1Z9QA 2CREA 4CC2A 2FG0A 1E7OA 3SHWA 2KGTA 1M8MA 2KNBB 1NEGA 4ORZA 2SRCA 1N5ZA 1UECA 2L3QA 2MIOA 2DE0X 2RPNA 2YUPA 2F2WA 3RNJA 1X27A 2DL8A 2EGEA 2DJQA 2GNCA 2RMOA 1YCSB 2FRYA 1WLPB 2YUOA 2BZXA 2JXBA 4AFUC 1E6GA 1SSHA 2JS0A 2RQVA 1CKBA 4FSSA 2LX7A 3CQTA 2J6FA 2O9SA 1M30A 1UJYA 3RBBB 2JS2A 5FW9A 1I0CA 5FWCA 1T3SA 1H8KA 1NEBA 1UJ0A 4AG1C 4J9GA 4J9BA 5EC7A 2FPFA 4CC3A 4AFZC 4D8KA 2L3SA 1UGVA 1QLYA 1M3CA 2DL7A 2DVJA 2CSQA 3ZL7C 3H0HA 4HVUA 2OJ2A 1GBQA 1AEYA 1HD3A 1X43A 3EG3A 4OMOA 5ECAA 2CH4W 4RTXA 4J9EA 2PNIA 2D8JA 2J6KA 2KYMA 2ED0A 1QKXA 2AZVA 4RTTA 2BZ8A 1MV0B 3I35A 2J05A 1UUEA 3R6NA 3KFVA 3EHQA 1AZGB 1JEGA 2M0YA 2AK5A 2EW3A 1B3QA 3REBB 1UG1A 2EVRA 2GQIA 1KFZA 1AWXA 2J6OA 3M0TA 1BU1A 1U3OA 3I5SA 1U06A 2X3WD 3PVLA 2C0OA 1RUWA 1EFNA 1YN8A 1YWOA 4J9IA 4RTVA 1GRIA 2CUDA 1PKTA 2J7IA 2RQUA 2LQWA 2RNAA 2FRWA 4WCIA 4AFSC 2A37A 2KRSA 2CT3A 2GGRA 2RQTA 4HVWA 1PWTA 1GFDA 1E6HA 1CKAA 2FPEA 4LUDA 5IXFA 4F14A 2DL4A 4OMMA 3VS2A 1Y57A 4GLMA 2KBTA 1W1FA 4JJBA 2EYZA 1SHGA 1XOVA 3EG0A 3NMZC 1LCKA 1PRMC 2EBPA 4DEYA 2AKLA 3IQLA 2EKHA 1I07A 2KRMA 1PRLC 1VYVA 1T3LA 1GFCA 4HCKA 4JPBW 1WYXA 4LE9A 2K9GA 2PTKA 1AZEA 1BK2A 1SRLA 1AWJA 2YUNA 2A36A 1GCQA 2KT1A 1WI7A 1TG0A 4JJDA 1VYTA 2MOXA 1PKSA 1BBZA 3TSWA 5GJVB 1W6XA 1KSWA 1NLPC 1M3BA
chains in the Genus database with same CATH superfamily
3OYKA 3CCET 2DXTA 1VYUA 3HRTA 2FVUA 1U5SA 4IIMA 4KUDK 1TXQA 3F70A 3VS1A 3FJ5A 3ASKA 4M78G 1VIEA 2L3PA 2BZYA 5HY6A 1JJ2S 1K73R 5L8RE 2X9HA 2VVKA 4X9DA 1K76A 4M7AE 3G71A 3TEEA 2EQMA 1OV3A 3HP9A 3QPHA 1B34A 3OS5A 4A4HA 2HQHA 3CXCS 4C5EA 5J39A 3G71T 4BE2A 1Y96B 2IG0A 3A98A 4XK8E 3VS5A 3J7AF 1NYFA 1RAEB 5IN1A 4ZGEB 1RAGB 4J6XA 4LUEA 3JCMQ 2DBMA 2GFAA 4HCBA 1RAAB 2EYWA 3BW1A 4PFZA 2C0TA 3VJPA 3OW2S 2ENMA 2HCKA 3CD6A 5HK0A 2K3BA 2RO0A 5LJ3e 3OYBA 1YJWA 1PG5B 3FB9A 1AD5A 2CS7A 4OMPA 1SHFA 1VQLA 2LQKA 3M0UA 3CD6T 5GMKm 1YJWT 4PNOA 3VU3C 3R6OA 3CCQA 1VQLT 3M0QA 1VQMA 3C0CA 1ZLMA 3DLMA 3OY9A 3I5RA 5KYUB 2CKKA 1M8VA 2QGFB 2KVQG 1WJQA 3CCQT 4C8QG 2QQ9A 2EYYA 5DLOA 4BUGA 3J80E 3PIPA 1VQMT 1JU5C 2M51A 4BACA 1HSQA 1SPKA 2K5IA 4JZ4A 2E70A 3CCVQ 1W2BS 3D7SB 1NJIU 4HT9A 1C1AA 2DXBA 3KXTA 1N8RU 5LJ5j 2CZ6B 2Y90A 4RTYA 2HD0A 1WXBA 1Q7YR 1M1GA 4OB0B 2DM1A 1Y7XA 2O01E 5IHKA 1FYNA 1X69A 1IGUA 1U1SA 1WXUA 2EKOA 2Z0WA 1K9MU 4O5VA 4RTZA 1VQ9Q 1S1NA 4C8QA 1M90U 3PVQA 2FO0A 3UA6A 2CP2A 1TUDA 1WDXA 1X6OA 3OYLA 3LGFA 3U23A 4M7DE 3UF4A 5D6WA 1G83A 2K7AA 3M58A 2LZ6B 1WHLA 2DMOA 2QTVA 4QVCA 3RKYA 2YDLA 1RAIB 2V1QA 2K4YA 1QVPA 1QP3A 4JS4A 2MK5A 1N9SA 2EQJA 2JUFA 5KYWB 1YJ9A 4OMQA 1K73C 4EMKB 2A3LA 1G3TA 4HA8A 4HKEA 3T9NA 2RK1A 2VB6A 1KJWA 4ZGJB 3LGLA 1QWFA 3TU4K 4MDXA 2XHCA 2DD5A 4X34A 3HRUA 2K5FA 2KDSA 2PQWA 1M1KU 2B8AA 2NWMA 4NL2A 2E12A 1VQLQ 3THKA 2V1RA 1EX4A 1TS9A 3H0FA 4F04B 3CPFA 2V26A 2DTHA 2GFUA 2WSCE 4D8DA 2DLPA 1OPLA 2QEXQ 5GAMg 2CGHA 4J5YA 1QVGS 2BIVA 3C4SA 2DRMA 2HBWA 1ZA1B 4KUIA 1AT1B 5D6YA 3AT1B 4XTXA 4M77G 3BFMA 2VUBA 2JVVA 3JCMf 1MV3A 1H92A 3V8JA 2EAYA 2H3JA 3ME9A 1LOJA 4J9DA 2ZZDA 5A0LA 4RTUA 4EPCA 2YSQA 4BDZA 2BTTA 2OTJQ 4M78F 4C5IA 4M7DD 3E9GA 4C5GA 2ROLA 4KGXB 3OYDA 1BI0A 1S72Q 4BY6C 1VQOQ 1VQ5A 4UC4A 5GAN3 3GPLA 1JO8A 2F2XA 5GAN8 2ROTA 4GLKA 3MP1A 1VQ5T 1X6GA 3URGA 1YI2A 3QG1A 3JRZA 1WA7A 5FROA 3HSBA 1JJ2A 1Q7YC 3PMIA 1ZUYA 4M75C 4R56A 3JV3A 4WTOB 4EMGA 1YI2T 1XTDA 4CC2A 1E7OA 1M8MA 2QQBA 1JJ2P 3CCSA 1M5Q1 4JJNK 2MIOA 2QK0A 2YUPA 2RPNA 1M9SA 3JCMg 1X27A 4C92C 3CXCA 3M57A 2LT4A 2RMOA 3RKWA 1VQPA 4BY6B 1EIFA 3CCST 4AFUC 1WQWA 1E6GA 4E7JA 1RABB 1LNXA 1YJ9Q 4CRIA 3FJPA 4XU2A 2OX7A 1RI0A 1VQPT 3CXCP 5CKHA 5FWCA 1T3SA 3Q1JA 5GMKh 1NEBA 3OW2A 4XU0A 4BD3A 5EC7A 2FPFA 2L3SA 1QLYA 5AYFA 2DVJA 3SWNC 3QYHB 4L59A 3ZL7C 3OW2P 3EG3A 5ECAA 3RERA 2I2LA 1KC8R 4C92B 4RTXA 5GAN6 1QP2A 1AHJB 1R0BG 4C8QE 3G4SA 4RTTA 2EIFA 1MV0B 2XDBA 8ATCB 2E10A 2M0YA 1HXDA 3E9FA 1W2BA 3SDZA 1NE8A 2FZGB 3WVDB 5KYUA 3PIOA 3JB9H 2KY9A 2YXYA 3I5SA 4ZN1A 3PVLA 2P4TA 2OTLA 2EYQA 1EFNA 3M53A 1YN8A 4XTZA 2CUDA 1PKTA 2EWNA 1WJSA 4PJNA 2OTLT 2CT3A 2GGRA 2LCLA 2YRCA 3QDRB 5CQXA 5LJ3d 1GFDA 1VQ4A 1E6HA 2DAQA 4FCYA 4F14A 3EG9B 2DL4A 2LVMA 1Y57A 3CCMQ 1BCMA 1VQ4T 1SHGA 2GQVA 5KCOA 2QXFA 3EGDB 4XTVA 1LCKA 2VGNA 1MNEA 3IQLA 1MHNA 1JRIA 2EKHA 5GANg 1BCOA 1PRLC 1GFCA 4JPBW 4LE9A 2K9GA 2FL7A 3P8DA 2A36A 2KT1A 2QGGA 1G3YA 3CEYA 4ELYC 1YIJA 1TWBA 3ER0A 2ATCB 3JB9I 3TSWA 1N6AA 4J6YA 1OQKA 1JB0E 1YIJT 1NJIR 2RI3A 3CC7Q 2ZPGB 4ZGDB 1N8RR 5KYWA 3CMEQ 1K9AA 4RUGA 1D1AA 2E6ZA 4J7IA 2EGAA 2NUPA 4OGEA 4PJOC 2AT1B 2DETA 4M77F 1VQKQ 2ESWA 4X1VA 1PHTA 2R5MA 1QW1A 3UA7A 4ME7A 3MJXA 2CT4A 3VRZA 1TUGB 5GAMe 3CPWS 1Q82U 1UE9A 2YRVA 4HXJA 1QVGA 1KQ1A 1M90R 2XDDA 1H641 3UT1A 4L6V5 3G4SQ 4QVDA 4FT2A 1AVZC 3JB9D 2RHZA 2QYZA 1WX6A 2E1HA 4GBQA 1QVGP 4M7DG 3HFOA 2AZSA 1SSFA 5GAOn 1NG2A 4PFPA 1KC8C 1YHQA 2DL5A 2JM9A 3GBQA 1SRMA 4OMNA 3DLLA 4J9HA 2DD4A 1AWWA 2W10A 3OYJA 1YHQT 3M54A 4PJOD 1LJOA 4RCCA 3JAME 2AKKA 1SEMA 3RR6A 5GAN5 4Y28E 2R58A 4JRKA 2EQIA 4Q5WA 1P92A 2L5QA 1OEBA 5I2SA 1WHGA 2K2MA 3MHXA 4PKCC 2KXCA 3JCMP 6AT1B 3G6EA 1UHCA 1M1KR 2HEQA 4JRPA 2RF0A 3OSSC 3GP8A 3JCMe 2JZ2A 2RH2A 1VA7A 3KUFA 2Y4XA 3G6ET 2MI6A 4CC7A 2DXUA 2L3RA 2KROA 2RJDA 1HJDA 2O88A 4ESRA 3TREA 5CCAA 3JCMJ 2DYBA 3H41A 4LN2A 3OYIA 1B7TA 2HAXA 3PMTA 3HFNA 1ABQA 1OX8A 4Y92A 4IUQA 5KE3A 1RLPC 2BE7D 3P8HA 4BI8B 1M1FA 2ZPEB 3MEAA 4QQ6A 4EDUA 2DYIA 1LPLA 3VS0A 3MPUB 5DLQE 3CCVT 3EGXB 4XAXB 2RN8A 1VQ7Q 4DBFA 1FMKA 2D1XA 4FSXA 2WSFE 1VQ9A 2MCNA 3V7SA 1B07A 1T0JA 4MZPA 4M75A 2PUOB 4M77B 4N4IA 3REAB 2PZ1A 2LMJA 2KAFA 2YUQA 1VQ8Q 1Q86U 3MEUA 1NJIC 2LNHB 4K11A 4OP0A 3OYMA 1VQ9T 4M7AF 1N8RC 4F7UB 4EIKA 4II1A 2R57A 3VYGA 3GOXA 2G3RA 3E19A 5L23A 1JXOA 5LJ5f 5FLXE 4C92A 1F1BB 2JMAA 4GY5A 2OAWA 4FU6A 2L0AA 1YHQQ 1K9MC 1K4US 1M90C 1CSKA 2BUDA 2K79A 3JCMc 2DTOA 2MYSA 5IH2A 1UHFA 5GAOm 4LDWA 2YLCA 5GAOl 5CKBA 4BE1A 1MUZA 5LJ3h 3JSCA 3OS2A 1PD0A 2I0NA 3SWNA 4B9WA 1NPRA 2DTIA 2COWA 4Z88A 4JS5A 2KRNA 4J9FA 1RAHB 2PUKB 1NYGA 1U8RA 2K6DA 5FRNA 2XD0A 1BIBA 2PVOB 3G6EQ 1OI1A 4PLIA 3FRNA 5GANe 5GMKl 3S3NA 3I55Q 2SEMA 2QEXA 5LJ5g 4FL6A 1IHWA 4RMOA 4BI4A 5I21A 4OF1A 2QEXT 5KYYB 1M1KC 2XI9A 3G7ZA 2JTEA 2M02A 4XTYA 1WJRA 2MWPA 2RD1A 4KGVB 4M7AC 4DEXA 4OMLA 1YCYA 2ABLA 4QVZA 2RK2A 5IHNA 1KQ2A 2OTJA 4J8OA 4A4KA 1KD1U 5D7UA 4J9CA 3PT9A 2DILA 2HL5C 1S72A 1WFWA 1VQOA 4A4FA 3CPWA 5GMKj 2OTJT 5J3BA 2CP0A 1K0XA 1MMDA 4M7DF 4E7IA 4EMKC 4LDUA 3EH2A 3QKJA 4J6WA 1Z9QA 1S72T 1VQOT 2FG0A 1I5LA 3SHWA 1X75C 5M9OA 2QAZA 1NEGA 2SRCA 1IXDA 1UECA 4E7HA 2GCXA 2F2WA 3RNJA 3QJYA 5GAMf 2A0FB 4M7AB 2COZA 4C0DB 2FRYA 1WLPB 2YUOA 3RMSA 2CP5A 2BZXA 2JXBA 1SSHA 4FYXB 4FSSA 2EJGA 2J6FA 1UJYA 3RBBB 2JS2A 4QQDA 5CVIA 1I0CA 1D0XA 3X28B 1FMWA 4ZTFA 2HZYA 2PVDB 4AG1C 2YRDA 2X51A 4AFZC 4D8KA 3L1AA 2FB7A 1M4ZA 2HL3A 2RM4A 1YJ9T 2CSQA 2JN0A 2X35A 2JNGA 4C0GA 2H3EB 4PJOA 4HVUA 1AEYA 1GBQA 1X43A 4OMOA 4OVAA 3OYYA 2CH4W 1I5OB 2QQRA 4JUVA 2D8JA 2J6KA 1WQ7A 2KYMA 2LT1A 3JB9J 3C95A 1WPYA 5GAN7 3P8BB 2D9TA 2J05A 4PK4A 3R6NA 2EQKA 1Q82R 4XU1A 2DIGA 3KFVA 2EW3A 2YWWA 2X4JA 4M75E 1UG1A 2E41A 1AWXA 2J6OA 3SD4A 3M0TA 2X4WA 1U06A 4RG2A 4LDVA 1RUWA 3CCRQ 2CYZB 4J9IA 3MP8A 3M4YA 4C92E 1KK7A 4MZTA 5GAOq 3VYHB 1QCNA 2KRSA 1PM3A 4KH0B 4BB7A 4AT1B 4LD9K 4OMMA 1VQNQ 2ZGWA 3LLRA 4C5HA 3CCLQ 1NZ9A 4A4GA 1W1FA 1WHKA 4DOVA 2LRQA 1I4K1 2LC4A 2MWOA 3ZBDA 1G5VA 1KHIA 3CCMA 5KYXB 4M7DB 3JCMd 1PRMC 2EBPA 5CQYA 2O4XB 1I07A 1SKUB 2KRMA 3CCMT 3A1PA 1T3LA 4HCKA 4FW2A 1KHCA 2OAUA 2PTKA 2HMAA 3L2VA 1AZEA 1BK2A 2YUNA 4FYVB 4F7UA 1VYTA 3CC2Q 1TH7A 1PKSA 1BBZA 4DBHA 2HBPA 2E5QA 4PJJA 1MMGA 2C0IA 2DZCA 3V7CA 4BDYA 3VKIA 2NUZA 4QKUA 5CR2A 1RADB 3M0RA 1PSFA 2M1HA 4M75D 3VRYA 3CC7A 2VYTA 1PC0A 1Y96A 3CMEA 1LVKA 1A0NB 3H9NA 1MMAA 3HKSA 4C8QF 1R8OB 5I11A 2EPDA 3TCJA 3OB9A 2B86A 5FRMA 1VQKA 3FEOA 3RMQA 3CC7T 1XJWB 1BB9A 2CDTA 3CMET 5LJ5e 1ZSGA 4C92D 1K1ZA 2YT6A 2DA9A 2JTMA 5GJWB 1VQKT 2D6FA 4M78C 1RLQC 4HCZA 4R55A 2XKOC 1KQSS 3EH1A 4Z8AA 2CP6A 1BYMA 2K57A 2KMTA 3I9QA 2KI7A 4OGCA 3G4ST 5GANf 1FMVA 3L2QA 5GAN4 1OYXA 2E65A 1Q82C 1FXXA 2A7YA 1Q81U 3QYGB 4ZNXA 1ARKA 1D3BB 1OPKA 2DNUA 4C0ZA 1RL2A 1B34B 4LXCA 3BE3A 5GAOr 1W2BP 5KYYA 4N4GA 3VS3A 1NBEB 2LX9A 4OMFB 2RHYA 4N4HA 2DBKA 5C6SA 4BI3A 4M78B 3QHSA 2ZPBB 1UFFA 2XDPA 2A08A 1M2OA 1I8FA 1ZBJA 2LJ3A 3OMCA 4PJOE 4FW1A 4FYWB 3OS0A 4FIBA 4NS5A 1C0MA 1R0CB 4DOWA 4N0AC 2FPDA 1TUCA 3I56Q 1YJNQ 3M0PA 1OZ2A 3GNGA 2X4YA 2J06A 4C8QC 4HVVA 2VC8A 5CK9A 4AFQC 2XK0A 3V7RA 3NHNA 1IGQA 2DEUA 5HK3A 4F16A 5CAIA 1ZQ1A 2G6FX 1D1BA 2A28A 3LYIA 2JJ9A 4C0FA 1ZX6A 3DB4A 3SEMA 4MMLA 3META 1WHJA 2JT4A 2L89A 3MO8A 2ZPIB 4IIOA 5GAMh 4JJCA 3OYHA 4EMKA 2P84A 3FLGA 3L2WA 4TVRA 4NOYA 3HRSA 1VQ7A 3NFCA 4CI0C 1TOVA 5LJ3j 2QDYB 3M55A 4JLIA 1ZUUA 1M27C 2FHDA 1K9MR 3DKMA 2JOYA 1VQ7T 4YTLA 3M5AA 4C8QB 2IPOB 2RB6A 4IUTA 2LCCA 2ECZA 2OI3A 1VQ8A 4E47A 2W0ZA 3H0IA 4JLGA 2XG8D 3M56A 2P4RA 1KIKA 5C0MA 1AWOA 2MPXC 2NUTB 1VQ8T 3N5BB 2LQNA 2HNIA 3HHTB 4XQ3A 2KE9A 3GLXA 3S3OA 1D0YA 1WIEA 3M59A 2M16A 5D6XA 3VS7A 1I1JA 2FEIA 2HKNA 4F7UE 3QJ6A 1MMNA 3TVTA 2XIDA 4LNPA 2MAMA 2O2OA 1IB8A 5HCKA 5CIUA 2K5LA 2XICA 1IO6A 2VWFA 2DF6A 2EYXA 3EG1A 3GNFB 1W4SA 3JCMh 4B9XA 1IZ6A 5IHIA 3JCMW 2PVGB 2VXFA 2EQUA 2QTXA 3X20B 1WZOA 1ABOA 1X6BA 2QQAA 5KYNA 2ED1A 1UEBA 3I55A 5KYXA 1ZUKA 3G1JA 4RTWA 4A53A 4M77C 2O4XA 1G2BA 2KK4A 3I55T 2KEAA 4M75G 4Z02A 3E1SA 4JZ3A 3A8LB 1NLOC 4OB2B 5HKCA 2JTFA 3ULRB 1OULA 2E5KA 4A63B 3FIFA 3X25B 4E7KA 2YLBA 4C92G 1YP5A 1WXTA 2XU8A 1D1CA 3PGGA 1XNIA 3DB3A 3M9QA 3OSVA 3O8VA 5LL6S 2K2VA 4ORZA 1Q95G 4EMHA 2DE0X 2PU9B 1KQSA 2DL8A 2R5AA 3NTHA 2GNCA 1YCSB 3LWHA 3INZA 2VASA 4J83A 2IVWA 2RQVA 3CC4Q 1WHHA 2O9SA 4WF2A 1KQSP 2K3XA 5I2MA 3EFRA 5FW9A 4V2SA 3KBGA 5DM7R 1HK9A 1UJ0A 4PLLA 2DO3A 3QUIA 4J9BA 1OU8A 4CC3A 2DK3A 5GAN2 1UGVA 1G3SA 1VUBA 4JRIA 2V8JA 3H0HA 1BKBA 2CZ0B 5KH6A 1ZA2B 3CMAQ 1D3BA 2PNIA 3OQ5A 2ED0A 1K8AU 2E3IA 4E2FB 5IAYA 3WXMB 2BZ8A 5LJ5d 3I35A 1UUEA 5GANh 1VQ6Q 1C6VX 1AZGB 3MEVA 4M78A 1B3QA 2EVRA 3BDUA 3OBWA 1ZHIA 1R77A 3EG9A 3MCAB 2E4HA 1FWZA 2CP7A 1FX7A 1BU1A 4PL6A 1YITQ 2X3WD 4D6WA 3RESA 2C0OA 1UGRB 4VUBA 1NPPA 1GRIA 4PFOA 4MDWA 2RQUA 1D0ZA 3LX7A 1MGQA 3C94A 3EGDA 2FRWA 2VGMA 4AFSC 3PFSA 3CCJQ 3CCRA 4HVWA 1PWTA 1GXIE 2CP3A 1CKAA 2FPEA 4C0DC 1PD1A 3CBPA 1Q81R 4DQ2A 1OZ3A 4ZTJA 4GLMA 4P5NA 3CCRT 3CBOA 2KBTA 4JJBA 4RG8A 2EYZA 2QA4Q 1M2VB 2L8DA 1XOVA 5A2QE 3JB9G 1IHVA 4A4EA 3EG0A 2MF2A 1VQNA 3A5ZB 3NMZC 3CCLA 4DEYA 3A8HB 1OU9A 2CZ1B 2AKLA 1ZSZC 4MZMA 3OMGA 5FU7C 1VQNT 3QBYA 1VYVA 3CCLT 3CPWP 3CCEQ 3M4GA 4N0AA 1SRLA 4ZN3A 1AWJA 4RCBA 1WI7A 3OBYA 4PJOG 1TG0A 2F69A 4M7AD 2DJZA 1G3WA 4XTWA 3E2UA 3L2UA 5GJVB 1W6XA 1KSWA 1NLPC 4O6JA 5CO7A 3RDVA 3CC2A 3OA6A 2NUTA 1TU0B 1J3TA 4A54A 5FWBA 3OYGA 2VV5A 4E6RA 4OB3B 1ZSZB 8AT1B 3CC2T 5FU7B 1K0SA 1MNDA 2KQWA 3FDRA 2CSIA 4X9CA 3ZEHA 3G71Q 1X2KA 5GMKi 5J26A 3VS6A 1QCOA 2CUBA 2X3XD 2E64A 5GAMd 1XQHA 3QO3A 1VIFA 3MP6A 3EGUA 1QCFA 2CH4A 4M75F 2NUPB 1V76A 3S3MA 1WNLA 2D8HA 5CKDA 3V8KA 1UDLA 2RI2A 1HYOA 3NPFA 1M3AA 3EFSA 5KCHA 2ZPHB 1UTIA 1QVFS 3H8ZA 2HDAA 4PJLA 3CD6Q 5DY9A 1KG1A 4C92F 2RJFA 4E7ZA 1N9RA 2P0KA 3EG2A 1YJWQ 3QIIA 1RACB 1PSEA 1SF9A 3VUBA 2DFUA 4M7DC 3CCUA 1T0HA 3OYEA 3PTAA 1V29B 2DXCA 3RKXA 3SFMA 3CCQQ 4KBMB 1AOJA 1JBMA 5EG2A 2V8IA 3CCUT 1VQMQ 3PE0A 1D09B 1W70A 2RA2A 3A8GB 4JRQA 4R0KA 3VV0A 2LJ1A 3VS4A 3X26B 4Z89A 2LTOA 3TSZA 1UGSB 4F7UG 4RKUE 4E7SA 3NGPA 1OX9A 1X2QA 2GTJA 1WHMA 9ATCB 3RIRA 2V8KA 2EGCA 3C12A 1WGSA 1Q81C 1JQQA 5GAMj 3EGXA 3UWNA 2H8HA 1GCQC 2LJ0A 3QWYA 2LCSA 2RQWA 4NL3A 3ZFJA 1ZBXA 2FYKA 2AHJB 2LP5A 2RJEA 2L2PA 2RQRA 4L5GA 4M77A 1QKWA 3I56A 5FU6C 4M78E 2VKNA 3PNWC 1RAFB 1N27A 1YJNA 2GTOA 2ZCFB 2LQ8A 1QWEA 1UGPB 3I56T 1YJNT 1K73U 2ZPFB 2HKQB 2LNVA 3OYNA 4OB1B 7AT1B 2RHXA 3EFOB 2HSPA 3OYCA 4IURA 1BI1A 1O75A 1NM7A 1O9SA 2COYA 2YHTA 3EAEA 5A0DA 3JCMb 2KR3A 4M4ZA 2XMFA 2F2VA 4JDSA 5LJ5h 4DA4A 2KSSA 4F17A 1GCPA 1G8XA 1PNJA 5FU6B 2O31A 2IIMA 2KYBA 5IT9E 1GBRA 1GL5A 4AMCA 3LWIA 4M75B 2K3YA 4ELZC 3L2RA 3BDLA 5GMKe 1QQJA 3J81E 1Q86R 2JMCA 3JCMV 4IKFA 1X01A 4KGZB 1V1CA 3VUZA 3CCUQ 4KULA 4QQGA 3HL8A 3JB9F 4ANJA 2QI2A 3CBMA 3L2ZA 3QWXX 2QDLA 2EJ9A 3UATA 1VOMA 1YBYA 5IXBA 4E7LA 3UPUA 5LJ3f 3LH5A 2RHIA 4AG2C 4J7FA 1YWPA 2DRKA 3X24B 3UDCA 1JXMA 2KT8A 2JM8A 4PJOF 1DJ7B 3RUXA 4KRTA 4M78D 2P0QA 2FZKB 2DZ9A 3SWNB 4M7AG 1RI9A 1Q7YU 1K8AR 4DBQA 5GANd 1M2VA 4PJMA 1Z9ZA 4HT8A 2AIRB 1I81A 3OS1A 3OYFA 1SG5A 1Y0MA 3O5ZA 2DL3A 1VQ5Q 2O9VA 1EZZB 1YNZA 5CKFA 3S6WA 3M0SA 3QZ9B 5I22A 2WACA 2WSEE 3NTIA 1OOTA 3LW5E 1YI2Q 2NLUA 2DEQA 2JW4A 2DX1A 2EFIA 3EHRA 2GBQA 4CC4B 4QT7A 2KXDA 2Y4YA 3OYAA 3QSUA 2RI5A 4LDXA 1H3HA 5LJ3g 4M7AA 1IRXA 2D0NA 3NTKA 1Y71A 4IUVA 2P0PA 3CCSQ 1BI2A 2CREA 3HPWA 1H3ZA 2KGTA 3A8OB 2KNBB 1VQPQ 4ATOA 2DPPB 1N5ZA 2L3QA 2F5KA 1KD1R 5CKEA 2QASA 2EGEA 1ZSZA 2DJQA 2GF7A 3GF5A 5AT1B 1UB4A 2F1LA 2FZCB 2DVEA 2RJCA 1QVFA 2HQXA 2JS0A 4C8QD 1CKBA 1PCXA 2LX7A 3CQTA 1M30A 5GANj 1H8KA 1QVFP 4B6MA 3CC4A 4J9GA 4F7UF 1QMCA 2VXEA 3HTRA 1M3CA 2DL7A 2E6NA 3CC4T 1BI3A 3V8LA 1BIAA 2OJ2A 1HD3A 3QXEB 4M77E 5KE2A 1UGQB 2M9UA 1Q86C 1TTHB 2ZAEA 3BY7A 4J9EA 3FC3A 2EJFA 1QKXA 2AZVA 2LDMA 4FT4A 2HSEB 3CMAA 3TQ7P 1IREB 2RHUA 3EHQA 1JEGA 2AK5A 4PJOB 3REBB 3MKDA 4DBRA 2OTLQ 3CMAT 2GQIA 3WVEB 1KFZA 1VQ6A 3AHUA 4QW2A 2DERA 1U3OA 4Y91A 2C06A 1VQ6T 2D0QB 1YWOA 4RTVA 4HCCA 1VQ4Q 2J7IA 2E3HA 1ACMB 2LQWA 2RNAA 4KT0E 5GAOp 1YITA 3A8MB 4M7DA 2BE9B 4WCIA 2QQSA 1K8AC 2A37A 2RQTA 2HQEA 3H6ZA 4LUDA 5IXFA 1YITT 3SB2A 5A0GA 3VS2A 4FYYB 2QG9B 2CZ7B 3CCJA 3QZ5B 4XU3A 2BKDN 4IUUA 4XTUA 3L42A 3LH0A 4LD6A 4IUPA 3CCJT 1Y07A 1TSFA 3QDFA 3EFOA 4BE0A 2QA4A 2X4XA 2DKGA 3MEWA 4FM4B 1YIJQ 1WYXA 2MMPA 3CCVA 3GIBA 2QA4T 1GCQA 4LDYA 2M0OA 2F5TX 2DIQA 4M77D 1U1TA 4JJDA 1YFNA 3JCMX 2MOXA 3CCEA 2NYSA 1KD1C 4KH1B 1M3BA 1KC8U 4MMKA
chains in the Genus database with same CATH topology
2C0IA 1K9AA 4RUGA 1VYUA 2NUZA 1U5SA 2EGAA 4IIMA 1J3TA 3M0RA 5FWBA 2ESWA 4X1VA 4E6RA 3VS1A 3VRYA 3FJ5A 1PHTA 3UA7A 3VRZA 2CT4A 1K0SA 1UE9A 2L3PA 4HXJA 2BZYA 2CSIA 1A0NB 5I11A 2EPDA 1X2KA 2B86A 3VS6A 2CUBA 2X3XD 2CDTA 1BB9A 1AVZC 1ZSGA 2VVKA 1K76A 1K1ZA 2YT6A 1WX6A 2DA9A 3EGUA 5GJWB 4GBQA 1QCFA 2CH4A 1OV3A 1RLQC 2AZSA 2D8HA 1NG2A 4Z8AA 2DL5A 2JM9A 3GBQA 1UDLA 1SRMA 3NPFA 4OMNA 1M3AA 3A98A 3VS5A 3I9QA 1NYFA 1UTIA 4J9HA 1AWWA 2HDAA 2W10A 4LUEA 3EG2A 2DBMA 2EYWA 4ZNXA 2C0TA 1ARKA 1T0HA 1OPKA 2DNUA 2AKKA 1SEMA 2ENMA 2HCKA 2K3BA 3VS3A 1AD5A 1AOJA 4OMPA 1SHFA 2EQIA 3M0UA 3PE0A 2DBKA 1W70A 1OEBA 2K2MA 4R0KA 2KXCA 2LJ1A 3VS4A 4Z89A 1UHCA 1UFFA 3M0QA 3TSZA 2HEQA 3C0CA 1ZLMA 3I5RA 2A08A 2RF0A 3NGPA 1X2QA 1ZBJA 2LJ3A 1VA7A 2GTJA 2EYYA 4CC7A 2EGCA 1JU5C 2M51A 1JQQA 2KROA 1HSQA 1HJDA 1SPKA 2O88A 4ESRA 4JZ4A 2FPDA 2H8HA 1GCQC 2LJ0A 1TUCA 2DYBA 3QWYA 3H41A 2LCSA 3M0PA 2RQWA 4LN2A 2J06A 2LP5A 4RTYA 4HVVA 1WXBA 1ABQA 4Y92A 4AFQC 2DM1A 1RLPC 2L2PA 2RQRA 5IHKA 1FYNA 1QKWA 1X69A 2VKNA 3NHNA 1WXUA 4F16A 3VS0A 2GTOA 4RTZA 2G6FX 1S1NA 2A28A 1QWEA 3PVQA 1ZX6A 3SEMA 2RN8A 2FO0A 3UA6A 1FMKA 1TUDA 2JT4A 2D1XA 1WDXA 2HSPA 3U23A 1NM7A 4IIOA 2MCNA 4JJCA 1B07A 1T0JA 3UF4A 1G83A 3REAB 2KR3A 2K7AA 2PZ1A 2LMJA 2YUQA 2LNHB 4M4ZA 4K11A 2XMFA 1ZUUA 2F2VA 1M27C 2LZ6B 2DMOA 4EIKA 2YDLA 2ECZA 2OI3A 1GCPA 1JXOA 2V1QA 4F17A 5L23A 1PNJA 2JMAA 2OAWA 2O31A 2W0ZA 3H0IA 2IIMA 2L0AA 1K4US 2KYBA 2P4RA 1GBRA 1GL5A 1KIKA 1AWOA 1CSKA 4OMQA 2K79A 2LQNA 5IH2A 1UHFA 2JMCA 2KE9A 1KJWA 1WIEA 1QWFA 1V1CA 3VS7A 1I1JA 1MUZA 2FEIA 3QWXX 2I0NA 2QDLA 2NWMA 3UATA 5IXBA 4Z88A 3THKA 2KRNA 2V1RA 3H0FA 3LH5A 4J9FA 3TVTA 4LNPA 1NYGA 4AG2C 2K6DA 4D8DA 1YWPA 2DLPA 2DRKA 1OPLA 2O2OA 1JXMA 2KT8A 5HCKA 2JM8A 1IO6A 2VWFA 2DF6A 2DRMA 2HBWA 2EYXA 4KRTA 3EG1A 5IHIA 2SEMA 1MV3A 1ABOA 1H92A 1RI9A 1X6BA 2ED1A 1Z9ZA 4J9DA 4RTUA 1Y0MA 3O5ZA 2DL3A 1ZUKA 2O9VA 4RTWA 2YSQA 2BTTA 1YNZA 2JTEA 3M0SA 1G2BA 2ROLA 5I22A 2KEAA 1OOTA 4DEXA 4OMLA 4JZ3A 2ABLA 2JW4A 1NLOC 2DX1A 5IHNA 3EHRA 2GBQA 4CC4B 3ULRB 4J9CA 4QT7A 1JO8A 2KXDA 2F2XA 2DILA 2E5KA 2ROTA 4A63B 1H3HA 1WFWA 1X6GA 2D0NA 1WA7A 1K0XA 1YP5A 1WXTA 1ZUYA 3JV3A 1Z9QA 2CREA 4CC2A 2FG0A 1E7OA 3SHWA 2KGTA 1M8MA 2KNBB 1NEGA 4ORZA 2SRCA 1N5ZA 1UECA 2L3QA 2MIOA 2DE0X 2RPNA 2YUPA 2F2WA 3RNJA 1X27A 2DL8A 2EGEA 2DJQA 2GNCA 2RMOA 1YCSB 2FRYA 1WLPB 2YUOA 2BZXA 2JXBA 4AFUC 1E6GA 1SSHA 2JS0A 2RQVA 1CKBA 4FSSA 2LX7A 3CQTA 2J6FA 2O9SA 1M30A 1UJYA 3RBBB 2JS2A 5FW9A 1I0CA 5FWCA 1T3SA 1H8KA 1NEBA 1UJ0A 4AG1C 4J9GA 4J9BA 5EC7A 2FPFA 4CC3A 4AFZC 4D8KA 2L3SA 1UGVA 1QLYA 1M3CA 2DL7A 2DVJA 2CSQA 3ZL7C 3H0HA 4HVUA 2OJ2A 1GBQA 1AEYA 1HD3A 1X43A 3EG3A 4OMOA 5ECAA 2CH4W 4RTXA 4J9EA 2PNIA 2D8JA 2J6KA 2KYMA 2ED0A 1QKXA 2AZVA 4RTTA 2BZ8A 1MV0B 3I35A 2J05A 1UUEA 3R6NA 3KFVA 3EHQA 1AZGB 1JEGA 2M0YA 2AK5A 2EW3A 1B3QA 3REBB 1UG1A 2EVRA 2GQIA 1KFZA 1AWXA 2J6OA 3M0TA 1BU1A 1U3OA 3I5SA 1U06A 2X3WD 3PVLA 2C0OA 1RUWA 1EFNA 1YN8A 1YWOA 4J9IA 4RTVA 1GRIA 2CUDA 1PKTA 2J7IA 2RQUA 2LQWA 2RNAA 2FRWA 4WCIA 4AFSC 2A37A 2KRSA 2CT3A 2GGRA 2RQTA 4HVWA 1PWTA 1GFDA 1E6HA 1CKAA 2FPEA 4LUDA 5IXFA 4F14A 2DL4A 4OMMA 3VS2A 1Y57A 4GLMA 2KBTA 1W1FA 4JJBA 2EYZA 1SHGA 1XOVA 3EG0A 3NMZC 1LCKA 1PRMC 2EBPA 4DEYA 2AKLA 3IQLA 2EKHA 1I07A 2KRMA 1PRLC 1VYVA 1T3LA 1GFCA 4HCKA 4JPBW 1WYXA 4LE9A 2K9GA 2PTKA 1AZEA 1BK2A 1SRLA 1AWJA 2YUNA 2A36A 1GCQA 2KT1A 1WI7A 1TG0A 4JJDA 1VYTA 2MOXA 1PKSA 1BBZA 3TSWA 5GJVB 1W6XA 1KSWA 1NLPC 1M3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0I A;  1K9A A;  4RUG A;  1VYU A;  2NUZ A;  1U5S A;  2EGA A;  4IIM A;  1J3T A;  3M0R A;  5FWB A;  2ESW A;  4X1V A;  4E6R A;  3VS1 A;  3VRY A;  3FJ5 A;  1PHT A;  3UA7 A;  3VRZ A;  2CT4 A;  1K0S A;  1UE9 A;  2L3P A;  4HXJ A;  2BZY A;  2CSI A;  1A0N B;  5I11 A;  2EPD A;  1X2K A;  2B86 A;  3VS6 A;  2CUB A;  2X3X D;  2CDT A;  1BB9 A;  1AVZ C;  1ZSG A;  2VVK A;  1K76 A;  1K1Z A;  2YT6 A;  1WX6 A;  2DA9 A;  3EGU A;  5GJW B;  4GBQ A;  1QCF A;  2CH4 A;  1OV3 A;  1RLQ C;  2AZS A;  2D8H A;  1NG2 A;  4Z8A A;  2DL5 A;  2JM9 A;  3GBQ A;  1UDL A;  1SRM A;  3NPF A;  4OMN A;  1M3A A;  3A98 A;  3VS5 A;  3I9Q A;  1NYF A;  1UTI A;  4J9H A;  1AWW A;  2HDA A;  2W10 A;  4LUE A;  3EG2 A;  2DBM A;  2EYW A;  4ZNX A;  2C0T A;  1ARK A;  1T0H A;  1OPK A;  2DNU A;  2AKK A;  1SEM A;  2ENM A;  2HCK A;  2K3B A;  3VS3 A;  1AD5 A;  1AOJ A;  4OMP A;  1SHF A;  2EQI A;  3M0U A;  3PE0 A;  2DBK A;  1W70 A;  1OEB A;  2K2M A;  4R0K A;  2KXC A;  2LJ1 A;  3VS4 A;  4Z89 A;  1UHC A;  1UFF A;  3M0Q A;  3TSZ A;  2HEQ A;  3C0C A;  1ZLM A;  3I5R A;  2A08 A;  2RF0 A;  3NGP A;  1X2Q A;  1ZBJ A;  2LJ3 A;  1VA7 A;  2GTJ A;  2EYY A;  4CC7 A;  2EGC A;  1JU5 C;  2M51 A;  1JQQ A;  2KRO A;  1HSQ A;  1HJD A;  1SPK A;  2O88 A;  4ESR A;  4JZ4 A;  2FPD A;  2H8H A;  1GCQ C;  2LJ0 A;  1TUC A;  2DYB A;  3QWY A;  3H41 A;  2LCS A;  3M0P A;  2RQW A;  4LN2 A;  2J06 A;  2LP5 A;  4RTY A;  4HVV A;  1WXB A;  1ABQ A;  4Y92 A;  4AFQ C;  2DM1 A;  1RLP C;  2L2P A;  2RQR A;  5IHK A;  1FYN A;  1QKW A;  1X69 A;  2VKN A;  3NHN A;  1WXU A;  4F16 A;  3VS0 A;  2GTO A;  4RTZ A;  2G6F X;  1S1N A;  2A28 A;  1QWE A;  3PVQ A;  1ZX6 A;  3SEM A;  2RN8 A;  2FO0 A;  3UA6 A;  1FMK A;  1TUD A;  2JT4 A;  2D1X A;  1WDX A;  2HSP A;  3U23 A;  1NM7 A;  4IIO A;  2MCN A;  4JJC A;  1B07 A;  1T0J A;  3UF4 A;  1G83 A;  3REA B;  2KR3 A;  2K7A A;  2PZ1 A;  2LMJ A;  2YUQ A;  2LNH B;  4M4Z A;  4K11 A;  2XMF A;  1ZUU A;  2F2V A;  1M27 C;  2LZ6 B;  2DMO A;  4EIK A;  2YDL A;  2ECZ A;  2OI3 A;  1GCP A;  1JXO A;  2V1Q A;  4F17 A;  5L23 A;  1PNJ A;  2JMA A;  2OAW A;  2O31 A;  2W0Z A;  3H0I A;  2IIM A;  2L0A A;  1K4U S;  2KYB A;  2P4R A;  1GBR A;  1GL5 A;  1KIK A;  1AWO A;  1CSK A;  4OMQ A;  2K79 A;  2LQN A;  5IH2 A;  1UHF A;  2JMC A;  2KE9 A;  1KJW A;  1WIE A;  1QWF A;  1V1C A;  3VS7 A;  1I1J A;  1MUZ A;  2FEI A;  3QWX X;  2I0N A;  2QDL A;  2NWM A;  3UAT A;  5IXB A;  4Z88 A;  3THK A;  2KRN A;  2V1R A;  3H0F A;  3LH5 A;  4J9F A;  3TVT A;  4LNP A;  1NYG A;  4AG2 C;  2K6D A;  4D8D A;  1YWP A;  2DLP A;  2DRK A;  1OPL A;  2O2O A;  1JXM A;  2KT8 A;  5HCK A;  2JM8 A;  1IO6 A;  2VWF A;  2DF6 A;  2DRM A;  2HBW A;  2EYX A;  4KRT A;  3EG1 A;  5IHI A;  2SEM A;  1MV3 A;  1ABO A;  1H92 A;  1RI9 A;  1X6B A;  2ED1 A;  1Z9Z A;  4J9D A;  4RTU A;  1Y0M A;  3O5Z A;  2DL3 A;  1ZUK A;  2O9V A;  4RTW A;  2YSQ A;  2BTT A;  1YNZ A;  2JTE A;  3M0S A;  1G2B A;  2ROL A;  5I22 A;  2KEA A;  1OOT A;  4DEX A;  4OML A;  4JZ3 A;  2ABL A;  2JW4 A;  1NLO C;  2DX1 A;  5IHN A;  3EHR A;  2GBQ A;  4CC4 B;  3ULR B;  4J9C A;  4QT7 A;  1JO8 A;  2KXD A;  2F2X A;  2DIL A;  2E5K A;  2ROT A;  4A63 B;  1H3H A;  1WFW A;  1X6G A;  2D0N A;  1WA7 A;  1K0X A;  1YP5 A;  1WXT A;  1ZUY A;  3JV3 A;  1Z9Q A;  2CRE A;  4CC2 A;  2FG0 A;  1E7O A;  3SHW A;  2KGT A;  1M8M A;  2KNB B;  1NEG A;  4ORZ A;  2SRC A;  1N5Z A;  1UEC A;  2L3Q A;  2MIO A;  2DE0 X;  2RPN A;  2YUP A;  2F2W A;  3RNJ A;  1X27 A;  2DL8 A;  2EGE A;  2DJQ A;  2GNC A;  2RMO A;  1YCS B;  2FRY A;  1WLP B;  2YUO A;  2BZX A;  2JXB A;  4AFU C;  1E6G A;  1SSH A;  2JS0 A;  2RQV A;  1CKB A;  4FSS A;  2LX7 A;  3CQT A;  2J6F A;  2O9S A;  1M30 A;  1UJY A;  3RBB B;  2JS2 A;  5FW9 A;  1I0C A;  5FWC A;  1T3S A;  1H8K A;  1NEB A;  1UJ0 A;  4AG1 C;  4J9G A;  4J9B A;  5EC7 A;  2FPF A;  4CC3 A;  4AFZ C;  4D8K A;  2L3S A;  1UGV A;  1QLY A;  1M3C A;  2DL7 A;  2DVJ A;  2CSQ A;  3ZL7 C;  3H0H A;  4HVU A;  2OJ2 A;  1GBQ A;  1AEY A;  1HD3 A;  1X43 A;  3EG3 A;  4OMO A;  5ECA A;  2CH4 W;  4RTX A;  4J9E A;  2PNI A;  2D8J A;  2J6K A;  2KYM A;  2ED0 A;  1QKX A;  2AZV A;  4RTT A;  2BZ8 A;  1MV0 B;  3I35 A;  2J05 A;  1UUE A;  3R6N A;  3KFV A;  3EHQ A;  1AZG B;  1JEG A;  2M0Y A;  2AK5 A;  2EW3 A;  1B3Q A;  3REB B;  1UG1 A;  2EVR A;  2GQI A;  1KFZ A;  1AWX A;  2J6O A;  3M0T A;  1BU1 A;  1U3O A;  3I5S A;  1U06 A;  2X3W D;  3PVL A;  2C0O A;  1RUW A;  1EFN A;  1YN8 A;  1YWO A;  4J9I A;  4RTV A;  1GRI A;  2CUD A;  1PKT A;  2J7I A;  2RQU A;  2LQW A;  2RNA A;  2FRW A;  4WCI A;  4AFS C;  2A37 A;  2KRS A;  2CT3 A;  2GGR A;  2RQT A;  4HVW A;  1PWT A;  1GFD A;  1E6H A;  1CKA A;  2FPE A;  4LUD A;  5IXF A;  4F14 A;  2DL4 A;  4OMM A;  3VS2 A;  1Y57 A;  4GLM A;  2KBT A;  1W1F A;  4JJB A;  2EYZ A;  1SHG A;  1XOV A;  3EG0 A;  3NMZ C;  1LCK A;  1PRM C;  2EBP A;  4DEY A;  2AKL A;  3IQL A;  2EKH A;  1I07 A;  2KRM A;  1PRL C;  1VYV A;  1T3L A;  1GFC A;  4HCK A;  4JPB W;  1WYX A;  4LE9 A;  2K9G A;  2PTK A;  1AZE A;  1BK2 A;  1SRL A;  1AWJ A;  2YUN A;  2A36 A;  1GCQ A;  2KT1 A;  1WI7 A;  1TG0 A;  4JJD A;  1VYT A;  2MOX A;  1PKS A;  1BBZ A;  3TSW A;  5GJV B;  1W6X A;  1KSW A;  1NLP C;  1M3B A; 
#chains in the Genus database with same CATH topology
 3OYK A;  3CCE T;  2DXT A;  1VYU A;  3HRT A;  2FVU A;  1U5S A;  4IIM A;  4KUD K;  1TXQ A;  3F70 A;  3VS1 A;  3FJ5 A;  3ASK A;  4M78 G;  1VIE A;  2L3P A;  2BZY A;  5HY6 A;  1JJ2 S;  1K73 R;  5L8R E;  2X9H A;  2VVK A;  4X9D A;  1K76 A;  4M7A E;  3G71 A;  3TEE A;  2EQM A;  1OV3 A;  3HP9 A;  3QPH A;  1B34 A;  3OS5 A;  4A4H A;  2HQH A;  3CXC S;  4C5E A;  5J39 A;  3G71 T;  4BE2 A;  1Y96 B;  2IG0 A;  3A98 A;  4XK8 E;  3VS5 A;  3J7A F;  1NYF A;  1RAE B;  5IN1 A;  4ZGE B;  1RAG B;  4J6X A;  4LUE A;  3JCM Q;  2DBM A;  2GFA A;  4HCB A;  1RAA B;  2EYW A;  3BW1 A;  4PFZ A;  2C0T A;  3VJP A;  3OW2 S;  2ENM A;  2HCK A;  3CD6 A;  5HK0 A;  2K3B A;  2RO0 A;  5LJ3 e;  3OYB A;  1YJW A;  1PG5 B;  3FB9 A;  1AD5 A;  2CS7 A;  4OMP A;  1SHF A;  1VQL A;  2LQK A;  3M0U A;  3CD6 T;  5GMK m;  1YJW T;  4PNO A;  3VU3 C;  3R6O A;  3CCQ A;  1VQL T;  3M0Q A;  1VQM A;  3C0C A;  1ZLM A;  3DLM A;  3OY9 A;  3I5R A;  5KYU B;  2CKK A;  1M8V A;  2QGF B;  2KVQ G;  1WJQ A;  3CCQ T;  4C8Q G;  2QQ9 A;  2EYY A;  5DLO A;  4BUG A;  3J80 E;  3PIP A;  1VQM T;  1JU5 C;  2M51 A;  4BAC A;  1HSQ A;  1SPK A;  2K5I A;  4JZ4 A;  2E70 A;  3CCV Q;  1W2B S;  3D7S B;  1NJI U;  4HT9 A;  1C1A A;  2DXB A;  3KXT A;  1N8R U;  5LJ5 j;  2CZ6 B;  2Y90 A;  4RTY A;  2HD0 A;  1WXB A;  1Q7Y R;  1M1G A;  4OB0 B;  2DM1 A;  1Y7X A;  2O01 E;  5IHK A;  1FYN A;  1X69 A;  1IGU A;  1U1S A;  1WXU A;  2EKO A;  2Z0W A;  1K9M U;  4O5V A;  4RTZ A;  1VQ9 Q;  1S1N A;  4C8Q A;  1M90 U;  3PVQ A;  2FO0 A;  3UA6 A;  2CP2 A;  1TUD A;  1WDX A;  1X6O A;  3OYL A;  3LGF A;  3U23 A;  4M7D E;  3UF4 A;  5D6W A;  1G83 A;  2K7A A;  3M58 A;  2LZ6 B;  1WHL A;  2DMO A;  2QTV A;  4QVC A;  3RKY A;  2YDL A;  1RAI B;  2V1Q A;  2K4Y A;  1QVP A;  1QP3 A;  4JS4 A;  2MK5 A;  1N9S A;  2EQJ A;  2JUF A;  5KYW B;  1YJ9 A;  4OMQ A;  1K73 C;  4EMK B;  2A3L A;  1G3T A;  4HA8 A;  4HKE A;  3T9N A;  2RK1 A;  2VB6 A;  1KJW A;  4ZGJ B;  3LGL A;  1QWF A;  3TU4 K;  4MDX A;  2XHC A;  2DD5 A;  4X34 A;  3HRU A;  2K5F A;  2KDS A;  2PQW A;  1M1K U;  2B8A A;  2NWM A;  4NL2 A;  2E12 A;  1VQL Q;  3THK A;  2V1R A;  1EX4 A;  1TS9 A;  3H0F A;  4F04 B;  3CPF A;  2V26 A;  2DTH A;  2GFU A;  2WSC E;  4D8D A;  2DLP A;  1OPL A;  2QEX Q;  5GAM g;  2CGH A;  4J5Y A;  1QVG S;  2BIV A;  3C4S A;  2DRM A;  2HBW A;  1ZA1 B;  4KUI A;  1AT1 B;  5D6Y A;  3AT1 B;  4XTX A;  4M77 G;  3BFM A;  2VUB A;  2JVV A;  3JCM f;  1MV3 A;  1H92 A;  3V8J A;  2EAY A;  2H3J A;  3ME9 A;  1LOJ A;  4J9D A;  2ZZD A;  5A0L A;  4RTU A;  4EPC A;  2YSQ A;  4BDZ A;  2BTT A;  2OTJ Q;  4M78 F;  4C5I A;  4M7D D;  3E9G A;  4C5G A;  2ROL A;  4KGX B;  3OYD A;  1BI0 A;  1S72 Q;  4BY6 C;  1VQO Q;  1VQ5 A;  4UC4 A;  5GAN 3;  3GPL A;  1JO8 A;  2F2X A;  5GAN 8;  2ROT A;  4GLK A;  3MP1 A;  1VQ5 T;  1X6G A;  3URG A;  1YI2 A;  3QG1 A;  3JRZ A;  1WA7 A;  5FRO A;  3HSB A;  1JJ2 A;  1Q7Y C;  3PMI A;  1ZUY A;  4M75 C;  4R56 A;  3JV3 A;  4WTO B;  4EMG A;  1YI2 T;  1XTD A;  4CC2 A;  1E7O A;  1M8M A;  2QQB A;  1JJ2 P;  3CCS A;  1M5Q 1;  4JJN K;  2MIO A;  2QK0 A;  2YUP A;  2RPN A;  1M9S A;  3JCM g;  1X27 A;  4C92 C;  3CXC A;  3M57 A;  2LT4 A;  2RMO A;  3RKW A;  1VQP A;  4BY6 B;  1EIF A;  3CCS T;  4AFU C;  1WQW A;  1E6G A;  4E7J A;  1RAB B;  1LNX A;  1YJ9 Q;  4CRI A;  3FJP A;  4XU2 A;  2OX7 A;  1RI0 A;  1VQP T;  3CXC P;  5CKH A;  5FWC A;  1T3S A;  3Q1J A;  5GMK h;  1NEB A;  3OW2 A;  4XU0 A;  4BD3 A;  5EC7 A;  2FPF A;  2L3S A;  1QLY A;  5AYF A;  2DVJ A;  3SWN C;  3QYH B;  4L59 A;  3ZL7 C;  3OW2 P;  3EG3 A;  5ECA A;  3RER A;  2I2L A;  1KC8 R;  4C92 B;  4RTX A;  5GAN 6;  1QP2 A;  1AHJ B;  1R0B G;  4C8Q E;  3G4S A;  4RTT A;  2EIF A;  1MV0 B;  2XDB A;  8ATC B;  2E10 A;  2M0Y A;  1HXD A;  3E9F A;  1W2B A;  3SDZ A;  1NE8 A;  2FZG B;  3WVD B;  5KYU A;  3PIO A;  3JB9 H;  2KY9 A;  2YXY A;  3I5S A;  4ZN1 A;  3PVL A;  2P4T A;  2OTL A;  2EYQ A;  1EFN A;  3M53 A;  1YN8 A;  4XTZ A;  2CUD A;  1PKT A;  2EWN A;  1WJS A;  4PJN A;  2OTL T;  2CT3 A;  2GGR A;  2LCL A;  2YRC A;  3QDR B;  5CQX A;  5LJ3 d;  1GFD A;  1VQ4 A;  1E6H A;  2DAQ A;  4FCY A;  4F14 A;  3EG9 B;  2DL4 A;  2LVM A;  1Y57 A;  3CCM Q;  1BCM A;  1VQ4 T;  1SHG A;  2GQV A;  5KCO A;  2QXF A;  3EGD B;  4XTV A;  1LCK A;  2VGN A;  1MNE A;  3IQL A;  1MHN A;  1JRI A;  2EKH A;  5GAN g;  1BCO A;  1PRL C;  1GFC A;  4JPB W;  4LE9 A;  2K9G A;  2FL7 A;  3P8D A;  2A36 A;  2KT1 A;  2QGG A;  1G3Y A;  3CEY A;  4ELY C;  1YIJ A;  1TWB A;  3ER0 A;  2ATC B;  3JB9 I;  3TSW A;  1N6A A;  4J6Y A;  1OQK A;  1JB0 E;  1YIJ T;  1NJI R;  2RI3 A;  3CC7 Q;  2ZPG B;  4ZGD B;  1N8R R;  5KYW A;  3CME Q;  1K9A A;  4RUG A;  1D1A A;  2E6Z A;  4J7I A;  2EGA A;  2NUP A;  4OGE A;  4PJO C;  2AT1 B;  2DET A;  4M77 F;  1VQK Q;  2ESW A;  4X1V A;  1PHT A;  2R5M A;  1QW1 A;  3UA7 A;  4ME7 A;  3MJX A;  2CT4 A;  3VRZ A;  1TUG B;  5GAM e;  3CPW S;  1Q82 U;  1UE9 A;  2YRV A;  4HXJ A;  1QVG A;  1KQ1 A;  1M90 R;  2XDD A;  1H64 1;  3UT1 A;  4L6V 5;  3G4S Q;  4QVD A;  4FT2 A;  1AVZ C;  3JB9 D;  2RHZ A;  2QYZ A;  1WX6 A;  2E1H A;  4GBQ A;  1QVG P;  4M7D G;  3HFO A;  2AZS A;  1SSF A;  5GAO n;  1NG2 A;  4PFP A;  1KC8 C;  1YHQ A;  2DL5 A;  2JM9 A;  3GBQ A;  1SRM A;  4OMN A;  3DLL A;  4J9H A;  2DD4 A;  1AWW A;  2W10 A;  3OYJ A;  1YHQ T;  3M54 A;  4PJO D;  1LJO A;  4RCC A;  3JAM E;  2AKK A;  1SEM A;  3RR6 A;  5GAN 5;  4Y28 E;  2R58 A;  4JRK A;  2EQI A;  4Q5W A;  1P92 A;  2L5Q A;  1OEB A;  5I2S A;  1WHG A;  2K2M A;  3MHX A;  4PKC C;  2KXC A;  3JCM P;  6AT1 B;  3G6E A;  1UHC A;  1M1K R;  2HEQ A;  4JRP A;  2RF0 A;  3OSS C;  3GP8 A;  3JCM e;  2JZ2 A;  2RH2 A;  1VA7 A;  3KUF A;  2Y4X A;  3G6E T;  2MI6 A;  4CC7 A;  2DXU A;  2L3R A;  2KRO A;  2RJD A;  1HJD A;  2O88 A;  4ESR A;  3TRE A;  5CCA A;  3JCM J;  2DYB A;  3H41 A;  4LN2 A;  3OYI A;  1B7T A;  2HAX A;  3PMT A;  3HFN A;  1ABQ A;  1OX8 A;  4Y92 A;  4IUQ A;  5KE3 A;  1RLP C;  2BE7 D;  3P8H A;  4BI8 B;  1M1F A;  2ZPE B;  3MEA A;  4QQ6 A;  4EDU A;  2DYI A;  1LPL A;  3VS0 A;  3MPU B;  5DLQ E;  3CCV T;  3EGX B;  4XAX B;  2RN8 A;  1VQ7 Q;  4DBF A;  1FMK A;  2D1X A;  4FSX A;  2WSF E;  1VQ9 A;  2MCN A;  3V7S A;  1B07 A;  1T0J A;  4MZP A;  4M75 A;  2PUO B;  4M77 B;  4N4I A;  3REA B;  2PZ1 A;  2LMJ A;  2KAF A;  2YUQ A;  1VQ8 Q;  1Q86 U;  3MEU A;  1NJI C;  2LNH B;  4K11 A;  4OP0 A;  3OYM A;  1VQ9 T;  4M7A F;  1N8R C;  4F7U B;  4EIK A;  4II1 A;  2R57 A;  3VYG A;  3GOX A;  2G3R A;  3E19 A;  5L23 A;  1JXO A;  5LJ5 f;  5FLX E;  4C92 A;  1F1B B;  2JMA A;  4GY5 A;  2OAW A;  4FU6 A;  2L0A A;  1YHQ Q;  1K9M C;  1K4U S;  1M90 C;  1CSK A;  2BUD A;  2K79 A;  3JCM c;  2DTO A;  2MYS A;  5IH2 A;  1UHF A;  5GAO m;  4LDW A;  2YLC A;  5GAO l;  5CKB A;  4BE1 A;  1MUZ A;  5LJ3 h;  3JSC A;  3OS2 A;  1PD0 A;  2I0N A;  3SWN A;  4B9W A;  1NPR A;  2DTI A;  2COW A;  4Z88 A;  4JS5 A;  2KRN A;  4J9F A;  1RAH B;  2PUK B;  1NYG A;  1U8R A;  2K6D A;  5FRN A;  2XD0 A;  1BIB A;  2PVO B;  3G6E Q;  1OI1 A;  4PLI A;  3FRN A;  5GAN e;  5GMK l;  3S3N A;  3I55 Q;  2SEM A;  2QEX A;  5LJ5 g;  4FL6 A;  1IHW A;  4RMO A;  4BI4 A;  5I21 A;  4OF1 A;  2QEX T;  5KYY B;  1M1K C;  2XI9 A;  3G7Z A;  2JTE A;  2M02 A;  4XTY A;  1WJR A;  2MWP A;  2RD1 A;  4KGV B;  4M7A C;  4DEX A;  4OML A;  1YCY A;  2ABL A;  4QVZ A;  2RK2 A;  5IHN A;  1KQ2 A;  2OTJ A;  4J8O A;  4A4K A;  1KD1 U;  5D7U A;  4J9C A;  3PT9 A;  2DIL A;  2HL5 C;  1S72 A;  1WFW A;  1VQO A;  4A4F A;  3CPW A;  5GMK j;  2OTJ T;  5J3B A;  2CP0 A;  1K0X A;  1MMD A;  4M7D F;  4E7I A;  4EMK C;  4LDU A;  3EH2 A;  3QKJ A;  4J6W A;  1Z9Q A;  1S72 T;  1VQO T;  2FG0 A;  1I5L A;  3SHW A;  1X75 C;  5M9O A;  2QAZ A;  1NEG A;  2SRC A;  1IXD A;  1UEC A;  4E7H A;  2GCX A;  2F2W A;  3RNJ A;  3QJY A;  5GAM f;  2A0F B;  4M7A B;  2COZ A;  4C0D B;  2FRY A;  1WLP B;  2YUO A;  3RMS A;  2CP5 A;  2BZX A;  2JXB A;  1SSH A;  4FYX B;  4FSS A;  2EJG A;  2J6F A;  1UJY A;  3RBB B;  2JS2 A;  4QQD A;  5CVI A;  1I0C A;  1D0X A;  3X28 B;  1FMW A;  4ZTF A;  2HZY A;  2PVD B;  4AG1 C;  2YRD A;  2X51 A;  4AFZ C;  4D8K A;  3L1A A;  2FB7 A;  1M4Z A;  2HL3 A;  2RM4 A;  1YJ9 T;  2CSQ A;  2JN0 A;  2X35 A;  2JNG A;  4C0G A;  2H3E B;  4PJO A;  4HVU A;  1AEY A;  1GBQ A;  1X43 A;  4OMO A;  4OVA A;  3OYY A;  2CH4 W;  1I5O B;  2QQR A;  4JUV A;  2D8J A;  2J6K A;  1WQ7 A;  2KYM A;  2LT1 A;  3JB9 J;  3C95 A;  1WPY A;  5GAN 7;  3P8B B;  2D9T A;  2J05 A;  4PK4 A;  3R6N A;  2EQK A;  1Q82 R;  4XU1 A;  2DIG A;  3KFV A;  2EW3 A;  2YWW A;  2X4J A;  4M75 E;  1UG1 A;  2E41 A;  1AWX A;  2J6O A;  3SD4 A;  3M0T A;  2X4W A;  1U06 A;  4RG2 A;  4LDV A;  1RUW A;  3CCR Q;  2CYZ B;  4J9I A;  3MP8 A;  3M4Y A;  4C92 E;  1KK7 A;  4MZT A;  5GAO q;  3VYH B;  1QCN A;  2KRS A;  1PM3 A;  4KH0 B;  4BB7 A;  4AT1 B;  4LD9 K;  4OMM A;  1VQN Q;  2ZGW A;  3LLR A;  4C5H A;  3CCL Q;  1NZ9 A;  4A4G A;  1W1F A;  1WHK A;  4DOV A;  2LRQ A;  1I4K 1;  2LC4 A;  2MWO A;  3ZBD A;  1G5V A;  1KHI A;  3CCM A;  5KYX B;  4M7D B;  3JCM d;  1PRM C;  2EBP A;  5CQY A;  2O4X B;  1I07 A;  1SKU B;  2KRM A;  3CCM T;  3A1P A;  1T3L A;  4HCK A;  4FW2 A;  1KHC A;  2OAU A;  2PTK A;  2HMA A;  3L2V A;  1AZE A;  1BK2 A;  2YUN A;  4FYV B;  4F7U A;  1VYT A;  3CC2 Q;  1TH7 A;  1PKS A;  1BBZ A;  4DBH A;  2HBP A;  2E5Q A;  4PJJ A;  1MMG A;  2C0I A;  2DZC A;  3V7C A;  4BDY A;  3VKI A;  2NUZ A;  4QKU A;  5CR2 A;  1RAD B;  3M0R A;  1PSF A;  2M1H A;  4M75 D;  3VRY A;  3CC7 A;  2VYT A;  1PC0 A;  1Y96 A;  3CME A;  1LVK A;  1A0N B;  3H9N A;  1MMA A;  3HKS A;  4C8Q F;  1R8O B;  5I11 A;  2EPD A;  3TCJ A;  3OB9 A;  2B86 A;  5FRM A;  1VQK A;  3FEO A;  3RMQ A;  3CC7 T;  1XJW B;  1BB9 A;  2CDT A;  3CME T;  5LJ5 e;  1ZSG A;  4C92 D;  1K1Z A;  2YT6 A;  2DA9 A;  2JTM A;  5GJW B;  1VQK T;  2D6F A;  4M78 C;  1RLQ C;  4HCZ A;  4R55 A;  2XKO C;  1KQS S;  3EH1 A;  4Z8A A;  2CP6 A;  1BYM A;  2K57 A;  2KMT A;  3I9Q A;  2KI7 A;  4OGC A;  3G4S T;  5GAN f;  1FMV A;  3L2Q A;  5GAN 4;  1OYX A;  2E65 A;  1Q82 C;  1FXX A;  2A7Y A;  1Q81 U;  3QYG B;  4ZNX A;  1ARK A;  1D3B B;  1OPK A;  2DNU A;  4C0Z A;  1RL2 A;  1B34 B;  4LXC A;  3BE3 A;  5GAO r;  1W2B P;  5KYY A;  4N4G A;  3VS3 A;  1NBE B;  2LX9 A;  4OMF B;  2RHY A;  4N4H A;  2DBK A;  5C6S A;  4BI3 A;  4M78 B;  3QHS A;  2ZPB B;  1UFF A;  2XDP A;  2A08 A;  1M2O A;  1I8F A;  1ZBJ A;  2LJ3 A;  3OMC A;  4PJO E;  4FW1 A;  4FYW B;  3OS0 A;  4FIB A;  4NS5 A;  1C0M A;  1R0C B;  4DOW A;  4N0A C;  2FPD A;  1TUC A;  3I56 Q;  1YJN Q;  3M0P A;  1OZ2 A;  3GNG A;  2X4Y A;  2J06 A;  4C8Q C;  4HVV A;  2VC8 A;  5CK9 A;  4AFQ C;  2XK0 A;  3V7R A;  3NHN A;  1IGQ A;  2DEU A;  5HK3 A;  4F16 A;  5CAI A;  1ZQ1 A;  2G6F X;  1D1B A;  2A28 A;  3LYI A;  2JJ9 A;  4C0F A;  1ZX6 A;  3DB4 A;  3SEM A;  4MML A;  3MET A;  1WHJ A;  2JT4 A;  2L89 A;  3MO8 A;  2ZPI B;  4IIO A;  5GAM h;  4JJC A;  3OYH A;  4EMK A;  2P84 A;  3FLG A;  3L2W A;  4TVR A;  4NOY A;  3HRS A;  1VQ7 A;  3NFC A;  4CI0 C;  1TOV A;  5LJ3 j;  2QDY B;  3M55 A;  4JLI A;  1ZUU A;  1M27 C;  2FHD A;  1K9M R;  3DKM A;  2JOY A;  1VQ7 T;  4YTL A;  3M5A A;  4C8Q B;  2IPO B;  2RB6 A;  4IUT A;  2LCC A;  2ECZ A;  2OI3 A;  1VQ8 A;  4E47 A;  2W0Z A;  3H0I A;  4JLG A;  2XG8 D;  3M56 A;  2P4R A;  1KIK A;  5C0M A;  1AWO A;  2MPX C;  2NUT B;  1VQ8 T;  3N5B B;  2LQN A;  2HNI A;  3HHT B;  4XQ3 A;  2KE9 A;  3GLX A;  3S3O A;  1D0Y A;  1WIE A;  3M59 A;  2M16 A;  5D6X A;  3VS7 A;  1I1J A;  2FEI A;  2HKN A;  4F7U E;  3QJ6 A;  1MMN A;  3TVT A;  2XID A;  4LNP A;  2MAM A;  2O2O A;  1IB8 A;  5HCK A;  5CIU A;  2K5L A;  2XIC A;  1IO6 A;  2VWF A;  2DF6 A;  2EYX A;  3EG1 A;  3GNF B;  1W4S A;  3JCM h;  4B9X A;  1IZ6 A;  5IHI A;  3JCM W;  2PVG B;  2VXF A;  2EQU A;  2QTX A;  3X20 B;  1WZO A;  1ABO A;  1X6B A;  2QQA A;  5KYN A;  2ED1 A;  1UEB A;  3I55 A;  5KYX A;  1ZUK A;  3G1J A;  4RTW A;  4A53 A;  4M77 C;  2O4X A;  1G2B A;  2KK4 A;  3I55 T;  2KEA A;  4M75 G;  4Z02 A;  3E1S A;  4JZ3 A;  3A8L B;  1NLO C;  4OB2 B;  5HKC A;  2JTF A;  3ULR B;  1OUL A;  2E5K A;  4A63 B;  3FIF A;  3X25 B;  4E7K A;  2YLB A;  4C92 G;  1YP5 A;  1WXT A;  2XU8 A;  1D1C A;  3PGG A;  1XNI A;  3DB3 A;  3M9Q A;  3OSV A;  3O8V A;  5LL6 S;  2K2V A;  4ORZ A;  1Q95 G;  4EMH A;  2DE0 X;  2PU9 B;  1KQS A;  2DL8 A;  2R5A A;  3NTH A;  2GNC A;  1YCS B;  3LWH A;  3INZ A;  2VAS A;  4J83 A;  2IVW A;  2RQV A;  3CC4 Q;  1WHH A;  2O9S A;  4WF2 A;  1KQS P;  2K3X A;  5I2M A;  3EFR A;  5FW9 A;  4V2S A;  3KBG A;  5DM7 R;  1HK9 A;  1UJ0 A;  4PLL A;  2DO3 A;  3QUI A;  4J9B A;  1OU8 A;  4CC3 A;  2DK3 A;  5GAN 2;  1UGV A;  1G3S A;  1VUB A;  4JRI A;  2V8J A;  3H0H A;  1BKB A;  2CZ0 B;  5KH6 A;  1ZA2 B;  3CMA Q;  1D3B A;  2PNI A;  3OQ5 A;  2ED0 A;  1K8A U;  2E3I A;  4E2F B;  5IAY A;  3WXM B;  2BZ8 A;  5LJ5 d;  3I35 A;  1UUE A;  5GAN h;  1VQ6 Q;  1C6V X;  1AZG B;  3MEV A;  4M78 A;  1B3Q A;  2EVR A;  3BDU A;  3OBW A;  1ZHI A;  1R77 A;  3EG9 A;  3MCA B;  2E4H A;  1FWZ A;  2CP7 A;  1FX7 A;  1BU1 A;  4PL6 A;  1YIT Q;  2X3W D;  4D6W A;  3RES A;  2C0O A;  1UGR B;  4VUB A;  1NPP A;  1GRI A;  4PFO A;  4MDW A;  2RQU A;  1D0Z A;  3LX7 A;  1MGQ A;  3C94 A;  3EGD A;  2FRW A;  2VGM A;  4AFS C;  3PFS A;  3CCJ Q;  3CCR A;  4HVW A;  1PWT A;  1GXI E;  2CP3 A;  1CKA A;  2FPE A;  4C0D C;  1PD1 A;  3CBP A;  1Q81 R;  4DQ2 A;  1OZ3 A;  4ZTJ A;  4GLM A;  4P5N A;  3CCR T;  3CBO A;  2KBT A;  4JJB A;  4RG8 A;  2EYZ A;  2QA4 Q;  1M2V B;  2L8D A;  1XOV A;  5A2Q E;  3JB9 G;  1IHV A;  4A4E A;  3EG0 A;  2MF2 A;  1VQN A;  3A5Z B;  3NMZ C;  3CCL A;  4DEY A;  3A8H B;  1OU9 A;  2CZ1 B;  2AKL A;  1ZSZ C;  4MZM A;  3OMG A;  5FU7 C;  1VQN T;  3QBY A;  1VYV A;  3CCL T;  3CPW P;  3CCE Q;  3M4G A;  4N0A A;  1SRL A;  4ZN3 A;  1AWJ A;  4RCB A;  1WI7 A;  3OBY A;  4PJO G;  1TG0 A;  2F69 A;  4M7A D;  2DJZ A;  1G3W A;  4XTW A;  3E2U A;  3L2U A;  5GJV B;  1W6X A;  1KSW A;  1NLP C;  4O6J A;  5CO7 A;  3RDV A;  3CC2 A;  3OA6 A;  2NUT A;  1TU0 B;  1J3T A;  4A54 A;  5FWB A;  3OYG A;  2VV5 A;  4E6R A;  4OB3 B;  1ZSZ B;  8AT1 B;  3CC2 T;  5FU7 B;  1K0S A;  1MND A;  2KQW A;  3FDR A;  2CSI A;  4X9C A;  3ZEH A;  3G71 Q;  1X2K A;  5GMK i;  5J26 A;  3VS6 A;  1QCO A;  2CUB A;  2X3X D;  2E64 A;  5GAM d;  1XQH A;  3QO3 A;  1VIF A;  3MP6 A;  3EGU A;  1QCF A;  2CH4 A;  4M75 F;  2NUP B;  1V76 A;  3S3M A;  1WNL A;  2D8H A;  5CKD A;  3V8K A;  1UDL A;  2RI2 A;  1HYO A;  3NPF A;  1M3A A;  3EFS A;  5KCH A;  2ZPH B;  1UTI A;  1QVF S;  3H8Z A;  2HDA A;  4PJL A;  3CD6 Q;  5DY9 A;  1KG1 A;  4C92 F;  2RJF A;  4E7Z A;  1N9R A;  2P0K A;  3EG2 A;  1YJW Q;  3QII A;  1RAC B;  1PSE A;  1SF9 A;  3VUB A;  2DFU A;  4M7D C;  3CCU A;  1T0H A;  3OYE A;  3PTA A;  1V29 B;  2DXC A;  3RKX A;  3SFM A;  3CCQ Q;  4KBM B;  1AOJ A;  1JBM A;  5EG2 A;  2V8I A;  3CCU T;  1VQM Q;  3PE0 A;  1D09 B;  1W70 A;  2RA2 A;  3A8G B;  4JRQ A;  4R0K A;  3VV0 A;  2LJ1 A;  3VS4 A;  3X26 B;  4Z89 A;  2LTO A;  3TSZ A;  1UGS B;  4F7U G;  4RKU E;  4E7S A;  3NGP A;  1OX9 A;  1X2Q A;  2GTJ A;  1WHM A;  9ATC B;  3RIR A;  2V8K A;  2EGC A;  3C12 A;  1WGS A;  1Q81 C;  1JQQ A;  5GAM j;  3EGX A;  3UWN A;  2H8H A;  1GCQ C;  2LJ0 A;  3QWY A;  2LCS A;  2RQW A;  4NL3 A;  3ZFJ A;  1ZBX A;  2FYK A;  2AHJ B;  2LP5 A;  2RJE A;  2L2P A;  2RQR A;  4L5G A;  4M77 A;  1QKW A;  3I56 A;  5FU6 C;  4M78 E;  2VKN A;  3PNW C;  1RAF B;  1N27 A;  1YJN A;  2GTO A;  2ZCF B;  2LQ8 A;  1QWE A;  1UGP B;  3I56 T;  1YJN T;  1K73 U;  2ZPF B;  2HKQ B;  2LNV A;  3OYN A;  4OB1 B;  7AT1 B;  2RHX A;  3EFO B;  2HSP A;  3OYC A;  4IUR A;  1BI1 A;  1O75 A;  1NM7 A;  1O9S A;  2COY A;  2YHT A;  3EAE A;  5A0D A;  3JCM b;  2KR3 A;  4M4Z A;  2XMF A;  2F2V A;  4JDS A;  5LJ5 h;  4DA4 A;  2KSS A;  4F17 A;  1GCP A;  1G8X A;  1PNJ A;  5FU6 B;  2O31 A;  2IIM A;  2KYB A;  5IT9 E;  1GBR A;  1GL5 A;  4AMC A;  3LWI A;  4M75 B;  2K3Y A;  4ELZ C;  3L2R A;  3BDL A;  5GMK e;  1QQJ A;  3J81 E;  1Q86 R;  2JMC A;  3JCM V;  4IKF A;  1X01 A;  4KGZ B;  1V1C A;  3VUZ A;  3CCU Q;  4KUL A;  4QQG A;  3HL8 A;  3JB9 F;  4ANJ A;  2QI2 A;  3CBM A;  3L2Z A;  3QWX X;  2QDL A;  2EJ9 A;  3UAT A;  1VOM A;  1YBY A;  5IXB A;  4E7L A;  3UPU A;  5LJ3 f;  3LH5 A;  2RHI A;  4AG2 C;  4J7F A;  1YWP A;  2DRK A;  3X24 B;  3UDC A;  1JXM A;  2KT8 A;  2JM8 A;  4PJO F;  1DJ7 B;  3RUX A;  4KRT A;  4M78 D;  2P0Q A;  2FZK B;  2DZ9 A;  3SWN B;  4M7A G;  1RI9 A;  1Q7Y U;  1K8A R;  4DBQ A;  5GAN d;  1M2V A;  4PJM A;  1Z9Z A;  4HT8 A;  2AIR B;  1I81 A;  3OS1 A;  3OYF A;  1SG5 A;  1Y0M A;  3O5Z A;  2DL3 A;  1VQ5 Q;  2O9V A;  1EZZ B;  1YNZ A;  5CKF A;  3S6W A;  3M0S A;  3QZ9 B;  5I22 A;  2WAC A;  2WSE E;  3NTI A;  1OOT A;  3LW5 E;  1YI2 Q;  2NLU A;  2DEQ A;  2JW4 A;  2DX1 A;  2EFI A;  3EHR A;  2GBQ A;  4CC4 B;  4QT7 A;  2KXD A;  2Y4Y A;  3OYA A;  3QSU A;  2RI5 A;  4LDX A;  1H3H A;  5LJ3 g;  4M7A A;  1IRX A;  2D0N A;  3NTK A;  1Y71 A;  4IUV A;  2P0P A;  3CCS Q;  1BI2 A;  2CRE A;  3HPW A;  1H3Z A;  2KGT A;  3A8O B;  2KNB B;  1VQP Q;  4ATO A;  2DPP B;  1N5Z A;  2L3Q A;  2F5K A;  1KD1 R;  5CKE A;  2QAS A;  2EGE A;  1ZSZ A;  2DJQ A;  2GF7 A;  3GF5 A;  5AT1 B;  1UB4 A;  2F1L A;  2FZC B;  2DVE A;  2RJC A;  1QVF A;  2HQX A;  2JS0 A;  4C8Q D;  1CKB A;  1PCX A;  2LX7 A;  3CQT A;  1M30 A;  5GAN j;  1H8K A;  1QVF P;  4B6M A;  3CC4 A;  4J9G A;  4F7U F;  1QMC A;  2VXE A;  3HTR A;  1M3C A;  2DL7 A;  2E6N A;  3CC4 T;  1BI3 A;  3V8L A;  1BIA A;  2OJ2 A;  1HD3 A;  3QXE B;  4M77 E;  5KE2 A;  1UGQ B;  2M9U A;  1Q86 C;  1TTH B;  2ZAE A;  3BY7 A;  4J9E A;  3FC3 A;  2EJF A;  1QKX A;  2AZV A;  2LDM A;  4FT4 A;  2HSE B;  3CMA A;  3TQ7 P;  1IRE B;  2RHU A;  3EHQ A;  1JEG A;  2AK5 A;  4PJO B;  3REB B;  3MKD A;  4DBR A;  2OTL Q;  3CMA T;  2GQI A;  3WVE B;  1KFZ A;  1VQ6 A;  3AHU A;  4QW2 A;  2DER A;  1U3O A;  4Y91 A;  2C06 A;  1VQ6 T;  2D0Q B;  1YWO A;  4RTV A;  4HCC A;  1VQ4 Q;  2J7I A;  2E3H A;  1ACM B;  2LQW A;  2RNA A;  4KT0 E;  5GAO p;  1YIT A;  3A8M B;  4M7D A;  2BE9 B;  4WCI A;  2QQS A;  1K8A C;  2A37 A;  2RQT A;  2HQE A;  3H6Z A;  4LUD A;  5IXF A;  1YIT T;  3SB2 A;  5A0G A;  3VS2 A;  4FYY B;  2QG9 B;  2CZ7 B;  3CCJ A;  3QZ5 B;  4XU3 A;  2BKD N;  4IUU A;  4XTU A;  3L42 A;  3LH0 A;  4LD6 A;  4IUP A;  3CCJ T;  1Y07 A;  1TSF A;  3QDF A;  3EFO A;  4BE0 A;  2QA4 A;  2X4X A;  2DKG A;  3MEW A;  4FM4 B;  1YIJ Q;  1WYX A;  2MMP A;  3CCV A;  3GIB A;  2QA4 T;  1GCQ A;  4LDY A;  2M0O A;  2F5T X;  2DIQ A;  4M77 D;  1U1T A;  4JJD A;  1YFN A;  3JCM X;  2MOX A;  3CCE A;  2NYS A;  1KD1 C;  4KH1 B;  1M3B A;  1KC8 U;  4MMK A; 
#chains in the Genus database with same CATH homology
 2C0I A;  1K9A A;  4RUG A;  1VYU A;  2NUZ A;  1U5S A;  2EGA A;  4IIM A;  1J3T A;  3M0R A;  5FWB A;  2ESW A;  4X1V A;  4E6R A;  3VS1 A;  3VRY A;  3FJ5 A;  1PHT A;  3UA7 A;  3VRZ A;  2CT4 A;  1K0S A;  1UE9 A;  2L3P A;  4HXJ A;  2BZY A;  2CSI A;  1A0N B;  5I11 A;  2EPD A;  1X2K A;  2B86 A;  3VS6 A;  2CUB A;  2X3X D;  2CDT A;  1BB9 A;  1AVZ C;  1ZSG A;  2VVK A;  1K76 A;  1K1Z A;  2YT6 A;  1WX6 A;  2DA9 A;  3EGU A;  5GJW B;  4GBQ A;  1QCF A;  2CH4 A;  1OV3 A;  1RLQ C;  2AZS A;  2D8H A;  1NG2 A;  4Z8A A;  2DL5 A;  2JM9 A;  3GBQ A;  1UDL A;  1SRM A;  3NPF A;  4OMN A;  1M3A A;  3A98 A;  3VS5 A;  3I9Q A;  1NYF A;  1UTI A;  4J9H A;  1AWW A;  2HDA A;  2W10 A;  4LUE A;  3EG2 A;  2DBM A;  2EYW A;  4ZNX A;  2C0T A;  1ARK A;  1T0H A;  1OPK A;  2DNU A;  2AKK A;  1SEM A;  2ENM A;  2HCK A;  2K3B A;  3VS3 A;  1AD5 A;  1AOJ A;  4OMP A;  1SHF A;  2EQI A;  3M0U A;  3PE0 A;  2DBK A;  1W70 A;  1OEB A;  2K2M A;  4R0K A;  2KXC A;  2LJ1 A;  3VS4 A;  4Z89 A;  1UHC A;  1UFF A;  3M0Q A;  3TSZ A;  2HEQ A;  3C0C A;  1ZLM A;  3I5R A;  2A08 A;  2RF0 A;  3NGP A;  1X2Q A;  1ZBJ A;  2LJ3 A;  1VA7 A;  2GTJ A;  2EYY A;  4CC7 A;  2EGC A;  1JU5 C;  2M51 A;  1JQQ A;  2KRO A;  1HSQ A;  1HJD A;  1SPK A;  2O88 A;  4ESR A;  4JZ4 A;  2FPD A;  2H8H A;  1GCQ C;  2LJ0 A;  1TUC A;  2DYB A;  3QWY A;  3H41 A;  2LCS A;  3M0P A;  2RQW A;  4LN2 A;  2J06 A;  2LP5 A;  4RTY A;  4HVV A;  1WXB A;  1ABQ A;  4Y92 A;  4AFQ C;  2DM1 A;  1RLP C;  2L2P A;  2RQR A;  5IHK A;  1FYN A;  1QKW A;  1X69 A;  2VKN A;  3NHN A;  1WXU A;  4F16 A;  3VS0 A;  2GTO A;  4RTZ A;  2G6F X;  1S1N A;  2A28 A;  1QWE A;  3PVQ A;  1ZX6 A;  3SEM A;  2RN8 A;  2FO0 A;  3UA6 A;  1FMK A;  1TUD A;  2JT4 A;  2D1X A;  1WDX A;  2HSP A;  3U23 A;  1NM7 A;  4IIO A;  2MCN A;  4JJC A;  1B07 A;  1T0J A;  3UF4 A;  1G83 A;  3REA B;  2KR3 A;  2K7A A;  2PZ1 A;  2LMJ A;  2YUQ A;  2LNH B;  4M4Z A;  4K11 A;  2XMF A;  1ZUU A;  2F2V A;  1M27 C;  2LZ6 B;  2DMO A;  4EIK A;  2YDL A;  2ECZ A;  2OI3 A;  1GCP A;  1JXO A;  2V1Q A;  4F17 A;  5L23 A;  1PNJ A;  2JMA A;  2OAW A;  2O31 A;  2W0Z A;  3H0I A;  2IIM A;  2L0A A;  1K4U S;  2KYB A;  2P4R A;  1GBR A;  1GL5 A;  1KIK A;  1AWO A;  1CSK A;  4OMQ A;  2K79 A;  2LQN A;  5IH2 A;  1UHF A;  2JMC A;  2KE9 A;  1KJW A;  1WIE A;  1QWF A;  1V1C A;  3VS7 A;  1I1J A;  1MUZ A;  2FEI A;  3QWX X;  2I0N A;  2QDL A;  2NWM A;  3UAT A;  5IXB A;  4Z88 A;  3THK A;  2KRN A;  2V1R A;  3H0F A;  3LH5 A;  4J9F A;  3TVT A;  4LNP A;  1NYG A;  4AG2 C;  2K6D A;  4D8D A;  1YWP A;  2DLP A;  2DRK A;  1OPL A;  2O2O A;  1JXM A;  2KT8 A;  5HCK A;  2JM8 A;  1IO6 A;  2VWF A;  2DF6 A;  2DRM A;  2HBW A;  2EYX A;  4KRT A;  3EG1 A;  5IHI A;  2SEM A;  1MV3 A;  1ABO A;  1H92 A;  1RI9 A;  1X6B A;  2ED1 A;  1Z9Z A;  4J9D A;  4RTU A;  1Y0M A;  3O5Z A;  2DL3 A;  1ZUK A;  2O9V A;  4RTW A;  2YSQ A;  2BTT A;  1YNZ A;  2JTE A;  3M0S A;  1G2B A;  2ROL A;  5I22 A;  2KEA A;  1OOT A;  4DEX A;  4OML A;  4JZ3 A;  2ABL A;  2JW4 A;  1NLO C;  2DX1 A;  5IHN A;  3EHR A;  2GBQ A;  4CC4 B;  3ULR B;  4J9C A;  4QT7 A;  1JO8 A;  2KXD A;  2F2X A;  2DIL A;  2E5K A;  2ROT A;  4A63 B;  1H3H A;  1WFW A;  1X6G A;  2D0N A;  1WA7 A;  1K0X A;  1YP5 A;  1WXT A;  1ZUY A;  3JV3 A;  1Z9Q A;  2CRE A;  4CC2 A;  2FG0 A;  1E7O A;  3SHW A;  2KGT A;  1M8M A;  2KNB B;  1NEG A;  4ORZ A;  2SRC A;  1N5Z A;  1UEC A;  2L3Q A;  2MIO A;  2DE0 X;  2RPN A;  2YUP A;  2F2W A;  3RNJ A;  1X27 A;  2DL8 A;  2EGE A;  2DJQ A;  2GNC A;  2RMO A;  1YCS B;  2FRY A;  1WLP B;  2YUO A;  2BZX A;  2JXB A;  4AFU C;  1E6G A;  1SSH A;  2JS0 A;  2RQV A;  1CKB A;  4FSS A;  2LX7 A;  3CQT A;  2J6F A;  2O9S A;  1M30 A;  1UJY A;  3RBB B;  2JS2 A;  5FW9 A;  1I0C A;  5FWC A;  1T3S A;  1H8K A;  1NEB A;  1UJ0 A;  4AG1 C;  4J9G A;  4J9B A;  5EC7 A;  2FPF A;  4CC3 A;  4AFZ C;  4D8K A;  2L3S A;  1UGV A;  1QLY A;  1M3C A;  2DL7 A;  2DVJ A;  2CSQ A;  3ZL7 C;  3H0H A;  4HVU A;  2OJ2 A;  1GBQ A;  1AEY A;  1HD3 A;  1X43 A;  3EG3 A;  4OMO A;  5ECA A;  2CH4 W;  4RTX A;  4J9E A;  2PNI A;  2D8J A;  2J6K A;  2KYM A;  2ED0 A;  1QKX A;  2AZV A;  4RTT A;  2BZ8 A;  1MV0 B;  3I35 A;  2J05 A;  1UUE A;  3R6N A;  3KFV A;  3EHQ A;  1AZG B;  1JEG A;  2M0Y A;  2AK5 A;  2EW3 A;  1B3Q A;  3REB B;  1UG1 A;  2EVR A;  2GQI A;  1KFZ A;  1AWX A;  2J6O A;  3M0T A;  1BU1 A;  1U3O A;  3I5S A;  1U06 A;  2X3W D;  3PVL A;  2C0O A;  1RUW A;  1EFN A;  1YN8 A;  1YWO A;  4J9I A;  4RTV A;  1GRI A;  2CUD A;  1PKT A;  2J7I A;  2RQU A;  2LQW A;  2RNA A;  2FRW A;  4WCI A;  4AFS C;  2A37 A;  2KRS A;  2CT3 A;  2GGR A;  2RQT A;  4HVW A;  1PWT A;  1GFD A;  1E6H A;  1CKA A;  2FPE A;  4LUD A;  5IXF A;  4F14 A;  2DL4 A;  4OMM A;  3VS2 A;  1Y57 A;  4GLM A;  2KBT A;  1W1F A;  4JJB A;  2EYZ A;  1SHG A;  1XOV A;  3EG0 A;  3NMZ C;  1LCK A;  1PRM C;  2EBP A;  4DEY A;  2AKL A;  3IQL A;  2EKH A;  1I07 A;  2KRM A;  1PRL C;  1VYV A;  1T3L A;  1GFC A;  4HCK A;  4JPB W;  1WYX A;  4LE9 A;  2K9G A;  2PTK A;  1AZE A;  1BK2 A;  1SRL A;  1AWJ A;  2YUN A;  2A36 A;  1GCQ A;  2KT1 A;  1WI7 A;  1TG0 A;  4JJD A;  1VYT A;  2MOX A;  1PKS A;  1BBZ A;  3TSW A;  5GJV B;  1W6X A;  1KSW A;  1NLP C;  1M3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...