2RQWA

Solution structure of bem1p sh3ci domain complexed with ste20p-prr peptide
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
105
structure length
105
Chain Sequence
GSLYAIVLYDFKAEKADELTTYVGENLFICAHHNCEWFIAKPIGRLGGPGLVPVGFVSIIDIATGYATGNDVIEDIKSVNLPTVQEWKSNIARYKASNISLGSVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Bud emergence protein 1
publication title Solution structure of a novel Cdc42-binding module of Bem1 and its interaction with Ste20 and Cdc42
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 7
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2009-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2rqwA01
2L2PA 3PE0A 1RI9A 2JMAA 1WA7A 2PTKA 4LE9A 4OMOA 1RUWA 4J9DA 2M51A 2DF6A 2L3SA 4RTXA 4ORZA 4AFQC 2MCNA 1BBZA 2J05A 1ABQA 4Z89A 1ZLMA 2LJ1A 1OEBA 1YP5A 3M0SA 2J6OA 1XOVA 1GFDA 4AG2C 1FYNA 1JXOA 2W10A 2FRYA 2YUNA 4J9CA 2AK5A 2GTJA 1UE9A 1WDXA 5I22A 2EYWA 2CUBA 1RLQC 4LUDA 4Z8AA 1WYXA 1N5ZA 2DE0X 2J6KA 2KE9A 2DX1A 2CH4W 2JMCA 3M0PA 2AZVA 2EYZA 4HVVA 4OMNA 3I5SA 5HCKA 2JS2A 2LJ3A 2DL3A 4RTTA 1WXTA 5EC7A 2FG0A 1NG2A 2V1RA 5L23A 3NHNA 2FPFA 3H41A 2JTEA 1BB9A 2MOXA 2ABLA 3THKA 1HSQA 4LNPA 1FMKA 4AFZC 1H3HA 4K11A 2JM9A 2KBTA 4OMMA 3QWXX 2EGEA 3H0FA 1AWJA 1WIEA 4GLMA 4OMLA 4D8KA 1J3TA 3KFVA 2FRWA 1ARKA 1HJDA 3IQLA 2ED0A 1M3AA 2H8HA 2X3WD 1SRLA 2RQTA 1QLYA 2YT6A 2LMJA 1QKXA 3JV3A 1M3BA 4HVWA 1T0JA 1AOJA 4CC4B 1K0SA 1X6BA 1G2BA 1YNZA 1GCQA 1V1CA 4LN2A 1BK2A 2IIMA 2LQNA 2O31A 3VRZA 3A98A 3TSWA 2P4RA 3VS7A 1Z9QA 2W0ZA 3H0IA 2O2OA 1JEGA 1T3LA 1X2KA 1Y0MA 4J9HA 1AWOA 1OV3A 2O88A 2C0IA 2EW3A 3EGUA 2ROLA 1I0CA 1VYVA 1M3CA 1ZBJA 1UDLA 1UJ0A 1YWOA 4GBQA 4AFUC 1M27C 2RQVA 4AFSC 3I9QA 1WLPB 3RNJA 4RUGA 4LUEA 2VVKA 2JXBA 2OAWA 1B3QA 2SEMA 4J9IA 4RTYA 1ZSGA 2DL7A 2E5KA 2FO0A 3PVLA 1ZUUA 4AG1C 2NWMA 2D8JA 5IH2A 1UHCA 5FWCA 3U23A 2L0AA 3EHRA 5IHIA 3VRYA 2OJ2A 2GQIA 3EG1A 1NLOC 2A28A 1RLPC 2J7IA 2A36A 1W6XA 1UGVA 3EHQA 2LX7A 4M4ZA 1AWWA 2YDLA 1PRMC 3UATA 2CSQA 1NEGA 3NMZC 2DL5A 1EFNA 2KT1A 1NYFA 2D0NA 3TVTA 3VS6A 1ZUYA 3UA7A 1X6GA 1WI7A 2DA9A 2DBKA 1Z9ZA 2ENMA 2KXDA 4F14A 1WFWA 1YWPA 1NM7A 4Z88A 1T0HA 2JW4A 1JXMA 1WX6A 2LNHB 3VS5A 2CREA 4J9GA 3R6NA 3VS3A 2GGRA 1ZX6A 1SPKA 2EYYA 1NLPC 2F2VA 2KRSA 1OOTA 2XMFA 1UECA 2GTOA 5IXBA 1WXUA 5IHNA 1AZGB 2BZXA 2DBMA 4KRTA 1KFZA 2EKHA 2AKLA 1BU1A 2LJ0A 3C0CA 1MV0B 2HCKA 4IIOA 2CDTA 1I1JA 1S1NA 4CC2A 2F2WA 1NYGA 2RF0A 1LCKA 1UFFA 5FWBA 2RQWA 4J9BA 2CT3A 2C0OA 2BTTA 1G83A 2PZ1A 2PNIA 1K9AA 1PNJA 3I35A 2RNAA 2QDLA 3TSZA 4HCKA 4HVUA 1MV3A 4X1VA 2HEQA 3M0RA 4JJCA 5I11A 4RTVA 2B86A 1B07A 1JQQA 1UHFA 4EIKA 2LQWA 2MIOA 1U5SA 2LP5A 3M0TA 1IO6A 4D8DA 2RN8A 2HBWA 2GBQA 1JU5C 1QWEA 4A63B 3RBBB 1QKWA 3VS2A 3SHWA 1SHFA 3FJ5A 2KXCA 1U3OA 4J9EA 4CC7A 2YUPA 1E6GA 2K6DA 2RQUA 2LZ6B 2HSPA 2EBPA 3GBQA 2D1XA 3I5RA 1VYTA 1PWTA 2RPNA 4FSSA 4R0KA 1JO8A 3VS1A 1AZEA 1H92A 1KJWA 2CH4A 2ESWA 4RTZA 2JM8A 1M30A 2KYBA 2DYBA 4WCIA 1UTIA 4OMPA 2FPDA 5IXFA 1GCPA 1ZUKA 4RTWA 2KROA 4JJDA 2YSQA 2O9VA 2DVJA 1GBRA 1SSHA 3H0HA 1M8MA 2J6FA 1K1ZA 4JZ3A 1I07A 2VWFA 2ECZA 4QT7A 1NEBA 2ROTA 2K7AA 3CQTA 1X27A 4F17A 1X43A 2CT4A 1H8KA 2GNCA 1TUCA 2EPDA 2DL8A 2V1QA 1SEMA 1UG1A 2FPEA 4JZ4A 2CSIA 3SEMA 2L3PA 5IHKA 3ULRB 2L3QA 2AZSA 1VA7A 3EG0A 1VYUA 2O9SA 3PVQA 3UF4A 4DEYA 3M0QA 5GJVB 2KGTA 5ECAA 1K4US 2EGCA 2X3XD 2AKKA 3REBB 2J06A 4DEXA 1QCFA 2JT4A 2KR3A 4JJBA 2A37A 2OI3A 1WXBA 2KRMA 4J9FA 2EGAA 3O5ZA 2NUZA 2HDAA 2KRNA 4CC3A 4IIMA 1W1FA 1CKAA 2RMOA 1E6HA 1PKTA 1YCSB 2F2XA 1MUZA 4JPBW 2DRMA 1PKSA 3REAB 2KYMA 2C0TA 1ABOA 1Y57A 2K3BA 2K2MA 2K9GA 1AEYA 2YUQA 2K79A 4HXJA 1W70A 2DM1A 2M0YA 3UA6A 2D8HA 2BZYA 2JS0A 3VS4A 5FW9A 1KSWA 1PRLC 1SRMA 1GRIA 4ZNXA 1U06A 5GJWB 1X2QA 2ED1A 1GL5A 2CUDA 2DLPA 1UUEA 3LH5A 3ZL7C 2DILA 1GCQC 2A08A 2EQIA 1KIKA 1AWXA 2KEAA 2I0NA 1CSKA 2BZ8A 2DRKA 3EG2A 1HD3A 1X69A 3M0UA 1K76A 4OMQA 2VKNA 1SHGA 1PHTA 2DNUA 1K0XA 1TG0A 1A0NB 2SRCA 3NGPA 1OPKA 4ESRA 1GBQA 1QWFA 2YUOA 1TUDA 3QWYA 1T3SA 4F16A 2EYXA 1CKBA 1AVZC 1YN8A 2KNBB 2DJQA 2G6FX 2DL4A 2FEIA 1OPLA 2EVRA 2KT8A 3NPFA 4RTUA 1AD5A 3VS0A 3EG3A 2RQRA 2DMOA 1UJYA 1E7OA 4E6RA 2LCSA 4Y92A 1GFCA
chains in the Genus database with same CATH superfamily
3PE0A 2LTOA 4JS5A 2RH2A 4EPCA 1N9SA 3M4YA 3HPWA 2M51A 3OYLA 3ZEHA 3ZBDA 2L3SA 3J81E 4RTXA 3GLXA 2GFUA 4AFQC 2CS7A 4PJOE 2J05A 1ABQA 2VXFA 4O5VA 3G6EQ 1ZLMA 1IHWA 3OMGA 1XOVA 5LJ5j 2W10A 1Q86R 4WF2A 5DM7R 1WDXA 3EG9B 1C6VX 1KD1R 4N0AC 1WYXA 1OULA 1BI1A 1BIBA 4KH1B 2CH4W 2H3JA 2AZVA 4C92D 4PLIA 4PJLA 2DTHA 2X35A 3CPWP 4LDVA 3EFSA 3S3NA 4PJOC 2VYTA 3JCMV 5HCKA 2DL3A 4RTTA 3PIOA 3CCQT 3I55T 2KI7A 3OYNA 1YHQT 3CCUQ 3NHNA 4KGXB 2E3HA 5FU7B 1KC8U 3SWNB 2QTVA 2MOXA 1O75A 3THKA 3MP8A 3OYDA 2CP3A 1VQMT 4OMMA 4R56A 4XAXB 4LDYA 1AWJA 5FU6B 1WIEA 2C06A 3OSVA 3KFVA 3EH2A 1ARKA 2F5TX 4JRKA 2CZ7B 2V8JA 3A1PA 2E12A 2ED0A 4IUTA 2DXCA 2KQWA 5HK0A 2RQTA 4HCBA 5KE2A 4V2SA 4M78D 3JV3A 4EMKB 2M1HA 3PGGA 1T0JA 2E4HA 3GOXA 1AOJA 4A53A 2E70A 4CC4B 1K0SA 1X6BA 1G2BA 3MP6A 1GCQA 2PVDB 4JRIA 3S3OA 1N27A 4QKUA 5D6YA 2O31A 3VRZA 1MNDA 4EMKC 3JB9D 3VYHB 1Z9QA 2XI9A 3OYAA 4J6WA 2Z0WA 2O2OA 4FYWB 1T3LA 4M77B 2RJEA 2EYQA 1D1AA 1RAAB 2P0KA 2DD4A 2XU8A 2P4TA 3QKJA 2EQJA 2K57A 2O88A 2MMPA 1ZHIA 5EG2A 4Q5WA 1WJSA 3OYEA 3GPLA 1M3CA 3HRTA 1UDLA 1UJ0A 1QVGA 1U1SA 4F7UA 2VVKA 3DLMA 2OAUA 4C8QB 3GP8A 1B3QA 2SEMA 3HL8A 4J9IA 2DL7A 4RTYA 2E5KA 2HQEA 1XQHA 1IB8A 1UHCA 1JJ2P 1TS9A 5IHIA 4A4KA 4DQ2A 5I21A 8ATCB 2XHCA 1WGSA 3MPUB 2DVEA 3EHQA 1NJIU 4PNOA 1PRMC 3SB2A 1VIFA 4MZPA 5FROA 3KXTA 1NYFA 4ATOA 5IN1A 2PVGB 1WI7A 4O6JA 4EMGA 2ENMA 4F14A 4DBHA 1UGPB 2LNHB 5C0MA 3S6WA 1MMDA 5GANj 3VS3A 3ZFJA 1OU9A 1D0XA 4QQDA 1SPKA 2EYYA 4E47A 2GCXA 2F2VA 2KRSA 1UECA 3M9QA 2CZ1B 3CC4A 5IXBA 5D6WA 2BZXA 4IUVA 3OYHA 2EKHA 4E7KA 2QQ9A 4IIOA 2XDDA 2CDTA 2E41A 1W2BP 1I1JA 4FW2A 2XG8D 3CMET 4M7AE 5FWBA 4FSXA 1MMAA 1QP3A 4ZN1A 3MEUA 1N8RR 5DY9A 2QGFB 1G83A 3LGFA 2PZ1A 4XU1A 1K9AA 1PNJA 3I35A 2K4YA 2RJDA 3L42A 4HCKA 4HVUA 1VQ5A 1YI2T 1PCXA 3M0RA 4AMCA 5CQXA 4RTVA 2B86A 1B07A 4M7DA 3A8LB 5KYXB 1U5SA 4M75E 3O8VA 4D8DA 5GMKh 3V8KA 1OX9A 1UGRB 4M7AC 3CD6A 1YBYA 3FJ5A 1FMVA 2KXCA 3M56A 1U3OA 4J9EA 4QVCA 1E6GA 2VASA 4M75B 2F5KA 2EBPA 2MF2A 3I5RA 1VYTA 4KGZB 1X6OA 4F7UB 4FSSA 3OB9A 1M30A 2X4WA 4E7ZA 1UTIA 2JTFA 2FPDA 1F1BB 4M75C 1GCPA 3A8MB 4F04B 2O9VA 3I55A 2DERA 4JLIA 1Q7YR 1V29B 2PU9B 3CXCP 3CC4Q 4JZ3A 1I07A 3LX7A 3JAME 2VWFA 2ZPHB 3JCMe 2IVWA 2CYZB 1G3YA 1NEBA 4N4IA 2E3IA 3ER0A 1VQNT 1X43A 3VUZA 1M90U 4LXCA 1H8KA 1KHCA 4RG2A 3X24B 3QDRB 4BY6B 4C92F 3T9NA 2DETA 2HQXA 3BE3A 3P8DA 5KH6A 4B9WA 1VQ6A 5GAOp 2L3PA 2BKDN 3CCST 3ULRB 5LJ3j 1VQ5Q 4BY6C 3UF4A 1W4SA 3M0QA 3M4GA 3V7CA 2VB6A 1D09B 5ECAA 1K4US 2LVMA 1Q82R 3BDLA 2QA4T 2RD1A 4M77G 4J9FA 1FWZA 3OYBA 3CD6Q 2KY9A 3H8ZA 1G3WA 4ZTFA 2RJFA 3QJ6A 1TXQA 1MUZA 4JPBW 1I8FA 2DRMA 2V8IA 1PKSA 2KYMA 4A4GA 5LJ3f 3CMAA 4LDUA 1AEYA 4M78F 1OZ2A 2CZ6B 5KYNA 4DBFA 4C8QG 3I55Q 1YJ9T 2D8HA 1WHMA 2BZYA 1KSWA 1HYOA 5GJWB 1RABB 5GAMe 1X2QA 3JB9F 4BDZA 1GL5A 1OX8A 2RB6A 4OB0B 1QVFS 1MMGA 4E7IA 3P8HA 1GXIE 2KMTA 2EQIA 4PK4A 3TEEA 2I0NA 2M9UA 2BZ8A 5GAN3 2F1LA 2L5QA 2YHTA 1OU8A 2M0OA 2B8AA 1K76A 2VKNA 5A2QE 1VQ6Q 3JCMc 1SHGA 3BW1A 1PHTA 1ZSZC 2SRCA 3NGPA 2QTXA 1VQOT 1Q81R 3J80E 1TUDA 3PFSA 4F16A 4BUGA 2EYXA 1KQSA 2ZCFB 5J26A 3A5ZB 3OW2S 5CCAA 3NPFA 1AD5A 2RK2A 3EG3A 3C95A 3WVEB 1UJYA 1E7OA 4L59A 2LCSA 3CCVA 3OYJA 1Q82C 4ZN3A 1ZA1B 2M16A 5GMKe 2JMAA 4NL2A 1HK9A 2PTKA 1RUWA 3CCMT 1MGQA 5LJ5h 4RCCA 3CMAQ 2M02A 2DZCA 4BI3A 5KYUA 2MCNA 1BBZA 2IPOB 3C12A 1LVKA 1M2OA 4XU0A 1YP5A 3OYKA 1GFDA 1I5OB 1UE9A 5I22A 2EYWA 1D0YA 4Z8AA 5GAN6 4GLKA 3L2WA 4BE0A 4LDXA 4DBRA 1VQLA 5D7UA 1N5ZA 2BIVA 4C0FA 2DX1A 4J6YA 2EYZA 4HVVA 4JRQA 2QXFA 3QUIA 3MJXA 3M5AA 3TQ7P 2LJ3A 4PJOD 4ELZC 1M9SA 1VQ9T 2GQVA 5EC7A 2R5AA 3DB4A 2RHYA 1NG2A 2V1RA 3X25B 4F7UG 1YJWA 4C0DC 3CCRT 2ABLA 3G71A 1HXDA 2HD0A 4JJNK 3LLRA 1H3HA 4PJJA 1Y07A 1IRXA 2EGEA 4GLMA 3CCVQ 3INZA 4OMLA 1VQPA 2FRWA 2QGGA 1KQ1A 1K73R 2L89A 3IQLA 1HJDA 3UWNA 1VQKA 2KAFA 3QZ5B 4QQ6A 3VJPA 1VQNA 1QLYA 2LMJA 1QKXA 1M3BA 2BE7D 4ZGEB 2EQUA 4LDWA 3M58A 4RCBA 1VQ7A 3DB3A 1YNZA 2KVQG 2D9TA 4ZTJA 1BK2A 3CBOA 1B7TA 2G3RA 3A98A 5CVIA 3CCSA 3VS7A 1K9MC 2W0ZA 1PC0A 1VQLQ 1OZ3A 3QIIA 2HAXA 1YITT 2QG9B 3OSSC 1X2KA 1Y0MA 3MHXA 4J9HA 2HSEB 2HL5C 3CBMA 1QW1A 1WHKA 3OYIA 2ROLA 1I0CA 1M5Q1 4MMLA 1VYVA 1ZBJA 5LJ5g 3KUFA 1PM3A 1YWOA 5KYUB 2OTJT 1YJWQ 4AFUC 1M27C 3CC7T 3I9QA 4XU3A 3SD4A 3RNJA 1YIJA 3OYCA 3I56A 3CCJA 3G71Q 2QQRA 2HL3A 1ZSGA 3E2UA 1D3BA 2VGMA 3PVLA 4FT2A 5GAN5 2V26A 1QVGS 4M7DG 2E6NA 3VRYA 9ATCB 2KDSA 4PKCC 3R6OA 1YFNA 1VQPQ 1UGVA 2LX7A 4C8QD 3RMSA 5KYWA 3QHSA 2A0FB 3UATA 2CSQA 1NEGA 1Y71A 3NMZC 4HKEA 4X34A 1VQKQ 4BACA 2P84A 3CC2A 1S72T 3VV0A 2X4YA 2RHUA 3EGXA 3L2UA 2D0NA 1VQNQ 3TVTA 4OB3B 4LD6A 3UA7A 1VQ4T 1LOJA 2CP7A 2DA9A 1K73C 1Z9ZA 3CCLT 3OYYA 5LJ5e 1WFWA 1NM7A 1VQ7Q 1T0HA 5HY6A 1JXMA 4C92A 3SFMA 2R58A 2CREA 3SDZA 3CCSQ 2FZGB 4OB1B 3A8GB 1RAIB 1YJNT 1OOTA 2GF7A 5A0DA 1OQKA 3MEAA 2RI3A 1AZGB 3JCMJ 2DBMA 1Y7XA 5FU7C 3LWIA 3SWNC 4ME7A 1MV0B 2JUFA 2K5FA 1S1NA 4CC2A 2E5QA 1SSFA 1NYGA 1B34A 1LCKA 1UFFA 1WJRA 2CT3A 3G7ZA 2F69A 1YIJQ 5FU6C 3I56Q 2Y4YA 3CCJQ 2EJGA 2HMAA 2O4XA 2AIRB 3V7RA 3CPWA 5CKHA 2X51A 2JNGA 2HKNA 1WJQA 3TSZA 1X75C 4M77E 4X1VA 2HEQA 5I11A 2KK4A 1UB4A 3TCJA 5GAOl 2LQWA 2LX9A 1M2VA 4FU6A 4M78A 3JCMh 1RAGB 1FX7A 2RN8A 3QPHA 3L2VA 2HBWA 2GBQA 1QWEA 1SG5A 2DPPB 5CO7A 3V8JA 4A63B 4J7IA 1EZZB 2GFAA 3VS2A 3SHWA 2QEXA 2RO0A 1SHFA 4Y28E 3VU3C 1Q86C 4M7AD 3CC2Q 2JTMA 4OP0A 4PLLA 1K9MU 4C8QE 2RQUA 1KD1C 3EAEA 4M77C 4MZTA 2OX7A 2RPNA 1IZ6A 1KJWA 2CH4A 4J7FA 2JM8A 4XTYA 2LQKA 1I5LA 5IXFA 4CI0C 2D6FA 2LNVA 2YSQA 1VQ9A 4XTWA 3CPFA 4M75D 1GBRA 3OY9A 3RR6A 1VQ8T 2XK0A 3EGDA 2J6FA 1IHVA 1K1ZA 3CCRA 5KYWB 4C8QC 3JCMW 2CT4A 5DLOA 3VKIA 4J5YA 2E65A 3CCEA 2DL8A 2V1QA 1UG1A 2FPEA 4JZ4A 1LJOA 1QCNA 3S3MA 2CSIA 3SEMA 4PJOF 3M59A 2L3QA 4C92B 2AZSA 1VA7A 1VYUA 2O9SA 3PVQA 5KCOA 4ZGJB 2KGTA 3PNWC 1ZA2B 2AKKA 3FB9A 3REBB 5GAMh 2J06A 3G4SA 2OTLA 1K73U 4L5GA 2A37A 1K8AR 4D6WA 1WXBA 3M54A 1JJ2A 1BI2A 2QEXQ 2EGAA 3LGLA 3O5ZA 2NUZA 1KQ2A 2KRNA 4MMKA 4CC3A 2VC8A 4IIMA 1CKAA 2RMOA 2DXBA 1YITA 3JCMP 4A4FA 2DEQA 3HTRA 3D7SB 2ATCB 2D0QB 2C0TA 2DK3A 2K3BA 3L1AA 3J7AF 2K9GA 2HNIA 4HCZA 3HFNA 5GANe 1M1KR 5I2MA 4XQ3A 5LJ5d 2MAMA 3VS4A 2CP6A 5FW9A 2EJFA 2OTJA 1U06A 1M2VB 2RA2A 4M78B 3EH1A 4C5HA 1PSFA 3JCMg 2ED1A 2DLPA 2X4XA 4HA8A 5CAIA 3LH5A 2DILA 1GCQC 4F7UE 1AWXA 3CCEQ 1CSKA 2DRKA 4VUBA 3EG2A 3MO8A 2NUTA 1K0XA 1TG0A 1BI0A 2VUBA 1JB0E 4ESRA 1GBQA 2FZCB 3OBYA 1WQ7A 1Q86U 1CKBA 1AVZC 1NE8A 3G4SQ 2OTLQ 4KH0B 4IUPA 4MDXA 4C5EA 1KD1U 3CCQA 2EVRA 2KT8A 4RTUA 2RQRA 2DMOA 1YHQA 3X20B 1KQSS 4E6RA 3V7SA 5L8RE 4DA4A 1GFCA 1YJNA 3NFCA 1RI9A 3G6ET 3EFRA 3RIRA 1VQMA 2XDBA 3ME9A 2DF6A 4WTOB 4PFZA 1XJWB 3OMCA 3A8OB 4Z89A 5KE3A 2LJ1A 5GMKl 1LPLA 4ANJA 3M0SA 2DTIA 1FYNA 2EIFA 2FRYA 2AK5A 2GTJA 3Q1JA 5I2SA 5GMKi 5GAMg 1N8RC 1TTHB 2CP0A 5KYYA 5CKDA 4OVAA 2WSCE 3CCUT 3CXCA 2JMCA 3QO3A 4PFPA 4OMNA 3OYGA 1EIFA 3I5SA 4KT0E 1M8VA 2JS2A 1WXTA 1TOVA 2YLBA 5L23A 4OGEA 2QDYB 2FPFA 4QVDA 3UPUA 2COYA 2JTEA 3H41A 3LH0A 1BB9A 1Q95G 3H9NA 1RACB 1HSQA 4LNPA 4AFZC 3HP9A 2MWPA 4IKFA 1QVPA 3CCQQ 4XTVA 4K11A 5CKFA 1YHQQ 4M7DB 5CK9A 2LRQA 3GNGA 3H0FA 3VYGA 2QAZA 2V8KA 3CBPA 1YJNQ 1RADB 1VQ8A 3MEVA 4XU2A 1VQMQ 4M7DC 1M3AA 1Q7YC 4M7AF 2NUTB 1XNIA 1M1GA 1SRLA 2LT1A 4X9DA 2YT6A 4HVWA 2EQMA 3HRSA 4FCYA 4II1A 2DD5A 3JB9H 4C92G 2O01E 2QQBA 1U1TA 1KC8R 2JJ9A 2LQNA 3E9GA 5KCHA 4M75F 3H0IA 4JLGA 3OA6A 1TU0B 3QG1A 4NOYA 4HCCA 2ZGWA 3CEYA 1VIEA 2C0IA 2WSEE 2EW3A 3EGUA 2VXEA 1JRIA 4NL3A 1QCOA 4GBQA 1VOMA 4AFSC 1WNLA 5CIUA 1WLPB 4RUGA 4LUEA 4QVZA 2DFUA 2JXBA 1WHGA 2FO0A 3JRZA 3CMEA 1ZUUA 4AG1C 1WHHA 2NWMA 2D8JA 3DKMA 1IREB 5IH2A 5FRNA 3RESA 1BYMA 4M78G 3EG1A 4DBQA 2L8DA 3OQ5A 2ZAEA 4E7LA 1RLPC 5A0LA 1W6XA 1NPPA 4J8OA 2DJZA 4PJNA 5KYYB 2JZ2A 3HHTB 1YI2A 3EFOA 4OB2B 3VUBA 5LL6S 1VUBA 3JSCA 2DL5A 3JCMd 3JB9G 1EFNA 1G3SA 4RKUE 1N8RU 2LDMA 5C6SA 4IUUA 4IUQA 1ZUYA 4BB7A 1QQJA 1X6GA 2DBKA 1QVFP 4N0AA 3QZ9B 2CP2A 1YWPA 4Z88A 5GAN4 1ZBXA 2JW4A 1WX6A 3VS5A 2Y90A 3EG9A 4J83A 3R6NA 2GGRA 1PSEA 1WHJA 2MPXC 5FRMA 5GAN2 1NLPC 4QQGA 4JRPA 4PJOA 2XMFA 4ELYC 3QBYA 2GTOA 1Q81C 1R0BG 2RI2A 2I2LA 4QW2A 1KFZA 2LJ0A 3C0CA 1NJIR 2HCKA 3OYMA 1D0ZA 4XTZA 4FYYB 3OW2P 2RF0A 1NBEB 2DIGA 2RQWA 2COZA 2H3EB 3QSUA 2BTTA 1WQWA 3SWNA 2PNIA 3MCAB 1MHNA 4E7SA 1UEBA 4FT4A 3CMEQ 6AT1B 1IXDA 1N6AA 1Q7YU 1UHFA 2A7YA 3CPWS 4KUIA 2LP5A 3M0TA 1IO6A 1JU5C 2K3XA 1BCMA 2QQAA 1YI2Q 3RBBB 2BE9B 2DAQA 5GAMd 1QKWA 3RUXA 1H641 1BIAA 1TUGB 4CC7A 4EMKA 3GBQA 2QA4A 4TVRA 1PWTA 3VS1A 1JO8A 3CC4T 1AZEA 2ESWA 3JB9I 4PL6A 2YWWA 4M77D 4RTZA 3ASKA 2DYBA 4WCIA 1I4K1 1BKBA 1ZUKA 2YRCA 4JJDA 2DVJA 1Q82U 1SSHA 4EMHA 1M8MA 2EQKA 4RMOA 3E1SA 3AT1B 3X26B 4JS4A 1NZ9A 2ROTA 2K7AA 1G8XA 3EFOB 1YJ9A 3HRUA 3G1JA 1ACMB 1VQ5T 2GNCA 2EPDA 1SEMA 2YLCA 5FLXE 1M1FA 1NJIC 4L6V5 4GY5A 5GANh 1MMNA 2JOYA 4C8QA 5IHKA 5HK3A 1WPYA 2CP5A 4DEYA 3L2QA 3CD6T 2DTOA 2EGCA 2X3XD 4PJOB 2JT4A 2OI3A 1VQOA 2FHDA 1R8OB 1KG1A 4KBMB 2HDAA 1E6HA 1PKTA 1YCSB 2NLUA 2R5MA 1M90R 2F2XA 2QA4Q 1JJ2S 4FL6A 4JDSA 2P0PA 5GAOr 1TWBA 1Q81U 4HT8A 2ZPEB 1Y57A 5LJ5f 4DOWA 2YUQA 3OS5A 3BFMA 2DM1A 3UA6A 2E1HA 3CCMA 1PRLC 3NTIA 1SRMA 1C1AA 2RM4A 3OYFA 2HQHA 4BI8B 2DKGA 1RL2A 2CUDA 1VQ6T 1YJ9Q 2XDPA 1P92A 1UUEA 3QYGB 3ZL7C 2VGNA 1KIKA 1FXXA 1QVGP 1N9RA 3FC3A 1HD3A 1X69A 2ZPGB 4OMQA 5CKBA 1PD0A 2DNUA 1A0NB 3JCMb 2MI6A 4KUDK 1YN8A 4M7AA 2KNBB 2G6FX 2DO3A 5KYXA 1W2BS 2DL4A 2EWNA 3META 1D3BB 2FEIA 4FM4B 4XK8E 3VS0A 1VQOQ 2HZYA 1KK7A 3CMAT 1H3ZA 1V76A 4UC4A 2L2PA 2FZKB 1O9SA 1WA7A 4LE9A 4M75A 4OMOA 2IG0A 4C92E 4J9DA 5LJ3h 2QK0A 2RI5A 2QI2A 3NTHA 3EGXB 4ORZA 4BE1A 1G5VA 5GANg 4C0ZA 1M90C 1OEBA 3CCMQ 2J6OA 4AG2C 1JXOA 5CR2A 2YUNA 4J9CA 4MZMA 2E6ZA 2CUBA 2XIDA 2FB7A 2LT4A 1RLQC 4LUDA 3OS0A 4XTUA 1PD1A 2DE0X 2J6KA 2YRDA 2KE9A 4C92C 3FLGA 2VV5A 3M0PA 1LNXA 1I81A 2E10A 1B34B 2FG0A 3CXCS 3MEWA 2QYZA 4M78E 2AT1B 5GAOm 2O4XB 3X28B 2P0QA 3CCVT 2WSFE 3MKDA 1KHIA 1FMKA 4PJMA 3L2ZA 3GF5A 5CQYA 1VQ9Q 2JM9A 2KBTA 2DXTA 3CC7A 3QWXX 4C0GA 3LYIA 3H6ZA 3CCRQ 4XTXA 5AYFA 1RI0A 2YRVA 5D6XA 4D8KA 1J3TA 1XTDA 2EJ9A 2COWA 2PUOB 3M53A 2DEUA 2H8HA 2X3WD 4M7DD 4M78C 3N5BB 2LQ8A 4FYVB 5CKEA 5GANf 1VQLT 1PG5B 3LW5E 1W2BA 1R0CB 4OGCA 1AT1B 4M7AB 4M77F 1YCYA 1DJ7B 1V1CA 3WVDB 4LN2A 1S72A 4C5IA 2IIMA 3TSWA 2P4RA 1VQ4A 4PJOG 3MP1A 2L3RA 3PMIA 2A3LA 1RAEB 1JEGA 2EFIA 3EGDB 3CCLA 1ZSZA 4NS5A 4YTLA 3C94A 2AHJB 1AWOA 1YJWT 1OV3A 3G71T 1NPRA 4C8QF 5LJ3g 1OYXA 1QP2A 1YITQ 1K8AC 1D1CA 5IAYA 5GAN7 2RQVA 3PTAA 3UT1A 2OAWA 4DOVA 1VQPT 1RAFB 2E64A 4FW1A 5FWCA 3U23A 2L0AA 3EHRA 2OTJQ 1VQKT 2OJ2A 3CC7Q 2GQIA 1NLOC 3RKWA 2A28A 3PT9A 1M1KC 2J7IA 2A36A 4M4ZA 2KSSA 3JCMf 1AWWA 3OBWA 2YDLA 4A4HA 1VQ7T 1IGQA 2DYIA 1U8RA 3L2RA 2KT1A 3JCMX 2XD0A 3VS6A 4A54A 5GAN8 3JCMQ 3BDUA 2WACA 2KXDA 2PQWA 5LJ3e 2DXUA 4E7HA 4M7DE 1BI3A 4BDYA 2DIQA 1S72Q 4J9GA 3FEOA 4X9CA 3HSBA 1SKUB 1ZX6A 1VQ4Q 2EKOA 2K2VA 4BD3A 3CCLQ 2RHXA 2RHIA 1WXUA 2YXYA 5IHNA 2K3YA 2PUKB 5GAMj 4KRTA 1YIJT 2AKLA 3FIFA 1BU1A 5GAOq 3HFOA 3I56T 3CCJT 3KBGA 1JBMA 2F2WA 2MYSA 5GAOn 4J9BA 4A4EA 2C0OA 1KQSP 1Y96A 3PMTA 2RNAA 2QDLA 1MV3A 4JJCA 4ZGDB 4B6MA 4EIKA 1JQQA 5GANd 3QXEB 3CC2T 2MIOA 2PVOB 3FDRA 3E19A 3RMQA 5GAMf 1ZSZB 2DZ9A 4RG8A 3RKXA 2LCLA 3QYHB 4F7UF 1X01A 3RKYA 2YUPA 2K6DA 3M55A 5GMKm 5GMKj 2LZ6B 2HSPA 4KULA 4MDWA 2D1XA 1ZQ1A 3UDCA 2NYSA 4R0KA 5A0GA 3AHUA 2QQSA 1H92A 4J6XA 2KYBA 1C0MA 4AT1B 1OI1A 1RAHB 4BE2A 1R77A 4OMPA 4RTWA 2RJCA 2KROA 3F70A 3H0HA 2NUPA 4BI4A 4E2FB 1K8AU 2ZPIB 3P8BB 3E9FA 5HKCA 2R57A 1IGUA 2ECZA 3V8LA 4QT7A 3FJPA 2FVUA 3CQTA 1X27A 4F17A 2MK5A 3M57A 1VQ8Q 4C5GA 5M9OA 1TUCA 1WHLA 4JUVA 1D1BA 3HKSA 4P5NA 1K9MR 3OS1A 4OMFB 1M1KU 1BCOA 1TSFA 4Y91A 2X4JA 3QJYA 3EG0A 5J3BA 4M7AG 5GJVB 2QEXT 4Z02A 2CZ0B 2FL7A 5AT1B 2EAYA 4FIBA 4B9XA 4DEXA 3TU4K 1QCFA 2KR3A 3PIPA 4JJBA 5DLQE 2KRMA 1G3TA 4N4HA 2XICA 3GNFB 4C0DB 2HBPA 3A8HB 2ZPBB 3BY7A 4EDUA 5J39A 3RERA 1KC8C 1WZOA 4M75G 1W1FA 4R55A 2ZPFB 5IT9E 1Y96B 3REAB 4IURA 4M7DF 1ABOA 2MWOA 2XKOC 2K2MA 3LWHA 1AHJB 2K79A 4HXJA 1W70A 5LJ3d 3G6EA 2M0YA 1UGQB 1QVFA 2JS0A 4LD9K 2QASA 3RDVA 3OS2A 1GRIA 4PFOA 3JB9J 4ZNXA 2HKQB 2Y4XA 3CCET 2RK1A 3FRNA 4E7JA 3GIBA 3WXMB 2JVVA 2K5LA 3URGA 2RHZA 7AT1B 4N4GA 2A08A 2X9HA 2JN0A 2KEAA 2LC4A 1MNEA 1M4ZA 3M0UA 2BUDA 3G4ST 2OTLT 2K5IA 1OPKA 1TH7A 2LCCA 3OW2A 1UGSB 1QWFA 4HT9A 2YUOA 4OF1A 3C4SA 3CCUA 3QWYA 1T3SA 3TREA 2FYKA 2ZZDA 2DJQA 2NUPB 1OPLA 3QDFA 4FYXB 4KGVB 1FMWA 1QMCA 1SF9A 3DLLA 4M77A 4CRIA 2CKKA 8AT1B 1EX4A 3NTKA 4Y92A 2CGHA
chains in the Genus database with same CATH topology
2L2PA 3PE0A 1RI9A 2JMAA 1WA7A 2PTKA 4LE9A 4OMOA 1RUWA 4J9DA 2M51A 2DF6A 2L3SA 4RTXA 4ORZA 4AFQC 2MCNA 1BBZA 2J05A 1ABQA 4Z89A 1ZLMA 2LJ1A 1OEBA 1YP5A 3M0SA 2J6OA 1XOVA 1GFDA 4AG2C 1FYNA 1JXOA 2W10A 2FRYA 2YUNA 4J9CA 2AK5A 2GTJA 1UE9A 1WDXA 5I22A 2EYWA 2CUBA 1RLQC 4LUDA 4Z8AA 1WYXA 1N5ZA 2DE0X 2J6KA 2KE9A 2DX1A 2CH4W 2JMCA 3M0PA 2AZVA 2EYZA 4HVVA 4OMNA 3I5SA 5HCKA 2JS2A 2LJ3A 2DL3A 4RTTA 1WXTA 5EC7A 2FG0A 1NG2A 2V1RA 5L23A 3NHNA 2FPFA 3H41A 2JTEA 1BB9A 2MOXA 2ABLA 3THKA 1HSQA 4LNPA 1FMKA 4AFZC 1H3HA 4K11A 2JM9A 2KBTA 4OMMA 3QWXX 2EGEA 3H0FA 1AWJA 1WIEA 4GLMA 4OMLA 4D8KA 1J3TA 3KFVA 2FRWA 1ARKA 1HJDA 3IQLA 2ED0A 1M3AA 2H8HA 2X3WD 1SRLA 2RQTA 1QLYA 2YT6A 2LMJA 1QKXA 3JV3A 1M3BA 4HVWA 1T0JA 1AOJA 4CC4B 1K0SA 1X6BA 1G2BA 1YNZA 1GCQA 1V1CA 4LN2A 1BK2A 2IIMA 2LQNA 2O31A 3VRZA 3A98A 3TSWA 2P4RA 3VS7A 1Z9QA 2W0ZA 3H0IA 2O2OA 1JEGA 1T3LA 1X2KA 1Y0MA 4J9HA 1AWOA 1OV3A 2O88A 2C0IA 2EW3A 3EGUA 2ROLA 1I0CA 1VYVA 1M3CA 1ZBJA 1UDLA 1UJ0A 1YWOA 4GBQA 4AFUC 1M27C 2RQVA 4AFSC 3I9QA 1WLPB 3RNJA 4RUGA 4LUEA 2VVKA 2JXBA 2OAWA 1B3QA 2SEMA 4J9IA 4RTYA 1ZSGA 2DL7A 2E5KA 2FO0A 3PVLA 1ZUUA 4AG1C 2NWMA 2D8JA 5IH2A 1UHCA 5FWCA 3U23A 2L0AA 3EHRA 5IHIA 3VRYA 2OJ2A 2GQIA 3EG1A 1NLOC 2A28A 1RLPC 2J7IA 2A36A 1W6XA 1UGVA 3EHQA 2LX7A 4M4ZA 1AWWA 2YDLA 1PRMC 3UATA 2CSQA 1NEGA 3NMZC 2DL5A 1EFNA 2KT1A 1NYFA 2D0NA 3TVTA 3VS6A 1ZUYA 3UA7A 1X6GA 1WI7A 2DA9A 2DBKA 1Z9ZA 2ENMA 2KXDA 4F14A 1WFWA 1YWPA 1NM7A 4Z88A 1T0HA 2JW4A 1JXMA 1WX6A 2LNHB 3VS5A 2CREA 4J9GA 3R6NA 3VS3A 2GGRA 1ZX6A 1SPKA 2EYYA 1NLPC 2F2VA 2KRSA 1OOTA 2XMFA 1UECA 2GTOA 5IXBA 1WXUA 5IHNA 1AZGB 2BZXA 2DBMA 4KRTA 1KFZA 2EKHA 2AKLA 1BU1A 2LJ0A 3C0CA 1MV0B 2HCKA 4IIOA 2CDTA 1I1JA 1S1NA 4CC2A 2F2WA 1NYGA 2RF0A 1LCKA 1UFFA 5FWBA 2RQWA 4J9BA 2CT3A 2C0OA 2BTTA 1G83A 2PZ1A 2PNIA 1K9AA 1PNJA 3I35A 2RNAA 2QDLA 3TSZA 4HCKA 4HVUA 1MV3A 4X1VA 2HEQA 3M0RA 4JJCA 5I11A 4RTVA 2B86A 1B07A 1JQQA 1UHFA 4EIKA 2LQWA 2MIOA 1U5SA 2LP5A 3M0TA 1IO6A 4D8DA 2RN8A 2HBWA 2GBQA 1JU5C 1QWEA 4A63B 3RBBB 1QKWA 3VS2A 3SHWA 1SHFA 3FJ5A 2KXCA 1U3OA 4J9EA 4CC7A 2YUPA 1E6GA 2K6DA 2RQUA 2LZ6B 2HSPA 2EBPA 3GBQA 2D1XA 3I5RA 1VYTA 1PWTA 2RPNA 4FSSA 4R0KA 1JO8A 3VS1A 1AZEA 1H92A 1KJWA 2CH4A 2ESWA 4RTZA 2JM8A 1M30A 2KYBA 2DYBA 4WCIA 1UTIA 4OMPA 2FPDA 5IXFA 1GCPA 1ZUKA 4RTWA 2KROA 4JJDA 2YSQA 2O9VA 2DVJA 1GBRA 1SSHA 3H0HA 1M8MA 2J6FA 1K1ZA 4JZ3A 1I07A 2VWFA 2ECZA 4QT7A 1NEBA 2ROTA 2K7AA 3CQTA 1X27A 4F17A 1X43A 2CT4A 1H8KA 2GNCA 1TUCA 2EPDA 2DL8A 2V1QA 1SEMA 1UG1A 2FPEA 4JZ4A 2CSIA 3SEMA 2L3PA 5IHKA 3ULRB 2L3QA 2AZSA 1VA7A 3EG0A 1VYUA 2O9SA 3PVQA 3UF4A 4DEYA 3M0QA 5GJVB 2KGTA 5ECAA 1K4US 2EGCA 2X3XD 2AKKA 3REBB 2J06A 4DEXA 1QCFA 2JT4A 2KR3A 4JJBA 2A37A 2OI3A 1WXBA 2KRMA 4J9FA 2EGAA 3O5ZA 2NUZA 2HDAA 2KRNA 4CC3A 4IIMA 1W1FA 1CKAA 2RMOA 1E6HA 1PKTA 1YCSB 2F2XA 1MUZA 4JPBW 2DRMA 1PKSA 3REAB 2KYMA 2C0TA 1ABOA 1Y57A 2K3BA 2K2MA 2K9GA 1AEYA 2YUQA 2K79A 4HXJA 1W70A 2DM1A 2M0YA 3UA6A 2D8HA 2BZYA 2JS0A 3VS4A 5FW9A 1KSWA 1PRLC 1SRMA 1GRIA 4ZNXA 1U06A 5GJWB 1X2QA 2ED1A 1GL5A 2CUDA 2DLPA 1UUEA 3LH5A 3ZL7C 2DILA 1GCQC 2A08A 2EQIA 1KIKA 1AWXA 2KEAA 2I0NA 1CSKA 2BZ8A 2DRKA 3EG2A 1HD3A 1X69A 3M0UA 1K76A 4OMQA 2VKNA 1SHGA 1PHTA 2DNUA 1K0XA 1TG0A 1A0NB 2SRCA 3NGPA 1OPKA 4ESRA 1GBQA 1QWFA 2YUOA 1TUDA 3QWYA 1T3SA 4F16A 2EYXA 1CKBA 1AVZC 1YN8A 2KNBB 2DJQA 2G6FX 2DL4A 2FEIA 1OPLA 2EVRA 2KT8A 3NPFA 4RTUA 1AD5A 3VS0A 3EG3A 2RQRA 2DMOA 1UJYA 1E7OA 4E6RA 2LCSA 4Y92A 1GFCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2P A;  3PE0 A;  1RI9 A;  2JMA A;  1WA7 A;  2PTK A;  4LE9 A;  4OMO A;  1RUW A;  4J9D A;  2M51 A;  2DF6 A;  2L3S A;  4RTX A;  4ORZ A;  4AFQ C;  2MCN A;  1BBZ A;  2J05 A;  1ABQ A;  4Z89 A;  1ZLM A;  2LJ1 A;  1OEB A;  1YP5 A;  3M0S A;  2J6O A;  1XOV A;  1GFD A;  4AG2 C;  1FYN A;  1JXO A;  2W10 A;  2FRY A;  2YUN A;  4J9C A;  2AK5 A;  2GTJ A;  1UE9 A;  1WDX A;  5I22 A;  2EYW A;  2CUB A;  1RLQ C;  4LUD A;  4Z8A A;  1WYX A;  1N5Z A;  2DE0 X;  2J6K A;  2KE9 A;  2DX1 A;  2CH4 W;  2JMC A;  3M0P A;  2AZV A;  2EYZ A;  4HVV A;  4OMN A;  3I5S A;  5HCK A;  2JS2 A;  2LJ3 A;  2DL3 A;  4RTT A;  1WXT A;  5EC7 A;  2FG0 A;  1NG2 A;  2V1R A;  5L23 A;  3NHN A;  2FPF A;  3H41 A;  2JTE A;  1BB9 A;  2MOX A;  2ABL A;  3THK A;  1HSQ A;  4LNP A;  1FMK A;  4AFZ C;  1H3H A;  4K11 A;  2JM9 A;  2KBT A;  4OMM A;  3QWX X;  2EGE A;  3H0F A;  1AWJ A;  1WIE A;  4GLM A;  4OML A;  4D8K A;  1J3T A;  3KFV A;  2FRW A;  1ARK A;  1HJD A;  3IQL A;  2ED0 A;  1M3A A;  2H8H A;  2X3W D;  1SRL A;  2RQT A;  1QLY A;  2YT6 A;  2LMJ A;  1QKX A;  3JV3 A;  1M3B A;  4HVW A;  1T0J A;  1AOJ A;  4CC4 B;  1K0S A;  1X6B A;  1G2B A;  1YNZ A;  1GCQ A;  1V1C A;  4LN2 A;  1BK2 A;  2IIM A;  2LQN A;  2O31 A;  3VRZ A;  3A98 A;  3TSW A;  2P4R A;  3VS7 A;  1Z9Q A;  2W0Z A;  3H0I A;  2O2O A;  1JEG A;  1T3L A;  1X2K A;  1Y0M A;  4J9H A;  1AWO A;  1OV3 A;  2O88 A;  2C0I A;  2EW3 A;  3EGU A;  2ROL A;  1I0C A;  1VYV A;  1M3C A;  1ZBJ A;  1UDL A;  1UJ0 A;  1YWO A;  4GBQ A;  4AFU C;  1M27 C;  2RQV A;  4AFS C;  3I9Q A;  1WLP B;  3RNJ A;  4RUG A;  4LUE A;  2VVK A;  2JXB A;  2OAW A;  1B3Q A;  2SEM A;  4J9I A;  4RTY A;  1ZSG A;  2DL7 A;  2E5K A;  2FO0 A;  3PVL A;  1ZUU A;  4AG1 C;  2NWM A;  2D8J A;  5IH2 A;  1UHC A;  5FWC A;  3U23 A;  2L0A A;  3EHR A;  5IHI A;  3VRY A;  2OJ2 A;  2GQI A;  3EG1 A;  1NLO C;  2A28 A;  1RLP C;  2J7I A;  2A36 A;  1W6X A;  1UGV A;  3EHQ A;  2LX7 A;  4M4Z A;  1AWW A;  2YDL A;  1PRM C;  3UAT A;  2CSQ A;  1NEG A;  3NMZ C;  2DL5 A;  1EFN A;  2KT1 A;  1NYF A;  2D0N A;  3TVT A;  3VS6 A;  1ZUY A;  3UA7 A;  1X6G A;  1WI7 A;  2DA9 A;  2DBK A;  1Z9Z A;  2ENM A;  2KXD A;  4F14 A;  1WFW A;  1YWP A;  1NM7 A;  4Z88 A;  1T0H A;  2JW4 A;  1JXM A;  1WX6 A;  2LNH B;  3VS5 A;  2CRE A;  4J9G A;  3R6N A;  3VS3 A;  2GGR A;  1ZX6 A;  1SPK A;  2EYY A;  1NLP C;  2F2V A;  2KRS A;  1OOT A;  2XMF A;  1UEC A;  2GTO A;  5IXB A;  1WXU A;  5IHN A;  1AZG B;  2BZX A;  2DBM A;  4KRT A;  1KFZ A;  2EKH A;  2AKL A;  1BU1 A;  2LJ0 A;  3C0C A;  1MV0 B;  2HCK A;  4IIO A;  2CDT A;  1I1J A;  1S1N A;  4CC2 A;  2F2W A;  1NYG A;  2RF0 A;  1LCK A;  1UFF A;  5FWB A;  2RQW A;  4J9B A;  2CT3 A;  2C0O A;  2BTT A;  1G83 A;  2PZ1 A;  2PNI A;  1K9A A;  1PNJ A;  3I35 A;  2RNA A;  2QDL A;  3TSZ A;  4HCK A;  4HVU A;  1MV3 A;  4X1V A;  2HEQ A;  3M0R A;  4JJC A;  5I11 A;  4RTV A;  2B86 A;  1B07 A;  1JQQ A;  1UHF A;  4EIK A;  2LQW A;  2MIO A;  1U5S A;  2LP5 A;  3M0T A;  1IO6 A;  4D8D A;  2RN8 A;  2HBW A;  2GBQ A;  1JU5 C;  1QWE A;  4A63 B;  3RBB B;  1QKW A;  3VS2 A;  3SHW A;  1SHF A;  3FJ5 A;  2KXC A;  1U3O A;  4J9E A;  4CC7 A;  2YUP A;  1E6G A;  2K6D A;  2RQU A;  2LZ6 B;  2HSP A;  2EBP A;  3GBQ A;  2D1X A;  3I5R A;  1VYT A;  1PWT A;  2RPN A;  4FSS A;  4R0K A;  1JO8 A;  3VS1 A;  1AZE A;  1H92 A;  1KJW A;  2CH4 A;  2ESW A;  4RTZ A;  2JM8 A;  1M30 A;  2KYB A;  2DYB A;  4WCI A;  1UTI A;  4OMP A;  2FPD A;  5IXF A;  1GCP A;  1ZUK A;  4RTW A;  2KRO A;  4JJD A;  2YSQ A;  2O9V A;  2DVJ A;  1GBR A;  1SSH A;  3H0H A;  1M8M A;  2J6F A;  1K1Z A;  4JZ3 A;  1I07 A;  2VWF A;  2ECZ A;  4QT7 A;  1NEB A;  2ROT A;  2K7A A;  3CQT A;  1X27 A;  4F17 A;  1X43 A;  2CT4 A;  1H8K A;  2GNC A;  1TUC A;  2EPD A;  2DL8 A;  2V1Q A;  1SEM A;  1UG1 A;  2FPE A;  4JZ4 A;  2CSI A;  3SEM A;  2L3P A;  5IHK A;  3ULR B;  2L3Q A;  2AZS A;  1VA7 A;  3EG0 A;  1VYU A;  2O9S A;  3PVQ A;  3UF4 A;  4DEY A;  3M0Q A;  5GJV B;  2KGT A;  5ECA A;  1K4U S;  2EGC A;  2X3X D;  2AKK A;  3REB B;  2J06 A;  4DEX A;  1QCF A;  2JT4 A;  2KR3 A;  4JJB A;  2A37 A;  2OI3 A;  1WXB A;  2KRM A;  4J9F A;  2EGA A;  3O5Z A;  2NUZ A;  2HDA A;  2KRN A;  4CC3 A;  4IIM A;  1W1F A;  1CKA A;  2RMO A;  1E6H A;  1PKT A;  1YCS B;  2F2X A;  1MUZ A;  4JPB W;  2DRM A;  1PKS A;  3REA B;  2KYM A;  2C0T A;  1ABO A;  1Y57 A;  2K3B A;  2K2M A;  2K9G A;  1AEY A;  2YUQ A;  2K79 A;  4HXJ A;  1W70 A;  2DM1 A;  2M0Y A;  3UA6 A;  2D8H A;  2BZY A;  2JS0 A;  3VS4 A;  5FW9 A;  1KSW A;  1PRL C;  1SRM A;  1GRI A;  4ZNX A;  1U06 A;  5GJW B;  1X2Q A;  2ED1 A;  1GL5 A;  2CUD A;  2DLP A;  1UUE A;  3LH5 A;  3ZL7 C;  2DIL A;  1GCQ C;  2A08 A;  2EQI A;  1KIK A;  1AWX A;  2KEA A;  2I0N A;  1CSK A;  2BZ8 A;  2DRK A;  3EG2 A;  1HD3 A;  1X69 A;  3M0U A;  1K76 A;  4OMQ A;  2VKN A;  1SHG A;  1PHT A;  2DNU A;  1K0X A;  1TG0 A;  1A0N B;  2SRC A;  3NGP A;  1OPK A;  4ESR A;  1GBQ A;  1QWF A;  2YUO A;  1TUD A;  3QWY A;  1T3S A;  4F16 A;  2EYX A;  1CKB A;  1AVZ C;  1YN8 A;  2KNB B;  2DJQ A;  2G6F X;  2DL4 A;  2FEI A;  1OPL A;  2EVR A;  2KT8 A;  3NPF A;  4RTU A;  1AD5 A;  3VS0 A;  3EG3 A;  2RQR A;  2DMO A;  1UJY A;  1E7O A;  4E6R A;  2LCS A;  4Y92 A;  1GFC A; 
#chains in the Genus database with same CATH topology
 3PE0 A;  2LTO A;  4JS5 A;  2RH2 A;  4EPC A;  1N9S A;  3M4Y A;  3HPW A;  2M51 A;  3OYL A;  3ZEH A;  3ZBD A;  2L3S A;  3J81 E;  4RTX A;  3GLX A;  2GFU A;  4AFQ C;  2CS7 A;  4PJO E;  2J05 A;  1ABQ A;  2VXF A;  4O5V A;  3G6E Q;  1ZLM A;  1IHW A;  3OMG A;  1XOV A;  5LJ5 j;  2W10 A;  1Q86 R;  4WF2 A;  5DM7 R;  1WDX A;  3EG9 B;  1C6V X;  1KD1 R;  4N0A C;  1WYX A;  1OUL A;  1BI1 A;  1BIB A;  4KH1 B;  2CH4 W;  2H3J A;  2AZV A;  4C92 D;  4PLI A;  4PJL A;  2DTH A;  2X35 A;  3CPW P;  4LDV A;  3EFS A;  3S3N A;  4PJO C;  2VYT A;  3JCM V;  5HCK A;  2DL3 A;  4RTT A;  3PIO A;  3CCQ T;  3I55 T;  2KI7 A;  3OYN A;  1YHQ T;  3CCU Q;  3NHN A;  4KGX B;  2E3H A;  5FU7 B;  1KC8 U;  3SWN B;  2QTV A;  2MOX A;  1O75 A;  3THK A;  3MP8 A;  3OYD A;  2CP3 A;  1VQM T;  4OMM A;  4R56 A;  4XAX B;  4LDY A;  1AWJ A;  5FU6 B;  1WIE A;  2C06 A;  3OSV A;  3KFV A;  3EH2 A;  1ARK A;  2F5T X;  4JRK A;  2CZ7 B;  2V8J A;  3A1P A;  2E12 A;  2ED0 A;  4IUT A;  2DXC A;  2KQW A;  5HK0 A;  2RQT A;  4HCB A;  5KE2 A;  4V2S A;  4M78 D;  3JV3 A;  4EMK B;  2M1H A;  3PGG A;  1T0J A;  2E4H A;  3GOX A;  1AOJ A;  4A53 A;  2E70 A;  4CC4 B;  1K0S A;  1X6B A;  1G2B A;  3MP6 A;  1GCQ A;  2PVD B;  4JRI A;  3S3O A;  1N27 A;  4QKU A;  5D6Y A;  2O31 A;  3VRZ A;  1MND A;  4EMK C;  3JB9 D;  3VYH B;  1Z9Q A;  2XI9 A;  3OYA A;  4J6W A;  2Z0W A;  2O2O A;  4FYW B;  1T3L A;  4M77 B;  2RJE A;  2EYQ A;  1D1A A;  1RAA B;  2P0K A;  2DD4 A;  2XU8 A;  2P4T A;  3QKJ A;  2EQJ A;  2K57 A;  2O88 A;  2MMP A;  1ZHI A;  5EG2 A;  4Q5W A;  1WJS A;  3OYE A;  3GPL A;  1M3C A;  3HRT A;  1UDL A;  1UJ0 A;  1QVG A;  1U1S A;  4F7U A;  2VVK A;  3DLM A;  2OAU A;  4C8Q B;  3GP8 A;  1B3Q A;  2SEM A;  3HL8 A;  4J9I A;  2DL7 A;  4RTY A;  2E5K A;  2HQE A;  1XQH A;  1IB8 A;  1UHC A;  1JJ2 P;  1TS9 A;  5IHI A;  4A4K A;  4DQ2 A;  5I21 A;  8ATC B;  2XHC A;  1WGS A;  3MPU B;  2DVE A;  3EHQ A;  1NJI U;  4PNO A;  1PRM C;  3SB2 A;  1VIF A;  4MZP A;  5FRO A;  3KXT A;  1NYF A;  4ATO A;  5IN1 A;  2PVG B;  1WI7 A;  4O6J A;  4EMG A;  2ENM A;  4F14 A;  4DBH A;  1UGP B;  2LNH B;  5C0M A;  3S6W A;  1MMD A;  5GAN j;  3VS3 A;  3ZFJ A;  1OU9 A;  1D0X A;  4QQD A;  1SPK A;  2EYY A;  4E47 A;  2GCX A;  2F2V A;  2KRS A;  1UEC A;  3M9Q A;  2CZ1 B;  3CC4 A;  5IXB A;  5D6W A;  2BZX A;  4IUV A;  3OYH A;  2EKH A;  4E7K A;  2QQ9 A;  4IIO A;  2XDD A;  2CDT A;  2E41 A;  1W2B P;  1I1J A;  4FW2 A;  2XG8 D;  3CME T;  4M7A E;  5FWB A;  4FSX A;  1MMA A;  1QP3 A;  4ZN1 A;  3MEU A;  1N8R R;  5DY9 A;  2QGF B;  1G83 A;  3LGF A;  2PZ1 A;  4XU1 A;  1K9A A;  1PNJ A;  3I35 A;  2K4Y A;  2RJD A;  3L42 A;  4HCK A;  4HVU A;  1VQ5 A;  1YI2 T;  1PCX A;  3M0R A;  4AMC A;  5CQX A;  4RTV A;  2B86 A;  1B07 A;  4M7D A;  3A8L B;  5KYX B;  1U5S A;  4M75 E;  3O8V A;  4D8D A;  5GMK h;  3V8K A;  1OX9 A;  1UGR B;  4M7A C;  3CD6 A;  1YBY A;  3FJ5 A;  1FMV A;  2KXC A;  3M56 A;  1U3O A;  4J9E A;  4QVC A;  1E6G A;  2VAS A;  4M75 B;  2F5K A;  2EBP A;  2MF2 A;  3I5R A;  1VYT A;  4KGZ B;  1X6O A;  4F7U B;  4FSS A;  3OB9 A;  1M30 A;  2X4W A;  4E7Z A;  1UTI A;  2JTF A;  2FPD A;  1F1B B;  4M75 C;  1GCP A;  3A8M B;  4F04 B;  2O9V A;  3I55 A;  2DER A;  4JLI A;  1Q7Y R;  1V29 B;  2PU9 B;  3CXC P;  3CC4 Q;  4JZ3 A;  1I07 A;  3LX7 A;  3JAM E;  2VWF A;  2ZPH B;  3JCM e;  2IVW A;  2CYZ B;  1G3Y A;  1NEB A;  4N4I A;  2E3I A;  3ER0 A;  1VQN T;  1X43 A;  3VUZ A;  1M90 U;  4LXC A;  1H8K A;  1KHC A;  4RG2 A;  3X24 B;  3QDR B;  4BY6 B;  4C92 F;  3T9N A;  2DET A;  2HQX A;  3BE3 A;  3P8D A;  5KH6 A;  4B9W A;  1VQ6 A;  5GAO p;  2L3P A;  2BKD N;  3CCS T;  3ULR B;  5LJ3 j;  1VQ5 Q;  4BY6 C;  3UF4 A;  1W4S A;  3M0Q A;  3M4G A;  3V7C A;  2VB6 A;  1D09 B;  5ECA A;  1K4U S;  2LVM A;  1Q82 R;  3BDL A;  2QA4 T;  2RD1 A;  4M77 G;  4J9F A;  1FWZ A;  3OYB A;  3CD6 Q;  2KY9 A;  3H8Z A;  1G3W A;  4ZTF A;  2RJF A;  3QJ6 A;  1TXQ A;  1MUZ A;  4JPB W;  1I8F A;  2DRM A;  2V8I A;  1PKS A;  2KYM A;  4A4G A;  5LJ3 f;  3CMA A;  4LDU A;  1AEY A;  4M78 F;  1OZ2 A;  2CZ6 B;  5KYN A;  4DBF A;  4C8Q G;  3I55 Q;  1YJ9 T;  2D8H A;  1WHM A;  2BZY A;  1KSW A;  1HYO A;  5GJW B;  1RAB B;  5GAM e;  1X2Q A;  3JB9 F;  4BDZ A;  1GL5 A;  1OX8 A;  2RB6 A;  4OB0 B;  1QVF S;  1MMG A;  4E7I A;  3P8H A;  1GXI E;  2KMT A;  2EQI A;  4PK4 A;  3TEE A;  2I0N A;  2M9U A;  2BZ8 A;  5GAN 3;  2F1L A;  2L5Q A;  2YHT A;  1OU8 A;  2M0O A;  2B8A A;  1K76 A;  2VKN A;  5A2Q E;  1VQ6 Q;  3JCM c;  1SHG A;  3BW1 A;  1PHT A;  1ZSZ C;  2SRC A;  3NGP A;  2QTX A;  1VQO T;  1Q81 R;  3J80 E;  1TUD A;  3PFS A;  4F16 A;  4BUG A;  2EYX A;  1KQS A;  2ZCF B;  5J26 A;  3A5Z B;  3OW2 S;  5CCA A;  3NPF A;  1AD5 A;  2RK2 A;  3EG3 A;  3C95 A;  3WVE B;  1UJY A;  1E7O A;  4L59 A;  2LCS A;  3CCV A;  3OYJ A;  1Q82 C;  4ZN3 A;  1ZA1 B;  2M16 A;  5GMK e;  2JMA A;  4NL2 A;  1HK9 A;  2PTK A;  1RUW A;  3CCM T;  1MGQ A;  5LJ5 h;  4RCC A;  3CMA Q;  2M02 A;  2DZC A;  4BI3 A;  5KYU A;  2MCN A;  1BBZ A;  2IPO B;  3C12 A;  1LVK A;  1M2O A;  4XU0 A;  1YP5 A;  3OYK A;  1GFD A;  1I5O B;  1UE9 A;  5I22 A;  2EYW A;  1D0Y A;  4Z8A A;  5GAN 6;  4GLK A;  3L2W A;  4BE0 A;  4LDX A;  4DBR A;  1VQL A;  5D7U A;  1N5Z A;  2BIV A;  4C0F A;  2DX1 A;  4J6Y A;  2EYZ A;  4HVV A;  4JRQ A;  2QXF A;  3QUI A;  3MJX A;  3M5A A;  3TQ7 P;  2LJ3 A;  4PJO D;  4ELZ C;  1M9S A;  1VQ9 T;  2GQV A;  5EC7 A;  2R5A A;  3DB4 A;  2RHY A;  1NG2 A;  2V1R A;  3X25 B;  4F7U G;  1YJW A;  4C0D C;  3CCR T;  2ABL A;  3G71 A;  1HXD A;  2HD0 A;  4JJN K;  3LLR A;  1H3H A;  4PJJ A;  1Y07 A;  1IRX A;  2EGE A;  4GLM A;  3CCV Q;  3INZ A;  4OML A;  1VQP A;  2FRW A;  2QGG A;  1KQ1 A;  1K73 R;  2L89 A;  3IQL A;  1HJD A;  3UWN A;  1VQK A;  2KAF A;  3QZ5 B;  4QQ6 A;  3VJP A;  1VQN A;  1QLY A;  2LMJ A;  1QKX A;  1M3B A;  2BE7 D;  4ZGE B;  2EQU A;  4LDW A;  3M58 A;  4RCB A;  1VQ7 A;  3DB3 A;  1YNZ A;  2KVQ G;  2D9T A;  4ZTJ A;  1BK2 A;  3CBO A;  1B7T A;  2G3R A;  3A98 A;  5CVI A;  3CCS A;  3VS7 A;  1K9M C;  2W0Z A;  1PC0 A;  1VQL Q;  1OZ3 A;  3QII A;  2HAX A;  1YIT T;  2QG9 B;  3OSS C;  1X2K A;  1Y0M A;  3MHX A;  4J9H A;  2HSE B;  2HL5 C;  3CBM A;  1QW1 A;  1WHK A;  3OYI A;  2ROL A;  1I0C A;  1M5Q 1;  4MML A;  1VYV A;  1ZBJ A;  5LJ5 g;  3KUF A;  1PM3 A;  1YWO A;  5KYU B;  2OTJ T;  1YJW Q;  4AFU C;  1M27 C;  3CC7 T;  3I9Q A;  4XU3 A;  3SD4 A;  3RNJ A;  1YIJ A;  3OYC A;  3I56 A;  3CCJ A;  3G71 Q;  2QQR A;  2HL3 A;  1ZSG A;  3E2U A;  1D3B A;  2VGM A;  3PVL A;  4FT2 A;  5GAN 5;  2V26 A;  1QVG S;  4M7D G;  2E6N A;  3VRY A;  9ATC B;  2KDS A;  4PKC C;  3R6O A;  1YFN A;  1VQP Q;  1UGV A;  2LX7 A;  4C8Q D;  3RMS A;  5KYW A;  3QHS A;  2A0F B;  3UAT A;  2CSQ A;  1NEG A;  1Y71 A;  3NMZ C;  4HKE A;  4X34 A;  1VQK Q;  4BAC A;  2P84 A;  3CC2 A;  1S72 T;  3VV0 A;  2X4Y A;  2RHU A;  3EGX A;  3L2U A;  2D0N A;  1VQN Q;  3TVT A;  4OB3 B;  4LD6 A;  3UA7 A;  1VQ4 T;  1LOJ A;  2CP7 A;  2DA9 A;  1K73 C;  1Z9Z A;  3CCL T;  3OYY A;  5LJ5 e;  1WFW A;  1NM7 A;  1VQ7 Q;  1T0H A;  5HY6 A;  1JXM A;  4C92 A;  3SFM A;  2R58 A;  2CRE A;  3SDZ A;  3CCS Q;  2FZG B;  4OB1 B;  3A8G B;  1RAI B;  1YJN T;  1OOT A;  2GF7 A;  5A0D A;  1OQK A;  3MEA A;  2RI3 A;  1AZG B;  3JCM J;  2DBM A;  1Y7X A;  5FU7 C;  3LWI A;  3SWN C;  4ME7 A;  1MV0 B;  2JUF A;  2K5F A;  1S1N A;  4CC2 A;  2E5Q A;  1SSF A;  1NYG A;  1B34 A;  1LCK A;  1UFF A;  1WJR A;  2CT3 A;  3G7Z A;  2F69 A;  1YIJ Q;  5FU6 C;  3I56 Q;  2Y4Y A;  3CCJ Q;  2EJG A;  2HMA A;  2O4X A;  2AIR B;  3V7R A;  3CPW A;  5CKH A;  2X51 A;  2JNG A;  2HKN A;  1WJQ A;  3TSZ A;  1X75 C;  4M77 E;  4X1V A;  2HEQ A;  5I11 A;  2KK4 A;  1UB4 A;  3TCJ A;  5GAO l;  2LQW A;  2LX9 A;  1M2V A;  4FU6 A;  4M78 A;  3JCM h;  1RAG B;  1FX7 A;  2RN8 A;  3QPH A;  3L2V A;  2HBW A;  2GBQ A;  1QWE A;  1SG5 A;  2DPP B;  5CO7 A;  3V8J A;  4A63 B;  4J7I A;  1EZZ B;  2GFA A;  3VS2 A;  3SHW A;  2QEX A;  2RO0 A;  1SHF A;  4Y28 E;  3VU3 C;  1Q86 C;  4M7A D;  3CC2 Q;  2JTM A;  4OP0 A;  4PLL A;  1K9M U;  4C8Q E;  2RQU A;  1KD1 C;  3EAE A;  4M77 C;  4MZT A;  2OX7 A;  2RPN A;  1IZ6 A;  1KJW A;  2CH4 A;  4J7F A;  2JM8 A;  4XTY A;  2LQK A;  1I5L A;  5IXF A;  4CI0 C;  2D6F A;  2LNV A;  2YSQ A;  1VQ9 A;  4XTW A;  3CPF A;  4M75 D;  1GBR A;  3OY9 A;  3RR6 A;  1VQ8 T;  2XK0 A;  3EGD A;  2J6F A;  1IHV A;  1K1Z A;  3CCR A;  5KYW B;  4C8Q C;  3JCM W;  2CT4 A;  5DLO A;  3VKI A;  4J5Y A;  2E65 A;  3CCE A;  2DL8 A;  2V1Q A;  1UG1 A;  2FPE A;  4JZ4 A;  1LJO A;  1QCN A;  3S3M A;  2CSI A;  3SEM A;  4PJO F;  3M59 A;  2L3Q A;  4C92 B;  2AZS A;  1VA7 A;  1VYU A;  2O9S A;  3PVQ A;  5KCO A;  4ZGJ B;  2KGT A;  3PNW C;  1ZA2 B;  2AKK A;  3FB9 A;  3REB B;  5GAM h;  2J06 A;  3G4S A;  2OTL A;  1K73 U;  4L5G A;  2A37 A;  1K8A R;  4D6W A;  1WXB A;  3M54 A;  1JJ2 A;  1BI2 A;  2QEX Q;  2EGA A;  3LGL A;  3O5Z A;  2NUZ A;  1KQ2 A;  2KRN A;  4MMK A;  4CC3 A;  2VC8 A;  4IIM A;  1CKA A;  2RMO A;  2DXB A;  1YIT A;  3JCM P;  4A4F A;  2DEQ A;  3HTR A;  3D7S B;  2ATC B;  2D0Q B;  2C0T A;  2DK3 A;  2K3B A;  3L1A A;  3J7A F;  2K9G A;  2HNI A;  4HCZ A;  3HFN A;  5GAN e;  1M1K R;  5I2M A;  4XQ3 A;  5LJ5 d;  2MAM A;  3VS4 A;  2CP6 A;  5FW9 A;  2EJF A;  2OTJ A;  1U06 A;  1M2V B;  2RA2 A;  4M78 B;  3EH1 A;  4C5H A;  1PSF A;  3JCM g;  2ED1 A;  2DLP A;  2X4X A;  4HA8 A;  5CAI A;  3LH5 A;  2DIL A;  1GCQ C;  4F7U E;  1AWX A;  3CCE Q;  1CSK A;  2DRK A;  4VUB A;  3EG2 A;  3MO8 A;  2NUT A;  1K0X A;  1TG0 A;  1BI0 A;  2VUB A;  1JB0 E;  4ESR A;  1GBQ A;  2FZC B;  3OBY A;  1WQ7 A;  1Q86 U;  1CKB A;  1AVZ C;  1NE8 A;  3G4S Q;  2OTL Q;  4KH0 B;  4IUP A;  4MDX A;  4C5E A;  1KD1 U;  3CCQ A;  2EVR A;  2KT8 A;  4RTU A;  2RQR A;  2DMO A;  1YHQ A;  3X20 B;  1KQS S;  4E6R A;  3V7S A;  5L8R E;  4DA4 A;  1GFC A;  1YJN A;  3NFC A;  1RI9 A;  3G6E T;  3EFR A;  3RIR A;  1VQM A;  2XDB A;  3ME9 A;  2DF6 A;  4WTO B;  4PFZ A;  1XJW B;  3OMC A;  3A8O B;  4Z89 A;  5KE3 A;  2LJ1 A;  5GMK l;  1LPL A;  4ANJ A;  3M0S A;  2DTI A;  1FYN A;  2EIF A;  2FRY A;  2AK5 A;  2GTJ A;  3Q1J A;  5I2S A;  5GMK i;  5GAM g;  1N8R C;  1TTH B;  2CP0 A;  5KYY A;  5CKD A;  4OVA A;  2WSC E;  3CCU T;  3CXC A;  2JMC A;  3QO3 A;  4PFP A;  4OMN A;  3OYG A;  1EIF A;  3I5S A;  4KT0 E;  1M8V A;  2JS2 A;  1WXT A;  1TOV A;  2YLB A;  5L23 A;  4OGE A;  2QDY B;  2FPF A;  4QVD A;  3UPU A;  2COY A;  2JTE A;  3H41 A;  3LH0 A;  1BB9 A;  1Q95 G;  3H9N A;  1RAC B;  1HSQ A;  4LNP A;  4AFZ C;  3HP9 A;  2MWP A;  4IKF A;  1QVP A;  3CCQ Q;  4XTV A;  4K11 A;  5CKF A;  1YHQ Q;  4M7D B;  5CK9 A;  2LRQ A;  3GNG A;  3H0F A;  3VYG A;  2QAZ A;  2V8K A;  3CBP A;  1YJN Q;  1RAD B;  1VQ8 A;  3MEV A;  4XU2 A;  1VQM Q;  4M7D C;  1M3A A;  1Q7Y C;  4M7A F;  2NUT B;  1XNI A;  1M1G A;  1SRL A;  2LT1 A;  4X9D A;  2YT6 A;  4HVW A;  2EQM A;  3HRS A;  4FCY A;  4II1 A;  2DD5 A;  3JB9 H;  4C92 G;  2O01 E;  2QQB A;  1U1T A;  1KC8 R;  2JJ9 A;  2LQN A;  3E9G A;  5KCH A;  4M75 F;  3H0I A;  4JLG A;  3OA6 A;  1TU0 B;  3QG1 A;  4NOY A;  4HCC A;  2ZGW A;  3CEY A;  1VIE A;  2C0I A;  2WSE E;  2EW3 A;  3EGU A;  2VXE A;  1JRI A;  4NL3 A;  1QCO A;  4GBQ A;  1VOM A;  4AFS C;  1WNL A;  5CIU A;  1WLP B;  4RUG A;  4LUE A;  4QVZ A;  2DFU A;  2JXB A;  1WHG A;  2FO0 A;  3JRZ A;  3CME A;  1ZUU A;  4AG1 C;  1WHH A;  2NWM A;  2D8J A;  3DKM A;  1IRE B;  5IH2 A;  5FRN A;  3RES A;  1BYM A;  4M78 G;  3EG1 A;  4DBQ A;  2L8D A;  3OQ5 A;  2ZAE A;  4E7L A;  1RLP C;  5A0L A;  1W6X A;  1NPP A;  4J8O A;  2DJZ A;  4PJN A;  5KYY B;  2JZ2 A;  3HHT B;  1YI2 A;  3EFO A;  4OB2 B;  3VUB A;  5LL6 S;  1VUB A;  3JSC A;  2DL5 A;  3JCM d;  3JB9 G;  1EFN A;  1G3S A;  4RKU E;  1N8R U;  2LDM A;  5C6S A;  4IUU A;  4IUQ A;  1ZUY A;  4BB7 A;  1QQJ A;  1X6G A;  2DBK A;  1QVF P;  4N0A A;  3QZ9 B;  2CP2 A;  1YWP A;  4Z88 A;  5GAN 4;  1ZBX A;  2JW4 A;  1WX6 A;  3VS5 A;  2Y90 A;  3EG9 A;  4J83 A;  3R6N A;  2GGR A;  1PSE A;  1WHJ A;  2MPX C;  5FRM A;  5GAN 2;  1NLP C;  4QQG A;  4JRP A;  4PJO A;  2XMF A;  4ELY C;  3QBY A;  2GTO A;  1Q81 C;  1R0B G;  2RI2 A;  2I2L A;  4QW2 A;  1KFZ A;  2LJ0 A;  3C0C A;  1NJI R;  2HCK A;  3OYM A;  1D0Z A;  4XTZ A;  4FYY B;  3OW2 P;  2RF0 A;  1NBE B;  2DIG A;  2RQW A;  2COZ A;  2H3E B;  3QSU A;  2BTT A;  1WQW A;  3SWN A;  2PNI A;  3MCA B;  1MHN A;  4E7S A;  1UEB A;  4FT4 A;  3CME Q;  6AT1 B;  1IXD A;  1N6A A;  1Q7Y U;  1UHF A;  2A7Y A;  3CPW S;  4KUI A;  2LP5 A;  3M0T A;  1IO6 A;  1JU5 C;  2K3X A;  1BCM A;  2QQA A;  1YI2 Q;  3RBB B;  2BE9 B;  2DAQ A;  5GAM d;  1QKW A;  3RUX A;  1H64 1;  1BIA A;  1TUG B;  4CC7 A;  4EMK A;  3GBQ A;  2QA4 A;  4TVR A;  1PWT A;  3VS1 A;  1JO8 A;  3CC4 T;  1AZE A;  2ESW A;  3JB9 I;  4PL6 A;  2YWW A;  4M77 D;  4RTZ A;  3ASK A;  2DYB A;  4WCI A;  1I4K 1;  1BKB A;  1ZUK A;  2YRC A;  4JJD A;  2DVJ A;  1Q82 U;  1SSH A;  4EMH A;  1M8M A;  2EQK A;  4RMO A;  3E1S A;  3AT1 B;  3X26 B;  4JS4 A;  1NZ9 A;  2ROT A;  2K7A A;  1G8X A;  3EFO B;  1YJ9 A;  3HRU A;  3G1J A;  1ACM B;  1VQ5 T;  2GNC A;  2EPD A;  1SEM A;  2YLC A;  5FLX E;  1M1F A;  1NJI C;  4L6V 5;  4GY5 A;  5GAN h;  1MMN A;  2JOY A;  4C8Q A;  5IHK A;  5HK3 A;  1WPY A;  2CP5 A;  4DEY A;  3L2Q A;  3CD6 T;  2DTO A;  2EGC A;  2X3X D;  4PJO B;  2JT4 A;  2OI3 A;  1VQO A;  2FHD A;  1R8O B;  1KG1 A;  4KBM B;  2HDA A;  1E6H A;  1PKT A;  1YCS B;  2NLU A;  2R5M A;  1M90 R;  2F2X A;  2QA4 Q;  1JJ2 S;  4FL6 A;  4JDS A;  2P0P A;  5GAO r;  1TWB A;  1Q81 U;  4HT8 A;  2ZPE B;  1Y57 A;  5LJ5 f;  4DOW A;  2YUQ A;  3OS5 A;  3BFM A;  2DM1 A;  3UA6 A;  2E1H A;  3CCM A;  1PRL C;  3NTI A;  1SRM A;  1C1A A;  2RM4 A;  3OYF A;  2HQH A;  4BI8 B;  2DKG A;  1RL2 A;  2CUD A;  1VQ6 T;  1YJ9 Q;  2XDP A;  1P92 A;  1UUE A;  3QYG B;  3ZL7 C;  2VGN A;  1KIK A;  1FXX A;  1QVG P;  1N9R A;  3FC3 A;  1HD3 A;  1X69 A;  2ZPG B;  4OMQ A;  5CKB A;  1PD0 A;  2DNU A;  1A0N B;  3JCM b;  2MI6 A;  4KUD K;  1YN8 A;  4M7A A;  2KNB B;  2G6F X;  2DO3 A;  5KYX A;  1W2B S;  2DL4 A;  2EWN A;  3MET A;  1D3B B;  2FEI A;  4FM4 B;  4XK8 E;  3VS0 A;  1VQO Q;  2HZY A;  1KK7 A;  3CMA T;  1H3Z A;  1V76 A;  4UC4 A;  2L2P A;  2FZK B;  1O9S A;  1WA7 A;  4LE9 A;  4M75 A;  4OMO A;  2IG0 A;  4C92 E;  4J9D A;  5LJ3 h;  2QK0 A;  2RI5 A;  2QI2 A;  3NTH A;  3EGX B;  4ORZ A;  4BE1 A;  1G5V A;  5GAN g;  4C0Z A;  1M90 C;  1OEB A;  3CCM Q;  2J6O A;  4AG2 C;  1JXO A;  5CR2 A;  2YUN A;  4J9C A;  4MZM A;  2E6Z A;  2CUB A;  2XID A;  2FB7 A;  2LT4 A;  1RLQ C;  4LUD A;  3OS0 A;  4XTU A;  1PD1 A;  2DE0 X;  2J6K A;  2YRD A;  2KE9 A;  4C92 C;  3FLG A;  2VV5 A;  3M0P A;  1LNX A;  1I81 A;  2E10 A;  1B34 B;  2FG0 A;  3CXC S;  3MEW A;  2QYZ A;  4M78 E;  2AT1 B;  5GAO m;  2O4X B;  3X28 B;  2P0Q A;  3CCV T;  2WSF E;  3MKD A;  1KHI A;  1FMK A;  4PJM A;  3L2Z A;  3GF5 A;  5CQY A;  1VQ9 Q;  2JM9 A;  2KBT A;  2DXT A;  3CC7 A;  3QWX X;  4C0G A;  3LYI A;  3H6Z A;  3CCR Q;  4XTX A;  5AYF A;  1RI0 A;  2YRV A;  5D6X A;  4D8K A;  1J3T A;  1XTD A;  2EJ9 A;  2COW A;  2PUO B;  3M53 A;  2DEU A;  2H8H A;  2X3W D;  4M7D D;  4M78 C;  3N5B B;  2LQ8 A;  4FYV B;  5CKE A;  5GAN f;  1VQL T;  1PG5 B;  3LW5 E;  1W2B A;  1R0C B;  4OGC A;  1AT1 B;  4M7A B;  4M77 F;  1YCY A;  1DJ7 B;  1V1C A;  3WVD B;  4LN2 A;  1S72 A;  4C5I A;  2IIM A;  3TSW A;  2P4R A;  1VQ4 A;  4PJO G;  3MP1 A;  2L3R A;  3PMI A;  2A3L A;  1RAE B;  1JEG A;  2EFI A;  3EGD B;  3CCL A;  1ZSZ A;  4NS5 A;  4YTL A;  3C94 A;  2AHJ B;  1AWO A;  1YJW T;  1OV3 A;  3G71 T;  1NPR A;  4C8Q F;  5LJ3 g;  1OYX A;  1QP2 A;  1YIT Q;  1K8A C;  1D1C A;  5IAY A;  5GAN 7;  2RQV A;  3PTA A;  3UT1 A;  2OAW A;  4DOV A;  1VQP T;  1RAF B;  2E64 A;  4FW1 A;  5FWC A;  3U23 A;  2L0A A;  3EHR A;  2OTJ Q;  1VQK T;  2OJ2 A;  3CC7 Q;  2GQI A;  1NLO C;  3RKW A;  2A28 A;  3PT9 A;  1M1K C;  2J7I A;  2A36 A;  4M4Z A;  2KSS A;  3JCM f;  1AWW A;  3OBW A;  2YDL A;  4A4H A;  1VQ7 T;  1IGQ A;  2DYI A;  1U8R A;  3L2R A;  2KT1 A;  3JCM X;  2XD0 A;  3VS6 A;  4A54 A;  5GAN 8;  3JCM Q;  3BDU A;  2WAC A;  2KXD A;  2PQW A;  5LJ3 e;  2DXU A;  4E7H A;  4M7D E;  1BI3 A;  4BDY A;  2DIQ A;  1S72 Q;  4J9G A;  3FEO A;  4X9C A;  3HSB A;  1SKU B;  1ZX6 A;  1VQ4 Q;  2EKO A;  2K2V A;  4BD3 A;  3CCL Q;  2RHX A;  2RHI A;  1WXU A;  2YXY A;  5IHN A;  2K3Y A;  2PUK B;  5GAM j;  4KRT A;  1YIJ T;  2AKL A;  3FIF A;  1BU1 A;  5GAO q;  3HFO A;  3I56 T;  3CCJ T;  3KBG A;  1JBM A;  2F2W A;  2MYS A;  5GAO n;  4J9B A;  4A4E A;  2C0O A;  1KQS P;  1Y96 A;  3PMT A;  2RNA A;  2QDL A;  1MV3 A;  4JJC A;  4ZGD B;  4B6M A;  4EIK A;  1JQQ A;  5GAN d;  3QXE B;  3CC2 T;  2MIO A;  2PVO B;  3FDR A;  3E19 A;  3RMQ A;  5GAM f;  1ZSZ B;  2DZ9 A;  4RG8 A;  3RKX A;  2LCL A;  3QYH B;  4F7U F;  1X01 A;  3RKY A;  2YUP A;  2K6D A;  3M55 A;  5GMK m;  5GMK j;  2LZ6 B;  2HSP A;  4KUL A;  4MDW A;  2D1X A;  1ZQ1 A;  3UDC A;  2NYS A;  4R0K A;  5A0G A;  3AHU A;  2QQS A;  1H92 A;  4J6X A;  2KYB A;  1C0M A;  4AT1 B;  1OI1 A;  1RAH B;  4BE2 A;  1R77 A;  4OMP A;  4RTW A;  2RJC A;  2KRO A;  3F70 A;  3H0H A;  2NUP A;  4BI4 A;  4E2F B;  1K8A U;  2ZPI B;  3P8B B;  3E9F A;  5HKC A;  2R57 A;  1IGU A;  2ECZ A;  3V8L A;  4QT7 A;  3FJP A;  2FVU A;  3CQT A;  1X27 A;  4F17 A;  2MK5 A;  3M57 A;  1VQ8 Q;  4C5G A;  5M9O A;  1TUC A;  1WHL A;  4JUV A;  1D1B A;  3HKS A;  4P5N A;  1K9M R;  3OS1 A;  4OMF B;  1M1K U;  1BCO A;  1TSF A;  4Y91 A;  2X4J A;  3QJY A;  3EG0 A;  5J3B A;  4M7A G;  5GJV B;  2QEX T;  4Z02 A;  2CZ0 B;  2FL7 A;  5AT1 B;  2EAY A;  4FIB A;  4B9X A;  4DEX A;  3TU4 K;  1QCF A;  2KR3 A;  3PIP A;  4JJB A;  5DLQ E;  2KRM A;  1G3T A;  4N4H A;  2XIC A;  3GNF B;  4C0D B;  2HBP A;  3A8H B;  2ZPB B;  3BY7 A;  4EDU A;  5J39 A;  3RER A;  1KC8 C;  1WZO A;  4M75 G;  1W1F A;  4R55 A;  2ZPF B;  5IT9 E;  1Y96 B;  3REA B;  4IUR A;  4M7D F;  1ABO A;  2MWO A;  2XKO C;  2K2M A;  3LWH A;  1AHJ B;  2K79 A;  4HXJ A;  1W70 A;  5LJ3 d;  3G6E A;  2M0Y A;  1UGQ B;  1QVF A;  2JS0 A;  4LD9 K;  2QAS A;  3RDV A;  3OS2 A;  1GRI A;  4PFO A;  3JB9 J;  4ZNX A;  2HKQ B;  2Y4X A;  3CCE T;  2RK1 A;  3FRN A;  4E7J A;  3GIB A;  3WXM B;  2JVV A;  2K5L A;  3URG A;  2RHZ A;  7AT1 B;  4N4G A;  2A08 A;  2X9H A;  2JN0 A;  2KEA A;  2LC4 A;  1MNE A;  1M4Z A;  3M0U A;  2BUD A;  3G4S T;  2OTL T;  2K5I A;  1OPK A;  1TH7 A;  2LCC A;  3OW2 A;  1UGS B;  1QWF A;  4HT9 A;  2YUO A;  4OF1 A;  3C4S A;  3CCU A;  3QWY A;  1T3S A;  3TRE A;  2FYK A;  2ZZD A;  2DJQ A;  2NUP B;  1OPL A;  3QDF A;  4FYX B;  4KGV B;  1FMW A;  1QMC A;  1SF9 A;  3DLL A;  4M77 A;  4CRI A;  2CKK A;  8AT1 B;  1EX4 A;  3NTK A;  4Y92 A;  2CGH A; 
#chains in the Genus database with same CATH homology
 2L2P A;  3PE0 A;  1RI9 A;  2JMA A;  1WA7 A;  2PTK A;  4LE9 A;  4OMO A;  1RUW A;  4J9D A;  2M51 A;  2DF6 A;  2L3S A;  4RTX A;  4ORZ A;  4AFQ C;  2MCN A;  1BBZ A;  2J05 A;  1ABQ A;  4Z89 A;  1ZLM A;  2LJ1 A;  1OEB A;  1YP5 A;  3M0S A;  2J6O A;  1XOV A;  1GFD A;  4AG2 C;  1FYN A;  1JXO A;  2W10 A;  2FRY A;  2YUN A;  4J9C A;  2AK5 A;  2GTJ A;  1UE9 A;  1WDX A;  5I22 A;  2EYW A;  2CUB A;  1RLQ C;  4LUD A;  4Z8A A;  1WYX A;  1N5Z A;  2DE0 X;  2J6K A;  2KE9 A;  2DX1 A;  2CH4 W;  2JMC A;  3M0P A;  2AZV A;  2EYZ A;  4HVV A;  4OMN A;  3I5S A;  5HCK A;  2JS2 A;  2LJ3 A;  2DL3 A;  4RTT A;  1WXT A;  5EC7 A;  2FG0 A;  1NG2 A;  2V1R A;  5L23 A;  3NHN A;  2FPF A;  3H41 A;  2JTE A;  1BB9 A;  2MOX A;  2ABL A;  3THK A;  1HSQ A;  4LNP A;  1FMK A;  4AFZ C;  1H3H A;  4K11 A;  2JM9 A;  2KBT A;  4OMM A;  3QWX X;  2EGE A;  3H0F A;  1AWJ A;  1WIE A;  4GLM A;  4OML A;  4D8K A;  1J3T A;  3KFV A;  2FRW A;  1ARK A;  1HJD A;  3IQL A;  2ED0 A;  1M3A A;  2H8H A;  2X3W D;  1SRL A;  2RQT A;  1QLY A;  2YT6 A;  2LMJ A;  1QKX A;  3JV3 A;  1M3B A;  4HVW A;  1T0J A;  1AOJ A;  4CC4 B;  1K0S A;  1X6B A;  1G2B A;  1YNZ A;  1GCQ A;  1V1C A;  4LN2 A;  1BK2 A;  2IIM A;  2LQN A;  2O31 A;  3VRZ A;  3A98 A;  3TSW A;  2P4R A;  3VS7 A;  1Z9Q A;  2W0Z A;  3H0I A;  2O2O A;  1JEG A;  1T3L A;  1X2K A;  1Y0M A;  4J9H A;  1AWO A;  1OV3 A;  2O88 A;  2C0I A;  2EW3 A;  3EGU A;  2ROL A;  1I0C A;  1VYV A;  1M3C A;  1ZBJ A;  1UDL A;  1UJ0 A;  1YWO A;  4GBQ A;  4AFU C;  1M27 C;  2RQV A;  4AFS C;  3I9Q A;  1WLP B;  3RNJ A;  4RUG A;  4LUE A;  2VVK A;  2JXB A;  2OAW A;  1B3Q A;  2SEM A;  4J9I A;  4RTY A;  1ZSG A;  2DL7 A;  2E5K A;  2FO0 A;  3PVL A;  1ZUU A;  4AG1 C;  2NWM A;  2D8J A;  5IH2 A;  1UHC A;  5FWC A;  3U23 A;  2L0A A;  3EHR A;  5IHI A;  3VRY A;  2OJ2 A;  2GQI A;  3EG1 A;  1NLO C;  2A28 A;  1RLP C;  2J7I A;  2A36 A;  1W6X A;  1UGV A;  3EHQ A;  2LX7 A;  4M4Z A;  1AWW A;  2YDL A;  1PRM C;  3UAT A;  2CSQ A;  1NEG A;  3NMZ C;  2DL5 A;  1EFN A;  2KT1 A;  1NYF A;  2D0N A;  3TVT A;  3VS6 A;  1ZUY A;  3UA7 A;  1X6G A;  1WI7 A;  2DA9 A;  2DBK A;  1Z9Z A;  2ENM A;  2KXD A;  4F14 A;  1WFW A;  1YWP A;  1NM7 A;  4Z88 A;  1T0H A;  2JW4 A;  1JXM A;  1WX6 A;  2LNH B;  3VS5 A;  2CRE A;  4J9G A;  3R6N A;  3VS3 A;  2GGR A;  1ZX6 A;  1SPK A;  2EYY A;  1NLP C;  2F2V A;  2KRS A;  1OOT A;  2XMF A;  1UEC A;  2GTO A;  5IXB A;  1WXU A;  5IHN A;  1AZG B;  2BZX A;  2DBM A;  4KRT A;  1KFZ A;  2EKH A;  2AKL A;  1BU1 A;  2LJ0 A;  3C0C A;  1MV0 B;  2HCK A;  4IIO A;  2CDT A;  1I1J A;  1S1N A;  4CC2 A;  2F2W A;  1NYG A;  2RF0 A;  1LCK A;  1UFF A;  5FWB A;  2RQW A;  4J9B A;  2CT3 A;  2C0O A;  2BTT A;  1G83 A;  2PZ1 A;  2PNI A;  1K9A A;  1PNJ A;  3I35 A;  2RNA A;  2QDL A;  3TSZ A;  4HCK A;  4HVU A;  1MV3 A;  4X1V A;  2HEQ A;  3M0R A;  4JJC A;  5I11 A;  4RTV A;  2B86 A;  1B07 A;  1JQQ A;  1UHF A;  4EIK A;  2LQW A;  2MIO A;  1U5S A;  2LP5 A;  3M0T A;  1IO6 A;  4D8D A;  2RN8 A;  2HBW A;  2GBQ A;  1JU5 C;  1QWE A;  4A63 B;  3RBB B;  1QKW A;  3VS2 A;  3SHW A;  1SHF A;  3FJ5 A;  2KXC A;  1U3O A;  4J9E A;  4CC7 A;  2YUP A;  1E6G A;  2K6D A;  2RQU A;  2LZ6 B;  2HSP A;  2EBP A;  3GBQ A;  2D1X A;  3I5R A;  1VYT A;  1PWT A;  2RPN A;  4FSS A;  4R0K A;  1JO8 A;  3VS1 A;  1AZE A;  1H92 A;  1KJW A;  2CH4 A;  2ESW A;  4RTZ A;  2JM8 A;  1M30 A;  2KYB A;  2DYB A;  4WCI A;  1UTI A;  4OMP A;  2FPD A;  5IXF A;  1GCP A;  1ZUK A;  4RTW A;  2KRO A;  4JJD A;  2YSQ A;  2O9V A;  2DVJ A;  1GBR A;  1SSH A;  3H0H A;  1M8M A;  2J6F A;  1K1Z A;  4JZ3 A;  1I07 A;  2VWF A;  2ECZ A;  4QT7 A;  1NEB A;  2ROT A;  2K7A A;  3CQT A;  1X27 A;  4F17 A;  1X43 A;  2CT4 A;  1H8K A;  2GNC A;  1TUC A;  2EPD A;  2DL8 A;  2V1Q A;  1SEM A;  1UG1 A;  2FPE A;  4JZ4 A;  2CSI A;  3SEM A;  2L3P A;  5IHK A;  3ULR B;  2L3Q A;  2AZS A;  1VA7 A;  3EG0 A;  1VYU A;  2O9S A;  3PVQ A;  3UF4 A;  4DEY A;  3M0Q A;  5GJV B;  2KGT A;  5ECA A;  1K4U S;  2EGC A;  2X3X D;  2AKK A;  3REB B;  2J06 A;  4DEX A;  1QCF A;  2JT4 A;  2KR3 A;  4JJB A;  2A37 A;  2OI3 A;  1WXB A;  2KRM A;  4J9F A;  2EGA A;  3O5Z A;  2NUZ A;  2HDA A;  2KRN A;  4CC3 A;  4IIM A;  1W1F A;  1CKA A;  2RMO A;  1E6H A;  1PKT A;  1YCS B;  2F2X A;  1MUZ A;  4JPB W;  2DRM A;  1PKS A;  3REA B;  2KYM A;  2C0T A;  1ABO A;  1Y57 A;  2K3B A;  2K2M A;  2K9G A;  1AEY A;  2YUQ A;  2K79 A;  4HXJ A;  1W70 A;  2DM1 A;  2M0Y A;  3UA6 A;  2D8H A;  2BZY A;  2JS0 A;  3VS4 A;  5FW9 A;  1KSW A;  1PRL C;  1SRM A;  1GRI A;  4ZNX A;  1U06 A;  5GJW B;  1X2Q A;  2ED1 A;  1GL5 A;  2CUD A;  2DLP A;  1UUE A;  3LH5 A;  3ZL7 C;  2DIL A;  1GCQ C;  2A08 A;  2EQI A;  1KIK A;  1AWX A;  2KEA A;  2I0N A;  1CSK A;  2BZ8 A;  2DRK A;  3EG2 A;  1HD3 A;  1X69 A;  3M0U A;  1K76 A;  4OMQ A;  2VKN A;  1SHG A;  1PHT A;  2DNU A;  1K0X A;  1TG0 A;  1A0N B;  2SRC A;  3NGP A;  1OPK A;  4ESR A;  1GBQ A;  1QWF A;  2YUO A;  1TUD A;  3QWY A;  1T3S A;  4F16 A;  2EYX A;  1CKB A;  1AVZ C;  1YN8 A;  2KNB B;  2DJQ A;  2G6F X;  2DL4 A;  2FEI A;  1OPL A;  2EVR A;  2KT8 A;  3NPF A;  4RTU A;  1AD5 A;  3VS0 A;  3EG3 A;  2RQR A;  2DMO A;  1UJY A;  1E7O A;  4E6R A;  2LCS A;  4Y92 A;  1GFC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...