2QK0A

Structural basis of microtubule plus end tracking by xmap215, clip-170 and eb1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
GSDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKMTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170, and EB1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords CAP-Gly domain-containing linker protein 1
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2qk0A00
2CP2A 2COZA 1WHMA 3RDVA 2HKNA 2Z0WA 1TXQA 1WHJA 1WHGA 2COYA 2E3IA 1LPLA 1TOVA 1WHKA 2HQHA 3E2UA 2E4HA 1IXDA 2E3HA 2HKQB 2COWA 2HL3A 3TQ7P 4B6MA 2M02A 2CP3A 1WHHA 2CP0A 2MPXC 2CP7A 2QK0A 2CP5A 2HL5C 1WHLA 2CP6A
chains in the Genus database with same CATH superfamily
2DE0X 5IXBA 1D1CA 3L2RA 2A0FB 2IIMA 3EFRA 2FO0A 2RK1A 4M7AG 2K5FA 4KUDK 1AZEA 1X01A 1M30A 5J26A 2HBWA 3E9FA 3I56T 3PFSA 3C12A 3P8BB 3CD6T 2CP3A 1QVPA 3HTRA 5GAOq 4FSSA 1TH7A 4M78G 2J7IA 1NJIR 3GIBA 1OYXA 2EQJA 2NUTB 1H641 4QKUA 2C0TA 2M1HA 5D6YA 3OYHA 3VYGA 3H0IA 2A37A 2HD0A 4MZTA 1M1FA 2LVMA 4JLGA 1UHFA 2RN8A 1YJWQ 4A4KA 3CMAA 1MMAA 2OAWA 2DBMA 2V26A 2J6OA 3THKA 2FPFA 3PE0A 2OTLA 1VQ9Q 2CKKA 2GTOA 2K4YA 2E65A 3MEWA 1AWWA 1X6GA 2KAFA 3CPFA 4BY6C 3G6EA 3E1SA 2LT1A 3HRTA 1MMDA 3U23A 1KJWA 4HCCA 2X4JA 5KYUA 4RG8A 2KYBA 3CXCS 2ECZA 1IO6A 4OB3B 1I4K1 3MP6A 1PD1A 1PC0A 4M7AB 3ZBDA 3VS1A 4C5HA 1K9MU 4KRTA 2CDTA 2JT4A 4JS5A 2LDMA 1I07A 1M8MA 4J5YA 4J8OA 5DLQE 4MDWA 1YI2T 1KQ1A 4GLKA 3EG2A 2CP6A 1JB0E 2LQNA 3V8JA 1VQ6Q 2E6ZA 4Z8AA 3QZ9B 2IPOB 1U3OA 2QEXT 1LPLA 1YN8A 2ZPFB 3JAME 4C8QB 3OYFA 1N6AA 3EG9A 3OYJA 2D1XA 4Q5WA 1M2OA 2CP0A 1WJSA 3OYMA 2JMCA 4OP0A 1OU9A 1XTDA 4C92G 2KRNA 4WCIA 3NMZC 4M7DE 1XNIA 1BCOA 2YHTA 3UATA 2RHXA 2O9SA 4JDSA 3MHXA 4M75G 2M0YA 4M7DA 1NLOC 2DM1A 2YSQA 2DXTA 4LUDA 5IHIA 1ARKA 4FW1A 3RKYA 1D0YA 1UJYA 3CCUQ 3L2ZA 1OQKA 1VQPT 1WA7A 5GAOn 3I55T 2QEXQ 5LJ5f 1Q82R 1D3BA 1WDXA 2GCXA 2JNGA 4HVWA 3S3MA 4OB1B 1YHQA 2A36A 3VRZA 5GMKe 2AZVA 3META 2ZCFB 3G71A 2BKDN 3FC3A 1EZZB 4MMLA 1HD3A 3JB9G 5GAOr 2BE9B 2DZ9A 1QP3A 1WHGA 5DLOA 1HJDA 3MP8A 1EFNA 3CD6Q 2KRSA 1HXDA 2E10A 5ECAA 2FPEA 2HQHA 3CPWA 3UA7A 3BFMA 1X6OA 1T3LA 3FRNA 2YUQA 4M75A 2CZ1B 2IVWA 2DXBA 2XI9A 2RJDA 1YWOA 3A8OB 1BCMA 3RR6A 3EGXA 3VJPA 4EMKA 4M78E 1M1KU 4M75E 2B86A 4JRPA 5IT9E 3M55A 4J9CA 2QXFA 1ZBXA 2XMFA 4XU3A 2BZXA 1AVZC 2RMOA 1K8AU 1SHGA 4F17A 1VQNQ 1YCSB 4DBQA 4E2FB 2FB7A 2V1QA 1YJNQ 2A28A 3JRZA 4A63B 2K2VA 4KBMB 4L6V5 1K4US 2GFAA 2EGAA 1QQJA 1ZSZA 5IXFA 4M77B 1R0CB 2WSEE 4C8QD 1ABOA 4B9WA 4F7UB 4LDUA 4BDYA 2YT6A 1M9SA 1UE9A 1B34A 2F2WA 1VYVA 3MKDA 3X20B 4II1A 4Y28E 1YIJT 1WNLA 1UECA 3L42A 2I2LA 1U8RA 5I11A 3TU4K 3RMQA 2QQRA 1S72Q 3JCMe 1QVFS 1RUWA 3OYKA 5CKFA 1PG5B 1YITA 2RJCA 1SRLA 3HFOA 2EYXA 1YBYA 3UPUA 2X4WA 3EGUA 2L3SA 2BZYA 4BE1A 4C92C 5AYFA 3H6ZA 2JTMA 5M9OA 3TCJA 1VQ7Q 4M78B 2LJ0A 2PUOB 3H8ZA 2O01E 2COWA 4PK4A 3ZEHA 3CMET 3OYIA 2EQIA 4F14A 1VUBA 4OB0B 3PT9A 3QSUA 2L89A 1QVGA 2DZCA 1RACB 4M75B 1Q82C 4Z88A 3M59A 1VQ5A 1RAEB 4HKEA 3CCQA 2QTXA 1IXDA 2JS0A 1BI2A 3CQTA 2XHCA 1SSHA 4PFOA 2MIOA 2F5KA 4PNOA 1U5SA 3H41A 1JJ2P 1O9SA 4DA4A 2EAYA 1VQOA 3OBWA 5A0LA 3FLGA 1GCQA 3G71T 4XK8E 1VQPA 3SB2A 2M02A 2A08A 1R77A 3OA6A 2XDBA 2K9GA 2C06A 1D3BB 1VQ8A 2OJ2A 4PLIA 5GANg 4M7DC 3BW1A 2QTVA 1K9AA 2KBTA 1HK9A 2C0IA 1EX4A 2VVKA 4JLIA 1KD1R 2P84A 3CCRT 2RHYA 3E2UA 5GAMd 4N4IA 2DYIA 1YHQQ 4M7AC 2NUPB 4M78A 3CCQQ 1VQ5Q 3NHNA 4OMPA 3FJPA 1IZ6A 2EGCA 1UGQB 4KUIA 1GXIE 2OTJT 1BI3A 5KYYA 1QW1A 3D7SB 4X34A 2XICA 3JCMP 3INZA 1YNZA 1Y0MA 4AG2C 5HKCA 4OMFB 1MMGA 2DVJA 4OF1A 4A4HA 3M0QA 1F1BB 1X27A 4N0AA 2DERA 3JCMX 1MHNA 3OYLA 2EQUA 2K79A 2QK0A 2OAUA 5FU6B 2A3LA 5C6SA 5IAYA 1VA7A 4PJOA 2RJFA 1KQSS 3F70A 1C6VX 3WXMB 1G3TA 3RBBB 2GGRA 2LCLA 2DVEA 2A7YA 2DL8A 4QQGA 5FWBA 4BY6B 1Q86R 5CAIA 1WLPB 1SRMA 5CQYA 1N8RC 1H3HA 4ZGEB 1UGPB 3A8MB 4M77E 2AT1B 2CP2A 2PVOB 1G3WA 4KH1B 3CCVA 3HHTB 4J9EA 1VQLQ 4KGVB 2OX7A 4XTWA 2X35A 1AWOA 1Q86U 2EQMA 4R55A 2LZ6B 1WYXA 2X4YA 4OMLA 2E3HA 5GAN2 2E41A 2CSIA 1NJIC 3N5BB 3VUBA 5KE2A 5KYWB 1TUCA 1TXQA 1YCYA 4RTVA 1FXXA 4J7FA 1PWTA 5GANd 5LJ3d 4MZMA 1M1KC 2H3JA 1ZX6A 4J6WA 2JOYA 4LUEA 4CI0C 1Q82U 1VQ6A 3I5RA 1SF9A 2YDLA 4CRIA 4C92A 5GMKh 2CZ0B 1UJ0A 1FMKA 1MV0B 2RI2A 1IHVA 4E7SA 2ROLA 4F7UE 1VYUA 2ZPIB 2HNIA 3C0CA 3NGPA 1SEMA 5CIUA 4JJNK 2O4XB 1JRIA 1NBEB 4F16A 2DILA 5FU6C 2WACA 4QT7A 1C0MA 1VQOT 2AIRB 4M78D 2KEAA 1OX9A 3RUXA 3PTAA 4JRKA 1ZA2B 3QJYA 3OS0A 4CC3A 3A8HB 4PFZA 1WHMA 2DXCA 2JW4A 4C5IA 1OEBA 1S72A 3VYHB 3H9NA 1KHCA 2LQWA 5GAN3 3CPWS 1K73U 5LJ3h 1H3ZA 2LRQA 4M77C 1YITT 3PVQA 2QQBA 3H0HA 2EGEA 1I5LA 1GRIA 4C5GA 1K8AR 2KMTA 2DJQA 9ATCB 3L2UA 5LJ5d 3URGA 2PVGB 2RQUA 2CUBA 2RQWA 3VS0A 1D0ZA 3MJXA 4EMKB 1OZ3A 4E6RA 5GANe 2M9UA 3CCMQ 2YLBA 4FM4B 3VS5A 1N9SA 4M77F 1J3TA 4J9HA 2DJZA 5GAMj 1UUEA 2KY9A 4AFQC 4C92E 1PD0A 4FT4A 1G8XA 4OMMA 4PKCC 1FWZA 2KSSA 1BB9A 3BDUA 2H3EB 1KC8R 1QKWA 4KULA 2FEIA 2YRDA 2CZ7B 3QYHB 1Q7YC 1M3AA 2CT3A 1KHIA 2ESWA 4L59A 3REBB 3L2WA 2G6FX 3ME9A 3AT1B 3QJ6A 2XU8A 1ZUYA 3V8KA 4KH0B 2KXDA 2JTFA 2ZPHB 3CMAQ 3OW2A 4L5GA 2QA4A 1YI2A 2QQSA 1Y96A 1YJNA 1YIJQ 4Z89A 3X25B 4ZGDB 2E3IA 2QDLA 2AHJB 3CCRA 3EFSA 4FSXA 3QWYA 3FJ5A 5GJWB 4M7AA 5EC7A 1AOJA 3FIFA 1YFNA 1T3SA 2FYKA 2LX9A 2HAXA 1I5OB 5CKBA 2JXBA 2HMAA 4M77G 3X26B 1RAIB 5GJVB 3G6ET 3LYIA 2KT1A 3JB9J 1Q7YU 1KQ2A 1UGSB 1RLQC 4JS4A 1M3BA 1T0HA 2WSFE 2LT4A 3UWNA 1N9RA 2BIVA 2V8JA 2XD0A 4M77A 4YTLA 3EG0A 3QHSA 4FIBA 2PVDB 1VQLA 4Z02A 5D6WA 2B8AA 5IH2A 2FZKB 1VQ4A 2HQXA 4FYXB 1BIAA 4F7UF 2QGFB 2RQVA 3NFCA 4XAXB 2DD4A 2M0OA 1VQ7A 3S3OA 2HL3A 1TTHB 1Z9ZA 2RM4A 1CKBA 1G2BA 1LCKA 3CC2Q 4M7DF 4PFPA 1BBZA 1TUGB 1QWFA 4M77D 1VOMA 3CBOA 2D8JA 4F7UG 5GANf 5I2SA 2K2MA 2KK4A 4PJOC 4X9DA 4J6XA 3HPWA 2VGNA 1BK2A 1K73R 2FL7A 3JB9F 2VXEA 4LN2A 3PIOA 2PTKA 2DEQA 2RI5A 3EAEA 5CR2A 2CH4A 1X6BA 4XTYA 1IHWA 2JZ2A 3JCMf 4C92B 2RI3A 3E19A 1JU5C 4M75D 2ED1A 4EPCA 1Z9QA 2F1LA 1PSEA 3VUZA 4F04B 3EHRA 4JZ3A 3KXTA 1VQ5T 4ELYC 4E7KA 1UGVA 1AHJB 1I1JA 1Y96B 4DEYA 2RO0A 2J05A 2MCNA 4IUQA 4PJOB 1KQSA 4X1VA 1Q81U 2EYYA 4ZGJB 2DRKA 3JV3A 3M53A 5GANh 4ATOA 4PJJA 4LD6A 5GAN6 3IQLA 5HK0A 1VQ4T 2CSQA 4OB2B 5CQXA 1UFFA 1Y7XA 3G4SQ 1KFZA 1W2BS 1SSFA 5IN1A 2HL5C 2F2VA 2HZYA 4NL3A 2QG9B 4A4FA 2F2XA 2DXUA 3QIIA 4GY5A 4WF2A 3RDVA 1AEYA 3A8LB 2DEUA 5GAOl 1RLPC 1W6XA 1VQMT 2KE9A 2DRMA 1VIFA 1ZQ1A 2NYSA 2K5IA 4D8DA 3X24B 3PVLA 2KQWA 1UHCA 4B6MA 3OS2A 4OGEA 4R56A 5HK3A 2DBKA 2FRWA 4N0AC 2RQTA 1JEGA 3Q1JA 1S1NA 2Z0WA 5LJ3j 3OMGA 1M8VA 4HXJA 1U1SA 1KG1A 1SHFA 1M3CA 2CT4A 5KCHA 1PRMC 1O75A 5I21A 2ROTA 3QKJA 2KGTA 3CBPA 1T0JA 3M0PA 2KDSA 2CP5A 2GQVA 4DBHA 2LJ3A 2FZCB 2DTHA 3SWNC 1BU1A 2QGGA 4HVUA 3LWHA 2YLCA 5IHKA 2AK5A 4QQDA 3CCUA 2YUNA 5EG2A 1YITQ 3CCJA 1CSKA 3CCVQ 3DKMA 1WI7A 2DFUA 1M2VA 1M1GA 1A0NB 1Y57A 5CVIA 4BE2A 3NTKA 4C0ZA 3EGXB 4FYVB 3QG1A 1YJWT 2DIQA 4PJOD 4M7DG 3VV0A 2MF2A 2HEQA 2EYZA 1S72T 5FROA 2EFIA 4HA8A 1MGQA 2BZ8A 3CC4Q 2EQKA 1YJ9T 2DO3A 3JCMW 2KROA 4RTYA 3UT1A 4QQ6A 1H8KA 4C0GA 3VU3C 1OOTA 3OSVA 2YUOA 2HBPA 3BE3A 2DLPA 3L2QA 3DLLA 1ACMB 4PJOG 4RCCA 2DETA 1G3SA 2V8IA 2GF7A 4HT9A 1WHJA 2LTOA 5IHNA 3A1PA 4RUGA 1Q86C 1NG2A 1RAAB 1RABB 1V1CA 1VQLT 1B34B 1QP2A 3PIPA 3HRUA 2DNUA 4C8QC 3QUIA 2BTTA 1VQ4Q 4XTZA 2NUZA 1M2VB 1MV3A 4M75C 5A0DA 5CO7A 1QWEA 4QVDA 4A4GA 4DEXA 2E5QA 1ZHIA 2GQIA 1ZSZC 4J6YA 3HKSA 3CXCA 5HY6A 3KBGA 1VQ9A 4C92F 3CCET 1IB8A 4A4EA 2RH2A 1IRXA 2JM9A 3MO8A 3CCLA 1VQOQ 1BKBA 1X2KA 2KNBB 2P0KA 1SPKA 2ZZDA 5HCKA 1K1ZA 2QI2A 4RMOA 2LQKA 2E6NA 4JRIA 2JS2A 3G6EQ 1R0BG 4M7DB 2AZSA 3JB9I 5A2QE 3FEOA 4BI8B 4QW2A 1KD1C 4IIOA 3PNWC 2XG8D 1K0SA 3I55Q 4BE0A 1D0XA 1GCQC 3JCMQ 1Q95G 4JJBA 3LGFA 4FL6A 3MEVA 3QWXX 1VQNT 1RAGB 4LDYA 1KSWA 3OQ5A 2OTJQ 1LNXA 2HSPA 1RAHB 2YRVA 1GFDA 2EBPA 3DLMA 2QEXA 3I35A 3QXEB 5J3BA 3RESA 4OVAA 4QVCA 2RQRA 4RTXA 3MP1A 2O2OA 5FRNA 1R8OB 3VS3A 4DOWA 3CCRQ 4GBQA 1QVGP 2KYMA 2K6DA 4M7AE 2DAQA 1GL5A 3GBQA 1JBMA 1WJQA 4FYYB 2QA4Q 1U1TA 4FYWB 4FCYA 3RKWA 2CREA 1JXOA 4OGCA 5GMKj 1K76A 2QQ9A 3UF4A 5KYXB 3VS2A 1B07A 5KYYB 2ZAEA 5GANj 3MCAB 3PMIA 2MMPA 3QDFA 5DY9A 3OYAA 4M78F 2W0ZA 5DM7R 5GAMh 2FPDA 4C0DC 1WZOA 4M4ZA 3EGDA 3OYBA 2COZA 3PMTA 2EPDA 4VUBA 2HDAA 2F5TX 4ANJA 1GBQA 4E47A 3L1AA 4ZTFA 3EG9B 3TSZA 3P8DA 1RADB 3I5SA 3CMAT 5FU7C 2HKQB 3RKXA 4KGZB 1VQ8T 3CCQT 3JCMb 4JJCA 4N4GA 3I56A 3DB4A 1YHQT 1OZ2A 1IREB 4J83A 2K3YA 1ZUKA 3RMSA 3LH0A 3OB9A 1WXBA 2NUTA 4JZ4A 3EFOB 2Y4XA 4C8QG 3OY9A 2RK2A 1V76A 3R6NA 3O5ZA 2VYTA 3ASKA 4OMNA 3JB9D 2C0OA 1VQKT 1QVGS 1W4SA 3G4ST 3ZL7C 3L2VA 4JJDA 1PCXA 3OS5A 2YWWA 3REAB 5KYUB 3RIRA 2HCKA 3CCSQ 4MMKA 2MWPA 3M4YA 2DTIA 2EWNA 1Y07A 2NUPA 2ZPBB 3M54A 1OU8A 3EH1A 4OMOA 2JM8A 4ZNXA 1YJNT 1ZA1B 3CCLT 2V1RA 1DJ7B 2QAZA 2ZGWA 2QA4T 4J9IA 1I0CA 3CCEA 4J9BA 2P4RA 2CS7A 4NS5A 1Y71A 5C0MA 3M0RA 3WVDB 5GAN8 2JN0A 2CUDA 2XIDA 3CCEQ 4D6WA 3GNFB 3CCST 3PGGA 3JCMh 2DL7A 1UEBA 1MNEA 2LCCA 2MYSA 1OPKA 3EH2A 3CXCP 2CH4W 1WJRA 3G1JA 3CC2A 3M57A 2EJGA 4O5VA 2YRCA 3ZFJA 1N5ZA 3SDZA 1PKSA 2ENMA 7AT1B 4ELZC 4M78C 3CC2T 1CKAA 3V7CA 4IUVA 4BB7A 4V2SA 2K3XA 2LQ8A 1OI1A 2FHDA 3GF5A 2ATCB 1TUDA 3G4SA 4RTWA 4FU6A 3CCMT 3P8HA 1KC8U 3JCMg 1TU0B 3CC7T 1JJ2A 3DB3A 3BDLA 4LNPA 1ABQA 1XQHA 1PM3A 3M56A 4LDWA 1X75C 4MZPA 1I81A 1ZSZB 1UTIA 2ZPGB 2DIGA 5D7UA 5CKEA 1M90R 4E7HA 4EMKC 2VXFA 2RHIA 2ABLA 2RNAA 2LC4A 3M58A 4LD9K 8AT1B 2DPPB 2LJ1A 3OYEA 2KI7A 4N4HA 1WX6A 3JB9H 4NL2A 2COYA 2DA9A 2ZPEB 3OYCA 4C8QF 1ZSGA 2E64A 2GFUA 5KH6A 3HRSA 2JVVA 2VGMA 3HL8A 3CEYA 3QBYA 1VIEA 3CCJQ 4AT1B 1UGRB 4X9CA 1K0XA 2VV5A 2J06A 5KYXA 1N8RU 1QVFA 1UDLA 1WQ7A 4CC2A 4EDUA 3OYDA 3GNGA 1K9MR 2AKKA 5GMKm 1NPRA 3OYNA 1D1BA 4M75F 1N8RR 1RI9A 2MOXA 4ME7A 4A54A 3S6WA 5I22A 2EW3A 1SKUB 2E4HA 1QCNA 3EGDB 2DTOA 3QO3A 4BACA 2LCSA 1PNJA 1GCPA 4BI4A 4XTVA 4EMGA 2CGHA 2M16A 5FW9A 1FX7A 2QYZA 4AFZC 4RG2A 5LJ3e 4AFSC 1OX8A 3A98A 1WXTA 4E7IA 2DL5A 2D0NA 4IUUA 1WHKA 5LJ5e 4J9FA 4BDZA 3RERA 3QYGB 4HCBA 1E7OA 3JSCA 1OV3A 5GAN5 3J80E 3R6OA 2RPNA 4J9DA 4E7JA 1XJWB 2HQEA 2NLUA 3CC4A 1VQMQ 2GNCA 2LX7A 4ESRA 4DOVA 5GMKl 2R57A 5GAMf 3CCUT 5FRMA 2Y4YA 3VS4A 1K9MC 2GBQA 2R5AA 3QPHA 3I55A 2LMJA 4ZN3A 1JXMA 4LE9A 3SEMA 2OI3A 3JCMc 2E12A 1QKXA 1NEGA 2QDYB 4ZTJA 2YUPA 4RTTA 4KT0E 3EG1A 1TOVA 4Y92A 4F7UA 1MUZA 2K57A 2RHUA 1YIJA 1X43A 2D0QB 2QASA 1U06A 1ZLMA 4LXCA 2OTJA 3LLRA 4PJOE 3OYGA 2JJ9A 2XK0A 4IIMA 3FDRA 4M7DD 3T9NA 2X51A 3BY7A 5LJ5g 1Q81R 1W1FA 1QMCA 2FZGB 2P4TA 2X3WD 2AKLA 3I56Q 3NTHA 2RJEA 1QCOA 4GLMA 2EKHA 3S3NA 3TSWA 1M90U 3EFOA 2R5MA 5CKDA 5GAN4 1KD1U 2CP7A 1G5VA 1LVKA 2O31A 4D8KA 3CD6A 1N27A 2E70A 3QZ5B 3SD4A 3LWIA 5D6XA 1YI2Q 2MK5A 3V7RA 4LDXA 1PSFA 4PLLA 1YJ9A 3SFMA 4J7IA 1IGQA 6AT1B 5L23A 3I9QA 3LW5E 4XU0A 3CCSA 1PHTA 1WPYA 2DMOA 2KXCA 2L5QA 1WXUA 2O4XA 3ER0A 3C94A 2F69A 2GTJA 1B7TA 3A5ZB 5L8RE 1BYMA 2V8KA 3C95A 3TVTA 4DBFA 1GFCA 2DKGA 5FWCA 2DD5A 4C0DB 3GOXA 2O9VA 2YXYA 1WFWA 3TQ7P 2RF0A 3CCVT 3AHUA 2NWMA 3OYYA 1W2BP 2RA2A 1NJIU 3SHWA 4PJOF 8ATCB 5CCAA 1WHLA 1NM7A 2EKOA 4FT2A 4XU1A 1JJ2S 1SG5A 1QLYA 2X3XD 1W70A 2DL3A 2ED0A 2MWOA 3JCMV 5GAMe 2Y90A 2JUFA 3V8LA 1BI1A 2DF6A 3MEAA 2SEMA 5GMKi 3CC7A 1M27C 4IURA 3MEUA 4RKUE 2KT8A 3CCMA 1AWXA 1KIKA 1UB4A 2RD1A 1VQNA 2RHZA 2DX1A 1VQ7T 4C8QA 2FVUA 2K5LA 4PJLA 2VUBA 2J6FA 2L2PA 3EHQA 1NLPC 1HYOA 4FW2A 3GPLA 5LJ3g 2DK3A 3V7SA 2DL4A 2L8DA 1ZUUA 5LJ3f 2H8HA 2X4XA 1NZ9A 5GAOp 4K11A 1YJ9Q 5AT1B 2BUDA 3M0SA 2HSEB 4NOYA 3OMCA 2KVQG 2VC8A 2LP5A 5I2MA 4LDVA 5GAN7 1PKTA 4AMCA 2P0QA 5FLXE 1NYGA 1LOJA 1RI0A 2VWFA 1NPPA 5GAOm 3VS6A 3GLXA 4HT8A 2PU9B 5KYWA 4E7ZA 1M5Q1 1PRLC 3QDRB 2DYBA 3G71Q 2CYZB 1BIBA 4XU2A 1E6HA 3M4GA 1KQSP 2D8HA 5LJ5h 3HP9A 3VRYA 2W10A 1X2QA 4Y91A 1VQMA 1AT1B 4XTXA 4DQ2A 1FMVA 4BD3A 5KYNA 2OTLT 5A0GA 2L0AA 2MPXC 4E7LA 1VQPQ 2I0NA 4EMHA 1H92A 1JQQA 2KR3A 1NE8A 2K7AA 3G7ZA 3KUFA 4C92D 2L3RA 2FG0A 1VYTA 3CC7Q 4C8QE 1HSQA 4M7AF 2EYWA 2M51A 3TEEA 1I8FA 4AFUC 2RB6A 1E6GA 3M0UA 3UA6A 4CC4B 1G3YA 1P92A 4XQ3A 1RAFB 4XTUA 4KGXB 1D09B 3OW2S 3A8GB 4HCKA 5KE3A 3SWNA 1K8AC 3CMEA 3NTIA 2VKNA 3CCJT 2OTLQ 2BE7D 2X9HA 2PZ1A 5LJ5j 5LL6S 1FMWA 1WGSA 3WVEB 4DBRA 1QCFA 1WHHA 3UDCA 1VQ8Q 2EJ9A 1VQ6T 2MI6A 2P0PA 4BUGA 1YWPA 2PUKB 1RL2A 3SWNB 3FB9A 2L3PA 4BI3A 1EIFA 4AG1C 4B9XA 2XDPA 1BI0A 1MMNA 1QVFP 2XKOC 2EYQA 4C5EA 4R0KA 1M4ZA 4PJNA 4OMQA 1UG1A 1OULA 2CZ6B 2LNHB 1MNDA 4J9GA 4TVRA 4IUPA 3CCLQ 4HCZA 4EIKA 3X28B 3EG3A 3CC4T 1GBRA 1TG0A 1TS9A 2SRCA 1K73C 3LH5A 1D1AA 4PL6A 3TREA 4A53A 5J39A 1LJOA 3CMEQ 1B3QA 2E5KA 3OBYA 1AZGB 2MAMA 3JCMJ 1KC8C 1Q7YR 3LX7A 2PQWA 4JRQA 2D6FA 4ORZA 3CPWP 1M1KR 1JO8A 2E1HA 3HSBA 4O6JA 1FYNA 1YP5A 2EIFA 3LGLA 1NYFA 4RTUA 1W2BA 4JUVA 4RCBA 3J7AF 1TSFA 2JTEA 1YJWA 4JPBW 1Q81C 4UC4A 3OSSC 3VS7A 3OW2P 2IG0A 3KFVA 3H0FA 3M9QA 4P5NA 2EVRA 2XDDA 3HFNA 2JMAA 3E9GA 1VQKA 2G3RA 3OS1A 4RTZA 2QQAA 2VASA 3M5AA 4PJMA 4CC7A 2KRMA 1IGUA 1X69A 3CBMA 3O8VA 4QVZA 1NEBA 2L3QA 3GP8A 4IUTA 2EJFA 2LNVA 4MDXA 3ULRB 1V29B 3M0TA 5CK9A 1AWJA 1KK7A 1M90C 4HVVA 1AD5A 4C0FA 5GAMg 1WQWA 5KCOA 4ZN1A 3J81E 3C4SA 2HKNA 3JCMd 1VQ9T 3VKIA 4WTOB 2FRYA 2D9TA 2K3BA 2R58A 1WIEA 1VQKQ 5CKHA 5FU7B 1C1AA 3RNJA 1G83A 1ZBJA 2J6KA 1TWBA 1XOVA 3MPUB 3NPFA 2O88A 1OPLA 4IKFA 2PNIA 2WSCE 2VB6A 4M7AD
chains in the Genus database with same CATH topology
2CP2A 2COZA 1WHMA 3RDVA 2HKNA 2Z0WA 1TXQA 1WHJA 1WHGA 2COYA 2E3IA 1LPLA 1TOVA 1WHKA 2HQHA 3E2UA 2E4HA 1IXDA 2E3HA 2HKQB 2COWA 2HL3A 3TQ7P 4B6MA 2M02A 2CP3A 1WHHA 2CP0A 2MPXC 2CP7A 2QK0A 2CP5A 2HL5C 1WHLA 2CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP2 A;  2COZ A;  1WHM A;  3RDV A;  2HKN A;  2Z0W A;  1TXQ A;  1WHJ A;  1WHG A;  2COY A;  2E3I A;  1LPL A;  1TOV A;  1WHK A;  2HQH A;  3E2U A;  2E4H A;  1IXD A;  2E3H A;  2HKQ B;  2COW A;  2HL3 A;  3TQ7 P;  4B6M A;  2M02 A;  2CP3 A;  1WHH A;  2CP0 A;  2MPX C;  2CP7 A;  2QK0 A;  2CP5 A;  2HL5 C;  1WHL A;  2CP6 A; 
#chains in the Genus database with same CATH topology
 2DE0 X;  5IXB A;  1D1C A;  3L2R A;  2A0F B;  2IIM A;  3EFR A;  2FO0 A;  2RK1 A;  4M7A G;  2K5F A;  4KUD K;  1AZE A;  1X01 A;  1M30 A;  5J26 A;  2HBW A;  3E9F A;  3I56 T;  3PFS A;  3C12 A;  3P8B B;  3CD6 T;  2CP3 A;  1QVP A;  3HTR A;  5GAO q;  4FSS A;  1TH7 A;  4M78 G;  2J7I A;  1NJI R;  3GIB A;  1OYX A;  2EQJ A;  2NUT B;  1H64 1;  4QKU A;  2C0T A;  2M1H A;  5D6Y A;  3OYH A;  3VYG A;  3H0I A;  2A37 A;  2HD0 A;  4MZT A;  1M1F A;  2LVM A;  4JLG A;  1UHF A;  2RN8 A;  1YJW Q;  4A4K A;  3CMA A;  1MMA A;  2OAW A;  2DBM A;  2V26 A;  2J6O A;  3THK A;  2FPF A;  3PE0 A;  2OTL A;  1VQ9 Q;  2CKK A;  2GTO A;  2K4Y A;  2E65 A;  3MEW A;  1AWW A;  1X6G A;  2KAF A;  3CPF A;  4BY6 C;  3G6E A;  3E1S A;  2LT1 A;  3HRT A;  1MMD A;  3U23 A;  1KJW A;  4HCC A;  2X4J A;  5KYU A;  4RG8 A;  2KYB A;  3CXC S;  2ECZ A;  1IO6 A;  4OB3 B;  1I4K 1;  3MP6 A;  1PD1 A;  1PC0 A;  4M7A B;  3ZBD A;  3VS1 A;  4C5H A;  1K9M U;  4KRT A;  2CDT A;  2JT4 A;  4JS5 A;  2LDM A;  1I07 A;  1M8M A;  4J5Y A;  4J8O A;  5DLQ E;  4MDW A;  1YI2 T;  1KQ1 A;  4GLK A;  3EG2 A;  2CP6 A;  1JB0 E;  2LQN A;  3V8J A;  1VQ6 Q;  2E6Z A;  4Z8A A;  3QZ9 B;  2IPO B;  1U3O A;  2QEX T;  1LPL A;  1YN8 A;  2ZPF B;  3JAM E;  4C8Q B;  3OYF A;  1N6A A;  3EG9 A;  3OYJ A;  2D1X A;  4Q5W A;  1M2O A;  2CP0 A;  1WJS A;  3OYM A;  2JMC A;  4OP0 A;  1OU9 A;  1XTD A;  4C92 G;  2KRN A;  4WCI A;  3NMZ C;  4M7D E;  1XNI A;  1BCO A;  2YHT A;  3UAT A;  2RHX A;  2O9S A;  4JDS A;  3MHX A;  4M75 G;  2M0Y A;  4M7D A;  1NLO C;  2DM1 A;  2YSQ A;  2DXT A;  4LUD A;  5IHI A;  1ARK A;  4FW1 A;  3RKY A;  1D0Y A;  1UJY A;  3CCU Q;  3L2Z A;  1OQK A;  1VQP T;  1WA7 A;  5GAO n;  3I55 T;  2QEX Q;  5LJ5 f;  1Q82 R;  1D3B A;  1WDX A;  2GCX A;  2JNG A;  4HVW A;  3S3M A;  4OB1 B;  1YHQ A;  2A36 A;  3VRZ A;  5GMK e;  2AZV A;  3MET A;  2ZCF B;  3G71 A;  2BKD N;  3FC3 A;  1EZZ B;  4MML A;  1HD3 A;  3JB9 G;  5GAO r;  2BE9 B;  2DZ9 A;  1QP3 A;  1WHG A;  5DLO A;  1HJD A;  3MP8 A;  1EFN A;  3CD6 Q;  2KRS A;  1HXD A;  2E10 A;  5ECA A;  2FPE A;  2HQH A;  3CPW A;  3UA7 A;  3BFM A;  1X6O A;  1T3L A;  3FRN A;  2YUQ A;  4M75 A;  2CZ1 B;  2IVW A;  2DXB A;  2XI9 A;  2RJD A;  1YWO A;  3A8O B;  1BCM A;  3RR6 A;  3EGX A;  3VJP A;  4EMK A;  4M78 E;  1M1K U;  4M75 E;  2B86 A;  4JRP A;  5IT9 E;  3M55 A;  4J9C A;  2QXF A;  1ZBX A;  2XMF A;  4XU3 A;  2BZX A;  1AVZ C;  2RMO A;  1K8A U;  1SHG A;  4F17 A;  1VQN Q;  1YCS B;  4DBQ A;  4E2F B;  2FB7 A;  2V1Q A;  1YJN Q;  2A28 A;  3JRZ A;  4A63 B;  2K2V A;  4KBM B;  4L6V 5;  1K4U S;  2GFA A;  2EGA A;  1QQJ A;  1ZSZ A;  5IXF A;  4M77 B;  1R0C B;  2WSE E;  4C8Q D;  1ABO A;  4B9W A;  4F7U B;  4LDU A;  4BDY A;  2YT6 A;  1M9S A;  1UE9 A;  1B34 A;  2F2W A;  1VYV A;  3MKD A;  3X20 B;  4II1 A;  4Y28 E;  1YIJ T;  1WNL A;  1UEC A;  3L42 A;  2I2L A;  1U8R A;  5I11 A;  3TU4 K;  3RMQ A;  2QQR A;  1S72 Q;  3JCM e;  1QVF S;  1RUW A;  3OYK A;  5CKF A;  1PG5 B;  1YIT A;  2RJC A;  1SRL A;  3HFO A;  2EYX A;  1YBY A;  3UPU A;  2X4W A;  3EGU A;  2L3S A;  2BZY A;  4BE1 A;  4C92 C;  5AYF A;  3H6Z A;  2JTM A;  5M9O A;  3TCJ A;  1VQ7 Q;  4M78 B;  2LJ0 A;  2PUO B;  3H8Z A;  2O01 E;  2COW A;  4PK4 A;  3ZEH A;  3CME T;  3OYI A;  2EQI A;  4F14 A;  1VUB A;  4OB0 B;  3PT9 A;  3QSU A;  2L89 A;  1QVG A;  2DZC A;  1RAC B;  4M75 B;  1Q82 C;  4Z88 A;  3M59 A;  1VQ5 A;  1RAE B;  4HKE A;  3CCQ A;  2QTX A;  1IXD A;  2JS0 A;  1BI2 A;  3CQT A;  2XHC A;  1SSH A;  4PFO A;  2MIO A;  2F5K A;  4PNO A;  1U5S A;  3H41 A;  1JJ2 P;  1O9S A;  4DA4 A;  2EAY A;  1VQO A;  3OBW A;  5A0L A;  3FLG A;  1GCQ A;  3G71 T;  4XK8 E;  1VQP A;  3SB2 A;  2M02 A;  2A08 A;  1R77 A;  3OA6 A;  2XDB A;  2K9G A;  2C06 A;  1D3B B;  1VQ8 A;  2OJ2 A;  4PLI A;  5GAN g;  4M7D C;  3BW1 A;  2QTV A;  1K9A A;  2KBT A;  1HK9 A;  2C0I A;  1EX4 A;  2VVK A;  4JLI A;  1KD1 R;  2P84 A;  3CCR T;  2RHY A;  3E2U A;  5GAM d;  4N4I A;  2DYI A;  1YHQ Q;  4M7A C;  2NUP B;  4M78 A;  3CCQ Q;  1VQ5 Q;  3NHN A;  4OMP A;  3FJP A;  1IZ6 A;  2EGC A;  1UGQ B;  4KUI A;  1GXI E;  2OTJ T;  1BI3 A;  5KYY A;  1QW1 A;  3D7S B;  4X34 A;  2XIC A;  3JCM P;  3INZ A;  1YNZ A;  1Y0M A;  4AG2 C;  5HKC A;  4OMF B;  1MMG A;  2DVJ A;  4OF1 A;  4A4H A;  3M0Q A;  1F1B B;  1X27 A;  4N0A A;  2DER A;  3JCM X;  1MHN A;  3OYL A;  2EQU A;  2K79 A;  2QK0 A;  2OAU A;  5FU6 B;  2A3L A;  5C6S A;  5IAY A;  1VA7 A;  4PJO A;  2RJF A;  1KQS S;  3F70 A;  1C6V X;  3WXM B;  1G3T A;  3RBB B;  2GGR A;  2LCL A;  2DVE A;  2A7Y A;  2DL8 A;  4QQG A;  5FWB A;  4BY6 B;  1Q86 R;  5CAI A;  1WLP B;  1SRM A;  5CQY A;  1N8R C;  1H3H A;  4ZGE B;  1UGP B;  3A8M B;  4M77 E;  2AT1 B;  2CP2 A;  2PVO B;  1G3W A;  4KH1 B;  3CCV A;  3HHT B;  4J9E A;  1VQL Q;  4KGV B;  2OX7 A;  4XTW A;  2X35 A;  1AWO A;  1Q86 U;  2EQM A;  4R55 A;  2LZ6 B;  1WYX A;  2X4Y A;  4OML A;  2E3H A;  5GAN 2;  2E41 A;  2CSI A;  1NJI C;  3N5B B;  3VUB A;  5KE2 A;  5KYW B;  1TUC A;  1TXQ A;  1YCY A;  4RTV A;  1FXX A;  4J7F A;  1PWT A;  5GAN d;  5LJ3 d;  4MZM A;  1M1K C;  2H3J A;  1ZX6 A;  4J6W A;  2JOY A;  4LUE A;  4CI0 C;  1Q82 U;  1VQ6 A;  3I5R A;  1SF9 A;  2YDL A;  4CRI A;  4C92 A;  5GMK h;  2CZ0 B;  1UJ0 A;  1FMK A;  1MV0 B;  2RI2 A;  1IHV A;  4E7S A;  2ROL A;  4F7U E;  1VYU A;  2ZPI B;  2HNI A;  3C0C A;  3NGP A;  1SEM A;  5CIU A;  4JJN K;  2O4X B;  1JRI A;  1NBE B;  4F16 A;  2DIL A;  5FU6 C;  2WAC A;  4QT7 A;  1C0M A;  1VQO T;  2AIR B;  4M78 D;  2KEA A;  1OX9 A;  3RUX A;  3PTA A;  4JRK A;  1ZA2 B;  3QJY A;  3OS0 A;  4CC3 A;  3A8H B;  4PFZ A;  1WHM A;  2DXC A;  2JW4 A;  4C5I A;  1OEB A;  1S72 A;  3VYH B;  3H9N A;  1KHC A;  2LQW A;  5GAN 3;  3CPW S;  1K73 U;  5LJ3 h;  1H3Z A;  2LRQ A;  4M77 C;  1YIT T;  3PVQ A;  2QQB A;  3H0H A;  2EGE A;  1I5L A;  1GRI A;  4C5G A;  1K8A R;  2KMT A;  2DJQ A;  9ATC B;  3L2U A;  5LJ5 d;  3URG A;  2PVG B;  2RQU A;  2CUB A;  2RQW A;  3VS0 A;  1D0Z A;  3MJX A;  4EMK B;  1OZ3 A;  4E6R A;  5GAN e;  2M9U A;  3CCM Q;  2YLB A;  4FM4 B;  3VS5 A;  1N9S A;  4M77 F;  1J3T A;  4J9H A;  2DJZ A;  5GAM j;  1UUE A;  2KY9 A;  4AFQ C;  4C92 E;  1PD0 A;  4FT4 A;  1G8X A;  4OMM A;  4PKC C;  1FWZ A;  2KSS A;  1BB9 A;  3BDU A;  2H3E B;  1KC8 R;  1QKW A;  4KUL A;  2FEI A;  2YRD A;  2CZ7 B;  3QYH B;  1Q7Y C;  1M3A A;  2CT3 A;  1KHI A;  2ESW A;  4L59 A;  3REB B;  3L2W A;  2G6F X;  3ME9 A;  3AT1 B;  3QJ6 A;  2XU8 A;  1ZUY A;  3V8K A;  4KH0 B;  2KXD A;  2JTF A;  2ZPH B;  3CMA Q;  3OW2 A;  4L5G A;  2QA4 A;  1YI2 A;  2QQS A;  1Y96 A;  1YJN A;  1YIJ Q;  4Z89 A;  3X25 B;  4ZGD B;  2E3I A;  2QDL A;  2AHJ B;  3CCR A;  3EFS A;  4FSX A;  3QWY A;  3FJ5 A;  5GJW B;  4M7A A;  5EC7 A;  1AOJ A;  3FIF A;  1YFN A;  1T3S A;  2FYK A;  2LX9 A;  2HAX A;  1I5O B;  5CKB A;  2JXB A;  2HMA A;  4M77 G;  3X26 B;  1RAI B;  5GJV B;  3G6E T;  3LYI A;  2KT1 A;  3JB9 J;  1Q7Y U;  1KQ2 A;  1UGS B;  1RLQ C;  4JS4 A;  1M3B A;  1T0H A;  2WSF E;  2LT4 A;  3UWN A;  1N9R A;  2BIV A;  2V8J A;  2XD0 A;  4M77 A;  4YTL A;  3EG0 A;  3QHS A;  4FIB A;  2PVD B;  1VQL A;  4Z02 A;  5D6W A;  2B8A A;  5IH2 A;  2FZK B;  1VQ4 A;  2HQX A;  4FYX B;  1BIA A;  4F7U F;  2QGF B;  2RQV A;  3NFC A;  4XAX B;  2DD4 A;  2M0O A;  1VQ7 A;  3S3O A;  2HL3 A;  1TTH B;  1Z9Z A;  2RM4 A;  1CKB A;  1G2B A;  1LCK A;  3CC2 Q;  4M7D F;  4PFP A;  1BBZ A;  1TUG B;  1QWF A;  4M77 D;  1VOM A;  3CBO A;  2D8J A;  4F7U G;  5GAN f;  5I2S A;  2K2M A;  2KK4 A;  4PJO C;  4X9D A;  4J6X A;  3HPW A;  2VGN A;  1BK2 A;  1K73 R;  2FL7 A;  3JB9 F;  2VXE A;  4LN2 A;  3PIO A;  2PTK A;  2DEQ A;  2RI5 A;  3EAE A;  5CR2 A;  2CH4 A;  1X6B A;  4XTY A;  1IHW A;  2JZ2 A;  3JCM f;  4C92 B;  2RI3 A;  3E19 A;  1JU5 C;  4M75 D;  2ED1 A;  4EPC A;  1Z9Q A;  2F1L A;  1PSE A;  3VUZ A;  4F04 B;  3EHR A;  4JZ3 A;  3KXT A;  1VQ5 T;  4ELY C;  4E7K A;  1UGV A;  1AHJ B;  1I1J A;  1Y96 B;  4DEY A;  2RO0 A;  2J05 A;  2MCN A;  4IUQ A;  4PJO B;  1KQS A;  4X1V A;  1Q81 U;  2EYY A;  4ZGJ B;  2DRK A;  3JV3 A;  3M53 A;  5GAN h;  4ATO A;  4PJJ A;  4LD6 A;  5GAN 6;  3IQL A;  5HK0 A;  1VQ4 T;  2CSQ A;  4OB2 B;  5CQX A;  1UFF A;  1Y7X A;  3G4S Q;  1KFZ A;  1W2B S;  1SSF A;  5IN1 A;  2HL5 C;  2F2V A;  2HZY A;  4NL3 A;  2QG9 B;  4A4F A;  2F2X A;  2DXU A;  3QII A;  4GY5 A;  4WF2 A;  3RDV A;  1AEY A;  3A8L B;  2DEU A;  5GAO l;  1RLP C;  1W6X A;  1VQM T;  2KE9 A;  2DRM A;  1VIF A;  1ZQ1 A;  2NYS A;  2K5I A;  4D8D A;  3X24 B;  3PVL A;  2KQW A;  1UHC A;  4B6M A;  3OS2 A;  4OGE A;  4R56 A;  5HK3 A;  2DBK A;  2FRW A;  4N0A C;  2RQT A;  1JEG A;  3Q1J A;  1S1N A;  2Z0W A;  5LJ3 j;  3OMG A;  1M8V A;  4HXJ A;  1U1S A;  1KG1 A;  1SHF A;  1M3C A;  2CT4 A;  5KCH A;  1PRM C;  1O75 A;  5I21 A;  2ROT A;  3QKJ A;  2KGT A;  3CBP A;  1T0J A;  3M0P A;  2KDS A;  2CP5 A;  2GQV A;  4DBH A;  2LJ3 A;  2FZC B;  2DTH A;  3SWN C;  1BU1 A;  2QGG A;  4HVU A;  3LWH A;  2YLC A;  5IHK A;  2AK5 A;  4QQD A;  3CCU A;  2YUN A;  5EG2 A;  1YIT Q;  3CCJ A;  1CSK A;  3CCV Q;  3DKM A;  1WI7 A;  2DFU A;  1M2V A;  1M1G A;  1A0N B;  1Y57 A;  5CVI A;  4BE2 A;  3NTK A;  4C0Z A;  3EGX B;  4FYV B;  3QG1 A;  1YJW T;  2DIQ A;  4PJO D;  4M7D G;  3VV0 A;  2MF2 A;  2HEQ A;  2EYZ A;  1S72 T;  5FRO A;  2EFI A;  4HA8 A;  1MGQ A;  2BZ8 A;  3CC4 Q;  2EQK A;  1YJ9 T;  2DO3 A;  3JCM W;  2KRO A;  4RTY A;  3UT1 A;  4QQ6 A;  1H8K A;  4C0G A;  3VU3 C;  1OOT A;  3OSV A;  2YUO A;  2HBP A;  3BE3 A;  2DLP A;  3L2Q A;  3DLL A;  1ACM B;  4PJO G;  4RCC A;  2DET A;  1G3S A;  2V8I A;  2GF7 A;  4HT9 A;  1WHJ A;  2LTO A;  5IHN A;  3A1P A;  4RUG A;  1Q86 C;  1NG2 A;  1RAA B;  1RAB B;  1V1C A;  1VQL T;  1B34 B;  1QP2 A;  3PIP A;  3HRU A;  2DNU A;  4C8Q C;  3QUI A;  2BTT A;  1VQ4 Q;  4XTZ A;  2NUZ A;  1M2V B;  1MV3 A;  4M75 C;  5A0D A;  5CO7 A;  1QWE A;  4QVD A;  4A4G A;  4DEX A;  2E5Q A;  1ZHI A;  2GQI A;  1ZSZ C;  4J6Y A;  3HKS A;  3CXC A;  5HY6 A;  3KBG A;  1VQ9 A;  4C92 F;  3CCE T;  1IB8 A;  4A4E A;  2RH2 A;  1IRX A;  2JM9 A;  3MO8 A;  3CCL A;  1VQO Q;  1BKB A;  1X2K A;  2KNB B;  2P0K A;  1SPK A;  2ZZD A;  5HCK A;  1K1Z A;  2QI2 A;  4RMO A;  2LQK A;  2E6N A;  4JRI A;  2JS2 A;  3G6E Q;  1R0B G;  4M7D B;  2AZS A;  3JB9 I;  5A2Q E;  3FEO A;  4BI8 B;  4QW2 A;  1KD1 C;  4IIO A;  3PNW C;  2XG8 D;  1K0S A;  3I55 Q;  4BE0 A;  1D0X A;  1GCQ C;  3JCM Q;  1Q95 G;  4JJB A;  3LGF A;  4FL6 A;  3MEV A;  3QWX X;  1VQN T;  1RAG B;  4LDY A;  1KSW A;  3OQ5 A;  2OTJ Q;  1LNX A;  2HSP A;  1RAH B;  2YRV A;  1GFD A;  2EBP A;  3DLM A;  2QEX A;  3I35 A;  3QXE B;  5J3B A;  3RES A;  4OVA A;  4QVC A;  2RQR A;  4RTX A;  3MP1 A;  2O2O A;  5FRN A;  1R8O B;  3VS3 A;  4DOW A;  3CCR Q;  4GBQ A;  1QVG P;  2KYM A;  2K6D A;  4M7A E;  2DAQ A;  1GL5 A;  3GBQ A;  1JBM A;  1WJQ A;  4FYY B;  2QA4 Q;  1U1T A;  4FYW B;  4FCY A;  3RKW A;  2CRE A;  1JXO A;  4OGC A;  5GMK j;  1K76 A;  2QQ9 A;  3UF4 A;  5KYX B;  3VS2 A;  1B07 A;  5KYY B;  2ZAE A;  5GAN j;  3MCA B;  3PMI A;  2MMP A;  3QDF A;  5DY9 A;  3OYA A;  4M78 F;  2W0Z A;  5DM7 R;  5GAM h;  2FPD A;  4C0D C;  1WZO A;  4M4Z A;  3EGD A;  3OYB A;  2COZ A;  3PMT A;  2EPD A;  4VUB A;  2HDA A;  2F5T X;  4ANJ A;  1GBQ A;  4E47 A;  3L1A A;  4ZTF A;  3EG9 B;  3TSZ A;  3P8D A;  1RAD B;  3I5S A;  3CMA T;  5FU7 C;  2HKQ B;  3RKX A;  4KGZ B;  1VQ8 T;  3CCQ T;  3JCM b;  4JJC A;  4N4G A;  3I56 A;  3DB4 A;  1YHQ T;  1OZ2 A;  1IRE B;  4J83 A;  2K3Y A;  1ZUK A;  3RMS A;  3LH0 A;  3OB9 A;  1WXB A;  2NUT A;  4JZ4 A;  3EFO B;  2Y4X A;  4C8Q G;  3OY9 A;  2RK2 A;  1V76 A;  3R6N A;  3O5Z A;  2VYT A;  3ASK A;  4OMN A;  3JB9 D;  2C0O A;  1VQK T;  1QVG S;  1W4S A;  3G4S T;  3ZL7 C;  3L2V A;  4JJD A;  1PCX A;  3OS5 A;  2YWW A;  3REA B;  5KYU B;  3RIR A;  2HCK A;  3CCS Q;  4MMK A;  2MWP A;  3M4Y A;  2DTI A;  2EWN A;  1Y07 A;  2NUP A;  2ZPB B;  3M54 A;  1OU8 A;  3EH1 A;  4OMO A;  2JM8 A;  4ZNX A;  1YJN T;  1ZA1 B;  3CCL T;  2V1R A;  1DJ7 B;  2QAZ A;  2ZGW A;  2QA4 T;  4J9I A;  1I0C A;  3CCE A;  4J9B A;  2P4R A;  2CS7 A;  4NS5 A;  1Y71 A;  5C0M A;  3M0R A;  3WVD B;  5GAN 8;  2JN0 A;  2CUD A;  2XID A;  3CCE Q;  4D6W A;  3GNF B;  3CCS T;  3PGG A;  3JCM h;  2DL7 A;  1UEB A;  1MNE A;  2LCC A;  2MYS A;  1OPK A;  3EH2 A;  3CXC P;  2CH4 W;  1WJR A;  3G1J A;  3CC2 A;  3M57 A;  2EJG A;  4O5V A;  2YRC A;  3ZFJ A;  1N5Z A;  3SDZ A;  1PKS A;  2ENM A;  7AT1 B;  4ELZ C;  4M78 C;  3CC2 T;  1CKA A;  3V7C A;  4IUV A;  4BB7 A;  4V2S A;  2K3X A;  2LQ8 A;  1OI1 A;  2FHD A;  3GF5 A;  2ATC B;  1TUD A;  3G4S A;  4RTW A;  4FU6 A;  3CCM T;  3P8H A;  1KC8 U;  3JCM g;  1TU0 B;  3CC7 T;  1JJ2 A;  3DB3 A;  3BDL A;  4LNP A;  1ABQ A;  1XQH A;  1PM3 A;  3M56 A;  4LDW A;  1X75 C;  4MZP A;  1I81 A;  1ZSZ B;  1UTI A;  2ZPG B;  2DIG A;  5D7U A;  5CKE A;  1M90 R;  4E7H A;  4EMK C;  2VXF A;  2RHI A;  2ABL A;  2RNA A;  2LC4 A;  3M58 A;  4LD9 K;  8AT1 B;  2DPP B;  2LJ1 A;  3OYE A;  2KI7 A;  4N4H A;  1WX6 A;  3JB9 H;  4NL2 A;  2COY A;  2DA9 A;  2ZPE B;  3OYC A;  4C8Q F;  1ZSG A;  2E64 A;  2GFU A;  5KH6 A;  3HRS A;  2JVV A;  2VGM A;  3HL8 A;  3CEY A;  3QBY A;  1VIE A;  3CCJ Q;  4AT1 B;  1UGR B;  4X9C A;  1K0X A;  2VV5 A;  2J06 A;  5KYX A;  1N8R U;  1QVF A;  1UDL A;  1WQ7 A;  4CC2 A;  4EDU A;  3OYD A;  3GNG A;  1K9M R;  2AKK A;  5GMK m;  1NPR A;  3OYN A;  1D1B A;  4M75 F;  1N8R R;  1RI9 A;  2MOX A;  4ME7 A;  4A54 A;  3S6W A;  5I22 A;  2EW3 A;  1SKU B;  2E4H A;  1QCN A;  3EGD B;  2DTO A;  3QO3 A;  4BAC A;  2LCS A;  1PNJ A;  1GCP A;  4BI4 A;  4XTV A;  4EMG A;  2CGH A;  2M16 A;  5FW9 A;  1FX7 A;  2QYZ A;  4AFZ C;  4RG2 A;  5LJ3 e;  4AFS C;  1OX8 A;  3A98 A;  1WXT A;  4E7I A;  2DL5 A;  2D0N A;  4IUU A;  1WHK A;  5LJ5 e;  4J9F A;  4BDZ A;  3RER A;  3QYG B;  4HCB A;  1E7O A;  3JSC A;  1OV3 A;  5GAN 5;  3J80 E;  3R6O A;  2RPN A;  4J9D A;  4E7J A;  1XJW B;  2HQE A;  2NLU A;  3CC4 A;  1VQM Q;  2GNC A;  2LX7 A;  4ESR A;  4DOV A;  5GMK l;  2R57 A;  5GAM f;  3CCU T;  5FRM A;  2Y4Y A;  3VS4 A;  1K9M C;  2GBQ A;  2R5A A;  3QPH A;  3I55 A;  2LMJ A;  4ZN3 A;  1JXM A;  4LE9 A;  3SEM A;  2OI3 A;  3JCM c;  2E12 A;  1QKX A;  1NEG A;  2QDY B;  4ZTJ A;  2YUP A;  4RTT A;  4KT0 E;  3EG1 A;  1TOV A;  4Y92 A;  4F7U A;  1MUZ A;  2K57 A;  2RHU A;  1YIJ A;  1X43 A;  2D0Q B;  2QAS A;  1U06 A;  1ZLM A;  4LXC A;  2OTJ A;  3LLR A;  4PJO E;  3OYG A;  2JJ9 A;  2XK0 A;  4IIM A;  3FDR A;  4M7D D;  3T9N A;  2X51 A;  3BY7 A;  5LJ5 g;  1Q81 R;  1W1F A;  1QMC A;  2FZG B;  2P4T A;  2X3W D;  2AKL A;  3I56 Q;  3NTH A;  2RJE A;  1QCO A;  4GLM A;  2EKH A;  3S3N A;  3TSW A;  1M90 U;  3EFO A;  2R5M A;  5CKD A;  5GAN 4;  1KD1 U;  2CP7 A;  1G5V A;  1LVK A;  2O31 A;  4D8K A;  3CD6 A;  1N27 A;  2E70 A;  3QZ5 B;  3SD4 A;  3LWI A;  5D6X A;  1YI2 Q;  2MK5 A;  3V7R A;  4LDX A;  1PSF A;  4PLL A;  1YJ9 A;  3SFM A;  4J7I A;  1IGQ A;  6AT1 B;  5L23 A;  3I9Q A;  3LW5 E;  4XU0 A;  3CCS A;  1PHT A;  1WPY A;  2DMO A;  2KXC A;  2L5Q A;  1WXU A;  2O4X A;  3ER0 A;  3C94 A;  2F69 A;  2GTJ A;  1B7T A;  3A5Z B;  5L8R E;  1BYM A;  2V8K A;  3C95 A;  3TVT A;  4DBF A;  1GFC A;  2DKG A;  5FWC A;  2DD5 A;  4C0D B;  3GOX A;  2O9V A;  2YXY A;  1WFW A;  3TQ7 P;  2RF0 A;  3CCV T;  3AHU A;  2NWM A;  3OYY A;  1W2B P;  2RA2 A;  1NJI U;  3SHW A;  4PJO F;  8ATC B;  5CCA A;  1WHL A;  1NM7 A;  2EKO A;  4FT2 A;  4XU1 A;  1JJ2 S;  1SG5 A;  1QLY A;  2X3X D;  1W70 A;  2DL3 A;  2ED0 A;  2MWO A;  3JCM V;  5GAM e;  2Y90 A;  2JUF A;  3V8L A;  1BI1 A;  2DF6 A;  3MEA A;  2SEM A;  5GMK i;  3CC7 A;  1M27 C;  4IUR A;  3MEU A;  4RKU E;  2KT8 A;  3CCM A;  1AWX A;  1KIK A;  1UB4 A;  2RD1 A;  1VQN A;  2RHZ A;  2DX1 A;  1VQ7 T;  4C8Q A;  2FVU A;  2K5L A;  4PJL A;  2VUB A;  2J6F A;  2L2P A;  3EHQ A;  1NLP C;  1HYO A;  4FW2 A;  3GPL A;  5LJ3 g;  2DK3 A;  3V7S A;  2DL4 A;  2L8D A;  1ZUU A;  5LJ3 f;  2H8H A;  2X4X A;  1NZ9 A;  5GAO p;  4K11 A;  1YJ9 Q;  5AT1 B;  2BUD A;  3M0S A;  2HSE B;  4NOY A;  3OMC A;  2KVQ G;  2VC8 A;  2LP5 A;  5I2M A;  4LDV A;  5GAN 7;  1PKT A;  4AMC A;  2P0Q A;  5FLX E;  1NYG A;  1LOJ A;  1RI0 A;  2VWF A;  1NPP A;  5GAO m;  3VS6 A;  3GLX A;  4HT8 A;  2PU9 B;  5KYW A;  4E7Z A;  1M5Q 1;  1PRL C;  3QDR B;  2DYB A;  3G71 Q;  2CYZ B;  1BIB A;  4XU2 A;  1E6H A;  3M4G A;  1KQS P;  2D8H A;  5LJ5 h;  3HP9 A;  3VRY A;  2W10 A;  1X2Q A;  4Y91 A;  1VQM A;  1AT1 B;  4XTX A;  4DQ2 A;  1FMV A;  4BD3 A;  5KYN A;  2OTL T;  5A0G A;  2L0A A;  2MPX C;  4E7L A;  1VQP Q;  2I0N A;  4EMH A;  1H92 A;  1JQQ A;  2KR3 A;  1NE8 A;  2K7A A;  3G7Z A;  3KUF A;  4C92 D;  2L3R A;  2FG0 A;  1VYT A;  3CC7 Q;  4C8Q E;  1HSQ A;  4M7A F;  2EYW A;  2M51 A;  3TEE A;  1I8F A;  4AFU C;  2RB6 A;  1E6G A;  3M0U A;  3UA6 A;  4CC4 B;  1G3Y A;  1P92 A;  4XQ3 A;  1RAF B;  4XTU A;  4KGX B;  1D09 B;  3OW2 S;  3A8G B;  4HCK A;  5KE3 A;  3SWN A;  1K8A C;  3CME A;  3NTI A;  2VKN A;  3CCJ T;  2OTL Q;  2BE7 D;  2X9H A;  2PZ1 A;  5LJ5 j;  5LL6 S;  1FMW A;  1WGS A;  3WVE B;  4DBR A;  1QCF A;  1WHH A;  3UDC A;  1VQ8 Q;  2EJ9 A;  1VQ6 T;  2MI6 A;  2P0P A;  4BUG A;  1YWP A;  2PUK B;  1RL2 A;  3SWN B;  3FB9 A;  2L3P A;  4BI3 A;  1EIF A;  4AG1 C;  4B9X A;  2XDP A;  1BI0 A;  1MMN A;  1QVF P;  2XKO C;  2EYQ A;  4C5E A;  4R0K A;  1M4Z A;  4PJN A;  4OMQ A;  1UG1 A;  1OUL A;  2CZ6 B;  2LNH B;  1MND A;  4J9G A;  4TVR A;  4IUP A;  3CCL Q;  4HCZ A;  4EIK A;  3X28 B;  3EG3 A;  3CC4 T;  1GBR A;  1TG0 A;  1TS9 A;  2SRC A;  1K73 C;  3LH5 A;  1D1A A;  4PL6 A;  3TRE A;  4A53 A;  5J39 A;  1LJO A;  3CME Q;  1B3Q A;  2E5K A;  3OBY A;  1AZG B;  2MAM A;  3JCM J;  1KC8 C;  1Q7Y R;  3LX7 A;  2PQW A;  4JRQ A;  2D6F A;  4ORZ A;  3CPW P;  1M1K R;  1JO8 A;  2E1H A;  3HSB A;  4O6J A;  1FYN A;  1YP5 A;  2EIF A;  3LGL A;  1NYF A;  4RTU A;  1W2B A;  4JUV A;  4RCB A;  3J7A F;  1TSF A;  2JTE A;  1YJW A;  4JPB W;  1Q81 C;  4UC4 A;  3OSS C;  3VS7 A;  3OW2 P;  2IG0 A;  3KFV A;  3H0F A;  3M9Q A;  4P5N A;  2EVR A;  2XDD A;  3HFN A;  2JMA A;  3E9G A;  1VQK A;  2G3R A;  3OS1 A;  4RTZ A;  2QQA A;  2VAS A;  3M5A A;  4PJM A;  4CC7 A;  2KRM A;  1IGU A;  1X69 A;  3CBM A;  3O8V A;  4QVZ A;  1NEB A;  2L3Q A;  3GP8 A;  4IUT A;  2EJF A;  2LNV A;  4MDX A;  3ULR B;  1V29 B;  3M0T A;  5CK9 A;  1AWJ A;  1KK7 A;  1M90 C;  4HVV A;  1AD5 A;  4C0F A;  5GAM g;  1WQW A;  5KCO A;  4ZN1 A;  3J81 E;  3C4S A;  2HKN A;  3JCM d;  1VQ9 T;  3VKI A;  4WTO B;  2FRY A;  2D9T A;  2K3B A;  2R58 A;  1WIE A;  1VQK Q;  5CKH A;  5FU7 B;  1C1A A;  3RNJ A;  1G83 A;  1ZBJ A;  2J6K A;  1TWB A;  1XOV A;  3MPU B;  3NPF A;  2O88 A;  1OPL A;  4IKF A;  2PNI A;  2WSC E;  2VB6 A;  4M7A D; 
#chains in the Genus database with same CATH homology
 2CP2 A;  2COZ A;  1WHM A;  3RDV A;  2HKN A;  2Z0W A;  1TXQ A;  1WHJ A;  1WHG A;  2COY A;  2E3I A;  1LPL A;  1TOV A;  1WHK A;  2HQH A;  3E2U A;  2E4H A;  1IXD A;  2E3H A;  2HKQ B;  2COW A;  2HL3 A;  3TQ7 P;  4B6M A;  2M02 A;  2CP3 A;  1WHH A;  2CP0 A;  2MPX C;  2CP7 A;  2QK0 A;  2CP5 A;  2HL5 C;  1WHL A;  2CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...