2QK0A

Structural basis of microtubule plus end tracking by xmap215, clip-170 and eb1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
73
structure length
73
Chain Sequence
GSDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKMTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords CAP-Gly domain-containing linker protein 1
publication title Structural Basis of Microtubule Plus End Tracking by XMAP215, CLIP-170, and EB1.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2007-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2qk0A00
2CP0A 3RDVA 1WHGA 1WHHA 2CP7A 3E2UA 3TQ7P 2HKNA 2COWA 2E4HA 2HL5C 2MPXC 2COZA 1TXQA 1TOVA 4B6MA 2HL3A 2Z0WA 2E3IA 2COYA 2M02A 1LPLA 2CP5A 2CP3A 2E3HA 2CP6A 2CP2A 1IXDA 1WHJA 1WHMA 1WHLA 2HKQB 2HQHA 2QK0A 1WHKA
chains in the Genus database with same CATH superfamily
1OQKA 3FRNA 4EIKA 2XK0A 4IUUA 3M0PA 4Z02A 4CC4B 1WNLA 2K3XA 1NPRA 1VQKA 2O4XB 2CREA 2VYTA 3UF4A 2IIMA 4M77F 3LLRA 1C0MA 3CBPA 1Y71A 1PG5B 4RTVA 2L8DA 4K11A 3OSVA 3OYCA 3EGXB 3AT1B 3GLXA 1YIJQ 2DM1A 3JCMg 1K0SA 1KJWA 3UA6A 1BI2A 3QZ9B 1WZOA 1VQ9A 2KE9A 1OI1A 2D9TA 5CKHA 1MMDA 4B6MA 3M58A 2LJ0A 2RQTA 2NWMA 4M75D 3EGUA 1D1AA 2ZPFB 1W4SA 3O8VA 1LJOA 1YJ9Q 1YI2T 3M0RA 1YJNQ 2L3RA 2DJQA 4M75B 5I22A 3JCMX 4JUVA 5FLXE 3MEVA 1KQSA 3CC2T 3FJPA 5FW9A 2GBQA 1VQPT 2KK4A 2E3IA 3CC7Q 3A8MB 2FG0A 4F04B 3QWXX 1LOJA 1LPLA 1M1GA 1K73U 2DFUA 4O6JA 2FZKB 5IH2A 2AZSA 1WX6A 2PVOB 2EGAA 1DJ7B 2B8AA 2YRCA 1YNZA 2L0AA 2K57A 1GCPA 1NZ9A 2DIGA 3JCMc 4HA8A 4BY6C 2RQVA 3H6ZA 2MF2A 3CMAT 4HVVA 1YWOA 4DBQA 4XTZA 1VQ6A 2BZXA 2KI7A 3I35A 1RLQC 2WACA 1JRIA 5GAN3 1KQ1A 4Z88A 2R5MA 2COWA 1YHQT 5HCKA 2AKLA 4IUTA 1BCMA 3H9NA 3BFMA 2QAZA 2EJFA 1VQNQ 2M9UA 2F2VA 2PU9B 3M0SA 2K79A 5C0MA 2XI9A 4DOVA 2HSEB 3CCQA 2RQUA 1ZSZA 4M78A 2ENMA 1U1TA 2RB6A 1BK2A 2QG9B 4FIBA 3CCMA 3JB9J 3CCJT 3OYJA 4KH0B 2P4RA 5KYWA 2BKDN 2FPDA 1YITA 4AFUC 3HTRA 4PJOA 4J5YA 4F14A 2M02A 2GTOA 3DLLA 2E3HA 3EG9A 1T0JA 2LRQA 2HKQB 3RESA 2CUBA 1K76A 1T3LA 5D7UA 2CP0A 3JRZA 2D1XA 3OYNA 2F69A 4A4GA 1KK7A 1UE9A 2E5KA 4OMQA 2RA2A 1VUBA 3QJYA 3CC4Q 1Y7XA 4HKEA 5DM7R 4M7AA 4A4KA 5GJWB 4M75E 2F2XA 4J9BA 2DL3A 3VS1A 4BE1A 2OTJT 4HVUA 1I1JA 2RJEA 4RKUE 3A8GB 2D8HA 1QVFS 5GAOq 2CT4A 3CC2Q 2AHJB 3M4GA 1VQPQ 2YUOA 4OF1A 2GQVA 4IIMA 3R6NA 2CZ7B 4N4GA 1UJYA 2H8HA 4Y91A 1MMGA 2EQMA 3CMET 2YLCA 1AT1B 5KYXA 1VQ4A 3QUIA 1VYUA 3PMIA 4XU0A 2X4YA 1IB8A 1RI0A 1PWTA 9ATCB 2DRMA 4FSXA 4OB3B 5GAMd 2J7IA 4M75F 1FMKA 3CMAQ 1VQ8T 1G8XA 4VUBA 4OVAA 5KYUA 3E9FA 2ABLA 2JTFA 3H0FA 3A1PA 4GLKA 4PL6A 1O75A 3I5RA 2HCKA 2W0ZA 2HKNA 1YHQQ 3QXEB 1JB0E 5GMKe 3MEAA 4C0ZA 3ASKA 1N9SA 3JCMe 2CZ1B 4C92A 3LGLA 3C95A 1RAIB 5CAIA 4BD3A 3CPWA 2EYYA 1KQ2A 5I2MA 2EQUA 4EMKB 2DKGA 3FJ5A 2KAFA 4MZPA 2JOYA 3CCJQ 2A37A 3OQ5A 2QA4T 1G3YA 4N0AA 4RTZA 3I55A 3FB9A 4OB0B 5LJ5d 1LNXA 3CCUT 4O5VA 2E41A 2ZPEB 4CC7A 1S72A 1RAHB 2DEUA 3JB9I 4EMHA 3JCMJ 2MOXA 1ZA2B 5CKBA 3BW1A 4RTTA 2XDBA 1UG1A 4ORZA 3A8HB 3QBYA 2NUTB 1OZ2A 1CSKA 5I21A 2COZA 3RKYA 2RHXA 7AT1B 1OX9A 3NTHA 3GF5A 1PHTA 2QYZA 1PSEA 2DXCA 1PCXA 4QVDA 2OTJQ 1M9SA 2PQWA 3ER0A 4DBFA 2I2LA 3G6ET 1N8RC 1X69A 1GFCA 4ZTJA 1M2OA 2EAYA 2EKHA 3QG1A 2YUQA 4E7JA 1WXBA 3CPWS 1YWPA 4QT7A 4M7DB 1YJWT 2EQJA 4CI0C 1QCOA 1BIAA 2KQWA 3VS7A 3P8DA 2XICA 4Q5WA 1N8RR 3OB9A 2XU8A 1AHJB 4QQDA 1MV3A 2YWWA 4LN2A 4F7UG 1D1CA 1QW1A 1VQ7A 1UDLA 1WJRA 1VQ8Q 3VS5A 1TUCA 2RNAA 2X3WD 2EVRA 2ZZDA 4ZN1A 4FW2A 3HKSA 3JCMb 1OZ3A 1VQOT 5LJ3d 3DLMA 3LH0A 4JS4A 3CCLT 3CCVA 1SPKA 1JXMA 4QVCA 2EJ9A 2G3RA 2KXCA 1I07A 2ZCFB 2LDMA 5HY6A 5GANj 1LCKA 2E70A 5GAMh 4JJCA 3HSBA 1GFDA 5IXBA 1UJ0A 4FSSA 3RKXA 4C5EA 3INZA 2LX7A 2OI3A 1E6GA 3SD4A 1H3ZA 4LDXA 4DEYA 3OW2A 4IUVA 4AFQC 2P0KA 1OPKA 2P84A 1A0NB 1TH7A 2EWNA 1VQLA 4YTLA 3CCUQ 2RMOA 1NYGA 4LDYA 1M8MA 4J6YA 1TWBA 3RNJA 1MMNA 1M90C 1J3TA 2HNIA 4PLLA 1AZGB 4J9DA 2HDAA 4M7DC 3E2UA 3VV0A 5ECAA 3OYDA 1H3HA 5LJ5h 3GNFB 4BE0A 3C4SA 3CD6Q 1M90R 3PE0A 5GAMg 4RUGA 5FU6C 3S3MA 3CCEQ 1SHFA 1RAGB 5IT9E 4C5HA 2PVDB 2JS0A 3NPFA 4XTYA 4OMPA 1Y96A 2CSIA 5CIUA 1YJNA 2RK1A 3G6EQ 1QCNA 4J7FA 3CXCA 2V8JA 2LX9A 5CKEA 4C8QC 4ELYC 1NM7A 1PC0A 4OMMA 1KHIA 4CC3A 3HFNA 4XTVA 5CKFA 1YJWQ 1X75C 3CC7A 5DY9A 2RO0A 4C0DC 3P8HA 4PJLA 2RHIA 3OW2S 5DLQE 3RDVA 1H92A 1QCFA 2HL5C 2M16A 2BZ8A 4F17A 5GMKl 1RAFB 2J6KA 1YBYA 4X9CA 2JVVA 4OMNA 1KC8U 1M4ZA 5FWCA 5LJ5g 2QEXA 3MPUB 1D3BB 2DBMA 3M53A 1SHGA 3M55A 1X6GA 2A28A 1WFWA 4XK8E 2F5KA 3OSSC 1WIEA 1QVGS 3VKIA 2AT1B 3G4SA 3OYBA 3VRYA 3JB9H 1G3SA 4B9WA 1VQOQ 4J9GA 3HFOA 2JTEA 2RI3A 1D1BA 4FT2A 1BI1A 4LUEA 2LJ1A 3MP8A 2PTKA 2QQRA 3VS6A 2CP2A 2FYKA 4X1VA 3OBYA 2H3EB 2GFUA 2CSQA 2MWPA 2QDLA 3QPHA 3L2WA 5LJ3h 5C6SA 3OS1A 4A4HA 1G2BA 1EFNA 5IHNA 2K5FA 2MMPA 2RPNA 1FX7A 1M2VB 4R55A 4NL3A 1KHCA 4FL6A 2MWOA 3EG9B 2ZPIB 2QQAA 1MNDA 1VQ5T 1EX4A 3VJPA 5CO7A 2YT6A 1WI7A 2O88A 2HSPA 2R57A 3NTIA 1QP3A 3META 2QQ9A 5HK0A 4HT9A 4OGEA 3CEYA 3KBGA 1ZBJA 3OS5A 4PK4A 5L8RE 2GTJA 3PVQA 3I9QA 3C94A 4F7UE 2SRCA 3X20B 1W2BA 2RF0A 1MHNA 4M77A 1K8AC 1CKAA 4PJJA 3OS2A 2EW3A 1BKBA 2XKOC 5CK9A 3GP8A 2DXTA 2VKNA 2ROLA 4Y28E 1YN8A 3CC4A 2L3PA 2NUPB 1XQHA 2IG0A 3RIRA 2RD1A 2P0PA 5GAMf 3A5ZB 3CQTA 4CC2A 3M54A 3FLGA 1N9RA 5LJ3g 3SFMA 2K2MA 2KYBA 1FYNA 3M56A 1K8AR 2JN0A 1VQKT 1B34B 4JZ4A 1QVFP 2M51A 2ED0A 3EGDA 4F7UF 5KYXB 5IHKA 1TUDA 3G71T 1X01A 2FRWA 1E6HA 1ZSZC 2YRDA 4M78C 1JO8A 2HAXA 2DILA 1QLYA 1ABOA 3ZBDA 1KC8C 2FPFA 2LQKA 1WA7A 4BDZA 2OJ2A 1VQ9T 1LVKA 2KMTA 2QQBA 4E7ZA 2KSSA 2XDDA 2HZYA 5KH6A 3CMAA 4PJOC 1HD3A 2J6OA 4E7LA 2HQHA 5LJ5f 3SWNA 1SRMA 2VUBA 1IREB 3GIBA 4OMLA 2IPOB 1MNEA 1OX8A 1P92A 2A0FB 2K3BA 3V7SA 3A98A 1KC8R 4OGCA 4OB1B 3PIPA 4NOYA 5HK3A 1HYOA 1W2BS 4C92B 2XG8D 4XU1A 2HQXA 2D6FA 2I0NA 2XMFA 1ZX6A 1WHKA 4RG2A 1U3OA 2DXBA 3PFSA 4LDWA 2GF7A 2M1HA 1FWZA 4M7AC 1D09B 2CKKA 2J05A 3CCRA 2JT4A 5GAMe 4ZN3A 1RAAB 2YHTA 5GAN5 3FC3A 3MHXA 1ABQA 3CCJA 3E19A 1QP2A 4C0FA 3QSUA 1UGRB 4BACA 1NLPC 3M0TA 2X35A 1PD0A 3HPWA 4NS5A 1G3TA 1RABB 1MV0B 5GJVB 2BIVA 5D6XA 1VQ5Q 3RR6A 5GAOn 3TREA 4N4IA 3OYAA 4R56A 1RUWA 2ROTA 1VQ6T 2KRMA 4XAXB 1KQSS 2OTLA 1VYTA 1BI0A 3LWIA 3MKDA 1NEBA 3NHNA 2VWFA 3N5BB 1PRLC 2VC8A 2KR3A 5D6YA 2QTVA 2DLPA 1CKBA 2E12A 1HXDA 2DTIA 4D6WA 2KGTA 1Q86C 5LJ5e 3CBOA 2AK5A 3MP6A 3CCQT 3JCMf 4PKCC 3VRZA 2DBKA 1RL2A 2J06A 1PD1A 3UT1A 3CCMT 2HBPA 2FEIA 5LJ3f 1Q7YC 1WHJA 1YITT 1YI2Q 3OBWA 4FYYB 4C92C 2JW4A 5KYYB 1Q86R 2DMOA 1N6AA 2O4XA 4GBQA 2VASA 2Y4XA 1GRIA 2FRYA 4PFPA 3NMZC 2MPXC 3EG3A 4PLIA 3G71Q 1PSFA 1UFFA 5EC7A 1WXUA 1K9AA 1N8RU 3QJ6A 2VGNA 3HRSA 2X4JA 2DX1A 4N0AC 1T3SA 1Q7YR 1GBRA 1VQ9Q 1WQ7A 2PZ1A 3G1JA 3OYMA 3GBQA 2JTMA 1M3CA 2QQSA 1TTHB 2DEQA 1NJIU 1JJ2A 1S1NA 3L42A 1RI9A 4Z8AA 1VQMA 3LW5E 1Q82U 3X24B 3FIFA 1U5SA 1V76A 4A4FA 5I2SA 1E7OA 4AT1B 2YSQA 1AWJA 5GMKj 1UHFA 3KXTA 2DL5A 3VU3C 4M75A 2LQWA 2KDSA 2RQWA 1WHLA 1M3AA 3HL8A 3J7AF 3MP1A 3X28B 2KY9A 2KRSA 5KCHA 1UTIA 3QO3A 4XU2A 1VQ4T 4M7DG 1M1KU 1K1ZA 3RMQA 1WYXA 2KROA 4LUDA 2BTTA 4J9HA 5LJ3e 4J9FA 3ZEHA 1VQ6Q 2DJZA 3DKMA 2QXFA 4BE2A 1KSWA 4LXCA 5CVIA 3EFOB 1RLPC 2DNUA 2KNBB 2L5QA 3DB3A 5DLOA 4JRQA 1NEGA 4JLGA 1M90U 3CD6A 3S6WA 4L6V5 1X43A 3LYIA 3I56A 3JAME 4PFOA 1JJ2S 1V29B 3CCEA 1KG1A 2LZ6B 1AZEA 1Y96B 2F2WA 3CCQQ 4LDUA 4FYVB 4J8OA 1RACB 2JZ2A 2LP5A 3D7SB 3QYHB 2DTOA 2V1QA 2KRNA 3CCMQ 1GCQA 2O9SA 1S72T 3S3NA 4KRTA 1YITQ 3IQLA 3PIOA 1Z9QA 4KUIA 3C12A 1NG2A 2RH2A 4HT8A 3QHSA 4M7DD 4HCZA 4OP0A 1B07A 2OX7A 4JS5A 3CCST 2F5TX 2HD0A 3TVTA 2FHDA 3NFCA 8ATCB 2JXBA 1M30A 1D0XA 3CPFA 3MEWA 1NJIC 1I5LA 2RHYA 3CMEQ 2RN8A 1Z9ZA 1H8KA 4J9CA 2CH4A 2M0OA 1Q82C 4B9XA 2EKOA 1ZUUA 1JEGA 5FU6B 3GOXA 2BUDA 3TEEA 3UPUA 2V8IA 4C0GA 1QVGP 2VXFA 3QDFA 4C8QD 1M1FA 4ME7A 3M4YA 5IN1A 3ULRB 2X4WA 3VYHB 2LNHB 2QK0A 1NJIR 4J83A 1K9MC 4RTWA 1ZSGA 4C8QB 1G3WA 4JJDA 1Q82R 1I81A 1KD1C 1HK9A 3EHQA 3PT9A 1EIFA 4KGZB 5AT1B 2QTXA 4KBMB 3SEMA 5GAOp 2LCCA 2DE0X 1W1FA 2VGMA 1XNIA 3OS0A 2O01E 1M1KC 1V1CA 2K2VA 4C0DB 2HMAA 1TS9A 1VQ4Q 3VS4A 4FM4B 1SF9A 4OB2B 3J80E 1W6XA 1R0CB 1OPLA 5CQXA 4LD9K 2D8JA 3HP9A 1VQ7T 5A0DA 1VYVA 1KD1R 5J26A 4A4EA 1C6VX 1VOMA 2P0QA 5GMKi 2QA4Q 2PUOB 2KVQG 1FMVA 1M1KR 1AD5A 5A0GA 5FRMA 3THKA 4OMFB 4TVRA 3CCVT 1AWXA 4IIOA 1UGPB 3V8JA 2X9HA 3PVLA 3O5ZA 2E10A 3EG0A 2KXDA 2BE9B 1YIJA 3E1SA 1SEMA 1UGQB 3VS3A 2VB6A 5FROA 1KFZA 2C06A 1U06A 2ESWA 4QVZA 2DAQA 4EMKA 3TSWA 1OU8A 1VQLT 4JPBW 1M5Q1 1K8AU 2RI5A 5A0LA 4JLIA 1S72Q 1U1SA 3EGDB 2ED1A 3QKJA 2DERA 2JJ9A 1YJ9A 1D0YA 4HCBA 3JCMV 4PJOG 3OMCA 3CCSQ 1Y0MA 1Y57A 2KBTA 3R6OA 1I4K1 2C0TA 2DTHA 2DETA 4M7DE 2DVEA 2E6ZA 2YUPA 3MEUA 3SWNB 1HSQA 1GL5A 3M5AA 4IUQA 2RJCA 4J6WA 1YCSB 1TU0B 3FDRA 5J39A 2GCXA 5GAOm 2GQIA 1GXIE 5GAOl 2ZAEA 4M7AG 4LE9A 1YJNT 2L3QA 5L23A 4E2FB 4C8QE 2ZPGB 4M77C 1U8RA 2RQRA 1W2BP 1ZLMA 3M57A 4A54A 1ZHIA 4M7DF 2VXEA 1NLOC 2RJFA 4L59A 3CCLQ 1WXTA 3RMSA 4M78D 3EHRA 1BYMA 2PUKB 2LNVA 1IRXA 1VQNA 1ZSZB 1VA7A 4M78B 3CBMA 1Q95G 4PJOD 2QEXT 2D0QB 1VQ7Q 2LJ3A 5GANd 1RADB 5KYWB 3CXCS 1BBZA 3G4ST 4PJOB 2X4XA 1UECA 4C8QF 3LX7A 4J6XA 4FCYA 2FZCB 3PGGA 4UC4A 4J9EA 1X2KA 2GGRA 1KQSP 2O31A 3OYFA 4DA4A 3QIIA 1WHHA 2FO0A 2SEMA 3A8LB 1BCOA 3UATA 3M9QA 3URGA 4ATOA 1I0CA 4QW2A 4M7AD 4A63B 3SWNC 3WVDB 3JV3A 2CZ6B 1UUEA 2K9GA 4C92G 1TG0A 2LVMA 1JBMA 2J6FA 3SB2A 4PFZA 3F70A 3VYGA 3OA6A 3H8ZA 4CRIA 3GPLA 4M7AB 4QKUA 1VQLQ 4E6RA 3EG2A 3MCAB 2CP7A 5KE2A 1YI2A 1Q86U 2KT8A 4ZGEB 1PNJA 2MCNA 4E7HA 2Y90A 2QI2A 2L89A 2YUNA 3BY7A 2JUFA 3G71A 4HVWA 3CC2A 3V8LA 4FW1A 3M0UA 5CR2A 1FMWA 1VQPA 1M3BA 4RMOA 2QGFB 1Q7YU 1AWWA 4JJNK 4RCBA 3VUZA 1X2QA 2CZ0B 3A8OB 3S3OA 1IGQA 4J7IA 4ZTFA 3ME9A 4F7UA 3CC4T 2DYIA 3VS0A 2E1HA 2L2PA 1YP5A 1MMAA 4F16A 1QVPA 1Q81C 2JM9A 1PKSA 4D8KA 1B7TA 5KYUB 2DD5A 1WLPB 4LD6A 2EYZA 2ZGWA 2MYSA 2EIFA 3EH2A 2OAWA 5FU7C 1MGQA 3TQ7P 3X25B 4C92D 4ESRA 3L1AA 4BI8B 3OYEA 1IGUA 2E5QA 4MZMA 4E7IA 1GBQA 2EPDA 4Z89A 1QMCA 3L2RA 2EGCA 3BDUA 1TSFA 3HRTA 1Q81R 1M27C 1IZ6A 3JSCA 1NE8A 1AVZC 1YHQA 5GAMj 2A3LA 2FB7A 4KH1B 3V8KA 1NBEB 2CGHA 4M78E 2QEXQ 4PNOA 2DPPB 4II1A 2RHUA 2V8KA 2X3XD 3MO8A 4MDXA 4PJOE 2EFIA 1D3BA 1TUGB 3G4SQ 1QQJA 1RAEB 2EBPA 3RERA 4RTUA 5IHIA 4GLMA 3U23A 2RJDA 4BB7A 3VUBA 5GAN2 4HCKA 2LMJA 3E9GA 2LTOA 1QVFA 5GANh 2EYXA 1UGSB 4M78F 1SG5A 5LJ5j 1QWFA 2K6DA 3J81E 1OOTA 2YXYA 4KT0E 2GFAA 2CP3A 4E7SA 3CCRT 4M7AE 4DEXA 1JJ2P 2RK2A 2G6FX 1XTDA 5FRNA 1I5OB 4PJOF 3L2ZA 2MK5A 4M75C 3H0IA 1XJWB 2W10A 4RG8A 3OYIA 3DB4A 2OTJA 3WVEB 1M2VA 4ZGJB 2CS7A 1UHCA 2DL7A 1UGVA 1YFNA 1VQKQ 2EQIA 2A08A 2OTLT 3V7RA 3BDLA 2XIDA 3L2UA 2JS2A 3BE3A 1C1AA 1ZUKA 1FXXA 3GNGA 3T9NA 2WSEE 3CPWP 3JCMW 2DD4A 2NLUA 3OYHA 4M7AF 3FEOA 5AYFA 2R5AA 3CMEA 1OULA 3SDZA 5GANg 1BB9A 4KGXB 2FVUA 2DZCA 2YRVA 3EGXA 3Q1JA 3L2QA 2LT1A 4FT4A 2NUPA 3WXMB 1PRMC 1G83A 2M0YA 3JB9G 1VQ8A 1KIKA 5CKDA 2F1LA 1QKWA 1R0BG 4BUGA 3JCMQ 2E4HA 3LWHA 2AZVA 4JRIA 2NUZA 1K73C 1R77A 2CUDA 4MMLA 4C92E 1B34A 4D8DA 3KUFA 2MIOA 1D0ZA 1O9SA 2P4TA 3UDCA 6AT1B 5IXFA 3H0HA 2DA9A 2FL7A 4RTYA 2XHCA 1K9MU 4NL2A 1GCQC 5KYNA 1SSFA 3QWYA 5LJ3j 1K73R 1OEBA 2KT1A 2K5IA 1KD1U 2FPEA 4J9IA 2QA4A 2CP5A 1AOJA 4DOWA 2LQNA 1VQMT 2V26A 3CCUA 4KULA 4X34A 3P8BB 4C92F 1YCYA 1UB4A 1X27A 1IHVA 4P5NA 1XOVA 2DZ9A 2QDYB 2RI2A 3JB9D 1IHWA 3LH5A 2ZPHB 4A53A 3CCRQ 2RHZA 4IURA 1IO6A 5LL6S 4C8QG 2LT4A 1WPYA 2DL4A 1F1BB 1N5ZA 3X26B 5CQYA 3OYLA 4IKFA 2E64A 2KEAA 3OYGA 1ACMB 1UEBA 1NPPA 3G7ZA 4XQ3A 2A7YA 3G6EA 2OAUA 2E65A 2DVJA 3I55T 4DBRA 1X6BA 1ZA1B 2ECZA 3CCSA 4BI3A 2OTLQ 2DO3A 2ZPBB 2QASA 4PJNA 4XTWA 1YJWA 1B3QA 2V1RA 3AHUA 2O2OA 1BIBA 2CYZB 4Y92A 4ZNXA 3CD6T 2C0IA 2COYA 3I56T 4M77G 4DQ2A 1ZBXA 3QDRB 5HKCA 3OW2P 3CCET 4E7KA 2EYWA 3PMTA 4JZ3A 4BDYA 5GANf 1HJDA 4OMOA 3EAEA 1ZQ1A 2CDTA 1OYXA 3LGFA 1X6OA 1JXOA 3M59A 2LC4A 4AFSC 4RTXA 2DYBA 1VQOA 4HXJA 2JM8A 5A2QE 4R0KA 3EFSA 3EFRA 2L3SA 2CP6A 3CCLA 5GAN8 1G5VA 2JNGA 2RM4A 5KYYA 4ZGDB 8AT1B 3REBB 3MJXA 1BI3A 1WDXA 1WHGA 2LCSA 4QQGA 4EMGA 2AIRB 4N4HA 5GAN4 1VIFA 4EMKC 3TCJA 3C0CA 4JRPA 2WSCE 4L5GA 1TOVA 4JDSA 3JCMd 4AG2C 5GAN7 1ARKA 2BE7D 5GAN6 4WTOB 1QWEA 4E47A 1VQMQ 3V7CA 4JJBA 1Y07A 1K9MR 4EPCA 4C5IA 1WJSA 2K3YA 3CXCP 1AWOA 2DL8A 4FU6A 2JMAA 3OMGA 4M77D 4M4ZA 2EGEA 3REAB 1PM3A 2MAMA 2K4YA 4KGVB 5CCAA 4M77B 2K7AA 1NYFA 1W70A 4DBHA 2ATCB 2O9VA 2NYSA 4V2SA 5GANe 5KE3A 1SSHA 2DXUA 4IUPA 5J3BA 1PKTA 2DIQA 3H41A 5GAOr 2WSFE 3NTKA 3SHWA 2HL3A 3RBBB 4BI4A 3PTAA 2VV5A 2QGGA 2BZYA 2DK3A 1QVGA 3I55Q 5D6WA 4M78G 1WHMA 3ZFJA 3I5SA 3PNWC 2YDLA 3TU4K 1VIEA 2E6NA 2HQEA 1OU9A 2Y4YA 3OYYA 3EFOA 5EG2A 2Z0WA 4F7UB 2EYQA 4AMCA 2C0OA 2GNCA 3I56Q 3JB9F 3OYKA 1YIJT 2PNIA 4HCCA 1WGSA 2R58A 4FYXB 2VVKA 3QYGB 2NUTA 5IAYA 3NGPA 2K5LA 1QKXA 3RKWA 2MI6A 1MUZA 2X51A 3RUXA 2DRKA 2LCLA 4XTUA 3TSZA 4EDUA 4GY5A 2EJGA 1T0HA 3HHTB 1WJQA 1YJ9T 3QZ5B 1I8FA 3EG1A 1IXDA 1Q81U 2CH4W 5KCOA 2A36A 5FWBA 2PVGB 1SKUB 5GMKm 1K0XA 3KFVA 2HEQA 5M9OA 3CC7T 3UWNA 3OY9A 4RCCA 4XU3A 1OV3A 4MZTA 4KUDK 4M7DA 3M0QA 2HBWA 1N27A 4WF2A 4AG1C 4LNPA 1JQQA 2H3JA 1WQWA 2DF6A 4AFZC 1H641 2B86A 2JMCA 2LQ8A 1K4US 4FYWB 1R8OB 3JCMP 4MDWA 4PJMA 1VQ5A 4WCIA 4LDVA 5GMKh 4JRKA 4ANJA 3EH1A 3JCMh 2D0NA 2YLBA 2XD0A 2XDPA 4M77E 2KYMA 5FU7B 4C5GA 1ZUYA 4M75G 1M8VA 2AKKA 2FZGB 4XTXA 3CCVQ 3HRUA 3ZL7C 4C8QA 3UA7A 3L2VA 1EZZB 1TXQA 5I11A 1VQNT 4ELZC 4QQ6A 2CT3A 2EQKA 1SRLA 4X9DA 1JU5C 3VS2A 4MMKA 1BU1A 4BY6B 2IVWA 1AEYA
chains in the Genus database with same CATH topology
2CP0A 3RDVA 1WHGA 1WHHA 2CP7A 3E2UA 3TQ7P 2HKNA 2COWA 2E4HA 2HL5C 2MPXC 2COZA 1TXQA 1TOVA 4B6MA 2HL3A 2Z0WA 2E3IA 2COYA 2M02A 1LPLA 2CP5A 2CP3A 2E3HA 2CP6A 2CP2A 1IXDA 1WHJA 1WHMA 1WHLA 2HKQB 2HQHA 2QK0A 1WHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CP0 A;  3RDV A;  1WHG A;  1WHH A;  2CP7 A;  3E2U A;  3TQ7 P;  2HKN A;  2COW A;  2E4H A;  2HL5 C;  2MPX C;  2COZ A;  1TXQ A;  1TOV A;  4B6M A;  2HL3 A;  2Z0W A;  2E3I A;  2COY A;  2M02 A;  1LPL A;  2CP5 A;  2CP3 A;  2E3H A;  2CP6 A;  2CP2 A;  1IXD A;  1WHJ A;  1WHM A;  1WHL A;  2HKQ B;  2HQH A;  2QK0 A;  1WHK A; 
#chains in the Genus database with same CATH topology
 1OQK A;  3FRN A;  4EIK A;  2XK0 A;  4IUU A;  3M0P A;  4Z02 A;  4CC4 B;  1WNL A;  2K3X A;  1NPR A;  1VQK A;  2O4X B;  2CRE A;  2VYT A;  3UF4 A;  2IIM A;  4M77 F;  3LLR A;  1C0M A;  3CBP A;  1Y71 A;  1PG5 B;  4RTV A;  2L8D A;  4K11 A;  3OSV A;  3OYC A;  3EGX B;  3AT1 B;  3GLX A;  1YIJ Q;  2DM1 A;  3JCM g;  1K0S A;  1KJW A;  3UA6 A;  1BI2 A;  3QZ9 B;  1WZO A;  1VQ9 A;  2KE9 A;  1OI1 A;  2D9T A;  5CKH A;  1MMD A;  4B6M A;  3M58 A;  2LJ0 A;  2RQT A;  2NWM A;  4M75 D;  3EGU A;  1D1A A;  2ZPF B;  1W4S A;  3O8V A;  1LJO A;  1YJ9 Q;  1YI2 T;  3M0R A;  1YJN Q;  2L3R A;  2DJQ A;  4M75 B;  5I22 A;  3JCM X;  4JUV A;  5FLX E;  3MEV A;  1KQS A;  3CC2 T;  3FJP A;  5FW9 A;  2GBQ A;  1VQP T;  2KK4 A;  2E3I A;  3CC7 Q;  3A8M B;  2FG0 A;  4F04 B;  3QWX X;  1LOJ A;  1LPL A;  1M1G A;  1K73 U;  2DFU A;  4O6J A;  2FZK B;  5IH2 A;  2AZS A;  1WX6 A;  2PVO B;  2EGA A;  1DJ7 B;  2B8A A;  2YRC A;  1YNZ A;  2L0A A;  2K57 A;  1GCP A;  1NZ9 A;  2DIG A;  3JCM c;  4HA8 A;  4BY6 C;  2RQV A;  3H6Z A;  2MF2 A;  3CMA T;  4HVV A;  1YWO A;  4DBQ A;  4XTZ A;  1VQ6 A;  2BZX A;  2KI7 A;  3I35 A;  1RLQ C;  2WAC A;  1JRI A;  5GAN 3;  1KQ1 A;  4Z88 A;  2R5M A;  2COW A;  1YHQ T;  5HCK A;  2AKL A;  4IUT A;  1BCM A;  3H9N A;  3BFM A;  2QAZ A;  2EJF A;  1VQN Q;  2M9U A;  2F2V A;  2PU9 B;  3M0S A;  2K79 A;  5C0M A;  2XI9 A;  4DOV A;  2HSE B;  3CCQ A;  2RQU A;  1ZSZ A;  4M78 A;  2ENM A;  1U1T A;  2RB6 A;  1BK2 A;  2QG9 B;  4FIB A;  3CCM A;  3JB9 J;  3CCJ T;  3OYJ A;  4KH0 B;  2P4R A;  5KYW A;  2BKD N;  2FPD A;  1YIT A;  4AFU C;  3HTR A;  4PJO A;  4J5Y A;  4F14 A;  2M02 A;  2GTO A;  3DLL A;  2E3H A;  3EG9 A;  1T0J A;  2LRQ A;  2HKQ B;  3RES A;  2CUB A;  1K76 A;  1T3L A;  5D7U A;  2CP0 A;  3JRZ A;  2D1X A;  3OYN A;  2F69 A;  4A4G A;  1KK7 A;  1UE9 A;  2E5K A;  4OMQ A;  2RA2 A;  1VUB A;  3QJY A;  3CC4 Q;  1Y7X A;  4HKE A;  5DM7 R;  4M7A A;  4A4K A;  5GJW B;  4M75 E;  2F2X A;  4J9B A;  2DL3 A;  3VS1 A;  4BE1 A;  2OTJ T;  4HVU A;  1I1J A;  2RJE A;  4RKU E;  3A8G B;  2D8H A;  1QVF S;  5GAO q;  2CT4 A;  3CC2 Q;  2AHJ B;  3M4G A;  1VQP Q;  2YUO A;  4OF1 A;  2GQV A;  4IIM A;  3R6N A;  2CZ7 B;  4N4G A;  1UJY A;  2H8H A;  4Y91 A;  1MMG A;  2EQM A;  3CME T;  2YLC A;  1AT1 B;  5KYX A;  1VQ4 A;  3QUI A;  1VYU A;  3PMI A;  4XU0 A;  2X4Y A;  1IB8 A;  1RI0 A;  1PWT A;  9ATC B;  2DRM A;  4FSX A;  4OB3 B;  5GAM d;  2J7I A;  4M75 F;  1FMK A;  3CMA Q;  1VQ8 T;  1G8X A;  4VUB A;  4OVA A;  5KYU A;  3E9F A;  2ABL A;  2JTF A;  3H0F A;  3A1P A;  4GLK A;  4PL6 A;  1O75 A;  3I5R A;  2HCK A;  2W0Z A;  2HKN A;  1YHQ Q;  3QXE B;  1JB0 E;  5GMK e;  3MEA A;  4C0Z A;  3ASK A;  1N9S A;  3JCM e;  2CZ1 B;  4C92 A;  3LGL A;  3C95 A;  1RAI B;  5CAI A;  4BD3 A;  3CPW A;  2EYY A;  1KQ2 A;  5I2M A;  2EQU A;  4EMK B;  2DKG A;  3FJ5 A;  2KAF A;  4MZP A;  2JOY A;  3CCJ Q;  2A37 A;  3OQ5 A;  2QA4 T;  1G3Y A;  4N0A A;  4RTZ A;  3I55 A;  3FB9 A;  4OB0 B;  5LJ5 d;  1LNX A;  3CCU T;  4O5V A;  2E41 A;  2ZPE B;  4CC7 A;  1S72 A;  1RAH B;  2DEU A;  3JB9 I;  4EMH A;  3JCM J;  2MOX A;  1ZA2 B;  5CKB A;  3BW1 A;  4RTT A;  2XDB A;  1UG1 A;  4ORZ A;  3A8H B;  3QBY A;  2NUT B;  1OZ2 A;  1CSK A;  5I21 A;  2COZ A;  3RKY A;  2RHX A;  7AT1 B;  1OX9 A;  3NTH A;  3GF5 A;  1PHT A;  2QYZ A;  1PSE A;  2DXC A;  1PCX A;  4QVD A;  2OTJ Q;  1M9S A;  2PQW A;  3ER0 A;  4DBF A;  2I2L A;  3G6E T;  1N8R C;  1X69 A;  1GFC A;  4ZTJ A;  1M2O A;  2EAY A;  2EKH A;  3QG1 A;  2YUQ A;  4E7J A;  1WXB A;  3CPW S;  1YWP A;  4QT7 A;  4M7D B;  1YJW T;  2EQJ A;  4CI0 C;  1QCO A;  1BIA A;  2KQW A;  3VS7 A;  3P8D A;  2XIC A;  4Q5W A;  1N8R R;  3OB9 A;  2XU8 A;  1AHJ B;  4QQD A;  1MV3 A;  2YWW A;  4LN2 A;  4F7U G;  1D1C A;  1QW1 A;  1VQ7 A;  1UDL A;  1WJR A;  1VQ8 Q;  3VS5 A;  1TUC A;  2RNA A;  2X3W D;  2EVR A;  2ZZD A;  4ZN1 A;  4FW2 A;  3HKS A;  3JCM b;  1OZ3 A;  1VQO T;  5LJ3 d;  3DLM A;  3LH0 A;  4JS4 A;  3CCL T;  3CCV A;  1SPK A;  1JXM A;  4QVC A;  2EJ9 A;  2G3R A;  2KXC A;  1I07 A;  2ZCF B;  2LDM A;  5HY6 A;  5GAN j;  1LCK A;  2E70 A;  5GAM h;  4JJC A;  3HSB A;  1GFD A;  5IXB A;  1UJ0 A;  4FSS A;  3RKX A;  4C5E A;  3INZ A;  2LX7 A;  2OI3 A;  1E6G A;  3SD4 A;  1H3Z A;  4LDX A;  4DEY A;  3OW2 A;  4IUV A;  4AFQ C;  2P0K A;  1OPK A;  2P84 A;  1A0N B;  1TH7 A;  2EWN A;  1VQL A;  4YTL A;  3CCU Q;  2RMO A;  1NYG A;  4LDY A;  1M8M A;  4J6Y A;  1TWB A;  3RNJ A;  1MMN A;  1M90 C;  1J3T A;  2HNI A;  4PLL A;  1AZG B;  4J9D A;  2HDA A;  4M7D C;  3E2U A;  3VV0 A;  5ECA A;  3OYD A;  1H3H A;  5LJ5 h;  3GNF B;  4BE0 A;  3C4S A;  3CD6 Q;  1M90 R;  3PE0 A;  5GAM g;  4RUG A;  5FU6 C;  3S3M A;  3CCE Q;  1SHF A;  1RAG B;  5IT9 E;  4C5H A;  2PVD B;  2JS0 A;  3NPF A;  4XTY A;  4OMP A;  1Y96 A;  2CSI A;  5CIU A;  1YJN A;  2RK1 A;  3G6E Q;  1QCN A;  4J7F A;  3CXC A;  2V8J A;  2LX9 A;  5CKE A;  4C8Q C;  4ELY C;  1NM7 A;  1PC0 A;  4OMM A;  1KHI A;  4CC3 A;  3HFN A;  4XTV A;  5CKF A;  1YJW Q;  1X75 C;  3CC7 A;  5DY9 A;  2RO0 A;  4C0D C;  3P8H A;  4PJL A;  2RHI A;  3OW2 S;  5DLQ E;  3RDV A;  1H92 A;  1QCF A;  2HL5 C;  2M16 A;  2BZ8 A;  4F17 A;  5GMK l;  1RAF B;  2J6K A;  1YBY A;  4X9C A;  2JVV A;  4OMN A;  1KC8 U;  1M4Z A;  5FWC A;  5LJ5 g;  2QEX A;  3MPU B;  1D3B B;  2DBM A;  3M53 A;  1SHG A;  3M55 A;  1X6G A;  2A28 A;  1WFW A;  4XK8 E;  2F5K A;  3OSS C;  1WIE A;  1QVG S;  3VKI A;  2AT1 B;  3G4S A;  3OYB A;  3VRY A;  3JB9 H;  1G3S A;  4B9W A;  1VQO Q;  4J9G A;  3HFO A;  2JTE A;  2RI3 A;  1D1B A;  4FT2 A;  1BI1 A;  4LUE A;  2LJ1 A;  3MP8 A;  2PTK A;  2QQR A;  3VS6 A;  2CP2 A;  2FYK A;  4X1V A;  3OBY A;  2H3E B;  2GFU A;  2CSQ A;  2MWP A;  2QDL A;  3QPH A;  3L2W A;  5LJ3 h;  5C6S A;  3OS1 A;  4A4H A;  1G2B A;  1EFN A;  5IHN A;  2K5F A;  2MMP A;  2RPN A;  1FX7 A;  1M2V B;  4R55 A;  4NL3 A;  1KHC A;  4FL6 A;  2MWO A;  3EG9 B;  2ZPI B;  2QQA A;  1MND A;  1VQ5 T;  1EX4 A;  3VJP A;  5CO7 A;  2YT6 A;  1WI7 A;  2O88 A;  2HSP A;  2R57 A;  3NTI A;  1QP3 A;  3MET A;  2QQ9 A;  5HK0 A;  4HT9 A;  4OGE A;  3CEY A;  3KBG A;  1ZBJ A;  3OS5 A;  4PK4 A;  5L8R E;  2GTJ A;  3PVQ A;  3I9Q A;  3C94 A;  4F7U E;  2SRC A;  3X20 B;  1W2B A;  2RF0 A;  1MHN A;  4M77 A;  1K8A C;  1CKA A;  4PJJ A;  3OS2 A;  2EW3 A;  1BKB A;  2XKO C;  5CK9 A;  3GP8 A;  2DXT A;  2VKN A;  2ROL A;  4Y28 E;  1YN8 A;  3CC4 A;  2L3P A;  2NUP B;  1XQH A;  2IG0 A;  3RIR A;  2RD1 A;  2P0P A;  5GAM f;  3A5Z B;  3CQT A;  4CC2 A;  3M54 A;  3FLG A;  1N9R A;  5LJ3 g;  3SFM A;  2K2M A;  2KYB A;  1FYN A;  3M56 A;  1K8A R;  2JN0 A;  1VQK T;  1B34 B;  4JZ4 A;  1QVF P;  2M51 A;  2ED0 A;  3EGD A;  4F7U F;  5KYX B;  5IHK A;  1TUD A;  3G71 T;  1X01 A;  2FRW A;  1E6H A;  1ZSZ C;  2YRD A;  4M78 C;  1JO8 A;  2HAX A;  2DIL A;  1QLY A;  1ABO A;  3ZBD A;  1KC8 C;  2FPF A;  2LQK A;  1WA7 A;  4BDZ A;  2OJ2 A;  1VQ9 T;  1LVK A;  2KMT A;  2QQB A;  4E7Z A;  2KSS A;  2XDD A;  2HZY A;  5KH6 A;  3CMA A;  4PJO C;  1HD3 A;  2J6O A;  4E7L A;  2HQH A;  5LJ5 f;  3SWN A;  1SRM A;  2VUB A;  1IRE B;  3GIB A;  4OML A;  2IPO B;  1MNE A;  1OX8 A;  1P92 A;  2A0F B;  2K3B A;  3V7S A;  3A98 A;  1KC8 R;  4OGC A;  4OB1 B;  3PIP A;  4NOY A;  5HK3 A;  1HYO A;  1W2B S;  4C92 B;  2XG8 D;  4XU1 A;  2HQX A;  2D6F A;  2I0N A;  2XMF A;  1ZX6 A;  1WHK A;  4RG2 A;  1U3O A;  2DXB A;  3PFS A;  4LDW A;  2GF7 A;  2M1H A;  1FWZ A;  4M7A C;  1D09 B;  2CKK A;  2J05 A;  3CCR A;  2JT4 A;  5GAM e;  4ZN3 A;  1RAA B;  2YHT A;  5GAN 5;  3FC3 A;  3MHX A;  1ABQ A;  3CCJ A;  3E19 A;  1QP2 A;  4C0F A;  3QSU A;  1UGR B;  4BAC A;  1NLP C;  3M0T A;  2X35 A;  1PD0 A;  3HPW A;  4NS5 A;  1G3T A;  1RAB B;  1MV0 B;  5GJV B;  2BIV A;  5D6X A;  1VQ5 Q;  3RR6 A;  5GAO n;  3TRE A;  4N4I A;  3OYA A;  4R56 A;  1RUW A;  2ROT A;  1VQ6 T;  2KRM A;  4XAX B;  1KQS S;  2OTL A;  1VYT A;  1BI0 A;  3LWI A;  3MKD A;  1NEB A;  3NHN A;  2VWF A;  3N5B B;  1PRL C;  2VC8 A;  2KR3 A;  5D6Y A;  2QTV A;  2DLP A;  1CKB A;  2E12 A;  1HXD A;  2DTI A;  4D6W A;  2KGT A;  1Q86 C;  5LJ5 e;  3CBO A;  2AK5 A;  3MP6 A;  3CCQ T;  3JCM f;  4PKC C;  3VRZ A;  2DBK A;  1RL2 A;  2J06 A;  1PD1 A;  3UT1 A;  3CCM T;  2HBP A;  2FEI A;  5LJ3 f;  1Q7Y C;  1WHJ A;  1YIT T;  1YI2 Q;  3OBW A;  4FYY B;  4C92 C;  2JW4 A;  5KYY B;  1Q86 R;  2DMO A;  1N6A A;  2O4X A;  4GBQ A;  2VAS A;  2Y4X A;  1GRI A;  2FRY A;  4PFP A;  3NMZ C;  2MPX C;  3EG3 A;  4PLI A;  3G71 Q;  1PSF A;  1UFF A;  5EC7 A;  1WXU A;  1K9A A;  1N8R U;  3QJ6 A;  2VGN A;  3HRS A;  2X4J A;  2DX1 A;  4N0A C;  1T3S A;  1Q7Y R;  1GBR A;  1VQ9 Q;  1WQ7 A;  2PZ1 A;  3G1J A;  3OYM A;  3GBQ A;  2JTM A;  1M3C A;  2QQS A;  1TTH B;  2DEQ A;  1NJI U;  1JJ2 A;  1S1N A;  3L42 A;  1RI9 A;  4Z8A A;  1VQM A;  3LW5 E;  1Q82 U;  3X24 B;  3FIF A;  1U5S A;  1V76 A;  4A4F A;  5I2S A;  1E7O A;  4AT1 B;  2YSQ A;  1AWJ A;  5GMK j;  1UHF A;  3KXT A;  2DL5 A;  3VU3 C;  4M75 A;  2LQW A;  2KDS A;  2RQW A;  1WHL A;  1M3A A;  3HL8 A;  3J7A F;  3MP1 A;  3X28 B;  2KY9 A;  2KRS A;  5KCH A;  1UTI A;  3QO3 A;  4XU2 A;  1VQ4 T;  4M7D G;  1M1K U;  1K1Z A;  3RMQ A;  1WYX A;  2KRO A;  4LUD A;  2BTT A;  4J9H A;  5LJ3 e;  4J9F A;  3ZEH A;  1VQ6 Q;  2DJZ A;  3DKM A;  2QXF A;  4BE2 A;  1KSW A;  4LXC A;  5CVI A;  3EFO B;  1RLP C;  2DNU A;  2KNB B;  2L5Q A;  3DB3 A;  5DLO A;  4JRQ A;  1NEG A;  4JLG A;  1M90 U;  3CD6 A;  3S6W A;  4L6V 5;  1X43 A;  3LYI A;  3I56 A;  3JAM E;  4PFO A;  1JJ2 S;  1V29 B;  3CCE A;  1KG1 A;  2LZ6 B;  1AZE A;  1Y96 B;  2F2W A;  3CCQ Q;  4LDU A;  4FYV B;  4J8O A;  1RAC B;  2JZ2 A;  2LP5 A;  3D7S B;  3QYH B;  2DTO A;  2V1Q A;  2KRN A;  3CCM Q;  1GCQ A;  2O9S A;  1S72 T;  3S3N A;  4KRT A;  1YIT Q;  3IQL A;  3PIO A;  1Z9Q A;  4KUI A;  3C12 A;  1NG2 A;  2RH2 A;  4HT8 A;  3QHS A;  4M7D D;  4HCZ A;  4OP0 A;  1B07 A;  2OX7 A;  4JS5 A;  3CCS T;  2F5T X;  2HD0 A;  3TVT A;  2FHD A;  3NFC A;  8ATC B;  2JXB A;  1M30 A;  1D0X A;  3CPF A;  3MEW A;  1NJI C;  1I5L A;  2RHY A;  3CME Q;  2RN8 A;  1Z9Z A;  1H8K A;  4J9C A;  2CH4 A;  2M0O A;  1Q82 C;  4B9X A;  2EKO A;  1ZUU A;  1JEG A;  5FU6 B;  3GOX A;  2BUD A;  3TEE A;  3UPU A;  2V8I A;  4C0G A;  1QVG P;  2VXF A;  3QDF A;  4C8Q D;  1M1F A;  4ME7 A;  3M4Y A;  5IN1 A;  3ULR B;  2X4W A;  3VYH B;  2LNH B;  2QK0 A;  1NJI R;  4J83 A;  1K9M C;  4RTW A;  1ZSG A;  4C8Q B;  1G3W A;  4JJD A;  1Q82 R;  1I81 A;  1KD1 C;  1HK9 A;  3EHQ A;  3PT9 A;  1EIF A;  4KGZ B;  5AT1 B;  2QTX A;  4KBM B;  3SEM A;  5GAO p;  2LCC A;  2DE0 X;  1W1F A;  2VGM A;  1XNI A;  3OS0 A;  2O01 E;  1M1K C;  1V1C A;  2K2V A;  4C0D B;  2HMA A;  1TS9 A;  1VQ4 Q;  3VS4 A;  4FM4 B;  1SF9 A;  4OB2 B;  3J80 E;  1W6X A;  1R0C B;  1OPL A;  5CQX A;  4LD9 K;  2D8J A;  3HP9 A;  1VQ7 T;  5A0D A;  1VYV A;  1KD1 R;  5J26 A;  4A4E A;  1C6V X;  1VOM A;  2P0Q A;  5GMK i;  2QA4 Q;  2PUO B;  2KVQ G;  1FMV A;  1M1K R;  1AD5 A;  5A0G A;  5FRM A;  3THK A;  4OMF B;  4TVR A;  3CCV T;  1AWX A;  4IIO A;  1UGP B;  3V8J A;  2X9H A;  3PVL A;  3O5Z A;  2E10 A;  3EG0 A;  2KXD A;  2BE9 B;  1YIJ A;  3E1S A;  1SEM A;  1UGQ B;  3VS3 A;  2VB6 A;  5FRO A;  1KFZ A;  2C06 A;  1U06 A;  2ESW A;  4QVZ A;  2DAQ A;  4EMK A;  3TSW A;  1OU8 A;  1VQL T;  4JPB W;  1M5Q 1;  1K8A U;  2RI5 A;  5A0L A;  4JLI A;  1S72 Q;  1U1S A;  3EGD B;  2ED1 A;  3QKJ A;  2DER A;  2JJ9 A;  1YJ9 A;  1D0Y A;  4HCB A;  3JCM V;  4PJO G;  3OMC A;  3CCS Q;  1Y0M A;  1Y57 A;  2KBT A;  3R6O A;  1I4K 1;  2C0T A;  2DTH A;  2DET A;  4M7D E;  2DVE A;  2E6Z A;  2YUP A;  3MEU A;  3SWN B;  1HSQ A;  1GL5 A;  3M5A A;  4IUQ A;  2RJC A;  4J6W A;  1YCS B;  1TU0 B;  3FDR A;  5J39 A;  2GCX A;  5GAO m;  2GQI A;  1GXI E;  5GAO l;  2ZAE A;  4M7A G;  4LE9 A;  1YJN T;  2L3Q A;  5L23 A;  4E2F B;  4C8Q E;  2ZPG B;  4M77 C;  1U8R A;  2RQR A;  1W2B P;  1ZLM A;  3M57 A;  4A54 A;  1ZHI A;  4M7D F;  2VXE A;  1NLO C;  2RJF A;  4L59 A;  3CCL Q;  1WXT A;  3RMS A;  4M78 D;  3EHR A;  1BYM A;  2PUK B;  2LNV A;  1IRX A;  1VQN A;  1ZSZ B;  1VA7 A;  4M78 B;  3CBM A;  1Q95 G;  4PJO D;  2QEX T;  2D0Q B;  1VQ7 Q;  2LJ3 A;  5GAN d;  1RAD B;  5KYW B;  3CXC S;  1BBZ A;  3G4S T;  4PJO B;  2X4X A;  1UEC A;  4C8Q F;  3LX7 A;  4J6X A;  4FCY A;  2FZC B;  3PGG A;  4UC4 A;  4J9E A;  1X2K A;  2GGR A;  1KQS P;  2O31 A;  3OYF A;  4DA4 A;  3QII A;  1WHH A;  2FO0 A;  2SEM A;  3A8L B;  1BCO A;  3UAT A;  3M9Q A;  3URG A;  4ATO A;  1I0C A;  4QW2 A;  4M7A D;  4A63 B;  3SWN C;  3WVD B;  3JV3 A;  2CZ6 B;  1UUE A;  2K9G A;  4C92 G;  1TG0 A;  2LVM A;  1JBM A;  2J6F A;  3SB2 A;  4PFZ A;  3F70 A;  3VYG A;  3OA6 A;  3H8Z A;  4CRI A;  3GPL A;  4M7A B;  4QKU A;  1VQL Q;  4E6R A;  3EG2 A;  3MCA B;  2CP7 A;  5KE2 A;  1YI2 A;  1Q86 U;  2KT8 A;  4ZGE B;  1PNJ A;  2MCN A;  4E7H A;  2Y90 A;  2QI2 A;  2L89 A;  2YUN A;  3BY7 A;  2JUF A;  3G71 A;  4HVW A;  3CC2 A;  3V8L A;  4FW1 A;  3M0U A;  5CR2 A;  1FMW A;  1VQP A;  1M3B A;  4RMO A;  2QGF B;  1Q7Y U;  1AWW A;  4JJN K;  4RCB A;  3VUZ A;  1X2Q A;  2CZ0 B;  3A8O B;  3S3O A;  1IGQ A;  4J7I A;  4ZTF A;  3ME9 A;  4F7U A;  3CC4 T;  2DYI A;  3VS0 A;  2E1H A;  2L2P A;  1YP5 A;  1MMA A;  4F16 A;  1QVP A;  1Q81 C;  2JM9 A;  1PKS A;  4D8K A;  1B7T A;  5KYU B;  2DD5 A;  1WLP B;  4LD6 A;  2EYZ A;  2ZGW A;  2MYS A;  2EIF A;  3EH2 A;  2OAW A;  5FU7 C;  1MGQ A;  3TQ7 P;  3X25 B;  4C92 D;  4ESR A;  3L1A A;  4BI8 B;  3OYE A;  1IGU A;  2E5Q A;  4MZM A;  4E7I A;  1GBQ A;  2EPD A;  4Z89 A;  1QMC A;  3L2R A;  2EGC A;  3BDU A;  1TSF A;  3HRT A;  1Q81 R;  1M27 C;  1IZ6 A;  3JSC A;  1NE8 A;  1AVZ C;  1YHQ A;  5GAM j;  2A3L A;  2FB7 A;  4KH1 B;  3V8K A;  1NBE B;  2CGH A;  4M78 E;  2QEX Q;  4PNO A;  2DPP B;  4II1 A;  2RHU A;  2V8K A;  2X3X D;  3MO8 A;  4MDX A;  4PJO E;  2EFI A;  1D3B A;  1TUG B;  3G4S Q;  1QQJ A;  1RAE B;  2EBP A;  3RER A;  4RTU A;  5IHI A;  4GLM A;  3U23 A;  2RJD A;  4BB7 A;  3VUB A;  5GAN 2;  4HCK A;  2LMJ A;  3E9G A;  2LTO A;  1QVF A;  5GAN h;  2EYX A;  1UGS B;  4M78 F;  1SG5 A;  5LJ5 j;  1QWF A;  2K6D A;  3J81 E;  1OOT A;  2YXY A;  4KT0 E;  2GFA A;  2CP3 A;  4E7S A;  3CCR T;  4M7A E;  4DEX A;  1JJ2 P;  2RK2 A;  2G6F X;  1XTD A;  5FRN A;  1I5O B;  4PJO F;  3L2Z A;  2MK5 A;  4M75 C;  3H0I A;  1XJW B;  2W10 A;  4RG8 A;  3OYI A;  3DB4 A;  2OTJ A;  3WVE B;  1M2V A;  4ZGJ B;  2CS7 A;  1UHC A;  2DL7 A;  1UGV A;  1YFN A;  1VQK Q;  2EQI A;  2A08 A;  2OTL T;  3V7R A;  3BDL A;  2XID A;  3L2U A;  2JS2 A;  3BE3 A;  1C1A A;  1ZUK A;  1FXX A;  3GNG A;  3T9N A;  2WSE E;  3CPW P;  3JCM W;  2DD4 A;  2NLU A;  3OYH A;  4M7A F;  3FEO A;  5AYF A;  2R5A A;  3CME A;  1OUL A;  3SDZ A;  5GAN g;  1BB9 A;  4KGX B;  2FVU A;  2DZC A;  2YRV A;  3EGX A;  3Q1J A;  3L2Q A;  2LT1 A;  4FT4 A;  2NUP A;  3WXM B;  1PRM C;  1G83 A;  2M0Y A;  3JB9 G;  1VQ8 A;  1KIK A;  5CKD A;  2F1L A;  1QKW A;  1R0B G;  4BUG A;  3JCM Q;  2E4H A;  3LWH A;  2AZV A;  4JRI A;  2NUZ A;  1K73 C;  1R77 A;  2CUD A;  4MML A;  4C92 E;  1B34 A;  4D8D A;  3KUF A;  2MIO A;  1D0Z A;  1O9S A;  2P4T A;  3UDC A;  6AT1 B;  5IXF A;  3H0H A;  2DA9 A;  2FL7 A;  4RTY A;  2XHC A;  1K9M U;  4NL2 A;  1GCQ C;  5KYN A;  1SSF A;  3QWY A;  5LJ3 j;  1K73 R;  1OEB A;  2KT1 A;  2K5I A;  1KD1 U;  2FPE A;  4J9I A;  2QA4 A;  2CP5 A;  1AOJ A;  4DOW A;  2LQN A;  1VQM T;  2V26 A;  3CCU A;  4KUL A;  4X34 A;  3P8B B;  4C92 F;  1YCY A;  1UB4 A;  1X27 A;  1IHV A;  4P5N A;  1XOV A;  2DZ9 A;  2QDY B;  2RI2 A;  3JB9 D;  1IHW A;  3LH5 A;  2ZPH B;  4A53 A;  3CCR Q;  2RHZ A;  4IUR A;  1IO6 A;  5LL6 S;  4C8Q G;  2LT4 A;  1WPY A;  2DL4 A;  1F1B B;  1N5Z A;  3X26 B;  5CQY A;  3OYL A;  4IKF A;  2E64 A;  2KEA A;  3OYG A;  1ACM B;  1UEB A;  1NPP A;  3G7Z A;  4XQ3 A;  2A7Y A;  3G6E A;  2OAU A;  2E65 A;  2DVJ A;  3I55 T;  4DBR A;  1X6B A;  1ZA1 B;  2ECZ A;  3CCS A;  4BI3 A;  2OTL Q;  2DO3 A;  2ZPB B;  2QAS A;  4PJN A;  4XTW A;  1YJW A;  1B3Q A;  2V1R A;  3AHU A;  2O2O A;  1BIB A;  2CYZ B;  4Y92 A;  4ZNX A;  3CD6 T;  2C0I A;  2COY A;  3I56 T;  4M77 G;  4DQ2 A;  1ZBX A;  3QDR B;  5HKC A;  3OW2 P;  3CCE T;  4E7K A;  2EYW A;  3PMT A;  4JZ3 A;  4BDY A;  5GAN f;  1HJD A;  4OMO A;  3EAE A;  1ZQ1 A;  2CDT A;  1OYX A;  3LGF A;  1X6O A;  1JXO A;  3M59 A;  2LC4 A;  4AFS C;  4RTX A;  2DYB A;  1VQO A;  4HXJ A;  2JM8 A;  5A2Q E;  4R0K A;  3EFS A;  3EFR A;  2L3S A;  2CP6 A;  3CCL A;  5GAN 8;  1G5V A;  2JNG A;  2RM4 A;  5KYY A;  4ZGD B;  8AT1 B;  3REB B;  3MJX A;  1BI3 A;  1WDX A;  1WHG A;  2LCS A;  4QQG A;  4EMG A;  2AIR B;  4N4H A;  5GAN 4;  1VIF A;  4EMK C;  3TCJ A;  3C0C A;  4JRP A;  2WSC E;  4L5G A;  1TOV A;  4JDS A;  3JCM d;  4AG2 C;  5GAN 7;  1ARK A;  2BE7 D;  5GAN 6;  4WTO B;  1QWE A;  4E47 A;  1VQM Q;  3V7C A;  4JJB A;  1Y07 A;  1K9M R;  4EPC A;  4C5I A;  1WJS A;  2K3Y A;  3CXC P;  1AWO A;  2DL8 A;  4FU6 A;  2JMA A;  3OMG A;  4M77 D;  4M4Z A;  2EGE A;  3REA B;  1PM3 A;  2MAM A;  2K4Y A;  4KGV B;  5CCA A;  4M77 B;  2K7A A;  1NYF A;  1W70 A;  4DBH A;  2ATC B;  2O9V A;  2NYS A;  4V2S A;  5GAN e;  5KE3 A;  1SSH A;  2DXU A;  4IUP A;  5J3B A;  1PKT A;  2DIQ A;  3H41 A;  5GAO r;  2WSF E;  3NTK A;  3SHW A;  2HL3 A;  3RBB B;  4BI4 A;  3PTA A;  2VV5 A;  2QGG A;  2BZY A;  2DK3 A;  1QVG A;  3I55 Q;  5D6W A;  4M78 G;  1WHM A;  3ZFJ A;  3I5S A;  3PNW C;  2YDL A;  3TU4 K;  1VIE A;  2E6N A;  2HQE A;  1OU9 A;  2Y4Y A;  3OYY A;  3EFO A;  5EG2 A;  2Z0W A;  4F7U B;  2EYQ A;  4AMC A;  2C0O A;  2GNC A;  3I56 Q;  3JB9 F;  3OYK A;  1YIJ T;  2PNI A;  4HCC A;  1WGS A;  2R58 A;  4FYX B;  2VVK A;  3QYG B;  2NUT A;  5IAY A;  3NGP A;  2K5L A;  1QKX A;  3RKW A;  2MI6 A;  1MUZ A;  2X51 A;  3RUX A;  2DRK A;  2LCL A;  4XTU A;  3TSZ A;  4EDU A;  4GY5 A;  2EJG A;  1T0H A;  3HHT B;  1WJQ A;  1YJ9 T;  3QZ5 B;  1I8F A;  3EG1 A;  1IXD A;  1Q81 U;  2CH4 W;  5KCO A;  2A36 A;  5FWB A;  2PVG B;  1SKU B;  5GMK m;  1K0X A;  3KFV A;  2HEQ A;  5M9O A;  3CC7 T;  3UWN A;  3OY9 A;  4RCC A;  4XU3 A;  1OV3 A;  4MZT A;  4KUD K;  4M7D A;  3M0Q A;  2HBW A;  1N27 A;  4WF2 A;  4AG1 C;  4LNP A;  1JQQ A;  2H3J A;  1WQW A;  2DF6 A;  4AFZ C;  1H64 1;  2B86 A;  2JMC A;  2LQ8 A;  1K4U S;  4FYW B;  1R8O B;  3JCM P;  4MDW A;  4PJM A;  1VQ5 A;  4WCI A;  4LDV A;  5GMK h;  4JRK A;  4ANJ A;  3EH1 A;  3JCM h;  2D0N A;  2YLB A;  2XD0 A;  2XDP A;  4M77 E;  2KYM A;  5FU7 B;  4C5G A;  1ZUY A;  4M75 G;  1M8V A;  2AKK A;  2FZG B;  4XTX A;  3CCV Q;  3HRU A;  3ZL7 C;  4C8Q A;  3UA7 A;  3L2V A;  1EZZ B;  1TXQ A;  5I11 A;  1VQN T;  4ELZ C;  4QQ6 A;  2CT3 A;  2EQK A;  1SRL A;  4X9D A;  1JU5 C;  3VS2 A;  4MMK A;  1BU1 A;  4BY6 B;  2IVW A;  1AEY A; 
#chains in the Genus database with same CATH homology
 2CP0 A;  3RDV A;  1WHG A;  1WHH A;  2CP7 A;  3E2U A;  3TQ7 P;  2HKN A;  2COW A;  2E4H A;  2HL5 C;  2MPX C;  2COZ A;  1TXQ A;  1TOV A;  4B6M A;  2HL3 A;  2Z0W A;  2E3I A;  2COY A;  2M02 A;  1LPL A;  2CP5 A;  2CP3 A;  2E3H A;  2CP6 A;  2CP2 A;  1IXD A;  1WHJ A;  1WHM A;  1WHL A;  2HKQ B;  2HQH A;  2QK0 A;  1WHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...