4M77C

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
69
Chain Sequence
b'TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYESERRSEMVFIRGDTVTLISTP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 14
structure length 69
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77C00
2QTXA 1B34B 4M75E 4M7AB 1M5Q1 3JCMd 4C8QC 4F7UG 4PJOC 3QO3A 2DVEA 5GAOr 1Y96A 3INZA 4PJOD 1N9RA 5LJ3g 2FB7A 5GAN5 2DZCA 2FYKA 5LJ5j 2DTHA 4M77D 3JB9F 4C8QG 4PJOG 2YHTA 5GAOm 2DEQA 5GANd 5GAOn 3AHUA 2DJZA 5CAIA 4V2SA 4F7UB 2Y90A 1WQWA 2EAYA 2DTOA 4M75F 5LJ3e 3RUXA 1HXDA 4M78C 5GAN2 4M77F 4M78D 4MMLA 5GAMj 5GAN7 5GAN4 4HT9A 2CGHA 5LJ3f 5GANg 4M77A 4RCCA 4JRKA 4XQ3A 4C8QB 4EMHA 2DTIA 1D3BA 5GAN3 4PJOB 4M78G 3L2ZA 3QHSA 4JRIA 2DKGA 5GAOq 3HSBA 1KQ1A 4M7AE 3FIFA 5GAMh 4M7DE 4HA8A 3JB9J 3RESA 3QUIA 4M78A 3BW1A 1JBMA 4J5YA 5GANe 1JRIA 4C92F 3HFOA 5GAN6 4X9DA 4XTXA 3RIRA 2RA2A 4QVCA 5GAOl 4XU3A 3BY7A 4M75C 3JB9D 4JLIA 1X01A 3HFNA 5GANf 4C92A 2EWNA 4M75D 4M77C 3V8JA 3EFSA 3JB9G 4DQ2A 1Y96B 3SB2A 3FB9A 4J6XA 5LJ3h 2I2LA 1LNXA 4F7UE 3V7SA 3JB9I 3JCMW 1I5LA 4M75G 3JCMb 4N0AA 5LJ5e 4M7DF 4RCBA 3JCMh 4M77G 3JCMV 3VU3C 3QSUA 1WNLA 2VC8A 4M75A 4QVDA 4C8QE 2RD1A 4PJOE 1KQ2A 4C92C 3BDUA 3JCMQ 5I21A 4C92D 4NL2A 2YLBA 5LJ5d 5GANh 1WQ7A 2DXUA 1BIAA 2JN0A 4M77B 4XTVA 4EMGA 4Y91A 1D3BB 4PNOA 4XU2A 4XTZA 4F7UF 4N0AC 4C92G 3JB9H 5GMKe 4XTWA 4NOYA 5LJ3j 1BIBA 3JCMP 4M7DC 2E10A 5LJ5g 3SWNC 3V7RA 4EMKA 4XTYA 4M78B 4M7DD 1H641 1TH7A 1M8VA 4JUVA 2VXFA 1N9SA 2HNIA 4WF2A 4A53A 4C92B 4M7AF 3JCMX 4M7DG 3M4GA 3RKYA 3JCMc 1U1TA 5DY9A 5GAMg 4M7AA 5GAN8 3JCMJ 2RB6A 3RKXA 5GANj 4M7DA 1I8FA 3SWNA 1LOJA 4A54A 5LJ5f 4EMKC 4X9CA 1HK9A 1I4K1 1I81A 2EJFA 4M77E 4M75B 5GAMe 4M7DB 2K57A 3SWNB 5GMKi 3V8KA 5GMKh 1LJOA 4XTUA 4XU1A 2E1HA 2RM4A 2YLCA 4C8QD 3PGGA 5GAMf 4J6WA 2E64A 3GIBA 4M7AC 2EJ9A 4F7UA 2E65A 4HT8A 4MMKA 4M78E 3FJPA 1MGQA 3JCMg 3V7CA 4M7AD 3BFMA 2VXEA 3V8LA 4C8QF 5GAMd 4PJOF 5GAOp 3RERA 5GMKl 4C92E 5LJ5h 4J6YA 4C8QA 4M7AG 4EMKB 4PJOA 2EJGA 2DXTA 3RKWA 1YCYA 3JCMe 4OP0A 4NL3A 1WPYA 1B34A 3L1AA 2E41A 3EFRA 2ZGWA 5GMKm 4XU0A 1U1SA 3JCMf 5GMKj 4M78F 5LJ3d 2DZ9A
chains in the Genus database with same CATH superfamily
1Q86U 2HZYA 3M56A 2F2XA 1WDXA 3MEVA 3M58A 2L2PA 1IHWA 3S6WA 2FYKA 5KCHA 3JB9F 3QWYA 1IXDA 1OU8A 1E6HA 7AT1B 2EFIA 2COZA 5GAN2 3EFOA 3L42A 2OTJT 1TUCA 4IIOA 1M1GA 4M77A 4JRKA 1YJ9Q 5KYXA 4KBMB 4GBQA 4LUEA 4M78A 1IO6A 1JRIA 1VQ5Q 2M0OA 1X6GA 3WVEB 3CXCP 1CKAA 3A98A 3SB2A 3META 2XDPA 2VB6A 1LNXA 2KYBA 3V7SA 4MZTA 3J81E 4IURA 4PJNA 1FMWA 4E7IA 1KQ2A 1Q86R 2LC4A 1GCQC 1I0CA 1ZSGA 1KQSS 2X4YA 1AZGB 2YLBA 1VQMQ 4HVUA 4XTVA 5GAN7 2ZPEB 2YRVA 4JZ3A 2KQWA 3VRYA 2DL8A 2J6KA 2FG0A 1OV3A 2OTLA 1U1TA 3L2WA 1XNIA 1GBQA 2RHZA 2F1LA 2MK5A 2NWMA 3HRSA 2LTOA 5A0GA 4X1VA 4LDVA 1PRLC 4YTLA 4D8DA 1T3SA 1KD1C 4HT8A 2YWWA 2O31A 5J3BA 1VQ9T 3HRUA 2VXEA 5KH6A 1ZBJA 2K9GA 3NMZC 1EZZB 4PJOA 5CQXA 2QDLA 1NBEB 1LVKA 1RI0A 4NL3A 4E7HA 1NPPA 4JS5A 1M27C 3OYIA 1TU0B 1MUZA 2OTJA 3CEYA 3R6NA 4E7KA 2RHYA 1J3TA 1I5OB 2RQVA 4FSXA 2G3RA 4WCIA 3VS6A 3M0TA 5LJ3g 2QI2A 3OQ5A 5KCOA 2CDTA 5FU7B 2OX7A 4II1A 2FEIA 3L2UA 4M78C 1EX4A 1IZ6A 5GJVB 2KAFA 2NUPB 1XQHA 4D6WA 3OYNA 2HEQA 3OS1A 4FYXB 1BK2A 1UJ0A 4ZGDB 4FU6A 4X9DA 5GAOl 1K0SA 1ARKA 2SRCA 3HFNA 3TQ7P 3CD6Q 4RTVA 1R0CB 5D6YA 2CT3A 4F7UE 2LMJA 3O8VA 3OYAA 4PJJA 3BE3A 3H9NA 3CCQQ 3G71T 2RK2A 1ZHIA 3G6ET 1VQLQ 1W4SA 4XTWA 4B9WA 4J9CA 4XTYA 5KE3A 3CPFA 2CT4A 1VQ9A 1K9MC 3C95A 3ER0A 5CCAA 2EVRA 2P0QA 2P4TA 2FPEA 4E47A 2K3YA 1I8FA 2E6ZA 4C0GA 1GFCA 4DBHA 2LT1A 3M0QA 3OW2P 2M02A 4E7LA 2HQHA 2YUNA 3FJ5A 1D1BA 2K2MA 3VUZA 5IAYA 2BIVA 2EJ9A 1VA7A 4DEXA 3SHWA 3VV0A 5GAMd 1IHVA 4LNPA 1KQSA 2DMOA 1SHGA 4A4GA 3QZ9B 5GMKm 2GF7A 4OMMA 4AFQC 4OB0B 2PQWA 1Y7XA 3JCMd 2QASA 3INZA 2DBMA 2DYBA 3NTKA 2CP3A 1UGRB 2CZ7B 3OBWA 1YJNT 5LJ3e 1QWEA 2AK5A 1HXDA 1JXMA 1ZA1B 5GAN4 1WIEA 3H41A 2YSQA 2DL5A 3MEAA 4KH1B 3PNWC 1UHCA 5KYYA 2O9SA 2MIOA 4HCCA 2M1HA 4IIMA 4XTXA 2XG8D 3G71A 1OZ3A 1R0BG 3G6EA 2A36A 2I2LA 4AFSC 1VQKT 3CC7T 3H0IA 1OQKA 4FM4B 1UGPB 1ACMB 2CP2A 2VWFA 4M77G 1TUGB 3EHRA 2CSQA 1DJ7B 4A63B 4MDXA 1D1CA 3PTAA 4RUGA 1RADB 2VGNA 2HL5C 3JCMP 3V7RA 4Z88A 4LD9K 2KGTA 1WHGA 3UT1A 2JS0A 2EKOA 3OYMA 2K79A 1M2OA 1UGSB 3D7SB 1R77A 4IUUA 4RKUE 4M75B 2K57A 2YLCA 1MMGA 1QWFA 4J6WA 2KSSA 4M7AD 3ASKA 1AT1B 3CC7Q 2K5LA 2D8JA 1O9SA 4BD3A 3VS0A 1M3AA 5CKBA 1YJNA 1U1SA 2DZ9A 3EHQA 1TOVA 2QG9B 4X34A 5CKEA 2GNCA 1E7OA 4AT1B 3QDRB 5GAN5 4OB1B 5J39A 1V1CA 4PJOG 2YHTA 2QA4Q 2FRYA 2EAYA 4DOVA 3OSVA 4BE1A 1K9MR 2X9HA 1VQKA 1X27A 5J26A 1ZSZB 2X4WA 2LZ6B 3CCEQ 2QQ9A 2FPFA 3FIFA 1O75A 1KK7A 2C06A 4M7DE 2VGMA 3LWHA 5GAN6 3RIRA 2EYZA 4HKEA 1XJWB 5KYWA 1QCNA 3CXCA 2JXBA 1KC8U 1G3YA 1KFZA 1SRMA 2KRNA 3UA7A 2ZAEA 3VS7A 2CYZB 2Z0WA 1YNZA 1Q82U 3BDLA 4GLKA 3BDUA 3H0HA 1M1KR 4C92D 3DLLA 1H3ZA 3TCJA 4ORZA 4RTYA 1JJ2S 4Z02A 4FCYA 3OS2A 1D0XA 3E19A 4OVAA 5EC7A 3ZEHA 3EGUA 3CPWP 1I81A 2IG0A 1OPLA 1AVZC 2K5FA 1G83A 1M9SA 1NPRA 3EG0A 1D09B 1WYXA 4BUGA 1X2QA 4Y92A 3LYIA 1RI9A 5GMKl 4J6YA 4PFZA 4CC2A 1Q82R 1UGVA 3PMTA 2JNGA 3E2UA 5DLQE 2CUBA 4C0DB 4F04B 1G3SA 5IHNA 1N8RC 2RJCA 4K11A 1M5Q1 2KVQG 4J9HA 1C0MA 4OMOA 2BZ8A 2F5KA 2DJZA 2CZ0B 3HL8A 1AWOA 1M90C 2EKHA 2GCXA 3EG9B 4MMLA 4E7JA 2CGHA 5GANg 2ZPFB 4HCKA 4RTXA 2LRQA 3GPLA 1ABQA 5GAMh 1Q81R 1ZA2B 2L0AA 2CREA 2DNUA 3QUIA 5FROA 2JMCA 3EH1A 3EH2A 2IIMA 4CI0C 4C0FA 3OY9A 3OBYA 1W2BP 3JSCA 1X69A 2YUQA 4IUQA 2JW4A 3JCMh 3LH0A 3QSUA 3E9GA 1SHFA 2K4YA 4QVDA 1GCPA 2XK0A 3EFOB 2DXCA 2PUKB 2FHDA 1SSHA 5LJ5d 2QXFA 2JN0A 4M77B 4Y91A 1Q7YR 2ABLA 5KYXB 2NYSA 2DXBA 4NOYA 3M53A 1MNDA 4M78B 1RAHB 1LCKA 1BB9A 4M7AA 5CK9A 3RKXA 4KUIA 2JS2A 4QW2A 1HK9A 2LCCA 2OI3A 3OW2A 2RK1A 2CH4A 1LJOA 3ME9A 3OS5A 4KT0E 4N4IA 1K8AU 3M59A 3OYKA 4VUBA 2JTFA 1YI2T 2B8AA 2DVJA 1U06A 4E7SA 4C8QA 3QBYA 3RKWA 4OP0A 2XDBA 2RHXA 1TTHB 1NZ9A 2M9UA 2L89A 2DK3A 4M75E 4PL6A 3M4YA 3O5ZA 1K73C 1K0XA 1ZSZC 4JJBA 3DKMA 4L5GA 5M9OA 3OYHA 3CCLT 3TSZA 1RUWA 3M0SA 1WX6A 4RTZA 5CAIA 2MPXC 3OS0A 2OJ2A 4M77F 4OMNA 4PFPA 1X75C 2FZKB 4EMHA 4PJOB 2DILA 5IN1A 2CZ1B 2XKOC 2DF6A 2E12A 5GANe 1V76A 1X2KA 4DBQA 1MHNA 3MP6A 1TSFA 4C92A 3MEUA 2RJDA 3GLXA 3EAEA 4ZGEB 3QPHA 4WTOB 2VC8A 3JV3A 2BE7D 3PT9A 2O2OA 4EMGA 4XTZA 3T9NA 4LDWA 4XAXB 1K9AA 4CRIA 3QJ6A 2OTLQ 1GXIE 4M7DD 1MMAA 5AYFA 2H8HA 2CP7A 1YI2A 3EG2A 3JCMJ 1NJIC 2F69A 2MYSA 2G6FX 3M0UA 4BACA 2PVDB 1SSFA 2A28A 1QVGP 5GMKh 3M0RA 5A2QE 4C0DC 1M4ZA 5IHKA 2GQVA 1ZQ1A 1WFWA 3VYHB 5CKFA 1VQ7T 4PJOF 1C6VX 2EW3A 3OYLA 2LNVA 4B6MA 3CCLA 2OTJQ 2QEXT 2JT4A 2FZGB 1OU9A 2FPDA 4KULA 2LJ3A 5GMKj 5LJ3d 2ED0A 3TEEA 2HSEB 2DERA 4A4KA 3G7ZA 5L23A 3UA6A 2FB7A 5D6WA 4C0ZA 2DTHA 2K2VA 2QDYB 4IUVA 1XTDA 3NFCA 3J7AF 2V1QA 4F16A 2I0NA 2JJ9A 4IUPA 1VQ4A 3QZ5B 1KG1A 2FZCB 4CC3A 2A3LA 5CR2A 1VQPT 3MHXA 1ZLMA 3CMET 2HAXA 3HRTA 2OAWA 4M77C 4N4GA 2P4RA 3EFSA 5FU6B 4AG1C 4J6XA 2NUTB 1SKUB 4OMPA 3JCMb 2ZZDA 4PK4A 3GNGA 2KR3A 4LN2A 3KBGA 3SEMA 3EGXA 3TREA 2RMOA 3OB9A 2XD0A 1WQ7A 1BIAA 2QGFB 3E1SA 4KGZB 1GRIA 1K73R 1QCFA 3I56A 1VQ9Q 5KYYB 2V26A 2BZXA 3JRZA 2DYIA 2D9TA 1N9SA 3LW5E 3I55A 1UG1A 1VUBA 2EYWA 2QQSA 4A53A 3PIOA 1VQ7A 3QXEB 1QCOA 2RI5A 2RQUA 3RMQA 1VQPQ 2LDMA 2EYQA 5LJ5f 3CPWA 4RTUA 2QEXA 3G4ST 4M77E 3VS5A 3LGFA 4R55A 5HKCA 3MKDA 5IXFA 2AIRB 2E5KA 4M78E 1KIKA 2QAZA 8ATCB 3IQLA 1BCOA 1IGQA 5LJ5h 4M7AG 3DB4A 1TWBA 1OPKA 2HL3A 2EGAA 1MV3A 3GOXA 4OGEA 4D8KA 2E3HA 1YHQT 4LD6A 1RAFB 4ZTFA 4PJOC 4BI3A 2DVEA 5GAOr 4A4HA 4PJMA 1VQPA 2QK0A 1WJQA 2DZCA 3HTRA 3H0FA 5LJ5j 4C8QG 3CMEA 4J8OA 2BKDN 4BB7A 4OB3B 1I1JA 2DL4A 5ECAA 3CXCS 2D1XA 1P92A 5GAN3 1NJIR 2P84A 2ZPGB 1UEBA 3G71Q 4C5EA 1VIFA 1AWJA 2E5QA 1Y57A 2YUPA 3G6EQ 5C6SA 1R8OB 1TXQA 2J06A 2NUTA 1PD1A 2H3EB 4M75D 5FRNA 3V8JA 2XHCA 1RL2A 5CQYA 3HP9A 4DQ2A 1W2BA 2PU9B 5HK0A 2RI3A 5DLOA 2QYZA 2RD1A 4PJOE 4J9FA 3CC2T 3I5RA 4LDXA 2L5QA 4R0KA 4C92G 3X28B 5KE2A 3G4SA 3OYBA 4EMKA 2RN8A 1W6XA 1KD1R 4BDZA 1G5VA 1X43A 1IRXA 5KYWB 1PCXA 3JCMc 2HQEA 5GAMg 3OYGA 1B3QA 2KMTA 2RB6A 2RO0A 1PG5B 1Y71A 4J83A 2ATCB 2JM8A 1I4K1 2QQAA 5KYNA 1NLPC 4JPBW 1AHJB 3PGGA 4J7IA 1BI3A 2E4HA 1YHQA 2E65A 3UATA 3WXMB 3JCMg 2RJEA 1VQ6T 1JU5C 2DL7A 2R58A 1YJNQ 2DO3A 1D0ZA 2J6OA 2EJGA 2K6DA 3H8ZA 3L1AA 5CKDA 2M51A 1PSFA 1M3BA 2L8DA 3ZFJA 3FLGA 1K9MU 2WSCE 3VYGA 1JEGA 3QO3A 4ELYC 4J9DA 2DIQA 2A08A 2EQJA 2MI6A 3A8HB 1VQKQ 2QTVA 4V2SA 1VIEA 2DTOA 1S72T 4MZMA 5FU6C 1E6GA 5LJ3f 2J7IA 2DA9A 4KRTA 3L2ZA 4JRIA 3REBB 1AZEA 2X3WD 4AG2C 4Q5WA 1M1KU 4OMLA 3CC2A 2CS7A 3I5SA 2GQIA 4LDUA 3RBBB 1BU1A 2X3XD 5LJ3h 3JB9I 1ZUKA 3CCJT 3VS1A 4J9GA 1YFNA 1YCSB 1AWWA 1HSQA 4C5HA 5CIUA 4A4EA 1QVFP 2BTTA 1YBYA 3M55A 4JZ4A 3X20B 4ATOA 1UB4A 2K5IA 3LGLA 2L3RA 5LJ3j 2L3QA 5CVIA 1PNJA 3OW2S 1H8KA 2XICA 1VQ8A 1OOTA 1M2VA 1VQ6A 1NLOC 3RDVA 3EG1A 5GAN8 1N5ZA 2V8IA 1A0NB 2WSEE 3P8HA 1QVGA 4IKFA 5GAMe 1JQQA 3V8KA 4DEYA 4XU1A 2K7AA 1B7TA 1WHKA 4P5NA 3CMAT 1WJRA 3PVQA 2P0KA 3MJXA 2DE0X 3QDFA 4GLMA 3JCMe 5FW9A 4LDYA 3CBPA 1HYOA 1GFDA 2Y4YA 4XU0A 3A8LB 1WXUA 1S72A 4M7AB 2LT4A 1UUEA 2LQWA 1NYFA 4CC4B 3VUBA 3CCRT 2KI7A 1N6AA 1Q81U 1UTIA 5I2SA 1YITT 4M77D 4ZN3A 5GANd 3DB3A 1PM3A 3CQTA 5L8RE 2F5TX 4M78D 4DBFA 3CCJA 1RAEB 3PE0A 1SEMA 3TU4K 4C8QB 2DTIA 1D3BA 4FYYB 4ZNXA 5FLXE 4IUTA 2C0OA 2X35A 3M9QA 4J5YA 3JB9D 3NPFA 1YJWT 3MCAB 4JLIA 1Q7YU 2VASA 4FW2A 9ATCB 2HSPA 4N0AA 4OB2B 4XK8E 1AWXA 2PTKA 1UHFA 2VKNA 3UF4A 3P8BB 4O5VA 4OMFB 2BE9B 2Y4XA 1FMKA 1WLPB 2A7YA 3OYYA 1FMVA 2M0YA 3JAME 2WACA 4ANJA 2R5MA 1PSEA 4PJLA 4J9IA 2K3BA 3VRZA 8AT1B 4C92B 4M7AF 1KQSP 4M7DG 3CMAA 1Q86C 2DAQA 1VQNA 2RQTA 3HKSA 4KGXB 4BI8B 1I07A 2EJFA 4KUDK 5GMKi 2EQUA 2E1HA 2RM4A 4ESRA 3NHNA 1QMCA 2KBTA 1YWPA 5IT9E 3X24B 1H92A 4C8QF 3CCRA 3U23A 3GBQA 4CC7A 3FEOA 2DXTA 2MCNA 1YITA 2E41A 3CBOA 3CCMA 4DBRA 4ME7A 2KYMA 3H6ZA 1Z9QA 1IREB 4ZN1A 3CCUT 1LPLA 4JRPA 2YRDA 2DM1A 3OMCA 3A1PA 4FIBA 3QJYA 5GAOm 2DEQA 1YJWA 2FVUA 1D0YA 1MV0B 1YIJT 2K3XA 2NUZA 1EIFA 3I9QA 4RCCA 3C4SA 2QQRA 2ZPIB 2KT8A 3QHSA 1M3CA 2DL3A 1WA7A 4HA8A 1G2BA 3SDZA 1MNEA 4C92F 4LUDA 2RA2A 1QP2A 3REAB 1JB0E 1N8RU 2YRCA 1RACB 4HCBA 4E2FB 2SEMA 3FB9A 4QKUA 2O01E 3NTHA 2F2VA 1WNLA 2GBQA 1K76A 4HVWA 2X51A 1OULA 4KH0B 2MOXA 3JCMQ 2IVWA 1YJ9T 2YT6A 4F7UF 1UJYA 2RHIA 3CPWS 2EBPA 1VQ5T 4FYVB 2AHJB 2ED1A 2RF0A 3E9FA 4BE2A 2D6FA 1YI2Q 4QQ6A 1QQJA 5HY6A 2V1RA 2HNIA 1VQ4T 4RTTA 1HD3A 5FWCA 3TVTA 3KUFA 2PUOB 1VQMT 3OYJA 1N8RR 1NE8A 3CCUA 3EGXB 3CCLQ 4F7UA 4M7AC 2W10A 4PLIA 3BFMA 4OF1A 3V8LA 3ZL7C 2O4XA 3QKJA 3URGA 2KEAA 3QWXX 1ZUUA 1QW1A 2CP5A 2LNHB 1BBZA 2W0ZA 1M90R 1CSKA 5A0DA 1FYNA 1YIJA 1PC0A 3I56T 4MDWA 1VQOT 5A0LA 4C8QC 1S1NA 3ULRB 1AOJA 1WZOA 1Y96A 2RJFA 3J80E 3OYDA 3I55T 1ABOA 2HKNA 5KYUA 2XIDA 2DIGA 1VQ4Q 3EG3A 2B86A 3A5ZB 1GBRA 1PWTA 1W2BS 1FX7A 3VJPA 2PZ1A 1WHLA 4BE0A 4M7AE 1IGUA 2CP6A 3TSWA 3HHTB 3JB9J 3GP8A 4QVCA 4JLGA 1YJ9A 5GANf 3S3MA 5CO7A 2V8KA 1K73U 2VUBA 3OA6A 1W70A 2O88A 2LJ1A 2MF2A 4M75G 1VQ5A 5LJ5e 1OI1A 1N27A 3JCMV 3RMSA 4QVZA 4C8QE 3NTIA 2R57A 3MP8A 3LWIA 1QVFA 4C92C 1W1FA 3GF5A 1VYVA 1ZUYA 3I56Q 1VQOQ 5I21A 2CUDA 5GANh 4HCZA 1YWOA 3I55Q 1GL5A 1K1ZA 4PLLA 1NEGA 2E10A 1VQMA 3LX7A 1VQ7Q 3CD6T 3PVLA 4HXJA 1QKXA 2QEXQ 2DRMA 5IHIA 3PFSA 5I2MA 3QG1A 5GANj 1MMNA 5C0MA 4Z89A 4OMQA 3WVDB 1XOVA 3CCQT 4M7DB 2XDDA 3SWNB 1UGQB 2E70A 2GGRA 3RNJA 2HMAA 3THKA 1VQLT 2EQMA 3GIBA 1AEYA 1VQOA 3CC4T 3FJPA 2RH2A 5HK3A 1RLQC 2KXCA 1TS9A 4C92E 1AD5A 4AMCA 1EFNA 4EMKB 1PD0A 2O9VA 1PKSA 1OEBA 3RR6A 5IXBA 3S3OA 4F17A 2BUDA 3OYFA 2QTXA 2XMFA 1ZBXA 1NJIU 2J6FA 3CMEQ 1Y07A 4RMOA 2HBWA 2D8HA 1VYTA 1X6OA 2AKLA 4JJCA 3AHUA 3M54A 2Y90A 1WQWA 2KK4A 2MWOA 1T0JA 4ZTJA 1OZ2A 2L3SA 4XQ3A 2OAUA 5GAOq 2GTOA 3VS4A 2FO0A 3FDRA 5D6XA 3MPUB 5I22A 3CC4Q 1KJWA 2RNAA 1X01A 2DRKA 2EWNA 1Y0MA 3OYCA 2KRMA 1I5LA 2DX1A 2LX7A 3R6OA 5D7UA 1KD1U 4M7DF 3Q1JA 3CD6A 3VU3C 2X4JA 4BI4A 3VKIA 3G4SQ 4NL2A 3MO8A 1JXOA 2EGEA 1UDLA 1G3WA 3CCQA 2ESWA 1H3HA 1QVGS 4Z8AA 1VQLA 3CC4A 2LX9A 3RKYA 3SD4A 2JZ2A 1SG5A 2AKKA 3OSSC 1M1KC 1WXBA 4M7DA 4FL6A 3SWNA 3PMIA 3CCST 4JRQA 2NLUA 1YHQQ 2KE9A 1IB8A 1QVPA 1JJ2P 2HBPA 1KSWA 1G8XA 3EGDB 3VS2A 1T3LA 2ROLA 4GY5A 2EQKA 3HPWA 2YDLA 2KXDA 1MGQA 4EDUA 2NUPA 3CCVT 2EYYA 5GAOp 4O6JA 2AZSA 2HDAA 2QQBA 1D1AA 1WPYA 2COWA 3EFRA 1M2VB 4FT2A 1QKWA 5FRMA 4OGCA 5HCKA 4F7UG 2DLPA 1KC8C 2DFUA 2LCLA 1OX9A 1VQ8T 1Q82C 1M1FA 3A8MB 2CP0A 4FYWB 1NYGA 4JDSA 3RUXA 1BCMA 4HT9A 3A8OB 2A37A 3CCSQ 3CC2Q 2EPDA 4M78G 4QQGA 2DKGA 3L2RA 3CBMA 3M57A 3DLMA 3KXTA 4J9BA 3HFOA 3BY7A 2VV5A 3LH5A 3CCVQ 4FSSA 3JB9G 4FT4A 4B9XA 4HVVA 2QA4T 4RCBA 1SF9A 2E6NA 2JUFA 3MEWA 1C1AA 2GFAA 2EQIA 3S3NA 1Q81C 4J7FA 4BY6B 2RPNA 3CCET 2R5AA 4L59A 1D3BB 1RLPC 2GTJA 3P8DA 4PNOA 3L2VA 1VQ8Q 3CCSA 2JVVA 2E3IA 4M7DC 3SWNC 1VQ6Q 1FWZA 2CH4W 2LCSA 3I35A 3QYHB 2JTMA 2QGGA 4E7ZA 2HD0A 3G1JA 1YP5A 4WF2A 5FU7C 3M4GA 2D0NA 5DY9A 2D0QB 3CCVA 4RG2A 2RI2A 4J9EA 4A54A 2YXYA 3EGDA 4EMKC 5CKHA 4X9CA 1BKBA 1Q7YC 1BI1A 1BI0A 4MZPA 4XTUA 4JJNK 4C8QD 4DOWA 2C0IA 2E64A 1WGSA 1T0HA 4MMKA 4FW1A 2KDSA 2ZPBB 1PRMC 1U5SA 2ZCFB 4KGVB 5IH2A 1S72Q 3X25B 3L2QA 3CC7A 1RABB 4C5IA 2JTEA 2FRWA 1B34B 2COYA 2DJQA 2RHUA 1PHTA 2AT1B 4E6RA 4NS5A 1Q95G 1OX8A 3UPUA 2IPOB 2EYXA 3CCJQ 2LJ0A 5GAOn 1KHCA 2P0PA 2LQ8A 3LLRA 1VQNT 1BI2A 4M75F 4AFZC 2VYTA 3VS3A 1QP3A 4EPCA 1TUDA 2QA4A 2M16A 5GJWB 4Y28E 3HSBA 1KQ1A 2PVOB 4LXCA 4QT7A 2L3PA 3N5BB 4M4ZA 1JO8A 1FXXA 3CCEA 2ECZA 1VYUA 1M8MA 1WHJA 3JCMW 1WHMA 1HJDA 3QYGB 3CCMT 3AT1B 2CSIA 1MMDA 1B07A 4M75A 1ZX6A 4R56A 1K8AC 2C0TA 4LE9A 1SPKA 1YN8A 3NGPA 2PVGB 4AFUC 2ROTA 1KC8R 1BIBA 4JJDA 3CMAQ 1U8RA 1UFFA 3GNFB 4BDYA 1VQNQ 5DM7R 1M8VA 1RAGB 4EIKA 1K4US 1WI7A 3JCMX 4RG8A 3A8GB 2KROA 2DPPB 2DEUA 2X4XA 2BZYA 1NEBA 2HKQB 1LOJA 3FRNA 4ELZC 3CCRQ 1NG2A 2LP5A 5GAMf 3FC3A 1YITQ 3OMGA 2DD5A 3UDCA 3C12A 3CCMQ 1OYXA 2V8JA 4DA4A 1ZSZA 1M30A 1CKBA 2GFUA 2DD4A 2H3JA 3F70A 2RQRA 1B34A 2MMPA 2ZGWA 1VOMA 3JCMf 3ZBDA 5LL6S 5EG2A 4C5GA 2CKKA 1WXTA 1Z9ZA 2JM9A 2KY9A 1YJWQ 2RQWA 2A0FB 3SFMA 1N9RA 4PJOD 2DBKA 2WSFE 1BYMA 6AT1B 2LVMA 2EGCA 4F14A 1WJSA 2F2WA 3M5AA 4UC4A 4F7UB 1WHHA 2XU8A 3UWNA 2HCKA 1QLYA 5GAMj 2O4XB 2FL7A 5I11A 4N4HA 1X6BA 4ZGJB 3RESA 3QIIA 3BW1A 1JBMA 2CZ6B 1QVFS 4BY6C 4XU3A 4M75C 3M0PA 3PIPA 1UE9A 1Y96B 1V29B 5KYUB 2VVKA 4TVRA 2PNIA 2YUOA 2LQNA 2ZPHB 2ENMA 2J05A 2HQXA 2MWPA 1F1BB 3C0CA 2DXUA 3OYEA 5FWBA 4XU2A 4N0AC 3JB9H 5GMKe 4PKCC 2EIFA 4JS4A 3C94A 2LQKA 1U3OA 5LJ5g 1GCQA 1H641 1TH7A 4JUVA 2VXFA 1G3TA 5AT1B 1RAAB 3KFVA 1NM7A 1SRLA 3CCUQ 1JJ2A 2MAMA 1TG0A 1M90U 1RAIB 2AZVA 4PFOA 2DETA 4L6V5 1PKTA 1UECA 3V7CA 4A4FA 2JMAA 2OTLT 2KT1A 3EG9A 3RERA 4RTWA 1KHIA 2JOYA 3MP1A 2KRSA 1YIJQ 1YCYA 4QQDA 2XI9A 3X26B 2KNBB 4M78F 1K8AR
chains in the Genus database with same CATH topology
1N8RC 2QTXA 1Q86U 2WSCE 2RJCA 3M56A 3VYGA 1ZBXA 3MEVA 1NJIU 1M5Q1 2KVQG 3M58A 3QO3A 1Y07A 4ELYC 4RMOA 2DIQA 3S6WA 2EQJA 2FYKA 5KCHA 1X6OA 3JB9F 2MI6A 3A8HB 2F5KA 3AHUA 2DJZA 2CZ0B 4V2SA 3HL8A 1VIEA 2Y90A 1WQWA 3M54A 2DTOA 2EFIA 1M90C 2KK4A 2MWOA 2GCXA 5GAN2 3L42A 4MZMA 5FU6C 1S72T 2OTJT 4MMLA 4ZTJA 1OZ2A 4E7JA 2CGHA 5LJ3f 1M1GA 5GANg 2ZPFB 4M77A 4JRKA 4XQ3A 2LRQA 3GPLA 3L2ZA 4JRIA 2OAUA 4KBMB 5GAOq 5GAMh 3QUIA 5FROA 3FDRA 4M78A 5D6XA 4Q5WA 1M1KU 3CC2A 1JRIA 2CS7A 2M0OA 1X01A 3WVEB 2EWNA 4LDUA 4CI0C 4C0FA 3OY9A 3OYCA 3OBYA 3SB2A 3JSCA 3META 2XDPA 5LJ3h 1LNXA 3JB9I 3V7SA 4MZTA 3J81E 4IURA 3CCJT 1I5LA 3R6OA 4IUQA 1KD1U 4M7DF 3Q1JA 3JCMh 3CD6A 3LH0A 3VU3C 3QSUA 2X4JA 3E9GA 4C5HA 2K4YA 4BI4A 4QVDA 4E7IA 1KQ2A 2XK0A 3VKIA 2LC4A 5CIUA 1KQSS 4A4EA 2DXCA 2X4YA 2PUKB 1YBYA 4NL2A 2YLBA 3M55A 2FHDA 3X20B 5LJ5d 2QXFA 4ATOA 2JN0A 4M77B 3MO8A 4XTVA 5GAN7 4Y91A 1UB4A 2ZPEB 2K5IA 3LGLA 2YRVA 2DXBA 2L3RA 4NOYA 3M53A 1G3WA 5LJ3j 5CVIA 3CCQA 2KQWA 1QVGS 3OW2S 4M78B 2XICA 1VQ8A 1VQLA 3CC4A 2LX9A 3RKYA 3SD4A 2OTLA 1U1TA 1VQ6A 3L2WA 4M7AA 5GAN8 2JZ2A 1XNIA 5CK9A 3OSSC 3RKXA 1M1KC 2RHZA 4M7DA 4FL6A 4KUIA 3SWNA 4QW2A 3PMIA 2V8IA 2WSEE 1HK9A 3CCST 3HRSA 4JRQA 2LCCA 2NLUA 3P8HA 2LTOA 5A0GA 1QVPA 1QVGA 2HBPA 3OW2A 5GAMe 2RK1A 4IKFA 3V8KA 1LJOA 4LDVA 4XU1A 3ME9A 3OS5A 4KT0E 4N4IA 4YTLA 1K8AU 4GY5A 3M59A 2EQKA 3OYKA 1KD1C 3HPWA 4P5NA 4HT8A 4VUBA 1VQ9T 5J3BA 1MGQA 3CMAT 1WJRA 4EDUA 3HRUA 2JTFA 2VXEA 5KH6A 3CCVT 5GAOp 2B8AA 1YI2T 4O6JA 2P0KA 4C8QA 4PJOA 5CQXA 3QBYA 3RKWA 1RI0A 4OP0A 3JCMe 2QQBA 4NL3A 4E7HA 1NPPA 4LDYA 1WPYA 4JS5A 2XDBA 2RHXA 3CBPA 3EFRA 1NZ9A 2Y4YA 4XU0A 3OYIA 3A8LB 2M9UA 1S72A 2L89A 4FT2A 2OTJA 2DK3A 4M75E 2LT4A 3CEYA 4OGCA 4PL6A 4M7AB 4E7KA 3M4YA 2RHYA 5FRMA 1K73C 4F7UG 4FSXA 2G3RA 3VUBA 3DKMA 3CCRT 1KC8C 1N6AA 4L5GA 1Q81U 5M9OA 2LCLA 5LJ3g 2QI2A 5I2SA 3OYHA 3OQ5A 5KCOA 1VQ8T 3CCLT 5FU7B 1YITT 4M77D 1Q82C 1M1FA 3A8MB 4ZN3A 5GANd 3DB3A 5CAIA 4II1A 4JDSA 3L2UA 3OS0A 3RUXA 4M78C 5L8RE 2F5TX 1IZ6A 4M77F 2KAFA 4M78D 1XQHA 4HT9A 3A8OB 3CCJA 1X75C 4D6WA 3TU4K 3OYNA 4C8QB 4EMHA 2DTIA 1D3BA 5IN1A 5FLXE 4PJOB 4IUTA 4M78G 4QQGA 3OS1A 2CZ1B 2DKGA 3L2RA 2X35A 3CBMA 2XKOC 2E12A 3M57A 3DLMA 4ZGDB 3M9QA 5GANe 4J5YA 3KXTA 3JB9D 3HFOA 4FU6A 4X9DA 5GAOl 1YJWT 1MHNA 3BY7A 3MCAB 4JLIA 3MP6A 2VV5A 3HFNA 4C92A 1Q7YU 3MEUA 2RJDA 3GLXA 3JB9G 3EAEA 4FT4A 4B9XA 5D6YA 4F7UE 2QA4T 4ZGEB 3QPHA 4N0AA 4OB2B 3O8VA 4RCBA 4XK8E 2E6NA 2JUFA 3MEWA 3OYAA 2VC8A 2GFAA 3P8BB 4O5VA 4OMFB 3S3NA 1Q81C 4J7FA 4BY6B 2Y4XA 3PT9A 3CCET 2A7YA 2R5AA 3G71T 2RK2A 3OYYA 1ZHIA 4EMGA 4L59A 1D3BB 4PNOA 4XTZA 3P8DA 3L2VA 3G6ET 3JAME 2WACA 3CCSA 1W4SA 2R5MA 2JVVA 3T9NA 4LDWA 4XTWA 4XAXB 1PSEA 4CRIA 4M7DC 3QJ6A 4B9WA 3SWNC 1FWZA 4XTYA 1GXIE 4M7DD 3QYHB 5KE3A 3CPFA 2JTMA 5AYFA 2HD0A 4WF2A 4C92B 1VQ9A 4M7AF 5FU7C 4M7DG 3M4GA 3C95A 3ER0A 3CMAA 1K9MC 1Q86C 5CCAA 2P0QA 2D0QB 2P4TA 5DY9A 4E47A 3CCVA 2DAQA 3JCMJ 4RG2A 2F69A 2K3YA 1YI2A 1NJIC 2RI2A 1VQNA 1I8FA 4A54A 2E6ZA 4C0GA 3HKSA 4EMKC 5CKHA 4X9CA 1BKBA 4BACA 4BI8B 1Q7YC 2PVDB 1SSFA 1BI1A 2EJFA 2LT1A 1BI0A 4KUDK 4MZPA 5GMKi 5GMKh 2EQUA 4XTUA 2E1HA 2RM4A 4C0DC 4C8QD 4DOWA 5A2QE 1M4ZA 4JJNK 4E7LA 3VUZA 5IAYA 2GQVA 2BIVA 2E64A 1WGSA 2EJ9A 1ZQ1A 4MMKA 3VYHB 2KDSA 5CKFA 3VV0A 3X24B 5IT9E 1VQ7T 4C8QF 5GAMd 3CCRA 4PJOF 2ZPBB 3OYLA 2LNVA 1KQSA 2ZCFB 3CCLA 3FEOA 2DXTA 3X25B 1YITA 3L2QA 2QEXT 3CC7A 2E41A 3CBOA 4A4GA 3QZ9B 4C5IA 4KULA 2GF7A 5GMKm 3CCMA 4ME7A 5GMKj 3H6ZA 1IREB 4ZN1A 5LJ3d 3CCUT 3TEEA 1B34B 4OB0B 2PQWA 1Y7XA 3JCMd 4JRPA 4A4KA 3G7ZA 3INZA 2RHUA 4NS5A 2FB7A 5D6WA 3OMCA 4C0ZA 3UPUA 3NTKA 2DTHA 2K2VA 1UGRB 2CZ7B 4FIBA 3QJYA 5GAOm 2DEQA 2QDYB 1YJWA 4IUVA 5GAOn 2P0PA 1KHCA 2FVUA 3OBWA 2LQ8A 3LLRA 1VQNT 1BI2A 1XTDA 3NFCA 4M75F 5LJ3e 1HXDA 1YJNT 2VYTA 3J7AF 1QP3A 1YIJT 4EPCA 5GAN4 2K3XA 1EIFA 4IUPA 2QA4A 4RCCA 1VQ4A 3C4SA 3MEAA 2M16A 3QZ5B 1KG1A 2QQRA 2ZPIB 4Y28E 2A3LA 3PNWC 3QHSA 5CR2A 1VQPT 3HSBA 1KQ1A 2PVOB 4HA8A 3N5BB 3MHXA 2M1HA 4HCCA 3SDZA 3CMET 2HAXA 4C92F 1FXXA 3CCEA 4XTXA 2RA2A 2XG8D 1QP2A 1JB0E 3G71A 1N8RU 1OZ3A 3HRTA 4M77C 4N4GA 4HCBA 3EFSA 5FU6B 3G6EA 3FB9A 4J6XA 2I2LA 1VQKT 3JCMW 3CC7T 4FM4B 3QYGB 1UGPB 3JCMb 3CCMT 2O01E 2ZZDA 3NTHA 4M77G 1WNLA 3GNGA 4M75A 4R56A 1K8AC 3JCMQ 1DJ7B 2IVWA 3KBGA 3TREA 1YJ9T 4MDXA 3PTAA 3OB9A 2XD0A 1WQ7A 1BIAA 4F7UF 3E1SA 2PVGB 2VGNA 2RHIA 3CPWS 3I56A 1BIBA 3JCMP 1VQ5T 2AHJB 3V7RA 1U8RA 3E9FA 4BE2A 2D6FA 3GNFB 3JRZA 4LD9K 4QQ6A 4BDYA 5DM7R 1M8VA 3UT1A 2D9TA 1N9SA 3LW5E 2HNIA 5HY6A 3I55A 1VUBA 2EKOA 3OYMA 2QQSA 4A53A 1VQ4T 3JCMX 3PIOA 1UGSB 1VQ7A 4RG8A 3A8GB 3QXEB 2DPPB 2RI5A 2X4XA 3RMQA 4ELZC 1LOJA 2LDMA 2EYQA 3FRNA 3KUFA 5LJ5f 3CPWA 2PUOB 2QEXA 3G4ST 4IUUA 4RKUE 4M77E 4M75B 3LGFA 2K57A 4R55A 1VQMT 5HKCA 3OYJA 2YLCA 1NE8A 3CCUA 5GAMf 4J6WA 3FC3A 2KSSA 4M7AC 4F7UA 4M78E 4PLIA 4M7AD 3OMGA 3BFMA 3ASKA 2DD5A 4OF1A 3UDCA 3C12A 3V8LA 2K5LA 2O4XA 3QKJA 1OYXA 2V8JA 3URGA 4DA4A 5LJ5h 4M7AG 1O9SA 3DB4A 1QW1A 4BD3A 2GFUA 2DD4A 2H3JA 3F70A 1B34A 2MMPA 5CKBA 2ZGWA 1YJNA 1U1SA 3JCMf 3ZBDA 5LL6S 5A0DA 5EG2A 4C5GA 3GOXA 2DZ9A 2CKKA 4OGEA 1YIJA 1YHQT 4LD6A 4X34A 3I56T 4MDWA 1VQOT 5A0LA 4ZTFA 2KY9A 4C8QC 5CKEA 4PJOC 4BI3A 2DVEA 5GAOr 4A4HA 1Y96A 2RJFA 3J80E 3SFMA 3OYDA 1N9RA 3QDRB 1VQPA 4PJOD 2WSFE 3I55T 1WJQA 1BYMA 5GAN5 2DZCA 2LVMA 4OB1B 5LJ5j 5J39A 4C8QG 3CMEA 1WJSA 4PJOG 2XIDA 2YHTA 2DIGA 3M5AA 4J8OA 2BKDN 4BB7A 4UC4A 4F7UB 2EAYA 4OB3B 2XU8A 3UWNA 4DOVA 3OSVA 3A5ZB 3CXCS 5GAMj 4BE1A 2O4XB 1W2BS 1P92A 1VQKA 1FX7A 3VJPA 5GAN3 5J26A 2FL7A 2X4WA 4BE0A 2QQ9A 2ZPGB 4M7AE 1UEBA 4C5EA 1VIFA 3FIFA 1O75A 2E5QA 4N4HA 2C06A 4ZGJB 3HHTB 3JB9J 4M7DE 3RESA 2VGMA 3QIIA 3LWHA 3BW1A 1JBMA 2CZ6B 5C6SA 3GP8A 1QVFS 4BY6C 5GAN6 1R8OB 3RIRA 4JLGA 4QVCA 3OYFA 1YJ9A 4HKEA 4M75C 4XU3A 5GANf 4M75D 3PIPA 3V8JA 3CXCA 5CO7A 3S3MA 5FRNA 2V8KA 2XHCA 1RL2A 2VUBA 3HP9A 5CQYA 4DQ2A 1Y96B 3OA6A 1W2BA 1K73U 1KC8U 2PU9B 1G3YA 2MF2A 4M75G 1VQ5A 5HK0A 5LJ5e 1OI1A 1V29B 2CYZB 2RI3A 5DLOA 1N27A 3JCMV 4TVRA 3RMSA 4QVZA 1Q82U 4C8QE 2RD1A 3BDLA 2R57A 3MP8A 3NTIA 3LWIA 1QVFA 4PJOE 4GLKA 4C92C 3BDUA 3GF5A 2ZPHB 3CC2T 5I21A 2HQXA 4C92D 2MWPA 5GANh 3DLLA 2DXUA 3OYEA 4HCZA 1H3ZA 3TCJA 4XU2A 4LDXA 2L5QA 4N0AC 4C92G 3JB9H 5GMKe 4PKCC 2EIFA 4PLLA 3X28B 5KE2A 3C94A 3G4SA 4JS4A 3OYBA 1JJ2S 2LQKA 2E10A 5LJ5g 4EMKA 1VQMA 3LX7A 3CD6T 1H641 1TH7A 4BDZA 4JUVA 2VXFA 1G5VA 1G3TA 4Z02A 3OS2A 3JCMc 3E19A 2HQEA 5GAMg 3OYGA 4OVAA 2KMTA 3PFSA 2RB6A 5I2MA 3QG1A 2RO0A 5GANj 1Y71A 4J83A 5C0MA 3ZEHA 1K9MU 1I4K1 1JJ2A 2MAMA 2QQAA 1I81A 3WVDB 2IG0A 1XOVA 1M90U 3CCQT 4M7DB 2XDDA 3SWNB 1UGQB 2E70A 1AHJB 2K5FA 3PGGA 4J7IA 1BI3A 4L6V5 1VQLT 2EQMA 3GIBA 1M9SA 2E65A 1YHQA 1VQOA 1NPRA 3CC4T 3FJPA 3WXMB 3JCMg 3V7CA 2RH2A 4A4FA 2RJEA 4BUGA 5HK3A 2OTLT 1VQ6T 3LYIA 3RERA 2R58A 1KHIA 2JOYA 3MP1A 5GMKl 4C92E 4J6YA 2DO3A 4EMKB 2EJGA 1YCYA 4QQDA 3H8ZA 2XI9A 3PMTA 2JNGA 3L1AA 3S3OA 5DLQE 3X26B 5CKDA 1PSFA 2L8DA 4C0DB 3ZFJA 2BUDA 1G3SA 4M78F 3FLGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QTX A;  1B34 B;  4M75 E;  4M7A B;  1M5Q 1;  3JCM d;  4C8Q C;  4F7U G;  4PJO C;  3QO3 A;  2DVE A;  5GAO r;  1Y96 A;  3INZ A;  4PJO D;  1N9R A;  5LJ3 g;  2FB7 A;  5GAN 5;  2DZC A;  2FYK A;  5LJ5 j;  2DTH A;  4M77 D;  3JB9 F;  4C8Q G;  4PJO G;  2YHT A;  5GAO m;  2DEQ A;  5GAN d;  5GAO n;  3AHU A;  2DJZ A;  5CAI A;  4V2S A;  4F7U B;  2Y90 A;  1WQW A;  2EAY A;  2DTO A;  4M75 F;  5LJ3 e;  3RUX A;  1HXD A;  4M78 C;  5GAN 2;  4M77 F;  4M78 D;  4MML A;  5GAM j;  5GAN 7;  5GAN 4;  4HT9 A;  2CGH A;  5LJ3 f;  5GAN g;  4M77 A;  4RCC A;  4JRK A;  4XQ3 A;  4C8Q B;  4EMH A;  2DTI A;  1D3B A;  5GAN 3;  4PJO B;  4M78 G;  3L2Z A;  3QHS A;  4JRI A;  2DKG A;  5GAO q;  3HSB A;  1KQ1 A;  4M7A E;  3FIF A;  5GAM h;  4M7D E;  4HA8 A;  3JB9 J;  3RES A;  3QUI A;  4M78 A;  3BW1 A;  1JBM A;  4J5Y A;  5GAN e;  1JRI A;  4C92 F;  3HFO A;  5GAN 6;  4X9D A;  4XTX A;  3RIR A;  2RA2 A;  4QVC A;  5GAO l;  4XU3 A;  3BY7 A;  4M75 C;  3JB9 D;  4JLI A;  1X01 A;  3HFN A;  5GAN f;  4C92 A;  2EWN A;  4M75 D;  4M77 C;  3V8J A;  3EFS A;  3JB9 G;  4DQ2 A;  1Y96 B;  3SB2 A;  3FB9 A;  4J6X A;  5LJ3 h;  2I2L A;  1LNX A;  4F7U E;  3V7S A;  3JB9 I;  3JCM W;  1I5L A;  4M75 G;  3JCM b;  4N0A A;  5LJ5 e;  4M7D F;  4RCB A;  3JCM h;  4M77 G;  3JCM V;  3VU3 C;  3QSU A;  1WNL A;  2VC8 A;  4M75 A;  4QVD A;  4C8Q E;  2RD1 A;  4PJO E;  1KQ2 A;  4C92 C;  3BDU A;  3JCM Q;  5I21 A;  4C92 D;  4NL2 A;  2YLB A;  5LJ5 d;  5GAN h;  1WQ7 A;  2DXU A;  1BIA A;  2JN0 A;  4M77 B;  4XTV A;  4EMG A;  4Y91 A;  1D3B B;  4PNO A;  4XU2 A;  4XTZ A;  4F7U F;  4N0A C;  4C92 G;  3JB9 H;  5GMK e;  4XTW A;  4NOY A;  5LJ3 j;  1BIB A;  3JCM P;  4M7D C;  2E10 A;  5LJ5 g;  3SWN C;  3V7R A;  4EMK A;  4XTY A;  4M78 B;  4M7D D;  1H64 1;  1TH7 A;  1M8V A;  4JUV A;  2VXF A;  1N9S A;  2HNI A;  4WF2 A;  4A53 A;  4C92 B;  4M7A F;  3JCM X;  4M7D G;  3M4G A;  3RKY A;  3JCM c;  1U1T A;  5DY9 A;  5GAM g;  4M7A A;  5GAN 8;  3JCM J;  2RB6 A;  3RKX A;  5GAN j;  4M7D A;  1I8F A;  3SWN A;  1LOJ A;  4A54 A;  5LJ5 f;  4EMK C;  4X9C A;  1HK9 A;  1I4K 1;  1I81 A;  2EJF A;  4M77 E;  4M75 B;  5GAM e;  4M7D B;  2K57 A;  3SWN B;  5GMK i;  3V8K A;  5GMK h;  1LJO A;  4XTU A;  4XU1 A;  2E1H A;  2RM4 A;  2YLC A;  4C8Q D;  3PGG A;  5GAM f;  4J6W A;  2E64 A;  3GIB A;  4M7A C;  2EJ9 A;  4F7U A;  2E65 A;  4HT8 A;  4MMK A;  4M78 E;  3FJP A;  1MGQ A;  3JCM g;  3V7C A;  4M7A D;  3BFM A;  2VXE A;  3V8L A;  4C8Q F;  5GAM d;  4PJO F;  5GAO p;  3RER A;  5GMK l;  4C92 E;  5LJ5 h;  4J6Y A;  4C8Q A;  4M7A G;  4EMK B;  4PJO A;  2EJG A;  2DXT A;  3RKW A;  1YCY A;  3JCM e;  4OP0 A;  4NL3 A;  1WPY A;  1B34 A;  3L1A A;  2E41 A;  3EFR A;  2ZGW A;  5GMK m;  4XU0 A;  1U1S A;  3JCM f;  5GMK j;  4M78 F;  5LJ3 d;  2DZ9 A; 
#chains in the Genus database with same CATH topology
 1Q86 U;  2HZY A;  3M56 A;  2F2X A;  1WDX A;  3MEV A;  3M58 A;  2L2P A;  1IHW A;  3S6W A;  2FYK A;  5KCH A;  3JB9 F;  3QWY A;  1IXD A;  1OU8 A;  1E6H A;  7AT1 B;  2EFI A;  2COZ A;  5GAN 2;  3EFO A;  3L42 A;  2OTJ T;  1TUC A;  4IIO A;  1M1G A;  4M77 A;  4JRK A;  1YJ9 Q;  5KYX A;  4KBM B;  4GBQ A;  4LUE A;  4M78 A;  1IO6 A;  1JRI A;  1VQ5 Q;  2M0O A;  1X6G A;  3WVE B;  3CXC P;  1CKA A;  3A98 A;  3SB2 A;  3MET A;  2XDP A;  2VB6 A;  1LNX A;  2KYB A;  3V7S A;  4MZT A;  3J81 E;  4IUR A;  4PJN A;  1FMW A;  4E7I A;  1KQ2 A;  1Q86 R;  2LC4 A;  1GCQ C;  1I0C A;  1ZSG A;  1KQS S;  2X4Y A;  1AZG B;  2YLB A;  1VQM Q;  4HVU A;  4XTV A;  5GAN 7;  2ZPE B;  2YRV A;  4JZ3 A;  2KQW A;  3VRY A;  2DL8 A;  2J6K A;  2FG0 A;  1OV3 A;  2OTL A;  1U1T A;  3L2W A;  1XNI A;  1GBQ A;  2RHZ A;  2F1L A;  2MK5 A;  2NWM A;  3HRS A;  2LTO A;  5A0G A;  4X1V A;  4LDV A;  1PRL C;  4YTL A;  4D8D A;  1T3S A;  1KD1 C;  4HT8 A;  2YWW A;  2O31 A;  5J3B A;  1VQ9 T;  3HRU A;  2VXE A;  5KH6 A;  1ZBJ A;  2K9G A;  3NMZ C;  1EZZ B;  4PJO A;  5CQX A;  2QDL A;  1NBE B;  1LVK A;  1RI0 A;  4NL3 A;  4E7H A;  1NPP A;  4JS5 A;  1M27 C;  3OYI A;  1TU0 B;  1MUZ A;  2OTJ A;  3CEY A;  3R6N A;  4E7K A;  2RHY A;  1J3T A;  1I5O B;  2RQV A;  4FSX A;  2G3R A;  4WCI A;  3VS6 A;  3M0T A;  5LJ3 g;  2QI2 A;  3OQ5 A;  5KCO A;  2CDT A;  5FU7 B;  2OX7 A;  4II1 A;  2FEI A;  3L2U A;  4M78 C;  1EX4 A;  1IZ6 A;  5GJV B;  2KAF A;  2NUP B;  1XQH A;  4D6W A;  3OYN A;  2HEQ A;  3OS1 A;  4FYX B;  1BK2 A;  1UJ0 A;  4ZGD B;  4FU6 A;  4X9D A;  5GAO l;  1K0S A;  1ARK A;  2SRC A;  3HFN A;  3TQ7 P;  3CD6 Q;  4RTV A;  1R0C B;  5D6Y A;  2CT3 A;  4F7U E;  2LMJ A;  3O8V A;  3OYA A;  4PJJ A;  3BE3 A;  3H9N A;  3CCQ Q;  3G71 T;  2RK2 A;  1ZHI A;  3G6E T;  1VQL Q;  1W4S A;  4XTW A;  4B9W A;  4J9C A;  4XTY A;  5KE3 A;  3CPF A;  2CT4 A;  1VQ9 A;  1K9M C;  3C95 A;  3ER0 A;  5CCA A;  2EVR A;  2P0Q A;  2P4T A;  2FPE A;  4E47 A;  2K3Y A;  1I8F A;  2E6Z A;  4C0G A;  1GFC A;  4DBH A;  2LT1 A;  3M0Q A;  3OW2 P;  2M02 A;  4E7L A;  2HQH A;  2YUN A;  3FJ5 A;  1D1B A;  2K2M A;  3VUZ A;  5IAY A;  2BIV A;  2EJ9 A;  1VA7 A;  4DEX A;  3SHW A;  3VV0 A;  5GAM d;  1IHV A;  4LNP A;  1KQS A;  2DMO A;  1SHG A;  4A4G A;  3QZ9 B;  5GMK m;  2GF7 A;  4OMM A;  4AFQ C;  4OB0 B;  2PQW A;  1Y7X A;  3JCM d;  2QAS A;  3INZ A;  2DBM A;  2DYB A;  3NTK A;  2CP3 A;  1UGR B;  2CZ7 B;  3OBW A;  1YJN T;  5LJ3 e;  1QWE A;  2AK5 A;  1HXD A;  1JXM A;  1ZA1 B;  5GAN 4;  1WIE A;  3H41 A;  2YSQ A;  2DL5 A;  3MEA A;  4KH1 B;  3PNW C;  1UHC A;  5KYY A;  2O9S A;  2MIO A;  4HCC A;  2M1H A;  4IIM A;  4XTX A;  2XG8 D;  3G71 A;  1OZ3 A;  1R0B G;  3G6E A;  2A36 A;  2I2L A;  4AFS C;  1VQK T;  3CC7 T;  3H0I A;  1OQK A;  4FM4 B;  1UGP B;  1ACM B;  2CP2 A;  2VWF A;  4M77 G;  1TUG B;  3EHR A;  2CSQ A;  1DJ7 B;  4A63 B;  4MDX A;  1D1C A;  3PTA A;  4RUG A;  1RAD B;  2VGN A;  2HL5 C;  3JCM P;  3V7R A;  4Z88 A;  4LD9 K;  2KGT A;  1WHG A;  3UT1 A;  2JS0 A;  2EKO A;  3OYM A;  2K79 A;  1M2O A;  1UGS B;  3D7S B;  1R77 A;  4IUU A;  4RKU E;  4M75 B;  2K57 A;  2YLC A;  1MMG A;  1QWF A;  4J6W A;  2KSS A;  4M7A D;  3ASK A;  1AT1 B;  3CC7 Q;  2K5L A;  2D8J A;  1O9S A;  4BD3 A;  3VS0 A;  1M3A A;  5CKB A;  1YJN A;  1U1S A;  2DZ9 A;  3EHQ A;  1TOV A;  2QG9 B;  4X34 A;  5CKE A;  2GNC A;  1E7O A;  4AT1 B;  3QDR B;  5GAN 5;  4OB1 B;  5J39 A;  1V1C A;  4PJO G;  2YHT A;  2QA4 Q;  2FRY A;  2EAY A;  4DOV A;  3OSV A;  4BE1 A;  1K9M R;  2X9H A;  1VQK A;  1X27 A;  5J26 A;  1ZSZ B;  2X4W A;  2LZ6 B;  3CCE Q;  2QQ9 A;  2FPF A;  3FIF A;  1O75 A;  1KK7 A;  2C06 A;  4M7D E;  2VGM A;  3LWH A;  5GAN 6;  3RIR A;  2EYZ A;  4HKE A;  1XJW B;  5KYW A;  1QCN A;  3CXC A;  2JXB A;  1KC8 U;  1G3Y A;  1KFZ A;  1SRM A;  2KRN A;  3UA7 A;  2ZAE A;  3VS7 A;  2CYZ B;  2Z0W A;  1YNZ A;  1Q82 U;  3BDL A;  4GLK A;  3BDU A;  3H0H A;  1M1K R;  4C92 D;  3DLL A;  1H3Z A;  3TCJ A;  4ORZ A;  4RTY A;  1JJ2 S;  4Z02 A;  4FCY A;  3OS2 A;  1D0X A;  3E19 A;  4OVA A;  5EC7 A;  3ZEH A;  3EGU A;  3CPW P;  1I81 A;  2IG0 A;  1OPL A;  1AVZ C;  2K5F A;  1G83 A;  1M9S A;  1NPR A;  3EG0 A;  1D09 B;  1WYX A;  4BUG A;  1X2Q A;  4Y92 A;  3LYI A;  1RI9 A;  5GMK l;  4J6Y A;  4PFZ A;  4CC2 A;  1Q82 R;  1UGV A;  3PMT A;  2JNG A;  3E2U A;  5DLQ E;  2CUB A;  4C0D B;  4F04 B;  1G3S A;  5IHN A;  1N8R C;  2RJC A;  4K11 A;  1M5Q 1;  2KVQ G;  4J9H A;  1C0M A;  4OMO A;  2BZ8 A;  2F5K A;  2DJZ A;  2CZ0 B;  3HL8 A;  1AWO A;  1M90 C;  2EKH A;  2GCX A;  3EG9 B;  4MML A;  4E7J A;  2CGH A;  5GAN g;  2ZPF B;  4HCK A;  4RTX A;  2LRQ A;  3GPL A;  1ABQ A;  5GAM h;  1Q81 R;  1ZA2 B;  2L0A A;  2CRE A;  2DNU A;  3QUI A;  5FRO A;  2JMC A;  3EH1 A;  3EH2 A;  2IIM A;  4CI0 C;  4C0F A;  3OY9 A;  3OBY A;  1W2B P;  3JSC A;  1X69 A;  2YUQ A;  4IUQ A;  2JW4 A;  3JCM h;  3LH0 A;  3QSU A;  3E9G A;  1SHF A;  2K4Y A;  4QVD A;  1GCP A;  2XK0 A;  3EFO B;  2DXC A;  2PUK B;  2FHD A;  1SSH A;  5LJ5 d;  2QXF A;  2JN0 A;  4M77 B;  4Y91 A;  1Q7Y R;  2ABL A;  5KYX B;  2NYS A;  2DXB A;  4NOY A;  3M53 A;  1MND A;  4M78 B;  1RAH B;  1LCK A;  1BB9 A;  4M7A A;  5CK9 A;  3RKX A;  4KUI A;  2JS2 A;  4QW2 A;  1HK9 A;  2LCC A;  2OI3 A;  3OW2 A;  2RK1 A;  2CH4 A;  1LJO A;  3ME9 A;  3OS5 A;  4KT0 E;  4N4I A;  1K8A U;  3M59 A;  3OYK A;  4VUB A;  2JTF A;  1YI2 T;  2B8A A;  2DVJ A;  1U06 A;  4E7S A;  4C8Q A;  3QBY A;  3RKW A;  4OP0 A;  2XDB A;  2RHX A;  1TTH B;  1NZ9 A;  2M9U A;  2L89 A;  2DK3 A;  4M75 E;  4PL6 A;  3M4Y A;  3O5Z A;  1K73 C;  1K0X A;  1ZSZ C;  4JJB A;  3DKM A;  4L5G A;  5M9O A;  3OYH A;  3CCL T;  3TSZ A;  1RUW A;  3M0S A;  1WX6 A;  4RTZ A;  5CAI A;  2MPX C;  3OS0 A;  2OJ2 A;  4M77 F;  4OMN A;  4PFP A;  1X75 C;  2FZK B;  4EMH A;  4PJO B;  2DIL A;  5IN1 A;  2CZ1 B;  2XKO C;  2DF6 A;  2E12 A;  5GAN e;  1V76 A;  1X2K A;  4DBQ A;  1MHN A;  3MP6 A;  1TSF A;  4C92 A;  3MEU A;  2RJD A;  3GLX A;  3EAE A;  4ZGE B;  3QPH A;  4WTO B;  2VC8 A;  3JV3 A;  2BE7 D;  3PT9 A;  2O2O A;  4EMG A;  4XTZ A;  3T9N A;  4LDW A;  4XAX B;  1K9A A;  4CRI A;  3QJ6 A;  2OTL Q;  1GXI E;  4M7D D;  1MMA A;  5AYF A;  2H8H A;  2CP7 A;  1YI2 A;  3EG2 A;  3JCM J;  1NJI C;  2F69 A;  2MYS A;  2G6F X;  3M0U A;  4BAC A;  2PVD B;  1SSF A;  2A28 A;  1QVG P;  5GMK h;  3M0R A;  5A2Q E;  4C0D C;  1M4Z A;  5IHK A;  2GQV A;  1ZQ1 A;  1WFW A;  3VYH B;  5CKF A;  1VQ7 T;  4PJO F;  1C6V X;  2EW3 A;  3OYL A;  2LNV A;  4B6M A;  3CCL A;  2OTJ Q;  2QEX T;  2JT4 A;  2FZG B;  1OU9 A;  2FPD A;  4KUL A;  2LJ3 A;  5GMK j;  5LJ3 d;  2ED0 A;  3TEE A;  2HSE B;  2DER A;  4A4K A;  3G7Z A;  5L23 A;  3UA6 A;  2FB7 A;  5D6W A;  4C0Z A;  2DTH A;  2K2V A;  2QDY B;  4IUV A;  1XTD A;  3NFC A;  3J7A F;  2V1Q A;  4F16 A;  2I0N A;  2JJ9 A;  4IUP A;  1VQ4 A;  3QZ5 B;  1KG1 A;  2FZC B;  4CC3 A;  2A3L A;  5CR2 A;  1VQP T;  3MHX A;  1ZLM A;  3CME T;  2HAX A;  3HRT A;  2OAW A;  4M77 C;  4N4G A;  2P4R A;  3EFS A;  5FU6 B;  4AG1 C;  4J6X A;  2NUT B;  1SKU B;  4OMP A;  3JCM b;  2ZZD A;  4PK4 A;  3GNG A;  2KR3 A;  4LN2 A;  3KBG A;  3SEM A;  3EGX A;  3TRE A;  2RMO A;  3OB9 A;  2XD0 A;  1WQ7 A;  1BIA A;  2QGF B;  3E1S A;  4KGZ B;  1GRI A;  1K73 R;  1QCF A;  3I56 A;  1VQ9 Q;  5KYY B;  2V26 A;  2BZX A;  3JRZ A;  2DYI A;  2D9T A;  1N9S A;  3LW5 E;  3I55 A;  1UG1 A;  1VUB A;  2EYW A;  2QQS A;  4A53 A;  3PIO A;  1VQ7 A;  3QXE B;  1QCO A;  2RI5 A;  2RQU A;  3RMQ A;  1VQP Q;  2LDM A;  2EYQ A;  5LJ5 f;  3CPW A;  4RTU A;  2QEX A;  3G4S T;  4M77 E;  3VS5 A;  3LGF A;  4R55 A;  5HKC A;  3MKD A;  5IXF A;  2AIR B;  2E5K A;  4M78 E;  1KIK A;  2QAZ A;  8ATC B;  3IQL A;  1BCO A;  1IGQ A;  5LJ5 h;  4M7A G;  3DB4 A;  1TWB A;  1OPK A;  2HL3 A;  2EGA A;  1MV3 A;  3GOX A;  4OGE A;  4D8K A;  2E3H A;  1YHQ T;  4LD6 A;  1RAF B;  4ZTF A;  4PJO C;  4BI3 A;  2DVE A;  5GAO r;  4A4H A;  4PJM A;  1VQP A;  2QK0 A;  1WJQ A;  2DZC A;  3HTR A;  3H0F A;  5LJ5 j;  4C8Q G;  3CME A;  4J8O A;  2BKD N;  4BB7 A;  4OB3 B;  1I1J A;  2DL4 A;  5ECA A;  3CXC S;  2D1X A;  1P92 A;  5GAN 3;  1NJI R;  2P84 A;  2ZPG B;  1UEB A;  3G71 Q;  4C5E A;  1VIF A;  1AWJ A;  2E5Q A;  1Y57 A;  2YUP A;  3G6E Q;  5C6S A;  1R8O B;  1TXQ A;  2J06 A;  2NUT A;  1PD1 A;  2H3E B;  4M75 D;  5FRN A;  3V8J A;  2XHC A;  1RL2 A;  5CQY A;  3HP9 A;  4DQ2 A;  1W2B A;  2PU9 B;  5HK0 A;  2RI3 A;  5DLO A;  2QYZ A;  2RD1 A;  4PJO E;  4J9F A;  3CC2 T;  3I5R A;  4LDX A;  2L5Q A;  4R0K A;  4C92 G;  3X28 B;  5KE2 A;  3G4S A;  3OYB A;  4EMK A;  2RN8 A;  1W6X A;  1KD1 R;  4BDZ A;  1G5V A;  1X43 A;  1IRX A;  5KYW B;  1PCX A;  3JCM c;  2HQE A;  5GAM g;  3OYG A;  1B3Q A;  2KMT A;  2RB6 A;  2RO0 A;  1PG5 B;  1Y71 A;  4J83 A;  2ATC B;  2JM8 A;  1I4K 1;  2QQA A;  5KYN A;  1NLP C;  4JPB W;  1AHJ B;  3PGG A;  4J7I A;  1BI3 A;  2E4H A;  1YHQ A;  2E65 A;  3UAT A;  3WXM B;  3JCM g;  2RJE A;  1VQ6 T;  1JU5 C;  2DL7 A;  2R58 A;  1YJN Q;  2DO3 A;  1D0Z A;  2J6O A;  2EJG A;  2K6D A;  3H8Z A;  3L1A A;  5CKD A;  2M51 A;  1PSF A;  1M3B A;  2L8D A;  3ZFJ A;  3FLG A;  1K9M U;  2WSC E;  3VYG A;  1JEG A;  3QO3 A;  4ELY C;  4J9D A;  2DIQ A;  2A08 A;  2EQJ A;  2MI6 A;  3A8H B;  1VQK Q;  2QTV A;  4V2S A;  1VIE A;  2DTO A;  1S72 T;  4MZM A;  5FU6 C;  1E6G A;  5LJ3 f;  2J7I A;  2DA9 A;  4KRT A;  3L2Z A;  4JRI A;  3REB B;  1AZE A;  2X3W D;  4AG2 C;  4Q5W A;  1M1K U;  4OML A;  3CC2 A;  2CS7 A;  3I5S A;  2GQI A;  4LDU A;  3RBB B;  1BU1 A;  2X3X D;  5LJ3 h;  3JB9 I;  1ZUK A;  3CCJ T;  3VS1 A;  4J9G A;  1YFN A;  1YCS B;  1AWW A;  1HSQ A;  4C5H A;  5CIU A;  4A4E A;  1QVF P;  2BTT A;  1YBY A;  3M55 A;  4JZ4 A;  3X20 B;  4ATO A;  1UB4 A;  2K5I A;  3LGL A;  2L3R A;  5LJ3 j;  2L3Q A;  5CVI A;  1PNJ A;  3OW2 S;  1H8K A;  2XIC A;  1VQ8 A;  1OOT A;  1M2V A;  1VQ6 A;  1NLO C;  3RDV A;  3EG1 A;  5GAN 8;  1N5Z A;  2V8I A;  1A0N B;  2WSE E;  3P8H A;  1QVG A;  4IKF A;  5GAM e;  1JQQ A;  3V8K A;  4DEY A;  4XU1 A;  2K7A A;  1B7T A;  1WHK A;  4P5N A;  3CMA T;  1WJR A;  3PVQ A;  2P0K A;  3MJX A;  2DE0 X;  3QDF A;  4GLM A;  3JCM e;  5FW9 A;  4LDY A;  3CBP A;  1HYO A;  1GFD A;  2Y4Y A;  4XU0 A;  3A8L B;  1WXU A;  1S72 A;  4M7A B;  2LT4 A;  1UUE A;  2LQW A;  1NYF A;  4CC4 B;  3VUB A;  3CCR T;  2KI7 A;  1N6A A;  1Q81 U;  1UTI A;  5I2S A;  1YIT T;  4M77 D;  4ZN3 A;  5GAN d;  3DB3 A;  1PM3 A;  3CQT A;  5L8R E;  2F5T X;  4M78 D;  4DBF A;  3CCJ A;  1RAE B;  3PE0 A;  1SEM A;  3TU4 K;  4C8Q B;  2DTI A;  1D3B A;  4FYY B;  4ZNX A;  5FLX E;  4IUT A;  2C0O A;  2X35 A;  3M9Q A;  4J5Y A;  3JB9 D;  3NPF A;  1YJW T;  3MCA B;  4JLI A;  1Q7Y U;  2VAS A;  4FW2 A;  9ATC B;  2HSP A;  4N0A A;  4OB2 B;  4XK8 E;  1AWX A;  2PTK A;  1UHF A;  2VKN A;  3UF4 A;  3P8B B;  4O5V A;  4OMF B;  2BE9 B;  2Y4X A;  1FMK A;  1WLP B;  2A7Y A;  3OYY A;  1FMV A;  2M0Y A;  3JAM E;  2WAC A;  4ANJ A;  2R5M A;  1PSE A;  4PJL A;  4J9I A;  2K3B A;  3VRZ A;  8AT1 B;  4C92 B;  4M7A F;  1KQS P;  4M7D G;  3CMA A;  1Q86 C;  2DAQ A;  1VQN A;  2RQT A;  3HKS A;  4KGX B;  4BI8 B;  1I07 A;  2EJF A;  4KUD K;  5GMK i;  2EQU A;  2E1H A;  2RM4 A;  4ESR A;  3NHN A;  1QMC A;  2KBT A;  1YWP A;  5IT9 E;  3X24 B;  1H92 A;  4C8Q F;  3CCR A;  3U23 A;  3GBQ A;  4CC7 A;  3FEO A;  2DXT A;  2MCN A;  1YIT A;  2E41 A;  3CBO A;  3CCM A;  4DBR A;  4ME7 A;  2KYM A;  3H6Z A;  1Z9Q A;  1IRE B;  4ZN1 A;  3CCU T;  1LPL A;  4JRP A;  2YRD A;  2DM1 A;  3OMC A;  3A1P A;  4FIB A;  3QJY A;  5GAO m;  2DEQ A;  1YJW A;  2FVU A;  1D0Y A;  1MV0 B;  1YIJ T;  2K3X A;  2NUZ A;  1EIF A;  3I9Q A;  4RCC A;  3C4S A;  2QQR A;  2ZPI B;  2KT8 A;  3QHS A;  1M3C A;  2DL3 A;  1WA7 A;  4HA8 A;  1G2B A;  3SDZ A;  1MNE A;  4C92 F;  4LUD A;  2RA2 A;  1QP2 A;  3REA B;  1JB0 E;  1N8R U;  2YRC A;  1RAC B;  4HCB A;  4E2F B;  2SEM A;  3FB9 A;  4QKU A;  2O01 E;  3NTH A;  2F2V A;  1WNL A;  2GBQ A;  1K76 A;  4HVW A;  2X51 A;  1OUL A;  4KH0 B;  2MOX A;  3JCM Q;  2IVW A;  1YJ9 T;  2YT6 A;  4F7U F;  1UJY A;  2RHI A;  3CPW S;  2EBP A;  1VQ5 T;  4FYV B;  2AHJ B;  2ED1 A;  2RF0 A;  3E9F A;  4BE2 A;  2D6F A;  1YI2 Q;  4QQ6 A;  1QQJ A;  5HY6 A;  2V1R A;  2HNI A;  1VQ4 T;  4RTT A;  1HD3 A;  5FWC A;  3TVT A;  3KUF A;  2PUO B;  1VQM T;  3OYJ A;  1N8R R;  1NE8 A;  3CCU A;  3EGX B;  3CCL Q;  4F7U A;  4M7A C;  2W10 A;  4PLI A;  3BFM A;  4OF1 A;  3V8L A;  3ZL7 C;  2O4X A;  3QKJ A;  3URG A;  2KEA A;  3QWX X;  1ZUU A;  1QW1 A;  2CP5 A;  2LNH B;  1BBZ A;  2W0Z A;  1M90 R;  1CSK A;  5A0D A;  1FYN A;  1YIJ A;  1PC0 A;  3I56 T;  4MDW A;  1VQO T;  5A0L A;  4C8Q C;  1S1N A;  3ULR B;  1AOJ A;  1WZO A;  1Y96 A;  2RJF A;  3J80 E;  3OYD A;  3I55 T;  1ABO A;  2HKN A;  5KYU A;  2XID A;  2DIG A;  1VQ4 Q;  3EG3 A;  2B86 A;  3A5Z B;  1GBR A;  1PWT A;  1W2B S;  1FX7 A;  3VJP A;  2PZ1 A;  1WHL A;  4BE0 A;  4M7A E;  1IGU A;  2CP6 A;  3TSW A;  3HHT B;  3JB9 J;  3GP8 A;  4QVC A;  4JLG A;  1YJ9 A;  5GAN f;  3S3M A;  5CO7 A;  2V8K A;  1K73 U;  2VUB A;  3OA6 A;  1W70 A;  2O88 A;  2LJ1 A;  2MF2 A;  4M75 G;  1VQ5 A;  5LJ5 e;  1OI1 A;  1N27 A;  3JCM V;  3RMS A;  4QVZ A;  4C8Q E;  3NTI A;  2R57 A;  3MP8 A;  3LWI A;  1QVF A;  4C92 C;  1W1F A;  3GF5 A;  1VYV A;  1ZUY A;  3I56 Q;  1VQO Q;  5I21 A;  2CUD A;  5GAN h;  4HCZ A;  1YWO A;  3I55 Q;  1GL5 A;  1K1Z A;  4PLL A;  1NEG A;  2E10 A;  1VQM A;  3LX7 A;  1VQ7 Q;  3CD6 T;  3PVL A;  4HXJ A;  1QKX A;  2QEX Q;  2DRM A;  5IHI A;  3PFS A;  5I2M A;  3QG1 A;  5GAN j;  1MMN A;  5C0M A;  4Z89 A;  4OMQ A;  3WVD B;  1XOV A;  3CCQ T;  4M7D B;  2XDD A;  3SWN B;  1UGQ B;  2E70 A;  2GGR A;  3RNJ A;  2HMA A;  3THK A;  1VQL T;  2EQM A;  3GIB A;  1AEY A;  1VQO A;  3CC4 T;  3FJP A;  2RH2 A;  5HK3 A;  1RLQ C;  2KXC A;  1TS9 A;  4C92 E;  1AD5 A;  4AMC A;  1EFN A;  4EMK B;  1PD0 A;  2O9V A;  1PKS A;  1OEB A;  3RR6 A;  5IXB A;  3S3O A;  4F17 A;  2BUD A;  3OYF A;  2QTX A;  2XMF A;  1ZBX A;  1NJI U;  2J6F A;  3CME Q;  1Y07 A;  4RMO A;  2HBW A;  2D8H A;  1VYT A;  1X6O A;  2AKL A;  4JJC A;  3AHU A;  3M54 A;  2Y90 A;  1WQW A;  2KK4 A;  2MWO A;  1T0J A;  4ZTJ A;  1OZ2 A;  2L3S A;  4XQ3 A;  2OAU A;  5GAO q;  2GTO A;  3VS4 A;  2FO0 A;  3FDR A;  5D6X A;  3MPU B;  5I22 A;  3CC4 Q;  1KJW A;  2RNA A;  1X01 A;  2DRK A;  2EWN A;  1Y0M A;  3OYC A;  2KRM A;  1I5L A;  2DX1 A;  2LX7 A;  3R6O A;  5D7U A;  1KD1 U;  4M7D F;  3Q1J A;  3CD6 A;  3VU3 C;  2X4J A;  4BI4 A;  3VKI A;  3G4S Q;  4NL2 A;  3MO8 A;  1JXO A;  2EGE A;  1UDL A;  1G3W A;  3CCQ A;  2ESW A;  1H3H A;  1QVG S;  4Z8A A;  1VQL A;  3CC4 A;  2LX9 A;  3RKY A;  3SD4 A;  2JZ2 A;  1SG5 A;  2AKK A;  3OSS C;  1M1K C;  1WXB A;  4M7D A;  4FL6 A;  3SWN A;  3PMI A;  3CCS T;  4JRQ A;  2NLU A;  1YHQ Q;  2KE9 A;  1IB8 A;  1QVP A;  1JJ2 P;  2HBP A;  1KSW A;  1G8X A;  3EGD B;  3VS2 A;  1T3L A;  2ROL A;  4GY5 A;  2EQK A;  3HPW A;  2YDL A;  2KXD A;  1MGQ A;  4EDU A;  2NUP A;  3CCV T;  2EYY A;  5GAO p;  4O6J A;  2AZS A;  2HDA A;  2QQB A;  1D1A A;  1WPY A;  2COW A;  3EFR A;  1M2V B;  4FT2 A;  1QKW A;  5FRM A;  4OGC A;  5HCK A;  4F7U G;  2DLP A;  1KC8 C;  2DFU A;  2LCL A;  1OX9 A;  1VQ8 T;  1Q82 C;  1M1F A;  3A8M B;  2CP0 A;  4FYW B;  1NYG A;  4JDS A;  3RUX A;  1BCM A;  4HT9 A;  3A8O B;  2A37 A;  3CCS Q;  3CC2 Q;  2EPD A;  4M78 G;  4QQG A;  2DKG A;  3L2R A;  3CBM A;  3M57 A;  3DLM A;  3KXT A;  4J9B A;  3HFO A;  3BY7 A;  2VV5 A;  3LH5 A;  3CCV Q;  4FSS A;  3JB9 G;  4FT4 A;  4B9X A;  4HVV A;  2QA4 T;  4RCB A;  1SF9 A;  2E6N A;  2JUF A;  3MEW A;  1C1A A;  2GFA A;  2EQI A;  3S3N A;  1Q81 C;  4J7F A;  4BY6 B;  2RPN A;  3CCE T;  2R5A A;  4L59 A;  1D3B B;  1RLP C;  2GTJ A;  3P8D A;  4PNO A;  3L2V A;  1VQ8 Q;  3CCS A;  2JVV A;  2E3I A;  4M7D C;  3SWN C;  1VQ6 Q;  1FWZ A;  2CH4 W;  2LCS A;  3I35 A;  3QYH B;  2JTM A;  2QGG A;  4E7Z A;  2HD0 A;  3G1J A;  1YP5 A;  4WF2 A;  5FU7 C;  3M4G A;  2D0N A;  5DY9 A;  2D0Q B;  3CCV A;  4RG2 A;  2RI2 A;  4J9E A;  4A54 A;  2YXY A;  3EGD A;  4EMK C;  5CKH A;  4X9C A;  1BKB A;  1Q7Y C;  1BI1 A;  1BI0 A;  4MZP A;  4XTU A;  4JJN K;  4C8Q D;  4DOW A;  2C0I A;  2E64 A;  1WGS A;  1T0H A;  4MMK A;  4FW1 A;  2KDS A;  2ZPB B;  1PRM C;  1U5S A;  2ZCF B;  4KGV B;  5IH2 A;  1S72 Q;  3X25 B;  3L2Q A;  3CC7 A;  1RAB B;  4C5I A;  2JTE A;  2FRW A;  1B34 B;  2COY A;  2DJQ A;  2RHU A;  1PHT A;  2AT1 B;  4E6R A;  4NS5 A;  1Q95 G;  1OX8 A;  3UPU A;  2IPO B;  2EYX A;  3CCJ Q;  2LJ0 A;  5GAO n;  1KHC A;  2P0P A;  2LQ8 A;  3LLR A;  1VQN T;  1BI2 A;  4M75 F;  4AFZ C;  2VYT A;  3VS3 A;  1QP3 A;  4EPC A;  1TUD A;  2QA4 A;  2M16 A;  5GJW B;  4Y28 E;  3HSB A;  1KQ1 A;  2PVO B;  4LXC A;  4QT7 A;  2L3P A;  3N5B B;  4M4Z A;  1JO8 A;  1FXX A;  3CCE A;  2ECZ A;  1VYU A;  1M8M A;  1WHJ A;  3JCM W;  1WHM A;  1HJD A;  3QYG B;  3CCM T;  3AT1 B;  2CSI A;  1MMD A;  1B07 A;  4M75 A;  1ZX6 A;  4R56 A;  1K8A C;  2C0T A;  4LE9 A;  1SPK A;  1YN8 A;  3NGP A;  2PVG B;  4AFU C;  2ROT A;  1KC8 R;  1BIB A;  4JJD A;  3CMA Q;  1U8R A;  1UFF A;  3GNF B;  4BDY A;  1VQN Q;  5DM7 R;  1M8V A;  1RAG B;  4EIK A;  1K4U S;  1WI7 A;  3JCM X;  4RG8 A;  3A8G B;  2KRO A;  2DPP B;  2DEU A;  2X4X A;  2BZY A;  1NEB A;  2HKQ B;  1LOJ A;  3FRN A;  4ELZ C;  3CCR Q;  1NG2 A;  2LP5 A;  5GAM f;  3FC3 A;  1YIT Q;  3OMG A;  2DD5 A;  3UDC A;  3C12 A;  3CCM Q;  1OYX A;  2V8J A;  4DA4 A;  1ZSZ A;  1M30 A;  1CKB A;  2GFU A;  2DD4 A;  2H3J A;  3F70 A;  2RQR A;  1B34 A;  2MMP A;  2ZGW A;  1VOM A;  3JCM f;  3ZBD A;  5LL6 S;  5EG2 A;  4C5G A;  2CKK A;  1WXT A;  1Z9Z A;  2JM9 A;  2KY9 A;  1YJW Q;  2RQW A;  2A0F B;  3SFM A;  1N9R A;  4PJO D;  2DBK A;  2WSF E;  1BYM A;  6AT1 B;  2LVM A;  2EGC A;  4F14 A;  1WJS A;  2F2W A;  3M5A A;  4UC4 A;  4F7U B;  1WHH A;  2XU8 A;  3UWN A;  2HCK A;  1QLY A;  5GAM j;  2O4X B;  2FL7 A;  5I11 A;  4N4H A;  1X6B A;  4ZGJ B;  3RES A;  3QII A;  3BW1 A;  1JBM A;  2CZ6 B;  1QVF S;  4BY6 C;  4XU3 A;  4M75 C;  3M0P A;  3PIP A;  1UE9 A;  1Y96 B;  1V29 B;  5KYU B;  2VVK A;  4TVR A;  2PNI A;  2YUO A;  2LQN A;  2ZPH B;  2ENM A;  2J05 A;  2HQX A;  2MWP A;  1F1B B;  3C0C A;  2DXU A;  3OYE A;  5FWB A;  4XU2 A;  4N0A C;  3JB9 H;  5GMK e;  4PKC C;  2EIF A;  4JS4 A;  3C94 A;  2LQK A;  1U3O A;  5LJ5 g;  1GCQ A;  1H64 1;  1TH7 A;  4JUV A;  2VXF A;  1G3T A;  5AT1 B;  1RAA B;  3KFV A;  1NM7 A;  1SRL A;  3CCU Q;  1JJ2 A;  2MAM A;  1TG0 A;  1M90 U;  1RAI B;  2AZV A;  4PFO A;  2DET A;  4L6V 5;  1PKT A;  1UEC A;  3V7C A;  4A4F A;  2JMA A;  2OTL T;  2KT1 A;  3EG9 A;  3RER A;  4RTW A;  1KHI A;  2JOY A;  3MP1 A;  2KRS A;  1YIJ Q;  1YCY A;  4QQD A;  2XI9 A;  3X26 B;  2KNB B;  4M78 F;  1K8A R; 
#chains in the Genus database with same CATH homology
 1N8R C;  2QTX A;  1Q86 U;  2WSC E;  2RJC A;  3M56 A;  3VYG A;  1ZBX A;  3MEV A;  1NJI U;  1M5Q 1;  2KVQ G;  3M58 A;  3QO3 A;  1Y07 A;  4ELY C;  4RMO A;  2DIQ A;  3S6W A;  2EQJ A;  2FYK A;  5KCH A;  1X6O A;  3JB9 F;  2MI6 A;  3A8H B;  2F5K A;  3AHU A;  2DJZ A;  2CZ0 B;  4V2S A;  3HL8 A;  1VIE A;  2Y90 A;  1WQW A;  3M54 A;  2DTO A;  2EFI A;  1M90 C;  2KK4 A;  2MWO A;  2GCX A;  5GAN 2;  3L42 A;  4MZM A;  5FU6 C;  1S72 T;  2OTJ T;  4MML A;  4ZTJ A;  1OZ2 A;  4E7J A;  2CGH A;  5LJ3 f;  1M1G A;  5GAN g;  2ZPF B;  4M77 A;  4JRK A;  4XQ3 A;  2LRQ A;  3GPL A;  3L2Z A;  4JRI A;  2OAU A;  4KBM B;  5GAO q;  5GAM h;  3QUI A;  5FRO A;  3FDR A;  4M78 A;  5D6X A;  4Q5W A;  1M1K U;  3CC2 A;  1JRI A;  2CS7 A;  2M0O A;  1X01 A;  3WVE B;  2EWN A;  4LDU A;  4CI0 C;  4C0F A;  3OY9 A;  3OYC A;  3OBY A;  3SB2 A;  3JSC A;  3MET A;  2XDP A;  5LJ3 h;  1LNX A;  3JB9 I;  3V7S A;  4MZT A;  3J81 E;  4IUR A;  3CCJ T;  1I5L A;  3R6O A;  4IUQ A;  1KD1 U;  4M7D F;  3Q1J A;  3JCM h;  3CD6 A;  3LH0 A;  3VU3 C;  3QSU A;  2X4J A;  3E9G A;  4C5H A;  2K4Y A;  4BI4 A;  4QVD A;  4E7I A;  1KQ2 A;  2XK0 A;  3VKI A;  2LC4 A;  5CIU A;  1KQS S;  4A4E A;  2DXC A;  2X4Y A;  2PUK B;  1YBY A;  4NL2 A;  2YLB A;  3M55 A;  2FHD A;  3X20 B;  5LJ5 d;  2QXF A;  4ATO A;  2JN0 A;  4M77 B;  3MO8 A;  4XTV A;  5GAN 7;  4Y91 A;  1UB4 A;  2ZPE B;  2K5I A;  3LGL A;  2YRV A;  2DXB A;  2L3R A;  4NOY A;  3M53 A;  1G3W A;  5LJ3 j;  5CVI A;  3CCQ A;  2KQW A;  1QVG S;  3OW2 S;  4M78 B;  2XIC A;  1VQ8 A;  1VQL A;  3CC4 A;  2LX9 A;  3RKY A;  3SD4 A;  2OTL A;  1U1T A;  1VQ6 A;  3L2W A;  4M7A A;  5GAN 8;  2JZ2 A;  1XNI A;  5CK9 A;  3OSS C;  3RKX A;  1M1K C;  2RHZ A;  4M7D A;  4FL6 A;  4KUI A;  3SWN A;  4QW2 A;  3PMI A;  2V8I A;  2WSE E;  1HK9 A;  3CCS T;  3HRS A;  4JRQ A;  2LCC A;  2NLU A;  3P8H A;  2LTO A;  5A0G A;  1QVP A;  1QVG A;  2HBP A;  3OW2 A;  5GAM e;  2RK1 A;  4IKF A;  3V8K A;  1LJO A;  4LDV A;  4XU1 A;  3ME9 A;  3OS5 A;  4KT0 E;  4N4I A;  4YTL A;  1K8A U;  4GY5 A;  3M59 A;  2EQK A;  3OYK A;  1KD1 C;  3HPW A;  4P5N A;  4HT8 A;  4VUB A;  1VQ9 T;  5J3B A;  1MGQ A;  3CMA T;  1WJR A;  4EDU A;  3HRU A;  2JTF A;  2VXE A;  5KH6 A;  3CCV T;  5GAO p;  2B8A A;  1YI2 T;  4O6J A;  2P0K A;  4C8Q A;  4PJO A;  5CQX A;  3QBY A;  3RKW A;  1RI0 A;  4OP0 A;  3JCM e;  2QQB A;  4NL3 A;  4E7H A;  1NPP A;  4LDY A;  1WPY A;  4JS5 A;  2XDB A;  2RHX A;  3CBP A;  3EFR A;  1NZ9 A;  2Y4Y A;  4XU0 A;  3OYI A;  3A8L B;  2M9U A;  1S72 A;  2L89 A;  4FT2 A;  2OTJ A;  2DK3 A;  4M75 E;  2LT4 A;  3CEY A;  4OGC A;  4PL6 A;  4M7A B;  4E7K A;  3M4Y A;  2RHY A;  5FRM A;  1K73 C;  4F7U G;  4FSX A;  2G3R A;  3VUB A;  3DKM A;  3CCR T;  1KC8 C;  1N6A A;  4L5G A;  1Q81 U;  5M9O A;  2LCL A;  5LJ3 g;  2QI2 A;  5I2S A;  3OYH A;  3OQ5 A;  5KCO A;  1VQ8 T;  3CCL T;  5FU7 B;  1YIT T;  4M77 D;  1Q82 C;  1M1F A;  3A8M B;  4ZN3 A;  5GAN d;  3DB3 A;  5CAI A;  4II1 A;  4JDS A;  3L2U A;  3OS0 A;  3RUX A;  4M78 C;  5L8R E;  2F5T X;  1IZ6 A;  4M77 F;  2KAF A;  4M78 D;  1XQH A;  4HT9 A;  3A8O B;  3CCJ A;  1X75 C;  4D6W A;  3TU4 K;  3OYN A;  4C8Q B;  4EMH A;  2DTI A;  1D3B A;  5IN1 A;  5FLX E;  4PJO B;  4IUT A;  4M78 G;  4QQG A;  3OS1 A;  2CZ1 B;  2DKG A;  3L2R A;  2X35 A;  3CBM A;  2XKO C;  2E12 A;  3M57 A;  3DLM A;  4ZGD B;  3M9Q A;  5GAN e;  4J5Y A;  3KXT A;  3JB9 D;  3HFO A;  4FU6 A;  4X9D A;  5GAO l;  1YJW T;  1MHN A;  3BY7 A;  3MCA B;  4JLI A;  3MP6 A;  2VV5 A;  3HFN A;  4C92 A;  1Q7Y U;  3MEU A;  2RJD A;  3GLX A;  3JB9 G;  3EAE A;  4FT4 A;  4B9X A;  5D6Y A;  4F7U E;  2QA4 T;  4ZGE B;  3QPH A;  4N0A A;  4OB2 B;  3O8V A;  4RCB A;  4XK8 E;  2E6N A;  2JUF A;  3MEW A;  3OYA A;  2VC8 A;  2GFA A;  3P8B B;  4O5V A;  4OMF B;  3S3N A;  1Q81 C;  4J7F A;  4BY6 B;  2Y4X A;  3PT9 A;  3CCE T;  2A7Y A;  2R5A A;  3G71 T;  2RK2 A;  3OYY A;  1ZHI A;  4EMG A;  4L59 A;  1D3B B;  4PNO A;  4XTZ A;  3P8D A;  3L2V A;  3G6E T;  3JAM E;  2WAC A;  3CCS A;  1W4S A;  2R5M A;  2JVV A;  3T9N A;  4LDW A;  4XTW A;  4XAX B;  1PSE A;  4CRI A;  4M7D C;  3QJ6 A;  4B9W A;  3SWN C;  1FWZ A;  4XTY A;  1GXI E;  4M7D D;  3QYH B;  5KE3 A;  3CPF A;  2JTM A;  5AYF A;  2HD0 A;  4WF2 A;  4C92 B;  1VQ9 A;  4M7A F;  5FU7 C;  4M7D G;  3M4G A;  3C95 A;  3ER0 A;  3CMA A;  1K9M C;  1Q86 C;  5CCA A;  2P0Q A;  2D0Q B;  2P4T A;  5DY9 A;  4E47 A;  3CCV A;  2DAQ A;  3JCM J;  4RG2 A;  2F69 A;  2K3Y A;  1YI2 A;  1NJI C;  2RI2 A;  1VQN A;  1I8F A;  4A54 A;  2E6Z A;  4C0G A;  3HKS A;  4EMK C;  5CKH A;  4X9C A;  1BKB A;  4BAC A;  4BI8 B;  1Q7Y C;  2PVD B;  1SSF A;  1BI1 A;  2EJF A;  2LT1 A;  1BI0 A;  4KUD K;  4MZP A;  5GMK i;  5GMK h;  2EQU A;  4XTU A;  2E1H A;  2RM4 A;  4C0D C;  4C8Q D;  4DOW A;  5A2Q E;  1M4Z A;  4JJN K;  4E7L A;  3VUZ A;  5IAY A;  2GQV A;  2BIV A;  2E64 A;  1WGS A;  2EJ9 A;  1ZQ1 A;  4MMK A;  3VYH B;  2KDS A;  5CKF A;  3VV0 A;  3X24 B;  5IT9 E;  1VQ7 T;  4C8Q F;  5GAM d;  3CCR A;  4PJO F;  2ZPB B;  3OYL A;  2LNV A;  1KQS A;  2ZCF B;  3CCL A;  3FEO A;  2DXT A;  3X25 B;  1YIT A;  3L2Q A;  2QEX T;  3CC7 A;  2E41 A;  3CBO A;  4A4G A;  3QZ9 B;  4C5I A;  4KUL A;  2GF7 A;  5GMK m;  3CCM A;  4ME7 A;  5GMK j;  3H6Z A;  1IRE B;  4ZN1 A;  5LJ3 d;  3CCU T;  3TEE A;  1B34 B;  4OB0 B;  2PQW A;  1Y7X A;  3JCM d;  4JRP A;  4A4K A;  3G7Z A;  3INZ A;  2RHU A;  4NS5 A;  2FB7 A;  5D6W A;  3OMC A;  4C0Z A;  3UPU A;  3NTK A;  2DTH A;  2K2V A;  1UGR B;  2CZ7 B;  4FIB A;  3QJY A;  5GAO m;  2DEQ A;  2QDY B;  1YJW A;  4IUV A;  5GAO n;  2P0P A;  1KHC A;  2FVU A;  3OBW A;  2LQ8 A;  3LLR A;  1VQN T;  1BI2 A;  1XTD A;  3NFC A;  4M75 F;  5LJ3 e;  1HXD A;  1YJN T;  2VYT A;  3J7A F;  1QP3 A;  1YIJ T;  4EPC A;  5GAN 4;  2K3X A;  1EIF A;  4IUP A;  2QA4 A;  4RCC A;  1VQ4 A;  3C4S A;  3MEA A;  2M16 A;  3QZ5 B;  1KG1 A;  2QQR A;  2ZPI B;  4Y28 E;  2A3L A;  3PNW C;  3QHS A;  5CR2 A;  1VQP T;  3HSB A;  1KQ1 A;  2PVO B;  4HA8 A;  3N5B B;  3MHX A;  2M1H A;  4HCC A;  3SDZ A;  3CME T;  2HAX A;  4C92 F;  1FXX A;  3CCE A;  4XTX A;  2RA2 A;  2XG8 D;  1QP2 A;  1JB0 E;  3G71 A;  1N8R U;  1OZ3 A;  3HRT A;  4M77 C;  4N4G A;  4HCB A;  3EFS A;  5FU6 B;  3G6E A;  3FB9 A;  4J6X A;  2I2L A;  1VQK T;  3JCM W;  3CC7 T;  4FM4 B;  3QYG B;  1UGP B;  3JCM b;  3CCM T;  2O01 E;  2ZZD A;  3NTH A;  4M77 G;  1WNL A;  3GNG A;  4M75 A;  4R56 A;  1K8A C;  3JCM Q;  1DJ7 B;  2IVW A;  3KBG A;  3TRE A;  1YJ9 T;  4MDX A;  3PTA A;  3OB9 A;  2XD0 A;  1WQ7 A;  1BIA A;  4F7U F;  3E1S A;  2PVG B;  2VGN A;  2RHI A;  3CPW S;  3I56 A;  1BIB A;  3JCM P;  1VQ5 T;  2AHJ B;  3V7R A;  1U8R A;  3E9F A;  4BE2 A;  2D6F A;  3GNF B;  3JRZ A;  4LD9 K;  4QQ6 A;  4BDY A;  5DM7 R;  1M8V A;  3UT1 A;  2D9T A;  1N9S A;  3LW5 E;  2HNI A;  5HY6 A;  3I55 A;  1VUB A;  2EKO A;  3OYM A;  2QQS A;  4A53 A;  1VQ4 T;  3JCM X;  3PIO A;  1UGS B;  1VQ7 A;  4RG8 A;  3A8G B;  3QXE B;  2DPP B;  2RI5 A;  2X4X A;  3RMQ A;  4ELZ C;  1LOJ A;  2LDM A;  2EYQ A;  3FRN A;  3KUF A;  5LJ5 f;  3CPW A;  2PUO B;  2QEX A;  3G4S T;  4IUU A;  4RKU E;  4M77 E;  4M75 B;  3LGF A;  2K57 A;  4R55 A;  1VQM T;  5HKC A;  3OYJ A;  2YLC A;  1NE8 A;  3CCU A;  5GAM f;  4J6W A;  3FC3 A;  2KSS A;  4M7A C;  4F7U A;  4M78 E;  4PLI A;  4M7A D;  3OMG A;  3BFM A;  3ASK A;  2DD5 A;  4OF1 A;  3UDC A;  3C12 A;  3V8L A;  2K5L A;  2O4X A;  3QKJ A;  1OYX A;  2V8J A;  3URG A;  4DA4 A;  5LJ5 h;  4M7A G;  1O9S A;  3DB4 A;  1QW1 A;  4BD3 A;  2GFU A;  2DD4 A;  2H3J A;  3F70 A;  1B34 A;  2MMP A;  5CKB A;  2ZGW A;  1YJN A;  1U1S A;  3JCM f;  3ZBD A;  5LL6 S;  5A0D A;  5EG2 A;  4C5G A;  3GOX A;  2DZ9 A;  2CKK A;  4OGE A;  1YIJ A;  1YHQ T;  4LD6 A;  4X34 A;  3I56 T;  4MDW A;  1VQO T;  5A0L A;  4ZTF A;  2KY9 A;  4C8Q C;  5CKE A;  4PJO C;  4BI3 A;  2DVE A;  5GAO r;  4A4H A;  1Y96 A;  2RJF A;  3J80 E;  3SFM A;  3OYD A;  1N9R A;  3QDR B;  1VQP A;  4PJO D;  2WSF E;  3I55 T;  1WJQ A;  1BYM A;  5GAN 5;  2DZC A;  2LVM A;  4OB1 B;  5LJ5 j;  5J39 A;  4C8Q G;  3CME A;  1WJS A;  4PJO G;  2XID A;  2YHT A;  2DIG A;  3M5A A;  4J8O A;  2BKD N;  4BB7 A;  4UC4 A;  4F7U B;  2EAY A;  4OB3 B;  2XU8 A;  3UWN A;  4DOV A;  3OSV A;  3A5Z B;  3CXC S;  5GAM j;  4BE1 A;  2O4X B;  1W2B S;  1P92 A;  1VQK A;  1FX7 A;  3VJP A;  5GAN 3;  5J26 A;  2FL7 A;  2X4W A;  4BE0 A;  2QQ9 A;  2ZPG B;  4M7A E;  1UEB A;  4C5E A;  1VIF A;  3FIF A;  1O75 A;  2E5Q A;  4N4H A;  2C06 A;  4ZGJ B;  3HHT B;  3JB9 J;  4M7D E;  3RES A;  2VGM A;  3QII A;  3LWH A;  3BW1 A;  1JBM A;  2CZ6 B;  5C6S A;  3GP8 A;  1QVF S;  4BY6 C;  5GAN 6;  1R8O B;  3RIR A;  4JLG A;  4QVC A;  3OYF A;  1YJ9 A;  4HKE A;  4M75 C;  4XU3 A;  5GAN f;  4M75 D;  3PIP A;  3V8J A;  3CXC A;  5CO7 A;  3S3M A;  5FRN A;  2V8K A;  2XHC A;  1RL2 A;  2VUB A;  3HP9 A;  5CQY A;  4DQ2 A;  1Y96 B;  3OA6 A;  1W2B A;  1K73 U;  1KC8 U;  2PU9 B;  1G3Y A;  2MF2 A;  4M75 G;  1VQ5 A;  5HK0 A;  5LJ5 e;  1OI1 A;  1V29 B;  2CYZ B;  2RI3 A;  5DLO A;  1N27 A;  3JCM V;  4TVR A;  3RMS A;  4QVZ A;  1Q82 U;  4C8Q E;  2RD1 A;  3BDL A;  2R57 A;  3MP8 A;  3NTI A;  3LWI A;  1QVF A;  4PJO E;  4GLK A;  4C92 C;  3BDU A;  3GF5 A;  2ZPH B;  3CC2 T;  5I21 A;  2HQX A;  4C92 D;  2MWP A;  5GAN h;  3DLL A;  2DXU A;  3OYE A;  4HCZ A;  1H3Z A;  3TCJ A;  4XU2 A;  4LDX A;  2L5Q A;  4N0A C;  4C92 G;  3JB9 H;  5GMK e;  4PKC C;  2EIF A;  4PLL A;  3X28 B;  5KE2 A;  3C94 A;  3G4S A;  4JS4 A;  3OYB A;  1JJ2 S;  2LQK A;  2E10 A;  5LJ5 g;  4EMK A;  1VQM A;  3LX7 A;  3CD6 T;  1H64 1;  1TH7 A;  4BDZ A;  4JUV A;  2VXF A;  1G5V A;  1G3T A;  4Z02 A;  3OS2 A;  3JCM c;  3E19 A;  2HQE A;  5GAM g;  3OYG A;  4OVA A;  2KMT A;  3PFS A;  2RB6 A;  5I2M A;  3QG1 A;  2RO0 A;  5GAN j;  1Y71 A;  4J83 A;  5C0M A;  3ZEH A;  1K9M U;  1I4K 1;  1JJ2 A;  2MAM A;  2QQA A;  1I81 A;  3WVD B;  2IG0 A;  1XOV A;  1M90 U;  3CCQ T;  4M7D B;  2XDD A;  3SWN B;  1UGQ B;  2E70 A;  1AHJ B;  2K5F A;  3PGG A;  4J7I A;  1BI3 A;  4L6V 5;  1VQL T;  2EQM A;  3GIB A;  1M9S A;  2E65 A;  1YHQ A;  1VQO A;  1NPR A;  3CC4 T;  3FJP A;  3WXM B;  3JCM g;  3V7C A;  2RH2 A;  4A4F A;  2RJE A;  4BUG A;  5HK3 A;  2OTL T;  1VQ6 T;  3LYI A;  3RER A;  2R58 A;  1KHI A;  2JOY A;  3MP1 A;  5GMK l;  4C92 E;  4J6Y A;  2DO3 A;  4EMK B;  2EJG A;  1YCY A;  4QQD A;  3H8Z A;  2XI9 A;  3PMT A;  2JNG A;  3L1A A;  3S3O A;  5DLQ E;  3X26 B;  5CKD A;  1PSF A;  2L8D A;  4C0D B;  3ZFJ A;  2BUD A;  1G3S A;  4M78 F;  3FLG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...