4M77C

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
69
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 69
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77C00
5GANd 1H641 3INZA 4RCCA 3JCMc 5LJ5h 5GAMh 5CAIA 3V7RA 3M4GA 3BFMA 2VXEA 5GMKl 1BIBA 3HFNA 4C92B 4JRKA 4EMKB 4F7UG 1I8FA 2I2LA 5GAMe 5LJ5e 2EWNA 4C92A 3QO3A 4XTVA 4QVCA 4OP0A 2FB7A 5GMKj 4X9CA 5GMKi 4M78A 4XQ3A 4XU0A 4C92F 5LJ5d 1Y96A 5LJ3g 5GAOm 3EFRA 3BY7A 1LJOA 4RCBA 4XU3A 3JCMW 2RM4A 2K57A 1LNXA 4XTUA 4XTYA 4M7AB 2CGHA 4WF2A 2YLCA 3JCMd 4M7AA 3V7CA 4JUVA 1HK9A 2DJZA 4C8QE 4M78C 2DXUA 1N9SA 1U1SA 1I4K1 4M78D 4XU2A 2E10A 3EFSA 4M75E 3HSBA 4HT9A 5LJ5f 5GAMj 4M7AF 2DZCA 4PJOE 5LJ3j 1MGQA 3FJPA 4JLIA 5GAN2 4C8QC 2JN0A 5LJ3h 3QHSA 4C8QD 4M7AC 4M75C 3PGGA 5I21A 4M7AD 5LJ3e 4M75D 4M7DE 1I5LA 2DZ9A 1JBMA 2DEQA 2E64A 2Y90A 3BDUA 4M78B 4C92G 3RESA 5GAOp 5GAOl 1Y96B 3V8KA 1WQ7A 2E41A 4J6XA 4M77E 5GAMd 4JRIA 5LJ3d 3V7SA 5GAOr 4M7DC 4M78G 3JCMV 4M7DD 4C8QB 4M78F 3RUXA 3VU3C 4C8QA 4M75B 4M77C 2ZGWA 2E1HA 1TH7A 2RB6A 3JCMJ 4M77D 4M75A 3JCMP 2DXTA 4PJOA 3FIFA 5GAN8 3RERA 4XTZA 4C8QF 4M7AG 2DTOA 5LJ5j 3JB9D 4HA8A 2VC8A 5DY9A 4M75F 3L1AA 4F7UE 2DKGA 4M7DB 3JCMX 2DVEA 1KQ2A 4XTWA 4M7DA 4PJOC 2HNIA 4XTXA 2DTIA 4QVDA 5GAN5 4M77B 4PJOD 3JB9H 2YLBA 4MMKA 3SWNA 4NL3A 4M77A 5GAOq 2EJ9A 4MMLA 1HXDA 4DQ2A 4M7DF 4X9DA 1D3BB 5GAN3 4XU1A 4M77F 1D3BA 1WNLA 3JCMg 3QSUA 4V2SA 4NOYA 3JB9G 3BW1A 2E65A 2RA2A 3SWNC 3JB9F 4PNOA 1M5Q1 1BIAA 3L2ZA 1KQ1A 2EAYA 3JCMf 4PJOB 1M8VA 1YCYA 4F7UB 5GAN4 3JB9I 4C8QG 4J5YA 5GANg 4F7UA 4M75G 4PJOG 4EMHA 2DTHA 4A53A 5GANf 4PJOF 1WQWA 3RIRA 1LOJA 1WPYA 1X01A 3RKXA 4A54A 5GMKm 4EMKA 3HFOA 4F7UF 5GANh 4HT8A 4N0AC 3JCMh 5GAN6 4J6WA 5GAN7 3JB9J 3AHUA 3GIBA 4C92E 3SWNB 3SB2A 2YHTA 5LJ5g 3JCMe 3V8LA 5GMKh 3V8JA 2FYKA 3FB9A 5GAMg 5GANj 4M7DG 2RD1A 1I81A 3QUIA 2QTXA 4M78E 3RKYA 5GAMf 5GMKe 1JRIA 4M77G 4Y91A 5LJ3f 1B34B 2VXFA 4J6YA 4C92C 4EMGA 4C92D 4EMKC 3JCMb 5GANe 1B34A 4NL2A 3JCMQ 2EJGA 5GAOn 2EJFA 4M7AE 3RKWA 4N0AA 1U1TA 1N9RA
chains in the Genus database with same CATH superfamily
3JCMc 2EYZA 5CAIA 2XDPA 2YUPA 2L2PA 4XTVA 2RNAA 2COYA 3M5AA 3VS4A 3AT1B 3GF5A 2EKHA 5FLXE 4CRIA 4FT4A 1Q86U 2FEIA 2CUBA 1HK9A 1X75C 2YRDA 3HSBA 2MCNA 5CQYA 3HRUA 1YNZA 3CXCP 4JRQA 4M7AC 2WSCE 2W10A 5EG2A 4B6MA 4DEXA 1VQMT 1VQ6A 4M7DE 1UGSB 1JBMA 3FC3A 1Q81R 1VOMA 1T3LA 1M30A 4M75B 2DXTA 3CCET 5GAN8 3QXEB 2JXBA 2DIQA 1PHTA 3OS5A 1B3QA 1AWJA 3M54A 2RHXA 3CMEA 2DTIA 1AZEA 4IURA 2EQKA 2YLBA 2FPDA 1HD3A 2EJ9A 1ABQA 3I55T 3WVEB 1YJNQ 1IHVA 1QVFA 3A1PA 4II1A 4Z02A 2DBMA 3OYEA 4QVZA 1UDLA 2HQXA 1G3YA 3MP1A 3J80E 2QQ9A 3G4SA 2LZ6B 3LWIA 4PJJA 1WXBA 2QAZA 1D1BA 3VS1A 1RAHB 5GMKm 3GIBA 5CKDA 1UECA 3S3OA 5CKBA 5GANj 2CP6A 1HYOA 3G71A 1SRMA 4E7SA 2SEMA 1ZHIA 2A08A 4C92D 2RQRA 3H6ZA 1VQ7Q 2RJDA 1RI9A 5AYFA 4DEYA 4FW1A 5LJ5j 2GGRA 3UATA 2HKQB 5HKCA 1S72Q 2NUPB 5GMKl 3VS7A 4F7UG 4TVRA 3OW2S 3QO3A 4Z88A 5CO7A 4PFOA 3OSVA 1LJOA 7AT1B 2YUQA 2XI9A 4XTUA 2CDTA 4JJNK 1K9MR 1X6BA 2L8DA 1M4ZA 2X3XD 1N8RC 1NJIC 3M0SA 2GTJA 1PD1A 1X2KA 1BCMA 2JS2A 1SKUB 4ESRA 1K1ZA 1ZX6A 1ZSZB 1YJNT 4PFZA 5LJ3e 4FCYA 2OTLQ 1WHLA 1OZ2A 3L2UA 4LDVA 1YIJA 2D0QB 2HL5C 3PMIA 2OTJQ 1AOJA 2KYBA 3LWHA 1UGQB 4J9DA 3UWNA 1RAGB 2AKKA 2H3EB 1UGRB 2DNUA 3PIPA 2P84A 4M7DB 1Q95G 2R5MA 1EFNA 1RLPC 1WJSA 4RTZA 2JT4A 1UTIA 3E9GA 5GAN3 1H3HA 2XDBA 2E65A 4JZ3A 4EPCA 3EGXB 2LJ0A 5GAN4 3JB9I 2QEXA 3BDLA 3CCMQ 2PUOB 2PQWA 3J7AF 1Q86C 2HBPA 1QCFA 4KGZB 4HT8A 2EPDA 4BI4A 2FG0A 4XAXB 2YHTA 2RJCA 1JXOA 2FO0A 1KC8R 1TUCA 1D09B 1GRIA 2KT1A 3JCMb 3VUZA 1BK2A 4L5GA 3CPWA 4Y28E 2OTLT 2DL8A 1U3OA 4PJNA 1IHWA 2NLUA 3P8DA 3HP9A 2V1RA 3M4GA 2OTJT 3N5BB 1PWTA 4WTOB 3X24B 3QWXX 5IAYA 4OP0A 2DILA 1QWEA 4GY5A 4J7FA 3H41A 1NEGA 2DFUA 1QVPA 2MK5A 4Y92A 2FPFA 4OB3B 3MPUB 3JCMd 1BBZA 1RAIB 2J06A 4IUUA 2E70A 3QBYA 4IUPA 4PFPA 2VGMA 1XJWB 3P8BB 4XU2A 2HD0A 1O9SA 4M7AF 1DJ7B 2O9VA 2FL7A 3TQ7P 1GFCA 3PE0A 3M53A 2DEQA 4EIKA 1F1BB 3CCMT 2HQEA 2HQHA 2K7AA 3REBB 2A28A 1MNEA 1GXIE 1WYXA 3I5SA 5J3BA 2RQVA 2O4XA 2J7IA 1Y07A 4KULA 4CI0C 2QG9B 2CKKA 3EG9B 3I5RA 3SD4A 1KQ2A 1YWPA 4KBMB 3PVLA 1YJWA 4CC7A 1M8MA 1M1KU 2NUZA 2JTEA 4E7KA 4M77A 2O01E 2F2VA 2GNCA 2MWPA 2MMPA 4X9DA 1RL2A 5KYWB 4MDWA 2X4WA 5KE3A 4D8DA 2YT6A 2H8HA 2M16A 4L6V5 4FW2A 2DL3A 3CCJA 1SHGA 4F16A 2CUDA 2KK4A 2ZPFB 3QJYA 4IIMA 2RI2A 5GMKh 1KD1C 5J26A 2MF2A 4M78E 2EYYA 2K3BA 2K5LA 5FRMA 1ZLMA 9ATCB 1VQKQ 4N0AA 1WXUA 4JJCA 2GTOA 3SHWA 2ZZDA 4J7IA 3QJ6A 2RPNA 2KR3A 3BFMA 5M9OA 1UG1A 1QVGS 3M57A 4JJBA 1BYMA 2DE0X 3OMGA 3I56A 3M0RA 5CVIA 4C92F 2DO3A 3NTKA 3JCMW 2LNVA 4QQ6A 2GFAA 4RG8A 4VUBA 1PC0A 4WF2A 5C6SA 2KE9A 1YP5A 1FMWA 2LVMA 4M78D 1VQ6Q 3OB9A 5LJ3j 4BI8B 4C8QD 8ATCB 1VQNT 3LGLA 3TU4K 2DBKA 2BZXA 3EG0A 4HCBA 2RJFA 1WQ7A 5CKEA 2DX1A 4EDUA 4FL6A 1VQ9T 2ZPEB 2EQJA 1IREB 4ELYC 2IIMA 1X69A 2OX7A 3OS1A 4F17A 2RB6A 4M75A 1NPRA 3PMTA 3CMEQ 2Y4XA 3HPWA 4ELZC 4FYWB 4LNPA 1Y57A 1JJ2A 1M2OA 2CYZB 3EFOB 5LL6S 1Y0MA 2PU9B 2PZ1A 2EQIA 1G8XA 1TG0A 2XMFA 1ZA1B 2WSFE 3G4SQ 4IUQA 1R77A 3BW1A 3HTRA 2RA2A 1RAAB 1QKWA 3X28B 3PT9A 4BY6B 4ATOA 1RAEB 2HL3A 2AZVA 2FHDA 3UA6A 3RIRA 1D0ZA 5A2QE 3ER0A 2VVKA 3G71Q 5GAN7 4KGVB 1UGVA 3RMQA 4IIOA 2M51A 2RMOA 4J9IA 4DBFA 5CKFA 1JRIA 4M77G 4Y91A 5LJ3f 4EMKC 5IN1A 1FMVA 4JRPA 1KQSA 2CT3A 4MMKA 1M1GA 3URGA 3O5ZA 3E2UA 2NUPA 3QZ5B 3CXCA 2K5IA 4X9CA 4XQ3A 2OJ2A 1Z9QA 1Y96A 2EQUA 2MYSA 3BY7A 4DOWA 2RM4A 3CMET 1R0BG 1OOTA 1GBQA 2DVJA 1M1KC 2YRCA 2KRSA 2CP7A 3R6OA 4E7JA 3GP8A 1MGQA 3LYIA 1YIJQ 4DOVA 1ZSZA 1H3ZA 2E3HA 3G4ST 1VQLA 2KAFA 2HAXA 5GAOp 4BI3A 3F70A 4JRIA 1W4SA 2ED0A 4J9EA 2GQVA 4J8OA 1OEBA 4QQDA 4X1VA 4M77C 5FROA 3JCMP 3G71T 3CPFA 5DLOA 3JB9D 3QKJA 4BE1A 2JMAA 4C0FA 5FRNA 4M7DA 4PJOC 3GLXA 2QASA 3QIIA 1E6GA 3SFMA 3FJ5A 2LJ3A 4LUDA 1WZOA 3WXMB 1RACB 2QEXQ 3CCLA 4V2SA 1AWXA 4K11A 4C0DB 3SWNC 4F04B 2J6OA 4BDYA 4AFSC 6AT1B 4M75G 2E6ZA 3OYNA 5IXFA 1Y7XA 3Q1JA 3JRZA 4N0AC 4J6WA 4OMLA 3JB9J 3JCMe 2FYKA 4ANJA 3UPUA 4LE9A 1MHNA 1BI1A 4KGXB 1YIJT 4ME7A 1SSHA 3DB3A 4M7AE 2YWWA 4A4KA 1AEYA 3C95A 2KT8A 3CBOA 5CIUA 1JJ2P 4P5NA 2L3PA 3FDRA 3CBMA 2JS0A 1VQ9A 3L42A 2X4JA 4O5VA 1U5SA 2KMTA 3QWYA 2EBPA 2J6FA 2RQTA 1N9SA 1I4K1 5J39A 2VUBA 1MV0B 1PNJA 3GNFB 3QDFA 3VV0A 2O9SA 2DXBA 4M75C 4RMOA 3MEAA 2QEXT 4M7AD 2E5KA 2F5KA 1T3SA 2E41A 1N5ZA 1KQSP 1MMDA 4LDYA 1GCQA 5FU7B 1M3BA 4M78F 3RUXA 4A63B 2KXDA 2F69A 2K79A 2E4HA 4C8QF 1YJWQ 3MJXA 4QKUA 5DY9A 3QYGB 1VQ4A 3CEYA 1YHQA 1AD5A 1BKBA 2HNIA 3EG9A 3EG2A 2DLPA 1RABB 1CKBA 1XOVA 1W70A 1D3BB 4E7HA 5KYWA 3CCJQ 2P4TA 2RH2A 2LT4A 5C0MA 4FYVB 3VS6A 2ABLA 3C0CA 2V8KA 1D1AA 1XNIA 4C92E 4M7DG 1WA7A 1M90R 5GJWB 3OYKA 2DA9A 2ATCB 3CD6A 1B34B 2X51A 1RUWA 3JCMQ 2PNIA 5GAOn 4B9XA 3CCRA 1IRXA 2AKLA 2PVOB 1UUEA 3I56Q 1WGSA 1OULA 2KY9A 1NM7A 1GCPA 1N27A 3M0TA 3OW2A 1FXXA 1OU9A 4IKFA 1TUDA 5KCOA 2OAUA 4RCBA 1ZSZC 3S3NA 1YJWT 4HCZA 2CREA 4M7AB 1K76A 4R0KA 1I1JA 5D6YA 5GAMj 3JV3A 2LX9A 2X4XA 1MMNA 2JW4A 1TU0B 1TWBA 3CCJT 1V29B 1KIKA 3MEUA 2HSPA 4ZN3A 2F2WA 3BE3A 1Y96B 4GLKA 2ED1A 1QVFS 4M7DC 3ULRB 2ROLA 1QLYA 4LDUA 4AG2C 1VIFA 2X9HA 1W2BS 5HY6A 1M27C 3FIFA 2LC4A 3RERA 1JQQA 1VQ8A 1YBYA 1Q81U 2JVVA 3H8ZA 3ZBDA 3M9QA 4RG2A 2LQWA 4PLLA 1PRLC 2B8AA 3EFOA 1WNLA 2M0OA 3I56T 1YI2A 1YWOA 2J6KA 4FT2A 2LT1A 3JB9F 1GBRA 4FM4B 1KQ1A 1P92A 1BCOA 5IT9E 2DAQA 2MI6A 4E6RA 1Q7YR 2X4YA 1S1NA 2DTHA 3A5ZB 4DBHA 5GANf 4OGEA 1LOJA 3H0FA 2F1LA 2EVRA 2KXCA 2O31A 1O75A 1I0CA 1ACMB 1RAFB 1I81A 5GAMf 5LJ5f 2DXCA 2YUNA 2EJGA 4ZNXA 5KYUB 3A8GB 1UHCA 2MOXA 5GANd 3L2VA 4E7LA 4C92B 2EWNA 1Q82R 2EW3A 1ZUKA 1WXTA 4M78A 5LJ5d 2VKNA 5GAOm 3OYFA 2GBQA 1G2BA 1TXQA 2IVWA 4XTYA 4XK8E 2YLCA 3OA6A 2P4RA 4JUVA 1X6OA 2D8JA 1QMCA 4WCIA 1GCQC 1VQLQ 1NLOC 4OB0B 2F2XA 3OYIA 1X6GA 5I21A 2QK0A 1R8OB 3M55A 2HDAA 2DZ9A 3OBYA 2Y90A 3BDUA 5GAOl 3CCQA 1X43A 4JLGA 1K9MU 3VRZA 2CS7A 2FRWA 4E7ZA 4J9HA 5L8RE 3VS5A 1WIEA 5CCAA 2ZGWA 3RR6A 3CMAA 4ZTFA 2ZCFB 1RLQC 3SEMA 5KYNA 5CKHA 5IH2A 3OW2P 2EGEA 2RHZA 4FYYB 3CCSA 5KYYB 4DA4A 1K8AR 4J83A 5IHKA 3CCLQ 4A4EA 2MWOA 4BD3A 2DF6A 2C0TA 3M58A 3MO8A 3CPWS 3A98A 1NLPC 1ZSGA 2PUKB 4QW2A 2EAYA 1TUGB 3J81E 1V1CA 1VQOA 2CZ0B 3VKIA 1G3TA 4BUGA 1WQWA 4NS5A 1IO6A 1FYNA 2O2OA 4A54A 3HFOA 3JSCA 3L2WA 2C0IA 3SB2A 3P8HA 3LGFA 3TCJA 5GMKe 1VQNQ 4J6YA 1VQLT 5HK3A 2AT1B 2RI3A 1YFNA 2EJFA 3A8MB 1Q82U 1U1TA 1H641 2YUOA 1VQ9Q 3DLLA 2DIGA 4C0ZA 2GF7A 2ZPBB 1WX6A 2I2LA 3L2QA 1KC8U 2L89A 4QVCA 4ZTJA 2D9TA 4AMCA 2GQIA 3TEEA 4OVAA 2AK5A 1Q81C 1Z9ZA 3EFRA 2KQWA 1TTHB 1SF9A 2CGHA 2QTVA 4C8QE 2XK0A 1U1SA 1K73R 3CCLT 1GL5A 1Y71A 1NPPA 5FWCA 1UFFA 1KHIA 1K4US 2R57A 1WFWA 5GAOr 2CP0A 4M78G 2K3YA 2BE9B 2DM1A 1VQ4Q 1H8KA 1YHQQ 2A7YA 3MCAB 1K8AU 2YDLA 4MZMA 5DLQE 2DVEA 2JOYA 3MEWA 2DD5A 5IHNA 4BY6C 2KRMA 4ZGEB 3CCUT 2RI5A 3M0PA 2CP5A 1D3BA 2GFUA 3OQ5A 4GBQA 4RTTA 2QGFB 1M5Q1 3FRNA 3QDRB 5FU6B 4HCCA 4AG1C 4HCKA 3CC7A 2C0OA 1JXMA 3RKXA 2F5TX 4F7UF 4JPBW 3EHRA 3EG1A 1FX7A 1M9SA 3CCRQ 1QW1A 1B34A 1EZZB 2L0AA 1K9MC 2FVUA 1OV3A 1WJRA 4RCCA 1TSFA 2RN8A 2LCCA 1C6VX 4JRKA 2QA4A 2XU8A 2DMOA 1E7OA 1VQ5A 4JZ4A 3UDCA 1NYGA 4E7IA 3OYBA 3C94A 1VQ4T 1VYUA 4XU0A 2ZPHB 5A0GA 1QCOA 2BKDN 4L59A 1YHQT 2L3RA 1K73U 3PVQA 2D1XA 1AT1B 2DRMA 2EYXA 1C1AA 1SHFA 4M7AA 2JM8A 2X3WD 4F14A 1JO8A 4PJOE 3OBWA 3EGUA 1VUBA 1YJ9A 3PGGA 1GFDA 2G6FX 1NZ9A 1MUZA 3EH1A 3QG1A 4M78B 3RESA 1ZUUA 5LJ3d 3JCMV 4C8QB 1M1FA 2A36A 1VQ8Q 2DETA 1XQHA 2E1HA 1NJIR 1N8RR 4M77D 2CZ7B 2VGNA 2R5AA 3CD6T 4J9GA 2EGCA 2YXYA 2VWFA 2VC8A 3ZL7C 1QVGP 5KYXB 3L1AA 1K0XA 1KSWA 4C0DC 4XTWA 3CCRT 1Q82C 2AZSA 4PJOD 2CSIA 2RQUA 4KRTA 4D6WA 1YI2Q 2DL4A 4CC3A 1KC8C 1QP2A 2BZYA 3JB9G 4LUEA 3NMZC 1KG1A 1UB4A 2JNGA 5GANg 1WHKA 3FLGA 3KUFA 1PRMC 3D7SB 1OYXA 3QYHB 2IPOB 2KGTA 3CXCS 1WI7A 3OYDA 1UE9A 2LQ8A 5KH6A 4LD6A 5GAMg 2QDLA 5LJ5g 2DL7A 3FB9A 2PVDB 2ZAEA 2HMAA 5GANh 4CC4B 1N6AA 2KROA 3HL8A 2KDSA 4N4GA 3CCVA 2JTMA 2JM9A 1YN8A 5KYUA 3TSWA 5GAMh 5LJ5h 1Q86R 2CZ1B 3OYMA 3NGPA 2VXEA 1BIBA 2K5FA 4C92A 2CZ6B 4FSSA 5I22A 4LXCA 3OYJA 1VQ8T 1T0HA 3NTHA 1SSFA 3OY9A 1W1FA 1LNXA 2FZCB 2XD0A 1D0YA 1UHFA 1PSFA 4OGCA 3V7CA 1W6XA 2CH4A 3DB4A 1M2VA 3M0UA 2BZ8A 4JLIA 1YI2T 5FU7C 1OI1A 3CCQQ 4E2FB 4M75D 3CCUA 4HVVA 2CH4W 4PL6A 1MMGA 2JJ9A 4J6XA 3ZFJA 3CMAQ 4LN2A 2LP5A 2Y4YA 2RHYA 3MKDA 1TH7A 1U8RA 1NYFA 3CCSQ 1V76A 4M7AG 1G83A 3UA7A 2QGGA 2HEQA 1RI0A 1I5OB 4BE2A 3JCMX 4M4ZA 3EGDB 5KYYA 1PD0A 1ZBXA 2D0NA 2LRQA 2DRKA 1OZ3A 2ECZA 3JB9H 2H3JA 5IXBA 4MMLA 3VUBA 2QDYB 1WHHA 1HJDA 1LVKA 4AT1B 4OMMA 1UEBA 2P0QA 4NOYA 2K3XA 5A0LA 2M9UA 1K73C 2DYIA 3OYAA 2MAMA 4EMHA 1OPLA 1VQKA 2QQAA 4KT0E 5GAN6 2Z0WA 3RMSA 3SDZA 2AHJB 1OPKA 1VQPA 3RKYA 2RHIA 1VA7A 3MEVA 4EMGA 1WHGA 3CCQT 2VYTA 4R56A 2LCLA 2DEUA 1ARKA 2HCKA 2R58A 4C5GA 1I8FA 3H9NA 3CMAT 3JAME 1QWFA 5D6WA 1KD1R 2L5QA 3A8HB 2BUDA 3CCST 3HRTA 3LLRA 1IGUA 3CBPA 4PK4A 3R6NA 2DJZA 2DXUA 1TOVA 2PVGB 3OS0A 1FWZA 1R0CB 2CP2A 3QHSA 3NHNA 1PCXA 1KFZA 2RF0A 2DYBA 2RHUA 1VQOT 4C92G 1K0SA 2AIRB 1YITA 1G5VA 3V7SA 1JU5C 2WSEE 2MIOA 4M7DD 2PTKA 2NUTA 3TREA 2V8JA 4OF1A 1W2BA 3EAEA 3C4SA 3G6EA 4F7UE 2VASA 1G3SA 2XDDA 4IUTA 3X25B 4DQ2A 1MMAA 3PNWC 1AVZC 4M77F 4YTLA 3CC7Q 1PG5B 4AFQC 4J5YA 2DJQA 3CC2A 4A53A 4PJOF 1X01A 3OMCA 1H92A 1RADB 5I11A 4KH0B 2XIDA 1ZUYA 1NBEB 3KXTA 4RTXA 5I2SA 4C92C 3LH0A 3M4YA 4OMOA 2FRYA 4CC2A 2QA4Q 2QQRA 1VYTA 2JZ2A 1N9RA 4JDSA 1VQ5Q 1KD1U 5CR2A 3VJPA 2FPEA 3MHXA 4BB7A 2QYZA 1M90U 4Z89A 2JUFA 1CKAA 1E6HA 4PJMA 3OYGA 4JS4A 4D8KA 1BI3A 5LJ3g 3CC4A 2EIFA 2E12A 1UJYA 2A37A 3IQLA 1YJ9Q 2DZCA 2LQKA 4UC4A 2EQMA 2BE7D 2FZGB 5GAN2 2JN0A 5LJ3h 2FZKB 1X2QA 1YCSB 2HBWA 1WHJA 2ZPGB 5D6XA 1VQ7T 1XTDA 2KI7A 3CC7T 2E64A 2L3QA 2COZA 4C0GA 4JJDA 5GAMd 1TS9A 1AZGB 1U06A 1S72T 1M1KR 3G7ZA 1WDXA 2XG8D 4C8QA 2X35A 2RJEA 1QP3A 3I35A 5GJVB 1VYVA 5AT1B 1M2VB 1JEGA 1EIFA 3LW5E 2CT4A 2EGAA 4M75F 3CQTA 5KYXA 2V8IA 5ECAA 4ZN1A 3OYLA 1LCKA 2IG0A 4NL3A 2KYMA 2DD4A 2QA4T 3WVDB 3THKA 2COWA 3I9QA 2LNHB 4XU1A 1VQ5T 3TSZA 3JCMf 1BIAA 2BTTA 3E9FA 3GNGA 2QXFA 4F7UB 5HK0A 1VQMA 4RTUA 2CP3A 2VB6A 2DL5A 4EMKA 1BI2A 4BACA 2L3SA 2ENMA 1QVFP 1AWWA 3CCVQ 1YJ9T 3CCEA 1SEMA 2K6DA 1PM3A 2VXFA 1ZBJA 1W2BP 3MP8A 2M0YA 2YRVA 5KCHA 1Q7YU 1J3TA 1QQJA 2LX7A 1D0XA 3PIOA 4RTVA 3INZA 4X34A 2DPPB 2C06A 3UF4A 1UJ0A 4ORZA 3GBQA 3I55A 1ZQ1A 1WLPB 2LJ1A 4OB2B 1D1CA 5DM7R 2JTFA 2JMCA 1KHCA 4OMQA 1LPLA 2RK2A 5A0DA 2ZPIB 3EHQA 3VRYA 2P0PA 3OSSC 4A4HA 3CCUQ 3FJPA 4AFUC 2B86A 5D7UA 4PLIA 3HKSA 2HKNA 2CSQA 4E47A 3VS0A 1QVGA 2NYSA 2E3IA 2D8HA 4FSXA 4HXJA 1AWOA 4LDWA 1OX9A 3M59A 4KH1B 3VU3C 2K2VA 1K9AA 4JS5A 3G1JA 4ZGDB 4A4FA 4PJOA 3OS2A 4HA8A 4BDZA 2E6NA 2DKGA 3CCVT 3M56A 3EGDA 5FWBA 5FU6C 4QT7A 3SWNA 4M7DF 1M90C 4HVWA 1OU8A 3OYHA 4AFZC 3MP6A 3RBBB 2NUTB 1MV3A 4PNOA 2D6FA 5FW9A 1YJNA 4LDXA 4C8QG 1ABOA 1VQPQ 1WPYA 3KBGA 1M3AA 2BIVA 2XHCA 3H0IA 3AHUA 2RO0A 3GPLA 3V8JA 3NTIA 3DKMA 2KEAA 1AHJB 3FEOA 3PFSA 3EH2A 4FU6A 2OAWA 4C5EA 2RK1A 3EG3A 2QI2A 1VQ7A 5IHIA 4QQGA 3CD6Q 1S72A 2FB7A 3X20B 2SRCA 3RDVA 5GMKi 2J05A 2LQNA 1A0NB 3CPWP 4GLMA 4XU3A 4RUGA 2WACA 3E19A 2QQSA 4BE0A 3ME9A 3GOXA 4M78C 3NPFA 2QQBA 1WJQA 4C8QC 4MDXA 1YITQ 1KJWA 3S3MA 4J9FA 1NE8A 1B07A 1VQKT 3V8KA 1IGQA 4M77E 1NG2A 2OTLA 4A4GA 3G6EQ 1VQPT 2OTJA 1WHMA 5CK9A 2XKOC 4XTZA 1QCNA 2DTOA 3UT1A 3O8VA 3TVTA 1Q7YC 1B7TA 2ROTA 2A0FB 1KK7A 4RTYA 4XTXA 3LX7A 1VIEA 4QVDA 4ZGJB 2DK3A 1JJ2S 5GAOq 1HXDA 2A3LA 4OB1B 2EYQA 1VQ6T 3CC2Q 2G3RA 5EC7A 4LD9K 3L2RA 1PKSA 3DLMA 3VYHB 4RTWA 3ASKA 1NEBA 1YCYA 4OMNA 3RNJA 2O88A 3A8LB 4PJOG 1M3CA 4FYXB 4RKUE 4Z8AA 2RQWA 2LDMA 3CCMA 2K4YA 1HSQA 5L23A 4PJLA 3V8LA 4DBQA 4KUDK 2QTXA 2XICA 3X26B 4J9BA 5GANe 3HHTB 4NL2A 1KQSS 3QPHA 5KE2A 1PSEA 3KFVA 3VS3A 1YITT 2VV5A 3RKWA 2OI3A 2NWMA 3H0HA 2M02A 3V7RA 2DERA 1M8VA 3HFNA 5GAMe 4EMKB 5LJ5e 3CC4Q 2P0KA 3LH5A 2EFIA 4J9CA 2LMJA 4DBRA 2KNBB 2KRNA 3G6ET 2GCXA 5GMKj 1UGPB 3OYYA 1X27A 1ZA2B 2HSEB 2K2MA 3REAB 1EX4A 1SG5A 3T9NA 3ZEHA 3M0QA 2K57A 2YSQA 4B9WA 1SRLA 1IZ6A 4MZPA 3VYGA 2E10A 3EFSA 4M75E 4HT9A 1PKTA 4FIBA 3VS2A 4KUIA 3NFCA 1I07A 3OYCA 3CC2T 4MZTA 2KVQG 2LTOA 1K8AC 1I5LA 2MPXC 1BB9A 2KBTA 1CSKA 3META 3S6WA 2HZYA 1C0MA 3HRSA 2O4XB 4C5IA 3U23A 3JCMJ 3EGXA 4N4IA 1BI0A 4HVUA 2E5QA 5I2MA 1QKXA 1OX8A 3C12A 8AT1B 1JB0E 4M77B 5GAN5 2LCSA 3PTAA 1NJIU 1N8RU 1IXDA 3JCMg 3QSUA 4IUVA 1VQMQ 1IB8A 3A8OB 3CC4T 3L2ZA 2W0ZA 4PJOB 1VQNA 1MNDA 2EKOA 2KSSA 4N4HA 4O6JA 2EYWA 4F7UA 4OMPA 5CQXA 2I0NA 4PKCC 2M1HA 3JCMh 3CCEQ 1G3WA 4OMFB 5HCKA 3SWNB 1BU1A 4Q5WA 1OQKA 2RD1A 4HKEA 4R55A 1T0JA 3QUIA 3E1SA 2V1QA 3QZ9B 1SPKA 4C5HA 1VQOQ 2K9GA 1FMKA 2ESWA 3I55Q 2V26A
chains in the Genus database with same CATH topology
1M1GA 1H641 4JDSA 3JCMc 1KD1U 3URGA 3DLLA 5CAIA 5CR2A 3VJPA 2DIGA 3MHXA 4BB7A 4C0ZA 1M90U 2GF7A 2ZPBB 2JUFA 2XDPA 1M1KU 2I2LA 3L2QA 3QZ5B 1KC8U 2L89A 4XTVA 4QVCA 4ZTJA 2D9TA 3CXCA 2K5IA 3OYGA 4JS4A 4X9CA 3TEEA 4OVAA 4XQ3A 1BI3A 1Y96A 3M5AA 2EQUA 2EIFA 5LJ3g 1Q81C 3CC4A 3EFRA 3BY7A 2E12A 2KQWA 4DOWA 2RM4A 3CMET 3GF5A 1M1KC 5FLXE 4CRIA 2CGHA 4FT4A 1Q86U 3R6OA 1HK9A 1X75C 4C8QE 2OTJT 2XK0A 1U1SA 4E7JA 3HSBA 5CQYA 3GP8A 2DZCA 2LQKA 3HRUA 1MGQA 2EQMA 1Y71A 3LYIA 4UC4A 1NPPA 5GAN2 2JN0A 5LJ3h 4JRQA 4M7AC 4DOVA 2WSCE 1KHIA 5EG2A 1H3ZA 1VQMT 1VQ6A 1VQLA 3G4ST 2ZPGB 5D6XA 1VQ7T 2R57A 1UGSB 1XTDA 2KAFA 2HAXA 1JBMA 3CC7T 2E64A 5GAOp 3FC3A 4BI3A 4C0GA 3F70A 5GAMd 4JRIA 5GAOr 1W4SA 1S72T 4M78G 2K3YA 3G7ZA 2GQVA 2XG8D 4J8OA 4QQDA 4C8QA 2X35A 4M75B 2RJEA 4M77C 5FROA 1QP3A 3JCMP 3G71T 2DXTA 2A7YA 3MCAB 3CCET 5GAN8 3CPFA 5DLOA 1K8AU 1EIFA 3LW5E 3QXEB 3JB9D 2DIQA 3QKJA 4MZMA 4M75F 5DLQE 4BE1A 2V8IA 4C0FA 3OS5A 5FRNA 2DVEA 4ZN1A 4M7DA 2JOYA 3M54A 3MEWA 2DD5A 2RHXA 3CMEA 2DTIA 3GLXA 3QIIA 3OYLA 4PJOC 4IURA 2IG0A 2EQKA 2YLBA 3SFMA 4NL3A 4BY6C 2EJ9A 2DD4A 2QA4T 3WXMB 3WVDB 3I55T 3WVEB 4ZGEB 3CCUT 2RI5A 4XU1A 1VQ5T 1D3BA 2GFUA 3CCLA 1QVFA 4V2SA 4II1A 3OQ5A 4C0DB 4Z02A 3SWNC 1M5Q1 1BIAA 3JCMf 3OYEA 3E9FA 3FRNA 3GNGA 2QXFA 4QVZA 2HQXA 4F7UB 3QDRB 1G3YA 5FU6B 5HK0A 3MP1A 3J80E 4BDYA 1VQMA 2QQ9A 3G4SA 4M75G 3LWIA 4HCCA 2E6ZA 3OYNA 3CC7A 3RKXA 1Y7XA 3Q1JA 5GMKm 2F5TX 1BI2A 4EMKA 4F7UF 3JRZA 4N0AC 3GIBA 4J6WA 4BACA 5CKDA 3JB9J 3S3OA 3JCMe 5CKBA 2FYKA 5GANj 1FX7A 3G71A 3UPUA 1YJ9T 3CCEA 1MHNA 1M9SA 1ZHIA 1BI1A 2VXFA 1QW1A 4C92D 3MP8A 2YRVA 1B34A 1YIJT 4ME7A 3H6ZA 5KCHA 1Q7YU 3DB3A 2RJDA 1K9MC 5AYFA 2FVUA 4M7AE 5LJ5j 3PIOA 4A4KA 1WJRA 3INZA 4X34A 4RCCA 5HKCA 2DPPB 3C95A 5GMKl 2LCCA 3CBOA 4F7UG 4JRKA 2QA4A 5CIUA 2XU8A 2C06A 4TVRA 3I55A 3OW2S 3QO3A 3FDRA 4P5NA 1ZQ1A 3CBMA 1VQ5A 1VQ9A 3UDCA 3L42A 4E7IA 4OB2B 3OYBA 5CO7A 3C94A 1VQ4T 5DM7R 4XU0A 2ZPHB 5A0GA 2JTFA 2BKDN 2X4JA 3OSVA 4L59A 1YHQT 4O5VA 1LJOA 2L3RA 1K73U 1KHCA 2XI9A 4XTUA 4JJNK 2KMTA 4M7AA 5A0DA 2RK2A 2ZPIB 2L8DA 1M4ZA 1NJIC 1N8RC 1N9SA 2P0PA 1I4K1 5J39A 4PJOE 3OBWA 3OSSC 2VUBA 4A4HA 3FJPA 3GNFB 1VUBA 3VV0A 4PLIA 2DXBA 3HKSA 4M75C 3MEAA 4E47A 3PGGA 4RMOA 2QEXT 1YJ9A 5LJ3e 1YJNT 4M7AD 1NZ9A 1QVGA 1OZ2A 3L2UA 2F5KA 3QG1A 4LDVA 1YIJA 2D0QB 4M78B 4FSXA 3RESA 3PMIA 2E41A 5LJ3d 4LDWA 4LDYA 5FU7B 3M59A 3JCMV 4C8QB 3LWHA 1M1FA 4M78F 3RUXA 3VU3C 2K2VA 1XQHA 2E1HA 4ZGDB 4JS5A 4A4FA 4M77D 2CZ7B 1UGQB 2F69A 2R5AA 2VGNA 3CD6T 4PJOA 3UWNA 3OS2A 4C8QF 4HA8A 2VC8A 4BDZA 5DY9A 1UGRB 2E6NA 3L1AA 3QYGB 3PIPA 1VQ4A 2DKGA 3CCVT 4M7DB 3CEYA 1YHQA 4C0DC 2R5MA 4XTWA 3CCRT 1Q82C 1BKBA 2HNIA 4PJOD 3M56A 1WJSA 1VQ7A 5FU6C 3SWNA 4D6WA 4M7DF 1M90C 1XOVA 3E9GA 3OYHA 1D3BB 4E7HA 5GAN3 1KC8C 3VKIA 3MP6A 1QP2A 2XDBA 3JB9G 2E65A 1KG1A 4PNOA 2P4TA 2RH2A 4EPCA 2D6FA 1UB4A 2LT4A 2JNGA 1YJNA 5GAN4 3JB9I 4C8QG 3BDLA 5GANg 2QEXA 4LDXA 2PUOB 3FLGA 5C0MA 3KUFA 2PQWA 1OYXA 1Q86C 3QYHB 3J7AF 1WPYA 2HBPA 3KBGA 2BIVA 4HT8A 3CXCS 3OYDA 2V8KA 2XHCA 4BI4A 3AHUA 2RO0A 3GPLA 1XNIA 2LQ8A 4C92E 5KH6A 3JB9H 4LD6A 4XAXB 2YHTA 5LJ5g 5GAMg 4M7DG 3V8JA 3OYKA 2RJCA 2PVDB 3DKMA 3FB9A 3NTIA 3CD6A 5GANh 1AHJB 3JCMb 1B34B 3FEOA 3VUZA 3PFSA 4L5GA 4FU6A 1N6AA 3HL8A 4C5EA 2KDSA 2RK1A 3JCMQ 3CPWA 4N4GA 4Y28E 3CCVA 2JTMA 5GAOn 4B9XA 2OTLT 3CCRA 5GAMh 5LJ5h 2PVOB 2NLUA 2CZ1B 2QI2A 1WGSA 3HP9A 3M4GA 2VXEA 3P8DA 3OYMA 2KY9A 3N5BB 1BIBA 4QQGA 2K5FA 3X24B 4C92A 1N27A 2CZ6B 3OW2A 3OYJA 1VQ8T 1S72A 1FXXA 5IAYA 4OP0A 4IKFA 2FB7A 4GY5A 4J7FA 3X20B 5GMKi 3NTHA 1SSFA 2OAUA 5KCOA 1QVPA 3OY9A 4RCBA 4XU3A 3S3NA 1YJWT 4HCZA 4OB3B 1LNXA 2WACA 3E19A 4M7AB 2XD0A 3JCMd 1PSFA 2QQSA 4BE0A 4OGCA 4IUUA 2E70A 3QBYA 4IUPA 3V7CA 3ME9A 3GOXA 4M78C 2VGMA 3DB4A 4M7DE 3P8BB 4XU2A 2HD0A 1O9SA 5D6YA 5GAMj 1DJ7B 4M7AF 4JLIA 1YI2T 2QQBA 5FU7C 1OI1A 1WJQA 2FL7A 2LX9A 4C8QC 2X4XA 4MDXA 4A53A 4M75D 3CCJT 1V29B 3S3MA 3CCUA 3M53A 3MEUA 4PL6A 1NE8A 2DEQA 4ZN3A 1VQKT 1Y96B 3V8KA 4J6XA 4GLKA 4M77E 3ZFJA 1QVFS 3CCMT 2OTLA 2HQEA 4M7DC 4A4GA 2Y4YA 2RHYA 4LDUA 1VIFA 1VQPT 2OTJA 1GXIE 5J3BA 1TH7A 1U8RA 1W2BS 5CK9A 2O4XA 5HY6A 3FIFA 2XKOC 2LC4A 3RERA 4XTZA 4M7AG 2DTOA 1Y07A 4KULA 1VQ8A 3UT1A 4CI0C 1YBYA 3O8VA 1Q7YC 1RI0A 1Q81U 4BE2A 2CKKA 3JCMX 2JVVA 3SD4A 3CCLT 3H8ZA 1KQ2A 4KBMB 3ZBDA 4XTXA 1YJWA 1ZBXA 2LRQA 1VIEA 3LX7A 3M9QA 4ZGJB 4QVDA 1OZ3A 2DK3A 4MMKA 4RG2A 4E7KA 2H3JA 1JJ2S 4M77A 4PLLA 5GAOq 4MMLA 1HXDA 2A3LA 2O01E 2QDYB 3VUBA 2MWPA 2MMPA 4X9DA 4OB1B 1RL2A 2EYQA 2B8AA 1VQ6T 4MDWA 1WNLA 2M0OA 2X4WA 5KE3A 1UEBA 2G3RA 2P0QA 4NOYA 3I56T 1YI2A 4LD9K 3L2RA 3DLMA 4FT2A 2LT1A 3JB9F 3VYHB 2M16A 1KQ1A 3ASKA 2K3XA 4FM4B 1P92A 1YCYA 5A0LA 4L6V5 5IT9E 2DAQA 2M9UA 2MI6A 1K73C 3CCJA 3A8LB 4PJOG 3OYAA 2MAMA 2X4YA 4EMHA 2DTHA 3A5ZB 5GANf 4OGEA 1VQKA 1LOJA 2QQAA 4KT0E 4RKUE 5GAN6 2LDMA 3CCMA 3RMSA 2K4YA 2KK4A 2ZPFB 2AHJB 3QJYA 2RI2A 3SDZA 1O75A 3V8LA 5GMKh 1VQPA 1KD1C 5J26A 4KUDK 2MF2A 1I81A 2QTXA 4M78E 3RKYA 2RHIA 5GAMf 5LJ5f 2XICA 3MEVA 3X26B 4EMGA 5GANe 3HHTB 2DXCA 4NL2A 1KQSS 3QPHA 3CCQT 5KE2A 1PSEA 2K5LA 2VYTA 2EJGA 4R56A 5FRMA 1YITT 2LCLA 3A8GB 2VV5A 4N0AA 3RKWA 2ZZDA 4J7IA 5GANd 2R58A 3QJ6A 3L2VA 3V7RA 3BFMA 5M9OA 4E7LA 1M8VA 3HFNA 4C5GA 4C92B 4EMKB 5GAMe 1I8FA 2P0KA 5LJ5e 1QVGS 2EFIA 2EWNA 3M57A 3CMAT 3JAME 1BYMA 3OMGA 3G6ET 2GCXA 5D6WA 3I56A 2L5QA 5GMKj 5CVIA 1UGPB 3A8HB 4M78A 2BUDA 4C92F 5LJ5d 2DO3A 3OYYA 3CCST 5GAOm 3HRTA 3NTKA 3LLRA 3T9NA 3OYFA 2LNVA 3JCMW 3CBPA 4QQ6A 3ZEHA 2K57A 2GFAA 2IVWA 4RG8A 4VUBA 4XTYA 4B9WA 4WF2A 4XK8E 2YLCA 3OA6A 5C6SA 4JUVA 1IZ6A 1X6OA 2DJZA 4MZPA 3VYGA 2DXUA 2LVMA 4M78D 2PVGB 2E10A 3EFSA 4M75E 3OS0A 4HT9A 1FWZA 3OB9A 4FIBA 5LJ3j 4KUIA 4BI8B 4OB0B 3NFCA 3OYIA 3QHSA 4C8QD 1VQNT 5I21A 3LGLA 3TU4K 3OYCA 3CC2T 4MZTA 2KVQG 1R8OB 2LTOA 3M55A 1K8AC 1I5LA 2DZ9A 4HCBA 2RHUA 3OBYA 2Y90A 3BDUA 4C92G 2RJFA 4JLGA 5GAOl 3CCQA 1VQOT 1K9MU 1WQ7A 5CKEA 1G5VA 1YITA 4EDUA 3V7SA 4FL6A 1VQ9T 2CS7A 2ZPEB 3META 2WSEE 2EQJA 3S6WA 4M7DD 1IREB 4ELYC 5L8RE 3TREA 3HRSA 5CCAA 3OS1A 2O4XB 2ZGWA 4C5IA 2V8JA 2RB6A 3JCMJ 4OF1A 4M75A 1NPRA 3CMAA 1W2BA 3EAEA 4ZTFA 4N4IA 1BI0A 2ZCFB 3PMTA 2E5QA 5I2MA 3C4SA 3G6EA 5CKHA 2RHZA 2Y4XA 4F7UE 3C12A 1G3SA 3HPWA 4ELZC 3CCSA 4DA4A 2XDDA 4IUTA 4J83A 1JB0E 4M77B 5GAN5 4A4EA 3X25B 2MWOA 4BD3A 4DQ2A 3PTAA 1JJ2A 1NJIU 2CYZB 5LL6S 1N8RU 2PU9B 3M58A 3PNWC 4M77F 3MO8A 3JCMg 3QSUA 4IUVA 2WSFE 3CPWS 4IUQA 3BW1A 4YTLA 3A8OB 2RA2A 3CC4T 2PUKB 3L2ZA 4QW2A 2EAYA 1VQNA 3X28B 3J81E 4PJOB 2EKOA 2KSSA 3PT9A 4N4HA 4O6JA 4J5YA 3CC2A 4F7UA 5CQXA 4BY6B 4ATOA 1VQOA 2CZ0B 2FHDA 4PKCC 1G3TA 4PJOF 1WQWA 2M1HA 1X01A 4NS5A 3OMCA 3RIRA 4A54A 4BUGA 3ER0A 3HFOA 3JSCA 5A2QE 3L2WA 3JCMh 5GAN7 1G3WA 3RMQA 4OMFB 3SWNB 3SB2A 3P8HA 2XIDA 4Q5WA 3KXTA 3LGFA 4R55A 2RD1A 4HKEA 5I2SA 3QUIA 3TCJA 3E1SA 5CKFA 1JRIA 4M77G 4Y91A 5LJ3f 4C92C 4J6YA 4EMKC 3QZ9B 5GMKe 5IN1A 5HK3A 1VQLT 2RI3A 3LH0A 3M4YA 4JRPA 1KQSA 4C5HA 2EJFA 3A8MB 2QQRA 1Q82U 2JZ2A 1U1TA 1N9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN d;  1H64 1;  3INZ A;  4RCC A;  3JCM c;  5LJ5 h;  5GAM h;  5CAI A;  3V7R A;  3M4G A;  3BFM A;  2VXE A;  5GMK l;  1BIB A;  3HFN A;  4C92 B;  4JRK A;  4EMK B;  4F7U G;  1I8F A;  2I2L A;  5GAM e;  5LJ5 e;  2EWN A;  4C92 A;  3QO3 A;  4XTV A;  4QVC A;  4OP0 A;  2FB7 A;  5GMK j;  4X9C A;  5GMK i;  4M78 A;  4XQ3 A;  4XU0 A;  4C92 F;  5LJ5 d;  1Y96 A;  5LJ3 g;  5GAO m;  3EFR A;  3BY7 A;  1LJO A;  4RCB A;  4XU3 A;  3JCM W;  2RM4 A;  2K57 A;  1LNX A;  4XTU A;  4XTY A;  4M7A B;  2CGH A;  4WF2 A;  2YLC A;  3JCM d;  4M7A A;  3V7C A;  4JUV A;  1HK9 A;  2DJZ A;  4C8Q E;  4M78 C;  2DXU A;  1N9S A;  1U1S A;  1I4K 1;  4M78 D;  4XU2 A;  2E10 A;  3EFS A;  4M75 E;  3HSB A;  4HT9 A;  5LJ5 f;  5GAM j;  4M7A F;  2DZC A;  4PJO E;  5LJ3 j;  1MGQ A;  3FJP A;  4JLI A;  5GAN 2;  4C8Q C;  2JN0 A;  5LJ3 h;  3QHS A;  4C8Q D;  4M7A C;  4M75 C;  3PGG A;  5I21 A;  4M7A D;  5LJ3 e;  4M75 D;  4M7D E;  1I5L A;  2DZ9 A;  1JBM A;  2DEQ A;  2E64 A;  2Y90 A;  3BDU A;  4M78 B;  4C92 G;  3RES A;  5GAO p;  5GAO l;  1Y96 B;  3V8K A;  1WQ7 A;  2E41 A;  4J6X A;  4M77 E;  5GAM d;  4JRI A;  5LJ3 d;  3V7S A;  5GAO r;  4M7D C;  4M78 G;  3JCM V;  4M7D D;  4C8Q B;  4M78 F;  3RUX A;  3VU3 C;  4C8Q A;  4M75 B;  4M77 C;  2ZGW A;  2E1H A;  1TH7 A;  2RB6 A;  3JCM J;  4M77 D;  4M75 A;  3JCM P;  2DXT A;  4PJO A;  3FIF A;  5GAN 8;  3RER A;  4XTZ A;  4C8Q F;  4M7A G;  2DTO A;  5LJ5 j;  3JB9 D;  4HA8 A;  2VC8 A;  5DY9 A;  4M75 F;  3L1A A;  4F7U E;  2DKG A;  4M7D B;  3JCM X;  2DVE A;  1KQ2 A;  4XTW A;  4M7D A;  4PJO C;  2HNI A;  4XTX A;  2DTI A;  4QVD A;  5GAN 5;  4M77 B;  4PJO D;  3JB9 H;  2YLB A;  4MMK A;  3SWN A;  4NL3 A;  4M77 A;  5GAO q;  2EJ9 A;  4MML A;  1HXD A;  4DQ2 A;  4M7D F;  4X9D A;  1D3B B;  5GAN 3;  4XU1 A;  4M77 F;  1D3B A;  1WNL A;  3JCM g;  3QSU A;  4V2S A;  4NOY A;  3JB9 G;  3BW1 A;  2E65 A;  2RA2 A;  3SWN C;  3JB9 F;  4PNO A;  1M5Q 1;  1BIA A;  3L2Z A;  1KQ1 A;  2EAY A;  3JCM f;  4PJO B;  1M8V A;  1YCY A;  4F7U B;  5GAN 4;  3JB9 I;  4C8Q G;  4J5Y A;  5GAN g;  4F7U A;  4M75 G;  4PJO G;  4EMH A;  2DTH A;  4A53 A;  5GAN f;  4PJO F;  1WQW A;  3RIR A;  1LOJ A;  1WPY A;  1X01 A;  3RKX A;  4A54 A;  5GMK m;  4EMK A;  3HFO A;  4F7U F;  5GAN h;  4HT8 A;  4N0A C;  3JCM h;  5GAN 6;  4J6W A;  5GAN 7;  3JB9 J;  3AHU A;  3GIB A;  4C92 E;  3SWN B;  3SB2 A;  2YHT A;  5LJ5 g;  3JCM e;  3V8L A;  5GMK h;  3V8J A;  2FYK A;  3FB9 A;  5GAM g;  5GAN j;  4M7D G;  2RD1 A;  1I81 A;  3QUI A;  2QTX A;  4M78 E;  3RKY A;  5GAM f;  5GMK e;  1JRI A;  4M77 G;  4Y91 A;  5LJ3 f;  1B34 B;  2VXF A;  4J6Y A;  4C92 C;  4EMG A;  4C92 D;  4EMK C;  3JCM b;  5GAN e;  1B34 A;  4NL2 A;  3JCM Q;  2EJG A;  5GAO n;  2EJF A;  4M7A E;  3RKW A;  4N0A A;  1U1T A;  1N9R A; 
#chains in the Genus database with same CATH topology
 3JCM c;  2EYZ A;  5CAI A;  2XDP A;  2YUP A;  2L2P A;  4XTV A;  2RNA A;  2COY A;  3M5A A;  3VS4 A;  3AT1 B;  3GF5 A;  2EKH A;  5FLX E;  4CRI A;  4FT4 A;  1Q86 U;  2FEI A;  2CUB A;  1HK9 A;  1X75 C;  2YRD A;  3HSB A;  2MCN A;  5CQY A;  3HRU A;  1YNZ A;  3CXC P;  4JRQ A;  4M7A C;  2WSC E;  2W10 A;  5EG2 A;  4B6M A;  4DEX A;  1VQM T;  1VQ6 A;  4M7D E;  1UGS B;  1JBM A;  3FC3 A;  1Q81 R;  1VOM A;  1T3L A;  1M30 A;  4M75 B;  2DXT A;  3CCE T;  5GAN 8;  3QXE B;  2JXB A;  2DIQ A;  1PHT A;  3OS5 A;  1B3Q A;  1AWJ A;  3M54 A;  2RHX A;  3CME A;  2DTI A;  1AZE A;  4IUR A;  2EQK A;  2YLB A;  2FPD A;  1HD3 A;  2EJ9 A;  1ABQ A;  3I55 T;  3WVE B;  1YJN Q;  1IHV A;  1QVF A;  3A1P A;  4II1 A;  4Z02 A;  2DBM A;  3OYE A;  4QVZ A;  1UDL A;  2HQX A;  1G3Y A;  3MP1 A;  3J80 E;  2QQ9 A;  3G4S A;  2LZ6 B;  3LWI A;  4PJJ A;  1WXB A;  2QAZ A;  1D1B A;  3VS1 A;  1RAH B;  5GMK m;  3GIB A;  5CKD A;  1UEC A;  3S3O A;  5CKB A;  5GAN j;  2CP6 A;  1HYO A;  3G71 A;  1SRM A;  4E7S A;  2SEM A;  1ZHI A;  2A08 A;  4C92 D;  2RQR A;  3H6Z A;  1VQ7 Q;  2RJD A;  1RI9 A;  5AYF A;  4DEY A;  4FW1 A;  5LJ5 j;  2GGR A;  3UAT A;  2HKQ B;  5HKC A;  1S72 Q;  2NUP B;  5GMK l;  3VS7 A;  4F7U G;  4TVR A;  3OW2 S;  3QO3 A;  4Z88 A;  5CO7 A;  4PFO A;  3OSV A;  1LJO A;  7AT1 B;  2YUQ A;  2XI9 A;  4XTU A;  2CDT A;  4JJN K;  1K9M R;  1X6B A;  2L8D A;  1M4Z A;  2X3X D;  1N8R C;  1NJI C;  3M0S A;  2GTJ A;  1PD1 A;  1X2K A;  1BCM A;  2JS2 A;  1SKU B;  4ESR A;  1K1Z A;  1ZX6 A;  1ZSZ B;  1YJN T;  4PFZ A;  5LJ3 e;  4FCY A;  2OTL Q;  1WHL A;  1OZ2 A;  3L2U A;  4LDV A;  1YIJ A;  2D0Q B;  2HL5 C;  3PMI A;  2OTJ Q;  1AOJ A;  2KYB A;  3LWH A;  1UGQ B;  4J9D A;  3UWN A;  1RAG B;  2AKK A;  2H3E B;  1UGR B;  2DNU A;  3PIP A;  2P84 A;  4M7D B;  1Q95 G;  2R5M A;  1EFN A;  1RLP C;  1WJS A;  4RTZ A;  2JT4 A;  1UTI A;  3E9G A;  5GAN 3;  1H3H A;  2XDB A;  2E65 A;  4JZ3 A;  4EPC A;  3EGX B;  2LJ0 A;  5GAN 4;  3JB9 I;  2QEX A;  3BDL A;  3CCM Q;  2PUO B;  2PQW A;  3J7A F;  1Q86 C;  2HBP A;  1QCF A;  4KGZ B;  4HT8 A;  2EPD A;  4BI4 A;  2FG0 A;  4XAX B;  2YHT A;  2RJC A;  1JXO A;  2FO0 A;  1KC8 R;  1TUC A;  1D09 B;  1GRI A;  2KT1 A;  3JCM b;  3VUZ A;  1BK2 A;  4L5G A;  3CPW A;  4Y28 E;  2OTL T;  2DL8 A;  1U3O A;  4PJN A;  1IHW A;  2NLU A;  3P8D A;  3HP9 A;  2V1R A;  3M4G A;  2OTJ T;  3N5B B;  1PWT A;  4WTO B;  3X24 B;  3QWX X;  5IAY A;  4OP0 A;  2DIL A;  1QWE A;  4GY5 A;  4J7F A;  3H41 A;  1NEG A;  2DFU A;  1QVP A;  2MK5 A;  4Y92 A;  2FPF A;  4OB3 B;  3MPU B;  3JCM d;  1BBZ A;  1RAI B;  2J06 A;  4IUU A;  2E70 A;  3QBY A;  4IUP A;  4PFP A;  2VGM A;  1XJW B;  3P8B B;  4XU2 A;  2HD0 A;  1O9S A;  4M7A F;  1DJ7 B;  2O9V A;  2FL7 A;  3TQ7 P;  1GFC A;  3PE0 A;  3M53 A;  2DEQ A;  4EIK A;  1F1B B;  3CCM T;  2HQE A;  2HQH A;  2K7A A;  3REB B;  2A28 A;  1MNE A;  1GXI E;  1WYX A;  3I5S A;  5J3B A;  2RQV A;  2O4X A;  2J7I A;  1Y07 A;  4KUL A;  4CI0 C;  2QG9 B;  2CKK A;  3EG9 B;  3I5R A;  3SD4 A;  1KQ2 A;  1YWP A;  4KBM B;  3PVL A;  1YJW A;  4CC7 A;  1M8M A;  1M1K U;  2NUZ A;  2JTE A;  4E7K A;  4M77 A;  2O01 E;  2F2V A;  2GNC A;  2MWP A;  2MMP A;  4X9D A;  1RL2 A;  5KYW B;  4MDW A;  2X4W A;  5KE3 A;  4D8D A;  2YT6 A;  2H8H A;  2M16 A;  4L6V 5;  4FW2 A;  2DL3 A;  3CCJ A;  1SHG A;  4F16 A;  2CUD A;  2KK4 A;  2ZPF B;  3QJY A;  4IIM A;  2RI2 A;  5GMK h;  1KD1 C;  5J26 A;  2MF2 A;  4M78 E;  2EYY A;  2K3B A;  2K5L A;  5FRM A;  1ZLM A;  9ATC B;  1VQK Q;  4N0A A;  1WXU A;  4JJC A;  2GTO A;  3SHW A;  2ZZD A;  4J7I A;  3QJ6 A;  2RPN A;  2KR3 A;  3BFM A;  5M9O A;  1UG1 A;  1QVG S;  3M57 A;  4JJB A;  1BYM A;  2DE0 X;  3OMG A;  3I56 A;  3M0R A;  5CVI A;  4C92 F;  2DO3 A;  3NTK A;  3JCM W;  2LNV A;  4QQ6 A;  2GFA A;  4RG8 A;  4VUB A;  1PC0 A;  4WF2 A;  5C6S A;  2KE9 A;  1YP5 A;  1FMW A;  2LVM A;  4M78 D;  1VQ6 Q;  3OB9 A;  5LJ3 j;  4BI8 B;  4C8Q D;  8ATC B;  1VQN T;  3LGL A;  3TU4 K;  2DBK A;  2BZX A;  3EG0 A;  4HCB A;  2RJF A;  1WQ7 A;  5CKE A;  2DX1 A;  4EDU A;  4FL6 A;  1VQ9 T;  2ZPE B;  2EQJ A;  1IRE B;  4ELY C;  2IIM A;  1X69 A;  2OX7 A;  3OS1 A;  4F17 A;  2RB6 A;  4M75 A;  1NPR A;  3PMT A;  3CME Q;  2Y4X A;  3HPW A;  4ELZ C;  4FYW B;  4LNP A;  1Y57 A;  1JJ2 A;  1M2O A;  2CYZ B;  3EFO B;  5LL6 S;  1Y0M A;  2PU9 B;  2PZ1 A;  2EQI A;  1G8X A;  1TG0 A;  2XMF A;  1ZA1 B;  2WSF E;  3G4S Q;  4IUQ A;  1R77 A;  3BW1 A;  3HTR A;  2RA2 A;  1RAA B;  1QKW A;  3X28 B;  3PT9 A;  4BY6 B;  4ATO A;  1RAE B;  2HL3 A;  2AZV A;  2FHD A;  3UA6 A;  3RIR A;  1D0Z A;  5A2Q E;  3ER0 A;  2VVK A;  3G71 Q;  5GAN 7;  4KGV B;  1UGV A;  3RMQ A;  4IIO A;  2M51 A;  2RMO A;  4J9I A;  4DBF A;  5CKF A;  1JRI A;  4M77 G;  4Y91 A;  5LJ3 f;  4EMK C;  5IN1 A;  1FMV A;  4JRP A;  1KQS A;  2CT3 A;  4MMK A;  1M1G A;  3URG A;  3O5Z A;  3E2U A;  2NUP A;  3QZ5 B;  3CXC A;  2K5I A;  4X9C A;  4XQ3 A;  2OJ2 A;  1Z9Q A;  1Y96 A;  2EQU A;  2MYS A;  3BY7 A;  4DOW A;  2RM4 A;  3CME T;  1R0B G;  1OOT A;  1GBQ A;  2DVJ A;  1M1K C;  2YRC A;  2KRS A;  2CP7 A;  3R6O A;  4E7J A;  3GP8 A;  1MGQ A;  3LYI A;  1YIJ Q;  4DOV A;  1ZSZ A;  1H3Z A;  2E3H A;  3G4S T;  1VQL A;  2KAF A;  2HAX A;  5GAO p;  4BI3 A;  3F70 A;  4JRI A;  1W4S A;  2ED0 A;  4J9E A;  2GQV A;  4J8O A;  1OEB A;  4QQD A;  4X1V A;  4M77 C;  5FRO A;  3JCM P;  3G71 T;  3CPF A;  5DLO A;  3JB9 D;  3QKJ A;  4BE1 A;  2JMA A;  4C0F A;  5FRN A;  4M7D A;  4PJO C;  3GLX A;  2QAS A;  3QII A;  1E6G A;  3SFM A;  3FJ5 A;  2LJ3 A;  4LUD A;  1WZO A;  3WXM B;  1RAC B;  2QEX Q;  3CCL A;  4V2S A;  1AWX A;  4K11 A;  4C0D B;  3SWN C;  4F04 B;  2J6O A;  4BDY A;  4AFS C;  6AT1 B;  4M75 G;  2E6Z A;  3OYN A;  5IXF A;  1Y7X A;  3Q1J A;  3JRZ A;  4N0A C;  4J6W A;  4OML A;  3JB9 J;  3JCM e;  2FYK A;  4ANJ A;  3UPU A;  4LE9 A;  1MHN A;  1BI1 A;  4KGX B;  1YIJ T;  4ME7 A;  1SSH A;  3DB3 A;  4M7A E;  2YWW A;  4A4K A;  1AEY A;  3C95 A;  2KT8 A;  3CBO A;  5CIU A;  1JJ2 P;  4P5N A;  2L3P A;  3FDR A;  3CBM A;  2JS0 A;  1VQ9 A;  3L42 A;  2X4J A;  4O5V A;  1U5S A;  2KMT A;  3QWY A;  2EBP A;  2J6F A;  2RQT A;  1N9S A;  1I4K 1;  5J39 A;  2VUB A;  1MV0 B;  1PNJ A;  3GNF B;  3QDF A;  3VV0 A;  2O9S A;  2DXB A;  4M75 C;  4RMO A;  3MEA A;  2QEX T;  4M7A D;  2E5K A;  2F5K A;  1T3S A;  2E41 A;  1N5Z A;  1KQS P;  1MMD A;  4LDY A;  1GCQ A;  5FU7 B;  1M3B A;  4M78 F;  3RUX A;  4A63 B;  2KXD A;  2F69 A;  2K79 A;  2E4H A;  4C8Q F;  1YJW Q;  3MJX A;  4QKU A;  5DY9 A;  3QYG B;  1VQ4 A;  3CEY A;  1YHQ A;  1AD5 A;  1BKB A;  2HNI A;  3EG9 A;  3EG2 A;  2DLP A;  1RAB B;  1CKB A;  1XOV A;  1W70 A;  1D3B B;  4E7H A;  5KYW A;  3CCJ Q;  2P4T A;  2RH2 A;  2LT4 A;  5C0M A;  4FYV B;  3VS6 A;  2ABL A;  3C0C A;  2V8K A;  1D1A A;  1XNI A;  4C92 E;  4M7D G;  1WA7 A;  1M90 R;  5GJW B;  3OYK A;  2DA9 A;  2ATC B;  3CD6 A;  1B34 B;  2X51 A;  1RUW A;  3JCM Q;  2PNI A;  5GAO n;  4B9X A;  3CCR A;  1IRX A;  2AKL A;  2PVO B;  1UUE A;  3I56 Q;  1WGS A;  1OUL A;  2KY9 A;  1NM7 A;  1GCP A;  1N27 A;  3M0T A;  3OW2 A;  1FXX A;  1OU9 A;  4IKF A;  1TUD A;  5KCO A;  2OAU A;  4RCB A;  1ZSZ C;  3S3N A;  1YJW T;  4HCZ A;  2CRE A;  4M7A B;  1K76 A;  4R0K A;  1I1J A;  5D6Y A;  5GAM j;  3JV3 A;  2LX9 A;  2X4X A;  1MMN A;  2JW4 A;  1TU0 B;  1TWB A;  3CCJ T;  1V29 B;  1KIK A;  3MEU A;  2HSP A;  4ZN3 A;  2F2W A;  3BE3 A;  1Y96 B;  4GLK A;  2ED1 A;  1QVF S;  4M7D C;  3ULR B;  2ROL A;  1QLY A;  4LDU A;  4AG2 C;  1VIF A;  2X9H A;  1W2B S;  5HY6 A;  1M27 C;  3FIF A;  2LC4 A;  3RER A;  1JQQ A;  1VQ8 A;  1YBY A;  1Q81 U;  2JVV A;  3H8Z A;  3ZBD A;  3M9Q A;  4RG2 A;  2LQW A;  4PLL A;  1PRL C;  2B8A A;  3EFO A;  1WNL A;  2M0O A;  3I56 T;  1YI2 A;  1YWO A;  2J6K A;  4FT2 A;  2LT1 A;  3JB9 F;  1GBR A;  4FM4 B;  1KQ1 A;  1P92 A;  1BCO A;  5IT9 E;  2DAQ A;  2MI6 A;  4E6R A;  1Q7Y R;  2X4Y A;  1S1N A;  2DTH A;  3A5Z B;  4DBH A;  5GAN f;  4OGE A;  1LOJ A;  3H0F A;  2F1L A;  2EVR A;  2KXC A;  2O31 A;  1O75 A;  1I0C A;  1ACM B;  1RAF B;  1I81 A;  5GAM f;  5LJ5 f;  2DXC A;  2YUN A;  2EJG A;  4ZNX A;  5KYU B;  3A8G B;  1UHC A;  2MOX A;  5GAN d;  3L2V A;  4E7L A;  4C92 B;  2EWN A;  1Q82 R;  2EW3 A;  1ZUK A;  1WXT A;  4M78 A;  5LJ5 d;  2VKN A;  5GAO m;  3OYF A;  2GBQ A;  1G2B A;  1TXQ A;  2IVW A;  4XTY A;  4XK8 E;  2YLC A;  3OA6 A;  2P4R A;  4JUV A;  1X6O A;  2D8J A;  1QMC A;  4WCI A;  1GCQ C;  1VQL Q;  1NLO C;  4OB0 B;  2F2X A;  3OYI A;  1X6G A;  5I21 A;  2QK0 A;  1R8O B;  3M55 A;  2HDA A;  2DZ9 A;  3OBY A;  2Y90 A;  3BDU A;  5GAO l;  3CCQ A;  1X43 A;  4JLG A;  1K9M U;  3VRZ A;  2CS7 A;  2FRW A;  4E7Z A;  4J9H A;  5L8R E;  3VS5 A;  1WIE A;  5CCA A;  2ZGW A;  3RR6 A;  3CMA A;  4ZTF A;  2ZCF B;  1RLQ C;  3SEM A;  5KYN A;  5CKH A;  5IH2 A;  3OW2 P;  2EGE A;  2RHZ A;  4FYY B;  3CCS A;  5KYY B;  4DA4 A;  1K8A R;  4J83 A;  5IHK A;  3CCL Q;  4A4E A;  2MWO A;  4BD3 A;  2DF6 A;  2C0T A;  3M58 A;  3MO8 A;  3CPW S;  3A98 A;  1NLP C;  1ZSG A;  2PUK B;  4QW2 A;  2EAY A;  1TUG B;  3J81 E;  1V1C A;  1VQO A;  2CZ0 B;  3VKI A;  1G3T A;  4BUG A;  1WQW A;  4NS5 A;  1IO6 A;  1FYN A;  2O2O A;  4A54 A;  3HFO A;  3JSC A;  3L2W A;  2C0I A;  3SB2 A;  3P8H A;  3LGF A;  3TCJ A;  5GMK e;  1VQN Q;  4J6Y A;  1VQL T;  5HK3 A;  2AT1 B;  2RI3 A;  1YFN A;  2EJF A;  3A8M B;  1Q82 U;  1U1T A;  1H64 1;  2YUO A;  1VQ9 Q;  3DLL A;  2DIG A;  4C0Z A;  2GF7 A;  2ZPB B;  1WX6 A;  2I2L A;  3L2Q A;  1KC8 U;  2L89 A;  4QVC A;  4ZTJ A;  2D9T A;  4AMC A;  2GQI A;  3TEE A;  4OVA A;  2AK5 A;  1Q81 C;  1Z9Z A;  3EFR A;  2KQW A;  1TTH B;  1SF9 A;  2CGH A;  2QTV A;  4C8Q E;  2XK0 A;  1U1S A;  1K73 R;  3CCL T;  1GL5 A;  1Y71 A;  1NPP A;  5FWC A;  1UFF A;  1KHI A;  1K4U S;  2R57 A;  1WFW A;  5GAO r;  2CP0 A;  4M78 G;  2K3Y A;  2BE9 B;  2DM1 A;  1VQ4 Q;  1H8K A;  1YHQ Q;  2A7Y A;  3MCA B;  1K8A U;  2YDL A;  4MZM A;  5DLQ E;  2DVE A;  2JOY A;  3MEW A;  2DD5 A;  5IHN A;  4BY6 C;  2KRM A;  4ZGE B;  3CCU T;  2RI5 A;  3M0P A;  2CP5 A;  1D3B A;  2GFU A;  3OQ5 A;  4GBQ A;  4RTT A;  2QGF B;  1M5Q 1;  3FRN A;  3QDR B;  5FU6 B;  4HCC A;  4AG1 C;  4HCK A;  3CC7 A;  2C0O A;  1JXM A;  3RKX A;  2F5T X;  4F7U F;  4JPB W;  3EHR A;  3EG1 A;  1FX7 A;  1M9S A;  3CCR Q;  1QW1 A;  1B34 A;  1EZZ B;  2L0A A;  1K9M C;  2FVU A;  1OV3 A;  1WJR A;  4RCC A;  1TSF A;  2RN8 A;  2LCC A;  1C6V X;  4JRK A;  2QA4 A;  2XU8 A;  2DMO A;  1E7O A;  1VQ5 A;  4JZ4 A;  3UDC A;  1NYG A;  4E7I A;  3OYB A;  3C94 A;  1VQ4 T;  1VYU A;  4XU0 A;  2ZPH B;  5A0G A;  1QCO A;  2BKD N;  4L59 A;  1YHQ T;  2L3R A;  1K73 U;  3PVQ A;  2D1X A;  1AT1 B;  2DRM A;  2EYX A;  1C1A A;  1SHF A;  4M7A A;  2JM8 A;  2X3W D;  4F14 A;  1JO8 A;  4PJO E;  3OBW A;  3EGU A;  1VUB A;  1YJ9 A;  3PGG A;  1GFD A;  2G6F X;  1NZ9 A;  1MUZ A;  3EH1 A;  3QG1 A;  4M78 B;  3RES A;  1ZUU A;  5LJ3 d;  3JCM V;  4C8Q B;  1M1F A;  2A36 A;  1VQ8 Q;  2DET A;  1XQH A;  2E1H A;  1NJI R;  1N8R R;  4M77 D;  2CZ7 B;  2VGN A;  2R5A A;  3CD6 T;  4J9G A;  2EGC A;  2YXY A;  2VWF A;  2VC8 A;  3ZL7 C;  1QVG P;  5KYX B;  3L1A A;  1K0X A;  1KSW A;  4C0D C;  4XTW A;  3CCR T;  1Q82 C;  2AZS A;  4PJO D;  2CSI A;  2RQU A;  4KRT A;  4D6W A;  1YI2 Q;  2DL4 A;  4CC3 A;  1KC8 C;  1QP2 A;  2BZY A;  3JB9 G;  4LUE A;  3NMZ C;  1KG1 A;  1UB4 A;  2JNG A;  5GAN g;  1WHK A;  3FLG A;  3KUF A;  1PRM C;  3D7S B;  1OYX A;  3QYH B;  2IPO B;  2KGT A;  3CXC S;  1WI7 A;  3OYD A;  1UE9 A;  2LQ8 A;  5KH6 A;  4LD6 A;  5GAM g;  2QDL A;  5LJ5 g;  2DL7 A;  3FB9 A;  2PVD B;  2ZAE A;  2HMA A;  5GAN h;  4CC4 B;  1N6A A;  2KRO A;  3HL8 A;  2KDS A;  4N4G A;  3CCV A;  2JTM A;  2JM9 A;  1YN8 A;  5KYU A;  3TSW A;  5GAM h;  5LJ5 h;  1Q86 R;  2CZ1 B;  3OYM A;  3NGP A;  2VXE A;  1BIB A;  2K5F A;  4C92 A;  2CZ6 B;  4FSS A;  5I22 A;  4LXC A;  3OYJ A;  1VQ8 T;  1T0H A;  3NTH A;  1SSF A;  3OY9 A;  1W1F A;  1LNX A;  2FZC B;  2XD0 A;  1D0Y A;  1UHF A;  1PSF A;  4OGC A;  3V7C A;  1W6X A;  2CH4 A;  3DB4 A;  1M2V A;  3M0U A;  2BZ8 A;  4JLI A;  1YI2 T;  5FU7 C;  1OI1 A;  3CCQ Q;  4E2F B;  4M75 D;  3CCU A;  4HVV A;  2CH4 W;  4PL6 A;  1MMG A;  2JJ9 A;  4J6X A;  3ZFJ A;  3CMA Q;  4LN2 A;  2LP5 A;  2Y4Y A;  2RHY A;  3MKD A;  1TH7 A;  1U8R A;  1NYF A;  3CCS Q;  1V76 A;  4M7A G;  1G83 A;  3UA7 A;  2QGG A;  2HEQ A;  1RI0 A;  1I5O B;  4BE2 A;  3JCM X;  4M4Z A;  3EGD B;  5KYY A;  1PD0 A;  1ZBX A;  2D0N A;  2LRQ A;  2DRK A;  1OZ3 A;  2ECZ A;  3JB9 H;  2H3J A;  5IXB A;  4MML A;  3VUB A;  2QDY B;  1WHH A;  1HJD A;  1LVK A;  4AT1 B;  4OMM A;  1UEB A;  2P0Q A;  4NOY A;  2K3X A;  5A0L A;  2M9U A;  1K73 C;  2DYI A;  3OYA A;  2MAM A;  4EMH A;  1OPL A;  1VQK A;  2QQA A;  4KT0 E;  5GAN 6;  2Z0W A;  3RMS A;  3SDZ A;  2AHJ B;  1OPK A;  1VQP A;  3RKY A;  2RHI A;  1VA7 A;  3MEV A;  4EMG A;  1WHG A;  3CCQ T;  2VYT A;  4R56 A;  2LCL A;  2DEU A;  1ARK A;  2HCK A;  2R58 A;  4C5G A;  1I8F A;  3H9N A;  3CMA T;  3JAM E;  1QWF A;  5D6W A;  1KD1 R;  2L5Q A;  3A8H B;  2BUD A;  3CCS T;  3HRT A;  3LLR A;  1IGU A;  3CBP A;  4PK4 A;  3R6N A;  2DJZ A;  2DXU A;  1TOV A;  2PVG B;  3OS0 A;  1FWZ A;  1R0C B;  2CP2 A;  3QHS A;  3NHN A;  1PCX A;  1KFZ A;  2RF0 A;  2DYB A;  2RHU A;  1VQO T;  4C92 G;  1K0S A;  2AIR B;  1YIT A;  1G5V A;  3V7S A;  1JU5 C;  2WSE E;  2MIO A;  4M7D D;  2PTK A;  2NUT A;  3TRE A;  2V8J A;  4OF1 A;  1W2B A;  3EAE A;  3C4S A;  3G6E A;  4F7U E;  2VAS A;  1G3S A;  2XDD A;  4IUT A;  3X25 B;  4DQ2 A;  1MMA A;  3PNW C;  1AVZ C;  4M77 F;  4YTL A;  3CC7 Q;  1PG5 B;  4AFQ C;  4J5Y A;  2DJQ A;  3CC2 A;  4A53 A;  4PJO F;  1X01 A;  3OMC A;  1H92 A;  1RAD B;  5I11 A;  4KH0 B;  2XID A;  1ZUY A;  1NBE B;  3KXT A;  4RTX A;  5I2S A;  4C92 C;  3LH0 A;  3M4Y A;  4OMO A;  2FRY A;  4CC2 A;  2QA4 Q;  2QQR A;  1VYT A;  2JZ2 A;  1N9R A;  4JDS A;  1VQ5 Q;  1KD1 U;  5CR2 A;  3VJP A;  2FPE A;  3MHX A;  4BB7 A;  2QYZ A;  1M90 U;  4Z89 A;  2JUF A;  1CKA A;  1E6H A;  4PJM A;  3OYG A;  4JS4 A;  4D8K A;  1BI3 A;  5LJ3 g;  3CC4 A;  2EIF A;  2E12 A;  1UJY A;  2A37 A;  3IQL A;  1YJ9 Q;  2DZC A;  2LQK A;  4UC4 A;  2EQM A;  2BE7 D;  2FZG B;  5GAN 2;  2JN0 A;  5LJ3 h;  2FZK B;  1X2Q A;  1YCS B;  2HBW A;  1WHJ A;  2ZPG B;  5D6X A;  1VQ7 T;  1XTD A;  2KI7 A;  3CC7 T;  2E64 A;  2L3Q A;  2COZ A;  4C0G A;  4JJD A;  5GAM d;  1TS9 A;  1AZG B;  1U06 A;  1S72 T;  1M1K R;  3G7Z A;  1WDX A;  2XG8 D;  4C8Q A;  2X35 A;  2RJE A;  1QP3 A;  3I35 A;  5GJV B;  1VYV A;  5AT1 B;  1M2V B;  1JEG A;  1EIF A;  3LW5 E;  2CT4 A;  2EGA A;  4M75 F;  3CQT A;  5KYX A;  2V8I A;  5ECA A;  4ZN1 A;  3OYL A;  1LCK A;  2IG0 A;  4NL3 A;  2KYM A;  2DD4 A;  2QA4 T;  3WVD B;  3THK A;  2COW A;  3I9Q A;  2LNH B;  4XU1 A;  1VQ5 T;  3TSZ A;  3JCM f;  1BIA A;  2BTT A;  3E9F A;  3GNG A;  2QXF A;  4F7U B;  5HK0 A;  1VQM A;  4RTU A;  2CP3 A;  2VB6 A;  2DL5 A;  4EMK A;  1BI2 A;  4BAC A;  2L3S A;  2ENM A;  1QVF P;  1AWW A;  3CCV Q;  1YJ9 T;  3CCE A;  1SEM A;  2K6D A;  1PM3 A;  2VXF A;  1ZBJ A;  1W2B P;  3MP8 A;  2M0Y A;  2YRV A;  5KCH A;  1Q7Y U;  1J3T A;  1QQJ A;  2LX7 A;  1D0X A;  3PIO A;  4RTV A;  3INZ A;  4X34 A;  2DPP B;  2C06 A;  3UF4 A;  1UJ0 A;  4ORZ A;  3GBQ A;  3I55 A;  1ZQ1 A;  1WLP B;  2LJ1 A;  4OB2 B;  1D1C A;  5DM7 R;  2JTF A;  2JMC A;  1KHC A;  4OMQ A;  1LPL A;  2RK2 A;  5A0D A;  2ZPI B;  3EHQ A;  3VRY A;  2P0P A;  3OSS C;  4A4H A;  3CCU Q;  3FJP A;  4AFU C;  2B86 A;  5D7U A;  4PLI A;  3HKS A;  2HKN A;  2CSQ A;  4E47 A;  3VS0 A;  1QVG A;  2NYS A;  2E3I A;  2D8H A;  4FSX A;  4HXJ A;  1AWO A;  4LDW A;  1OX9 A;  3M59 A;  4KH1 B;  3VU3 C;  2K2V A;  1K9A A;  4JS5 A;  3G1J A;  4ZGD B;  4A4F A;  4PJO A;  3OS2 A;  4HA8 A;  4BDZ A;  2E6N A;  2DKG A;  3CCV T;  3M56 A;  3EGD A;  5FWB A;  5FU6 C;  4QT7 A;  3SWN A;  4M7D F;  1M90 C;  4HVW A;  1OU8 A;  3OYH A;  4AFZ C;  3MP6 A;  3RBB B;  2NUT B;  1MV3 A;  4PNO A;  2D6F A;  5FW9 A;  1YJN A;  4LDX A;  4C8Q G;  1ABO A;  1VQP Q;  1WPY A;  3KBG A;  1M3A A;  2BIV A;  2XHC A;  3H0I A;  3AHU A;  2RO0 A;  3GPL A;  3V8J A;  3NTI A;  3DKM A;  2KEA A;  1AHJ B;  3FEO A;  3PFS A;  3EH2 A;  4FU6 A;  2OAW A;  4C5E A;  2RK1 A;  3EG3 A;  2QI2 A;  1VQ7 A;  5IHI A;  4QQG A;  3CD6 Q;  1S72 A;  2FB7 A;  3X20 B;  2SRC A;  3RDV A;  5GMK i;  2J05 A;  2LQN A;  1A0N B;  3CPW P;  4GLM A;  4XU3 A;  4RUG A;  2WAC A;  3E19 A;  2QQS A;  4BE0 A;  3ME9 A;  3GOX A;  4M78 C;  3NPF A;  2QQB A;  1WJQ A;  4C8Q C;  4MDX A;  1YIT Q;  1KJW A;  3S3M A;  4J9F A;  1NE8 A;  1B07 A;  1VQK T;  3V8K A;  1IGQ A;  4M77 E;  1NG2 A;  2OTL A;  4A4G A;  3G6E Q;  1VQP T;  2OTJ A;  1WHM A;  5CK9 A;  2XKO C;  4XTZ A;  1QCN A;  2DTO A;  3UT1 A;  3O8V A;  3TVT A;  1Q7Y C;  1B7T A;  2ROT A;  2A0F B;  1KK7 A;  4RTY A;  4XTX A;  3LX7 A;  1VIE A;  4QVD A;  4ZGJ B;  2DK3 A;  1JJ2 S;  5GAO q;  1HXD A;  2A3L A;  4OB1 B;  2EYQ A;  1VQ6 T;  3CC2 Q;  2G3R A;  5EC7 A;  4LD9 K;  3L2R A;  1PKS A;  3DLM A;  3VYH B;  4RTW A;  3ASK A;  1NEB A;  1YCY A;  4OMN A;  3RNJ A;  2O88 A;  3A8L B;  4PJO G;  1M3C A;  4FYX B;  4RKU E;  4Z8A A;  2RQW A;  2LDM A;  3CCM A;  2K4Y A;  1HSQ A;  5L23 A;  4PJL A;  3V8L A;  4DBQ A;  4KUD K;  2QTX A;  2XIC A;  3X26 B;  4J9B A;  5GAN e;  3HHT B;  4NL2 A;  1KQS S;  3QPH A;  5KE2 A;  1PSE A;  3KFV A;  3VS3 A;  1YIT T;  2VV5 A;  3RKW A;  2OI3 A;  2NWM A;  3H0H A;  2M02 A;  3V7R A;  2DER A;  1M8V A;  3HFN A;  5GAM e;  4EMK B;  5LJ5 e;  3CC4 Q;  2P0K A;  3LH5 A;  2EFI A;  4J9C A;  2LMJ A;  4DBR A;  2KNB B;  2KRN A;  3G6E T;  2GCX A;  5GMK j;  1UGP B;  3OYY A;  1X27 A;  1ZA2 B;  2HSE B;  2K2M A;  3REA B;  1EX4 A;  1SG5 A;  3T9N A;  3ZEH A;  3M0Q A;  2K57 A;  2YSQ A;  4B9W A;  1SRL A;  1IZ6 A;  4MZP A;  3VYG A;  2E10 A;  3EFS A;  4M75 E;  4HT9 A;  1PKT A;  4FIB A;  3VS2 A;  4KUI A;  3NFC A;  1I07 A;  3OYC A;  3CC2 T;  4MZT A;  2KVQ G;  2LTO A;  1K8A C;  1I5L A;  2MPX C;  1BB9 A;  2KBT A;  1CSK A;  3MET A;  3S6W A;  2HZY A;  1C0M A;  3HRS A;  2O4X B;  4C5I A;  3U23 A;  3JCM J;  3EGX A;  4N4I A;  1BI0 A;  4HVU A;  2E5Q A;  5I2M A;  1QKX A;  1OX8 A;  3C12 A;  8AT1 B;  1JB0 E;  4M77 B;  5GAN 5;  2LCS A;  3PTA A;  1NJI U;  1N8R U;  1IXD A;  3JCM g;  3QSU A;  4IUV A;  1VQM Q;  1IB8 A;  3A8O B;  3CC4 T;  3L2Z A;  2W0Z A;  4PJO B;  1VQN A;  1MND A;  2EKO A;  2KSS A;  4N4H A;  4O6J A;  2EYW A;  4F7U A;  4OMP A;  5CQX A;  2I0N A;  4PKC C;  2M1H A;  3JCM h;  3CCE Q;  1G3W A;  4OMF B;  5HCK A;  3SWN B;  1BU1 A;  4Q5W A;  1OQK A;  2RD1 A;  4HKE A;  4R55 A;  1T0J A;  3QUI A;  3E1S A;  2V1Q A;  3QZ9 B;  1SPK A;  4C5H A;  1VQO Q;  2K9G A;  1FMK A;  2ESW A;  3I55 Q;  2V26 A; 
#chains in the Genus database with same CATH homology
 1M1G A;  1H64 1;  4JDS A;  3JCM c;  1KD1 U;  3URG A;  3DLL A;  5CAI A;  5CR2 A;  3VJP A;  2DIG A;  3MHX A;  4BB7 A;  4C0Z A;  1M90 U;  2GF7 A;  2ZPB B;  2JUF A;  2XDP A;  1M1K U;  2I2L A;  3L2Q A;  3QZ5 B;  1KC8 U;  2L89 A;  4XTV A;  4QVC A;  4ZTJ A;  2D9T A;  3CXC A;  2K5I A;  3OYG A;  4JS4 A;  4X9C A;  3TEE A;  4OVA A;  4XQ3 A;  1BI3 A;  1Y96 A;  3M5A A;  2EQU A;  2EIF A;  5LJ3 g;  1Q81 C;  3CC4 A;  3EFR A;  3BY7 A;  2E12 A;  2KQW A;  4DOW A;  2RM4 A;  3CME T;  3GF5 A;  1M1K C;  5FLX E;  4CRI A;  2CGH A;  4FT4 A;  1Q86 U;  3R6O A;  1HK9 A;  1X75 C;  4C8Q E;  2OTJ T;  2XK0 A;  1U1S A;  4E7J A;  3HSB A;  5CQY A;  3GP8 A;  2DZC A;  2LQK A;  3HRU A;  1MGQ A;  2EQM A;  1Y71 A;  3LYI A;  4UC4 A;  1NPP A;  5GAN 2;  2JN0 A;  5LJ3 h;  4JRQ A;  4M7A C;  4DOV A;  2WSC E;  1KHI A;  5EG2 A;  1H3Z A;  1VQM T;  1VQ6 A;  1VQL A;  3G4S T;  2ZPG B;  5D6X A;  1VQ7 T;  2R57 A;  1UGS B;  1XTD A;  2KAF A;  2HAX A;  1JBM A;  3CC7 T;  2E64 A;  5GAO p;  3FC3 A;  4BI3 A;  4C0G A;  3F70 A;  5GAM d;  4JRI A;  5GAO r;  1W4S A;  1S72 T;  4M78 G;  2K3Y A;  3G7Z A;  2GQV A;  2XG8 D;  4J8O A;  4QQD A;  4C8Q A;  2X35 A;  4M75 B;  2RJE A;  4M77 C;  5FRO A;  1QP3 A;  3JCM P;  3G71 T;  2DXT A;  2A7Y A;  3MCA B;  3CCE T;  5GAN 8;  3CPF A;  5DLO A;  1K8A U;  1EIF A;  3LW5 E;  3QXE B;  3JB9 D;  2DIQ A;  3QKJ A;  4MZM A;  4M75 F;  5DLQ E;  4BE1 A;  2V8I A;  4C0F A;  3OS5 A;  5FRN A;  2DVE A;  4ZN1 A;  4M7D A;  2JOY A;  3M54 A;  3MEW A;  2DD5 A;  2RHX A;  3CME A;  2DTI A;  3GLX A;  3QII A;  3OYL A;  4PJO C;  4IUR A;  2IG0 A;  2EQK A;  2YLB A;  3SFM A;  4NL3 A;  4BY6 C;  2EJ9 A;  2DD4 A;  2QA4 T;  3WXM B;  3WVD B;  3I55 T;  3WVE B;  4ZGE B;  3CCU T;  2RI5 A;  4XU1 A;  1VQ5 T;  1D3B A;  2GFU A;  3CCL A;  1QVF A;  4V2S A;  4II1 A;  3OQ5 A;  4C0D B;  4Z02 A;  3SWN C;  1M5Q 1;  1BIA A;  3JCM f;  3OYE A;  3E9F A;  3FRN A;  3GNG A;  2QXF A;  4QVZ A;  2HQX A;  4F7U B;  3QDR B;  1G3Y A;  5FU6 B;  5HK0 A;  3MP1 A;  3J80 E;  4BDY A;  1VQM A;  2QQ9 A;  3G4S A;  4M75 G;  3LWI A;  4HCC A;  2E6Z A;  3OYN A;  3CC7 A;  3RKX A;  1Y7X A;  3Q1J A;  5GMK m;  2F5T X;  1BI2 A;  4EMK A;  4F7U F;  3JRZ A;  4N0A C;  3GIB A;  4J6W A;  4BAC A;  5CKD A;  3JB9 J;  3S3O A;  3JCM e;  5CKB A;  2FYK A;  5GAN j;  1FX7 A;  3G71 A;  3UPU A;  1YJ9 T;  3CCE A;  1MHN A;  1M9S A;  1ZHI A;  1BI1 A;  2VXF A;  1QW1 A;  4C92 D;  3MP8 A;  2YRV A;  1B34 A;  1YIJ T;  4ME7 A;  3H6Z A;  5KCH A;  1Q7Y U;  3DB3 A;  2RJD A;  1K9M C;  5AYF A;  2FVU A;  4M7A E;  5LJ5 j;  3PIO A;  4A4K A;  1WJR A;  3INZ A;  4X34 A;  4RCC A;  5HKC A;  2DPP B;  3C95 A;  5GMK l;  2LCC A;  3CBO A;  4F7U G;  4JRK A;  2QA4 A;  5CIU A;  2XU8 A;  2C06 A;  4TVR A;  3I55 A;  3OW2 S;  3QO3 A;  3FDR A;  4P5N A;  1ZQ1 A;  3CBM A;  1VQ5 A;  1VQ9 A;  3UDC A;  3L42 A;  4E7I A;  4OB2 B;  3OYB A;  5CO7 A;  3C94 A;  1VQ4 T;  5DM7 R;  4XU0 A;  2ZPH B;  5A0G A;  2JTF A;  2BKD N;  2X4J A;  3OSV A;  4L59 A;  1YHQ T;  4O5V A;  1LJO A;  2L3R A;  1K73 U;  1KHC A;  2XI9 A;  4XTU A;  4JJN K;  2KMT A;  4M7A A;  5A0D A;  2RK2 A;  2ZPI B;  2L8D A;  1M4Z A;  1NJI C;  1N8R C;  1N9S A;  2P0P A;  1I4K 1;  5J39 A;  4PJO E;  3OBW A;  3OSS C;  2VUB A;  4A4H A;  3FJP A;  3GNF B;  1VUB A;  3VV0 A;  4PLI A;  2DXB A;  3HKS A;  4M75 C;  3MEA A;  4E47 A;  3PGG A;  4RMO A;  2QEX T;  1YJ9 A;  5LJ3 e;  1YJN T;  4M7A D;  1NZ9 A;  1QVG A;  1OZ2 A;  3L2U A;  2F5K A;  3QG1 A;  4LDV A;  1YIJ A;  2D0Q B;  4M78 B;  4FSX A;  3RES A;  3PMI A;  2E41 A;  5LJ3 d;  4LDW A;  4LDY A;  5FU7 B;  3M59 A;  3JCM V;  4C8Q B;  3LWH A;  1M1F A;  4M78 F;  3RUX A;  3VU3 C;  2K2V A;  1XQH A;  2E1H A;  4ZGD B;  4JS5 A;  4A4F A;  4M77 D;  2CZ7 B;  1UGQ B;  2F69 A;  2R5A A;  2VGN A;  3CD6 T;  4PJO A;  3UWN A;  3OS2 A;  4C8Q F;  4HA8 A;  2VC8 A;  4BDZ A;  5DY9 A;  1UGR B;  2E6N A;  3L1A A;  3QYG B;  3PIP A;  1VQ4 A;  2DKG A;  3CCV T;  4M7D B;  3CEY A;  1YHQ A;  4C0D C;  2R5M A;  4XTW A;  3CCR T;  1Q82 C;  1BKB A;  2HNI A;  4PJO D;  3M56 A;  1WJS A;  1VQ7 A;  5FU6 C;  3SWN A;  4D6W A;  4M7D F;  1M90 C;  1XOV A;  3E9G A;  3OYH A;  1D3B B;  4E7H A;  5GAN 3;  1KC8 C;  3VKI A;  3MP6 A;  1QP2 A;  2XDB A;  3JB9 G;  2E65 A;  1KG1 A;  4PNO A;  2P4T A;  2RH2 A;  4EPC A;  2D6F A;  1UB4 A;  2LT4 A;  2JNG A;  1YJN A;  5GAN 4;  3JB9 I;  4C8Q G;  3BDL A;  5GAN g;  2QEX A;  4LDX A;  2PUO B;  3FLG A;  5C0M A;  3KUF A;  2PQW A;  1OYX A;  1Q86 C;  3QYH B;  3J7A F;  1WPY A;  2HBP A;  3KBG A;  2BIV A;  4HT8 A;  3CXC S;  3OYD A;  2V8K A;  2XHC A;  4BI4 A;  3AHU A;  2RO0 A;  3GPL A;  1XNI A;  2LQ8 A;  4C92 E;  5KH6 A;  3JB9 H;  4LD6 A;  4XAX B;  2YHT A;  5LJ5 g;  5GAM g;  4M7D G;  3V8J A;  3OYK A;  2RJC A;  2PVD B;  3DKM A;  3FB9 A;  3NTI A;  3CD6 A;  5GAN h;  1AHJ B;  3JCM b;  1B34 B;  3FEO A;  3VUZ A;  3PFS A;  4L5G A;  4FU6 A;  1N6A A;  3HL8 A;  4C5E A;  2KDS A;  2RK1 A;  3JCM Q;  3CPW A;  4N4G A;  4Y28 E;  3CCV A;  2JTM A;  5GAO n;  4B9X A;  2OTL T;  3CCR A;  5GAM h;  5LJ5 h;  2PVO B;  2NLU A;  2CZ1 B;  2QI2 A;  1WGS A;  3HP9 A;  3M4G A;  2VXE A;  3P8D A;  3OYM A;  2KY9 A;  3N5B B;  1BIB A;  4QQG A;  2K5F A;  3X24 B;  4C92 A;  1N27 A;  2CZ6 B;  3OW2 A;  3OYJ A;  1VQ8 T;  1S72 A;  1FXX A;  5IAY A;  4OP0 A;  4IKF A;  2FB7 A;  4GY5 A;  4J7F A;  3X20 B;  5GMK i;  3NTH A;  1SSF A;  2OAU A;  5KCO A;  1QVP A;  3OY9 A;  4RCB A;  4XU3 A;  3S3N A;  1YJW T;  4HCZ A;  4OB3 B;  1LNX A;  2WAC A;  3E19 A;  4M7A B;  2XD0 A;  3JCM d;  1PSF A;  2QQS A;  4BE0 A;  4OGC A;  4IUU A;  2E70 A;  3QBY A;  4IUP A;  3V7C A;  3ME9 A;  3GOX A;  4M78 C;  2VGM A;  3DB4 A;  4M7D E;  3P8B B;  4XU2 A;  2HD0 A;  1O9S A;  5D6Y A;  5GAM j;  1DJ7 B;  4M7A F;  4JLI A;  1YI2 T;  2QQB A;  5FU7 C;  1OI1 A;  1WJQ A;  2FL7 A;  2LX9 A;  4C8Q C;  2X4X A;  4MDX A;  4A53 A;  4M75 D;  3CCJ T;  1V29 B;  3S3M A;  3CCU A;  3M53 A;  3MEU A;  4PL6 A;  1NE8 A;  2DEQ A;  4ZN3 A;  1VQK T;  1Y96 B;  3V8K A;  4J6X A;  4GLK A;  4M77 E;  3ZFJ A;  1QVF S;  3CCM T;  2OTL A;  2HQE A;  4M7D C;  4A4G A;  2Y4Y A;  2RHY A;  4LDU A;  1VIF A;  1VQP T;  2OTJ A;  1GXI E;  5J3B A;  1TH7 A;  1U8R A;  1W2B S;  5CK9 A;  2O4X A;  5HY6 A;  3FIF A;  2XKO C;  2LC4 A;  3RER A;  4XTZ A;  4M7A G;  2DTO A;  1Y07 A;  4KUL A;  1VQ8 A;  3UT1 A;  4CI0 C;  1YBY A;  3O8V A;  1Q7Y C;  1RI0 A;  1Q81 U;  4BE2 A;  2CKK A;  3JCM X;  2JVV A;  3SD4 A;  3CCL T;  3H8Z A;  1KQ2 A;  4KBM B;  3ZBD A;  4XTX A;  1YJW A;  1ZBX A;  2LRQ A;  1VIE A;  3LX7 A;  3M9Q A;  4ZGJ B;  4QVD A;  1OZ3 A;  2DK3 A;  4MMK A;  4RG2 A;  4E7K A;  2H3J A;  1JJ2 S;  4M77 A;  4PLL A;  5GAO q;  4MML A;  1HXD A;  2A3L A;  2O01 E;  2QDY B;  3VUB A;  2MWP A;  2MMP A;  4X9D A;  4OB1 B;  1RL2 A;  2EYQ A;  2B8A A;  1VQ6 T;  4MDW A;  1WNL A;  2M0O A;  2X4W A;  5KE3 A;  1UEB A;  2G3R A;  2P0Q A;  4NOY A;  3I56 T;  1YI2 A;  4LD9 K;  3L2R A;  3DLM A;  4FT2 A;  2LT1 A;  3JB9 F;  3VYH B;  2M16 A;  1KQ1 A;  3ASK A;  2K3X A;  4FM4 B;  1P92 A;  1YCY A;  5A0L A;  4L6V 5;  5IT9 E;  2DAQ A;  2M9U A;  2MI6 A;  1K73 C;  3CCJ A;  3A8L B;  4PJO G;  3OYA A;  2MAM A;  2X4Y A;  4EMH A;  2DTH A;  3A5Z B;  5GAN f;  4OGE A;  1VQK A;  1LOJ A;  2QQA A;  4KT0 E;  4RKU E;  5GAN 6;  2LDM A;  3CCM A;  3RMS A;  2K4Y A;  2KK4 A;  2ZPF B;  2AHJ B;  3QJY A;  2RI2 A;  3SDZ A;  1O75 A;  3V8L A;  5GMK h;  1VQP A;  1KD1 C;  5J26 A;  4KUD K;  2MF2 A;  1I81 A;  2QTX A;  4M78 E;  3RKY A;  2RHI A;  5GAM f;  5LJ5 f;  2XIC A;  3MEV A;  3X26 B;  4EMG A;  5GAN e;  3HHT B;  2DXC A;  4NL2 A;  1KQS S;  3QPH A;  3CCQ T;  5KE2 A;  1PSE A;  2K5L A;  2VYT A;  2EJG A;  4R56 A;  5FRM A;  1YIT T;  2LCL A;  3A8G B;  2VV5 A;  4N0A A;  3RKW A;  2ZZD A;  4J7I A;  5GAN d;  2R58 A;  3QJ6 A;  3L2V A;  3V7R A;  3BFM A;  5M9O A;  4E7L A;  1M8V A;  3HFN A;  4C5G A;  4C92 B;  4EMK B;  5GAM e;  1I8F A;  2P0K A;  5LJ5 e;  1QVG S;  2EFI A;  2EWN A;  3M57 A;  3CMA T;  3JAM E;  1BYM A;  3OMG A;  3G6E T;  2GCX A;  5D6W A;  3I56 A;  2L5Q A;  5GMK j;  5CVI A;  1UGP B;  3A8H B;  4M78 A;  2BUD A;  4C92 F;  5LJ5 d;  2DO3 A;  3OYY A;  3CCS T;  5GAO m;  3HRT A;  3NTK A;  3LLR A;  3T9N A;  3OYF A;  2LNV A;  3JCM W;  3CBP A;  4QQ6 A;  3ZEH A;  2K57 A;  2GFA A;  2IVW A;  4RG8 A;  4VUB A;  4XTY A;  4B9W A;  4WF2 A;  4XK8 E;  2YLC A;  3OA6 A;  5C6S A;  4JUV A;  1IZ6 A;  1X6O A;  2DJZ A;  4MZP A;  3VYG A;  2DXU A;  2LVM A;  4M78 D;  2PVG B;  2E10 A;  3EFS A;  4M75 E;  3OS0 A;  4HT9 A;  1FWZ A;  3OB9 A;  4FIB A;  5LJ3 j;  4KUI A;  4BI8 B;  4OB0 B;  3NFC A;  3OYI A;  3QHS A;  4C8Q D;  1VQN T;  5I21 A;  3LGL A;  3TU4 K;  3OYC A;  3CC2 T;  4MZT A;  2KVQ G;  1R8O B;  2LTO A;  3M55 A;  1K8A C;  1I5L A;  2DZ9 A;  4HCB A;  2RHU A;  3OBY A;  2Y90 A;  3BDU A;  4C92 G;  2RJF A;  4JLG A;  5GAO l;  3CCQ A;  1VQO T;  1K9M U;  1WQ7 A;  5CKE A;  1G5V A;  1YIT A;  4EDU A;  3V7S A;  4FL6 A;  1VQ9 T;  2CS7 A;  2ZPE B;  3MET A;  2WSE E;  2EQJ A;  3S6W A;  4M7D D;  1IRE B;  4ELY C;  5L8R E;  3TRE A;  3HRS A;  5CCA A;  3OS1 A;  2O4X B;  2ZGW A;  4C5I A;  2V8J A;  2RB6 A;  3JCM J;  4OF1 A;  4M75 A;  1NPR A;  3CMA A;  1W2B A;  3EAE A;  4ZTF A;  4N4I A;  1BI0 A;  2ZCF B;  3PMT A;  2E5Q A;  5I2M A;  3C4S A;  3G6E A;  5CKH A;  2RHZ A;  2Y4X A;  4F7U E;  3C12 A;  1G3S A;  3HPW A;  4ELZ C;  3CCS A;  4DA4 A;  2XDD A;  4IUT A;  4J83 A;  1JB0 E;  4M77 B;  5GAN 5;  4A4E A;  3X25 B;  2MWO A;  4BD3 A;  4DQ2 A;  3PTA A;  1JJ2 A;  1NJI U;  2CYZ B;  5LL6 S;  1N8R U;  2PU9 B;  3M58 A;  3PNW C;  4M77 F;  3MO8 A;  3JCM g;  3QSU A;  4IUV A;  2WSF E;  3CPW S;  4IUQ A;  3BW1 A;  4YTL A;  3A8O B;  2RA2 A;  3CC4 T;  2PUK B;  3L2Z A;  4QW2 A;  2EAY A;  1VQN A;  3X28 B;  3J81 E;  4PJO B;  2EKO A;  2KSS A;  3PT9 A;  4N4H A;  4O6J A;  4J5Y A;  3CC2 A;  4F7U A;  5CQX A;  4BY6 B;  4ATO A;  1VQO A;  2CZ0 B;  2FHD A;  4PKC C;  1G3T A;  4PJO F;  1WQW A;  2M1H A;  1X01 A;  4NS5 A;  3OMC A;  3RIR A;  4A54 A;  4BUG A;  3ER0 A;  3HFO A;  3JSC A;  5A2Q E;  3L2W A;  3JCM h;  5GAN 7;  1G3W A;  3RMQ A;  4OMF B;  3SWN B;  3SB2 A;  3P8H A;  2XID A;  4Q5W A;  3KXT A;  3LGF A;  4R55 A;  2RD1 A;  4HKE A;  5I2S A;  3QUI A;  3TCJ A;  3E1S A;  5CKF A;  1JRI A;  4M77 G;  4Y91 A;  5LJ3 f;  4C92 C;  4J6Y A;  4EMK C;  3QZ9 B;  5GMK e;  5IN1 A;  5HK3 A;  1VQL T;  2RI3 A;  3LH0 A;  3M4Y A;  4JRP A;  1KQS A;  4C5H A;  2EJF A;  3A8M B;  2QQR A;  1Q82 U;  2JZ2 A;  1U1T A;  1N9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...