4M77C

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
69
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 14
structure length 69
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77C00
4M7DG 4C92C 1I81A 3JCMP 3JCMX 5GMKm 5LJ5g 4M77F 4M75B 4X9CA 3JCMh 4PJOF 4EMKB 5LJ5j 1WQWA 2DXTA 3PGGA 4M75D 1JBMA 3L1AA 4XQ3A 3VU3C 3V7SA 4M7DA 3JCMf 4M77G 2VXEA 4PJOG 1LNXA 4M78C 5GAN7 5LJ3d 3JCMe 4XTUA 1TH7A 4M75C 4EMKC 3HSBA 5LJ3h 2E10A 4JRIA 4QVDA 4M7AE 4XTYA 4F7UA 3BY7A 1U1SA 4M77A 4NOYA 1I5LA 4PJOA 4XU3A 3V8LA 2YLBA 5GAOm 3JCMb 3JB9F 4DQ2A 4C92B 5GAN6 5LJ3f 4HT8A 4NL3A 4C92D 4M7AF 3BW1A 5GMKl 5LJ3e 2RD1A 3M4GA 3EFRA 1Y96A 3JB9G 1WNLA 3FB9A 4M77B 4M7DC 1YCYA 4PJOB 1MGQA 2EJFA 4M78B 5LJ5d 4F7UF 4MMLA 1B34A 3SWNB 3JB9H 4M7AG 2DTHA 5LJ5h 5GAN5 2E41A 3EFSA 4M78D 2RM4A 3RKYA 2FB7A 5GAMg 4C8QE 2DJZA 2VXFA 5GAMj 4HT9A 4F7UG 4Y91A 4M77C 1I4K1 1Y96B 2CGHA 4M7AA 2DVEA 4XU0A 5GAOq 3BFMA 2EAYA 4PJOC 3SWNC 2DTIA 4EMGA 2VC8A 5GMKj 1BIBA 1KQ1A 5LJ5f 5GAN3 2E65A 5LJ5e 1D3BA 4C8QF 4J6XA 1HK9A 2ZGWA 3QUIA 2HNIA 4OP0A 4M75E 4NL2A 4M7DB 2E64A 4M7AB 3V7CA 4C8QG 4M7DD 1LJOA 2FYKA 5I21A 2DZCA 4F7UB 2DKGA 2YHTA 1D3BB 4XU1A 5GAN2 5GAOn 3RERA 3RIRA 3V8KA 3JCMW 4J6WA 4C8QA 2EJGA 4M7AC 4M77D 2JN0A 5GANg 1M5Q1 4PNOA 4PJOD 5GANj 4A54A 4XTWA 5GAMd 4J5YA 4RCCA 5GAN8 3JB9J 5GAMh 5GAOr 2EWNA 2DTOA 3INZA 3SB2A 1WQ7A 4C92E 1KQ2A 3QO3A 2QTXA 4A53A 5GMKh 5GMKi 1B34B 2YLCA 3HFOA 5GAOl 4M75A 3RUXA 4EMKA 1M8VA 4M77E 2RA2A 4PJOE 5GAMf 3GIBA 4M78E 1X01A 1BIAA 4WF2A 4C92F 5GAMe 3JCMQ 1U1TA 3JB9D 1HXDA 4RCBA 3JCMg 4C8QC 3FIFA 4XTVA 2DXUA 4JRKA 3V8JA 4N0AA 4M7AD 5GMKe 4XTXA 4C92G 1N9RA 4M78F 4V2SA 4HA8A 4M75F 5GANd 3QHSA 4C92A 1I8FA 1LOJA 3HFNA 5GANh 3AHUA 1WPYA 5GAN4 4M78G 2RB6A 5LJ3g 2I2LA 3FJPA 5LJ3j 4M75G 4XTZA 4JUVA 4MMKA 3RKWA 4M7DE 2K57A 3BDUA 4EMHA 1JRIA 2DEQA 2E1HA 3JB9I 4C8QB 4M78A 2EJ9A 3QSUA 3SWNA 2Y90A 4X9DA 1H641 3L2ZA 3JCMV 4F7UE 5GANf 3RESA 3JCMJ 4N0AC 4C8QD 5GANe 5DY9A 4M7DF 4XU2A 3V7RA 1N9SA 5CAIA 5GAOp 3JCMc 4JLIA 3JCMd 3RKXA 4QVCA 4J6YA 2DZ9A
chains in the Genus database with same CATH superfamily
4F14A 3NTIA 2EW3A 1MHNA 3JCMX 4M77F 3FJ5A 2G3RA 1VQPT 5GJWB 4OGCA 2A3LA 2CT3A 1VQ6A 2CZ1B 2V8JA 2W0ZA 5KYYA 3CCMA 3VS4A 1X27A 3CMEQ 4MZMA 5GMKl 2L3RA 3JB9G 3PMTA 1AEYA 2KDSA 3WVDB 2YUOA 3QBYA 1XTDA 5LJ5h 5GAMg 3G71A 1C0MA 1QLYA 1BIBA 1NJIR 5LJ5f 1GL5A 2EYXA 2P0PA 3CCST 4M75E 1UGRB 4XAXB 5KYXA 3CBPA 4FYVB 3X25B 4C8QG 2XMFA 3A98A 1VA7A 3M57A 2YHTA 3MEUA 4R0KA 2ZAEA 2ZZDA 3A8OB 4M77D 2RF0A 4A54A 2KEAA 2QDYB 1NE8A 1ACMB 3QO3A 2LQKA 1GBQA 3CBOA 1M27C 2E3IA 5GMKi 1Q7YR 3OYLA 1K73U 2CP7A 1VQMQ 2QAZA 4BY6C 4WF2A 2KVQG 4RG8A 1U1TA 1N6AA 3FIFA 3GP8A 2MCNA 2CT4A 3GNFB 1EX4A 2BTTA 2V1QA 1HD3A 4J9FA 4F04B 2C0TA 4C92A 2X4WA 2B86A 2RB6A 2EYQA 1VQ4A 1QW1A 3CD6Q 2QTVA 3CCLT 4ANJA 3CC2Q 1YN8A 4C0DC 1KFZA 1X69A 2DEQA 3OYFA 4RTYA 3QG1A 2DXBA 1Q81C 1S72Q 1N9SA 4CI0C 5GAOp 3JCMd 2YUPA 3FC3A 1RAAB 2F69A 2VGNA 4N4GA 4BDZA 4EIKA 2KAFA 3CXCS 5A0DA 4EMKC 1WGSA 4LXCA 3I5RA 1JQQA 3QYHB 5HKCA 1G3WA 1RAFB 4OVAA 4M7AF 4RTZA 2EQJA 4M77B 3S3NA 2EJFA 2QGFB 2XK0A 4PJNA 1ZUKA 3RKYA 2P4RA 3LWHA 1VQ6T 3EAEA 3META 4LDVA 4PJOC 2VV5A 3PFSA 3SWNC 1FXXA 3OS1A 2YT6A 3KBGA 1PHTA 3URGA 3CC4A 4IUQA 1PD0A 5FW9A 2FYKA 5C6SA 5KYYB 3CCSQ 4HCCA 1BI2A 4QT7A 3E9GA 4FW2A 2XU8A 1OULA 1EFNA 1K9AA 3X28B 5GAN8 3G71T 4ZGJB 3P8DA 3MHXA 4BE2A 4ORZA 4D6WA 1AZEA 1NJIC 4IUVA 3C4SA 2COYA 4XTVA 1FMVA 4M7AD 1Q86R 2DD5A 1IREB 1AWWA 3OYJA 1AD5A 5KYXB 2PVGB 3MKDA 4HKEA 1M1FA 2K57A 2K3XA 1VQNA 4F7UE 3WVEB 2LJ1A 3CCLQ 1IZ6A 1VYUA 3H0IA 3QIIA 2HQEA 3REBB 4HCKA 2RJCA 2HDAA 3JCMh 3E9FA 2DD4A 4AG2C 4OMOA 3JCMf 2HBPA 4A4GA 3D7SB 2LQ8A 3VV0A 3OYBA 4AFUC 5FROA 4E2FB 1AZGB 4LUEA 3TSZA 4C92B 2OTJA 1QQJA 3OYNA 4A4KA 2LNHB 3BW1A 5LJ3e 1B34A 1TWBA 1WDXA 1AVZC 3H0FA 3OYAA 3NGPA 3NFCA 5IAYA 2DJZA 2L5QA 2LT1A 3JV3A 1PRMC 1YJWT 2GCXA 1VQ6Q 1T0JA 1VYVA 2C0IA 3EGXA 2KT1A 4JJCA 2R5AA 5KE2A 4M7AB 1K73R 1ZLMA 5IHKA 3G4SA 1UJYA 2BZ8A 3VS3A 3G6EA 1M8MA 2E5QA 1Y57A 3JCMW 1TS9A 1OI1A 2LT4A 1IGQA 2JTFA 1I1JA 2X51A 5EC7A 3CC4T 1VQ5T 1RUWA 3G71Q 2RA2A 2RJFA 5I22A 2F5KA 1BIAA 3OYKA 2HMAA 3MP8A 1HXDA 1M1KU 3ME9A 3X20B 1D1BA 3S3MA 2IG0A 3F70A 3TQ7P 3V8JA 1QVFA 1S1NA 5GMKe 1OU9A 3R6NA 5L23A 2D6FA 1EZZB 3AHUA 1RAGB 2GFAA 1G2BA 1MMGA 4RUGA 1KQSP 1X43A 4DBRA 8AT1B 3TREA 3LLRA 2CP6A 2KYMA 2RMOA 3JCMc 3JRZA 2LX9A 1M1GA 3TSWA 3JCMP 3MEAA 1U3OA 5GMKm 5KH6A 1IO6A 1QCFA 5CCAA 4XQ3A 2IVWA 1D0XA 1KG1A 3EHQA 3VRZA 5FRMA 3OYMA 1VQNT 2DPPB 1JJ2A 4M7AE 1VQ4Q 1R8OB 4PJOA 2HCKA 4LDWA 2RHIA 5GAN6 4X34A 1WHLA 5HY6A 3S3OA 2DBKA 4HT8A 1QMCA 3OMCA 2FZCB 1M3BA 2L2PA 3TVTA 4RTXA 3R6OA 1KD1U 3J81E 1C1AA 4MMLA 3OBWA 1W6XA 4OF1A 4M77C 1Y96B 2HD0A 3BFMA 2DF6A 1JB0E 1WHGA 5GAN3 3TCJA 2JS2A 1KHIA 2K3BA 3SEMA 1ZUUA 4B9WA 2ZPHB 4AMCA 3OBYA 1XQHA 1NBEB 1YJWQ 2YUNA 2KK4A 2AT1B 3V8KA 4OGEA 2PU9B 2ZPBB 1LCKA 5J39A 1VQKA 2JOYA 5A0LA 4A53A 1B34B 4M75A 3OB9A 2O2OA 3G4ST 5GAMe 2K5LA 3QWXX 1QVGA 3CC4Q 2DXUA 3OYEA 4C92G 1K73C 2FO0A 2JMCA 4M78F 1BB9A 3A8LB 3EGXB 1FYNA 4M75F 2CP0A 1W70A 3M54A 1YWPA 4MZTA 3CC2A 2AZSA 3X24B 5LJ3j 2VUBA 2BE9B 2QGGA 2X9HA 1UEBA 2KY9A 2RHYA 3PVQA 3VYHB 3OYHA 4JPBW 2DL4A 2R58A 1AOJA 2RHUA 3LH5A 4QQGA 4RG2A 2L89A 1BBZA 4CC3A 3M56A 3LWIA 3QKJA 5CKBA 4DBQA 1RLQC 2RQVA 2QA4A 1VQPA 2E5KA 2O9SA 4L59A 4QVDA 5CKFA 1U1SA 4XU3A 9ATCB 3NHNA 2OJ2A 1VQNQ 4KUDK 4II1A 4NL3A 3CC7T 2RJEA 5C0MA 1PC0A 4YTLA 1HJDA 2YRDA 3A1PA 2QQBA 4M78D 1PKTA 4C5IA 2V1RA 1IRXA 4Y91A 3BDLA 2QI2A 2J06A 3GNGA 3H9NA 5GMKj 1TU0B 1KIKA 3LYIA 3CCSA 3I9QA 1LJOA 1T3SA 3PE0A 3PMIA 1CSKA 1MV0B 1M1KR 4M7AC 3SDZA 3OW2P 2KI7A 3UPUA 2VYTA 3SB2A 4JJDA 4AG1C 4KH1B 1UB4A 4AFSC 2F2WA 2JW4A 3RUXA 1J3TA 2ATCB 3HP9A 2RQUA 3NMZC 4MDXA 1FMWA 2LRQA 1N9RA 5IXBA 3G4SQ 1KHCA 1RL2A 2VKNA 5GANd 2FZKB 1WFWA 1UJ0A 2OX7A 4XTZA 2CREA 4E7KA 2E1HA 4KT0E 3CCLA 1K9MU 2Y90A 3I55A 3MP6A 3LX7A 1YNZA 3BE3A 3EG1A 3QZ9B 2PUKB 1PKSA 4JLGA 1YIJA 2AK5A 5LJ5g 1NPPA 5L8RE 2P84A 4M75B 4C5HA 1H3ZA 3QWYA 3L1AA 1I07A 4PJMA 5I11A 1OPKA 2K9GA 1X6OA 4F7UA 5KYWB 2DXCA 4M77A 2LCLA 1PG5B 1YHQT 1BU1A 5FWCA 5GAOm 1NYFA 1ZQ1A 2ZPGB 5IXFA 5FRNA 4J9CA 3L2QA 1MUZA 4BD3A 2MMPA 4F7UF 2Y4YA 4CC2A 2KE9A 2ZPIB 5GAN5 2QA4T 3EGDA 3M0TA 2FEIA 5GAMj 3CC7Q 4HT9A 2CZ6B 4LE9A 3UWNA 4XU0A 3T9NA 2CP5A 1VIEA 4IURA 1SSHA 2ZGWA 2HNIA 1K4US 4A4FA 1WIEA 2HSEB 3HRUA 3RIRA 4J6WA 4E6RA 1RABB 4GY5A 2DE0X 4ZNXA 1NEBA 2PNIA 1Q82C 1Y71A 5D6WA 2PVDB 4BI8B 1TUDA 1SKUB 1M8VA 2E3HA 1SG5A 4JRQA 1H3HA 4M78E 1Z9QA 3MJXA 3KXTA 4JS4A 1N27A 1QWFA 1WHHA 1VUBA 4OMLA 4OB3B 4RMOA 1WHJA 3REAB 3QHSA 4A4EA 5GANh 2LJ3A 3Q1JA 2M02A 4L6V5 5CQYA 4OMMA 3OS2A 1WYXA 2RNAA 3OYYA 4XK8E 5GANf 3JCMJ 1VQKQ 2J7IA 5DY9A 4ELZC 4M7DF 2E6ZA 2A36A 3RNJA 1F1BB 5DLOA 2XDPA 4IUTA 2DYIA 4PJJA 3OA6A 4ZGDB 3EG3A 2PVOB 3WXMB 4PJOG 2EFIA 2X3WD 2NWMA 4F16A 2XG8D 4CC4B 3I55T 2GNCA 2PUOB 1YIJT 1VIFA 1UFFA 3FB9A 4IKFA 2CSQA 1MNDA 4OB0B 2ESWA 2O01E 2HAXA 1D0ZA 3UA6A 4M4ZA 4M7AA 1KD1C 4QVZA 4EPCA 2QA4Q 1VQPQ 4DA4A 2E6NA 2XD0A 4J6XA 1YITT 1YJWA 4NL2A 4CC7A 3M55A 2K2VA 1TSFA 4M7DD 5KE3A 3H8ZA 1VYTA 4F7UB 1D3BB 2JN0A 3LGFA 1RAHB 2QXFA 3JB9J 2KRNA 2OAWA 3DLMA 1K8AU 5IN1A 2EYZA 3GOXA 3EHRA 4Z02A 3EGDB 1VQ8T 1VQ5A 1XJWB 2YXYA 3JCMg 2FPDA 2CS7A 4JDSA 1K9MR 2LCSA 1WI7A 4D8DA 1QVPA 1XOVA 1M90U 2K3YA 3RR6A 1OQKA 1LOJA 2RO0A 3GBQA 4BI3A 3J80E 1IHWA 2AIRB 3ZBDA 1O9SA 1V29B 3SD4A 1NLPC 3THKA 2L0AA 1WXBA 2DZ9A 4J8OA 2BE7D 4QKUA 2X4YA 5D7UA 4KH0B 4X9CA 4R56A 1T0HA 2P4TA 3H0HA 2RJDA 4M78C 5LL6S 3FRNA 4M75C 4PKCC 1E6GA 4E47A 2GGRA 4FM4B 2CKKA 1X2KA 2EVRA 4J9IA 2JS0A 2QQRA 1RAIB 3JCMb 4DQ2A 2LP5A 2D0QB 4PLLA 2JT4A 1Q7YC 1PSEA 3I55Q 1Y96A 5HK3A 1M9SA 1KQSA 4RTVA 1YIJQ 4DEXA 4E7IA 3PT9A 3CCQA 4LDUA 3CXCP 3L2WA 1FX7A 2DVEA 4EMGA 1E6HA 2E65A 5A2QE 2DM1A 1YJNA 1HK9A 3QUIA 3HRSA 2LC4A 4RTTA 1U06A 1KC8U 2V26A 1FWZA 4LN2A 5GAOn 3RERA 3A8GB 2H8HA 3QXEB 3EFOB 4K11A 3M0SA 2QQSA 2JM9A 1RACB 1NM7A 2RK1A 4J5YA 4Q5WA 2SRCA 1Z9ZA 2C0OA 3PTAA 2YRCA 2DTOA 3A5ZB 4EDUA 1AWOA 4J9HA 5GAOl 1SHFA 3CBMA 1C6VX 2FRWA 1VQ9T 1HYOA 1PD1A 1WA7A 4RTWA 2Y4XA 1K1ZA 3O5ZA 4HCBA 1VQ8Q 4FYYB 4QW2A 2RN8A 4FW1A 3O8VA 2DBMA 2PQWA 1RLPC 4Y28E 3QDFA 1WHMA 4M7DE 4B9XA 3JCMV 3L2ZA 2K5FA 3RESA 4HVVA 1LVKA 1D09B 2M9UA 2KBTA 3KUFA 4JLIA 1BI0A 2JVVA 4J6YA 2DEUA 1E7OA 1YJ9A 2CUBA 1Y0MA 3VU3C 2LNVA 1NEGA 4M77G 1WXUA 4LDYA 4A63B 1UDLA 2J6OA 5FLXE 5J3BA 2QG9B 2VB6A 2KRMA 4J9GA 3MP1A 1BYMA 1UG1A 3JB9F 4KULA 2MWOA 3CCET 2DYBA 4X1VA 3OYDA 4AFZC 1UGPB 2K6DA 1D0YA 2I0NA 3CC7A 2DTHA 1MMNA 4ATOA 1PRLC 2A0FB 1Q86C 1UGQB 2KYBA 2L8DA 5LJ5e 2ED1A 4C8QF 2QEXA 2YUQA 1H8KA 1K8AR 1SRMA 2KRSA 2RHXA 1M30A 1ZA2B 3M0PA 2P0QA 4LDXA 2MF2A 2XHCA 3CCQT 1U5SA 4XTWA 1TUCA 1IB8A 1Q81U 1M90R 4PFPA 2HZYA 1XNIA 2ED0A 3H41A 1YJNT 1WJQA 1GBRA 5A0GA 3JB9D 2QK0A 3LGLA 2DL3A 1N8RU 3HRTA 2M0OA 3QYGB 1VOMA 1I8FA 1WJSA 2R57A 3FJPA 3DB3A 3HPWA 3X26B 1NPRA 2A7YA 3FEOA 4OMQA 4E7JA 4M78A 3ASKA 4FYWB 3H6ZA 4L5GA 4N0AC 4C8QD 3OW2A 3PIPA 4XU2A 1OPLA 4ZN1A 1VQ5Q 3VS1A 4RKUE 1LPLA 2AHJB 2XI9A 1DJ7B 5KYWA 1V1CA 3PGGA 2HQXA 1QKWA 5KCOA 2DETA 3OYGA 2X4XA 4KRTA 4BE1A 1LNXA 5GAN7 1W2BS 1QVGS 5LJ3d 4GBQA 3L2VA 3BY7A 3M58A 4CRIA 5J26A 1U8RA 1ZUYA 2JMAA 1YHQA 3M0UA 4JJBA 1YWOA 4MDWA 1SEMA 2RD1A 2CZ0B 3EFRA 3L42A 1WNLA 1SF9A 1YJ9T 4M7DC 4M7AG 1G3YA 1PSFA 1KC8R 3E2UA 2E41A 3CCEQ 4LD9K 3VS7A 3OSSC 4O6JA 4FSXA 2QDLA 4C0ZA 5GAOq 1MMAA 2JZ2A 4J7IA 1K0XA 5AYFA 3MEWA 1X6GA 5CVIA 3OSVA 1BKBA 2YSQA 3DB4A 2JNGA 2NYSA 1ARKA 2COWA 1EIFA 1NZ9A 3EH1A 3VS5A 2M0YA 1ZSGA 2IPOB 4VUBA 2EJGA 2WSFE 1VQOA 4Z89A 3HL8A 3VKIA 2EWNA 3INZA 1YCSB 3CCQQ 2DRMA 2QEXT 2RQRA 4BDYA 3HFOA 2ROLA 2XKOC 1IXDA 2KR3A 3HTRA 3JCMQ 3L2RA 1OU8A 2XDDA 3E19A 2GQIA 4RCBA 3S6WA 3FLGA 1YJNQ 5AT1B 2C06A 1X2QA 2JTMA 2J6KA 1K0SA 2EPDA 2NLUA 4FT4A 3CMET 1I5OB 2K79A 2O31A 2G6FX 3NTHA 1H641 2CH4A 3C94A 1YI2A 2XICA 1G83A 4GLMA 2L3PA 3RKXA 2DIQA 4Z8AA 4N4IA 2L3SA 1AWXA 2MOXA 5LJ5j 2LX7A 2A08A 3VUZA 4WTOB 1W2BP 2RH2A 1SSFA 3JCMe 3M0RA 4KUIA 5LJ3h 3J7AF 2GFUA 3CPWS 4PFZA 5FU6C 4HCZA 4Z88A 2H3JA 2BUDA 5LJ3f 4ELYC 1IHVA 2DILA 2F2VA 3EG0A 3P8BB 1ZSZB 2HL5C 4M78B 2O4XA 2FZGB 4LD6A 1M2OA 2KQWA 4C8QE 1YJ9Q 3HKSA 4QQ6A 3U23A 1UHCA 2GTJA 2DTIA 2DERA 1KQ1A 1Q81R 2F2XA 1D3BA 4BB7A 4JJNK 5CKDA 2D9TA 2O9VA 3RDVA 2DL7A 4ZGEB 1YITA 5I21A 1BI1A 3G7ZA 5GANg 2D8HA 5GAMd 1IGUA 4DBHA 1N8RR 2PTKA 1KC8C 2JJ9A 1ZBXA 1OZ3A 1ZHIA 5GMKh 1X6BA 2DA9A 3QJ6A 4PJOE 1RADB 1JXMA 4E7SA 3L2UA 3MCAB 3UATA 1M2VB 2QEXQ 1VQ8A 2H3EB 4N0AA 5CKEA 3CCUT 1VQOT 2X35A 1WPYA 3RKWA 3GPLA 3SHWA 4OB2B 3DLLA 4PK4A 2X4JA 1TOVA 4FT2A 4UC4A 4BACA 1MNEA 3EG2A 2RK2A 3OYIA 2MYSA 2DXTA 5D6XA 1ABOA 3PVLA 3V7SA 4M7DA 1X75C 1M1KC 2FG0A 4DEYA 1TH7A 3CPWP 4JRIA 1YI2T 2HSPA 3CPFA 2ZPFB 4AFQC 2HBWA 3CCVA 3M4GA 1BI3A 1OOTA 3VYGA 1YCYA 1MGQA 3JB9H 2ZCFB 2LTOA 1ZBJA 2EGAA 1JO8A 2NUZA 1UGSB 1V76A 1I4K1 2CGHA 1D1CA 2HKNA 2YRVA 1WJRA 4JZ3A 1UECA 2OI3A 2LZ6B 5IT9E 4J9EA 2E4HA 5FU7B 3EFOA 3OS5A 2COZA 3RBBB 3ZEHA 2NUPB 3P8HA 4IIOA 1YHQQ 2DK3A 5GAN2 3CMAA 3M4YA 2LJ0A 5I2SA 1M5Q1 3CCJA 5IHIA 4B6MA 2FVUA 1RI0A 5GAMh 2K5IA 2EKHA 1MMDA 3IQLA 5IHNA 4OMFB 2PZ1A 1CKAA 2O4XB 4OMPA 1G5VA 1G8XA 5GAMf 2OTLA 3VS6A 1X01A 2F1LA 4C92F 3JAME 3CXCA 3M9QA 1QP3A 1R0CB 4C8QC 3ER0A 1VQ9A 3MEVA 3AT1B 5EG2A 3HHTB 3QPHA 2LQWA 2KROA 4V2SA 3OQ5A 2NUTA 1OX9A 3HFNA 4FYXB 1CKBA 4M78G 4PL6A 2RHZA 5KYUB 4M75G 2HQHA 3CCUQ 1VQOQ 1SHGA 1WX6A 2EQIA 1N8RC 1JU5C 2ZPEB 2EJ9A 1ABQA 1GXIE 4J7FA 3I5SA 5CAIA 2CP2A 3N5BB 2MPXC 1SRLA 2DIGA 1I81A 5KCHA 2EQUA 3OYCA 4R55A 3MO8A 4C5EA 1WHKA 3CCMT 4BE0A 5I2MA 2QQAA 1I5LA 2KT8A 2RI2A 4C92D 1GFCA 1YI2Q 2CUDA 3CCEA 1K76A 1TXQA 4FU6A 2RM4A 1ZSZC 1O75A 2EYYA 1HSQA 2QQ9A 4P5NA 2VC8A 3LW5E 4WCIA 2KGTA 3EG9A 2X3XD 1YBYA 5DLQE 4M7DB 4DOVA 1TTHB 3CCVT 2AKLA 3V7CA 1M3CA 3ZFJA 1Y7XA 4XU1A 2HL3A 3I56A 4PNOA 3NPFA 3UA7A 4RCCA 3QJYA 1WQ7A 5HK0A 2P0KA 1KQSS 2LDMA 1UTIA 4DBFA 4M77E 3PIOA 3M0QA 1AT1B 2WSEE 3TEEA 2WACA 1UGVA 2JXBA 2MIOA 1ZX6A 4LUDA 4J83A 2DFUA 4HXJA 2FHDA 3CMAT 1AHJB 2M51A 1YITQ 1KK7A 4HA8A 3CCJT 1VQ4T 1FMKA 4ZN3A 4KGXB 2I2LA 1GCPA 3EGUA 2D8JA 4EMHA 3JB9I 2DAQA 2OTLT 1Y07A 2KSSA 1RAEB 3VRYA 1OV3A 5DM7R 4Y92A 4QVCA 2FPEA 1VQ7A 3M59A 3C12A 2K4YA 4C5GA 1JBMA 1BCMA 3NTKA 2VXEA 2CYZB 3A8MB 4D8KA 3VS2A 2BZYA 2L3QA 2NUTB 3V8LA 2YLBA 1GCQC 2KMTA 3CCMQ 2DNUA 4JS5A 4E7LA 1Q82U 3OS0A 2JTEA 1K9MC 4IUUA 2FB7A 2VXFA 4F7UG 5FU6B 4FCYA 3GF5A 1G3SA 4PLIA 8ATCB 4N4HA 1QVFS 4C0GA 1VQLA 5CK9A 3GLXA 1TUGB 2JUFA 4OP0A 2FL7A 3SFMA 3C95A 3EH2A 2M1HA 2OAUA 2E70A 1BK2A 1PCXA 1UUEA 2BZXA 5FU7C 3CCVQ 4C8QA 2JM8A 3CCRA 1OEBA 2DRKA 1JXOA 2ECZA 2GBQA 4C0FA 4C92E 3CEYA 2ROTA 2QTXA 1QCOA 4JRPA 3UF4A 1GFDA 4EMKA 2ABLA 4OB1B 4OMNA 1ZA1B 1RI9A 2AZVA 2MK5A 2FRYA 3KFVA 4JRKA 2EYWA 3UDCA 1JJ2S 3EG9B 3I56T 1NG2A 3OY9A 5CIUA 5CQXA 2E12A 3CMAQ 2O88A 3ZL7C 2DVJA 1PWTA 2HKQB 3CMEA 3CCJQ 2F5TX 2V8IA 1JRIA 2CP3A 5M9OA 4NS5A 3RMQA 4ZTFA 3QSUA 3SWNA 4A4HA 4ESRA 3TU4K 3M53A 5GANe 1PNJA 2RI3A 2EGCA 5GJVB 3LH0A 2EIFA 2OTLQ 1M4ZA 2DL5A 2LQNA 2J6FA 4M7DG 2DX1A 4PJOF 1WQWA 2EGEA 2YWWA 1VQ9Q 2MI6A 3I35A 5FWBA 1W1FA 4KBMB 4AT1B 1NLOC 1QKXA 1SPKA 2CZ7B 2XIDA 2E10A 4XTYA 2OTJT 1ZSZA 2VVKA 4NOYA 2M16A 5KYNA 2LCCA 2CSIA 1VQ7T 4J9BA 3A8HB 3PNWC 2K2MA 4PJLA 4FL6A 2BKDN 2WSCE 1PM3A 3OW2S 1KJWA 2B8AA 2V8KA 2FPFA 1VQMA 1QVFP 1I0CA 2GQVA 3ULRB 3VUBA 2QASA 3OMGA 2D0NA 1YP5A 1UE9A 2E64A 1W2BA 1NYGA 3M5AA 3G6ET 2DMOA 4RTUA 2DKGA 1WLPB 2A28A 4E7ZA 2DJQA 3DKMA 4E7HA 2MAMA 4GLKA 2RI5A 3CD6A 4PJOD 2K7AA 2LMJA 3UT1A 1NJIU 2HEQA 5CR2A 5GAOr 6AT1B 4BY6B 1KQ2A 1M2VA 2Z0WA 1VQLT 1AWJA 1OX8A 2DL8A 1S72A 2QYZA 3GIBA 4HVWA 2IIMA 7AT1B 4O5VA 2DLPA 3C0CA 4ME7A 4DOWA 1JJ2P 1R0BG 2KNBB 5HCKA 2RQWA 1R77A 3CCRT 4C0DB 3CCUA 5D6YA 1Q7YU 5GAN4 5LJ3g 3I56Q 1N5ZA 2DO3A 3MPUB 1YFNA 2GF7A 4C8QB 1B3QA 1MV3A 4X9DA 4BI4A 2J05A 3V7RA 3QDRB 3VS0A 1D1AA 1QWEA 1GCQA 1K8AC 4C92C 4J9DA 4EMKB 1Q82R 1OZ2A 4M75D 4FIBA 4BUGA 4XTUA 3HSBA 3E1SA 1M90C 5CKHA 2VASA 2A37A 2OTJQ 3VJPA 2KXDA 4IIMA 4PJOB 1UHFA 1M3AA 4PFOA 3SWNB 5LJ5d 1VQ7Q 1GRIA 3EFSA 1G3TA 1KSWA 1B07A 4F17A 1QVGP 1OYXA 2EAYA 3CQTA 4KGVB 2AKKA 2NUPA 1QCNA 2VGMA 1P92A 2ENMA 4JZ4A 1QP2A 2CDTA 3CPWA 2DZCA 2MWPA 3G1JA 1JEGA 4FSSA 5CO7A 2EQKA 3G6EQ 5GANj 1VQMT 1VQKT 2LVMA 1H92A 4KGZB 2BIVA 2SEMA 2KXCA 5IH2A 1WXTA 2W10A 1A0NB 1Q95G 2YLCA 3RMSA 3JSCA 2XDBA 1B7TA 2RQTA 1VQLQ 4IUPA 3QZ5B 2EQMA 2EKOA 5KYUA 4XTXA 1WZOA 5ECAA 2VWFA 4MZPA 3CD6T 3CC2T 2CH4W 1KD1R 3FDRA 4QQDA 2R5MA 4HVUA 4ZTJA 4JUVA 4LNPA 4MMKA 1S72T 3CCRQ 1T3LA 3BDUA 1W4SA 2RPNA 4TVRA 2D1XA 1TG0A 2YDLA 1Q86U 1BCOA 2EBPA 2GTOA
chains in the Genus database with same CATH topology
3NTIA 1I81A 1MHNA 3JCMX 3M56A 3LWIA 4M77F 5KCHA 1YJ9A 2G3RA 2EQUA 1VQPT 3QKJA 5CKBA 4OGCA 3VU3C 2LNVA 4R55A 3OYCA 3MO8A 4M77G 4C5EA 4LDYA 2QA4A 1VQPA 2A3LA 1VQ6A 4L59A 2CZ1B 5FLXE 5J3BA 4QVDA 3CCMT 5CKFA 4BE0A 5I2MA 2V8JA 1U1SA 3CCMA 2QQAA 1I5LA 3MP1A 4XU3A 1BYMA 3JB9F 4KULA 4KUDK 4II1A 2RI2A 2MWOA 3CCET 4NL3A 4C92D 4MZMA 3OYDA 1UGPB 5GMKl 2L3RA 3CC7T 2RJEA 5C0MA 3JB9G 3CCEA 3PMTA 4YTLA 2KDSA 3WVDB 3QBYA 3CC7A 1XTDA 4FU6A 2DTHA 5LJ5h 2QQBA 4M78D 4ATOA 2RM4A 5GAMg 4C5IA 4Y91A 3BDLA 2QI2A 1Q86C 1O75A 3G71A 3GNGA 2QQ9A 4P5NA 2VC8A 3LW5E 1BIBA 5GMKj 1UGQB 5LJ5f 2L8DA 5LJ5e 2P0PA 4C8QF 2QEXA 3CCST 1YBYA 4M75E 1UGRB 5DLQE 4M7DB 4XAXB 4DOVA 3CCVT 2RHXA 3CBPA 3LYIA 3CCSA 3V7CA 3X25B 4C8QG 1LJOA 3M57A 3PMIA 3ZFJA 1Y7XA 2YHTA 3MEUA 2P0QA 4XU1A 4LDXA 2MF2A 2XHCA 2ZZDA 4M7AC 3A8OB 3CCQT 4M77D 3I56A 4PNOA 3SDZA 4A54A 4XTWA 3UPUA 4RCCA 2QDYB 3QJYA 1Q81U 2VYTA 1NE8A 3SB2A 1WQ7A 5HK0A 1UB4A 3QO3A 1XNIA 2LQKA 3CBOA 2P0KA 5GMKi 1KQSS 2LDMA 3OYLA 1YJNT 1K73U 3RUXA 4M77E 3PIOA 1WJQA 3HP9A 4BY6C 4WF2A 2KVQG 2WSEE 5A0GA 4RG8A 1U1TA 2WACA 3TEEA 1N6AA 3JB9D 3FIFA 3LGLA 4J83A 3GP8A 2FHDA 3CMAT 1AHJB 4MDXA 2LRQA 1N9RA 3GNFB 1N8RU 1KHCA 4HA8A 1RL2A 3HRTA 3CCJT 2M0OA 3QYGB 1VQ4T 5GANd 4C92A 1I8FA 4ZN3A 2X4WA 1WJSA 2RB6A 2EYQA 1VQ4A 2I2LA 2R57A 3FJPA 1QW1A 3DB3A 3HPWA 4XTZA 3X26B 3CCLT 1NPRA 2A7YA 3FEOA 4C0DC 4E7KA 4EMHA 2E1HA 2DEQA 4E7JA 3OYFA 4KT0E 3JB9I 3CCLA 2DAQA 3ASKA 4M78A 1Q86U 2Y90A 1K9MU 2OTLT 3H6ZA 1Y07A 3MP6A 3LX7A 4L5GA 2KSSA 4N0AC 3QG1A 4C8QD 3I55A 3OW2A 3PIPA 2DXBA 3QZ9B 4XU2A 1Q81C 1N9SA 2PUKB 4CI0C 5GAOp 3JCMd 5DM7R 4QVCA 1VQ7A 4ZN1A 4JLGA 1YIJA 3M59A 3FC3A 4RKUE 2F69A 2VGNA 5LJ5g 1NPPA 2AHJB 3C12A 4M75B 4N4GA 5L8RE 2XI9A 1DJ7B 2K4YA 4BDZA 4C5HA 1H3ZA 3PGGA 2HQXA 4C5GA 1JBMA 3L1AA 5KCOA 3NTKA 3OYGA 2X4XA 2VXEA 4BE1A 2CYZB 1LNXA 2KAFA 5GAN7 3CXCS 5LJ3d 1W2BS 5A0DA 1QVGS 3A8MB 4EMKC 1X6OA 1WGSA 3L2VA 4F7UA 3BY7A 3M58A 4CRIA 2DXCA 3QYHB 4M77A 5J26A 2LCLA 5HKCA 1YHQT 1U8RA 3V8LA 1G3WA 2YLBA 5GAOm 2KMTA 1YHQA 1ZQ1A 4MDWA 2ZPGB 4JS5A 4OVAA 4E7LA 1Q82U 5FRNA 4M7AF 2RD1A 2CZ0B 3EFRA 3L42A 3OS0A 1WNLA 2EQJA 1YJ9T 4M77B 3S3NA 4M7DC 2EJFA 3L2QA 2XK0A 4BD3A 2MMPA 4F7UF 1K9MC 4M7AG 2Y4YA 2ZPIB 1G3YA 1PSFA 5GAN5 4LD9K 2E41A 4IUUA 3RKYA 2QA4T 2FB7A 3LWHA 3OSSC 2VXFA 4O6JA 4FSXA 4C0ZA 3EAEA 3META 4LDVA 2CZ6B 5FU6B 4F7UG 5GAMj 1VQ6T 3GF5A 3UWNA 4HT9A 4PJOC 4XU0A 5GAOq 1G3SA 4PLIA 2VV5A 3T9NA 3PFSA 1VIEA 2JZ2A 4N4HA 3SWNC 1FXXA 4J7IA 3OS1A 1QVFS 5AYFA 3MEWA 3KBGA 4IURA 5CVIA 3OSVA 4C0GA 5CK9A 1BKBA 1VQLA 3DB4A 3GLXA 3URGA 2JNGA 3CC4A 2ZGWA 2JUFA 2HNIA 4OP0A 4IUQA 2FL7A 3SFMA 4A4FA 3C95A 1EIFA 2M1HA 1NZ9A 2FYKA 2OAUA 2E70A 5C6SA 4HCCA 1BI2A 3HRUA 5FU7C 3RIRA 4VUBA 3E9GA 4J6WA 2EJGA 4C8QA 2XU8A 2WSFE 1VQOA 4GY5A 3X28B 5GAN8 3CCRA 3G71T 3HL8A 3VKIA 3P8DA 4ZGJB 2EWNA 4C0FA 1Y71A 3INZA 5D6WA 4C92E 1Q82C 2PVDB 3CEYA 3MHXA 4BI8B 4BE2A 2QTXA 2QEXT 4JRPA 4BDYA 3HFOA 4EMKA 1M8VA 4OB1B 4D6WA 1NJIC 4JRQA 4IUVA 2XKOC 4M78E 3JCMQ 3L2RA 2XDDA 3E19A 3KXTA 3S6WA 1N27A 4RCBA 4JS4A 3C4SA 3FLGA 4XTVA 2C06A 4JRKA 2JTMA 3UDCA 4M7AD 1VUBA 4OB3B 4RMOA 1JJ2S 3I56T 2DD5A 1IREB 3OY9A 3OYJA 5CIUA 5CQXA 3QHSA 2E12A 2NLUA 4FT4A 4A4EA 5GANh 2PVGB 3Q1JA 3CMET 4HKEA 4L6V5 1M1FA 3CMEA 2K57A 2K3XA 2F5TX 5CQYA 2V8IA 3NTHA 1VQNA 1JRIA 5M9OA 4NS5A 3RMQA 4ZTFA 3OS2A 3QSUA 3SWNA 4A4HA 1H641 3OYYA 3C94A 4XK8E 3WVEB 4F7UE 5GANf 2XICA 3TU4K 3JCMJ 1YI2A 3M53A 5GANe 5DY9A 4ELZC 4M7DF 1IZ6A 2E6ZA 2HQEA 2RI3A 3QIIA 5DLOA 3RKXA 2RJCA 2DIQA 2XDPA 3LH0A 2EIFA 3E9FA 4IUTA 4N4IA 1M4ZA 3JCMh 4M7DG 2DD4A 3OA6A 5LJ5j 4PJOF 1WQWA 4ZGDB 2MI6A 2HBPA 2PVOB 2RH2A 1SSFA 3JCMf 3VUZA 4PJOG 3WXMB 2EFIA 4KBMB 4A4GA 2LQ8A 3JCMe 2XIDA 3VV0A 2CZ7B 4KUIA 3OYBA 5LJ3h 2E10A 3J7AF 2GFUA 2XG8D 3CPWS 4XTYA 5FROA 3I55T 2OTJT 5FU6C 4NOYA 4HCZA 2M16A 2H3JA 2OTJA 4C92B 3OYNA 2BUDA 2LCCA 4A4KA 5LJ3f 2PUOB 4ELYC 3A8HB 1VQ7T 1YIJT 1VIFA 3BW1A 3P8BB 5LJ3e 3PNWC 3FB9A 4IKFA 4M78B 2O4XA 1B34A 4FL6A 2BKDN 2WSCE 4LD6A 3OYAA 2KQWA 3NFCA 2DJZA 4OB0B 4C8QE 2B8AA 2O01E 2V8KA 5IAYA 3OW2S 2HAXA 3HKSA 4QQ6A 1VQMA 4M7AA 2L5QA 2LT1A 2GQVA 2DTIA 1KD1C 3VUBA 4QVZA 1KQ1A 4EPCA 3OMGA 1YJWT 4DA4A 2E6NA 2XD0A 2GCXA 1D3BA 4BB7A 4J6XA 1YITT 4JJNK 2R5AA 5CKDA 2D9TA 1YJWA 4NL2A 5KE2A 3M55A 2E64A 4M7AB 4ZGEB 1W2BA 3M5AA 2K2VA 3G6ET 3G4SA 1YITA 4M7DD 5KE3A 3H8ZA 5I21A 4F7UB 3G6EA 2DKGA 1D3BB 1BI1A 2E5QA 3JCMW 3DKMA 4E7HA 2MAMA 4GLKA 2JN0A 2RI5A 3G7ZA 5GANg 3CD6A 3LGFA 4PJOD 1OI1A 2QXFA 3UT1A 5GAMd 5CR2A 1NJIU 3JB9J 2LT4A 5GAOr 1KC8C 4BY6B 1ZBXA 2JTFA 1OZ3A 1ZHIA 1KQ2A 1VQLT 3DLMA 1K8AU 5IN1A 5GMKh 3CC4T 1VQ5T 1S72A 3GOXA 3QJ6A 2RA2A 2RJFA 4Z02A 4PJOE 1VQ8T 1VQ5A 3GIBA 2F5KA 1BIAA 4O5VA 3OYKA 3L2UA 3MP8A 1HXDA 3MCAB 4ME7A 4JDSA 2CS7A 3ME9A 3JCMg 3X20B 3S3MA 1M1KU 1VQ8A 2IG0A 4DOWA 3F70A 4N0AA 3V8JA 1QVFA 5GMKe 1QVPA 5CKEA 1XOVA 3CCUT 1VQOT 1M90U 2K3YA 2X35A 2D6FA 3CCRT 4C0DB 3CCUA 1LOJA 5D6YA 3AHUA 1Q7YU 1WPYA 5GAN4 5LJ3g 2GFAA 3RKWA 2RO0A 4BI3A 3J80E 2DO3A 3ZBDA 1O9SA 3GPLA 4OB2B 2GF7A 1V29B 4C8QB 3SD4A 4X9DA 3DLLA 3TREA 4BI4A 2X4JA 3LLRA 3V7RA 3QDRB 4FT2A 4UC4A 3JCMc 4BACA 3JRZA 2DZ9A 4J8OA 2LX9A 1K8AC 1M1GA 2RK2A 4C92C 3MEAA 3JCMP 5GMKm 3OYIA 2X4YA 4X9CA 4EMKB 5KH6A 4R56A 1OZ2A 2DXTA 4M75D 4FIBA 5D6XA 5CCAA 4XQ3A 3V7SA 4M7DA 2P4TA 4BUGA 2IVWA 1X75C 2RJDA 1M1KC 1KG1A 4M78C 5LL6S 5FRMA 3OYMA 4XTUA 1TH7A 3FRNA 2DPPB 4M75C 4PKCC 1VQNT 4JRIA 3HSBA 1JJ2A 4M7AE 4E47A 4FM4B 1YI2T 2CKKA 3E1SA 1R8OB 1M90C 4PJOA 2QQRA 3CPFA 3JCMb 2ZPFB 4LDWA 5CKHA 4DQ2A 2D0QB 2RHIA 4PLLA 4X34A 5GAN6 1Q7YC 5HY6A 3S3OA 4HT8A 3OMCA 1PSEA 3CCVA 3VJPA 3M4GA 1BI3A 1Y96A 5HK3A 1M9SA 3R6OA 3VYGA 1YCYA 1KD1U 1KQSA 1MGQA 3J81E 3JB9H 5LJ5d 4PJOB 2ZCFB 4MMLA 2LTOA 3OBWA 3SWNB 3EFSA 4E7IA 1G3TA 3PT9A 4OF1A 3CCQA 4LDUA 1UGSB 3L2WA 4M77C 3N5BB 1I4K1 1FX7A 1Y96B 2CGHA 2HD0A 2DVEA 3BFMA 1OYXA 2EAYA 1JB0E 4EMGA 2YRVA 1WJRA 5GAN3 2E65A 3TCJA 5A2QE 1KHIA 5IT9E 2VGMA 1YJNA 1HK9A 3QUIA 4B9WA 1P92A 2ZPHB 3HRSA 5FU7B 2LC4A 3OBYA 1QP2A 1XQHA 3OS5A 3ZEHA 3P8HA 1KC8U 3CPWA 1FWZA 2DZCA 2KK4A 2MWPA 2DK3A 5GAN2 5GAOn 3CMAA 5CO7A 3RERA 3A8GB 3V8KA 3QXEB 2EQKA 3M4YA 5I2SA 1M5Q1 4OGEA 2QQSA 2PU9B 3CCJA 4Q5WA 5GANj 2RK1A 4J5YA 2ZPBB 2FVUA 1VQMT 1RI0A 1VQKT 5GAMh 3PTAA 2LVMA 2DTOA 2K5IA 3A5ZB 4EDUA 5J39A 4OMFB 2BIVA 1VQKA 2JOYA 5A0LA 4A53A 2O4XB 1B34B 2YLCA 3RMSA 5GAOl 3JSCA 1G5VA 4M75A 2XDBA 5GAMf 3OB9A 2OTLA 3CBMA 3G4ST 1X01A 4C92F 5GAMe 2K5LA 3JAME 1VQ9T 3CXCA 1QVGA 3M9QA 1QP3A 4C8QC 4IUPA 2DXUA 3QZ5B 3ER0A 2EQMA 2EKOA 2Y4XA 3OYEA 1VQ9A 4XTXA 4C92G 3MEVA 1K73C 4HCBA 5EG2A 4MZPA 3HHTB 3QPHA 3CD6T 4M78F 4V2SA 3CC2T 3A8LB 3OQ5A 4QW2A 4M75F 3M54A 3O8VA 3FDRA 2PQWA 4MZTA 3HFNA 4QQDA 3CC2A 2R5MA 4Y28E 4M78G 4PL6A 2RHZA 4ZTJA 3X24B 5LJ3j 4M75G 4M7DE 4JUVA 4MMKA 2VUBA 1S72T 1UEBA 3BDUA 1N8RC 2KY9A 2RHYA 3VYHB 3OYHA 1W4SA 2ZPEB 2EJ9A 4TVRA 3JCMV 3L2ZA 4B9XA 1GXIE 2K5FA 2R58A 3RESA 4J7FA 2RHUA 4QQGA 4RG2A 2M9UA 3KUFA 4JLIA 5CAIA 1BI0A 2JVVA 4J6YA 2L89A 2DIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M7D G;  4C92 C;  1I81 A;  3JCM P;  3JCM X;  5GMK m;  5LJ5 g;  4M77 F;  4M75 B;  4X9C A;  3JCM h;  4PJO F;  4EMK B;  5LJ5 j;  1WQW A;  2DXT A;  3PGG A;  4M75 D;  1JBM A;  3L1A A;  4XQ3 A;  3VU3 C;  3V7S A;  4M7D A;  3JCM f;  4M77 G;  2VXE A;  4PJO G;  1LNX A;  4M78 C;  5GAN 7;  5LJ3 d;  3JCM e;  4XTU A;  1TH7 A;  4M75 C;  4EMK C;  3HSB A;  5LJ3 h;  2E10 A;  4JRI A;  4QVD A;  4M7A E;  4XTY A;  4F7U A;  3BY7 A;  1U1S A;  4M77 A;  4NOY A;  1I5L A;  4PJO A;  4XU3 A;  3V8L A;  2YLB A;  5GAO m;  3JCM b;  3JB9 F;  4DQ2 A;  4C92 B;  5GAN 6;  5LJ3 f;  4HT8 A;  4NL3 A;  4C92 D;  4M7A F;  3BW1 A;  5GMK l;  5LJ3 e;  2RD1 A;  3M4G A;  3EFR A;  1Y96 A;  3JB9 G;  1WNL A;  3FB9 A;  4M77 B;  4M7D C;  1YCY A;  4PJO B;  1MGQ A;  2EJF A;  4M78 B;  5LJ5 d;  4F7U F;  4MML A;  1B34 A;  3SWN B;  3JB9 H;  4M7A G;  2DTH A;  5LJ5 h;  5GAN 5;  2E41 A;  3EFS A;  4M78 D;  2RM4 A;  3RKY A;  2FB7 A;  5GAM g;  4C8Q E;  2DJZ A;  2VXF A;  5GAM j;  4HT9 A;  4F7U G;  4Y91 A;  4M77 C;  1I4K 1;  1Y96 B;  2CGH A;  4M7A A;  2DVE A;  4XU0 A;  5GAO q;  3BFM A;  2EAY A;  4PJO C;  3SWN C;  2DTI A;  4EMG A;  2VC8 A;  5GMK j;  1BIB A;  1KQ1 A;  5LJ5 f;  5GAN 3;  2E65 A;  5LJ5 e;  1D3B A;  4C8Q F;  4J6X A;  1HK9 A;  2ZGW A;  3QUI A;  2HNI A;  4OP0 A;  4M75 E;  4NL2 A;  4M7D B;  2E64 A;  4M7A B;  3V7C A;  4C8Q G;  4M7D D;  1LJO A;  2FYK A;  5I21 A;  2DZC A;  4F7U B;  2DKG A;  2YHT A;  1D3B B;  4XU1 A;  5GAN 2;  5GAO n;  3RER A;  3RIR A;  3V8K A;  3JCM W;  4J6W A;  4C8Q A;  2EJG A;  4M7A C;  4M77 D;  2JN0 A;  5GAN g;  1M5Q 1;  4PNO A;  4PJO D;  5GAN j;  4A54 A;  4XTW A;  5GAM d;  4J5Y A;  4RCC A;  5GAN 8;  3JB9 J;  5GAM h;  5GAO r;  2EWN A;  2DTO A;  3INZ A;  3SB2 A;  1WQ7 A;  4C92 E;  1KQ2 A;  3QO3 A;  2QTX A;  4A53 A;  5GMK h;  5GMK i;  1B34 B;  2YLC A;  3HFO A;  5GAO l;  4M75 A;  3RUX A;  4EMK A;  1M8V A;  4M77 E;  2RA2 A;  4PJO E;  5GAM f;  3GIB A;  4M78 E;  1X01 A;  1BIA A;  4WF2 A;  4C92 F;  5GAM e;  3JCM Q;  1U1T A;  3JB9 D;  1HXD A;  4RCB A;  3JCM g;  4C8Q C;  3FIF A;  4XTV A;  2DXU A;  4JRK A;  3V8J A;  4N0A A;  4M7A D;  5GMK e;  4XTX A;  4C92 G;  1N9R A;  4M78 F;  4V2S A;  4HA8 A;  4M75 F;  5GAN d;  3QHS A;  4C92 A;  1I8F A;  1LOJ A;  3HFN A;  5GAN h;  3AHU A;  1WPY A;  5GAN 4;  4M78 G;  2RB6 A;  5LJ3 g;  2I2L A;  3FJP A;  5LJ3 j;  4M75 G;  4XTZ A;  4JUV A;  4MMK A;  3RKW A;  4M7D E;  2K57 A;  3BDU A;  4EMH A;  1JRI A;  2DEQ A;  2E1H A;  3JB9 I;  4C8Q B;  4M78 A;  2EJ9 A;  3QSU A;  3SWN A;  2Y90 A;  4X9D A;  1H64 1;  3L2Z A;  3JCM V;  4F7U E;  5GAN f;  3RES A;  3JCM J;  4N0A C;  4C8Q D;  5GAN e;  5DY9 A;  4M7D F;  4XU2 A;  3V7R A;  1N9S A;  5CAI A;  5GAO p;  3JCM c;  4JLI A;  3JCM d;  3RKX A;  4QVC A;  4J6Y A;  2DZ9 A; 
#chains in the Genus database with same CATH topology
 4F14 A;  3NTI A;  2EW3 A;  1MHN A;  3JCM X;  4M77 F;  3FJ5 A;  2G3R A;  1VQP T;  5GJW B;  4OGC A;  2A3L A;  2CT3 A;  1VQ6 A;  2CZ1 B;  2V8J A;  2W0Z A;  5KYY A;  3CCM A;  3VS4 A;  1X27 A;  3CME Q;  4MZM A;  5GMK l;  2L3R A;  3JB9 G;  3PMT A;  1AEY A;  2KDS A;  3WVD B;  2YUO A;  3QBY A;  1XTD A;  5LJ5 h;  5GAM g;  3G71 A;  1C0M A;  1QLY A;  1BIB A;  1NJI R;  5LJ5 f;  1GL5 A;  2EYX A;  2P0P A;  3CCS T;  4M75 E;  1UGR B;  4XAX B;  5KYX A;  3CBP A;  4FYV B;  3X25 B;  4C8Q G;  2XMF A;  3A98 A;  1VA7 A;  3M57 A;  2YHT A;  3MEU A;  4R0K A;  2ZAE A;  2ZZD A;  3A8O B;  4M77 D;  2RF0 A;  4A54 A;  2KEA A;  2QDY B;  1NE8 A;  1ACM B;  3QO3 A;  2LQK A;  1GBQ A;  3CBO A;  1M27 C;  2E3I A;  5GMK i;  1Q7Y R;  3OYL A;  1K73 U;  2CP7 A;  1VQM Q;  2QAZ A;  4BY6 C;  4WF2 A;  2KVQ G;  4RG8 A;  1U1T A;  1N6A A;  3FIF A;  3GP8 A;  2MCN A;  2CT4 A;  3GNF B;  1EX4 A;  2BTT A;  2V1Q A;  1HD3 A;  4J9F A;  4F04 B;  2C0T A;  4C92 A;  2X4W A;  2B86 A;  2RB6 A;  2EYQ A;  1VQ4 A;  1QW1 A;  3CD6 Q;  2QTV A;  3CCL T;  4ANJ A;  3CC2 Q;  1YN8 A;  4C0D C;  1KFZ A;  1X69 A;  2DEQ A;  3OYF A;  4RTY A;  3QG1 A;  2DXB A;  1Q81 C;  1S72 Q;  1N9S A;  4CI0 C;  5GAO p;  3JCM d;  2YUP A;  3FC3 A;  1RAA B;  2F69 A;  2VGN A;  4N4G A;  4BDZ A;  4EIK A;  2KAF A;  3CXC S;  5A0D A;  4EMK C;  1WGS A;  4LXC A;  3I5R A;  1JQQ A;  3QYH B;  5HKC A;  1G3W A;  1RAF B;  4OVA A;  4M7A F;  4RTZ A;  2EQJ A;  4M77 B;  3S3N A;  2EJF A;  2QGF B;  2XK0 A;  4PJN A;  1ZUK A;  3RKY A;  2P4R A;  3LWH A;  1VQ6 T;  3EAE A;  3MET A;  4LDV A;  4PJO C;  2VV5 A;  3PFS A;  3SWN C;  1FXX A;  3OS1 A;  2YT6 A;  3KBG A;  1PHT A;  3URG A;  3CC4 A;  4IUQ A;  1PD0 A;  5FW9 A;  2FYK A;  5C6S A;  5KYY B;  3CCS Q;  4HCC A;  1BI2 A;  4QT7 A;  3E9G A;  4FW2 A;  2XU8 A;  1OUL A;  1EFN A;  1K9A A;  3X28 B;  5GAN 8;  3G71 T;  4ZGJ B;  3P8D A;  3MHX A;  4BE2 A;  4ORZ A;  4D6W A;  1AZE A;  1NJI C;  4IUV A;  3C4S A;  2COY A;  4XTV A;  1FMV A;  4M7A D;  1Q86 R;  2DD5 A;  1IRE B;  1AWW A;  3OYJ A;  1AD5 A;  5KYX B;  2PVG B;  3MKD A;  4HKE A;  1M1F A;  2K57 A;  2K3X A;  1VQN A;  4F7U E;  3WVE B;  2LJ1 A;  3CCL Q;  1IZ6 A;  1VYU A;  3H0I A;  3QII A;  2HQE A;  3REB B;  4HCK A;  2RJC A;  2HDA A;  3JCM h;  3E9F A;  2DD4 A;  4AG2 C;  4OMO A;  3JCM f;  2HBP A;  4A4G A;  3D7S B;  2LQ8 A;  3VV0 A;  3OYB A;  4AFU C;  5FRO A;  4E2F B;  1AZG B;  4LUE A;  3TSZ A;  4C92 B;  2OTJ A;  1QQJ A;  3OYN A;  4A4K A;  2LNH B;  3BW1 A;  5LJ3 e;  1B34 A;  1TWB A;  1WDX A;  1AVZ C;  3H0F A;  3OYA A;  3NGP A;  3NFC A;  5IAY A;  2DJZ A;  2L5Q A;  2LT1 A;  3JV3 A;  1PRM C;  1YJW T;  2GCX A;  1VQ6 Q;  1T0J A;  1VYV A;  2C0I A;  3EGX A;  2KT1 A;  4JJC A;  2R5A A;  5KE2 A;  4M7A B;  1K73 R;  1ZLM A;  5IHK A;  3G4S A;  1UJY A;  2BZ8 A;  3VS3 A;  3G6E A;  1M8M A;  2E5Q A;  1Y57 A;  3JCM W;  1TS9 A;  1OI1 A;  2LT4 A;  1IGQ A;  2JTF A;  1I1J A;  2X51 A;  5EC7 A;  3CC4 T;  1VQ5 T;  1RUW A;  3G71 Q;  2RA2 A;  2RJF A;  5I22 A;  2F5K A;  1BIA A;  3OYK A;  2HMA A;  3MP8 A;  1HXD A;  1M1K U;  3ME9 A;  3X20 B;  1D1B A;  3S3M A;  2IG0 A;  3F70 A;  3TQ7 P;  3V8J A;  1QVF A;  1S1N A;  5GMK e;  1OU9 A;  3R6N A;  5L23 A;  2D6F A;  1EZZ B;  3AHU A;  1RAG B;  2GFA A;  1G2B A;  1MMG A;  4RUG A;  1KQS P;  1X43 A;  4DBR A;  8AT1 B;  3TRE A;  3LLR A;  2CP6 A;  2KYM A;  2RMO A;  3JCM c;  3JRZ A;  2LX9 A;  1M1G A;  3TSW A;  3JCM P;  3MEA A;  1U3O A;  5GMK m;  5KH6 A;  1IO6 A;  1QCF A;  5CCA A;  4XQ3 A;  2IVW A;  1D0X A;  1KG1 A;  3EHQ A;  3VRZ A;  5FRM A;  3OYM A;  1VQN T;  2DPP B;  1JJ2 A;  4M7A E;  1VQ4 Q;  1R8O B;  4PJO A;  2HCK A;  4LDW A;  2RHI A;  5GAN 6;  4X34 A;  1WHL A;  5HY6 A;  3S3O A;  2DBK A;  4HT8 A;  1QMC A;  3OMC A;  2FZC B;  1M3B A;  2L2P A;  3TVT A;  4RTX A;  3R6O A;  1KD1 U;  3J81 E;  1C1A A;  4MML A;  3OBW A;  1W6X A;  4OF1 A;  4M77 C;  1Y96 B;  2HD0 A;  3BFM A;  2DF6 A;  1JB0 E;  1WHG A;  5GAN 3;  3TCJ A;  2JS2 A;  1KHI A;  2K3B A;  3SEM A;  1ZUU A;  4B9W A;  2ZPH B;  4AMC A;  3OBY A;  1XQH A;  1NBE B;  1YJW Q;  2YUN A;  2KK4 A;  2AT1 B;  3V8K A;  4OGE A;  2PU9 B;  2ZPB B;  1LCK A;  5J39 A;  1VQK A;  2JOY A;  5A0L A;  4A53 A;  1B34 B;  4M75 A;  3OB9 A;  2O2O A;  3G4S T;  5GAM e;  2K5L A;  3QWX X;  1QVG A;  3CC4 Q;  2DXU A;  3OYE A;  4C92 G;  1K73 C;  2FO0 A;  2JMC A;  4M78 F;  1BB9 A;  3A8L B;  3EGX B;  1FYN A;  4M75 F;  2CP0 A;  1W70 A;  3M54 A;  1YWP A;  4MZT A;  3CC2 A;  2AZS A;  3X24 B;  5LJ3 j;  2VUB A;  2BE9 B;  2QGG A;  2X9H A;  1UEB A;  2KY9 A;  2RHY A;  3PVQ A;  3VYH B;  3OYH A;  4JPB W;  2DL4 A;  2R58 A;  1AOJ A;  2RHU A;  3LH5 A;  4QQG A;  4RG2 A;  2L89 A;  1BBZ A;  4CC3 A;  3M56 A;  3LWI A;  3QKJ A;  5CKB A;  4DBQ A;  1RLQ C;  2RQV A;  2QA4 A;  1VQP A;  2E5K A;  2O9S A;  4L59 A;  4QVD A;  5CKF A;  1U1S A;  4XU3 A;  9ATC B;  3NHN A;  2OJ2 A;  1VQN Q;  4KUD K;  4II1 A;  4NL3 A;  3CC7 T;  2RJE A;  5C0M A;  1PC0 A;  4YTL A;  1HJD A;  2YRD A;  3A1P A;  2QQB A;  4M78 D;  1PKT A;  4C5I A;  2V1R A;  1IRX A;  4Y91 A;  3BDL A;  2QI2 A;  2J06 A;  3GNG A;  3H9N A;  5GMK j;  1TU0 B;  1KIK A;  3LYI A;  3CCS A;  3I9Q A;  1LJO A;  1T3S A;  3PE0 A;  3PMI A;  1CSK A;  1MV0 B;  1M1K R;  4M7A C;  3SDZ A;  3OW2 P;  2KI7 A;  3UPU A;  2VYT A;  3SB2 A;  4JJD A;  4AG1 C;  4KH1 B;  1UB4 A;  4AFS C;  2F2W A;  2JW4 A;  3RUX A;  1J3T A;  2ATC B;  3HP9 A;  2RQU A;  3NMZ C;  4MDX A;  1FMW A;  2LRQ A;  1N9R A;  5IXB A;  3G4S Q;  1KHC A;  1RL2 A;  2VKN A;  5GAN d;  2FZK B;  1WFW A;  1UJ0 A;  2OX7 A;  4XTZ A;  2CRE A;  4E7K A;  2E1H A;  4KT0 E;  3CCL A;  1K9M U;  2Y90 A;  3I55 A;  3MP6 A;  3LX7 A;  1YNZ A;  3BE3 A;  3EG1 A;  3QZ9 B;  2PUK B;  1PKS A;  4JLG A;  1YIJ A;  2AK5 A;  5LJ5 g;  1NPP A;  5L8R E;  2P84 A;  4M75 B;  4C5H A;  1H3Z A;  3QWY A;  3L1A A;  1I07 A;  4PJM A;  5I11 A;  1OPK A;  2K9G A;  1X6O A;  4F7U A;  5KYW B;  2DXC A;  4M77 A;  2LCL A;  1PG5 B;  1YHQ T;  1BU1 A;  5FWC A;  5GAO m;  1NYF A;  1ZQ1 A;  2ZPG B;  5IXF A;  5FRN A;  4J9C A;  3L2Q A;  1MUZ A;  4BD3 A;  2MMP A;  4F7U F;  2Y4Y A;  4CC2 A;  2KE9 A;  2ZPI B;  5GAN 5;  2QA4 T;  3EGD A;  3M0T A;  2FEI A;  5GAM j;  3CC7 Q;  4HT9 A;  2CZ6 B;  4LE9 A;  3UWN A;  4XU0 A;  3T9N A;  2CP5 A;  1VIE A;  4IUR A;  1SSH A;  2ZGW A;  2HNI A;  1K4U S;  4A4F A;  1WIE A;  2HSE B;  3HRU A;  3RIR A;  4J6W A;  4E6R A;  1RAB B;  4GY5 A;  2DE0 X;  4ZNX A;  1NEB A;  2PNI A;  1Q82 C;  1Y71 A;  5D6W A;  2PVD B;  4BI8 B;  1TUD A;  1SKU B;  1M8V A;  2E3H A;  1SG5 A;  4JRQ A;  1H3H A;  4M78 E;  1Z9Q A;  3MJX A;  3KXT A;  4JS4 A;  1N27 A;  1QWF A;  1WHH A;  1VUB A;  4OML A;  4OB3 B;  4RMO A;  1WHJ A;  3REA B;  3QHS A;  4A4E A;  5GAN h;  2LJ3 A;  3Q1J A;  2M02 A;  4L6V 5;  5CQY A;  4OMM A;  3OS2 A;  1WYX A;  2RNA A;  3OYY A;  4XK8 E;  5GAN f;  3JCM J;  1VQK Q;  2J7I A;  5DY9 A;  4ELZ C;  4M7D F;  2E6Z A;  2A36 A;  3RNJ A;  1F1B B;  5DLO A;  2XDP A;  4IUT A;  2DYI A;  4PJJ A;  3OA6 A;  4ZGD B;  3EG3 A;  2PVO B;  3WXM B;  4PJO G;  2EFI A;  2X3W D;  2NWM A;  4F16 A;  2XG8 D;  4CC4 B;  3I55 T;  2GNC A;  2PUO B;  1YIJ T;  1VIF A;  1UFF A;  3FB9 A;  4IKF A;  2CSQ A;  1MND A;  4OB0 B;  2ESW A;  2O01 E;  2HAX A;  1D0Z A;  3UA6 A;  4M4Z A;  4M7A A;  1KD1 C;  4QVZ A;  4EPC A;  2QA4 Q;  1VQP Q;  4DA4 A;  2E6N A;  2XD0 A;  4J6X A;  1YIT T;  1YJW A;  4NL2 A;  4CC7 A;  3M55 A;  2K2V A;  1TSF A;  4M7D D;  5KE3 A;  3H8Z A;  1VYT A;  4F7U B;  1D3B B;  2JN0 A;  3LGF A;  1RAH B;  2QXF A;  3JB9 J;  2KRN A;  2OAW A;  3DLM A;  1K8A U;  5IN1 A;  2EYZ A;  3GOX A;  3EHR A;  4Z02 A;  3EGD B;  1VQ8 T;  1VQ5 A;  1XJW B;  2YXY A;  3JCM g;  2FPD A;  2CS7 A;  4JDS A;  1K9M R;  2LCS A;  1WI7 A;  4D8D A;  1QVP A;  1XOV A;  1M90 U;  2K3Y A;  3RR6 A;  1OQK A;  1LOJ A;  2RO0 A;  3GBQ A;  4BI3 A;  3J80 E;  1IHW A;  2AIR B;  3ZBD A;  1O9S A;  1V29 B;  3SD4 A;  1NLP C;  3THK A;  2L0A A;  1WXB A;  2DZ9 A;  4J8O A;  2BE7 D;  4QKU A;  2X4Y A;  5D7U A;  4KH0 B;  4X9C A;  4R56 A;  1T0H A;  2P4T A;  3H0H A;  2RJD A;  4M78 C;  5LL6 S;  3FRN A;  4M75 C;  4PKC C;  1E6G A;  4E47 A;  2GGR A;  4FM4 B;  2CKK A;  1X2K A;  2EVR A;  4J9I A;  2JS0 A;  2QQR A;  1RAI B;  3JCM b;  4DQ2 A;  2LP5 A;  2D0Q B;  4PLL A;  2JT4 A;  1Q7Y C;  1PSE A;  3I55 Q;  1Y96 A;  5HK3 A;  1M9S A;  1KQS A;  4RTV A;  1YIJ Q;  4DEX A;  4E7I A;  3PT9 A;  3CCQ A;  4LDU A;  3CXC P;  3L2W A;  1FX7 A;  2DVE A;  4EMG A;  1E6H A;  2E65 A;  5A2Q E;  2DM1 A;  1YJN A;  1HK9 A;  3QUI A;  3HRS A;  2LC4 A;  4RTT A;  1U06 A;  1KC8 U;  2V26 A;  1FWZ A;  4LN2 A;  5GAO n;  3RER A;  3A8G B;  2H8H A;  3QXE B;  3EFO B;  4K11 A;  3M0S A;  2QQS A;  2JM9 A;  1RAC B;  1NM7 A;  2RK1 A;  4J5Y A;  4Q5W A;  2SRC A;  1Z9Z A;  2C0O A;  3PTA A;  2YRC A;  2DTO A;  3A5Z B;  4EDU A;  1AWO A;  4J9H A;  5GAO l;  1SHF A;  3CBM A;  1C6V X;  2FRW A;  1VQ9 T;  1HYO A;  1PD1 A;  1WA7 A;  4RTW A;  2Y4X A;  1K1Z A;  3O5Z A;  4HCB A;  1VQ8 Q;  4FYY B;  4QW2 A;  2RN8 A;  4FW1 A;  3O8V A;  2DBM A;  2PQW A;  1RLP C;  4Y28 E;  3QDF A;  1WHM A;  4M7D E;  4B9X A;  3JCM V;  3L2Z A;  2K5F A;  3RES A;  4HVV A;  1LVK A;  1D09 B;  2M9U A;  2KBT A;  3KUF A;  4JLI A;  1BI0 A;  2JVV A;  4J6Y A;  2DEU A;  1E7O A;  1YJ9 A;  2CUB A;  1Y0M A;  3VU3 C;  2LNV A;  1NEG A;  4M77 G;  1WXU A;  4LDY A;  4A63 B;  1UDL A;  2J6O A;  5FLX E;  5J3B A;  2QG9 B;  2VB6 A;  2KRM A;  4J9G A;  3MP1 A;  1BYM A;  1UG1 A;  3JB9 F;  4KUL A;  2MWO A;  3CCE T;  2DYB A;  4X1V A;  3OYD A;  4AFZ C;  1UGP B;  2K6D A;  1D0Y A;  2I0N A;  3CC7 A;  2DTH A;  1MMN A;  4ATO A;  1PRL C;  2A0F B;  1Q86 C;  1UGQ B;  2KYB A;  2L8D A;  5LJ5 e;  2ED1 A;  4C8Q F;  2QEX A;  2YUQ A;  1H8K A;  1K8A R;  1SRM A;  2KRS A;  2RHX A;  1M30 A;  1ZA2 B;  3M0P A;  2P0Q A;  4LDX A;  2MF2 A;  2XHC A;  3CCQ T;  1U5S A;  4XTW A;  1TUC A;  1IB8 A;  1Q81 U;  1M90 R;  4PFP A;  2HZY A;  1XNI A;  2ED0 A;  3H41 A;  1YJN T;  1WJQ A;  1GBR A;  5A0G A;  3JB9 D;  2QK0 A;  3LGL A;  2DL3 A;  1N8R U;  3HRT A;  2M0O A;  3QYG B;  1VOM A;  1I8F A;  1WJS A;  2R57 A;  3FJP A;  3DB3 A;  3HPW A;  3X26 B;  1NPR A;  2A7Y A;  3FEO A;  4OMQ A;  4E7J A;  4M78 A;  3ASK A;  4FYW B;  3H6Z A;  4L5G A;  4N0A C;  4C8Q D;  3OW2 A;  3PIP A;  4XU2 A;  1OPL A;  4ZN1 A;  1VQ5 Q;  3VS1 A;  4RKU E;  1LPL A;  2AHJ B;  2XI9 A;  1DJ7 B;  5KYW A;  1V1C A;  3PGG A;  2HQX A;  1QKW A;  5KCO A;  2DET A;  3OYG A;  2X4X A;  4KRT A;  4BE1 A;  1LNX A;  5GAN 7;  1W2B S;  1QVG S;  5LJ3 d;  4GBQ A;  3L2V A;  3BY7 A;  3M58 A;  4CRI A;  5J26 A;  1U8R A;  1ZUY A;  2JMA A;  1YHQ A;  3M0U A;  4JJB A;  1YWO A;  4MDW A;  1SEM A;  2RD1 A;  2CZ0 B;  3EFR A;  3L42 A;  1WNL A;  1SF9 A;  1YJ9 T;  4M7D C;  4M7A G;  1G3Y A;  1PSF A;  1KC8 R;  3E2U A;  2E41 A;  3CCE Q;  4LD9 K;  3VS7 A;  3OSS C;  4O6J A;  4FSX A;  2QDL A;  4C0Z A;  5GAO q;  1MMA A;  2JZ2 A;  4J7I A;  1K0X A;  5AYF A;  3MEW A;  1X6G A;  5CVI A;  3OSV A;  1BKB A;  2YSQ A;  3DB4 A;  2JNG A;  2NYS A;  1ARK A;  2COW A;  1EIF A;  1NZ9 A;  3EH1 A;  3VS5 A;  2M0Y A;  1ZSG A;  2IPO B;  4VUB A;  2EJG A;  2WSF E;  1VQO A;  4Z89 A;  3HL8 A;  3VKI A;  2EWN A;  3INZ A;  1YCS B;  3CCQ Q;  2DRM A;  2QEX T;  2RQR A;  4BDY A;  3HFO A;  2ROL A;  2XKO C;  1IXD A;  2KR3 A;  3HTR A;  3JCM Q;  3L2R A;  1OU8 A;  2XDD A;  3E19 A;  2GQI A;  4RCB A;  3S6W A;  3FLG A;  1YJN Q;  5AT1 B;  2C06 A;  1X2Q A;  2JTM A;  2J6K A;  1K0S A;  2EPD A;  2NLU A;  4FT4 A;  3CME T;  1I5O B;  2K79 A;  2O31 A;  2G6F X;  3NTH A;  1H64 1;  2CH4 A;  3C94 A;  1YI2 A;  2XIC A;  1G83 A;  4GLM A;  2L3P A;  3RKX A;  2DIQ A;  4Z8A A;  4N4I A;  2L3S A;  1AWX A;  2MOX A;  5LJ5 j;  2LX7 A;  2A08 A;  3VUZ A;  4WTO B;  1W2B P;  2RH2 A;  1SSF A;  3JCM e;  3M0R A;  4KUI A;  5LJ3 h;  3J7A F;  2GFU A;  3CPW S;  4PFZ A;  5FU6 C;  4HCZ A;  4Z88 A;  2H3J A;  2BUD A;  5LJ3 f;  4ELY C;  1IHV A;  2DIL A;  2F2V A;  3EG0 A;  3P8B B;  1ZSZ B;  2HL5 C;  4M78 B;  2O4X A;  2FZG B;  4LD6 A;  1M2O A;  2KQW A;  4C8Q E;  1YJ9 Q;  3HKS A;  4QQ6 A;  3U23 A;  1UHC A;  2GTJ A;  2DTI A;  2DER A;  1KQ1 A;  1Q81 R;  2F2X A;  1D3B A;  4BB7 A;  4JJN K;  5CKD A;  2D9T A;  2O9V A;  3RDV A;  2DL7 A;  4ZGE B;  1YIT A;  5I21 A;  1BI1 A;  3G7Z A;  5GAN g;  2D8H A;  5GAM d;  1IGU A;  4DBH A;  1N8R R;  2PTK A;  1KC8 C;  2JJ9 A;  1ZBX A;  1OZ3 A;  1ZHI A;  5GMK h;  1X6B A;  2DA9 A;  3QJ6 A;  4PJO E;  1RAD B;  1JXM A;  4E7S A;  3L2U A;  3MCA B;  3UAT A;  1M2V B;  2QEX Q;  1VQ8 A;  2H3E B;  4N0A A;  5CKE A;  3CCU T;  1VQO T;  2X35 A;  1WPY A;  3RKW A;  3GPL A;  3SHW A;  4OB2 B;  3DLL A;  4PK4 A;  2X4J A;  1TOV A;  4FT2 A;  4UC4 A;  4BAC A;  1MNE A;  3EG2 A;  2RK2 A;  3OYI A;  2MYS A;  2DXT A;  5D6X A;  1ABO A;  3PVL A;  3V7S A;  4M7D A;  1X75 C;  1M1K C;  2FG0 A;  4DEY A;  1TH7 A;  3CPW P;  4JRI A;  1YI2 T;  2HSP A;  3CPF A;  2ZPF B;  4AFQ C;  2HBW A;  3CCV A;  3M4G A;  1BI3 A;  1OOT A;  3VYG A;  1YCY A;  1MGQ A;  3JB9 H;  2ZCF B;  2LTO A;  1ZBJ A;  2EGA A;  1JO8 A;  2NUZ A;  1UGS B;  1V76 A;  1I4K 1;  2CGH A;  1D1C A;  2HKN A;  2YRV A;  1WJR A;  4JZ3 A;  1UEC A;  2OI3 A;  2LZ6 B;  5IT9 E;  4J9E A;  2E4H A;  5FU7 B;  3EFO A;  3OS5 A;  2COZ A;  3RBB B;  3ZEH A;  2NUP B;  3P8H A;  4IIO A;  1YHQ Q;  2DK3 A;  5GAN 2;  3CMA A;  3M4Y A;  2LJ0 A;  5I2S A;  1M5Q 1;  3CCJ A;  5IHI A;  4B6M A;  2FVU A;  1RI0 A;  5GAM h;  2K5I A;  2EKH A;  1MMD A;  3IQL A;  5IHN A;  4OMF B;  2PZ1 A;  1CKA A;  2O4X B;  4OMP A;  1G5V A;  1G8X A;  5GAM f;  2OTL A;  3VS6 A;  1X01 A;  2F1L A;  4C92 F;  3JAM E;  3CXC A;  3M9Q A;  1QP3 A;  1R0C B;  4C8Q C;  3ER0 A;  1VQ9 A;  3MEV A;  3AT1 B;  5EG2 A;  3HHT B;  3QPH A;  2LQW A;  2KRO A;  4V2S A;  3OQ5 A;  2NUT A;  1OX9 A;  3HFN A;  4FYX B;  1CKB A;  4M78 G;  4PL6 A;  2RHZ A;  5KYU B;  4M75 G;  2HQH A;  3CCU Q;  1VQO Q;  1SHG A;  1WX6 A;  2EQI A;  1N8R C;  1JU5 C;  2ZPE B;  2EJ9 A;  1ABQ A;  1GXI E;  4J7F A;  3I5S A;  5CAI A;  2CP2 A;  3N5B B;  2MPX C;  1SRL A;  2DIG A;  1I81 A;  5KCH A;  2EQU A;  3OYC A;  4R55 A;  3MO8 A;  4C5E A;  1WHK A;  3CCM T;  4BE0 A;  5I2M A;  2QQA A;  1I5L A;  2KT8 A;  2RI2 A;  4C92 D;  1GFC A;  1YI2 Q;  2CUD A;  3CCE A;  1K76 A;  1TXQ A;  4FU6 A;  2RM4 A;  1ZSZ C;  1O75 A;  2EYY A;  1HSQ A;  2QQ9 A;  4P5N A;  2VC8 A;  3LW5 E;  4WCI A;  2KGT A;  3EG9 A;  2X3X D;  1YBY A;  5DLQ E;  4M7D B;  4DOV A;  1TTH B;  3CCV T;  2AKL A;  3V7C A;  1M3C A;  3ZFJ A;  1Y7X A;  4XU1 A;  2HL3 A;  3I56 A;  4PNO A;  3NPF A;  3UA7 A;  4RCC A;  3QJY A;  1WQ7 A;  5HK0 A;  2P0K A;  1KQS S;  2LDM A;  1UTI A;  4DBF A;  4M77 E;  3PIO A;  3M0Q A;  1AT1 B;  2WSE E;  3TEE A;  2WAC A;  1UGV A;  2JXB A;  2MIO A;  1ZX6 A;  4LUD A;  4J83 A;  2DFU A;  4HXJ A;  2FHD A;  3CMA T;  1AHJ B;  2M51 A;  1YIT Q;  1KK7 A;  4HA8 A;  3CCJ T;  1VQ4 T;  1FMK A;  4ZN3 A;  4KGX B;  2I2L A;  1GCP A;  3EGU A;  2D8J A;  4EMH A;  3JB9 I;  2DAQ A;  2OTL T;  1Y07 A;  2KSS A;  1RAE B;  3VRY A;  1OV3 A;  5DM7 R;  4Y92 A;  4QVC A;  2FPE A;  1VQ7 A;  3M59 A;  3C12 A;  2K4Y A;  4C5G A;  1JBM A;  1BCM A;  3NTK A;  2VXE A;  2CYZ B;  3A8M B;  4D8K A;  3VS2 A;  2BZY A;  2L3Q A;  2NUT B;  3V8L A;  2YLB A;  1GCQ C;  2KMT A;  3CCM Q;  2DNU A;  4JS5 A;  4E7L A;  1Q82 U;  3OS0 A;  2JTE A;  1K9M C;  4IUU A;  2FB7 A;  2VXF A;  4F7U G;  5FU6 B;  4FCY A;  3GF5 A;  1G3S A;  4PLI A;  8ATC B;  4N4H A;  1QVF S;  4C0G A;  1VQL A;  5CK9 A;  3GLX A;  1TUG B;  2JUF A;  4OP0 A;  2FL7 A;  3SFM A;  3C95 A;  3EH2 A;  2M1H A;  2OAU A;  2E70 A;  1BK2 A;  1PCX A;  1UUE A;  2BZX A;  5FU7 C;  3CCV Q;  4C8Q A;  2JM8 A;  3CCR A;  1OEB A;  2DRK A;  1JXO A;  2ECZ A;  2GBQ A;  4C0F A;  4C92 E;  3CEY A;  2ROT A;  2QTX A;  1QCO A;  4JRP A;  3UF4 A;  1GFD A;  4EMK A;  2ABL A;  4OB1 B;  4OMN A;  1ZA1 B;  1RI9 A;  2AZV A;  2MK5 A;  2FRY A;  3KFV A;  4JRK A;  2EYW A;  3UDC A;  1JJ2 S;  3EG9 B;  3I56 T;  1NG2 A;  3OY9 A;  5CIU A;  5CQX A;  2E12 A;  3CMA Q;  2O88 A;  3ZL7 C;  2DVJ A;  1PWT A;  2HKQ B;  3CME A;  3CCJ Q;  2F5T X;  2V8I A;  1JRI A;  2CP3 A;  5M9O A;  4NS5 A;  3RMQ A;  4ZTF A;  3QSU A;  3SWN A;  4A4H A;  4ESR A;  3TU4 K;  3M53 A;  5GAN e;  1PNJ A;  2RI3 A;  2EGC A;  5GJV B;  3LH0 A;  2EIF A;  2OTL Q;  1M4Z A;  2DL5 A;  2LQN A;  2J6F A;  4M7D G;  2DX1 A;  4PJO F;  1WQW A;  2EGE A;  2YWW A;  1VQ9 Q;  2MI6 A;  3I35 A;  5FWB A;  1W1F A;  4KBM B;  4AT1 B;  1NLO C;  1QKX A;  1SPK A;  2CZ7 B;  2XID A;  2E10 A;  4XTY A;  2OTJ T;  1ZSZ A;  2VVK A;  4NOY A;  2M16 A;  5KYN A;  2LCC A;  2CSI A;  1VQ7 T;  4J9B A;  3A8H B;  3PNW C;  2K2M A;  4PJL A;  4FL6 A;  2BKD N;  2WSC E;  1PM3 A;  3OW2 S;  1KJW A;  2B8A A;  2V8K A;  2FPF A;  1VQM A;  1QVF P;  1I0C A;  2GQV A;  3ULR B;  3VUB A;  2QAS A;  3OMG A;  2D0N A;  1YP5 A;  1UE9 A;  2E64 A;  1W2B A;  1NYG A;  3M5A A;  3G6E T;  2DMO A;  4RTU A;  2DKG A;  1WLP B;  2A28 A;  4E7Z A;  2DJQ A;  3DKM A;  4E7H A;  2MAM A;  4GLK A;  2RI5 A;  3CD6 A;  4PJO D;  2K7A A;  2LMJ A;  3UT1 A;  1NJI U;  2HEQ A;  5CR2 A;  5GAO r;  6AT1 B;  4BY6 B;  1KQ2 A;  1M2V A;  2Z0W A;  1VQL T;  1AWJ A;  1OX8 A;  2DL8 A;  1S72 A;  2QYZ A;  3GIB A;  4HVW A;  2IIM A;  7AT1 B;  4O5V A;  2DLP A;  3C0C A;  4ME7 A;  4DOW A;  1JJ2 P;  1R0B G;  2KNB B;  5HCK A;  2RQW A;  1R77 A;  3CCR T;  4C0D B;  3CCU A;  5D6Y A;  1Q7Y U;  5GAN 4;  5LJ3 g;  3I56 Q;  1N5Z A;  2DO3 A;  3MPU B;  1YFN A;  2GF7 A;  4C8Q B;  1B3Q A;  1MV3 A;  4X9D A;  4BI4 A;  2J05 A;  3V7R A;  3QDR B;  3VS0 A;  1D1A A;  1QWE A;  1GCQ A;  1K8A C;  4C92 C;  4J9D A;  4EMK B;  1Q82 R;  1OZ2 A;  4M75 D;  4FIB A;  4BUG A;  4XTU A;  3HSB A;  3E1S A;  1M90 C;  5CKH A;  2VAS A;  2A37 A;  2OTJ Q;  3VJP A;  2KXD A;  4IIM A;  4PJO B;  1UHF A;  1M3A A;  4PFO A;  3SWN B;  5LJ5 d;  1VQ7 Q;  1GRI A;  3EFS A;  1G3T A;  1KSW A;  1B07 A;  4F17 A;  1QVG P;  1OYX A;  2EAY A;  3CQT A;  4KGV B;  2AKK A;  2NUP A;  1QCN A;  2VGM A;  1P92 A;  2ENM A;  4JZ4 A;  1QP2 A;  2CDT A;  3CPW A;  2DZC A;  2MWP A;  3G1J A;  1JEG A;  4FSS A;  5CO7 A;  2EQK A;  3G6E Q;  5GAN j;  1VQM T;  1VQK T;  2LVM A;  1H92 A;  4KGZ B;  2BIV A;  2SEM A;  2KXC A;  5IH2 A;  1WXT A;  2W10 A;  1A0N B;  1Q95 G;  2YLC A;  3RMS A;  3JSC A;  2XDB A;  1B7T A;  2RQT A;  1VQL Q;  4IUP A;  3QZ5 B;  2EQM A;  2EKO A;  5KYU A;  4XTX A;  1WZO A;  5ECA A;  2VWF A;  4MZP A;  3CD6 T;  3CC2 T;  2CH4 W;  1KD1 R;  3FDR A;  4QQD A;  2R5M A;  4HVU A;  4ZTJ A;  4JUV A;  4LNP A;  4MMK A;  1S72 T;  3CCR Q;  1T3L A;  3BDU A;  1W4S A;  2RPN A;  4TVR A;  2D1X A;  1TG0 A;  2YDL A;  1Q86 U;  1BCO A;  2EBP A;  2GTO A; 
#chains in the Genus database with same CATH homology
 3NTI A;  1I81 A;  1MHN A;  3JCM X;  3M56 A;  3LWI A;  4M77 F;  5KCH A;  1YJ9 A;  2G3R A;  2EQU A;  1VQP T;  3QKJ A;  5CKB A;  4OGC A;  3VU3 C;  2LNV A;  4R55 A;  3OYC A;  3MO8 A;  4M77 G;  4C5E A;  4LDY A;  2QA4 A;  1VQP A;  2A3L A;  1VQ6 A;  4L59 A;  2CZ1 B;  5FLX E;  5J3B A;  4QVD A;  3CCM T;  5CKF A;  4BE0 A;  5I2M A;  2V8J A;  1U1S A;  3CCM A;  2QQA A;  1I5L A;  3MP1 A;  4XU3 A;  1BYM A;  3JB9 F;  4KUL A;  4KUD K;  4II1 A;  2RI2 A;  2MWO A;  3CCE T;  4NL3 A;  4C92 D;  4MZM A;  3OYD A;  1UGP B;  5GMK l;  2L3R A;  3CC7 T;  2RJE A;  5C0M A;  3JB9 G;  3CCE A;  3PMT A;  4YTL A;  2KDS A;  3WVD B;  3QBY A;  3CC7 A;  1XTD A;  4FU6 A;  2DTH A;  5LJ5 h;  2QQB A;  4M78 D;  4ATO A;  2RM4 A;  5GAM g;  4C5I A;  4Y91 A;  3BDL A;  2QI2 A;  1Q86 C;  1O75 A;  3G71 A;  3GNG A;  2QQ9 A;  4P5N A;  2VC8 A;  3LW5 E;  1BIB A;  5GMK j;  1UGQ B;  5LJ5 f;  2L8D A;  5LJ5 e;  2P0P A;  4C8Q F;  2QEX A;  3CCS T;  1YBY A;  4M75 E;  1UGR B;  5DLQ E;  4M7D B;  4XAX B;  4DOV A;  3CCV T;  2RHX A;  3CBP A;  3LYI A;  3CCS A;  3V7C A;  3X25 B;  4C8Q G;  1LJO A;  3M57 A;  3PMI A;  3ZFJ A;  1Y7X A;  2YHT A;  3MEU A;  2P0Q A;  4XU1 A;  4LDX A;  2MF2 A;  2XHC A;  2ZZD A;  4M7A C;  3A8O B;  3CCQ T;  4M77 D;  3I56 A;  4PNO A;  3SDZ A;  4A54 A;  4XTW A;  3UPU A;  4RCC A;  2QDY B;  3QJY A;  1Q81 U;  2VYT A;  1NE8 A;  3SB2 A;  1WQ7 A;  5HK0 A;  1UB4 A;  3QO3 A;  1XNI A;  2LQK A;  3CBO A;  2P0K A;  5GMK i;  1KQS S;  2LDM A;  3OYL A;  1YJN T;  1K73 U;  3RUX A;  4M77 E;  3PIO A;  1WJQ A;  3HP9 A;  4BY6 C;  4WF2 A;  2KVQ G;  2WSE E;  5A0G A;  4RG8 A;  1U1T A;  2WAC A;  3TEE A;  1N6A A;  3JB9 D;  3FIF A;  3LGL A;  4J83 A;  3GP8 A;  2FHD A;  3CMA T;  1AHJ B;  4MDX A;  2LRQ A;  1N9R A;  3GNF B;  1N8R U;  1KHC A;  4HA8 A;  1RL2 A;  3HRT A;  3CCJ T;  2M0O A;  3QYG B;  1VQ4 T;  5GAN d;  4C92 A;  1I8F A;  4ZN3 A;  2X4W A;  1WJS A;  2RB6 A;  2EYQ A;  1VQ4 A;  2I2L A;  2R57 A;  3FJP A;  1QW1 A;  3DB3 A;  3HPW A;  4XTZ A;  3X26 B;  3CCL T;  1NPR A;  2A7Y A;  3FEO A;  4C0D C;  4E7K A;  4EMH A;  2E1H A;  2DEQ A;  4E7J A;  3OYF A;  4KT0 E;  3JB9 I;  3CCL A;  2DAQ A;  3ASK A;  4M78 A;  1Q86 U;  2Y90 A;  1K9M U;  2OTL T;  3H6Z A;  1Y07 A;  3MP6 A;  3LX7 A;  4L5G A;  2KSS A;  4N0A C;  3QG1 A;  4C8Q D;  3I55 A;  3OW2 A;  3PIP A;  2DXB A;  3QZ9 B;  4XU2 A;  1Q81 C;  1N9S A;  2PUK B;  4CI0 C;  5GAO p;  3JCM d;  5DM7 R;  4QVC A;  1VQ7 A;  4ZN1 A;  4JLG A;  1YIJ A;  3M59 A;  3FC3 A;  4RKU E;  2F69 A;  2VGN A;  5LJ5 g;  1NPP A;  2AHJ B;  3C12 A;  4M75 B;  4N4G A;  5L8R E;  2XI9 A;  1DJ7 B;  2K4Y A;  4BDZ A;  4C5H A;  1H3Z A;  3PGG A;  2HQX A;  4C5G A;  1JBM A;  3L1A A;  5KCO A;  3NTK A;  3OYG A;  2X4X A;  2VXE A;  4BE1 A;  2CYZ B;  1LNX A;  2KAF A;  5GAN 7;  3CXC S;  5LJ3 d;  1W2B S;  5A0D A;  1QVG S;  3A8M B;  4EMK C;  1X6O A;  1WGS A;  3L2V A;  4F7U A;  3BY7 A;  3M58 A;  4CRI A;  2DXC A;  3QYH B;  4M77 A;  5J26 A;  2LCL A;  5HKC A;  1YHQ T;  1U8R A;  3V8L A;  1G3W A;  2YLB A;  5GAO m;  2KMT A;  1YHQ A;  1ZQ1 A;  4MDW A;  2ZPG B;  4JS5 A;  4OVA A;  4E7L A;  1Q82 U;  5FRN A;  4M7A F;  2RD1 A;  2CZ0 B;  3EFR A;  3L42 A;  3OS0 A;  1WNL A;  2EQJ A;  1YJ9 T;  4M77 B;  3S3N A;  4M7D C;  2EJF A;  3L2Q A;  2XK0 A;  4BD3 A;  2MMP A;  4F7U F;  1K9M C;  4M7A G;  2Y4Y A;  2ZPI B;  1G3Y A;  1PSF A;  5GAN 5;  4LD9 K;  2E41 A;  4IUU A;  3RKY A;  2QA4 T;  2FB7 A;  3LWH A;  3OSS C;  2VXF A;  4O6J A;  4FSX A;  4C0Z A;  3EAE A;  3MET A;  4LDV A;  2CZ6 B;  5FU6 B;  4F7U G;  5GAM j;  1VQ6 T;  3GF5 A;  3UWN A;  4HT9 A;  4PJO C;  4XU0 A;  5GAO q;  1G3S A;  4PLI A;  2VV5 A;  3T9N A;  3PFS A;  1VIE A;  2JZ2 A;  4N4H A;  3SWN C;  1FXX A;  4J7I A;  3OS1 A;  1QVF S;  5AYF A;  3MEW A;  3KBG A;  4IUR A;  5CVI A;  3OSV A;  4C0G A;  5CK9 A;  1BKB A;  1VQL A;  3DB4 A;  3GLX A;  3URG A;  2JNG A;  3CC4 A;  2ZGW A;  2JUF A;  2HNI A;  4OP0 A;  4IUQ A;  2FL7 A;  3SFM A;  4A4F A;  3C95 A;  1EIF A;  2M1H A;  1NZ9 A;  2FYK A;  2OAU A;  2E70 A;  5C6S A;  4HCC A;  1BI2 A;  3HRU A;  5FU7 C;  3RIR A;  4VUB A;  3E9G A;  4J6W A;  2EJG A;  4C8Q A;  2XU8 A;  2WSF E;  1VQO A;  4GY5 A;  3X28 B;  5GAN 8;  3CCR A;  3G71 T;  3HL8 A;  3VKI A;  3P8D A;  4ZGJ B;  2EWN A;  4C0F A;  1Y71 A;  3INZ A;  5D6W A;  4C92 E;  1Q82 C;  2PVD B;  3CEY A;  3MHX A;  4BI8 B;  4BE2 A;  2QTX A;  2QEX T;  4JRP A;  4BDY A;  3HFO A;  4EMK A;  1M8V A;  4OB1 B;  4D6W A;  1NJI C;  4JRQ A;  4IUV A;  2XKO C;  4M78 E;  3JCM Q;  3L2R A;  2XDD A;  3E19 A;  3KXT A;  3S6W A;  1N27 A;  4RCB A;  4JS4 A;  3C4S A;  3FLG A;  4XTV A;  2C06 A;  4JRK A;  2JTM A;  3UDC A;  4M7A D;  1VUB A;  4OB3 B;  4RMO A;  1JJ2 S;  3I56 T;  2DD5 A;  1IRE B;  3OY9 A;  3OYJ A;  5CIU A;  5CQX A;  3QHS A;  2E12 A;  2NLU A;  4FT4 A;  4A4E A;  5GAN h;  2PVG B;  3Q1J A;  3CME T;  4HKE A;  4L6V 5;  1M1F A;  3CME A;  2K57 A;  2K3X A;  2F5T X;  5CQY A;  2V8I A;  3NTH A;  1VQN A;  1JRI A;  5M9O A;  4NS5 A;  3RMQ A;  4ZTF A;  3OS2 A;  3QSU A;  3SWN A;  4A4H A;  1H64 1;  3OYY A;  3C94 A;  4XK8 E;  3WVE B;  4F7U E;  5GAN f;  2XIC A;  3TU4 K;  3JCM J;  1YI2 A;  3M53 A;  5GAN e;  5DY9 A;  4ELZ C;  4M7D F;  1IZ6 A;  2E6Z A;  2HQE A;  2RI3 A;  3QII A;  5DLO A;  3RKX A;  2RJC A;  2DIQ A;  2XDP A;  3LH0 A;  2EIF A;  3E9F A;  4IUT A;  4N4I A;  1M4Z A;  3JCM h;  4M7D G;  2DD4 A;  3OA6 A;  5LJ5 j;  4PJO F;  1WQW A;  4ZGD B;  2MI6 A;  2HBP A;  2PVO B;  2RH2 A;  1SSF A;  3JCM f;  3VUZ A;  4PJO G;  3WXM B;  2EFI A;  4KBM B;  4A4G A;  2LQ8 A;  3JCM e;  2XID A;  3VV0 A;  2CZ7 B;  4KUI A;  3OYB A;  5LJ3 h;  2E10 A;  3J7A F;  2GFU A;  2XG8 D;  3CPW S;  4XTY A;  5FRO A;  3I55 T;  2OTJ T;  5FU6 C;  4NOY A;  4HCZ A;  2M16 A;  2H3J A;  2OTJ A;  4C92 B;  3OYN A;  2BUD A;  2LCC A;  4A4K A;  5LJ3 f;  2PUO B;  4ELY C;  3A8H B;  1VQ7 T;  1YIJ T;  1VIF A;  3BW1 A;  3P8B B;  5LJ3 e;  3PNW C;  3FB9 A;  4IKF A;  4M78 B;  2O4X A;  1B34 A;  4FL6 A;  2BKD N;  2WSC E;  4LD6 A;  3OYA A;  2KQW A;  3NFC A;  2DJZ A;  4OB0 B;  4C8Q E;  2B8A A;  2O01 E;  2V8K A;  5IAY A;  3OW2 S;  2HAX A;  3HKS A;  4QQ6 A;  1VQM A;  4M7A A;  2L5Q A;  2LT1 A;  2GQV A;  2DTI A;  1KD1 C;  3VUB A;  4QVZ A;  1KQ1 A;  4EPC A;  3OMG A;  1YJW T;  4DA4 A;  2E6N A;  2XD0 A;  2GCX A;  1D3B A;  4BB7 A;  4J6X A;  1YIT T;  4JJN K;  2R5A A;  5CKD A;  2D9T A;  1YJW A;  4NL2 A;  5KE2 A;  3M55 A;  2E64 A;  4M7A B;  4ZGE B;  1W2B A;  3M5A A;  2K2V A;  3G6E T;  3G4S A;  1YIT A;  4M7D D;  5KE3 A;  3H8Z A;  5I21 A;  4F7U B;  3G6E A;  2DKG A;  1D3B B;  1BI1 A;  2E5Q A;  3JCM W;  3DKM A;  4E7H A;  2MAM A;  4GLK A;  2JN0 A;  2RI5 A;  3G7Z A;  5GAN g;  3CD6 A;  3LGF A;  4PJO D;  1OI1 A;  2QXF A;  3UT1 A;  5GAM d;  5CR2 A;  1NJI U;  3JB9 J;  2LT4 A;  5GAO r;  1KC8 C;  4BY6 B;  1ZBX A;  2JTF A;  1OZ3 A;  1ZHI A;  1KQ2 A;  1VQL T;  3DLM A;  1K8A U;  5IN1 A;  5GMK h;  3CC4 T;  1VQ5 T;  1S72 A;  3GOX A;  3QJ6 A;  2RA2 A;  2RJF A;  4Z02 A;  4PJO E;  1VQ8 T;  1VQ5 A;  3GIB A;  2F5K A;  1BIA A;  4O5V A;  3OYK A;  3L2U A;  3MP8 A;  1HXD A;  3MCA B;  4ME7 A;  4JDS A;  2CS7 A;  3ME9 A;  3JCM g;  3X20 B;  3S3M A;  1M1K U;  1VQ8 A;  2IG0 A;  4DOW A;  3F70 A;  4N0A A;  3V8J A;  1QVF A;  5GMK e;  1QVP A;  5CKE A;  1XOV A;  3CCU T;  1VQO T;  1M90 U;  2K3Y A;  2X35 A;  2D6F A;  3CCR T;  4C0D B;  3CCU A;  1LOJ A;  5D6Y A;  3AHU A;  1Q7Y U;  1WPY A;  5GAN 4;  5LJ3 g;  2GFA A;  3RKW A;  2RO0 A;  4BI3 A;  3J80 E;  2DO3 A;  3ZBD A;  1O9S A;  3GPL A;  4OB2 B;  2GF7 A;  1V29 B;  4C8Q B;  3SD4 A;  4X9D A;  3DLL A;  3TRE A;  4BI4 A;  2X4J A;  3LLR A;  3V7R A;  3QDR B;  4FT2 A;  4UC4 A;  3JCM c;  4BAC A;  3JRZ A;  2DZ9 A;  4J8O A;  2LX9 A;  1K8A C;  1M1G A;  2RK2 A;  4C92 C;  3MEA A;  3JCM P;  5GMK m;  3OYI A;  2X4Y A;  4X9C A;  4EMK B;  5KH6 A;  4R56 A;  1OZ2 A;  2DXT A;  4M75 D;  4FIB A;  5D6X A;  5CCA A;  4XQ3 A;  3V7S A;  4M7D A;  2P4T A;  4BUG A;  2IVW A;  1X75 C;  2RJD A;  1M1K C;  1KG1 A;  4M78 C;  5LL6 S;  5FRM A;  3OYM A;  4XTU A;  1TH7 A;  3FRN A;  2DPP B;  4M75 C;  4PKC C;  1VQN T;  4JRI A;  3HSB A;  1JJ2 A;  4M7A E;  4E47 A;  4FM4 B;  1YI2 T;  2CKK A;  3E1S A;  1R8O B;  1M90 C;  4PJO A;  2QQR A;  3CPF A;  3JCM b;  2ZPF B;  4LDW A;  5CKH A;  4DQ2 A;  2D0Q B;  2RHI A;  4PLL A;  4X34 A;  5GAN 6;  1Q7Y C;  5HY6 A;  3S3O A;  4HT8 A;  3OMC A;  1PSE A;  3CCV A;  3VJP A;  3M4G A;  1BI3 A;  1Y96 A;  5HK3 A;  1M9S A;  3R6O A;  3VYG A;  1YCY A;  1KD1 U;  1KQS A;  1MGQ A;  3J81 E;  3JB9 H;  5LJ5 d;  4PJO B;  2ZCF B;  4MML A;  2LTO A;  3OBW A;  3SWN B;  3EFS A;  4E7I A;  1G3T A;  3PT9 A;  4OF1 A;  3CCQ A;  4LDU A;  1UGS B;  3L2W A;  4M77 C;  3N5B B;  1I4K 1;  1FX7 A;  1Y96 B;  2CGH A;  2HD0 A;  2DVE A;  3BFM A;  1OYX A;  2EAY A;  1JB0 E;  4EMG A;  2YRV A;  1WJR A;  5GAN 3;  2E65 A;  3TCJ A;  5A2Q E;  1KHI A;  5IT9 E;  2VGM A;  1YJN A;  1HK9 A;  3QUI A;  4B9W A;  1P92 A;  2ZPH B;  3HRS A;  5FU7 B;  2LC4 A;  3OBY A;  1QP2 A;  1XQH A;  3OS5 A;  3ZEH A;  3P8H A;  1KC8 U;  3CPW A;  1FWZ A;  2DZC A;  2KK4 A;  2MWP A;  2DK3 A;  5GAN 2;  5GAO n;  3CMA A;  5CO7 A;  3RER A;  3A8G B;  3V8K A;  3QXE B;  2EQK A;  3M4Y A;  5I2S A;  1M5Q 1;  4OGE A;  2QQS A;  2PU9 B;  3CCJ A;  4Q5W A;  5GAN j;  2RK1 A;  4J5Y A;  2ZPB B;  2FVU A;  1VQM T;  1RI0 A;  1VQK T;  5GAM h;  3PTA A;  2LVM A;  2DTO A;  2K5I A;  3A5Z B;  4EDU A;  5J39 A;  4OMF B;  2BIV A;  1VQK A;  2JOY A;  5A0L A;  4A53 A;  2O4X B;  1B34 B;  2YLC A;  3RMS A;  5GAO l;  3JSC A;  1G5V A;  4M75 A;  2XDB A;  5GAM f;  3OB9 A;  2OTL A;  3CBM A;  3G4S T;  1X01 A;  4C92 F;  5GAM e;  2K5L A;  3JAM E;  1VQ9 T;  3CXC A;  1QVG A;  3M9Q A;  1QP3 A;  4C8Q C;  4IUP A;  2DXU A;  3QZ5 B;  3ER0 A;  2EQM A;  2EKO A;  2Y4X A;  3OYE A;  1VQ9 A;  4XTX A;  4C92 G;  3MEV A;  1K73 C;  4HCB A;  5EG2 A;  4MZP A;  3HHT B;  3QPH A;  3CD6 T;  4M78 F;  4V2S A;  3CC2 T;  3A8L B;  3OQ5 A;  4QW2 A;  4M75 F;  3M54 A;  3O8V A;  3FDR A;  2PQW A;  4MZT A;  3HFN A;  4QQD A;  3CC2 A;  2R5M A;  4Y28 E;  4M78 G;  4PL6 A;  2RHZ A;  4ZTJ A;  3X24 B;  5LJ3 j;  4M75 G;  4M7D E;  4JUV A;  4MMK A;  2VUB A;  1S72 T;  1UEB A;  3BDU A;  1N8R C;  2KY9 A;  2RHY A;  3VYH B;  3OYH A;  1W4S A;  2ZPE B;  2EJ9 A;  4TVR A;  3JCM V;  3L2Z A;  4B9X A;  1GXI E;  2K5F A;  2R58 A;  3RES A;  4J7F A;  2RHU A;  4QQG A;  4RG2 A;  2M9U A;  3KUF A;  4JLI A;  5CAI A;  1BI0 A;  2JVV A;  4J6Y A;  2L89 A;  2DIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...