4M77C

Crystal structure of lsm2-8 complex, space group i212121
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
77
structure length
69
Chain Sequence
TPLDLLKLNLDERVYIKLRGARTLVGTLQAFDSHSNIVLSDAVETIYESERRSEMVFIRGDTVTLISTP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords U6 snRNA-associated Sm-like protein LSm8
publication title Crystal structures of the Lsm complex bound to the 3' end sequence of U6 small nuclear RNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 14
structure length 69
sequence length 77
chains with identical sequence J
ec nomenclature
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01423 LSM LSM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4m77C00
5GAN5 1JBMA 5GANj 1M8VA 2EJGA 5GMKe 5GAN7 4XU0A 5GAMd 4XU3A 4M75C 2VC8A 4HT8A 4M78C 2DJZA 5I21A 2HNIA 2I2LA 4F7UE 5LJ5e 4PJOE 4RCBA 4PJOG 3JCMX 4V2SA 1WQ7A 4C8QB 5GANd 3HSBA 4M7DB 4MMLA 3GIBA 2EWNA 2E10A 4M7AB 2K57A 2QTXA 3RIRA 4M77C 3JCMJ 4N0AC 1U1SA 5GAOm 2DZ9A 4C8QF 4XTYA 5GAMj 3JCMg 4HT9A 1WQWA 5LJ5g 4M7DF 4M7AF 4PJOA 2DXTA 1LNXA 3RERA 4A53A 4M75F 4EMGA 1I4K1 5LJ3e 5GMKi 4EMKB 2YLCA 2CGHA 4C92C 4PJOD 2ZGWA 4J6YA 3FJPA 4M78F 3JB9H 1Y96A 3SWNC 3L2ZA 1X01A 4XQ3A 4XTVA 3PGGA 4NL2A 4C8QE 4C8QG 3JCMb 3JCMP 3RKWA 4XTUA 3RKYA 1HXDA 4M7DE 4M7DG 1BIAA 2E41A 4M7AG 4XTZA 1HK9A 3JCMd 1MGQA 1LJOA 4M75G 3RESA 4DQ2A 5GAMf 5LJ5d 5GAOl 3JCMV 3FIFA 4M78G 5LJ3g 1WNLA 1WPYA 3QO3A 1D3BB 1B34B 4QVDA 4C8QA 5GANf 5GAOn 3V8JA 2EAYA 2EJFA 4M75B 4M7DA 1N9RA 5GMKj 4M7AA 1TH7A 4C8QD 1M5Q1 5GAMh 2DXUA 1KQ2A 4M78B 4M75A 5GAN4 3HFOA 3INZA 4XTXA 4M78A 3FB9A 5LJ3d 1I5LA 1LOJA 5LJ5j 2FYKA 2DZCA 5GANh 3SB2A 2DVEA 4M77B 3JB9J 4EMKA 1JRIA 4RCCA 3RKXA 4NL3A 1N9SA 4PJOC 4A54A 4M77A 5GMKm 4N0AA 4M7AE 3QSUA 2EJ9A 2RB6A 4Y91A 4JLIA 2JN0A 4M75E 2YHTA 3EFSA 4M77F 4NOYA 5GANe 2YLBA 4M78E 3JCMf 4C92B 3AHUA 5LJ5f 3V7RA 5GAOq 4JRKA 4WF2A 3JB9F 5LJ3j 1I8FA 3SWNB 4XU1A 3JCMW 4F7UB 4XTWA 2RA2A 2DTHA 2DEQA 3SWNA 5GAN6 1D3BA 1B34A 4HA8A 3QHSA 4M77E 4C92F 4J5YA 4M77G 4X9DA 5DY9A 3BFMA 1I81A 3HFNA 5GANg 5GAOr 2FB7A 5GMKl 2E1HA 2RD1A 3JCMh 4C8QC 4F7UF 5LJ5h 4JUVA 2VXFA 3JB9G 4M7AD 3M4GA 2VXEA 4M75D 4M7DD 4M7DC 3RUXA 4M7AC 4OP0A 1H641 3V8LA 2DTIA 3BDUA 3BY7A 4M78D 5LJ3f 3V7CA 4C92E 5GAMe 3V7SA 4C92G 3JCMc 5GAN8 3BW1A 4MMKA 4XU2A 3JCMe 2Y90A 4F7UG 1KQ1A 4JRIA 3VU3C 2DKGA 2E64A 4M77D 4EMKC 2DTOA 3JCMQ 1U1TA 1YCYA 5LJ3h 5CAIA 3JB9D 3L1AA 4EMHA 4J6XA 5GAMg 4C92A 3V8KA 4QVCA 4PJOB 2E65A 2RM4A 1BIBA 4J6WA 5GMKh 4F7UA 4C92D 3JB9I 3EFRA 1Y96B 3QUIA 4PNOA 5GAOp 5GAN3 5GAN2 4X9CA 4PJOF
chains in the Genus database with same CATH superfamily
1X2QA 1LVKA 3CCQQ 4C5HA 4DEYA 5GAMd 3MP6A 1WXBA 2RH2A 2DE0X 3I56Q 3QWXX 4PJOG 3DLLA 4KGZB 1K9MU 5CKFA 4M7AB 1GBRA 1WXUA 3EFOA 2YDLA 2DZ9A 2CYZB 2CP6A 4XTYA 2K3XA 1K8AC 2NUPB 4RTXA 1LNXA 2DNUA 3UF4A 2J06A 1JQQA 4E7ZA 2FL7A 2RPNA 2DLPA 1YIJA 5LJ3g 2IG0A 3OW2S 1WPYA 2GNCA 2PUOB 2J6OA 2LNVA 2HMAA 4NS5A 1OZ2A 1PKSA 1SF9A 3I5SA 1VQKA 4M75A 5GAN4 2M0OA 5J3BA 4E6RA 1NBEB 2O9VA 3A5ZB 2DL5A 1K73U 2DXBA 2P84A 4DEXA 1SSHA 4ZGDB 3CCUT 2QI2A 3MP1A 2RB6A 1VQ8Q 3E9GA 1CKAA 2DVJA 1VQOA 1UGRB 4M78E 4HVWA 3CCJA 4FT2A 4Y28E 3OBWA 1I8FA 1YI2T 2PVOB 1G5VA 4Z02A 4HA8A 4PFOA 4FIBA 3PNWC 2QEXQ 3GLXA 2VB6A 4M7AD 2VXFA 2KBTA 1K76A 4OMOA 3CCMT 1OX9A 3ER0A 4M7AC 1VYUA 1VQ5T 1ZLMA 4C5EA 3BDUA 1ABOA 3BW1A 1VQ5A 3OW2P 3A8MB 4DOVA 3EGUA 1UJYA 2E5QA 4JRIA 3CCRA 2AZVA 5FROA 2MOXA 2HQEA 3CCET 4C92A 4JS4A 2DRMA 1BI1A 4OGEA 3UDCA 2LQNA 1BU1A 1VYTA 2WACA 3QG1A 3L2WA 1PM3A 1T0JA 2ROTA 3CMET 2FZKB 3HL8A 4F7UE 3JCMX 2GBQA 2GTJA 1KG1A 2L2PA 3OYBA 2K57A 1ZQ1A 3MO8A 4DBRA 3HRSA 2C06A 3G7ZA 3RR6A 4M75F 1QLYA 4PJOD 2HZYA 2DBMA 1UEBA 4DOWA 1VQ4A 3LWHA 2ED0A 3I55Q 4B9XA 1K8AR 4FM4B 1D1BA 1KSWA 8AT1B 2LX9A 1YN8A 2AIRB 3JSCA 5GANf 2KMTA 5KYNA 1VQLA 1D1CA 3CCLQ 2DXUA 4M78B 4OB1B 3HTRA 4LUEA 3S6WA 5FWBA 4QT7A 2DZCA 3A8OB 3J80E 5CKHA 2A36A 2HL5C 1YJNA 1R0BG 2KRMA 3ZBDA 1YITT 5C6SA 2RHIA 4O6JA 1VQMQ 4XU1A 2RI3A 1YITA 2QDLA 4FT4A 1B34A 1JB0E 3M4YA 4C92F 4M77G 1IO6A 3CD6A 1ZUYA 5DM7R 3OW2A 1Q82C 3S3OA 1Q95G 2MAMA 4BE2A 1YFNA 2X4JA 4L6V5 3AT1B 3SFMA 1UDLA 3CXCS 3L1AA 4HVUA 2QTVA 3TSWA 1OOTA 2RQWA 1ZUKA 4WTOB 3CMAQ 4PJLA 4A63B 2QASA 1VQNQ 2DAQA 3LH5A 1OQKA 3EGXB 2XKOC 5GAN7 2AK5A 2YRVA 4FYXB 3CCQT 2VC8A 2LQWA 4M78C 3L42A 5HK0A 3I56T 2JJ9A 2VVKA 6AT1B 3KBGA 4QQ6A 1ZBJA 1FWZA 1I5OB 4GLMA 4OGCA 5IXBA 3J7AF 2E70A 4ORZA 1BI3A 1DJ7B 1Z9QA 2D0NA 4HT9A 1NG2A 1R0CB 4LDWA 4KUIA 3OSSC 1Q86C 2OX7A 2CDTA 4M7DE 3LYIA 4IUUA 4ZTJA 2LJ3A 4AFQC 3CXCP 1IB8A 1JO8A 4KRTA 2ZPFB 3DLMA 2LCLA 5KE2A 5FU6B 5L8RE 1RAIB 3OYGA 4M7AA 2DYBA 2O9SA 2BZ8A 4MDXA 3EG2A 3OYCA 1SG5A 4J9EA 4ANJA 4LN2A 2JN0A 2YSQA 4M75E 1G83A 4OMPA 1M90C 1VQ8T 3V7RA 3UPUA 4LE9A 3X20B 3VS2A 4JRQA 4LD9K 1E6HA 2JS2A 3SWNA 1HSQA 1WJQA 2QEXT 3H0FA 1TUCA 2RJDA 3VKIA 2KYMA 2QEXA 2X9HA 4D8DA 3CC4A 1YJ9T 4BACA 2KRNA 1YJ9A 4ZGEB 2RN8A 4M77D 4F14A 2VGMA 1VQ7Q 1Q82R 1U1TA 1QCNA 5LJ3h 1AWOA 3HKSA 4A4KA 2I0NA 2CZ1B 1TOVA 3EFRA 2EIFA 4OB3B 2EBPA 4HCKA 1M8MA 3OYHA 5GMKe 4XU3A 2X3WD 4AMCA 4CC3A 5A0DA 1T3SA 2BZXA 4FSSA 1YCSB 3RMQA 4YTLA 4LUDA 2E6ZA 1T0HA 4M7DB 3GIBA 2EWNA 2AKKA 3RIRA 3G6EA 4F04B 1U1SA 3SDZA 3J81E 5D6XA 2JT4A 4M7AF 2FO0A 3CC2A 2VKNA 1MV0B 1Y57A 2CH4W 1MV3A 1KD1R 2HBPA 3CXCA 2HD0A 3VS0A 3H6ZA 2JM9A 3RESA 3I55T 1KQSS 2V26A 2RQTA 1JXMA 2LZ6B 3VRYA 1D3BB 1WHMA 2CUBA 2JZ2A 4M75B 1N9RA 2J6KA 3CCLT 1GCQC 2PVDB 2DD5A 5LJ3d 1UTIA 5D6WA 1N9SA 3THKA 1PSFA 3A8LB 3OMCA 1UJ0A 2OTJA 5KYYB 3EFSA 2YLBA 4WCIA 2PZ1A 5IHKA 3RDVA 2K79A 4OMMA 2HQXA 2LCSA 3JCMW 2L0AA 4CC7A 5FLXE 2CP3A 5GAN6 1VQMT 1I1JA 1PRLC 2E5KA 4PK4A 3NPFA 1Y07A 3BFMA 1M90R 4B9WA 4M7DD 2GCXA 3VV0A 2VXEA 5CO7A 3VS7A 4M7DC 3EH2A 4OP0A 2KK4A 2ATCB 3L2RA 1ACMB 3V7CA 1KK7A 1KQSP 3GOXA 1YBYA 1QVFS 2KXDA 3Q1JA 1BIBA 2FRYA 2YT6A 4J9BA 2K3YA 3CMAT 5J26A 2H8HA 3CMAA 2OAUA 1VQNT 1NJIR 3CCVA 4JRPA 1G3WA 4M75C 2ROLA 3PIPA 2DJZA 2AKLA 1H3HA 3E1SA 5IT9E 2MIOA 4KT0E 4RMOA 2KYBA 4DBQA 1BBZA 2ZPBB 3H8ZA 1WQWA 2CKKA 1N27A 3TSZA 4FYYB 4BE1A 4IUTA 5IXFA 4DBFA 3OY9A 4C8QG 3EGXA 1M1GA 3HRTA 3LW5E 1QVFP 4ME7A 2HDAA 2YRCA 4F16A 3M54A 3GBQA 2KR3A 2P0KA 1QVGS 2EQIA 5GAOn 2KROA 1UHCA 2FPFA 5GMKj 1WDXA 4FCYA 5CQYA 2DILA 1YHQQ 3CPFA 1N8RR 4KH1B 2RHZA 2DVEA 4E2FB 4F17A 1MMGA 4IKFA 4M77A 4M7AE 3EG9B 4IURA 1OYXA 1TS9A 2CS7A 3VS4A 3TU4K 3L2UA 3JCMf 4Z8AA 2KT8A 1LPLA 2L3SA 4BB7A 1D1AA 1X69A 2DEQA 2K5IA 1X6BA 4KBMB 3GPLA 2JVVA 5DY9A 4D8KA 2EYXA 1VA7A 1KQSA 2A37A 3E9FA 3CBOA 2LMJA 3META 2NLUA 2RJEA 2QDYB 1NLOC 1KQ1A 2DXCA 1QVGP 3NTKA 3VU3C 1WYXA 1K0SA 2GTOA 3JCMQ 4N4GA 1VQ9A 1C0MA 1ZUUA 1VQ7T 5C0MA 2A3LA 1QCFA 2COZA 2P4RA 3DB4A 4J9GA 2AZSA 4PNOA 3E19A 2KVQG 4ZGJB 2XMFA 3NMZC 3CPWS 5CIUA 3UA6A 4PJOE 1PHTA 5IAYA 2NWMA 1NZ9A 1U06A 4MZTA 3L2QA 1GCQA 2PVGB 4HCBA 1SRLA 2SEMA 4JLGA 1S72A 2K9GA 4EMKB 2YLCA 1QVFA 3OYKA 4NL2A 2QA4Q 1UB4A 1HXDA 2K3BA 4M4ZA 2ABLA 1XQHA 2XICA 2EVRA 1LJOA 3CBMA 1EIFA 2WSFE 5CKEA 3VS5A 1IXDA 3QO3A 1WHHA 2GGRA 2LCCA 1KHIA 2ED1A 3V8JA 3JAME 4M7DA 2NUZA 4C8QD 5L23A 5KCOA 1GFCA 4II1A 2X51A 2CT3A 3VUBA 3CPWP 1M1KU 1OI1A 3CCSQ 1YP5A 2HBWA 1FX7A 1PWTA 1QVPA 2JTEA 2MWPA 1X2KA 2W10A 1FMWA 1WX6A 3MEAA 5LJ5f 4WF2A 3JB9F 1KHCA 3SWNB 4XTWA 2RA2A 3M56A 1D3BA 5I11A 2LT1A 1YWPA 4JJCA 1V1CA 3MEUA 1MNEA 4DBHA 4ESRA 2BUDA 3V8LA 2HKNA 1QVGA 3V7SA 2LTOA 5EG2A 4C0DB 2O31A 1CKBA 4RKUE 2KE9A 3CCUA 3SEMA 4EMKC 3PMTA 2CSQA 5KYYA 3QPHA 2LQKA 3SD4A 1QP2A 3OS0A 3PFSA 4PJOB 1PNJA 2D8HA 1K9MR 3PMIA 1YI2A 1SPKA 3CEYA 1G3TA 2OI3A 5GAN5 3QYHB 1I07A 2LDMA 1SHGA 3P8DA 3CCMA 4HT8A 2Y4YA 5LJ5e 1TWBA 3M0PA 1KC8C 3HSBA 4FYVB 4BI4A 5HK3A 2DL8A 2ZCFB 4N4HA 3CCEA 2EGEA 1GXIE 4M7DF 2CP2A 1HJDA 1PKTA 4A53A 4EMGA 3ASKA 4GLKA 2CGHA 1ZSGA 4JZ4A 4RTVA 3SWNC 4L5GA 3OQ5A 2E41A 1OV3A 2L8DA 4K11A 1K73R 4M78G 3CMEA 1WNLA 3CPWA 3NFCA 1VQ6Q 4C0DC 1H8KA 2BZYA 3PIOA 2X35A 1WHJA 4VUBA 1YHQT 2RHYA 2QQ9A 1IGQA 2F1LA 4KULA 4RCCA 3H41A 4PJOC 4N0AA 1AT1B 2M0YA 1IRXA 2L89A 2JNGA 4D6WA 1KC8U 2JW4A 4Z88A 3D7SB 1VYVA 1VQPQ 1T3LA 1W70A 3BE3A 4M77E 2Z0WA 3EH1A 1I81A 3GP8A 1BB9A 1VUBA 4ELZC 1FMVA 1AEYA 1WJRA 2JTMA 2HCKA 9ATCB 4F7UG 4FW2A 2JXBA 3OYMA 1D09B 4IUVA 5A0GA 3OYAA 3EG9A 1ARKA 2DTOA 4P5NA 3LX7A 1YCYA 4FU6A 3G1JA 4QVCA 1AVZC 1UGSB 1N6AA 1JJ2S 2L5QA 4PLLA 2B86A 3LH0A 4XU0A 4AG1C 1M2VB 3FLGA 2DL4A 2HNIA 4RCBA 2W0ZA 4KGVB 2MYSA 3JRZA 3MP8A 1R8OB 3VS6A 2E10A 2SRCA 1M3BA 3QJYA 1M3CA 5GAOm 2HSPA 1BI0A 3HPWA 3OSVA 5KYXA 1IGUA 2JS0A 3VS3A 4LXCA 1TU0B 4XQ3A 3REAB 3PGGA 3JCMb 2YXYA 2EQKA 4QQGA 4XTUA 5CKBA 2ECZA 2A08A 2X4YA 2QA4T 3FDRA 2YWWA 5GAOl 3CCQA 2QA4A 1V76A 2EGAA 4OMQA 3I56A 4RG2A 2GFAA 2MCNA 2D0QB 3WVDB 3UATA 1JJ2P 3P8BB 5LJ5j 2CSIA 5GANh 1MHNA 4BY6B 4OVAA 5HCKA 4M77B 4EMKA 2O88A 3CCST 2CP5A 4C0ZA 2COYA 3C4SA 5HY6A 1GFDA 1QCOA 2ZPIB 3EGDB 2CUDA 2L3QA 3NGPA 2VYTA 1G3YA 5FU7B 4A4EA 2XDPA 2H3EB 1TUDA 5GAOr 4OB2B 1UGVA 4MZPA 4O5VA 3KFVA 3BY7A 2RMOA 1GCPA 3JCMc 5GAN8 2MMPA 3UT1A 2EYWA 1QWFA 4FL6A 4J9CA 1LCKA 1VIEA 1AWXA 2BE9B 2QXFA 4QKUA 1VQ8A 3M0QA 4IIOA 5CK9A 1RACB 1G8XA 4J6WA 1RLQC 2R58A 3KXTA 1Y96B 3TVTA 1KJWA 1Y71A 2XI9A 1MMAA 3G71Q 5I21A 4E7IA 1BKBA 4V2SA 2BTTA 5ECAA 5GANd 1A0NB 2C0IA 4BY6C 4M77C 3UWNA 1TUGB 5J39A 3JCMg 1K1ZA 4QW2A 4PJOA 1OPKA 1SSFA 3S3MA 3RERA 4UC4A 3JB9H 1N5ZA 1G3SA 5I2SA 5FU6C 5FU7C 3MPUB 4MZMA 3G4SQ 2QQRA 4M75G 1WIEA 2EQJA 1JJ2A 1GL5A 4BD3A 1B7TA 1OZ3A 4QQDA 1X43A 4MDWA 1YJWQ 4LNPA 2YRDA 1VQ6T 4LDYA 1WI7A 1LOJA 1VQ6A 3REBB 4ELYC 1X27A 4LDUA 1W2BS 1VOMA 2FPDA 3IQLA 2OTLQ 2GF7A 1WXTA 1Y0MA 2L3PA 7AT1B 1OU8A 3I55A 4JRKA 1QP3A 4IUQA 2HAXA 1Q86R 2QGFB 4J9DA 2O4XB 2QK0A 1VQPT 4XAXB 1MMNA 1AD5A 3CCLA 1H641 4J7IA 1QWEA 3I5RA 4C92G 2RF0A 2CZ0B 4ZN3A 2FRWA 1W6XA 3QDRB 3DB3A 1XOVA 2KQWA 1NJIU 3A8GB 3WVEB 1ZSZB 2EQMA 3OYFA 3A1PA 3M9QA 3HP9A 4XK8E 1VQMA 1W2BP 4PJOF 1YIJQ 2JM8A 4E7JA 3NHNA 2V8KA 1U5SA 1EFNA 1AHJB 1RAEB 3O5ZA 2KT1A 1VQKQ 2QQAA 1M9SA 3OYIA 2DF6A 4JS5A 3JCMJ 3OYYA 1FMKA 1UFFA 2QGGA 2DA9A 5LJ5g 3CQTA 3VRZA 1JU5C 4EIKA 2RNAA 2RHUA 1TG0A 4C8QE 3L2ZA 1X01A 1VQOQ 1V29B 3RKWA 2IPOB 3CCJQ 1VQNA 4ATOA 1YWOA 5GAMf 1M2VA 2DYIA 2EYZA 1MNDA 1M30A 1RABB 2L3RA 2KDSA 2PNIA 1X6OA 2K2MA 1F1BB 4OF1A 3CCRQ 3OYEA 3C95A 1JRIA 4KGXB 2YUPA 1ZSZC 3MHXA 1W1FA 5FWCA 2YHTA 1Q81U 4JJNK 2LNHB 2QAZA 1Q7YU 2K5LA 5FW9A 3U23A 3S3NA 2GFUA 2RD1A 4Q5WA 2KNBB 2D8JA 4X1VA 3M4GA 3RNJA 2E6NA 1H92A 5FRMA 4R56A 5GAMe 2MWOA 4AFZC 1HD3A 1O9SA 4IIMA 3R6OA 3MJXA 2E64A 8ATCB 2HKQB 2LJ1A 4Y92A 5CAIA 1RL2A 2EQUA 3EGDA 1RUWA 3V8KA 1W2BA 1VQ4Q 4C92D 1QKWA 2XIDA 1S1NA 2E3IA 2AHJB 4RTTA 2DX1A 3CC7Q 1H3ZA 3VUZA 3G71T 2RI2A 3PVLA 1VQLQ 2ZPEB 3QJ6A 3TQ7P 4C8QB 2IVWA 2BKDN 4N0AC 2LT4A 2HSEB 2COWA 3C0CA 1M1KC 2XK0A 1QQJA 1VQ7A 2RK1A 5KYXB 1AWWA 4JDSA 2C0OA 5IHNA 5EC7A 2JMAA 2PU9B 3FJPA 1YJNQ 1Y96A 1RLPC 2LQ8A 2P0QA 4M7AG 1HK9A 1BCMA 2AT1B 4C5GA 2EKHA 3G4ST 3URGA 2XDBA 3CD6Q 4BUGA 3EHRA 1FYNA 5KYWA 1M5Q1 3EG0A 5M9OA 5A2QE 4ZTFA 1YJWT 2DK3A 3C94A 3R6NA 4TVRA 4BI8B 4DA4A 4A54A 4Y91A 3A8HB 2OTLT 2LX7A 4M77F 4OMLA 2CP7A 2FZGB 2ESWA 3AHUA 4J7FA 5GAOq 3GNFB 2RI5A 1C1AA 3OBYA 2DTHA 2QQBA 3C12A 4X9DA 4R55A 2F5TX 1WLPB 5KH6A 3JCMh 2J05A 4C8QC 2YUQA 2WSCE 3MKDA 3RUXA 1KFZA 2M16A 2MF2A 4RG8A 2F69A 2G6FX 2HL3A 4AFUC 1FXXA 2PTKA 4JPBW 3OB9A 5GJVB 3OS1A 1BI2A 3NTIA 3EG3A 2RO0A 1E6GA 1ABQA 3JB9I 2EFIA 2DIQA 1RI9A 2DL3A 2O4XA 1M27C 2FVUA 2DBKA 4BE0A 1YIJT 1RADB 2QQSA 1WHLA 4RTWA 4E7LA 2X3XD 2MPXC 2B8AA 1KIKA 2A7YA 2EYYA 2DETA 1VQKT 1M1FA 2J6FA 2XDDA 3MEWA 2H3JA 2F2WA 1U3OA 5GAMj 1ZSZA 2DEUA 4FYWB 2ZGWA 3TEEA 4OB0B 3JCMP 2KXCA 1Y7XA 4GY5A 1M1KR 1VQOT 1PD1A 1BIAA 2LJ0A 3JCMd 5CKDA 3CCJT 3TREA 3SHWA 2LRQA 1QW1A 3MCAB 1WFWA 2ZZDA 3M0RA 4GBQA 2EAYA 2PUKB 2EJFA 1PG5B 3T9NA 3GNGA 1UUEA 3CC4Q 4XTXA 3FB9A 1RAFB 1K8AU 1I5LA 2FYKA 1YJ9Q 2NUTB 3SB2A 3OS5A 2DFUA 3RKXA 4NL3A 3CCRT 3EG1A 2EW3A 4N4IA 1M3AA 1EX4A 2F2XA 1AZEA 1WZOA 4J83A 1IZ6A 2QYZA 4C5IA 2RHXA 2EPDA 3CBPA 2RQUA 2KEAA 2FB7A 2E1HA 5LJ5h 4JJDA 2EKOA 1K9AA 4MMKA 2CH4A 1YHQA 4R0KA 2Y90A 3OYLA 3G6EQ 1NPPA 3RMSA 3CC2Q 1RAGB 2E65A 4EPCA 3FRNA 4PKCC 2YUNA 3QUIA 1VQ4T 4X9CA 4J9FA 1JBMA 4BI3A 3ZFJA 1WJSA 1NLPC 3M59A 2R57A 2FEIA 3CC7T 4C0FA 2KSSA 1D0YA 4A4GA 5DLQE 5A0LA 1OULA 2KAFA 3CC7A 1VQLT 1NPRA 1UGPB 3H9NA 2KGTA 1WGSA 3GF5A 2MI6A 3H0IA 1BCOA 4JJBA 3M0SA 4KH0B 5I2MA 1X6GA 4IUPA 1B3QA 2X4XA 2OTJQ 5LL6S 2RJCA 5HKCA 4HCCA 1YJNT 2EGCA 3QYGB 2QG9B 2BIVA 2VV5A 5KE3A 2M9UA 4DQ2A 5LJ5d 1M2OA 2XD0A 5DLOA 2LVMA 2CZ7B 4C8QA 3CD6T 1K0XA 4E47A 2E4HA 1NYFA 1KQ2A 1AZGB 2R5AA 2DJQA 1KC8R 2DD4A 1XJWB 3JB9J 1VIFA 4J8OA 1OX8A 4AFSC 2WSEE 3QSUA 1TTHB 4NOYA 5GANe 3L2VA 3DKMA 1AWJA 1PSEA 4F7UB 1OPLA 2CZ6B 3CCVQ 1NM7A 2A0FB 3HFNA 3QZ9B 3JB9G 2ZPHB 3H0HA 4M78D 5LJ3f 3I35A 1I0CA 3VYGA 3M0TA 3CCSA 1RAAB 3M53A 5I22A 5KYUA 1KD1C 5GAMg 3PT9A 4PFZA 2DIGA 4JZ3A 1R77A 1TXQA 5GAN2 2HQHA 3M0UA 2DRKA 2JTFA 1ZX6A 2K4YA 1Q82U 4FW1A 1CSKA 2I2LA 1SHFA 5KCHA 4MMLA 3LWIA 2JOYA 1SRMA 1O75A 1ZA2B 4C8QF 1AOJA 1ZHIA 2NUPA 1I4K1 5LJ3e 4E7SA 3LGLA 4OMFB 4XTVA 3OS2A 1IHVA 2P0PA 1UG1A 1RI0A 4M7DG 1XNIA 2MK5A 1MGQA 4AT1B 1ZBXA 3EAEA 3M58A 2JUFA 2OAWA 1WHKA 3PTAA 4QVDA 4PJNA 4LD6A 5KYWB 1PC0A 1KD1U 2M02A 3HFOA 3INZA 1OEBA 1MUZA 3CC4T 3I9QA 2DL7A 3VJPA 3OYDA 1VQ9Q 1U8RA 2D6FA 4Z89A 3M5AA 1Q86U 2GQVA 4JLIA 4ZN1A 5IHIA 3ZL7C 1NJIC 2FZCB 3QWYA 3QBYA 3OMGA 1M4ZA 5CCAA 2K2VA 3M55A 1W4SA 5CQXA 4JUVA 4E7HA 3RBBB 2NYSA 2DTIA 4PL6A 2VASA 4C92E 5CVIA 3FJ5A 2NUTA 1ZA1B 1MMDA 1RAHB 1PRMC 2BE7D 3G6ET 3QZ5B 1OU9A 1S72Q 2FPEA 1QMCA 5AYFA 3EFOB 3JB9D 1M90U 1PD0A 4EMHA 4J6XA 3CC2T 3LLRA 5GMKh 4L59A 2KY9A 1JEGA 2KI7A 5GAOp 4OMNA 5GAN3 3OYNA 5GANj 1VQPA 2CT4A 2A28A 2HEQA 2RJFA 3LGFA 1BYMA 3FEOA 3ULRB 4FSXA 4QVZA 1N8RC 3WXMB 1D0XA 2JMCA 4PJJA 2X4WA 2XU8A 3UA7A 1SEMA 3HHTB 2LP5A 3NTHA 4BDZA 3HRUA 4ZNXA 3E2UA 5GMKi 2DERA 3FC3A 2ZPGB 3QKJA 3BDLA 4HVVA 2OTJT 2OJ2A 3RKYA 3F70A 3ZEHA 4CRIA 2P4TA 1Q81C 2K7AA 4XTZA 1Q7YC 2R5MA 5IH2A 3JCMV 3FIFA 1K4US 4J9HA 4PJMA 4BDYA 3A98A 1TH7A 2IIMA 1IREB 4M78A 3X28B 3VS1A 3CCUQ 3OYJA 2D1XA 3QIIA 1WA7A 2EJ9A 4RTZA 2V8JA 2V1QA 1YI2Q 3QXEB 3JV3A 4C92B 2EYQA 5LJ3j 1N8RU 2F2VA 2D9TA 4B6MA 1QKXA 3QHSA 4J5YA 3X26B 3CCVT 2F5KA 3CCMQ 5CR2A 1VQ5Q 1D0ZA 2XG8D 4M75D 5GJWB 2FHDA 4RTUA 1X75C 1UECA 1NE8A 3X24B 2DPPB 2K5FA 1WHGA 3M57A 4KUDK 2V1RA 2DKGA 3CCEQ 1JXOA 2C0TA 4LDVA 3EHQA 3VYHB 2E12A 1XTDA 2VUBA 2ENMA 2KRSA 1UHFA 2Y4XA 4F7UA 2XHCA 2M1HA 2DO3A 1M8VA 4HXJA 2EJGA 2O2OA 3N5BB 3CMEQ 2PQWA 4CI0C 1C6VX 1SKUB 1E7OA 2GQIA 1BK2A 1GBQA 3QDFA 4A4FA 1WQ7A 3KUFA 4J9IA 2YUOA 2DM1A 3TCJA 2QTXA 3P8HA 3O8VA 1PCXA 2DXTA 1GRIA 2LC4A 2ZAEA 1UGQB 4C92C 4J6YA 3X25B 4M78F 1P92A 4AG2C 4RUGA 2FG0A 2K6DA 3PE0A 3G71A 2V8IA 1NYGA 2CREA 2VWFA 1B34B 4EDUA 5FRNA 1Q81R 1Z9ZA 5GAMh 1Q7YR 1HYOA 4PFPA 4X34A 2RK2A 3MEVA 5GMKm 1K9MC 5AT1B 1VQ9T 4CC4B 1YITQ 1UE9A 4HKEA 1NEGA 5D7UA 1TSFA 2VGNA 3ME9A 4HCZA 3G4SA 3PVQA 2CP0A 4CC2A 5GANg 5GMKl 4F7UF 1J3TA 2RQVA 1NEBA 4A4HA 1IHWA 1YJWA 2RQRA 2O01E 4XU2A 2J7IA 2DMOA 3JCMe 2E3HA 5KYUB 4RTYA 4E7KA 2M51A 4LDXA 1YNZA 1S72T 2OTLA 1B07A 4PLIA 5IN1A 2RM4A 1EZZB 3OA6A 1K73C 2G3RA 1G2BA 5D6YA 4C0GA
chains in the Genus database with same CATH topology
3CMAA 2OAUA 1VQNT 1JBMA 4BI3A 3CCVA 1Y71A 4JRPA 2XI9A 3ZFJA 4C5HA 1WJSA 5GAMd 3MP6A 2RH2A 1G3WA 4M75C 3M59A 3PIPA 2R57A 2DJZA 5I21A 3CC7T 4E7IA 4C0FA 1BKBA 4PJOG 2KSSA 4A4GA 3DLLA 4V2SA 5DLQE 5A0LA 5GANd 2KAFA 1K9MU 3CC7A 1VQLT 5CKFA 1NPRA 4M7AB 4BY6C 1UGPB 3E1SA 4M77C 5IT9E 3UWNA 3GF5A 1WGSA 4KT0E 2MI6A 2DZ9A 2CYZB 5J39A 4XTYA 4RMOA 2K3XA 2ZPBB 5I2MA 1K8AC 3JCMg 3H8ZA 1WQWA 4QW2A 4IUPA 2CKKA 4PJOA 1LNXA 1N27A 1SSFA 3S3MA 3RERA 2X4XA 4BE1A 4IUTA 4UC4A 5LL6S 3JB9H 2RJCA 5HKCA 1G3SA 5I2SA 5FU6C 4HCCA 3OY9A 4C8QG 5FU7C 1YJNT 2FL7A 1M1GA 4MZMA 3QYGB 3HRTA 3LW5E 2BIVA 2VV5A 4ME7A 2QQRA 5KE3A 2M9UA 4M75G 4DQ2A 5LJ5d 1YIJA 5LJ3g 2XD0A 2EQJA 2IG0A 3M54A 4BD3A 5DLOA 3OW2S 1WPYA 2LVMA 2CZ7B 1JJ2A 2PUOB 2LNVA 2P0KA 4C8QA 1OZ3A 4QQDA 5GAOn 1QVGS 4MDWA 4NS5A 3CD6T 1OZ2A 4E47A 5GMKj 1VQKA 1KQ2A 4M75A 5GAN4 2M0OA 2R5AA 5CQYA 5J3BA 1VQ6T 4LDYA 3CPFA 1LOJA 3A5ZB 1VQ6A 1K73U 2DD4A 2DXBA 4ELYC 2RHZA 4LDUA 2DVEA 3JB9J 1VIFA 4J8OA 1W2BS 4ZGDB 3CCUT 4IKFA 2QI2A 4M77A 2GF7A 2WSEE 3MP1A 3QSUA 2RB6A 4M7AE 4IURA 1OYXA 3E9GA 2CS7A 4NOYA 5GANe 3L2VA 3TU4K 1UGRB 3DKMA 4M78E 1VQOA 3L2UA 3JCMf 3CCJA 4FT2A 1PSEA 4JRKA 1QP3A 4Y28E 3OBWA 3I55A 1I8FA 4IUQA 1YI2T 2HAXA 4BB7A 4F7UB 2PVOB 1G5VA 4Z02A 2DEQA 2CZ6B 2K5IA 4HA8A 4FIBA 3PNWC 2O4XB 4KBMB 3GPLA 3GLXA 2JVVA 4XAXB 5DY9A 1VQPT 3HFNA 3QZ9B 4M7AD 3JB9G 2VXFA 1KQSA 2ZPHB 3CCMT 3CCLA 3ER0A 4M7AC 1H641 4J7IA 1VQ5T 4C5EA 3BDUA 4M78D 5LJ3f 3E9FA 4C92G 3CBOA 3BW1A 2NLUA 3META 1VQ5A 2CZ0B 2QDYB 2RJEA 3A8MB 4DOVA 3VYGA 4ZN3A 2E5QA 1KQ1A 2DXCA 3QDRB 4JRIA 3CCRA 3DB3A 3CCSA 3M53A 3NTKA 3VU3C 1KD1C 3JCMQ 4N4GA 5FROA 1XOVA 2HQEA 1VQ9A 3CCET 1VQ7T 5C0MA 2A3LA 5GAMg 2KQWA 4C92A 3PT9A 1NJIU 2DIGA 4JS4A 3A8GB 3WVEB 3DB4A 2EQMA 3OYFA 1BI1A 3M9QA 3HP9A 4OGEA 4PNOA 3E19A 2KVQG 4XK8E 1VQMA 3UDCA 5GAN2 4PJOF 4ZGJB 2WACA 3QG1A 2JTFA 3L2WA 3CPWS 5CIUA 2K4YA 4E7JA 1Q82U 2V8KA 3CMET 3HL8A 2I2LA 4F7UE 4PJOE 3JCMX 1AHJB 5IAYA 5KCHA 1NZ9A 1KG1A 2QQAA 1M9SA 3OYIA 4MZTA 3L2QA 4MMLA 3OYBA 4JS5A 2K57A 2PVGB 3LWIA 3JCMJ 4HCBA 2JOYA 3OYYA 1O75A 4JLGA 4C8QF 1ZQ1A 3MO8A 1S72A 3HRSA 2C06A 5LJ5g 3G7ZA 1ZHIA 4M75F 1I4K1 5LJ3e 4EMKB 2YLCA 4PJOD 1QVFA 3OYKA 3LGLA 4OMFB 1UEBA 2RHUA 4C8QE 3L2ZA 1X01A 4XTVA 2P0PA 4NL2A 1V29B 4DOWA 3OS2A 1RI0A 3LWHA 1VQ4A 3RKWA 1UB4A 1HXDA 1VQNA 4M7DG 4B9XA 4ATOA 1XNIA 4FM4B 1XQHA 2XICA 1MGQA 1LJOA 3CBMA 5GAMf 1ZBXA 1EIFA 2LX9A 2WSFE 3EAEA 2JUFA 3M58A 5CKEA 3QO3A 3PTAA 4QVDA 3JSCA 4LD6A 5GANf 2LCCA 1KHIA 3V8JA 3JAME 2KMTA 1VQLA 4M7DA 2L3RA 1KD1U 4C8QD 2KDSA 5KCOA 2DXUA 1X6OA 4M78B 4II1A 4OB1B 3HFOA 3INZA 3VUBA 3S6WA 1M1KU 3CC4T 1OI1A 4OF1A 2DZCA 3A8OB 3J80E 3OYEA 3C95A 3VJPA 1JRIA 5CKHA 3OYDA 1U8RA 2D6FA 1FX7A 3M5AA 3MHXA 1Q86U 2GQVA 4JLIA 1QVPA 4ZN1A 1YJNA 2YHTA 1Q81U 2MWPA 4JJNK 3ZBDA 1YITT 1Q7YU 5C6SA 2RHIA 1NJIC 5LJ5f 3MEAA 4WF2A 3JB9F 1KHCA 4O6JA 3QBYA 3SWNB 4XU1A 2RI3A 1YITA 4XTWA 2RA2A 3OMGA 1M4ZA 3M56A 2K5LA 2K2VA 4FT4A 5CCAA 1D3BA 1JB0E 1B34A 3M55A 2LT1A 3M4YA 4C92F 4M77G 1W4SA 3S3NA 3CD6A 2GFUA 2RD1A 4Q5WA 5DM7R 5CQXA 4JUVA 3M4GA 3MEUA 3OW2A 1Q82C 2E6NA 3S3OA 4E7HA 5FRMA 2BUDA 4PL6A 2DTIA 2MAMA 3V8LA 4R56A 4C92E 1QVGA 5GAMe 2MWOA 2LTOA 2X4JA 5CVIA 5EG2A 3V7SA 4BE2A 4C0DB 4L6V5 1O9SA 3SFMA 3R6OA 3G6ET 3QZ5B 4RKUE 3CCUA 2E64A 4EMKC 5AYFA 3PMTA 3QPHA 5CAIA 3CXCS 1RL2A 2EQUA 3L1AA 3JB9D 1M90U 2LQKA 3SD4A 4J6XA 4EMHA 1QP2A 3V8KA 3OS0A 1W2BA 3PFSA 4PJOB 3CC2T 3LLRA 5GMKh 4L59A 2KY9A 3PMIA 4C92D 1YI2A 5GAOp 2DAQA 5GAN3 3CEYA 3OYNA 2XIDA 1G3TA 5GAN5 2XKOC 5GANj 1VQPA 3QYHB 2AHJB 5GAN7 2LDMA 2YRVA 3P8DA 2RJFA 3CCQT 3LGFA 2VC8A 3CCMA 4HT8A 1BYMA 1H3ZA 4M78C 3L42A 3VUZA 2RI2A 2Y4YA 3FEOA 5HK0A 4FSXA 5LJ5e 3G71T 3I56T 4QVZA 1KC8C 2ZPEB 3QJ6A 4C8QB 2IVWA 1N8RC 3WXMB 3HSBA 3KBGA 4QQ6A 4BI4A 5HK3A 1FWZA 2BKDN 4OGCA 3J7AF 2LT4A 2X4WA 2E70A 2XU8A 4N0AC 1BI3A 3HHTB 2ZCFB 3NTHA 1DJ7B 4N4HA 3CCEA 2XK0A 4BDZA 1M1KC 3HRUA 1VQ7A 4HT9A 2RK1A 4M7DF 1GXIE 4A53A 4EMGA 4JDSA 4LDWA 5GMKi 3ASKA 4GLKA 2CGHA 2PU9B 2ZPGB 3FJPA 3QKJA 1Y96A 3BDLA 4KUIA 3FC3A 3SWNC 3OSSC 4L5GA 2LQ8A 1Q86C 2OTJT 2P0QA 3OQ5A 3F70A 3LYIA 3RKYA 2P4TA 4IUUA 3ZEHA 4CRIA 4ZTJA 2E41A 1Q81C 4M7AG 4XTZA 1HK9A 1Q7YC 2R5MA 2L8DA 4C5GA 3JCMV 2ZPFB 3G4ST 3FIFA 3DLMA 4M78G 3CMEA 1WNLA 2LCLA 3URGA 2XDBA 5KE2A 5FU6B 4BUGA 4BDYA 5L8RE 3CPWA 3NFCA 3OYGA 4M7AA 1TH7A 4C0DC 1M5Q1 5M9OA 5A2QE 3PIOA 2X35A 1IREB 4ZTFA 1YJWT 4M78A 4MDXA 3X28B 2DK3A 3C94A 4VUBA 1YHQT 4TVRA 2RHYA 2QQ9A 3OYCA 3OYJA 4KULA 4RCCA 4BI8B 4DA4A 4PJOC 4A54A 3QIIA 4N0AA 4M7DE 2EJ9A 4Y91A 3A8HB 2V8JA 2JN0A 4M75E 2OTLT 2L89A 2JNGA 4M77F 1M90C 1VQ8T 3QXEB 4C92B 4D6WA 3AHUA 3V7RA 4J7FA 5GAOq 2EYQA 3X20B 3UPUA 5LJ3j 3GNFB 1KC8U 4JRQA 4LD9K 2RI5A 1N8RU 2D9TA 2DTHA 3OBYA 2QQBA 3SWNA 3QHSA 3C12A 4M77E 4J5YA 4X9DA 3X26B 3CCVT 4R55A 2F5TX 1I81A 1WJQA 2F5KA 3GP8A 1VUBA 3JCMh 4C8QC 4ELZC 5KH6A 5CR2A 2QEXT 2XG8D 2WSCE 4M75D 3RUXA 2RJDA 1WJRA 2FHDA 2M16A 3VKIA 2QEXA 2MF2A 1X75C 3CC4A 1NE8A 4RG8A 3X24B 2DPPB 2K5FA 2JTMA 4BACA 1YJ9T 2F69A 3M57A 1FXXA 4F7UG 4KUDK 1YJ9A 3OYMA 4ZGEB 4IUVA 3OB9A 5A0GA 2DKGA 4M77D 1BI2A 2VGMA 3OS1A 3OYAA 2DTOA 4LDVA 4P5NA 1U1TA 1YCYA 2RO0A 3LX7A 3NTIA 4FU6A 5LJ3h 3VYHB 2E12A 3HKSA 1XTDA 4A4KA 2VUBA 2CZ1B 4QVCA 2Y4XA 1UGSB 4F7UA 3JB9I 1N6AA 2EFIA 2EIFA 3EFRA 2DIQA 2XHCA 4OB3B 1JJ2S 2O4XA 2M1HA 2DO3A 2L5QA 2FVUA 1M8VA 4PLLA 2EJGA 3N5BB 3OYHA 5GMKe 3LH0A 4XU0A 2PQWA 4XU3A 4CI0C 4BE0A 1YIJT 3FLGA 2QQSA 5A0DA 4E7LA 2HNIA 4A4FA 4RCBA 3RMQA 4YTLA 1WQ7A 3KUFA 2B8AA 2E6ZA 2A7YA 3JRZA 3MP8A 1R8OB 4M7DB 3GIBA 2EWNA 2E10A 1M1FA 3RIRA 2QTXA 3TCJA 3G6EA 1VQKT 1U1SA 3SDZA 3J81E 3QJYA 2XDDA 3MEWA 5GAOm 2H3JA 5D6XA 3P8HA 3O8VA 5GAMj 4M7AF 2DXTA 2LC4A 1BI0A 3HPWA 3CC2A 3OSVA 1UGQB 4C92C 2ZGWA 4J6YA 3X25B 4M78F 1P92A 2HBPA 4OB0B 3TEEA 3CXCA 3JCMP 4XQ3A 2HD0A 3PGGA 3JCMb 2EQKA 4QQGA 1Y7XA 4XTUA 4GY5A 3H6ZA 1VQOT 1BIAA 5CKBA 2X4YA 3JCMd 2QA4T 5CKDA 3RESA 3CCJT 3I55T 3FDRA 5GAOl 3TREA 3CCQA 2QA4A 1KQSS 3G71A 2LRQA 2V8IA 1QW1A 3MCAB 1D3BB 1B34B 2ZZDA 4EDUA 3I56A 5FRNA 4RG2A 2GFAA 2JZ2A 2EAYA 2PUKB 2EJFA 4M75B 1N9RA 2D0QB 3T9NA 3WVDB 3P8BB 5GAMh 3GNGA 3CCLT 4XTXA 2PVDB 2DD5A 3FB9A 5LJ3d 1K8AU 1I5LA 5LJ5j 2FYKA 4X34A 5D6WA 3SB2A 1MHNA 4BY6B 3OS5A 4OVAA 4M77B 5GANh 4EMKA 3RKXA 4NL3A 3CCRT 1N9SA 3CCST 4C0ZA 2RK2A 3MEVA 5GMKm 4N4IA 1K9MC 3C4SA 5HY6A 1PSFA 3A8LB 3OMCA 2OTJA 2ZPIB 1VQ9T 4J83A 3EFSA 4HKEA 1IZ6A 2YLBA 2VGNA 3ME9A 4HCZA 2HQXA 2VYTA 1G3YA 4C5IA 3JCMW 3G4SA 5FLXE 5FU7B 4A4EA 2RHXA 5GAN6 3CBPA 1VQMT 2XDPA 1Y07A 3BFMA 5GAOr 5GANg 4B9WA 2FB7A 5GMKl 2E1HA 4F7UF 2GCXA 4OB2B 4M7DD 5LJ5h 4MZPA 4O5VA 3VV0A 2VXEA 5CO7A 4M7DC 4A4HA 4OP0A 2KK4A 2EKOA 1YJWA 3BY7A 3L2RA 3V7CA 3JCMc 5GAN8 2O01E 4MMKA 2MMPA 4XU2A 1YHQA 3JCMe 2Y90A 3OYLA 3UT1A 1NPPA 4FL6A 4E7KA 3RMSA 3GOXA 1YBYA 1QVFS 4LDXA 1VIEA 1S72T 2OTLA 4PLIA 5IN1A 2QXFA 1VQ8A 5CK9A 2E65A 3Q1JA 2RM4A 3OA6A 1BIBA 4J6WA 4EPCA 2R58A 3FRNA 2G3RA 4PKCC 3KXTA 1K73C 2K3YA 3CMAT 1Y96B 3QUIA 5D6YA 1VQ4T 5J26A 4X9CA 4C0GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAN 5;  1JBM A;  5GAN j;  1M8V A;  2EJG A;  5GMK e;  5GAN 7;  4XU0 A;  5GAM d;  4XU3 A;  4M75 C;  2VC8 A;  4HT8 A;  4M78 C;  2DJZ A;  5I21 A;  2HNI A;  2I2L A;  4F7U E;  5LJ5 e;  4PJO E;  4RCB A;  4PJO G;  3JCM X;  4V2S A;  1WQ7 A;  4C8Q B;  5GAN d;  3HSB A;  4M7D B;  4MML A;  3GIB A;  2EWN A;  2E10 A;  4M7A B;  2K57 A;  2QTX A;  3RIR A;  4M77 C;  3JCM J;  4N0A C;  1U1S A;  5GAO m;  2DZ9 A;  4C8Q F;  4XTY A;  5GAM j;  3JCM g;  4HT9 A;  1WQW A;  5LJ5 g;  4M7D F;  4M7A F;  4PJO A;  2DXT A;  1LNX A;  3RER A;  4A53 A;  4M75 F;  4EMG A;  1I4K 1;  5LJ3 e;  5GMK i;  4EMK B;  2YLC A;  2CGH A;  4C92 C;  4PJO D;  2ZGW A;  4J6Y A;  3FJP A;  4M78 F;  3JB9 H;  1Y96 A;  3SWN C;  3L2Z A;  1X01 A;  4XQ3 A;  4XTV A;  3PGG A;  4NL2 A;  4C8Q E;  4C8Q G;  3JCM b;  3JCM P;  3RKW A;  4XTU A;  3RKY A;  1HXD A;  4M7D E;  4M7D G;  1BIA A;  2E41 A;  4M7A G;  4XTZ A;  1HK9 A;  3JCM d;  1MGQ A;  1LJO A;  4M75 G;  3RES A;  4DQ2 A;  5GAM f;  5LJ5 d;  5GAO l;  3JCM V;  3FIF A;  4M78 G;  5LJ3 g;  1WNL A;  1WPY A;  3QO3 A;  1D3B B;  1B34 B;  4QVD A;  4C8Q A;  5GAN f;  5GAO n;  3V8J A;  2EAY A;  2EJF A;  4M75 B;  4M7D A;  1N9R A;  5GMK j;  4M7A A;  1TH7 A;  4C8Q D;  1M5Q 1;  5GAM h;  2DXU A;  1KQ2 A;  4M78 B;  4M75 A;  5GAN 4;  3HFO A;  3INZ A;  4XTX A;  4M78 A;  3FB9 A;  5LJ3 d;  1I5L A;  1LOJ A;  5LJ5 j;  2FYK A;  2DZC A;  5GAN h;  3SB2 A;  2DVE A;  4M77 B;  3JB9 J;  4EMK A;  1JRI A;  4RCC A;  3RKX A;  4NL3 A;  1N9S A;  4PJO C;  4A54 A;  4M77 A;  5GMK m;  4N0A A;  4M7A E;  3QSU A;  2EJ9 A;  2RB6 A;  4Y91 A;  4JLI A;  2JN0 A;  4M75 E;  2YHT A;  3EFS A;  4M77 F;  4NOY A;  5GAN e;  2YLB A;  4M78 E;  3JCM f;  4C92 B;  3AHU A;  5LJ5 f;  3V7R A;  5GAO q;  4JRK A;  4WF2 A;  3JB9 F;  5LJ3 j;  1I8F A;  3SWN B;  4XU1 A;  3JCM W;  4F7U B;  4XTW A;  2RA2 A;  2DTH A;  2DEQ A;  3SWN A;  5GAN 6;  1D3B A;  1B34 A;  4HA8 A;  3QHS A;  4M77 E;  4C92 F;  4J5Y A;  4M77 G;  4X9D A;  5DY9 A;  3BFM A;  1I81 A;  3HFN A;  5GAN g;  5GAO r;  2FB7 A;  5GMK l;  2E1H A;  2RD1 A;  3JCM h;  4C8Q C;  4F7U F;  5LJ5 h;  4JUV A;  2VXF A;  3JB9 G;  4M7A D;  3M4G A;  2VXE A;  4M75 D;  4M7D D;  4M7D C;  3RUX A;  4M7A C;  4OP0 A;  1H64 1;  3V8L A;  2DTI A;  3BDU A;  3BY7 A;  4M78 D;  5LJ3 f;  3V7C A;  4C92 E;  5GAM e;  3V7S A;  4C92 G;  3JCM c;  5GAN 8;  3BW1 A;  4MMK A;  4XU2 A;  3JCM e;  2Y90 A;  4F7U G;  1KQ1 A;  4JRI A;  3VU3 C;  2DKG A;  2E64 A;  4M77 D;  4EMK C;  2DTO A;  3JCM Q;  1U1T A;  1YCY A;  5LJ3 h;  5CAI A;  3JB9 D;  3L1A A;  4EMH A;  4J6X A;  5GAM g;  4C92 A;  3V8K A;  4QVC A;  4PJO B;  2E65 A;  2RM4 A;  1BIB A;  4J6W A;  5GMK h;  4F7U A;  4C92 D;  3JB9 I;  3EFR A;  1Y96 B;  3QUI A;  4PNO A;  5GAO p;  5GAN 3;  5GAN 2;  4X9C A;  4PJO F; 
#chains in the Genus database with same CATH topology
 1X2Q A;  1LVK A;  3CCQ Q;  4C5H A;  4DEY A;  5GAM d;  3MP6 A;  1WXB A;  2RH2 A;  2DE0 X;  3I56 Q;  3QWX X;  4PJO G;  3DLL A;  4KGZ B;  1K9M U;  5CKF A;  4M7A B;  1GBR A;  1WXU A;  3EFO A;  2YDL A;  2DZ9 A;  2CYZ B;  2CP6 A;  4XTY A;  2K3X A;  1K8A C;  2NUP B;  4RTX A;  1LNX A;  2DNU A;  3UF4 A;  2J06 A;  1JQQ A;  4E7Z A;  2FL7 A;  2RPN A;  2DLP A;  1YIJ A;  5LJ3 g;  2IG0 A;  3OW2 S;  1WPY A;  2GNC A;  2PUO B;  2J6O A;  2LNV A;  2HMA A;  4NS5 A;  1OZ2 A;  1PKS A;  1SF9 A;  3I5S A;  1VQK A;  4M75 A;  5GAN 4;  2M0O A;  5J3B A;  4E6R A;  1NBE B;  2O9V A;  3A5Z B;  2DL5 A;  1K73 U;  2DXB A;  2P84 A;  4DEX A;  1SSH A;  4ZGD B;  3CCU T;  2QI2 A;  3MP1 A;  2RB6 A;  1VQ8 Q;  3E9G A;  1CKA A;  2DVJ A;  1VQO A;  1UGR B;  4M78 E;  4HVW A;  3CCJ A;  4FT2 A;  4Y28 E;  3OBW A;  1I8F A;  1YI2 T;  2PVO B;  1G5V A;  4Z02 A;  4HA8 A;  4PFO A;  4FIB A;  3PNW C;  2QEX Q;  3GLX A;  2VB6 A;  4M7A D;  2VXF A;  2KBT A;  1K76 A;  4OMO A;  3CCM T;  1OX9 A;  3ER0 A;  4M7A C;  1VYU A;  1VQ5 T;  1ZLM A;  4C5E A;  3BDU A;  1ABO A;  3BW1 A;  1VQ5 A;  3OW2 P;  3A8M B;  4DOV A;  3EGU A;  1UJY A;  2E5Q A;  4JRI A;  3CCR A;  2AZV A;  5FRO A;  2MOX A;  2HQE A;  3CCE T;  4C92 A;  4JS4 A;  2DRM A;  1BI1 A;  4OGE A;  3UDC A;  2LQN A;  1BU1 A;  1VYT A;  2WAC A;  3QG1 A;  3L2W A;  1PM3 A;  1T0J A;  2ROT A;  3CME T;  2FZK B;  3HL8 A;  4F7U E;  3JCM X;  2GBQ A;  2GTJ A;  1KG1 A;  2L2P A;  3OYB A;  2K57 A;  1ZQ1 A;  3MO8 A;  4DBR A;  3HRS A;  2C06 A;  3G7Z A;  3RR6 A;  4M75 F;  1QLY A;  4PJO D;  2HZY A;  2DBM A;  1UEB A;  4DOW A;  1VQ4 A;  3LWH A;  2ED0 A;  3I55 Q;  4B9X A;  1K8A R;  4FM4 B;  1D1B A;  1KSW A;  8AT1 B;  2LX9 A;  1YN8 A;  2AIR B;  3JSC A;  5GAN f;  2KMT A;  5KYN A;  1VQL A;  1D1C A;  3CCL Q;  2DXU A;  4M78 B;  4OB1 B;  3HTR A;  4LUE A;  3S6W A;  5FWB A;  4QT7 A;  2DZC A;  3A8O B;  3J80 E;  5CKH A;  2A36 A;  2HL5 C;  1YJN A;  1R0B G;  2KRM A;  3ZBD A;  1YIT T;  5C6S A;  2RHI A;  4O6J A;  1VQM Q;  4XU1 A;  2RI3 A;  1YIT A;  2QDL A;  4FT4 A;  1B34 A;  1JB0 E;  3M4Y A;  4C92 F;  4M77 G;  1IO6 A;  3CD6 A;  1ZUY A;  5DM7 R;  3OW2 A;  1Q82 C;  3S3O A;  1Q95 G;  2MAM A;  4BE2 A;  1YFN A;  2X4J A;  4L6V 5;  3AT1 B;  3SFM A;  1UDL A;  3CXC S;  3L1A A;  4HVU A;  2QTV A;  3TSW A;  1OOT A;  2RQW A;  1ZUK A;  4WTO B;  3CMA Q;  4PJL A;  4A63 B;  2QAS A;  1VQN Q;  2DAQ A;  3LH5 A;  1OQK A;  3EGX B;  2XKO C;  5GAN 7;  2AK5 A;  2YRV A;  4FYX B;  3CCQ T;  2VC8 A;  2LQW A;  4M78 C;  3L42 A;  5HK0 A;  3I56 T;  2JJ9 A;  2VVK A;  6AT1 B;  3KBG A;  4QQ6 A;  1ZBJ A;  1FWZ A;  1I5O B;  4GLM A;  4OGC A;  5IXB A;  3J7A F;  2E70 A;  4ORZ A;  1BI3 A;  1DJ7 B;  1Z9Q A;  2D0N A;  4HT9 A;  1NG2 A;  1R0C B;  4LDW A;  4KUI A;  3OSS C;  1Q86 C;  2OX7 A;  2CDT A;  4M7D E;  3LYI A;  4IUU A;  4ZTJ A;  2LJ3 A;  4AFQ C;  3CXC P;  1IB8 A;  1JO8 A;  4KRT A;  2ZPF B;  3DLM A;  2LCL A;  5KE2 A;  5FU6 B;  5L8R E;  1RAI B;  3OYG A;  4M7A A;  2DYB A;  2O9S A;  2BZ8 A;  4MDX A;  3EG2 A;  3OYC A;  1SG5 A;  4J9E A;  4ANJ A;  4LN2 A;  2JN0 A;  2YSQ A;  4M75 E;  1G83 A;  4OMP A;  1M90 C;  1VQ8 T;  3V7R A;  3UPU A;  4LE9 A;  3X20 B;  3VS2 A;  4JRQ A;  4LD9 K;  1E6H A;  2JS2 A;  3SWN A;  1HSQ A;  1WJQ A;  2QEX T;  3H0F A;  1TUC A;  2RJD A;  3VKI A;  2KYM A;  2QEX A;  2X9H A;  4D8D A;  3CC4 A;  1YJ9 T;  4BAC A;  2KRN A;  1YJ9 A;  4ZGE B;  2RN8 A;  4M77 D;  4F14 A;  2VGM A;  1VQ7 Q;  1Q82 R;  1U1T A;  1QCN A;  5LJ3 h;  1AWO A;  3HKS A;  4A4K A;  2I0N A;  2CZ1 B;  1TOV A;  3EFR A;  2EIF A;  4OB3 B;  2EBP A;  4HCK A;  1M8M A;  3OYH A;  5GMK e;  4XU3 A;  2X3W D;  4AMC A;  4CC3 A;  5A0D A;  1T3S A;  2BZX A;  4FSS A;  1YCS B;  3RMQ A;  4YTL A;  4LUD A;  2E6Z A;  1T0H A;  4M7D B;  3GIB A;  2EWN A;  2AKK A;  3RIR A;  3G6E A;  4F04 B;  1U1S A;  3SDZ A;  3J81 E;  5D6X A;  2JT4 A;  4M7A F;  2FO0 A;  3CC2 A;  2VKN A;  1MV0 B;  1Y57 A;  2CH4 W;  1MV3 A;  1KD1 R;  2HBP A;  3CXC A;  2HD0 A;  3VS0 A;  3H6Z A;  2JM9 A;  3RES A;  3I55 T;  1KQS S;  2V26 A;  2RQT A;  1JXM A;  2LZ6 B;  3VRY A;  1D3B B;  1WHM A;  2CUB A;  2JZ2 A;  4M75 B;  1N9R A;  2J6K A;  3CCL T;  1GCQ C;  2PVD B;  2DD5 A;  5LJ3 d;  1UTI A;  5D6W A;  1N9S A;  3THK A;  1PSF A;  3A8L B;  3OMC A;  1UJ0 A;  2OTJ A;  5KYY B;  3EFS A;  2YLB A;  4WCI A;  2PZ1 A;  5IHK A;  3RDV A;  2K79 A;  4OMM A;  2HQX A;  2LCS A;  3JCM W;  2L0A A;  4CC7 A;  5FLX E;  2CP3 A;  5GAN 6;  1VQM T;  1I1J A;  1PRL C;  2E5K A;  4PK4 A;  3NPF A;  1Y07 A;  3BFM A;  1M90 R;  4B9W A;  4M7D D;  2GCX A;  3VV0 A;  2VXE A;  5CO7 A;  3VS7 A;  4M7D C;  3EH2 A;  4OP0 A;  2KK4 A;  2ATC B;  3L2R A;  1ACM B;  3V7C A;  1KK7 A;  1KQS P;  3GOX A;  1YBY A;  1QVF S;  2KXD A;  3Q1J A;  1BIB A;  2FRY A;  2YT6 A;  4J9B A;  2K3Y A;  3CMA T;  5J26 A;  2H8H A;  3CMA A;  2OAU A;  1VQN T;  1NJI R;  3CCV A;  4JRP A;  1G3W A;  4M75 C;  2ROL A;  3PIP A;  2DJZ A;  2AKL A;  1H3H A;  3E1S A;  5IT9 E;  2MIO A;  4KT0 E;  4RMO A;  2KYB A;  4DBQ A;  1BBZ A;  2ZPB B;  3H8Z A;  1WQW A;  2CKK A;  1N27 A;  3TSZ A;  4FYY B;  4BE1 A;  4IUT A;  5IXF A;  4DBF A;  3OY9 A;  4C8Q G;  3EGX A;  1M1G A;  3HRT A;  3LW5 E;  1QVF P;  4ME7 A;  2HDA A;  2YRC A;  4F16 A;  3M54 A;  3GBQ A;  2KR3 A;  2P0K A;  1QVG S;  2EQI A;  5GAO n;  2KRO A;  1UHC A;  2FPF A;  5GMK j;  1WDX A;  4FCY A;  5CQY A;  2DIL A;  1YHQ Q;  3CPF A;  1N8R R;  4KH1 B;  2RHZ A;  2DVE A;  4E2F B;  4F17 A;  1MMG A;  4IKF A;  4M77 A;  4M7A E;  3EG9 B;  4IUR A;  1OYX A;  1TS9 A;  2CS7 A;  3VS4 A;  3TU4 K;  3L2U A;  3JCM f;  4Z8A A;  2KT8 A;  1LPL A;  2L3S A;  4BB7 A;  1D1A A;  1X69 A;  2DEQ A;  2K5I A;  1X6B A;  4KBM B;  3GPL A;  2JVV A;  5DY9 A;  4D8K A;  2EYX A;  1VA7 A;  1KQS A;  2A37 A;  3E9F A;  3CBO A;  2LMJ A;  3MET A;  2NLU A;  2RJE A;  2QDY B;  1NLO C;  1KQ1 A;  2DXC A;  1QVG P;  3NTK A;  3VU3 C;  1WYX A;  1K0S A;  2GTO A;  3JCM Q;  4N4G A;  1VQ9 A;  1C0M A;  1ZUU A;  1VQ7 T;  5C0M A;  2A3L A;  1QCF A;  2COZ A;  2P4R A;  3DB4 A;  4J9G A;  2AZS A;  4PNO A;  3E19 A;  2KVQ G;  4ZGJ B;  2XMF A;  3NMZ C;  3CPW S;  5CIU A;  3UA6 A;  4PJO E;  1PHT A;  5IAY A;  2NWM A;  1NZ9 A;  1U06 A;  4MZT A;  3L2Q A;  1GCQ A;  2PVG B;  4HCB A;  1SRL A;  2SEM A;  4JLG A;  1S72 A;  2K9G A;  4EMK B;  2YLC A;  1QVF A;  3OYK A;  4NL2 A;  2QA4 Q;  1UB4 A;  1HXD A;  2K3B A;  4M4Z A;  2ABL A;  1XQH A;  2XIC A;  2EVR A;  1LJO A;  3CBM A;  1EIF A;  2WSF E;  5CKE A;  3VS5 A;  1IXD A;  3QO3 A;  1WHH A;  2GGR A;  2LCC A;  1KHI A;  2ED1 A;  3V8J A;  3JAM E;  4M7D A;  2NUZ A;  4C8Q D;  5L23 A;  5KCO A;  1GFC A;  4II1 A;  2X51 A;  2CT3 A;  3VUB A;  3CPW P;  1M1K U;  1OI1 A;  3CCS Q;  1YP5 A;  2HBW A;  1FX7 A;  1PWT A;  1QVP A;  2JTE A;  2MWP A;  1X2K A;  2W10 A;  1FMW A;  1WX6 A;  3MEA A;  5LJ5 f;  4WF2 A;  3JB9 F;  1KHC A;  3SWN B;  4XTW A;  2RA2 A;  3M56 A;  1D3B A;  5I11 A;  2LT1 A;  1YWP A;  4JJC A;  1V1C A;  3MEU A;  1MNE A;  4DBH A;  4ESR A;  2BUD A;  3V8L A;  2HKN A;  1QVG A;  3V7S A;  2LTO A;  5EG2 A;  4C0D B;  2O31 A;  1CKB A;  4RKU E;  2KE9 A;  3CCU A;  3SEM A;  4EMK C;  3PMT A;  2CSQ A;  5KYY A;  3QPH A;  2LQK A;  3SD4 A;  1QP2 A;  3OS0 A;  3PFS A;  4PJO B;  1PNJ A;  2D8H A;  1K9M R;  3PMI A;  1YI2 A;  1SPK A;  3CEY A;  1G3T A;  2OI3 A;  5GAN 5;  3QYH B;  1I07 A;  2LDM A;  1SHG A;  3P8D A;  3CCM A;  4HT8 A;  2Y4Y A;  5LJ5 e;  1TWB A;  3M0P A;  1KC8 C;  3HSB A;  4FYV B;  4BI4 A;  5HK3 A;  2DL8 A;  2ZCF B;  4N4H A;  3CCE A;  2EGE A;  1GXI E;  4M7D F;  2CP2 A;  1HJD A;  1PKT A;  4A53 A;  4EMG A;  3ASK A;  4GLK A;  2CGH A;  1ZSG A;  4JZ4 A;  4RTV A;  3SWN C;  4L5G A;  3OQ5 A;  2E41 A;  1OV3 A;  2L8D A;  4K11 A;  1K73 R;  4M78 G;  3CME A;  1WNL A;  3CPW A;  3NFC A;  1VQ6 Q;  4C0D C;  1H8K A;  2BZY A;  3PIO A;  2X35 A;  1WHJ A;  4VUB A;  1YHQ T;  2RHY A;  2QQ9 A;  1IGQ A;  2F1L A;  4KUL A;  4RCC A;  3H41 A;  4PJO C;  4N0A A;  1AT1 B;  2M0Y A;  1IRX A;  2L89 A;  2JNG A;  4D6W A;  1KC8 U;  2JW4 A;  4Z88 A;  3D7S B;  1VYV A;  1VQP Q;  1T3L A;  1W70 A;  3BE3 A;  4M77 E;  2Z0W A;  3EH1 A;  1I81 A;  3GP8 A;  1BB9 A;  1VUB A;  4ELZ C;  1FMV A;  1AEY A;  1WJR A;  2JTM A;  2HCK A;  9ATC B;  4F7U G;  4FW2 A;  2JXB A;  3OYM A;  1D09 B;  4IUV A;  5A0G A;  3OYA A;  3EG9 A;  1ARK A;  2DTO A;  4P5N A;  3LX7 A;  1YCY A;  4FU6 A;  3G1J A;  4QVC A;  1AVZ C;  1UGS B;  1N6A A;  1JJ2 S;  2L5Q A;  4PLL A;  2B86 A;  3LH0 A;  4XU0 A;  4AG1 C;  1M2V B;  3FLG A;  2DL4 A;  2HNI A;  4RCB A;  2W0Z A;  4KGV B;  2MYS A;  3JRZ A;  3MP8 A;  1R8O B;  3VS6 A;  2E10 A;  2SRC A;  1M3B A;  3QJY A;  1M3C A;  5GAO m;  2HSP A;  1BI0 A;  3HPW A;  3OSV A;  5KYX A;  1IGU A;  2JS0 A;  3VS3 A;  4LXC A;  1TU0 B;  4XQ3 A;  3REA B;  3PGG A;  3JCM b;  2YXY A;  2EQK A;  4QQG A;  4XTU A;  5CKB A;  2ECZ A;  2A08 A;  2X4Y A;  2QA4 T;  3FDR A;  2YWW A;  5GAO l;  3CCQ A;  2QA4 A;  1V76 A;  2EGA A;  4OMQ A;  3I56 A;  4RG2 A;  2GFA A;  2MCN A;  2D0Q B;  3WVD B;  3UAT A;  1JJ2 P;  3P8B B;  5LJ5 j;  2CSI A;  5GAN h;  1MHN A;  4BY6 B;  4OVA A;  5HCK A;  4M77 B;  4EMK A;  2O88 A;  3CCS T;  2CP5 A;  4C0Z A;  2COY A;  3C4S A;  5HY6 A;  1GFD A;  1QCO A;  2ZPI B;  3EGD B;  2CUD A;  2L3Q A;  3NGP A;  2VYT A;  1G3Y A;  5FU7 B;  4A4E A;  2XDP A;  2H3E B;  1TUD A;  5GAO r;  4OB2 B;  1UGV A;  4MZP A;  4O5V A;  3KFV A;  3BY7 A;  2RMO A;  1GCP A;  3JCM c;  5GAN 8;  2MMP A;  3UT1 A;  2EYW A;  1QWF A;  4FL6 A;  4J9C A;  1LCK A;  1VIE A;  1AWX A;  2BE9 B;  2QXF A;  4QKU A;  1VQ8 A;  3M0Q A;  4IIO A;  5CK9 A;  1RAC B;  1G8X A;  4J6W A;  1RLQ C;  2R58 A;  3KXT A;  1Y96 B;  3TVT A;  1KJW A;  1Y71 A;  2XI9 A;  1MMA A;  3G71 Q;  5I21 A;  4E7I A;  1BKB A;  4V2S A;  2BTT A;  5ECA A;  5GAN d;  1A0N B;  2C0I A;  4BY6 C;  4M77 C;  3UWN A;  1TUG B;  5J39 A;  3JCM g;  1K1Z A;  4QW2 A;  4PJO A;  1OPK A;  1SSF A;  3S3M A;  3RER A;  4UC4 A;  3JB9 H;  1N5Z A;  1G3S A;  5I2S A;  5FU6 C;  5FU7 C;  3MPU B;  4MZM A;  3G4S Q;  2QQR A;  4M75 G;  1WIE A;  2EQJ A;  1JJ2 A;  1GL5 A;  4BD3 A;  1B7T A;  1OZ3 A;  4QQD A;  1X43 A;  4MDW A;  1YJW Q;  4LNP A;  2YRD A;  1VQ6 T;  4LDY A;  1WI7 A;  1LOJ A;  1VQ6 A;  3REB B;  4ELY C;  1X27 A;  4LDU A;  1W2B S;  1VOM A;  2FPD A;  3IQL A;  2OTL Q;  2GF7 A;  1WXT A;  1Y0M A;  2L3P A;  7AT1 B;  1OU8 A;  3I55 A;  4JRK A;  1QP3 A;  4IUQ A;  2HAX A;  1Q86 R;  2QGF B;  4J9D A;  2O4X B;  2QK0 A;  1VQP T;  4XAX B;  1MMN A;  1AD5 A;  3CCL A;  1H64 1;  4J7I A;  1QWE A;  3I5R A;  4C92 G;  2RF0 A;  2CZ0 B;  4ZN3 A;  2FRW A;  1W6X A;  3QDR B;  3DB3 A;  1XOV A;  2KQW A;  1NJI U;  3A8G B;  3WVE B;  1ZSZ B;  2EQM A;  3OYF A;  3A1P A;  3M9Q A;  3HP9 A;  4XK8 E;  1VQM A;  1W2B P;  4PJO F;  1YIJ Q;  2JM8 A;  4E7J A;  3NHN A;  2V8K A;  1U5S A;  1EFN A;  1AHJ B;  1RAE B;  3O5Z A;  2KT1 A;  1VQK Q;  2QQA A;  1M9S A;  3OYI A;  2DF6 A;  4JS5 A;  3JCM J;  3OYY A;  1FMK A;  1UFF A;  2QGG A;  2DA9 A;  5LJ5 g;  3CQT A;  3VRZ A;  1JU5 C;  4EIK A;  2RNA A;  2RHU A;  1TG0 A;  4C8Q E;  3L2Z A;  1X01 A;  1VQO Q;  1V29 B;  3RKW A;  2IPO B;  3CCJ Q;  1VQN A;  4ATO A;  1YWO A;  5GAM f;  1M2V A;  2DYI A;  2EYZ A;  1MND A;  1M30 A;  1RAB B;  2L3R A;  2KDS A;  2PNI A;  1X6O A;  2K2M A;  1F1B B;  4OF1 A;  3CCR Q;  3OYE A;  3C95 A;  1JRI A;  4KGX B;  2YUP A;  1ZSZ C;  3MHX A;  1W1F A;  5FWC A;  2YHT A;  1Q81 U;  4JJN K;  2LNH B;  2QAZ A;  1Q7Y U;  2K5L A;  5FW9 A;  3U23 A;  3S3N A;  2GFU A;  2RD1 A;  4Q5W A;  2KNB B;  2D8J A;  4X1V A;  3M4G A;  3RNJ A;  2E6N A;  1H92 A;  5FRM A;  4R56 A;  5GAM e;  2MWO A;  4AFZ C;  1HD3 A;  1O9S A;  4IIM A;  3R6O A;  3MJX A;  2E64 A;  8ATC B;  2HKQ B;  2LJ1 A;  4Y92 A;  5CAI A;  1RL2 A;  2EQU A;  3EGD A;  1RUW A;  3V8K A;  1W2B A;  1VQ4 Q;  4C92 D;  1QKW A;  2XID A;  1S1N A;  2E3I A;  2AHJ B;  4RTT A;  2DX1 A;  3CC7 Q;  1H3Z A;  3VUZ A;  3G71 T;  2RI2 A;  3PVL A;  1VQL Q;  2ZPE B;  3QJ6 A;  3TQ7 P;  4C8Q B;  2IVW A;  2BKD N;  4N0A C;  2LT4 A;  2HSE B;  2COW A;  3C0C A;  1M1K C;  2XK0 A;  1QQJ A;  1VQ7 A;  2RK1 A;  5KYX B;  1AWW A;  4JDS A;  2C0O A;  5IHN A;  5EC7 A;  2JMA A;  2PU9 B;  3FJP A;  1YJN Q;  1Y96 A;  1RLP C;  2LQ8 A;  2P0Q A;  4M7A G;  1HK9 A;  1BCM A;  2AT1 B;  4C5G A;  2EKH A;  3G4S T;  3URG A;  2XDB A;  3CD6 Q;  4BUG A;  3EHR A;  1FYN A;  5KYW A;  1M5Q 1;  3EG0 A;  5M9O A;  5A2Q E;  4ZTF A;  1YJW T;  2DK3 A;  3C94 A;  3R6N A;  4TVR A;  4BI8 B;  4DA4 A;  4A54 A;  4Y91 A;  3A8H B;  2OTL T;  2LX7 A;  4M77 F;  4OML A;  2CP7 A;  2FZG B;  2ESW A;  3AHU A;  4J7F A;  5GAO q;  3GNF B;  2RI5 A;  1C1A A;  3OBY A;  2DTH A;  2QQB A;  3C12 A;  4X9D A;  4R55 A;  2F5T X;  1WLP B;  5KH6 A;  3JCM h;  2J05 A;  4C8Q C;  2YUQ A;  2WSC E;  3MKD A;  3RUX A;  1KFZ A;  2M16 A;  2MF2 A;  4RG8 A;  2F69 A;  2G6F X;  2HL3 A;  4AFU C;  1FXX A;  2PTK A;  4JPB W;  3OB9 A;  5GJV B;  3OS1 A;  1BI2 A;  3NTI A;  3EG3 A;  2RO0 A;  1E6G A;  1ABQ A;  3JB9 I;  2EFI A;  2DIQ A;  1RI9 A;  2DL3 A;  2O4X A;  1M27 C;  2FVU A;  2DBK A;  4BE0 A;  1YIJ T;  1RAD B;  2QQS A;  1WHL A;  4RTW A;  4E7L A;  2X3X D;  2MPX C;  2B8A A;  1KIK A;  2A7Y A;  2EYY A;  2DET A;  1VQK T;  1M1F A;  2J6F A;  2XDD A;  3MEW A;  2H3J A;  2F2W A;  1U3O A;  5GAM j;  1ZSZ A;  2DEU A;  4FYW B;  2ZGW A;  3TEE A;  4OB0 B;  3JCM P;  2KXC A;  1Y7X A;  4GY5 A;  1M1K R;  1VQO T;  1PD1 A;  1BIA A;  2LJ0 A;  3JCM d;  5CKD A;  3CCJ T;  3TRE A;  3SHW A;  2LRQ A;  1QW1 A;  3MCA B;  1WFW A;  2ZZD A;  3M0R A;  4GBQ A;  2EAY A;  2PUK B;  2EJF A;  1PG5 B;  3T9N A;  3GNG A;  1UUE A;  3CC4 Q;  4XTX A;  3FB9 A;  1RAF B;  1K8A U;  1I5L A;  2FYK A;  1YJ9 Q;  2NUT B;  3SB2 A;  3OS5 A;  2DFU A;  3RKX A;  4NL3 A;  3CCR T;  3EG1 A;  2EW3 A;  4N4I A;  1M3A A;  1EX4 A;  2F2X A;  1AZE A;  1WZO A;  4J83 A;  1IZ6 A;  2QYZ A;  4C5I A;  2RHX A;  2EPD A;  3CBP A;  2RQU A;  2KEA A;  2FB7 A;  2E1H A;  5LJ5 h;  4JJD A;  2EKO A;  1K9A A;  4MMK A;  2CH4 A;  1YHQ A;  4R0K A;  2Y90 A;  3OYL A;  3G6E Q;  1NPP A;  3RMS A;  3CC2 Q;  1RAG B;  2E65 A;  4EPC A;  3FRN A;  4PKC C;  2YUN A;  3QUI A;  1VQ4 T;  4X9C A;  4J9F A;  1JBM A;  4BI3 A;  3ZFJ A;  1WJS A;  1NLP C;  3M59 A;  2R57 A;  2FEI A;  3CC7 T;  4C0F A;  2KSS A;  1D0Y A;  4A4G A;  5DLQ E;  5A0L A;  1OUL A;  2KAF A;  3CC7 A;  1VQL T;  1NPR A;  1UGP B;  3H9N A;  2KGT A;  1WGS A;  3GF5 A;  2MI6 A;  3H0I A;  1BCO A;  4JJB A;  3M0S A;  4KH0 B;  5I2M A;  1X6G A;  4IUP A;  1B3Q A;  2X4X A;  2OTJ Q;  5LL6 S;  2RJC A;  5HKC A;  4HCC A;  1YJN T;  2EGC A;  3QYG B;  2QG9 B;  2BIV A;  2VV5 A;  5KE3 A;  2M9U A;  4DQ2 A;  5LJ5 d;  1M2O A;  2XD0 A;  5DLO A;  2LVM A;  2CZ7 B;  4C8Q A;  3CD6 T;  1K0X A;  4E47 A;  2E4H A;  1NYF A;  1KQ2 A;  1AZG B;  2R5A A;  2DJQ A;  1KC8 R;  2DD4 A;  1XJW B;  3JB9 J;  1VIF A;  4J8O A;  1OX8 A;  4AFS C;  2WSE E;  3QSU A;  1TTH B;  4NOY A;  5GAN e;  3L2V A;  3DKM A;  1AWJ A;  1PSE A;  4F7U B;  1OPL A;  2CZ6 B;  3CCV Q;  1NM7 A;  2A0F B;  3HFN A;  3QZ9 B;  3JB9 G;  2ZPH B;  3H0H A;  4M78 D;  5LJ3 f;  3I35 A;  1I0C A;  3VYG A;  3M0T A;  3CCS A;  1RAA B;  3M53 A;  5I22 A;  5KYU A;  1KD1 C;  5GAM g;  3PT9 A;  4PFZ A;  2DIG A;  4JZ3 A;  1R77 A;  1TXQ A;  5GAN 2;  2HQH A;  3M0U A;  2DRK A;  2JTF A;  1ZX6 A;  2K4Y A;  1Q82 U;  4FW1 A;  1CSK A;  2I2L A;  1SHF A;  5KCH A;  4MML A;  3LWI A;  2JOY A;  1SRM A;  1O75 A;  1ZA2 B;  4C8Q F;  1AOJ A;  1ZHI A;  2NUP A;  1I4K 1;  5LJ3 e;  4E7S A;  3LGL A;  4OMF B;  4XTV A;  3OS2 A;  1IHV A;  2P0P A;  1UG1 A;  1RI0 A;  4M7D G;  1XNI A;  2MK5 A;  1MGQ A;  4AT1 B;  1ZBX A;  3EAE A;  3M58 A;  2JUF A;  2OAW A;  1WHK A;  3PTA A;  4QVD A;  4PJN A;  4LD6 A;  5KYW B;  1PC0 A;  1KD1 U;  2M02 A;  3HFO A;  3INZ A;  1OEB A;  1MUZ A;  3CC4 T;  3I9Q A;  2DL7 A;  3VJP A;  3OYD A;  1VQ9 Q;  1U8R A;  2D6F A;  4Z89 A;  3M5A A;  1Q86 U;  2GQV A;  4JLI A;  4ZN1 A;  5IHI A;  3ZL7 C;  1NJI C;  2FZC B;  3QWY A;  3QBY A;  3OMG A;  1M4Z A;  5CCA A;  2K2V A;  3M55 A;  1W4S A;  5CQX A;  4JUV A;  4E7H A;  3RBB B;  2NYS A;  2DTI A;  4PL6 A;  2VAS A;  4C92 E;  5CVI A;  3FJ5 A;  2NUT A;  1ZA1 B;  1MMD A;  1RAH B;  1PRM C;  2BE7 D;  3G6E T;  3QZ5 B;  1OU9 A;  1S72 Q;  2FPE A;  1QMC A;  5AYF A;  3EFO B;  3JB9 D;  1M90 U;  1PD0 A;  4EMH A;  4J6X A;  3CC2 T;  3LLR A;  5GMK h;  4L59 A;  2KY9 A;  1JEG A;  2KI7 A;  5GAO p;  4OMN A;  5GAN 3;  3OYN A;  5GAN j;  1VQP A;  2CT4 A;  2A28 A;  2HEQ A;  2RJF A;  3LGF A;  1BYM A;  3FEO A;  3ULR B;  4FSX A;  4QVZ A;  1N8R C;  3WXM B;  1D0X A;  2JMC A;  4PJJ A;  2X4W A;  2XU8 A;  3UA7 A;  1SEM A;  3HHT B;  2LP5 A;  3NTH A;  4BDZ A;  3HRU A;  4ZNX A;  3E2U A;  5GMK i;  2DER A;  3FC3 A;  2ZPG B;  3QKJ A;  3BDL A;  4HVV A;  2OTJ T;  2OJ2 A;  3RKY A;  3F70 A;  3ZEH A;  4CRI A;  2P4T A;  1Q81 C;  2K7A A;  4XTZ A;  1Q7Y C;  2R5M A;  5IH2 A;  3JCM V;  3FIF A;  1K4U S;  4J9H A;  4PJM A;  4BDY A;  3A98 A;  1TH7 A;  2IIM A;  1IRE B;  4M78 A;  3X28 B;  3VS1 A;  3CCU Q;  3OYJ A;  2D1X A;  3QII A;  1WA7 A;  2EJ9 A;  4RTZ A;  2V8J A;  2V1Q A;  1YI2 Q;  3QXE B;  3JV3 A;  4C92 B;  2EYQ A;  5LJ3 j;  1N8R U;  2F2V A;  2D9T A;  4B6M A;  1QKX A;  3QHS A;  4J5Y A;  3X26 B;  3CCV T;  2F5K A;  3CCM Q;  5CR2 A;  1VQ5 Q;  1D0Z A;  2XG8 D;  4M75 D;  5GJW B;  2FHD A;  4RTU A;  1X75 C;  1UEC A;  1NE8 A;  3X24 B;  2DPP B;  2K5F A;  1WHG A;  3M57 A;  4KUD K;  2V1R A;  2DKG A;  3CCE Q;  1JXO A;  2C0T A;  4LDV A;  3EHQ A;  3VYH B;  2E12 A;  1XTD A;  2VUB A;  2ENM A;  2KRS A;  1UHF A;  2Y4X A;  4F7U A;  2XHC A;  2M1H A;  2DO3 A;  1M8V A;  4HXJ A;  2EJG A;  2O2O A;  3N5B B;  3CME Q;  2PQW A;  4CI0 C;  1C6V X;  1SKU B;  1E7O A;  2GQI A;  1BK2 A;  1GBQ A;  3QDF A;  4A4F A;  1WQ7 A;  3KUF A;  4J9I A;  2YUO A;  2DM1 A;  3TCJ A;  2QTX A;  3P8H A;  3O8V A;  1PCX A;  2DXT A;  1GRI A;  2LC4 A;  2ZAE A;  1UGQ B;  4C92 C;  4J6Y A;  3X25 B;  4M78 F;  1P92 A;  4AG2 C;  4RUG A;  2FG0 A;  2K6D A;  3PE0 A;  3G71 A;  2V8I A;  1NYG A;  2CRE A;  2VWF A;  1B34 B;  4EDU A;  5FRN A;  1Q81 R;  1Z9Z A;  5GAM h;  1Q7Y R;  1HYO A;  4PFP A;  4X34 A;  2RK2 A;  3MEV A;  5GMK m;  1K9M C;  5AT1 B;  1VQ9 T;  4CC4 B;  1YIT Q;  1UE9 A;  4HKE A;  1NEG A;  5D7U A;  1TSF A;  2VGN A;  3ME9 A;  4HCZ A;  3G4S A;  3PVQ A;  2CP0 A;  4CC2 A;  5GAN g;  5GMK l;  4F7U F;  1J3T A;  2RQV A;  1NEB A;  4A4H A;  1IHW A;  1YJW A;  2RQR A;  2O01 E;  4XU2 A;  2J7I A;  2DMO A;  3JCM e;  2E3H A;  5KYU B;  4RTY A;  4E7K A;  2M51 A;  4LDX A;  1YNZ A;  1S72 T;  2OTL A;  1B07 A;  4PLI A;  5IN1 A;  2RM4 A;  1EZZ B;  3OA6 A;  1K73 C;  2G3R A;  1G2B A;  5D6Y A;  4C0G A; 
#chains in the Genus database with same CATH homology
 3CMA A;  2OAU A;  1VQN T;  1JBM A;  4BI3 A;  3CCV A;  1Y71 A;  4JRP A;  2XI9 A;  3ZFJ A;  4C5H A;  1WJS A;  5GAM d;  3MP6 A;  2RH2 A;  1G3W A;  4M75 C;  3M59 A;  3PIP A;  2R57 A;  2DJZ A;  5I21 A;  3CC7 T;  4E7I A;  4C0F A;  1BKB A;  4PJO G;  2KSS A;  4A4G A;  3DLL A;  4V2S A;  5DLQ E;  5A0L A;  5GAN d;  2KAF A;  1K9M U;  3CC7 A;  1VQL T;  5CKF A;  1NPR A;  4M7A B;  4BY6 C;  1UGP B;  3E1S A;  4M77 C;  5IT9 E;  3UWN A;  3GF5 A;  1WGS A;  4KT0 E;  2MI6 A;  2DZ9 A;  2CYZ B;  5J39 A;  4XTY A;  4RMO A;  2K3X A;  2ZPB B;  5I2M A;  1K8A C;  3JCM g;  3H8Z A;  1WQW A;  4QW2 A;  4IUP A;  2CKK A;  4PJO A;  1LNX A;  1N27 A;  1SSF A;  3S3M A;  3RER A;  2X4X A;  4BE1 A;  4IUT A;  4UC4 A;  5LL6 S;  3JB9 H;  2RJC A;  5HKC A;  1G3S A;  5I2S A;  5FU6 C;  4HCC A;  3OY9 A;  4C8Q G;  5FU7 C;  1YJN T;  2FL7 A;  1M1G A;  4MZM A;  3QYG B;  3HRT A;  3LW5 E;  2BIV A;  2VV5 A;  4ME7 A;  2QQR A;  5KE3 A;  2M9U A;  4M75 G;  4DQ2 A;  5LJ5 d;  1YIJ A;  5LJ3 g;  2XD0 A;  2EQJ A;  2IG0 A;  3M54 A;  4BD3 A;  5DLO A;  3OW2 S;  1WPY A;  2LVM A;  2CZ7 B;  1JJ2 A;  2PUO B;  2LNV A;  2P0K A;  4C8Q A;  1OZ3 A;  4QQD A;  5GAO n;  1QVG S;  4MDW A;  4NS5 A;  3CD6 T;  1OZ2 A;  4E47 A;  5GMK j;  1VQK A;  1KQ2 A;  4M75 A;  5GAN 4;  2M0O A;  2R5A A;  5CQY A;  5J3B A;  1VQ6 T;  4LDY A;  3CPF A;  1LOJ A;  3A5Z B;  1VQ6 A;  1K73 U;  2DD4 A;  2DXB A;  4ELY C;  2RHZ A;  4LDU A;  2DVE A;  3JB9 J;  1VIF A;  4J8O A;  1W2B S;  4ZGD B;  3CCU T;  4IKF A;  2QI2 A;  4M77 A;  2GF7 A;  2WSE E;  3MP1 A;  3QSU A;  2RB6 A;  4M7A E;  4IUR A;  1OYX A;  3E9G A;  2CS7 A;  4NOY A;  5GAN e;  3L2V A;  3TU4 K;  1UGR B;  3DKM A;  4M78 E;  1VQO A;  3L2U A;  3JCM f;  3CCJ A;  4FT2 A;  1PSE A;  4JRK A;  1QP3 A;  4Y28 E;  3OBW A;  3I55 A;  1I8F A;  4IUQ A;  1YI2 T;  2HAX A;  4BB7 A;  4F7U B;  2PVO B;  1G5V A;  4Z02 A;  2DEQ A;  2CZ6 B;  2K5I A;  4HA8 A;  4FIB A;  3PNW C;  2O4X B;  4KBM B;  3GPL A;  3GLX A;  2JVV A;  4XAX B;  5DY9 A;  1VQP T;  3HFN A;  3QZ9 B;  4M7A D;  3JB9 G;  2VXF A;  1KQS A;  2ZPH B;  3CCM T;  3CCL A;  3ER0 A;  4M7A C;  1H64 1;  4J7I A;  1VQ5 T;  4C5E A;  3BDU A;  4M78 D;  5LJ3 f;  3E9F A;  4C92 G;  3CBO A;  3BW1 A;  2NLU A;  3MET A;  1VQ5 A;  2CZ0 B;  2QDY B;  2RJE A;  3A8M B;  4DOV A;  3VYG A;  4ZN3 A;  2E5Q A;  1KQ1 A;  2DXC A;  3QDR B;  4JRI A;  3CCR A;  3DB3 A;  3CCS A;  3M53 A;  3NTK A;  3VU3 C;  1KD1 C;  3JCM Q;  4N4G A;  5FRO A;  1XOV A;  2HQE A;  1VQ9 A;  3CCE T;  1VQ7 T;  5C0M A;  2A3L A;  5GAM g;  2KQW A;  4C92 A;  3PT9 A;  1NJI U;  2DIG A;  4JS4 A;  3A8G B;  3WVE B;  3DB4 A;  2EQM A;  3OYF A;  1BI1 A;  3M9Q A;  3HP9 A;  4OGE A;  4PNO A;  3E19 A;  2KVQ G;  4XK8 E;  1VQM A;  3UDC A;  5GAN 2;  4PJO F;  4ZGJ B;  2WAC A;  3QG1 A;  2JTF A;  3L2W A;  3CPW S;  5CIU A;  2K4Y A;  4E7J A;  1Q82 U;  2V8K A;  3CME T;  3HL8 A;  2I2L A;  4F7U E;  4PJO E;  3JCM X;  1AHJ B;  5IAY A;  5KCH A;  1NZ9 A;  1KG1 A;  2QQA A;  1M9S A;  3OYI A;  4MZT A;  3L2Q A;  4MML A;  3OYB A;  4JS5 A;  2K57 A;  2PVG B;  3LWI A;  3JCM J;  4HCB A;  2JOY A;  3OYY A;  1O75 A;  4JLG A;  4C8Q F;  1ZQ1 A;  3MO8 A;  1S72 A;  3HRS A;  2C06 A;  5LJ5 g;  3G7Z A;  1ZHI A;  4M75 F;  1I4K 1;  5LJ3 e;  4EMK B;  2YLC A;  4PJO D;  1QVF A;  3OYK A;  3LGL A;  4OMF B;  1UEB A;  2RHU A;  4C8Q E;  3L2Z A;  1X01 A;  4XTV A;  2P0P A;  4NL2 A;  1V29 B;  4DOW A;  3OS2 A;  1RI0 A;  3LWH A;  1VQ4 A;  3RKW A;  1UB4 A;  1HXD A;  1VQN A;  4M7D G;  4B9X A;  4ATO A;  1XNI A;  4FM4 B;  1XQH A;  2XIC A;  1MGQ A;  1LJO A;  3CBM A;  5GAM f;  1ZBX A;  1EIF A;  2LX9 A;  2WSF E;  3EAE A;  2JUF A;  3M58 A;  5CKE A;  3QO3 A;  3PTA A;  4QVD A;  3JSC A;  4LD6 A;  5GAN f;  2LCC A;  1KHI A;  3V8J A;  3JAM E;  2KMT A;  1VQL A;  4M7D A;  2L3R A;  1KD1 U;  4C8Q D;  2KDS A;  5KCO A;  2DXU A;  1X6O A;  4M78 B;  4II1 A;  4OB1 B;  3HFO A;  3INZ A;  3VUB A;  3S6W A;  1M1K U;  3CC4 T;  1OI1 A;  4OF1 A;  2DZC A;  3A8O B;  3J80 E;  3OYE A;  3C95 A;  3VJP A;  1JRI A;  5CKH A;  3OYD A;  1U8R A;  2D6F A;  1FX7 A;  3M5A A;  3MHX A;  1Q86 U;  2GQV A;  4JLI A;  1QVP A;  4ZN1 A;  1YJN A;  2YHT A;  1Q81 U;  2MWP A;  4JJN K;  3ZBD A;  1YIT T;  1Q7Y U;  5C6S A;  2RHI A;  1NJI C;  5LJ5 f;  3MEA A;  4WF2 A;  3JB9 F;  1KHC A;  4O6J A;  3QBY A;  3SWN B;  4XU1 A;  2RI3 A;  1YIT A;  4XTW A;  2RA2 A;  3OMG A;  1M4Z A;  3M56 A;  2K5L A;  2K2V A;  4FT4 A;  5CCA A;  1D3B A;  1JB0 E;  1B34 A;  3M55 A;  2LT1 A;  3M4Y A;  4C92 F;  4M77 G;  1W4S A;  3S3N A;  3CD6 A;  2GFU A;  2RD1 A;  4Q5W A;  5DM7 R;  5CQX A;  4JUV A;  3M4G A;  3MEU A;  3OW2 A;  1Q82 C;  2E6N A;  3S3O A;  4E7H A;  5FRM A;  2BUD A;  4PL6 A;  2DTI A;  2MAM A;  3V8L A;  4R56 A;  4C92 E;  1QVG A;  5GAM e;  2MWO A;  2LTO A;  2X4J A;  5CVI A;  5EG2 A;  3V7S A;  4BE2 A;  4C0D B;  4L6V 5;  1O9S A;  3SFM A;  3R6O A;  3G6E T;  3QZ5 B;  4RKU E;  3CCU A;  2E64 A;  4EMK C;  5AYF A;  3PMT A;  3QPH A;  5CAI A;  3CXC S;  1RL2 A;  2EQU A;  3L1A A;  3JB9 D;  1M90 U;  2LQK A;  3SD4 A;  4J6X A;  4EMH A;  1QP2 A;  3V8K A;  3OS0 A;  1W2B A;  3PFS A;  4PJO B;  3CC2 T;  3LLR A;  5GMK h;  4L59 A;  2KY9 A;  3PMI A;  4C92 D;  1YI2 A;  5GAO p;  2DAQ A;  5GAN 3;  3CEY A;  3OYN A;  2XID A;  1G3T A;  5GAN 5;  2XKO C;  5GAN j;  1VQP A;  3QYH B;  2AHJ B;  5GAN 7;  2LDM A;  2YRV A;  3P8D A;  2RJF A;  3CCQ T;  3LGF A;  2VC8 A;  3CCM A;  4HT8 A;  1BYM A;  1H3Z A;  4M78 C;  3L42 A;  3VUZ A;  2RI2 A;  2Y4Y A;  3FEO A;  5HK0 A;  4FSX A;  5LJ5 e;  3G71 T;  3I56 T;  4QVZ A;  1KC8 C;  2ZPE B;  3QJ6 A;  4C8Q B;  2IVW A;  1N8R C;  3WXM B;  3HSB A;  3KBG A;  4QQ6 A;  4BI4 A;  5HK3 A;  1FWZ A;  2BKD N;  4OGC A;  3J7A F;  2LT4 A;  2X4W A;  2E70 A;  2XU8 A;  4N0A C;  1BI3 A;  3HHT B;  2ZCF B;  3NTH A;  1DJ7 B;  4N4H A;  3CCE A;  2XK0 A;  4BDZ A;  1M1K C;  3HRU A;  1VQ7 A;  4HT9 A;  2RK1 A;  4M7D F;  1GXI E;  4A53 A;  4EMG A;  4JDS A;  4LDW A;  5GMK i;  3ASK A;  4GLK A;  2CGH A;  2PU9 B;  2ZPG B;  3FJP A;  3QKJ A;  1Y96 A;  3BDL A;  4KUI A;  3FC3 A;  3SWN C;  3OSS C;  4L5G A;  2LQ8 A;  1Q86 C;  2OTJ T;  2P0Q A;  3OQ5 A;  3F70 A;  3LYI A;  3RKY A;  2P4T A;  4IUU A;  3ZEH A;  4CRI A;  4ZTJ A;  2E41 A;  1Q81 C;  4M7A G;  4XTZ A;  1HK9 A;  1Q7Y C;  2R5M A;  2L8D A;  4C5G A;  3JCM V;  2ZPF B;  3G4S T;  3FIF A;  3DLM A;  4M78 G;  3CME A;  1WNL A;  2LCL A;  3URG A;  2XDB A;  5KE2 A;  5FU6 B;  4BUG A;  4BDY A;  5L8R E;  3CPW A;  3NFC A;  3OYG A;  4M7A A;  1TH7 A;  4C0D C;  1M5Q 1;  5M9O A;  5A2Q E;  3PIO A;  2X35 A;  1IRE B;  4ZTF A;  1YJW T;  4M78 A;  4MDX A;  3X28 B;  2DK3 A;  3C94 A;  4VUB A;  1YHQ T;  4TVR A;  2RHY A;  2QQ9 A;  3OYC A;  3OYJ A;  4KUL A;  4RCC A;  4BI8 B;  4DA4 A;  4PJO C;  4A54 A;  3QII A;  4N0A A;  4M7D E;  2EJ9 A;  4Y91 A;  3A8H B;  2V8J A;  2JN0 A;  4M75 E;  2OTL T;  2L89 A;  2JNG A;  4M77 F;  1M90 C;  1VQ8 T;  3QXE B;  4C92 B;  4D6W A;  3AHU A;  3V7R A;  4J7F A;  5GAO q;  2EYQ A;  3X20 B;  3UPU A;  5LJ3 j;  3GNF B;  1KC8 U;  4JRQ A;  4LD9 K;  2RI5 A;  1N8R U;  2D9T A;  2DTH A;  3OBY A;  2QQB A;  3SWN A;  3QHS A;  3C12 A;  4M77 E;  4J5Y A;  4X9D A;  3X26 B;  3CCV T;  4R55 A;  2F5T X;  1I81 A;  1WJQ A;  2F5K A;  3GP8 A;  1VUB A;  3JCM h;  4C8Q C;  4ELZ C;  5KH6 A;  5CR2 A;  2QEX T;  2XG8 D;  2WSC E;  4M75 D;  3RUX A;  2RJD A;  1WJR A;  2FHD A;  2M16 A;  3VKI A;  2QEX A;  2MF2 A;  1X75 C;  3CC4 A;  1NE8 A;  4RG8 A;  3X24 B;  2DPP B;  2K5F A;  2JTM A;  4BAC A;  1YJ9 T;  2F69 A;  3M57 A;  1FXX A;  4F7U G;  4KUD K;  1YJ9 A;  3OYM A;  4ZGE B;  4IUV A;  3OB9 A;  5A0G A;  2DKG A;  4M77 D;  1BI2 A;  2VGM A;  3OS1 A;  3OYA A;  2DTO A;  4LDV A;  4P5N A;  1U1T A;  1YCY A;  2RO0 A;  3LX7 A;  3NTI A;  4FU6 A;  5LJ3 h;  3VYH B;  2E12 A;  3HKS A;  1XTD A;  4A4K A;  2VUB A;  2CZ1 B;  4QVC A;  2Y4X A;  1UGS B;  4F7U A;  3JB9 I;  1N6A A;  2EFI A;  2EIF A;  3EFR A;  2DIQ A;  2XHC A;  4OB3 B;  1JJ2 S;  2O4X A;  2M1H A;  2DO3 A;  2L5Q A;  2FVU A;  1M8V A;  4PLL A;  2EJG A;  3N5B B;  3OYH A;  5GMK e;  3LH0 A;  4XU0 A;  2PQW A;  4XU3 A;  4CI0 C;  4BE0 A;  1YIJ T;  3FLG A;  2QQS A;  5A0D A;  4E7L A;  2HNI A;  4A4F A;  4RCB A;  3RMQ A;  4YTL A;  1WQ7 A;  3KUF A;  2B8A A;  2E6Z A;  2A7Y A;  3JRZ A;  3MP8 A;  1R8O B;  4M7D B;  3GIB A;  2EWN A;  2E10 A;  1M1F A;  3RIR A;  2QTX A;  3TCJ A;  3G6E A;  1VQK T;  1U1S A;  3SDZ A;  3J81 E;  3QJY A;  2XDD A;  3MEW A;  5GAO m;  2H3J A;  5D6X A;  3P8H A;  3O8V A;  5GAM j;  4M7A F;  2DXT A;  2LC4 A;  1BI0 A;  3HPW A;  3CC2 A;  3OSV A;  1UGQ B;  4C92 C;  2ZGW A;  4J6Y A;  3X25 B;  4M78 F;  1P92 A;  2HBP A;  4OB0 B;  3TEE A;  3CXC A;  3JCM P;  4XQ3 A;  2HD0 A;  3PGG A;  3JCM b;  2EQK A;  4QQG A;  1Y7X A;  4XTU A;  4GY5 A;  3H6Z A;  1VQO T;  1BIA A;  5CKB A;  2X4Y A;  3JCM d;  2QA4 T;  5CKD A;  3RES A;  3CCJ T;  3I55 T;  3FDR A;  5GAO l;  3TRE A;  3CCQ A;  2QA4 A;  1KQS S;  3G71 A;  2LRQ A;  2V8I A;  1QW1 A;  3MCA B;  1D3B B;  1B34 B;  2ZZD A;  4EDU A;  3I56 A;  5FRN A;  4RG2 A;  2GFA A;  2JZ2 A;  2EAY A;  2PUK B;  2EJF A;  4M75 B;  1N9R A;  2D0Q B;  3T9N A;  3WVD B;  3P8B B;  5GAM h;  3GNG A;  3CCL T;  4XTX A;  2PVD B;  2DD5 A;  3FB9 A;  5LJ3 d;  1K8A U;  1I5L A;  5LJ5 j;  2FYK A;  4X34 A;  5D6W A;  3SB2 A;  1MHN A;  4BY6 B;  3OS5 A;  4OVA A;  4M77 B;  5GAN h;  4EMK A;  3RKX A;  4NL3 A;  3CCR T;  1N9S A;  3CCS T;  4C0Z A;  2RK2 A;  3MEV A;  5GMK m;  4N4I A;  1K9M C;  3C4S A;  5HY6 A;  1PSF A;  3A8L B;  3OMC A;  2OTJ A;  2ZPI B;  1VQ9 T;  4J83 A;  3EFS A;  4HKE A;  1IZ6 A;  2YLB A;  2VGN A;  3ME9 A;  4HCZ A;  2HQX A;  2VYT A;  1G3Y A;  4C5I A;  3JCM W;  3G4S A;  5FLX E;  5FU7 B;  4A4E A;  2RHX A;  5GAN 6;  3CBP A;  1VQM T;  2XDP A;  1Y07 A;  3BFM A;  5GAO r;  5GAN g;  4B9W A;  2FB7 A;  5GMK l;  2E1H A;  4F7U F;  2GCX A;  4OB2 B;  4M7D D;  5LJ5 h;  4MZP A;  4O5V A;  3VV0 A;  2VXE A;  5CO7 A;  4M7D C;  4A4H A;  4OP0 A;  2KK4 A;  2EKO A;  1YJW A;  3BY7 A;  3L2R A;  3V7C A;  3JCM c;  5GAN 8;  2O01 E;  4MMK A;  2MMP A;  4XU2 A;  1YHQ A;  3JCM e;  2Y90 A;  3OYL A;  3UT1 A;  1NPP A;  4FL6 A;  4E7K A;  3RMS A;  3GOX A;  1YBY A;  1QVF S;  4LDX A;  1VIE A;  1S72 T;  2OTL A;  4PLI A;  5IN1 A;  2QXF A;  1VQ8 A;  5CK9 A;  2E65 A;  3Q1J A;  2RM4 A;  3OA6 A;  1BIB A;  4J6W A;  4EPC A;  2R58 A;  3FRN A;  2G3R A;  4PKC C;  3KXT A;  1K73 C;  2K3Y A;  3CMA T;  1Y96 B;  3QUI A;  5D6Y A;  1VQ4 T;  5J26 A;  4X9C A;  4C0G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...